data_6G4N
# 
_entry.id   6G4N 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6G4N         
WWPDB D_1200009414 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6G4N 
_pdbx_database_status.recvd_initial_deposition_date   2018-03-28 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Santoni, G.'    1 ? 
'De la Mora, E.' 2 ? 
'de Souza, J.'   3 ? 
'Silman, I.'     4 ? 
'Sussman, J.'    5 ? 
'Baati, R.'      6 ? 
'Weik, M.'       7 ? 
'Nachon, F.'     8 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'J. Med. Chem.' 
_citation.journal_id_ASTM           JMCMAR 
_citation.journal_id_CSD            0151 
_citation.journal_id_ISSN           1520-4804 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            61 
_citation.language                  ? 
_citation.page_first                7630 
_citation.page_last                 7639 
_citation.title                     
'Structure-Based Optimization of Nonquaternary Reactivators of Acetylcholinesterase Inhibited by Organophosphorus Nerve Agents.' 
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1021/acs.jmedchem.8b00592 
_citation.pdbx_database_id_PubMed   30125110 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Santoni, G.'    1  0000-0001-6215-998X 
primary 'de Sousa, J.'   2  ?                   
primary 'de la Mora, E.' 3  ?                   
primary 'Dias, J.'       4  ?                   
primary 'Jean, L.'       5  0000-0002-1745-4952 
primary 'Sussman, J.L.'  6  ?                   
primary 'Silman, I.'     7  ?                   
primary 'Renard, P.Y.'   8  ?                   
primary 'Brown, R.C.D.'  9  ?                   
primary 'Weik, M.'       10 ?                   
primary 'Baati, R.'      11 ?                   
primary 'Nachon, F.'     12 0000-0003-0293-2429 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6G4N 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     91.807 
_cell.length_a_esd                 ? 
_cell.length_b                     107.208 
_cell.length_b_esd                 ? 
_cell.length_c                     150.450 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6G4N 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat Acetylcholinesterase                                                                                   60736.516 
2   3.1.1.7 ? ? ? 
2 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose                                                               221.208   
4   ?       ? ? ? 
3 non-polymer syn '6-[4-[(7-chloranyl-1,2,3,4-tetrahydroacridin-9-yl)amino]butyl]-2-[(oxidanylamino)methyl]pyridin-3-ol' 426.939   
2   ?       ? ? ? 
4 non-polymer syn 'CHLORIDE ION'                                                                                         35.453    
1   ?       ? ? ? 
5 water       nat water                                                                                                  18.015    
355 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        AChE 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATAC
;
_entity_poly.pdbx_seq_one_letter_code_can   
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATAC
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   ASP n 
1 3   HIS n 
1 4   SER n 
1 5   GLU n 
1 6   LEU n 
1 7   LEU n 
1 8   VAL n 
1 9   ASN n 
1 10  THR n 
1 11  LYS n 
1 12  SER n 
1 13  GLY n 
1 14  LYS n 
1 15  VAL n 
1 16  MET n 
1 17  GLY n 
1 18  THR n 
1 19  ARG n 
1 20  VAL n 
1 21  PRO n 
1 22  VAL n 
1 23  LEU n 
1 24  SER n 
1 25  SER n 
1 26  HIS n 
1 27  ILE n 
1 28  SER n 
1 29  ALA n 
1 30  PHE n 
1 31  LEU n 
1 32  GLY n 
1 33  ILE n 
1 34  PRO n 
1 35  PHE n 
1 36  ALA n 
1 37  GLU n 
1 38  PRO n 
1 39  PRO n 
1 40  VAL n 
1 41  GLY n 
1 42  ASN n 
1 43  MET n 
1 44  ARG n 
1 45  PHE n 
1 46  ARG n 
1 47  ARG n 
1 48  PRO n 
1 49  GLU n 
1 50  PRO n 
1 51  LYS n 
1 52  LYS n 
1 53  PRO n 
1 54  TRP n 
1 55  SER n 
1 56  GLY n 
1 57  VAL n 
1 58  TRP n 
1 59  ASN n 
1 60  ALA n 
1 61  SER n 
1 62  THR n 
1 63  TYR n 
1 64  PRO n 
1 65  ASN n 
1 66  ASN n 
1 67  CYS n 
1 68  GLN n 
1 69  GLN n 
1 70  TYR n 
1 71  VAL n 
1 72  ASP n 
1 73  GLU n 
1 74  GLN n 
1 75  PHE n 
1 76  PRO n 
1 77  GLY n 
1 78  PHE n 
1 79  SER n 
1 80  GLY n 
1 81  SER n 
1 82  GLU n 
1 83  MET n 
1 84  TRP n 
1 85  ASN n 
1 86  PRO n 
1 87  ASN n 
1 88  ARG n 
1 89  GLU n 
1 90  MET n 
1 91  SER n 
1 92  GLU n 
1 93  ASP n 
1 94  CYS n 
1 95  LEU n 
1 96  TYR n 
1 97  LEU n 
1 98  ASN n 
1 99  ILE n 
1 100 TRP n 
1 101 VAL n 
1 102 PRO n 
1 103 SER n 
1 104 PRO n 
1 105 ARG n 
1 106 PRO n 
1 107 LYS n 
1 108 SER n 
1 109 THR n 
1 110 THR n 
1 111 VAL n 
1 112 MET n 
1 113 VAL n 
1 114 TRP n 
1 115 ILE n 
1 116 TYR n 
1 117 GLY n 
1 118 GLY n 
1 119 GLY n 
1 120 PHE n 
1 121 TYR n 
1 122 SER n 
1 123 GLY n 
1 124 SER n 
1 125 SER n 
1 126 THR n 
1 127 LEU n 
1 128 ASP n 
1 129 VAL n 
1 130 TYR n 
1 131 ASN n 
1 132 GLY n 
1 133 LYS n 
1 134 TYR n 
1 135 LEU n 
1 136 ALA n 
1 137 TYR n 
1 138 THR n 
1 139 GLU n 
1 140 GLU n 
1 141 VAL n 
1 142 VAL n 
1 143 LEU n 
1 144 VAL n 
1 145 SER n 
1 146 LEU n 
1 147 SER n 
1 148 TYR n 
1 149 ARG n 
1 150 VAL n 
1 151 GLY n 
1 152 ALA n 
1 153 PHE n 
1 154 GLY n 
1 155 PHE n 
1 156 LEU n 
1 157 ALA n 
1 158 LEU n 
1 159 HIS n 
1 160 GLY n 
1 161 SER n 
1 162 GLN n 
1 163 GLU n 
1 164 ALA n 
1 165 PRO n 
1 166 GLY n 
1 167 ASN n 
1 168 VAL n 
1 169 GLY n 
1 170 LEU n 
1 171 LEU n 
1 172 ASP n 
1 173 GLN n 
1 174 ARG n 
1 175 MET n 
1 176 ALA n 
1 177 LEU n 
1 178 GLN n 
1 179 TRP n 
1 180 VAL n 
1 181 HIS n 
1 182 ASP n 
1 183 ASN n 
1 184 ILE n 
1 185 GLN n 
1 186 PHE n 
1 187 PHE n 
1 188 GLY n 
1 189 GLY n 
1 190 ASP n 
1 191 PRO n 
1 192 LYS n 
1 193 THR n 
1 194 VAL n 
1 195 THR n 
1 196 ILE n 
1 197 PHE n 
1 198 GLY n 
1 199 GLU n 
1 200 SER n 
1 201 ALA n 
1 202 GLY n 
1 203 GLY n 
1 204 ALA n 
1 205 SER n 
1 206 VAL n 
1 207 GLY n 
1 208 MET n 
1 209 HIS n 
1 210 ILE n 
1 211 LEU n 
1 212 SER n 
1 213 PRO n 
1 214 GLY n 
1 215 SER n 
1 216 ARG n 
1 217 ASP n 
1 218 LEU n 
1 219 PHE n 
1 220 ARG n 
1 221 ARG n 
1 222 ALA n 
1 223 ILE n 
1 224 LEU n 
1 225 GLN n 
1 226 SER n 
1 227 GLY n 
1 228 SER n 
1 229 PRO n 
1 230 ASN n 
1 231 CYS n 
1 232 PRO n 
1 233 TRP n 
1 234 ALA n 
1 235 SER n 
1 236 VAL n 
1 237 SER n 
1 238 VAL n 
1 239 ALA n 
1 240 GLU n 
1 241 GLY n 
1 242 ARG n 
1 243 ARG n 
1 244 ARG n 
1 245 ALA n 
1 246 VAL n 
1 247 GLU n 
1 248 LEU n 
1 249 GLY n 
1 250 ARG n 
1 251 ASN n 
1 252 LEU n 
1 253 ASN n 
1 254 CYS n 
1 255 ASN n 
1 256 LEU n 
1 257 ASN n 
1 258 SER n 
1 259 ASP n 
1 260 GLU n 
1 261 GLU n 
1 262 LEU n 
1 263 ILE n 
1 264 HIS n 
1 265 CYS n 
1 266 LEU n 
1 267 ARG n 
1 268 GLU n 
1 269 LYS n 
1 270 LYS n 
1 271 PRO n 
1 272 GLN n 
1 273 GLU n 
1 274 LEU n 
1 275 ILE n 
1 276 ASP n 
1 277 VAL n 
1 278 GLU n 
1 279 TRP n 
1 280 ASN n 
1 281 VAL n 
1 282 LEU n 
1 283 PRO n 
1 284 PHE n 
1 285 ASP n 
1 286 SER n 
1 287 ILE n 
1 288 PHE n 
1 289 ARG n 
1 290 PHE n 
1 291 SER n 
1 292 PHE n 
1 293 VAL n 
1 294 PRO n 
1 295 VAL n 
1 296 ILE n 
1 297 ASP n 
1 298 GLY n 
1 299 GLU n 
1 300 PHE n 
1 301 PHE n 
1 302 PRO n 
1 303 THR n 
1 304 SER n 
1 305 LEU n 
1 306 GLU n 
1 307 SER n 
1 308 MET n 
1 309 LEU n 
1 310 ASN n 
1 311 SER n 
1 312 GLY n 
1 313 ASN n 
1 314 PHE n 
1 315 LYS n 
1 316 LYS n 
1 317 THR n 
1 318 GLN n 
1 319 ILE n 
1 320 LEU n 
1 321 LEU n 
1 322 GLY n 
1 323 VAL n 
1 324 ASN n 
1 325 LYS n 
1 326 ASP n 
1 327 GLU n 
1 328 GLY n 
1 329 SER n 
1 330 PHE n 
1 331 PHE n 
1 332 LEU n 
1 333 LEU n 
1 334 TYR n 
1 335 GLY n 
1 336 ALA n 
1 337 PRO n 
1 338 GLY n 
1 339 PHE n 
1 340 SER n 
1 341 LYS n 
1 342 ASP n 
1 343 SER n 
1 344 GLU n 
1 345 SER n 
1 346 LYS n 
1 347 ILE n 
1 348 SER n 
1 349 ARG n 
1 350 GLU n 
1 351 ASP n 
1 352 PHE n 
1 353 MET n 
1 354 SER n 
1 355 GLY n 
1 356 VAL n 
1 357 LYS n 
1 358 LEU n 
1 359 SER n 
1 360 VAL n 
1 361 PRO n 
1 362 HIS n 
1 363 ALA n 
1 364 ASN n 
1 365 ASP n 
1 366 LEU n 
1 367 GLY n 
1 368 LEU n 
1 369 ASP n 
1 370 ALA n 
1 371 VAL n 
1 372 THR n 
1 373 LEU n 
1 374 GLN n 
1 375 TYR n 
1 376 THR n 
1 377 ASP n 
1 378 TRP n 
1 379 MET n 
1 380 ASP n 
1 381 ASP n 
1 382 ASN n 
1 383 ASN n 
1 384 GLY n 
1 385 ILE n 
1 386 LYS n 
1 387 ASN n 
1 388 ARG n 
1 389 ASP n 
1 390 GLY n 
1 391 LEU n 
1 392 ASP n 
1 393 ASP n 
1 394 ILE n 
1 395 VAL n 
1 396 GLY n 
1 397 ASP n 
1 398 HIS n 
1 399 ASN n 
1 400 VAL n 
1 401 ILE n 
1 402 CYS n 
1 403 PRO n 
1 404 LEU n 
1 405 MET n 
1 406 HIS n 
1 407 PHE n 
1 408 VAL n 
1 409 ASN n 
1 410 LYS n 
1 411 TYR n 
1 412 THR n 
1 413 LYS n 
1 414 PHE n 
1 415 GLY n 
1 416 ASN n 
1 417 GLY n 
1 418 THR n 
1 419 TYR n 
1 420 LEU n 
1 421 TYR n 
1 422 PHE n 
1 423 PHE n 
1 424 ASN n 
1 425 HIS n 
1 426 ARG n 
1 427 ALA n 
1 428 SER n 
1 429 ASN n 
1 430 LEU n 
1 431 VAL n 
1 432 TRP n 
1 433 PRO n 
1 434 GLU n 
1 435 TRP n 
1 436 MET n 
1 437 GLY n 
1 438 VAL n 
1 439 ILE n 
1 440 HIS n 
1 441 GLY n 
1 442 TYR n 
1 443 GLU n 
1 444 ILE n 
1 445 GLU n 
1 446 PHE n 
1 447 VAL n 
1 448 PHE n 
1 449 GLY n 
1 450 LEU n 
1 451 PRO n 
1 452 LEU n 
1 453 VAL n 
1 454 LYS n 
1 455 GLU n 
1 456 LEU n 
1 457 ASN n 
1 458 TYR n 
1 459 THR n 
1 460 ALA n 
1 461 GLU n 
1 462 GLU n 
1 463 GLU n 
1 464 ALA n 
1 465 LEU n 
1 466 SER n 
1 467 ARG n 
1 468 ARG n 
1 469 ILE n 
1 470 MET n 
1 471 HIS n 
1 472 TYR n 
1 473 TRP n 
1 474 ALA n 
1 475 THR n 
1 476 PHE n 
1 477 ALA n 
1 478 LYS n 
1 479 THR n 
1 480 GLY n 
1 481 ASN n 
1 482 PRO n 
1 483 ASN n 
1 484 GLU n 
1 485 PRO n 
1 486 HIS n 
1 487 SER n 
1 488 GLN n 
1 489 GLU n 
1 490 SER n 
1 491 LYS n 
1 492 TRP n 
1 493 PRO n 
1 494 LEU n 
1 495 PHE n 
1 496 THR n 
1 497 THR n 
1 498 LYS n 
1 499 GLU n 
1 500 GLN n 
1 501 LYS n 
1 502 PHE n 
1 503 ILE n 
1 504 ASP n 
1 505 LEU n 
1 506 ASN n 
1 507 THR n 
1 508 GLU n 
1 509 PRO n 
1 510 MET n 
1 511 LYS n 
1 512 VAL n 
1 513 HIS n 
1 514 GLN n 
1 515 ARG n 
1 516 LEU n 
1 517 ARG n 
1 518 VAL n 
1 519 GLN n 
1 520 MET n 
1 521 CYS n 
1 522 VAL n 
1 523 PHE n 
1 524 TRP n 
1 525 ASN n 
1 526 GLN n 
1 527 PHE n 
1 528 LEU n 
1 529 PRO n 
1 530 LYS n 
1 531 LEU n 
1 532 LEU n 
1 533 ASN n 
1 534 ALA n 
1 535 THR n 
1 536 ALA n 
1 537 CYS n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           1 
_entity_src_nat.pdbx_end_seq_num           537 
_entity_src_nat.common_name                'Pacific electric ray' 
_entity_src_nat.pdbx_organism_scientific   'Tetronarce californica' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      7787 
_entity_src_nat.genus                      ? 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_TETCF 
_struct_ref.pdbx_db_accession          P04058 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATAC
;
_struct_ref.pdbx_align_begin           22 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6G4N A 1 ? 537 ? P04058 22 ? 558 ? 1 537 
2 1 6G4N B 1 ? 537 ? P04058 22 ? 558 ? 1 537 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE ? 'C3 H7 N O2'       89.093  
ARG 'L-peptide linking'          y ARGININE ? 'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking'          y ASPARAGINE ? 'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID' ? 'C4 H7 N O4'       133.103 
CL  non-polymer                  . 'CHLORIDE ION' ? 'Cl -1'            35.453  
CYS 'L-peptide linking'          y CYSTEINE ? 'C3 H7 N O2 S'     121.158 
E2W non-polymer                  . 
'6-[4-[(7-chloranyl-1,2,3,4-tetrahydroacridin-9-yl)amino]butyl]-2-[(oxidanylamino)methyl]pyridin-3-ol' ? 'C23 H27 Cl N4 O2' 
426.939 
GLN 'L-peptide linking'          y GLUTAMINE ? 'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID' ? 'C5 H9 N O4'       147.129 
GLY 'peptide linking'            y GLYCINE ? 'C2 H5 N O2'       75.067  
HIS 'L-peptide linking'          y HISTIDINE ? 'C6 H10 N3 O2 1'   156.162 
HOH non-polymer                  . WATER ? 'H2 O'             18.015  
ILE 'L-peptide linking'          y ISOLEUCINE ? 'C6 H13 N O2'      131.173 
LEU 'L-peptide linking'          y LEUCINE ? 'C6 H13 N O2'      131.173 
LYS 'L-peptide linking'          y LYSINE ? 'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking'          y METHIONINE ? 'C5 H11 N O2 S'    149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ? 'C8 H15 N O6'      221.208 
PHE 'L-peptide linking'          y PHENYLALANINE ? 'C9 H11 N O2'      165.189 
PRO 'L-peptide linking'          y PROLINE ? 'C5 H9 N O2'       115.130 
SER 'L-peptide linking'          y SERINE ? 'C3 H7 N O3'       105.093 
THR 'L-peptide linking'          y THREONINE ? 'C4 H9 N O3'       119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN ? 'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking'          y TYROSINE ? 'C9 H11 N O3'      181.189 
VAL 'L-peptide linking'          y VALINE ? 'C5 H11 N O2'      117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6G4N 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.04 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         59.59 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              5.8 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
;150 mM MES
36% PEG 200
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2012-10-10 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.99 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ESRF BEAMLINE ID29' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.99 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   ID29 
_diffrn_source.pdbx_synchrotron_site       ESRF 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6G4N 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.9 
_reflns.d_resolution_low                 46.3 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       33562 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.9 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  6.3 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            10.1 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  0.175 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.99 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.9 
_reflns_shell.d_res_low                   3.0 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             0.883 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.90 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6G4N 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.900 
_refine.ls_d_res_low                             46.291 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     33493 
_refine.ls_number_reflns_R_free                  1003 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.68 
_refine.ls_percent_reflns_R_free                 2.99 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1894 
_refine.ls_R_factor_R_free                       0.2706 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1869 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.36 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      1ea5 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 31.51 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.36 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8488 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         117 
_refine_hist.number_atoms_solvent             355 
_refine_hist.number_atoms_total               8960 
_refine_hist.d_res_high                       2.900 
_refine_hist.d_res_low                        46.291 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.008  ? 8872  ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.038  ? 12058 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 19.278 ? 5202  ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.060  ? 1261  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.007  ? 1564  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.9000 3.0529  . . 138 4562 100.00 . . . 0.3594 . 0.2638 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.0529 3.2441  . . 142 4574 100.00 . . . 0.2985 . 0.2340 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.2441 3.4945  . . 142 4595 100.00 . . . 0.2971 . 0.2041 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.4945 3.8461  . . 143 4608 100.00 . . . 0.2742 . 0.1685 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.8461 4.4022  . . 143 4626 100.00 . . . 0.2315 . 0.1504 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.4022 5.5449  . . 145 4672 100.00 . . . 0.2211 . 0.1507 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.5449 46.2969 . . 150 4853 99.00  . . . 0.2835 . 0.2048 . . . . . . . . . . 
# 
_struct.entry_id                     6G4N 
_struct.title                        'Torpedo californica acetylcholinesterase bound to uncharged hybrid reactivator 2' 
_struct.pdbx_descriptor              'Acetylcholinesterase (E.C.3.1.1.7)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6G4N 
_struct_keywords.text            'acetylcholinesterase, tabun, nerve agent, HYDROLASE' 
_struct_keywords.pdbx_keywords   HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 2 ? 
G N N 2 ? 
H N N 3 ? 
I N N 4 ? 
J N N 5 ? 
K N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 VAL A 40  ? ARG A 44  ? VAL A 40  ARG A 44  5 ? 5  
HELX_P HELX_P2  AA2 PHE A 78  ? MET A 83  ? PHE A 78  MET A 83  1 ? 6  
HELX_P HELX_P3  AA3 GLY A 132 ? GLU A 139 ? GLY A 132 GLU A 139 1 ? 8  
HELX_P HELX_P4  AA4 VAL A 150 ? LEU A 156 ? VAL A 150 LEU A 156 1 ? 7  
HELX_P HELX_P5  AA5 ASN A 167 ? ILE A 184 ? ASN A 167 ILE A 184 1 ? 18 
HELX_P HELX_P6  AA6 GLN A 185 ? PHE A 187 ? GLN A 185 PHE A 187 5 ? 3  
HELX_P HELX_P7  AA7 SER A 200 ? SER A 212 ? SER A 200 SER A 212 1 ? 13 
HELX_P HELX_P8  AA8 PRO A 213 ? PHE A 219 ? PRO A 213 PHE A 219 5 ? 7  
HELX_P HELX_P9  AA9 SER A 237 ? LEU A 252 ? SER A 237 LEU A 252 1 ? 16 
HELX_P HELX_P10 AB1 SER A 258 ? GLU A 268 ? SER A 258 GLU A 268 1 ? 11 
HELX_P HELX_P11 AB2 LYS A 270 ? ASP A 276 ? LYS A 270 ASP A 276 1 ? 7  
HELX_P HELX_P12 AB3 VAL A 277 ? LEU A 282 ? VAL A 277 LEU A 282 5 ? 6  
HELX_P HELX_P13 AB4 SER A 304 ? GLY A 312 ? SER A 304 GLY A 312 1 ? 9  
HELX_P HELX_P14 AB5 GLY A 328 ? ALA A 336 ? GLY A 328 ALA A 336 1 ? 9  
HELX_P HELX_P15 AB6 SER A 348 ? VAL A 360 ? SER A 348 VAL A 360 1 ? 13 
HELX_P HELX_P16 AB7 ASN A 364 ? THR A 376 ? ASN A 364 THR A 376 1 ? 13 
HELX_P HELX_P17 AB8 ASN A 383 ? VAL A 400 ? ASN A 383 VAL A 400 1 ? 18 
HELX_P HELX_P18 AB9 VAL A 400 ? LYS A 413 ? VAL A 400 LYS A 413 1 ? 14 
HELX_P HELX_P19 AC1 PRO A 433 ? GLY A 437 ? PRO A 433 GLY A 437 5 ? 5  
HELX_P HELX_P20 AC2 GLU A 443 ? PHE A 448 ? GLU A 443 PHE A 448 1 ? 6  
HELX_P HELX_P21 AC3 GLY A 449 ? ASN A 457 ? GLY A 449 ASN A 457 5 ? 9  
HELX_P HELX_P22 AC4 THR A 459 ? GLY A 480 ? THR A 459 GLY A 480 1 ? 22 
HELX_P HELX_P23 AC5 ARG A 517 ? GLN A 526 ? ARG A 517 GLN A 526 1 ? 10 
HELX_P HELX_P24 AC6 GLN A 526 ? THR A 535 ? GLN A 526 THR A 535 1 ? 10 
HELX_P HELX_P25 AC7 VAL B 40  ? ARG B 44  ? VAL B 40  ARG B 44  5 ? 5  
HELX_P HELX_P26 AC8 PHE B 78  ? MET B 83  ? PHE B 78  MET B 83  1 ? 6  
HELX_P HELX_P27 AC9 LEU B 127 ? ASN B 131 ? LEU B 127 ASN B 131 5 ? 5  
HELX_P HELX_P28 AD1 GLY B 132 ? GLU B 140 ? GLY B 132 GLU B 140 1 ? 9  
HELX_P HELX_P29 AD2 VAL B 150 ? LEU B 156 ? VAL B 150 LEU B 156 1 ? 7  
HELX_P HELX_P30 AD3 ASN B 167 ? ILE B 184 ? ASN B 167 ILE B 184 1 ? 18 
HELX_P HELX_P31 AD4 GLN B 185 ? PHE B 187 ? GLN B 185 PHE B 187 5 ? 3  
HELX_P HELX_P32 AD5 SER B 200 ? SER B 212 ? SER B 200 SER B 212 1 ? 13 
HELX_P HELX_P33 AD6 SER B 212 ? ASP B 217 ? SER B 212 ASP B 217 1 ? 6  
HELX_P HELX_P34 AD7 SER B 237 ? ASN B 251 ? SER B 237 ASN B 251 1 ? 15 
HELX_P HELX_P35 AD8 SER B 258 ? LYS B 269 ? SER B 258 LYS B 269 1 ? 12 
HELX_P HELX_P36 AD9 LYS B 270 ? ASP B 276 ? LYS B 270 ASP B 276 1 ? 7  
HELX_P HELX_P37 AE1 VAL B 277 ? LEU B 282 ? VAL B 277 LEU B 282 5 ? 6  
HELX_P HELX_P38 AE2 SER B 304 ? GLY B 312 ? SER B 304 GLY B 312 1 ? 9  
HELX_P HELX_P39 AE3 GLY B 328 ? ALA B 336 ? GLY B 328 ALA B 336 1 ? 9  
HELX_P HELX_P40 AE4 SER B 348 ? VAL B 360 ? SER B 348 VAL B 360 1 ? 13 
HELX_P HELX_P41 AE5 ASN B 364 ? TYR B 375 ? ASN B 364 TYR B 375 1 ? 12 
HELX_P HELX_P42 AE6 ASN B 383 ? VAL B 400 ? ASN B 383 VAL B 400 1 ? 18 
HELX_P HELX_P43 AE7 VAL B 400 ? LYS B 413 ? VAL B 400 LYS B 413 1 ? 14 
HELX_P HELX_P44 AE8 PRO B 433 ? GLY B 437 ? PRO B 433 GLY B 437 5 ? 5  
HELX_P HELX_P45 AE9 GLU B 443 ? PHE B 448 ? GLU B 443 PHE B 448 1 ? 6  
HELX_P HELX_P46 AF1 GLY B 449 ? VAL B 453 ? GLY B 449 VAL B 453 5 ? 5  
HELX_P HELX_P47 AF2 THR B 459 ? GLY B 480 ? THR B 459 GLY B 480 1 ? 22 
HELX_P HELX_P48 AF3 ARG B 517 ? GLN B 526 ? ARG B 517 GLN B 526 1 ? 10 
HELX_P HELX_P49 AF4 GLN B 526 ? ALA B 534 ? GLN B 526 ALA B 534 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?   ? A CYS 67  SG  ? ? ? 1_555 A CYS 94  SG ? ? A CYS 67  A CYS 94  1_555 ? ? ? ? ? ? ? 2.043 ? ?               
disulf2 disulf ?   ? A CYS 254 SG  ? ? ? 1_555 A CYS 265 SG ? ? A CYS 254 A CYS 265 1_555 ? ? ? ? ? ? ? 2.054 ? ?               
disulf3 disulf ?   ? A CYS 402 SG  ? ? ? 1_555 A CYS 521 SG ? ? A CYS 402 A CYS 521 1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf4 disulf ?   ? B CYS 67  SG  ? ? ? 1_555 B CYS 94  SG ? ? B CYS 67  B CYS 94  1_555 ? ? ? ? ? ? ? 2.062 ? ?               
disulf5 disulf ?   ? B CYS 254 SG  ? ? ? 1_555 B CYS 265 SG ? ? B CYS 254 B CYS 265 1_555 ? ? ? ? ? ? ? 2.046 ? ?               
disulf6 disulf ?   ? B CYS 402 SG  ? ? ? 1_555 B CYS 521 SG ? ? B CYS 402 B CYS 521 1_555 ? ? ? ? ? ? ? 2.152 ? ?               
covale1 covale one ? A ASN 59  ND2 ? ? ? 1_555 C NAG .   C1 ? ? A ASN 59  A NAG 601 1_555 ? ? ? ? ? ? ? 1.451 ? N-Glycosylation 
covale2 covale one ? A ASN 416 ND2 ? ? ? 1_555 D NAG .   C1 ? ? A ASN 416 A NAG 602 1_555 ? ? ? ? ? ? ? 1.449 ? N-Glycosylation 
covale3 covale one ? B ASN 59  ND2 ? ? ? 1_555 F NAG .   C1 ? ? B ASN 59  B NAG 601 1_555 ? ? ? ? ? ? ? 1.455 ? N-Glycosylation 
covale4 covale one ? B ASN 416 ND2 ? ? ? 1_555 G NAG .   C1 ? ? B ASN 416 B NAG 602 1_555 ? ? ? ? ? ? ? 1.455 ? N-Glycosylation 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 SER 103 A . ? SER 103 A PRO 104 A ? PRO 104 A 1 4.08 
2 GLU 489 A . ? GLU 489 A SER 490 A ? SER 490 A 1 1.76 
3 SER 103 B . ? SER 103 B PRO 104 B ? PRO 104 B 1 2.25 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3  ? 
AA2 ? 11 ? 
AA3 ? 3  ? 
AA4 ? 11 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1  2  ? anti-parallel 
AA1 2  3  ? parallel      
AA2 1  2  ? anti-parallel 
AA2 2  3  ? anti-parallel 
AA2 3  4  ? anti-parallel 
AA2 4  5  ? parallel      
AA2 5  6  ? parallel      
AA2 6  7  ? parallel      
AA2 7  8  ? parallel      
AA2 8  9  ? parallel      
AA2 9  10 ? parallel      
AA2 10 11 ? anti-parallel 
AA3 1  2  ? anti-parallel 
AA3 2  3  ? parallel      
AA4 1  2  ? anti-parallel 
AA4 2  3  ? anti-parallel 
AA4 3  4  ? anti-parallel 
AA4 4  5  ? parallel      
AA4 5  6  ? parallel      
AA4 6  7  ? parallel      
AA4 7  8  ? parallel      
AA4 8  9  ? parallel      
AA4 9  10 ? parallel      
AA4 10 11 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1  LEU A 7   ? THR A 10  ? LEU A 7   THR A 10  
AA1 2  GLY A 13  ? MET A 16  ? GLY A 13  MET A 16  
AA1 3  VAL A 57  ? ASN A 59  ? VAL A 57  ASN A 59  
AA2 1  THR A 18  ? PRO A 21  ? THR A 18  PRO A 21  
AA2 2  HIS A 26  ? PRO A 34  ? HIS A 26  PRO A 34  
AA2 3  TYR A 96  ? VAL A 101 ? TYR A 96  VAL A 101 
AA2 4  VAL A 142 ? SER A 145 ? VAL A 142 SER A 145 
AA2 5  THR A 109 ? ILE A 115 ? THR A 109 ILE A 115 
AA2 6  GLY A 189 ? GLU A 199 ? GLY A 189 GLU A 199 
AA2 7  ARG A 221 ? GLN A 225 ? ARG A 221 GLN A 225 
AA2 8  ILE A 319 ? ASN A 324 ? ILE A 319 ASN A 324 
AA2 9  THR A 418 ? PHE A 423 ? THR A 418 PHE A 423 
AA2 10 LYS A 501 ? LEU A 505 ? LYS A 501 LEU A 505 
AA2 11 VAL A 512 ? GLN A 514 ? VAL A 512 GLN A 514 
AA3 1  LEU B 7   ? ASN B 9   ? LEU B 7   ASN B 9   
AA3 2  LYS B 14  ? MET B 16  ? LYS B 14  MET B 16  
AA3 3  VAL B 57  ? ASN B 59  ? VAL B 57  ASN B 59  
AA4 1  THR B 18  ? PRO B 21  ? THR B 18  PRO B 21  
AA4 2  HIS B 26  ? PRO B 34  ? HIS B 26  PRO B 34  
AA4 3  TYR B 96  ? VAL B 101 ? TYR B 96  VAL B 101 
AA4 4  VAL B 142 ? SER B 145 ? VAL B 142 SER B 145 
AA4 5  THR B 109 ? ILE B 115 ? THR B 109 ILE B 115 
AA4 6  GLY B 189 ? GLU B 199 ? GLY B 189 GLU B 199 
AA4 7  ARG B 221 ? GLN B 225 ? ARG B 221 GLN B 225 
AA4 8  ILE B 319 ? ASN B 324 ? ILE B 319 ASN B 324 
AA4 9  THR B 418 ? PHE B 423 ? THR B 418 PHE B 423 
AA4 10 LYS B 501 ? LEU B 505 ? LYS B 501 LEU B 505 
AA4 11 VAL B 512 ? GLN B 514 ? VAL B 512 GLN B 514 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1  2  N VAL A 8   ? N VAL A 8   O VAL A 15  ? O VAL A 15  
AA1 2  3  N LYS A 14  ? N LYS A 14  O TRP A 58  ? O TRP A 58  
AA2 1  2  N VAL A 20  ? N VAL A 20  O ILE A 27  ? O ILE A 27  
AA2 2  3  N PHE A 30  ? N PHE A 30  O ILE A 99  ? O ILE A 99  
AA2 3  4  N TRP A 100 ? N TRP A 100 O LEU A 143 ? O LEU A 143 
AA2 4  5  O VAL A 144 ? O VAL A 144 N TRP A 114 ? N TRP A 114 
AA2 5  6  N THR A 109 ? N THR A 109 O ASP A 190 ? O ASP A 190 
AA2 6  7  N GLY A 198 ? N GLY A 198 O GLN A 225 ? O GLN A 225 
AA2 7  8  N ALA A 222 ? N ALA A 222 O LEU A 320 ? O LEU A 320 
AA2 8  9  N LEU A 321 ? N LEU A 321 O TYR A 419 ? O TYR A 419 
AA2 9  10 N PHE A 422 ? N PHE A 422 O LEU A 505 ? O LEU A 505 
AA2 10 11 N PHE A 502 ? N PHE A 502 O HIS A 513 ? O HIS A 513 
AA3 1  2  N VAL B 8   ? N VAL B 8   O VAL B 15  ? O VAL B 15  
AA3 2  3  N LYS B 14  ? N LYS B 14  O TRP B 58  ? O TRP B 58  
AA4 1  2  N THR B 18  ? N THR B 18  O ALA B 29  ? O ALA B 29  
AA4 2  3  N PHE B 30  ? N PHE B 30  O ILE B 99  ? O ILE B 99  
AA4 3  4  N TRP B 100 ? N TRP B 100 O LEU B 143 ? O LEU B 143 
AA4 4  5  O VAL B 144 ? O VAL B 144 N TRP B 114 ? N TRP B 114 
AA4 5  6  N VAL B 111 ? N VAL B 111 O THR B 195 ? O THR B 195 
AA4 6  7  N ILE B 196 ? N ILE B 196 O ILE B 223 ? O ILE B 223 
AA4 7  8  N LEU B 224 ? N LEU B 224 O LEU B 320 ? O LEU B 320 
AA4 8  9  N VAL B 323 ? N VAL B 323 O PHE B 423 ? O PHE B 423 
AA4 9  10 N PHE B 422 ? N PHE B 422 O ILE B 503 ? O ILE B 503 
AA4 10 11 N PHE B 502 ? N PHE B 502 O HIS B 513 ? O HIS B 513 
# 
_atom_sites.entry_id                    6G4N 
_atom_sites.fract_transf_matrix[1][1]   0.010892 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009328 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006647 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . SER A 1 4   ? 22.036  -10.095 85.410  1.00 85.45  ? 4   SER A N   1 
ATOM   2    C  CA  . SER A 1 4   ? 21.312  -11.248 84.877  1.00 90.58  ? 4   SER A CA  1 
ATOM   3    C  C   . SER A 1 4   ? 21.296  -11.260 83.346  1.00 84.56  ? 4   SER A C   1 
ATOM   4    O  O   . SER A 1 4   ? 21.914  -10.413 82.696  1.00 83.58  ? 4   SER A O   1 
ATOM   5    C  CB  . SER A 1 4   ? 19.874  -11.277 85.419  1.00 87.72  ? 4   SER A CB  1 
ATOM   6    O  OG  . SER A 1 4   ? 19.109  -12.321 84.830  1.00 81.32  ? 4   SER A OG  1 
ATOM   7    N  N   . GLU A 1 5   ? 20.584  -12.238 82.785  1.00 71.38  ? 5   GLU A N   1 
ATOM   8    C  CA  . GLU A 1 5   ? 20.419  -12.376 81.344  1.00 64.47  ? 5   GLU A CA  1 
ATOM   9    C  C   . GLU A 1 5   ? 19.227  -11.585 80.821  1.00 61.86  ? 5   GLU A C   1 
ATOM   10   O  O   . GLU A 1 5   ? 19.311  -10.962 79.755  1.00 64.31  ? 5   GLU A O   1 
ATOM   11   C  CB  . GLU A 1 5   ? 20.264  -13.853 80.978  1.00 65.57  ? 5   GLU A CB  1 
ATOM   12   C  CG  . GLU A 1 5   ? 19.407  -14.120 79.741  1.00 63.93  ? 5   GLU A CG  1 
ATOM   13   C  CD  . GLU A 1 5   ? 19.391  -15.592 79.360  1.00 71.22  ? 5   GLU A CD  1 
ATOM   14   O  OE1 . GLU A 1 5   ? 19.646  -15.913 78.173  1.00 63.36  ? 5   GLU A OE1 1 
ATOM   15   O  OE2 . GLU A 1 5   ? 19.142  -16.430 80.261  1.00 80.13  ? 5   GLU A OE2 1 
ATOM   16   N  N   . LEU A 1 6   ? 18.113  -11.607 81.546  1.00 53.52  ? 6   LEU A N   1 
ATOM   17   C  CA  . LEU A 1 6   ? 16.949  -10.807 81.196  1.00 41.21  ? 6   LEU A CA  1 
ATOM   18   C  C   . LEU A 1 6   ? 17.068  -9.364  81.658  1.00 33.18  ? 6   LEU A C   1 
ATOM   19   O  O   . LEU A 1 6   ? 16.123  -8.591  81.470  1.00 26.60  ? 6   LEU A O   1 
ATOM   20   C  CB  . LEU A 1 6   ? 15.682  -11.426 81.795  1.00 50.68  ? 6   LEU A CB  1 
ATOM   21   C  CG  . LEU A 1 6   ? 15.420  -12.898 81.466  1.00 54.76  ? 6   LEU A CG  1 
ATOM   22   C  CD1 . LEU A 1 6   ? 14.316  -13.482 82.359  1.00 48.25  ? 6   LEU A CD1 1 
ATOM   23   C  CD2 . LEU A 1 6   ? 15.067  -13.048 79.987  1.00 57.59  ? 6   LEU A CD2 1 
ATOM   24   N  N   . LEU A 1 7   ? 18.176  -8.987  82.287  1.00 42.11  ? 7   LEU A N   1 
ATOM   25   C  CA  . LEU A 1 7   ? 18.422  -7.607  82.677  1.00 47.13  ? 7   LEU A CA  1 
ATOM   26   C  C   . LEU A 1 7   ? 19.552  -7.063  81.817  1.00 48.17  ? 7   LEU A C   1 
ATOM   27   O  O   . LEU A 1 7   ? 20.663  -7.606  81.816  1.00 57.09  ? 7   LEU A O   1 
ATOM   28   C  CB  . LEU A 1 7   ? 18.755  -7.490  84.165  1.00 54.88  ? 7   LEU A CB  1 
ATOM   29   C  CG  . LEU A 1 7   ? 18.896  -6.038  84.629  1.00 59.80  ? 7   LEU A CG  1 
ATOM   30   C  CD1 . LEU A 1 7   ? 17.941  -5.737  85.759  1.00 56.95  ? 7   LEU A CD1 1 
ATOM   31   C  CD2 . LEU A 1 7   ? 20.332  -5.730  85.046  1.00 64.07  ? 7   LEU A CD2 1 
ATOM   32   N  N   . VAL A 1 8   ? 19.257  -6.002  81.081  1.00 42.87  ? 8   VAL A N   1 
ATOM   33   C  CA  . VAL A 1 8   ? 20.185  -5.387  80.145  1.00 39.02  ? 8   VAL A CA  1 
ATOM   34   C  C   . VAL A 1 8   ? 20.219  -3.898  80.442  1.00 34.04  ? 8   VAL A C   1 
ATOM   35   O  O   . VAL A 1 8   ? 19.173  -3.280  80.692  1.00 30.32  ? 8   VAL A O   1 
ATOM   36   C  CB  . VAL A 1 8   ? 19.765  -5.655  78.683  1.00 42.60  ? 8   VAL A CB  1 
ATOM   37   C  CG1 . VAL A 1 8   ? 20.584  -4.807  77.712  1.00 36.65  ? 8   VAL A CG1 1 
ATOM   38   C  CG2 . VAL A 1 8   ? 19.874  -7.159  78.363  1.00 44.73  ? 8   VAL A CG2 1 
ATOM   39   N  N   . ASN A 1 9   ? 21.417  -3.323  80.435  1.00 29.87  ? 9   ASN A N   1 
ATOM   40   C  CA  . ASN A 1 9   ? 21.601  -1.928  80.824  1.00 31.86  ? 9   ASN A CA  1 
ATOM   41   C  C   . ASN A 1 9   ? 22.066  -1.136  79.603  1.00 35.59  ? 9   ASN A C   1 
ATOM   42   O  O   . ASN A 1 9   ? 23.243  -1.162  79.227  1.00 48.67  ? 9   ASN A O   1 
ATOM   43   C  CB  . ASN A 1 9   ? 22.564  -1.819  82.004  1.00 28.81  ? 9   ASN A CB  1 
ATOM   44   C  CG  . ASN A 1 9   ? 22.995  -0.404  82.262  1.00 46.65  ? 9   ASN A CG  1 
ATOM   45   O  OD1 . ASN A 1 9   ? 22.165  0.489   82.462  1.00 61.91  ? 9   ASN A OD1 1 
ATOM   46   N  ND2 . ASN A 1 9   ? 24.302  -0.191  82.304  1.00 49.61  ? 9   ASN A ND2 1 
ATOM   47   N  N   . THR A 1 10  ? 21.121  -0.451  78.976  1.00 32.05  ? 10  THR A N   1 
ATOM   48   C  CA  . THR A 1 10  ? 21.380  0.405   77.837  1.00 29.53  ? 10  THR A CA  1 
ATOM   49   C  C   . THR A 1 10  ? 21.895  1.760   78.295  1.00 38.74  ? 10  THR A C   1 
ATOM   50   O  O   . THR A 1 10  ? 21.904  2.083   79.490  1.00 43.92  ? 10  THR A O   1 
ATOM   51   C  CB  . THR A 1 10  ? 20.109  0.639   77.048  1.00 23.42  ? 10  THR A CB  1 
ATOM   52   O  OG1 . THR A 1 10  ? 19.335  1.614   77.752  1.00 30.31  ? 10  THR A OG1 1 
ATOM   53   C  CG2 . THR A 1 10  ? 19.309  -0.633  76.943  1.00 21.30  ? 10  THR A CG2 1 
ATOM   54   N  N   . LYS A 1 11  ? 22.258  2.586   77.308  1.00 34.03  ? 11  LYS A N   1 
ATOM   55   C  CA  . LYS A 1 11  ? 22.804  3.913   77.569  1.00 39.57  ? 11  LYS A CA  1 
ATOM   56   C  C   . LYS A 1 11  ? 21.758  4.895   78.068  1.00 35.35  ? 11  LYS A C   1 
ATOM   57   O  O   . LYS A 1 11  ? 22.125  5.976   78.548  1.00 37.55  ? 11  LYS A O   1 
ATOM   58   C  CB  . LYS A 1 11  ? 23.489  4.461   76.316  1.00 42.40  ? 11  LYS A CB  1 
ATOM   59   C  CG  . LYS A 1 11  ? 24.370  3.432   75.622  1.00 34.83  ? 11  LYS A CG  1 
ATOM   60   C  CD  . LYS A 1 11  ? 25.193  4.046   74.534  1.00 27.82  ? 11  LYS A CD  1 
ATOM   61   C  CE  . LYS A 1 11  ? 26.646  3.595   74.618  1.00 35.29  ? 11  LYS A CE  1 
ATOM   62   N  NZ  . LYS A 1 11  ? 27.254  3.561   73.234  1.00 48.85  ? 11  LYS A NZ  1 
ATOM   63   N  N   . SER A 1 12  ? 20.481  4.540   78.000  1.00 33.53  ? 12  SER A N   1 
ATOM   64   C  CA  . SER A 1 12  ? 19.434  5.370   78.569  1.00 41.28  ? 12  SER A CA  1 
ATOM   65   C  C   . SER A 1 12  ? 18.846  4.800   79.857  1.00 33.55  ? 12  SER A C   1 
ATOM   66   O  O   . SER A 1 12  ? 18.131  5.520   80.564  1.00 27.25  ? 12  SER A O   1 
ATOM   67   C  CB  . SER A 1 12  ? 18.323  5.588   77.531  1.00 53.69  ? 12  SER A CB  1 
ATOM   68   O  OG  . SER A 1 12  ? 18.853  6.067   76.306  1.00 62.85  ? 12  SER A OG  1 
ATOM   69   N  N   . GLY A 1 13  ? 19.129  3.549   80.189  1.00 27.76  ? 13  GLY A N   1 
ATOM   70   C  CA  . GLY A 1 13  ? 18.614  2.984   81.418  1.00 23.21  ? 13  GLY A CA  1 
ATOM   71   C  C   . GLY A 1 13  ? 18.562  1.472   81.375  1.00 31.01  ? 13  GLY A C   1 
ATOM   72   O  O   . GLY A 1 13  ? 18.839  0.839   80.361  1.00 38.59  ? 13  GLY A O   1 
ATOM   73   N  N   . LYS A 1 14  ? 18.206  0.907   82.518  1.00 29.74  ? 14  LYS A N   1 
ATOM   74   C  CA  . LYS A 1 14  ? 18.068  -0.532  82.636  1.00 32.53  ? 14  LYS A CA  1 
ATOM   75   C  C   . LYS A 1 14  ? 16.690  -0.957  82.158  1.00 31.89  ? 14  LYS A C   1 
ATOM   76   O  O   . LYS A 1 14  ? 15.696  -0.239  82.324  1.00 22.99  ? 14  LYS A O   1 
ATOM   77   C  CB  . LYS A 1 14  ? 18.275  -1.000  84.082  1.00 32.14  ? 14  LYS A CB  1 
ATOM   78   C  CG  . LYS A 1 14  ? 19.186  -0.121  84.916  1.00 32.57  ? 14  LYS A CG  1 
ATOM   79   C  CD  . LYS A 1 14  ? 19.903  -0.946  85.978  1.00 35.71  ? 14  LYS A CD  1 
ATOM   80   C  CE  . LYS A 1 14  ? 20.235  -0.103  87.210  1.00 34.43  ? 14  LYS A CE  1 
ATOM   81   N  NZ  . LYS A 1 14  ? 21.344  -0.699  88.005  1.00 33.01  ? 14  LYS A NZ  1 
ATOM   82   N  N   . VAL A 1 15  ? 16.643  -2.141  81.555  1.00 29.87  ? 15  VAL A N   1 
ATOM   83   C  CA  . VAL A 1 15  ? 15.395  -2.742  81.110  1.00 29.50  ? 15  VAL A CA  1 
ATOM   84   C  C   . VAL A 1 15  ? 15.409  -4.197  81.543  1.00 34.22  ? 15  VAL A C   1 
ATOM   85   O  O   . VAL A 1 15  ? 16.461  -4.843  81.585  1.00 39.79  ? 15  VAL A O   1 
ATOM   86   C  CB  . VAL A 1 15  ? 15.198  -2.626  79.579  1.00 28.00  ? 15  VAL A CB  1 
ATOM   87   C  CG1 . VAL A 1 15  ? 15.023  -1.171  79.171  1.00 21.63  ? 15  VAL A CG1 1 
ATOM   88   C  CG2 . VAL A 1 15  ? 16.380  -3.233  78.845  1.00 31.49  ? 15  VAL A CG2 1 
ATOM   89   N  N   . MET A 1 16  ? 14.231  -4.705  81.886  1.00 33.88  ? 16  MET A N   1 
ATOM   90   C  CA  . MET A 1 16  ? 14.066  -6.078  82.340  1.00 35.16  ? 16  MET A CA  1 
ATOM   91   C  C   . MET A 1 16  ? 13.100  -6.756  81.389  1.00 32.67  ? 16  MET A C   1 
ATOM   92   O  O   . MET A 1 16  ? 11.925  -6.372  81.314  1.00 26.14  ? 16  MET A O   1 
ATOM   93   C  CB  . MET A 1 16  ? 13.548  -6.139  83.781  1.00 39.44  ? 16  MET A CB  1 
ATOM   94   C  CG  . MET A 1 16  ? 13.124  -7.518  84.274  1.00 47.35  ? 16  MET A CG  1 
ATOM   95   S  SD  . MET A 1 16  ? 14.517  -8.569  84.720  1.00 63.14  ? 16  MET A SD  1 
ATOM   96   C  CE  . MET A 1 16  ? 13.725  -9.775  85.794  1.00 66.10  ? 16  MET A CE  1 
ATOM   97   N  N   . GLY A 1 17  ? 13.600  -7.743  80.660  1.00 28.78  ? 17  GLY A N   1 
ATOM   98   C  CA  . GLY A 1 17  ? 12.813  -8.483  79.703  1.00 27.90  ? 17  GLY A CA  1 
ATOM   99   C  C   . GLY A 1 17  ? 12.015  -9.596  80.338  1.00 42.57  ? 17  GLY A C   1 
ATOM   100  O  O   . GLY A 1 17  ? 11.715  -9.585  81.539  1.00 45.43  ? 17  GLY A O   1 
ATOM   101  N  N   . THR A 1 18  ? 11.661  -10.571 79.506  1.00 45.88  ? 18  THR A N   1 
ATOM   102  C  CA  . THR A 1 18  ? 10.882  -11.721 79.930  1.00 50.77  ? 18  THR A CA  1 
ATOM   103  C  C   . THR A 1 18  ? 11.262  -12.921 79.075  1.00 49.29  ? 18  THR A C   1 
ATOM   104  O  O   . THR A 1 18  ? 11.633  -12.779 77.904  1.00 52.71  ? 18  THR A O   1 
ATOM   105  C  CB  . THR A 1 18  ? 9.378   -11.456 79.827  1.00 57.27  ? 18  THR A CB  1 
ATOM   106  O  OG1 . THR A 1 18  ? 8.675   -12.694 79.948  1.00 62.09  ? 18  THR A OG1 1 
ATOM   107  C  CG2 . THR A 1 18  ? 9.035   -10.806 78.495  1.00 59.79  ? 18  THR A CG2 1 
ATOM   108  N  N   . ARG A 1 19  ? 11.166  -14.103 79.673  1.00 44.53  ? 19  ARG A N   1 
ATOM   109  C  CA  . ARG A 1 19  ? 11.527  -15.356 79.016  1.00 35.58  ? 19  ARG A CA  1 
ATOM   110  C  C   . ARG A 1 19  ? 10.259  -15.929 78.380  1.00 39.35  ? 19  ARG A C   1 
ATOM   111  O  O   . ARG A 1 19  ? 9.407   -16.507 79.061  1.00 45.12  ? 19  ARG A O   1 
ATOM   112  C  CB  . ARG A 1 19  ? 12.189  -16.290 80.025  1.00 26.49  ? 19  ARG A CB  1 
ATOM   113  C  CG  . ARG A 1 19  ? 12.039  -17.757 79.767  1.00 27.19  ? 19  ARG A CG  1 
ATOM   114  C  CD  . ARG A 1 19  ? 12.974  -18.519 80.645  1.00 34.13  ? 19  ARG A CD  1 
ATOM   115  N  NE  . ARG A 1 19  ? 14.173  -18.856 79.897  1.00 55.32  ? 19  ARG A NE  1 
ATOM   116  C  CZ  . ARG A 1 19  ? 14.571  -20.099 79.660  1.00 65.55  ? 19  ARG A CZ  1 
ATOM   117  N  NH1 . ARG A 1 19  ? 13.852  -21.106 80.135  1.00 71.44  ? 19  ARG A NH1 1 
ATOM   118  N  NH2 . ARG A 1 19  ? 15.679  -20.317 78.958  1.00 51.90  ? 19  ARG A NH2 1 
ATOM   119  N  N   . VAL A 1 20  ? 10.115  -15.717 77.074  1.00 43.88  ? 20  VAL A N   1 
ATOM   120  C  CA  . VAL A 1 20  ? 8.935   -16.137 76.318  1.00 35.42  ? 20  VAL A CA  1 
ATOM   121  C  C   . VAL A 1 20  ? 9.222   -17.508 75.727  1.00 35.79  ? 20  VAL A C   1 
ATOM   122  O  O   . VAL A 1 20  ? 10.369  -17.804 75.363  1.00 43.16  ? 20  VAL A O   1 
ATOM   123  C  CB  . VAL A 1 20  ? 8.566   -15.129 75.214  1.00 27.49  ? 20  VAL A CB  1 
ATOM   124  C  CG1 . VAL A 1 20  ? 8.506   -13.717 75.761  1.00 26.22  ? 20  VAL A CG1 1 
ATOM   125  C  CG2 . VAL A 1 20  ? 9.568   -15.176 74.090  1.00 29.01  ? 20  VAL A CG2 1 
ATOM   126  N  N   . PRO A 1 21  ? 8.233   -18.383 75.633  1.00 34.82  ? 21  PRO A N   1 
ATOM   127  C  CA  . PRO A 1 21  ? 8.471   -19.669 74.981  1.00 35.02  ? 21  PRO A CA  1 
ATOM   128  C  C   . PRO A 1 21  ? 8.181   -19.565 73.493  1.00 43.72  ? 21  PRO A C   1 
ATOM   129  O  O   . PRO A 1 21  ? 7.302   -18.826 73.041  1.00 39.23  ? 21  PRO A O   1 
ATOM   130  C  CB  . PRO A 1 21  ? 7.480   -20.596 75.694  1.00 34.04  ? 21  PRO A CB  1 
ATOM   131  C  CG  . PRO A 1 21  ? 6.321   -19.693 76.017  1.00 39.32  ? 21  PRO A CG  1 
ATOM   132  C  CD  . PRO A 1 21  ? 6.881   -18.292 76.209  1.00 38.30  ? 21  PRO A CD  1 
ATOM   133  N  N   . VAL A 1 22  ? 8.973   -20.299 72.723  1.00 44.69  ? 22  VAL A N   1 
ATOM   134  C  CA  . VAL A 1 22  ? 8.787   -20.429 71.286  1.00 36.35  ? 22  VAL A CA  1 
ATOM   135  C  C   . VAL A 1 22  ? 9.114   -21.875 70.955  1.00 30.19  ? 22  VAL A C   1 
ATOM   136  O  O   . VAL A 1 22  ? 10.263  -22.298 71.121  1.00 26.74  ? 22  VAL A O   1 
ATOM   137  C  CB  . VAL A 1 22  ? 9.674   -19.463 70.481  1.00 37.30  ? 22  VAL A CB  1 
ATOM   138  C  CG1 . VAL A 1 22  ? 11.072  -19.374 71.076  1.00 33.00  ? 22  VAL A CG1 1 
ATOM   139  C  CG2 . VAL A 1 22  ? 9.751   -19.894 69.021  1.00 36.23  ? 22  VAL A CG2 1 
ATOM   140  N  N   . LEU A 1 23  ? 8.096   -22.645 70.545  1.00 38.60  ? 23  LEU A N   1 
ATOM   141  C  CA  . LEU A 1 23  ? 8.207   -24.038 70.094  1.00 51.72  ? 23  LEU A CA  1 
ATOM   142  C  C   . LEU A 1 23  ? 9.158   -24.896 70.913  1.00 53.02  ? 23  LEU A C   1 
ATOM   143  O  O   . LEU A 1 23  ? 10.369  -24.856 70.670  1.00 60.38  ? 23  LEU A O   1 
ATOM   144  C  CB  . LEU A 1 23  ? 8.691   -24.114 68.636  1.00 51.85  ? 23  LEU A CB  1 
ATOM   145  C  CG  . LEU A 1 23  ? 8.222   -23.158 67.540  1.00 57.41  ? 23  LEU A CG  1 
ATOM   146  C  CD1 . LEU A 1 23  ? 9.224   -23.159 66.422  1.00 23.94  ? 23  LEU A CD1 1 
ATOM   147  C  CD2 . LEU A 1 23  ? 6.862   -23.574 67.015  1.00 58.47  ? 23  LEU A CD2 1 
ATOM   148  N  N   . SER A 1 24  ? 8.648   -25.691 71.853  1.00 50.12  ? 24  SER A N   1 
ATOM   149  C  CA  . SER A 1 24  ? 9.515   -26.675 72.496  1.00 65.44  ? 24  SER A CA  1 
ATOM   150  C  C   . SER A 1 24  ? 10.649  -26.028 73.302  1.00 66.85  ? 24  SER A C   1 
ATOM   151  O  O   . SER A 1 24  ? 11.493  -26.732 73.866  1.00 61.03  ? 24  SER A O   1 
ATOM   152  C  CB  . SER A 1 24  ? 10.075  -27.633 71.418  1.00 67.24  ? 24  SER A CB  1 
ATOM   153  O  OG  . SER A 1 24  ? 10.980  -28.614 71.916  1.00 70.25  ? 24  SER A OG  1 
ATOM   154  N  N   . SER A 1 25  ? 10.681  -24.699 73.379  1.00 70.26  ? 25  SER A N   1 
ATOM   155  C  CA  . SER A 1 25  ? 11.826  -23.997 73.958  1.00 61.38  ? 25  SER A CA  1 
ATOM   156  C  C   . SER A 1 25  ? 11.429  -22.565 74.318  1.00 51.56  ? 25  SER A C   1 
ATOM   157  O  O   . SER A 1 25  ? 10.243  -22.217 74.380  1.00 52.80  ? 25  SER A O   1 
ATOM   158  C  CB  . SER A 1 25  ? 13.022  -24.030 72.997  1.00 58.39  ? 25  SER A CB  1 
ATOM   159  O  OG  . SER A 1 25  ? 14.060  -23.174 73.445  1.00 52.58  ? 25  SER A OG  1 
ATOM   160  N  N   . HIS A 1 26  ? 12.437  -21.740 74.591  1.00 40.44  ? 26  HIS A N   1 
ATOM   161  C  CA  . HIS A 1 26  ? 12.232  -20.386 75.076  1.00 44.05  ? 26  HIS A CA  1 
ATOM   162  C  C   . HIS A 1 26  ? 13.351  -19.503 74.545  1.00 44.44  ? 26  HIS A C   1 
ATOM   163  O  O   . HIS A 1 26  ? 14.445  -19.977 74.218  1.00 49.33  ? 26  HIS A O   1 
ATOM   164  C  CB  . HIS A 1 26  ? 12.227  -20.301 76.617  1.00 56.13  ? 26  HIS A CB  1 
ATOM   165  C  CG  . HIS A 1 26  ? 11.464  -21.396 77.294  1.00 65.98  ? 26  HIS A CG  1 
ATOM   166  N  ND1 . HIS A 1 26  ? 10.324  -21.156 78.036  1.00 71.50  ? 26  HIS A ND1 1 
ATOM   167  C  CD2 . HIS A 1 26  ? 11.690  -22.729 77.371  1.00 65.48  ? 26  HIS A CD2 1 
ATOM   168  C  CE1 . HIS A 1 26  ? 9.870   -22.294 78.528  1.00 70.50  ? 26  HIS A CE1 1 
ATOM   169  N  NE2 . HIS A 1 26  ? 10.678  -23.264 78.136  1.00 71.75  ? 26  HIS A NE2 1 
ATOM   170  N  N   . ILE A 1 27  ? 13.066  -18.205 74.476  1.00 37.02  ? 27  ILE A N   1 
ATOM   171  C  CA  . ILE A 1 27  ? 14.061  -17.180 74.184  1.00 23.56  ? 27  ILE A CA  1 
ATOM   172  C  C   . ILE A 1 27  ? 13.658  -15.928 74.946  1.00 32.45  ? 27  ILE A C   1 
ATOM   173  O  O   . ILE A 1 27  ? 12.594  -15.875 75.575  1.00 25.78  ? 27  ILE A O   1 
ATOM   174  C  CB  . ILE A 1 27  ? 14.175  -16.858 72.682  1.00 30.86  ? 27  ILE A CB  1 
ATOM   175  C  CG1 . ILE A 1 27  ? 12.815  -16.438 72.135  1.00 23.03  ? 27  ILE A CG1 1 
ATOM   176  C  CG2 . ILE A 1 27  ? 14.761  -18.027 71.883  1.00 36.85  ? 27  ILE A CG2 1 
ATOM   177  C  CD1 . ILE A 1 27  ? 12.921  -15.702 70.861  1.00 39.20  ? 27  ILE A CD1 1 
ATOM   178  N  N   . SER A 1 28  ? 14.477  -14.895 74.847  1.00 37.68  ? 28  SER A N   1 
ATOM   179  C  CA  . SER A 1 28  ? 14.268  -13.664 75.586  1.00 31.16  ? 28  SER A CA  1 
ATOM   180  C  C   . SER A 1 28  ? 13.597  -12.621 74.708  1.00 35.93  ? 28  SER A C   1 
ATOM   181  O  O   . SER A 1 28  ? 13.802  -12.574 73.490  1.00 41.56  ? 28  SER A O   1 
ATOM   182  C  CB  . SER A 1 28  ? 15.598  -13.128 76.106  1.00 28.15  ? 28  SER A CB  1 
ATOM   183  O  OG  . SER A 1 28  ? 16.155  -14.045 77.031  1.00 38.85  ? 28  SER A OG  1 
ATOM   184  N  N   . ALA A 1 29  ? 12.796  -11.777 75.348  1.00 24.50  ? 29  ALA A N   1 
ATOM   185  C  CA  . ALA A 1 29  ? 12.123  -10.690 74.663  1.00 24.29  ? 29  ALA A CA  1 
ATOM   186  C  C   . ALA A 1 29  ? 12.130  -9.460  75.551  1.00 27.91  ? 29  ALA A C   1 
ATOM   187  O  O   . ALA A 1 29  ? 11.945  -9.563  76.766  1.00 39.05  ? 29  ALA A O   1 
ATOM   188  C  CB  . ALA A 1 29  ? 10.688  -11.073 74.299  1.00 26.13  ? 29  ALA A CB  1 
ATOM   189  N  N   . PHE A 1 30  ? 12.326  -8.297  74.942  1.00 20.10  ? 30  PHE A N   1 
ATOM   190  C  CA  . PHE A 1 30  ? 12.306  -7.028  75.661  1.00 28.48  ? 30  PHE A CA  1 
ATOM   191  C  C   . PHE A 1 30  ? 11.345  -6.121  74.902  1.00 27.40  ? 30  PHE A C   1 
ATOM   192  O  O   . PHE A 1 30  ? 11.720  -5.490  73.914  1.00 37.17  ? 30  PHE A O   1 
ATOM   193  C  CB  . PHE A 1 30  ? 13.705  -6.430  75.776  1.00 29.31  ? 30  PHE A CB  1 
ATOM   194  C  CG  . PHE A 1 30  ? 14.767  -7.412  76.201  1.00 32.40  ? 30  PHE A CG  1 
ATOM   195  C  CD1 . PHE A 1 30  ? 15.241  -7.419  77.510  1.00 41.76  ? 30  PHE A CD1 1 
ATOM   196  C  CD2 . PHE A 1 30  ? 15.328  -8.289  75.290  1.00 32.76  ? 30  PHE A CD2 1 
ATOM   197  C  CE1 . PHE A 1 30  ? 16.239  -8.302  77.903  1.00 35.61  ? 30  PHE A CE1 1 
ATOM   198  C  CE2 . PHE A 1 30  ? 16.317  -9.166  75.676  1.00 39.52  ? 30  PHE A CE2 1 
ATOM   199  C  CZ  . PHE A 1 30  ? 16.771  -9.177  76.985  1.00 36.81  ? 30  PHE A CZ  1 
ATOM   200  N  N   . LEU A 1 31  ? 10.109  -6.053  75.372  1.00 25.39  ? 31  LEU A N   1 
ATOM   201  C  CA  . LEU A 1 31  ? 9.021   -5.440  74.633  1.00 18.90  ? 31  LEU A CA  1 
ATOM   202  C  C   . LEU A 1 31  ? 8.725   -4.039  75.146  1.00 18.82  ? 31  LEU A C   1 
ATOM   203  O  O   . LEU A 1 31  ? 8.776   -3.782  76.344  1.00 19.31  ? 31  LEU A O   1 
ATOM   204  C  CB  . LEU A 1 31  ? 7.778   -6.322  74.723  1.00 26.97  ? 31  LEU A CB  1 
ATOM   205  C  CG  . LEU A 1 31  ? 8.093   -7.777  74.345  1.00 36.36  ? 31  LEU A CG  1 
ATOM   206  C  CD1 . LEU A 1 31  ? 6.912   -8.665  74.594  1.00 33.46  ? 31  LEU A CD1 1 
ATOM   207  C  CD2 . LEU A 1 31  ? 8.531   -7.910  72.883  1.00 45.89  ? 31  LEU A CD2 1 
ATOM   208  N  N   . GLY A 1 32  ? 8.411   -3.134  74.228  1.00 31.66  ? 32  GLY A N   1 
ATOM   209  C  CA  . GLY A 1 32  ? 7.990   -1.802  74.610  1.00 31.84  ? 32  GLY A CA  1 
ATOM   210  C  C   . GLY A 1 32  ? 9.093   -0.896  75.101  1.00 39.32  ? 32  GLY A C   1 
ATOM   211  O  O   . GLY A 1 32  ? 8.846   -0.054  75.976  1.00 44.11  ? 32  GLY A O   1 
ATOM   212  N  N   . ILE A 1 33  ? 10.300  -1.023  74.553  1.00 37.48  ? 33  ILE A N   1 
ATOM   213  C  CA  . ILE A 1 33  ? 11.430  -0.207  74.986  1.00 28.26  ? 33  ILE A CA  1 
ATOM   214  C  C   . ILE A 1 33  ? 11.308  1.194   74.402  1.00 24.35  ? 33  ILE A C   1 
ATOM   215  O  O   . ILE A 1 33  ? 11.249  1.346   73.181  1.00 25.12  ? 33  ILE A O   1 
ATOM   216  C  CB  . ILE A 1 33  ? 12.751  -0.860  74.580  1.00 30.32  ? 33  ILE A CB  1 
ATOM   217  C  CG1 . ILE A 1 33  ? 12.755  -2.329  75.016  1.00 27.61  ? 33  ILE A CG1 1 
ATOM   218  C  CG2 . ILE A 1 33  ? 13.903  -0.099  75.168  1.00 19.07  ? 33  ILE A CG2 1 
ATOM   219  C  CD1 . ILE A 1 33  ? 14.057  -2.996  74.739  1.00 19.21  ? 33  ILE A CD1 1 
ATOM   220  N  N   . PRO A 1 34  ? 11.278  2.232   75.230  1.00 27.77  ? 34  PRO A N   1 
ATOM   221  C  CA  . PRO A 1 34  ? 11.199  3.603   74.709  1.00 21.73  ? 34  PRO A CA  1 
ATOM   222  C  C   . PRO A 1 34  ? 12.447  3.900   73.910  1.00 24.18  ? 34  PRO A C   1 
ATOM   223  O  O   . PRO A 1 34  ? 13.528  3.387   74.212  1.00 29.73  ? 34  PRO A O   1 
ATOM   224  C  CB  . PRO A 1 34  ? 11.127  4.484   75.969  1.00 32.27  ? 34  PRO A CB  1 
ATOM   225  C  CG  . PRO A 1 34  ? 11.371  3.579   77.143  1.00 28.16  ? 34  PRO A CG  1 
ATOM   226  C  CD  . PRO A 1 34  ? 11.332  2.155   76.697  1.00 19.95  ? 34  PRO A CD  1 
ATOM   227  N  N   . PHE A 1 35  ? 12.284  4.684   72.842  1.00 31.50  ? 35  PHE A N   1 
ATOM   228  C  CA  . PHE A 1 35  ? 13.426  5.155   72.072  1.00 26.02  ? 35  PHE A CA  1 
ATOM   229  C  C   . PHE A 1 35  ? 13.370  6.632   71.741  1.00 30.34  ? 35  PHE A C   1 
ATOM   230  O  O   . PHE A 1 35  ? 14.400  7.181   71.348  1.00 37.38  ? 35  PHE A O   1 
ATOM   231  C  CB  . PHE A 1 35  ? 13.608  4.320   70.786  1.00 19.23  ? 35  PHE A CB  1 
ATOM   232  C  CG  . PHE A 1 35  ? 12.661  4.659   69.664  1.00 28.02  ? 35  PHE A CG  1 
ATOM   233  C  CD1 . PHE A 1 35  ? 12.919  5.721   68.809  1.00 30.48  ? 35  PHE A CD1 1 
ATOM   234  C  CD2 . PHE A 1 35  ? 11.552  3.865   69.417  1.00 29.64  ? 35  PHE A CD2 1 
ATOM   235  C  CE1 . PHE A 1 35  ? 12.056  6.024   67.773  1.00 32.87  ? 35  PHE A CE1 1 
ATOM   236  C  CE2 . PHE A 1 35  ? 10.677  4.161   68.374  1.00 25.68  ? 35  PHE A CE2 1 
ATOM   237  C  CZ  . PHE A 1 35  ? 10.930  5.245   67.553  1.00 29.56  ? 35  PHE A CZ  1 
ATOM   238  N  N   . ALA A 1 36  ? 12.232  7.299   71.914  1.00 28.86  ? 36  ALA A N   1 
ATOM   239  C  CA  . ALA A 1 36  ? 12.171  8.749   71.775  1.00 30.15  ? 36  ALA A CA  1 
ATOM   240  C  C   . ALA A 1 36  ? 11.354  9.331   72.921  1.00 31.97  ? 36  ALA A C   1 
ATOM   241  O  O   . ALA A 1 36  ? 10.688  8.604   73.659  1.00 40.15  ? 36  ALA A O   1 
ATOM   242  C  CB  . ALA A 1 36  ? 11.570  9.159   70.423  1.00 27.38  ? 36  ALA A CB  1 
ATOM   243  N  N   . GLU A 1 37  ? 11.333  10.641  73.032  1.00 32.31  ? 37  GLU A N   1 
ATOM   244  C  CA  . GLU A 1 37  ? 10.527  11.268  74.045  1.00 31.76  ? 37  GLU A CA  1 
ATOM   245  C  C   . GLU A 1 37  ? 9.144   11.193  73.498  1.00 35.34  ? 37  GLU A C   1 
ATOM   246  O  O   . GLU A 1 37  ? 8.981   11.300  72.310  1.00 41.38  ? 37  GLU A O   1 
ATOM   247  C  CB  . GLU A 1 37  ? 10.930  12.712  74.233  1.00 19.45  ? 37  GLU A CB  1 
ATOM   248  C  CG  . GLU A 1 37  ? 11.929  12.943  75.332  1.00 20.35  ? 37  GLU A CG  1 
ATOM   249  C  CD  . GLU A 1 37  ? 11.402  12.600  76.693  1.00 47.81  ? 37  GLU A CD  1 
ATOM   250  O  OE1 . GLU A 1 37  ? 11.705  11.523  77.201  1.00 53.90  ? 37  GLU A OE1 1 
ATOM   251  O  OE2 . GLU A 1 37  ? 10.669  13.417  77.254  1.00 51.61  ? 37  GLU A OE2 1 
ATOM   252  N  N   . PRO A 1 38  ? 8.120   10.966  74.401  1.00 36.14  ? 38  PRO A N   1 
ATOM   253  C  CA  . PRO A 1 38  ? 6.784   10.898  73.796  1.00 36.09  ? 38  PRO A CA  1 
ATOM   254  C  C   . PRO A 1 38  ? 6.433   12.129  73.024  1.00 35.23  ? 38  PRO A C   1 
ATOM   255  O  O   . PRO A 1 38  ? 6.600   13.189  73.524  1.00 46.05  ? 38  PRO A O   1 
ATOM   256  C  CB  . PRO A 1 38  ? 5.872   10.737  74.988  1.00 32.65  ? 38  PRO A CB  1 
ATOM   257  C  CG  . PRO A 1 38  ? 6.646   9.888   75.875  1.00 33.00  ? 38  PRO A CG  1 
ATOM   258  C  CD  . PRO A 1 38  ? 7.953   10.582  75.865  1.00 34.69  ? 38  PRO A CD  1 
ATOM   259  N  N   . PRO A 1 39  ? 5.938   11.943  71.750  1.00 36.02  ? 39  PRO A N   1 
ATOM   260  C  CA  . PRO A 1 39  ? 5.635   13.172  71.015  1.00 30.54  ? 39  PRO A CA  1 
ATOM   261  C  C   . PRO A 1 39  ? 4.217   13.687  71.117  1.00 32.22  ? 39  PRO A C   1 
ATOM   262  O  O   . PRO A 1 39  ? 3.434   13.533  70.226  1.00 36.17  ? 39  PRO A O   1 
ATOM   263  C  CB  . PRO A 1 39  ? 5.942   12.785  69.593  1.00 22.11  ? 39  PRO A CB  1 
ATOM   264  C  CG  . PRO A 1 39  ? 5.561   11.401  69.484  1.00 21.94  ? 39  PRO A CG  1 
ATOM   265  C  CD  . PRO A 1 39  ? 5.696   10.769  70.798  1.00 36.40  ? 39  PRO A CD  1 
ATOM   266  N  N   . VAL A 1 40  ? 3.907   14.332  72.219  1.00 27.64  ? 40  VAL A N   1 
ATOM   267  C  CA  . VAL A 1 40  ? 2.589   14.830  72.440  1.00 31.64  ? 40  VAL A CA  1 
ATOM   268  C  C   . VAL A 1 40  ? 2.587   16.294  72.715  1.00 40.25  ? 40  VAL A C   1 
ATOM   269  O  O   . VAL A 1 40  ? 3.601   16.849  72.991  1.00 48.24  ? 40  VAL A O   1 
ATOM   270  C  CB  . VAL A 1 40  ? 2.010   14.164  73.651  1.00 32.92  ? 40  VAL A CB  1 
ATOM   271  C  CG1 . VAL A 1 40  ? 1.855   12.714  73.365  1.00 34.38  ? 40  VAL A CG1 1 
ATOM   272  C  CG2 . VAL A 1 40  ? 2.952   14.325  74.802  1.00 19.60  ? 40  VAL A CG2 1 
ATOM   273  N  N   . GLY A 1 41  ? 1.417   16.900  72.636  1.00 36.34  ? 41  GLY A N   1 
ATOM   274  C  CA  . GLY A 1 41  ? 1.225   18.325  72.859  1.00 20.24  ? 41  GLY A CA  1 
ATOM   275  C  C   . GLY A 1 41  ? 1.977   19.130  71.830  1.00 39.12  ? 41  GLY A C   1 
ATOM   276  O  O   . GLY A 1 41  ? 1.960   18.822  70.631  1.00 33.40  ? 41  GLY A O   1 
ATOM   277  N  N   . ASN A 1 42  ? 2.698   20.143  72.314  1.00 46.91  ? 42  ASN A N   1 
ATOM   278  C  CA  . ASN A 1 42  ? 3.602   20.955  71.504  1.00 53.76  ? 42  ASN A CA  1 
ATOM   279  C  C   . ASN A 1 42  ? 4.480   20.125  70.575  1.00 44.70  ? 42  ASN A C   1 
ATOM   280  O  O   . ASN A 1 42  ? 5.045   20.649  69.615  1.00 36.99  ? 42  ASN A O   1 
ATOM   281  C  CB  . ASN A 1 42  ? 4.495   21.800  72.414  1.00 69.58  ? 42  ASN A CB  1 
ATOM   282  C  CG  . ASN A 1 42  ? 3.924   23.174  72.675  1.00 81.85  ? 42  ASN A CG  1 
ATOM   283  O  OD1 . ASN A 1 42  ? 2.759   23.444  72.369  1.00 83.88  ? 42  ASN A OD1 1 
ATOM   284  N  ND2 . ASN A 1 42  ? 4.742   24.056  73.245  1.00 84.54  ? 42  ASN A ND2 1 
ATOM   285  N  N   . MET A 1 43  ? 4.615   18.840  70.851  1.00 19.68  ? 43  MET A N   1 
ATOM   286  C  CA  . MET A 1 43  ? 5.564   18.029  70.130  1.00 29.64  ? 43  MET A CA  1 
ATOM   287  C  C   . MET A 1 43  ? 4.906   17.207  69.043  1.00 42.59  ? 43  MET A C   1 
ATOM   288  O  O   . MET A 1 43  ? 5.584   16.425  68.364  1.00 45.81  ? 43  MET A O   1 
ATOM   289  C  CB  . MET A 1 43  ? 6.335   17.152  71.114  1.00 27.87  ? 43  MET A CB  1 
ATOM   290  C  CG  . MET A 1 43  ? 7.474   17.934  71.745  1.00 27.43  ? 43  MET A CG  1 
ATOM   291  S  SD  . MET A 1 43  ? 8.419   16.966  72.912  1.00 47.14  ? 43  MET A SD  1 
ATOM   292  C  CE  . MET A 1 43  ? 8.711   15.483  71.952  1.00 44.82  ? 43  MET A CE  1 
ATOM   293  N  N   . ARG A 1 44  ? 3.610   17.396  68.834  1.00 47.11  ? 44  ARG A N   1 
ATOM   294  C  CA  . ARG A 1 44  ? 2.957   16.802  67.677  1.00 35.54  ? 44  ARG A CA  1 
ATOM   295  C  C   . ARG A 1 44  ? 3.473   17.447  66.386  1.00 35.39  ? 44  ARG A C   1 
ATOM   296  O  O   . ARG A 1 44  ? 3.611   18.675  66.296  1.00 28.25  ? 44  ARG A O   1 
ATOM   297  C  CB  . ARG A 1 44  ? 1.441   16.954  67.797  1.00 18.15  ? 44  ARG A CB  1 
ATOM   298  C  CG  . ARG A 1 44  ? 0.645   16.275  66.684  1.00 27.20  ? 44  ARG A CG  1 
ATOM   299  C  CD  . ARG A 1 44  ? -0.854  16.507  66.861  1.00 30.63  ? 44  ARG A CD  1 
ATOM   300  N  NE  . ARG A 1 44  ? -1.378  15.776  68.012  1.00 32.40  ? 44  ARG A NE  1 
ATOM   301  C  CZ  . ARG A 1 44  ? -2.625  15.857  68.453  1.00 32.16  ? 44  ARG A CZ  1 
ATOM   302  N  NH1 . ARG A 1 44  ? -3.481  16.668  67.871  1.00 26.09  ? 44  ARG A NH1 1 
ATOM   303  N  NH2 . ARG A 1 44  ? -2.991  15.148  69.502  1.00 44.88  ? 44  ARG A NH2 1 
ATOM   304  N  N   . PHE A 1 45  ? 3.768   16.607  65.392  1.00 39.36  ? 45  PHE A N   1 
ATOM   305  C  CA  . PHE A 1 45  ? 4.213   16.952  64.024  1.00 41.65  ? 45  PHE A CA  1 
ATOM   306  C  C   . PHE A 1 45  ? 5.683   17.325  63.979  1.00 39.86  ? 45  PHE A C   1 
ATOM   307  O  O   . PHE A 1 45  ? 6.128   17.890  62.961  1.00 43.70  ? 45  PHE A O   1 
ATOM   308  C  CB  . PHE A 1 45  ? 3.428   18.105  63.379  1.00 32.28  ? 45  PHE A CB  1 
ATOM   309  C  CG  . PHE A 1 45  ? 1.953   17.914  63.409  1.00 28.43  ? 45  PHE A CG  1 
ATOM   310  C  CD1 . PHE A 1 45  ? 1.136   18.889  63.942  1.00 22.46  ? 45  PHE A CD1 1 
ATOM   311  C  CD2 . PHE A 1 45  ? 1.381   16.752  62.908  1.00 31.48  ? 45  PHE A CD2 1 
ATOM   312  C  CE1 . PHE A 1 45  ? -0.221  18.707  63.980  1.00 27.10  ? 45  PHE A CE1 1 
ATOM   313  C  CE2 . PHE A 1 45  ? 0.023   16.563  62.945  1.00 26.84  ? 45  PHE A CE2 1 
ATOM   314  C  CZ  . PHE A 1 45  ? -0.781  17.543  63.478  1.00 29.41  ? 45  PHE A CZ  1 
ATOM   315  N  N   . ARG A 1 46  ? 6.451   17.060  65.031  1.00 29.54  ? 46  ARG A N   1 
ATOM   316  C  CA  . ARG A 1 46  ? 7.842   17.472  65.050  1.00 29.01  ? 46  ARG A CA  1 
ATOM   317  C  C   . ARG A 1 46  ? 8.777   16.272  65.076  1.00 38.91  ? 46  ARG A C   1 
ATOM   318  O  O   . ARG A 1 46  ? 8.380   15.131  65.357  1.00 22.89  ? 46  ARG A O   1 
ATOM   319  C  CB  . ARG A 1 46  ? 8.153   18.410  66.222  1.00 36.11  ? 46  ARG A CB  1 
ATOM   320  C  CG  . ARG A 1 46  ? 7.268   19.640  66.224  1.00 57.95  ? 46  ARG A CG  1 
ATOM   321  C  CD  . ARG A 1 46  ? 7.808   20.823  67.015  1.00 62.18  ? 46  ARG A CD  1 
ATOM   322  N  NE  . ARG A 1 46  ? 8.731   20.420  68.058  1.00 55.33  ? 46  ARG A NE  1 
ATOM   323  C  CZ  . ARG A 1 46  ? 8.571   20.710  69.338  1.00 54.76  ? 46  ARG A CZ  1 
ATOM   324  N  NH1 . ARG A 1 46  ? 9.488   20.303  70.193  1.00 47.13  ? 46  ARG A NH1 1 
ATOM   325  N  NH2 . ARG A 1 46  ? 7.497   21.380  69.737  1.00 51.32  ? 46  ARG A NH2 1 
ATOM   326  N  N   . ARG A 1 47  ? 10.030  16.572  64.741  1.00 45.55  ? 47  ARG A N   1 
ATOM   327  C  CA  . ARG A 1 47  ? 11.080  15.575  64.733  1.00 38.31  ? 47  ARG A CA  1 
ATOM   328  C  C   . ARG A 1 47  ? 11.144  14.892  66.096  1.00 33.89  ? 47  ARG A C   1 
ATOM   329  O  O   . ARG A 1 47  ? 10.946  15.550  67.130  1.00 23.39  ? 47  ARG A O   1 
ATOM   330  C  CB  . ARG A 1 47  ? 12.423  16.228  64.398  1.00 44.12  ? 47  ARG A CB  1 
ATOM   331  C  CG  . ARG A 1 47  ? 12.400  17.026  63.103  1.00 50.35  ? 47  ARG A CG  1 
ATOM   332  C  CD  . ARG A 1 47  ? 13.789  17.531  62.697  1.00 53.57  ? 47  ARG A CD  1 
ATOM   333  N  NE  . ARG A 1 47  ? 13.885  17.668  61.245  1.00 51.66  ? 47  ARG A NE  1 
ATOM   334  C  CZ  . ARG A 1 47  ? 13.451  18.718  60.551  1.00 55.96  ? 47  ARG A CZ  1 
ATOM   335  N  NH1 . ARG A 1 47  ? 13.574  18.726  59.226  1.00 51.79  ? 47  ARG A NH1 1 
ATOM   336  N  NH2 . ARG A 1 47  ? 12.904  19.763  61.174  1.00 56.15  ? 47  ARG A NH2 1 
ATOM   337  N  N   . PRO A 1 48  ? 11.390  13.584  66.137  1.00 31.43  ? 48  PRO A N   1 
ATOM   338  C  CA  . PRO A 1 48  ? 11.537  12.909  67.427  1.00 17.38  ? 48  PRO A CA  1 
ATOM   339  C  C   . PRO A 1 48  ? 12.674  13.544  68.205  1.00 35.08  ? 48  PRO A C   1 
ATOM   340  O  O   . PRO A 1 48  ? 13.596  14.128  67.626  1.00 25.17  ? 48  PRO A O   1 
ATOM   341  C  CB  . PRO A 1 48  ? 11.880  11.464  67.052  1.00 16.98  ? 48  PRO A CB  1 
ATOM   342  C  CG  . PRO A 1 48  ? 11.656  11.331  65.612  1.00 30.24  ? 48  PRO A CG  1 
ATOM   343  C  CD  . PRO A 1 48  ? 11.588  12.685  64.987  1.00 33.12  ? 48  PRO A CD  1 
ATOM   344  N  N   . GLU A 1 49  ? 12.584  13.446  69.542  1.00 41.61  ? 49  GLU A N   1 
ATOM   345  C  CA  . GLU A 1 49  ? 13.693  13.722  70.443  1.00 39.38  ? 49  GLU A CA  1 
ATOM   346  C  C   . GLU A 1 49  ? 14.073  12.445  71.181  1.00 42.68  ? 49  GLU A C   1 
ATOM   347  O  O   . GLU A 1 49  ? 13.184  11.695  71.596  1.00 49.39  ? 49  GLU A O   1 
ATOM   348  C  CB  . GLU A 1 49  ? 13.323  14.812  71.452  1.00 41.49  ? 49  GLU A CB  1 
ATOM   349  C  CG  . GLU A 1 49  ? 12.608  15.989  70.828  1.00 54.23  ? 49  GLU A CG  1 
ATOM   350  C  CD  . GLU A 1 49  ? 13.564  17.005  70.245  1.00 63.65  ? 49  GLU A CD  1 
ATOM   351  O  OE1 . GLU A 1 49  ? 13.094  17.970  69.600  1.00 65.51  ? 49  GLU A OE1 1 
ATOM   352  O  OE2 . GLU A 1 49  ? 14.786  16.840  70.443  1.00 70.78  ? 49  GLU A OE2 1 
ATOM   353  N  N   . PRO A 1 50  ? 15.363  12.153  71.341  1.00 37.76  ? 50  PRO A N   1 
ATOM   354  C  CA  . PRO A 1 50  ? 15.747  10.859  71.922  1.00 33.05  ? 50  PRO A CA  1 
ATOM   355  C  C   . PRO A 1 50  ? 15.264  10.750  73.354  1.00 41.63  ? 50  PRO A C   1 
ATOM   356  O  O   . PRO A 1 50  ? 15.302  11.720  74.115  1.00 42.23  ? 50  PRO A O   1 
ATOM   357  C  CB  . PRO A 1 50  ? 17.275  10.858  71.849  1.00 19.63  ? 50  PRO A CB  1 
ATOM   358  C  CG  . PRO A 1 50  ? 17.660  12.269  71.600  1.00 25.49  ? 50  PRO A CG  1 
ATOM   359  C  CD  . PRO A 1 50  ? 16.518  12.999  71.006  1.00 19.67  ? 50  PRO A CD  1 
ATOM   360  N  N   . LYS A 1 51  ? 14.779  9.557   73.702  1.00 43.37  ? 51  LYS A N   1 
ATOM   361  C  CA  . LYS A 1 51  ? 14.248  9.317   75.036  1.00 43.54  ? 51  LYS A CA  1 
ATOM   362  C  C   . LYS A 1 51  ? 15.267  9.747   76.081  1.00 48.40  ? 51  LYS A C   1 
ATOM   363  O  O   . LYS A 1 51  ? 16.443  9.385   76.000  1.00 52.61  ? 51  LYS A O   1 
ATOM   364  C  CB  . LYS A 1 51  ? 13.890  7.833   75.201  1.00 40.10  ? 51  LYS A CB  1 
ATOM   365  C  CG  . LYS A 1 51  ? 13.118  7.489   76.493  1.00 31.47  ? 51  LYS A CG  1 
ATOM   366  C  CD  . LYS A 1 51  ? 12.157  8.599   76.879  1.00 24.68  ? 51  LYS A CD  1 
ATOM   367  C  CE  . LYS A 1 51  ? 11.396  8.287   78.148  1.00 34.50  ? 51  LYS A CE  1 
ATOM   368  N  NZ  . LYS A 1 51  ? 10.832  6.907   78.120  1.00 42.47  ? 51  LYS A NZ  1 
ATOM   369  N  N   . LYS A 1 52  ? 14.819  10.562  77.034  1.00 50.02  ? 52  LYS A N   1 
ATOM   370  C  CA  . LYS A 1 52  ? 15.684  10.968  78.133  1.00 43.59  ? 52  LYS A CA  1 
ATOM   371  C  C   . LYS A 1 52  ? 15.911  9.784   79.072  1.00 34.31  ? 52  LYS A C   1 
ATOM   372  O  O   . LYS A 1 52  ? 15.012  8.959   79.260  1.00 27.20  ? 52  LYS A O   1 
ATOM   373  C  CB  . LYS A 1 52  ? 15.076  12.151  78.886  1.00 52.60  ? 52  LYS A CB  1 
ATOM   374  C  CG  . LYS A 1 52  ? 14.818  13.350  77.973  1.00 68.07  ? 52  LYS A CG  1 
ATOM   375  C  CD  . LYS A 1 52  ? 14.619  14.658  78.732  1.00 78.13  ? 52  LYS A CD  1 
ATOM   376  C  CE  . LYS A 1 52  ? 14.857  15.855  77.811  1.00 79.86  ? 52  LYS A CE  1 
ATOM   377  N  NZ  . LYS A 1 52  ? 16.226  15.820  77.206  1.00 81.56  ? 52  LYS A NZ  1 
ATOM   378  N  N   . PRO A 1 53  ? 17.110  9.650   79.633  1.00 39.68  ? 53  PRO A N   1 
ATOM   379  C  CA  . PRO A 1 53  ? 17.438  8.448   80.417  1.00 38.71  ? 53  PRO A CA  1 
ATOM   380  C  C   . PRO A 1 53  ? 16.597  8.322   81.674  1.00 37.18  ? 53  PRO A C   1 
ATOM   381  O  O   . PRO A 1 53  ? 16.283  9.315   82.333  1.00 45.36  ? 53  PRO A O   1 
ATOM   382  C  CB  . PRO A 1 53  ? 18.913  8.648   80.770  1.00 38.80  ? 53  PRO A CB  1 
ATOM   383  C  CG  . PRO A 1 53  ? 19.420  9.558   79.698  1.00 48.07  ? 53  PRO A CG  1 
ATOM   384  C  CD  . PRO A 1 53  ? 18.293  10.468  79.329  1.00 38.05  ? 53  PRO A CD  1 
ATOM   385  N  N   . TRP A 1 54  ? 16.250  7.084   82.018  1.00 24.66  ? 54  TRP A N   1 
ATOM   386  C  CA  . TRP A 1 54  ? 15.455  6.819   83.208  1.00 26.91  ? 54  TRP A CA  1 
ATOM   387  C  C   . TRP A 1 54  ? 16.273  6.117   84.285  1.00 39.10  ? 54  TRP A C   1 
ATOM   388  O  O   . TRP A 1 54  ? 17.270  5.437   84.021  1.00 42.06  ? 54  TRP A O   1 
ATOM   389  C  CB  . TRP A 1 54  ? 14.240  5.959   82.880  1.00 25.66  ? 54  TRP A CB  1 
ATOM   390  C  CG  . TRP A 1 54  ? 14.620  4.644   82.295  1.00 30.49  ? 54  TRP A CG  1 
ATOM   391  C  CD1 . TRP A 1 54  ? 14.752  3.455   82.953  1.00 36.22  ? 54  TRP A CD1 1 
ATOM   392  C  CD2 . TRP A 1 54  ? 14.928  4.379   80.928  1.00 30.07  ? 54  TRP A CD2 1 
ATOM   393  N  NE1 . TRP A 1 54  ? 15.121  2.459   82.075  1.00 26.12  ? 54  TRP A NE1 1 
ATOM   394  C  CE2 . TRP A 1 54  ? 15.232  3.003   80.824  1.00 33.11  ? 54  TRP A CE2 1 
ATOM   395  C  CE3 . TRP A 1 54  ? 14.969  5.169   79.778  1.00 32.54  ? 54  TRP A CE3 1 
ATOM   396  C  CZ2 . TRP A 1 54  ? 15.577  2.403   79.614  1.00 37.81  ? 54  TRP A CZ2 1 
ATOM   397  C  CZ3 . TRP A 1 54  ? 15.304  4.571   78.579  1.00 35.75  ? 54  TRP A CZ3 1 
ATOM   398  C  CH2 . TRP A 1 54  ? 15.609  3.201   78.506  1.00 36.96  ? 54  TRP A CH2 1 
ATOM   399  N  N   . SER A 1 55  ? 15.809  6.272   85.512  1.00 38.55  ? 55  SER A N   1 
ATOM   400  C  CA  . SER A 1 55  ? 16.398  5.622   86.668  1.00 33.77  ? 55  SER A CA  1 
ATOM   401  C  C   . SER A 1 55  ? 15.596  4.377   87.026  1.00 34.85  ? 55  SER A C   1 
ATOM   402  O  O   . SER A 1 55  ? 14.395  4.287   86.752  1.00 40.34  ? 55  SER A O   1 
ATOM   403  C  CB  . SER A 1 55  ? 16.425  6.594   87.839  1.00 34.14  ? 55  SER A CB  1 
ATOM   404  O  OG  . SER A 1 55  ? 15.243  7.379   87.802  1.00 37.06  ? 55  SER A OG  1 
ATOM   405  N  N   . GLY A 1 56  ? 16.263  3.418   87.652  1.00 26.34  ? 56  GLY A N   1 
ATOM   406  C  CA  . GLY A 1 56  ? 15.598  2.163   87.922  1.00 32.46  ? 56  GLY A CA  1 
ATOM   407  C  C   . GLY A 1 56  ? 15.432  1.350   86.651  1.00 42.18  ? 56  GLY A C   1 
ATOM   408  O  O   . GLY A 1 56  ? 16.056  1.616   85.618  1.00 56.91  ? 56  GLY A O   1 
ATOM   409  N  N   . VAL A 1 57  ? 14.558  0.352   86.729  1.00 34.64  ? 57  VAL A N   1 
ATOM   410  C  CA  . VAL A 1 57  ? 14.432  -0.681  85.709  1.00 31.38  ? 57  VAL A CA  1 
ATOM   411  C  C   . VAL A 1 57  ? 13.117  -0.496  84.963  1.00 34.31  ? 57  VAL A C   1 
ATOM   412  O  O   . VAL A 1 57  ? 12.034  -0.626  85.557  1.00 24.28  ? 57  VAL A O   1 
ATOM   413  C  CB  . VAL A 1 57  ? 14.496  -2.085  86.327  1.00 39.06  ? 57  VAL A CB  1 
ATOM   414  C  CG1 . VAL A 1 57  ? 14.398  -3.139  85.237  1.00 42.22  ? 57  VAL A CG1 1 
ATOM   415  C  CG2 . VAL A 1 57  ? 15.754  -2.262  87.149  1.00 26.15  ? 57  VAL A CG2 1 
ATOM   416  N  N   . TRP A 1 58  ? 13.215  -0.243  83.648  1.00 35.55  ? 58  TRP A N   1 
ATOM   417  C  CA  . TRP A 1 58  ? 12.038  -0.175  82.778  1.00 29.16  ? 58  TRP A CA  1 
ATOM   418  C  C   . TRP A 1 58  ? 11.478  -1.572  82.556  1.00 25.75  ? 58  TRP A C   1 
ATOM   419  O  O   . TRP A 1 58  ? 12.174  -2.459  82.044  1.00 31.25  ? 58  TRP A O   1 
ATOM   420  C  CB  . TRP A 1 58  ? 12.380  0.473   81.434  1.00 26.57  ? 58  TRP A CB  1 
ATOM   421  C  CG  . TRP A 1 58  ? 11.167  0.860   80.624  1.00 28.62  ? 58  TRP A CG  1 
ATOM   422  C  CD1 . TRP A 1 58  ? 10.342  0.021   79.909  1.00 32.27  ? 58  TRP A CD1 1 
ATOM   423  C  CD2 . TRP A 1 58  ? 10.637  2.181   80.446  1.00 33.10  ? 58  TRP A CD2 1 
ATOM   424  N  NE1 . TRP A 1 58  ? 9.335   0.745   79.297  1.00 24.71  ? 58  TRP A NE1 1 
ATOM   425  C  CE2 . TRP A 1 58  ? 9.491   2.069   79.610  1.00 26.08  ? 58  TRP A CE2 1 
ATOM   426  C  CE3 . TRP A 1 58  ? 11.016  3.451   80.906  1.00 31.61  ? 58  TRP A CE3 1 
ATOM   427  C  CZ2 . TRP A 1 58  ? 8.729   3.177   79.229  1.00 20.14  ? 58  TRP A CZ2 1 
ATOM   428  C  CZ3 . TRP A 1 58  ? 10.249  4.561   80.521  1.00 26.99  ? 58  TRP A CZ3 1 
ATOM   429  C  CH2 . TRP A 1 58  ? 9.121   4.410   79.694  1.00 27.05  ? 58  TRP A CH2 1 
ATOM   430  N  N   . ASN A 1 59  ? 10.225  -1.771  82.949  1.00 24.02  ? 59  ASN A N   1 
ATOM   431  C  CA  . ASN A 1 59  ? 9.572   -3.067  82.783  1.00 40.50  ? 59  ASN A CA  1 
ATOM   432  C  C   . ASN A 1 59  ? 9.242   -3.214  81.297  1.00 45.68  ? 59  ASN A C   1 
ATOM   433  O  O   . ASN A 1 59  ? 8.401   -2.497  80.739  1.00 37.53  ? 59  ASN A O   1 
ATOM   434  C  CB  . ASN A 1 59  ? 8.353   -3.139  83.704  1.00 47.66  ? 59  ASN A CB  1 
ATOM   435  C  CG  . ASN A 1 59  ? 7.581   -4.464  83.628  1.00 53.10  ? 59  ASN A CG  1 
ATOM   436  O  OD1 . ASN A 1 59  ? 7.450   -5.063  82.556  1.00 50.87  ? 59  ASN A OD1 1 
ATOM   437  N  ND2 . ASN A 1 59  ? 7.019   -4.897  84.783  1.00 54.80  ? 59  ASN A ND2 1 
ATOM   438  N  N   . ALA A 1 60  ? 9.960   -4.107  80.630  1.00 40.57  ? 60  ALA A N   1 
ATOM   439  C  CA  . ALA A 1 60  ? 9.796   -4.324  79.206  1.00 30.36  ? 60  ALA A CA  1 
ATOM   440  C  C   . ALA A 1 60  ? 9.345   -5.762  78.973  1.00 38.66  ? 60  ALA A C   1 
ATOM   441  O  O   . ALA A 1 60  ? 10.008  -6.554  78.303  1.00 43.16  ? 60  ALA A O   1 
ATOM   442  C  CB  . ALA A 1 60  ? 11.093  -4.016  78.475  1.00 27.60  ? 60  ALA A CB  1 
ATOM   443  N  N   . SER A 1 61  ? 8.206   -6.101  79.565  1.00 42.61  ? 61  SER A N   1 
ATOM   444  C  CA  . SER A 1 61  ? 7.653   -7.441  79.489  1.00 44.57  ? 61  SER A CA  1 
ATOM   445  C  C   . SER A 1 61  ? 6.344   -7.499  78.724  1.00 39.35  ? 61  SER A C   1 
ATOM   446  O  O   . SER A 1 61  ? 5.804   -8.596  78.534  1.00 37.06  ? 61  SER A O   1 
ATOM   447  C  CB  . SER A 1 61  ? 7.422   -8.006  80.899  1.00 38.97  ? 61  SER A CB  1 
ATOM   448  O  OG  . SER A 1 61  ? 6.698   -7.072  81.679  1.00 42.91  ? 61  SER A OG  1 
ATOM   449  N  N   . THR A 1 62  ? 5.787   -6.359  78.329  1.00 34.10  ? 62  THR A N   1 
ATOM   450  C  CA  . THR A 1 62  ? 4.585   -6.361  77.515  1.00 45.50  ? 62  THR A CA  1 
ATOM   451  C  C   . THR A 1 62  ? 4.728   -5.331  76.405  1.00 50.30  ? 62  THR A C   1 
ATOM   452  O  O   . THR A 1 62  ? 5.323   -4.267  76.602  1.00 49.15  ? 62  THR A O   1 
ATOM   453  C  CB  . THR A 1 62  ? 3.314   -6.067  78.329  1.00 37.45  ? 62  THR A CB  1 
ATOM   454  O  OG1 . THR A 1 62  ? 3.158   -4.654  78.474  1.00 36.66  ? 62  THR A OG1 1 
ATOM   455  C  CG2 . THR A 1 62  ? 3.375   -6.708  79.702  1.00 32.93  ? 62  THR A CG2 1 
ATOM   456  N  N   . TYR A 1 63  ? 4.172   -5.668  75.240  1.00 44.22  ? 63  TYR A N   1 
ATOM   457  C  CA  . TYR A 1 63  ? 4.055   -4.821  74.060  1.00 33.51  ? 63  TYR A CA  1 
ATOM   458  C  C   . TYR A 1 63  ? 3.646   -3.396  74.417  1.00 18.35  ? 63  TYR A C   1 
ATOM   459  O  O   . TYR A 1 63  ? 2.894   -3.186  75.373  1.00 23.69  ? 63  TYR A O   1 
ATOM   460  C  CB  . TYR A 1 63  ? 3.032   -5.424  73.097  1.00 30.26  ? 63  TYR A CB  1 
ATOM   461  C  CG  . TYR A 1 63  ? 3.563   -6.489  72.158  1.00 33.50  ? 63  TYR A CG  1 
ATOM   462  C  CD1 . TYR A 1 63  ? 4.760   -6.318  71.472  1.00 38.08  ? 63  TYR A CD1 1 
ATOM   463  C  CD2 . TYR A 1 63  ? 2.855   -7.663  71.943  1.00 34.17  ? 63  TYR A CD2 1 
ATOM   464  C  CE1 . TYR A 1 63  ? 5.234   -7.291  70.591  1.00 36.51  ? 63  TYR A CE1 1 
ATOM   465  C  CE2 . TYR A 1 63  ? 3.323   -8.638  71.074  1.00 40.79  ? 63  TYR A CE2 1 
ATOM   466  C  CZ  . TYR A 1 63  ? 4.512   -8.447  70.400  1.00 36.43  ? 63  TYR A CZ  1 
ATOM   467  O  OH  . TYR A 1 63  ? 4.969   -9.417  69.533  1.00 37.35  ? 63  TYR A OH  1 
ATOM   468  N  N   . PRO A 1 64  ? 4.103   -2.405  73.682  1.00 25.59  ? 64  PRO A N   1 
ATOM   469  C  CA  . PRO A 1 64  ? 3.718   -1.028  73.989  1.00 24.21  ? 64  PRO A CA  1 
ATOM   470  C  C   . PRO A 1 64  ? 2.400   -0.674  73.339  1.00 25.46  ? 64  PRO A C   1 
ATOM   471  O  O   . PRO A 1 64  ? 1.742   -1.552  72.775  1.00 24.58  ? 64  PRO A O   1 
ATOM   472  C  CB  . PRO A 1 64  ? 4.862   -0.216  73.385  1.00 39.03  ? 64  PRO A CB  1 
ATOM   473  C  CG  . PRO A 1 64  ? 5.218   -1.008  72.155  1.00 41.25  ? 64  PRO A CG  1 
ATOM   474  C  CD  . PRO A 1 64  ? 5.038   -2.466  72.543  1.00 39.16  ? 64  PRO A CD  1 
ATOM   475  N  N   . ASN A 1 65  ? 2.019   0.602   73.378  1.00 26.45  ? 65  ASN A N   1 
ATOM   476  C  CA  . ASN A 1 65  ? 0.822   1.001   72.660  1.00 29.64  ? 65  ASN A CA  1 
ATOM   477  C  C   . ASN A 1 65  ? 1.096   1.144   71.174  1.00 31.26  ? 65  ASN A C   1 
ATOM   478  O  O   . ASN A 1 65  ? 2.245   1.268   70.727  1.00 39.18  ? 65  ASN A O   1 
ATOM   479  C  CB  . ASN A 1 65  ? 0.250   2.314   73.198  1.00 36.46  ? 65  ASN A CB  1 
ATOM   480  C  CG  . ASN A 1 65  ? -0.269  2.188   74.624  1.00 32.94  ? 65  ASN A CG  1 
ATOM   481  O  OD1 . ASN A 1 65  ? -0.788  1.132   75.032  1.00 22.02  ? 65  ASN A OD1 1 
ATOM   482  N  ND2 . ASN A 1 65  ? -0.181  3.283   75.373  1.00 32.07  ? 65  ASN A ND2 1 
ATOM   483  N  N   . ASN A 1 66  ? 0.008   1.122   70.406  1.00 23.47  ? 66  ASN A N   1 
ATOM   484  C  CA  . ASN A 1 66  ? 0.050   1.373   68.976  1.00 16.08  ? 66  ASN A CA  1 
ATOM   485  C  C   . ASN A 1 66  ? -0.169  2.856   68.738  1.00 19.42  ? 66  ASN A C   1 
ATOM   486  O  O   . ASN A 1 66  ? -0.722  3.559   69.586  1.00 16.32  ? 66  ASN A O   1 
ATOM   487  C  CB  . ASN A 1 66  ? -1.010  0.563   68.247  1.00 16.04  ? 66  ASN A CB  1 
ATOM   488  C  CG  . ASN A 1 66  ? -1.000  -0.876  68.655  1.00 30.33  ? 66  ASN A CG  1 
ATOM   489  O  OD1 . ASN A 1 66  ? -0.393  -1.708  68.012  1.00 45.06  ? 66  ASN A OD1 1 
ATOM   490  N  ND2 . ASN A 1 66  ? -1.701  -1.184  69.722  1.00 48.94  ? 66  ASN A ND2 1 
ATOM   491  N  N   . CYS A 1 67  ? 0.298   3.337   67.586  1.00 24.06  ? 67  CYS A N   1 
ATOM   492  C  CA  . CYS A 1 67  ? 0.133   4.753   67.291  1.00 36.56  ? 67  CYS A CA  1 
ATOM   493  C  C   . CYS A 1 67  ? -1.298  5.056   66.847  1.00 36.98  ? 67  CYS A C   1 
ATOM   494  O  O   . CYS A 1 67  ? -2.086  4.163   66.520  1.00 29.86  ? 67  CYS A O   1 
ATOM   495  C  CB  . CYS A 1 67  ? 1.125   5.201   66.228  1.00 38.42  ? 67  CYS A CB  1 
ATOM   496  S  SG  . CYS A 1 67  ? 2.818   4.930   66.739  1.00 50.73  ? 67  CYS A SG  1 
ATOM   497  N  N   . GLN A 1 68  ? -1.629  6.347   66.854  1.00 35.18  ? 68  GLN A N   1 
ATOM   498  C  CA  . GLN A 1 68  ? -2.956  6.790   66.453  1.00 29.07  ? 68  GLN A CA  1 
ATOM   499  C  C   . GLN A 1 68  ? -3.156  6.586   64.956  1.00 40.80  ? 68  GLN A C   1 
ATOM   500  O  O   . GLN A 1 68  ? -2.391  7.104   64.132  1.00 45.21  ? 68  GLN A O   1 
ATOM   501  C  CB  . GLN A 1 68  ? -3.159  8.249   66.835  1.00 21.06  ? 68  GLN A CB  1 
ATOM   502  C  CG  . GLN A 1 68  ? -3.092  8.492   68.319  1.00 35.88  ? 68  GLN A CG  1 
ATOM   503  C  CD  . GLN A 1 68  ? -4.414  8.231   69.011  1.00 41.40  ? 68  GLN A CD  1 
ATOM   504  O  OE1 . GLN A 1 68  ? -5.341  7.667   68.424  1.00 48.99  ? 68  GLN A OE1 1 
ATOM   505  N  NE2 . GLN A 1 68  ? -4.507  8.651   70.272  1.00 55.11  ? 68  GLN A NE2 1 
ATOM   506  N  N   . GLN A 1 69  ? -4.191  5.834   64.596  1.00 31.43  ? 69  GLN A N   1 
ATOM   507  C  CA  . GLN A 1 69  ? -4.311  5.454   63.201  1.00 29.80  ? 69  GLN A CA  1 
ATOM   508  C  C   . GLN A 1 69  ? -5.745  5.052   62.890  1.00 38.91  ? 69  GLN A C   1 
ATOM   509  O  O   . GLN A 1 69  ? -6.535  4.728   63.782  1.00 34.12  ? 69  GLN A O   1 
ATOM   510  C  CB  . GLN A 1 69  ? -3.359  4.311   62.875  1.00 16.92  ? 69  GLN A CB  1 
ATOM   511  C  CG  . GLN A 1 69  ? -3.753  3.047   63.584  1.00 21.46  ? 69  GLN A CG  1 
ATOM   512  C  CD  . GLN A 1 69  ? -2.752  1.947   63.401  1.00 20.65  ? 69  GLN A CD  1 
ATOM   513  O  OE1 . GLN A 1 69  ? -2.807  1.194   62.430  1.00 21.02  ? 69  GLN A OE1 1 
ATOM   514  N  NE2 . GLN A 1 69  ? -1.822  1.843   64.340  1.00 26.46  ? 69  GLN A NE2 1 
ATOM   515  N  N   . TYR A 1 70  ? -6.062  5.082   61.597  1.00 34.55  ? 70  TYR A N   1 
ATOM   516  C  CA  . TYR A 1 70  ? -7.368  4.653   61.127  1.00 31.13  ? 70  TYR A CA  1 
ATOM   517  C  C   . TYR A 1 70  ? -7.531  3.159   61.368  1.00 27.94  ? 70  TYR A C   1 
ATOM   518  O  O   . TYR A 1 70  ? -6.572  2.387   61.310  1.00 34.04  ? 70  TYR A O   1 
ATOM   519  C  CB  . TYR A 1 70  ? -7.532  4.994   59.643  1.00 37.96  ? 70  TYR A CB  1 
ATOM   520  C  CG  . TYR A 1 70  ? -8.686  4.321   58.922  1.00 36.89  ? 70  TYR A CG  1 
ATOM   521  C  CD1 . TYR A 1 70  ? -9.893  4.988   58.714  1.00 30.64  ? 70  TYR A CD1 1 
ATOM   522  C  CD2 . TYR A 1 70  ? -8.556  3.034   58.425  1.00 40.61  ? 70  TYR A CD2 1 
ATOM   523  C  CE1 . TYR A 1 70  ? -10.939 4.377   58.047  1.00 34.48  ? 70  TYR A CE1 1 
ATOM   524  C  CE2 . TYR A 1 70  ? -9.593  2.417   57.764  1.00 44.99  ? 70  TYR A CE2 1 
ATOM   525  C  CZ  . TYR A 1 70  ? -10.779 3.089   57.573  1.00 43.06  ? 70  TYR A CZ  1 
ATOM   526  O  OH  . TYR A 1 70  ? -11.800 2.457   56.904  1.00 49.01  ? 70  TYR A OH  1 
ATOM   527  N  N   . VAL A 1 71  ? -8.761  2.750   61.645  1.00 22.27  ? 71  VAL A N   1 
ATOM   528  C  CA  . VAL A 1 71  ? -9.037  1.384   62.057  1.00 26.89  ? 71  VAL A CA  1 
ATOM   529  C  C   . VAL A 1 71  ? -10.044 0.790   61.086  1.00 31.47  ? 71  VAL A C   1 
ATOM   530  O  O   . VAL A 1 71  ? -11.228 1.145   61.106  1.00 39.29  ? 71  VAL A O   1 
ATOM   531  C  CB  . VAL A 1 71  ? -9.535  1.316   63.502  1.00 16.75  ? 71  VAL A CB  1 
ATOM   532  C  CG1 . VAL A 1 71  ? -10.010 -0.076  63.827  1.00 22.61  ? 71  VAL A CG1 1 
ATOM   533  C  CG2 . VAL A 1 71  ? -8.408  1.727   64.436  1.00 17.83  ? 71  VAL A CG2 1 
ATOM   534  N  N   . ASP A 1 72  ? -9.573  -0.125  60.246  1.00 30.94  ? 72  ASP A N   1 
ATOM   535  C  CA  . ASP A 1 72  ? -10.419 -0.732  59.233  1.00 25.55  ? 72  ASP A CA  1 
ATOM   536  C  C   . ASP A 1 72  ? -11.569 -1.467  59.890  1.00 30.29  ? 72  ASP A C   1 
ATOM   537  O  O   . ASP A 1 72  ? -11.364 -2.419  60.649  1.00 30.78  ? 72  ASP A O   1 
ATOM   538  C  CB  . ASP A 1 72  ? -9.600  -1.685  58.366  1.00 30.67  ? 72  ASP A CB  1 
ATOM   539  C  CG  . ASP A 1 72  ? -10.462 -2.570  57.491  1.00 47.95  ? 72  ASP A CG  1 
ATOM   540  O  OD1 . ASP A 1 72  ? -11.569 -2.127  57.106  1.00 62.39  ? 72  ASP A OD1 1 
ATOM   541  O  OD2 . ASP A 1 72  ? -10.033 -3.703  57.177  1.00 53.96  ? 72  ASP A OD2 1 
ATOM   542  N  N   . GLU A 1 73  ? -12.787 -1.035  59.575  1.00 38.97  ? 73  GLU A N   1 
ATOM   543  C  CA  . GLU A 1 73  ? -13.990 -1.693  60.063  1.00 45.14  ? 73  GLU A CA  1 
ATOM   544  C  C   . GLU A 1 73  ? -14.865 -2.210  58.926  1.00 31.93  ? 73  GLU A C   1 
ATOM   545  O  O   . GLU A 1 73  ? -16.055 -2.461  59.132  1.00 29.72  ? 73  GLU A O   1 
ATOM   546  C  CB  . GLU A 1 73  ? -14.787 -0.742  60.959  1.00 58.90  ? 73  GLU A CB  1 
ATOM   547  C  CG  . GLU A 1 73  ? -13.975 -0.073  62.047  1.00 64.98  ? 73  GLU A CG  1 
ATOM   548  C  CD  . GLU A 1 73  ? -14.737 1.059   62.715  1.00 76.86  ? 73  GLU A CD  1 
ATOM   549  O  OE1 . GLU A 1 73  ? -15.918 0.855   63.083  1.00 78.07  ? 73  GLU A OE1 1 
ATOM   550  O  OE2 . GLU A 1 73  ? -14.165 2.166   62.864  1.00 82.97  ? 73  GLU A OE2 1 
ATOM   551  N  N   . GLN A 1 74  ? -14.313 -2.385  57.727  1.00 24.68  ? 74  GLN A N   1 
ATOM   552  C  CA  . GLN A 1 74  ? -15.152 -2.874  56.641  1.00 36.01  ? 74  GLN A CA  1 
ATOM   553  C  C   . GLN A 1 74  ? -15.720 -4.251  56.957  1.00 36.05  ? 74  GLN A C   1 
ATOM   554  O  O   . GLN A 1 74  ? -16.898 -4.520  56.690  1.00 42.37  ? 74  GLN A O   1 
ATOM   555  C  CB  . GLN A 1 74  ? -14.377 -2.920  55.329  1.00 41.56  ? 74  GLN A CB  1 
ATOM   556  C  CG  . GLN A 1 74  ? -15.284 -3.082  54.131  1.00 43.06  ? 74  GLN A CG  1 
ATOM   557  C  CD  . GLN A 1 74  ? -15.808 -1.747  53.670  1.00 64.70  ? 74  GLN A CD  1 
ATOM   558  O  OE1 . GLN A 1 74  ? -16.131 -0.878  54.486  1.00 70.51  ? 74  GLN A OE1 1 
ATOM   559  N  NE2 . GLN A 1 74  ? -15.873 -1.558  52.357  1.00 76.08  ? 74  GLN A NE2 1 
ATOM   560  N  N   . PHE A 1 75  ? -14.904 -5.136  57.523  1.00 20.80  ? 75  PHE A N   1 
ATOM   561  C  CA  . PHE A 1 75  ? -15.306 -6.508  57.802  1.00 22.80  ? 75  PHE A CA  1 
ATOM   562  C  C   . PHE A 1 75  ? -15.070 -6.776  59.276  1.00 37.21  ? 75  PHE A C   1 
ATOM   563  O  O   . PHE A 1 75  ? -14.051 -7.363  59.659  1.00 46.86  ? 75  PHE A O   1 
ATOM   564  C  CB  . PHE A 1 75  ? -14.545 -7.500  56.929  1.00 25.44  ? 75  PHE A CB  1 
ATOM   565  C  CG  . PHE A 1 75  ? -14.767 -7.306  55.466  1.00 31.43  ? 75  PHE A CG  1 
ATOM   566  C  CD1 . PHE A 1 75  ? -15.952 -7.703  54.880  1.00 28.99  ? 75  PHE A CD1 1 
ATOM   567  C  CD2 . PHE A 1 75  ? -13.784 -6.721  54.671  1.00 34.92  ? 75  PHE A CD2 1 
ATOM   568  C  CE1 . PHE A 1 75  ? -16.164 -7.514  53.519  1.00 38.85  ? 75  PHE A CE1 1 
ATOM   569  C  CE2 . PHE A 1 75  ? -13.989 -6.534  53.314  1.00 34.85  ? 75  PHE A CE2 1 
ATOM   570  C  CZ  . PHE A 1 75  ? -15.183 -6.927  52.734  1.00 34.12  ? 75  PHE A CZ  1 
ATOM   571  N  N   . PRO A 1 76  ? -15.995 -6.360  60.134  1.00 38.62  ? 76  PRO A N   1 
ATOM   572  C  CA  . PRO A 1 76  ? -15.829 -6.605  61.570  1.00 39.40  ? 76  PRO A CA  1 
ATOM   573  C  C   . PRO A 1 76  ? -15.866 -8.095  61.868  1.00 34.85  ? 76  PRO A C   1 
ATOM   574  O  O   . PRO A 1 76  ? -16.601 -8.861  61.240  1.00 36.60  ? 76  PRO A O   1 
ATOM   575  C  CB  . PRO A 1 76  ? -17.018 -5.865  62.201  1.00 45.71  ? 76  PRO A CB  1 
ATOM   576  C  CG  . PRO A 1 76  ? -17.574 -4.995  61.117  1.00 44.85  ? 76  PRO A CG  1 
ATOM   577  C  CD  . PRO A 1 76  ? -17.259 -5.680  59.829  1.00 42.49  ? 76  PRO A CD  1 
ATOM   578  N  N   . GLY A 1 77  ? -15.040 -8.506  62.823  1.00 37.57  ? 77  GLY A N   1 
ATOM   579  C  CA  . GLY A 1 77  ? -14.857 -9.908  63.120  1.00 45.51  ? 77  GLY A CA  1 
ATOM   580  C  C   . GLY A 1 77  ? -13.946 -10.652 62.169  1.00 46.41  ? 77  GLY A C   1 
ATOM   581  O  O   . GLY A 1 77  ? -13.328 -11.643 62.580  1.00 47.60  ? 77  GLY A O   1 
ATOM   582  N  N   . PHE A 1 78  ? -13.830 -10.202 60.916  1.00 41.75  ? 78  PHE A N   1 
ATOM   583  C  CA  . PHE A 1 78  ? -13.089 -10.938 59.898  1.00 39.55  ? 78  PHE A CA  1 
ATOM   584  C  C   . PHE A 1 78  ? -11.599 -10.927 60.212  1.00 45.02  ? 78  PHE A C   1 
ATOM   585  O  O   . PHE A 1 78  ? -10.974 -9.863  60.252  1.00 42.57  ? 78  PHE A O   1 
ATOM   586  C  CB  . PHE A 1 78  ? -13.348 -10.334 58.525  1.00 44.28  ? 78  PHE A CB  1 
ATOM   587  C  CG  . PHE A 1 78  ? -12.754 -11.123 57.394  1.00 46.45  ? 78  PHE A CG  1 
ATOM   588  C  CD1 . PHE A 1 78  ? -13.146 -12.431 57.168  1.00 40.55  ? 78  PHE A CD1 1 
ATOM   589  C  CD2 . PHE A 1 78  ? -11.807 -10.561 56.559  1.00 48.89  ? 78  PHE A CD2 1 
ATOM   590  C  CE1 . PHE A 1 78  ? -12.607 -13.165 56.132  1.00 36.67  ? 78  PHE A CE1 1 
ATOM   591  C  CE2 . PHE A 1 78  ? -11.262 -11.295 55.516  1.00 52.36  ? 78  PHE A CE2 1 
ATOM   592  C  CZ  . PHE A 1 78  ? -11.668 -12.600 55.304  1.00 42.67  ? 78  PHE A CZ  1 
ATOM   593  N  N   . SER A 1 79  ? -11.032 -12.118 60.425  1.00 50.25  ? 79  SER A N   1 
ATOM   594  C  CA  . SER A 1 79  ? -9.632  -12.217 60.827  1.00 39.10  ? 79  SER A CA  1 
ATOM   595  C  C   . SER A 1 79  ? -8.702  -11.670 59.759  1.00 31.63  ? 79  SER A C   1 
ATOM   596  O  O   . SER A 1 79  ? -7.677  -11.065 60.090  1.00 34.06  ? 79  SER A O   1 
ATOM   597  C  CB  . SER A 1 79  ? -9.270  -13.670 61.146  1.00 36.90  ? 79  SER A CB  1 
ATOM   598  O  OG  . SER A 1 79  ? -9.676  -14.548 60.107  1.00 34.48  ? 79  SER A OG  1 
ATOM   599  N  N   . GLY A 1 80  ? -9.054  -11.853 58.482  1.00 30.49  ? 80  GLY A N   1 
ATOM   600  C  CA  . GLY A 1 80  ? -8.183  -11.415 57.401  1.00 28.35  ? 80  GLY A CA  1 
ATOM   601  C  C   . GLY A 1 80  ? -7.954  -9.919  57.382  1.00 26.80  ? 80  GLY A C   1 
ATOM   602  O  O   . GLY A 1 80  ? -6.915  -9.448  56.917  1.00 34.62  ? 80  GLY A O   1 
ATOM   603  N  N   . SER A 1 81  ? -8.919  -9.151  57.862  1.00 27.70  ? 81  SER A N   1 
ATOM   604  C  CA  . SER A 1 81  ? -8.725  -7.719  57.988  1.00 31.80  ? 81  SER A CA  1 
ATOM   605  C  C   . SER A 1 81  ? -8.400  -7.301  59.408  1.00 32.22  ? 81  SER A C   1 
ATOM   606  O  O   . SER A 1 81  ? -7.637  -6.350  59.600  1.00 34.31  ? 81  SER A O   1 
ATOM   607  C  CB  . SER A 1 81  ? -9.971  -6.979  57.501  1.00 34.42  ? 81  SER A CB  1 
ATOM   608  O  OG  . SER A 1 81  ? -11.136 -7.539  58.073  1.00 38.28  ? 81  SER A OG  1 
ATOM   609  N  N   . GLU A 1 82  ? -8.951  -8.009  60.398  1.00 35.87  ? 82  GLU A N   1 
ATOM   610  C  CA  . GLU A 1 82  ? -8.664  -7.710  61.795  1.00 34.77  ? 82  GLU A CA  1 
ATOM   611  C  C   . GLU A 1 82  ? -7.192  -7.936  62.128  1.00 34.23  ? 82  GLU A C   1 
ATOM   612  O  O   . GLU A 1 82  ? -6.636  -7.236  62.982  1.00 32.85  ? 82  GLU A O   1 
ATOM   613  C  CB  . GLU A 1 82  ? -9.552  -8.567  62.694  1.00 37.67  ? 82  GLU A CB  1 
ATOM   614  C  CG  . GLU A 1 82  ? -10.184 -7.815  63.868  1.00 59.17  ? 82  GLU A CG  1 
ATOM   615  C  CD  . GLU A 1 82  ? -11.514 -7.132  63.512  1.00 69.71  ? 82  GLU A CD  1 
ATOM   616  O  OE1 . GLU A 1 82  ? -12.535 -7.842  63.367  1.00 66.99  ? 82  GLU A OE1 1 
ATOM   617  O  OE2 . GLU A 1 82  ? -11.541 -5.884  63.369  1.00 78.74  ? 82  GLU A OE2 1 
ATOM   618  N  N   . MET A 1 83  ? -6.534  -8.872  61.442  1.00 27.98  ? 83  MET A N   1 
ATOM   619  C  CA  . MET A 1 83  ? -5.147  -9.187  61.767  1.00 36.01  ? 83  MET A CA  1 
ATOM   620  C  C   . MET A 1 83  ? -4.185  -8.028  61.515  1.00 32.19  ? 83  MET A C   1 
ATOM   621  O  O   . MET A 1 83  ? -3.061  -8.069  62.015  1.00 37.76  ? 83  MET A O   1 
ATOM   622  C  CB  . MET A 1 83  ? -4.687  -10.401 60.968  1.00 45.73  ? 83  MET A CB  1 
ATOM   623  C  CG  . MET A 1 83  ? -4.769  -10.154 59.475  1.00 46.82  ? 83  MET A CG  1 
ATOM   624  S  SD  . MET A 1 83  ? -3.863  -11.332 58.482  1.00 45.54  ? 83  MET A SD  1 
ATOM   625  C  CE  . MET A 1 83  ? -2.251  -11.029 59.185  1.00 52.56  ? 83  MET A CE  1 
ATOM   626  N  N   . TRP A 1 84  ? -4.582  -7.003  60.751  1.00 31.17  ? 84  TRP A N   1 
ATOM   627  C  CA  . TRP A 1 84  ? -3.720  -5.849  60.500  1.00 32.70  ? 84  TRP A CA  1 
ATOM   628  C  C   . TRP A 1 84  ? -4.122  -4.607  61.294  1.00 30.25  ? 84  TRP A C   1 
ATOM   629  O  O   . TRP A 1 84  ? -3.425  -3.589  61.207  1.00 21.98  ? 84  TRP A O   1 
ATOM   630  C  CB  . TRP A 1 84  ? -3.682  -5.493  58.999  1.00 30.63  ? 84  TRP A CB  1 
ATOM   631  C  CG  . TRP A 1 84  ? -3.547  -6.657  58.085  1.00 33.57  ? 84  TRP A CG  1 
ATOM   632  C  CD1 . TRP A 1 84  ? -4.555  -7.361  57.491  1.00 38.47  ? 84  TRP A CD1 1 
ATOM   633  C  CD2 . TRP A 1 84  ? -2.333  -7.295  57.702  1.00 35.86  ? 84  TRP A CD2 1 
ATOM   634  N  NE1 . TRP A 1 84  ? -4.042  -8.386  56.738  1.00 41.23  ? 84  TRP A NE1 1 
ATOM   635  C  CE2 . TRP A 1 84  ? -2.680  -8.372  56.857  1.00 39.72  ? 84  TRP A CE2 1 
ATOM   636  C  CE3 . TRP A 1 84  ? -0.981  -7.056  57.983  1.00 20.71  ? 84  TRP A CE3 1 
ATOM   637  C  CZ2 . TRP A 1 84  ? -1.737  -9.196  56.295  1.00 38.67  ? 84  TRP A CZ2 1 
ATOM   638  C  CZ3 . TRP A 1 84  ? -0.050  -7.872  57.429  1.00 17.30  ? 84  TRP A CZ3 1 
ATOM   639  C  CH2 . TRP A 1 84  ? -0.425  -8.933  56.589  1.00 34.93  ? 84  TRP A CH2 1 
ATOM   640  N  N   . ASN A 1 85  ? -5.211  -4.668  62.075  1.00 31.33  ? 85  ASN A N   1 
ATOM   641  C  CA  . ASN A 1 85  ? -5.613  -3.578  62.954  1.00 16.13  ? 85  ASN A CA  1 
ATOM   642  C  C   . ASN A 1 85  ? -4.793  -3.566  64.240  1.00 16.22  ? 85  ASN A C   1 
ATOM   643  O  O   . ASN A 1 85  ? -4.285  -4.601  64.681  1.00 35.97  ? 85  ASN A O   1 
ATOM   644  C  CB  . ASN A 1 85  ? -7.091  -3.699  63.317  1.00 30.45  ? 85  ASN A CB  1 
ATOM   645  C  CG  . ASN A 1 85  ? -8.010  -3.380  62.159  1.00 43.16  ? 85  ASN A CG  1 
ATOM   646  O  OD1 . ASN A 1 85  ? -8.728  -4.259  61.670  1.00 56.05  ? 85  ASN A OD1 1 
ATOM   647  N  ND2 . ASN A 1 85  ? -8.005  -2.117  61.717  1.00 34.83  ? 85  ASN A ND2 1 
ATOM   648  N  N   . PRO A 1 86  ? -4.674  -2.406  64.878  1.00 16.14  ? 86  PRO A N   1 
ATOM   649  C  CA  . PRO A 1 86  ? -4.016  -2.344  66.190  1.00 22.04  ? 86  PRO A CA  1 
ATOM   650  C  C   . PRO A 1 86  ? -4.631  -3.336  67.167  1.00 28.99  ? 86  PRO A C   1 
ATOM   651  O  O   . PRO A 1 86  ? -5.850  -3.517  67.203  1.00 39.14  ? 86  PRO A O   1 
ATOM   652  C  CB  . PRO A 1 86  ? -4.256  -0.898  66.645  1.00 16.30  ? 86  PRO A CB  1 
ATOM   653  C  CG  . PRO A 1 86  ? -4.726  -0.138  65.446  1.00 16.00  ? 86  PRO A CG  1 
ATOM   654  C  CD  . PRO A 1 86  ? -4.963  -1.079  64.316  1.00 22.52  ? 86  PRO A CD  1 
ATOM   655  N  N   . ASN A 1 87  ? -3.778  -3.975  67.979  1.00 36.06  ? 87  ASN A N   1 
ATOM   656  C  CA  . ASN A 1 87  ? -4.231  -4.929  68.999  1.00 29.17  ? 87  ASN A CA  1 
ATOM   657  C  C   . ASN A 1 87  ? -3.962  -4.482  70.433  1.00 28.43  ? 87  ASN A C   1 
ATOM   658  O  O   . ASN A 1 87  ? -4.229  -5.243  71.365  1.00 42.10  ? 87  ASN A O   1 
ATOM   659  C  CB  . ASN A 1 87  ? -3.586  -6.297  68.769  1.00 19.06  ? 87  ASN A CB  1 
ATOM   660  C  CG  . ASN A 1 87  ? -2.091  -6.198  68.606  1.00 31.45  ? 87  ASN A CG  1 
ATOM   661  O  OD1 . ASN A 1 87  ? -1.557  -5.120  68.333  1.00 35.22  ? 87  ASN A OD1 1 
ATOM   662  N  ND2 . ASN A 1 87  ? -1.402  -7.320  68.767  1.00 37.89  ? 87  ASN A ND2 1 
ATOM   663  N  N   . ARG A 1 88  ? -3.431  -3.289  70.639  1.00 27.71  ? 88  ARG A N   1 
ATOM   664  C  CA  . ARG A 1 88  ? -3.285  -2.712  71.965  1.00 29.30  ? 88  ARG A CA  1 
ATOM   665  C  C   . ARG A 1 88  ? -3.903  -1.323  71.948  1.00 32.83  ? 88  ARG A C   1 
ATOM   666  O  O   . ARG A 1 88  ? -4.435  -0.867  70.934  1.00 38.71  ? 88  ARG A O   1 
ATOM   667  C  CB  . ARG A 1 88  ? -1.810  -2.635  72.393  1.00 25.38  ? 88  ARG A CB  1 
ATOM   668  C  CG  . ARG A 1 88  ? -1.042  -3.941  72.321  1.00 26.24  ? 88  ARG A CG  1 
ATOM   669  C  CD  . ARG A 1 88  ? -1.265  -4.813  73.557  1.00 36.08  ? 88  ARG A CD  1 
ATOM   670  N  NE  . ARG A 1 88  ? -0.731  -6.155  73.345  1.00 49.00  ? 88  ARG A NE  1 
ATOM   671  C  CZ  . ARG A 1 88  ? -1.459  -7.217  73.003  1.00 59.91  ? 88  ARG A CZ  1 
ATOM   672  N  NH1 . ARG A 1 88  ? -2.778  -7.121  72.832  1.00 65.92  ? 88  ARG A NH1 1 
ATOM   673  N  NH2 . ARG A 1 88  ? -0.861  -8.388  72.833  1.00 57.72  ? 88  ARG A NH2 1 
ATOM   674  N  N   . GLU A 1 89  ? -3.820  -0.635  73.079  1.00 31.29  ? 89  GLU A N   1 
ATOM   675  C  CA  . GLU A 1 89  ? -4.298  0.733   73.129  1.00 34.10  ? 89  GLU A CA  1 
ATOM   676  C  C   . GLU A 1 89  ? -3.527  1.586   72.122  1.00 28.54  ? 89  GLU A C   1 
ATOM   677  O  O   . GLU A 1 89  ? -2.406  1.267   71.725  1.00 37.60  ? 89  GLU A O   1 
ATOM   678  C  CB  . GLU A 1 89  ? -4.155  1.283   74.547  1.00 47.79  ? 89  GLU A CB  1 
ATOM   679  C  CG  . GLU A 1 89  ? -5.256  2.244   74.968  1.00 61.27  ? 89  GLU A CG  1 
ATOM   680  C  CD  . GLU A 1 89  ? -4.982  2.883   76.327  1.00 72.85  ? 89  GLU A CD  1 
ATOM   681  O  OE1 . GLU A 1 89  ? -4.662  2.145   77.287  1.00 73.20  ? 89  GLU A OE1 1 
ATOM   682  O  OE2 . GLU A 1 89  ? -5.077  4.127   76.429  1.00 74.40  ? 89  GLU A OE2 1 
ATOM   683  N  N   . MET A 1 90  ? -4.157  2.674   71.688  1.00 32.16  ? 90  MET A N   1 
ATOM   684  C  CA  . MET A 1 90  ? -3.565  3.618   70.743  1.00 30.77  ? 90  MET A CA  1 
ATOM   685  C  C   . MET A 1 90  ? -3.298  4.944   71.439  1.00 32.15  ? 90  MET A C   1 
ATOM   686  O  O   . MET A 1 90  ? -4.236  5.629   71.858  1.00 37.81  ? 90  MET A O   1 
ATOM   687  C  CB  . MET A 1 90  ? -4.466  3.851   69.533  1.00 27.00  ? 90  MET A CB  1 
ATOM   688  C  CG  . MET A 1 90  ? -4.483  2.743   68.521  1.00 36.84  ? 90  MET A CG  1 
ATOM   689  S  SD  . MET A 1 90  ? -5.492  3.197   67.082  1.00 39.79  ? 90  MET A SD  1 
ATOM   690  C  CE  . MET A 1 90  ? -6.723  4.240   67.817  1.00 17.49  ? 90  MET A CE  1 
ATOM   691  N  N   . SER A 1 91  ? -2.023  5.314   71.533  1.00 26.59  ? 91  SER A N   1 
ATOM   692  C  CA  . SER A 1 91  ? -1.614  6.589   72.097  1.00 29.62  ? 91  SER A CA  1 
ATOM   693  C  C   . SER A 1 91  ? -0.749  7.344   71.097  1.00 30.33  ? 91  SER A C   1 
ATOM   694  O  O   . SER A 1 91  ? -0.144  6.757   70.191  1.00 27.06  ? 91  SER A O   1 
ATOM   695  C  CB  . SER A 1 91  ? -0.837  6.401   73.409  1.00 17.86  ? 91  SER A CB  1 
ATOM   696  O  OG  . SER A 1 91  ? -0.490  7.662   73.955  1.00 30.64  ? 91  SER A OG  1 
ATOM   697  N  N   . GLU A 1 92  ? -0.703  8.668   71.268  1.00 28.18  ? 92  GLU A N   1 
ATOM   698  C  CA  . GLU A 1 92  ? 0.368   9.425   70.636  1.00 28.70  ? 92  GLU A CA  1 
ATOM   699  C  C   . GLU A 1 92  ? 1.716   9.059   71.243  1.00 29.46  ? 92  GLU A C   1 
ATOM   700  O  O   . GLU A 1 92  ? 2.748   9.129   70.570  1.00 28.75  ? 92  GLU A O   1 
ATOM   701  C  CB  . GLU A 1 92  ? 0.112   10.922  70.767  1.00 28.18  ? 92  GLU A CB  1 
ATOM   702  C  CG  . GLU A 1 92  ? -0.884  11.492  69.779  1.00 34.89  ? 92  GLU A CG  1 
ATOM   703  C  CD  . GLU A 1 92  ? -0.807  13.015  69.713  1.00 50.58  ? 92  GLU A CD  1 
ATOM   704  O  OE1 . GLU A 1 92  ? -1.449  13.683  70.563  1.00 59.48  ? 92  GLU A OE1 1 
ATOM   705  O  OE2 . GLU A 1 92  ? -0.091  13.540  68.826  1.00 45.56  ? 92  GLU A OE2 1 
ATOM   706  N  N   . ASP A 1 93  ? 1.723   8.680   72.513  1.00 33.91  ? 93  ASP A N   1 
ATOM   707  C  CA  . ASP A 1 93  ? 2.907   8.146   73.160  1.00 38.73  ? 93  ASP A CA  1 
ATOM   708  C  C   . ASP A 1 93  ? 3.097   6.715   72.681  1.00 38.94  ? 93  ASP A C   1 
ATOM   709  O  O   . ASP A 1 93  ? 2.610   5.775   73.312  1.00 46.06  ? 93  ASP A O   1 
ATOM   710  C  CB  . ASP A 1 93  ? 2.736   8.236   74.680  1.00 46.49  ? 93  ASP A CB  1 
ATOM   711  C  CG  . ASP A 1 93  ? 3.856   7.564   75.451  1.00 52.39  ? 93  ASP A CG  1 
ATOM   712  O  OD1 . ASP A 1 93  ? 5.027   7.668   75.032  1.00 56.05  ? 93  ASP A OD1 1 
ATOM   713  O  OD2 . ASP A 1 93  ? 3.554   6.936   76.492  1.00 53.08  ? 93  ASP A OD2 1 
ATOM   714  N  N   . CYS A 1 94  ? 3.774   6.535   71.555  1.00 38.46  ? 94  CYS A N   1 
ATOM   715  C  CA  . CYS A 1 94  ? 3.818   5.228   70.912  1.00 36.18  ? 94  CYS A CA  1 
ATOM   716  C  C   . CYS A 1 94  ? 5.179   4.863   70.337  1.00 30.40  ? 94  CYS A C   1 
ATOM   717  O  O   . CYS A 1 94  ? 5.305   3.784   69.747  1.00 17.18  ? 94  CYS A O   1 
ATOM   718  C  CB  . CYS A 1 94  ? 2.771   5.151   69.789  1.00 35.52  ? 94  CYS A CB  1 
ATOM   719  S  SG  . CYS A 1 94  ? 3.155   6.173   68.325  1.00 36.83  ? 94  CYS A SG  1 
ATOM   720  N  N   . LEU A 1 95  ? 6.202   5.701   70.505  1.00 35.06  ? 95  LEU A N   1 
ATOM   721  C  CA  . LEU A 1 95  ? 7.496   5.453   69.875  1.00 16.25  ? 95  LEU A CA  1 
ATOM   722  C  C   . LEU A 1 95  ? 8.340   4.538   70.754  1.00 16.56  ? 95  LEU A C   1 
ATOM   723  O  O   . LEU A 1 95  ? 9.224   4.963   71.491  1.00 33.27  ? 95  LEU A O   1 
ATOM   724  C  CB  . LEU A 1 95  ? 8.195   6.769   69.566  1.00 22.94  ? 95  LEU A CB  1 
ATOM   725  C  CG  . LEU A 1 95  ? 7.438   7.503   68.454  1.00 22.36  ? 95  LEU A CG  1 
ATOM   726  C  CD1 . LEU A 1 95  ? 8.145   8.764   68.010  1.00 21.98  ? 95  LEU A CD1 1 
ATOM   727  C  CD2 . LEU A 1 95  ? 7.248   6.562   67.267  1.00 17.20  ? 95  LEU A CD2 1 
ATOM   728  N  N   . TYR A 1 96  ? 8.078   3.242   70.626  1.00 21.15  ? 96  TYR A N   1 
ATOM   729  C  CA  . TYR A 1 96  ? 8.777   2.196   71.350  1.00 16.76  ? 96  TYR A CA  1 
ATOM   730  C  C   . TYR A 1 96  ? 9.194   1.112   70.363  1.00 32.19  ? 96  TYR A C   1 
ATOM   731  O  O   . TYR A 1 96  ? 8.663   1.028   69.252  1.00 37.28  ? 96  TYR A O   1 
ATOM   732  C  CB  . TYR A 1 96  ? 7.884   1.591   72.441  1.00 28.77  ? 96  TYR A CB  1 
ATOM   733  C  CG  . TYR A 1 96  ? 7.282   2.600   73.415  1.00 28.56  ? 96  TYR A CG  1 
ATOM   734  C  CD1 . TYR A 1 96  ? 7.761   2.698   74.725  1.00 20.19  ? 96  TYR A CD1 1 
ATOM   735  C  CD2 . TYR A 1 96  ? 6.225   3.440   73.034  1.00 20.86  ? 96  TYR A CD2 1 
ATOM   736  C  CE1 . TYR A 1 96  ? 7.225   3.603   75.616  1.00 18.53  ? 96  TYR A CE1 1 
ATOM   737  C  CE2 . TYR A 1 96  ? 5.688   4.361   73.918  1.00 21.09  ? 96  TYR A CE2 1 
ATOM   738  C  CZ  . TYR A 1 96  ? 6.190   4.430   75.216  1.00 29.93  ? 96  TYR A CZ  1 
ATOM   739  O  OH  . TYR A 1 96  ? 5.671   5.324   76.126  1.00 38.26  ? 96  TYR A OH  1 
ATOM   740  N  N   . LEU A 1 97  ? 10.152  0.273   70.769  1.00 23.60  ? 97  LEU A N   1 
ATOM   741  C  CA  . LEU A 1 97  ? 10.594  -0.848  69.944  1.00 21.81  ? 97  LEU A CA  1 
ATOM   742  C  C   . LEU A 1 97  ? 10.635  -2.123  70.781  1.00 23.55  ? 97  LEU A C   1 
ATOM   743  O  O   . LEU A 1 97  ? 10.511  -2.090  72.005  1.00 30.76  ? 97  LEU A O   1 
ATOM   744  C  CB  . LEU A 1 97  ? 11.958  -0.576  69.291  1.00 16.62  ? 97  LEU A CB  1 
ATOM   745  C  CG  . LEU A 1 97  ? 13.147  -0.134  70.139  1.00 30.07  ? 97  LEU A CG  1 
ATOM   746  C  CD1 . LEU A 1 97  ? 13.847  -1.358  70.717  1.00 35.86  ? 97  LEU A CD1 1 
ATOM   747  C  CD2 . LEU A 1 97  ? 14.143  0.735   69.329  1.00 21.62  ? 97  LEU A CD2 1 
ATOM   748  N  N   . ASN A 1 98  ? 10.793  -3.262  70.105  1.00 17.00  ? 98  ASN A N   1 
ATOM   749  C  CA  . ASN A 1 98  ? 10.826  -4.563  70.765  1.00 30.88  ? 98  ASN A CA  1 
ATOM   750  C  C   . ASN A 1 98  ? 11.968  -5.389  70.201  1.00 26.19  ? 98  ASN A C   1 
ATOM   751  O  O   . ASN A 1 98  ? 12.210  -5.370  68.995  1.00 36.60  ? 98  ASN A O   1 
ATOM   752  C  CB  . ASN A 1 98  ? 9.539   -5.368  70.562  1.00 32.27  ? 98  ASN A CB  1 
ATOM   753  C  CG  . ASN A 1 98  ? 8.325   -4.508  70.502  1.00 26.68  ? 98  ASN A CG  1 
ATOM   754  O  OD1 . ASN A 1 98  ? 7.846   -4.180  69.412  1.00 31.22  ? 98  ASN A OD1 1 
ATOM   755  N  ND2 . ASN A 1 98  ? 7.796   -4.143  71.665  1.00 18.22  ? 98  ASN A ND2 1 
ATOM   756  N  N   . ILE A 1 99  ? 12.625  -6.155  71.070  1.00 23.81  ? 99  ILE A N   1 
ATOM   757  C  CA  . ILE A 1 99  ? 13.772  -6.974  70.709  1.00 21.15  ? 99  ILE A CA  1 
ATOM   758  C  C   . ILE A 1 99  ? 13.521  -8.401  71.166  1.00 19.23  ? 99  ILE A C   1 
ATOM   759  O  O   . ILE A 1 99  ? 13.205  -8.630  72.335  1.00 22.09  ? 99  ILE A O   1 
ATOM   760  C  CB  . ILE A 1 99  ? 15.064  -6.449  71.358  1.00 26.13  ? 99  ILE A CB  1 
ATOM   761  C  CG1 . ILE A 1 99  ? 15.014  -4.921  71.481  1.00 22.65  ? 99  ILE A CG1 1 
ATOM   762  C  CG2 . ILE A 1 99  ? 16.283  -6.954  70.582  1.00 33.94  ? 99  ILE A CG2 1 
ATOM   763  C  CD1 . ILE A 1 99  ? 16.274  -4.301  72.102  1.00 27.49  ? 99  ILE A CD1 1 
ATOM   764  N  N   . TRP A 1 100 ? 13.698  -9.357  70.269  1.00 26.02  ? 100 TRP A N   1 
ATOM   765  C  CA  . TRP A 1 100 ? 13.830  -10.754 70.656  1.00 31.09  ? 100 TRP A CA  1 
ATOM   766  C  C   . TRP A 1 100 ? 15.301  -11.136 70.598  1.00 43.06  ? 100 TRP A C   1 
ATOM   767  O  O   . TRP A 1 100 ? 15.981  -10.828 69.608  1.00 46.78  ? 100 TRP A O   1 
ATOM   768  C  CB  . TRP A 1 100 ? 13.007  -11.664 69.747  1.00 22.68  ? 100 TRP A CB  1 
ATOM   769  C  CG  . TRP A 1 100 ? 11.560  -11.468 69.924  1.00 22.76  ? 100 TRP A CG  1 
ATOM   770  C  CD1 . TRP A 1 100 ? 10.718  -12.227 70.685  1.00 29.62  ? 100 TRP A CD1 1 
ATOM   771  C  CD2 . TRP A 1 100 ? 10.767  -10.427 69.361  1.00 20.76  ? 100 TRP A CD2 1 
ATOM   772  N  NE1 . TRP A 1 100 ? 9.446   -11.728 70.618  1.00 33.90  ? 100 TRP A NE1 1 
ATOM   773  C  CE2 . TRP A 1 100 ? 9.448   -10.622 69.807  1.00 33.23  ? 100 TRP A CE2 1 
ATOM   774  C  CE3 . TRP A 1 100 ? 11.039  -9.357  68.513  1.00 29.07  ? 100 TRP A CE3 1 
ATOM   775  C  CZ2 . TRP A 1 100 ? 8.397   -9.783  69.429  1.00 38.97  ? 100 TRP A CZ2 1 
ATOM   776  C  CZ3 . TRP A 1 100 ? 9.992   -8.522  68.139  1.00 41.54  ? 100 TRP A CZ3 1 
ATOM   777  C  CH2 . TRP A 1 100 ? 8.688   -8.742  68.599  1.00 36.02  ? 100 TRP A CH2 1 
ATOM   778  N  N   . VAL A 1 101 ? 15.792  -11.777 71.642  1.00 40.82  ? 101 VAL A N   1 
ATOM   779  C  CA  . VAL A 1 101 ? 17.171  -12.241 71.714  1.00 31.65  ? 101 VAL A CA  1 
ATOM   780  C  C   . VAL A 1 101 ? 17.143  -13.763 71.860  1.00 25.50  ? 101 VAL A C   1 
ATOM   781  O  O   . VAL A 1 101 ? 16.410  -14.270 72.708  1.00 34.86  ? 101 VAL A O   1 
ATOM   782  C  CB  . VAL A 1 101 ? 17.960  -11.614 72.875  1.00 33.95  ? 101 VAL A CB  1 
ATOM   783  C  CG1 . VAL A 1 101 ? 19.390  -12.121 72.877  1.00 22.12  ? 101 VAL A CG1 1 
ATOM   784  C  CG2 . VAL A 1 101 ? 17.946  -10.096 72.770  1.00 36.19  ? 101 VAL A CG2 1 
ATOM   785  N  N   . PRO A 1 102 ? 17.887  -14.503 71.050  1.00 27.47  ? 102 PRO A N   1 
ATOM   786  C  CA  . PRO A 1 102 ? 18.019  -15.943 71.299  1.00 30.78  ? 102 PRO A CA  1 
ATOM   787  C  C   . PRO A 1 102 ? 18.611  -16.164 72.677  1.00 28.18  ? 102 PRO A C   1 
ATOM   788  O  O   . PRO A 1 102 ? 19.409  -15.359 73.167  1.00 24.80  ? 102 PRO A O   1 
ATOM   789  C  CB  . PRO A 1 102 ? 18.967  -16.428 70.193  1.00 22.88  ? 102 PRO A CB  1 
ATOM   790  C  CG  . PRO A 1 102 ? 19.431  -15.215 69.491  1.00 29.94  ? 102 PRO A CG  1 
ATOM   791  C  CD  . PRO A 1 102 ? 18.487  -14.100 69.774  1.00 26.61  ? 102 PRO A CD  1 
ATOM   792  N  N   . SER A 1 103 ? 18.164  -17.231 73.324  1.00 29.67  ? 103 SER A N   1 
ATOM   793  C  CA  . SER A 1 103 ? 18.726  -17.612 74.601  1.00 43.03  ? 103 SER A CA  1 
ATOM   794  C  C   . SER A 1 103 ? 19.439  -18.939 74.365  1.00 47.88  ? 103 SER A C   1 
ATOM   795  O  O   . SER A 1 103 ? 18.864  -19.852 73.782  1.00 52.28  ? 103 SER A O   1 
ATOM   796  C  CB  . SER A 1 103 ? 17.653  -17.724 75.698  1.00 48.15  ? 103 SER A CB  1 
ATOM   797  O  OG  . SER A 1 103 ? 18.219  -17.637 77.004  1.00 47.13  ? 103 SER A OG  1 
ATOM   798  N  N   . PRO A 1 104 ? 20.700  -19.048 74.817  1.00 49.79  ? 104 PRO A N   1 
ATOM   799  C  CA  . PRO A 1 104 ? 21.459  -18.054 75.596  1.00 49.84  ? 104 PRO A CA  1 
ATOM   800  C  C   . PRO A 1 104 ? 21.869  -16.824 74.765  1.00 49.07  ? 104 PRO A C   1 
ATOM   801  O  O   . PRO A 1 104 ? 21.920  -16.916 73.535  1.00 57.53  ? 104 PRO A O   1 
ATOM   802  C  CB  . PRO A 1 104 ? 22.688  -18.831 76.058  1.00 43.78  ? 104 PRO A CB  1 
ATOM   803  C  CG  . PRO A 1 104 ? 22.786  -20.002 75.147  1.00 40.52  ? 104 PRO A CG  1 
ATOM   804  C  CD  . PRO A 1 104 ? 21.440  -20.303 74.622  1.00 42.17  ? 104 PRO A CD  1 
ATOM   805  N  N   . ARG A 1 105 ? 22.132  -15.697 75.420  1.00 38.86  ? 105 ARG A N   1 
ATOM   806  C  CA  . ARG A 1 105 ? 22.513  -14.487 74.698  1.00 35.86  ? 105 ARG A CA  1 
ATOM   807  C  C   . ARG A 1 105 ? 23.798  -14.715 73.906  1.00 40.74  ? 105 ARG A C   1 
ATOM   808  O  O   . ARG A 1 105 ? 24.848  -14.990 74.509  1.00 51.75  ? 105 ARG A O   1 
ATOM   809  C  CB  . ARG A 1 105 ? 22.690  -13.320 75.673  1.00 27.45  ? 105 ARG A CB  1 
ATOM   810  C  CG  . ARG A 1 105 ? 23.342  -12.093 75.072  1.00 28.22  ? 105 ARG A CG  1 
ATOM   811  C  CD  . ARG A 1 105 ? 22.618  -10.799 75.449  1.00 48.64  ? 105 ARG A CD  1 
ATOM   812  N  NE  . ARG A 1 105 ? 22.177  -10.708 76.848  1.00 61.41  ? 105 ARG A NE  1 
ATOM   813  C  CZ  . ARG A 1 105 ? 22.771  -9.978  77.793  1.00 64.05  ? 105 ARG A CZ  1 
ATOM   814  N  NH1 . ARG A 1 105 ? 23.859  -9.275  77.520  1.00 66.57  ? 105 ARG A NH1 1 
ATOM   815  N  NH2 . ARG A 1 105 ? 22.277  -9.953  79.023  1.00 64.58  ? 105 ARG A NH2 1 
ATOM   816  N  N   . PRO A 1 106 ? 23.767  -14.640 72.579  1.00 38.17  ? 106 PRO A N   1 
ATOM   817  C  CA  . PRO A 1 106 ? 25.014  -14.735 71.814  1.00 43.63  ? 106 PRO A CA  1 
ATOM   818  C  C   . PRO A 1 106 ? 25.815  -13.451 71.960  1.00 44.63  ? 106 PRO A C   1 
ATOM   819  O  O   . PRO A 1 106 ? 25.336  -12.436 72.466  1.00 43.85  ? 106 PRO A O   1 
ATOM   820  C  CB  . PRO A 1 106 ? 24.532  -14.944 70.379  1.00 35.66  ? 106 PRO A CB  1 
ATOM   821  C  CG  . PRO A 1 106 ? 23.232  -14.198 70.346  1.00 30.97  ? 106 PRO A CG  1 
ATOM   822  C  CD  . PRO A 1 106 ? 22.603  -14.430 71.702  1.00 33.32  ? 106 PRO A CD  1 
ATOM   823  N  N   . LYS A 1 107 ? 27.063  -13.508 71.519  1.00 47.27  ? 107 LYS A N   1 
ATOM   824  C  CA  . LYS A 1 107 ? 27.915  -12.327 71.470  1.00 55.82  ? 107 LYS A CA  1 
ATOM   825  C  C   . LYS A 1 107 ? 28.029  -11.855 70.022  1.00 65.46  ? 107 LYS A C   1 
ATOM   826  O  O   . LYS A 1 107 ? 28.395  -12.641 69.138  1.00 75.74  ? 107 LYS A O   1 
ATOM   827  C  CB  . LYS A 1 107 ? 29.299  -12.630 72.054  1.00 55.53  ? 107 LYS A CB  1 
ATOM   828  C  CG  . LYS A 1 107 ? 29.840  -14.004 71.679  1.00 52.77  ? 107 LYS A CG  1 
ATOM   829  C  CD  . LYS A 1 107 ? 31.318  -14.151 71.994  1.00 56.96  ? 107 LYS A CD  1 
ATOM   830  C  CE  . LYS A 1 107 ? 31.543  -14.452 73.460  1.00 62.24  ? 107 LYS A CE  1 
ATOM   831  N  NZ  . LYS A 1 107 ? 32.965  -14.787 73.750  1.00 62.34  ? 107 LYS A NZ  1 
ATOM   832  N  N   . SER A 1 108 ? 27.691  -10.582 69.781  1.00 53.25  ? 108 SER A N   1 
ATOM   833  C  CA  . SER A 1 108 ? 27.844  -9.972  68.461  1.00 51.30  ? 108 SER A CA  1 
ATOM   834  C  C   . SER A 1 108 ? 27.229  -10.815 67.344  1.00 51.41  ? 108 SER A C   1 
ATOM   835  O  O   . SER A 1 108 ? 27.947  -11.483 66.591  1.00 53.52  ? 108 SER A O   1 
ATOM   836  C  CB  . SER A 1 108 ? 29.327  -9.740  68.170  1.00 56.65  ? 108 SER A CB  1 
ATOM   837  O  OG  . SER A 1 108 ? 29.529  -8.890  67.057  1.00 63.35  ? 108 SER A OG  1 
ATOM   838  N  N   . THR A 1 109 ? 25.911  -10.800 67.219  1.00 45.69  ? 109 THR A N   1 
ATOM   839  C  CA  . THR A 1 109 ? 25.257  -11.545 66.158  1.00 37.22  ? 109 THR A CA  1 
ATOM   840  C  C   . THR A 1 109 ? 24.485  -10.592 65.253  1.00 33.33  ? 109 THR A C   1 
ATOM   841  O  O   . THR A 1 109 ? 24.298  -9.412  65.558  1.00 37.00  ? 109 THR A O   1 
ATOM   842  C  CB  . THR A 1 109 ? 24.323  -12.616 66.727  1.00 39.86  ? 109 THR A CB  1 
ATOM   843  O  OG1 . THR A 1 109 ? 23.988  -13.551 65.694  1.00 43.39  ? 109 THR A OG1 1 
ATOM   844  C  CG2 . THR A 1 109 ? 23.049  -11.982 67.259  1.00 38.45  ? 109 THR A CG2 1 
ATOM   845  N  N   . THR A 1 110 ? 24.049  -11.125 64.118  1.00 31.86  ? 110 THR A N   1 
ATOM   846  C  CA  . THR A 1 110 ? 23.330  -10.340 63.127  1.00 32.17  ? 110 THR A CA  1 
ATOM   847  C  C   . THR A 1 110 ? 22.057  -9.741  63.714  1.00 32.39  ? 110 THR A C   1 
ATOM   848  O  O   . THR A 1 110 ? 21.454  -10.287 64.642  1.00 33.32  ? 110 THR A O   1 
ATOM   849  C  CB  . THR A 1 110 ? 22.995  -11.235 61.944  1.00 33.47  ? 110 THR A CB  1 
ATOM   850  O  OG1 . THR A 1 110 ? 24.161  -12.001 61.618  1.00 36.84  ? 110 THR A OG1 1 
ATOM   851  C  CG2 . THR A 1 110 ? 22.566  -10.408 60.750  1.00 30.26  ? 110 THR A CG2 1 
ATOM   852  N  N   . VAL A 1 111 ? 21.642  -8.603  63.170  1.00 34.07  ? 111 VAL A N   1 
ATOM   853  C  CA  . VAL A 1 111 ? 20.461  -7.910  63.671  1.00 34.36  ? 111 VAL A CA  1 
ATOM   854  C  C   . VAL A 1 111 ? 19.531  -7.603  62.502  1.00 30.61  ? 111 VAL A C   1 
ATOM   855  O  O   . VAL A 1 111 ? 19.958  -7.029  61.491  1.00 27.44  ? 111 VAL A O   1 
ATOM   856  C  CB  . VAL A 1 111 ? 20.838  -6.619  64.415  1.00 18.68  ? 111 VAL A CB  1 
ATOM   857  C  CG1 . VAL A 1 111 ? 19.617  -5.945  64.902  1.00 18.20  ? 111 VAL A CG1 1 
ATOM   858  C  CG2 . VAL A 1 111 ? 21.754  -6.933  65.547  1.00 21.43  ? 111 VAL A CG2 1 
ATOM   859  N  N   . MET A 1 112 ? 18.260  -7.970  62.652  1.00 21.23  ? 112 MET A N   1 
ATOM   860  C  CA  . MET A 1 112 ? 17.223  -7.674  61.673  1.00 26.47  ? 112 MET A CA  1 
ATOM   861  C  C   . MET A 1 112 ? 16.184  -6.753  62.301  1.00 25.00  ? 112 MET A C   1 
ATOM   862  O  O   . MET A 1 112 ? 15.477  -7.153  63.227  1.00 16.92  ? 112 MET A O   1 
ATOM   863  C  CB  . MET A 1 112 ? 16.585  -8.966  61.160  1.00 29.42  ? 112 MET A CB  1 
ATOM   864  C  CG  . MET A 1 112 ? 17.595  -9.853  60.444  1.00 39.21  ? 112 MET A CG  1 
ATOM   865  S  SD  . MET A 1 112 ? 17.032  -11.509 59.960  1.00 40.50  ? 112 MET A SD  1 
ATOM   866  C  CE  . MET A 1 112 ? 16.155  -11.137 58.433  1.00 31.38  ? 112 MET A CE  1 
ATOM   867  N  N   . VAL A 1 113 ? 16.104  -5.521  61.803  1.00 23.85  ? 113 VAL A N   1 
ATOM   868  C  CA  . VAL A 1 113 ? 15.117  -4.538  62.242  1.00 24.61  ? 113 VAL A CA  1 
ATOM   869  C  C   . VAL A 1 113 ? 13.917  -4.617  61.300  1.00 22.92  ? 113 VAL A C   1 
ATOM   870  O  O   . VAL A 1 113 ? 14.048  -4.366  60.098  1.00 18.92  ? 113 VAL A O   1 
ATOM   871  C  CB  . VAL A 1 113 ? 15.712  -3.118  62.259  1.00 25.12  ? 113 VAL A CB  1 
ATOM   872  C  CG1 . VAL A 1 113 ? 14.631  -2.100  62.468  1.00 15.73  ? 113 VAL A CG1 1 
ATOM   873  C  CG2 . VAL A 1 113 ? 16.780  -2.970  63.341  1.00 25.01  ? 113 VAL A CG2 1 
ATOM   874  N  N   . TRP A 1 114 ? 12.744  -4.957  61.838  1.00 23.53  ? 114 TRP A N   1 
ATOM   875  C  CA  . TRP A 1 114 ? 11.514  -4.985  61.057  1.00 22.22  ? 114 TRP A CA  1 
ATOM   876  C  C   . TRP A 1 114 ? 10.855  -3.617  61.037  1.00 20.48  ? 114 TRP A C   1 
ATOM   877  O  O   . TRP A 1 114 ? 10.837  -2.910  62.046  1.00 20.96  ? 114 TRP A O   1 
ATOM   878  C  CB  . TRP A 1 114 ? 10.528  -6.002  61.618  1.00 27.09  ? 114 TRP A CB  1 
ATOM   879  C  CG  . TRP A 1 114 ? 9.174   -5.990  60.919  1.00 37.67  ? 114 TRP A CG  1 
ATOM   880  C  CD1 . TRP A 1 114 ? 7.982   -5.567  61.440  1.00 41.02  ? 114 TRP A CD1 1 
ATOM   881  C  CD2 . TRP A 1 114 ? 8.891   -6.425  59.584  1.00 32.72  ? 114 TRP A CD2 1 
ATOM   882  N  NE1 . TRP A 1 114 ? 6.978   -5.720  60.515  1.00 38.73  ? 114 TRP A NE1 1 
ATOM   883  C  CE2 . TRP A 1 114 ? 7.510   -6.245  59.368  1.00 35.47  ? 114 TRP A CE2 1 
ATOM   884  C  CE3 . TRP A 1 114 ? 9.672   -6.950  58.552  1.00 32.67  ? 114 TRP A CE3 1 
ATOM   885  C  CZ2 . TRP A 1 114 ? 6.894   -6.573  58.163  1.00 40.99  ? 114 TRP A CZ2 1 
ATOM   886  C  CZ3 . TRP A 1 114 ? 9.060   -7.278  57.353  1.00 37.80  ? 114 TRP A CZ3 1 
ATOM   887  C  CH2 . TRP A 1 114 ? 7.683   -7.089  57.167  1.00 38.11  ? 114 TRP A CH2 1 
ATOM   888  N  N   . ILE A 1 115 ? 10.294  -3.254  59.889  1.00 21.97  ? 115 ILE A N   1 
ATOM   889  C  CA  . ILE A 1 115 ? 9.603   -1.983  59.729  1.00 29.79  ? 115 ILE A CA  1 
ATOM   890  C  C   . ILE A 1 115 ? 8.233   -2.277  59.137  1.00 36.10  ? 115 ILE A C   1 
ATOM   891  O  O   . ILE A 1 115 ? 8.132   -2.684  57.971  1.00 32.70  ? 115 ILE A O   1 
ATOM   892  C  CB  . ILE A 1 115 ? 10.387  -1.016  58.841  1.00 28.76  ? 115 ILE A CB  1 
ATOM   893  C  CG1 . ILE A 1 115 ? 11.701  -0.666  59.500  1.00 14.60  ? 115 ILE A CG1 1 
ATOM   894  C  CG2 . ILE A 1 115 ? 9.591   0.251   58.592  1.00 32.25  ? 115 ILE A CG2 1 
ATOM   895  C  CD1 . ILE A 1 115 ? 12.440  0.365   58.736  1.00 18.81  ? 115 ILE A CD1 1 
ATOM   896  N  N   . TYR A 1 116 ? 7.180   -2.080  59.929  1.00 34.33  ? 116 TYR A N   1 
ATOM   897  C  CA  . TYR A 1 116 ? 5.840   -2.345  59.425  1.00 29.49  ? 116 TYR A CA  1 
ATOM   898  C  C   . TYR A 1 116 ? 5.442   -1.298  58.385  1.00 32.15  ? 116 TYR A C   1 
ATOM   899  O  O   . TYR A 1 116 ? 5.924   -0.160  58.393  1.00 31.98  ? 116 TYR A O   1 
ATOM   900  C  CB  . TYR A 1 116 ? 4.817   -2.375  60.570  1.00 21.21  ? 116 TYR A CB  1 
ATOM   901  C  CG  . TYR A 1 116 ? 4.621   -1.068  61.326  1.00 16.96  ? 116 TYR A CG  1 
ATOM   902  C  CD1 . TYR A 1 116 ? 3.926   -0.006  60.761  1.00 14.05  ? 116 TYR A CD1 1 
ATOM   903  C  CD2 . TYR A 1 116 ? 5.093   -0.920  62.621  1.00 18.13  ? 116 TYR A CD2 1 
ATOM   904  C  CE1 . TYR A 1 116 ? 3.749   1.167   61.434  1.00 18.58  ? 116 TYR A CE1 1 
ATOM   905  C  CE2 . TYR A 1 116 ? 4.918   0.259   63.314  1.00 23.25  ? 116 TYR A CE2 1 
ATOM   906  C  CZ  . TYR A 1 116 ? 4.248   1.303   62.714  1.00 28.95  ? 116 TYR A CZ  1 
ATOM   907  O  OH  . TYR A 1 116 ? 4.070   2.487   63.399  1.00 34.12  ? 116 TYR A OH  1 
ATOM   908  N  N   . GLY A 1 117 ? 4.545   -1.697  57.481  1.00 25.50  ? 117 GLY A N   1 
ATOM   909  C  CA  . GLY A 1 117 ? 3.922   -0.798  56.549  1.00 18.63  ? 117 GLY A CA  1 
ATOM   910  C  C   . GLY A 1 117 ? 2.453   -0.588  56.856  1.00 28.73  ? 117 GLY A C   1 
ATOM   911  O  O   . GLY A 1 117 ? 1.996   -0.725  57.997  1.00 33.62  ? 117 GLY A O   1 
ATOM   912  N  N   . GLY A 1 118 ? 1.693   -0.272  55.819  1.00 37.81  ? 118 GLY A N   1 
ATOM   913  C  CA  . GLY A 1 118 ? 0.306   0.070   56.041  1.00 33.91  ? 118 GLY A CA  1 
ATOM   914  C  C   . GLY A 1 118 ? 0.015   1.425   55.439  1.00 29.19  ? 118 GLY A C   1 
ATOM   915  O  O   . GLY A 1 118 ? -0.743  2.232   56.000  1.00 24.85  ? 118 GLY A O   1 
ATOM   916  N  N   . GLY A 1 119 ? 0.665   1.684   54.303  1.00 22.58  ? 119 GLY A N   1 
ATOM   917  C  CA  . GLY A 1 119 ? 0.373   2.855   53.506  1.00 13.57  ? 119 GLY A CA  1 
ATOM   918  C  C   . GLY A 1 119 ? 0.782   4.170   54.107  1.00 13.57  ? 119 GLY A C   1 
ATOM   919  O  O   . GLY A 1 119 ? 0.349   5.210   53.619  1.00 18.07  ? 119 GLY A O   1 
ATOM   920  N  N   . PHE A 1 120 ? 1.612   4.155   55.152  1.00 23.62  ? 120 PHE A N   1 
ATOM   921  C  CA  . PHE A 1 120 ? 1.975   5.311   55.977  1.00 21.62  ? 120 PHE A CA  1 
ATOM   922  C  C   . PHE A 1 120 ? 0.803   5.881   56.764  1.00 23.17  ? 120 PHE A C   1 
ATOM   923  O  O   . PHE A 1 120 ? 0.949   6.932   57.405  1.00 19.12  ? 120 PHE A O   1 
ATOM   924  C  CB  . PHE A 1 120 ? 2.636   6.426   55.159  1.00 20.61  ? 120 PHE A CB  1 
ATOM   925  C  CG  . PHE A 1 120 ? 3.919   5.997   54.519  1.00 31.52  ? 120 PHE A CG  1 
ATOM   926  C  CD1 . PHE A 1 120 ? 5.104   6.087   55.208  1.00 19.82  ? 120 PHE A CD1 1 
ATOM   927  C  CD2 . PHE A 1 120 ? 3.936   5.482   53.237  1.00 34.17  ? 120 PHE A CD2 1 
ATOM   928  C  CE1 . PHE A 1 120 ? 6.263   5.689   54.632  1.00 24.73  ? 120 PHE A CE1 1 
ATOM   929  C  CE2 . PHE A 1 120 ? 5.109   5.087   52.672  1.00 28.40  ? 120 PHE A CE2 1 
ATOM   930  C  CZ  . PHE A 1 120 ? 6.266   5.187   53.370  1.00 13.66  ? 120 PHE A CZ  1 
ATOM   931  N  N   . TYR A 1 121 ? -0.347  5.213   56.760  1.00 22.19  ? 121 TYR A N   1 
ATOM   932  C  CA  . TYR A 1 121 ? -1.506  5.689   57.484  1.00 21.60  ? 121 TYR A CA  1 
ATOM   933  C  C   . TYR A 1 121 ? -1.901  4.756   58.617  1.00 24.17  ? 121 TYR A C   1 
ATOM   934  O  O   . TYR A 1 121 ? -2.834  5.075   59.367  1.00 28.05  ? 121 TYR A O   1 
ATOM   935  C  CB  . TYR A 1 121 ? -2.693  5.889   56.518  1.00 28.09  ? 121 TYR A CB  1 
ATOM   936  C  CG  . TYR A 1 121 ? -3.403  4.612   56.057  1.00 28.16  ? 121 TYR A CG  1 
ATOM   937  C  CD1 . TYR A 1 121 ? -4.390  4.016   56.846  1.00 18.08  ? 121 TYR A CD1 1 
ATOM   938  C  CD2 . TYR A 1 121 ? -3.108  4.027   54.827  1.00 27.72  ? 121 TYR A CD2 1 
ATOM   939  C  CE1 . TYR A 1 121 ? -5.030  2.875   56.454  1.00 21.49  ? 121 TYR A CE1 1 
ATOM   940  C  CE2 . TYR A 1 121 ? -3.757  2.874   54.416  1.00 33.88  ? 121 TYR A CE2 1 
ATOM   941  C  CZ  . TYR A 1 121 ? -4.722  2.303   55.241  1.00 36.60  ? 121 TYR A CZ  1 
ATOM   942  O  OH  . TYR A 1 121 ? -5.399  1.157   54.877  1.00 42.07  ? 121 TYR A OH  1 
ATOM   943  N  N   . SER A 1 122 ? -1.222  3.623   58.763  1.00 15.22  ? 122 SER A N   1 
ATOM   944  C  CA  . SER A 1 122 ? -1.623  2.609   59.724  1.00 23.15  ? 122 SER A CA  1 
ATOM   945  C  C   . SER A 1 122 ? -0.500  1.587   59.848  1.00 27.06  ? 122 SER A C   1 
ATOM   946  O  O   . SER A 1 122 ? 0.414   1.527   59.023  1.00 27.91  ? 122 SER A O   1 
ATOM   947  C  CB  . SER A 1 122 ? -2.936  1.940   59.301  1.00 14.34  ? 122 SER A CB  1 
ATOM   948  O  OG  . SER A 1 122 ? -2.692  0.920   58.348  1.00 24.65  ? 122 SER A OG  1 
ATOM   949  N  N   . GLY A 1 123 ? -0.586  0.772   60.887  1.00 24.04  ? 123 GLY A N   1 
ATOM   950  C  CA  . GLY A 1 123 ? 0.355   -0.315  61.069  1.00 20.98  ? 123 GLY A CA  1 
ATOM   951  C  C   . GLY A 1 123 ? 0.858   -0.266  62.492  1.00 19.02  ? 123 GLY A C   1 
ATOM   952  O  O   . GLY A 1 123 ? 0.922   0.795   63.119  1.00 20.95  ? 123 GLY A O   1 
ATOM   953  N  N   . SER A 1 124 ? 1.233   -1.431  63.008  1.00 16.65  ? 124 SER A N   1 
ATOM   954  C  CA  . SER A 1 124 ? 1.601   -1.570  64.403  1.00 26.26  ? 124 SER A CA  1 
ATOM   955  C  C   . SER A 1 124 ? 2.865   -2.397  64.537  1.00 41.54  ? 124 SER A C   1 
ATOM   956  O  O   . SER A 1 124 ? 3.134   -3.292  63.732  1.00 46.17  ? 124 SER A O   1 
ATOM   957  C  CB  . SER A 1 124 ? 0.487   -2.220  65.189  1.00 28.55  ? 124 SER A CB  1 
ATOM   958  O  OG  . SER A 1 124 ? -0.600  -1.322  65.312  1.00 43.09  ? 124 SER A OG  1 
ATOM   959  N  N   . SER A 1 125 ? 3.646   -2.085  65.563  1.00 42.74  ? 125 SER A N   1 
ATOM   960  C  CA  . SER A 1 125 ? 4.789   -2.934  65.850  1.00 39.78  ? 125 SER A CA  1 
ATOM   961  C  C   . SER A 1 125 ? 4.388   -4.232  66.530  1.00 34.88  ? 125 SER A C   1 
ATOM   962  O  O   . SER A 1 125 ? 5.233   -5.125  66.659  1.00 26.03  ? 125 SER A O   1 
ATOM   963  C  CB  . SER A 1 125 ? 5.793   -2.198  66.734  1.00 36.50  ? 125 SER A CB  1 
ATOM   964  O  OG  . SER A 1 125 ? 5.825   -2.779  68.025  1.00 34.00  ? 125 SER A OG  1 
ATOM   965  N  N   . THR A 1 126 ? 3.127   -4.369  66.953  1.00 25.93  ? 126 THR A N   1 
ATOM   966  C  CA  . THR A 1 126 ? 2.784   -5.379  67.945  1.00 28.23  ? 126 THR A CA  1 
ATOM   967  C  C   . THR A 1 126 ? 1.841   -6.448  67.421  1.00 28.98  ? 126 THR A C   1 
ATOM   968  O  O   . THR A 1 126 ? 1.327   -7.241  68.219  1.00 36.51  ? 126 THR A O   1 
ATOM   969  C  CB  . THR A 1 126 ? 2.205   -4.717  69.211  1.00 26.74  ? 126 THR A CB  1 
ATOM   970  O  OG1 . THR A 1 126 ? 1.013   -3.991  68.908  1.00 21.57  ? 126 THR A OG1 1 
ATOM   971  C  CG2 . THR A 1 126 ? 3.231   -3.749  69.826  1.00 24.20  ? 126 THR A CG2 1 
ATOM   972  N  N   . LEU A 1 127 ? 1.640   -6.522  66.106  1.00 26.83  ? 127 LEU A N   1 
ATOM   973  C  CA  . LEU A 1 127 ? 0.730   -7.500  65.518  1.00 23.97  ? 127 LEU A CA  1 
ATOM   974  C  C   . LEU A 1 127 ? 1.279   -8.918  65.639  1.00 31.50  ? 127 LEU A C   1 
ATOM   975  O  O   . LEU A 1 127 ? 2.487   -9.151  65.779  1.00 40.35  ? 127 LEU A O   1 
ATOM   976  C  CB  . LEU A 1 127 ? 0.489   -7.200  64.043  1.00 24.76  ? 127 LEU A CB  1 
ATOM   977  C  CG  . LEU A 1 127 ? 0.086   -5.770  63.713  1.00 27.87  ? 127 LEU A CG  1 
ATOM   978  C  CD1 . LEU A 1 127 ? -0.088  -5.609  62.230  1.00 34.61  ? 127 LEU A CD1 1 
ATOM   979  C  CD2 . LEU A 1 127 ? -1.198  -5.438  64.430  1.00 29.49  ? 127 LEU A CD2 1 
ATOM   980  N  N   . ASP A 1 128 ? 0.365   -9.879  65.546  1.00 23.39  ? 128 ASP A N   1 
ATOM   981  C  CA  . ASP A 1 128 ? 0.769   -11.268 65.682  1.00 29.06  ? 128 ASP A CA  1 
ATOM   982  C  C   . ASP A 1 128 ? 1.604   -11.724 64.498  1.00 40.04  ? 128 ASP A C   1 
ATOM   983  O  O   . ASP A 1 128 ? 2.444   -12.613 64.657  1.00 51.19  ? 128 ASP A O   1 
ATOM   984  C  CB  . ASP A 1 128 ? -0.462  -12.154 65.864  1.00 39.23  ? 128 ASP A CB  1 
ATOM   985  C  CG  . ASP A 1 128 ? -1.274  -11.772 67.102  1.00 54.26  ? 128 ASP A CG  1 
ATOM   986  O  OD1 . ASP A 1 128 ? -0.685  -11.256 68.081  1.00 62.28  ? 128 ASP A OD1 1 
ATOM   987  O  OD2 . ASP A 1 128 ? -2.503  -11.983 67.096  1.00 54.44  ? 128 ASP A OD2 1 
ATOM   988  N  N   . VAL A 1 129 ? 1.411   -11.122 63.316  1.00 37.86  ? 129 VAL A N   1 
ATOM   989  C  CA  . VAL A 1 129 ? 2.225   -11.495 62.156  1.00 39.85  ? 129 VAL A CA  1 
ATOM   990  C  C   . VAL A 1 129 ? 3.671   -11.036 62.327  1.00 38.85  ? 129 VAL A C   1 
ATOM   991  O  O   . VAL A 1 129 ? 4.598   -11.657 61.789  1.00 33.72  ? 129 VAL A O   1 
ATOM   992  C  CB  . VAL A 1 129 ? 1.631   -10.928 60.849  1.00 37.33  ? 129 VAL A CB  1 
ATOM   993  C  CG1 . VAL A 1 129 ? 1.104   -12.049 59.949  1.00 31.38  ? 129 VAL A CG1 1 
ATOM   994  C  CG2 . VAL A 1 129 ? 0.555   -9.896  61.153  1.00 38.84  ? 129 VAL A CG2 1 
ATOM   995  N  N   . TYR A 1 130 ? 3.901   -9.947  63.053  1.00 31.28  ? 130 TYR A N   1 
ATOM   996  C  CA  . TYR A 1 130 ? 5.265   -9.496  63.263  1.00 28.63  ? 130 TYR A CA  1 
ATOM   997  C  C   . TYR A 1 130 ? 5.880   -10.093 64.530  1.00 39.46  ? 130 TYR A C   1 
ATOM   998  O  O   . TYR A 1 130 ? 6.938   -9.630  64.977  1.00 47.82  ? 130 TYR A O   1 
ATOM   999  C  CB  . TYR A 1 130 ? 5.314   -7.968  63.303  1.00 29.25  ? 130 TYR A CB  1 
ATOM   1000 C  CG  . TYR A 1 130 ? 4.563   -7.267  62.180  1.00 32.58  ? 130 TYR A CG  1 
ATOM   1001 C  CD1 . TYR A 1 130 ? 4.411   -7.854  60.919  1.00 28.49  ? 130 TYR A CD1 1 
ATOM   1002 C  CD2 . TYR A 1 130 ? 4.003   -6.005  62.387  1.00 30.01  ? 130 TYR A CD2 1 
ATOM   1003 C  CE1 . TYR A 1 130 ? 3.709   -7.200  59.902  1.00 31.91  ? 130 TYR A CE1 1 
ATOM   1004 C  CE2 . TYR A 1 130 ? 3.308   -5.349  61.383  1.00 32.09  ? 130 TYR A CE2 1 
ATOM   1005 C  CZ  . TYR A 1 130 ? 3.160   -5.943  60.141  1.00 39.63  ? 130 TYR A CZ  1 
ATOM   1006 O  OH  . TYR A 1 130 ? 2.462   -5.262  59.154  1.00 39.65  ? 130 TYR A OH  1 
ATOM   1007 N  N   . ASN A 1 131 ? 5.244   -11.112 65.114  1.00 32.70  ? 131 ASN A N   1 
ATOM   1008 C  CA  . ASN A 1 131 ? 5.792   -11.797 66.276  1.00 35.35  ? 131 ASN A CA  1 
ATOM   1009 C  C   . ASN A 1 131 ? 7.150   -12.408 65.946  1.00 38.11  ? 131 ASN A C   1 
ATOM   1010 O  O   . ASN A 1 131 ? 7.233   -13.409 65.227  1.00 40.05  ? 131 ASN A O   1 
ATOM   1011 C  CB  . ASN A 1 131 ? 4.826   -12.876 66.763  1.00 42.86  ? 131 ASN A CB  1 
ATOM   1012 C  CG  . ASN A 1 131 ? 5.169   -13.388 68.153  1.00 46.80  ? 131 ASN A CG  1 
ATOM   1013 O  OD1 . ASN A 1 131 ? 6.326   -13.332 68.586  1.00 47.76  ? 131 ASN A OD1 1 
ATOM   1014 N  ND2 . ASN A 1 131 ? 4.163   -13.905 68.858  1.00 46.58  ? 131 ASN A ND2 1 
ATOM   1015 N  N   . GLY A 1 132 ? 8.216   -11.829 66.489  1.00 30.48  ? 132 GLY A N   1 
ATOM   1016 C  CA  . GLY A 1 132 ? 9.548   -12.194 66.076  1.00 29.43  ? 132 GLY A CA  1 
ATOM   1017 C  C   . GLY A 1 132 ? 10.215  -13.349 66.785  1.00 28.86  ? 132 GLY A C   1 
ATOM   1018 O  O   . GLY A 1 132 ? 11.352  -13.692 66.433  1.00 22.74  ? 132 GLY A O   1 
ATOM   1019 N  N   . LYS A 1 133 ? 9.555   -13.984 67.757  1.00 24.42  ? 133 LYS A N   1 
ATOM   1020 C  CA  . LYS A 1 133 ? 10.227  -15.045 68.504  1.00 26.45  ? 133 LYS A CA  1 
ATOM   1021 C  C   . LYS A 1 133 ? 10.650  -16.211 67.611  1.00 28.54  ? 133 LYS A C   1 
ATOM   1022 O  O   . LYS A 1 133 ? 11.706  -16.808 67.841  1.00 32.96  ? 133 LYS A O   1 
ATOM   1023 C  CB  . LYS A 1 133 ? 9.336   -15.544 69.640  1.00 31.52  ? 133 LYS A CB  1 
ATOM   1024 C  CG  . LYS A 1 133 ? 8.059   -16.270 69.223  1.00 31.17  ? 133 LYS A CG  1 
ATOM   1025 C  CD  . LYS A 1 133 ? 7.279   -16.634 70.486  1.00 40.94  ? 133 LYS A CD  1 
ATOM   1026 C  CE  . LYS A 1 133 ? 5.969   -17.333 70.191  1.00 38.74  ? 133 LYS A CE  1 
ATOM   1027 N  NZ  . LYS A 1 133 ? 4.926   -16.966 71.184  1.00 28.01  ? 133 LYS A NZ  1 
ATOM   1028 N  N   . TYR A 1 134 ? 9.866   -16.531 66.577  1.00 29.65  ? 134 TYR A N   1 
ATOM   1029 C  CA  . TYR A 1 134 ? 10.171  -17.688 65.738  1.00 25.68  ? 134 TYR A CA  1 
ATOM   1030 C  C   . TYR A 1 134 ? 11.441  -17.469 64.924  1.00 32.85  ? 134 TYR A C   1 
ATOM   1031 O  O   . TYR A 1 134 ? 12.339  -18.325 64.901  1.00 26.50  ? 134 TYR A O   1 
ATOM   1032 C  CB  . TYR A 1 134 ? 8.987   -17.986 64.825  1.00 20.41  ? 134 TYR A CB  1 
ATOM   1033 C  CG  . TYR A 1 134 ? 7.688   -17.971 65.573  1.00 25.51  ? 134 TYR A CG  1 
ATOM   1034 C  CD1 . TYR A 1 134 ? 7.294   -19.070 66.316  1.00 27.74  ? 134 TYR A CD1 1 
ATOM   1035 C  CD2 . TYR A 1 134 ? 6.869   -16.841 65.568  1.00 29.17  ? 134 TYR A CD2 1 
ATOM   1036 C  CE1 . TYR A 1 134 ? 6.126   -19.056 67.033  1.00 28.18  ? 134 TYR A CE1 1 
ATOM   1037 C  CE2 . TYR A 1 134 ? 5.689   -16.818 66.276  1.00 30.47  ? 134 TYR A CE2 1 
ATOM   1038 C  CZ  . TYR A 1 134 ? 5.320   -17.939 67.004  1.00 31.90  ? 134 TYR A CZ  1 
ATOM   1039 O  OH  . TYR A 1 134 ? 4.144   -17.961 67.718  1.00 21.14  ? 134 TYR A OH  1 
ATOM   1040 N  N   . LEU A 1 135 ? 11.543  -16.325 64.255  1.00 35.31  ? 135 LEU A N   1 
ATOM   1041 C  CA  . LEU A 1 135 ? 12.661  -16.140 63.341  1.00 32.09  ? 135 LEU A CA  1 
ATOM   1042 C  C   . LEU A 1 135 ? 13.951  -15.900 64.108  1.00 33.45  ? 135 LEU A C   1 
ATOM   1043 O  O   . LEU A 1 135 ? 14.980  -16.511 63.794  1.00 43.12  ? 135 LEU A O   1 
ATOM   1044 C  CB  . LEU A 1 135 ? 12.348  -15.003 62.373  1.00 32.46  ? 135 LEU A CB  1 
ATOM   1045 C  CG  . LEU A 1 135 ? 13.418  -14.293 61.561  1.00 26.78  ? 135 LEU A CG  1 
ATOM   1046 C  CD1 . LEU A 1 135 ? 14.024  -15.249 60.544  1.00 26.65  ? 135 LEU A CD1 1 
ATOM   1047 C  CD2 . LEU A 1 135 ? 12.770  -13.130 60.855  1.00 20.80  ? 135 LEU A CD2 1 
ATOM   1048 N  N   . ALA A 1 136 ? 13.904  -15.059 65.148  1.00 39.61  ? 136 ALA A N   1 
ATOM   1049 C  CA  . ALA A 1 136 ? 15.071  -14.870 66.012  1.00 37.87  ? 136 ALA A CA  1 
ATOM   1050 C  C   . ALA A 1 136 ? 15.581  -16.203 66.535  1.00 33.47  ? 136 ALA A C   1 
ATOM   1051 O  O   . ALA A 1 136 ? 16.794  -16.463 66.544  1.00 21.27  ? 136 ALA A O   1 
ATOM   1052 C  CB  . ALA A 1 136 ? 14.730  -13.946 67.183  1.00 19.84  ? 136 ALA A CB  1 
ATOM   1053 N  N   . TYR A 1 137 ? 14.653  -17.065 66.968  1.00 27.52  ? 137 TYR A N   1 
ATOM   1054 C  CA  . TYR A 1 137 ? 15.029  -18.352 67.540  1.00 26.66  ? 137 TYR A CA  1 
ATOM   1055 C  C   . TYR A 1 137 ? 15.602  -19.285 66.485  1.00 30.69  ? 137 TYR A C   1 
ATOM   1056 O  O   . TYR A 1 137 ? 16.669  -19.877 66.682  1.00 28.23  ? 137 TYR A O   1 
ATOM   1057 C  CB  . TYR A 1 137 ? 13.826  -19.007 68.221  1.00 22.41  ? 137 TYR A CB  1 
ATOM   1058 C  CG  . TYR A 1 137 ? 13.986  -20.499 68.470  1.00 33.77  ? 137 TYR A CG  1 
ATOM   1059 C  CD1 . TYR A 1 137 ? 14.651  -20.964 69.604  1.00 42.91  ? 137 TYR A CD1 1 
ATOM   1060 C  CD2 . TYR A 1 137 ? 13.454  -21.439 67.593  1.00 35.09  ? 137 TYR A CD2 1 
ATOM   1061 C  CE1 . TYR A 1 137 ? 14.799  -22.323 69.847  1.00 35.75  ? 137 TYR A CE1 1 
ATOM   1062 C  CE2 . TYR A 1 137 ? 13.596  -22.796 67.828  1.00 35.68  ? 137 TYR A CE2 1 
ATOM   1063 C  CZ  . TYR A 1 137 ? 14.260  -23.232 68.960  1.00 32.02  ? 137 TYR A CZ  1 
ATOM   1064 O  OH  . TYR A 1 137 ? 14.389  -24.579 69.200  1.00 26.28  ? 137 TYR A OH  1 
ATOM   1065 N  N   . THR A 1 138 ? 14.889  -19.455 65.366  1.00 30.71  ? 138 THR A N   1 
ATOM   1066 C  CA  . THR A 1 138 ? 15.272  -20.497 64.424  1.00 34.61  ? 138 THR A CA  1 
ATOM   1067 C  C   . THR A 1 138 ? 16.522  -20.130 63.655  1.00 30.89  ? 138 THR A C   1 
ATOM   1068 O  O   . THR A 1 138 ? 17.252  -21.022 63.209  1.00 38.05  ? 138 THR A O   1 
ATOM   1069 C  CB  . THR A 1 138 ? 14.156  -20.773 63.429  1.00 35.97  ? 138 THR A CB  1 
ATOM   1070 O  OG1 . THR A 1 138 ? 13.902  -19.572 62.700  1.00 50.46  ? 138 THR A OG1 1 
ATOM   1071 C  CG2 . THR A 1 138 ? 12.896  -21.237 64.131  1.00 27.27  ? 138 THR A CG2 1 
ATOM   1072 N  N   . GLU A 1 139 ? 16.778  -18.842 63.460  1.00 21.81  ? 139 GLU A N   1 
ATOM   1073 C  CA  . GLU A 1 139 ? 17.929  -18.433 62.668  1.00 33.01  ? 139 GLU A CA  1 
ATOM   1074 C  C   . GLU A 1 139 ? 18.970  -17.686 63.496  1.00 43.03  ? 139 GLU A C   1 
ATOM   1075 O  O   . GLU A 1 139 ? 19.843  -17.023 62.930  1.00 41.59  ? 139 GLU A O   1 
ATOM   1076 C  CB  . GLU A 1 139 ? 17.464  -17.614 61.468  1.00 35.77  ? 139 GLU A CB  1 
ATOM   1077 C  CG  . GLU A 1 139 ? 16.543  -18.425 60.536  1.00 42.00  ? 139 GLU A CG  1 
ATOM   1078 C  CD  . GLU A 1 139 ? 17.300  -19.443 59.675  1.00 43.24  ? 139 GLU A CD  1 
ATOM   1079 O  OE1 . GLU A 1 139 ? 18.397  -19.112 59.180  1.00 48.16  ? 139 GLU A OE1 1 
ATOM   1080 O  OE2 . GLU A 1 139 ? 16.810  -20.586 59.517  1.00 39.23  ? 139 GLU A OE2 1 
ATOM   1081 N  N   . GLU A 1 140 ? 18.892  -17.811 64.826  1.00 46.47  ? 140 GLU A N   1 
ATOM   1082 C  CA  . GLU A 1 140 ? 19.864  -17.274 65.787  1.00 40.47  ? 140 GLU A CA  1 
ATOM   1083 C  C   . GLU A 1 140 ? 20.265  -15.833 65.475  1.00 36.32  ? 140 GLU A C   1 
ATOM   1084 O  O   . GLU A 1 140 ? 21.446  -15.489 65.398  1.00 40.20  ? 140 GLU A O   1 
ATOM   1085 C  CB  . GLU A 1 140 ? 21.081  -18.194 65.890  1.00 43.28  ? 140 GLU A CB  1 
ATOM   1086 C  CG  . GLU A 1 140 ? 20.951  -19.150 67.089  1.00 60.67  ? 140 GLU A CG  1 
ATOM   1087 C  CD  . GLU A 1 140 ? 21.707  -20.470 66.937  1.00 69.30  ? 140 GLU A CD  1 
ATOM   1088 O  OE1 . GLU A 1 140 ? 22.307  -20.912 67.947  1.00 65.20  ? 140 GLU A OE1 1 
ATOM   1089 O  OE2 . GLU A 1 140 ? 21.688  -21.068 65.829  1.00 67.27  ? 140 GLU A OE2 1 
ATOM   1090 N  N   . VAL A 1 141 ? 19.249  -14.979 65.337  1.00 28.98  ? 141 VAL A N   1 
ATOM   1091 C  CA  . VAL A 1 141 ? 19.409  -13.564 65.036  1.00 30.20  ? 141 VAL A CA  1 
ATOM   1092 C  C   . VAL A 1 141 ? 18.740  -12.762 66.143  1.00 36.47  ? 141 VAL A C   1 
ATOM   1093 O  O   . VAL A 1 141 ? 17.822  -13.233 66.817  1.00 36.00  ? 141 VAL A O   1 
ATOM   1094 C  CB  . VAL A 1 141 ? 18.808  -13.189 63.661  1.00 31.78  ? 141 VAL A CB  1 
ATOM   1095 C  CG1 . VAL A 1 141 ? 19.573  -13.863 62.552  1.00 45.48  ? 141 VAL A CG1 1 
ATOM   1096 C  CG2 . VAL A 1 141 ? 17.337  -13.587 63.575  1.00 20.91  ? 141 VAL A CG2 1 
ATOM   1097 N  N   . VAL A 1 142 ? 19.212  -11.536 66.325  1.00 36.56  ? 142 VAL A N   1 
ATOM   1098 C  CA  . VAL A 1 142 ? 18.542  -10.572 67.188  1.00 29.96  ? 142 VAL A CA  1 
ATOM   1099 C  C   . VAL A 1 142 ? 17.563  -9.796  66.317  1.00 31.53  ? 142 VAL A C   1 
ATOM   1100 O  O   . VAL A 1 142 ? 17.967  -9.134  65.355  1.00 33.78  ? 142 VAL A O   1 
ATOM   1101 C  CB  . VAL A 1 142 ? 19.550  -9.633  67.873  1.00 28.23  ? 142 VAL A CB  1 
ATOM   1102 C  CG1 . VAL A 1 142 ? 18.866  -8.369  68.401  1.00 19.34  ? 142 VAL A CG1 1 
ATOM   1103 C  CG2 . VAL A 1 142 ? 20.273  -10.360 68.984  1.00 29.52  ? 142 VAL A CG2 1 
ATOM   1104 N  N   . LEU A 1 143 ? 16.275  -9.887  66.642  1.00 29.23  ? 143 LEU A N   1 
ATOM   1105 C  CA  . LEU A 1 143 ? 15.225  -9.235  65.873  1.00 21.56  ? 143 LEU A CA  1 
ATOM   1106 C  C   . LEU A 1 143 ? 14.669  -8.045  66.640  1.00 26.53  ? 143 LEU A C   1 
ATOM   1107 O  O   . LEU A 1 143 ? 14.150  -8.204  67.749  1.00 33.19  ? 143 LEU A O   1 
ATOM   1108 C  CB  . LEU A 1 143 ? 14.098  -10.206 65.538  1.00 29.26  ? 143 LEU A CB  1 
ATOM   1109 C  CG  . LEU A 1 143 ? 13.123  -9.494  64.589  1.00 42.16  ? 143 LEU A CG  1 
ATOM   1110 C  CD1 . LEU A 1 143 ? 13.580  -9.660  63.140  1.00 51.74  ? 143 LEU A CD1 1 
ATOM   1111 C  CD2 . LEU A 1 143 ? 11.692  -9.950  64.739  1.00 38.53  ? 143 LEU A CD2 1 
ATOM   1112 N  N   . VAL A 1 144 ? 14.777  -6.861  66.043  1.00 32.81  ? 144 VAL A N   1 
ATOM   1113 C  CA  . VAL A 1 144 ? 14.103  -5.650  66.503  1.00 31.96  ? 144 VAL A CA  1 
ATOM   1114 C  C   . VAL A 1 144 ? 12.912  -5.390  65.592  1.00 28.95  ? 144 VAL A C   1 
ATOM   1115 O  O   . VAL A 1 144 ? 12.947  -5.692  64.395  1.00 43.90  ? 144 VAL A O   1 
ATOM   1116 C  CB  . VAL A 1 144 ? 15.064  -4.439  66.507  1.00 31.61  ? 144 VAL A CB  1 
ATOM   1117 C  CG1 . VAL A 1 144 ? 14.299  -3.128  66.624  1.00 28.06  ? 144 VAL A CG1 1 
ATOM   1118 C  CG2 . VAL A 1 144 ? 16.089  -4.567  67.610  1.00 36.14  ? 144 VAL A CG2 1 
ATOM   1119 N  N   . SER A 1 145 ? 11.837  -4.843  66.157  1.00 23.08  ? 145 SER A N   1 
ATOM   1120 C  CA  . SER A 1 145 ? 10.734  -4.288  65.379  1.00 22.68  ? 145 SER A CA  1 
ATOM   1121 C  C   . SER A 1 145 ? 10.400  -2.931  65.972  1.00 17.20  ? 145 SER A C   1 
ATOM   1122 O  O   . SER A 1 145 ? 10.116  -2.832  67.170  1.00 22.45  ? 145 SER A O   1 
ATOM   1123 C  CB  . SER A 1 145 ? 9.508   -5.204  65.391  1.00 24.68  ? 145 SER A CB  1 
ATOM   1124 O  OG  . SER A 1 145 ? 8.551   -4.763  66.334  1.00 39.02  ? 145 SER A OG  1 
ATOM   1125 N  N   . LEU A 1 146 ? 10.452  -1.890  65.151  1.00 21.39  ? 146 LEU A N   1 
ATOM   1126 C  CA  . LEU A 1 146 ? 10.304  -0.532  65.648  1.00 23.06  ? 146 LEU A CA  1 
ATOM   1127 C  C   . LEU A 1 146 ? 8.873   -0.046  65.447  1.00 21.06  ? 146 LEU A C   1 
ATOM   1128 O  O   . LEU A 1 146 ? 7.984   -0.794  65.026  1.00 15.03  ? 146 LEU A O   1 
ATOM   1129 C  CB  . LEU A 1 146 ? 11.319  0.394   64.971  1.00 15.33  ? 146 LEU A CB  1 
ATOM   1130 C  CG  . LEU A 1 146 ? 11.490  0.357   63.452  1.00 15.06  ? 146 LEU A CG  1 
ATOM   1131 C  CD1 . LEU A 1 146 ? 10.428  1.205   62.750  1.00 16.65  ? 146 LEU A CD1 1 
ATOM   1132 C  CD2 . LEU A 1 146 ? 12.892  0.831   63.074  1.00 15.58  ? 146 LEU A CD2 1 
ATOM   1133 N  N   . SER A 1 147 ? 8.649   1.224   65.777  1.00 18.29  ? 147 SER A N   1 
ATOM   1134 C  CA  . SER A 1 147 ? 7.387   1.886   65.475  1.00 32.76  ? 147 SER A CA  1 
ATOM   1135 C  C   . SER A 1 147 ? 7.681   3.310   65.035  1.00 37.85  ? 147 SER A C   1 
ATOM   1136 O  O   . SER A 1 147 ? 8.732   3.875   65.351  1.00 33.42  ? 147 SER A O   1 
ATOM   1137 C  CB  . SER A 1 147 ? 6.432   1.913   66.671  1.00 38.85  ? 147 SER A CB  1 
ATOM   1138 O  OG  . SER A 1 147 ? 6.927   2.784   67.678  1.00 41.26  ? 147 SER A OG  1 
ATOM   1139 N  N   . TYR A 1 148 ? 6.732   3.883   64.297  1.00 39.81  ? 148 TYR A N   1 
ATOM   1140 C  CA  . TYR A 1 148 ? 6.828   5.260   63.829  1.00 36.58  ? 148 TYR A CA  1 
ATOM   1141 C  C   . TYR A 1 148 ? 5.417   5.821   63.696  1.00 29.24  ? 148 TYR A C   1 
ATOM   1142 O  O   . TYR A 1 148 ? 4.461   5.082   63.437  1.00 20.29  ? 148 TYR A O   1 
ATOM   1143 C  CB  . TYR A 1 148 ? 7.583   5.361   62.489  1.00 36.48  ? 148 TYR A CB  1 
ATOM   1144 C  CG  . TYR A 1 148 ? 6.972   4.516   61.387  1.00 29.34  ? 148 TYR A CG  1 
ATOM   1145 C  CD1 . TYR A 1 148 ? 7.143   3.133   61.372  1.00 16.36  ? 148 TYR A CD1 1 
ATOM   1146 C  CD2 . TYR A 1 148 ? 6.214   5.097   60.373  1.00 25.20  ? 148 TYR A CD2 1 
ATOM   1147 C  CE1 . TYR A 1 148 ? 6.581   2.355   60.392  1.00 13.97  ? 148 TYR A CE1 1 
ATOM   1148 C  CE2 . TYR A 1 148 ? 5.646   4.318   59.373  1.00 22.25  ? 148 TYR A CE2 1 
ATOM   1149 C  CZ  . TYR A 1 148 ? 5.835   2.949   59.394  1.00 25.69  ? 148 TYR A CZ  1 
ATOM   1150 O  OH  . TYR A 1 148 ? 5.284   2.167   58.410  1.00 29.77  ? 148 TYR A OH  1 
ATOM   1151 N  N   . ARG A 1 149 ? 5.291   7.130   63.876  1.00 14.74  ? 149 ARG A N   1 
ATOM   1152 C  CA  . ARG A 1 149 ? 3.992   7.746   63.687  1.00 19.41  ? 149 ARG A CA  1 
ATOM   1153 C  C   . ARG A 1 149 ? 3.538   7.634   62.238  1.00 35.72  ? 149 ARG A C   1 
ATOM   1154 O  O   . ARG A 1 149 ? 4.337   7.734   61.297  1.00 30.55  ? 149 ARG A O   1 
ATOM   1155 C  CB  . ARG A 1 149 ? 4.013   9.210   64.105  1.00 21.83  ? 149 ARG A CB  1 
ATOM   1156 C  CG  . ARG A 1 149 ? 4.480   9.421   65.501  1.00 30.73  ? 149 ARG A CG  1 
ATOM   1157 C  CD  . ARG A 1 149 ? 4.824   10.855  65.721  1.00 31.71  ? 149 ARG A CD  1 
ATOM   1158 N  NE  . ARG A 1 149 ? 6.242   11.065  65.464  1.00 34.94  ? 149 ARG A NE  1 
ATOM   1159 C  CZ  . ARG A 1 149 ? 6.861   12.222  65.641  1.00 36.20  ? 149 ARG A CZ  1 
ATOM   1160 N  NH1 . ARG A 1 149 ? 6.172   13.261  66.067  1.00 35.73  ? 149 ARG A NH1 1 
ATOM   1161 N  NH2 . ARG A 1 149 ? 8.154   12.332  65.379  1.00 32.29  ? 149 ARG A NH2 1 
ATOM   1162 N  N   . VAL A 1 150 ? 2.224   7.478   62.077  1.00 33.21  ? 150 VAL A N   1 
ATOM   1163 C  CA  . VAL A 1 150 ? 1.587   7.274   60.794  1.00 24.39  ? 150 VAL A CA  1 
ATOM   1164 C  C   . VAL A 1 150 ? 0.499   8.325   60.635  1.00 27.46  ? 150 VAL A C   1 
ATOM   1165 O  O   . VAL A 1 150 ? 0.193   9.083   61.563  1.00 25.05  ? 150 VAL A O   1 
ATOM   1166 C  CB  . VAL A 1 150 ? 1.000   5.866   60.680  1.00 23.59  ? 150 VAL A CB  1 
ATOM   1167 C  CG1 . VAL A 1 150 ? 2.056   4.836   61.096  1.00 19.10  ? 150 VAL A CG1 1 
ATOM   1168 C  CG2 . VAL A 1 150 ? -0.233  5.773   61.543  1.00 22.14  ? 150 VAL A CG2 1 
ATOM   1169 N  N   . GLY A 1 151 ? -0.094  8.353   59.432  1.00 26.47  ? 151 GLY A N   1 
ATOM   1170 C  CA  . GLY A 1 151 ? -1.032  9.398   59.055  1.00 20.44  ? 151 GLY A CA  1 
ATOM   1171 C  C   . GLY A 1 151 ? -0.471  10.788  59.292  1.00 26.36  ? 151 GLY A C   1 
ATOM   1172 O  O   . GLY A 1 151 ? 0.756   10.971  59.324  1.00 32.71  ? 151 GLY A O   1 
ATOM   1173 N  N   . ALA A 1 152 ? -1.358  11.774  59.480  1.00 30.25  ? 152 ALA A N   1 
ATOM   1174 C  CA  . ALA A 1 152 ? -0.911  13.157  59.653  1.00 29.83  ? 152 ALA A CA  1 
ATOM   1175 C  C   . ALA A 1 152 ? 0.062   13.300  60.819  1.00 30.64  ? 152 ALA A C   1 
ATOM   1176 O  O   . ALA A 1 152 ? 0.959   14.152  60.774  1.00 24.09  ? 152 ALA A O   1 
ATOM   1177 C  CB  . ALA A 1 152 ? -2.113  14.085  59.845  1.00 20.12  ? 152 ALA A CB  1 
ATOM   1178 N  N   . PHE A 1 153 ? -0.095  12.472  61.856  1.00 28.76  ? 153 PHE A N   1 
ATOM   1179 C  CA  . PHE A 1 153 ? 0.851   12.474  62.965  1.00 32.85  ? 153 PHE A CA  1 
ATOM   1180 C  C   . PHE A 1 153 ? 2.284   12.312  62.471  1.00 44.63  ? 153 PHE A C   1 
ATOM   1181 O  O   . PHE A 1 153 ? 3.186   13.041  62.906  1.00 36.53  ? 153 PHE A O   1 
ATOM   1182 C  CB  . PHE A 1 153 ? 0.492   11.363  63.948  1.00 24.28  ? 153 PHE A CB  1 
ATOM   1183 C  CG  . PHE A 1 153 ? -0.925  11.426  64.422  1.00 27.33  ? 153 PHE A CG  1 
ATOM   1184 C  CD1 . PHE A 1 153 ? -1.325  12.413  65.320  1.00 23.76  ? 153 PHE A CD1 1 
ATOM   1185 C  CD2 . PHE A 1 153 ? -1.866  10.511  63.967  1.00 32.75  ? 153 PHE A CD2 1 
ATOM   1186 C  CE1 . PHE A 1 153 ? -2.638  12.487  65.750  1.00 26.63  ? 153 PHE A CE1 1 
ATOM   1187 C  CE2 . PHE A 1 153 ? -3.183  10.574  64.398  1.00 27.02  ? 153 PHE A CE2 1 
ATOM   1188 C  CZ  . PHE A 1 153 ? -3.569  11.562  65.286  1.00 26.69  ? 153 PHE A CZ  1 
ATOM   1189 N  N   . GLY A 1 154 ? 2.505   11.382  61.541  1.00 50.38  ? 154 GLY A N   1 
ATOM   1190 C  CA  . GLY A 1 154 ? 3.835   11.112  61.030  1.00 35.60  ? 154 GLY A CA  1 
ATOM   1191 C  C   . GLY A 1 154 ? 4.232   11.928  59.818  1.00 26.60  ? 154 GLY A C   1 
ATOM   1192 O  O   . GLY A 1 154 ? 5.430   12.143  59.603  1.00 20.97  ? 154 GLY A O   1 
ATOM   1193 N  N   . PHE A 1 155 ? 3.264   12.403  59.009  1.00 19.33  ? 155 PHE A N   1 
ATOM   1194 C  CA  . PHE A 1 155 ? 3.661   12.965  57.724  1.00 26.59  ? 155 PHE A CA  1 
ATOM   1195 C  C   . PHE A 1 155 ? 2.965   14.256  57.310  1.00 33.46  ? 155 PHE A C   1 
ATOM   1196 O  O   . PHE A 1 155 ? 3.163   14.697  56.167  1.00 35.60  ? 155 PHE A O   1 
ATOM   1197 C  CB  . PHE A 1 155 ? 3.485   11.908  56.653  1.00 14.63  ? 155 PHE A CB  1 
ATOM   1198 C  CG  . PHE A 1 155 ? 4.240   10.671  56.951  1.00 14.39  ? 155 PHE A CG  1 
ATOM   1199 C  CD1 . PHE A 1 155 ? 5.601   10.616  56.696  1.00 14.42  ? 155 PHE A CD1 1 
ATOM   1200 C  CD2 . PHE A 1 155 ? 3.619   9.577   57.530  1.00 19.89  ? 155 PHE A CD2 1 
ATOM   1201 C  CE1 . PHE A 1 155 ? 6.333   9.488   56.975  1.00 14.27  ? 155 PHE A CE1 1 
ATOM   1202 C  CE2 . PHE A 1 155 ? 4.348   8.437   57.813  1.00 17.93  ? 155 PHE A CE2 1 
ATOM   1203 C  CZ  . PHE A 1 155 ? 5.711   8.394   57.525  1.00 14.08  ? 155 PHE A CZ  1 
ATOM   1204 N  N   . LEU A 1 156 ? 2.193   14.895  58.185  1.00 19.55  ? 156 LEU A N   1 
ATOM   1205 C  CA  . LEU A 1 156 ? 1.717   16.227  57.854  1.00 26.96  ? 156 LEU A CA  1 
ATOM   1206 C  C   . LEU A 1 156 ? 2.920   17.131  57.615  1.00 28.99  ? 156 LEU A C   1 
ATOM   1207 O  O   . LEU A 1 156 ? 3.906   17.079  58.352  1.00 32.00  ? 156 LEU A O   1 
ATOM   1208 C  CB  . LEU A 1 156 ? 0.813   16.768  58.958  1.00 34.62  ? 156 LEU A CB  1 
ATOM   1209 C  CG  . LEU A 1 156 ? 0.356   18.208  58.703  1.00 36.88  ? 156 LEU A CG  1 
ATOM   1210 C  CD1 . LEU A 1 156 ? -1.134  18.350  58.961  1.00 40.98  ? 156 LEU A CD1 1 
ATOM   1211 C  CD2 . LEU A 1 156 ? 1.120   19.198  59.587  1.00 18.73  ? 156 LEU A CD2 1 
ATOM   1212 N  N   . ALA A 1 157 ? 2.874   17.929  56.551  1.00 38.79  ? 157 ALA A N   1 
ATOM   1213 C  CA  . ALA A 1 157 ? 4.086   18.601  56.085  1.00 36.87  ? 157 ALA A CA  1 
ATOM   1214 C  C   . ALA A 1 157 ? 3.794   20.020  55.613  1.00 32.88  ? 157 ALA A C   1 
ATOM   1215 O  O   . ALA A 1 157 ? 3.119   20.222  54.600  1.00 30.58  ? 157 ALA A O   1 
ATOM   1216 C  CB  . ALA A 1 157 ? 4.747   17.797  54.976  1.00 27.85  ? 157 ALA A CB  1 
ATOM   1217 N  N   . LEU A 1 158 ? 4.319   20.996  56.344  1.00 30.28  ? 158 LEU A N   1 
ATOM   1218 C  CA  . LEU A 1 158 ? 4.311   22.401  55.950  1.00 31.02  ? 158 LEU A CA  1 
ATOM   1219 C  C   . LEU A 1 158 ? 5.770   22.785  55.747  1.00 31.36  ? 158 LEU A C   1 
ATOM   1220 O  O   . LEU A 1 158 ? 6.434   23.291  56.652  1.00 36.00  ? 158 LEU A O   1 
ATOM   1221 C  CB  . LEU A 1 158 ? 3.650   23.257  57.014  1.00 32.29  ? 158 LEU A CB  1 
ATOM   1222 C  CG  . LEU A 1 158 ? 2.202   22.910  57.353  1.00 30.55  ? 158 LEU A CG  1 
ATOM   1223 C  CD1 . LEU A 1 158 ? 1.809   23.676  58.555  1.00 31.93  ? 158 LEU A CD1 1 
ATOM   1224 C  CD2 . LEU A 1 158 ? 1.272   23.293  56.209  1.00 28.79  ? 158 LEU A CD2 1 
ATOM   1225 N  N   . HIS A 1 159 ? 6.281   22.517  54.556  1.00 34.17  ? 159 HIS A N   1 
ATOM   1226 C  CA  . HIS A 1 159 ? 7.708   22.689  54.338  1.00 34.55  ? 159 HIS A CA  1 
ATOM   1227 C  C   . HIS A 1 159 ? 8.089   24.152  54.488  1.00 37.70  ? 159 HIS A C   1 
ATOM   1228 O  O   . HIS A 1 159 ? 7.459   25.034  53.900  1.00 37.44  ? 159 HIS A O   1 
ATOM   1229 C  CB  . HIS A 1 159 ? 8.121   22.184  52.965  1.00 28.71  ? 159 HIS A CB  1 
ATOM   1230 C  CG  . HIS A 1 159 ? 9.599   22.217  52.756  1.00 35.57  ? 159 HIS A CG  1 
ATOM   1231 N  ND1 . HIS A 1 159 ? 10.195  22.960  51.760  1.00 35.90  ? 159 HIS A ND1 1 
ATOM   1232 C  CD2 . HIS A 1 159 ? 10.606  21.619  53.436  1.00 38.27  ? 159 HIS A CD2 1 
ATOM   1233 C  CE1 . HIS A 1 159 ? 11.505  22.804  51.823  1.00 40.32  ? 159 HIS A CE1 1 
ATOM   1234 N  NE2 . HIS A 1 159 ? 11.780  21.995  52.831  1.00 43.12  ? 159 HIS A NE2 1 
ATOM   1235 N  N   . GLY A 1 160 ? 9.124   24.404  55.283  1.00 32.91  ? 160 GLY A N   1 
ATOM   1236 C  CA  . GLY A 1 160 ? 9.505   25.757  55.623  1.00 28.01  ? 160 GLY A CA  1 
ATOM   1237 C  C   . GLY A 1 160 ? 9.434   25.914  57.120  1.00 37.70  ? 160 GLY A C   1 
ATOM   1238 O  O   . GLY A 1 160 ? 10.418  26.267  57.776  1.00 47.59  ? 160 GLY A O   1 
ATOM   1239 N  N   . SER A 1 161 ? 8.255   25.638  57.665  1.00 42.24  ? 161 SER A N   1 
ATOM   1240 C  CA  . SER A 1 161 ? 8.097   25.513  59.105  1.00 38.24  ? 161 SER A CA  1 
ATOM   1241 C  C   . SER A 1 161 ? 9.012   24.423  59.645  1.00 37.46  ? 161 SER A C   1 
ATOM   1242 O  O   . SER A 1 161 ? 9.194   23.373  59.025  1.00 42.84  ? 161 SER A O   1 
ATOM   1243 C  CB  . SER A 1 161 ? 6.638   25.189  59.447  1.00 32.21  ? 161 SER A CB  1 
ATOM   1244 O  OG  . SER A 1 161 ? 6.492   24.839  60.814  1.00 32.99  ? 161 SER A OG  1 
ATOM   1245 N  N   . GLN A 1 162 ? 9.603   24.677  60.803  1.00 45.85  ? 162 GLN A N   1 
ATOM   1246 C  CA  . GLN A 1 162 ? 10.277  23.621  61.541  1.00 50.65  ? 162 GLN A CA  1 
ATOM   1247 C  C   . GLN A 1 162 ? 9.358   22.988  62.568  1.00 45.78  ? 162 GLN A C   1 
ATOM   1248 O  O   . GLN A 1 162 ? 9.739   22.000  63.199  1.00 43.37  ? 162 GLN A O   1 
ATOM   1249 C  CB  . GLN A 1 162 ? 11.549  24.160  62.208  1.00 53.77  ? 162 GLN A CB  1 
ATOM   1250 C  CG  . GLN A 1 162 ? 12.507  24.846  61.216  1.00 60.63  ? 162 GLN A CG  1 
ATOM   1251 C  CD  . GLN A 1 162 ? 12.825  23.991  59.969  1.00 61.03  ? 162 GLN A CD  1 
ATOM   1252 O  OE1 . GLN A 1 162 ? 13.077  22.782  60.068  1.00 51.89  ? 162 GLN A OE1 1 
ATOM   1253 N  NE2 . GLN A 1 162 ? 12.806  24.627  58.792  1.00 59.29  ? 162 GLN A NE2 1 
ATOM   1254 N  N   . GLU A 1 163 ? 8.148   23.526  62.730  1.00 46.41  ? 163 GLU A N   1 
ATOM   1255 C  CA  . GLU A 1 163 ? 7.170   22.923  63.622  1.00 42.33  ? 163 GLU A CA  1 
ATOM   1256 C  C   . GLU A 1 163 ? 6.467   21.734  62.976  1.00 49.05  ? 163 GLU A C   1 
ATOM   1257 O  O   . GLU A 1 163 ? 6.131   20.772  63.676  1.00 48.62  ? 163 GLU A O   1 
ATOM   1258 C  CB  . GLU A 1 163 ? 6.158   23.976  64.073  1.00 39.89  ? 163 GLU A CB  1 
ATOM   1259 C  CG  . GLU A 1 163 ? 6.773   25.083  64.919  1.00 44.53  ? 163 GLU A CG  1 
ATOM   1260 C  CD  . GLU A 1 163 ? 7.483   24.554  66.171  1.00 54.51  ? 163 GLU A CD  1 
ATOM   1261 O  OE1 . GLU A 1 163 ? 6.871   23.742  66.907  1.00 54.54  ? 163 GLU A OE1 1 
ATOM   1262 O  OE2 . GLU A 1 163 ? 8.647   24.956  66.426  1.00 51.95  ? 163 GLU A OE2 1 
ATOM   1263 N  N   . ALA A 1 164 ? 6.245   21.763  61.656  1.00 49.23  ? 164 ALA A N   1 
ATOM   1264 C  CA  . ALA A 1 164 ? 5.745   20.598  60.919  1.00 41.10  ? 164 ALA A CA  1 
ATOM   1265 C  C   . ALA A 1 164 ? 6.501   20.448  59.605  1.00 44.86  ? 164 ALA A C   1 
ATOM   1266 O  O   . ALA A 1 164 ? 5.981   20.795  58.534  1.00 44.98  ? 164 ALA A O   1 
ATOM   1267 C  CB  . ALA A 1 164 ? 4.245   20.701  60.670  1.00 31.45  ? 164 ALA A CB  1 
ATOM   1268 N  N   . PRO A 1 165 ? 7.731   19.912  59.652  1.00 38.44  ? 165 PRO A N   1 
ATOM   1269 C  CA  . PRO A 1 165 ? 8.523   19.740  58.416  1.00 33.37  ? 165 PRO A CA  1 
ATOM   1270 C  C   . PRO A 1 165 ? 8.043   18.607  57.520  1.00 29.47  ? 165 PRO A C   1 
ATOM   1271 O  O   . PRO A 1 165 ? 8.138   18.717  56.291  1.00 26.58  ? 165 PRO A O   1 
ATOM   1272 C  CB  . PRO A 1 165 ? 9.932   19.449  58.949  1.00 26.97  ? 165 PRO A CB  1 
ATOM   1273 C  CG  . PRO A 1 165 ? 9.722   18.964  60.338  1.00 20.43  ? 165 PRO A CG  1 
ATOM   1274 C  CD  . PRO A 1 165 ? 8.534   19.677  60.862  1.00 22.14  ? 165 PRO A CD  1 
ATOM   1275 N  N   . GLY A 1 166 ? 7.556   17.516  58.092  1.00 24.55  ? 166 GLY A N   1 
ATOM   1276 C  CA  . GLY A 1 166 ? 7.222   16.348  57.310  1.00 27.13  ? 166 GLY A CA  1 
ATOM   1277 C  C   . GLY A 1 166 ? 8.322   15.299  57.368  1.00 28.29  ? 166 GLY A C   1 
ATOM   1278 O  O   . GLY A 1 166 ? 9.471   15.570  57.717  1.00 36.98  ? 166 GLY A O   1 
ATOM   1279 N  N   . ASN A 1 167 ? 7.957   14.072  57.036  1.00 22.06  ? 167 ASN A N   1 
ATOM   1280 C  CA  . ASN A 1 167 ? 8.882   12.956  57.128  1.00 25.01  ? 167 ASN A CA  1 
ATOM   1281 C  C   . ASN A 1 167 ? 9.300   12.657  58.554  1.00 25.85  ? 167 ASN A C   1 
ATOM   1282 O  O   . ASN A 1 167 ? 10.275  11.914  58.781  1.00 18.30  ? 167 ASN A O   1 
ATOM   1283 C  CB  . ASN A 1 167 ? 10.108  13.181  56.247  1.00 22.00  ? 167 ASN A CB  1 
ATOM   1284 C  CG  . ASN A 1 167 ? 9.732   13.442  54.837  1.00 25.73  ? 167 ASN A CG  1 
ATOM   1285 O  OD1 . ASN A 1 167 ? 10.181  14.389  54.201  1.00 40.35  ? 167 ASN A OD1 1 
ATOM   1286 N  ND2 . ASN A 1 167 ? 8.849   12.603  54.340  1.00 15.20  ? 167 ASN A ND2 1 
ATOM   1287 N  N   . VAL A 1 168 ? 8.559   13.189  59.529  1.00 15.56  ? 168 VAL A N   1 
ATOM   1288 C  CA  . VAL A 1 168 ? 8.931   12.909  60.904  1.00 25.17  ? 168 VAL A CA  1 
ATOM   1289 C  C   . VAL A 1 168 ? 8.642   11.450  61.246  1.00 15.33  ? 168 VAL A C   1 
ATOM   1290 O  O   . VAL A 1 168 ? 9.237   10.893  62.170  1.00 15.41  ? 168 VAL A O   1 
ATOM   1291 C  CB  . VAL A 1 168 ? 8.258   13.931  61.839  1.00 16.03  ? 168 VAL A CB  1 
ATOM   1292 C  CG1 . VAL A 1 168 ? 8.618   15.324  61.380  1.00 16.45  ? 168 VAL A CG1 1 
ATOM   1293 C  CG2 . VAL A 1 168 ? 6.763   13.764  61.866  1.00 21.16  ? 168 VAL A CG2 1 
ATOM   1294 N  N   . GLY A 1 169 ? 7.794   10.790  60.469  1.00 14.97  ? 169 GLY A N   1 
ATOM   1295 C  CA  . GLY A 1 169 ? 7.649   9.357   60.625  1.00 27.98  ? 169 GLY A CA  1 
ATOM   1296 C  C   . GLY A 1 169 ? 8.894   8.608   60.196  1.00 26.49  ? 169 GLY A C   1 
ATOM   1297 O  O   . GLY A 1 169 ? 9.328   7.672   60.874  1.00 30.44  ? 169 GLY A O   1 
ATOM   1298 N  N   . LEU A 1 170 ? 9.484   8.994   59.063  1.00 27.14  ? 170 LEU A N   1 
ATOM   1299 C  CA  . LEU A 1 170 ? 10.755  8.384   58.694  1.00 22.65  ? 170 LEU A CA  1 
ATOM   1300 C  C   . LEU A 1 170 ? 11.842  8.779   59.682  1.00 26.01  ? 170 LEU A C   1 
ATOM   1301 O  O   . LEU A 1 170 ? 12.700  7.959   60.033  1.00 31.24  ? 170 LEU A O   1 
ATOM   1302 C  CB  . LEU A 1 170 ? 11.154  8.771   57.272  1.00 21.43  ? 170 LEU A CB  1 
ATOM   1303 C  CG  . LEU A 1 170 ? 10.250  8.296   56.140  1.00 20.30  ? 170 LEU A CG  1 
ATOM   1304 C  CD1 . LEU A 1 170 ? 10.372  9.252   54.976  1.00 17.67  ? 170 LEU A CD1 1 
ATOM   1305 C  CD2 . LEU A 1 170 ? 10.561  6.863   55.733  1.00 21.04  ? 170 LEU A CD2 1 
ATOM   1306 N  N   . LEU A 1 171 ? 11.806  10.026  60.161  1.00 18.97  ? 171 LEU A N   1 
ATOM   1307 C  CA  . LEU A 1 171 ? 12.735  10.431  61.210  1.00 29.54  ? 171 LEU A CA  1 
ATOM   1308 C  C   . LEU A 1 171 ? 12.539  9.610   62.484  1.00 35.75  ? 171 LEU A C   1 
ATOM   1309 O  O   . LEU A 1 171 ? 13.522  9.258   63.148  1.00 39.65  ? 171 LEU A O   1 
ATOM   1310 C  CB  . LEU A 1 171 ? 12.585  11.924  61.489  1.00 34.26  ? 171 LEU A CB  1 
ATOM   1311 C  CG  . LEU A 1 171 ? 13.143  12.772  60.343  1.00 31.27  ? 171 LEU A CG  1 
ATOM   1312 C  CD1 . LEU A 1 171 ? 12.790  14.250  60.489  1.00 23.24  ? 171 LEU A CD1 1 
ATOM   1313 C  CD2 . LEU A 1 171 ? 14.648  12.562  60.260  1.00 22.04  ? 171 LEU A CD2 1 
ATOM   1314 N  N   . ASP A 1 172 ? 11.282  9.304   62.852  1.00 30.91  ? 172 ASP A N   1 
ATOM   1315 C  CA  . ASP A 1 172 ? 11.041  8.338   63.927  1.00 22.09  ? 172 ASP A CA  1 
ATOM   1316 C  C   . ASP A 1 172 ? 11.857  7.071   63.706  1.00 25.65  ? 172 ASP A C   1 
ATOM   1317 O  O   . ASP A 1 172 ? 12.618  6.643   64.582  1.00 21.07  ? 172 ASP A O   1 
ATOM   1318 C  CB  . ASP A 1 172 ? 9.555   7.954   64.043  1.00 24.37  ? 172 ASP A CB  1 
ATOM   1319 C  CG  . ASP A 1 172 ? 8.660   9.102   64.447  1.00 34.27  ? 172 ASP A CG  1 
ATOM   1320 O  OD1 . ASP A 1 172 ? 9.169   10.100  64.986  1.00 39.93  ? 172 ASP A OD1 1 
ATOM   1321 O  OD2 . ASP A 1 172 ? 7.426   8.991   64.240  1.00 30.67  ? 172 ASP A OD2 1 
ATOM   1322 N  N   . GLN A 1 173 ? 11.699  6.441   62.538  1.00 30.56  ? 173 GLN A N   1 
ATOM   1323 C  CA  . GLN A 1 173 ? 12.345  5.149   62.387  1.00 37.45  ? 173 GLN A CA  1 
ATOM   1324 C  C   . GLN A 1 173 ? 13.853  5.285   62.267  1.00 33.69  ? 173 GLN A C   1 
ATOM   1325 O  O   . GLN A 1 173 ? 14.574  4.317   62.536  1.00 37.21  ? 173 GLN A O   1 
ATOM   1326 C  CB  . GLN A 1 173 ? 11.751  4.360   61.213  1.00 44.98  ? 173 GLN A CB  1 
ATOM   1327 C  CG  . GLN A 1 173 ? 11.200  5.135   60.024  1.00 51.78  ? 173 GLN A CG  1 
ATOM   1328 C  CD  . GLN A 1 173 ? 10.609  4.191   58.960  1.00 47.29  ? 173 GLN A CD  1 
ATOM   1329 O  OE1 . GLN A 1 173 ? 11.309  3.335   58.426  1.00 53.60  ? 173 GLN A OE1 1 
ATOM   1330 N  NE2 . GLN A 1 173 ? 9.318   4.333   58.675  1.00 28.80  ? 173 GLN A NE2 1 
ATOM   1331 N  N   . ARG A 1 174 ? 14.356  6.470   61.923  1.00 21.62  ? 174 ARG A N   1 
ATOM   1332 C  CA  . ARG A 1 174 ? 15.802  6.651   61.962  1.00 26.58  ? 174 ARG A CA  1 
ATOM   1333 C  C   . ARG A 1 174 ? 16.297  6.752   63.400  1.00 30.62  ? 174 ARG A C   1 
ATOM   1334 O  O   . ARG A 1 174 ? 17.384  6.264   63.726  1.00 33.43  ? 174 ARG A O   1 
ATOM   1335 C  CB  . ARG A 1 174 ? 16.212  7.880   61.150  1.00 25.12  ? 174 ARG A CB  1 
ATOM   1336 C  CG  . ARG A 1 174 ? 17.666  8.262   61.335  1.00 21.78  ? 174 ARG A CG  1 
ATOM   1337 C  CD  . ARG A 1 174 ? 18.044  9.592   60.712  1.00 20.57  ? 174 ARG A CD  1 
ATOM   1338 N  NE  . ARG A 1 174 ? 17.741  9.671   59.295  1.00 18.32  ? 174 ARG A NE  1 
ATOM   1339 C  CZ  . ARG A 1 174 ? 17.999  10.738  58.555  1.00 32.15  ? 174 ARG A CZ  1 
ATOM   1340 N  NH1 . ARG A 1 174 ? 18.557  11.794  59.120  1.00 40.99  ? 174 ARG A NH1 1 
ATOM   1341 N  NH2 . ARG A 1 174 ? 17.684  10.738  57.271  1.00 16.99  ? 174 ARG A NH2 1 
ATOM   1342 N  N   . MET A 1 175 ? 15.503  7.359   64.281  1.00 30.41  ? 175 MET A N   1 
ATOM   1343 C  CA  . MET A 1 175 ? 15.894  7.422   65.682  1.00 25.24  ? 175 MET A CA  1 
ATOM   1344 C  C   . MET A 1 175 ? 15.989  6.025   66.286  1.00 22.68  ? 175 MET A C   1 
ATOM   1345 O  O   . MET A 1 175 ? 16.967  5.704   66.967  1.00 31.36  ? 175 MET A O   1 
ATOM   1346 C  CB  . MET A 1 175 ? 14.912  8.290   66.460  1.00 25.59  ? 175 MET A CB  1 
ATOM   1347 C  CG  . MET A 1 175 ? 15.330  8.497   67.902  1.00 38.54  ? 175 MET A CG  1 
ATOM   1348 S  SD  . MET A 1 175 ? 14.922  10.137  68.541  1.00 48.48  ? 175 MET A SD  1 
ATOM   1349 C  CE  . MET A 1 175 ? 15.724  11.187  67.328  1.00 37.31  ? 175 MET A CE  1 
ATOM   1350 N  N   . ALA A 1 176 ? 15.000  5.173   66.020  1.00 16.42  ? 176 ALA A N   1 
ATOM   1351 C  CA  . ALA A 1 176 ? 15.070  3.786   66.473  1.00 30.91  ? 176 ALA A CA  1 
ATOM   1352 C  C   . ALA A 1 176 ? 16.294  3.073   65.908  1.00 28.60  ? 176 ALA A C   1 
ATOM   1353 O  O   . ALA A 1 176 ? 16.963  2.313   66.617  1.00 34.05  ? 176 ALA A O   1 
ATOM   1354 C  CB  . ALA A 1 176 ? 13.787  3.039   66.087  1.00 27.75  ? 176 ALA A CB  1 
ATOM   1355 N  N   . LEU A 1 177 ? 16.602  3.296   64.629  1.00 26.85  ? 177 LEU A N   1 
ATOM   1356 C  CA  . LEU A 1 177 ? 17.814  2.713   64.067  1.00 20.36  ? 177 LEU A CA  1 
ATOM   1357 C  C   . LEU A 1 177 ? 19.057  3.203   64.813  1.00 24.91  ? 177 LEU A C   1 
ATOM   1358 O  O   . LEU A 1 177 ? 19.935  2.405   65.169  1.00 17.65  ? 177 LEU A O   1 
ATOM   1359 C  CB  . LEU A 1 177 ? 17.889  3.026   62.571  1.00 19.19  ? 177 LEU A CB  1 
ATOM   1360 C  CG  . LEU A 1 177 ? 16.986  2.142   61.699  1.00 30.55  ? 177 LEU A CG  1 
ATOM   1361 C  CD1 . LEU A 1 177 ? 17.110  2.459   60.201  1.00 15.93  ? 177 LEU A CD1 1 
ATOM   1362 C  CD2 . LEU A 1 177 ? 17.242  0.660   61.970  1.00 30.80  ? 177 LEU A CD2 1 
ATOM   1363 N  N   . GLN A 1 178 ? 19.129  4.514   65.080  1.00 17.44  ? 178 GLN A N   1 
ATOM   1364 C  CA  . GLN A 1 178 ? 20.207  5.077   65.890  1.00 22.23  ? 178 GLN A CA  1 
ATOM   1365 C  C   . GLN A 1 178 ? 20.204  4.540   67.323  1.00 25.19  ? 178 GLN A C   1 
ATOM   1366 O  O   . GLN A 1 178 ? 21.256  4.496   67.967  1.00 19.41  ? 178 GLN A O   1 
ATOM   1367 C  CB  . GLN A 1 178 ? 20.111  6.602   65.903  1.00 25.46  ? 178 GLN A CB  1 
ATOM   1368 C  CG  . GLN A 1 178 ? 21.259  7.284   66.632  1.00 34.06  ? 178 GLN A CG  1 
ATOM   1369 C  CD  . GLN A 1 178 ? 22.404  7.566   65.685  1.00 46.15  ? 178 GLN A CD  1 
ATOM   1370 O  OE1 . GLN A 1 178 ? 23.518  7.053   65.863  1.00 46.40  ? 178 GLN A OE1 1 
ATOM   1371 N  NE2 . GLN A 1 178 ? 22.121  8.351   64.633  1.00 49.32  ? 178 GLN A NE2 1 
ATOM   1372 N  N   . TRP A 1 179 ? 19.044  4.130   67.845  1.00 29.35  ? 179 TRP A N   1 
ATOM   1373 C  CA  . TRP A 1 179 ? 19.043  3.438   69.128  1.00 19.67  ? 179 TRP A CA  1 
ATOM   1374 C  C   . TRP A 1 179 ? 19.628  2.038   68.997  1.00 21.12  ? 179 TRP A C   1 
ATOM   1375 O  O   . TRP A 1 179 ? 20.415  1.608   69.850  1.00 24.87  ? 179 TRP A O   1 
ATOM   1376 C  CB  . TRP A 1 179 ? 17.635  3.364   69.693  1.00 18.02  ? 179 TRP A CB  1 
ATOM   1377 C  CG  . TRP A 1 179 ? 17.597  2.869   71.114  1.00 18.44  ? 179 TRP A CG  1 
ATOM   1378 C  CD1 . TRP A 1 179 ? 17.518  3.632   72.231  1.00 18.82  ? 179 TRP A CD1 1 
ATOM   1379 C  CD2 . TRP A 1 179 ? 17.627  1.505   71.560  1.00 23.80  ? 179 TRP A CD2 1 
ATOM   1380 N  NE1 . TRP A 1 179 ? 17.498  2.836   73.351  1.00 36.59  ? 179 TRP A NE1 1 
ATOM   1381 C  CE2 . TRP A 1 179 ? 17.557  1.525   72.964  1.00 31.38  ? 179 TRP A CE2 1 
ATOM   1382 C  CE3 . TRP A 1 179 ? 17.684  0.271   70.907  1.00 23.29  ? 179 TRP A CE3 1 
ATOM   1383 C  CZ2 . TRP A 1 179 ? 17.555  0.359   73.731  1.00 30.65  ? 179 TRP A CZ2 1 
ATOM   1384 C  CZ3 . TRP A 1 179 ? 17.673  -0.887  71.665  1.00 18.73  ? 179 TRP A CZ3 1 
ATOM   1385 C  CH2 . TRP A 1 179 ? 17.614  -0.836  73.058  1.00 26.91  ? 179 TRP A CH2 1 
ATOM   1386 N  N   . VAL A 1 180 ? 19.249  1.305   67.946  1.00 24.06  ? 180 VAL A N   1 
ATOM   1387 C  CA  . VAL A 1 180 ? 19.868  0.005   67.702  1.00 34.81  ? 180 VAL A CA  1 
ATOM   1388 C  C   . VAL A 1 180 ? 21.382  0.149   67.595  1.00 34.59  ? 180 VAL A C   1 
ATOM   1389 O  O   . VAL A 1 180 ? 22.142  -0.690  68.096  1.00 30.21  ? 180 VAL A O   1 
ATOM   1390 C  CB  . VAL A 1 180 ? 19.274  -0.645  66.440  1.00 35.69  ? 180 VAL A CB  1 
ATOM   1391 C  CG1 . VAL A 1 180 ? 20.158  -1.829  65.989  1.00 35.00  ? 180 VAL A CG1 1 
ATOM   1392 C  CG2 . VAL A 1 180 ? 17.822  -1.087  66.687  1.00 22.84  ? 180 VAL A CG2 1 
ATOM   1393 N  N   . HIS A 1 181 ? 21.840  1.234   66.966  1.00 31.41  ? 181 HIS A N   1 
ATOM   1394 C  CA  . HIS A 1 181 ? 23.269  1.430   66.755  1.00 36.68  ? 181 HIS A CA  1 
ATOM   1395 C  C   . HIS A 1 181 ? 24.015  1.550   68.071  1.00 43.69  ? 181 HIS A C   1 
ATOM   1396 O  O   . HIS A 1 181 ? 25.168  1.114   68.172  1.00 47.78  ? 181 HIS A O   1 
ATOM   1397 C  CB  . HIS A 1 181 ? 23.497  2.677   65.899  1.00 39.36  ? 181 HIS A CB  1 
ATOM   1398 C  CG  . HIS A 1 181 ? 24.918  2.874   65.472  1.00 36.29  ? 181 HIS A CG  1 
ATOM   1399 N  ND1 . HIS A 1 181 ? 25.740  3.828   66.035  1.00 37.58  ? 181 HIS A ND1 1 
ATOM   1400 C  CD2 . HIS A 1 181 ? 25.656  2.256   64.519  1.00 39.12  ? 181 HIS A CD2 1 
ATOM   1401 C  CE1 . HIS A 1 181 ? 26.927  3.781   65.455  1.00 39.69  ? 181 HIS A CE1 1 
ATOM   1402 N  NE2 . HIS A 1 181 ? 26.902  2.838   64.529  1.00 40.69  ? 181 HIS A NE2 1 
ATOM   1403 N  N   . ASP A 1 182 ? 23.371  2.114   69.092  1.00 40.19  ? 182 ASP A N   1 
ATOM   1404 C  CA  . ASP A 1 182 ? 24.039  2.391   70.353  1.00 34.21  ? 182 ASP A CA  1 
ATOM   1405 C  C   . ASP A 1 182 ? 23.736  1.382   71.451  1.00 35.05  ? 182 ASP A C   1 
ATOM   1406 O  O   . ASP A 1 182 ? 24.378  1.435   72.500  1.00 52.64  ? 182 ASP A O   1 
ATOM   1407 C  CB  . ASP A 1 182 ? 23.667  3.789   70.860  1.00 34.03  ? 182 ASP A CB  1 
ATOM   1408 C  CG  . ASP A 1 182 ? 23.867  4.875   69.814  1.00 39.40  ? 182 ASP A CG  1 
ATOM   1409 O  OD1 . ASP A 1 182 ? 24.724  4.714   68.916  1.00 34.01  ? 182 ASP A OD1 1 
ATOM   1410 O  OD2 . ASP A 1 182 ? 23.169  5.912   69.907  1.00 49.53  ? 182 ASP A OD2 1 
ATOM   1411 N  N   . ASN A 1 183 ? 22.782  0.476   71.264  1.00 28.00  ? 183 ASN A N   1 
ATOM   1412 C  CA  . ASN A 1 183 ? 22.416  -0.413  72.353  1.00 20.62  ? 183 ASN A CA  1 
ATOM   1413 C  C   . ASN A 1 183 ? 22.275  -1.881  71.982  1.00 36.76  ? 183 ASN A C   1 
ATOM   1414 O  O   . ASN A 1 183 ? 22.350  -2.722  72.884  1.00 47.26  ? 183 ASN A O   1 
ATOM   1415 C  CB  . ASN A 1 183 ? 21.121  0.069   73.014  1.00 20.32  ? 183 ASN A CB  1 
ATOM   1416 C  CG  . ASN A 1 183 ? 21.196  1.531   73.426  1.00 29.07  ? 183 ASN A CG  1 
ATOM   1417 O  OD1 . ASN A 1 183 ? 21.629  1.841   74.535  1.00 28.37  ? 183 ASN A OD1 1 
ATOM   1418 N  ND2 . ASN A 1 183 ? 20.751  2.434   72.549  1.00 22.49  ? 183 ASN A ND2 1 
ATOM   1419 N  N   . ILE A 1 184 ? 22.108  -2.231  70.707  1.00 33.16  ? 184 ILE A N   1 
ATOM   1420 C  CA  . ILE A 1 184 ? 21.958  -3.642  70.363  1.00 32.15  ? 184 ILE A CA  1 
ATOM   1421 C  C   . ILE A 1 184 ? 23.141  -4.456  70.874  1.00 26.70  ? 184 ILE A C   1 
ATOM   1422 O  O   . ILE A 1 184 ? 22.999  -5.644  71.181  1.00 21.08  ? 184 ILE A O   1 
ATOM   1423 C  CB  . ILE A 1 184 ? 21.767  -3.805  68.835  1.00 34.63  ? 184 ILE A CB  1 
ATOM   1424 C  CG1 . ILE A 1 184 ? 20.895  -5.029  68.534  1.00 31.23  ? 184 ILE A CG1 1 
ATOM   1425 C  CG2 . ILE A 1 184 ? 23.105  -3.930  68.120  1.00 19.96  ? 184 ILE A CG2 1 
ATOM   1426 C  CD1 . ILE A 1 184 ? 19.542  -5.006  69.256  1.00 27.18  ? 184 ILE A CD1 1 
ATOM   1427 N  N   . GLN A 1 185 ? 24.320  -3.835  70.981  1.00 34.89  ? 185 GLN A N   1 
ATOM   1428 C  CA  . GLN A 1 185 ? 25.491  -4.558  71.463  1.00 44.66  ? 185 GLN A CA  1 
ATOM   1429 C  C   . GLN A 1 185 ? 25.276  -5.065  72.882  1.00 42.97  ? 185 GLN A C   1 
ATOM   1430 O  O   . GLN A 1 185 ? 25.844  -6.091  73.272  1.00 42.84  ? 185 GLN A O   1 
ATOM   1431 C  CB  . GLN A 1 185 ? 26.734  -3.666  71.391  1.00 48.47  ? 185 GLN A CB  1 
ATOM   1432 C  CG  . GLN A 1 185 ? 26.780  -2.555  72.439  1.00 47.10  ? 185 GLN A CG  1 
ATOM   1433 C  CD  . GLN A 1 185 ? 27.928  -1.580  72.221  1.00 48.06  ? 185 GLN A CD  1 
ATOM   1434 O  OE1 . GLN A 1 185 ? 28.068  -0.988  71.142  1.00 40.88  ? 185 GLN A OE1 1 
ATOM   1435 N  NE2 . GLN A 1 185 ? 28.759  -1.409  73.245  1.00 49.23  ? 185 GLN A NE2 1 
ATOM   1436 N  N   . PHE A 1 186 ? 24.443  -4.375  73.657  1.00 36.22  ? 186 PHE A N   1 
ATOM   1437 C  CA  . PHE A 1 186 ? 24.111  -4.823  74.997  1.00 31.64  ? 186 PHE A CA  1 
ATOM   1438 C  C   . PHE A 1 186 ? 23.107  -5.973  74.992  1.00 37.03  ? 186 PHE A C   1 
ATOM   1439 O  O   . PHE A 1 186 ? 22.809  -6.541  76.045  1.00 42.79  ? 186 PHE A O   1 
ATOM   1440 C  CB  . PHE A 1 186 ? 23.612  -3.622  75.807  1.00 22.73  ? 186 PHE A CB  1 
ATOM   1441 C  CG  . PHE A 1 186 ? 24.557  -2.450  75.780  1.00 29.26  ? 186 PHE A CG  1 
ATOM   1442 C  CD1 . PHE A 1 186 ? 25.818  -2.550  76.368  1.00 24.01  ? 186 PHE A CD1 1 
ATOM   1443 C  CD2 . PHE A 1 186 ? 24.194  -1.246  75.196  1.00 31.73  ? 186 PHE A CD2 1 
ATOM   1444 C  CE1 . PHE A 1 186 ? 26.703  -1.488  76.352  1.00 24.18  ? 186 PHE A CE1 1 
ATOM   1445 C  CE2 . PHE A 1 186 ? 25.082  -0.170  75.186  1.00 33.16  ? 186 PHE A CE2 1 
ATOM   1446 C  CZ  . PHE A 1 186 ? 26.341  -0.298  75.760  1.00 23.69  ? 186 PHE A CZ  1 
ATOM   1447 N  N   . PHE A 1 187 ? 22.591  -6.351  73.834  1.00 48.69  ? 187 PHE A N   1 
ATOM   1448 C  CA  . PHE A 1 187 ? 21.782  -7.552  73.714  1.00 46.04  ? 187 PHE A CA  1 
ATOM   1449 C  C   . PHE A 1 187 ? 22.491  -8.613  72.893  1.00 36.31  ? 187 PHE A C   1 
ATOM   1450 O  O   . PHE A 1 187 ? 21.869  -9.598  72.493  1.00 40.82  ? 187 PHE A O   1 
ATOM   1451 C  CB  . PHE A 1 187 ? 20.424  -7.218  73.098  1.00 45.74  ? 187 PHE A CB  1 
ATOM   1452 C  CG  . PHE A 1 187 ? 19.635  -6.188  73.873  1.00 42.85  ? 187 PHE A CG  1 
ATOM   1453 C  CD1 . PHE A 1 187 ? 19.886  -4.822  73.702  1.00 39.42  ? 187 PHE A CD1 1 
ATOM   1454 C  CD2 . PHE A 1 187 ? 18.625  -6.580  74.746  1.00 30.71  ? 187 PHE A CD2 1 
ATOM   1455 C  CE1 . PHE A 1 187 ? 19.157  -3.867  74.394  1.00 27.58  ? 187 PHE A CE1 1 
ATOM   1456 C  CE2 . PHE A 1 187 ? 17.891  -5.635  75.437  1.00 25.24  ? 187 PHE A CE2 1 
ATOM   1457 C  CZ  . PHE A 1 187 ? 18.157  -4.272  75.260  1.00 25.53  ? 187 PHE A CZ  1 
ATOM   1458 N  N   . GLY A 1 188 ? 23.786  -8.443  72.655  1.00 33.08  ? 188 GLY A N   1 
ATOM   1459 C  CA  . GLY A 1 188 ? 24.487  -9.372  71.806  1.00 28.97  ? 188 GLY A CA  1 
ATOM   1460 C  C   . GLY A 1 188 ? 24.189  -9.175  70.349  1.00 28.38  ? 188 GLY A C   1 
ATOM   1461 O  O   . GLY A 1 188 ? 24.405  -10.090 69.547  1.00 23.81  ? 188 GLY A O   1 
ATOM   1462 N  N   . GLY A 1 189 ? 23.665  -8.009  69.984  1.00 31.48  ? 189 GLY A N   1 
ATOM   1463 C  CA  . GLY A 1 189 ? 23.563  -7.634  68.589  1.00 42.19  ? 189 GLY A CA  1 
ATOM   1464 C  C   . GLY A 1 189 ? 24.877  -7.038  68.107  1.00 43.95  ? 189 GLY A C   1 
ATOM   1465 O  O   . GLY A 1 189 ? 25.553  -6.315  68.838  1.00 47.43  ? 189 GLY A O   1 
ATOM   1466 N  N   . ASP A 1 190 ? 25.243  -7.376  66.871  1.00 40.65  ? 190 ASP A N   1 
ATOM   1467 C  CA  . ASP A 1 190 ? 26.397  -6.771  66.217  1.00 34.52  ? 190 ASP A CA  1 
ATOM   1468 C  C   . ASP A 1 190 ? 25.932  -5.511  65.495  1.00 26.78  ? 190 ASP A C   1 
ATOM   1469 O  O   . ASP A 1 190 ? 25.256  -5.620  64.463  1.00 27.96  ? 190 ASP A O   1 
ATOM   1470 C  CB  . ASP A 1 190 ? 27.028  -7.752  65.240  1.00 39.54  ? 190 ASP A CB  1 
ATOM   1471 C  CG  . ASP A 1 190 ? 28.255  -7.187  64.549  1.00 63.60  ? 190 ASP A CG  1 
ATOM   1472 O  OD1 . ASP A 1 190 ? 28.665  -6.053  64.882  1.00 68.11  ? 190 ASP A OD1 1 
ATOM   1473 O  OD2 . ASP A 1 190 ? 28.832  -7.892  63.686  1.00 73.05  ? 190 ASP A OD2 1 
ATOM   1474 N  N   . PRO A 1 191 ? 26.268  -4.310  65.969  1.00 23.02  ? 191 PRO A N   1 
ATOM   1475 C  CA  . PRO A 1 191 ? 25.763  -3.094  65.308  1.00 21.48  ? 191 PRO A CA  1 
ATOM   1476 C  C   . PRO A 1 191 ? 26.290  -2.931  63.899  1.00 35.15  ? 191 PRO A C   1 
ATOM   1477 O  O   . PRO A 1 191 ? 25.855  -2.006  63.205  1.00 38.51  ? 191 PRO A O   1 
ATOM   1478 C  CB  . PRO A 1 191 ? 26.264  -1.951  66.204  1.00 22.83  ? 191 PRO A CB  1 
ATOM   1479 C  CG  . PRO A 1 191 ? 27.173  -2.594  67.242  1.00 24.05  ? 191 PRO A CG  1 
ATOM   1480 C  CD  . PRO A 1 191 ? 27.410  -4.022  66.851  1.00 24.07  ? 191 PRO A CD  1 
ATOM   1481 N  N   . LYS A 1 192 ? 27.229  -3.780  63.474  1.00 41.33  ? 192 LYS A N   1 
ATOM   1482 C  CA  . LYS A 1 192 ? 27.790  -3.755  62.133  1.00 47.15  ? 192 LYS A CA  1 
ATOM   1483 C  C   . LYS A 1 192 ? 27.066  -4.684  61.170  1.00 48.38  ? 192 LYS A C   1 
ATOM   1484 O  O   . LYS A 1 192 ? 27.216  -4.532  59.954  1.00 55.45  ? 192 LYS A O   1 
ATOM   1485 C  CB  . LYS A 1 192 ? 29.269  -4.145  62.188  1.00 54.43  ? 192 LYS A CB  1 
ATOM   1486 C  CG  . LYS A 1 192 ? 30.068  -3.350  63.201  1.00 57.56  ? 192 LYS A CG  1 
ATOM   1487 C  CD  . LYS A 1 192 ? 31.547  -3.654  63.098  1.00 59.67  ? 192 LYS A CD  1 
ATOM   1488 C  CE  . LYS A 1 192 ? 32.340  -2.379  62.874  1.00 56.21  ? 192 LYS A CE  1 
ATOM   1489 N  NZ  . LYS A 1 192 ? 32.421  -2.012  61.436  1.00 51.46  ? 192 LYS A NZ  1 
ATOM   1490 N  N   . THR A 1 193 ? 26.299  -5.641  61.681  1.00 41.03  ? 193 THR A N   1 
ATOM   1491 C  CA  . THR A 1 193 ? 25.571  -6.574  60.834  1.00 41.94  ? 193 THR A CA  1 
ATOM   1492 C  C   . THR A 1 193 ? 24.066  -6.369  61.014  1.00 41.29  ? 193 THR A C   1 
ATOM   1493 O  O   . THR A 1 193 ? 23.344  -7.258  61.493  1.00 36.34  ? 193 THR A O   1 
ATOM   1494 C  CB  . THR A 1 193 ? 26.003  -8.002  61.168  1.00 45.68  ? 193 THR A CB  1 
ATOM   1495 O  OG1 . THR A 1 193 ? 27.377  -8.031  61.355  1.00 49.23  ? 193 THR A OG1 1 
ATOM   1496 C  CG2 . THR A 1 193 ? 25.666  -8.950  60.084  1.00 41.37  ? 193 THR A CG2 1 
ATOM   1497 N  N   . VAL A 1 194 ? 23.590  -5.186  60.636  1.00 36.12  ? 194 VAL A N   1 
ATOM   1498 C  CA  . VAL A 1 194 ? 22.195  -4.797  60.805  1.00 32.92  ? 194 VAL A CA  1 
ATOM   1499 C  C   . VAL A 1 194 ? 21.506  -4.822  59.445  1.00 38.89  ? 194 VAL A C   1 
ATOM   1500 O  O   . VAL A 1 194 ? 22.002  -4.250  58.463  1.00 30.13  ? 194 VAL A O   1 
ATOM   1501 C  CB  . VAL A 1 194 ? 22.090  -3.417  61.479  1.00 23.88  ? 194 VAL A CB  1 
ATOM   1502 C  CG1 . VAL A 1 194 ? 20.712  -2.826  61.345  1.00 17.55  ? 194 VAL A CG1 1 
ATOM   1503 C  CG2 . VAL A 1 194 ? 22.412  -3.556  62.914  1.00 22.57  ? 194 VAL A CG2 1 
ATOM   1504 N  N   . THR A 1 195 ? 20.363  -5.487  59.388  1.00 42.02  ? 195 THR A N   1 
ATOM   1505 C  CA  . THR A 1 195 ? 19.550  -5.544  58.185  1.00 30.35  ? 195 THR A CA  1 
ATOM   1506 C  C   . THR A 1 195 ? 18.178  -4.988  58.519  1.00 26.08  ? 195 THR A C   1 
ATOM   1507 O  O   . THR A 1 195 ? 17.479  -5.546  59.369  1.00 16.62  ? 195 THR A O   1 
ATOM   1508 C  CB  . THR A 1 195 ? 19.418  -6.978  57.678  1.00 27.80  ? 195 THR A CB  1 
ATOM   1509 O  OG1 . THR A 1 195 ? 20.722  -7.544  57.460  1.00 31.14  ? 195 THR A OG1 1 
ATOM   1510 C  CG2 . THR A 1 195 ? 18.643  -6.974  56.409  1.00 26.88  ? 195 THR A CG2 1 
ATOM   1511 N  N   . ILE A 1 196 ? 17.802  -3.895  57.872  1.00 33.10  ? 196 ILE A N   1 
ATOM   1512 C  CA  . ILE A 1 196 ? 16.442  -3.371  57.967  1.00 31.51  ? 196 ILE A CA  1 
ATOM   1513 C  C   . ILE A 1 196 ? 15.607  -4.023  56.880  1.00 26.11  ? 196 ILE A C   1 
ATOM   1514 O  O   . ILE A 1 196 ? 16.096  -4.299  55.775  1.00 34.84  ? 196 ILE A O   1 
ATOM   1515 C  CB  . ILE A 1 196 ? 16.425  -1.837  57.844  1.00 20.64  ? 196 ILE A CB  1 
ATOM   1516 C  CG1 . ILE A 1 196 ? 16.912  -1.413  56.467  1.00 16.71  ? 196 ILE A CG1 1 
ATOM   1517 C  CG2 . ILE A 1 196 ? 17.344  -1.236  58.884  1.00 16.43  ? 196 ILE A CG2 1 
ATOM   1518 C  CD1 . ILE A 1 196 ? 16.777  0.035   56.213  1.00 17.16  ? 196 ILE A CD1 1 
ATOM   1519 N  N   . PHE A 1 197 ? 14.351  -4.304  57.195  1.00 22.91  ? 197 PHE A N   1 
ATOM   1520 C  CA  . PHE A 1 197 ? 13.484  -4.941  56.219  1.00 31.03  ? 197 PHE A CA  1 
ATOM   1521 C  C   . PHE A 1 197 ? 12.045  -4.581  56.542  1.00 33.01  ? 197 PHE A C   1 
ATOM   1522 O  O   . PHE A 1 197 ? 11.667  -4.442  57.712  1.00 46.07  ? 197 PHE A O   1 
ATOM   1523 C  CB  . PHE A 1 197 ? 13.711  -6.464  56.155  1.00 25.46  ? 197 PHE A CB  1 
ATOM   1524 C  CG  . PHE A 1 197 ? 13.328  -7.218  57.397  1.00 28.54  ? 197 PHE A CG  1 
ATOM   1525 C  CD1 . PHE A 1 197 ? 13.933  -6.947  58.613  1.00 27.67  ? 197 PHE A CD1 1 
ATOM   1526 C  CD2 . PHE A 1 197 ? 12.440  -8.279  57.324  1.00 28.18  ? 197 PHE A CD2 1 
ATOM   1527 C  CE1 . PHE A 1 197 ? 13.597  -7.661  59.749  1.00 25.03  ? 197 PHE A CE1 1 
ATOM   1528 C  CE2 . PHE A 1 197 ? 12.114  -9.018  58.453  1.00 23.21  ? 197 PHE A CE2 1 
ATOM   1529 C  CZ  . PHE A 1 197 ? 12.688  -8.706  59.666  1.00 22.77  ? 197 PHE A CZ  1 
ATOM   1530 N  N   . GLY A 1 198 ? 11.262  -4.386  55.486  1.00 23.04  ? 198 GLY A N   1 
ATOM   1531 C  CA  . GLY A 1 198 ? 9.921   -3.858  55.641  1.00 31.17  ? 198 GLY A CA  1 
ATOM   1532 C  C   . GLY A 1 198 ? 9.049   -4.175  54.451  1.00 24.59  ? 198 GLY A C   1 
ATOM   1533 O  O   . GLY A 1 198 ? 9.532   -4.491  53.361  1.00 16.79  ? 198 GLY A O   1 
ATOM   1534 N  N   . GLU A 1 199 ? 7.750   -4.070  54.669  1.00 26.05  ? 199 GLU A N   1 
ATOM   1535 C  CA  . GLU A 1 199 ? 6.775   -4.465  53.671  1.00 23.98  ? 199 GLU A CA  1 
ATOM   1536 C  C   . GLU A 1 199 ? 5.898   -3.279  53.316  1.00 20.04  ? 199 GLU A C   1 
ATOM   1537 O  O   . GLU A 1 199 ? 5.462   -2.530  54.201  1.00 16.98  ? 199 GLU A O   1 
ATOM   1538 C  CB  . GLU A 1 199 ? 5.931   -5.630  54.180  1.00 25.34  ? 199 GLU A CB  1 
ATOM   1539 C  CG  . GLU A 1 199 ? 5.267   -6.420  53.085  1.00 39.08  ? 199 GLU A CG  1 
ATOM   1540 C  CD  . GLU A 1 199 ? 3.879   -5.907  52.786  1.00 55.01  ? 199 GLU A CD  1 
ATOM   1541 O  OE1 . GLU A 1 199 ? 3.375   -5.052  53.556  1.00 51.08  ? 199 GLU A OE1 1 
ATOM   1542 O  OE2 . GLU A 1 199 ? 3.288   -6.370  51.784  1.00 67.90  ? 199 GLU A OE2 1 
ATOM   1543 N  N   . SER A 1 200 ? 5.661   -3.111  52.010  1.00 13.97  ? 200 SER A N   1 
ATOM   1544 C  CA  . SER A 1 200 ? 4.726   -2.119  51.497  1.00 17.85  ? 200 SER A CA  1 
ATOM   1545 C  C   . SER A 1 200 ? 5.206   -0.720  51.862  1.00 20.36  ? 200 SER A C   1 
ATOM   1546 O  O   . SER A 1 200 ? 6.238   -0.259  51.364  1.00 16.92  ? 200 SER A O   1 
ATOM   1547 C  CB  . SER A 1 200 ? 3.313   -2.381  52.034  1.00 23.36  ? 200 SER A CB  1 
ATOM   1548 O  OG  . SER A 1 200 ? 2.393   -1.400  51.599  1.00 34.40  ? 200 SER A OG  1 
ATOM   1549 N  N   . ALA A 1 201 ? 4.485   -0.029  52.739  1.00 21.21  ? 201 ALA A N   1 
ATOM   1550 C  CA  . ALA A 1 201 ? 5.020   1.229   53.224  1.00 18.05  ? 201 ALA A CA  1 
ATOM   1551 C  C   . ALA A 1 201 ? 6.356   0.991   53.910  1.00 19.58  ? 201 ALA A C   1 
ATOM   1552 O  O   . ALA A 1 201 ? 7.312   1.745   53.706  1.00 23.54  ? 201 ALA A O   1 
ATOM   1553 C  CB  . ALA A 1 201 ? 4.018   1.902   54.158  1.00 23.74  ? 201 ALA A CB  1 
ATOM   1554 N  N   . GLY A 1 202 ? 6.458   -0.094  54.678  1.00 19.55  ? 202 GLY A N   1 
ATOM   1555 C  CA  . GLY A 1 202 ? 7.722   -0.419  55.319  1.00 27.18  ? 202 GLY A CA  1 
ATOM   1556 C  C   . GLY A 1 202 ? 8.851   -0.662  54.337  1.00 38.04  ? 202 GLY A C   1 
ATOM   1557 O  O   . GLY A 1 202 ? 10.012  -0.361  54.637  1.00 38.22  ? 202 GLY A O   1 
ATOM   1558 N  N   . GLY A 1 203 ? 8.532   -1.206  53.157  1.00 34.65  ? 203 GLY A N   1 
ATOM   1559 C  CA  . GLY A 1 203 ? 9.519   -1.445  52.118  1.00 25.08  ? 203 GLY A CA  1 
ATOM   1560 C  C   . GLY A 1 203 ? 9.925   -0.170  51.396  1.00 30.01  ? 203 GLY A C   1 
ATOM   1561 O  O   . GLY A 1 203 ? 11.116  0.066   51.122  1.00 14.32  ? 203 GLY A O   1 
ATOM   1562 N  N   . ALA A 1 204 ? 8.933   0.663   51.069  1.00 19.00  ? 204 ALA A N   1 
ATOM   1563 C  CA  . ALA A 1 204 ? 9.249   2.014   50.625  1.00 25.81  ? 204 ALA A CA  1 
ATOM   1564 C  C   . ALA A 1 204 ? 10.172  2.691   51.626  1.00 26.66  ? 204 ALA A C   1 
ATOM   1565 O  O   . ALA A 1 204 ? 11.166  3.319   51.243  1.00 24.83  ? 204 ALA A O   1 
ATOM   1566 C  CB  . ALA A 1 204 ? 7.964   2.825   50.433  1.00 29.57  ? 204 ALA A CB  1 
ATOM   1567 N  N   . SER A 1 205 ? 9.890   2.509   52.921  1.00 32.49  ? 205 SER A N   1 
ATOM   1568 C  CA  . SER A 1 205 ? 10.698  3.104   53.983  1.00 27.51  ? 205 SER A CA  1 
ATOM   1569 C  C   . SER A 1 205 ? 12.148  2.643   53.915  1.00 21.99  ? 205 SER A C   1 
ATOM   1570 O  O   . SER A 1 205 ? 13.072  3.466   53.905  1.00 22.99  ? 205 SER A O   1 
ATOM   1571 C  CB  . SER A 1 205 ? 10.092  2.763   55.334  1.00 23.23  ? 205 SER A CB  1 
ATOM   1572 O  OG  . SER A 1 205 ? 8.732   3.140   55.343  1.00 33.05  ? 205 SER A OG  1 
ATOM   1573 N  N   . VAL A 1 206 ? 12.365  1.326   53.894  1.00 14.40  ? 206 VAL A N   1 
ATOM   1574 C  CA  . VAL A 1 206 ? 13.688  0.743   53.668  1.00 14.72  ? 206 VAL A CA  1 
ATOM   1575 C  C   . VAL A 1 206 ? 14.347  1.434   52.482  1.00 25.56  ? 206 VAL A C   1 
ATOM   1576 O  O   . VAL A 1 206 ? 15.500  1.875   52.557  1.00 26.77  ? 206 VAL A O   1 
ATOM   1577 C  CB  . VAL A 1 206 ? 13.596  -0.776  53.416  1.00 27.17  ? 206 VAL A CB  1 
ATOM   1578 C  CG1 . VAL A 1 206 ? 14.864  -1.295  52.771  1.00 15.16  ? 206 VAL A CG1 1 
ATOM   1579 C  CG2 . VAL A 1 206 ? 13.293  -1.544  54.695  1.00 14.75  ? 206 VAL A CG2 1 
ATOM   1580 N  N   . GLY A 1 207 ? 13.603  1.541   51.380  1.00 18.22  ? 207 GLY A N   1 
ATOM   1581 C  CA  . GLY A 1 207 ? 14.138  2.218   50.216  1.00 20.11  ? 207 GLY A CA  1 
ATOM   1582 C  C   . GLY A 1 207 ? 14.580  3.630   50.527  1.00 25.20  ? 207 GLY A C   1 
ATOM   1583 O  O   . GLY A 1 207 ? 15.662  4.063   50.122  1.00 32.99  ? 207 GLY A O   1 
ATOM   1584 N  N   . MET A 1 208 ? 13.754  4.370   51.264  1.00 26.49  ? 208 MET A N   1 
ATOM   1585 C  CA  . MET A 1 208 ? 14.080  5.773   51.493  1.00 29.37  ? 208 MET A CA  1 
ATOM   1586 C  C   . MET A 1 208 ? 15.286  5.928   52.406  1.00 30.92  ? 208 MET A C   1 
ATOM   1587 O  O   . MET A 1 208 ? 15.985  6.942   52.336  1.00 29.04  ? 208 MET A O   1 
ATOM   1588 C  CB  . MET A 1 208 ? 12.871  6.509   52.064  1.00 20.41  ? 208 MET A CB  1 
ATOM   1589 C  CG  . MET A 1 208 ? 11.636  6.328   51.245  1.00 29.57  ? 208 MET A CG  1 
ATOM   1590 S  SD  . MET A 1 208 ? 10.155  7.087   51.932  1.00 32.43  ? 208 MET A SD  1 
ATOM   1591 C  CE  . MET A 1 208 ? 9.180   7.351   50.435  1.00 17.19  ? 208 MET A CE  1 
ATOM   1592 N  N   . HIS A 1 209 ? 15.547  4.950   53.271  1.00 29.69  ? 209 HIS A N   1 
ATOM   1593 C  CA  . HIS A 1 209 ? 16.759  5.028   54.076  1.00 33.20  ? 209 HIS A CA  1 
ATOM   1594 C  C   . HIS A 1 209 ? 17.983  4.775   53.219  1.00 31.73  ? 209 HIS A C   1 
ATOM   1595 O  O   . HIS A 1 209 ? 18.985  5.489   53.332  1.00 32.85  ? 209 HIS A O   1 
ATOM   1596 C  CB  . HIS A 1 209 ? 16.682  4.049   55.242  1.00 27.89  ? 209 HIS A CB  1 
ATOM   1597 C  CG  . HIS A 1 209 ? 15.737  4.498   56.303  1.00 21.39  ? 209 HIS A CG  1 
ATOM   1598 N  ND1 . HIS A 1 209 ? 15.798  5.760   56.855  1.00 20.65  ? 209 HIS A ND1 1 
ATOM   1599 C  CD2 . HIS A 1 209 ? 14.674  3.885   56.872  1.00 15.04  ? 209 HIS A CD2 1 
ATOM   1600 C  CE1 . HIS A 1 209 ? 14.828  5.895   57.740  1.00 26.14  ? 209 HIS A CE1 1 
ATOM   1601 N  NE2 . HIS A 1 209 ? 14.131  4.772   57.770  1.00 24.57  ? 209 HIS A NE2 1 
ATOM   1602 N  N   . ILE A 1 210 ? 17.900  3.783   52.335  1.00 23.07  ? 210 ILE A N   1 
ATOM   1603 C  CA  . ILE A 1 210 ? 18.933  3.597   51.329  1.00 16.51  ? 210 ILE A CA  1 
ATOM   1604 C  C   . ILE A 1 210 ? 19.238  4.904   50.616  1.00 19.75  ? 210 ILE A C   1 
ATOM   1605 O  O   . ILE A 1 210 ? 20.405  5.233   50.372  1.00 35.31  ? 210 ILE A O   1 
ATOM   1606 C  CB  . ILE A 1 210 ? 18.506  2.500   50.349  1.00 23.92  ? 210 ILE A CB  1 
ATOM   1607 C  CG1 . ILE A 1 210 ? 18.635  1.144   51.036  1.00 16.36  ? 210 ILE A CG1 1 
ATOM   1608 C  CG2 . ILE A 1 210 ? 19.322  2.583   49.084  1.00 31.25  ? 210 ILE A CG2 1 
ATOM   1609 C  CD1 . ILE A 1 210 ? 18.327  -0.010  50.141  1.00 26.31  ? 210 ILE A CD1 1 
ATOM   1610 N  N   . LEU A 1 211 ? 18.208  5.690   50.305  1.00 23.19  ? 211 LEU A N   1 
ATOM   1611 C  CA  . LEU A 1 211 ? 18.439  6.956   49.606  1.00 32.18  ? 211 LEU A CA  1 
ATOM   1612 C  C   . LEU A 1 211 ? 18.882  8.090   50.525  1.00 34.63  ? 211 LEU A C   1 
ATOM   1613 O  O   . LEU A 1 211 ? 19.629  8.968   50.082  1.00 41.12  ? 211 LEU A O   1 
ATOM   1614 C  CB  . LEU A 1 211 ? 17.189  7.386   48.832  1.00 24.08  ? 211 LEU A CB  1 
ATOM   1615 C  CG  . LEU A 1 211 ? 16.796  6.385   47.740  1.00 36.49  ? 211 LEU A CG  1 
ATOM   1616 C  CD1 . LEU A 1 211 ? 15.406  6.633   47.230  1.00 31.06  ? 211 LEU A CD1 1 
ATOM   1617 C  CD2 . LEU A 1 211 ? 17.788  6.433   46.578  1.00 48.45  ? 211 LEU A CD2 1 
ATOM   1618 N  N   . SER A 1 212 ? 18.487  8.088   51.779  1.00 32.52  ? 212 SER A N   1 
ATOM   1619 C  CA  . SER A 1 212 ? 18.678  9.297   52.572  1.00 34.61  ? 212 SER A CA  1 
ATOM   1620 C  C   . SER A 1 212 ? 20.081  9.346   53.151  1.00 32.27  ? 212 SER A C   1 
ATOM   1621 O  O   . SER A 1 212 ? 20.473  8.418   53.859  1.00 34.76  ? 212 SER A O   1 
ATOM   1622 C  CB  . SER A 1 212 ? 17.666  9.382   53.693  1.00 33.60  ? 212 SER A CB  1 
ATOM   1623 O  OG  . SER A 1 212 ? 17.893  10.536  54.487  1.00 38.46  ? 212 SER A OG  1 
ATOM   1624 N  N   . PRO A 1 213 ? 20.859  10.411  52.892  1.00 34.66  ? 213 PRO A N   1 
ATOM   1625 C  CA  . PRO A 1 213 ? 22.209  10.482  53.492  1.00 31.94  ? 213 PRO A CA  1 
ATOM   1626 C  C   . PRO A 1 213 ? 22.200  10.466  55.017  1.00 34.78  ? 213 PRO A C   1 
ATOM   1627 O  O   . PRO A 1 213 ? 23.119  9.900   55.622  1.00 42.48  ? 213 PRO A O   1 
ATOM   1628 C  CB  . PRO A 1 213 ? 22.807  11.778  52.927  1.00 19.47  ? 213 PRO A CB  1 
ATOM   1629 C  CG  . PRO A 1 213 ? 21.705  12.486  52.198  1.00 19.20  ? 213 PRO A CG  1 
ATOM   1630 C  CD  . PRO A 1 213 ? 20.580  11.511  51.944  1.00 27.95  ? 213 PRO A CD  1 
ATOM   1631 N  N   . GLY A 1 214 ? 21.180  11.020  55.664  1.00 31.44  ? 214 GLY A N   1 
ATOM   1632 C  CA  . GLY A 1 214 ? 21.145  10.959  57.121  1.00 36.60  ? 214 GLY A CA  1 
ATOM   1633 C  C   . GLY A 1 214 ? 20.865  9.587   57.721  1.00 30.24  ? 214 GLY A C   1 
ATOM   1634 O  O   . GLY A 1 214 ? 20.926  9.441   58.948  1.00 25.16  ? 214 GLY A O   1 
ATOM   1635 N  N   . SER A 1 215 ? 20.546  8.581   56.901  1.00 21.31  ? 215 SER A N   1 
ATOM   1636 C  CA  . SER A 1 215 ? 20.224  7.249   57.391  1.00 17.27  ? 215 SER A CA  1 
ATOM   1637 C  C   . SER A 1 215 ? 21.194  6.172   56.947  1.00 29.02  ? 215 SER A C   1 
ATOM   1638 O  O   . SER A 1 215 ? 21.118  5.049   57.465  1.00 17.36  ? 215 SER A O   1 
ATOM   1639 C  CB  . SER A 1 215 ? 18.810  6.832   56.956  1.00 30.79  ? 215 SER A CB  1 
ATOM   1640 O  OG  . SER A 1 215 ? 17.828  7.824   57.243  1.00 32.42  ? 215 SER A OG  1 
ATOM   1641 N  N   . ARG A 1 216 ? 22.118  6.484   56.032  1.00 38.35  ? 216 ARG A N   1 
ATOM   1642 C  CA  . ARG A 1 216 ? 22.883  5.444   55.349  1.00 43.47  ? 216 ARG A CA  1 
ATOM   1643 C  C   . ARG A 1 216 ? 23.843  4.714   56.274  1.00 44.89  ? 216 ARG A C   1 
ATOM   1644 O  O   . ARG A 1 216 ? 24.240  3.580   55.973  1.00 52.03  ? 216 ARG A O   1 
ATOM   1645 C  CB  . ARG A 1 216 ? 23.717  6.020   54.209  1.00 49.64  ? 216 ARG A CB  1 
ATOM   1646 C  CG  . ARG A 1 216 ? 23.097  7.059   53.340  1.00 50.12  ? 216 ARG A CG  1 
ATOM   1647 C  CD  . ARG A 1 216 ? 23.407  6.742   51.904  1.00 51.96  ? 216 ARG A CD  1 
ATOM   1648 N  NE  . ARG A 1 216 ? 23.556  7.940   51.081  1.00 53.02  ? 216 ARG A NE  1 
ATOM   1649 C  CZ  . ARG A 1 216 ? 22.698  8.279   50.134  1.00 44.94  ? 216 ARG A CZ  1 
ATOM   1650 N  NH1 . ARG A 1 216 ? 22.884  9.386   49.427  1.00 47.88  ? 216 ARG A NH1 1 
ATOM   1651 N  NH2 . ARG A 1 216 ? 21.593  7.571   49.995  1.00 51.65  ? 216 ARG A NH2 1 
ATOM   1652 N  N   . ASP A 1 217 ? 24.272  5.347   57.356  1.00 37.67  ? 217 ASP A N   1 
ATOM   1653 C  CA  . ASP A 1 217 ? 25.288  4.731   58.188  1.00 31.48  ? 217 ASP A CA  1 
ATOM   1654 C  C   . ASP A 1 217 ? 24.697  3.921   59.324  1.00 30.83  ? 217 ASP A C   1 
ATOM   1655 O  O   . ASP A 1 217 ? 25.448  3.303   60.082  1.00 19.41  ? 217 ASP A O   1 
ATOM   1656 C  CB  . ASP A 1 217 ? 26.247  5.801   58.703  1.00 37.27  ? 217 ASP A CB  1 
ATOM   1657 C  CG  . ASP A 1 217 ? 27.217  6.269   57.617  1.00 56.84  ? 217 ASP A CG  1 
ATOM   1658 O  OD1 . ASP A 1 217 ? 27.375  5.544   56.603  1.00 54.12  ? 217 ASP A OD1 1 
ATOM   1659 O  OD2 . ASP A 1 217 ? 27.815  7.358   57.767  1.00 67.40  ? 217 ASP A OD2 1 
ATOM   1660 N  N   . LEU A 1 218 ? 23.372  3.850   59.414  1.00 33.77  ? 218 LEU A N   1 
ATOM   1661 C  CA  . LEU A 1 218 ? 22.701  3.195   60.524  1.00 34.75  ? 218 LEU A CA  1 
ATOM   1662 C  C   . LEU A 1 218 ? 22.320  1.750   60.233  1.00 39.55  ? 218 LEU A C   1 
ATOM   1663 O  O   . LEU A 1 218 ? 21.641  1.123   61.059  1.00 40.67  ? 218 LEU A O   1 
ATOM   1664 C  CB  . LEU A 1 218 ? 21.464  3.993   60.910  1.00 28.57  ? 218 LEU A CB  1 
ATOM   1665 C  CG  . LEU A 1 218 ? 21.893  5.395   61.318  1.00 27.76  ? 218 LEU A CG  1 
ATOM   1666 C  CD1 . LEU A 1 218 ? 20.719  6.349   61.258  1.00 29.49  ? 218 LEU A CD1 1 
ATOM   1667 C  CD2 . LEU A 1 218 ? 22.494  5.356   62.709  1.00 20.04  ? 218 LEU A CD2 1 
ATOM   1668 N  N   . PHE A 1 219 ? 22.733  1.209   59.087  1.00 35.72  ? 219 PHE A N   1 
ATOM   1669 C  CA  . PHE A 1 219 ? 22.460  -0.186  58.766  1.00 30.73  ? 219 PHE A CA  1 
ATOM   1670 C  C   . PHE A 1 219 ? 23.435  -0.633  57.694  1.00 31.02  ? 219 PHE A C   1 
ATOM   1671 O  O   . PHE A 1 219 ? 24.157  0.176   57.108  1.00 30.39  ? 219 PHE A O   1 
ATOM   1672 C  CB  . PHE A 1 219 ? 21.021  -0.399  58.297  1.00 25.16  ? 219 PHE A CB  1 
ATOM   1673 C  CG  . PHE A 1 219 ? 20.690  0.320   57.023  1.00 21.28  ? 219 PHE A CG  1 
ATOM   1674 C  CD1 . PHE A 1 219 ? 20.411  1.676   57.031  1.00 21.49  ? 219 PHE A CD1 1 
ATOM   1675 C  CD2 . PHE A 1 219 ? 20.665  -0.359  55.816  1.00 20.17  ? 219 PHE A CD2 1 
ATOM   1676 C  CE1 . PHE A 1 219 ? 20.101  2.345   55.862  1.00 26.45  ? 219 PHE A CE1 1 
ATOM   1677 C  CE2 . PHE A 1 219 ? 20.352  0.303   54.643  1.00 20.61  ? 219 PHE A CE2 1 
ATOM   1678 C  CZ  . PHE A 1 219 ? 20.068  1.660   54.665  1.00 21.39  ? 219 PHE A CZ  1 
ATOM   1679 N  N   . ARG A 1 220 ? 23.432  -1.941  57.443  1.00 24.11  ? 220 ARG A N   1 
ATOM   1680 C  CA  . ARG A 1 220 ? 24.344  -2.579  56.508  1.00 27.10  ? 220 ARG A CA  1 
ATOM   1681 C  C   . ARG A 1 220 ? 23.656  -2.976  55.204  1.00 32.19  ? 220 ARG A C   1 
ATOM   1682 O  O   . ARG A 1 220 ? 24.133  -2.618  54.120  1.00 40.58  ? 220 ARG A O   1 
ATOM   1683 C  CB  . ARG A 1 220 ? 24.980  -3.806  57.181  1.00 31.84  ? 220 ARG A CB  1 
ATOM   1684 C  CG  . ARG A 1 220 ? 25.950  -4.615  56.312  1.00 40.70  ? 220 ARG A CG  1 
ATOM   1685 C  CD  . ARG A 1 220 ? 27.373  -4.070  56.388  1.00 54.03  ? 220 ARG A CD  1 
ATOM   1686 N  NE  . ARG A 1 220 ? 28.360  -5.001  55.831  1.00 63.62  ? 220 ARG A NE  1 
ATOM   1687 C  CZ  . ARG A 1 220 ? 29.166  -5.775  56.560  1.00 65.74  ? 220 ARG A CZ  1 
ATOM   1688 N  NH1 . ARG A 1 220 ? 29.117  -5.734  57.889  1.00 56.89  ? 220 ARG A NH1 1 
ATOM   1689 N  NH2 . ARG A 1 220 ? 30.031  -6.589  55.957  1.00 68.06  ? 220 ARG A NH2 1 
ATOM   1690 N  N   . ARG A 1 221 ? 22.545  -3.709  55.282  1.00 21.15  ? 221 ARG A N   1 
ATOM   1691 C  CA  . ARG A 1 221 ? 21.858  -4.237  54.112  1.00 24.42  ? 221 ARG A CA  1 
ATOM   1692 C  C   . ARG A 1 221 ? 20.358  -3.986  54.224  1.00 28.47  ? 221 ARG A C   1 
ATOM   1693 O  O   . ARG A 1 221 ? 19.862  -3.430  55.213  1.00 39.96  ? 221 ARG A O   1 
ATOM   1694 C  CB  . ARG A 1 221 ? 22.110  -5.737  53.932  1.00 26.50  ? 221 ARG A CB  1 
ATOM   1695 C  CG  . ARG A 1 221 ? 23.416  -6.254  54.463  1.00 22.84  ? 221 ARG A CG  1 
ATOM   1696 C  CD  . ARG A 1 221 ? 23.748  -7.541  53.752  1.00 32.17  ? 221 ARG A CD  1 
ATOM   1697 N  NE  . ARG A 1 221 ? 24.470  -8.492  54.591  1.00 46.41  ? 221 ARG A NE  1 
ATOM   1698 C  CZ  . ARG A 1 221 ? 25.783  -8.475  54.805  1.00 44.10  ? 221 ARG A CZ  1 
ATOM   1699 N  NH1 . ARG A 1 221 ? 26.520  -7.530  54.258  1.00 36.27  ? 221 ARG A NH1 1 
ATOM   1700 N  NH2 . ARG A 1 221 ? 26.343  -9.402  55.578  1.00 39.84  ? 221 ARG A NH2 1 
ATOM   1701 N  N   . ALA A 1 222 ? 19.621  -4.442  53.210  1.00 21.20  ? 222 ALA A N   1 
ATOM   1702 C  CA  . ALA A 1 222 ? 18.224  -4.053  53.076  1.00 28.28  ? 222 ALA A CA  1 
ATOM   1703 C  C   . ALA A 1 222 ? 17.426  -5.151  52.391  1.00 30.62  ? 222 ALA A C   1 
ATOM   1704 O  O   . ALA A 1 222 ? 17.847  -5.675  51.359  1.00 38.11  ? 222 ALA A O   1 
ATOM   1705 C  CB  . ALA A 1 222 ? 18.105  -2.749  52.283  1.00 16.30  ? 222 ALA A CB  1 
ATOM   1706 N  N   . ILE A 1 223 ? 16.280  -5.496  52.968  1.00 28.81  ? 223 ILE A N   1 
ATOM   1707 C  CA  . ILE A 1 223 ? 15.266  -6.292  52.292  1.00 22.52  ? 223 ILE A CA  1 
ATOM   1708 C  C   . ILE A 1 223 ? 14.062  -5.402  52.061  1.00 22.86  ? 223 ILE A C   1 
ATOM   1709 O  O   . ILE A 1 223 ? 13.756  -4.539  52.893  1.00 28.30  ? 223 ILE A O   1 
ATOM   1710 C  CB  . ILE A 1 223 ? 14.886  -7.546  53.091  1.00 18.21  ? 223 ILE A CB  1 
ATOM   1711 C  CG1 . ILE A 1 223 ? 16.078  -8.492  53.170  1.00 18.35  ? 223 ILE A CG1 1 
ATOM   1712 C  CG2 . ILE A 1 223 ? 13.664  -8.220  52.521  1.00 16.05  ? 223 ILE A CG2 1 
ATOM   1713 C  CD1 . ILE A 1 223 ? 16.488  -8.796  54.566  1.00 16.87  ? 223 ILE A CD1 1 
ATOM   1714 N  N   . LEU A 1 224 ? 13.428  -5.560  50.900  1.00 24.10  ? 224 LEU A N   1 
ATOM   1715 C  CA  . LEU A 1 224 ? 12.234  -4.803  50.542  1.00 26.18  ? 224 LEU A CA  1 
ATOM   1716 C  C   . LEU A 1 224 ? 11.220  -5.774  49.965  1.00 30.20  ? 224 LEU A C   1 
ATOM   1717 O  O   . LEU A 1 224 ? 11.520  -6.488  49.004  1.00 32.16  ? 224 LEU A O   1 
ATOM   1718 C  CB  . LEU A 1 224 ? 12.524  -3.698  49.524  1.00 22.28  ? 224 LEU A CB  1 
ATOM   1719 C  CG  . LEU A 1 224 ? 13.509  -2.561  49.759  1.00 22.25  ? 224 LEU A CG  1 
ATOM   1720 C  CD1 . LEU A 1 224 ? 14.925  -3.019  49.556  1.00 22.77  ? 224 LEU A CD1 1 
ATOM   1721 C  CD2 . LEU A 1 224 ? 13.199  -1.456  48.777  1.00 34.98  ? 224 LEU A CD2 1 
ATOM   1722 N  N   . GLN A 1 225 ? 10.024  -5.796  50.536  1.00 28.92  ? 225 GLN A N   1 
ATOM   1723 C  CA  . GLN A 1 225 ? 8.986   -6.725  50.122  1.00 25.88  ? 225 GLN A CA  1 
ATOM   1724 C  C   . GLN A 1 225 ? 7.776   -5.921  49.669  1.00 24.37  ? 225 GLN A C   1 
ATOM   1725 O  O   . GLN A 1 225 ? 7.186   -5.182  50.467  1.00 19.52  ? 225 GLN A O   1 
ATOM   1726 C  CB  . GLN A 1 225 ? 8.641   -7.670  51.274  1.00 22.89  ? 225 GLN A CB  1 
ATOM   1727 C  CG  . GLN A 1 225 ? 9.880   -8.227  51.959  1.00 25.20  ? 225 GLN A CG  1 
ATOM   1728 C  CD  . GLN A 1 225 ? 9.579   -9.038  53.214  1.00 31.78  ? 225 GLN A CD  1 
ATOM   1729 O  OE1 . GLN A 1 225 ? 10.451  -9.249  54.062  1.00 22.95  ? 225 GLN A OE1 1 
ATOM   1730 N  NE2 . GLN A 1 225 ? 8.344   -9.510  53.327  1.00 43.73  ? 225 GLN A NE2 1 
ATOM   1731 N  N   . SER A 1 226 ? 7.429   -6.043  48.385  1.00 27.86  ? 226 SER A N   1 
ATOM   1732 C  CA  . SER A 1 226 ? 6.207   -5.443  47.843  1.00 30.47  ? 226 SER A CA  1 
ATOM   1733 C  C   . SER A 1 226 ? 6.130   -3.949  48.137  1.00 27.97  ? 226 SER A C   1 
ATOM   1734 O  O   . SER A 1 226 ? 5.068   -3.419  48.459  1.00 32.42  ? 226 SER A O   1 
ATOM   1735 C  CB  . SER A 1 226 ? 4.961   -6.143  48.386  1.00 28.12  ? 226 SER A CB  1 
ATOM   1736 O  OG  . SER A 1 226 ? 4.980   -7.525  48.079  1.00 42.40  ? 226 SER A OG  1 
ATOM   1737 N  N   . GLY A 1 227 ? 7.266   -3.269  48.056  1.00 24.50  ? 227 GLY A N   1 
ATOM   1738 C  CA  . GLY A 1 227 ? 7.314   -1.839  48.307  1.00 28.68  ? 227 GLY A CA  1 
ATOM   1739 C  C   . GLY A 1 227 ? 8.683   -1.286  47.948  1.00 34.02  ? 227 GLY A C   1 
ATOM   1740 O  O   . GLY A 1 227 ? 9.683   -2.019  47.975  1.00 16.43  ? 227 GLY A O   1 
ATOM   1741 N  N   . SER A 1 228 ? 8.760   -0.009  47.598  1.00 37.98  ? 228 SER A N   1 
ATOM   1742 C  CA  . SER A 1 228 ? 9.994   0.543   47.067  1.00 29.47  ? 228 SER A CA  1 
ATOM   1743 C  C   . SER A 1 228 ? 9.894   2.059   47.131  1.00 18.79  ? 228 SER A C   1 
ATOM   1744 O  O   . SER A 1 228 ? 8.790   2.616   47.152  1.00 14.34  ? 228 SER A O   1 
ATOM   1745 C  CB  . SER A 1 228 ? 10.236  0.056   45.624  1.00 29.33  ? 228 SER A CB  1 
ATOM   1746 O  OG  . SER A 1 228 ? 9.371   0.698   44.711  1.00 29.13  ? 228 SER A OG  1 
ATOM   1747 N  N   . PRO A 1 229 ? 11.015  2.758   47.197  1.00 22.76  ? 229 PRO A N   1 
ATOM   1748 C  CA  . PRO A 1 229 ? 10.929  4.189   47.515  1.00 28.30  ? 229 PRO A CA  1 
ATOM   1749 C  C   . PRO A 1 229 ? 10.244  5.007   46.441  1.00 32.43  ? 229 PRO A C   1 
ATOM   1750 O  O   . PRO A 1 229 ? 9.758   6.100   46.749  1.00 35.88  ? 229 PRO A O   1 
ATOM   1751 C  CB  . PRO A 1 229 ? 12.400  4.609   47.690  1.00 20.17  ? 229 PRO A CB  1 
ATOM   1752 C  CG  . PRO A 1 229 ? 13.153  3.589   46.931  1.00 15.25  ? 229 PRO A CG  1 
ATOM   1753 C  CD  . PRO A 1 229 ? 12.411  2.306   47.119  1.00 15.32  ? 229 PRO A CD  1 
ATOM   1754 N  N   . ASN A 1 230 ? 10.189  4.524   45.198  1.00 37.76  ? 230 ASN A N   1 
ATOM   1755 C  CA  . ASN A 1 230 ? 9.674   5.284   44.061  1.00 35.54  ? 230 ASN A CA  1 
ATOM   1756 C  C   . ASN A 1 230 ? 8.211   4.964   43.729  1.00 38.79  ? 230 ASN A C   1 
ATOM   1757 O  O   . ASN A 1 230 ? 7.743   5.305   42.634  1.00 35.11  ? 230 ASN A O   1 
ATOM   1758 C  CB  . ASN A 1 230 ? 10.546  5.020   42.834  1.00 15.60  ? 230 ASN A CB  1 
ATOM   1759 C  CG  . ASN A 1 230 ? 10.755  3.542   42.607  1.00 29.79  ? 230 ASN A CG  1 
ATOM   1760 O  OD1 . ASN A 1 230 ? 11.130  2.819   43.539  1.00 36.19  ? 230 ASN A OD1 1 
ATOM   1761 N  ND2 . ASN A 1 230 ? 10.482  3.071   41.393  1.00 24.62  ? 230 ASN A ND2 1 
ATOM   1762 N  N   . CYS A 1 231 ? 7.480   4.312   44.632  1.00 31.82  ? 231 CYS A N   1 
ATOM   1763 C  CA  . CYS A 1 231 ? 6.097   3.984   44.327  1.00 30.60  ? 231 CYS A CA  1 
ATOM   1764 C  C   . CYS A 1 231 ? 5.269   5.262   44.193  1.00 31.31  ? 231 CYS A C   1 
ATOM   1765 O  O   . CYS A 1 231 ? 5.582   6.284   44.811  1.00 28.53  ? 231 CYS A O   1 
ATOM   1766 C  CB  . CYS A 1 231 ? 5.509   3.071   45.399  1.00 30.93  ? 231 CYS A CB  1 
ATOM   1767 S  SG  . CYS A 1 231 ? 6.216   1.394   45.390  1.00 27.11  ? 231 CYS A SG  1 
ATOM   1768 N  N   . PRO A 1 232 ? 4.224   5.243   43.358  1.00 34.22  ? 232 PRO A N   1 
ATOM   1769 C  CA  . PRO A 1 232 ? 3.429   6.465   43.155  1.00 29.84  ? 232 PRO A CA  1 
ATOM   1770 C  C   . PRO A 1 232 ? 2.644   6.875   44.385  1.00 32.38  ? 232 PRO A C   1 
ATOM   1771 O  O   . PRO A 1 232 ? 2.319   8.062   44.540  1.00 33.11  ? 232 PRO A O   1 
ATOM   1772 C  CB  . PRO A 1 232 ? 2.493   6.084   42.008  1.00 32.15  ? 232 PRO A CB  1 
ATOM   1773 C  CG  . PRO A 1 232 ? 2.326   4.590   42.167  1.00 39.86  ? 232 PRO A CG  1 
ATOM   1774 C  CD  . PRO A 1 232 ? 3.671   4.088   42.627  1.00 38.14  ? 232 PRO A CD  1 
ATOM   1775 N  N   . TRP A 1 233 ? 2.326   5.934   45.263  1.00 20.93  ? 233 TRP A N   1 
ATOM   1776 C  CA  . TRP A 1 233 ? 1.597   6.281   46.469  1.00 32.95  ? 233 TRP A CA  1 
ATOM   1777 C  C   . TRP A 1 233 ? 2.514   6.709   47.611  1.00 30.76  ? 233 TRP A C   1 
ATOM   1778 O  O   . TRP A 1 233 ? 2.030   7.221   48.626  1.00 18.13  ? 233 TRP A O   1 
ATOM   1779 C  CB  . TRP A 1 233 ? 0.731   5.096   46.892  1.00 26.79  ? 233 TRP A CB  1 
ATOM   1780 C  CG  . TRP A 1 233 ? 1.477   3.829   46.893  1.00 22.80  ? 233 TRP A CG  1 
ATOM   1781 C  CD1 . TRP A 1 233 ? 1.500   2.900   45.915  1.00 18.22  ? 233 TRP A CD1 1 
ATOM   1782 C  CD2 . TRP A 1 233 ? 2.334   3.347   47.928  1.00 30.33  ? 233 TRP A CD2 1 
ATOM   1783 N  NE1 . TRP A 1 233 ? 2.298   1.844   46.276  1.00 22.20  ? 233 TRP A NE1 1 
ATOM   1784 C  CE2 . TRP A 1 233 ? 2.827   2.095   47.511  1.00 25.60  ? 233 TRP A CE2 1 
ATOM   1785 C  CE3 . TRP A 1 233 ? 2.723   3.846   49.174  1.00 19.67  ? 233 TRP A CE3 1 
ATOM   1786 C  CZ2 . TRP A 1 233 ? 3.704   1.343   48.282  1.00 19.05  ? 233 TRP A CZ2 1 
ATOM   1787 C  CZ3 . TRP A 1 233 ? 3.578   3.088   49.946  1.00 21.93  ? 233 TRP A CZ3 1 
ATOM   1788 C  CH2 . TRP A 1 233 ? 4.061   1.853   49.500  1.00 20.48  ? 233 TRP A CH2 1 
ATOM   1789 N  N   . ALA A 1 234 ? 3.819   6.567   47.441  1.00 31.93  ? 234 ALA A N   1 
ATOM   1790 C  CA  . ALA A 1 234 ? 4.763   6.639   48.539  1.00 25.90  ? 234 ALA A CA  1 
ATOM   1791 C  C   . ALA A 1 234 ? 5.387   8.016   48.736  1.00 19.29  ? 234 ALA A C   1 
ATOM   1792 O  O   . ALA A 1 234 ? 6.172   8.183   49.675  1.00 21.59  ? 234 ALA A O   1 
ATOM   1793 C  CB  . ALA A 1 234 ? 5.860   5.587   48.344  1.00 14.01  ? 234 ALA A CB  1 
ATOM   1794 N  N   . SER A 1 235 ? 5.051   9.014   47.917  1.00 19.08  ? 235 SER A N   1 
ATOM   1795 C  CA  . SER A 1 235 ? 5.615   10.345  48.142  1.00 23.56  ? 235 SER A CA  1 
ATOM   1796 C  C   . SER A 1 235 ? 4.688   11.419  47.594  1.00 25.17  ? 235 SER A C   1 
ATOM   1797 O  O   . SER A 1 235 ? 3.698   11.133  46.915  1.00 40.78  ? 235 SER A O   1 
ATOM   1798 C  CB  . SER A 1 235 ? 7.015   10.494  47.525  1.00 24.37  ? 235 SER A CB  1 
ATOM   1799 O  OG  . SER A 1 235 ? 7.356   9.395   46.700  1.00 30.55  ? 235 SER A OG  1 
ATOM   1800 N  N   . VAL A 1 236 ? 5.024   12.668  47.909  1.00 15.25  ? 236 VAL A N   1 
ATOM   1801 C  CA  . VAL A 1 236 ? 4.304   13.825  47.401  1.00 15.59  ? 236 VAL A CA  1 
ATOM   1802 C  C   . VAL A 1 236 ? 5.293   14.974  47.306  1.00 23.06  ? 236 VAL A C   1 
ATOM   1803 O  O   . VAL A 1 236 ? 6.304   15.000  48.012  1.00 44.99  ? 236 VAL A O   1 
ATOM   1804 C  CB  . VAL A 1 236 ? 3.092   14.228  48.288  1.00 22.01  ? 236 VAL A CB  1 
ATOM   1805 C  CG1 . VAL A 1 236 ? 1.913   13.285  48.098  1.00 15.28  ? 236 VAL A CG1 1 
ATOM   1806 C  CG2 . VAL A 1 236 ? 3.477   14.294  49.747  1.00 17.24  ? 236 VAL A CG2 1 
ATOM   1807 N  N   . SER A 1 237 ? 5.010   15.918  46.415  1.00 16.48  ? 237 SER A N   1 
ATOM   1808 C  CA  . SER A 1 237 ? 5.742   17.171  46.404  1.00 25.52  ? 237 SER A CA  1 
ATOM   1809 C  C   . SER A 1 237 ? 5.435   17.960  47.670  1.00 41.30  ? 237 SER A C   1 
ATOM   1810 O  O   . SER A 1 237 ? 4.409   17.753  48.328  1.00 44.65  ? 237 SER A O   1 
ATOM   1811 C  CB  . SER A 1 237 ? 5.346   18.023  45.208  1.00 37.48  ? 237 SER A CB  1 
ATOM   1812 O  OG  . SER A 1 237 ? 4.089   18.643  45.467  1.00 43.84  ? 237 SER A OG  1 
ATOM   1813 N  N   . VAL A 1 238 ? 6.319   18.910  47.991  1.00 39.21  ? 238 VAL A N   1 
ATOM   1814 C  CA  . VAL A 1 238 ? 6.025   19.781  49.120  1.00 28.89  ? 238 VAL A CA  1 
ATOM   1815 C  C   . VAL A 1 238 ? 4.749   20.566  48.859  1.00 26.54  ? 238 VAL A C   1 
ATOM   1816 O  O   . VAL A 1 238 ? 3.951   20.789  49.778  1.00 38.13  ? 238 VAL A O   1 
ATOM   1817 C  CB  . VAL A 1 238 ? 7.214   20.714  49.437  1.00 33.07  ? 238 VAL A CB  1 
ATOM   1818 C  CG1 . VAL A 1 238 ? 8.511   19.939  49.466  1.00 45.14  ? 238 VAL A CG1 1 
ATOM   1819 C  CG2 . VAL A 1 238 ? 7.301   21.847  48.463  1.00 33.19  ? 238 VAL A CG2 1 
ATOM   1820 N  N   . ALA A 1 239 ? 4.511   20.963  47.610  1.00 26.36  ? 239 ALA A N   1 
ATOM   1821 C  CA  . ALA A 1 239 ? 3.339   21.777  47.309  1.00 34.10  ? 239 ALA A CA  1 
ATOM   1822 C  C   . ALA A 1 239 ? 2.054   21.009  47.587  1.00 38.02  ? 239 ALA A C   1 
ATOM   1823 O  O   . ALA A 1 239 ? 1.149   21.518  48.263  1.00 31.11  ? 239 ALA A O   1 
ATOM   1824 C  CB  . ALA A 1 239 ? 3.377   22.254  45.858  1.00 19.21  ? 239 ALA A CB  1 
ATOM   1825 N  N   . GLU A 1 240 ? 1.955   19.782  47.056  1.00 34.94  ? 240 GLU A N   1 
ATOM   1826 C  CA  . GLU A 1 240 ? 0.794   18.936  47.321  1.00 38.48  ? 240 GLU A CA  1 
ATOM   1827 C  C   . GLU A 1 240 ? 0.757   18.497  48.781  1.00 39.56  ? 240 GLU A C   1 
ATOM   1828 O  O   . GLU A 1 240 ? -0.324  18.375  49.372  1.00 47.40  ? 240 GLU A O   1 
ATOM   1829 C  CB  . GLU A 1 240 ? 0.800   17.717  46.387  1.00 34.45  ? 240 GLU A CB  1 
ATOM   1830 C  CG  . GLU A 1 240 ? -0.079  16.538  46.833  1.00 26.87  ? 240 GLU A CG  1 
ATOM   1831 C  CD  . GLU A 1 240 ? -1.555  16.781  46.543  1.00 35.32  ? 240 GLU A CD  1 
ATOM   1832 O  OE1 . GLU A 1 240 ? -2.425  16.038  47.078  1.00 36.34  ? 240 GLU A OE1 1 
ATOM   1833 O  OE2 . GLU A 1 240 ? -1.851  17.738  45.778  1.00 35.20  ? 240 GLU A OE2 1 
ATOM   1834 N  N   . GLY A 1 241 ? 1.919   18.279  49.389  1.00 30.35  ? 241 GLY A N   1 
ATOM   1835 C  CA  . GLY A 1 241 ? 1.930   18.036  50.817  1.00 33.45  ? 241 GLY A CA  1 
ATOM   1836 C  C   . GLY A 1 241 ? 1.358   19.207  51.590  1.00 32.88  ? 241 GLY A C   1 
ATOM   1837 O  O   . GLY A 1 241 ? 0.557   19.031  52.512  1.00 29.81  ? 241 GLY A O   1 
ATOM   1838 N  N   . ARG A 1 242 ? 1.757   20.425  51.211  1.00 29.42  ? 242 ARG A N   1 
ATOM   1839 C  CA  . ARG A 1 242 ? 1.210   21.622  51.844  1.00 27.05  ? 242 ARG A CA  1 
ATOM   1840 C  C   . ARG A 1 242 ? -0.293  21.715  51.626  1.00 26.75  ? 242 ARG A C   1 
ATOM   1841 O  O   . ARG A 1 242 ? -1.040  22.118  52.523  1.00 27.26  ? 242 ARG A O   1 
ATOM   1842 C  CB  . ARG A 1 242 ? 1.901   22.866  51.289  1.00 18.82  ? 242 ARG A CB  1 
ATOM   1843 C  CG  . ARG A 1 242 ? 1.438   24.194  51.876  1.00 19.50  ? 242 ARG A CG  1 
ATOM   1844 C  CD  . ARG A 1 242 ? 2.608   25.146  51.897  1.00 20.07  ? 242 ARG A CD  1 
ATOM   1845 N  NE  . ARG A 1 242 ? 2.468   26.142  52.948  1.00 29.44  ? 242 ARG A NE  1 
ATOM   1846 C  CZ  . ARG A 1 242 ? 3.329   26.288  53.951  1.00 41.56  ? 242 ARG A CZ  1 
ATOM   1847 N  NH1 . ARG A 1 242 ? 3.131   27.245  54.835  1.00 49.18  ? 242 ARG A NH1 1 
ATOM   1848 N  NH2 . ARG A 1 242 ? 4.366   25.470  54.069  1.00 37.14  ? 242 ARG A NH2 1 
ATOM   1849 N  N   . ARG A 1 243 ? -0.752  21.348  50.435  1.00 23.90  ? 243 ARG A N   1 
ATOM   1850 C  CA  . ARG A 1 243 ? -2.136  21.584  50.082  1.00 26.94  ? 243 ARG A CA  1 
ATOM   1851 C  C   . ARG A 1 243 ? -3.041  20.747  50.967  1.00 34.65  ? 243 ARG A C   1 
ATOM   1852 O  O   . ARG A 1 243 ? -4.037  21.247  51.516  1.00 47.10  ? 243 ARG A O   1 
ATOM   1853 C  CB  . ARG A 1 243 ? -2.360  21.256  48.608  1.00 40.83  ? 243 ARG A CB  1 
ATOM   1854 C  CG  . ARG A 1 243 ? -3.622  21.903  48.046  1.00 57.17  ? 243 ARG A CG  1 
ATOM   1855 C  CD  . ARG A 1 243 ? -4.385  21.032  47.071  1.00 51.31  ? 243 ARG A CD  1 
ATOM   1856 N  NE  . ARG A 1 243 ? -5.134  19.978  47.751  1.00 44.17  ? 243 ARG A NE  1 
ATOM   1857 C  CZ  . ARG A 1 243 ? -4.915  18.699  47.509  1.00 44.24  ? 243 ARG A CZ  1 
ATOM   1858 N  NH1 . ARG A 1 243 ? -3.991  18.394  46.621  1.00 49.52  ? 243 ARG A NH1 1 
ATOM   1859 N  NH2 . ARG A 1 243 ? -5.609  17.755  48.123  1.00 39.56  ? 243 ARG A NH2 1 
ATOM   1860 N  N   . ARG A 1 244 ? -2.679  19.466  51.155  1.00 26.83  ? 244 ARG A N   1 
ATOM   1861 C  CA  . ARG A 1 244 ? -3.497  18.596  52.002  1.00 32.44  ? 244 ARG A CA  1 
ATOM   1862 C  C   . ARG A 1 244 ? -3.353  18.973  53.463  1.00 35.66  ? 244 ARG A C   1 
ATOM   1863 O  O   . ARG A 1 244 ? -4.323  18.905  54.233  1.00 40.66  ? 244 ARG A O   1 
ATOM   1864 C  CB  . ARG A 1 244 ? -3.161  17.116  51.811  1.00 29.58  ? 244 ARG A CB  1 
ATOM   1865 C  CG  . ARG A 1 244 ? -2.657  16.693  50.427  1.00 37.28  ? 244 ARG A CG  1 
ATOM   1866 C  CD  . ARG A 1 244 ? -2.307  15.215  50.420  1.00 34.09  ? 244 ARG A CD  1 
ATOM   1867 N  NE  . ARG A 1 244 ? -2.188  14.686  49.053  1.00 24.52  ? 244 ARG A NE  1 
ATOM   1868 C  CZ  . ARG A 1 244 ? -1.795  13.449  48.745  1.00 17.42  ? 244 ARG A CZ  1 
ATOM   1869 N  NH1 . ARG A 1 244 ? -1.516  12.598  49.699  1.00 15.09  ? 244 ARG A NH1 1 
ATOM   1870 N  NH2 . ARG A 1 244 ? -1.716  13.063  47.483  1.00 23.76  ? 244 ARG A NH2 1 
ATOM   1871 N  N   . ALA A 1 245 ? -2.148  19.355  53.871  1.00 29.60  ? 245 ALA A N   1 
ATOM   1872 C  CA  . ALA A 1 245 ? -2.001  19.942  55.189  1.00 26.70  ? 245 ALA A CA  1 
ATOM   1873 C  C   . ALA A 1 245 ? -3.018  21.055  55.370  1.00 35.65  ? 245 ALA A C   1 
ATOM   1874 O  O   . ALA A 1 245 ? -3.795  21.063  56.334  1.00 48.30  ? 245 ALA A O   1 
ATOM   1875 C  CB  . ALA A 1 245 ? -0.580  20.459  55.357  1.00 33.31  ? 245 ALA A CB  1 
ATOM   1876 N  N   . VAL A 1 246 ? -3.074  21.966  54.397  1.00 27.94  ? 246 VAL A N   1 
ATOM   1877 C  CA  . VAL A 1 246 ? -3.959  23.118  54.505  1.00 30.15  ? 246 VAL A CA  1 
ATOM   1878 C  C   . VAL A 1 246 ? -5.417  22.683  54.476  1.00 19.22  ? 246 VAL A C   1 
ATOM   1879 O  O   . VAL A 1 246 ? -6.239  23.177  55.253  1.00 22.52  ? 246 VAL A O   1 
ATOM   1880 C  CB  . VAL A 1 246 ? -3.639  24.135  53.396  1.00 31.70  ? 246 VAL A CB  1 
ATOM   1881 C  CG1 . VAL A 1 246 ? -4.764  25.145  53.253  1.00 20.43  ? 246 VAL A CG1 1 
ATOM   1882 C  CG2 . VAL A 1 246 ? -2.296  24.846  53.690  1.00 19.97  ? 246 VAL A CG2 1 
ATOM   1883 N  N   . GLU A 1 247 ? -5.769  21.754  53.591  1.00 18.82  ? 247 GLU A N   1 
ATOM   1884 C  CA  . GLU A 1 247 ? -7.178  21.375  53.510  1.00 38.45  ? 247 GLU A CA  1 
ATOM   1885 C  C   . GLU A 1 247 ? -7.592  20.595  54.745  1.00 40.09  ? 247 GLU A C   1 
ATOM   1886 O  O   . GLU A 1 247 ? -8.753  20.667  55.171  1.00 40.22  ? 247 GLU A O   1 
ATOM   1887 C  CB  . GLU A 1 247 ? -7.457  20.585  52.223  1.00 18.63  ? 247 GLU A CB  1 
ATOM   1888 C  CG  . GLU A 1 247 ? -8.921  20.240  52.004  1.00 30.10  ? 247 GLU A CG  1 
ATOM   1889 C  CD  . GLU A 1 247 ? -9.698  21.401  51.397  1.00 54.45  ? 247 GLU A CD  1 
ATOM   1890 O  OE1 . GLU A 1 247 ? -9.158  22.530  51.414  1.00 66.84  ? 247 GLU A OE1 1 
ATOM   1891 O  OE2 . GLU A 1 247 ? -10.847 21.209  50.922  1.00 54.51  ? 247 GLU A OE2 1 
ATOM   1892 N  N   . LEU A 1 248 ? -6.651  19.875  55.351  1.00 38.86  ? 248 LEU A N   1 
ATOM   1893 C  CA  . LEU A 1 248 ? -6.938  19.251  56.632  1.00 38.51  ? 248 LEU A CA  1 
ATOM   1894 C  C   . LEU A 1 248 ? -7.343  20.300  57.660  1.00 32.06  ? 248 LEU A C   1 
ATOM   1895 O  O   . LEU A 1 248 ? -8.283  20.096  58.442  1.00 27.90  ? 248 LEU A O   1 
ATOM   1896 C  CB  . LEU A 1 248 ? -5.725  18.464  57.106  1.00 32.47  ? 248 LEU A CB  1 
ATOM   1897 C  CG  . LEU A 1 248 ? -5.933  17.874  58.497  1.00 28.56  ? 248 LEU A CG  1 
ATOM   1898 C  CD1 . LEU A 1 248 ? -6.745  16.621  58.350  1.00 17.17  ? 248 LEU A CD1 1 
ATOM   1899 C  CD2 . LEU A 1 248 ? -4.597  17.556  59.158  1.00 24.63  ? 248 LEU A CD2 1 
ATOM   1900 N  N   . GLY A 1 249 ? -6.663  21.444  57.653  1.00 26.70  ? 249 GLY A N   1 
ATOM   1901 C  CA  . GLY A 1 249 ? -7.130  22.560  58.449  1.00 29.02  ? 249 GLY A CA  1 
ATOM   1902 C  C   . GLY A 1 249 ? -8.530  22.999  58.070  1.00 24.60  ? 249 GLY A C   1 
ATOM   1903 O  O   . GLY A 1 249 ? -9.320  23.377  58.937  1.00 33.78  ? 249 GLY A O   1 
ATOM   1904 N  N   . ARG A 1 250 ? -8.870  22.936  56.782  1.00 22.87  ? 250 ARG A N   1 
ATOM   1905 C  CA  . ARG A 1 250 ? -10.169 23.449  56.365  1.00 23.45  ? 250 ARG A CA  1 
ATOM   1906 C  C   . ARG A 1 250 ? -11.297 22.537  56.825  1.00 27.78  ? 250 ARG A C   1 
ATOM   1907 O  O   . ARG A 1 250 ? -12.348 23.021  57.266  1.00 25.43  ? 250 ARG A O   1 
ATOM   1908 C  CB  . ARG A 1 250 ? -10.214 23.647  54.852  1.00 28.06  ? 250 ARG A CB  1 
ATOM   1909 C  CG  . ARG A 1 250 ? -10.956 24.931  54.459  1.00 34.24  ? 250 ARG A CG  1 
ATOM   1910 C  CD  . ARG A 1 250 ? -11.041 25.124  52.965  1.00 33.23  ? 250 ARG A CD  1 
ATOM   1911 N  NE  . ARG A 1 250 ? -9.811  24.706  52.306  1.00 49.74  ? 250 ARG A NE  1 
ATOM   1912 C  CZ  . ARG A 1 250 ? -8.859  25.530  51.873  1.00 49.86  ? 250 ARG A CZ  1 
ATOM   1913 N  NH1 . ARG A 1 250 ? -7.780  25.030  51.283  1.00 47.37  ? 250 ARG A NH1 1 
ATOM   1914 N  NH2 . ARG A 1 250 ? -8.981  26.844  52.021  1.00 46.70  ? 250 ARG A NH2 1 
ATOM   1915 N  N   . ASN A 1 251 ? -11.094 21.219  56.744  1.00 31.90  ? 251 ASN A N   1 
ATOM   1916 C  CA  . ASN A 1 251 ? -12.077 20.285  57.287  1.00 35.80  ? 251 ASN A CA  1 
ATOM   1917 C  C   . ASN A 1 251 ? -12.339 20.548  58.765  1.00 41.42  ? 251 ASN A C   1 
ATOM   1918 O  O   . ASN A 1 251 ? -13.492 20.536  59.211  1.00 42.92  ? 251 ASN A O   1 
ATOM   1919 C  CB  . ASN A 1 251 ? -11.608 18.844  57.087  1.00 38.74  ? 251 ASN A CB  1 
ATOM   1920 C  CG  . ASN A 1 251 ? -12.039 18.268  55.749  1.00 42.09  ? 251 ASN A CG  1 
ATOM   1921 O  OD1 . ASN A 1 251 ? -13.011 17.510  55.673  1.00 39.83  ? 251 ASN A OD1 1 
ATOM   1922 N  ND2 . ASN A 1 251 ? -11.316 18.623  54.684  1.00 42.51  ? 251 ASN A ND2 1 
ATOM   1923 N  N   . LEU A 1 252 ? -11.290 20.791  59.545  1.00 40.59  ? 252 LEU A N   1 
ATOM   1924 C  CA  . LEU A 1 252 ? -11.475 21.022  60.969  1.00 44.53  ? 252 LEU A CA  1 
ATOM   1925 C  C   . LEU A 1 252 ? -11.683 22.505  61.309  1.00 46.06  ? 252 LEU A C   1 
ATOM   1926 O  O   . LEU A 1 252 ? -11.472 22.903  62.463  1.00 41.21  ? 252 LEU A O   1 
ATOM   1927 C  CB  . LEU A 1 252 ? -10.297 20.432  61.748  1.00 42.90  ? 252 LEU A CB  1 
ATOM   1928 C  CG  . LEU A 1 252 ? -10.188 18.906  61.627  1.00 37.68  ? 252 LEU A CG  1 
ATOM   1929 C  CD1 . LEU A 1 252 ? -9.074  18.334  62.482  1.00 36.78  ? 252 LEU A CD1 1 
ATOM   1930 C  CD2 . LEU A 1 252 ? -11.501 18.248  61.975  1.00 38.27  ? 252 LEU A CD2 1 
ATOM   1931 N  N   . ASN A 1 253 ? -12.121 23.310  60.339  1.00 43.54  ? 253 ASN A N   1 
ATOM   1932 C  CA  . ASN A 1 253 ? -12.428 24.729  60.537  1.00 47.01  ? 253 ASN A CA  1 
ATOM   1933 C  C   . ASN A 1 253 ? -11.333 25.413  61.346  1.00 43.69  ? 253 ASN A C   1 
ATOM   1934 O  O   . ASN A 1 253 ? -11.569 26.040  62.378  1.00 52.42  ? 253 ASN A O   1 
ATOM   1935 C  CB  . ASN A 1 253 ? -13.800 24.919  61.192  1.00 53.01  ? 253 ASN A CB  1 
ATOM   1936 C  CG  . ASN A 1 253 ? -14.935 24.850  60.187  1.00 74.01  ? 253 ASN A CG  1 
ATOM   1937 O  OD1 . ASN A 1 253 ? -14.867 25.449  59.109  1.00 86.36  ? 253 ASN A OD1 1 
ATOM   1938 N  ND2 . ASN A 1 253 ? -15.980 24.105  60.526  1.00 78.93  ? 253 ASN A ND2 1 
ATOM   1939 N  N   . CYS A 1 254 ? -10.118 25.262  60.853  1.00 32.31  ? 254 CYS A N   1 
ATOM   1940 C  CA  . CYS A 1 254 ? -8.939  25.840  61.467  1.00 35.15  ? 254 CYS A CA  1 
ATOM   1941 C  C   . CYS A 1 254 ? -8.591  27.176  60.833  1.00 48.28  ? 254 CYS A C   1 
ATOM   1942 O  O   . CYS A 1 254 ? -8.998  27.492  59.710  1.00 57.70  ? 254 CYS A O   1 
ATOM   1943 C  CB  . CYS A 1 254 ? -7.756  24.885  61.339  1.00 39.80  ? 254 CYS A CB  1 
ATOM   1944 S  SG  . CYS A 1 254 ? -7.663  23.788  62.730  1.00 46.95  ? 254 CYS A SG  1 
ATOM   1945 N  N   . ASN A 1 255 ? -7.810  27.958  61.568  1.00 47.66  ? 255 ASN A N   1 
ATOM   1946 C  CA  . ASN A 1 255 ? -7.231  29.158  60.988  1.00 44.44  ? 255 ASN A CA  1 
ATOM   1947 C  C   . ASN A 1 255 ? -6.192  28.779  59.943  1.00 43.88  ? 255 ASN A C   1 
ATOM   1948 O  O   . ASN A 1 255 ? -5.406  27.850  60.143  1.00 45.40  ? 255 ASN A O   1 
ATOM   1949 C  CB  . ASN A 1 255 ? -6.589  30.011  62.063  1.00 44.91  ? 255 ASN A CB  1 
ATOM   1950 C  CG  . ASN A 1 255 ? -6.451  31.423  61.633  1.00 54.15  ? 255 ASN A CG  1 
ATOM   1951 O  OD1 . ASN A 1 255 ? -5.734  31.714  60.678  1.00 54.81  ? 255 ASN A OD1 1 
ATOM   1952 N  ND2 . ASN A 1 255 ? -7.130  32.326  62.329  1.00 65.05  ? 255 ASN A ND2 1 
ATOM   1953 N  N   . LEU A 1 256 ? -6.175  29.508  58.824  1.00 47.67  ? 256 LEU A N   1 
ATOM   1954 C  CA  . LEU A 1 256 ? -5.407  29.081  57.657  1.00 40.40  ? 256 LEU A CA  1 
ATOM   1955 C  C   . LEU A 1 256 ? -4.419  30.114  57.133  1.00 41.86  ? 256 LEU A C   1 
ATOM   1956 O  O   . LEU A 1 256 ? -3.851  29.897  56.055  1.00 53.04  ? 256 LEU A O   1 
ATOM   1957 C  CB  . LEU A 1 256 ? -6.342  28.671  56.511  1.00 28.85  ? 256 LEU A CB  1 
ATOM   1958 C  CG  . LEU A 1 256 ? -7.100  27.357  56.711  1.00 40.29  ? 256 LEU A CG  1 
ATOM   1959 C  CD1 . LEU A 1 256 ? -7.940  26.994  55.488  1.00 38.56  ? 256 LEU A CD1 1 
ATOM   1960 C  CD2 . LEU A 1 256 ? -6.138  26.221  57.051  1.00 45.45  ? 256 LEU A CD2 1 
ATOM   1961 N  N   . ASN A 1 257 ? -4.180  31.222  57.841  1.00 42.10  ? 257 ASN A N   1 
ATOM   1962 C  CA  . ASN A 1 257 ? -3.316  32.252  57.257  1.00 54.44  ? 257 ASN A CA  1 
ATOM   1963 C  C   . ASN A 1 257 ? -1.847  31.844  57.291  1.00 48.05  ? 257 ASN A C   1 
ATOM   1964 O  O   . ASN A 1 257 ? -1.141  31.971  56.286  1.00 50.32  ? 257 ASN A O   1 
ATOM   1965 C  CB  . ASN A 1 257 ? -3.509  33.610  57.932  1.00 63.87  ? 257 ASN A CB  1 
ATOM   1966 C  CG  . ASN A 1 257 ? -4.941  33.860  58.351  1.00 71.93  ? 257 ASN A CG  1 
ATOM   1967 O  OD1 . ASN A 1 257 ? -5.241  33.966  59.539  1.00 73.45  ? 257 ASN A OD1 1 
ATOM   1968 N  ND2 . ASN A 1 257 ? -5.847  33.910  57.374  1.00 74.02  ? 257 ASN A ND2 1 
ATOM   1969 N  N   . SER A 1 258 ? -1.361  31.346  58.423  1.00 41.66  ? 258 SER A N   1 
ATOM   1970 C  CA  . SER A 1 258 ? 0.031   30.929  58.481  1.00 48.04  ? 258 SER A CA  1 
ATOM   1971 C  C   . SER A 1 258 ? 0.149   29.561  59.127  1.00 42.09  ? 258 SER A C   1 
ATOM   1972 O  O   . SER A 1 258 ? -0.771  29.086  59.796  1.00 41.38  ? 258 SER A O   1 
ATOM   1973 C  CB  . SER A 1 258 ? 0.905   31.937  59.238  1.00 53.81  ? 258 SER A CB  1 
ATOM   1974 O  OG  . SER A 1 258 ? 0.416   32.149  60.546  1.00 51.82  ? 258 SER A OG  1 
ATOM   1975 N  N   . ASP A 1 259 ? 1.314   28.941  58.909  1.00 36.62  ? 259 ASP A N   1 
ATOM   1976 C  CA  . ASP A 1 259 ? 1.591   27.631  59.485  1.00 36.29  ? 259 ASP A CA  1 
ATOM   1977 C  C   . ASP A 1 259 ? 1.515   27.672  60.991  1.00 42.72  ? 259 ASP A C   1 
ATOM   1978 O  O   . ASP A 1 259 ? 1.045   26.722  61.629  1.00 55.04  ? 259 ASP A O   1 
ATOM   1979 C  CB  . ASP A 1 259 ? 2.978   27.161  59.083  1.00 42.21  ? 259 ASP A CB  1 
ATOM   1980 C  CG  . ASP A 1 259 ? 3.201   27.259  57.622  1.00 46.19  ? 259 ASP A CG  1 
ATOM   1981 O  OD1 . ASP A 1 259 ? 2.204   27.474  56.902  1.00 45.64  ? 259 ASP A OD1 1 
ATOM   1982 O  OD2 . ASP A 1 259 ? 4.362   27.115  57.178  1.00 51.64  ? 259 ASP A OD2 1 
ATOM   1983 N  N   . GLU A 1 260 ? 2.021   28.747  61.581  1.00 38.46  ? 260 GLU A N   1 
ATOM   1984 C  CA  . GLU A 1 260 ? 1.996   28.840  63.027  1.00 39.89  ? 260 GLU A CA  1 
ATOM   1985 C  C   . GLU A 1 260 ? 0.566   28.766  63.538  1.00 44.12  ? 260 GLU A C   1 
ATOM   1986 O  O   . GLU A 1 260 ? 0.239   27.914  64.374  1.00 47.86  ? 260 GLU A O   1 
ATOM   1987 C  CB  . GLU A 1 260 ? 2.705   30.113  63.475  1.00 37.60  ? 260 GLU A CB  1 
ATOM   1988 C  CG  . GLU A 1 260 ? 4.172   29.852  63.747  1.00 50.25  ? 260 GLU A CG  1 
ATOM   1989 C  CD  . GLU A 1 260 ? 4.383   28.742  64.777  1.00 65.08  ? 260 GLU A CD  1 
ATOM   1990 O  OE1 . GLU A 1 260 ? 3.664   28.728  65.811  1.00 67.09  ? 260 GLU A OE1 1 
ATOM   1991 O  OE2 . GLU A 1 260 ? 5.259   27.874  64.539  1.00 67.96  ? 260 GLU A OE2 1 
ATOM   1992 N  N   . GLU A 1 261 ? -0.318  29.607  62.996  1.00 40.34  ? 261 GLU A N   1 
ATOM   1993 C  CA  . GLU A 1 261 ? -1.720  29.524  63.382  1.00 44.98  ? 261 GLU A CA  1 
ATOM   1994 C  C   . GLU A 1 261 ? -2.310  28.180  62.992  1.00 38.55  ? 261 GLU A C   1 
ATOM   1995 O  O   . GLU A 1 261 ? -2.988  27.536  63.800  1.00 35.94  ? 261 GLU A O   1 
ATOM   1996 C  CB  . GLU A 1 261 ? -2.515  30.669  62.757  1.00 58.46  ? 261 GLU A CB  1 
ATOM   1997 C  CG  . GLU A 1 261 ? -1.723  31.942  62.591  1.00 76.36  ? 261 GLU A CG  1 
ATOM   1998 C  CD  . GLU A 1 261 ? -2.565  33.127  62.126  1.00 84.70  ? 261 GLU A CD  1 
ATOM   1999 O  OE1 . GLU A 1 261 ? -3.783  33.155  62.411  1.00 81.45  ? 261 GLU A OE1 1 
ATOM   2000 O  OE2 . GLU A 1 261 ? -2.020  34.015  61.422  1.00 91.14  ? 261 GLU A OE2 1 
ATOM   2001 N  N   . LEU A 1 262 ? -2.028  27.720  61.773  1.00 34.81  ? 262 LEU A N   1 
ATOM   2002 C  CA  . LEU A 1 262 ? -2.589  26.450  61.324  1.00 25.22  ? 262 LEU A CA  1 
ATOM   2003 C  C   . LEU A 1 262 ? -2.206  25.324  62.272  1.00 27.51  ? 262 LEU A C   1 
ATOM   2004 O  O   . LEU A 1 262 ? -3.070  24.577  62.749  1.00 28.84  ? 262 LEU A O   1 
ATOM   2005 C  CB  . LEU A 1 262 ? -2.127  26.137  59.905  1.00 21.06  ? 262 LEU A CB  1 
ATOM   2006 C  CG  . LEU A 1 262 ? -2.365  24.701  59.445  1.00 25.55  ? 262 LEU A CG  1 
ATOM   2007 C  CD1 . LEU A 1 262 ? -3.808  24.286  59.674  1.00 20.17  ? 262 LEU A CD1 1 
ATOM   2008 C  CD2 . LEU A 1 262 ? -2.016  24.571  57.980  1.00 34.67  ? 262 LEU A CD2 1 
ATOM   2009 N  N   . ILE A 1 263 ? -0.910  25.201  62.575  1.00 27.77  ? 263 ILE A N   1 
ATOM   2010 C  CA  . ILE A 1 263 ? -0.448  24.098  63.408  1.00 26.18  ? 263 ILE A CA  1 
ATOM   2011 C  C   . ILE A 1 263 ? -0.984  24.225  64.828  1.00 40.19  ? 263 ILE A C   1 
ATOM   2012 O  O   . ILE A 1 263 ? -1.429  23.234  65.425  1.00 39.58  ? 263 ILE A O   1 
ATOM   2013 C  CB  . ILE A 1 263 ? 1.080   24.029  63.389  1.00 21.73  ? 263 ILE A CB  1 
ATOM   2014 C  CG1 . ILE A 1 263 ? 1.554   23.610  62.011  1.00 24.34  ? 263 ILE A CG1 1 
ATOM   2015 C  CG2 . ILE A 1 263 ? 1.580   23.040  64.439  1.00 26.30  ? 263 ILE A CG2 1 
ATOM   2016 C  CD1 . ILE A 1 263 ? 3.051   23.774  61.850  1.00 37.27  ? 263 ILE A CD1 1 
ATOM   2017 N  N   . HIS A 1 264 ? -0.955  25.437  65.396  1.00 39.45  ? 264 HIS A N   1 
ATOM   2018 C  CA  . HIS A 1 264 ? -1.486  25.600  66.742  1.00 35.35  ? 264 HIS A CA  1 
ATOM   2019 C  C   . HIS A 1 264 ? -2.951  25.194  66.792  1.00 42.23  ? 264 HIS A C   1 
ATOM   2020 O  O   . HIS A 1 264 ? -3.401  24.588  67.772  1.00 50.66  ? 264 HIS A O   1 
ATOM   2021 C  CB  . HIS A 1 264 ? -1.297  27.032  67.233  1.00 41.23  ? 264 HIS A CB  1 
ATOM   2022 C  CG  . HIS A 1 264 ? -1.842  27.268  68.609  1.00 52.17  ? 264 HIS A CG  1 
ATOM   2023 N  ND1 . HIS A 1 264 ? -2.661  28.334  68.914  1.00 57.71  ? 264 HIS A ND1 1 
ATOM   2024 C  CD2 . HIS A 1 264 ? -1.710  26.555  69.752  1.00 57.73  ? 264 HIS A CD2 1 
ATOM   2025 C  CE1 . HIS A 1 264 ? -3.002  28.274  70.189  1.00 62.45  ? 264 HIS A CE1 1 
ATOM   2026 N  NE2 . HIS A 1 264 ? -2.436  27.205  70.720  1.00 64.55  ? 264 HIS A NE2 1 
ATOM   2027 N  N   . CYS A 1 265 ? -3.700  25.478  65.723  1.00 39.77  ? 265 CYS A N   1 
ATOM   2028 C  CA  . CYS A 1 265 ? -5.073  24.991  65.632  1.00 43.68  ? 265 CYS A CA  1 
ATOM   2029 C  C   . CYS A 1 265 ? -5.114  23.467  65.585  1.00 40.92  ? 265 CYS A C   1 
ATOM   2030 O  O   . CYS A 1 265 ? -5.915  22.839  66.286  1.00 38.00  ? 265 CYS A O   1 
ATOM   2031 C  CB  . CYS A 1 265 ? -5.771  25.580  64.406  1.00 57.92  ? 265 CYS A CB  1 
ATOM   2032 S  SG  . CYS A 1 265 ? -7.521  25.115  64.291  1.00 77.74  ? 265 CYS A SG  1 
ATOM   2033 N  N   . LEU A 1 266 ? -4.254  22.851  64.764  1.00 41.10  ? 266 LEU A N   1 
ATOM   2034 C  CA  . LEU A 1 266 ? -4.283  21.395  64.622  1.00 47.82  ? 266 LEU A CA  1 
ATOM   2035 C  C   . LEU A 1 266 ? -3.719  20.661  65.835  1.00 55.05  ? 266 LEU A C   1 
ATOM   2036 O  O   . LEU A 1 266 ? -3.986  19.464  65.999  1.00 58.01  ? 266 LEU A O   1 
ATOM   2037 C  CB  . LEU A 1 266 ? -3.522  20.957  63.371  1.00 45.16  ? 266 LEU A CB  1 
ATOM   2038 C  CG  . LEU A 1 266 ? -4.374  20.862  62.105  1.00 55.48  ? 266 LEU A CG  1 
ATOM   2039 C  CD1 . LEU A 1 266 ? -3.503  20.605  60.888  1.00 48.21  ? 266 LEU A CD1 1 
ATOM   2040 C  CD2 . LEU A 1 266 ? -5.465  19.786  62.236  1.00 64.08  ? 266 LEU A CD2 1 
ATOM   2041 N  N   . ARG A 1 267 ? -2.945  21.335  66.680  1.00 50.82  ? 267 ARG A N   1 
ATOM   2042 C  CA  . ARG A 1 267 ? -2.385  20.673  67.845  1.00 40.04  ? 267 ARG A CA  1 
ATOM   2043 C  C   . ARG A 1 267 ? -3.360  20.600  69.008  1.00 44.33  ? 267 ARG A C   1 
ATOM   2044 O  O   . ARG A 1 267 ? -3.096  19.871  69.971  1.00 45.53  ? 267 ARG A O   1 
ATOM   2045 C  CB  . ARG A 1 267 ? -1.121  21.393  68.292  1.00 30.29  ? 267 ARG A CB  1 
ATOM   2046 C  CG  . ARG A 1 267 ? 0.148   20.910  67.630  1.00 20.63  ? 267 ARG A CG  1 
ATOM   2047 C  CD  . ARG A 1 267 ? 1.311   21.807  68.030  1.00 29.14  ? 267 ARG A CD  1 
ATOM   2048 N  NE  . ARG A 1 267 ? 2.557   21.425  67.380  1.00 41.91  ? 267 ARG A NE  1 
ATOM   2049 C  CZ  . ARG A 1 267 ? 3.611   22.224  67.278  1.00 48.42  ? 267 ARG A CZ  1 
ATOM   2050 N  NH1 . ARG A 1 267 ? 3.562   23.449  67.788  1.00 54.44  ? 267 ARG A NH1 1 
ATOM   2051 N  NH2 . ARG A 1 267 ? 4.703   21.806  66.652  1.00 44.22  ? 267 ARG A NH2 1 
ATOM   2052 N  N   . GLU A 1 268 ? -4.464  21.341  68.952  1.00 42.79  ? 268 GLU A N   1 
ATOM   2053 C  CA  . GLU A 1 268 ? -5.452  21.293  70.019  1.00 52.96  ? 268 GLU A CA  1 
ATOM   2054 C  C   . GLU A 1 268 ? -6.552  20.273  69.752  1.00 45.04  ? 268 GLU A C   1 
ATOM   2055 O  O   . GLU A 1 268 ? -7.331  19.961  70.660  1.00 46.27  ? 268 GLU A O   1 
ATOM   2056 C  CB  . GLU A 1 268 ? -6.069  22.682  70.234  1.00 68.16  ? 268 GLU A CB  1 
ATOM   2057 C  CG  . GLU A 1 268 ? -5.052  23.822  70.342  1.00 79.93  ? 268 GLU A CG  1 
ATOM   2058 C  CD  . GLU A 1 268 ? -4.590  24.095  71.773  1.00 91.02  ? 268 GLU A CD  1 
ATOM   2059 O  OE1 . GLU A 1 268 ? -5.059  23.407  72.709  1.00 91.74  ? 268 GLU A OE1 1 
ATOM   2060 O  OE2 . GLU A 1 268 ? -3.759  25.011  71.960  1.00 95.55  ? 268 GLU A OE2 1 
ATOM   2061 N  N   . LYS A 1 269 ? -6.624  19.745  68.540  1.00 36.49  ? 269 LYS A N   1 
ATOM   2062 C  CA  . LYS A 1 269 ? -7.632  18.755  68.216  1.00 28.82  ? 269 LYS A CA  1 
ATOM   2063 C  C   . LYS A 1 269 ? -7.274  17.423  68.855  1.00 31.16  ? 269 LYS A C   1 
ATOM   2064 O  O   . LYS A 1 269 ? -6.099  17.035  68.915  1.00 28.60  ? 269 LYS A O   1 
ATOM   2065 C  CB  . LYS A 1 269 ? -7.745  18.598  66.701  1.00 30.69  ? 269 LYS A CB  1 
ATOM   2066 C  CG  . LYS A 1 269 ? -7.912  19.890  65.889  1.00 36.59  ? 269 LYS A CG  1 
ATOM   2067 C  CD  . LYS A 1 269 ? -9.384  20.122  65.580  1.00 51.78  ? 269 LYS A CD  1 
ATOM   2068 C  CE  . LYS A 1 269 ? -9.742  21.607  65.559  1.00 60.16  ? 269 LYS A CE  1 
ATOM   2069 N  NZ  . LYS A 1 269 ? -10.078 22.142  66.923  1.00 59.28  ? 269 LYS A NZ  1 
ATOM   2070 N  N   . LYS A 1 270 ? -8.296  16.725  69.346  1.00 39.01  ? 270 LYS A N   1 
ATOM   2071 C  CA  . LYS A 1 270 ? -8.098  15.345  69.756  1.00 48.42  ? 270 LYS A CA  1 
ATOM   2072 C  C   . LYS A 1 270 ? -7.615  14.522  68.557  1.00 47.49  ? 270 LYS A C   1 
ATOM   2073 O  O   . LYS A 1 270 ? -7.972  14.807  67.408  1.00 49.99  ? 270 LYS A O   1 
ATOM   2074 C  CB  . LYS A 1 270 ? -9.389  14.767  70.339  1.00 50.60  ? 270 LYS A CB  1 
ATOM   2075 C  CG  . LYS A 1 270 ? -9.755  15.345  71.704  1.00 61.52  ? 270 LYS A CG  1 
ATOM   2076 C  CD  . LYS A 1 270 ? -11.265 15.384  71.928  1.00 67.75  ? 270 LYS A CD  1 
ATOM   2077 C  CE  . LYS A 1 270 ? -11.612 16.099  73.229  1.00 66.83  ? 270 LYS A CE  1 
ATOM   2078 N  NZ  . LYS A 1 270 ? -13.079 16.345  73.360  1.00 66.63  ? 270 LYS A NZ  1 
ATOM   2079 N  N   . PRO A 1 271 ? -6.778  13.514  68.796  1.00 31.41  ? 271 PRO A N   1 
ATOM   2080 C  CA  . PRO A 1 271 ? -6.202  12.759  67.672  1.00 31.92  ? 271 PRO A CA  1 
ATOM   2081 C  C   . PRO A 1 271 ? -7.234  12.148  66.732  1.00 38.65  ? 271 PRO A C   1 
ATOM   2082 O  O   . PRO A 1 271 ? -7.030  12.169  65.507  1.00 42.84  ? 271 PRO A O   1 
ATOM   2083 C  CB  . PRO A 1 271 ? -5.361  11.681  68.370  1.00 23.15  ? 271 PRO A CB  1 
ATOM   2084 C  CG  . PRO A 1 271 ? -5.142  12.193  69.735  1.00 31.31  ? 271 PRO A CG  1 
ATOM   2085 C  CD  . PRO A 1 271 ? -6.308  13.037  70.098  1.00 30.49  ? 271 PRO A CD  1 
ATOM   2086 N  N   . GLN A 1 272 ? -8.346  11.611  67.252  1.00 36.34  ? 272 GLN A N   1 
ATOM   2087 C  CA  . GLN A 1 272 ? -9.290  10.955  66.350  1.00 38.65  ? 272 GLN A CA  1 
ATOM   2088 C  C   . GLN A 1 272 ? -10.108 11.959  65.550  1.00 41.36  ? 272 GLN A C   1 
ATOM   2089 O  O   . GLN A 1 272 ? -10.633 11.599  64.488  1.00 55.60  ? 272 GLN A O   1 
ATOM   2090 C  CB  . GLN A 1 272 ? -10.203 9.979   67.104  1.00 24.41  ? 272 GLN A CB  1 
ATOM   2091 C  CG  . GLN A 1 272 ? -10.777 8.917   66.174  1.00 35.32  ? 272 GLN A CG  1 
ATOM   2092 C  CD  . GLN A 1 272 ? -10.033 7.597   66.260  1.00 44.95  ? 272 GLN A CD  1 
ATOM   2093 O  OE1 . GLN A 1 272 ? -9.695  7.139   67.348  1.00 48.56  ? 272 GLN A OE1 1 
ATOM   2094 N  NE2 . GLN A 1 272 ? -9.691  7.031   65.099  1.00 46.89  ? 272 GLN A NE2 1 
ATOM   2095 N  N   . GLU A 1 273 ? -10.187 13.215  65.999  1.00 27.11  ? 273 GLU A N   1 
ATOM   2096 C  CA  . GLU A 1 273 ? -10.690 14.258  65.112  1.00 33.80  ? 273 GLU A CA  1 
ATOM   2097 C  C   . GLU A 1 273 ? -9.837  14.388  63.858  1.00 40.91  ? 273 GLU A C   1 
ATOM   2098 O  O   . GLU A 1 273 ? -10.362 14.710  62.783  1.00 44.44  ? 273 GLU A O   1 
ATOM   2099 C  CB  . GLU A 1 273 ? -10.745 15.609  65.814  1.00 34.20  ? 273 GLU A CB  1 
ATOM   2100 C  CG  . GLU A 1 273 ? -11.640 15.683  67.015  1.00 43.91  ? 273 GLU A CG  1 
ATOM   2101 C  CD  . GLU A 1 273 ? -11.473 17.005  67.758  1.00 56.10  ? 273 GLU A CD  1 
ATOM   2102 O  OE1 . GLU A 1 273 ? -11.225 16.969  68.997  1.00 59.49  ? 273 GLU A OE1 1 
ATOM   2103 O  OE2 . GLU A 1 273 ? -11.593 18.078  67.104  1.00 48.90  ? 273 GLU A OE2 1 
ATOM   2104 N  N   . LEU A 1 274 ? -8.526  14.160  63.971  1.00 33.93  ? 274 LEU A N   1 
ATOM   2105 C  CA  . LEU A 1 274 ? -7.685  14.213  62.782  1.00 22.72  ? 274 LEU A CA  1 
ATOM   2106 C  C   . LEU A 1 274 ? -7.930  12.999  61.908  1.00 22.64  ? 274 LEU A C   1 
ATOM   2107 O  O   . LEU A 1 274 ? -8.189  13.126  60.705  1.00 25.98  ? 274 LEU A O   1 
ATOM   2108 C  CB  . LEU A 1 274 ? -6.217  14.310  63.171  1.00 22.11  ? 274 LEU A CB  1 
ATOM   2109 C  CG  . LEU A 1 274 ? -5.656  15.704  63.441  1.00 26.51  ? 274 LEU A CG  1 
ATOM   2110 C  CD1 . LEU A 1 274 ? -6.516  16.431  64.448  1.00 18.06  ? 274 LEU A CD1 1 
ATOM   2111 C  CD2 . LEU A 1 274 ? -4.212  15.600  63.940  1.00 25.24  ? 274 LEU A CD2 1 
ATOM   2112 N  N   . ILE A 1 275 ? -7.889  11.810  62.508  1.00 21.13  ? 275 ILE A N   1 
ATOM   2113 C  CA  . ILE A 1 275 ? -8.121  10.581  61.758  1.00 23.67  ? 275 ILE A CA  1 
ATOM   2114 C  C   . ILE A 1 275 ? -9.466  10.591  61.049  1.00 30.89  ? 275 ILE A C   1 
ATOM   2115 O  O   . ILE A 1 275 ? -9.606  10.029  59.954  1.00 35.03  ? 275 ILE A O   1 
ATOM   2116 C  CB  . ILE A 1 275 ? -8.005  9.376   62.704  1.00 21.61  ? 275 ILE A CB  1 
ATOM   2117 C  CG1 . ILE A 1 275 ? -6.636  9.390   63.383  1.00 31.57  ? 275 ILE A CG1 1 
ATOM   2118 C  CG2 . ILE A 1 275 ? -8.204  8.078   61.933  1.00 23.93  ? 275 ILE A CG2 1 
ATOM   2119 C  CD1 . ILE A 1 275 ? -6.539  8.473   64.578  1.00 36.44  ? 275 ILE A CD1 1 
ATOM   2120 N  N   . ASP A 1 276 ? -10.473 11.230  61.645  1.00 35.05  ? 276 ASP A N   1 
ATOM   2121 C  CA  . ASP A 1 276 ? -11.824 11.150  61.114  1.00 39.02  ? 276 ASP A CA  1 
ATOM   2122 C  C   . ASP A 1 276 ? -12.020 11.987  59.858  1.00 43.03  ? 276 ASP A C   1 
ATOM   2123 O  O   . ASP A 1 276 ? -13.055 11.842  59.194  1.00 39.37  ? 276 ASP A O   1 
ATOM   2124 C  CB  . ASP A 1 276 ? -12.836 11.563  62.186  1.00 55.22  ? 276 ASP A CB  1 
ATOM   2125 C  CG  . ASP A 1 276 ? -13.533 10.360  62.834  1.00 63.93  ? 276 ASP A CG  1 
ATOM   2126 O  OD1 . ASP A 1 276 ? -13.806 9.379   62.097  1.00 70.69  ? 276 ASP A OD1 1 
ATOM   2127 O  OD2 . ASP A 1 276 ? -13.813 10.401  64.065  1.00 52.18  ? 276 ASP A OD2 1 
ATOM   2128 N  N   . VAL A 1 277 ? -11.059 12.846  59.511  1.00 40.28  ? 277 VAL A N   1 
ATOM   2129 C  CA  . VAL A 1 277 ? -11.118 13.607  58.273  1.00 28.88  ? 277 VAL A CA  1 
ATOM   2130 C  C   . VAL A 1 277 ? -9.901  13.358  57.391  1.00 28.17  ? 277 VAL A C   1 
ATOM   2131 O  O   . VAL A 1 277 ? -9.753  14.009  56.355  1.00 24.31  ? 277 VAL A O   1 
ATOM   2132 C  CB  . VAL A 1 277 ? -11.292 15.117  58.540  1.00 25.71  ? 277 VAL A CB  1 
ATOM   2133 C  CG1 . VAL A 1 277 ? -12.527 15.392  59.410  1.00 21.74  ? 277 VAL A CG1 1 
ATOM   2134 C  CG2 . VAL A 1 277 ? -10.053 15.696  59.165  1.00 24.08  ? 277 VAL A CG2 1 
ATOM   2135 N  N   . GLU A 1 278 ? -9.034  12.410  57.768  1.00 35.77  ? 278 GLU A N   1 
ATOM   2136 C  CA  . GLU A 1 278 ? -7.756  12.243  57.076  1.00 32.16  ? 278 GLU A CA  1 
ATOM   2137 C  C   . GLU A 1 278 ? -7.935  11.905  55.598  1.00 28.16  ? 278 GLU A C   1 
ATOM   2138 O  O   . GLU A 1 278 ? -7.115  12.308  54.768  1.00 32.20  ? 278 GLU A O   1 
ATOM   2139 C  CB  . GLU A 1 278 ? -6.921  11.171  57.776  1.00 43.12  ? 278 GLU A CB  1 
ATOM   2140 C  CG  . GLU A 1 278 ? -6.176  10.225  56.830  1.00 54.01  ? 278 GLU A CG  1 
ATOM   2141 C  CD  . GLU A 1 278 ? -5.211  9.305   57.557  1.00 54.00  ? 278 GLU A CD  1 
ATOM   2142 O  OE1 . GLU A 1 278 ? -4.034  9.242   57.145  1.00 57.07  ? 278 GLU A OE1 1 
ATOM   2143 O  OE2 . GLU A 1 278 ? -5.623  8.654   58.540  1.00 46.74  ? 278 GLU A OE2 1 
ATOM   2144 N  N   . TRP A 1 279 ? -8.996  11.196  55.236  1.00 31.52  ? 279 TRP A N   1 
ATOM   2145 C  CA  . TRP A 1 279 ? -9.155  10.838  53.835  1.00 25.77  ? 279 TRP A CA  1 
ATOM   2146 C  C   . TRP A 1 279 ? -9.727  11.964  52.989  1.00 22.36  ? 279 TRP A C   1 
ATOM   2147 O  O   . TRP A 1 279 ? -9.526  11.956  51.773  1.00 39.99  ? 279 TRP A O   1 
ATOM   2148 C  CB  . TRP A 1 279 ? -10.024 9.589   53.706  1.00 29.09  ? 279 TRP A CB  1 
ATOM   2149 C  CG  . TRP A 1 279 ? -9.406  8.387   54.370  1.00 31.47  ? 279 TRP A CG  1 
ATOM   2150 C  CD1 . TRP A 1 279 ? -9.709  7.888   55.604  1.00 28.71  ? 279 TRP A CD1 1 
ATOM   2151 C  CD2 . TRP A 1 279 ? -8.369  7.552   53.844  1.00 37.89  ? 279 TRP A CD2 1 
ATOM   2152 N  NE1 . TRP A 1 279 ? -8.932  6.789   55.875  1.00 29.14  ? 279 TRP A NE1 1 
ATOM   2153 C  CE2 . TRP A 1 279 ? -8.102  6.561   54.810  1.00 38.74  ? 279 TRP A CE2 1 
ATOM   2154 C  CE3 . TRP A 1 279 ? -7.641  7.544   52.651  1.00 39.75  ? 279 TRP A CE3 1 
ATOM   2155 C  CZ2 . TRP A 1 279 ? -7.142  5.572   54.619  1.00 45.42  ? 279 TRP A CZ2 1 
ATOM   2156 C  CZ3 . TRP A 1 279 ? -6.682  6.558   52.463  1.00 42.77  ? 279 TRP A CZ3 1 
ATOM   2157 C  CH2 . TRP A 1 279 ? -6.445  5.586   53.440  1.00 46.09  ? 279 TRP A CH2 1 
ATOM   2158 N  N   . ASN A 1 280 ? -10.388 12.948  53.591  1.00 23.47  ? 280 ASN A N   1 
ATOM   2159 C  CA  . ASN A 1 280 ? -11.010 14.031  52.822  1.00 38.34  ? 280 ASN A CA  1 
ATOM   2160 C  C   . ASN A 1 280 ? -10.013 14.985  52.177  1.00 33.23  ? 280 ASN A C   1 
ATOM   2161 O  O   . ASN A 1 280 ? -10.448 15.994  51.612  1.00 40.81  ? 280 ASN A O   1 
ATOM   2162 C  CB  . ASN A 1 280 ? -11.938 14.874  53.704  1.00 41.40  ? 280 ASN A CB  1 
ATOM   2163 C  CG  . ASN A 1 280 ? -12.941 14.045  54.452  1.00 50.76  ? 280 ASN A CG  1 
ATOM   2164 O  OD1 . ASN A 1 280 ? -12.916 12.815  54.401  1.00 56.51  ? 280 ASN A OD1 1 
ATOM   2165 N  ND2 . ASN A 1 280 ? -13.824 14.714  55.176  1.00 59.86  ? 280 ASN A ND2 1 
ATOM   2166 N  N   . VAL A 1 281 ? -8.706  14.747  52.284  1.00 16.79  ? 281 VAL A N   1 
ATOM   2167 C  CA  . VAL A 1 281 ? -7.736  15.668  51.708  1.00 27.32  ? 281 VAL A CA  1 
ATOM   2168 C  C   . VAL A 1 281 ? -7.134  15.140  50.411  1.00 29.63  ? 281 VAL A C   1 
ATOM   2169 O  O   . VAL A 1 281 ? -6.414  15.890  49.734  1.00 34.97  ? 281 VAL A O   1 
ATOM   2170 C  CB  . VAL A 1 281 ? -6.617  16.014  52.719  1.00 27.04  ? 281 VAL A CB  1 
ATOM   2171 C  CG1 . VAL A 1 281 ? -7.202  16.508  54.051  1.00 21.90  ? 281 VAL A CG1 1 
ATOM   2172 C  CG2 . VAL A 1 281 ? -5.720  14.813  52.961  1.00 29.36  ? 281 VAL A CG2 1 
ATOM   2173 N  N   . LEU A 1 282 ? -7.422  13.891  50.034  1.00 18.48  ? 282 LEU A N   1 
ATOM   2174 C  CA  . LEU A 1 282 ? -6.899  13.330  48.793  1.00 20.20  ? 282 LEU A CA  1 
ATOM   2175 C  C   . LEU A 1 282 ? -7.460  14.061  47.570  1.00 30.73  ? 282 LEU A C   1 
ATOM   2176 O  O   . LEU A 1 282 ? -8.664  14.339  47.514  1.00 40.32  ? 282 LEU A O   1 
ATOM   2177 C  CB  . LEU A 1 282 ? -7.250  11.849  48.694  1.00 25.56  ? 282 LEU A CB  1 
ATOM   2178 C  CG  . LEU A 1 282 ? -6.562  10.825  49.596  1.00 29.75  ? 282 LEU A CG  1 
ATOM   2179 C  CD1 . LEU A 1 282 ? -7.198  9.456   49.371  1.00 22.86  ? 282 LEU A CD1 1 
ATOM   2180 C  CD2 . LEU A 1 282 ? -5.053  10.756  49.300  1.00 30.08  ? 282 LEU A CD2 1 
ATOM   2181 N  N   . PRO A 1 283 ? -6.631  14.326  46.548  1.00 37.82  ? 283 PRO A N   1 
ATOM   2182 C  CA  . PRO A 1 283 ? -7.094  15.127  45.400  1.00 35.26  ? 283 PRO A CA  1 
ATOM   2183 C  C   . PRO A 1 283 ? -7.974  14.386  44.412  1.00 33.50  ? 283 PRO A C   1 
ATOM   2184 O  O   . PRO A 1 283 ? -8.513  15.032  43.503  1.00 35.06  ? 283 PRO A O   1 
ATOM   2185 C  CB  . PRO A 1 283 ? -5.782  15.538  44.716  1.00 37.50  ? 283 PRO A CB  1 
ATOM   2186 C  CG  . PRO A 1 283 ? -4.899  14.372  44.937  1.00 41.28  ? 283 PRO A CG  1 
ATOM   2187 C  CD  . PRO A 1 283 ? -5.228  13.905  46.371  1.00 43.66  ? 283 PRO A CD  1 
ATOM   2188 N  N   . PHE A 1 284 ? -8.126  13.068  44.535  1.00 32.40  ? 284 PHE A N   1 
ATOM   2189 C  CA  . PHE A 1 284 ? -8.864  12.288  43.551  1.00 36.10  ? 284 PHE A CA  1 
ATOM   2190 C  C   . PHE A 1 284 ? -9.666  11.197  44.235  1.00 38.85  ? 284 PHE A C   1 
ATOM   2191 O  O   . PHE A 1 284 ? -9.343  10.753  45.340  1.00 27.23  ? 284 PHE A O   1 
ATOM   2192 C  CB  . PHE A 1 284 ? -7.943  11.603  42.523  1.00 34.43  ? 284 PHE A CB  1 
ATOM   2193 C  CG  . PHE A 1 284 ? -7.062  12.540  41.759  1.00 34.01  ? 284 PHE A CG  1 
ATOM   2194 C  CD1 . PHE A 1 284 ? -7.607  13.539  40.960  1.00 36.57  ? 284 PHE A CD1 1 
ATOM   2195 C  CD2 . PHE A 1 284 ? -5.688  12.403  41.812  1.00 37.58  ? 284 PHE A CD2 1 
ATOM   2196 C  CE1 . PHE A 1 284 ? -6.794  14.407  40.245  1.00 40.72  ? 284 PHE A CE1 1 
ATOM   2197 C  CE2 . PHE A 1 284 ? -4.864  13.264  41.095  1.00 52.10  ? 284 PHE A CE2 1 
ATOM   2198 C  CZ  . PHE A 1 284 ? -5.421  14.269  40.306  1.00 49.06  ? 284 PHE A CZ  1 
ATOM   2199 N  N   . ASP A 1 285 ? -10.708 10.746  43.537  1.00 51.38  ? 285 ASP A N   1 
ATOM   2200 C  CA  . ASP A 1 285 ? -11.296 9.441   43.817  1.00 56.14  ? 285 ASP A CA  1 
ATOM   2201 C  C   . ASP A 1 285 ? -10.317 8.373   43.355  1.00 48.52  ? 285 ASP A C   1 
ATOM   2202 O  O   . ASP A 1 285 ? -10.014 8.283   42.162  1.00 56.26  ? 285 ASP A O   1 
ATOM   2203 C  CB  . ASP A 1 285 ? -12.642 9.283   43.107  1.00 60.82  ? 285 ASP A CB  1 
ATOM   2204 C  CG  . ASP A 1 285 ? -13.758 10.095  43.760  1.00 67.48  ? 285 ASP A CG  1 
ATOM   2205 O  OD1 . ASP A 1 285 ? -13.601 10.512  44.931  1.00 77.85  ? 285 ASP A OD1 1 
ATOM   2206 O  OD2 . ASP A 1 285 ? -14.802 10.300  43.105  1.00 62.79  ? 285 ASP A OD2 1 
ATOM   2207 N  N   . SER A 1 286 ? -9.802  7.573   44.283  1.00 35.28  ? 286 SER A N   1 
ATOM   2208 C  CA  . SER A 1 286 ? -8.674  6.734   43.915  1.00 23.66  ? 286 SER A CA  1 
ATOM   2209 C  C   . SER A 1 286 ? -8.619  5.507   44.802  1.00 21.46  ? 286 SER A C   1 
ATOM   2210 O  O   . SER A 1 286 ? -9.143  5.505   45.917  1.00 38.61  ? 286 SER A O   1 
ATOM   2211 C  CB  . SER A 1 286 ? -7.359  7.507   44.028  1.00 29.41  ? 286 SER A CB  1 
ATOM   2212 O  OG  . SER A 1 286 ? -7.082  7.826   45.377  1.00 34.73  ? 286 SER A OG  1 
ATOM   2213 N  N   . ILE A 1 287 ? -7.956  4.465   44.293  1.00 24.04  ? 287 ILE A N   1 
ATOM   2214 C  CA  . ILE A 1 287 ? -7.521  3.334   45.106  1.00 25.64  ? 287 ILE A CA  1 
ATOM   2215 C  C   . ILE A 1 287 ? -6.000  3.334   45.191  1.00 28.98  ? 287 ILE A C   1 
ATOM   2216 O  O   . ILE A 1 287 ? -5.301  3.867   44.318  1.00 29.26  ? 287 ILE A O   1 
ATOM   2217 C  CB  . ILE A 1 287 ? -8.045  1.988   44.572  1.00 20.33  ? 287 ILE A CB  1 
ATOM   2218 C  CG1 . ILE A 1 287 ? -7.365  1.609   43.273  1.00 15.85  ? 287 ILE A CG1 1 
ATOM   2219 C  CG2 . ILE A 1 287 ? -9.556  2.037   44.346  1.00 26.97  ? 287 ILE A CG2 1 
ATOM   2220 C  CD1 . ILE A 1 287 ? -7.458  0.131   43.029  1.00 25.88  ? 287 ILE A CD1 1 
ATOM   2221 N  N   . PHE A 1 288 ? -5.492  2.766   46.284  1.00 33.78  ? 288 PHE A N   1 
ATOM   2222 C  CA  . PHE A 1 288 ? -4.055  2.665   46.555  1.00 30.45  ? 288 PHE A CA  1 
ATOM   2223 C  C   . PHE A 1 288 ? -3.391  4.040   46.690  1.00 30.68  ? 288 PHE A C   1 
ATOM   2224 O  O   . PHE A 1 288 ? -2.246  4.237   46.276  1.00 21.40  ? 288 PHE A O   1 
ATOM   2225 C  CB  . PHE A 1 288 ? -3.363  1.822   45.482  1.00 24.47  ? 288 PHE A CB  1 
ATOM   2226 C  CG  . PHE A 1 288 ? -2.257  0.960   46.005  1.00 22.09  ? 288 PHE A CG  1 
ATOM   2227 C  CD1 . PHE A 1 288 ? -1.339  1.458   46.925  1.00 23.04  ? 288 PHE A CD1 1 
ATOM   2228 C  CD2 . PHE A 1 288 ? -2.136  -0.357  45.584  1.00 22.16  ? 288 PHE A CD2 1 
ATOM   2229 C  CE1 . PHE A 1 288 ? -0.307  0.664   47.412  1.00 19.75  ? 288 PHE A CE1 1 
ATOM   2230 C  CE2 . PHE A 1 288 ? -1.112  -1.160  46.067  1.00 24.52  ? 288 PHE A CE2 1 
ATOM   2231 C  CZ  . PHE A 1 288 ? -0.198  -0.649  46.990  1.00 22.99  ? 288 PHE A CZ  1 
ATOM   2232 N  N   . ARG A 1 289 ? -4.098  5.004   47.284  1.00 31.33  ? 289 ARG A N   1 
ATOM   2233 C  CA  . ARG A 1 289 ? -3.488  6.287   47.616  1.00 33.05  ? 289 ARG A CA  1 
ATOM   2234 C  C   . ARG A 1 289 ? -3.873  6.712   49.025  1.00 39.40  ? 289 ARG A C   1 
ATOM   2235 O  O   . ARG A 1 289 ? -4.984  6.441   49.497  1.00 44.12  ? 289 ARG A O   1 
ATOM   2236 C  CB  . ARG A 1 289 ? -3.843  7.413   46.610  1.00 29.33  ? 289 ARG A CB  1 
ATOM   2237 C  CG  . ARG A 1 289 ? -3.516  7.122   45.159  1.00 24.10  ? 289 ARG A CG  1 
ATOM   2238 C  CD  . ARG A 1 289 ? -2.126  7.687   44.799  1.00 20.77  ? 289 ARG A CD  1 
ATOM   2239 N  NE  . ARG A 1 289 ? -1.788  7.496   43.379  1.00 27.52  ? 289 ARG A NE  1 
ATOM   2240 C  CZ  . ARG A 1 289 ? -1.629  6.313   42.786  1.00 31.81  ? 289 ARG A CZ  1 
ATOM   2241 N  NH1 . ARG A 1 289 ? -1.815  5.194   43.473  1.00 27.89  ? 289 ARG A NH1 1 
ATOM   2242 N  NH2 . ARG A 1 289 ? -1.322  6.269   41.495  1.00 39.05  ? 289 ARG A NH2 1 
ATOM   2243 N  N   . PHE A 1 290 ? -2.930  7.369   49.697  1.00 30.01  ? 290 PHE A N   1 
ATOM   2244 C  CA  . PHE A 1 290 ? -3.049  7.675   51.110  1.00 27.56  ? 290 PHE A CA  1 
ATOM   2245 C  C   . PHE A 1 290 ? -2.638  9.122   51.351  1.00 25.82  ? 290 PHE A C   1 
ATOM   2246 O  O   . PHE A 1 290 ? -1.801  9.678   50.631  1.00 21.12  ? 290 PHE A O   1 
ATOM   2247 C  CB  . PHE A 1 290 ? -2.209  6.700   51.930  1.00 27.71  ? 290 PHE A CB  1 
ATOM   2248 C  CG  . PHE A 1 290 ? -2.061  5.333   51.285  1.00 26.48  ? 290 PHE A CG  1 
ATOM   2249 C  CD1 . PHE A 1 290 ? -0.851  4.941   50.736  1.00 24.52  ? 290 PHE A CD1 1 
ATOM   2250 C  CD2 . PHE A 1 290 ? -3.132  4.452   51.219  1.00 20.95  ? 290 PHE A CD2 1 
ATOM   2251 C  CE1 . PHE A 1 290 ? -0.703  3.699   50.158  1.00 20.49  ? 290 PHE A CE1 1 
ATOM   2252 C  CE2 . PHE A 1 290 ? -2.987  3.210   50.625  1.00 22.07  ? 290 PHE A CE2 1 
ATOM   2253 C  CZ  . PHE A 1 290 ? -1.772  2.833   50.101  1.00 17.64  ? 290 PHE A CZ  1 
ATOM   2254 N  N   . SER A 1 291 ? -3.235  9.724   52.383  1.00 20.33  ? 291 SER A N   1 
ATOM   2255 C  CA  . SER A 1 291 ? -3.284  11.181  52.471  1.00 20.38  ? 291 SER A CA  1 
ATOM   2256 C  C   . SER A 1 291 ? -1.935  11.776  52.853  1.00 25.74  ? 291 SER A C   1 
ATOM   2257 O  O   . SER A 1 291 ? -1.437  12.697  52.190  1.00 22.14  ? 291 SER A O   1 
ATOM   2258 C  CB  . SER A 1 291 ? -4.351  11.605  53.476  1.00 28.97  ? 291 SER A CB  1 
ATOM   2259 O  OG  . SER A 1 291 ? -5.501  10.786  53.371  1.00 45.93  ? 291 SER A OG  1 
ATOM   2260 N  N   . PHE A 1 292 ? -1.343  11.303  53.937  1.00 27.28  ? 292 PHE A N   1 
ATOM   2261 C  CA  . PHE A 1 292 ? -0.103  11.892  54.419  1.00 29.17  ? 292 PHE A CA  1 
ATOM   2262 C  C   . PHE A 1 292 ? 1.012   10.859  54.322  1.00 28.48  ? 292 PHE A C   1 
ATOM   2263 O  O   . PHE A 1 292 ? 1.013   9.847   55.036  1.00 20.48  ? 292 PHE A O   1 
ATOM   2264 C  CB  . PHE A 1 292 ? -0.287  12.463  55.821  1.00 27.95  ? 292 PHE A CB  1 
ATOM   2265 C  CG  . PHE A 1 292 ? -1.403  13.474  55.904  1.00 15.18  ? 292 PHE A CG  1 
ATOM   2266 C  CD1 . PHE A 1 292 ? -1.147  14.824  55.723  1.00 19.02  ? 292 PHE A CD1 1 
ATOM   2267 C  CD2 . PHE A 1 292 ? -2.702  13.077  56.173  1.00 19.05  ? 292 PHE A CD2 1 
ATOM   2268 C  CE1 . PHE A 1 292 ? -2.175  15.748  55.795  1.00 23.10  ? 292 PHE A CE1 1 
ATOM   2269 C  CE2 . PHE A 1 292 ? -3.724  13.996  56.260  1.00 15.63  ? 292 PHE A CE2 1 
ATOM   2270 C  CZ  . PHE A 1 292 ? -3.468  15.325  56.071  1.00 18.13  ? 292 PHE A CZ  1 
ATOM   2271 N  N   . VAL A 1 293 ? 1.936   11.125  53.406  1.00 31.30  ? 293 VAL A N   1 
ATOM   2272 C  CA  . VAL A 1 293 ? 3.012   10.223  53.026  1.00 28.16  ? 293 VAL A CA  1 
ATOM   2273 C  C   . VAL A 1 293 ? 4.292   11.051  53.053  1.00 14.41  ? 293 VAL A C   1 
ATOM   2274 O  O   . VAL A 1 293 ? 4.249   12.277  53.229  1.00 22.59  ? 293 VAL A O   1 
ATOM   2275 C  CB  . VAL A 1 293 ? 2.757   9.607   51.636  1.00 26.75  ? 293 VAL A CB  1 
ATOM   2276 C  CG1 . VAL A 1 293 ? 1.426   8.842   51.586  1.00 14.03  ? 293 VAL A CG1 1 
ATOM   2277 C  CG2 . VAL A 1 293 ? 2.810   10.686  50.575  1.00 14.41  ? 293 VAL A CG2 1 
ATOM   2278 N  N   . PRO A 1 294 ? 5.443   10.425  52.893  1.00 27.28  ? 294 PRO A N   1 
ATOM   2279 C  CA  . PRO A 1 294 ? 6.692   11.179  52.808  1.00 14.61  ? 294 PRO A CA  1 
ATOM   2280 C  C   . PRO A 1 294 ? 6.679   12.312  51.787  1.00 20.43  ? 294 PRO A C   1 
ATOM   2281 O  O   . PRO A 1 294 ? 6.015   12.249  50.751  1.00 34.95  ? 294 PRO A O   1 
ATOM   2282 C  CB  . PRO A 1 294 ? 7.706   10.106  52.416  1.00 25.36  ? 294 PRO A CB  1 
ATOM   2283 C  CG  . PRO A 1 294 ? 7.171   8.861   53.036  1.00 20.11  ? 294 PRO A CG  1 
ATOM   2284 C  CD  . PRO A 1 294 ? 5.680   8.991   53.127  1.00 30.17  ? 294 PRO A CD  1 
ATOM   2285 N  N   . VAL A 1 295 ? 7.469   13.338  52.095  1.00 28.39  ? 295 VAL A N   1 
ATOM   2286 C  CA  . VAL A 1 295 ? 7.672   14.517  51.258  1.00 38.18  ? 295 VAL A CA  1 
ATOM   2287 C  C   . VAL A 1 295 ? 9.058   14.434  50.629  1.00 35.12  ? 295 VAL A C   1 
ATOM   2288 O  O   . VAL A 1 295 ? 9.980   13.801  51.163  1.00 24.37  ? 295 VAL A O   1 
ATOM   2289 C  CB  . VAL A 1 295 ? 7.537   15.822  52.080  1.00 33.81  ? 295 VAL A CB  1 
ATOM   2290 C  CG1 . VAL A 1 295 ? 7.583   17.047  51.177  1.00 39.42  ? 295 VAL A CG1 1 
ATOM   2291 C  CG2 . VAL A 1 295 ? 6.268   15.803  52.812  1.00 37.92  ? 295 VAL A CG2 1 
ATOM   2292 N  N   . ILE A 1 296 ? 9.200   15.083  49.472  1.00 36.13  ? 296 ILE A N   1 
ATOM   2293 C  CA  . ILE A 1 296 ? 10.507  15.275  48.859  1.00 30.81  ? 296 ILE A CA  1 
ATOM   2294 C  C   . ILE A 1 296 ? 10.898  16.720  49.171  1.00 30.24  ? 296 ILE A C   1 
ATOM   2295 O  O   . ILE A 1 296 ? 10.687  17.635  48.367  1.00 30.64  ? 296 ILE A O   1 
ATOM   2296 C  CB  . ILE A 1 296 ? 10.477  14.932  47.354  1.00 26.25  ? 296 ILE A CB  1 
ATOM   2297 C  CG1 . ILE A 1 296 ? 10.692  13.433  47.117  1.00 18.25  ? 296 ILE A CG1 1 
ATOM   2298 C  CG2 . ILE A 1 296 ? 11.629  15.575  46.649  1.00 37.51  ? 296 ILE A CG2 1 
ATOM   2299 C  CD1 . ILE A 1 296 ? 9.863   12.468  47.936  1.00 15.81  ? 296 ILE A CD1 1 
ATOM   2300 N  N   . ASP A 1 297 ? 11.412  16.938  50.388  1.00 39.17  ? 297 ASP A N   1 
ATOM   2301 C  CA  . ASP A 1 297 ? 11.636  18.267  50.952  1.00 46.82  ? 297 ASP A CA  1 
ATOM   2302 C  C   . ASP A 1 297 ? 13.013  18.835  50.647  1.00 51.89  ? 297 ASP A C   1 
ATOM   2303 O  O   . ASP A 1 297 ? 13.220  20.050  50.785  1.00 59.54  ? 297 ASP A O   1 
ATOM   2304 C  CB  . ASP A 1 297 ? 11.456  18.229  52.474  1.00 49.52  ? 297 ASP A CB  1 
ATOM   2305 C  CG  . ASP A 1 297 ? 12.281  17.145  53.117  1.00 48.65  ? 297 ASP A CG  1 
ATOM   2306 O  OD1 . ASP A 1 297 ? 12.946  16.405  52.353  1.00 42.50  ? 297 ASP A OD1 1 
ATOM   2307 O  OD2 . ASP A 1 297 ? 12.256  17.025  54.365  1.00 56.56  ? 297 ASP A OD2 1 
ATOM   2308 N  N   . GLY A 1 298 ? 13.958  17.993  50.256  1.00 44.43  ? 298 GLY A N   1 
ATOM   2309 C  CA  . GLY A 1 298 ? 15.299  18.440  49.977  1.00 39.60  ? 298 GLY A CA  1 
ATOM   2310 C  C   . GLY A 1 298 ? 16.290  18.152  51.077  1.00 37.76  ? 298 GLY A C   1 
ATOM   2311 O  O   . GLY A 1 298 ? 17.491  18.288  50.846  1.00 43.95  ? 298 GLY A O   1 
ATOM   2312 N  N   . GLU A 1 299 ? 15.825  17.757  52.260  1.00 40.21  ? 299 GLU A N   1 
ATOM   2313 C  CA  . GLU A 1 299 ? 16.692  17.526  53.407  1.00 38.98  ? 299 GLU A CA  1 
ATOM   2314 C  C   . GLU A 1 299 ? 16.884  16.040  53.671  1.00 34.52  ? 299 GLU A C   1 
ATOM   2315 O  O   . GLU A 1 299 ? 18.000  15.526  53.579  1.00 49.55  ? 299 GLU A O   1 
ATOM   2316 C  CB  . GLU A 1 299 ? 16.115  18.241  54.639  1.00 36.94  ? 299 GLU A CB  1 
ATOM   2317 C  CG  . GLU A 1 299 ? 15.884  19.739  54.405  1.00 53.62  ? 299 GLU A CG  1 
ATOM   2318 C  CD  . GLU A 1 299 ? 14.995  20.384  55.470  1.00 69.78  ? 299 GLU A CD  1 
ATOM   2319 O  OE1 . GLU A 1 299 ? 14.815  19.779  56.553  1.00 66.34  ? 299 GLU A OE1 1 
ATOM   2320 O  OE2 . GLU A 1 299 ? 14.474  21.497  55.221  1.00 74.75  ? 299 GLU A OE2 1 
ATOM   2321 N  N   . PHE A 1 300 ? 15.812  15.338  54.011  1.00 27.96  ? 300 PHE A N   1 
ATOM   2322 C  CA  . PHE A 1 300 ? 15.840  13.883  54.078  1.00 32.22  ? 300 PHE A CA  1 
ATOM   2323 C  C   . PHE A 1 300 ? 16.054  13.287  52.700  1.00 36.41  ? 300 PHE A C   1 
ATOM   2324 O  O   . PHE A 1 300 ? 16.569  12.170  52.580  1.00 43.47  ? 300 PHE A O   1 
ATOM   2325 C  CB  . PHE A 1 300 ? 14.520  13.394  54.674  1.00 40.30  ? 300 PHE A CB  1 
ATOM   2326 C  CG  . PHE A 1 300 ? 14.524  11.971  55.141  1.00 26.74  ? 300 PHE A CG  1 
ATOM   2327 C  CD1 . PHE A 1 300 ? 14.415  10.924  54.240  1.00 17.32  ? 300 PHE A CD1 1 
ATOM   2328 C  CD2 . PHE A 1 300 ? 14.548  11.687  56.497  1.00 31.65  ? 300 PHE A CD2 1 
ATOM   2329 C  CE1 . PHE A 1 300 ? 14.382  9.617   54.686  1.00 22.47  ? 300 PHE A CE1 1 
ATOM   2330 C  CE2 . PHE A 1 300 ? 14.517  10.382  56.953  1.00 31.42  ? 300 PHE A CE2 1 
ATOM   2331 C  CZ  . PHE A 1 300 ? 14.436  9.342   56.047  1.00 27.95  ? 300 PHE A CZ  1 
ATOM   2332 N  N   . PHE A 1 301 ? 15.657  14.010  51.656  1.00 36.55  ? 301 PHE A N   1 
ATOM   2333 C  CA  . PHE A 1 301 ? 15.881  13.596  50.271  1.00 32.88  ? 301 PHE A CA  1 
ATOM   2334 C  C   . PHE A 1 301 ? 16.573  14.739  49.539  1.00 34.32  ? 301 PHE A C   1 
ATOM   2335 O  O   . PHE A 1 301 ? 15.898  15.680  49.093  1.00 34.89  ? 301 PHE A O   1 
ATOM   2336 C  CB  . PHE A 1 301 ? 14.572  13.241  49.580  1.00 33.43  ? 301 PHE A CB  1 
ATOM   2337 C  CG  . PHE A 1 301 ? 13.856  12.045  50.162  1.00 36.72  ? 301 PHE A CG  1 
ATOM   2338 C  CD1 . PHE A 1 301 ? 14.446  10.794  50.175  1.00 43.38  ? 301 PHE A CD1 1 
ATOM   2339 C  CD2 . PHE A 1 301 ? 12.561  12.162  50.633  1.00 33.50  ? 301 PHE A CD2 1 
ATOM   2340 C  CE1 . PHE A 1 301 ? 13.761  9.687   50.687  1.00 39.44  ? 301 PHE A CE1 1 
ATOM   2341 C  CE2 . PHE A 1 301 ? 11.880  11.065  51.138  1.00 31.04  ? 301 PHE A CE2 1 
ATOM   2342 C  CZ  . PHE A 1 301 ? 12.481  9.829   51.167  1.00 28.08  ? 301 PHE A CZ  1 
ATOM   2343 N  N   . PRO A 1 302 ? 17.907  14.709  49.416  1.00 42.31  ? 302 PRO A N   1 
ATOM   2344 C  CA  . PRO A 1 302 ? 18.632  15.761  48.681  1.00 42.29  ? 302 PRO A CA  1 
ATOM   2345 C  C   . PRO A 1 302 ? 17.938  16.289  47.433  1.00 43.90  ? 302 PRO A C   1 
ATOM   2346 O  O   . PRO A 1 302 ? 17.768  17.503  47.293  1.00 42.44  ? 302 PRO A O   1 
ATOM   2347 C  CB  . PRO A 1 302 ? 19.943  15.062  48.311  1.00 38.86  ? 302 PRO A CB  1 
ATOM   2348 C  CG  . PRO A 1 302 ? 20.172  14.121  49.442  1.00 40.98  ? 302 PRO A CG  1 
ATOM   2349 C  CD  . PRO A 1 302 ? 18.828  13.733  50.017  1.00 41.83  ? 302 PRO A CD  1 
ATOM   2350 N  N   . THR A 1 303 ? 17.530  15.395  46.532  1.00 47.87  ? 303 THR A N   1 
ATOM   2351 C  CA  . THR A 1 303 ? 16.888  15.768  45.275  1.00 45.05  ? 303 THR A CA  1 
ATOM   2352 C  C   . THR A 1 303 ? 15.799  14.747  44.950  1.00 47.49  ? 303 THR A C   1 
ATOM   2353 O  O   . THR A 1 303 ? 15.426  13.907  45.780  1.00 38.03  ? 303 THR A O   1 
ATOM   2354 C  CB  . THR A 1 303 ? 17.913  15.858  44.138  1.00 45.63  ? 303 THR A CB  1 
ATOM   2355 O  OG1 . THR A 1 303 ? 18.882  14.810  44.280  1.00 47.98  ? 303 THR A OG1 1 
ATOM   2356 C  CG2 . THR A 1 303 ? 18.614  17.202  44.145  1.00 51.72  ? 303 THR A CG2 1 
ATOM   2357 N  N   . SER A 1 304 ? 15.286  14.828  43.722  1.00 50.45  ? 304 SER A N   1 
ATOM   2358 C  CA  . SER A 1 304 ? 14.266  13.897  43.259  1.00 41.09  ? 304 SER A CA  1 
ATOM   2359 C  C   . SER A 1 304 ? 14.768  12.465  43.358  1.00 34.45  ? 304 SER A C   1 
ATOM   2360 O  O   . SER A 1 304 ? 15.953  12.190  43.164  1.00 38.74  ? 304 SER A O   1 
ATOM   2361 C  CB  . SER A 1 304 ? 13.897  14.192  41.812  1.00 42.70  ? 304 SER A CB  1 
ATOM   2362 O  OG  . SER A 1 304 ? 14.765  13.487  40.938  1.00 42.44  ? 304 SER A OG  1 
ATOM   2363 N  N   . LEU A 1 305 ? 13.849  11.541  43.654  1.00 28.85  ? 305 LEU A N   1 
ATOM   2364 C  CA  . LEU A 1 305 ? 14.251  10.140  43.767  1.00 36.04  ? 305 LEU A CA  1 
ATOM   2365 C  C   . LEU A 1 305 ? 14.804  9.610   42.450  1.00 38.46  ? 305 LEU A C   1 
ATOM   2366 O  O   . LEU A 1 305 ? 15.730  8.790   42.439  1.00 43.23  ? 305 LEU A O   1 
ATOM   2367 C  CB  . LEU A 1 305 ? 13.091  9.268   44.250  1.00 16.46  ? 305 LEU A CB  1 
ATOM   2368 C  CG  . LEU A 1 305 ? 12.510  9.707   45.593  1.00 22.61  ? 305 LEU A CG  1 
ATOM   2369 C  CD1 . LEU A 1 305 ? 11.235  8.958   45.955  1.00 15.61  ? 305 LEU A CD1 1 
ATOM   2370 C  CD2 . LEU A 1 305 ? 13.559  9.563   46.701  1.00 22.88  ? 305 LEU A CD2 1 
ATOM   2371 N  N   . GLU A 1 306 ? 14.266  10.074  41.328  1.00 31.26  ? 306 GLU A N   1 
ATOM   2372 C  CA  . GLU A 1 306 ? 14.790  9.623   40.051  1.00 31.17  ? 306 GLU A CA  1 
ATOM   2373 C  C   . GLU A 1 306 ? 16.250  10.030  39.892  1.00 37.90  ? 306 GLU A C   1 
ATOM   2374 O  O   . GLU A 1 306 ? 17.105  9.201   39.554  1.00 41.89  ? 306 GLU A O   1 
ATOM   2375 C  CB  . GLU A 1 306 ? 13.935  10.183  38.923  1.00 27.53  ? 306 GLU A CB  1 
ATOM   2376 C  CG  . GLU A 1 306 ? 14.191  9.535   37.579  1.00 41.72  ? 306 GLU A CG  1 
ATOM   2377 C  CD  . GLU A 1 306 ? 13.996  8.030   37.606  1.00 49.48  ? 306 GLU A CD  1 
ATOM   2378 O  OE1 . GLU A 1 306 ? 13.182  7.536   38.430  1.00 49.17  ? 306 GLU A OE1 1 
ATOM   2379 O  OE2 . GLU A 1 306 ? 14.669  7.342   36.805  1.00 46.60  ? 306 GLU A OE2 1 
ATOM   2380 N  N   . SER A 1 307 ? 16.560  11.303  40.160  1.00 32.20  ? 307 SER A N   1 
ATOM   2381 C  CA  . SER A 1 307 ? 17.930  11.773  39.979  1.00 34.31  ? 307 SER A CA  1 
ATOM   2382 C  C   . SER A 1 307 ? 18.893  11.046  40.911  1.00 37.16  ? 307 SER A C   1 
ATOM   2383 O  O   . SER A 1 307 ? 19.992  10.660  40.500  1.00 38.73  ? 307 SER A O   1 
ATOM   2384 C  CB  . SER A 1 307 ? 18.001  13.285  40.190  1.00 30.73  ? 307 SER A CB  1 
ATOM   2385 O  OG  . SER A 1 307 ? 17.650  13.630  41.511  1.00 50.67  ? 307 SER A OG  1 
ATOM   2386 N  N   . MET A 1 308 ? 18.491  10.825  42.162  1.00 41.45  ? 308 MET A N   1 
ATOM   2387 C  CA  . MET A 1 308 ? 19.361  10.097  43.077  1.00 47.50  ? 308 MET A CA  1 
ATOM   2388 C  C   . MET A 1 308 ? 19.596  8.671   42.595  1.00 42.23  ? 308 MET A C   1 
ATOM   2389 O  O   . MET A 1 308 ? 20.702  8.133   42.752  1.00 35.31  ? 308 MET A O   1 
ATOM   2390 C  CB  . MET A 1 308 ? 18.774  10.114  44.491  1.00 44.15  ? 308 MET A CB  1 
ATOM   2391 C  CG  . MET A 1 308 ? 18.473  11.514  44.992  1.00 48.47  ? 308 MET A CG  1 
ATOM   2392 S  SD  . MET A 1 308 ? 17.892  11.594  46.694  1.00 50.73  ? 308 MET A SD  1 
ATOM   2393 C  CE  . MET A 1 308 ? 19.362  11.049  47.551  1.00 56.15  ? 308 MET A CE  1 
ATOM   2394 N  N   . LEU A 1 309 ? 18.580  8.052   41.990  1.00 32.37  ? 309 LEU A N   1 
ATOM   2395 C  CA  . LEU A 1 309 ? 18.786  6.741   41.389  1.00 34.36  ? 309 LEU A CA  1 
ATOM   2396 C  C   . LEU A 1 309 ? 19.722  6.827   40.189  1.00 40.74  ? 309 LEU A C   1 
ATOM   2397 O  O   . LEU A 1 309 ? 20.578  5.956   39.993  1.00 42.68  ? 309 LEU A O   1 
ATOM   2398 C  CB  . LEU A 1 309 ? 17.442  6.145   40.991  1.00 34.18  ? 309 LEU A CB  1 
ATOM   2399 C  CG  . LEU A 1 309 ? 16.587  5.718   42.193  1.00 33.83  ? 309 LEU A CG  1 
ATOM   2400 C  CD1 . LEU A 1 309 ? 15.085  5.685   41.864  1.00 17.06  ? 309 LEU A CD1 1 
ATOM   2401 C  CD2 . LEU A 1 309 ? 17.059  4.371   42.691  1.00 18.22  ? 309 LEU A CD2 1 
ATOM   2402 N  N   . ASN A 1 310 ? 19.592  7.880   39.383  1.00 39.87  ? 310 ASN A N   1 
ATOM   2403 C  CA  . ASN A 1 310 ? 20.400  7.969   38.172  1.00 39.82  ? 310 ASN A CA  1 
ATOM   2404 C  C   . ASN A 1 310 ? 21.856  8.251   38.495  1.00 40.32  ? 310 ASN A C   1 
ATOM   2405 O  O   . ASN A 1 310 ? 22.754  7.566   37.993  1.00 42.29  ? 310 ASN A O   1 
ATOM   2406 C  CB  . ASN A 1 310 ? 19.848  9.041   37.242  1.00 46.70  ? 310 ASN A CB  1 
ATOM   2407 C  CG  . ASN A 1 310 ? 18.592  8.600   36.550  1.00 46.41  ? 310 ASN A CG  1 
ATOM   2408 O  OD1 . ASN A 1 310 ? 18.280  7.407   36.510  1.00 34.36  ? 310 ASN A OD1 1 
ATOM   2409 N  ND2 . ASN A 1 310 ? 17.853  9.558   36.002  1.00 55.03  ? 310 ASN A ND2 1 
ATOM   2410 N  N   . SER A 1 311 ? 22.115  9.264   39.321  1.00 41.63  ? 311 SER A N   1 
ATOM   2411 C  CA  . SER A 1 311 ? 23.490  9.561   39.699  1.00 41.36  ? 311 SER A CA  1 
ATOM   2412 C  C   . SER A 1 311 ? 24.101  8.478   40.572  1.00 47.25  ? 311 SER A C   1 
ATOM   2413 O  O   . SER A 1 311 ? 25.321  8.489   40.785  1.00 52.61  ? 311 SER A O   1 
ATOM   2414 C  CB  . SER A 1 311 ? 23.559  10.899  40.430  1.00 35.02  ? 311 SER A CB  1 
ATOM   2415 O  OG  . SER A 1 311 ? 22.836  10.832  41.643  1.00 40.08  ? 311 SER A OG  1 
ATOM   2416 N  N   . GLY A 1 312 ? 23.297  7.541   41.067  1.00 40.70  ? 312 GLY A N   1 
ATOM   2417 C  CA  . GLY A 1 312 ? 23.805  6.625   42.063  1.00 40.77  ? 312 GLY A CA  1 
ATOM   2418 C  C   . GLY A 1 312 ? 24.025  7.250   43.422  1.00 37.78  ? 312 GLY A C   1 
ATOM   2419 O  O   . GLY A 1 312 ? 24.751  6.687   44.237  1.00 33.33  ? 312 GLY A O   1 
ATOM   2420 N  N   . ASN A 1 313 ? 23.416  8.407   43.692  1.00 35.64  ? 313 ASN A N   1 
ATOM   2421 C  CA  . ASN A 1 313 ? 23.509  9.059   44.997  1.00 29.07  ? 313 ASN A CA  1 
ATOM   2422 C  C   . ASN A 1 313 ? 22.680  8.272   46.018  1.00 25.68  ? 313 ASN A C   1 
ATOM   2423 O  O   . ASN A 1 313 ? 21.655  8.717   46.537  1.00 27.86  ? 313 ASN A O   1 
ATOM   2424 C  CB  . ASN A 1 313 ? 23.059  10.513  44.893  1.00 37.14  ? 313 ASN A CB  1 
ATOM   2425 C  CG  . ASN A 1 313 ? 22.995  11.224  46.248  1.00 43.83  ? 313 ASN A CG  1 
ATOM   2426 O  OD1 . ASN A 1 313 ? 23.582  10.780  47.243  1.00 57.38  ? 313 ASN A OD1 1 
ATOM   2427 N  ND2 . ASN A 1 313 ? 22.281  12.342  46.283  1.00 34.04  ? 313 ASN A ND2 1 
ATOM   2428 N  N   . PHE A 1 314 ? 23.145  7.072   46.320  1.00 19.45  ? 314 PHE A N   1 
ATOM   2429 C  CA  . PHE A 1 314 ? 22.497  6.328   47.386  1.00 18.82  ? 314 PHE A CA  1 
ATOM   2430 C  C   . PHE A 1 314 ? 23.481  5.345   47.989  1.00 25.82  ? 314 PHE A C   1 
ATOM   2431 O  O   . PHE A 1 314 ? 24.618  5.204   47.538  1.00 34.49  ? 314 PHE A O   1 
ATOM   2432 C  CB  . PHE A 1 314 ? 21.226  5.615   46.906  1.00 18.22  ? 314 PHE A CB  1 
ATOM   2433 C  CG  . PHE A 1 314 ? 21.393  4.879   45.604  1.00 27.32  ? 314 PHE A CG  1 
ATOM   2434 C  CD1 . PHE A 1 314 ? 21.860  3.572   45.564  1.00 28.88  ? 314 PHE A CD1 1 
ATOM   2435 C  CD2 . PHE A 1 314 ? 21.076  5.506   44.412  1.00 29.96  ? 314 PHE A CD2 1 
ATOM   2436 C  CE1 . PHE A 1 314 ? 22.013  2.899   44.326  1.00 25.09  ? 314 PHE A CE1 1 
ATOM   2437 C  CE2 . PHE A 1 314 ? 21.214  4.844   43.195  1.00 34.56  ? 314 PHE A CE2 1 
ATOM   2438 C  CZ  . PHE A 1 314 ? 21.686  3.532   43.151  1.00 30.80  ? 314 PHE A CZ  1 
ATOM   2439 N  N   . LYS A 1 315 ? 23.020  4.679   49.038  1.00 30.77  ? 315 LYS A N   1 
ATOM   2440 C  CA  . LYS A 1 315 ? 23.807  3.670   49.733  1.00 30.44  ? 315 LYS A CA  1 
ATOM   2441 C  C   . LYS A 1 315 ? 24.118  2.494   48.813  1.00 28.42  ? 315 LYS A C   1 
ATOM   2442 O  O   . LYS A 1 315 ? 23.218  1.933   48.173  1.00 24.88  ? 315 LYS A O   1 
ATOM   2443 C  CB  . LYS A 1 315 ? 23.018  3.216   50.966  1.00 25.73  ? 315 LYS A CB  1 
ATOM   2444 C  CG  . LYS A 1 315 ? 23.382  1.876   51.545  1.00 20.21  ? 315 LYS A CG  1 
ATOM   2445 C  CD  . LYS A 1 315 ? 23.718  1.991   53.022  1.00 20.38  ? 315 LYS A CD  1 
ATOM   2446 C  CE  . LYS A 1 315 ? 23.929  0.624   53.658  1.00 18.44  ? 315 LYS A CE  1 
ATOM   2447 N  NZ  . LYS A 1 315 ? 25.159  0.696   54.503  1.00 19.03  ? 315 LYS A NZ  1 
ATOM   2448 N  N   . LYS A 1 316 ? 25.394  2.127   48.739  1.00 19.69  ? 316 LYS A N   1 
ATOM   2449 C  CA  . LYS A 1 316 ? 25.822  0.976   47.951  1.00 25.41  ? 316 LYS A CA  1 
ATOM   2450 C  C   . LYS A 1 316 ? 26.007  -0.211  48.881  1.00 31.36  ? 316 LYS A C   1 
ATOM   2451 O  O   . LYS A 1 316 ? 26.843  -0.168  49.792  1.00 40.17  ? 316 LYS A O   1 
ATOM   2452 C  CB  . LYS A 1 316 ? 27.128  1.238   47.206  1.00 20.88  ? 316 LYS A CB  1 
ATOM   2453 C  CG  . LYS A 1 316 ? 27.311  2.629   46.720  1.00 31.32  ? 316 LYS A CG  1 
ATOM   2454 C  CD  . LYS A 1 316 ? 26.867  2.776   45.311  1.00 33.69  ? 316 LYS A CD  1 
ATOM   2455 C  CE  . LYS A 1 316 ? 26.446  4.200   45.058  1.00 39.63  ? 316 LYS A CE  1 
ATOM   2456 N  NZ  . LYS A 1 316 ? 27.301  5.205   45.796  1.00 40.78  ? 316 LYS A NZ  1 
ATOM   2457 N  N   . THR A 1 317 ? 25.240  -1.267  48.644  1.00 29.82  ? 317 THR A N   1 
ATOM   2458 C  CA  . THR A 1 317 ? 25.398  -2.493  49.407  1.00 33.23  ? 317 THR A CA  1 
ATOM   2459 C  C   . THR A 1 317 ? 24.643  -3.582  48.668  1.00 25.78  ? 317 THR A C   1 
ATOM   2460 O  O   . THR A 1 317 ? 24.457  -3.478  47.456  1.00 38.26  ? 317 THR A O   1 
ATOM   2461 C  CB  . THR A 1 317 ? 24.903  -2.308  50.848  1.00 37.08  ? 317 THR A CB  1 
ATOM   2462 O  OG1 . THR A 1 317 ? 25.091  -3.518  51.590  1.00 47.23  ? 317 THR A OG1 1 
ATOM   2463 C  CG2 . THR A 1 317 ? 23.435  -1.898  50.868  1.00 25.02  ? 317 THR A CG2 1 
ATOM   2464 N  N   . GLN A 1 318 ? 24.219  -4.626  49.363  1.00 19.35  ? 318 GLN A N   1 
ATOM   2465 C  CA  . GLN A 1 318 ? 23.402  -5.663  48.758  1.00 25.38  ? 318 GLN A CA  1 
ATOM   2466 C  C   . GLN A 1 318 ? 21.960  -5.506  49.228  1.00 29.43  ? 318 GLN A C   1 
ATOM   2467 O  O   . GLN A 1 318 ? 21.704  -5.277  50.417  1.00 27.48  ? 318 GLN A O   1 
ATOM   2468 C  CB  . GLN A 1 318 ? 23.918  -7.059  49.098  1.00 19.66  ? 318 GLN A CB  1 
ATOM   2469 C  CG  . GLN A 1 318 ? 25.372  -7.232  48.914  1.00 29.41  ? 318 GLN A CG  1 
ATOM   2470 C  CD  . GLN A 1 318 ? 26.134  -6.839  50.161  1.00 42.64  ? 318 GLN A CD  1 
ATOM   2471 O  OE1 . GLN A 1 318 ? 25.681  -7.101  51.281  1.00 45.19  ? 318 GLN A OE1 1 
ATOM   2472 N  NE2 . GLN A 1 318 ? 27.293  -6.191  49.978  1.00 43.71  ? 318 GLN A NE2 1 
ATOM   2473 N  N   . ILE A 1 319 ? 21.024  -5.611  48.289  1.00 28.48  ? 319 ILE A N   1 
ATOM   2474 C  CA  . ILE A 1 319 ? 19.605  -5.617  48.602  1.00 17.61  ? 319 ILE A CA  1 
ATOM   2475 C  C   . ILE A 1 319 ? 19.031  -6.956  48.178  1.00 29.49  ? 319 ILE A C   1 
ATOM   2476 O  O   . ILE A 1 319 ? 19.506  -7.602  47.237  1.00 37.13  ? 319 ILE A O   1 
ATOM   2477 C  CB  . ILE A 1 319 ? 18.850  -4.463  47.919  1.00 17.24  ? 319 ILE A CB  1 
ATOM   2478 C  CG1 . ILE A 1 319 ? 19.045  -4.558  46.405  1.00 26.84  ? 319 ILE A CG1 1 
ATOM   2479 C  CG2 . ILE A 1 319 ? 19.338  -3.115  48.461  1.00 17.16  ? 319 ILE A CG2 1 
ATOM   2480 C  CD1 . ILE A 1 319 ? 18.125  -3.673  45.626  1.00 31.53  ? 319 ILE A CD1 1 
ATOM   2481 N  N   . LEU A 1 320 ? 18.015  -7.383  48.904  1.00 22.05  ? 320 LEU A N   1 
ATOM   2482 C  CA  . LEU A 1 320 ? 17.208  -8.529  48.537  1.00 21.94  ? 320 LEU A CA  1 
ATOM   2483 C  C   . LEU A 1 320 ? 15.764  -8.055  48.529  1.00 18.81  ? 320 LEU A C   1 
ATOM   2484 O  O   . LEU A 1 320 ? 15.334  -7.338  49.436  1.00 19.57  ? 320 LEU A O   1 
ATOM   2485 C  CB  . LEU A 1 320 ? 17.429  -9.691  49.507  1.00 17.70  ? 320 LEU A CB  1 
ATOM   2486 C  CG  . LEU A 1 320 ? 16.518  -10.895 49.262  1.00 31.28  ? 320 LEU A CG  1 
ATOM   2487 C  CD1 . LEU A 1 320 ? 17.204  -12.224 49.626  1.00 23.50  ? 320 LEU A CD1 1 
ATOM   2488 C  CD2 . LEU A 1 320 ? 15.194  -10.761 50.014  1.00 38.27  ? 320 LEU A CD2 1 
ATOM   2489 N  N   . LEU A 1 321 ? 15.017  -8.413  47.498  1.00 17.97  ? 321 LEU A N   1 
ATOM   2490 C  CA  . LEU A 1 321 ? 13.731  -7.746  47.369  1.00 21.04  ? 321 LEU A CA  1 
ATOM   2491 C  C   . LEU A 1 321 ? 12.863  -8.518  46.395  1.00 21.38  ? 321 LEU A C   1 
ATOM   2492 O  O   . LEU A 1 321 ? 13.359  -9.321  45.603  1.00 22.03  ? 321 LEU A O   1 
ATOM   2493 C  CB  . LEU A 1 321 ? 13.897  -6.294  46.921  1.00 21.37  ? 321 LEU A CB  1 
ATOM   2494 C  CG  . LEU A 1 321 ? 14.302  -6.006  45.477  1.00 24.14  ? 321 LEU A CG  1 
ATOM   2495 C  CD1 . LEU A 1 321 ? 14.367  -4.497  45.257  1.00 16.30  ? 321 LEU A CD1 1 
ATOM   2496 C  CD2 . LEU A 1 321 ? 15.623  -6.670  45.090  1.00 24.77  ? 321 LEU A CD2 1 
ATOM   2497 N  N   . GLY A 1 322 ? 11.559  -8.279  46.479  1.00 30.06  ? 322 GLY A N   1 
ATOM   2498 C  CA  . GLY A 1 322 ? 10.626  -9.022  45.653  1.00 33.53  ? 322 GLY A CA  1 
ATOM   2499 C  C   . GLY A 1 322 ? 9.205   -8.551  45.856  1.00 23.93  ? 322 GLY A C   1 
ATOM   2500 O  O   . GLY A 1 322 ? 8.946   -7.559  46.547  1.00 20.09  ? 322 GLY A O   1 
ATOM   2501 N  N   . VAL A 1 323 ? 8.281   -9.281  45.228  1.00 16.29  ? 323 VAL A N   1 
ATOM   2502 C  CA  . VAL A 1 323 ? 6.883   -8.873  45.144  1.00 18.87  ? 323 VAL A CA  1 
ATOM   2503 C  C   . VAL A 1 323 ? 6.013   -10.116 45.187  1.00 25.19  ? 323 VAL A C   1 
ATOM   2504 O  O   . VAL A 1 323 ? 6.451   -11.227 44.867  1.00 16.84  ? 323 VAL A O   1 
ATOM   2505 C  CB  . VAL A 1 323 ? 6.567   -8.061  43.857  1.00 25.80  ? 323 VAL A CB  1 
ATOM   2506 C  CG1 . VAL A 1 323 ? 7.271   -6.710  43.869  1.00 28.00  ? 323 VAL A CG1 1 
ATOM   2507 C  CG2 . VAL A 1 323 ? 6.948   -8.857  42.587  1.00 16.59  ? 323 VAL A CG2 1 
ATOM   2508 N  N   . ASN A 1 324 ? 4.761   -9.915  45.572  1.00 28.69  ? 324 ASN A N   1 
ATOM   2509 C  CA  . ASN A 1 324 ? 3.749   -10.953 45.498  1.00 27.95  ? 324 ASN A CA  1 
ATOM   2510 C  C   . ASN A 1 324 ? 3.088   -10.949 44.123  1.00 26.68  ? 324 ASN A C   1 
ATOM   2511 O  O   . ASN A 1 324 ? 3.225   -10.007 43.339  1.00 18.77  ? 324 ASN A O   1 
ATOM   2512 C  CB  . ASN A 1 324 ? 2.705   -10.752 46.589  1.00 35.13  ? 324 ASN A CB  1 
ATOM   2513 C  CG  . ASN A 1 324 ? 3.277   -10.942 47.967  1.00 32.55  ? 324 ASN A CG  1 
ATOM   2514 O  OD1 . ASN A 1 324 ? 4.467   -11.195 48.110  1.00 33.91  ? 324 ASN A OD1 1 
ATOM   2515 N  ND2 . ASN A 1 324 ? 2.438   -10.810 48.991  1.00 28.51  ? 324 ASN A ND2 1 
ATOM   2516 N  N   . LYS A 1 325 ? 2.336   -12.018 43.850  1.00 31.88  ? 325 LYS A N   1 
ATOM   2517 C  CA  . LYS A 1 325 ? 1.734   -12.203 42.533  1.00 24.38  ? 325 LYS A CA  1 
ATOM   2518 C  C   . LYS A 1 325 ? 0.508   -11.323 42.331  1.00 24.41  ? 325 LYS A C   1 
ATOM   2519 O  O   . LYS A 1 325 ? 0.272   -10.839 41.223  1.00 34.30  ? 325 LYS A O   1 
ATOM   2520 C  CB  . LYS A 1 325 ? 1.362   -13.668 42.337  1.00 26.25  ? 325 LYS A CB  1 
ATOM   2521 C  CG  . LYS A 1 325 ? 0.437   -13.917 41.167  1.00 39.78  ? 325 LYS A CG  1 
ATOM   2522 C  CD  . LYS A 1 325 ? 0.779   -15.213 40.449  1.00 39.47  ? 325 LYS A CD  1 
ATOM   2523 C  CE  . LYS A 1 325 ? -0.403  -15.698 39.651  1.00 37.10  ? 325 LYS A CE  1 
ATOM   2524 N  NZ  . LYS A 1 325 ? -1.425  -16.214 40.589  1.00 42.51  ? 325 LYS A NZ  1 
ATOM   2525 N  N   . ASP A 1 326 ? -0.275  -11.099 43.377  1.00 31.48  ? 326 ASP A N   1 
ATOM   2526 C  CA  . ASP A 1 326 ? -1.538  -10.368 43.284  1.00 36.06  ? 326 ASP A CA  1 
ATOM   2527 C  C   . ASP A 1 326 ? -1.509  -9.209  44.271  1.00 40.04  ? 326 ASP A C   1 
ATOM   2528 O  O   . ASP A 1 326 ? -2.289  -9.176  45.221  1.00 42.96  ? 326 ASP A O   1 
ATOM   2529 C  CB  . ASP A 1 326 ? -2.706  -11.292 43.557  1.00 31.23  ? 326 ASP A CB  1 
ATOM   2530 C  CG  . ASP A 1 326 ? -2.568  -12.613 42.844  1.00 39.28  ? 326 ASP A CG  1 
ATOM   2531 O  OD1 . ASP A 1 326 ? -3.048  -12.739 41.696  1.00 56.14  ? 326 ASP A OD1 1 
ATOM   2532 O  OD2 . ASP A 1 326 ? -1.953  -13.523 43.426  1.00 35.89  ? 326 ASP A OD2 1 
ATOM   2533 N  N   . GLU A 1 327 ? -0.605  -8.257  44.036  1.00 44.77  ? 327 GLU A N   1 
ATOM   2534 C  CA  . GLU A 1 327 ? -0.522  -7.089  44.906  1.00 40.65  ? 327 GLU A CA  1 
ATOM   2535 C  C   . GLU A 1 327 ? -1.850  -6.355  44.992  1.00 41.05  ? 327 GLU A C   1 
ATOM   2536 O  O   . GLU A 1 327 ? -2.212  -5.846  46.058  1.00 50.38  ? 327 GLU A O   1 
ATOM   2537 C  CB  . GLU A 1 327 ? 0.561   -6.134  44.412  1.00 41.81  ? 327 GLU A CB  1 
ATOM   2538 C  CG  . GLU A 1 327 ? 1.959   -6.713  44.462  1.00 58.87  ? 327 GLU A CG  1 
ATOM   2539 C  CD  . GLU A 1 327 ? 2.431   -7.018  45.878  1.00 64.08  ? 327 GLU A CD  1 
ATOM   2540 O  OE1 . GLU A 1 327 ? 1.770   -6.586  46.851  1.00 66.05  ? 327 GLU A OE1 1 
ATOM   2541 O  OE2 . GLU A 1 327 ? 3.470   -7.700  46.014  1.00 68.49  ? 327 GLU A OE2 1 
ATOM   2542 N  N   . GLY A 1 328 ? -2.598  -6.299  43.888  1.00 31.89  ? 328 GLY A N   1 
ATOM   2543 C  CA  . GLY A 1 328 ? -3.720  -5.388  43.835  1.00 30.88  ? 328 GLY A CA  1 
ATOM   2544 C  C   . GLY A 1 328 ? -5.061  -5.869  44.359  1.00 30.78  ? 328 GLY A C   1 
ATOM   2545 O  O   . GLY A 1 328 ? -5.956  -5.052  44.599  1.00 16.17  ? 328 GLY A O   1 
ATOM   2546 N  N   . SER A 1 329 ? -5.237  -7.171  44.561  1.00 23.88  ? 329 SER A N   1 
ATOM   2547 C  CA  . SER A 1 329 ? -6.566  -7.670  44.876  1.00 20.55  ? 329 SER A CA  1 
ATOM   2548 C  C   . SER A 1 329 ? -7.124  -7.030  46.147  1.00 22.01  ? 329 SER A C   1 
ATOM   2549 O  O   . SER A 1 329 ? -8.317  -6.711  46.209  1.00 33.32  ? 329 SER A O   1 
ATOM   2550 C  CB  . SER A 1 329 ? -6.531  -9.188  44.980  1.00 24.10  ? 329 SER A CB  1 
ATOM   2551 O  OG  . SER A 1 329 ? -5.784  -9.593  46.104  1.00 38.36  ? 329 SER A OG  1 
ATOM   2552 N  N   . PHE A 1 330 ? -6.282  -6.805  47.158  1.00 20.62  ? 330 PHE A N   1 
ATOM   2553 C  CA  . PHE A 1 330 ? -6.775  -6.180  48.386  1.00 28.06  ? 330 PHE A CA  1 
ATOM   2554 C  C   . PHE A 1 330 ? -7.398  -4.818  48.098  1.00 24.30  ? 330 PHE A C   1 
ATOM   2555 O  O   . PHE A 1 330 ? -8.491  -4.506  48.594  1.00 21.76  ? 330 PHE A O   1 
ATOM   2556 C  CB  . PHE A 1 330 ? -5.649  -6.045  49.422  1.00 31.05  ? 330 PHE A CB  1 
ATOM   2557 C  CG  . PHE A 1 330 ? -6.138  -5.752  50.818  1.00 41.53  ? 330 PHE A CG  1 
ATOM   2558 C  CD1 . PHE A 1 330 ? -6.410  -6.790  51.707  1.00 49.36  ? 330 PHE A CD1 1 
ATOM   2559 C  CD2 . PHE A 1 330 ? -6.336  -4.444  51.245  1.00 46.92  ? 330 PHE A CD2 1 
ATOM   2560 C  CE1 . PHE A 1 330 ? -6.874  -6.531  53.000  1.00 44.98  ? 330 PHE A CE1 1 
ATOM   2561 C  CE2 . PHE A 1 330 ? -6.795  -4.175  52.534  1.00 50.77  ? 330 PHE A CE2 1 
ATOM   2562 C  CZ  . PHE A 1 330 ? -7.064  -5.226  53.414  1.00 44.45  ? 330 PHE A CZ  1 
ATOM   2563 N  N   . PHE A 1 331 ? -6.741  -4.006  47.269  1.00 22.71  ? 331 PHE A N   1 
ATOM   2564 C  CA  . PHE A 1 331 ? -7.197  -2.634  47.083  1.00 28.33  ? 331 PHE A CA  1 
ATOM   2565 C  C   . PHE A 1 331 ? -8.402  -2.527  46.158  1.00 31.01  ? 331 PHE A C   1 
ATOM   2566 O  O   . PHE A 1 331 ? -9.186  -1.581  46.289  1.00 37.01  ? 331 PHE A O   1 
ATOM   2567 C  CB  . PHE A 1 331 ? -6.047  -1.772  46.578  1.00 24.45  ? 331 PHE A CB  1 
ATOM   2568 C  CG  . PHE A 1 331 ? -4.904  -1.703  47.539  1.00 28.10  ? 331 PHE A CG  1 
ATOM   2569 C  CD1 . PHE A 1 331 ? -3.870  -2.627  47.474  1.00 25.20  ? 331 PHE A CD1 1 
ATOM   2570 C  CD2 . PHE A 1 331 ? -4.881  -0.726  48.538  1.00 31.33  ? 331 PHE A CD2 1 
ATOM   2571 C  CE1 . PHE A 1 331 ? -2.814  -2.568  48.380  1.00 29.39  ? 331 PHE A CE1 1 
ATOM   2572 C  CE2 . PHE A 1 331 ? -3.835  -0.646  49.437  1.00 23.07  ? 331 PHE A CE2 1 
ATOM   2573 C  CZ  . PHE A 1 331 ? -2.794  -1.571  49.359  1.00 31.35  ? 331 PHE A CZ  1 
ATOM   2574 N  N   . LEU A 1 332 ? -8.580  -3.465  45.229  1.00 16.42  ? 332 LEU A N   1 
ATOM   2575 C  CA  . LEU A 1 332 ? -9.835  -3.476  44.482  1.00 32.34  ? 332 LEU A CA  1 
ATOM   2576 C  C   . LEU A 1 332 ? -11.013 -3.823  45.386  1.00 36.92  ? 332 LEU A C   1 
ATOM   2577 O  O   . LEU A 1 332 ? -12.102 -3.251  45.245  1.00 34.13  ? 332 LEU A O   1 
ATOM   2578 C  CB  . LEU A 1 332 ? -9.754  -4.441  43.301  1.00 17.30  ? 332 LEU A CB  1 
ATOM   2579 C  CG  . LEU A 1 332 ? -8.563  -4.107  42.413  1.00 23.01  ? 332 LEU A CG  1 
ATOM   2580 C  CD1 . LEU A 1 332 ? -8.100  -5.320  41.606  1.00 27.18  ? 332 LEU A CD1 1 
ATOM   2581 C  CD2 . LEU A 1 332 ? -8.903  -2.936  41.520  1.00 20.75  ? 332 LEU A CD2 1 
ATOM   2582 N  N   . LEU A 1 333 ? -10.805 -4.740  46.335  1.00 29.92  ? 333 LEU A N   1 
ATOM   2583 C  CA  . LEU A 1 333 ? -11.903 -5.197  47.176  1.00 23.62  ? 333 LEU A CA  1 
ATOM   2584 C  C   . LEU A 1 333 ? -12.440 -4.070  48.032  1.00 31.10  ? 333 LEU A C   1 
ATOM   2585 O  O   . LEU A 1 333 ? -13.618 -4.075  48.405  1.00 40.44  ? 333 LEU A O   1 
ATOM   2586 C  CB  . LEU A 1 333 ? -11.447 -6.357  48.061  1.00 26.52  ? 333 LEU A CB  1 
ATOM   2587 C  CG  . LEU A 1 333 ? -12.408 -6.749  49.189  1.00 33.65  ? 333 LEU A CG  1 
ATOM   2588 C  CD1 . LEU A 1 333 ? -13.666 -7.362  48.610  1.00 38.64  ? 333 LEU A CD1 1 
ATOM   2589 C  CD2 . LEU A 1 333 ? -11.777 -7.707  50.166  1.00 37.32  ? 333 LEU A CD2 1 
ATOM   2590 N  N   . TYR A 1 334 ? -11.606 -3.082  48.331  1.00 36.35  ? 334 TYR A N   1 
ATOM   2591 C  CA  . TYR A 1 334 ? -12.025 -1.969  49.169  1.00 40.89  ? 334 TYR A CA  1 
ATOM   2592 C  C   . TYR A 1 334 ? -12.520 -0.761  48.384  1.00 44.35  ? 334 TYR A C   1 
ATOM   2593 O  O   . TYR A 1 334 ? -13.419 -0.060  48.850  1.00 45.79  ? 334 TYR A O   1 
ATOM   2594 C  CB  . TYR A 1 334 ? -10.873 -1.550  50.088  1.00 37.16  ? 334 TYR A CB  1 
ATOM   2595 C  CG  . TYR A 1 334 ? -10.709 -2.451  51.299  1.00 43.06  ? 334 TYR A CG  1 
ATOM   2596 C  CD1 . TYR A 1 334 ? -10.178 -3.735  51.183  1.00 47.19  ? 334 TYR A CD1 1 
ATOM   2597 C  CD2 . TYR A 1 334 ? -11.096 -2.017  52.562  1.00 43.42  ? 334 TYR A CD2 1 
ATOM   2598 C  CE1 . TYR A 1 334 ? -10.037 -4.550  52.296  1.00 42.64  ? 334 TYR A CE1 1 
ATOM   2599 C  CE2 . TYR A 1 334 ? -10.950 -2.820  53.676  1.00 40.68  ? 334 TYR A CE2 1 
ATOM   2600 C  CZ  . TYR A 1 334 ? -10.420 -4.077  53.541  1.00 38.22  ? 334 TYR A CZ  1 
ATOM   2601 O  OH  . TYR A 1 334 ? -10.291 -4.856  54.660  1.00 30.12  ? 334 TYR A OH  1 
ATOM   2602 N  N   . GLY A 1 335 ? -11.988 -0.494  47.203  1.00 50.23  ? 335 GLY A N   1 
ATOM   2603 C  CA  . GLY A 1 335 ? -12.311 0.778   46.602  1.00 45.74  ? 335 GLY A CA  1 
ATOM   2604 C  C   . GLY A 1 335 ? -12.975 0.724   45.247  1.00 34.84  ? 335 GLY A C   1 
ATOM   2605 O  O   . GLY A 1 335 ? -13.379 1.770   44.736  1.00 35.66  ? 335 GLY A O   1 
ATOM   2606 N  N   . ALA A 1 336 ? -13.103 -0.462  44.650  1.00 31.53  ? 336 ALA A N   1 
ATOM   2607 C  CA  . ALA A 1 336 ? -13.478 -0.508  43.241  1.00 28.66  ? 336 ALA A CA  1 
ATOM   2608 C  C   . ALA A 1 336 ? -14.769 -1.293  43.030  1.00 26.95  ? 336 ALA A C   1 
ATOM   2609 O  O   . ALA A 1 336 ? -14.946 -2.374  43.599  1.00 37.89  ? 336 ALA A O   1 
ATOM   2610 C  CB  . ALA A 1 336 ? -12.358 -1.126  42.395  1.00 17.79  ? 336 ALA A CB  1 
ATOM   2611 N  N   . PRO A 1 337 ? -15.668 -0.792  42.199  1.00 25.50  ? 337 PRO A N   1 
ATOM   2612 C  CA  . PRO A 1 337 ? -16.997 -1.402  42.099  1.00 29.19  ? 337 PRO A CA  1 
ATOM   2613 C  C   . PRO A 1 337 ? -16.956 -2.788  41.467  1.00 28.94  ? 337 PRO A C   1 
ATOM   2614 O  O   . PRO A 1 337 ? -16.022 -3.146  40.747  1.00 32.56  ? 337 PRO A O   1 
ATOM   2615 C  CB  . PRO A 1 337 ? -17.761 -0.413  41.216  1.00 33.09  ? 337 PRO A CB  1 
ATOM   2616 C  CG  . PRO A 1 337 ? -16.691 0.162   40.329  1.00 35.04  ? 337 PRO A CG  1 
ATOM   2617 C  CD  . PRO A 1 337 ? -15.463 0.272   41.201  1.00 32.59  ? 337 PRO A CD  1 
ATOM   2618 N  N   . GLY A 1 338 ? -17.990 -3.578  41.760  1.00 26.08  ? 338 GLY A N   1 
ATOM   2619 C  CA  . GLY A 1 338 ? -18.143 -4.904  41.202  1.00 25.56  ? 338 GLY A CA  1 
ATOM   2620 C  C   . GLY A 1 338 ? -17.443 -6.008  41.966  1.00 31.37  ? 338 GLY A C   1 
ATOM   2621 O  O   . GLY A 1 338 ? -17.746 -7.191  41.739  1.00 29.67  ? 338 GLY A O   1 
ATOM   2622 N  N   . PHE A 1 339 ? -16.513 -5.656  42.852  1.00 31.11  ? 339 PHE A N   1 
ATOM   2623 C  CA  . PHE A 1 339 ? -15.768 -6.613  43.653  1.00 30.26  ? 339 PHE A CA  1 
ATOM   2624 C  C   . PHE A 1 339 ? -16.445 -6.830  44.998  1.00 31.94  ? 339 PHE A C   1 
ATOM   2625 O  O   . PHE A 1 339 ? -16.884 -5.878  45.649  1.00 28.33  ? 339 PHE A O   1 
ATOM   2626 C  CB  . PHE A 1 339 ? -14.342 -6.114  43.885  1.00 38.59  ? 339 PHE A CB  1 
ATOM   2627 C  CG  . PHE A 1 339 ? -13.523 -6.064  42.646  1.00 42.72  ? 339 PHE A CG  1 
ATOM   2628 C  CD1 . PHE A 1 339 ? -12.729 -7.144  42.286  1.00 41.15  ? 339 PHE A CD1 1 
ATOM   2629 C  CD2 . PHE A 1 339 ? -13.556 -4.951  41.828  1.00 41.57  ? 339 PHE A CD2 1 
ATOM   2630 C  CE1 . PHE A 1 339 ? -11.975 -7.113  41.138  1.00 26.88  ? 339 PHE A CE1 1 
ATOM   2631 C  CE2 . PHE A 1 339 ? -12.809 -4.913  40.672  1.00 39.91  ? 339 PHE A CE2 1 
ATOM   2632 C  CZ  . PHE A 1 339 ? -12.015 -6.001  40.327  1.00 33.24  ? 339 PHE A CZ  1 
ATOM   2633 N  N   . SER A 1 340 ? -16.498 -8.088  45.423  1.00 27.24  ? 340 SER A N   1 
ATOM   2634 C  CA  . SER A 1 340 ? -17.041 -8.446  46.720  1.00 28.23  ? 340 SER A CA  1 
ATOM   2635 C  C   . SER A 1 340 ? -16.169 -9.520  47.348  1.00 36.73  ? 340 SER A C   1 
ATOM   2636 O  O   . SER A 1 340 ? -15.508 -10.296 46.649  1.00 30.66  ? 340 SER A O   1 
ATOM   2637 C  CB  . SER A 1 340 ? -18.483 -8.944  46.612  1.00 38.74  ? 340 SER A CB  1 
ATOM   2638 O  OG  . SER A 1 340 ? -18.812 -9.761  47.722  1.00 46.96  ? 340 SER A OG  1 
ATOM   2639 N  N   . LYS A 1 341 ? -16.174 -9.550  48.686  1.00 43.65  ? 341 LYS A N   1 
ATOM   2640 C  CA  . LYS A 1 341 ? -15.425 -10.567 49.418  1.00 37.82  ? 341 LYS A CA  1 
ATOM   2641 C  C   . LYS A 1 341 ? -16.060 -11.942 49.272  1.00 31.90  ? 341 LYS A C   1 
ATOM   2642 O  O   . LYS A 1 341 ? -15.356 -12.959 49.289  1.00 30.85  ? 341 LYS A O   1 
ATOM   2643 C  CB  . LYS A 1 341 ? -15.324 -10.180 50.900  1.00 41.43  ? 341 LYS A CB  1 
ATOM   2644 C  CG  . LYS A 1 341 ? -15.020 -11.341 51.860  1.00 42.00  ? 341 LYS A CG  1 
ATOM   2645 C  CD  . LYS A 1 341 ? -14.559 -10.850 53.232  1.00 39.97  ? 341 LYS A CD  1 
ATOM   2646 C  CE  . LYS A 1 341 ? -15.475 -11.339 54.348  1.00 43.84  ? 341 LYS A CE  1 
ATOM   2647 N  NZ  . LYS A 1 341 ? -15.908 -12.752 54.129  1.00 45.52  ? 341 LYS A NZ  1 
ATOM   2648 N  N   . ASP A 1 342 ? -17.377 -11.995 49.112  1.00 33.02  ? 342 ASP A N   1 
ATOM   2649 C  CA  . ASP A 1 342 ? -18.087 -13.262 49.163  1.00 48.01  ? 342 ASP A CA  1 
ATOM   2650 C  C   . ASP A 1 342 ? -18.440 -13.807 47.784  1.00 47.08  ? 342 ASP A C   1 
ATOM   2651 O  O   . ASP A 1 342 ? -18.884 -14.956 47.687  1.00 48.92  ? 342 ASP A O   1 
ATOM   2652 C  CB  . ASP A 1 342 ? -19.357 -13.116 50.019  1.00 54.61  ? 342 ASP A CB  1 
ATOM   2653 C  CG  . ASP A 1 342 ? -19.097 -12.372 51.334  1.00 65.18  ? 342 ASP A CG  1 
ATOM   2654 O  OD1 . ASP A 1 342 ? -18.325 -12.885 52.183  1.00 67.17  ? 342 ASP A OD1 1 
ATOM   2655 O  OD2 . ASP A 1 342 ? -19.673 -11.273 51.521  1.00 67.22  ? 342 ASP A OD2 1 
ATOM   2656 N  N   . SER A 1 343 ? -18.240 -13.037 46.724  1.00 42.91  ? 343 SER A N   1 
ATOM   2657 C  CA  . SER A 1 343 ? -18.538 -13.509 45.382  1.00 47.37  ? 343 SER A CA  1 
ATOM   2658 C  C   . SER A 1 343 ? -17.249 -13.758 44.613  1.00 49.65  ? 343 SER A C   1 
ATOM   2659 O  O   . SER A 1 343 ? -16.142 -13.461 45.077  1.00 46.85  ? 343 SER A O   1 
ATOM   2660 C  CB  . SER A 1 343 ? -19.427 -12.511 44.628  1.00 48.54  ? 343 SER A CB  1 
ATOM   2661 O  OG  . SER A 1 343 ? -18.660 -11.562 43.910  1.00 42.94  ? 343 SER A OG  1 
ATOM   2662 N  N   . GLU A 1 344 ? -17.414 -14.330 43.416  1.00 49.39  ? 344 GLU A N   1 
ATOM   2663 C  CA  . GLU A 1 344 ? -16.290 -14.502 42.508  1.00 41.16  ? 344 GLU A CA  1 
ATOM   2664 C  C   . GLU A 1 344 ? -15.794 -13.179 41.955  1.00 32.84  ? 344 GLU A C   1 
ATOM   2665 O  O   . GLU A 1 344 ? -14.693 -13.134 41.407  1.00 40.56  ? 344 GLU A O   1 
ATOM   2666 C  CB  . GLU A 1 344 ? -16.681 -15.405 41.351  1.00 45.18  ? 344 GLU A CB  1 
ATOM   2667 C  CG  . GLU A 1 344 ? -15.766 -16.580 41.122  1.00 58.38  ? 344 GLU A CG  1 
ATOM   2668 C  CD  . GLU A 1 344 ? -16.233 -17.421 39.941  1.00 76.63  ? 344 GLU A CD  1 
ATOM   2669 O  OE1 . GLU A 1 344 ? -15.704 -18.537 39.741  1.00 83.31  ? 344 GLU A OE1 1 
ATOM   2670 O  OE2 . GLU A 1 344 ? -17.142 -16.964 39.213  1.00 77.53  ? 344 GLU A OE2 1 
ATOM   2671 N  N   . SER A 1 345 ? -16.581 -12.116 42.079  1.00 22.74  ? 345 SER A N   1 
ATOM   2672 C  CA  . SER A 1 345 ? -16.217 -10.796 41.584  1.00 34.40  ? 345 SER A CA  1 
ATOM   2673 C  C   . SER A 1 345 ? -15.863 -10.862 40.101  1.00 32.56  ? 345 SER A C   1 
ATOM   2674 O  O   . SER A 1 345 ? -14.736 -10.622 39.681  1.00 21.81  ? 345 SER A O   1 
ATOM   2675 C  CB  . SER A 1 345 ? -15.066 -10.189 42.398  1.00 32.10  ? 345 SER A CB  1 
ATOM   2676 O  OG  . SER A 1 345 ? -15.402 -10.075 43.771  1.00 39.65  ? 345 SER A OG  1 
ATOM   2677 N  N   . LYS A 1 346 ? -16.842 -11.232 39.298  1.00 31.65  ? 346 LYS A N   1 
ATOM   2678 C  CA  . LYS A 1 346 ? -16.679 -10.927 37.894  1.00 23.84  ? 346 LYS A CA  1 
ATOM   2679 C  C   . LYS A 1 346 ? -17.108 -9.487  37.684  1.00 32.52  ? 346 LYS A C   1 
ATOM   2680 O  O   . LYS A 1 346 ? -17.905 -8.931  38.449  1.00 43.39  ? 346 LYS A O   1 
ATOM   2681 C  CB  . LYS A 1 346 ? -17.450 -11.893 37.000  1.00 26.58  ? 346 LYS A CB  1 
ATOM   2682 C  CG  . LYS A 1 346 ? -17.283 -13.355 37.367  1.00 37.19  ? 346 LYS A CG  1 
ATOM   2683 C  CD  . LYS A 1 346 ? -18.148 -14.235 36.481  1.00 49.14  ? 346 LYS A CD  1 
ATOM   2684 C  CE  . LYS A 1 346 ? -17.836 -15.715 36.674  1.00 63.02  ? 346 LYS A CE  1 
ATOM   2685 N  NZ  . LYS A 1 346 ? -19.091 -16.527 36.804  1.00 63.89  ? 346 LYS A NZ  1 
ATOM   2686 N  N   . ILE A 1 347 ? -16.509 -8.855  36.688  1.00 33.36  ? 347 ILE A N   1 
ATOM   2687 C  CA  . ILE A 1 347 ? -16.594 -7.416  36.530  1.00 33.03  ? 347 ILE A CA  1 
ATOM   2688 C  C   . ILE A 1 347 ? -17.121 -7.133  35.133  1.00 35.72  ? 347 ILE A C   1 
ATOM   2689 O  O   . ILE A 1 347 ? -16.431 -7.375  34.131  1.00 37.70  ? 347 ILE A O   1 
ATOM   2690 C  CB  . ILE A 1 347 ? -15.239 -6.738  36.787  1.00 43.77  ? 347 ILE A CB  1 
ATOM   2691 C  CG1 . ILE A 1 347 ? -15.083 -6.446  38.284  1.00 34.92  ? 347 ILE A CG1 1 
ATOM   2692 C  CG2 . ILE A 1 347 ? -15.072 -5.447  35.995  1.00 52.15  ? 347 ILE A CG2 1 
ATOM   2693 C  CD1 . ILE A 1 347 ? -14.899 -7.652  39.127  1.00 21.00  ? 347 ILE A CD1 1 
ATOM   2694 N  N   . SER A 1 348 ? -18.366 -6.678  35.065  1.00 36.24  ? 348 SER A N   1 
ATOM   2695 C  CA  . SER A 1 348 ? -18.876 -6.097  33.836  1.00 31.15  ? 348 SER A CA  1 
ATOM   2696 C  C   . SER A 1 348 ? -17.887 -5.071  33.320  1.00 35.40  ? 348 SER A C   1 
ATOM   2697 O  O   . SER A 1 348 ? -17.243 -4.361  34.093  1.00 41.02  ? 348 SER A O   1 
ATOM   2698 C  CB  . SER A 1 348 ? -20.216 -5.401  34.057  1.00 43.71  ? 348 SER A CB  1 
ATOM   2699 O  OG  . SER A 1 348 ? -20.002 -4.014  34.288  1.00 43.94  ? 348 SER A OG  1 
ATOM   2700 N  N   . ARG A 1 349 ? -17.792 -4.980  31.994  1.00 43.61  ? 349 ARG A N   1 
ATOM   2701 C  CA  . ARG A 1 349 ? -16.827 -4.078  31.378  1.00 38.95  ? 349 ARG A CA  1 
ATOM   2702 C  C   . ARG A 1 349 ? -17.037 -2.640  31.837  1.00 32.43  ? 349 ARG A C   1 
ATOM   2703 O  O   . ARG A 1 349 ? -16.067 -1.889  31.989  1.00 30.76  ? 349 ARG A O   1 
ATOM   2704 C  CB  . ARG A 1 349 ? -16.892 -4.166  29.848  1.00 40.24  ? 349 ARG A CB  1 
ATOM   2705 C  CG  . ARG A 1 349 ? -15.911 -3.207  29.212  1.00 42.67  ? 349 ARG A CG  1 
ATOM   2706 C  CD  . ARG A 1 349 ? -14.861 -3.974  28.478  1.00 39.66  ? 349 ARG A CD  1 
ATOM   2707 N  NE  . ARG A 1 349 ? -13.898 -3.040  27.920  1.00 41.77  ? 349 ARG A NE  1 
ATOM   2708 C  CZ  . ARG A 1 349 ? -12.587 -3.108  28.078  1.00 38.22  ? 349 ARG A CZ  1 
ATOM   2709 N  NH1 . ARG A 1 349 ? -12.065 -4.083  28.791  1.00 23.63  ? 349 ARG A NH1 1 
ATOM   2710 N  NH2 . ARG A 1 349 ? -11.834 -2.186  27.496  1.00 50.53  ? 349 ARG A NH2 1 
ATOM   2711 N  N   . GLU A 1 350 ? -18.291 -2.235  32.046  1.00 35.09  ? 350 GLU A N   1 
ATOM   2712 C  CA  . GLU A 1 350 ? -18.567 -0.889  32.541  1.00 35.94  ? 350 GLU A CA  1 
ATOM   2713 C  C   . GLU A 1 350 ? -17.865 -0.624  33.869  1.00 32.54  ? 350 GLU A C   1 
ATOM   2714 O  O   . GLU A 1 350 ? -17.335 0.471   34.100  1.00 26.05  ? 350 GLU A O   1 
ATOM   2715 C  CB  . GLU A 1 350 ? -20.068 -0.710  32.692  1.00 44.17  ? 350 GLU A CB  1 
ATOM   2716 C  CG  . GLU A 1 350 ? -20.568 0.680   32.441  1.00 52.45  ? 350 GLU A CG  1 
ATOM   2717 C  CD  . GLU A 1 350 ? -21.962 0.921   33.014  1.00 64.57  ? 350 GLU A CD  1 
ATOM   2718 O  OE1 . GLU A 1 350 ? -22.168 0.705   34.239  1.00 63.36  ? 350 GLU A OE1 1 
ATOM   2719 O  OE2 . GLU A 1 350 ? -22.865 1.311   32.228  1.00 69.29  ? 350 GLU A OE2 1 
ATOM   2720 N  N   . ASP A 1 351 ? -17.865 -1.604  34.766  1.00 33.78  ? 351 ASP A N   1 
ATOM   2721 C  CA  . ASP A 1 351 ? -17.118 -1.402  35.997  1.00 36.60  ? 351 ASP A CA  1 
ATOM   2722 C  C   . ASP A 1 351 ? -15.621 -1.421  35.745  1.00 33.72  ? 351 ASP A C   1 
ATOM   2723 O  O   . ASP A 1 351 ? -14.868 -0.727  36.439  1.00 37.27  ? 351 ASP A O   1 
ATOM   2724 C  CB  . ASP A 1 351 ? -17.514 -2.447  37.030  1.00 40.59  ? 351 ASP A CB  1 
ATOM   2725 C  CG  . ASP A 1 351 ? -18.721 -2.023  37.827  1.00 52.25  ? 351 ASP A CG  1 
ATOM   2726 O  OD1 . ASP A 1 351 ? -19.420 -1.071  37.399  1.00 43.12  ? 351 ASP A OD1 1 
ATOM   2727 O  OD2 . ASP A 1 351 ? -18.965 -2.639  38.883  1.00 64.12  ? 351 ASP A OD2 1 
ATOM   2728 N  N   . PHE A 1 352 ? -15.174 -2.191  34.757  1.00 21.20  ? 352 PHE A N   1 
ATOM   2729 C  CA  . PHE A 1 352 ? -13.762 -2.192  34.401  1.00 30.75  ? 352 PHE A CA  1 
ATOM   2730 C  C   . PHE A 1 352 ? -13.266 -0.779  34.128  1.00 28.64  ? 352 PHE A C   1 
ATOM   2731 O  O   . PHE A 1 352 ? -12.169 -0.405  34.556  1.00 19.89  ? 352 PHE A O   1 
ATOM   2732 C  CB  . PHE A 1 352 ? -13.528 -3.094  33.187  1.00 34.07  ? 352 PHE A CB  1 
ATOM   2733 C  CG  . PHE A 1 352 ? -12.110 -3.133  32.727  1.00 28.34  ? 352 PHE A CG  1 
ATOM   2734 C  CD1 . PHE A 1 352 ? -11.237 -4.065  33.249  1.00 27.22  ? 352 PHE A CD1 1 
ATOM   2735 C  CD2 . PHE A 1 352 ? -11.648 -2.232  31.772  1.00 26.71  ? 352 PHE A CD2 1 
ATOM   2736 C  CE1 . PHE A 1 352 ? -9.913  -4.102  32.841  1.00 39.71  ? 352 PHE A CE1 1 
ATOM   2737 C  CE2 . PHE A 1 352 ? -10.327 -2.260  31.353  1.00 33.57  ? 352 PHE A CE2 1 
ATOM   2738 C  CZ  . PHE A 1 352 ? -9.456  -3.202  31.887  1.00 39.56  ? 352 PHE A CZ  1 
ATOM   2739 N  N   . MET A 1 353 ? -14.048 0.029   33.406  1.00 20.96  ? 353 MET A N   1 
ATOM   2740 C  CA  . MET A 1 353 ? -13.559 1.377   33.126  1.00 42.70  ? 353 MET A CA  1 
ATOM   2741 C  C   . MET A 1 353 ? -13.519 2.218   34.384  1.00 41.54  ? 353 MET A C   1 
ATOM   2742 O  O   . MET A 1 353 ? -12.553 2.956   34.620  1.00 28.28  ? 353 MET A O   1 
ATOM   2743 C  CB  . MET A 1 353 ? -14.387 2.123   32.086  1.00 57.85  ? 353 MET A CB  1 
ATOM   2744 C  CG  . MET A 1 353 ? -13.971 1.884   30.657  1.00 69.84  ? 353 MET A CG  1 
ATOM   2745 S  SD  . MET A 1 353 ? -14.112 0.166   30.229  1.00 83.77  ? 353 MET A SD  1 
ATOM   2746 C  CE  . MET A 1 353 ? -15.846 0.163   29.680  1.00 81.33  ? 353 MET A CE  1 
ATOM   2747 N  N   . SER A 1 354 ? -14.614 2.180   35.158  1.00 49.34  ? 354 SER A N   1 
ATOM   2748 C  CA  . SER A 1 354 ? -14.622 2.778   36.490  1.00 33.38  ? 354 SER A CA  1 
ATOM   2749 C  C   . SER A 1 354 ? -13.427 2.314   37.309  1.00 34.07  ? 354 SER A C   1 
ATOM   2750 O  O   . SER A 1 354 ? -12.778 3.126   37.983  1.00 29.64  ? 354 SER A O   1 
ATOM   2751 C  CB  . SER A 1 354 ? -15.921 2.430   37.210  1.00 28.06  ? 354 SER A CB  1 
ATOM   2752 O  OG  . SER A 1 354 ? -17.051 2.894   36.497  1.00 34.82  ? 354 SER A OG  1 
ATOM   2753 N  N   . GLY A 1 355 ? -13.132 1.008   37.275  1.00 30.95  ? 355 GLY A N   1 
ATOM   2754 C  CA  . GLY A 1 355 ? -11.958 0.502   37.966  1.00 29.75  ? 355 GLY A CA  1 
ATOM   2755 C  C   . GLY A 1 355 ? -10.654 1.080   37.446  1.00 32.03  ? 355 GLY A C   1 
ATOM   2756 O  O   . GLY A 1 355 ? -9.737  1.353   38.221  1.00 32.16  ? 355 GLY A O   1 
ATOM   2757 N  N   . VAL A 1 356 ? -10.545 1.257   36.126  1.00 41.54  ? 356 VAL A N   1 
ATOM   2758 C  CA  . VAL A 1 356 ? -9.290  1.720   35.533  1.00 37.20  ? 356 VAL A CA  1 
ATOM   2759 C  C   . VAL A 1 356 ? -9.025  3.164   35.915  1.00 34.21  ? 356 VAL A C   1 
ATOM   2760 O  O   . VAL A 1 356 ? -7.904  3.529   36.298  1.00 26.46  ? 356 VAL A O   1 
ATOM   2761 C  CB  . VAL A 1 356 ? -9.321  1.551   34.006  1.00 36.39  ? 356 VAL A CB  1 
ATOM   2762 C  CG1 . VAL A 1 356 ? -8.166  2.301   33.365  1.00 18.99  ? 356 VAL A CG1 1 
ATOM   2763 C  CG2 . VAL A 1 356 ? -9.255  0.087   33.643  1.00 40.14  ? 356 VAL A CG2 1 
ATOM   2764 N  N   . LYS A 1 357 ? -10.062 4.004   35.805  1.00 32.65  ? 357 LYS A N   1 
ATOM   2765 C  CA  . LYS A 1 357 ? -9.948  5.419   36.136  1.00 29.33  ? 357 LYS A CA  1 
ATOM   2766 C  C   . LYS A 1 357 ? -9.646  5.612   37.616  1.00 35.73  ? 357 LYS A C   1 
ATOM   2767 O  O   . LYS A 1 357 ? -9.003  6.596   38.002  1.00 49.31  ? 357 LYS A O   1 
ATOM   2768 C  CB  . LYS A 1 357 ? -11.232 6.145   35.719  1.00 19.03  ? 357 LYS A CB  1 
ATOM   2769 C  CG  . LYS A 1 357 ? -11.487 7.494   36.384  1.00 24.35  ? 357 LYS A CG  1 
ATOM   2770 C  CD  . LYS A 1 357 ? -10.877 8.618   35.557  1.00 29.78  ? 357 LYS A CD  1 
ATOM   2771 C  CE  . LYS A 1 357 ? -11.690 9.923   35.582  1.00 39.34  ? 357 LYS A CE  1 
ATOM   2772 N  NZ  . LYS A 1 357 ? -10.845 11.166  35.360  1.00 47.49  ? 357 LYS A NZ  1 
ATOM   2773 N  N   . LEU A 1 358 ? -10.077 4.669   38.452  1.00 30.36  ? 358 LEU A N   1 
ATOM   2774 C  CA  . LEU A 1 358 ? -9.732  4.711   39.864  1.00 30.72  ? 358 LEU A CA  1 
ATOM   2775 C  C   . LEU A 1 358 ? -8.264  4.370   40.070  1.00 42.03  ? 358 LEU A C   1 
ATOM   2776 O  O   . LEU A 1 358 ? -7.603  4.923   40.959  1.00 44.96  ? 358 LEU A O   1 
ATOM   2777 C  CB  . LEU A 1 358 ? -10.628 3.728   40.624  1.00 37.77  ? 358 LEU A CB  1 
ATOM   2778 C  CG  . LEU A 1 358 ? -11.712 4.138   41.638  1.00 29.13  ? 358 LEU A CG  1 
ATOM   2779 C  CD1 . LEU A 1 358 ? -12.056 5.609   41.559  1.00 17.59  ? 358 LEU A CD1 1 
ATOM   2780 C  CD2 . LEU A 1 358 ? -12.963 3.274   41.461  1.00 17.90  ? 358 LEU A CD2 1 
ATOM   2781 N  N   . SER A 1 359 ? -7.738  3.458   39.254  1.00 42.19  ? 359 SER A N   1 
ATOM   2782 C  CA  . SER A 1 359 ? -6.406  2.926   39.486  1.00 36.74  ? 359 SER A CA  1 
ATOM   2783 C  C   . SER A 1 359 ? -5.322  3.890   39.046  1.00 33.49  ? 359 SER A C   1 
ATOM   2784 O  O   . SER A 1 359 ? -4.238  3.907   39.637  1.00 37.15  ? 359 SER A O   1 
ATOM   2785 C  CB  . SER A 1 359 ? -6.250  1.592   38.766  1.00 42.55  ? 359 SER A CB  1 
ATOM   2786 O  OG  . SER A 1 359 ? -7.238  0.675   39.214  1.00 46.53  ? 359 SER A OG  1 
ATOM   2787 N  N   . VAL A 1 360 ? -5.581  4.694   38.026  1.00 31.45  ? 360 VAL A N   1 
ATOM   2788 C  CA  . VAL A 1 360 ? -4.591  5.669   37.578  1.00 35.53  ? 360 VAL A CA  1 
ATOM   2789 C  C   . VAL A 1 360 ? -5.219  7.051   37.718  1.00 38.12  ? 360 VAL A C   1 
ATOM   2790 O  O   . VAL A 1 360 ? -5.401  7.763   36.717  1.00 34.75  ? 360 VAL A O   1 
ATOM   2791 C  CB  . VAL A 1 360 ? -4.116  5.371   36.147  1.00 23.89  ? 360 VAL A CB  1 
ATOM   2792 C  CG1 . VAL A 1 360 ? -3.162  4.219   36.160  1.00 17.04  ? 360 VAL A CG1 1 
ATOM   2793 C  CG2 . VAL A 1 360 ? -5.279  4.981   35.302  1.00 31.17  ? 360 VAL A CG2 1 
ATOM   2794 N  N   . PRO A 1 361 ? -5.520  7.475   38.948  1.00 33.71  ? 361 PRO A N   1 
ATOM   2795 C  CA  . PRO A 1 361 ? -6.245  8.740   39.157  1.00 32.68  ? 361 PRO A CA  1 
ATOM   2796 C  C   . PRO A 1 361 ? -5.654  9.927   38.424  1.00 42.05  ? 361 PRO A C   1 
ATOM   2797 O  O   . PRO A 1 361 ? -6.391  10.851  38.045  1.00 43.69  ? 361 PRO A O   1 
ATOM   2798 C  CB  . PRO A 1 361 ? -6.132  8.942   40.671  1.00 38.70  ? 361 PRO A CB  1 
ATOM   2799 C  CG  . PRO A 1 361 ? -4.830  8.267   41.020  1.00 37.16  ? 361 PRO A CG  1 
ATOM   2800 C  CD  . PRO A 1 361 ? -4.834  7.030   40.172  1.00 36.00  ? 361 PRO A CD  1 
ATOM   2801 N  N   . HIS A 1 362 ? -4.339  9.929   38.215  1.00 43.01  ? 362 HIS A N   1 
ATOM   2802 C  CA  . HIS A 1 362 ? -3.635  11.087  37.692  1.00 47.38  ? 362 HIS A CA  1 
ATOM   2803 C  C   . HIS A 1 362 ? -3.628  11.165  36.168  1.00 51.45  ? 362 HIS A C   1 
ATOM   2804 O  O   . HIS A 1 362 ? -3.321  12.230  35.620  1.00 57.82  ? 362 HIS A O   1 
ATOM   2805 C  CB  . HIS A 1 362 ? -2.199  11.076  38.211  1.00 47.91  ? 362 HIS A CB  1 
ATOM   2806 C  CG  . HIS A 1 362 ? -1.441  9.835   37.857  1.00 50.90  ? 362 HIS A CG  1 
ATOM   2807 N  ND1 . HIS A 1 362 ? -1.732  8.603   38.403  1.00 52.04  ? 362 HIS A ND1 1 
ATOM   2808 C  CD2 . HIS A 1 362 ? -0.407  9.635   37.006  1.00 46.13  ? 362 HIS A CD2 1 
ATOM   2809 C  CE1 . HIS A 1 362 ? -0.903  7.699   37.910  1.00 48.10  ? 362 HIS A CE1 1 
ATOM   2810 N  NE2 . HIS A 1 362 ? -0.091  8.299   37.058  1.00 41.72  ? 362 HIS A NE2 1 
ATOM   2811 N  N   . ALA A 1 363 ? -3.957  10.082  35.471  1.00 41.99  ? 363 ALA A N   1 
ATOM   2812 C  CA  . ALA A 1 363 ? -3.825  10.071  34.022  1.00 37.98  ? 363 ALA A CA  1 
ATOM   2813 C  C   . ALA A 1 363 ? -4.894  10.934  33.365  1.00 36.77  ? 363 ALA A C   1 
ATOM   2814 O  O   . ALA A 1 363 ? -5.996  11.095  33.885  1.00 35.15  ? 363 ALA A O   1 
ATOM   2815 C  CB  . ALA A 1 363 ? -3.923  8.646   33.489  1.00 41.36  ? 363 ALA A CB  1 
ATOM   2816 N  N   . ASN A 1 364 ? -4.554  11.492  32.204  1.00 41.77  ? 364 ASN A N   1 
ATOM   2817 C  CA  . ASN A 1 364 ? -5.533  12.163  31.361  1.00 30.77  ? 364 ASN A CA  1 
ATOM   2818 C  C   . ASN A 1 364 ? -6.325  11.119  30.577  1.00 25.05  ? 364 ASN A C   1 
ATOM   2819 O  O   . ASN A 1 364 ? -6.101  9.912   30.702  1.00 24.10  ? 364 ASN A O   1 
ATOM   2820 C  CB  . ASN A 1 364 ? -4.839  13.147  30.426  1.00 37.35  ? 364 ASN A CB  1 
ATOM   2821 C  CG  . ASN A 1 364 ? -3.978  12.449  29.384  1.00 42.87  ? 364 ASN A CG  1 
ATOM   2822 O  OD1 . ASN A 1 364 ? -3.634  11.277  29.533  1.00 41.88  ? 364 ASN A OD1 1 
ATOM   2823 N  ND2 . ASN A 1 364 ? -3.636  13.164  28.319  1.00 41.87  ? 364 ASN A ND2 1 
ATOM   2824 N  N   . ASP A 1 365 ? -7.252  11.579  29.738  1.00 37.84  ? 365 ASP A N   1 
ATOM   2825 C  CA  . ASP A 1 365 ? -8.090  10.640  28.992  1.00 52.03  ? 365 ASP A CA  1 
ATOM   2826 C  C   . ASP A 1 365 ? -7.247  9.715   28.120  1.00 43.60  ? 365 ASP A C   1 
ATOM   2827 O  O   . ASP A 1 365 ? -7.449  8.495   28.107  1.00 40.96  ? 365 ASP A O   1 
ATOM   2828 C  CB  . ASP A 1 365 ? -9.103  11.397  28.132  1.00 62.26  ? 365 ASP A CB  1 
ATOM   2829 C  CG  . ASP A 1 365 ? -10.066 12.223  28.956  1.00 69.86  ? 365 ASP A CG  1 
ATOM   2830 O  OD1 . ASP A 1 365 ? -11.142 11.693  29.314  1.00 66.19  ? 365 ASP A OD1 1 
ATOM   2831 O  OD2 . ASP A 1 365 ? -9.749  13.402  29.232  1.00 76.15  ? 365 ASP A OD2 1 
ATOM   2832 N  N   . LEU A 1 366 ? -6.289  10.280  27.385  1.00 33.23  ? 366 LEU A N   1 
ATOM   2833 C  CA  . LEU A 1 366 ? -5.505  9.459   26.470  1.00 30.11  ? 366 LEU A CA  1 
ATOM   2834 C  C   . LEU A 1 366 ? -4.740  8.378   27.219  1.00 30.48  ? 366 LEU A C   1 
ATOM   2835 O  O   . LEU A 1 366 ? -4.693  7.225   26.774  1.00 24.97  ? 366 LEU A O   1 
ATOM   2836 C  CB  . LEU A 1 366 ? -4.559  10.341  25.661  1.00 29.80  ? 366 LEU A CB  1 
ATOM   2837 C  CG  . LEU A 1 366 ? -3.594  9.656   24.708  1.00 28.12  ? 366 LEU A CG  1 
ATOM   2838 C  CD1 . LEU A 1 366 ? -4.341  8.844   23.669  1.00 30.99  ? 366 LEU A CD1 1 
ATOM   2839 C  CD2 . LEU A 1 366 ? -2.808  10.734  24.032  1.00 38.10  ? 366 LEU A CD2 1 
ATOM   2840 N  N   . GLY A 1 367 ? -4.156  8.727   28.371  1.00 32.40  ? 367 GLY A N   1 
ATOM   2841 C  CA  . GLY A 1 367 ? -3.491  7.725   29.185  1.00 20.34  ? 367 GLY A CA  1 
ATOM   2842 C  C   . GLY A 1 367 ? -4.448  6.669   29.703  1.00 32.76  ? 367 GLY A C   1 
ATOM   2843 O  O   . GLY A 1 367 ? -4.094  5.492   29.814  1.00 33.92  ? 367 GLY A O   1 
ATOM   2844 N  N   . LEU A 1 368 ? -5.676  7.069   30.030  1.00 28.53  ? 368 LEU A N   1 
ATOM   2845 C  CA  . LEU A 1 368 ? -6.662  6.071   30.419  1.00 24.10  ? 368 LEU A CA  1 
ATOM   2846 C  C   . LEU A 1 368 ? -6.870  5.063   29.308  1.00 24.87  ? 368 LEU A C   1 
ATOM   2847 O  O   . LEU A 1 368 ? -6.884  3.850   29.545  1.00 24.73  ? 368 LEU A O   1 
ATOM   2848 C  CB  . LEU A 1 368 ? -7.973  6.744   30.786  1.00 29.73  ? 368 LEU A CB  1 
ATOM   2849 C  CG  . LEU A 1 368 ? -7.912  7.271   32.214  1.00 37.52  ? 368 LEU A CG  1 
ATOM   2850 C  CD1 . LEU A 1 368 ? -9.118  8.146   32.476  1.00 45.32  ? 368 LEU A CD1 1 
ATOM   2851 C  CD2 . LEU A 1 368 ? -7.853  6.103   33.181  1.00 24.51  ? 368 LEU A CD2 1 
ATOM   2852 N  N   . ASP A 1 369 ? -7.000  5.547   28.079  1.00 31.87  ? 369 ASP A N   1 
ATOM   2853 C  CA  . ASP A 1 369 ? -7.177  4.639   26.959  1.00 25.25  ? 369 ASP A CA  1 
ATOM   2854 C  C   . ASP A 1 369 ? -5.972  3.730   26.807  1.00 24.85  ? 369 ASP A C   1 
ATOM   2855 O  O   . ASP A 1 369 ? -6.129  2.520   26.619  1.00 31.05  ? 369 ASP A O   1 
ATOM   2856 C  CB  . ASP A 1 369 ? -7.436  5.440   25.692  1.00 39.65  ? 369 ASP A CB  1 
ATOM   2857 C  CG  . ASP A 1 369 ? -8.795  6.126   25.711  1.00 57.36  ? 369 ASP A CG  1 
ATOM   2858 O  OD1 . ASP A 1 369 ? -9.732  5.597   26.352  1.00 54.82  ? 369 ASP A OD1 1 
ATOM   2859 O  OD2 . ASP A 1 369 ? -8.924  7.202   25.093  1.00 70.82  ? 369 ASP A OD2 1 
ATOM   2860 N  N   . ALA A 1 370 ? -4.763  4.289   26.918  1.00 21.39  ? 370 ALA A N   1 
ATOM   2861 C  CA  . ALA A 1 370 ? -3.555  3.470   26.882  1.00 21.24  ? 370 ALA A CA  1 
ATOM   2862 C  C   . ALA A 1 370 ? -3.612  2.359   27.925  1.00 29.75  ? 370 ALA A C   1 
ATOM   2863 O  O   . ALA A 1 370 ? -3.466  1.176   27.593  1.00 24.51  ? 370 ALA A O   1 
ATOM   2864 C  CB  . ALA A 1 370 ? -2.320  4.339   27.091  1.00 21.03  ? 370 ALA A CB  1 
ATOM   2865 N  N   . VAL A 1 371 ? -3.846  2.714   29.194  1.00 29.98  ? 371 VAL A N   1 
ATOM   2866 C  CA  . VAL A 1 371 ? -3.968  1.678   30.219  1.00 33.41  ? 371 VAL A CA  1 
ATOM   2867 C  C   . VAL A 1 371 ? -5.017  0.657   29.809  1.00 31.77  ? 371 VAL A C   1 
ATOM   2868 O  O   . VAL A 1 371 ? -4.814  -0.558  29.935  1.00 31.61  ? 371 VAL A O   1 
ATOM   2869 C  CB  . VAL A 1 371 ? -4.295  2.292   31.595  1.00 32.84  ? 371 VAL A CB  1 
ATOM   2870 C  CG1 . VAL A 1 371 ? -4.375  1.191   32.664  1.00 18.58  ? 371 VAL A CG1 1 
ATOM   2871 C  CG2 . VAL A 1 371 ? -3.266  3.338   31.978  1.00 28.82  ? 371 VAL A CG2 1 
ATOM   2872 N  N   . THR A 1 372 ? -6.144  1.133   29.287  1.00 36.30  ? 372 THR A N   1 
ATOM   2873 C  CA  . THR A 1 372 ? -7.230  0.224   28.955  1.00 36.91  ? 372 THR A CA  1 
ATOM   2874 C  C   . THR A 1 372 ? -6.847  -0.701  27.810  1.00 31.54  ? 372 THR A C   1 
ATOM   2875 O  O   . THR A 1 372 ? -6.906  -1.921  27.949  1.00 31.40  ? 372 THR A O   1 
ATOM   2876 C  CB  . THR A 1 372 ? -8.486  1.001   28.605  1.00 30.83  ? 372 THR A CB  1 
ATOM   2877 O  OG1 . THR A 1 372 ? -8.851  1.842   29.706  1.00 31.39  ? 372 THR A OG1 1 
ATOM   2878 C  CG2 . THR A 1 372 ? -9.584  0.028   28.319  1.00 21.76  ? 372 THR A CG2 1 
ATOM   2879 N  N   . LEU A 1 373 ? -6.445  -0.148  26.670  1.00 30.89  ? 373 LEU A N   1 
ATOM   2880 C  CA  . LEU A 1 373 ? -6.073  -1.031  25.573  1.00 30.12  ? 373 LEU A CA  1 
ATOM   2881 C  C   . LEU A 1 373 ? -4.977  -1.990  26.006  1.00 33.17  ? 373 LEU A C   1 
ATOM   2882 O  O   . LEU A 1 373 ? -4.917  -3.136  25.538  1.00 33.31  ? 373 LEU A O   1 
ATOM   2883 C  CB  . LEU A 1 373 ? -5.628  -0.224  24.357  1.00 23.24  ? 373 LEU A CB  1 
ATOM   2884 C  CG  . LEU A 1 373 ? -4.954  -1.079  23.285  1.00 29.64  ? 373 LEU A CG  1 
ATOM   2885 C  CD1 . LEU A 1 373 ? -5.953  -2.087  22.687  1.00 24.34  ? 373 LEU A CD1 1 
ATOM   2886 C  CD2 . LEU A 1 373 ? -4.353  -0.191  22.222  1.00 32.52  ? 373 LEU A CD2 1 
ATOM   2887 N  N   . GLN A 1 374 ? -4.149  -1.568  26.953  1.00 21.51  ? 374 GLN A N   1 
ATOM   2888 C  CA  . GLN A 1 374 ? -2.991  -2.369  27.279  1.00 28.43  ? 374 GLN A CA  1 
ATOM   2889 C  C   . GLN A 1 374 ? -3.362  -3.647  28.014  1.00 25.59  ? 374 GLN A C   1 
ATOM   2890 O  O   . GLN A 1 374 ? -2.655  -4.648  27.864  1.00 31.13  ? 374 GLN A O   1 
ATOM   2891 C  CB  . GLN A 1 374 ? -2.015  -1.506  28.070  1.00 36.66  ? 374 GLN A CB  1 
ATOM   2892 C  CG  . GLN A 1 374 ? -0.698  -2.149  28.415  1.00 48.08  ? 374 GLN A CG  1 
ATOM   2893 C  CD  . GLN A 1 374 ? 0.220   -2.431  27.229  1.00 52.12  ? 374 GLN A CD  1 
ATOM   2894 O  OE1 . GLN A 1 374 ? 1.281   -3.043  27.407  1.00 53.84  ? 374 GLN A OE1 1 
ATOM   2895 N  NE2 . GLN A 1 374 ? -0.173  -1.994  26.025  1.00 43.71  ? 374 GLN A NE2 1 
ATOM   2896 N  N   . TYR A 1 375 ? -4.489  -3.669  28.732  1.00 27.46  ? 375 TYR A N   1 
ATOM   2897 C  CA  . TYR A 1 375 ? -4.826  -4.791  29.604  1.00 35.62  ? 375 TYR A CA  1 
ATOM   2898 C  C   . TYR A 1 375 ? -6.110  -5.552  29.242  1.00 33.91  ? 375 TYR A C   1 
ATOM   2899 O  O   . TYR A 1 375 ? -6.556  -6.379  30.049  1.00 27.15  ? 375 TYR A O   1 
ATOM   2900 C  CB  . TYR A 1 375 ? -4.931  -4.305  31.055  1.00 35.72  ? 375 TYR A CB  1 
ATOM   2901 C  CG  . TYR A 1 375 ? -3.605  -4.103  31.764  1.00 28.92  ? 375 TYR A CG  1 
ATOM   2902 C  CD1 . TYR A 1 375 ? -3.063  -5.104  32.568  1.00 27.14  ? 375 TYR A CD1 1 
ATOM   2903 C  CD2 . TYR A 1 375 ? -2.904  -2.915  31.640  1.00 23.79  ? 375 TYR A CD2 1 
ATOM   2904 C  CE1 . TYR A 1 375 ? -1.854  -4.926  33.227  1.00 22.58  ? 375 TYR A CE1 1 
ATOM   2905 C  CE2 . TYR A 1 375 ? -1.695  -2.727  32.291  1.00 23.08  ? 375 TYR A CE2 1 
ATOM   2906 C  CZ  . TYR A 1 375 ? -1.176  -3.735  33.087  1.00 25.58  ? 375 TYR A CZ  1 
ATOM   2907 O  OH  . TYR A 1 375 ? 0.029   -3.552  33.737  1.00 31.46  ? 375 TYR A OH  1 
ATOM   2908 N  N   . THR A 1 376 ? -6.720  -5.321  28.075  1.00 27.67  ? 376 THR A N   1 
ATOM   2909 C  CA  . THR A 1 376 ? -7.926  -6.054  27.701  1.00 27.77  ? 376 THR A CA  1 
ATOM   2910 C  C   . THR A 1 376 ? -7.654  -7.034  26.573  1.00 32.68  ? 376 THR A C   1 
ATOM   2911 O  O   . THR A 1 376 ? -6.854  -6.766  25.677  1.00 44.85  ? 376 THR A O   1 
ATOM   2912 C  CB  . THR A 1 376 ? -9.060  -5.146  27.227  1.00 42.77  ? 376 THR A CB  1 
ATOM   2913 O  OG1 . THR A 1 376 ? -8.932  -4.930  25.832  1.00 51.46  ? 376 THR A OG1 1 
ATOM   2914 C  CG2 . THR A 1 376 ? -9.050  -3.842  27.922  1.00 22.34  ? 376 THR A CG2 1 
ATOM   2915 N  N   . ASP A 1 377 ? -8.364  -8.156  26.599  1.00 36.91  ? 377 ASP A N   1 
ATOM   2916 C  CA  . ASP A 1 377 ? -8.334  -9.128  25.507  1.00 38.59  ? 377 ASP A CA  1 
ATOM   2917 C  C   . ASP A 1 377 ? -9.481  -8.786  24.561  1.00 46.29  ? 377 ASP A C   1 
ATOM   2918 O  O   . ASP A 1 377 ? -10.645 -9.080  24.846  1.00 37.17  ? 377 ASP A O   1 
ATOM   2919 C  CB  . ASP A 1 377 ? -8.441  -10.547 26.058  1.00 42.92  ? 377 ASP A CB  1 
ATOM   2920 C  CG  . ASP A 1 377 ? -8.392  -11.607 24.973  1.00 60.95  ? 377 ASP A CG  1 
ATOM   2921 O  OD1 . ASP A 1 377 ? -8.168  -11.260 23.790  1.00 67.92  ? 377 ASP A OD1 1 
ATOM   2922 O  OD2 . ASP A 1 377 ? -8.555  -12.801 25.304  1.00 68.28  ? 377 ASP A OD2 1 
ATOM   2923 N  N   . TRP A 1 378 ? -9.161  -8.172  23.421  1.00 50.76  ? 378 TRP A N   1 
ATOM   2924 C  CA  . TRP A 1 378 ? -10.221 -7.649  22.566  1.00 39.66  ? 378 TRP A CA  1 
ATOM   2925 C  C   . TRP A 1 378 ? -10.937 -8.718  21.753  1.00 33.92  ? 378 TRP A C   1 
ATOM   2926 O  O   . TRP A 1 378 ? -11.844 -8.383  20.975  1.00 28.29  ? 378 TRP A O   1 
ATOM   2927 C  CB  . TRP A 1 378 ? -9.683  -6.542  21.652  1.00 32.20  ? 378 TRP A CB  1 
ATOM   2928 C  CG  . TRP A 1 378 ? -9.888  -5.239  22.321  1.00 31.38  ? 378 TRP A CG  1 
ATOM   2929 C  CD1 . TRP A 1 378 ? -8.933  -4.445  22.866  1.00 28.66  ? 378 TRP A CD1 1 
ATOM   2930 C  CD2 . TRP A 1 378 ? -11.149 -4.610  22.605  1.00 44.63  ? 378 TRP A CD2 1 
ATOM   2931 N  NE1 . TRP A 1 378 ? -9.509  -3.340  23.448  1.00 29.81  ? 378 TRP A NE1 1 
ATOM   2932 C  CE2 . TRP A 1 378 ? -10.868 -3.420  23.309  1.00 42.04  ? 378 TRP A CE2 1 
ATOM   2933 C  CE3 . TRP A 1 378 ? -12.487 -4.930  22.319  1.00 51.93  ? 378 TRP A CE3 1 
ATOM   2934 C  CZ2 . TRP A 1 378 ? -11.870 -2.539  23.727  1.00 49.17  ? 378 TRP A CZ2 1 
ATOM   2935 C  CZ3 . TRP A 1 378 ? -13.487 -4.054  22.735  1.00 52.25  ? 378 TRP A CZ3 1 
ATOM   2936 C  CH2 . TRP A 1 378 ? -13.169 -2.873  23.433  1.00 55.90  ? 378 TRP A CH2 1 
ATOM   2937 N  N   . MET A 1 379 ? -10.584 -9.987  21.922  1.00 29.68  ? 379 MET A N   1 
ATOM   2938 C  CA  . MET A 1 379 ? -11.464 -11.023 21.404  1.00 39.54  ? 379 MET A CA  1 
ATOM   2939 C  C   . MET A 1 379 ? -12.579 -11.363 22.379  1.00 44.07  ? 379 MET A C   1 
ATOM   2940 O  O   . MET A 1 379 ? -13.575 -11.965 21.965  1.00 49.71  ? 379 MET A O   1 
ATOM   2941 C  CB  . MET A 1 379 ? -10.666 -12.276 21.036  1.00 38.52  ? 379 MET A CB  1 
ATOM   2942 C  CG  . MET A 1 379 ? -9.476  -11.949 20.149  1.00 60.87  ? 379 MET A CG  1 
ATOM   2943 S  SD  . MET A 1 379 ? -8.695  -13.350 19.311  1.00 73.12  ? 379 MET A SD  1 
ATOM   2944 C  CE  . MET A 1 379 ? -7.289  -13.637 20.395  1.00 52.24  ? 379 MET A CE  1 
ATOM   2945 N  N   . ASP A 1 380 ? -12.460 -10.931 23.634  1.00 42.86  ? 380 ASP A N   1 
ATOM   2946 C  CA  . ASP A 1 380 ? -13.330 -11.357 24.723  1.00 49.04  ? 380 ASP A CA  1 
ATOM   2947 C  C   . ASP A 1 380 ? -13.399 -10.254 25.781  1.00 52.03  ? 380 ASP A C   1 
ATOM   2948 O  O   . ASP A 1 380 ? -13.007 -10.432 26.934  1.00 54.25  ? 380 ASP A O   1 
ATOM   2949 C  CB  . ASP A 1 380 ? -12.812 -12.672 25.306  1.00 56.74  ? 380 ASP A CB  1 
ATOM   2950 C  CG  . ASP A 1 380 ? -13.903 -13.500 25.983  1.00 65.25  ? 380 ASP A CG  1 
ATOM   2951 O  OD1 . ASP A 1 380 ? -15.094 -13.110 25.923  1.00 69.05  ? 380 ASP A OD1 1 
ATOM   2952 O  OD2 . ASP A 1 380 ? -13.560 -14.557 26.565  1.00 58.68  ? 380 ASP A OD2 1 
ATOM   2953 N  N   . ASP A 1 381 ? -13.907 -9.072  25.408  1.00 52.55  ? 381 ASP A N   1 
ATOM   2954 C  CA  . ASP A 1 381 ? -13.896 -7.939  26.332  1.00 47.96  ? 381 ASP A CA  1 
ATOM   2955 C  C   . ASP A 1 381 ? -15.015 -7.989  27.362  1.00 53.28  ? 381 ASP A C   1 
ATOM   2956 O  O   . ASP A 1 381 ? -14.888 -7.372  28.419  1.00 61.97  ? 381 ASP A O   1 
ATOM   2957 C  CB  . ASP A 1 381 ? -13.979 -6.618  25.570  1.00 40.92  ? 381 ASP A CB  1 
ATOM   2958 C  CG  . ASP A 1 381 ? -15.069 -6.621  24.532  1.00 44.06  ? 381 ASP A CG  1 
ATOM   2959 O  OD1 . ASP A 1 381 ? -14.895 -7.323  23.518  1.00 45.36  ? 381 ASP A OD1 1 
ATOM   2960 O  OD2 . ASP A 1 381 ? -16.093 -5.927  24.719  1.00 45.09  ? 381 ASP A OD2 1 
ATOM   2961 N  N   . ASN A 1 382 ? -16.112 -8.688  27.090  1.00 54.80  ? 382 ASN A N   1 
ATOM   2962 C  CA  . ASN A 1 382 ? -17.177 -8.803  28.075  1.00 49.60  ? 382 ASN A CA  1 
ATOM   2963 C  C   . ASN A 1 382 ? -17.039 -10.054 28.928  1.00 48.25  ? 382 ASN A C   1 
ATOM   2964 O  O   . ASN A 1 382 ? -18.037 -10.566 29.459  1.00 46.29  ? 382 ASN A O   1 
ATOM   2965 C  CB  . ASN A 1 382 ? -18.538 -8.735  27.382  1.00 48.36  ? 382 ASN A CB  1 
ATOM   2966 C  CG  . ASN A 1 382 ? -18.918 -7.308  27.034  1.00 54.55  ? 382 ASN A CG  1 
ATOM   2967 O  OD1 . ASN A 1 382 ? -18.443 -6.367  27.674  1.00 52.24  ? 382 ASN A OD1 1 
ATOM   2968 N  ND2 . ASN A 1 382 ? -19.757 -7.134  26.014  1.00 58.93  ? 382 ASN A ND2 1 
ATOM   2969 N  N   . ASN A 1 383 ? -15.813 -10.548 29.086  1.00 44.47  ? 383 ASN A N   1 
ATOM   2970 C  CA  . ASN A 1 383 ? -15.544 -11.718 29.911  1.00 37.55  ? 383 ASN A CA  1 
ATOM   2971 C  C   . ASN A 1 383 ? -15.266 -11.200 31.314  1.00 39.61  ? 383 ASN A C   1 
ATOM   2972 O  O   . ASN A 1 383 ? -14.218 -10.605 31.577  1.00 46.14  ? 383 ASN A O   1 
ATOM   2973 C  CB  . ASN A 1 383 ? -14.391 -12.528 29.329  1.00 27.66  ? 383 ASN A CB  1 
ATOM   2974 C  CG  . ASN A 1 383 ? -13.920 -13.630 30.245  1.00 35.03  ? 383 ASN A CG  1 
ATOM   2975 O  OD1 . ASN A 1 383 ? -13.970 -13.518 31.472  1.00 42.10  ? 383 ASN A OD1 1 
ATOM   2976 N  ND2 . ASN A 1 383 ? -13.518 -14.747 29.646  1.00 36.49  ? 383 ASN A ND2 1 
ATOM   2977 N  N   . GLY A 1 384 ? -16.211 -11.437 32.216  1.00 38.62  ? 384 GLY A N   1 
ATOM   2978 C  CA  . GLY A 1 384 ? -16.120 -10.871 33.550  1.00 39.99  ? 384 GLY A CA  1 
ATOM   2979 C  C   . GLY A 1 384 ? -14.860 -11.247 34.308  1.00 37.34  ? 384 GLY A C   1 
ATOM   2980 O  O   . GLY A 1 384 ? -14.424 -10.504 35.187  1.00 40.18  ? 384 GLY A O   1 
ATOM   2981 N  N   . ILE A 1 385 ? -14.255 -12.393 33.989  1.00 34.35  ? 385 ILE A N   1 
ATOM   2982 C  CA  . ILE A 1 385 ? -13.040 -12.802 34.693  1.00 32.57  ? 385 ILE A CA  1 
ATOM   2983 C  C   . ILE A 1 385 ? -11.838 -12.027 34.182  1.00 39.50  ? 385 ILE A C   1 
ATOM   2984 O  O   . ILE A 1 385 ? -11.141 -11.362 34.959  1.00 43.10  ? 385 ILE A O   1 
ATOM   2985 C  CB  . ILE A 1 385 ? -12.805 -14.317 34.573  1.00 30.68  ? 385 ILE A CB  1 
ATOM   2986 C  CG1 . ILE A 1 385 ? -13.901 -15.091 35.299  1.00 29.83  ? 385 ILE A CG1 1 
ATOM   2987 C  CG2 . ILE A 1 385 ? -11.443 -14.684 35.136  1.00 23.60  ? 385 ILE A CG2 1 
ATOM   2988 C  CD1 . ILE A 1 385 ? -13.617 -16.567 35.386  1.00 27.82  ? 385 ILE A CD1 1 
ATOM   2989 N  N   . LYS A 1 386 ? -11.579 -12.109 32.869  1.00 23.35  ? 386 LYS A N   1 
ATOM   2990 C  CA  . LYS A 1 386 ? -10.419 -11.427 32.299  1.00 29.26  ? 386 LYS A CA  1 
ATOM   2991 C  C   . LYS A 1 386 ? -10.403 -9.948  32.636  1.00 31.34  ? 386 LYS A C   1 
ATOM   2992 O  O   . LYS A 1 386 ? -9.325  -9.345  32.716  1.00 28.23  ? 386 LYS A O   1 
ATOM   2993 C  CB  . LYS A 1 386 ? -10.359 -11.601 30.778  1.00 23.61  ? 386 LYS A CB  1 
ATOM   2994 C  CG  . LYS A 1 386 ? -9.938  -13.003 30.359  1.00 36.27  ? 386 LYS A CG  1 
ATOM   2995 C  CD  . LYS A 1 386 ? -10.559 -13.433 29.063  1.00 31.12  ? 386 LYS A CD  1 
ATOM   2996 C  CE  . LYS A 1 386 ? -9.507  -13.711 28.026  1.00 25.53  ? 386 LYS A CE  1 
ATOM   2997 N  NZ  . LYS A 1 386 ? -10.038 -14.776 27.136  1.00 27.81  ? 386 LYS A NZ  1 
ATOM   2998 N  N   . ASN A 1 387 ? -11.577 -9.341  32.827  1.00 24.45  ? 387 ASN A N   1 
ATOM   2999 C  CA  . ASN A 1 387 ? -11.578 -7.958  33.272  1.00 29.78  ? 387 ASN A CA  1 
ATOM   3000 C  C   . ASN A 1 387 ? -11.126 -7.843  34.719  1.00 33.84  ? 387 ASN A C   1 
ATOM   3001 O  O   . ASN A 1 387 ? -10.382 -6.919  35.071  1.00 43.36  ? 387 ASN A O   1 
ATOM   3002 C  CB  . ASN A 1 387 ? -12.956 -7.350  33.098  1.00 36.12  ? 387 ASN A CB  1 
ATOM   3003 C  CG  . ASN A 1 387 ? -13.402 -7.371  31.679  1.00 47.08  ? 387 ASN A CG  1 
ATOM   3004 O  OD1 . ASN A 1 387 ? -13.245 -6.382  30.976  1.00 54.41  ? 387 ASN A OD1 1 
ATOM   3005 N  ND2 . ASN A 1 387 ? -13.950 -8.491  31.232  1.00 55.38  ? 387 ASN A ND2 1 
ATOM   3006 N  N   . ARG A 1 388 ? -11.545 -8.775  35.571  1.00 25.13  ? 388 ARG A N   1 
ATOM   3007 C  CA  . ARG A 1 388 ? -11.202 -8.649  36.978  1.00 30.69  ? 388 ARG A CA  1 
ATOM   3008 C  C   . ARG A 1 388 ? -9.709  -8.900  37.179  1.00 31.41  ? 388 ARG A C   1 
ATOM   3009 O  O   . ARG A 1 388 ? -8.992  -8.092  37.794  1.00 25.86  ? 388 ARG A O   1 
ATOM   3010 C  CB  . ARG A 1 388 ? -12.045 -9.608  37.812  1.00 20.86  ? 388 ARG A CB  1 
ATOM   3011 C  CG  . ARG A 1 388 ? -11.462 -9.845  39.193  1.00 20.79  ? 388 ARG A CG  1 
ATOM   3012 C  CD  . ARG A 1 388 ? -11.866 -11.151 39.781  1.00 20.82  ? 388 ARG A CD  1 
ATOM   3013 N  NE  . ARG A 1 388 ? -11.038 -12.226 39.276  1.00 37.71  ? 388 ARG A NE  1 
ATOM   3014 C  CZ  . ARG A 1 388 ? -11.419 -13.493 39.247  1.00 31.96  ? 388 ARG A CZ  1 
ATOM   3015 N  NH1 . ARG A 1 388 ? -10.599 -14.410 38.776  1.00 22.30  ? 388 ARG A NH1 1 
ATOM   3016 N  NH2 . ARG A 1 388 ? -12.629 -13.815 39.653  1.00 32.05  ? 388 ARG A NH2 1 
ATOM   3017 N  N   . ASP A 1 389 ? -9.212  -10.011 36.636  1.00 28.87  ? 389 ASP A N   1 
ATOM   3018 C  CA  . ASP A 1 389 ? -7.771  -10.189 36.557  1.00 35.23  ? 389 ASP A CA  1 
ATOM   3019 C  C   . ASP A 1 389 ? -7.103  -9.001  35.879  1.00 30.70  ? 389 ASP A C   1 
ATOM   3020 O  O   . ASP A 1 389 ? -6.016  -8.583  36.294  1.00 22.69  ? 389 ASP A O   1 
ATOM   3021 C  CB  . ASP A 1 389 ? -7.473  -11.493 35.834  1.00 40.99  ? 389 ASP A CB  1 
ATOM   3022 C  CG  . ASP A 1 389 ? -7.969  -12.704 36.608  1.00 57.65  ? 389 ASP A CG  1 
ATOM   3023 O  OD1 . ASP A 1 389 ? -8.325  -12.558 37.795  1.00 62.91  ? 389 ASP A OD1 1 
ATOM   3024 O  OD2 . ASP A 1 389 ? -7.976  -13.819 36.038  1.00 67.05  ? 389 ASP A OD2 1 
ATOM   3025 N  N   . GLY A 1 390 ? -7.746  -8.434  34.857  1.00 20.10  ? 390 GLY A N   1 
ATOM   3026 C  CA  . GLY A 1 390 ? -7.270  -7.223  34.229  1.00 19.86  ? 390 GLY A CA  1 
ATOM   3027 C  C   . GLY A 1 390 ? -6.931  -6.145  35.230  1.00 23.85  ? 390 GLY A C   1 
ATOM   3028 O  O   . GLY A 1 390 ? -5.769  -5.737  35.340  1.00 24.24  ? 390 GLY A O   1 
ATOM   3029 N  N   . LEU A 1 391 ? -7.942  -5.705  35.984  1.00 22.41  ? 391 LEU A N   1 
ATOM   3030 C  CA  . LEU A 1 391 ? -7.742  -4.679  37.008  1.00 25.42  ? 391 LEU A CA  1 
ATOM   3031 C  C   . LEU A 1 391 ? -6.712  -5.101  38.051  1.00 31.77  ? 391 LEU A C   1 
ATOM   3032 O  O   . LEU A 1 391 ? -5.887  -4.287  38.483  1.00 27.11  ? 391 LEU A O   1 
ATOM   3033 C  CB  . LEU A 1 391 ? -9.070  -4.353  37.693  1.00 20.79  ? 391 LEU A CB  1 
ATOM   3034 C  CG  . LEU A 1 391 ? -10.020 -3.507  36.852  1.00 33.56  ? 391 LEU A CG  1 
ATOM   3035 C  CD1 . LEU A 1 391 ? -11.372 -3.408  37.506  1.00 50.33  ? 391 LEU A CD1 1 
ATOM   3036 C  CD2 . LEU A 1 391 ? -9.429  -2.115  36.651  1.00 33.98  ? 391 LEU A CD2 1 
ATOM   3037 N  N   . ASP A 1 392 ? -6.769  -6.357  38.495  1.00 35.67  ? 392 ASP A N   1 
ATOM   3038 C  CA  . ASP A 1 392 ? -5.822  -6.839  39.493  1.00 36.06  ? 392 ASP A CA  1 
ATOM   3039 C  C   . ASP A 1 392 ? -4.387  -6.632  39.027  1.00 40.41  ? 392 ASP A C   1 
ATOM   3040 O  O   . ASP A 1 392 ? -3.521  -6.189  39.794  1.00 46.38  ? 392 ASP A O   1 
ATOM   3041 C  CB  . ASP A 1 392 ? -6.106  -8.312  39.769  1.00 52.69  ? 392 ASP A CB  1 
ATOM   3042 C  CG  . ASP A 1 392 ? -5.462  -8.809  41.034  1.00 78.34  ? 392 ASP A CG  1 
ATOM   3043 O  OD1 . ASP A 1 392 ? -6.101  -9.640  41.708  1.00 85.77  ? 392 ASP A OD1 1 
ATOM   3044 O  OD2 . ASP A 1 392 ? -4.325  -8.391  41.355  1.00 95.05  ? 392 ASP A OD2 1 
ATOM   3045 N  N   . ASP A 1 393 ? -4.120  -6.933  37.763  1.00 35.34  ? 393 ASP A N   1 
ATOM   3046 C  CA  . ASP A 1 393 ? -2.782  -6.718  37.244  1.00 26.04  ? 393 ASP A CA  1 
ATOM   3047 C  C   . ASP A 1 393 ? -2.467  -5.231  37.120  1.00 22.82  ? 393 ASP A C   1 
ATOM   3048 O  O   . ASP A 1 393 ? -1.360  -4.807  37.468  1.00 29.30  ? 393 ASP A O   1 
ATOM   3049 C  CB  . ASP A 1 393 ? -2.632  -7.454  35.920  1.00 37.78  ? 393 ASP A CB  1 
ATOM   3050 C  CG  . ASP A 1 393 ? -2.657  -8.968  36.109  1.00 46.72  ? 393 ASP A CG  1 
ATOM   3051 O  OD1 . ASP A 1 393 ? -2.399  -9.418  37.255  1.00 46.00  ? 393 ASP A OD1 1 
ATOM   3052 O  OD2 . ASP A 1 393 ? -2.927  -9.702  35.127  1.00 49.15  ? 393 ASP A OD2 1 
ATOM   3053 N  N   . ILE A 1 394 ? -3.430  -4.414  36.675  1.00 22.84  ? 394 ILE A N   1 
ATOM   3054 C  CA  . ILE A 1 394 ? -3.197  -2.967  36.585  1.00 22.62  ? 394 ILE A CA  1 
ATOM   3055 C  C   . ILE A 1 394 ? -2.696  -2.415  37.914  1.00 22.52  ? 394 ILE A C   1 
ATOM   3056 O  O   . ILE A 1 394 ? -1.630  -1.794  37.983  1.00 30.82  ? 394 ILE A O   1 
ATOM   3057 C  CB  . ILE A 1 394 ? -4.464  -2.221  36.138  1.00 26.89  ? 394 ILE A CB  1 
ATOM   3058 C  CG1 . ILE A 1 394 ? -4.686  -2.371  34.630  1.00 21.15  ? 394 ILE A CG1 1 
ATOM   3059 C  CG2 . ILE A 1 394 ? -4.376  -0.740  36.553  1.00 17.23  ? 394 ILE A CG2 1 
ATOM   3060 C  CD1 . ILE A 1 394 ? -6.135  -2.261  34.246  1.00 18.57  ? 394 ILE A CD1 1 
ATOM   3061 N  N   . VAL A 1 395 ? -3.452  -2.623  38.993  1.00 16.55  ? 395 VAL A N   1 
ATOM   3062 C  CA  . VAL A 1 395 ? -3.082  -1.925  40.217  1.00 27.22  ? 395 VAL A CA  1 
ATOM   3063 C  C   . VAL A 1 395 ? -1.822  -2.536  40.805  1.00 25.06  ? 395 VAL A C   1 
ATOM   3064 O  O   . VAL A 1 395 ? -0.945  -1.811  41.292  1.00 21.94  ? 395 VAL A O   1 
ATOM   3065 C  CB  . VAL A 1 395 ? -4.246  -1.876  41.230  1.00 35.57  ? 395 VAL A CB  1 
ATOM   3066 C  CG1 . VAL A 1 395 ? -5.421  -1.221  40.591  1.00 41.33  ? 395 VAL A CG1 1 
ATOM   3067 C  CG2 . VAL A 1 395 ? -4.662  -3.212  41.658  1.00 35.59  ? 395 VAL A CG2 1 
ATOM   3068 N  N   . GLY A 1 396 ? -1.675  -3.863  40.706  1.00 22.40  ? 396 GLY A N   1 
ATOM   3069 C  CA  . GLY A 1 396 ? -0.422  -4.491  41.105  1.00 15.93  ? 396 GLY A CA  1 
ATOM   3070 C  C   . GLY A 1 396 ? 0.766   -3.960  40.324  1.00 24.41  ? 396 GLY A C   1 
ATOM   3071 O  O   . GLY A 1 396 ? 1.742   -3.471  40.903  1.00 22.82  ? 396 GLY A O   1 
ATOM   3072 N  N   . ASP A 1 397 ? 0.693   -4.027  38.991  1.00 28.07  ? 397 ASP A N   1 
ATOM   3073 C  CA  . ASP A 1 397 ? 1.813   -3.570  38.176  1.00 22.48  ? 397 ASP A CA  1 
ATOM   3074 C  C   . ASP A 1 397 ? 2.059   -2.080  38.365  1.00 24.54  ? 397 ASP A C   1 
ATOM   3075 O  O   . ASP A 1 397 ? 3.201   -1.656  38.584  1.00 28.44  ? 397 ASP A O   1 
ATOM   3076 C  CB  . ASP A 1 397 ? 1.559   -3.900  36.710  1.00 23.68  ? 397 ASP A CB  1 
ATOM   3077 C  CG  . ASP A 1 397 ? 1.333   -5.396  36.478  1.00 32.06  ? 397 ASP A CG  1 
ATOM   3078 O  OD1 . ASP A 1 397 ? 1.445   -6.171  37.468  1.00 30.71  ? 397 ASP A OD1 1 
ATOM   3079 O  OD2 . ASP A 1 397 ? 1.055   -5.797  35.310  1.00 24.16  ? 397 ASP A OD2 1 
ATOM   3080 N  N   . HIS A 1 398 ? 0.995   -1.278  38.344  1.00 19.45  ? 398 HIS A N   1 
ATOM   3081 C  CA  . HIS A 1 398 ? 1.159   0.166   38.481  1.00 25.41  ? 398 HIS A CA  1 
ATOM   3082 C  C   . HIS A 1 398 ? 1.736   0.571   39.842  1.00 22.67  ? 398 HIS A C   1 
ATOM   3083 O  O   . HIS A 1 398 ? 2.563   1.488   39.919  1.00 15.48  ? 398 HIS A O   1 
ATOM   3084 C  CB  . HIS A 1 398 ? -0.176  0.869   38.256  1.00 28.48  ? 398 HIS A CB  1 
ATOM   3085 C  CG  . HIS A 1 398 ? -0.124  2.335   38.527  1.00 26.91  ? 398 HIS A CG  1 
ATOM   3086 N  ND1 . HIS A 1 398 ? 0.821   3.156   37.955  1.00 27.60  ? 398 HIS A ND1 1 
ATOM   3087 C  CD2 . HIS A 1 398 ? -0.892  3.129   39.308  1.00 25.78  ? 398 HIS A CD2 1 
ATOM   3088 C  CE1 . HIS A 1 398 ? 0.636   4.395   38.373  1.00 32.48  ? 398 HIS A CE1 1 
ATOM   3089 N  NE2 . HIS A 1 398 ? -0.398  4.406   39.195  1.00 30.97  ? 398 HIS A NE2 1 
ATOM   3090 N  N   . ASN A 1 399 ? 1.301   -0.062  40.931  1.00 15.30  ? 399 ASN A N   1 
ATOM   3091 C  CA  . ASN A 1 399 ? 1.617   0.503   42.242  1.00 27.99  ? 399 ASN A CA  1 
ATOM   3092 C  C   . ASN A 1 399 ? 2.754   -0.197  42.979  1.00 30.28  ? 399 ASN A C   1 
ATOM   3093 O  O   . ASN A 1 399 ? 3.366   0.414   43.866  1.00 20.67  ? 399 ASN A O   1 
ATOM   3094 C  CB  . ASN A 1 399 ? 0.377   0.515   43.144  1.00 25.02  ? 399 ASN A CB  1 
ATOM   3095 C  CG  . ASN A 1 399 ? -0.682  1.485   42.654  1.00 31.79  ? 399 ASN A CG  1 
ATOM   3096 O  OD1 . ASN A 1 399 ? -0.600  2.691   42.886  1.00 33.46  ? 399 ASN A OD1 1 
ATOM   3097 N  ND2 . ASN A 1 399 ? -1.690  0.957   41.986  1.00 35.86  ? 399 ASN A ND2 1 
ATOM   3098 N  N   . VAL A 1 400 ? 3.072   -1.439  42.632  1.00 31.17  ? 400 VAL A N   1 
ATOM   3099 C  CA  . VAL A 1 400 ? 4.146   -2.137  43.325  1.00 27.62  ? 400 VAL A CA  1 
ATOM   3100 C  C   . VAL A 1 400 ? 5.194   -2.646  42.338  1.00 30.38  ? 400 VAL A C   1 
ATOM   3101 O  O   . VAL A 1 400 ? 6.320   -2.135  42.303  1.00 26.48  ? 400 VAL A O   1 
ATOM   3102 C  CB  . VAL A 1 400 ? 3.576   -3.288  44.167  1.00 23.27  ? 400 VAL A CB  1 
ATOM   3103 C  CG1 . VAL A 1 400 ? 4.693   -4.144  44.711  1.00 22.24  ? 400 VAL A CG1 1 
ATOM   3104 C  CG2 . VAL A 1 400 ? 2.731   -2.727  45.292  1.00 24.88  ? 400 VAL A CG2 1 
ATOM   3105 N  N   . ILE A 1 401 ? 4.809   -3.617  41.499  1.00 35.57  ? 401 ILE A N   1 
ATOM   3106 C  CA  . ILE A 1 401 ? 5.774   -4.429  40.745  1.00 31.83  ? 401 ILE A CA  1 
ATOM   3107 C  C   . ILE A 1 401 ? 6.635   -3.571  39.827  1.00 30.14  ? 401 ILE A C   1 
ATOM   3108 O  O   . ILE A 1 401 ? 7.868   -3.611  39.886  1.00 36.08  ? 401 ILE A O   1 
ATOM   3109 C  CB  . ILE A 1 401 ? 5.052   -5.520  39.938  1.00 23.24  ? 401 ILE A CB  1 
ATOM   3110 C  CG1 . ILE A 1 401 ? 4.289   -6.450  40.887  1.00 25.31  ? 401 ILE A CG1 1 
ATOM   3111 C  CG2 . ILE A 1 401 ? 6.052   -6.264  39.082  1.00 16.81  ? 401 ILE A CG2 1 
ATOM   3112 C  CD1 . ILE A 1 401 ? 3.626   -7.605  40.186  1.00 22.20  ? 401 ILE A CD1 1 
ATOM   3113 N  N   . CYS A 1 402 ? 6.014   -2.827  38.944  1.00 26.00  ? 402 CYS A N   1 
ATOM   3114 C  CA  . CYS A 1 402 ? 6.833   -2.075  38.004  1.00 29.48  ? 402 CYS A CA  1 
ATOM   3115 C  C   . CYS A 1 402 ? 7.593   -0.966  38.727  1.00 27.59  ? 402 CYS A C   1 
ATOM   3116 O  O   . CYS A 1 402 ? 8.753   -0.703  38.388  1.00 23.97  ? 402 CYS A O   1 
ATOM   3117 C  CB  . CYS A 1 402 ? 5.977   -1.545  36.849  1.00 16.79  ? 402 CYS A CB  1 
ATOM   3118 S  SG  . CYS A 1 402 ? 5.323   -2.956  35.855  1.00 17.27  ? 402 CYS A SG  1 
ATOM   3119 N  N   . PRO A 1 403 ? 7.015   -0.306  39.736  1.00 30.46  ? 403 PRO A N   1 
ATOM   3120 C  CA  . PRO A 1 403 ? 7.851   0.615   40.518  1.00 24.21  ? 403 PRO A CA  1 
ATOM   3121 C  C   . PRO A 1 403 ? 9.051   -0.069  41.138  1.00 27.10  ? 403 PRO A C   1 
ATOM   3122 O  O   . PRO A 1 403 ? 10.155  0.493   41.134  1.00 15.86  ? 403 PRO A O   1 
ATOM   3123 C  CB  . PRO A 1 403 ? 6.882   1.158   41.575  1.00 25.75  ? 403 PRO A CB  1 
ATOM   3124 C  CG  . PRO A 1 403 ? 5.563   1.120   40.892  1.00 30.97  ? 403 PRO A CG  1 
ATOM   3125 C  CD  . PRO A 1 403 ? 5.587   -0.142  40.073  1.00 30.49  ? 403 PRO A CD  1 
ATOM   3126 N  N   . LEU A 1 404 ? 8.870   -1.284  41.657  1.00 33.01  ? 404 LEU A N   1 
ATOM   3127 C  CA  . LEU A 1 404 ? 9.986   -1.979  42.288  1.00 31.16  ? 404 LEU A CA  1 
ATOM   3128 C  C   . LEU A 1 404 ? 11.029  -2.352  41.249  1.00 37.21  ? 404 LEU A C   1 
ATOM   3129 O  O   . LEU A 1 404 ? 12.226  -2.107  41.443  1.00 47.91  ? 404 LEU A O   1 
ATOM   3130 C  CB  . LEU A 1 404 ? 9.491   -3.217  43.049  1.00 28.96  ? 404 LEU A CB  1 
ATOM   3131 C  CG  . LEU A 1 404 ? 10.535  -4.084  43.774  1.00 23.43  ? 404 LEU A CG  1 
ATOM   3132 C  CD1 . LEU A 1 404 ? 10.086  -4.519  45.140  1.00 15.43  ? 404 LEU A CD1 1 
ATOM   3133 C  CD2 . LEU A 1 404 ? 10.899  -5.315  42.955  1.00 26.31  ? 404 LEU A CD2 1 
ATOM   3134 N  N   . MET A 1 405 ? 10.586  -2.925  40.120  1.00 32.33  ? 405 MET A N   1 
ATOM   3135 C  CA  . MET A 1 405 ? 11.522  -3.286  39.058  1.00 24.94  ? 405 MET A CA  1 
ATOM   3136 C  C   . MET A 1 405 ? 12.292  -2.083  38.544  1.00 23.02  ? 405 MET A C   1 
ATOM   3137 O  O   . MET A 1 405 ? 13.473  -2.204  38.207  1.00 28.82  ? 405 MET A O   1 
ATOM   3138 C  CB  . MET A 1 405 ? 10.844  -3.970  37.881  1.00 17.40  ? 405 MET A CB  1 
ATOM   3139 C  CG  . MET A 1 405 ? 10.116  -5.220  38.217  1.00 17.36  ? 405 MET A CG  1 
ATOM   3140 S  SD  . MET A 1 405 ? 11.291  -6.594  38.549  1.00 39.51  ? 405 MET A SD  1 
ATOM   3141 C  CE  . MET A 1 405 ? 12.473  -6.702  37.197  1.00 53.50  ? 405 MET A CE  1 
ATOM   3142 N  N   . HIS A 1 406 ? 11.643  -0.928  38.415  1.00 20.26  ? 406 HIS A N   1 
ATOM   3143 C  CA  . HIS A 1 406 ? 12.402  0.247   38.019  1.00 21.53  ? 406 HIS A CA  1 
ATOM   3144 C  C   . HIS A 1 406 ? 13.507  0.521   39.024  1.00 28.93  ? 406 HIS A C   1 
ATOM   3145 O  O   . HIS A 1 406 ? 14.618  0.929   38.658  1.00 38.99  ? 406 HIS A O   1 
ATOM   3146 C  CB  . HIS A 1 406 ? 11.487  1.450   37.905  1.00 24.95  ? 406 HIS A CB  1 
ATOM   3147 C  CG  . HIS A 1 406 ? 12.211  2.708   37.556  1.00 29.93  ? 406 HIS A CG  1 
ATOM   3148 N  ND1 . HIS A 1 406 ? 12.746  3.560   38.502  1.00 38.40  ? 406 HIS A ND1 1 
ATOM   3149 C  CD2 . HIS A 1 406 ? 12.522  3.245   36.352  1.00 33.09  ? 406 HIS A CD2 1 
ATOM   3150 C  CE1 . HIS A 1 406 ? 13.329  4.582   37.899  1.00 43.23  ? 406 HIS A CE1 1 
ATOM   3151 N  NE2 . HIS A 1 406 ? 13.207  4.414   36.593  1.00 43.27  ? 406 HIS A NE2 1 
ATOM   3152 N  N   . PHE A 1 407 ? 13.202  0.312   40.304  1.00 30.59  ? 407 PHE A N   1 
ATOM   3153 C  CA  . PHE A 1 407 ? 14.186  0.518   41.356  1.00 26.48  ? 407 PHE A CA  1 
ATOM   3154 C  C   . PHE A 1 407 ? 15.292  -0.528  41.274  1.00 19.89  ? 407 PHE A C   1 
ATOM   3155 O  O   . PHE A 1 407 ? 16.476  -0.197  41.411  1.00 22.24  ? 407 PHE A O   1 
ATOM   3156 C  CB  . PHE A 1 407 ? 13.479  0.495   42.712  1.00 16.17  ? 407 PHE A CB  1 
ATOM   3157 C  CG  . PHE A 1 407 ? 14.400  0.584   43.889  1.00 16.13  ? 407 PHE A CG  1 
ATOM   3158 C  CD1 . PHE A 1 407 ? 14.749  -0.537  44.616  1.00 16.11  ? 407 PHE A CD1 1 
ATOM   3159 C  CD2 . PHE A 1 407 ? 14.928  1.806   44.262  1.00 16.19  ? 407 PHE A CD2 1 
ATOM   3160 C  CE1 . PHE A 1 407 ? 15.605  -0.435  45.694  1.00 21.03  ? 407 PHE A CE1 1 
ATOM   3161 C  CE2 . PHE A 1 407 ? 15.781  1.920   45.335  1.00 16.86  ? 407 PHE A CE2 1 
ATOM   3162 C  CZ  . PHE A 1 407 ? 16.123  0.803   46.055  1.00 24.53  ? 407 PHE A CZ  1 
ATOM   3163 N  N   . VAL A 1 408 ? 14.933  -1.790  41.018  1.00 17.59  ? 408 VAL A N   1 
ATOM   3164 C  CA  . VAL A 1 408 ? 15.934  -2.853  41.034  1.00 23.58  ? 408 VAL A CA  1 
ATOM   3165 C  C   . VAL A 1 408 ? 16.860  -2.736  39.830  1.00 29.07  ? 408 VAL A C   1 
ATOM   3166 O  O   . VAL A 1 408 ? 18.018  -3.167  39.877  1.00 25.01  ? 408 VAL A O   1 
ATOM   3167 C  CB  . VAL A 1 408 ? 15.255  -4.235  41.090  1.00 29.30  ? 408 VAL A CB  1 
ATOM   3168 C  CG1 . VAL A 1 408 ? 14.603  -4.549  39.787  1.00 36.41  ? 408 VAL A CG1 1 
ATOM   3169 C  CG2 . VAL A 1 408 ? 16.246  -5.323  41.412  1.00 28.97  ? 408 VAL A CG2 1 
ATOM   3170 N  N   . ASN A 1 409 ? 16.384  -2.159  38.733  1.00 33.59  ? 409 ASN A N   1 
ATOM   3171 C  CA  . ASN A 1 409 ? 17.307  -1.930  37.633  1.00 28.38  ? 409 ASN A CA  1 
ATOM   3172 C  C   . ASN A 1 409 ? 18.201  -0.738  37.928  1.00 36.32  ? 409 ASN A C   1 
ATOM   3173 O  O   . ASN A 1 409 ? 19.417  -0.807  37.716  1.00 45.75  ? 409 ASN A O   1 
ATOM   3174 C  CB  . ASN A 1 409 ? 16.545  -1.745  36.320  1.00 23.12  ? 409 ASN A CB  1 
ATOM   3175 C  CG  . ASN A 1 409 ? 16.254  -3.075  35.616  1.00 33.90  ? 409 ASN A CG  1 
ATOM   3176 O  OD1 . ASN A 1 409 ? 15.191  -3.676  35.807  1.00 43.11  ? 409 ASN A OD1 1 
ATOM   3177 N  ND2 . ASN A 1 409 ? 17.196  -3.531  34.789  1.00 36.54  ? 409 ASN A ND2 1 
ATOM   3178 N  N   . LYS A 1 410 ? 17.625  0.342   38.459  1.00 34.04  ? 410 LYS A N   1 
ATOM   3179 C  CA  . LYS A 1 410 ? 18.420  1.530   38.748  1.00 32.80  ? 410 LYS A CA  1 
ATOM   3180 C  C   . LYS A 1 410 ? 19.481  1.241   39.798  1.00 26.99  ? 410 LYS A C   1 
ATOM   3181 O  O   . LYS A 1 410 ? 20.638  1.663   39.661  1.00 19.52  ? 410 LYS A O   1 
ATOM   3182 C  CB  . LYS A 1 410 ? 17.509  2.661   39.205  1.00 27.71  ? 410 LYS A CB  1 
ATOM   3183 C  CG  . LYS A 1 410 ? 16.661  3.236   38.089  1.00 38.80  ? 410 LYS A CG  1 
ATOM   3184 C  CD  . LYS A 1 410 ? 17.509  3.952   37.036  1.00 44.19  ? 410 LYS A CD  1 
ATOM   3185 C  CE  . LYS A 1 410 ? 16.622  4.625   35.981  1.00 45.66  ? 410 LYS A CE  1 
ATOM   3186 N  NZ  . LYS A 1 410 ? 17.396  5.348   34.938  1.00 45.71  ? 410 LYS A NZ  1 
ATOM   3187 N  N   . TYR A 1 411 ? 19.104  0.508   40.844  1.00 25.72  ? 411 TYR A N   1 
ATOM   3188 C  CA  . TYR A 1 411 ? 20.009  0.276   41.962  1.00 32.43  ? 411 TYR A CA  1 
ATOM   3189 C  C   . TYR A 1 411 ? 21.166  -0.627  41.553  1.00 28.14  ? 411 TYR A C   1 
ATOM   3190 O  O   . TYR A 1 411 ? 22.297  -0.459  42.029  1.00 20.73  ? 411 TYR A O   1 
ATOM   3191 C  CB  . TYR A 1 411 ? 19.243  -0.327  43.151  1.00 28.92  ? 411 TYR A CB  1 
ATOM   3192 C  CG  . TYR A 1 411 ? 20.143  -0.607  44.333  1.00 32.37  ? 411 TYR A CG  1 
ATOM   3193 C  CD1 . TYR A 1 411 ? 20.421  0.394   45.256  1.00 37.26  ? 411 TYR A CD1 1 
ATOM   3194 C  CD2 . TYR A 1 411 ? 20.739  -1.852  44.513  1.00 18.32  ? 411 TYR A CD2 1 
ATOM   3195 C  CE1 . TYR A 1 411 ? 21.271  0.175   46.335  1.00 43.61  ? 411 TYR A CE1 1 
ATOM   3196 C  CE2 . TYR A 1 411 ? 21.587  -2.090  45.589  1.00 41.84  ? 411 TYR A CE2 1 
ATOM   3197 C  CZ  . TYR A 1 411 ? 21.848  -1.066  46.501  1.00 48.64  ? 411 TYR A CZ  1 
ATOM   3198 O  OH  . TYR A 1 411 ? 22.683  -1.270  47.583  1.00 51.96  ? 411 TYR A OH  1 
ATOM   3199 N  N   . THR A 1 412 ? 20.903  -1.576  40.655  1.00 23.04  ? 412 THR A N   1 
ATOM   3200 C  CA  . THR A 1 412 ? 21.910  -2.577  40.311  1.00 29.18  ? 412 THR A CA  1 
ATOM   3201 C  C   . THR A 1 412 ? 23.081  -1.988  39.532  1.00 22.50  ? 412 THR A C   1 
ATOM   3202 O  O   . THR A 1 412 ? 24.201  -2.508  39.624  1.00 21.40  ? 412 THR A O   1 
ATOM   3203 C  CB  . THR A 1 412 ? 21.249  -3.698  39.527  1.00 33.43  ? 412 THR A CB  1 
ATOM   3204 O  OG1 . THR A 1 412 ? 20.395  -4.414  40.422  1.00 23.79  ? 412 THR A OG1 1 
ATOM   3205 C  CG2 . THR A 1 412 ? 22.290  -4.661  38.949  1.00 38.02  ? 412 THR A CG2 1 
ATOM   3206 N  N   . LYS A 1 413 ? 22.855  -0.901  38.789  1.00 20.86  ? 413 LYS A N   1 
ATOM   3207 C  CA  . LYS A 1 413 ? 23.966  -0.199  38.151  1.00 37.55  ? 413 LYS A CA  1 
ATOM   3208 C  C   . LYS A 1 413 ? 25.043  0.199   39.155  1.00 30.92  ? 413 LYS A C   1 
ATOM   3209 O  O   . LYS A 1 413 ? 26.216  0.324   38.788  1.00 22.61  ? 413 LYS A O   1 
ATOM   3210 C  CB  . LYS A 1 413 ? 23.465  1.045   37.416  1.00 39.94  ? 413 LYS A CB  1 
ATOM   3211 C  CG  . LYS A 1 413 ? 22.285  0.809   36.494  1.00 47.84  ? 413 LYS A CG  1 
ATOM   3212 C  CD  . LYS A 1 413 ? 22.382  1.694   35.256  1.00 55.14  ? 413 LYS A CD  1 
ATOM   3213 C  CE  . LYS A 1 413 ? 21.179  1.533   34.329  1.00 53.42  ? 413 LYS A CE  1 
ATOM   3214 N  NZ  . LYS A 1 413 ? 19.964  2.234   34.850  1.00 56.01  ? 413 LYS A NZ  1 
ATOM   3215 N  N   . PHE A 1 414 ? 24.671  0.387   40.421  1.00 21.21  ? 414 PHE A N   1 
ATOM   3216 C  CA  . PHE A 1 414 ? 25.586  0.915   41.421  1.00 31.68  ? 414 PHE A CA  1 
ATOM   3217 C  C   . PHE A 1 414 ? 25.748  0.050   42.669  1.00 25.09  ? 414 PHE A C   1 
ATOM   3218 O  O   . PHE A 1 414 ? 26.733  0.223   43.386  1.00 29.24  ? 414 PHE A O   1 
ATOM   3219 C  CB  . PHE A 1 414 ? 25.137  2.319   41.856  1.00 32.02  ? 414 PHE A CB  1 
ATOM   3220 C  CG  . PHE A 1 414 ? 25.310  3.378   40.798  1.00 35.29  ? 414 PHE A CG  1 
ATOM   3221 C  CD1 . PHE A 1 414 ? 26.553  3.963   40.583  1.00 35.41  ? 414 PHE A CD1 1 
ATOM   3222 C  CD2 . PHE A 1 414 ? 24.226  3.814   40.043  1.00 33.01  ? 414 PHE A CD2 1 
ATOM   3223 C  CE1 . PHE A 1 414 ? 26.719  4.945   39.626  1.00 31.85  ? 414 PHE A CE1 1 
ATOM   3224 C  CE2 . PHE A 1 414 ? 24.382  4.801   39.086  1.00 27.38  ? 414 PHE A CE2 1 
ATOM   3225 C  CZ  . PHE A 1 414 ? 25.631  5.366   38.878  1.00 30.88  ? 414 PHE A CZ  1 
ATOM   3226 N  N   . GLY A 1 415 ? 24.830  -0.861  42.957  1.00 27.80  ? 415 GLY A N   1 
ATOM   3227 C  CA  . GLY A 1 415 ? 24.917  -1.645  44.168  1.00 30.15  ? 415 GLY A CA  1 
ATOM   3228 C  C   . GLY A 1 415 ? 26.062  -2.638  44.132  1.00 29.63  ? 415 GLY A C   1 
ATOM   3229 O  O   . GLY A 1 415 ? 26.878  -2.669  43.210  1.00 40.97  ? 415 GLY A O   1 
ATOM   3230 N  N   . ASN A 1 416 ? 26.105  -3.479  45.168  1.00 20.92  ? 416 ASN A N   1 
ATOM   3231 C  CA  . ASN A 1 416 ? 27.090  -4.546  45.295  1.00 27.44  ? 416 ASN A CA  1 
ATOM   3232 C  C   . ASN A 1 416 ? 26.406  -5.904  45.459  1.00 28.33  ? 416 ASN A C   1 
ATOM   3233 O  O   . ASN A 1 416 ? 26.963  -6.834  46.046  1.00 41.19  ? 416 ASN A O   1 
ATOM   3234 C  CB  . ASN A 1 416 ? 28.050  -4.246  46.455  1.00 34.53  ? 416 ASN A CB  1 
ATOM   3235 C  CG  . ASN A 1 416 ? 29.206  -5.246  46.553  1.00 31.28  ? 416 ASN A CG  1 
ATOM   3236 O  OD1 . ASN A 1 416 ? 29.251  -6.045  47.480  1.00 29.54  ? 416 ASN A OD1 1 
ATOM   3237 N  ND2 . ASN A 1 416 ? 30.129  -5.209  45.588  1.00 34.79  ? 416 ASN A ND2 1 
ATOM   3238 N  N   . GLY A 1 417 ? 25.195  -6.035  44.933  1.00 29.36  ? 417 GLY A N   1 
ATOM   3239 C  CA  . GLY A 1 417 ? 24.475  -7.293  44.997  1.00 33.52  ? 417 GLY A CA  1 
ATOM   3240 C  C   . GLY A 1 417 ? 22.973  -7.101  45.013  1.00 42.53  ? 417 GLY A C   1 
ATOM   3241 O  O   . GLY A 1 417 ? 22.464  -6.202  45.689  1.00 52.17  ? 417 GLY A O   1 
ATOM   3242 N  N   . THR A 1 418 ? 22.249  -7.938  44.277  1.00 40.19  ? 418 THR A N   1 
ATOM   3243 C  CA  . THR A 1 418 ? 20.809  -7.772  44.119  1.00 26.79  ? 418 THR A CA  1 
ATOM   3244 C  C   . THR A 1 418 ? 20.167  -9.138  43.951  1.00 22.48  ? 418 THR A C   1 
ATOM   3245 O  O   . THR A 1 418 ? 20.561  -9.891  43.059  1.00 24.65  ? 418 THR A O   1 
ATOM   3246 C  CB  . THR A 1 418 ? 20.489  -6.910  42.899  1.00 30.72  ? 418 THR A CB  1 
ATOM   3247 O  OG1 . THR A 1 418 ? 20.945  -5.571  43.107  1.00 41.96  ? 418 THR A OG1 1 
ATOM   3248 C  CG2 . THR A 1 418 ? 19.027  -6.893  42.666  1.00 33.82  ? 418 THR A CG2 1 
ATOM   3249 N  N   . TYR A 1 419 ? 19.179  -9.456  44.782  1.00 26.67  ? 419 TYR A N   1 
ATOM   3250 C  CA  . TYR A 1 419 ? 18.474  -10.729 44.670  1.00 28.20  ? 419 TYR A CA  1 
ATOM   3251 C  C   . TYR A 1 419 ? 16.976  -10.473 44.589  1.00 24.28  ? 419 TYR A C   1 
ATOM   3252 O  O   . TYR A 1 419 ? 16.376  -9.967  45.545  1.00 22.97  ? 419 TYR A O   1 
ATOM   3253 C  CB  . TYR A 1 419 ? 18.807  -11.643 45.848  1.00 31.43  ? 419 TYR A CB  1 
ATOM   3254 C  CG  . TYR A 1 419 ? 20.271  -12.006 45.947  1.00 31.93  ? 419 TYR A CG  1 
ATOM   3255 C  CD1 . TYR A 1 419 ? 20.750  -13.192 45.395  1.00 20.67  ? 419 TYR A CD1 1 
ATOM   3256 C  CD2 . TYR A 1 419 ? 21.178  -11.164 46.601  1.00 35.84  ? 419 TYR A CD2 1 
ATOM   3257 C  CE1 . TYR A 1 419 ? 22.091  -13.526 45.482  1.00 25.34  ? 419 TYR A CE1 1 
ATOM   3258 C  CE2 . TYR A 1 419 ? 22.520  -11.496 46.703  1.00 29.74  ? 419 TYR A CE2 1 
ATOM   3259 C  CZ  . TYR A 1 419 ? 22.972  -12.675 46.140  1.00 30.45  ? 419 TYR A CZ  1 
ATOM   3260 O  OH  . TYR A 1 419 ? 24.304  -13.000 46.241  1.00 30.93  ? 419 TYR A OH  1 
ATOM   3261 N  N   . LEU A 1 420 ? 16.371  -10.836 43.461  1.00 18.76  ? 420 LEU A N   1 
ATOM   3262 C  CA  . LEU A 1 420 ? 14.972  -10.541 43.207  1.00 20.36  ? 420 LEU A CA  1 
ATOM   3263 C  C   . LEU A 1 420 ? 14.153  -11.807 43.382  1.00 26.36  ? 420 LEU A C   1 
ATOM   3264 O  O   . LEU A 1 420 ? 14.589  -12.895 42.988  1.00 34.73  ? 420 LEU A O   1 
ATOM   3265 C  CB  . LEU A 1 420 ? 14.776  -9.987  41.801  1.00 33.54  ? 420 LEU A CB  1 
ATOM   3266 C  CG  . LEU A 1 420 ? 13.404  -9.366  41.582  1.00 49.04  ? 420 LEU A CG  1 
ATOM   3267 C  CD1 . LEU A 1 420 ? 13.668  -8.019  40.917  1.00 56.93  ? 420 LEU A CD1 1 
ATOM   3268 C  CD2 . LEU A 1 420 ? 12.469  -10.233 40.752  1.00 58.71  ? 420 LEU A CD2 1 
ATOM   3269 N  N   . TYR A 1 421 ? 12.972  -11.675 43.979  1.00 18.05  ? 421 TYR A N   1 
ATOM   3270 C  CA  . TYR A 1 421 ? 12.098  -12.824 44.141  1.00 24.30  ? 421 TYR A CA  1 
ATOM   3271 C  C   . TYR A 1 421 ? 10.697  -12.449 43.702  1.00 19.55  ? 421 TYR A C   1 
ATOM   3272 O  O   . TYR A 1 421 ? 10.364  -11.271 43.557  1.00 17.53  ? 421 TYR A O   1 
ATOM   3273 C  CB  . TYR A 1 421 ? 12.083  -13.359 45.584  1.00 18.19  ? 421 TYR A CB  1 
ATOM   3274 C  CG  . TYR A 1 421 ? 11.393  -12.467 46.589  1.00 29.23  ? 421 TYR A CG  1 
ATOM   3275 C  CD1 . TYR A 1 421 ? 10.004  -12.452 46.708  1.00 35.05  ? 421 TYR A CD1 1 
ATOM   3276 C  CD2 . TYR A 1 421 ? 12.125  -11.658 47.437  1.00 27.49  ? 421 TYR A CD2 1 
ATOM   3277 C  CE1 . TYR A 1 421 ? 9.369   -11.640 47.627  1.00 25.55  ? 421 TYR A CE1 1 
ATOM   3278 C  CE2 . TYR A 1 421 ? 11.498  -10.851 48.371  1.00 29.17  ? 421 TYR A CE2 1 
ATOM   3279 C  CZ  . TYR A 1 421 ? 10.125  -10.845 48.459  1.00 29.46  ? 421 TYR A CZ  1 
ATOM   3280 O  OH  . TYR A 1 421 ? 9.519   -10.029 49.391  1.00 37.61  ? 421 TYR A OH  1 
ATOM   3281 N  N   . PHE A 1 422 ? 9.888   -13.486 43.496  1.00 18.86  ? 422 PHE A N   1 
ATOM   3282 C  CA  . PHE A 1 422 ? 8.495   -13.363 43.068  1.00 26.51  ? 422 PHE A CA  1 
ATOM   3283 C  C   . PHE A 1 422 ? 7.737   -14.386 43.899  1.00 31.92  ? 422 PHE A C   1 
ATOM   3284 O  O   . PHE A 1 422 ? 7.755   -15.585 43.597  1.00 34.70  ? 422 PHE A O   1 
ATOM   3285 C  CB  . PHE A 1 422 ? 8.323   -13.624 41.572  1.00 22.61  ? 422 PHE A CB  1 
ATOM   3286 C  CG  . PHE A 1 422 ? 6.902   -13.489 41.074  1.00 24.14  ? 422 PHE A CG  1 
ATOM   3287 C  CD1 . PHE A 1 422 ? 6.283   -12.246 41.011  1.00 24.35  ? 422 PHE A CD1 1 
ATOM   3288 C  CD2 . PHE A 1 422 ? 6.200   -14.597 40.623  1.00 32.78  ? 422 PHE A CD2 1 
ATOM   3289 C  CE1 . PHE A 1 422 ? 4.977   -12.111 40.525  1.00 20.24  ? 422 PHE A CE1 1 
ATOM   3290 C  CE2 . PHE A 1 422 ? 4.895   -14.469 40.130  1.00 32.78  ? 422 PHE A CE2 1 
ATOM   3291 C  CZ  . PHE A 1 422 ? 4.281   -13.223 40.092  1.00 24.87  ? 422 PHE A CZ  1 
ATOM   3292 N  N   . PHE A 1 423 ? 7.098   -13.915 44.955  1.00 32.86  ? 423 PHE A N   1 
ATOM   3293 C  CA  . PHE A 1 423 ? 6.370   -14.803 45.842  1.00 27.11  ? 423 PHE A CA  1 
ATOM   3294 C  C   . PHE A 1 423 ? 4.979   -15.041 45.269  1.00 27.21  ? 423 PHE A C   1 
ATOM   3295 O  O   . PHE A 1 423 ? 4.235   -14.088 45.016  1.00 34.29  ? 423 PHE A O   1 
ATOM   3296 C  CB  . PHE A 1 423 ? 6.311   -14.192 47.238  1.00 20.68  ? 423 PHE A CB  1 
ATOM   3297 C  CG  . PHE A 1 423 ? 5.606   -15.048 48.245  1.00 27.99  ? 423 PHE A CG  1 
ATOM   3298 C  CD1 . PHE A 1 423 ? 6.306   -15.974 48.990  1.00 25.19  ? 423 PHE A CD1 1 
ATOM   3299 C  CD2 . PHE A 1 423 ? 4.239   -14.920 48.450  1.00 27.76  ? 423 PHE A CD2 1 
ATOM   3300 C  CE1 . PHE A 1 423 ? 5.660   -16.757 49.914  1.00 34.12  ? 423 PHE A CE1 1 
ATOM   3301 C  CE2 . PHE A 1 423 ? 3.592   -15.702 49.370  1.00 33.92  ? 423 PHE A CE2 1 
ATOM   3302 C  CZ  . PHE A 1 423 ? 4.301   -16.616 50.112  1.00 37.38  ? 423 PHE A CZ  1 
ATOM   3303 N  N   . ASN A 1 424 ? 4.627   -16.302 45.055  1.00 18.89  ? 424 ASN A N   1 
ATOM   3304 C  CA  . ASN A 1 424 ? 3.290   -16.578 44.550  1.00 25.71  ? 424 ASN A CA  1 
ATOM   3305 C  C   . ASN A 1 424 ? 2.800   -17.910 45.127  1.00 31.90  ? 424 ASN A C   1 
ATOM   3306 O  O   . ASN A 1 424 ? 2.644   -18.937 44.466  1.00 30.39  ? 424 ASN A O   1 
ATOM   3307 C  CB  . ASN A 1 424 ? 3.259   -16.586 43.019  1.00 36.05  ? 424 ASN A CB  1 
ATOM   3308 C  CG  . ASN A 1 424 ? 4.329   -17.492 42.397  1.00 38.59  ? 424 ASN A CG  1 
ATOM   3309 O  OD1 . ASN A 1 424 ? 5.070   -18.186 43.095  1.00 42.09  ? 424 ASN A OD1 1 
ATOM   3310 N  ND2 . ASN A 1 424 ? 4.401   -17.488 41.070  1.00 39.59  ? 424 ASN A ND2 1 
ATOM   3311 N  N   . HIS A 1 425 ? 2.539   -17.941 46.423  1.00 40.81  ? 425 HIS A N   1 
ATOM   3312 C  CA  . HIS A 1 425 ? 2.040   -19.163 47.038  1.00 43.94  ? 425 HIS A CA  1 
ATOM   3313 C  C   . HIS A 1 425 ? 0.686   -18.883 47.678  1.00 59.31  ? 425 HIS A C   1 
ATOM   3314 O  O   . HIS A 1 425 ? 0.605   -18.252 48.738  1.00 68.90  ? 425 HIS A O   1 
ATOM   3315 C  CB  . HIS A 1 425 ? 3.009   -19.723 48.060  1.00 36.89  ? 425 HIS A CB  1 
ATOM   3316 C  CG  . HIS A 1 425 ? 2.452   -20.898 48.795  1.00 34.57  ? 425 HIS A CG  1 
ATOM   3317 N  ND1 . HIS A 1 425 ? 2.322   -22.142 48.215  1.00 35.86  ? 425 HIS A ND1 1 
ATOM   3318 C  CD2 . HIS A 1 425 ? 1.940   -21.006 50.043  1.00 27.64  ? 425 HIS A CD2 1 
ATOM   3319 C  CE1 . HIS A 1 425 ? 1.782   -22.975 49.086  1.00 35.84  ? 425 HIS A CE1 1 
ATOM   3320 N  NE2 . HIS A 1 425 ? 1.539   -22.310 50.202  1.00 34.65  ? 425 HIS A NE2 1 
ATOM   3321 N  N   . ARG A 1 426 ? -0.370  -19.363 47.026  1.00 56.33  ? 426 ARG A N   1 
ATOM   3322 C  CA  . ARG A 1 426 ? -1.702  -19.365 47.609  1.00 50.51  ? 426 ARG A CA  1 
ATOM   3323 C  C   . ARG A 1 426 ? -1.712  -20.271 48.829  1.00 45.12  ? 426 ARG A C   1 
ATOM   3324 O  O   . ARG A 1 426 ? -1.702  -21.502 48.685  1.00 30.34  ? 426 ARG A O   1 
ATOM   3325 C  CB  . ARG A 1 426 ? -2.728  -19.842 46.584  1.00 59.27  ? 426 ARG A CB  1 
ATOM   3326 C  CG  . ARG A 1 426 ? -4.122  -19.989 47.132  1.00 62.14  ? 426 ARG A CG  1 
ATOM   3327 C  CD  . ARG A 1 426 ? -4.706  -18.647 47.494  1.00 52.66  ? 426 ARG A CD  1 
ATOM   3328 N  NE  . ARG A 1 426 ? -6.023  -18.816 48.087  1.00 48.50  ? 426 ARG A NE  1 
ATOM   3329 C  CZ  . ARG A 1 426 ? -6.904  -17.836 48.244  1.00 43.05  ? 426 ARG A CZ  1 
ATOM   3330 N  NH1 . ARG A 1 426 ? -8.087  -18.103 48.800  1.00 41.42  ? 426 ARG A NH1 1 
ATOM   3331 N  NH2 . ARG A 1 426 ? -6.606  -16.598 47.841  1.00 25.89  ? 426 ARG A NH2 1 
ATOM   3332 N  N   . ALA A 1 427 ? -1.703  -19.673 50.024  1.00 46.06  ? 427 ALA A N   1 
ATOM   3333 C  CA  . ALA A 1 427 ? -1.731  -20.461 51.246  1.00 43.93  ? 427 ALA A CA  1 
ATOM   3334 C  C   . ALA A 1 427 ? -2.971  -21.345 51.266  1.00 51.38  ? 427 ALA A C   1 
ATOM   3335 O  O   . ALA A 1 427 ? -4.024  -20.996 50.721  1.00 54.82  ? 427 ALA A O   1 
ATOM   3336 C  CB  . ALA A 1 427 ? -1.699  -19.556 52.478  1.00 40.83  ? 427 ALA A CB  1 
ATOM   3337 N  N   . SER A 1 428 ? -2.831  -22.520 51.875  1.00 50.46  ? 428 SER A N   1 
ATOM   3338 C  CA  . SER A 1 428 ? -3.946  -23.458 51.896  1.00 50.79  ? 428 SER A CA  1 
ATOM   3339 C  C   . SER A 1 428 ? -5.001  -23.039 52.907  1.00 56.65  ? 428 SER A C   1 
ATOM   3340 O  O   . SER A 1 428 ? -6.201  -23.211 52.667  1.00 64.82  ? 428 SER A O   1 
ATOM   3341 C  CB  . SER A 1 428 ? -3.437  -24.863 52.201  1.00 48.99  ? 428 SER A CB  1 
ATOM   3342 O  OG  . SER A 1 428 ? -2.505  -24.814 53.267  1.00 58.39  ? 428 SER A OG  1 
ATOM   3343 N  N   . ASN A 1 429 ? -4.574  -22.470 54.029  1.00 55.62  ? 429 ASN A N   1 
ATOM   3344 C  CA  . ASN A 1 429 ? -5.471  -22.072 55.101  1.00 63.86  ? 429 ASN A CA  1 
ATOM   3345 C  C   . ASN A 1 429 ? -5.913  -20.610 55.003  1.00 64.65  ? 429 ASN A C   1 
ATOM   3346 O  O   . ASN A 1 429 ? -6.289  -20.020 56.024  1.00 67.93  ? 429 ASN A O   1 
ATOM   3347 C  CB  . ASN A 1 429 ? -4.798  -22.322 56.455  1.00 71.39  ? 429 ASN A CB  1 
ATOM   3348 C  CG  . ASN A 1 429 ? -3.598  -21.402 56.698  1.00 74.28  ? 429 ASN A CG  1 
ATOM   3349 O  OD1 . ASN A 1 429 ? -2.894  -21.003 55.761  1.00 79.87  ? 429 ASN A OD1 1 
ATOM   3350 N  ND2 . ASN A 1 429 ? -3.363  -21.066 57.963  1.00 64.04  ? 429 ASN A ND2 1 
ATOM   3351 N  N   . LEU A 1 430 ? -5.887  -20.010 53.815  1.00 57.29  ? 430 LEU A N   1 
ATOM   3352 C  CA  . LEU A 1 430 ? -6.135  -18.578 53.772  1.00 55.76  ? 430 LEU A CA  1 
ATOM   3353 C  C   . LEU A 1 430 ? -7.631  -18.274 53.861  1.00 54.64  ? 430 LEU A C   1 
ATOM   3354 O  O   . LEU A 1 430 ? -8.491  -19.084 53.502  1.00 45.85  ? 430 LEU A O   1 
ATOM   3355 C  CB  . LEU A 1 430 ? -5.540  -17.942 52.513  1.00 63.69  ? 430 LEU A CB  1 
ATOM   3356 C  CG  . LEU A 1 430 ? -5.203  -16.458 52.723  1.00 66.84  ? 430 LEU A CG  1 
ATOM   3357 C  CD1 . LEU A 1 430 ? -4.000  -16.341 53.649  1.00 68.61  ? 430 LEU A CD1 1 
ATOM   3358 C  CD2 . LEU A 1 430 ? -4.979  -15.697 51.416  1.00 58.33  ? 430 LEU A CD2 1 
ATOM   3359 N  N   . VAL A 1 431 ? -7.925  -17.067 54.345  1.00 61.77  ? 431 VAL A N   1 
ATOM   3360 C  CA  . VAL A 1 431 ? -9.285  -16.667 54.677  1.00 58.42  ? 431 VAL A CA  1 
ATOM   3361 C  C   . VAL A 1 431 ? -9.998  -15.927 53.545  1.00 51.32  ? 431 VAL A C   1 
ATOM   3362 O  O   . VAL A 1 431 ? -11.233 -15.986 53.471  1.00 56.23  ? 431 VAL A O   1 
ATOM   3363 C  CB  . VAL A 1 431 ? -9.281  -15.806 55.957  1.00 60.38  ? 431 VAL A CB  1 
ATOM   3364 C  CG1 . VAL A 1 431 ? -8.650  -16.577 57.097  1.00 61.65  ? 431 VAL A CG1 1 
ATOM   3365 C  CG2 . VAL A 1 431 ? -8.529  -14.506 55.722  1.00 63.66  ? 431 VAL A CG2 1 
ATOM   3366 N  N   . TRP A 1 432 ? -9.268  -15.232 52.671  1.00 33.61  ? 432 TRP A N   1 
ATOM   3367 C  CA  . TRP A 1 432 ? -9.911  -14.482 51.597  1.00 31.81  ? 432 TRP A CA  1 
ATOM   3368 C  C   . TRP A 1 432 ? -10.306 -15.407 50.442  1.00 28.85  ? 432 TRP A C   1 
ATOM   3369 O  O   . TRP A 1 432 ? -9.864  -16.556 50.377  1.00 29.43  ? 432 TRP A O   1 
ATOM   3370 C  CB  . TRP A 1 432 ? -8.979  -13.384 51.113  1.00 33.87  ? 432 TRP A CB  1 
ATOM   3371 C  CG  . TRP A 1 432 ? -8.470  -12.502 52.207  1.00 40.68  ? 432 TRP A CG  1 
ATOM   3372 C  CD1 . TRP A 1 432 ? -7.385  -12.728 53.001  1.00 46.39  ? 432 TRP A CD1 1 
ATOM   3373 C  CD2 . TRP A 1 432 ? -9.001  -11.231 52.604  1.00 34.93  ? 432 TRP A CD2 1 
ATOM   3374 N  NE1 . TRP A 1 432 ? -7.214  -11.677 53.876  1.00 49.41  ? 432 TRP A NE1 1 
ATOM   3375 C  CE2 . TRP A 1 432 ? -8.192  -10.747 53.648  1.00 35.77  ? 432 TRP A CE2 1 
ATOM   3376 C  CE3 . TRP A 1 432 ? -10.080 -10.459 52.178  1.00 21.79  ? 432 TRP A CE3 1 
ATOM   3377 C  CZ2 . TRP A 1 432 ? -8.428  -9.535  54.262  1.00 27.93  ? 432 TRP A CZ2 1 
ATOM   3378 C  CZ3 . TRP A 1 432 ? -10.313 -9.267  52.792  1.00 17.98  ? 432 TRP A CZ3 1 
ATOM   3379 C  CH2 . TRP A 1 432 ? -9.495  -8.812  53.826  1.00 25.78  ? 432 TRP A CH2 1 
ATOM   3380 N  N   . PRO A 1 433 ? -11.173 -14.951 49.538  1.00 23.90  ? 433 PRO A N   1 
ATOM   3381 C  CA  . PRO A 1 433 ? -11.574 -15.801 48.413  1.00 25.97  ? 433 PRO A CA  1 
ATOM   3382 C  C   . PRO A 1 433 ? -10.436 -15.999 47.429  1.00 37.49  ? 433 PRO A C   1 
ATOM   3383 O  O   . PRO A 1 433 ? -9.426  -15.289 47.429  1.00 42.82  ? 433 PRO A O   1 
ATOM   3384 C  CB  . PRO A 1 433 ? -12.713 -15.017 47.773  1.00 21.52  ? 433 PRO A CB  1 
ATOM   3385 C  CG  . PRO A 1 433 ? -12.381 -13.611 48.097  1.00 31.67  ? 433 PRO A CG  1 
ATOM   3386 C  CD  . PRO A 1 433 ? -11.922 -13.687 49.528  1.00 26.36  ? 433 PRO A CD  1 
ATOM   3387 N  N   . GLU A 1 434 ? -10.643 -16.972 46.540  1.00 38.07  ? 434 GLU A N   1 
ATOM   3388 C  CA  . GLU A 1 434 ? -9.564  -17.374 45.651  1.00 31.08  ? 434 GLU A CA  1 
ATOM   3389 C  C   . GLU A 1 434 ? -9.261  -16.311 44.602  1.00 28.41  ? 434 GLU A C   1 
ATOM   3390 O  O   . GLU A 1 434 ? -8.086  -16.108 44.272  1.00 30.18  ? 434 GLU A O   1 
ATOM   3391 C  CB  . GLU A 1 434 ? -9.886  -18.717 45.012  1.00 38.21  ? 434 GLU A CB  1 
ATOM   3392 C  CG  . GLU A 1 434 ? -10.071 -19.824 46.050  1.00 59.49  ? 434 GLU A CG  1 
ATOM   3393 C  CD  . GLU A 1 434 ? -9.590  -21.187 45.574  1.00 77.22  ? 434 GLU A CD  1 
ATOM   3394 O  OE1 . GLU A 1 434 ? -8.862  -21.246 44.556  1.00 79.23  ? 434 GLU A OE1 1 
ATOM   3395 O  OE2 . GLU A 1 434 ? -9.944  -22.201 46.220  1.00 82.26  ? 434 GLU A OE2 1 
ATOM   3396 N  N   . TRP A 1 435 ? -10.280 -15.594 44.105  1.00 23.14  ? 435 TRP A N   1 
ATOM   3397 C  CA  . TRP A 1 435 ? -10.028 -14.555 43.106  1.00 25.66  ? 435 TRP A CA  1 
ATOM   3398 C  C   . TRP A 1 435 ? -8.960  -13.581 43.568  1.00 28.97  ? 435 TRP A C   1 
ATOM   3399 O  O   . TRP A 1 435 ? -8.226  -13.029 42.743  1.00 41.28  ? 435 TRP A O   1 
ATOM   3400 C  CB  . TRP A 1 435 ? -11.311 -13.781 42.745  1.00 27.06  ? 435 TRP A CB  1 
ATOM   3401 C  CG  . TRP A 1 435 ? -11.779 -12.699 43.732  1.00 35.67  ? 435 TRP A CG  1 
ATOM   3402 C  CD1 . TRP A 1 435 ? -12.809 -12.799 44.638  1.00 38.90  ? 435 TRP A CD1 1 
ATOM   3403 C  CD2 . TRP A 1 435 ? -11.261 -11.365 43.874  1.00 33.48  ? 435 TRP A CD2 1 
ATOM   3404 N  NE1 . TRP A 1 435 ? -12.947 -11.624 45.336  1.00 31.32  ? 435 TRP A NE1 1 
ATOM   3405 C  CE2 . TRP A 1 435 ? -12.011 -10.729 44.886  1.00 28.74  ? 435 TRP A CE2 1 
ATOM   3406 C  CE3 . TRP A 1 435 ? -10.233 -10.650 43.252  1.00 42.25  ? 435 TRP A CE3 1 
ATOM   3407 C  CZ2 . TRP A 1 435 ? -11.765 -9.413  45.282  1.00 26.81  ? 435 TRP A CZ2 1 
ATOM   3408 C  CZ3 . TRP A 1 435 ? -9.985  -9.342  43.658  1.00 37.95  ? 435 TRP A CZ3 1 
ATOM   3409 C  CH2 . TRP A 1 435 ? -10.750 -8.741  44.659  1.00 26.58  ? 435 TRP A CH2 1 
ATOM   3410 N  N   . MET A 1 436 ? -8.842  -13.363 44.877  1.00 19.66  ? 436 MET A N   1 
ATOM   3411 C  CA  . MET A 1 436 ? -7.871  -12.385 45.342  1.00 21.93  ? 436 MET A CA  1 
ATOM   3412 C  C   . MET A 1 436 ? -6.441  -12.901 45.262  1.00 22.82  ? 436 MET A C   1 
ATOM   3413 O  O   . MET A 1 436 ? -5.510  -12.105 45.418  1.00 30.78  ? 436 MET A O   1 
ATOM   3414 C  CB  . MET A 1 436 ? -8.174  -11.938 46.777  1.00 33.28  ? 436 MET A CB  1 
ATOM   3415 C  CG  . MET A 1 436 ? -9.589  -11.429 47.045  1.00 37.34  ? 436 MET A CG  1 
ATOM   3416 S  SD  . MET A 1 436 ? -9.822  -10.722 48.695  1.00 35.50  ? 436 MET A SD  1 
ATOM   3417 C  CE  . MET A 1 436 ? -8.929  -9.163  48.507  1.00 38.26  ? 436 MET A CE  1 
ATOM   3418 N  N   . GLY A 1 437 ? -6.248  -14.207 45.048  1.00 19.89  ? 437 GLY A N   1 
ATOM   3419 C  CA  . GLY A 1 437 ? -4.932  -14.809 44.868  1.00 35.93  ? 437 GLY A CA  1 
ATOM   3420 C  C   . GLY A 1 437 ? -3.943  -14.626 46.019  1.00 50.58  ? 437 GLY A C   1 
ATOM   3421 O  O   . GLY A 1 437 ? -4.277  -14.734 47.206  1.00 63.44  ? 437 GLY A O   1 
ATOM   3422 N  N   . VAL A 1 438 ? -2.687  -14.375 45.648  1.00 37.44  ? 438 VAL A N   1 
ATOM   3423 C  CA  . VAL A 1 438 ? -1.596  -14.191 46.604  1.00 27.11  ? 438 VAL A CA  1 
ATOM   3424 C  C   . VAL A 1 438 ? -1.670  -12.745 47.084  1.00 20.68  ? 438 VAL A C   1 
ATOM   3425 O  O   . VAL A 1 438 ? -1.179  -11.826 46.424  1.00 22.43  ? 438 VAL A O   1 
ATOM   3426 C  CB  . VAL A 1 438 ? -0.236  -14.529 45.988  1.00 33.15  ? 438 VAL A CB  1 
ATOM   3427 C  CG1 . VAL A 1 438 ? 0.905   -13.868 46.739  1.00 30.23  ? 438 VAL A CG1 1 
ATOM   3428 C  CG2 . VAL A 1 438 ? -0.050  -16.029 45.972  1.00 34.56  ? 438 VAL A CG2 1 
ATOM   3429 N  N   . ILE A 1 439 ? -2.299  -12.542 48.242  1.00 23.96  ? 439 ILE A N   1 
ATOM   3430 C  CA  . ILE A 1 439 ? -2.647  -11.196 48.681  1.00 29.19  ? 439 ILE A CA  1 
ATOM   3431 C  C   . ILE A 1 439 ? -1.391  -10.409 49.010  1.00 23.65  ? 439 ILE A C   1 
ATOM   3432 O  O   . ILE A 1 439 ? -0.415  -10.949 49.555  1.00 21.16  ? 439 ILE A O   1 
ATOM   3433 C  CB  . ILE A 1 439 ? -3.573  -11.235 49.911  1.00 40.73  ? 439 ILE A CB  1 
ATOM   3434 C  CG1 . ILE A 1 439 ? -4.620  -12.336 49.772  1.00 47.65  ? 439 ILE A CG1 1 
ATOM   3435 C  CG2 . ILE A 1 439 ? -4.228  -9.863  50.139  1.00 28.07  ? 439 ILE A CG2 1 
ATOM   3436 C  CD1 . ILE A 1 439 ? -5.389  -12.240 48.522  1.00 43.19  ? 439 ILE A CD1 1 
ATOM   3437 N  N   . HIS A 1 440 ? -1.421  -9.125  48.678  1.00 22.13  ? 440 HIS A N   1 
ATOM   3438 C  CA  . HIS A 1 440 ? -0.526  -8.142  49.266  1.00 37.52  ? 440 HIS A CA  1 
ATOM   3439 C  C   . HIS A 1 440 ? -0.382  -8.378  50.761  1.00 25.29  ? 440 HIS A C   1 
ATOM   3440 O  O   . HIS A 1 440 ? -1.371  -8.465  51.486  1.00 21.19  ? 440 HIS A O   1 
ATOM   3441 C  CB  . HIS A 1 440 ? -1.082  -6.744  48.993  1.00 50.76  ? 440 HIS A CB  1 
ATOM   3442 C  CG  . HIS A 1 440 ? -0.347  -5.636  49.685  1.00 54.48  ? 440 HIS A CG  1 
ATOM   3443 N  ND1 . HIS A 1 440 ? 0.685   -4.942  49.086  1.00 54.42  ? 440 HIS A ND1 1 
ATOM   3444 C  CD2 . HIS A 1 440 ? -0.538  -5.058  50.896  1.00 45.03  ? 440 HIS A CD2 1 
ATOM   3445 C  CE1 . HIS A 1 440 ? 1.115   -4.002  49.908  1.00 50.75  ? 440 HIS A CE1 1 
ATOM   3446 N  NE2 . HIS A 1 440 ? 0.386   -4.048  51.011  1.00 48.40  ? 440 HIS A NE2 1 
ATOM   3447 N  N   . GLY A 1 441 ? 0.850   -8.540  51.214  1.00 27.05  ? 441 GLY A N   1 
ATOM   3448 C  CA  . GLY A 1 441 ? 1.135   -8.684  52.617  1.00 28.15  ? 441 GLY A CA  1 
ATOM   3449 C  C   . GLY A 1 441 ? 1.233   -10.110 53.121  1.00 22.64  ? 441 GLY A C   1 
ATOM   3450 O  O   . GLY A 1 441 ? 1.790   -10.324 54.196  1.00 15.77  ? 441 GLY A O   1 
ATOM   3451 N  N   . TYR A 1 442 ? 0.725   -11.090 52.387  1.00 28.70  ? 442 TYR A N   1 
ATOM   3452 C  CA  . TYR A 1 442 ? 0.619   -12.430 52.950  1.00 29.27  ? 442 TYR A CA  1 
ATOM   3453 C  C   . TYR A 1 442 ? 1.859   -13.276 52.711  1.00 26.76  ? 442 TYR A C   1 
ATOM   3454 O  O   . TYR A 1 442 ? 1.841   -14.475 52.986  1.00 19.32  ? 442 TYR A O   1 
ATOM   3455 C  CB  . TYR A 1 442 ? -0.652  -13.109 52.437  1.00 34.00  ? 442 TYR A CB  1 
ATOM   3456 C  CG  . TYR A 1 442 ? -1.849  -12.544 53.186  1.00 41.43  ? 442 TYR A CG  1 
ATOM   3457 C  CD1 . TYR A 1 442 ? -2.204  -11.200 53.053  1.00 37.08  ? 442 TYR A CD1 1 
ATOM   3458 C  CD2 . TYR A 1 442 ? -2.576  -13.328 54.082  1.00 34.60  ? 442 TYR A CD2 1 
ATOM   3459 C  CE1 . TYR A 1 442 ? -3.255  -10.670 53.763  1.00 35.58  ? 442 TYR A CE1 1 
ATOM   3460 C  CE2 . TYR A 1 442 ? -3.639  -12.807 54.797  1.00 19.57  ? 442 TYR A CE2 1 
ATOM   3461 C  CZ  . TYR A 1 442 ? -3.968  -11.476 54.636  1.00 31.43  ? 442 TYR A CZ  1 
ATOM   3462 O  OH  . TYR A 1 442 ? -5.022  -10.942 55.336  1.00 40.17  ? 442 TYR A OH  1 
ATOM   3463 N  N   . GLU A 1 443 ? 2.945   -12.668 52.233  1.00 29.89  ? 443 GLU A N   1 
ATOM   3464 C  CA  . GLU A 1 443 ? 4.250   -13.314 52.313  1.00 36.97  ? 443 GLU A CA  1 
ATOM   3465 C  C   . GLU A 1 443 ? 4.787   -13.273 53.744  1.00 29.97  ? 443 GLU A C   1 
ATOM   3466 O  O   . GLU A 1 443 ? 5.559   -14.148 54.155  1.00 21.61  ? 443 GLU A O   1 
ATOM   3467 C  CB  . GLU A 1 443 ? 5.218   -12.609 51.363  1.00 36.88  ? 443 GLU A CB  1 
ATOM   3468 C  CG  . GLU A 1 443 ? 5.615   -11.224 51.882  1.00 48.62  ? 443 GLU A CG  1 
ATOM   3469 C  CD  . GLU A 1 443 ? 5.081   -10.098 51.039  1.00 59.51  ? 443 GLU A CD  1 
ATOM   3470 O  OE1 . GLU A 1 443 ? 3.990   -9.588  51.365  1.00 58.72  ? 443 GLU A OE1 1 
ATOM   3471 O  OE2 . GLU A 1 443 ? 5.758   -9.712  50.062  1.00 72.11  ? 443 GLU A OE2 1 
ATOM   3472 N  N   . ILE A 1 444 ? 4.359   -12.273 54.514  1.00 20.89  ? 444 ILE A N   1 
ATOM   3473 C  CA  . ILE A 1 444 ? 4.944   -11.974 55.811  1.00 28.06  ? 444 ILE A CA  1 
ATOM   3474 C  C   . ILE A 1 444 ? 4.860   -13.160 56.772  1.00 35.25  ? 444 ILE A C   1 
ATOM   3475 O  O   . ILE A 1 444 ? 5.779   -13.382 57.576  1.00 31.55  ? 444 ILE A O   1 
ATOM   3476 C  CB  . ILE A 1 444 ? 4.262   -10.713 56.377  1.00 27.31  ? 444 ILE A CB  1 
ATOM   3477 C  CG1 . ILE A 1 444 ? 4.652   -9.491  55.527  1.00 27.24  ? 444 ILE A CG1 1 
ATOM   3478 C  CG2 . ILE A 1 444 ? 4.615   -10.526 57.835  1.00 29.64  ? 444 ILE A CG2 1 
ATOM   3479 C  CD1 . ILE A 1 444 ? 3.840   -8.235  55.802  1.00 22.03  ? 444 ILE A CD1 1 
ATOM   3480 N  N   . GLU A 1 445 ? 3.780   -13.944 56.708  1.00 32.97  ? 445 GLU A N   1 
ATOM   3481 C  CA  . GLU A 1 445 ? 3.686   -15.116 57.577  1.00 39.42  ? 445 GLU A CA  1 
ATOM   3482 C  C   . GLU A 1 445 ? 4.898   -16.026 57.416  1.00 31.76  ? 445 GLU A C   1 
ATOM   3483 O  O   . GLU A 1 445 ? 5.447   -16.541 58.397  1.00 21.92  ? 445 GLU A O   1 
ATOM   3484 C  CB  . GLU A 1 445 ? 2.401   -15.884 57.280  1.00 46.68  ? 445 GLU A CB  1 
ATOM   3485 C  CG  . GLU A 1 445 ? 1.151   -15.121 57.642  1.00 55.70  ? 445 GLU A CG  1 
ATOM   3486 C  CD  . GLU A 1 445 ? 0.012   -15.393 56.680  1.00 60.34  ? 445 GLU A CD  1 
ATOM   3487 O  OE1 . GLU A 1 445 ? -1.090  -14.840 56.891  1.00 60.51  ? 445 GLU A OE1 1 
ATOM   3488 O  OE2 . GLU A 1 445 ? 0.222   -16.161 55.715  1.00 63.60  ? 445 GLU A OE2 1 
ATOM   3489 N  N   . PHE A 1 446 ? 5.344   -16.219 56.184  1.00 33.45  ? 446 PHE A N   1 
ATOM   3490 C  CA  . PHE A 1 446 ? 6.477   -17.101 55.966  1.00 36.23  ? 446 PHE A CA  1 
ATOM   3491 C  C   . PHE A 1 446 ? 7.785   -16.470 56.442  1.00 38.36  ? 446 PHE A C   1 
ATOM   3492 O  O   . PHE A 1 446 ? 8.637   -17.163 57.013  1.00 38.42  ? 446 PHE A O   1 
ATOM   3493 C  CB  . PHE A 1 446 ? 6.523   -17.477 54.497  1.00 23.30  ? 446 PHE A CB  1 
ATOM   3494 C  CG  . PHE A 1 446 ? 5.362   -18.308 54.074  1.00 20.90  ? 446 PHE A CG  1 
ATOM   3495 C  CD1 . PHE A 1 446 ? 4.161   -17.717 53.701  1.00 30.36  ? 446 PHE A CD1 1 
ATOM   3496 C  CD2 . PHE A 1 446 ? 5.453   -19.682 54.070  1.00 23.03  ? 446 PHE A CD2 1 
ATOM   3497 C  CE1 . PHE A 1 446 ? 3.066   -18.492 53.312  1.00 26.59  ? 446 PHE A CE1 1 
ATOM   3498 C  CE2 . PHE A 1 446 ? 4.371   -20.455 53.683  1.00 32.57  ? 446 PHE A CE2 1 
ATOM   3499 C  CZ  . PHE A 1 446 ? 3.172   -19.857 53.300  1.00 24.88  ? 446 PHE A CZ  1 
ATOM   3500 N  N   . VAL A 1 447 ? 7.959   -15.160 56.234  1.00 27.61  ? 447 VAL A N   1 
ATOM   3501 C  CA  . VAL A 1 447 ? 9.149   -14.481 56.742  1.00 28.54  ? 447 VAL A CA  1 
ATOM   3502 C  C   . VAL A 1 447 ? 9.249   -14.632 58.258  1.00 28.87  ? 447 VAL A C   1 
ATOM   3503 O  O   . VAL A 1 447 ? 10.331  -14.868 58.810  1.00 29.72  ? 447 VAL A O   1 
ATOM   3504 C  CB  . VAL A 1 447 ? 9.139   -12.997 56.319  1.00 27.43  ? 447 VAL A CB  1 
ATOM   3505 C  CG1 . VAL A 1 447 ? 10.234  -12.209 57.046  1.00 16.78  ? 447 VAL A CG1 1 
ATOM   3506 C  CG2 . VAL A 1 447 ? 9.315   -12.871 54.817  1.00 31.81  ? 447 VAL A CG2 1 
ATOM   3507 N  N   . PHE A 1 448 ? 8.130   -14.514 58.954  1.00 26.11  ? 448 PHE A N   1 
ATOM   3508 C  CA  . PHE A 1 448 ? 8.146   -14.545 60.407  1.00 27.67  ? 448 PHE A CA  1 
ATOM   3509 C  C   . PHE A 1 448 ? 7.919   -15.942 60.967  1.00 28.16  ? 448 PHE A C   1 
ATOM   3510 O  O   . PHE A 1 448 ? 7.756   -16.090 62.182  1.00 25.34  ? 448 PHE A O   1 
ATOM   3511 C  CB  . PHE A 1 448 ? 7.123   -13.545 60.958  1.00 17.47  ? 448 PHE A CB  1 
ATOM   3512 C  CG  . PHE A 1 448 ? 7.645   -12.151 60.991  1.00 23.76  ? 448 PHE A CG  1 
ATOM   3513 C  CD1 . PHE A 1 448 ? 8.095   -11.595 62.177  1.00 31.31  ? 448 PHE A CD1 1 
ATOM   3514 C  CD2 . PHE A 1 448 ? 7.766   -11.419 59.826  1.00 24.58  ? 448 PHE A CD2 1 
ATOM   3515 C  CE1 . PHE A 1 448 ? 8.615   -10.314 62.205  1.00 29.00  ? 448 PHE A CE1 1 
ATOM   3516 C  CE2 . PHE A 1 448 ? 8.283   -10.134 59.850  1.00 29.00  ? 448 PHE A CE2 1 
ATOM   3517 C  CZ  . PHE A 1 448 ? 8.710   -9.581  61.040  1.00 23.64  ? 448 PHE A CZ  1 
ATOM   3518 N  N   . GLY A 1 449 ? 7.936   -16.967 60.114  1.00 26.75  ? 449 GLY A N   1 
ATOM   3519 C  CA  . GLY A 1 449 ? 7.856   -18.336 60.582  1.00 27.68  ? 449 GLY A CA  1 
ATOM   3520 C  C   . GLY A 1 449 ? 6.533   -18.766 61.184  1.00 26.44  ? 449 GLY A C   1 
ATOM   3521 O  O   . GLY A 1 449 ? 6.516   -19.660 62.025  1.00 22.77  ? 449 GLY A O   1 
ATOM   3522 N  N   . LEU A 1 450 ? 5.423   -18.186 60.771  1.00 22.49  ? 450 LEU A N   1 
ATOM   3523 C  CA  . LEU A 1 450 ? 4.172   -18.599 61.388  1.00 20.03  ? 450 LEU A CA  1 
ATOM   3524 C  C   . LEU A 1 450 ? 3.680   -19.965 60.911  1.00 46.74  ? 450 LEU A C   1 
ATOM   3525 O  O   . LEU A 1 450 ? 2.959   -20.635 61.659  1.00 54.11  ? 450 LEU A O   1 
ATOM   3526 C  CB  . LEU A 1 450 ? 3.113   -17.513 61.185  1.00 37.07  ? 450 LEU A CB  1 
ATOM   3527 C  CG  . LEU A 1 450 ? 3.132   -16.383 62.214  1.00 44.20  ? 450 LEU A CG  1 
ATOM   3528 C  CD1 . LEU A 1 450 ? 4.367   -15.495 62.051  1.00 44.11  ? 450 LEU A CD1 1 
ATOM   3529 C  CD2 . LEU A 1 450 ? 1.858   -15.549 62.136  1.00 48.58  ? 450 LEU A CD2 1 
ATOM   3530 N  N   . PRO A 1 451 ? 4.021   -20.431 59.706  1.00 34.83  ? 451 PRO A N   1 
ATOM   3531 C  CA  . PRO A 1 451 ? 3.712   -21.829 59.363  1.00 31.92  ? 451 PRO A CA  1 
ATOM   3532 C  C   . PRO A 1 451 ? 4.343   -22.878 60.297  1.00 36.35  ? 451 PRO A C   1 
ATOM   3533 O  O   . PRO A 1 451 ? 3.996   -24.068 60.182  1.00 37.80  ? 451 PRO A O   1 
ATOM   3534 C  CB  . PRO A 1 451 ? 4.254   -21.976 57.928  1.00 24.88  ? 451 PRO A CB  1 
ATOM   3535 C  CG  . PRO A 1 451 ? 4.239   -20.649 57.379  1.00 33.29  ? 451 PRO A CG  1 
ATOM   3536 C  CD  . PRO A 1 451 ? 4.403   -19.664 58.508  1.00 33.48  ? 451 PRO A CD  1 
ATOM   3537 N  N   . LEU A 1 452 ? 5.214   -22.494 61.239  1.00 32.48  ? 452 LEU A N   1 
ATOM   3538 C  CA  . LEU A 1 452 ? 6.008   -23.473 61.981  1.00 30.45  ? 452 LEU A CA  1 
ATOM   3539 C  C   . LEU A 1 452 ? 5.425   -23.881 63.325  1.00 34.07  ? 452 LEU A C   1 
ATOM   3540 O  O   . LEU A 1 452 ? 5.995   -24.777 63.966  1.00 27.09  ? 452 LEU A O   1 
ATOM   3541 C  CB  . LEU A 1 452 ? 7.443   -22.966 62.170  1.00 26.62  ? 452 LEU A CB  1 
ATOM   3542 C  CG  . LEU A 1 452 ? 8.205   -22.985 60.843  1.00 52.38  ? 452 LEU A CG  1 
ATOM   3543 C  CD1 . LEU A 1 452 ? 7.857   -21.766 59.948  1.00 67.43  ? 452 LEU A CD1 1 
ATOM   3544 C  CD2 . LEU A 1 452 ? 9.701   -23.188 61.094  1.00 48.47  ? 452 LEU A CD2 1 
ATOM   3545 N  N   . VAL A 1 453 ? 4.312   -23.280 63.756  1.00 42.56  ? 453 VAL A N   1 
ATOM   3546 C  CA  . VAL A 1 453 ? 3.594   -23.712 64.954  1.00 58.27  ? 453 VAL A CA  1 
ATOM   3547 C  C   . VAL A 1 453 ? 2.387   -24.524 64.502  1.00 60.78  ? 453 VAL A C   1 
ATOM   3548 O  O   . VAL A 1 453 ? 1.691   -24.139 63.552  1.00 66.52  ? 453 VAL A O   1 
ATOM   3549 C  CB  . VAL A 1 453 ? 3.197   -22.507 65.828  1.00 63.92  ? 453 VAL A CB  1 
ATOM   3550 C  CG1 . VAL A 1 453 ? 4.364   -21.620 65.992  1.00 70.08  ? 453 VAL A CG1 1 
ATOM   3551 C  CG2 . VAL A 1 453 ? 1.984   -21.761 65.336  1.00 53.72  ? 453 VAL A CG2 1 
ATOM   3552 N  N   . LYS A 1 454 ? 2.182   -25.692 65.116  1.00 47.73  ? 454 LYS A N   1 
ATOM   3553 C  CA  . LYS A 1 454 ? 1.217   -26.623 64.541  1.00 43.56  ? 454 LYS A CA  1 
ATOM   3554 C  C   . LYS A 1 454 ? -0.223  -26.225 64.830  1.00 40.89  ? 454 LYS A C   1 
ATOM   3555 O  O   . LYS A 1 454 ? -1.138  -26.684 64.134  1.00 40.05  ? 454 LYS A O   1 
ATOM   3556 C  CB  . LYS A 1 454 ? 1.504   -28.047 65.024  1.00 46.67  ? 454 LYS A CB  1 
ATOM   3557 C  CG  . LYS A 1 454 ? 2.749   -28.651 64.367  1.00 58.68  ? 454 LYS A CG  1 
ATOM   3558 C  CD  . LYS A 1 454 ? 2.883   -28.183 62.911  1.00 67.89  ? 454 LYS A CD  1 
ATOM   3559 C  CE  . LYS A 1 454 ? 4.067   -28.815 62.190  1.00 70.39  ? 454 LYS A CE  1 
ATOM   3560 N  NZ  . LYS A 1 454 ? 3.860   -28.807 60.705  1.00 70.28  ? 454 LYS A NZ  1 
ATOM   3561 N  N   . GLU A 1 455 ? -0.439  -25.348 65.805  1.00 46.35  ? 455 GLU A N   1 
ATOM   3562 C  CA  . GLU A 1 455 ? -1.789  -24.893 66.109  1.00 57.20  ? 455 GLU A CA  1 
ATOM   3563 C  C   . GLU A 1 455 ? -2.343  -23.931 65.064  1.00 59.03  ? 455 GLU A C   1 
ATOM   3564 O  O   . GLU A 1 455 ? -3.555  -23.690 65.064  1.00 58.85  ? 455 GLU A O   1 
ATOM   3565 C  CB  . GLU A 1 455 ? -1.843  -24.230 67.493  1.00 59.74  ? 455 GLU A CB  1 
ATOM   3566 C  CG  . GLU A 1 455 ? -1.459  -25.136 68.665  1.00 70.83  ? 455 GLU A CG  1 
ATOM   3567 C  CD  . GLU A 1 455 ? 0.025   -25.465 68.719  1.00 74.49  ? 455 GLU A CD  1 
ATOM   3568 O  OE1 . GLU A 1 455 ? 0.844   -24.644 68.233  1.00 74.11  ? 455 GLU A OE1 1 
ATOM   3569 O  OE2 . GLU A 1 455 ? 0.374   -26.549 69.248  1.00 75.38  ? 455 GLU A OE2 1 
ATOM   3570 N  N   . LEU A 1 456 ? -1.511  -23.369 64.181  1.00 55.80  ? 456 LEU A N   1 
ATOM   3571 C  CA  . LEU A 1 456 ? -2.056  -22.515 63.135  1.00 46.54  ? 456 LEU A CA  1 
ATOM   3572 C  C   . LEU A 1 456 ? -2.434  -23.263 61.876  1.00 44.65  ? 456 LEU A C   1 
ATOM   3573 O  O   . LEU A 1 456 ? -2.833  -22.613 60.909  1.00 42.22  ? 456 LEU A O   1 
ATOM   3574 C  CB  . LEU A 1 456 ? -1.106  -21.383 62.754  1.00 36.84  ? 456 LEU A CB  1 
ATOM   3575 C  CG  . LEU A 1 456 ? -0.719  -20.464 63.907  1.00 31.92  ? 456 LEU A CG  1 
ATOM   3576 C  CD1 . LEU A 1 456 ? 0.304   -19.383 63.472  1.00 21.26  ? 456 LEU A CD1 1 
ATOM   3577 C  CD2 . LEU A 1 456 ? -1.965  -19.877 64.530  1.00 25.19  ? 456 LEU A CD2 1 
ATOM   3578 N  N   . ASN A 1 457 ? -2.325  -24.592 61.863  1.00 46.72  ? 457 ASN A N   1 
ATOM   3579 C  CA  . ASN A 1 457 ? -2.878  -25.430 60.795  1.00 53.69  ? 457 ASN A CA  1 
ATOM   3580 C  C   . ASN A 1 457 ? -2.371  -24.985 59.413  1.00 57.09  ? 457 ASN A C   1 
ATOM   3581 O  O   . ASN A 1 457 ? -3.109  -24.468 58.576  1.00 62.09  ? 457 ASN A O   1 
ATOM   3582 C  CB  . ASN A 1 457 ? -4.415  -25.422 60.845  1.00 55.91  ? 457 ASN A CB  1 
ATOM   3583 C  CG  . ASN A 1 457 ? -4.985  -26.134 62.082  1.00 57.27  ? 457 ASN A CG  1 
ATOM   3584 O  OD1 . ASN A 1 457 ? -5.397  -27.297 62.017  1.00 54.52  ? 457 ASN A OD1 1 
ATOM   3585 N  ND2 . ASN A 1 457 ? -5.031  -25.425 63.207  1.00 53.50  ? 457 ASN A ND2 1 
ATOM   3586 N  N   . TYR A 1 458 ? -1.072  -25.179 59.204  1.00 49.70  ? 458 TYR A N   1 
ATOM   3587 C  CA  . TYR A 1 458 ? -0.447  -24.995 57.904  1.00 31.48  ? 458 TYR A CA  1 
ATOM   3588 C  C   . TYR A 1 458 ? -0.005  -26.348 57.369  1.00 33.25  ? 458 TYR A C   1 
ATOM   3589 O  O   . TYR A 1 458 ? 0.251   -27.282 58.132  1.00 38.77  ? 458 TYR A O   1 
ATOM   3590 C  CB  . TYR A 1 458 ? 0.774   -24.088 57.973  1.00 24.50  ? 458 TYR A CB  1 
ATOM   3591 C  CG  . TYR A 1 458 ? 0.551   -22.596 57.891  1.00 26.64  ? 458 TYR A CG  1 
ATOM   3592 C  CD1 . TYR A 1 458 ? 0.243   -21.858 59.031  1.00 27.27  ? 458 TYR A CD1 1 
ATOM   3593 C  CD2 . TYR A 1 458 ? 0.742   -21.910 56.696  1.00 21.77  ? 458 TYR A CD2 1 
ATOM   3594 C  CE1 . TYR A 1 458 ? 0.086   -20.482 58.980  1.00 31.65  ? 458 TYR A CE1 1 
ATOM   3595 C  CE2 . TYR A 1 458 ? 0.581   -20.533 56.630  1.00 39.23  ? 458 TYR A CE2 1 
ATOM   3596 C  CZ  . TYR A 1 458 ? 0.252   -19.823 57.781  1.00 39.41  ? 458 TYR A CZ  1 
ATOM   3597 O  OH  . TYR A 1 458 ? 0.089   -18.455 57.741  1.00 41.84  ? 458 TYR A OH  1 
ATOM   3598 N  N   . THR A 1 459 ? 0.093   -26.450 56.052  1.00 33.44  ? 459 THR A N   1 
ATOM   3599 C  CA  . THR A 1 459 ? 0.563   -27.699 55.497  1.00 41.90  ? 459 THR A CA  1 
ATOM   3600 C  C   . THR A 1 459 ? 2.054   -27.868 55.793  1.00 46.58  ? 459 THR A C   1 
ATOM   3601 O  O   . THR A 1 459 ? 2.765   -26.908 56.117  1.00 47.41  ? 459 THR A O   1 
ATOM   3602 C  CB  . THR A 1 459 ? 0.288   -27.751 53.996  1.00 43.15  ? 459 THR A CB  1 
ATOM   3603 O  OG1 . THR A 1 459 ? 0.167   -29.117 53.589  1.00 55.58  ? 459 THR A OG1 1 
ATOM   3604 C  CG2 . THR A 1 459 ? 1.425   -27.141 53.232  1.00 35.07  ? 459 THR A CG2 1 
ATOM   3605 N  N   . ALA A 1 460 ? 2.523   -29.118 55.697  1.00 40.97  ? 460 ALA A N   1 
ATOM   3606 C  CA  . ALA A 1 460 ? 3.938   -29.393 55.916  1.00 26.99  ? 460 ALA A CA  1 
ATOM   3607 C  C   . ALA A 1 460 ? 4.813   -28.629 54.936  1.00 39.85  ? 460 ALA A C   1 
ATOM   3608 O  O   . ALA A 1 460 ? 5.961   -28.288 55.260  1.00 35.67  ? 460 ALA A O   1 
ATOM   3609 C  CB  . ALA A 1 460 ? 4.206   -30.890 55.803  1.00 28.26  ? 460 ALA A CB  1 
ATOM   3610 N  N   . GLU A 1 461 ? 4.286   -28.351 53.740  1.00 39.33  ? 461 GLU A N   1 
ATOM   3611 C  CA  . GLU A 1 461 ? 5.057   -27.687 52.696  1.00 46.23  ? 461 GLU A CA  1 
ATOM   3612 C  C   . GLU A 1 461 ? 5.288   -26.223 53.031  1.00 45.95  ? 461 GLU A C   1 
ATOM   3613 O  O   . GLU A 1 461 ? 6.420   -25.735 52.942  1.00 44.21  ? 461 GLU A O   1 
ATOM   3614 C  CB  . GLU A 1 461 ? 4.349   -27.817 51.343  1.00 57.85  ? 461 GLU A CB  1 
ATOM   3615 C  CG  . GLU A 1 461 ? 4.487   -29.172 50.666  1.00 69.83  ? 461 GLU A CG  1 
ATOM   3616 C  CD  . GLU A 1 461 ? 3.963   -30.310 51.528  1.00 84.65  ? 461 GLU A CD  1 
ATOM   3617 O  OE1 . GLU A 1 461 ? 4.784   -30.988 52.191  1.00 92.51  ? 461 GLU A OE1 1 
ATOM   3618 O  OE2 . GLU A 1 461 ? 2.724   -30.503 51.573  1.00 85.33  ? 461 GLU A OE2 1 
ATOM   3619 N  N   . GLU A 1 462 ? 4.226   -25.505 53.416  1.00 48.11  ? 462 GLU A N   1 
ATOM   3620 C  CA  . GLU A 1 462 ? 4.376   -24.085 53.725  1.00 42.11  ? 462 GLU A CA  1 
ATOM   3621 C  C   . GLU A 1 462 ? 5.327   -23.894 54.898  1.00 39.74  ? 462 GLU A C   1 
ATOM   3622 O  O   . GLU A 1 462 ? 6.077   -22.910 54.945  1.00 31.19  ? 462 GLU A O   1 
ATOM   3623 C  CB  . GLU A 1 462 ? 3.002   -23.455 53.994  1.00 37.75  ? 462 GLU A CB  1 
ATOM   3624 C  CG  . GLU A 1 462 ? 1.896   -24.099 53.173  1.00 39.88  ? 462 GLU A CG  1 
ATOM   3625 C  CD  . GLU A 1 462 ? 0.563   -23.370 53.169  1.00 47.81  ? 462 GLU A CD  1 
ATOM   3626 O  OE1 . GLU A 1 462 ? 0.350   -22.450 52.356  1.00 45.72  ? 462 GLU A OE1 1 
ATOM   3627 O  OE2 . GLU A 1 462 ? -0.300  -23.735 53.990  1.00 62.80  ? 462 GLU A OE2 1 
ATOM   3628 N  N   . GLU A 1 463 ? 5.347   -24.856 55.827  1.00 39.47  ? 463 GLU A N   1 
ATOM   3629 C  CA  . GLU A 1 463 ? 6.354   -24.850 56.880  1.00 38.62  ? 463 GLU A CA  1 
ATOM   3630 C  C   . GLU A 1 463 ? 7.747   -24.838 56.282  1.00 43.23  ? 463 GLU A C   1 
ATOM   3631 O  O   . GLU A 1 463 ? 8.550   -23.946 56.569  1.00 51.36  ? 463 GLU A O   1 
ATOM   3632 C  CB  . GLU A 1 463 ? 6.189   -26.057 57.790  1.00 42.42  ? 463 GLU A CB  1 
ATOM   3633 C  CG  . GLU A 1 463 ? 7.446   -26.375 58.555  1.00 55.57  ? 463 GLU A CG  1 
ATOM   3634 C  CD  . GLU A 1 463 ? 7.153   -26.891 59.929  1.00 69.49  ? 463 GLU A CD  1 
ATOM   3635 O  OE1 . GLU A 1 463 ? 5.955   -26.942 60.286  1.00 75.87  ? 463 GLU A OE1 1 
ATOM   3636 O  OE2 . GLU A 1 463 ? 8.114   -27.251 60.645  1.00 73.92  ? 463 GLU A OE2 1 
ATOM   3637 N  N   . ALA A 1 464 ? 8.033   -25.821 55.422  1.00 41.50  ? 464 ALA A N   1 
ATOM   3638 C  CA  . ALA A 1 464 ? 9.320   -25.884 54.733  1.00 35.40  ? 464 ALA A CA  1 
ATOM   3639 C  C   . ALA A 1 464 ? 9.621   -24.581 54.012  1.00 30.82  ? 464 ALA A C   1 
ATOM   3640 O  O   . ALA A 1 464 ? 10.725  -24.034 54.127  1.00 30.21  ? 464 ALA A O   1 
ATOM   3641 C  CB  . ALA A 1 464 ? 9.328   -27.047 53.744  1.00 25.06  ? 464 ALA A CB  1 
ATOM   3642 N  N   . LEU A 1 465 ? 8.639   -24.055 53.284  1.00 22.84  ? 465 LEU A N   1 
ATOM   3643 C  CA  . LEU A 1 465 ? 8.868   -22.832 52.531  1.00 32.06  ? 465 LEU A CA  1 
ATOM   3644 C  C   . LEU A 1 465 ? 9.106   -21.668 53.478  1.00 41.29  ? 465 LEU A C   1 
ATOM   3645 O  O   . LEU A 1 465 ? 9.937   -20.789 53.214  1.00 48.87  ? 465 LEU A O   1 
ATOM   3646 C  CB  . LEU A 1 465 ? 7.683   -22.559 51.602  1.00 21.83  ? 465 LEU A CB  1 
ATOM   3647 C  CG  . LEU A 1 465 ? 7.680   -21.196 50.908  1.00 31.82  ? 465 LEU A CG  1 
ATOM   3648 C  CD1 . LEU A 1 465 ? 8.732   -21.171 49.809  1.00 21.13  ? 465 LEU A CD1 1 
ATOM   3649 C  CD2 . LEU A 1 465 ? 6.312   -20.866 50.335  1.00 28.88  ? 465 LEU A CD2 1 
ATOM   3650 N  N   . SER A 1 466 ? 8.427   -21.673 54.620  1.00 34.90  ? 466 SER A N   1 
ATOM   3651 C  CA  . SER A 1 466 ? 8.730   -20.652 55.606  1.00 33.49  ? 466 SER A CA  1 
ATOM   3652 C  C   . SER A 1 466 ? 10.130  -20.830 56.172  1.00 36.72  ? 466 SER A C   1 
ATOM   3653 O  O   . SER A 1 466 ? 10.850  -19.844 56.364  1.00 43.45  ? 466 SER A O   1 
ATOM   3654 C  CB  . SER A 1 466 ? 7.704   -20.671 56.719  1.00 30.12  ? 466 SER A CB  1 
ATOM   3655 O  OG  . SER A 1 466 ? 8.084   -19.697 57.663  1.00 30.51  ? 466 SER A OG  1 
ATOM   3656 N  N   . ARG A 1 467 ? 10.544  -22.078 56.446  1.00 33.83  ? 467 ARG A N   1 
ATOM   3657 C  CA  . ARG A 1 467 ? 11.866  -22.249 57.045  1.00 38.54  ? 467 ARG A CA  1 
ATOM   3658 C  C   . ARG A 1 467 ? 12.965  -21.813 56.093  1.00 33.35  ? 467 ARG A C   1 
ATOM   3659 O  O   . ARG A 1 467 ? 13.965  -21.229 56.535  1.00 35.13  ? 467 ARG A O   1 
ATOM   3660 C  CB  . ARG A 1 467 ? 12.141  -23.689 57.484  1.00 43.71  ? 467 ARG A CB  1 
ATOM   3661 C  CG  . ARG A 1 467 ? 10.959  -24.502 57.923  1.00 46.74  ? 467 ARG A CG  1 
ATOM   3662 C  CD  . ARG A 1 467 ? 11.350  -25.631 58.866  1.00 39.08  ? 467 ARG A CD  1 
ATOM   3663 N  NE  . ARG A 1 467 ? 11.927  -25.088 60.085  1.00 29.88  ? 467 ARG A NE  1 
ATOM   3664 C  CZ  . ARG A 1 467 ? 11.812  -25.657 61.274  1.00 31.45  ? 467 ARG A CZ  1 
ATOM   3665 N  NH1 . ARG A 1 467 ? 11.128  -26.778 61.399  1.00 39.44  ? 467 ARG A NH1 1 
ATOM   3666 N  NH2 . ARG A 1 467 ? 12.344  -25.082 62.340  1.00 36.69  ? 467 ARG A NH2 1 
ATOM   3667 N  N   . ARG A 1 468 ? 12.809  -22.066 54.794  1.00 24.49  ? 468 ARG A N   1 
ATOM   3668 C  CA  . ARG A 1 468 ? 13.890  -21.676 53.903  1.00 42.35  ? 468 ARG A CA  1 
ATOM   3669 C  C   . ARG A 1 468 ? 13.795  -20.230 53.433  1.00 38.57  ? 468 ARG A C   1 
ATOM   3670 O  O   . ARG A 1 468 ? 14.821  -19.671 53.024  1.00 28.38  ? 468 ARG A O   1 
ATOM   3671 C  CB  . ARG A 1 468 ? 14.001  -22.629 52.705  1.00 41.79  ? 468 ARG A CB  1 
ATOM   3672 C  CG  . ARG A 1 468 ? 12.761  -22.870 51.898  1.00 44.83  ? 468 ARG A CG  1 
ATOM   3673 C  CD  . ARG A 1 468 ? 13.077  -23.858 50.761  1.00 48.79  ? 468 ARG A CD  1 
ATOM   3674 N  NE  . ARG A 1 468 ? 13.387  -23.161 49.518  1.00 45.32  ? 468 ARG A NE  1 
ATOM   3675 C  CZ  . ARG A 1 468 ? 12.485  -22.913 48.573  1.00 43.98  ? 468 ARG A CZ  1 
ATOM   3676 N  NH1 . ARG A 1 468 ? 11.227  -23.329 48.730  1.00 34.18  ? 468 ARG A NH1 1 
ATOM   3677 N  NH2 . ARG A 1 468 ? 12.837  -22.254 47.475  1.00 49.12  ? 468 ARG A NH2 1 
ATOM   3678 N  N   . ILE A 1 469 ? 12.622  -19.594 53.510  1.00 20.51  ? 469 ILE A N   1 
ATOM   3679 C  CA  . ILE A 1 469 ? 12.589  -18.145 53.322  1.00 26.26  ? 469 ILE A CA  1 
ATOM   3680 C  C   . ILE A 1 469 ? 13.285  -17.451 54.483  1.00 23.48  ? 469 ILE A C   1 
ATOM   3681 O  O   . ILE A 1 469 ? 14.105  -16.545 54.286  1.00 21.78  ? 469 ILE A O   1 
ATOM   3682 C  CB  . ILE A 1 469 ? 11.151  -17.628 53.163  1.00 29.37  ? 469 ILE A CB  1 
ATOM   3683 C  CG1 . ILE A 1 469 ? 10.588  -17.979 51.789  1.00 26.88  ? 469 ILE A CG1 1 
ATOM   3684 C  CG2 . ILE A 1 469 ? 11.117  -16.110 53.398  1.00 18.47  ? 469 ILE A CG2 1 
ATOM   3685 C  CD1 . ILE A 1 469 ? 9.081   -17.902 51.723  1.00 19.18  ? 469 ILE A CD1 1 
ATOM   3686 N  N   . MET A 1 470 ? 12.950  -17.851 55.716  1.00 25.23  ? 470 MET A N   1 
ATOM   3687 C  CA  . MET A 1 470 ? 13.660  -17.322 56.877  1.00 30.61  ? 470 MET A CA  1 
ATOM   3688 C  C   . MET A 1 470 ? 15.162  -17.506 56.739  1.00 33.88  ? 470 MET A C   1 
ATOM   3689 O  O   . MET A 1 470 ? 15.936  -16.577 56.995  1.00 31.02  ? 470 MET A O   1 
ATOM   3690 C  CB  . MET A 1 470 ? 13.172  -17.974 58.171  1.00 31.78  ? 470 MET A CB  1 
ATOM   3691 C  CG  . MET A 1 470 ? 11.709  -17.753 58.533  1.00 35.33  ? 470 MET A CG  1 
ATOM   3692 S  SD  . MET A 1 470 ? 11.376  -18.079 60.307  1.00 38.85  ? 470 MET A SD  1 
ATOM   3693 C  CE  . MET A 1 470 ? 11.768  -19.822 60.443  1.00 20.92  ? 470 MET A CE  1 
ATOM   3694 N  N   . HIS A 1 471 ? 15.593  -18.698 56.325  1.00 33.71  ? 471 HIS A N   1 
ATOM   3695 C  CA  . HIS A 1 471 ? 17.013  -18.920 56.103  1.00 27.45  ? 471 HIS A CA  1 
ATOM   3696 C  C   . HIS A 1 471 ? 17.556  -17.980 55.030  1.00 29.69  ? 471 HIS A C   1 
ATOM   3697 O  O   . HIS A 1 471 ? 18.581  -17.322 55.235  1.00 31.97  ? 471 HIS A O   1 
ATOM   3698 C  CB  . HIS A 1 471 ? 17.257  -20.375 55.733  1.00 24.22  ? 471 HIS A CB  1 
ATOM   3699 C  CG  . HIS A 1 471 ? 18.677  -20.790 55.913  1.00 35.91  ? 471 HIS A CG  1 
ATOM   3700 N  ND1 . HIS A 1 471 ? 19.345  -20.640 57.110  1.00 35.06  ? 471 HIS A ND1 1 
ATOM   3701 C  CD2 . HIS A 1 471 ? 19.565  -21.336 55.052  1.00 43.96  ? 471 HIS A CD2 1 
ATOM   3702 C  CE1 . HIS A 1 471 ? 20.581  -21.085 56.981  1.00 35.13  ? 471 HIS A CE1 1 
ATOM   3703 N  NE2 . HIS A 1 471 ? 20.739  -21.519 55.743  1.00 43.38  ? 471 HIS A NE2 1 
ATOM   3704 N  N   . TYR A 1 472 ? 16.873  -17.899 53.880  1.00 31.99  ? 472 TYR A N   1 
ATOM   3705 C  CA  . TYR A 1 472 ? 17.259  -16.938 52.845  1.00 32.79  ? 472 TYR A CA  1 
ATOM   3706 C  C   . TYR A 1 472 ? 17.434  -15.549 53.443  1.00 37.25  ? 472 TYR A C   1 
ATOM   3707 O  O   . TYR A 1 472 ? 18.488  -14.918 53.297  1.00 36.65  ? 472 TYR A O   1 
ATOM   3708 C  CB  . TYR A 1 472 ? 16.208  -16.890 51.726  1.00 25.49  ? 472 TYR A CB  1 
ATOM   3709 C  CG  . TYR A 1 472 ? 16.183  -18.070 50.777  1.00 25.77  ? 472 TYR A CG  1 
ATOM   3710 C  CD1 . TYR A 1 472 ? 17.328  -18.810 50.520  1.00 30.38  ? 472 TYR A CD1 1 
ATOM   3711 C  CD2 . TYR A 1 472 ? 15.004  -18.443 50.132  1.00 22.44  ? 472 TYR A CD2 1 
ATOM   3712 C  CE1 . TYR A 1 472 ? 17.297  -19.889 49.658  1.00 31.67  ? 472 TYR A CE1 1 
ATOM   3713 C  CE2 . TYR A 1 472 ? 14.962  -19.524 49.268  1.00 21.19  ? 472 TYR A CE2 1 
ATOM   3714 C  CZ  . TYR A 1 472 ? 16.112  -20.239 49.034  1.00 36.02  ? 472 TYR A CZ  1 
ATOM   3715 O  OH  . TYR A 1 472 ? 16.091  -21.315 48.179  1.00 43.77  ? 472 TYR A OH  1 
ATOM   3716 N  N   . TRP A 1 473 ? 16.399  -15.067 54.134  1.00 38.73  ? 473 TRP A N   1 
ATOM   3717 C  CA  . TRP A 1 473 ? 16.451  -13.759 54.773  1.00 35.70  ? 473 TRP A CA  1 
ATOM   3718 C  C   . TRP A 1 473 ? 17.591  -13.688 55.783  1.00 38.83  ? 473 TRP A C   1 
ATOM   3719 O  O   . TRP A 1 473 ? 18.450  -12.800 55.717  1.00 36.75  ? 473 TRP A O   1 
ATOM   3720 C  CB  . TRP A 1 473 ? 15.111  -13.481 55.452  1.00 25.22  ? 473 TRP A CB  1 
ATOM   3721 C  CG  . TRP A 1 473 ? 14.097  -12.770 54.601  1.00 28.93  ? 473 TRP A CG  1 
ATOM   3722 C  CD1 . TRP A 1 473 ? 13.395  -11.650 54.940  1.00 26.94  ? 473 TRP A CD1 1 
ATOM   3723 C  CD2 . TRP A 1 473 ? 13.663  -13.125 53.282  1.00 38.60  ? 473 TRP A CD2 1 
ATOM   3724 N  NE1 . TRP A 1 473 ? 12.552  -11.286 53.921  1.00 30.74  ? 473 TRP A NE1 1 
ATOM   3725 C  CE2 . TRP A 1 473 ? 12.696  -12.177 52.891  1.00 39.01  ? 473 TRP A CE2 1 
ATOM   3726 C  CE3 . TRP A 1 473 ? 14.005  -14.142 52.388  1.00 37.54  ? 473 TRP A CE3 1 
ATOM   3727 C  CZ2 . TRP A 1 473 ? 12.071  -12.218 51.649  1.00 41.51  ? 473 TRP A CZ2 1 
ATOM   3728 C  CZ3 . TRP A 1 473 ? 13.381  -14.183 51.159  1.00 35.01  ? 473 TRP A CZ3 1 
ATOM   3729 C  CH2 . TRP A 1 473 ? 12.424  -13.228 50.800  1.00 37.89  ? 473 TRP A CH2 1 
ATOM   3730 N  N   . ALA A 1 474 ? 17.618  -14.630 56.721  1.00 29.96  ? 474 ALA A N   1 
ATOM   3731 C  CA  . ALA A 1 474 ? 18.648  -14.613 57.746  1.00 28.86  ? 474 ALA A CA  1 
ATOM   3732 C  C   . ALA A 1 474 ? 20.039  -14.725 57.130  1.00 35.85  ? 474 ALA A C   1 
ATOM   3733 O  O   . ALA A 1 474 ? 20.911  -13.886 57.390  1.00 38.96  ? 474 ALA A O   1 
ATOM   3734 C  CB  . ALA A 1 474 ? 18.397  -15.739 58.742  1.00 29.69  ? 474 ALA A CB  1 
ATOM   3735 N  N   . THR A 1 475 ? 20.267  -15.757 56.310  1.00 30.96  ? 475 THR A N   1 
ATOM   3736 C  CA  . THR A 1 475 ? 21.572  -15.903 55.667  1.00 33.05  ? 475 THR A CA  1 
ATOM   3737 C  C   . THR A 1 475 ? 21.946  -14.648 54.889  1.00 34.91  ? 475 THR A C   1 
ATOM   3738 O  O   . THR A 1 475 ? 23.100  -14.203 54.925  1.00 27.83  ? 475 THR A O   1 
ATOM   3739 C  CB  . THR A 1 475 ? 21.587  -17.111 54.737  1.00 28.38  ? 475 THR A CB  1 
ATOM   3740 O  OG1 . THR A 1 475 ? 20.921  -18.208 55.376  1.00 38.05  ? 475 THR A OG1 1 
ATOM   3741 C  CG2 . THR A 1 475 ? 23.003  -17.507 54.427  1.00 22.46  ? 475 THR A CG2 1 
ATOM   3742 N  N   . PHE A 1 476 ? 20.982  -14.051 54.191  1.00 34.90  ? 476 PHE A N   1 
ATOM   3743 C  CA  . PHE A 1 476 ? 21.275  -12.787 53.532  1.00 33.56  ? 476 PHE A CA  1 
ATOM   3744 C  C   . PHE A 1 476 ? 21.714  -11.742 54.541  1.00 27.77  ? 476 PHE A C   1 
ATOM   3745 O  O   . PHE A 1 476 ? 22.640  -10.969 54.283  1.00 29.59  ? 476 PHE A O   1 
ATOM   3746 C  CB  . PHE A 1 476 ? 20.070  -12.285 52.738  1.00 28.27  ? 476 PHE A CB  1 
ATOM   3747 C  CG  . PHE A 1 476 ? 20.293  -10.944 52.090  1.00 18.84  ? 476 PHE A CG  1 
ATOM   3748 C  CD1 . PHE A 1 476 ? 19.833  -9.774  52.684  1.00 18.28  ? 476 PHE A CD1 1 
ATOM   3749 C  CD2 . PHE A 1 476 ? 21.003  -10.853 50.907  1.00 19.17  ? 476 PHE A CD2 1 
ATOM   3750 C  CE1 . PHE A 1 476 ? 20.047  -8.546  52.076  1.00 36.87  ? 476 PHE A CE1 1 
ATOM   3751 C  CE2 . PHE A 1 476 ? 21.226  -9.627  50.297  1.00 22.85  ? 476 PHE A CE2 1 
ATOM   3752 C  CZ  . PHE A 1 476 ? 20.750  -8.473  50.870  1.00 18.41  ? 476 PHE A CZ  1 
ATOM   3753 N  N   . ALA A 1 477 ? 21.057  -11.699 55.698  1.00 35.75  ? 477 ALA A N   1 
ATOM   3754 C  CA  . ALA A 1 477 ? 21.403  -10.685 56.687  1.00 31.12  ? 477 ALA A CA  1 
ATOM   3755 C  C   . ALA A 1 477 ? 22.805  -10.915 57.246  1.00 28.27  ? 477 ALA A C   1 
ATOM   3756 O  O   . ALA A 1 477 ? 23.540  -9.953  57.492  1.00 23.93  ? 477 ALA A O   1 
ATOM   3757 C  CB  . ALA A 1 477 ? 20.353  -10.663 57.795  1.00 18.76  ? 477 ALA A CB  1 
ATOM   3758 N  N   . LYS A 1 478 ? 23.206  -12.178 57.424  1.00 20.38  ? 478 LYS A N   1 
ATOM   3759 C  CA  . LYS A 1 478 ? 24.567  -12.471 57.871  1.00 32.71  ? 478 LYS A CA  1 
ATOM   3760 C  C   . LYS A 1 478 ? 25.595  -12.182 56.773  1.00 43.21  ? 478 LYS A C   1 
ATOM   3761 O  O   . LYS A 1 478 ? 26.474  -11.330 56.942  1.00 42.66  ? 478 LYS A O   1 
ATOM   3762 C  CB  . LYS A 1 478 ? 24.658  -13.924 58.346  1.00 39.13  ? 478 LYS A CB  1 
ATOM   3763 C  CG  . LYS A 1 478 ? 23.751  -14.220 59.548  1.00 58.18  ? 478 LYS A CG  1 
ATOM   3764 C  CD  . LYS A 1 478 ? 22.954  -15.527 59.409  1.00 63.96  ? 478 LYS A CD  1 
ATOM   3765 C  CE  . LYS A 1 478 ? 22.199  -15.887 60.698  1.00 53.03  ? 478 LYS A CE  1 
ATOM   3766 N  NZ  . LYS A 1 478 ? 21.390  -17.141 60.544  1.00 47.90  ? 478 LYS A NZ  1 
ATOM   3767 N  N   . THR A 1 479 ? 25.482  -12.853 55.622  1.00 43.69  ? 479 THR A N   1 
ATOM   3768 C  CA  . THR A 1 479 ? 26.557  -12.852 54.635  1.00 33.86  ? 479 THR A CA  1 
ATOM   3769 C  C   . THR A 1 479 ? 26.328  -11.915 53.445  1.00 28.41  ? 479 THR A C   1 
ATOM   3770 O  O   . THR A 1 479 ? 27.250  -11.726 52.643  1.00 22.24  ? 479 THR A O   1 
ATOM   3771 C  CB  . THR A 1 479 ? 26.806  -14.285 54.124  1.00 34.61  ? 479 THR A CB  1 
ATOM   3772 O  OG1 . THR A 1 479 ? 25.834  -14.642 53.129  1.00 39.33  ? 479 THR A OG1 1 
ATOM   3773 C  CG2 . THR A 1 479 ? 26.730  -15.276 55.267  1.00 23.18  ? 479 THR A CG2 1 
ATOM   3774 N  N   . GLY A 1 480 ? 25.156  -11.301 53.313  1.00 23.96  ? 480 GLY A N   1 
ATOM   3775 C  CA  . GLY A 1 480 ? 24.895  -10.520 52.114  1.00 22.07  ? 480 GLY A CA  1 
ATOM   3776 C  C   . GLY A 1 480 ? 24.590  -11.351 50.886  1.00 27.12  ? 480 GLY A C   1 
ATOM   3777 O  O   . GLY A 1 480 ? 24.557  -10.812 49.771  1.00 20.84  ? 480 GLY A O   1 
ATOM   3778 N  N   . ASN A 1 481 ? 24.379  -12.660 51.069  1.00 23.96  ? 481 ASN A N   1 
ATOM   3779 C  CA  . ASN A 1 481 ? 24.096  -13.639 50.032  1.00 34.53  ? 481 ASN A CA  1 
ATOM   3780 C  C   . ASN A 1 481 ? 23.171  -14.674 50.647  1.00 36.82  ? 481 ASN A C   1 
ATOM   3781 O  O   . ASN A 1 481 ? 23.576  -15.365 51.589  1.00 42.17  ? 481 ASN A O   1 
ATOM   3782 C  CB  . ASN A 1 481 ? 25.382  -14.305 49.534  1.00 39.00  ? 481 ASN A CB  1 
ATOM   3783 C  CG  . ASN A 1 481 ? 25.131  -15.414 48.517  1.00 29.47  ? 481 ASN A CG  1 
ATOM   3784 O  OD1 . ASN A 1 481 ? 24.142  -16.157 48.585  1.00 30.39  ? 481 ASN A OD1 1 
ATOM   3785 N  ND2 . ASN A 1 481 ? 26.073  -15.574 47.607  1.00 27.59  ? 481 ASN A ND2 1 
ATOM   3786 N  N   . PRO A 1 482 ? 21.953  -14.846 50.123  1.00 33.08  ? 482 PRO A N   1 
ATOM   3787 C  CA  . PRO A 1 482 ? 20.993  -15.763 50.750  1.00 33.35  ? 482 PRO A CA  1 
ATOM   3788 C  C   . PRO A 1 482 ? 21.322  -17.234 50.562  1.00 35.22  ? 482 PRO A C   1 
ATOM   3789 O  O   . PRO A 1 482 ? 20.594  -18.080 51.097  1.00 37.89  ? 482 PRO A O   1 
ATOM   3790 C  CB  . PRO A 1 482 ? 19.680  -15.409 50.047  1.00 27.39  ? 482 PRO A CB  1 
ATOM   3791 C  CG  . PRO A 1 482 ? 20.112  -15.034 48.688  1.00 23.17  ? 482 PRO A CG  1 
ATOM   3792 C  CD  . PRO A 1 482 ? 21.424  -14.291 48.870  1.00 27.58  ? 482 PRO A CD  1 
ATOM   3793 N  N   . ASN A 1 483 ? 22.368  -17.585 49.825  1.00 22.52  ? 483 ASN A N   1 
ATOM   3794 C  CA  . ASN A 1 483 ? 22.771  -18.979 49.728  1.00 36.50  ? 483 ASN A CA  1 
ATOM   3795 C  C   . ASN A 1 483 ? 23.952  -19.262 50.657  1.00 42.53  ? 483 ASN A C   1 
ATOM   3796 O  O   . ASN A 1 483 ? 24.784  -18.387 50.917  1.00 38.25  ? 483 ASN A O   1 
ATOM   3797 C  CB  . ASN A 1 483 ? 23.126  -19.349 48.277  1.00 33.22  ? 483 ASN A CB  1 
ATOM   3798 C  CG  . ASN A 1 483 ? 22.094  -18.854 47.266  1.00 32.55  ? 483 ASN A CG  1 
ATOM   3799 O  OD1 . ASN A 1 483 ? 22.337  -17.902 46.507  1.00 27.28  ? 483 ASN A OD1 1 
ATOM   3800 N  ND2 . ASN A 1 483 ? 20.929  -19.511 47.251  1.00 27.08  ? 483 ASN A ND2 1 
ATOM   3801 N  N   . GLU A 1 484 ? 24.007  -20.495 51.173  1.00 45.45  ? 484 GLU A N   1 
ATOM   3802 C  CA  . GLU A 1 484 ? 25.185  -20.946 51.891  1.00 51.75  ? 484 GLU A CA  1 
ATOM   3803 C  C   . GLU A 1 484 ? 26.236  -21.435 50.898  1.00 67.18  ? 484 GLU A C   1 
ATOM   3804 O  O   . GLU A 1 484 ? 25.913  -21.788 49.760  1.00 64.40  ? 484 GLU A O   1 
ATOM   3805 C  CB  . GLU A 1 484 ? 24.818  -22.046 52.883  1.00 53.61  ? 484 GLU A CB  1 
ATOM   3806 C  CG  . GLU A 1 484 ? 24.008  -21.543 54.067  1.00 63.30  ? 484 GLU A CG  1 
ATOM   3807 C  CD  . GLU A 1 484 ? 24.022  -22.502 55.248  1.00 76.09  ? 484 GLU A CD  1 
ATOM   3808 O  OE1 . GLU A 1 484 ? 23.895  -23.727 55.024  1.00 74.26  ? 484 GLU A OE1 1 
ATOM   3809 O  OE2 . GLU A 1 484 ? 24.174  -22.029 56.400  1.00 81.86  ? 484 GLU A OE2 1 
ATOM   3810 N  N   . PRO A 1 485 ? 27.516  -21.432 51.293  1.00 83.70  ? 485 PRO A N   1 
ATOM   3811 C  CA  . PRO A 1 485 ? 28.583  -21.801 50.338  1.00 89.40  ? 485 PRO A CA  1 
ATOM   3812 C  C   . PRO A 1 485 ? 28.749  -23.292 50.094  1.00 92.96  ? 485 PRO A C   1 
ATOM   3813 O  O   . PRO A 1 485 ? 29.280  -23.665 49.040  1.00 91.88  ? 485 PRO A O   1 
ATOM   3814 C  CB  . PRO A 1 485 ? 29.848  -21.216 50.980  1.00 89.06  ? 485 PRO A CB  1 
ATOM   3815 C  CG  . PRO A 1 485 ? 29.340  -20.154 51.932  1.00 86.40  ? 485 PRO A CG  1 
ATOM   3816 C  CD  . PRO A 1 485 ? 28.045  -20.697 52.456  1.00 83.30  ? 485 PRO A CD  1 
ATOM   3817 N  N   . HIS A 1 486 ? 28.353  -24.154 51.025  1.00 106.92 ? 486 HIS A N   1 
ATOM   3818 C  CA  . HIS A 1 486 ? 28.305  -25.579 50.734  1.00 116.12 ? 486 HIS A CA  1 
ATOM   3819 C  C   . HIS A 1 486 ? 26.969  -25.850 50.054  1.00 111.10 ? 486 HIS A C   1 
ATOM   3820 O  O   . HIS A 1 486 ? 26.808  -25.546 48.868  1.00 112.91 ? 486 HIS A O   1 
ATOM   3821 C  CB  . HIS A 1 486 ? 28.507  -26.403 52.008  1.00 129.69 ? 486 HIS A CB  1 
ATOM   3822 C  CG  . HIS A 1 486 ? 29.459  -25.783 52.981  1.00 136.28 ? 486 HIS A CG  1 
ATOM   3823 N  ND1 . HIS A 1 486 ? 29.050  -24.943 53.999  1.00 135.13 ? 486 HIS A ND1 1 
ATOM   3824 C  CD2 . HIS A 1 486 ? 30.806  -25.861 53.075  1.00 136.25 ? 486 HIS A CD2 1 
ATOM   3825 C  CE1 . HIS A 1 486 ? 30.103  -24.551 54.693  1.00 133.74 ? 486 HIS A CE1 1 
ATOM   3826 N  NE2 . HIS A 1 486 ? 31.181  -25.092 54.151  1.00 133.93 ? 486 HIS A NE2 1 
ATOM   3827 N  N   . SER A 1 487 ? 26.016  -26.421 50.787  1.00 103.68 ? 487 SER A N   1 
ATOM   3828 C  CA  . SER A 1 487 ? 24.584  -26.269 50.533  1.00 99.42  ? 487 SER A CA  1 
ATOM   3829 C  C   . SER A 1 487 ? 24.125  -26.818 49.186  1.00 98.44  ? 487 SER A C   1 
ATOM   3830 O  O   . SER A 1 487 ? 23.138  -26.321 48.640  1.00 101.00 ? 487 SER A O   1 
ATOM   3831 C  CB  . SER A 1 487 ? 24.161  -24.799 50.642  1.00 101.58 ? 487 SER A CB  1 
ATOM   3832 O  OG  . SER A 1 487 ? 24.697  -24.010 49.591  1.00 103.78 ? 487 SER A OG  1 
ATOM   3833 N  N   . GLN A 1 488 ? 24.818  -27.823 48.640  1.00 95.24  ? 488 GLN A N   1 
ATOM   3834 C  CA  . GLN A 1 488 ? 24.395  -28.602 47.472  1.00 94.26  ? 488 GLN A CA  1 
ATOM   3835 C  C   . GLN A 1 488 ? 23.490  -27.852 46.488  1.00 92.46  ? 488 GLN A C   1 
ATOM   3836 O  O   . GLN A 1 488 ? 23.973  -27.289 45.501  1.00 95.98  ? 488 GLN A O   1 
ATOM   3837 C  CB  . GLN A 1 488 ? 23.721  -29.895 47.955  1.00 97.98  ? 488 GLN A CB  1 
ATOM   3838 C  CG  . GLN A 1 488 ? 22.690  -29.721 49.081  1.00 102.66 ? 488 GLN A CG  1 
ATOM   3839 C  CD  . GLN A 1 488 ? 21.260  -29.816 48.580  1.00 106.45 ? 488 GLN A CD  1 
ATOM   3840 O  OE1 . GLN A 1 488 ? 20.976  -30.566 47.649  1.00 108.76 ? 488 GLN A OE1 1 
ATOM   3841 N  NE2 . GLN A 1 488 ? 20.361  -29.029 49.170  1.00 106.20 ? 488 GLN A NE2 1 
ATOM   3842 N  N   . GLU A 1 489 ? 22.183  -27.857 46.748  1.00 88.80  ? 489 GLU A N   1 
ATOM   3843 C  CA  . GLU A 1 489 ? 21.157  -27.140 45.985  1.00 93.16  ? 489 GLU A CA  1 
ATOM   3844 C  C   . GLU A 1 489 ? 20.554  -26.067 46.907  1.00 88.81  ? 489 GLU A C   1 
ATOM   3845 O  O   . GLU A 1 489 ? 20.540  -26.245 48.129  1.00 87.51  ? 489 GLU A O   1 
ATOM   3846 C  CB  . GLU A 1 489 ? 20.050  -28.096 45.494  1.00 99.85  ? 489 GLU A CB  1 
ATOM   3847 C  CG  . GLU A 1 489 ? 20.487  -29.399 44.796  1.00 104.28 ? 489 GLU A CG  1 
ATOM   3848 C  CD  . GLU A 1 489 ? 19.364  -30.458 44.757  1.00 102.47 ? 489 GLU A CD  1 
ATOM   3849 O  OE1 . GLU A 1 489 ? 18.554  -30.456 43.802  1.00 98.96  ? 489 GLU A OE1 1 
ATOM   3850 O  OE2 . GLU A 1 489 ? 19.283  -31.296 45.686  1.00 103.49 ? 489 GLU A OE2 1 
ATOM   3851 N  N   . SER A 1 490 ? 20.039  -24.969 46.363  1.00 82.82  ? 490 SER A N   1 
ATOM   3852 C  CA  . SER A 1 490 ? 19.961  -24.701 44.939  1.00 71.13  ? 490 SER A CA  1 
ATOM   3853 C  C   . SER A 1 490 ? 20.172  -23.206 44.810  1.00 59.16  ? 490 SER A C   1 
ATOM   3854 O  O   . SER A 1 490 ? 19.366  -22.421 45.299  1.00 65.38  ? 490 SER A O   1 
ATOM   3855 C  CB  . SER A 1 490 ? 18.606  -25.133 44.376  1.00 70.04  ? 490 SER A CB  1 
ATOM   3856 O  OG  . SER A 1 490 ? 18.687  -25.426 42.995  1.00 73.28  ? 490 SER A OG  1 
ATOM   3857 N  N   . LYS A 1 491 ? 21.263  -22.801 44.183  1.00 50.47  ? 491 LYS A N   1 
ATOM   3858 C  CA  . LYS A 1 491 ? 21.710  -21.424 44.331  1.00 48.19  ? 491 LYS A CA  1 
ATOM   3859 C  C   . LYS A 1 491 ? 20.702  -20.458 43.719  1.00 40.57  ? 491 LYS A C   1 
ATOM   3860 O  O   . LYS A 1 491 ? 20.215  -20.668 42.601  1.00 43.34  ? 491 LYS A O   1 
ATOM   3861 C  CB  . LYS A 1 491 ? 23.095  -21.243 43.709  1.00 56.52  ? 491 LYS A CB  1 
ATOM   3862 C  CG  . LYS A 1 491 ? 24.271  -21.570 44.655  1.00 59.97  ? 491 LYS A CG  1 
ATOM   3863 C  CD  . LYS A 1 491 ? 24.217  -23.007 45.170  1.00 67.49  ? 491 LYS A CD  1 
ATOM   3864 C  CE  . LYS A 1 491 ? 25.597  -23.534 45.522  1.00 75.92  ? 491 LYS A CE  1 
ATOM   3865 N  NZ  . LYS A 1 491 ? 25.542  -24.958 45.962  1.00 78.35  ? 491 LYS A NZ  1 
ATOM   3866 N  N   . TRP A 1 492 ? 20.371  -19.412 44.484  1.00 34.97  ? 492 TRP A N   1 
ATOM   3867 C  CA  . TRP A 1 492 ? 19.499  -18.337 44.028  1.00 30.76  ? 492 TRP A CA  1 
ATOM   3868 C  C   . TRP A 1 492 ? 20.353  -17.265 43.363  1.00 35.75  ? 492 TRP A C   1 
ATOM   3869 O  O   . TRP A 1 492 ? 21.090  -16.552 44.065  1.00 33.69  ? 492 TRP A O   1 
ATOM   3870 C  CB  . TRP A 1 492 ? 18.715  -17.772 45.200  1.00 25.49  ? 492 TRP A CB  1 
ATOM   3871 C  CG  . TRP A 1 492 ? 17.956  -16.464 45.015  1.00 25.42  ? 492 TRP A CG  1 
ATOM   3872 C  CD1 . TRP A 1 492 ? 17.944  -15.638 43.926  1.00 27.70  ? 492 TRP A CD1 1 
ATOM   3873 C  CD2 . TRP A 1 492 ? 17.103  -15.850 45.988  1.00 23.61  ? 492 TRP A CD2 1 
ATOM   3874 N  NE1 . TRP A 1 492 ? 17.137  -14.550 44.166  1.00 29.74  ? 492 TRP A NE1 1 
ATOM   3875 C  CE2 . TRP A 1 492 ? 16.610  -14.660 45.424  1.00 19.82  ? 492 TRP A CE2 1 
ATOM   3876 C  CE3 . TRP A 1 492 ? 16.702  -16.202 47.284  1.00 20.21  ? 492 TRP A CE3 1 
ATOM   3877 C  CZ2 . TRP A 1 492 ? 15.747  -13.819 46.109  1.00 22.87  ? 492 TRP A CZ2 1 
ATOM   3878 C  CZ3 . TRP A 1 492 ? 15.857  -15.365 47.964  1.00 19.50  ? 492 TRP A CZ3 1 
ATOM   3879 C  CH2 . TRP A 1 492 ? 15.383  -14.189 47.379  1.00 21.58  ? 492 TRP A CH2 1 
ATOM   3880 N  N   . PRO A 1 493 ? 20.274  -17.104 42.043  1.00 22.91  ? 493 PRO A N   1 
ATOM   3881 C  CA  . PRO A 1 493 ? 21.250  -16.282 41.318  1.00 24.85  ? 493 PRO A CA  1 
ATOM   3882 C  C   . PRO A 1 493 ? 21.175  -14.804 41.634  1.00 29.70  ? 493 PRO A C   1 
ATOM   3883 O  O   . PRO A 1 493 ? 20.103  -14.249 41.881  1.00 30.55  ? 493 PRO A O   1 
ATOM   3884 C  CB  . PRO A 1 493 ? 20.892  -16.520 39.847  1.00 23.52  ? 493 PRO A CB  1 
ATOM   3885 C  CG  . PRO A 1 493 ? 19.518  -17.090 39.879  1.00 46.46  ? 493 PRO A CG  1 
ATOM   3886 C  CD  . PRO A 1 493 ? 19.454  -17.904 41.127  1.00 23.25  ? 493 PRO A CD  1 
ATOM   3887 N  N   . LEU A 1 494 ? 22.352  -14.171 41.600  1.00 29.99  ? 494 LEU A N   1 
ATOM   3888 C  CA  . LEU A 1 494 ? 22.453  -12.720 41.528  1.00 35.31  ? 494 LEU A CA  1 
ATOM   3889 C  C   . LEU A 1 494 ? 21.549  -12.173 40.428  1.00 33.78  ? 494 LEU A C   1 
ATOM   3890 O  O   . LEU A 1 494 ? 21.305  -12.825 39.408  1.00 30.49  ? 494 LEU A O   1 
ATOM   3891 C  CB  . LEU A 1 494 ? 23.898  -12.300 41.232  1.00 45.32  ? 494 LEU A CB  1 
ATOM   3892 C  CG  . LEU A 1 494 ? 24.864  -11.754 42.284  1.00 46.66  ? 494 LEU A CG  1 
ATOM   3893 C  CD1 . LEU A 1 494 ? 24.213  -10.604 43.026  1.00 54.34  ? 494 LEU A CD1 1 
ATOM   3894 C  CD2 . LEU A 1 494 ? 25.347  -12.834 43.236  1.00 43.64  ? 494 LEU A CD2 1 
ATOM   3895 N  N   . PHE A 1 495 ? 21.068  -10.953 40.633  1.00 28.89  ? 495 PHE A N   1 
ATOM   3896 C  CA  . PHE A 1 495 ? 20.332  -10.215 39.616  1.00 25.66  ? 495 PHE A CA  1 
ATOM   3897 C  C   . PHE A 1 495 ? 21.284  -9.225  38.958  1.00 30.51  ? 495 PHE A C   1 
ATOM   3898 O  O   . PHE A 1 495 ? 21.761  -8.287  39.610  1.00 35.97  ? 495 PHE A O   1 
ATOM   3899 C  CB  . PHE A 1 495 ? 19.137  -9.484  40.225  1.00 24.73  ? 495 PHE A CB  1 
ATOM   3900 C  CG  . PHE A 1 495 ? 18.417  -8.603  39.256  1.00 29.86  ? 495 PHE A CG  1 
ATOM   3901 C  CD1 . PHE A 1 495 ? 18.848  -7.304  39.018  1.00 28.17  ? 495 PHE A CD1 1 
ATOM   3902 C  CD2 . PHE A 1 495 ? 17.304  -9.073  38.574  1.00 31.51  ? 495 PHE A CD2 1 
ATOM   3903 C  CE1 . PHE A 1 495 ? 18.181  -6.490  38.118  1.00 26.34  ? 495 PHE A CE1 1 
ATOM   3904 C  CE2 . PHE A 1 495 ? 16.626  -8.260  37.680  1.00 27.10  ? 495 PHE A CE2 1 
ATOM   3905 C  CZ  . PHE A 1 495 ? 17.074  -6.969  37.446  1.00 28.04  ? 495 PHE A CZ  1 
ATOM   3906 N  N   . THR A 1 496 ? 21.549  -9.418  37.674  1.00 26.92  ? 496 THR A N   1 
ATOM   3907 C  CA  . THR A 1 496 ? 22.547  -8.614  36.986  1.00 35.11  ? 496 THR A CA  1 
ATOM   3908 C  C   . THR A 1 496 ? 21.905  -7.794  35.882  1.00 34.31  ? 496 THR A C   1 
ATOM   3909 O  O   . THR A 1 496 ? 20.861  -8.157  35.341  1.00 40.09  ? 496 THR A O   1 
ATOM   3910 C  CB  . THR A 1 496 ? 23.640  -9.487  36.403  1.00 32.63  ? 496 THR A CB  1 
ATOM   3911 O  OG1 . THR A 1 496 ? 23.112  -10.227 35.289  1.00 23.83  ? 496 THR A OG1 1 
ATOM   3912 C  CG2 . THR A 1 496 ? 24.115  -10.439 37.474  1.00 31.11  ? 496 THR A CG2 1 
ATOM   3913 N  N   . THR A 1 497 ? 22.559  -6.681  35.550  1.00 27.72  ? 497 THR A N   1 
ATOM   3914 C  CA  . THR A 1 497 ? 21.954  -5.701  34.656  1.00 34.19  ? 497 THR A CA  1 
ATOM   3915 C  C   . THR A 1 497 ? 21.536  -6.335  33.331  1.00 39.64  ? 497 THR A C   1 
ATOM   3916 O  O   . THR A 1 497 ? 20.466  -6.022  32.794  1.00 41.03  ? 497 THR A O   1 
ATOM   3917 C  CB  . THR A 1 497 ? 22.931  -4.545  34.427  1.00 38.06  ? 497 THR A CB  1 
ATOM   3918 O  OG1 . THR A 1 497 ? 22.935  -3.681  35.573  1.00 38.48  ? 497 THR A OG1 1 
ATOM   3919 C  CG2 . THR A 1 497 ? 22.560  -3.746  33.170  1.00 30.65  ? 497 THR A CG2 1 
ATOM   3920 N  N   . LYS A 1 498 ? 22.344  -7.257  32.811  1.00 40.05  ? 498 LYS A N   1 
ATOM   3921 C  CA  . LYS A 1 498 ? 22.080  -7.811  31.491  1.00 42.24  ? 498 LYS A CA  1 
ATOM   3922 C  C   . LYS A 1 498 ? 21.163  -9.023  31.533  1.00 40.90  ? 498 LYS A C   1 
ATOM   3923 O  O   . LYS A 1 498 ? 20.291  -9.153  30.669  1.00 54.45  ? 498 LYS A O   1 
ATOM   3924 C  CB  . LYS A 1 498 ? 23.394  -8.174  30.789  1.00 48.93  ? 498 LYS A CB  1 
ATOM   3925 C  CG  . LYS A 1 498 ? 24.254  -6.956  30.421  1.00 61.69  ? 498 LYS A CG  1 
ATOM   3926 C  CD  . LYS A 1 498 ? 23.535  -6.014  29.446  1.00 63.44  ? 498 LYS A CD  1 
ATOM   3927 C  CE  . LYS A 1 498 ? 24.043  -6.189  28.002  1.00 54.77  ? 498 LYS A CE  1 
ATOM   3928 N  NZ  . LYS A 1 498 ? 23.142  -5.597  26.951  1.00 35.79  ? 498 LYS A NZ  1 
ATOM   3929 N  N   . GLU A 1 499 ? 21.318  -9.912  32.517  1.00 30.46  ? 499 GLU A N   1 
ATOM   3930 C  CA  . GLU A 1 499 ? 20.547  -11.152 32.511  1.00 33.84  ? 499 GLU A CA  1 
ATOM   3931 C  C   . GLU A 1 499 ? 19.272  -11.101 33.352  1.00 31.77  ? 499 GLU A C   1 
ATOM   3932 O  O   . GLU A 1 499 ? 18.351  -11.884 33.092  1.00 25.82  ? 499 GLU A O   1 
ATOM   3933 C  CB  . GLU A 1 499 ? 21.423  -12.324 32.964  1.00 41.68  ? 499 GLU A CB  1 
ATOM   3934 C  CG  . GLU A 1 499 ? 22.439  -12.752 31.915  1.00 62.84  ? 499 GLU A CG  1 
ATOM   3935 C  CD  . GLU A 1 499 ? 22.975  -14.154 32.156  1.00 78.98  ? 499 GLU A CD  1 
ATOM   3936 O  OE1 . GLU A 1 499 ? 22.752  -15.027 31.280  1.00 87.73  ? 499 GLU A OE1 1 
ATOM   3937 O  OE2 . GLU A 1 499 ? 23.603  -14.382 33.222  1.00 73.22  ? 499 GLU A OE2 1 
ATOM   3938 N  N   . GLN A 1 500 ? 19.201  -10.211 34.341  1.00 29.48  ? 500 GLN A N   1 
ATOM   3939 C  CA  . GLN A 1 500 ? 17.976  -9.899  35.078  1.00 31.72  ? 500 GLN A CA  1 
ATOM   3940 C  C   . GLN A 1 500 ? 17.252  -11.166 35.558  1.00 40.90  ? 500 GLN A C   1 
ATOM   3941 O  O   . GLN A 1 500 ? 16.080  -11.394 35.251  1.00 49.41  ? 500 GLN A O   1 
ATOM   3942 C  CB  . GLN A 1 500 ? 17.046  -9.030  34.222  1.00 27.26  ? 500 GLN A CB  1 
ATOM   3943 C  CG  . GLN A 1 500 ? 17.712  -7.859  33.524  1.00 39.47  ? 500 GLN A CG  1 
ATOM   3944 C  CD  . GLN A 1 500 ? 16.721  -6.927  32.805  1.00 50.49  ? 500 GLN A CD  1 
ATOM   3945 O  OE1 . GLN A 1 500 ? 15.501  -7.013  33.007  1.00 57.71  ? 500 GLN A OE1 1 
ATOM   3946 N  NE2 . GLN A 1 500 ? 17.253  -6.043  31.946  1.00 42.07  ? 500 GLN A NE2 1 
ATOM   3947 N  N   . LYS A 1 501 ? 17.968  -11.998 36.319  1.00 31.42  ? 501 LYS A N   1 
ATOM   3948 C  CA  . LYS A 1 501 ? 17.423  -13.269 36.790  1.00 23.38  ? 501 LYS A CA  1 
ATOM   3949 C  C   . LYS A 1 501 ? 16.703  -13.101 38.128  1.00 21.51  ? 501 LYS A C   1 
ATOM   3950 O  O   . LYS A 1 501 ? 16.969  -12.161 38.883  1.00 20.67  ? 501 LYS A O   1 
ATOM   3951 C  CB  . LYS A 1 501 ? 18.526  -14.324 36.922  1.00 22.68  ? 501 LYS A CB  1 
ATOM   3952 C  CG  . LYS A 1 501 ? 18.933  -14.996 35.627  1.00 30.55  ? 501 LYS A CG  1 
ATOM   3953 C  CD  . LYS A 1 501 ? 20.438  -15.217 35.582  1.00 39.58  ? 501 LYS A CD  1 
ATOM   3954 C  CE  . LYS A 1 501 ? 20.826  -16.367 34.645  1.00 49.27  ? 501 LYS A CE  1 
ATOM   3955 N  NZ  . LYS A 1 501 ? 21.076  -17.653 35.368  1.00 58.61  ? 501 LYS A NZ  1 
ATOM   3956 N  N   . PHE A 1 502 ? 15.773  -14.025 38.408  1.00 28.64  ? 502 PHE A N   1 
ATOM   3957 C  CA  . PHE A 1 502 ? 15.088  -14.085 39.703  1.00 29.16  ? 502 PHE A CA  1 
ATOM   3958 C  C   . PHE A 1 502 ? 14.498  -15.481 39.891  1.00 26.50  ? 502 PHE A C   1 
ATOM   3959 O  O   . PHE A 1 502 ? 14.590  -16.344 39.010  1.00 33.62  ? 502 PHE A O   1 
ATOM   3960 C  CB  . PHE A 1 502 ? 13.995  -13.024 39.837  1.00 25.60  ? 502 PHE A CB  1 
ATOM   3961 C  CG  . PHE A 1 502 ? 12.804  -13.282 38.963  1.00 45.29  ? 502 PHE A CG  1 
ATOM   3962 C  CD1 . PHE A 1 502 ? 11.727  -14.030 39.422  1.00 45.11  ? 502 PHE A CD1 1 
ATOM   3963 C  CD2 . PHE A 1 502 ? 12.770  -12.794 37.662  1.00 47.92  ? 502 PHE A CD2 1 
ATOM   3964 C  CE1 . PHE A 1 502 ? 10.641  -14.284 38.597  1.00 38.37  ? 502 PHE A CE1 1 
ATOM   3965 C  CE2 . PHE A 1 502 ? 11.686  -13.039 36.841  1.00 35.10  ? 502 PHE A CE2 1 
ATOM   3966 C  CZ  . PHE A 1 502 ? 10.621  -13.780 37.312  1.00 34.73  ? 502 PHE A CZ  1 
ATOM   3967 N  N   . ILE A 1 503 ? 13.860  -15.687 41.048  1.00 20.57  ? 503 ILE A N   1 
ATOM   3968 C  CA  . ILE A 1 503 ? 13.420  -17.013 41.464  1.00 32.20  ? 503 ILE A CA  1 
ATOM   3969 C  C   . ILE A 1 503 ? 11.994  -16.957 41.988  1.00 34.00  ? 503 ILE A C   1 
ATOM   3970 O  O   . ILE A 1 503 ? 11.536  -15.935 42.509  1.00 37.13  ? 503 ILE A O   1 
ATOM   3971 C  CB  . ILE A 1 503 ? 14.332  -17.624 42.551  1.00 32.05  ? 503 ILE A CB  1 
ATOM   3972 C  CG1 . ILE A 1 503 ? 14.335  -16.739 43.798  1.00 31.58  ? 503 ILE A CG1 1 
ATOM   3973 C  CG2 . ILE A 1 503 ? 15.727  -17.838 42.018  1.00 34.62  ? 503 ILE A CG2 1 
ATOM   3974 C  CD1 . ILE A 1 503 ? 14.343  -17.527 45.078  1.00 41.17  ? 503 ILE A CD1 1 
ATOM   3975 N  N   . ASP A 1 504 ? 11.306  -18.087 41.866  1.00 32.48  ? 504 ASP A N   1 
ATOM   3976 C  CA  . ASP A 1 504 ? 9.973   -18.257 42.416  1.00 39.23  ? 504 ASP A CA  1 
ATOM   3977 C  C   . ASP A 1 504 ? 10.078  -18.700 43.864  1.00 43.64  ? 504 ASP A C   1 
ATOM   3978 O  O   . ASP A 1 504 ? 10.821  -19.633 44.187  1.00 55.04  ? 504 ASP A O   1 
ATOM   3979 C  CB  . ASP A 1 504 ? 9.184   -19.285 41.610  1.00 53.19  ? 504 ASP A CB  1 
ATOM   3980 C  CG  . ASP A 1 504 ? 8.562   -18.686 40.369  1.00 76.93  ? 504 ASP A CG  1 
ATOM   3981 O  OD1 . ASP A 1 504 ? 8.308   -17.458 40.382  1.00 88.56  ? 504 ASP A OD1 1 
ATOM   3982 O  OD2 . ASP A 1 504 ? 8.334   -19.429 39.386  1.00 77.10  ? 504 ASP A OD2 1 
ATOM   3983 N  N   . LEU A 1 505 ? 9.342   -18.026 44.728  1.00 31.95  ? 505 LEU A N   1 
ATOM   3984 C  CA  . LEU A 1 505 ? 9.158   -18.461 46.102  1.00 29.42  ? 505 LEU A CA  1 
ATOM   3985 C  C   . LEU A 1 505 ? 7.815   -19.167 46.185  1.00 33.57  ? 505 LEU A C   1 
ATOM   3986 O  O   . LEU A 1 505 ? 6.762   -18.522 46.099  1.00 38.80  ? 505 LEU A O   1 
ATOM   3987 C  CB  . LEU A 1 505 ? 9.220   -17.275 47.057  1.00 25.89  ? 505 LEU A CB  1 
ATOM   3988 C  CG  . LEU A 1 505 ? 10.666  -16.992 47.394  1.00 27.32  ? 505 LEU A CG  1 
ATOM   3989 C  CD1 . LEU A 1 505 ? 10.769  -15.757 48.284  1.00 34.40  ? 505 LEU A CD1 1 
ATOM   3990 C  CD2 . LEU A 1 505 ? 11.224  -18.258 48.042  1.00 19.93  ? 505 LEU A CD2 1 
ATOM   3991 N  N   . ASN A 1 506 ? 7.853   -20.480 46.332  1.00 21.05  ? 506 ASN A N   1 
ATOM   3992 C  CA  . ASN A 1 506 ? 6.641   -21.272 46.521  1.00 34.45  ? 506 ASN A CA  1 
ATOM   3993 C  C   . ASN A 1 506 ? 7.074   -22.698 46.819  1.00 36.12  ? 506 ASN A C   1 
ATOM   3994 O  O   . ASN A 1 506 ? 8.267   -22.980 46.989  1.00 37.78  ? 506 ASN A O   1 
ATOM   3995 C  CB  . ASN A 1 506 ? 5.708   -21.199 45.308  1.00 35.28  ? 506 ASN A CB  1 
ATOM   3996 C  CG  . ASN A 1 506 ? 6.420   -21.496 44.003  1.00 37.43  ? 506 ASN A CG  1 
ATOM   3997 O  OD1 . ASN A 1 506 ? 6.806   -22.637 43.743  1.00 45.42  ? 506 ASN A OD1 1 
ATOM   3998 N  ND2 . ASN A 1 506 ? 6.582   -20.473 43.166  1.00 26.60  ? 506 ASN A ND2 1 
ATOM   3999 N  N   . THR A 1 507 ? 6.102   -23.603 46.858  1.00 36.47  ? 507 THR A N   1 
ATOM   4000 C  CA  . THR A 1 507 ? 6.320   -24.951 47.356  1.00 44.34  ? 507 THR A CA  1 
ATOM   4001 C  C   . THR A 1 507 ? 6.976   -25.873 46.337  1.00 46.72  ? 507 THR A C   1 
ATOM   4002 O  O   . THR A 1 507 ? 7.301   -27.015 46.683  1.00 44.32  ? 507 THR A O   1 
ATOM   4003 C  CB  . THR A 1 507 ? 4.988   -25.538 47.825  1.00 51.43  ? 507 THR A CB  1 
ATOM   4004 O  OG1 . THR A 1 507 ? 3.977   -25.264 46.847  1.00 58.97  ? 507 THR A OG1 1 
ATOM   4005 C  CG2 . THR A 1 507 ? 4.584   -24.911 49.153  1.00 42.35  ? 507 THR A CG2 1 
ATOM   4006 N  N   . GLU A 1 508 ? 7.182   -25.418 45.106  1.00 51.22  ? 508 GLU A N   1 
ATOM   4007 C  CA  . GLU A 1 508 ? 7.833   -26.237 44.094  1.00 55.17  ? 508 GLU A CA  1 
ATOM   4008 C  C   . GLU A 1 508 ? 9.335   -25.987 44.102  1.00 59.02  ? 508 GLU A C   1 
ATOM   4009 O  O   . GLU A 1 508 ? 9.803   -24.978 44.642  1.00 59.34  ? 508 GLU A O   1 
ATOM   4010 C  CB  . GLU A 1 508 ? 7.241   -25.936 42.714  1.00 53.23  ? 508 GLU A CB  1 
ATOM   4011 C  CG  . GLU A 1 508 ? 5.762   -26.300 42.588  1.00 59.37  ? 508 GLU A CG  1 
ATOM   4012 C  CD  . GLU A 1 508 ? 5.329   -26.597 41.154  1.00 70.55  ? 508 GLU A CD  1 
ATOM   4013 O  OE1 . GLU A 1 508 ? 4.127   -26.427 40.851  1.00 68.68  ? 508 GLU A OE1 1 
ATOM   4014 O  OE2 . GLU A 1 508 ? 6.177   -27.017 40.333  1.00 79.06  ? 508 GLU A OE2 1 
ATOM   4015 N  N   . PRO A 1 509 ? 10.126  -26.908 43.543  1.00 57.54  ? 509 PRO A N   1 
ATOM   4016 C  CA  . PRO A 1 509 ? 11.578  -26.681 43.460  1.00 56.97  ? 509 PRO A CA  1 
ATOM   4017 C  C   . PRO A 1 509 ? 11.897  -25.383 42.727  1.00 63.34  ? 509 PRO A C   1 
ATOM   4018 O  O   . PRO A 1 509 ? 11.284  -25.055 41.709  1.00 68.82  ? 509 PRO A O   1 
ATOM   4019 C  CB  . PRO A 1 509 ? 12.085  -27.903 42.688  1.00 52.38  ? 509 PRO A CB  1 
ATOM   4020 C  CG  . PRO A 1 509 ? 11.052  -28.952 42.920  1.00 52.82  ? 509 PRO A CG  1 
ATOM   4021 C  CD  . PRO A 1 509 ? 9.742   -28.247 43.057  1.00 51.24  ? 509 PRO A CD  1 
ATOM   4022 N  N   . MET A 1 510 ? 12.871  -24.646 43.259  1.00 62.79  ? 510 MET A N   1 
ATOM   4023 C  CA  . MET A 1 510 ? 13.127  -23.287 42.797  1.00 61.70  ? 510 MET A CA  1 
ATOM   4024 C  C   . MET A 1 510 ? 13.509  -23.264 41.322  1.00 58.75  ? 510 MET A C   1 
ATOM   4025 O  O   . MET A 1 510 ? 14.265  -24.112 40.846  1.00 63.59  ? 510 MET A O   1 
ATOM   4026 C  CB  . MET A 1 510 ? 14.234  -22.648 43.636  1.00 61.77  ? 510 MET A CB  1 
ATOM   4027 C  CG  . MET A 1 510 ? 14.670  -21.285 43.140  1.00 59.98  ? 510 MET A CG  1 
ATOM   4028 S  SD  . MET A 1 510 ? 16.444  -21.071 43.343  1.00 62.07  ? 510 MET A SD  1 
ATOM   4029 C  CE  . MET A 1 510 ? 16.530  -20.701 45.097  1.00 64.85  ? 510 MET A CE  1 
ATOM   4030 N  N   . LYS A 1 511 ? 12.972  -22.281 40.598  1.00 59.45  ? 511 LYS A N   1 
ATOM   4031 C  CA  . LYS A 1 511 ? 13.265  -22.077 39.185  1.00 59.51  ? 511 LYS A CA  1 
ATOM   4032 C  C   . LYS A 1 511 ? 13.679  -20.631 38.952  1.00 53.72  ? 511 LYS A C   1 
ATOM   4033 O  O   . LYS A 1 511 ? 13.127  -19.713 39.564  1.00 46.39  ? 511 LYS A O   1 
ATOM   4034 C  CB  . LYS A 1 511 ? 12.054  -22.420 38.304  1.00 59.10  ? 511 LYS A CB  1 
ATOM   4035 C  CG  . LYS A 1 511 ? 11.725  -23.902 38.268  1.00 64.24  ? 511 LYS A CG  1 
ATOM   4036 C  CD  . LYS A 1 511 ? 10.486  -24.184 37.428  1.00 67.18  ? 511 LYS A CD  1 
ATOM   4037 C  CE  . LYS A 1 511 ? 10.675  -25.445 36.576  1.00 68.04  ? 511 LYS A CE  1 
ATOM   4038 N  NZ  . LYS A 1 511 ? 9.427   -25.895 35.883  1.00 61.59  ? 511 LYS A NZ  1 
ATOM   4039 N  N   . VAL A 1 512 ? 14.652  -20.431 38.067  1.00 48.39  ? 512 VAL A N   1 
ATOM   4040 C  CA  . VAL A 1 512 ? 15.134  -19.094 37.744  1.00 36.30  ? 512 VAL A CA  1 
ATOM   4041 C  C   . VAL A 1 512 ? 14.343  -18.570 36.554  1.00 33.96  ? 512 VAL A C   1 
ATOM   4042 O  O   . VAL A 1 512 ? 13.985  -19.335 35.646  1.00 38.07  ? 512 VAL A O   1 
ATOM   4043 C  CB  . VAL A 1 512 ? 16.649  -19.114 37.457  1.00 29.41  ? 512 VAL A CB  1 
ATOM   4044 C  CG1 . VAL A 1 512 ? 17.199  -17.712 37.319  1.00 27.20  ? 512 VAL A CG1 1 
ATOM   4045 C  CG2 . VAL A 1 512 ? 17.373  -19.832 38.550  1.00 39.39  ? 512 VAL A CG2 1 
ATOM   4046 N  N   . HIS A 1 513 ? 14.050  -17.269 36.562  1.00 25.87  ? 513 HIS A N   1 
ATOM   4047 C  CA  . HIS A 1 513 ? 13.411  -16.623 35.422  1.00 33.76  ? 513 HIS A CA  1 
ATOM   4048 C  C   . HIS A 1 513 ? 14.116  -15.309 35.117  1.00 43.18  ? 513 HIS A C   1 
ATOM   4049 O  O   . HIS A 1 513 ? 14.827  -14.756 35.960  1.00 51.84  ? 513 HIS A O   1 
ATOM   4050 C  CB  . HIS A 1 513 ? 11.912  -16.383 35.659  1.00 28.42  ? 513 HIS A CB  1 
ATOM   4051 C  CG  . HIS A 1 513 ? 11.121  -17.643 35.790  1.00 37.06  ? 513 HIS A CG  1 
ATOM   4052 N  ND1 . HIS A 1 513 ? 10.660  -18.119 37.003  1.00 38.28  ? 513 HIS A ND1 1 
ATOM   4053 C  CD2 . HIS A 1 513 ? 10.736  -18.548 34.857  1.00 46.30  ? 513 HIS A CD2 1 
ATOM   4054 C  CE1 . HIS A 1 513 ? 10.009  -19.252 36.811  1.00 47.19  ? 513 HIS A CE1 1 
ATOM   4055 N  NE2 . HIS A 1 513 ? 10.044  -19.536 35.519  1.00 54.81  ? 513 HIS A NE2 1 
ATOM   4056 N  N   . GLN A 1 514 ? 13.920  -14.815 33.893  1.00 36.08  ? 514 GLN A N   1 
ATOM   4057 C  CA  . GLN A 1 514 ? 14.513  -13.563 33.448  1.00 29.48  ? 514 GLN A CA  1 
ATOM   4058 C  C   . GLN A 1 514 ? 13.419  -12.547 33.167  1.00 24.88  ? 514 GLN A C   1 
ATOM   4059 O  O   . GLN A 1 514 ? 12.322  -12.904 32.732  1.00 27.72  ? 514 GLN A O   1 
ATOM   4060 C  CB  . GLN A 1 514 ? 15.352  -13.763 32.191  1.00 46.76  ? 514 GLN A CB  1 
ATOM   4061 C  CG  . GLN A 1 514 ? 16.736  -14.283 32.472  1.00 58.70  ? 514 GLN A CG  1 
ATOM   4062 C  CD  . GLN A 1 514 ? 17.556  -14.436 31.215  1.00 60.78  ? 514 GLN A CD  1 
ATOM   4063 O  OE1 . GLN A 1 514 ? 18.611  -15.075 31.222  1.00 61.48  ? 514 GLN A OE1 1 
ATOM   4064 N  NE2 . GLN A 1 514 ? 17.064  -13.860 30.115  1.00 58.81  ? 514 GLN A NE2 1 
ATOM   4065 N  N   . ARG A 1 515 ? 13.732  -11.277 33.430  1.00 29.63  ? 515 ARG A N   1 
ATOM   4066 C  CA  . ARG A 1 515 ? 12.855  -10.141 33.150  1.00 27.53  ? 515 ARG A CA  1 
ATOM   4067 C  C   . ARG A 1 515 ? 11.458  -10.315 33.739  1.00 36.64  ? 515 ARG A C   1 
ATOM   4068 O  O   . ARG A 1 515 ? 10.513  -10.659 33.025  1.00 43.51  ? 515 ARG A O   1 
ATOM   4069 C  CB  . ARG A 1 515 ? 12.770  -9.907  31.642  1.00 25.02  ? 515 ARG A CB  1 
ATOM   4070 C  CG  . ARG A 1 515 ? 14.002  -9.286  31.033  1.00 28.45  ? 515 ARG A CG  1 
ATOM   4071 C  CD  . ARG A 1 515 ? 14.372  -10.021 29.768  1.00 49.44  ? 515 ARG A CD  1 
ATOM   4072 N  NE  . ARG A 1 515 ? 14.858  -9.097  28.745  1.00 57.86  ? 515 ARG A NE  1 
ATOM   4073 C  CZ  . ARG A 1 515 ? 16.136  -8.839  28.527  1.00 59.98  ? 515 ARG A CZ  1 
ATOM   4074 N  NH1 . ARG A 1 515 ? 16.476  -7.987  27.570  1.00 54.92  ? 515 ARG A NH1 1 
ATOM   4075 N  NH2 . ARG A 1 515 ? 17.045  -9.428  29.284  1.00 66.30  ? 515 ARG A NH2 1 
ATOM   4076 N  N   . LEU A 1 516 ? 11.316  -10.078 35.040  1.00 40.11  ? 516 LEU A N   1 
ATOM   4077 C  CA  . LEU A 1 516 ? 10.004  -10.121 35.669  1.00 29.88  ? 516 LEU A CA  1 
ATOM   4078 C  C   . LEU A 1 516 ? 9.103   -9.042  35.086  1.00 29.79  ? 516 LEU A C   1 
ATOM   4079 O  O   . LEU A 1 516 ? 9.439   -7.852  35.130  1.00 24.59  ? 516 LEU A O   1 
ATOM   4080 C  CB  . LEU A 1 516 ? 10.146  -9.945  37.179  1.00 24.22  ? 516 LEU A CB  1 
ATOM   4081 C  CG  . LEU A 1 516 ? 8.888   -9.825  38.047  1.00 24.39  ? 516 LEU A CG  1 
ATOM   4082 C  CD1 . LEU A 1 516 ? 7.899   -10.933 37.722  1.00 25.86  ? 516 LEU A CD1 1 
ATOM   4083 C  CD2 . LEU A 1 516 ? 9.248   -9.901  39.521  1.00 17.97  ? 516 LEU A CD2 1 
ATOM   4084 N  N   . ARG A 1 517 ? 7.971   -9.474  34.518  1.00 32.01  ? 517 ARG A N   1 
ATOM   4085 C  CA  . ARG A 1 517 ? 6.928   -8.580  34.013  1.00 25.10  ? 517 ARG A CA  1 
ATOM   4086 C  C   . ARG A 1 517 ? 7.497   -7.502  33.097  1.00 22.36  ? 517 ARG A C   1 
ATOM   4087 O  O   . ARG A 1 517 ? 7.058   -6.351  33.102  1.00 19.52  ? 517 ARG A O   1 
ATOM   4088 C  CB  . ARG A 1 517 ? 6.139   -7.960  35.169  1.00 24.42  ? 517 ARG A CB  1 
ATOM   4089 C  CG  . ARG A 1 517 ? 5.003   -8.871  35.612  1.00 34.13  ? 517 ARG A CG  1 
ATOM   4090 C  CD  . ARG A 1 517 ? 3.911   -8.170  36.397  1.00 27.84  ? 517 ARG A CD  1 
ATOM   4091 N  NE  . ARG A 1 517 ? 2.738   -7.846  35.591  1.00 32.11  ? 517 ARG A NE  1 
ATOM   4092 C  CZ  . ARG A 1 517 ? 1.972   -8.722  34.949  1.00 36.50  ? 517 ARG A CZ  1 
ATOM   4093 N  NH1 . ARG A 1 517 ? 2.242   -10.019 35.007  1.00 35.47  ? 517 ARG A NH1 1 
ATOM   4094 N  NH2 . ARG A 1 517 ? 0.931   -8.283  34.253  1.00 32.47  ? 517 ARG A NH2 1 
ATOM   4095 N  N   . VAL A 1 518 ? 8.492   -7.872  32.295  1.00 20.00  ? 518 VAL A N   1 
ATOM   4096 C  CA  . VAL A 1 518 ? 9.170   -6.846  31.512  1.00 35.05  ? 518 VAL A CA  1 
ATOM   4097 C  C   . VAL A 1 518 ? 8.182   -6.135  30.601  1.00 38.29  ? 518 VAL A C   1 
ATOM   4098 O  O   . VAL A 1 518 ? 8.248   -4.910  30.436  1.00 36.05  ? 518 VAL A O   1 
ATOM   4099 C  CB  . VAL A 1 518 ? 10.363  -7.432  30.727  1.00 25.24  ? 518 VAL A CB  1 
ATOM   4100 C  CG1 . VAL A 1 518 ? 9.925   -8.475  29.709  1.00 21.62  ? 518 VAL A CG1 1 
ATOM   4101 C  CG2 . VAL A 1 518 ? 11.143  -6.312  30.064  1.00 21.17  ? 518 VAL A CG2 1 
ATOM   4102 N  N   . GLN A 1 519 ? 7.209   -6.874  30.050  1.00 36.75  ? 519 GLN A N   1 
ATOM   4103 C  CA  . GLN A 1 519 ? 6.344   -6.295  29.027  1.00 33.03  ? 519 GLN A CA  1 
ATOM   4104 C  C   . GLN A 1 519 ? 5.449   -5.210  29.610  1.00 24.41  ? 519 GLN A C   1 
ATOM   4105 O  O   . GLN A 1 519 ? 5.453   -4.072  29.125  1.00 26.65  ? 519 GLN A O   1 
ATOM   4106 C  CB  . GLN A 1 519 ? 5.513   -7.373  28.341  1.00 35.54  ? 519 GLN A CB  1 
ATOM   4107 C  CG  . GLN A 1 519 ? 4.853   -6.862  27.070  1.00 40.47  ? 519 GLN A CG  1 
ATOM   4108 C  CD  . GLN A 1 519 ? 5.811   -6.792  25.901  1.00 41.82  ? 519 GLN A CD  1 
ATOM   4109 O  OE1 . GLN A 1 519 ? 6.815   -7.501  25.858  1.00 45.51  ? 519 GLN A OE1 1 
ATOM   4110 N  NE2 . GLN A 1 519 ? 5.520   -5.904  24.958  1.00 46.13  ? 519 GLN A NE2 1 
ATOM   4111 N  N   . MET A 1 520 ? 4.709   -5.520  30.678  1.00 19.86  ? 520 MET A N   1 
ATOM   4112 C  CA  . MET A 1 520 ? 3.892   -4.475  31.292  1.00 26.08  ? 520 MET A CA  1 
ATOM   4113 C  C   . MET A 1 520 ? 4.744   -3.399  31.957  1.00 20.58  ? 520 MET A C   1 
ATOM   4114 O  O   . MET A 1 520 ? 4.309   -2.246  32.054  1.00 21.94  ? 520 MET A O   1 
ATOM   4115 C  CB  . MET A 1 520 ? 2.895   -5.051  32.308  1.00 26.86  ? 520 MET A CB  1 
ATOM   4116 C  CG  . MET A 1 520 ? 2.097   -6.279  31.839  1.00 40.52  ? 520 MET A CG  1 
ATOM   4117 S  SD  . MET A 1 520 ? 1.198   -6.143  30.259  1.00 51.58  ? 520 MET A SD  1 
ATOM   4118 C  CE  . MET A 1 520 ? 0.621   -4.482  30.338  1.00 44.38  ? 520 MET A CE  1 
ATOM   4119 N  N   . CYS A 1 521 ? 5.959   -3.730  32.396  1.00 18.84  ? 521 CYS A N   1 
ATOM   4120 C  CA  . CYS A 1 521 ? 6.748   -2.711  33.080  1.00 23.69  ? 521 CYS A CA  1 
ATOM   4121 C  C   . CYS A 1 521 ? 7.376   -1.717  32.112  1.00 22.08  ? 521 CYS A C   1 
ATOM   4122 O  O   . CYS A 1 521 ? 7.548   -0.547  32.470  1.00 19.53  ? 521 CYS A O   1 
ATOM   4123 C  CB  . CYS A 1 521 ? 7.787   -3.379  33.988  1.00 31.51  ? 521 CYS A CB  1 
ATOM   4124 S  SG  . CYS A 1 521 ? 6.948   -4.125  35.488  1.00 48.95  ? 521 CYS A SG  1 
ATOM   4125 N  N   . VAL A 1 522 ? 7.696   -2.133  30.882  1.00 30.83  ? 522 VAL A N   1 
ATOM   4126 C  CA  . VAL A 1 522 ? 8.035   -1.149  29.853  1.00 28.16  ? 522 VAL A CA  1 
ATOM   4127 C  C   . VAL A 1 522 ? 6.890   -0.160  29.663  1.00 27.42  ? 522 VAL A C   1 
ATOM   4128 O  O   . VAL A 1 522 ? 7.092   1.062   29.658  1.00 32.68  ? 522 VAL A O   1 
ATOM   4129 C  CB  . VAL A 1 522 ? 8.386   -1.830  28.522  1.00 36.40  ? 522 VAL A CB  1 
ATOM   4130 C  CG1 . VAL A 1 522 ? 8.620   -0.753  27.461  1.00 21.32  ? 522 VAL A CG1 1 
ATOM   4131 C  CG2 . VAL A 1 522 ? 9.615   -2.716  28.673  1.00 43.47  ? 522 VAL A CG2 1 
ATOM   4132 N  N   . PHE A 1 523 ? 5.669   -0.674  29.495  1.00 20.56  ? 523 PHE A N   1 
ATOM   4133 C  CA  . PHE A 1 523 ? 4.496   0.193   29.460  1.00 24.87  ? 523 PHE A CA  1 
ATOM   4134 C  C   . PHE A 1 523 ? 4.480   1.162   30.640  1.00 24.59  ? 523 PHE A C   1 
ATOM   4135 O  O   . PHE A 1 523 ? 4.352   2.379   30.463  1.00 19.18  ? 523 PHE A O   1 
ATOM   4136 C  CB  . PHE A 1 523 ? 3.221   -0.654  29.459  1.00 29.93  ? 523 PHE A CB  1 
ATOM   4137 C  CG  . PHE A 1 523 ? 1.977   0.147   29.683  1.00 34.94  ? 523 PHE A CG  1 
ATOM   4138 C  CD1 . PHE A 1 523 ? 1.528   1.050   28.727  1.00 26.83  ? 523 PHE A CD1 1 
ATOM   4139 C  CD2 . PHE A 1 523 ? 1.289   0.043   30.891  1.00 38.87  ? 523 PHE A CD2 1 
ATOM   4140 C  CE1 . PHE A 1 523 ? 0.396   1.803   28.969  1.00 36.74  ? 523 PHE A CE1 1 
ATOM   4141 C  CE2 . PHE A 1 523 ? 0.164   0.789   31.140  1.00 35.47  ? 523 PHE A CE2 1 
ATOM   4142 C  CZ  . PHE A 1 523 ? -0.288  1.673   30.187  1.00 41.79  ? 523 PHE A CZ  1 
ATOM   4143 N  N   . TRP A 1 524 ? 4.633   0.632   31.857  1.00 19.21  ? 524 TRP A N   1 
ATOM   4144 C  CA  . TRP A 1 524 ? 4.434   1.438   33.054  1.00 23.39  ? 524 TRP A CA  1 
ATOM   4145 C  C   . TRP A 1 524 ? 5.631   2.322   33.399  1.00 34.41  ? 524 TRP A C   1 
ATOM   4146 O  O   . TRP A 1 524 ? 5.442   3.415   33.947  1.00 42.92  ? 524 TRP A O   1 
ATOM   4147 C  CB  . TRP A 1 524 ? 4.109   0.535   34.243  1.00 23.04  ? 524 TRP A CB  1 
ATOM   4148 C  CG  . TRP A 1 524 ? 2.718   -0.015  34.239  1.00 28.20  ? 524 TRP A CG  1 
ATOM   4149 C  CD1 . TRP A 1 524 ? 2.351   -1.321  34.069  1.00 26.53  ? 524 TRP A CD1 1 
ATOM   4150 C  CD2 . TRP A 1 524 ? 1.502   0.719   34.437  1.00 29.60  ? 524 TRP A CD2 1 
ATOM   4151 N  NE1 . TRP A 1 524 ? 0.984   -1.443  34.136  1.00 19.74  ? 524 TRP A NE1 1 
ATOM   4152 C  CE2 . TRP A 1 524 ? 0.441   -0.206  34.361  1.00 22.14  ? 524 TRP A CE2 1 
ATOM   4153 C  CE3 . TRP A 1 524 ? 1.209   2.069   34.660  1.00 31.48  ? 524 TRP A CE3 1 
ATOM   4154 C  CZ2 . TRP A 1 524 ? -0.884  0.175   34.505  1.00 17.50  ? 524 TRP A CZ2 1 
ATOM   4155 C  CZ3 . TRP A 1 524 ? -0.105  2.445   34.803  1.00 17.25  ? 524 TRP A CZ3 1 
ATOM   4156 C  CH2 . TRP A 1 524 ? -1.135  1.502   34.721  1.00 17.37  ? 524 TRP A CH2 1 
ATOM   4157 N  N   . ASN A 1 525 ? 6.860   1.880   33.130  1.00 32.72  ? 525 ASN A N   1 
ATOM   4158 C  CA  . ASN A 1 525 ? 8.007   2.667   33.567  1.00 30.70  ? 525 ASN A CA  1 
ATOM   4159 C  C   . ASN A 1 525 ? 8.500   3.625   32.492  1.00 34.77  ? 525 ASN A C   1 
ATOM   4160 O  O   . ASN A 1 525 ? 9.008   4.706   32.827  1.00 33.23  ? 525 ASN A O   1 
ATOM   4161 C  CB  . ASN A 1 525 ? 9.162   1.758   34.011  1.00 26.61  ? 525 ASN A CB  1 
ATOM   4162 C  CG  . ASN A 1 525 ? 8.769   0.801   35.131  1.00 31.91  ? 525 ASN A CG  1 
ATOM   4163 O  OD1 . ASN A 1 525 ? 7.901   1.109   35.959  1.00 40.60  ? 525 ASN A OD1 1 
ATOM   4164 N  ND2 . ASN A 1 525 ? 9.405   -0.374  35.155  1.00 29.61  ? 525 ASN A ND2 1 
ATOM   4165 N  N   . GLN A 1 526 ? 8.355   3.271   31.211  1.00 30.80  ? 526 GLN A N   1 
ATOM   4166 C  CA  . GLN A 1 526 ? 8.810   4.143   30.130  1.00 32.58  ? 526 GLN A CA  1 
ATOM   4167 C  C   . GLN A 1 526 ? 7.685   4.764   29.311  1.00 33.23  ? 526 GLN A C   1 
ATOM   4168 O  O   . GLN A 1 526 ? 7.692   5.984   29.122  1.00 34.84  ? 526 GLN A O   1 
ATOM   4169 C  CB  . GLN A 1 526 ? 9.782   3.397   29.199  1.00 34.05  ? 526 GLN A CB  1 
ATOM   4170 C  CG  . GLN A 1 526 ? 11.032  2.943   29.923  1.00 50.09  ? 526 GLN A CG  1 
ATOM   4171 C  CD  . GLN A 1 526 ? 11.960  2.106   29.069  1.00 63.16  ? 526 GLN A CD  1 
ATOM   4172 O  OE1 . GLN A 1 526 ? 12.774  1.343   29.594  1.00 66.00  ? 526 GLN A OE1 1 
ATOM   4173 N  NE2 . GLN A 1 526 ? 11.863  2.262   27.746  1.00 73.03  ? 526 GLN A NE2 1 
ATOM   4174 N  N   . PHE A 1 527 ? 6.705   3.983   28.823  1.00 30.49  ? 527 PHE A N   1 
ATOM   4175 C  CA  . PHE A 1 527 ? 5.756   4.541   27.855  1.00 30.72  ? 527 PHE A CA  1 
ATOM   4176 C  C   . PHE A 1 527 ? 4.740   5.502   28.464  1.00 30.19  ? 527 PHE A C   1 
ATOM   4177 O  O   . PHE A 1 527 ? 4.713   6.682   28.104  1.00 20.69  ? 527 PHE A O   1 
ATOM   4178 C  CB  . PHE A 1 527 ? 4.981   3.453   27.105  1.00 32.33  ? 527 PHE A CB  1 
ATOM   4179 C  CG  . PHE A 1 527 ? 4.048   4.016   26.057  1.00 33.25  ? 527 PHE A CG  1 
ATOM   4180 C  CD1 . PHE A 1 527 ? 4.536   4.836   25.060  1.00 22.22  ? 527 PHE A CD1 1 
ATOM   4181 C  CD2 . PHE A 1 527 ? 2.684   3.790   26.114  1.00 32.83  ? 527 PHE A CD2 1 
ATOM   4182 C  CE1 . PHE A 1 527 ? 3.697   5.382   24.139  1.00 36.75  ? 527 PHE A CE1 1 
ATOM   4183 C  CE2 . PHE A 1 527 ? 1.840   4.329   25.178  1.00 21.98  ? 527 PHE A CE2 1 
ATOM   4184 C  CZ  . PHE A 1 527 ? 2.337   5.129   24.200  1.00 22.63  ? 527 PHE A CZ  1 
ATOM   4185 N  N   . LEU A 1 528 ? 3.869   5.010   29.348  1.00 29.89  ? 528 LEU A N   1 
ATOM   4186 C  CA  . LEU A 1 528 ? 2.847   5.893   29.903  1.00 28.66  ? 528 LEU A CA  1 
ATOM   4187 C  C   . LEU A 1 528 ? 3.442   7.128   30.561  1.00 26.71  ? 528 LEU A C   1 
ATOM   4188 O  O   . LEU A 1 528 ? 2.872   8.218   30.380  1.00 29.61  ? 528 LEU A O   1 
ATOM   4189 C  CB  . LEU A 1 528 ? 1.940   5.134   30.884  1.00 31.70  ? 528 LEU A CB  1 
ATOM   4190 C  CG  . LEU A 1 528 ? 0.737   5.935   31.409  1.00 28.73  ? 528 LEU A CG  1 
ATOM   4191 C  CD1 . LEU A 1 528 ? -0.173  6.379   30.289  1.00 27.37  ? 528 LEU A CD1 1 
ATOM   4192 C  CD2 . LEU A 1 528 ? -0.060  5.116   32.385  1.00 33.37  ? 528 LEU A CD2 1 
ATOM   4193 N  N   . PRO A 1 529 ? 4.554   7.049   31.302  1.00 26.37  ? 529 PRO A N   1 
ATOM   4194 C  CA  . PRO A 1 529 ? 5.219   8.290   31.743  1.00 22.31  ? 529 PRO A CA  1 
ATOM   4195 C  C   . PRO A 1 529 ? 5.434   9.275   30.615  1.00 20.55  ? 529 PRO A C   1 
ATOM   4196 O  O   . PRO A 1 529 ? 5.131   10.471  30.757  1.00 21.55  ? 529 PRO A O   1 
ATOM   4197 C  CB  . PRO A 1 529 ? 6.547   7.776   32.300  1.00 28.05  ? 529 PRO A CB  1 
ATOM   4198 C  CG  . PRO A 1 529 ? 6.237   6.410   32.786  1.00 22.45  ? 529 PRO A CG  1 
ATOM   4199 C  CD  . PRO A 1 529 ? 5.216   5.849   31.849  1.00 23.17  ? 529 PRO A CD  1 
ATOM   4200 N  N   . LYS A 1 530 ? 5.936   8.772   29.481  1.00 33.17  ? 530 LYS A N   1 
ATOM   4201 C  CA  . LYS A 1 530 ? 6.148   9.572   28.276  1.00 35.72  ? 530 LYS A CA  1 
ATOM   4202 C  C   . LYS A 1 530 ? 4.835   10.132  27.744  1.00 39.23  ? 530 LYS A C   1 
ATOM   4203 O  O   . LYS A 1 530 ? 4.750   11.319  27.414  1.00 43.50  ? 530 LYS A O   1 
ATOM   4204 C  CB  . LYS A 1 530 ? 6.841   8.698   27.222  1.00 36.94  ? 530 LYS A CB  1 
ATOM   4205 C  CG  . LYS A 1 530 ? 8.014   9.283   26.452  1.00 46.10  ? 530 LYS A CG  1 
ATOM   4206 C  CD  . LYS A 1 530 ? 7.580   9.680   25.039  1.00 63.56  ? 530 LYS A CD  1 
ATOM   4207 C  CE  . LYS A 1 530 ? 8.767   10.014  24.124  1.00 64.59  ? 530 LYS A CE  1 
ATOM   4208 N  NZ  . LYS A 1 530 ? 8.347   10.738  22.889  1.00 71.66  ? 530 LYS A NZ  1 
ATOM   4209 N  N   . LEU A 1 531 ? 3.795   9.298   27.669  1.00 47.33  ? 531 LEU A N   1 
ATOM   4210 C  CA  . LEU A 1 531 ? 2.495   9.766   27.196  1.00 52.43  ? 531 LEU A CA  1 
ATOM   4211 C  C   . LEU A 1 531 ? 1.991   10.927  28.047  1.00 43.83  ? 531 LEU A C   1 
ATOM   4212 O  O   . LEU A 1 531 ? 1.608   11.980  27.523  1.00 43.97  ? 531 LEU A O   1 
ATOM   4213 C  CB  . LEU A 1 531 ? 1.485   8.608   27.193  1.00 52.37  ? 531 LEU A CB  1 
ATOM   4214 C  CG  . LEU A 1 531 ? 0.164   8.770   26.425  1.00 49.12  ? 531 LEU A CG  1 
ATOM   4215 C  CD1 . LEU A 1 531 ? -0.288  7.438   25.868  1.00 57.83  ? 531 LEU A CD1 1 
ATOM   4216 C  CD2 . LEU A 1 531 ? -0.914  9.335   27.309  1.00 35.62  ? 531 LEU A CD2 1 
ATOM   4217 N  N   . LEU A 1 532 ? 2.019   10.761  29.367  1.00 37.45  ? 532 LEU A N   1 
ATOM   4218 C  CA  . LEU A 1 532 ? 1.432   11.767  30.244  1.00 42.06  ? 532 LEU A CA  1 
ATOM   4219 C  C   . LEU A 1 532 ? 2.258   13.045  30.263  1.00 42.11  ? 532 LEU A C   1 
ATOM   4220 O  O   . LEU A 1 532 ? 1.691   14.147  30.309  1.00 46.46  ? 532 LEU A O   1 
ATOM   4221 C  CB  . LEU A 1 532 ? 1.266   11.202  31.649  1.00 36.71  ? 532 LEU A CB  1 
ATOM   4222 C  CG  . LEU A 1 532 ? 0.210   10.097  31.633  1.00 34.22  ? 532 LEU A CG  1 
ATOM   4223 C  CD1 . LEU A 1 532 ? 0.249   9.282   32.911  1.00 39.81  ? 532 LEU A CD1 1 
ATOM   4224 C  CD2 . LEU A 1 532 ? -1.168  10.690  31.405  1.00 26.29  ? 532 LEU A CD2 1 
ATOM   4225 N  N   . ASN A 1 533 ? 3.589   12.932  30.220  1.00 27.66  ? 533 ASN A N   1 
ATOM   4226 C  CA  . ASN A 1 533 ? 4.400   14.142  30.130  1.00 40.33  ? 533 ASN A CA  1 
ATOM   4227 C  C   . ASN A 1 533 ? 4.013   14.967  28.905  1.00 46.21  ? 533 ASN A C   1 
ATOM   4228 O  O   . ASN A 1 533 ? 3.760   16.173  29.009  1.00 51.12  ? 533 ASN A O   1 
ATOM   4229 C  CB  . ASN A 1 533 ? 5.887   13.794  30.097  1.00 47.30  ? 533 ASN A CB  1 
ATOM   4230 C  CG  . ASN A 1 533 ? 6.774   15.030  30.119  1.00 54.12  ? 533 ASN A CG  1 
ATOM   4231 O  OD1 . ASN A 1 533 ? 7.020   15.609  31.181  1.00 53.09  ? 533 ASN A OD1 1 
ATOM   4232 N  ND2 . ASN A 1 533 ? 7.260   15.440  28.947  1.00 58.72  ? 533 ASN A ND2 1 
ATOM   4233 N  N   . ALA A 1 534 ? 3.918   14.321  27.742  1.00 37.48  ? 534 ALA A N   1 
ATOM   4234 C  CA  . ALA A 1 534 ? 3.688   15.041  26.497  1.00 37.59  ? 534 ALA A CA  1 
ATOM   4235 C  C   . ALA A 1 534 ? 2.226   15.394  26.247  1.00 43.69  ? 534 ALA A C   1 
ATOM   4236 O  O   . ALA A 1 534 ? 1.936   16.047  25.236  1.00 51.56  ? 534 ALA A O   1 
ATOM   4237 C  CB  . ALA A 1 534 ? 4.210   14.223  25.318  1.00 38.47  ? 534 ALA A CB  1 
ATOM   4238 N  N   . THR A 1 535 ? 1.306   14.985  27.117  1.00 40.85  ? 535 THR A N   1 
ATOM   4239 C  CA  . THR A 1 535 ? -0.122  15.239  26.890  1.00 55.11  ? 535 THR A CA  1 
ATOM   4240 C  C   . THR A 1 535 ? -0.807  15.786  28.145  1.00 58.18  ? 535 THR A C   1 
ATOM   4241 O  O   . THR A 1 535 ? -1.893  16.370  28.083  1.00 54.99  ? 535 THR A O   1 
ATOM   4242 C  CB  . THR A 1 535 ? -0.870  13.952  26.424  1.00 63.82  ? 535 THR A CB  1 
ATOM   4243 O  OG1 . THR A 1 535 ? -0.633  12.884  27.347  1.00 70.48  ? 535 THR A OG1 1 
ATOM   4244 C  CG2 . THR A 1 535 ? -0.399  13.517  25.047  1.00 64.82  ? 535 THR A CG2 1 
ATOM   4245 N  N   . SER B 1 4   ? -22.664 -13.677 -36.966 1.00 51.51  ? 4   SER B N   1 
ATOM   4246 C  CA  . SER B 1 4   ? -21.297 -13.747 -36.464 1.00 58.83  ? 4   SER B CA  1 
ATOM   4247 C  C   . SER B 1 4   ? -21.200 -13.440 -34.972 1.00 64.08  ? 4   SER B C   1 
ATOM   4248 O  O   . SER B 1 4   ? -21.846 -12.528 -34.453 1.00 64.29  ? 4   SER B O   1 
ATOM   4249 C  CB  . SER B 1 4   ? -20.381 -12.794 -37.235 1.00 62.84  ? 4   SER B CB  1 
ATOM   4250 O  OG  . SER B 1 4   ? -19.018 -13.034 -36.915 1.00 59.58  ? 4   SER B OG  1 
ATOM   4251 N  N   . GLU B 1 5   ? -20.345 -14.209 -34.306 1.00 61.93  ? 5   GLU B N   1 
ATOM   4252 C  CA  . GLU B 1 5   ? -20.164 -14.184 -32.863 1.00 46.54  ? 5   GLU B CA  1 
ATOM   4253 C  C   . GLU B 1 5   ? -19.041 -13.246 -32.438 1.00 40.77  ? 5   GLU B C   1 
ATOM   4254 O  O   . GLU B 1 5   ? -19.141 -12.589 -31.396 1.00 41.86  ? 5   GLU B O   1 
ATOM   4255 C  CB  . GLU B 1 5   ? -19.881 -15.608 -32.378 1.00 47.01  ? 5   GLU B CB  1 
ATOM   4256 C  CG  . GLU B 1 5   ? -20.053 -15.854 -30.890 1.00 55.51  ? 5   GLU B CG  1 
ATOM   4257 C  CD  . GLU B 1 5   ? -19.487 -17.203 -30.474 1.00 56.80  ? 5   GLU B CD  1 
ATOM   4258 O  OE1 . GLU B 1 5   ? -18.569 -17.697 -31.162 1.00 72.69  ? 5   GLU B OE1 1 
ATOM   4259 O  OE2 . GLU B 1 5   ? -19.961 -17.780 -29.480 1.00 45.91  ? 5   GLU B OE2 1 
ATOM   4260 N  N   . LEU B 1 6   ? -17.969 -13.178 -33.223 1.00 41.69  ? 6   LEU B N   1 
ATOM   4261 C  CA  . LEU B 1 6   ? -16.821 -12.332 -32.930 1.00 42.93  ? 6   LEU B CA  1 
ATOM   4262 C  C   . LEU B 1 6   ? -16.956 -10.933 -33.500 1.00 40.58  ? 6   LEU B C   1 
ATOM   4263 O  O   . LEU B 1 6   ? -15.983 -10.177 -33.469 1.00 44.31  ? 6   LEU B O   1 
ATOM   4264 C  CB  . LEU B 1 6   ? -15.529 -12.956 -33.475 1.00 50.96  ? 6   LEU B CB  1 
ATOM   4265 C  CG  . LEU B 1 6   ? -15.310 -14.467 -33.388 1.00 56.19  ? 6   LEU B CG  1 
ATOM   4266 C  CD1 . LEU B 1 6   ? -14.260 -14.922 -34.382 1.00 45.34  ? 6   LEU B CD1 1 
ATOM   4267 C  CD2 . LEU B 1 6   ? -14.878 -14.844 -31.993 1.00 65.64  ? 6   LEU B CD2 1 
ATOM   4268 N  N   . LEU B 1 7   ? -18.110 -10.583 -34.054 1.00 37.97  ? 7   LEU B N   1 
ATOM   4269 C  CA  . LEU B 1 7   ? -18.344 -9.250  -34.591 1.00 49.89  ? 7   LEU B CA  1 
ATOM   4270 C  C   . LEU B 1 7   ? -19.557 -8.648  -33.901 1.00 57.95  ? 7   LEU B C   1 
ATOM   4271 O  O   . LEU B 1 7   ? -20.634 -9.259  -33.880 1.00 69.58  ? 7   LEU B O   1 
ATOM   4272 C  CB  . LEU B 1 7   ? -18.542 -9.278  -36.109 1.00 60.62  ? 7   LEU B CB  1 
ATOM   4273 C  CG  . LEU B 1 7   ? -18.721 -7.892  -36.752 1.00 64.89  ? 7   LEU B CG  1 
ATOM   4274 C  CD1 . LEU B 1 7   ? -17.923 -7.801  -38.038 1.00 65.40  ? 7   LEU B CD1 1 
ATOM   4275 C  CD2 . LEU B 1 7   ? -20.192 -7.554  -37.020 1.00 65.01  ? 7   LEU B CD2 1 
ATOM   4276 N  N   . VAL B 1 8   ? -19.375 -7.455  -33.337 1.00 49.76  ? 8   VAL B N   1 
ATOM   4277 C  CA  . VAL B 1 8   ? -20.321 -6.849  -32.401 1.00 45.19  ? 8   VAL B CA  1 
ATOM   4278 C  C   . VAL B 1 8   ? -20.414 -5.364  -32.717 1.00 33.56  ? 8   VAL B C   1 
ATOM   4279 O  O   . VAL B 1 8   ? -19.396 -4.710  -32.957 1.00 39.51  ? 8   VAL B O   1 
ATOM   4280 C  CB  . VAL B 1 8   ? -19.875 -7.074  -30.935 1.00 42.28  ? 8   VAL B CB  1 
ATOM   4281 C  CG1 . VAL B 1 8   ? -20.808 -6.373  -29.977 1.00 47.03  ? 8   VAL B CG1 1 
ATOM   4282 C  CG2 . VAL B 1 8   ? -19.800 -8.562  -30.610 1.00 31.78  ? 8   VAL B CG2 1 
ATOM   4283 N  N   . ASN B 1 9   ? -21.619 -4.820  -32.724 1.00 26.48  ? 9   ASN B N   1 
ATOM   4284 C  CA  A ASN B 1 9   ? -21.816 -3.415  -33.085 0.55 36.84  ? 9   ASN B CA  1 
ATOM   4285 C  CA  B ASN B 1 9   ? -21.836 -3.425  -33.092 0.45 36.66  ? 9   ASN B CA  1 
ATOM   4286 C  C   . ASN B 1 9   ? -22.164 -2.649  -31.821 1.00 40.15  ? 9   ASN B C   1 
ATOM   4287 O  O   . ASN B 1 9   ? -23.283 -2.740  -31.311 1.00 50.30  ? 9   ASN B O   1 
ATOM   4288 C  CB  A ASN B 1 9   ? -22.893 -3.232  -34.148 0.55 37.42  ? 9   ASN B CB  1 
ATOM   4289 C  CB  B ASN B 1 9   ? -22.946 -3.314  -34.135 0.45 37.44  ? 9   ASN B CB  1 
ATOM   4290 C  CG  A ASN B 1 9   ? -22.941 -1.807  -34.683 0.55 34.72  ? 9   ASN B CG  1 
ATOM   4291 C  CG  B ASN B 1 9   ? -23.259 -4.654  -34.810 0.45 36.59  ? 9   ASN B CG  1 
ATOM   4292 O  OD1 A ASN B 1 9   ? -21.904 -1.172  -34.880 0.55 28.61  ? 9   ASN B OD1 1 
ATOM   4293 O  OD1 B ASN B 1 9   ? -23.449 -5.677  -34.144 0.45 34.25  ? 9   ASN B OD1 1 
ATOM   4294 N  ND2 A ASN B 1 9   ? -24.149 -1.295  -34.908 0.55 29.42  ? 9   ASN B ND2 1 
ATOM   4295 N  ND2 B ASN B 1 9   ? -23.299 -4.648  -36.136 0.45 29.57  ? 9   ASN B ND2 1 
ATOM   4296 N  N   . THR B 1 10  ? -21.194 -1.890  -31.322 1.00 36.19  ? 10  THR B N   1 
ATOM   4297 C  CA  . THR B 1 10  ? -21.368 -1.097  -30.119 1.00 25.19  ? 10  THR B CA  1 
ATOM   4298 C  C   . THR B 1 10  ? -21.870 0.299   -30.478 1.00 28.72  ? 10  THR B C   1 
ATOM   4299 O  O   . THR B 1 10  ? -22.017 0.650   -31.651 1.00 26.77  ? 10  THR B O   1 
ATOM   4300 C  CB  . THR B 1 10  ? -20.057 -1.009  -29.348 1.00 34.62  ? 10  THR B CB  1 
ATOM   4301 O  OG1 . THR B 1 10  ? -19.294 0.096   -29.840 1.00 36.54  ? 10  THR B OG1 1 
ATOM   4302 C  CG2 . THR B 1 10  ? -19.259 -2.287  -29.525 1.00 23.97  ? 10  THR B CG2 1 
ATOM   4303 N  N   . LYS B 1 11  ? -22.126 1.115   -29.448 1.00 28.22  ? 11  LYS B N   1 
ATOM   4304 C  CA  . LYS B 1 11  ? -22.666 2.457   -29.659 1.00 35.99  ? 11  LYS B CA  1 
ATOM   4305 C  C   . LYS B 1 11  ? -21.642 3.414   -30.235 1.00 42.23  ? 11  LYS B C   1 
ATOM   4306 O  O   . LYS B 1 11  ? -22.007 4.531   -30.618 1.00 42.29  ? 11  LYS B O   1 
ATOM   4307 C  CB  . LYS B 1 11  ? -23.196 3.052   -28.353 1.00 43.80  ? 11  LYS B CB  1 
ATOM   4308 C  CG  . LYS B 1 11  ? -24.112 2.144   -27.558 1.00 48.37  ? 11  LYS B CG  1 
ATOM   4309 C  CD  . LYS B 1 11  ? -25.443 2.812   -27.302 1.00 50.73  ? 11  LYS B CD  1 
ATOM   4310 C  CE  . LYS B 1 11  ? -26.450 1.751   -27.060 1.00 55.67  ? 11  LYS B CE  1 
ATOM   4311 N  NZ  . LYS B 1 11  ? -26.283 0.788   -28.166 1.00 64.18  ? 11  LYS B NZ  1 
ATOM   4312 N  N   . SER B 1 12  ? -20.377 3.011   -30.280 1.00 45.69  ? 12  SER B N   1 
ATOM   4313 C  CA  . SER B 1 12  ? -19.306 3.847   -30.785 1.00 47.20  ? 12  SER B CA  1 
ATOM   4314 C  C   . SER B 1 12  ? -18.709 3.329   -32.087 1.00 38.80  ? 12  SER B C   1 
ATOM   4315 O  O   . SER B 1 12  ? -17.957 4.063   -32.736 1.00 39.06  ? 12  SER B O   1 
ATOM   4316 C  CB  . SER B 1 12  ? -18.208 3.976   -29.720 1.00 58.33  ? 12  SER B CB  1 
ATOM   4317 O  OG  . SER B 1 12  ? -18.763 4.254   -28.440 1.00 63.50  ? 12  SER B OG  1 
ATOM   4318 N  N   . GLY B 1 13  ? -19.035 2.110   -32.492 1.00 29.69  ? 13  GLY B N   1 
ATOM   4319 C  CA  . GLY B 1 13  ? -18.512 1.547   -33.718 1.00 28.94  ? 13  GLY B CA  1 
ATOM   4320 C  C   . GLY B 1 13  ? -18.540 0.033   -33.673 1.00 30.43  ? 13  GLY B C   1 
ATOM   4321 O  O   . GLY B 1 13  ? -18.945 -0.582  -32.690 1.00 31.13  ? 13  GLY B O   1 
ATOM   4322 N  N   . LYS B 1 14  ? -18.114 -0.560  -34.773 1.00 31.13  ? 14  LYS B N   1 
ATOM   4323 C  CA  . LYS B 1 14  ? -18.104 -2.006  -34.849 1.00 27.35  ? 14  LYS B CA  1 
ATOM   4324 C  C   . LYS B 1 14  ? -16.750 -2.541  -34.407 1.00 27.93  ? 14  LYS B C   1 
ATOM   4325 O  O   . LYS B 1 14  ? -15.697 -1.964  -34.708 1.00 26.73  ? 14  LYS B O   1 
ATOM   4326 C  CB  . LYS B 1 14  ? -18.455 -2.516  -36.255 1.00 35.59  ? 14  LYS B CB  1 
ATOM   4327 C  CG  . LYS B 1 14  ? -19.456 -1.682  -37.061 1.00 37.45  ? 14  LYS B CG  1 
ATOM   4328 C  CD  . LYS B 1 14  ? -20.052 -2.531  -38.195 1.00 35.13  ? 14  LYS B CD  1 
ATOM   4329 C  CE  . LYS B 1 14  ? -20.917 -1.711  -39.155 1.00 38.01  ? 14  LYS B CE  1 
ATOM   4330 N  NZ  . LYS B 1 14  ? -20.125 -1.136  -40.283 1.00 36.31  ? 14  LYS B NZ  1 
ATOM   4331 N  N   . VAL B 1 15  ? -16.801 -3.657  -33.687 1.00 31.36  ? 15  VAL B N   1 
ATOM   4332 C  CA  . VAL B 1 15  ? -15.645 -4.330  -33.114 1.00 33.77  ? 15  VAL B CA  1 
ATOM   4333 C  C   . VAL B 1 15  ? -15.612 -5.753  -33.661 1.00 35.42  ? 15  VAL B C   1 
ATOM   4334 O  O   . VAL B 1 15  ? -16.663 -6.372  -33.879 1.00 30.97  ? 15  VAL B O   1 
ATOM   4335 C  CB  . VAL B 1 15  ? -15.719 -4.304  -31.566 1.00 33.76  ? 15  VAL B CB  1 
ATOM   4336 C  CG1 . VAL B 1 15  ? -14.982 -5.460  -30.951 1.00 40.74  ? 15  VAL B CG1 1 
ATOM   4337 C  CG2 . VAL B 1 15  ? -15.150 -2.996  -31.037 1.00 23.89  ? 15  VAL B CG2 1 
ATOM   4338 N  N   . MET B 1 16  ? -14.407 -6.257  -33.919 1.00 38.80  ? 16  MET B N   1 
ATOM   4339 C  CA  . MET B 1 16  ? -14.211 -7.646  -34.310 1.00 43.03  ? 16  MET B CA  1 
ATOM   4340 C  C   . MET B 1 16  ? -13.230 -8.280  -33.339 1.00 36.74  ? 16  MET B C   1 
ATOM   4341 O  O   . MET B 1 16  ? -12.151 -7.730  -33.093 1.00 36.61  ? 16  MET B O   1 
ATOM   4342 C  CB  . MET B 1 16  ? -13.701 -7.764  -35.745 1.00 50.51  ? 16  MET B CB  1 
ATOM   4343 C  CG  . MET B 1 16  ? -13.268 -9.157  -36.151 1.00 65.18  ? 16  MET B CG  1 
ATOM   4344 S  SD  . MET B 1 16  ? -14.628 -10.248 -36.603 1.00 74.84  ? 16  MET B SD  1 
ATOM   4345 C  CE  . MET B 1 16  ? -13.817 -11.226 -37.875 1.00 73.40  ? 16  MET B CE  1 
ATOM   4346 N  N   . GLY B 1 17  ? -13.610 -9.420  -32.784 1.00 29.28  ? 17  GLY B N   1 
ATOM   4347 C  CA  . GLY B 1 17  ? -12.849 -10.072 -31.756 1.00 23.88  ? 17  GLY B CA  1 
ATOM   4348 C  C   . GLY B 1 17  ? -12.072 -11.261 -32.267 1.00 37.41  ? 17  GLY B C   1 
ATOM   4349 O  O   . GLY B 1 17  ? -11.757 -11.369 -33.456 1.00 47.36  ? 17  GLY B O   1 
ATOM   4350 N  N   . THR B 1 18  ? -11.764 -12.169 -31.352 1.00 34.12  ? 18  THR B N   1 
ATOM   4351 C  CA  . THR B 1 18  ? -10.880 -13.281 -31.645 1.00 37.80  ? 18  THR B CA  1 
ATOM   4352 C  C   . THR B 1 18  ? -11.304 -14.495 -30.837 1.00 33.80  ? 18  THR B C   1 
ATOM   4353 O  O   . THR B 1 18  ? -11.820 -14.373 -29.721 1.00 31.96  ? 18  THR B O   1 
ATOM   4354 C  CB  . THR B 1 18  ? -9.420  -12.941 -31.326 1.00 50.39  ? 18  THR B CB  1 
ATOM   4355 O  OG1 . THR B 1 18  ? -8.635  -14.134 -31.364 1.00 53.92  ? 18  THR B OG1 1 
ATOM   4356 C  CG2 . THR B 1 18  ? -9.309  -12.314 -29.941 1.00 48.81  ? 18  THR B CG2 1 
ATOM   4357 N  N   . ARG B 1 19  ? -11.048 -15.668 -31.410 1.00 29.05  ? 19  ARG B N   1 
ATOM   4358 C  CA  . ARG B 1 19  ? -11.447 -16.959 -30.856 1.00 24.38  ? 19  ARG B CA  1 
ATOM   4359 C  C   . ARG B 1 19  ? -10.240 -17.548 -30.124 1.00 37.44  ? 19  ARG B C   1 
ATOM   4360 O  O   . ARG B 1 19  ? -9.389  -18.208 -30.722 1.00 35.24  ? 19  ARG B O   1 
ATOM   4361 C  CB  . ARG B 1 19  ? -11.938 -17.858 -31.981 1.00 26.48  ? 19  ARG B CB  1 
ATOM   4362 C  CG  . ARG B 1 19  ? -12.189 -19.288 -31.602 1.00 37.18  ? 19  ARG B CG  1 
ATOM   4363 C  CD  . ARG B 1 19  ? -13.485 -19.746 -32.200 1.00 50.73  ? 19  ARG B CD  1 
ATOM   4364 N  NE  . ARG B 1 19  ? -13.574 -21.198 -32.129 1.00 60.37  ? 19  ARG B NE  1 
ATOM   4365 C  CZ  . ARG B 1 19  ? -14.441 -21.847 -31.371 1.00 69.52  ? 19  ARG B CZ  1 
ATOM   4366 N  NH1 . ARG B 1 19  ? -14.452 -23.175 -31.384 1.00 76.74  ? 19  ARG B NH1 1 
ATOM   4367 N  NH2 . ARG B 1 19  ? -15.281 -21.153 -30.624 1.00 62.05  ? 19  ARG B NH2 1 
ATOM   4368 N  N   . VAL B 1 20  ? -10.150 -17.297 -28.820 1.00 40.75  ? 20  VAL B N   1 
ATOM   4369 C  CA  . VAL B 1 20  ? -9.011  -17.801 -28.050 1.00 38.69  ? 20  VAL B CA  1 
ATOM   4370 C  C   . VAL B 1 20  ? -9.334  -19.170 -27.461 1.00 37.17  ? 20  VAL B C   1 
ATOM   4371 O  O   . VAL B 1 20  ? -10.445 -19.401 -26.956 1.00 22.62  ? 20  VAL B O   1 
ATOM   4372 C  CB  . VAL B 1 20  ? -8.571  -16.817 -26.950 1.00 37.66  ? 20  VAL B CB  1 
ATOM   4373 C  CG1 . VAL B 1 20  ? -8.452  -15.423 -27.501 1.00 31.94  ? 20  VAL B CG1 1 
ATOM   4374 C  CG2 . VAL B 1 20  ? -9.515  -16.831 -25.776 1.00 49.77  ? 20  VAL B CG2 1 
ATOM   4375 N  N   . PRO B 1 21  ? -8.401  -20.109 -27.520 1.00 39.14  ? 21  PRO B N   1 
ATOM   4376 C  CA  . PRO B 1 21  ? -8.613  -21.397 -26.864 1.00 45.72  ? 21  PRO B CA  1 
ATOM   4377 C  C   . PRO B 1 21  ? -8.435  -21.270 -25.356 1.00 48.63  ? 21  PRO B C   1 
ATOM   4378 O  O   . PRO B 1 21  ? -7.713  -20.401 -24.855 1.00 48.77  ? 21  PRO B O   1 
ATOM   4379 C  CB  . PRO B 1 21  ? -7.530  -22.283 -27.489 1.00 38.90  ? 21  PRO B CB  1 
ATOM   4380 C  CG  . PRO B 1 21  ? -6.408  -21.315 -27.790 1.00 29.82  ? 21  PRO B CG  1 
ATOM   4381 C  CD  . PRO B 1 21  ? -7.063  -20.004 -28.134 1.00 31.05  ? 21  PRO B CD  1 
ATOM   4382 N  N   . VAL B 1 22  ? -9.117  -22.152 -24.628 1.00 41.84  ? 22  VAL B N   1 
ATOM   4383 C  CA  . VAL B 1 22  ? -9.028  -22.153 -23.174 1.00 42.00  ? 22  VAL B CA  1 
ATOM   4384 C  C   . VAL B 1 22  ? -9.340  -23.541 -22.637 1.00 47.83  ? 22  VAL B C   1 
ATOM   4385 O  O   . VAL B 1 22  ? -10.460 -24.045 -22.810 1.00 44.55  ? 22  VAL B O   1 
ATOM   4386 C  CB  . VAL B 1 22  ? -9.973  -21.103 -22.563 1.00 49.62  ? 22  VAL B CB  1 
ATOM   4387 C  CG1 . VAL B 1 22  ? -11.399 -21.264 -23.119 1.00 48.71  ? 22  VAL B CG1 1 
ATOM   4388 C  CG2 . VAL B 1 22  ? -9.946  -21.170 -21.026 1.00 50.84  ? 22  VAL B CG2 1 
ATOM   4389 N  N   . LEU B 1 23  ? -8.351  -24.164 -21.989 1.00 52.70  ? 23  LEU B N   1 
ATOM   4390 C  CA  . LEU B 1 23  ? -8.528  -25.425 -21.261 1.00 51.56  ? 23  LEU B CA  1 
ATOM   4391 C  C   . LEU B 1 23  ? -9.290  -26.455 -22.104 1.00 58.27  ? 23  LEU B C   1 
ATOM   4392 O  O   . LEU B 1 23  ? -10.361 -26.941 -21.729 1.00 61.52  ? 23  LEU B O   1 
ATOM   4393 C  CB  . LEU B 1 23  ? -9.252  -25.189 -19.928 1.00 35.63  ? 23  LEU B CB  1 
ATOM   4394 C  CG  . LEU B 1 23  ? -8.806  -24.110 -18.932 1.00 33.35  ? 23  LEU B CG  1 
ATOM   4395 C  CD1 . LEU B 1 23  ? -9.645  -24.169 -17.680 1.00 39.95  ? 23  LEU B CD1 1 
ATOM   4396 C  CD2 . LEU B 1 23  ? -7.355  -24.233 -18.545 1.00 39.69  ? 23  LEU B CD2 1 
ATOM   4397 N  N   . SER B 1 24  ? -8.732  -26.763 -23.275 1.00 55.11  ? 24  SER B N   1 
ATOM   4398 C  CA  . SER B 1 24  ? -9.333  -27.732 -24.197 1.00 59.49  ? 24  SER B CA  1 
ATOM   4399 C  C   . SER B 1 24  ? -10.742 -27.321 -24.625 1.00 50.18  ? 24  SER B C   1 
ATOM   4400 O  O   . SER B 1 24  ? -11.615 -28.163 -24.846 1.00 42.38  ? 24  SER B O   1 
ATOM   4401 C  CB  . SER B 1 24  ? -9.338  -29.141 -23.600 1.00 67.18  ? 24  SER B CB  1 
ATOM   4402 O  OG  . SER B 1 24  ? -8.044  -29.715 -23.673 1.00 76.87  ? 24  SER B OG  1 
ATOM   4403 N  N   . SER B 1 25  ? -10.964 -26.019 -24.736 1.00 47.15  ? 25  SER B N   1 
ATOM   4404 C  CA  . SER B 1 25  ? -12.129 -25.459 -25.397 1.00 47.59  ? 25  SER B CA  1 
ATOM   4405 C  C   . SER B 1 25  ? -11.725 -24.079 -25.894 1.00 48.12  ? 25  SER B C   1 
ATOM   4406 O  O   . SER B 1 25  ? -10.539 -23.736 -25.918 1.00 58.75  ? 25  SER B O   1 
ATOM   4407 C  CB  . SER B 1 25  ? -13.340 -25.421 -24.454 1.00 50.20  ? 25  SER B CB  1 
ATOM   4408 O  OG  . SER B 1 25  ? -14.522 -25.009 -25.130 1.00 46.04  ? 25  SER B OG  1 
ATOM   4409 N  N   . HIS B 1 26  ? -12.705 -23.279 -26.292 1.00 37.83  ? 26  HIS B N   1 
ATOM   4410 C  CA  . HIS B 1 26  ? -12.427 -21.926 -26.738 1.00 39.71  ? 26  HIS B CA  1 
ATOM   4411 C  C   . HIS B 1 26  ? -13.505 -20.999 -26.205 1.00 36.33  ? 26  HIS B C   1 
ATOM   4412 O  O   . HIS B 1 26  ? -14.558 -21.441 -25.741 1.00 37.82  ? 26  HIS B O   1 
ATOM   4413 C  CB  . HIS B 1 26  ? -12.362 -21.819 -28.270 1.00 49.26  ? 26  HIS B CB  1 
ATOM   4414 C  CG  . HIS B 1 26  ? -11.581 -22.915 -28.926 1.00 55.41  ? 26  HIS B CG  1 
ATOM   4415 N  ND1 . HIS B 1 26  ? -12.074 -24.195 -29.076 1.00 56.47  ? 26  HIS B ND1 1 
ATOM   4416 C  CD2 . HIS B 1 26  ? -10.340 -22.923 -29.471 1.00 56.06  ? 26  HIS B CD2 1 
ATOM   4417 C  CE1 . HIS B 1 26  ? -11.172 -24.943 -29.685 1.00 55.41  ? 26  HIS B CE1 1 
ATOM   4418 N  NE2 . HIS B 1 26  ? -10.109 -24.196 -29.932 1.00 56.69  ? 26  HIS B NE2 1 
ATOM   4419 N  N   . ILE B 1 27  ? -13.211 -19.701 -26.262 1.00 29.17  ? 27  ILE B N   1 
ATOM   4420 C  CA  . ILE B 1 27  ? -14.197 -18.644 -26.088 1.00 30.16  ? 27  ILE B CA  1 
ATOM   4421 C  C   . ILE B 1 27  ? -13.719 -17.424 -26.865 1.00 36.52  ? 27  ILE B C   1 
ATOM   4422 O  O   . ILE B 1 27  ? -12.581 -17.362 -27.339 1.00 39.62  ? 27  ILE B O   1 
ATOM   4423 C  CB  . ILE B 1 27  ? -14.429 -18.260 -24.612 1.00 30.59  ? 27  ILE B CB  1 
ATOM   4424 C  CG1 . ILE B 1 27  ? -13.091 -17.972 -23.929 1.00 35.10  ? 27  ILE B CG1 1 
ATOM   4425 C  CG2 . ILE B 1 27  ? -15.299 -19.308 -23.893 1.00 26.95  ? 27  ILE B CG2 1 
ATOM   4426 C  CD1 . ILE B 1 27  ? -13.248 -17.234 -22.633 1.00 48.13  ? 27  ILE B CD1 1 
ATOM   4427 N  N   . SER B 1 28  ? -14.593 -16.432 -26.971 1.00 28.42  ? 28  SER B N   1 
ATOM   4428 C  CA  . SER B 1 28  ? -14.331 -15.240 -27.752 1.00 22.29  ? 28  SER B CA  1 
ATOM   4429 C  C   . SER B 1 28  ? -13.881 -14.122 -26.831 1.00 21.45  ? 28  SER B C   1 
ATOM   4430 O  O   . SER B 1 28  ? -14.494 -13.890 -25.790 1.00 44.94  ? 28  SER B O   1 
ATOM   4431 C  CB  . SER B 1 28  ? -15.576 -14.823 -28.534 1.00 22.87  ? 28  SER B CB  1 
ATOM   4432 O  OG  . SER B 1 28  ? -16.757 -15.014 -27.775 1.00 39.98  ? 28  SER B OG  1 
ATOM   4433 N  N   . ALA B 1 29  ? -12.811 -13.440 -27.219 1.00 27.35  ? 29  ALA B N   1 
ATOM   4434 C  CA  . ALA B 1 29  ? -12.269 -12.301 -26.492 1.00 20.75  ? 29  ALA B CA  1 
ATOM   4435 C  C   . ALA B 1 29  ? -12.255 -11.067 -27.388 1.00 30.83  ? 29  ALA B C   1 
ATOM   4436 O  O   . ALA B 1 29  ? -12.010 -11.168 -28.594 1.00 36.37  ? 29  ALA B O   1 
ATOM   4437 C  CB  . ALA B 1 29  ? -10.858 -12.607 -26.006 1.00 20.39  ? 29  ALA B CB  1 
ATOM   4438 N  N   . PHE B 1 30  ? -12.504 -9.902  -26.799 1.00 20.69  ? 30  PHE B N   1 
ATOM   4439 C  CA  . PHE B 1 30  ? -12.458 -8.624  -27.507 1.00 26.29  ? 30  PHE B CA  1 
ATOM   4440 C  C   . PHE B 1 30  ? -11.462 -7.718  -26.789 1.00 32.84  ? 30  PHE B C   1 
ATOM   4441 O  O   . PHE B 1 30  ? -11.759 -7.198  -25.712 1.00 46.84  ? 30  PHE B O   1 
ATOM   4442 C  CB  . PHE B 1 30  ? -13.855 -8.018  -27.586 1.00 26.97  ? 30  PHE B CB  1 
ATOM   4443 C  CG  . PHE B 1 30  ? -14.858 -8.951  -28.186 1.00 42.21  ? 30  PHE B CG  1 
ATOM   4444 C  CD1 . PHE B 1 30  ? -15.215 -8.832  -29.521 1.00 42.16  ? 30  PHE B CD1 1 
ATOM   4445 C  CD2 . PHE B 1 30  ? -15.422 -9.965  -27.433 1.00 53.93  ? 30  PHE B CD2 1 
ATOM   4446 C  CE1 . PHE B 1 30  ? -16.109 -9.689  -30.091 1.00 41.38  ? 30  PHE B CE1 1 
ATOM   4447 C  CE2 . PHE B 1 30  ? -16.324 -10.828 -28.005 1.00 57.89  ? 30  PHE B CE2 1 
ATOM   4448 C  CZ  . PHE B 1 30  ? -16.669 -10.686 -29.341 1.00 46.27  ? 30  PHE B CZ  1 
ATOM   4449 N  N   . LEU B 1 31  ? -10.287 -7.519  -27.382 1.00 20.73  ? 31  LEU B N   1 
ATOM   4450 C  CA  . LEU B 1 31  ? -9.146  -6.941  -26.683 1.00 20.27  ? 31  LEU B CA  1 
ATOM   4451 C  C   . LEU B 1 31  ? -8.782  -5.567  -27.217 1.00 34.01  ? 31  LEU B C   1 
ATOM   4452 O  O   . LEU B 1 31  ? -8.872  -5.310  -28.420 1.00 44.25  ? 31  LEU B O   1 
ATOM   4453 C  CB  . LEU B 1 31  ? -7.931  -7.869  -26.757 1.00 20.28  ? 31  LEU B CB  1 
ATOM   4454 C  CG  . LEU B 1 31  ? -8.337  -9.327  -26.508 1.00 31.19  ? 31  LEU B CG  1 
ATOM   4455 C  CD1 . LEU B 1 31  ? -7.262  -10.294 -26.939 1.00 25.96  ? 31  LEU B CD1 1 
ATOM   4456 C  CD2 . LEU B 1 31  ? -8.675  -9.555  -25.046 1.00 37.63  ? 31  LEU B CD2 1 
ATOM   4457 N  N   . GLY B 1 32  ? -8.356  -4.693  -26.308 1.00 30.50  ? 32  GLY B N   1 
ATOM   4458 C  CA  . GLY B 1 32  ? -7.970  -3.347  -26.688 1.00 30.89  ? 32  GLY B CA  1 
ATOM   4459 C  C   . GLY B 1 32  ? -9.087  -2.516  -27.276 1.00 35.65  ? 32  GLY B C   1 
ATOM   4460 O  O   . GLY B 1 32  ? -8.837  -1.708  -28.176 1.00 30.24  ? 32  GLY B O   1 
ATOM   4461 N  N   . ILE B 1 33  ? -10.316 -2.691  -26.792 1.00 35.38  ? 33  ILE B N   1 
ATOM   4462 C  CA  . ILE B 1 33  ? -11.432 -1.836  -27.184 1.00 21.15  ? 33  ILE B CA  1 
ATOM   4463 C  C   . ILE B 1 33  ? -11.273 -0.447  -26.578 1.00 32.16  ? 33  ILE B C   1 
ATOM   4464 O  O   . ILE B 1 33  ? -11.187 -0.311  -25.351 1.00 20.38  ? 33  ILE B O   1 
ATOM   4465 C  CB  . ILE B 1 33  ? -12.772 -2.436  -26.764 1.00 20.97  ? 33  ILE B CB  1 
ATOM   4466 C  CG1 . ILE B 1 33  ? -12.969 -3.798  -27.431 1.00 21.27  ? 33  ILE B CG1 1 
ATOM   4467 C  CG2 . ILE B 1 33  ? -13.878 -1.444  -27.068 1.00 21.46  ? 33  ILE B CG2 1 
ATOM   4468 C  CD1 . ILE B 1 33  ? -14.384 -4.360  -27.304 1.00 21.29  ? 33  ILE B CD1 1 
ATOM   4469 N  N   . PRO B 1 34  ? -11.217 0.606   -27.387 1.00 33.58  ? 34  PRO B N   1 
ATOM   4470 C  CA  . PRO B 1 34  ? -11.156 1.961   -26.825 1.00 28.67  ? 34  PRO B CA  1 
ATOM   4471 C  C   . PRO B 1 34  ? -12.456 2.326   -26.148 1.00 32.91  ? 34  PRO B C   1 
ATOM   4472 O  O   . PRO B 1 34  ? -13.533 1.909   -26.574 1.00 43.55  ? 34  PRO B O   1 
ATOM   4473 C  CB  . PRO B 1 34  ? -10.927 2.844   -28.055 1.00 34.16  ? 34  PRO B CB  1 
ATOM   4474 C  CG  . PRO B 1 34  ? -11.491 2.038   -29.188 1.00 23.19  ? 34  PRO B CG  1 
ATOM   4475 C  CD  . PRO B 1 34  ? -11.193 0.611   -28.861 1.00 22.60  ? 34  PRO B CD  1 
ATOM   4476 N  N   . PHE B 1 35  ? -12.352 3.124   -25.087 1.00 38.79  ? 35  PHE B N   1 
ATOM   4477 C  CA  . PHE B 1 35  ? -13.534 3.689   -24.449 1.00 34.64  ? 35  PHE B CA  1 
ATOM   4478 C  C   . PHE B 1 35  ? -13.447 5.189   -24.200 1.00 32.43  ? 35  PHE B C   1 
ATOM   4479 O  O   . PHE B 1 35  ? -14.469 5.796   -23.872 1.00 38.67  ? 35  PHE B O   1 
ATOM   4480 C  CB  . PHE B 1 35  ? -13.844 2.967   -23.123 1.00 38.51  ? 35  PHE B CB  1 
ATOM   4481 C  CG  . PHE B 1 35  ? -12.763 3.096   -22.079 1.00 37.68  ? 35  PHE B CG  1 
ATOM   4482 C  CD1 . PHE B 1 35  ? -12.710 4.197   -21.241 1.00 28.47  ? 35  PHE B CD1 1 
ATOM   4483 C  CD2 . PHE B 1 35  ? -11.816 2.096   -21.921 1.00 37.31  ? 35  PHE B CD2 1 
ATOM   4484 C  CE1 . PHE B 1 35  ? -11.715 4.307   -20.296 1.00 28.77  ? 35  PHE B CE1 1 
ATOM   4485 C  CE2 . PHE B 1 35  ? -10.822 2.205   -20.970 1.00 33.63  ? 35  PHE B CE2 1 
ATOM   4486 C  CZ  . PHE B 1 35  ? -10.769 3.312   -20.161 1.00 27.49  ? 35  PHE B CZ  1 
ATOM   4487 N  N   . ALA B 1 36  ? -12.285 5.810   -24.358 1.00 31.07  ? 36  ALA B N   1 
ATOM   4488 C  CA  . ALA B 1 36  ? -12.180 7.255   -24.229 1.00 29.56  ? 36  ALA B CA  1 
ATOM   4489 C  C   . ALA B 1 36  ? -11.270 7.793   -25.324 1.00 29.42  ? 36  ALA B C   1 
ATOM   4490 O  O   . ALA B 1 36  ? -10.553 7.043   -25.995 1.00 33.33  ? 36  ALA B O   1 
ATOM   4491 C  CB  . ALA B 1 36  ? -11.656 7.662   -22.840 1.00 22.94  ? 36  ALA B CB  1 
ATOM   4492 N  N   . GLU B 1 37  ? -11.307 9.106   -25.502 1.00 28.78  ? 37  GLU B N   1 
ATOM   4493 C  CA  . GLU B 1 37  ? -10.322 9.750   -26.356 1.00 37.19  ? 37  GLU B CA  1 
ATOM   4494 C  C   . GLU B 1 37  ? -8.944  9.640   -25.713 1.00 53.08  ? 37  GLU B C   1 
ATOM   4495 O  O   . GLU B 1 37  ? -8.823  9.731   -24.484 1.00 61.28  ? 37  GLU B O   1 
ATOM   4496 C  CB  . GLU B 1 37  ? -10.669 11.221  -26.581 1.00 34.33  ? 37  GLU B CB  1 
ATOM   4497 C  CG  . GLU B 1 37  ? -11.827 11.446  -27.550 1.00 38.44  ? 37  GLU B CG  1 
ATOM   4498 C  CD  . GLU B 1 37  ? -11.527 10.932  -28.954 1.00 46.28  ? 37  GLU B CD  1 
ATOM   4499 O  OE1 . GLU B 1 37  ? -10.698 11.564  -29.665 1.00 41.82  ? 37  GLU B OE1 1 
ATOM   4500 O  OE2 . GLU B 1 37  ? -12.111 9.887   -29.334 1.00 42.28  ? 37  GLU B OE2 1 
ATOM   4501 N  N   . PRO B 1 38  ? -7.898  9.420   -26.501 1.00 55.12  ? 38  PRO B N   1 
ATOM   4502 C  CA  . PRO B 1 38  ? -6.530  9.398   -25.945 1.00 51.52  ? 38  PRO B CA  1 
ATOM   4503 C  C   . PRO B 1 38  ? -6.208  10.709  -25.250 1.00 45.57  ? 38  PRO B C   1 
ATOM   4504 O  O   . PRO B 1 38  ? -6.312  11.786  -25.856 1.00 57.68  ? 38  PRO B O   1 
ATOM   4505 C  CB  . PRO B 1 38  ? -5.645  9.189   -27.186 1.00 54.88  ? 38  PRO B CB  1 
ATOM   4506 C  CG  . PRO B 1 38  ? -6.550  8.506   -28.177 1.00 56.15  ? 38  PRO B CG  1 
ATOM   4507 C  CD  . PRO B 1 38  ? -7.936  9.055   -27.928 1.00 52.36  ? 38  PRO B CD  1 
ATOM   4508 N  N   . PRO B 1 39  ? -5.806  10.663  -23.984 1.00 36.96  ? 39  PRO B N   1 
ATOM   4509 C  CA  . PRO B 1 39  ? -5.522  11.888  -23.219 1.00 36.26  ? 39  PRO B CA  1 
ATOM   4510 C  C   . PRO B 1 39  ? -4.115  12.424  -23.452 1.00 33.11  ? 39  PRO B C   1 
ATOM   4511 O  O   . PRO B 1 39  ? -3.252  12.436  -22.582 1.00 35.83  ? 39  PRO B O   1 
ATOM   4512 C  CB  . PRO B 1 39  ? -5.743  11.434  -21.769 1.00 22.73  ? 39  PRO B CB  1 
ATOM   4513 C  CG  . PRO B 1 39  ? -5.917  9.934   -21.813 1.00 25.80  ? 39  PRO B CG  1 
ATOM   4514 C  CD  . PRO B 1 39  ? -5.582  9.465   -23.189 1.00 33.66  ? 39  PRO B CD  1 
ATOM   4515 N  N   . VAL B 1 40  ? -3.864  12.899  -24.664 1.00 37.57  ? 40  VAL B N   1 
ATOM   4516 C  CA  . VAL B 1 40  ? -2.529  13.275  -25.100 1.00 37.03  ? 40  VAL B CA  1 
ATOM   4517 C  C   . VAL B 1 40  ? -2.447  14.795  -25.243 1.00 38.75  ? 40  VAL B C   1 
ATOM   4518 O  O   . VAL B 1 40  ? -3.455  15.504  -25.230 1.00 39.71  ? 40  VAL B O   1 
ATOM   4519 C  CB  . VAL B 1 40  ? -2.154  12.591  -26.432 1.00 34.71  ? 40  VAL B CB  1 
ATOM   4520 C  CG1 . VAL B 1 40  ? -2.279  11.077  -26.299 1.00 35.44  ? 40  VAL B CG1 1 
ATOM   4521 C  CG2 . VAL B 1 40  ? -3.032  13.115  -27.546 1.00 30.34  ? 40  VAL B CG2 1 
ATOM   4522 N  N   . GLY B 1 41  ? -1.221  15.289  -25.417 1.00 40.69  ? 41  GLY B N   1 
ATOM   4523 C  CA  . GLY B 1 41  ? -0.984  16.705  -25.612 1.00 43.66  ? 41  GLY B CA  1 
ATOM   4524 C  C   . GLY B 1 41  ? -1.712  17.581  -24.616 1.00 46.06  ? 41  GLY B C   1 
ATOM   4525 O  O   . GLY B 1 41  ? -1.514  17.462  -23.400 1.00 51.77  ? 41  GLY B O   1 
ATOM   4526 N  N   . ASN B 1 42  ? -2.595  18.441  -25.116 1.00 41.54  ? 42  ASN B N   1 
ATOM   4527 C  CA  . ASN B 1 42  ? -3.339  19.310  -24.218 1.00 53.20  ? 42  ASN B CA  1 
ATOM   4528 C  C   . ASN B 1 42  ? -4.375  18.558  -23.378 1.00 48.02  ? 42  ASN B C   1 
ATOM   4529 O  O   . ASN B 1 42  ? -5.005  19.173  -22.511 1.00 47.63  ? 42  ASN B O   1 
ATOM   4530 C  CB  . ASN B 1 42  ? -3.997  20.424  -25.031 1.00 58.96  ? 42  ASN B CB  1 
ATOM   4531 C  CG  . ASN B 1 42  ? -5.073  19.903  -25.964 1.00 59.84  ? 42  ASN B CG  1 
ATOM   4532 O  OD1 . ASN B 1 42  ? -5.120  18.706  -26.263 1.00 66.08  ? 42  ASN B OD1 1 
ATOM   4533 N  ND2 . ASN B 1 42  ? -5.924  20.805  -26.459 1.00 45.86  ? 42  ASN B ND2 1 
ATOM   4534 N  N   . MET B 1 43  ? -4.561  17.257  -23.598 1.00 43.23  ? 43  MET B N   1 
ATOM   4535 C  CA  . MET B 1 43  ? -5.484  16.453  -22.800 1.00 45.46  ? 43  MET B CA  1 
ATOM   4536 C  C   . MET B 1 43  ? -4.802  15.748  -21.635 1.00 46.90  ? 43  MET B C   1 
ATOM   4537 O  O   . MET B 1 43  ? -5.477  15.054  -20.863 1.00 37.94  ? 43  MET B O   1 
ATOM   4538 C  CB  . MET B 1 43  ? -6.172  15.409  -23.678 1.00 43.50  ? 43  MET B CB  1 
ATOM   4539 C  CG  . MET B 1 43  ? -6.698  15.967  -24.961 1.00 55.27  ? 43  MET B CG  1 
ATOM   4540 S  SD  . MET B 1 43  ? -8.462  16.220  -24.866 1.00 59.99  ? 43  MET B SD  1 
ATOM   4541 C  CE  . MET B 1 43  ? -9.002  14.524  -24.602 1.00 54.48  ? 43  MET B CE  1 
ATOM   4542 N  N   . ARG B 1 44  ? -3.486  15.884  -21.506 1.00 51.12  ? 44  ARG B N   1 
ATOM   4543 C  CA  . ARG B 1 44  ? -2.803  15.299  -20.366 1.00 47.87  ? 44  ARG B CA  1 
ATOM   4544 C  C   . ARG B 1 44  ? -3.272  15.981  -19.088 1.00 40.18  ? 44  ARG B C   1 
ATOM   4545 O  O   . ARG B 1 44  ? -3.428  17.205  -19.036 1.00 32.27  ? 44  ARG B O   1 
ATOM   4546 C  CB  . ARG B 1 44  ? -1.289  15.430  -20.530 1.00 51.34  ? 44  ARG B CB  1 
ATOM   4547 C  CG  . ARG B 1 44  ? -0.478  14.651  -19.504 1.00 53.05  ? 44  ARG B CG  1 
ATOM   4548 C  CD  . ARG B 1 44  ? 0.987   15.085  -19.515 1.00 52.73  ? 44  ARG B CD  1 
ATOM   4549 N  NE  . ARG B 1 44  ? 1.804   14.371  -20.494 1.00 52.11  ? 44  ARG B NE  1 
ATOM   4550 C  CZ  . ARG B 1 44  ? 3.079   14.660  -20.748 1.00 50.25  ? 44  ARG B CZ  1 
ATOM   4551 N  NH1 . ARG B 1 44  ? 3.666   15.659  -20.107 1.00 56.66  ? 44  ARG B NH1 1 
ATOM   4552 N  NH2 . ARG B 1 44  ? 3.772   13.960  -21.641 1.00 40.38  ? 44  ARG B NH2 1 
ATOM   4553 N  N   . PHE B 1 45  ? -3.548  15.172  -18.071 1.00 39.57  ? 45  PHE B N   1 
ATOM   4554 C  CA  . PHE B 1 45  ? -4.020  15.566  -16.745 1.00 45.85  ? 45  PHE B CA  1 
ATOM   4555 C  C   . PHE B 1 45  ? -5.505  15.908  -16.696 1.00 43.54  ? 45  PHE B C   1 
ATOM   4556 O  O   . PHE B 1 45  ? -5.988  16.256  -15.618 1.00 35.55  ? 45  PHE B O   1 
ATOM   4557 C  CB  . PHE B 1 45  ? -3.250  16.766  -16.170 1.00 48.79  ? 45  PHE B CB  1 
ATOM   4558 C  CG  . PHE B 1 45  ? -1.761  16.587  -16.170 1.00 44.30  ? 45  PHE B CG  1 
ATOM   4559 C  CD1 . PHE B 1 45  ? -1.198  15.395  -15.756 1.00 44.87  ? 45  PHE B CD1 1 
ATOM   4560 C  CD2 . PHE B 1 45  ? -0.931  17.609  -16.597 1.00 35.22  ? 45  PHE B CD2 1 
ATOM   4561 C  CE1 . PHE B 1 45  ? 0.156   15.233  -15.759 1.00 47.38  ? 45  PHE B CE1 1 
ATOM   4562 C  CE2 . PHE B 1 45  ? 0.418   17.452  -16.608 1.00 36.47  ? 45  PHE B CE2 1 
ATOM   4563 C  CZ  . PHE B 1 45  ? 0.969   16.264  -16.188 1.00 47.58  ? 45  PHE B CZ  1 
ATOM   4564 N  N   . ARG B 1 46  ? -6.242  15.830  -17.798 1.00 48.11  ? 46  ARG B N   1 
ATOM   4565 C  CA  . ARG B 1 46  ? -7.612  16.323  -17.818 1.00 38.71  ? 46  ARG B CA  1 
ATOM   4566 C  C   . ARG B 1 46  ? -8.621  15.186  -17.757 1.00 33.73  ? 46  ARG B C   1 
ATOM   4567 O  O   . ARG B 1 46  ? -8.304  14.012  -17.970 1.00 22.78  ? 46  ARG B O   1 
ATOM   4568 C  CB  . ARG B 1 46  ? -7.883  17.177  -19.058 1.00 39.26  ? 46  ARG B CB  1 
ATOM   4569 C  CG  . ARG B 1 46  ? -7.379  18.593  -18.910 1.00 51.39  ? 46  ARG B CG  1 
ATOM   4570 C  CD  . ARG B 1 46  ? -7.964  19.550  -19.927 1.00 60.73  ? 46  ARG B CD  1 
ATOM   4571 N  NE  . ARG B 1 46  ? -7.831  19.055  -21.288 1.00 75.91  ? 46  ARG B NE  1 
ATOM   4572 C  CZ  . ARG B 1 46  ? -8.828  18.527  -21.991 1.00 86.77  ? 46  ARG B CZ  1 
ATOM   4573 N  NH1 . ARG B 1 46  ? -10.047 18.428  -21.463 1.00 84.49  ? 46  ARG B NH1 1 
ATOM   4574 N  NH2 . ARG B 1 46  ? -8.603  18.105  -23.228 1.00 91.18  ? 46  ARG B NH2 1 
ATOM   4575 N  N   . ARG B 1 47  ? -9.853  15.562  -17.453 1.00 34.56  ? 47  ARG B N   1 
ATOM   4576 C  CA  . ARG B 1 47  ? -10.919 14.585  -17.350 1.00 36.55  ? 47  ARG B CA  1 
ATOM   4577 C  C   . ARG B 1 47  ? -11.052 13.874  -18.687 1.00 28.41  ? 47  ARG B C   1 
ATOM   4578 O  O   . ARG B 1 47  ? -10.976 14.525  -19.740 1.00 33.78  ? 47  ARG B O   1 
ATOM   4579 C  CB  . ARG B 1 47  ? -12.241 15.256  -16.965 1.00 50.63  ? 47  ARG B CB  1 
ATOM   4580 C  CG  . ARG B 1 47  ? -12.248 15.839  -15.552 1.00 56.47  ? 47  ARG B CG  1 
ATOM   4581 C  CD  . ARG B 1 47  ? -13.544 16.580  -15.257 1.00 61.21  ? 47  ARG B CD  1 
ATOM   4582 N  NE  . ARG B 1 47  ? -13.316 18.003  -15.004 1.00 64.62  ? 47  ARG B NE  1 
ATOM   4583 C  CZ  . ARG B 1 47  ? -13.265 18.555  -13.794 1.00 56.64  ? 47  ARG B CZ  1 
ATOM   4584 N  NH1 . ARG B 1 47  ? -13.048 19.866  -13.675 1.00 46.24  ? 47  ARG B NH1 1 
ATOM   4585 N  NH2 . ARG B 1 47  ? -13.448 17.801  -12.707 1.00 50.79  ? 47  ARG B NH2 1 
ATOM   4586 N  N   . PRO B 1 48  ? -11.238 12.560  -18.694 1.00 33.55  ? 48  PRO B N   1 
ATOM   4587 C  CA  . PRO B 1 48  ? -11.383 11.842  -19.965 1.00 32.63  ? 48  PRO B CA  1 
ATOM   4588 C  C   . PRO B 1 48  ? -12.571 12.357  -20.754 1.00 36.74  ? 48  PRO B C   1 
ATOM   4589 O  O   . PRO B 1 48  ? -13.516 12.941  -20.214 1.00 27.48  ? 48  PRO B O   1 
ATOM   4590 C  CB  . PRO B 1 48  ? -11.606 10.378  -19.546 1.00 26.16  ? 48  PRO B CB  1 
ATOM   4591 C  CG  . PRO B 1 48  ? -11.527 10.345  -18.066 1.00 37.08  ? 48  PRO B CG  1 
ATOM   4592 C  CD  . PRO B 1 48  ? -11.594 11.735  -17.533 1.00 36.52  ? 48  PRO B CD  1 
ATOM   4593 N  N   . GLU B 1 49  ? -12.500 12.134  -22.063 1.00 46.62  ? 49  GLU B N   1 
ATOM   4594 C  CA  . GLU B 1 49  ? -13.575 12.413  -22.991 1.00 39.93  ? 49  GLU B CA  1 
ATOM   4595 C  C   . GLU B 1 49  ? -13.970 11.126  -23.704 1.00 42.26  ? 49  GLU B C   1 
ATOM   4596 O  O   . GLU B 1 49  ? -13.097 10.338  -24.098 1.00 47.13  ? 49  GLU B O   1 
ATOM   4597 C  CB  . GLU B 1 49  ? -13.165 13.472  -24.008 1.00 37.84  ? 49  GLU B CB  1 
ATOM   4598 C  CG  . GLU B 1 49  ? -14.273 14.456  -24.351 1.00 60.93  ? 49  GLU B CG  1 
ATOM   4599 C  CD  . GLU B 1 49  ? -14.568 15.426  -23.213 1.00 70.22  ? 49  GLU B CD  1 
ATOM   4600 O  OE1 . GLU B 1 49  ? -15.710 15.931  -23.137 1.00 73.23  ? 49  GLU B OE1 1 
ATOM   4601 O  OE2 . GLU B 1 49  ? -13.661 15.681  -22.391 1.00 70.24  ? 49  GLU B OE2 1 
ATOM   4602 N  N   . PRO B 1 50  ? -15.270 10.872  -23.855 1.00 39.13  ? 50  PRO B N   1 
ATOM   4603 C  CA  . PRO B 1 50  ? -15.713 9.597   -24.438 1.00 40.14  ? 50  PRO B CA  1 
ATOM   4604 C  C   . PRO B 1 50  ? -15.195 9.432   -25.859 1.00 45.72  ? 50  PRO B C   1 
ATOM   4605 O  O   . PRO B 1 50  ? -15.273 10.354  -26.680 1.00 42.23  ? 50  PRO B O   1 
ATOM   4606 C  CB  . PRO B 1 50  ? -17.243 9.695   -24.422 1.00 28.50  ? 50  PRO B CB  1 
ATOM   4607 C  CG  . PRO B 1 50  ? -17.581 10.955  -23.731 1.00 24.94  ? 50  PRO B CG  1 
ATOM   4608 C  CD  . PRO B 1 50  ? -16.366 11.663  -23.279 1.00 30.30  ? 50  PRO B CD  1 
ATOM   4609 N  N   . LYS B 1 51  ? -14.655 8.246   -26.133 1.00 43.61  ? 51  LYS B N   1 
ATOM   4610 C  CA  . LYS B 1 51  ? -14.137 7.906   -27.453 1.00 44.61  ? 51  LYS B CA  1 
ATOM   4611 C  C   . LYS B 1 51  ? -15.094 8.354   -28.550 1.00 49.92  ? 51  LYS B C   1 
ATOM   4612 O  O   . LYS B 1 51  ? -16.279 8.009   -28.535 1.00 48.79  ? 51  LYS B O   1 
ATOM   4613 C  CB  . LYS B 1 51  ? -13.901 6.395   -27.530 1.00 41.28  ? 51  LYS B CB  1 
ATOM   4614 C  CG  . LYS B 1 51  ? -13.320 5.904   -28.843 1.00 39.30  ? 51  LYS B CG  1 
ATOM   4615 C  CD  . LYS B 1 51  ? -12.077 6.683   -29.208 1.00 36.87  ? 51  LYS B CD  1 
ATOM   4616 C  CE  . LYS B 1 51  ? -11.228 5.938   -30.216 1.00 33.09  ? 51  LYS B CE  1 
ATOM   4617 N  NZ  . LYS B 1 51  ? -10.089 6.791   -30.662 1.00 39.01  ? 51  LYS B NZ  1 
ATOM   4618 N  N   . LYS B 1 52  ? -14.585 9.157   -29.481 1.00 49.25  ? 52  LYS B N   1 
ATOM   4619 C  CA  . LYS B 1 52  ? -15.396 9.571   -30.614 1.00 41.33  ? 52  LYS B CA  1 
ATOM   4620 C  C   . LYS B 1 52  ? -15.688 8.360   -31.495 1.00 39.60  ? 52  LYS B C   1 
ATOM   4621 O  O   . LYS B 1 52  ? -14.820 7.498   -31.670 1.00 36.41  ? 52  LYS B O   1 
ATOM   4622 C  CB  . LYS B 1 52  ? -14.685 10.661  -31.421 1.00 40.78  ? 52  LYS B CB  1 
ATOM   4623 C  CG  . LYS B 1 52  ? -14.644 12.038  -30.745 1.00 48.81  ? 52  LYS B CG  1 
ATOM   4624 C  CD  . LYS B 1 52  ? -16.005 12.443  -30.139 1.00 60.71  ? 52  LYS B CD  1 
ATOM   4625 C  CE  . LYS B 1 52  ? -17.072 12.743  -31.211 1.00 61.90  ? 52  LYS B CE  1 
ATOM   4626 N  NZ  . LYS B 1 52  ? -18.408 13.142  -30.654 1.00 52.08  ? 52  LYS B NZ  1 
ATOM   4627 N  N   . PRO B 1 53  ? -16.891 8.260   -32.059 1.00 38.56  ? 53  PRO B N   1 
ATOM   4628 C  CA  . PRO B 1 53  ? -17.257 7.040   -32.789 1.00 39.09  ? 53  PRO B CA  1 
ATOM   4629 C  C   . PRO B 1 53  ? -16.402 6.870   -34.037 1.00 46.38  ? 53  PRO B C   1 
ATOM   4630 O  O   . PRO B 1 53  ? -16.192 7.817   -34.799 1.00 55.25  ? 53  PRO B O   1 
ATOM   4631 C  CB  . PRO B 1 53  ? -18.731 7.260   -33.147 1.00 36.48  ? 53  PRO B CB  1 
ATOM   4632 C  CG  . PRO B 1 53  ? -19.141 8.519   -32.449 1.00 43.17  ? 53  PRO B CG  1 
ATOM   4633 C  CD  . PRO B 1 53  ? -17.912 9.306   -32.188 1.00 38.54  ? 53  PRO B CD  1 
ATOM   4634 N  N   . TRP B 1 54  ? -15.914 5.651   -34.244 1.00 37.35  ? 54  TRP B N   1 
ATOM   4635 C  CA  . TRP B 1 54  ? -15.119 5.325   -35.414 1.00 34.93  ? 54  TRP B CA  1 
ATOM   4636 C  C   . TRP B 1 54  ? -15.989 4.716   -36.504 1.00 41.10  ? 54  TRP B C   1 
ATOM   4637 O  O   . TRP B 1 54  ? -17.127 4.290   -36.280 1.00 34.76  ? 54  TRP B O   1 
ATOM   4638 C  CB  . TRP B 1 54  ? -13.997 4.354   -35.060 1.00 28.24  ? 54  TRP B CB  1 
ATOM   4639 C  CG  . TRP B 1 54  ? -14.496 3.007   -34.632 1.00 41.55  ? 54  TRP B CG  1 
ATOM   4640 C  CD1 . TRP B 1 54  ? -14.764 1.934   -35.435 1.00 49.97  ? 54  TRP B CD1 1 
ATOM   4641 C  CD2 . TRP B 1 54  ? -14.773 2.581   -33.292 1.00 46.34  ? 54  TRP B CD2 1 
ATOM   4642 N  NE1 . TRP B 1 54  ? -15.198 0.866   -34.676 1.00 49.44  ? 54  TRP B NE1 1 
ATOM   4643 C  CE2 . TRP B 1 54  ? -15.207 1.238   -33.358 1.00 47.66  ? 54  TRP B CE2 1 
ATOM   4644 C  CE3 . TRP B 1 54  ? -14.692 3.203   -32.042 1.00 44.88  ? 54  TRP B CE3 1 
ATOM   4645 C  CZ2 . TRP B 1 54  ? -15.564 0.509   -32.220 1.00 46.53  ? 54  TRP B CZ2 1 
ATOM   4646 C  CZ3 . TRP B 1 54  ? -15.052 2.476   -30.913 1.00 43.09  ? 54  TRP B CZ3 1 
ATOM   4647 C  CH2 . TRP B 1 54  ? -15.484 1.144   -31.011 1.00 39.97  ? 54  TRP B CH2 1 
ATOM   4648 N  N   . SER B 1 55  ? -15.418 4.670   -37.701 1.00 45.85  ? 55  SER B N   1 
ATOM   4649 C  CA  . SER B 1 55  ? -15.998 3.987   -38.843 1.00 42.09  ? 55  SER B CA  1 
ATOM   4650 C  C   . SER B 1 55  ? -15.212 2.710   -39.110 1.00 43.21  ? 55  SER B C   1 
ATOM   4651 O  O   . SER B 1 55  ? -14.077 2.546   -38.656 1.00 50.43  ? 55  SER B O   1 
ATOM   4652 C  CB  . SER B 1 55  ? -15.994 4.897   -40.076 1.00 41.30  ? 55  SER B CB  1 
ATOM   4653 O  OG  . SER B 1 55  ? -16.579 6.156   -39.769 1.00 38.88  ? 55  SER B OG  1 
ATOM   4654 N  N   . GLY B 1 56  ? -15.829 1.794   -39.841 1.00 43.74  ? 56  GLY B N   1 
ATOM   4655 C  CA  . GLY B 1 56  ? -15.160 0.542   -40.121 1.00 39.85  ? 56  GLY B CA  1 
ATOM   4656 C  C   . GLY B 1 56  ? -15.172 -0.374  -38.914 1.00 37.27  ? 56  GLY B C   1 
ATOM   4657 O  O   . GLY B 1 56  ? -15.901 -0.170  -37.939 1.00 37.57  ? 56  GLY B O   1 
ATOM   4658 N  N   . VAL B 1 57  ? -14.342 -1.406  -38.988 1.00 43.90  ? 57  VAL B N   1 
ATOM   4659 C  CA  . VAL B 1 57  ? -14.290 -2.450  -37.972 1.00 44.16  ? 57  VAL B CA  1 
ATOM   4660 C  C   . VAL B 1 57  ? -12.975 -2.326  -37.217 1.00 41.65  ? 57  VAL B C   1 
ATOM   4661 O  O   . VAL B 1 57  ? -11.904 -2.239  -37.834 1.00 32.63  ? 57  VAL B O   1 
ATOM   4662 C  CB  . VAL B 1 57  ? -14.432 -3.848  -38.599 1.00 37.43  ? 57  VAL B CB  1 
ATOM   4663 C  CG1 . VAL B 1 57  ? -14.315 -4.900  -37.526 1.00 29.73  ? 57  VAL B CG1 1 
ATOM   4664 C  CG2 . VAL B 1 57  ? -15.752 -3.969  -39.352 1.00 34.77  ? 57  VAL B CG2 1 
ATOM   4665 N  N   . TRP B 1 58  ? -13.051 -2.335  -35.887 1.00 39.12  ? 58  TRP B N   1 
ATOM   4666 C  CA  . TRP B 1 58  ? -11.865 -2.199  -35.047 1.00 44.23  ? 58  TRP B CA  1 
ATOM   4667 C  C   . TRP B 1 58  ? -11.256 -3.578  -34.793 1.00 48.51  ? 58  TRP B C   1 
ATOM   4668 O  O   . TRP B 1 58  ? -11.892 -4.430  -34.161 1.00 48.23  ? 58  TRP B O   1 
ATOM   4669 C  CB  . TRP B 1 58  ? -12.227 -1.512  -33.730 1.00 38.95  ? 58  TRP B CB  1 
ATOM   4670 C  CG  . TRP B 1 58  ? -11.045 -1.161  -32.891 1.00 41.75  ? 58  TRP B CG  1 
ATOM   4671 C  CD1 . TRP B 1 58  ? -10.260 -2.023  -32.163 1.00 42.03  ? 58  TRP B CD1 1 
ATOM   4672 C  CD2 . TRP B 1 58  ? -10.509 0.149   -32.672 1.00 40.20  ? 58  TRP B CD2 1 
ATOM   4673 N  NE1 . TRP B 1 58  ? -9.265  -1.325  -31.516 1.00 40.08  ? 58  TRP B NE1 1 
ATOM   4674 C  CE2 . TRP B 1 58  ? -9.395  0.007   -31.807 1.00 37.00  ? 58  TRP B CE2 1 
ATOM   4675 C  CE3 . TRP B 1 58  ? -10.860 1.429   -33.118 1.00 30.55  ? 58  TRP B CE3 1 
ATOM   4676 C  CZ2 . TRP B 1 58  ? -8.631  1.093   -31.390 1.00 24.18  ? 58  TRP B CZ2 1 
ATOM   4677 C  CZ3 . TRP B 1 58  ? -10.090 2.515   -32.699 1.00 25.52  ? 58  TRP B CZ3 1 
ATOM   4678 C  CH2 . TRP B 1 58  ? -8.989  2.335   -31.847 1.00 24.82  ? 58  TRP B CH2 1 
ATOM   4679 N  N   . ASN B 1 59  ? -10.025 -3.798  -35.272 1.00 26.24  ? 59  ASN B N   1 
ATOM   4680 C  CA  . ASN B 1 59  ? -9.417  -5.119  -35.121 1.00 48.05  ? 59  ASN B CA  1 
ATOM   4681 C  C   . ASN B 1 59  ? -9.043  -5.361  -33.669 1.00 44.55  ? 59  ASN B C   1 
ATOM   4682 O  O   . ASN B 1 59  ? -7.906  -5.092  -33.272 1.00 59.60  ? 59  ASN B O   1 
ATOM   4683 C  CB  . ASN B 1 59  ? -8.188  -5.284  -36.033 1.00 60.49  ? 59  ASN B CB  1 
ATOM   4684 C  CG  . ASN B 1 59  ? -7.675  -6.727  -36.074 1.00 64.81  ? 59  ASN B CG  1 
ATOM   4685 O  OD1 . ASN B 1 59  ? -8.428  -7.657  -35.783 1.00 69.18  ? 59  ASN B OD1 1 
ATOM   4686 N  ND2 . ASN B 1 59  ? -6.404  -6.921  -36.468 1.00 61.56  ? 59  ASN B ND2 1 
ATOM   4687 N  N   . ALA B 1 60  ? -9.978  -5.875  -32.875 1.00 29.98  ? 60  ALA B N   1 
ATOM   4688 C  CA  . ALA B 1 60  ? -9.799  -5.985  -31.421 1.00 28.07  ? 60  ALA B CA  1 
ATOM   4689 C  C   . ALA B 1 60  ? -9.342  -7.379  -30.986 1.00 30.11  ? 60  ALA B C   1 
ATOM   4690 O  O   . ALA B 1 60  ? -9.967  -8.028  -30.145 1.00 28.74  ? 60  ALA B O   1 
ATOM   4691 C  CB  . ALA B 1 60  ? -11.089 -5.598  -30.711 1.00 28.66  ? 60  ALA B CB  1 
ATOM   4692 N  N   . SER B 1 61  ? -8.235  -7.859  -31.544 1.00 37.01  ? 61  SER B N   1 
ATOM   4693 C  CA  . SER B 1 61  ? -7.745  -9.203  -31.275 1.00 43.51  ? 61  SER B CA  1 
ATOM   4694 C  C   . SER B 1 61  ? -6.406  -9.192  -30.563 1.00 46.09  ? 61  SER B C   1 
ATOM   4695 O  O   . SER B 1 61  ? -5.876  -10.261 -30.234 1.00 40.51  ? 61  SER B O   1 
ATOM   4696 C  CB  . SER B 1 61  ? -7.638  -10.007 -32.581 1.00 36.15  ? 61  SER B CB  1 
ATOM   4697 O  OG  . SER B 1 61  ? -7.028  -9.230  -33.594 1.00 37.34  ? 61  SER B OG  1 
ATOM   4698 N  N   . THR B 1 62  ? -5.848  -8.014  -30.317 1.00 44.84  ? 62  THR B N   1 
ATOM   4699 C  CA  . THR B 1 62  ? -4.603  -7.880  -29.586 1.00 49.77  ? 62  THR B CA  1 
ATOM   4700 C  C   . THR B 1 62  ? -4.840  -7.013  -28.357 1.00 40.59  ? 62  THR B C   1 
ATOM   4701 O  O   . THR B 1 62  ? -5.754  -6.184  -28.337 1.00 32.11  ? 62  THR B O   1 
ATOM   4702 C  CB  . THR B 1 62  ? -3.496  -7.274  -30.475 1.00 50.33  ? 62  THR B CB  1 
ATOM   4703 O  OG1 . THR B 1 62  ? -3.920  -6.002  -30.985 1.00 51.47  ? 62  THR B OG1 1 
ATOM   4704 C  CG2 . THR B 1 62  ? -3.199  -8.201  -31.645 1.00 45.01  ? 62  THR B CG2 1 
ATOM   4705 N  N   . TYR B 1 63  ? -4.024  -7.232  -27.318 1.00 37.99  ? 63  TYR B N   1 
ATOM   4706 C  CA  . TYR B 1 63  ? -4.035  -6.336  -26.173 1.00 33.75  ? 63  TYR B CA  1 
ATOM   4707 C  C   . TYR B 1 63  ? -3.633  -4.933  -26.618 1.00 36.78  ? 63  TYR B C   1 
ATOM   4708 O  O   . TYR B 1 63  ? -2.982  -4.757  -27.650 1.00 46.71  ? 63  TYR B O   1 
ATOM   4709 C  CB  . TYR B 1 63  ? -3.079  -6.817  -25.085 1.00 19.54  ? 63  TYR B CB  1 
ATOM   4710 C  CG  . TYR B 1 63  ? -3.587  -7.926  -24.192 1.00 27.97  ? 63  TYR B CG  1 
ATOM   4711 C  CD1 . TYR B 1 63  ? -4.708  -7.746  -23.380 1.00 35.83  ? 63  TYR B CD1 1 
ATOM   4712 C  CD2 . TYR B 1 63  ? -2.920  -9.145  -24.125 1.00 27.39  ? 63  TYR B CD2 1 
ATOM   4713 C  CE1 . TYR B 1 63  ? -5.164  -8.764  -22.540 1.00 38.31  ? 63  TYR B CE1 1 
ATOM   4714 C  CE2 . TYR B 1 63  ? -3.372  -10.167 -23.292 1.00 39.27  ? 63  TYR B CE2 1 
ATOM   4715 C  CZ  . TYR B 1 63  ? -4.485  -9.969  -22.498 1.00 43.97  ? 63  TYR B CZ  1 
ATOM   4716 O  OH  . TYR B 1 63  ? -4.911  -10.983 -21.672 1.00 50.68  ? 63  TYR B OH  1 
ATOM   4717 N  N   . PRO B 1 64  ? -4.012  -3.924  -25.865 1.00 29.60  ? 64  PRO B N   1 
ATOM   4718 C  CA  . PRO B 1 64  ? -3.622  -2.561  -26.231 1.00 28.49  ? 64  PRO B CA  1 
ATOM   4719 C  C   . PRO B 1 64  ? -2.343  -2.188  -25.519 1.00 36.19  ? 64  PRO B C   1 
ATOM   4720 O  O   . PRO B 1 64  ? -1.755  -3.035  -24.842 1.00 32.19  ? 64  PRO B O   1 
ATOM   4721 C  CB  . PRO B 1 64  ? -4.801  -1.728  -25.736 1.00 37.48  ? 64  PRO B CB  1 
ATOM   4722 C  CG  . PRO B 1 64  ? -5.221  -2.480  -24.487 1.00 39.14  ? 64  PRO B CG  1 
ATOM   4723 C  CD  . PRO B 1 64  ? -4.902  -3.942  -24.693 1.00 30.33  ? 64  PRO B CD  1 
ATOM   4724 N  N   . ASN B 1 65  ? -1.919  -0.933  -25.634 1.00 37.57  ? 65  ASN B N   1 
ATOM   4725 C  CA  . ASN B 1 65  ? -0.728  -0.500  -24.927 1.00 29.60  ? 65  ASN B CA  1 
ATOM   4726 C  C   . ASN B 1 65  ? -1.002  -0.388  -23.438 1.00 27.64  ? 65  ASN B C   1 
ATOM   4727 O  O   . ASN B 1 65  ? -2.151  -0.392  -22.990 1.00 30.19  ? 65  ASN B O   1 
ATOM   4728 C  CB  . ASN B 1 65  ? -0.228  0.836   -25.471 1.00 34.54  ? 65  ASN B CB  1 
ATOM   4729 C  CG  . ASN B 1 65  ? 0.197   0.746   -26.934 1.00 39.51  ? 65  ASN B CG  1 
ATOM   4730 O  OD1 . ASN B 1 65  ? -0.073  1.655   -27.726 1.00 38.41  ? 65  ASN B OD1 1 
ATOM   4731 N  ND2 . ASN B 1 65  ? 0.878   -0.355  -27.296 1.00 37.92  ? 65  ASN B ND2 1 
ATOM   4732 N  N   . ASN B 1 66  ? 0.075   -0.308  -22.663 1.00 26.70  ? 66  ASN B N   1 
ATOM   4733 C  CA  . ASN B 1 66  ? -0.064  -0.019  -21.248 1.00 25.46  ? 66  ASN B CA  1 
ATOM   4734 C  C   . ASN B 1 66  ? 0.185   1.462   -21.003 1.00 25.15  ? 66  ASN B C   1 
ATOM   4735 O  O   . ASN B 1 66  ? 0.757   2.159   -21.835 1.00 37.27  ? 66  ASN B O   1 
ATOM   4736 C  CB  . ASN B 1 66  ? 0.884   -0.864  -20.400 1.00 31.56  ? 66  ASN B CB  1 
ATOM   4737 C  CG  . ASN B 1 66  ? 0.772   -2.332  -20.703 1.00 37.20  ? 66  ASN B CG  1 
ATOM   4738 O  OD1 . ASN B 1 66  ? -0.249  -2.943  -20.390 1.00 53.57  ? 66  ASN B OD1 1 
ATOM   4739 N  ND2 . ASN B 1 66  ? 1.880   -2.947  -21.127 1.00 29.64  ? 66  ASN B ND2 1 
ATOM   4740 N  N   . CYS B 1 67  ? -0.276  1.950   -19.861 1.00 33.53  ? 67  CYS B N   1 
ATOM   4741 C  CA  . CYS B 1 67  ? -0.108  3.367   -19.593 1.00 41.51  ? 67  CYS B CA  1 
ATOM   4742 C  C   . CYS B 1 67  ? 1.350   3.659   -19.270 1.00 44.09  ? 67  CYS B C   1 
ATOM   4743 O  O   . CYS B 1 67  ? 2.145   2.761   -18.984 1.00 44.41  ? 67  CYS B O   1 
ATOM   4744 C  CB  . CYS B 1 67  ? -1.035  3.818   -18.460 1.00 42.59  ? 67  CYS B CB  1 
ATOM   4745 S  SG  . CYS B 1 67  ? -2.811  3.666   -18.880 1.00 52.49  ? 67  CYS B SG  1 
ATOM   4746 N  N   . GLN B 1 68  ? 1.709   4.933   -19.360 1.00 45.12  ? 68  GLN B N   1 
ATOM   4747 C  CA  . GLN B 1 68  ? 3.028   5.365   -18.925 1.00 40.95  ? 68  GLN B CA  1 
ATOM   4748 C  C   . GLN B 1 68  ? 3.114   5.245   -17.406 1.00 41.58  ? 68  GLN B C   1 
ATOM   4749 O  O   . GLN B 1 68  ? 2.296   5.818   -16.679 1.00 43.14  ? 68  GLN B O   1 
ATOM   4750 C  CB  . GLN B 1 68  ? 3.308   6.790   -19.398 1.00 33.82  ? 68  GLN B CB  1 
ATOM   4751 C  CG  . GLN B 1 68  ? 3.020   6.995   -20.865 1.00 41.39  ? 68  GLN B CG  1 
ATOM   4752 C  CD  . GLN B 1 68  ? 4.266   6.793   -21.711 1.00 48.43  ? 68  GLN B CD  1 
ATOM   4753 O  OE1 . GLN B 1 68  ? 5.291   6.333   -21.198 1.00 36.72  ? 68  GLN B OE1 1 
ATOM   4754 N  NE2 . GLN B 1 68  ? 4.177   7.104   -23.020 1.00 60.11  ? 68  GLN B NE2 1 
ATOM   4755 N  N   . GLN B 1 69  ? 4.085   4.476   -16.926 1.00 34.51  ? 69  GLN B N   1 
ATOM   4756 C  CA  . GLN B 1 69  ? 4.163   4.127   -15.519 1.00 31.79  ? 69  GLN B CA  1 
ATOM   4757 C  C   . GLN B 1 69  ? 5.609   3.808   -15.164 1.00 32.55  ? 69  GLN B C   1 
ATOM   4758 O  O   . GLN B 1 69  ? 6.449   3.567   -16.033 1.00 31.44  ? 69  GLN B O   1 
ATOM   4759 C  CB  . GLN B 1 69  ? 3.259   2.933   -15.201 1.00 17.66  ? 69  GLN B CB  1 
ATOM   4760 C  CG  . GLN B 1 69  ? 3.634   1.680   -15.943 1.00 20.90  ? 69  GLN B CG  1 
ATOM   4761 C  CD  . GLN B 1 69  ? 2.694   0.527   -15.672 1.00 23.12  ? 69  GLN B CD  1 
ATOM   4762 O  OE1 . GLN B 1 69  ? 2.798   -0.159  -14.653 1.00 28.42  ? 69  GLN B OE1 1 
ATOM   4763 N  NE2 . GLN B 1 69  ? 1.766   0.306   -16.589 1.00 24.34  ? 69  GLN B NE2 1 
ATOM   4764 N  N   . TYR B 1 70  ? 5.900   3.819   -13.870 1.00 34.31  ? 70  TYR B N   1 
ATOM   4765 C  CA  . TYR B 1 70  ? 7.222   3.406   -13.423 1.00 44.02  ? 70  TYR B CA  1 
ATOM   4766 C  C   . TYR B 1 70  ? 7.412   1.910   -13.653 1.00 45.94  ? 70  TYR B C   1 
ATOM   4767 O  O   . TYR B 1 70  ? 6.477   1.116   -13.513 1.00 46.02  ? 70  TYR B O   1 
ATOM   4768 C  CB  . TYR B 1 70  ? 7.410   3.759   -11.950 1.00 39.49  ? 70  TYR B CB  1 
ATOM   4769 C  CG  . TYR B 1 70  ? 8.601   3.131   -11.281 1.00 31.81  ? 70  TYR B CG  1 
ATOM   4770 C  CD1 . TYR B 1 70  ? 9.805   3.811   -11.183 1.00 27.42  ? 70  TYR B CD1 1 
ATOM   4771 C  CD2 . TYR B 1 70  ? 8.506   1.866   -10.706 1.00 37.62  ? 70  TYR B CD2 1 
ATOM   4772 C  CE1 . TYR B 1 70  ? 10.894  3.239   -10.546 1.00 36.40  ? 70  TYR B CE1 1 
ATOM   4773 C  CE2 . TYR B 1 70  ? 9.580   1.282   -10.070 1.00 40.24  ? 70  TYR B CE2 1 
ATOM   4774 C  CZ  . TYR B 1 70  ? 10.776  1.968   -9.988  1.00 43.52  ? 70  TYR B CZ  1 
ATOM   4775 O  OH  . TYR B 1 70  ? 11.846  1.370   -9.349  1.00 40.14  ? 70  TYR B OH  1 
ATOM   4776 N  N   . VAL B 1 71  ? 8.628   1.522   -14.017 1.00 43.93  ? 71  VAL B N   1 
ATOM   4777 C  CA  . VAL B 1 71  ? 8.938   0.124   -14.273 1.00 38.65  ? 71  VAL B CA  1 
ATOM   4778 C  C   . VAL B 1 71  ? 9.975   -0.329  -13.260 1.00 38.01  ? 71  VAL B C   1 
ATOM   4779 O  O   . VAL B 1 71  ? 10.962  0.371   -13.007 1.00 36.72  ? 71  VAL B O   1 
ATOM   4780 C  CB  . VAL B 1 71  ? 9.431   -0.107  -15.714 1.00 18.89  ? 71  VAL B CB  1 
ATOM   4781 C  CG1 . VAL B 1 71  ? 9.953   -1.518  -15.876 1.00 18.90  ? 71  VAL B CG1 1 
ATOM   4782 C  CG2 . VAL B 1 71  ? 8.309   0.157   -16.692 1.00 18.89  ? 71  VAL B CG2 1 
ATOM   4783 N  N   . ASP B 1 72  ? 9.748   -1.510  -12.694 1.00 34.70  ? 72  ASP B N   1 
ATOM   4784 C  CA  . ASP B 1 72  ? 10.541  -2.018  -11.585 1.00 37.59  ? 72  ASP B CA  1 
ATOM   4785 C  C   . ASP B 1 72  ? 11.717  -2.830  -12.119 1.00 33.69  ? 72  ASP B C   1 
ATOM   4786 O  O   . ASP B 1 72  ? 11.529  -3.891  -12.719 1.00 33.73  ? 72  ASP B O   1 
ATOM   4787 C  CB  . ASP B 1 72  ? 9.653   -2.852  -10.672 1.00 41.37  ? 72  ASP B CB  1 
ATOM   4788 C  CG  . ASP B 1 72  ? 10.435  -3.605  -9.649  1.00 45.03  ? 72  ASP B CG  1 
ATOM   4789 O  OD1 . ASP B 1 72  ? 11.500  -3.089  -9.247  1.00 51.23  ? 72  ASP B OD1 1 
ATOM   4790 O  OD2 . ASP B 1 72  ? 9.987   -4.711  -9.264  1.00 37.98  ? 72  ASP B OD2 1 
ATOM   4791 N  N   . GLU B 1 73  ? 12.934  -2.347  -11.880 1.00 34.97  ? 73  GLU B N   1 
ATOM   4792 C  CA  . GLU B 1 73  ? 14.132  -3.045  -12.324 1.00 47.05  ? 73  GLU B CA  1 
ATOM   4793 C  C   . GLU B 1 73  ? 14.946  -3.600  -11.161 1.00 40.75  ? 73  GLU B C   1 
ATOM   4794 O  O   . GLU B 1 73  ? 16.100  -3.990  -11.350 1.00 30.63  ? 73  GLU B O   1 
ATOM   4795 C  CB  . GLU B 1 73  ? 14.994  -2.122  -13.182 1.00 58.34  ? 73  GLU B CB  1 
ATOM   4796 C  CG  . GLU B 1 73  ? 14.233  -1.434  -14.303 1.00 71.58  ? 73  GLU B CG  1 
ATOM   4797 C  CD  . GLU B 1 73  ? 15.124  -0.538  -15.147 1.00 85.39  ? 73  GLU B CD  1 
ATOM   4798 O  OE1 . GLU B 1 73  ? 15.098  -0.660  -16.391 1.00 86.17  ? 73  GLU B OE1 1 
ATOM   4799 O  OE2 . GLU B 1 73  ? 15.864  0.284   -14.564 1.00 95.35  ? 73  GLU B OE2 1 
ATOM   4800 N  N   . GLN B 1 74  ? 14.353  -3.663  -9.966  1.00 38.02  ? 74  GLN B N   1 
ATOM   4801 C  CA  . GLN B 1 74  ? 15.098  -4.070  -8.780  1.00 34.63  ? 74  GLN B CA  1 
ATOM   4802 C  C   . GLN B 1 74  ? 15.731  -5.442  -8.956  1.00 31.73  ? 74  GLN B C   1 
ATOM   4803 O  O   . GLN B 1 74  ? 16.909  -5.635  -8.631  1.00 39.70  ? 74  GLN B O   1 
ATOM   4804 C  CB  . GLN B 1 74  ? 14.180  -4.071  -7.565  1.00 45.31  ? 74  GLN B CB  1 
ATOM   4805 C  CG  . GLN B 1 74  ? 14.785  -4.717  -6.344  1.00 47.01  ? 74  GLN B CG  1 
ATOM   4806 C  CD  . GLN B 1 74  ? 15.683  -3.769  -5.605  1.00 53.05  ? 74  GLN B CD  1 
ATOM   4807 O  OE1 . GLN B 1 74  ? 16.416  -2.987  -6.218  1.00 58.17  ? 74  GLN B OE1 1 
ATOM   4808 N  NE2 . GLN B 1 74  ? 15.619  -3.808  -4.275  1.00 53.54  ? 74  GLN B NE2 1 
ATOM   4809 N  N   . PHE B 1 75  ? 14.966  -6.416  -9.448  1.00 25.49  ? 75  PHE B N   1 
ATOM   4810 C  CA  . PHE B 1 75  ? 15.507  -7.735  -9.776  1.00 34.09  ? 75  PHE B CA  1 
ATOM   4811 C  C   . PHE B 1 75  ? 15.309  -8.003  -11.261 1.00 37.43  ? 75  PHE B C   1 
ATOM   4812 O  O   . PHE B 1 75  ? 14.301  -8.604  -11.674 1.00 37.39  ? 75  PHE B O   1 
ATOM   4813 C  CB  . PHE B 1 75  ? 14.880  -8.826  -8.920  1.00 35.02  ? 75  PHE B CB  1 
ATOM   4814 C  CG  . PHE B 1 75  ? 14.824  -8.476  -7.476  1.00 42.79  ? 75  PHE B CG  1 
ATOM   4815 C  CD1 . PHE B 1 75  ? 13.618  -8.207  -6.863  1.00 45.79  ? 75  PHE B CD1 1 
ATOM   4816 C  CD2 . PHE B 1 75  ? 15.981  -8.372  -6.736  1.00 46.96  ? 75  PHE B CD2 1 
ATOM   4817 C  CE1 . PHE B 1 75  ? 13.568  -7.878  -5.531  1.00 42.96  ? 75  PHE B CE1 1 
ATOM   4818 C  CE2 . PHE B 1 75  ? 15.931  -8.027  -5.394  1.00 47.45  ? 75  PHE B CE2 1 
ATOM   4819 C  CZ  . PHE B 1 75  ? 14.732  -7.785  -4.794  1.00 37.44  ? 75  PHE B CZ  1 
ATOM   4820 N  N   . PRO B 1 76  ? 16.251  -7.571  -12.093 1.00 30.50  ? 76  PRO B N   1 
ATOM   4821 C  CA  . PRO B 1 76  ? 16.153  -7.819  -13.532 1.00 31.85  ? 76  PRO B CA  1 
ATOM   4822 C  C   . PRO B 1 76  ? 16.085  -9.310  -13.831 1.00 33.28  ? 76  PRO B C   1 
ATOM   4823 O  O   . PRO B 1 76  ? 16.900  -10.101 -13.338 1.00 26.77  ? 76  PRO B O   1 
ATOM   4824 C  CB  . PRO B 1 76  ? 17.440  -7.196  -14.082 1.00 40.87  ? 76  PRO B CB  1 
ATOM   4825 C  CG  . PRO B 1 76  ? 17.896  -6.247  -13.039 1.00 41.00  ? 76  PRO B CG  1 
ATOM   4826 C  CD  . PRO B 1 76  ? 17.471  -6.834  -11.737 1.00 38.39  ? 76  PRO B CD  1 
ATOM   4827 N  N   . GLY B 1 77  ? 15.099  -9.687  -14.652 1.00 36.07  ? 77  GLY B N   1 
ATOM   4828 C  CA  . GLY B 1 77  ? 14.923  -11.055 -15.079 1.00 41.54  ? 77  GLY B CA  1 
ATOM   4829 C  C   . GLY B 1 77  ? 14.078  -11.907 -14.158 1.00 40.11  ? 77  GLY B C   1 
ATOM   4830 O  O   . GLY B 1 77  ? 13.571  -12.948 -14.591 1.00 38.10  ? 77  GLY B O   1 
ATOM   4831 N  N   . PHE B 1 78  ? 13.902  -11.490 -12.909 1.00 34.45  ? 78  PHE B N   1 
ATOM   4832 C  CA  . PHE B 1 78  ? 13.230  -12.311 -11.915 1.00 31.51  ? 78  PHE B CA  1 
ATOM   4833 C  C   . PHE B 1 78  ? 11.726  -12.310 -12.164 1.00 41.12  ? 78  PHE B C   1 
ATOM   4834 O  O   . PHE B 1 78  ? 11.075  -11.263 -12.064 1.00 38.88  ? 78  PHE B O   1 
ATOM   4835 C  CB  . PHE B 1 78  ? 13.547  -11.778 -10.527 1.00 36.58  ? 78  PHE B CB  1 
ATOM   4836 C  CG  . PHE B 1 78  ? 12.965  -12.592 -9.416  1.00 39.42  ? 78  PHE B CG  1 
ATOM   4837 C  CD1 . PHE B 1 78  ? 13.299  -13.935 -9.272  1.00 37.61  ? 78  PHE B CD1 1 
ATOM   4838 C  CD2 . PHE B 1 78  ? 12.093  -12.010 -8.505  1.00 37.12  ? 78  PHE B CD2 1 
ATOM   4839 C  CE1 . PHE B 1 78  ? 12.775  -14.697 -8.237  1.00 42.00  ? 78  PHE B CE1 1 
ATOM   4840 C  CE2 . PHE B 1 78  ? 11.565  -12.761 -7.462  1.00 50.71  ? 78  PHE B CE2 1 
ATOM   4841 C  CZ  . PHE B 1 78  ? 11.911  -14.114 -7.327  1.00 51.95  ? 78  PHE B CZ  1 
ATOM   4842 N  N   . SER B 1 79  ? 11.173  -13.486 -12.479 1.00 44.54  ? 79  SER B N   1 
ATOM   4843 C  CA  . SER B 1 79  ? 9.762   -13.567 -12.848 1.00 33.55  ? 79  SER B CA  1 
ATOM   4844 C  C   . SER B 1 79  ? 8.862   -13.040 -11.744 1.00 37.14  ? 79  SER B C   1 
ATOM   4845 O  O   . SER B 1 79  ? 7.814   -12.449 -12.030 1.00 33.66  ? 79  SER B O   1 
ATOM   4846 C  CB  . SER B 1 79  ? 9.390   -15.008 -13.189 1.00 36.04  ? 79  SER B CB  1 
ATOM   4847 O  OG  . SER B 1 79  ? 9.640   -15.881 -12.093 1.00 41.77  ? 79  SER B OG  1 
ATOM   4848 N  N   . GLY B 1 80  ? 9.266   -13.226 -10.482 1.00 44.68  ? 80  GLY B N   1 
ATOM   4849 C  CA  . GLY B 1 80  ? 8.462   -12.812 -9.343  1.00 32.28  ? 80  GLY B CA  1 
ATOM   4850 C  C   . GLY B 1 80  ? 8.169   -11.328 -9.293  1.00 29.21  ? 80  GLY B C   1 
ATOM   4851 O  O   . GLY B 1 80  ? 7.200   -10.926 -8.654  1.00 32.27  ? 80  GLY B O   1 
ATOM   4852 N  N   . SER B 1 81  ? 8.985   -10.499 -9.943  1.00 35.74  ? 81  SER B N   1 
ATOM   4853 C  CA  . SER B 1 81  ? 8.704   -9.071  -10.028 1.00 39.35  ? 81  SER B CA  1 
ATOM   4854 C  C   . SER B 1 81  ? 8.308   -8.614  -11.419 1.00 38.69  ? 81  SER B C   1 
ATOM   4855 O  O   . SER B 1 81  ? 7.548   -7.648  -11.545 1.00 30.86  ? 81  SER B O   1 
ATOM   4856 C  CB  . SER B 1 81  ? 9.921   -8.251  -9.587  1.00 43.97  ? 81  SER B CB  1 
ATOM   4857 O  OG  . SER B 1 81  ? 10.933  -8.282  -10.578 1.00 40.96  ? 81  SER B OG  1 
ATOM   4858 N  N   . GLU B 1 82  ? 8.823   -9.271  -12.463 1.00 41.21  ? 82  GLU B N   1 
ATOM   4859 C  CA  . GLU B 1 82  ? 8.492   -8.882  -13.829 1.00 39.16  ? 82  GLU B CA  1 
ATOM   4860 C  C   . GLU B 1 82  ? 7.092   -9.346  -14.222 1.00 37.28  ? 82  GLU B C   1 
ATOM   4861 O  O   . GLU B 1 82  ? 6.520   -8.830  -15.188 1.00 36.22  ? 82  GLU B O   1 
ATOM   4862 C  CB  . GLU B 1 82  ? 9.578   -9.406  -14.771 1.00 26.73  ? 82  GLU B CB  1 
ATOM   4863 C  CG  . GLU B 1 82  ? 10.971  -9.086  -14.205 1.00 49.71  ? 82  GLU B CG  1 
ATOM   4864 C  CD  . GLU B 1 82  ? 12.071  -8.881  -15.246 1.00 63.47  ? 82  GLU B CD  1 
ATOM   4865 O  OE1 . GLU B 1 82  ? 12.361  -9.821  -16.018 1.00 61.43  ? 82  GLU B OE1 1 
ATOM   4866 O  OE2 . GLU B 1 82  ? 12.667  -7.779  -15.268 1.00 66.15  ? 82  GLU B OE2 1 
ATOM   4867 N  N   . MET B 1 83  ? 6.521   -10.275 -13.456 1.00 30.65  ? 83  MET B N   1 
ATOM   4868 C  CA  . MET B 1 83  ? 5.101   -10.585 -13.513 1.00 20.34  ? 83  MET B CA  1 
ATOM   4869 C  C   . MET B 1 83  ? 4.219   -9.345  -13.375 1.00 25.29  ? 83  MET B C   1 
ATOM   4870 O  O   . MET B 1 83  ? 3.078   -9.350  -13.849 1.00 32.43  ? 83  MET B O   1 
ATOM   4871 C  CB  . MET B 1 83  ? 4.824   -11.611 -12.409 1.00 27.73  ? 83  MET B CB  1 
ATOM   4872 C  CG  . MET B 1 83  ? 3.430   -11.665 -11.850 1.00 49.27  ? 83  MET B CG  1 
ATOM   4873 S  SD  . MET B 1 83  ? 3.336   -12.942 -10.587 1.00 59.28  ? 83  MET B SD  1 
ATOM   4874 C  CE  . MET B 1 83  ? 4.929   -12.723 -9.834  1.00 61.32  ? 83  MET B CE  1 
ATOM   4875 N  N   . TRP B 1 84  ? 4.726   -8.272  -12.771 1.00 28.72  ? 84  TRP B N   1 
ATOM   4876 C  CA  . TRP B 1 84  ? 3.921   -7.108  -12.423 1.00 15.56  ? 84  TRP B CA  1 
ATOM   4877 C  C   . TRP B 1 84  ? 4.159   -5.922  -13.330 1.00 15.89  ? 84  TRP B C   1 
ATOM   4878 O  O   . TRP B 1 84  ? 3.355   -4.988  -13.301 1.00 16.98  ? 84  TRP B O   1 
ATOM   4879 C  CB  . TRP B 1 84  ? 4.217   -6.703  -10.970 1.00 28.11  ? 84  TRP B CB  1 
ATOM   4880 C  CG  . TRP B 1 84  ? 3.892   -7.806  -10.083 1.00 29.88  ? 84  TRP B CG  1 
ATOM   4881 C  CD1 . TRP B 1 84  ? 4.753   -8.533  -9.323  1.00 32.69  ? 84  TRP B CD1 1 
ATOM   4882 C  CD2 . TRP B 1 84  ? 2.600   -8.352  -9.868  1.00 34.67  ? 84  TRP B CD2 1 
ATOM   4883 N  NE1 . TRP B 1 84  ? 4.072   -9.515  -8.647  1.00 24.62  ? 84  TRP B NE1 1 
ATOM   4884 C  CE2 . TRP B 1 84  ? 2.747   -9.417  -8.963  1.00 26.94  ? 84  TRP B CE2 1 
ATOM   4885 C  CE3 . TRP B 1 84  ? 1.325   -8.043  -10.354 1.00 29.67  ? 84  TRP B CE3 1 
ATOM   4886 C  CZ2 . TRP B 1 84  ? 1.686   -10.165 -8.539  1.00 28.28  ? 84  TRP B CZ2 1 
ATOM   4887 C  CZ3 . TRP B 1 84  ? 0.272   -8.789  -9.934  1.00 23.05  ? 84  TRP B CZ3 1 
ATOM   4888 C  CH2 . TRP B 1 84  ? 0.451   -9.840  -9.032  1.00 24.29  ? 84  TRP B CH2 1 
ATOM   4889 N  N   . ASN B 1 85  ? 5.236   -5.944  -14.119 1.00 24.01  ? 85  ASN B N   1 
ATOM   4890 C  CA  . ASN B 1 85  ? 5.606   -4.862  -15.009 1.00 24.82  ? 85  ASN B CA  1 
ATOM   4891 C  C   . ASN B 1 85  ? 4.796   -4.907  -16.307 1.00 27.60  ? 85  ASN B C   1 
ATOM   4892 O  O   . ASN B 1 85  ? 4.209   -5.945  -16.659 1.00 21.79  ? 85  ASN B O   1 
ATOM   4893 C  CB  . ASN B 1 85  ? 7.101   -4.946  -15.319 1.00 40.63  ? 85  ASN B CB  1 
ATOM   4894 C  CG  . ASN B 1 85  ? 7.986   -4.435  -14.169 1.00 55.38  ? 85  ASN B CG  1 
ATOM   4895 O  OD1 . ASN B 1 85  ? 7.648   -3.464  -13.479 1.00 60.53  ? 85  ASN B OD1 1 
ATOM   4896 N  ND2 . ASN B 1 85  ? 9.130   -5.097  -13.968 1.00 47.31  ? 85  ASN B ND2 1 
ATOM   4897 N  N   . PRO B 1 86  ? 4.750   -3.784  -17.037 1.00 32.92  ? 86  PRO B N   1 
ATOM   4898 C  CA  . PRO B 1 86  ? 4.085   -3.771  -18.353 1.00 21.84  ? 86  PRO B CA  1 
ATOM   4899 C  C   . PRO B 1 86  ? 4.645   -4.846  -19.275 1.00 23.29  ? 86  PRO B C   1 
ATOM   4900 O  O   . PRO B 1 86  ? 5.858   -5.016  -19.374 1.00 39.56  ? 86  PRO B O   1 
ATOM   4901 C  CB  . PRO B 1 86  ? 4.391   -2.370  -18.882 1.00 20.05  ? 86  PRO B CB  1 
ATOM   4902 C  CG  . PRO B 1 86  ? 4.592   -1.520  -17.641 1.00 17.85  ? 86  PRO B CG  1 
ATOM   4903 C  CD  . PRO B 1 86  ? 5.189   -2.435  -16.608 1.00 28.87  ? 86  PRO B CD  1 
ATOM   4904 N  N   . ASN B 1 87  ? 3.751   -5.574  -19.957 1.00 24.60  ? 87  ASN B N   1 
ATOM   4905 C  CA  . ASN B 1 87  ? 4.150   -6.596  -20.925 1.00 28.73  ? 87  ASN B CA  1 
ATOM   4906 C  C   . ASN B 1 87  ? 3.869   -6.180  -22.358 1.00 34.82  ? 87  ASN B C   1 
ATOM   4907 O  O   . ASN B 1 87  ? 4.079   -6.976  -23.285 1.00 39.93  ? 87  ASN B O   1 
ATOM   4908 C  CB  . ASN B 1 87  ? 3.451   -7.929  -20.641 1.00 18.43  ? 87  ASN B CB  1 
ATOM   4909 C  CG  . ASN B 1 87  ? 1.956   -7.774  -20.492 1.00 31.57  ? 87  ASN B CG  1 
ATOM   4910 O  OD1 . ASN B 1 87  ? 1.454   -6.659  -20.307 1.00 35.78  ? 87  ASN B OD1 1 
ATOM   4911 N  ND2 . ASN B 1 87  ? 1.235   -8.877  -20.559 1.00 37.24  ? 87  ASN B ND2 1 
ATOM   4912 N  N   . ARG B 1 88  ? 3.379   -4.967  -22.560 1.00 37.51  ? 88  ARG B N   1 
ATOM   4913 C  CA  . ARG B 1 88  ? 3.240   -4.345  -23.863 1.00 34.89  ? 88  ARG B CA  1 
ATOM   4914 C  C   . ARG B 1 88  ? 3.941   -3.002  -23.839 1.00 32.19  ? 88  ARG B C   1 
ATOM   4915 O  O   . ARG B 1 88  ? 4.459   -2.556  -22.813 1.00 37.53  ? 88  ARG B O   1 
ATOM   4916 C  CB  . ARG B 1 88  ? 1.768   -4.159  -24.252 1.00 45.04  ? 88  ARG B CB  1 
ATOM   4917 C  CG  . ARG B 1 88  ? 0.960   -5.409  -24.068 1.00 52.29  ? 88  ARG B CG  1 
ATOM   4918 C  CD  . ARG B 1 88  ? 0.834   -6.150  -25.378 1.00 55.43  ? 88  ARG B CD  1 
ATOM   4919 N  NE  . ARG B 1 88  ? 0.883   -7.595  -25.160 1.00 61.56  ? 88  ARG B NE  1 
ATOM   4920 C  CZ  . ARG B 1 88  ? 0.869   -8.507  -26.123 1.00 71.01  ? 88  ARG B CZ  1 
ATOM   4921 N  NH1 . ARG B 1 88  ? 0.913   -9.791  -25.792 1.00 80.59  ? 88  ARG B NH1 1 
ATOM   4922 N  NH2 . ARG B 1 88  ? 0.780   -8.124  -27.383 1.00 64.74  ? 88  ARG B NH2 1 
ATOM   4923 N  N   . GLU B 1 89  ? 3.958   -2.360  -24.997 1.00 37.33  ? 89  GLU B N   1 
ATOM   4924 C  CA  . GLU B 1 89  ? 4.526   -1.034  -25.068 1.00 37.75  ? 89  GLU B CA  1 
ATOM   4925 C  C   . GLU B 1 89  ? 3.707   -0.089  -24.202 1.00 37.04  ? 89  GLU B C   1 
ATOM   4926 O  O   . GLU B 1 89  ? 2.557   -0.363  -23.839 1.00 36.88  ? 89  GLU B O   1 
ATOM   4927 C  CB  . GLU B 1 89  ? 4.577   -0.554  -26.513 1.00 45.70  ? 89  GLU B CB  1 
ATOM   4928 C  CG  . GLU B 1 89  ? 5.699   0.430   -26.772 1.00 62.29  ? 89  GLU B CG  1 
ATOM   4929 C  CD  . GLU B 1 89  ? 5.925   0.667   -28.254 1.00 79.27  ? 89  GLU B CD  1 
ATOM   4930 O  OE1 . GLU B 1 89  ? 5.460   -0.160  -29.068 1.00 82.76  ? 89  GLU B OE1 1 
ATOM   4931 O  OE2 . GLU B 1 89  ? 6.569   1.676   -28.609 1.00 86.82  ? 89  GLU B OE2 1 
ATOM   4932 N  N   . MET B 1 90  ? 4.334   1.017   -23.827 1.00 38.73  ? 90  MET B N   1 
ATOM   4933 C  CA  . MET B 1 90  ? 3.674   2.051   -23.053 1.00 30.32  ? 90  MET B CA  1 
ATOM   4934 C  C   . MET B 1 90  ? 3.479   3.292   -23.904 1.00 30.44  ? 90  MET B C   1 
ATOM   4935 O  O   . MET B 1 90  ? 4.320   3.631   -24.748 1.00 34.41  ? 90  MET B O   1 
ATOM   4936 C  CB  . MET B 1 90  ? 4.450   2.402   -21.785 1.00 38.30  ? 90  MET B CB  1 
ATOM   4937 C  CG  . MET B 1 90  ? 4.792   1.199   -20.919 1.00 47.25  ? 90  MET B CG  1 
ATOM   4938 S  SD  . MET B 1 90  ? 6.237   1.550   -19.916 1.00 43.04  ? 90  MET B SD  1 
ATOM   4939 C  CE  . MET B 1 90  ? 5.461   2.667   -18.814 1.00 36.85  ? 90  MET B CE  1 
ATOM   4940 N  N   . SER B 1 91  ? 2.349   3.947   -23.666 1.00 31.52  ? 91  SER B N   1 
ATOM   4941 C  CA  . SER B 1 91  ? 1.882   5.094   -24.419 1.00 34.40  ? 91  SER B CA  1 
ATOM   4942 C  C   . SER B 1 91  ? 0.864   5.822   -23.558 1.00 30.44  ? 91  SER B C   1 
ATOM   4943 O  O   . SER B 1 91  ? 0.101   5.195   -22.818 1.00 36.27  ? 91  SER B O   1 
ATOM   4944 C  CB  . SER B 1 91  ? 1.255   4.663   -25.752 1.00 32.58  ? 91  SER B CB  1 
ATOM   4945 O  OG  . SER B 1 91  ? 0.313   5.610   -26.202 1.00 22.86  ? 91  SER B OG  1 
ATOM   4946 N  N   . GLU B 1 92  ? 0.859   7.148   -23.656 1.00 29.07  ? 92  GLU B N   1 
ATOM   4947 C  CA  . GLU B 1 92  ? -0.249  7.892   -23.077 1.00 36.02  ? 92  GLU B CA  1 
ATOM   4948 C  C   . GLU B 1 92  ? -1.588  7.531   -23.720 1.00 37.55  ? 92  GLU B C   1 
ATOM   4949 O  O   . GLU B 1 92  ? -2.643  7.881   -23.175 1.00 35.76  ? 92  GLU B O   1 
ATOM   4950 C  CB  . GLU B 1 92  ? 0.023   9.388   -23.199 1.00 42.41  ? 92  GLU B CB  1 
ATOM   4951 C  CG  . GLU B 1 92  ? 0.859   9.967   -22.072 1.00 43.01  ? 92  GLU B CG  1 
ATOM   4952 C  CD  . GLU B 1 92  ? 1.222   11.425  -22.327 1.00 56.93  ? 92  GLU B CD  1 
ATOM   4953 O  OE1 . GLU B 1 92  ? 2.136   11.674  -23.152 1.00 57.44  ? 92  GLU B OE1 1 
ATOM   4954 O  OE2 . GLU B 1 92  ? 0.581   12.318  -21.720 1.00 61.12  ? 92  GLU B OE2 1 
ATOM   4955 N  N   . ASP B 1 93  ? -1.563  6.833   -24.856 1.00 33.48  ? 93  ASP B N   1 
ATOM   4956 C  CA  . ASP B 1 93  ? -2.760  6.341   -25.529 1.00 34.38  ? 93  ASP B CA  1 
ATOM   4957 C  C   . ASP B 1 93  ? -3.020  4.926   -25.022 1.00 41.95  ? 93  ASP B C   1 
ATOM   4958 O  O   . ASP B 1 93  ? -2.774  3.930   -25.701 1.00 57.98  ? 93  ASP B O   1 
ATOM   4959 C  CB  . ASP B 1 93  ? -2.551  6.402   -27.039 1.00 39.41  ? 93  ASP B CB  1 
ATOM   4960 C  CG  . ASP B 1 93  ? -3.674  5.763   -27.837 1.00 49.64  ? 93  ASP B CG  1 
ATOM   4961 O  OD1 . ASP B 1 93  ? -3.523  5.694   -29.076 1.00 50.62  ? 93  ASP B OD1 1 
ATOM   4962 O  OD2 . ASP B 1 93  ? -4.691  5.337   -27.250 1.00 57.52  ? 93  ASP B OD2 1 
ATOM   4963 N  N   . CYS B 1 94  ? -3.543  4.837   -23.798 1.00 42.47  ? 94  CYS B N   1 
ATOM   4964 C  CA  . CYS B 1 94  ? -3.646  3.549   -23.124 1.00 33.25  ? 94  CYS B CA  1 
ATOM   4965 C  C   . CYS B 1 94  ? -5.036  3.165   -22.641 1.00 25.54  ? 94  CYS B C   1 
ATOM   4966 O  O   . CYS B 1 94  ? -5.170  2.100   -22.031 1.00 19.67  ? 94  CYS B O   1 
ATOM   4967 C  CB  . CYS B 1 94  ? -2.700  3.510   -21.920 1.00 30.44  ? 94  CYS B CB  1 
ATOM   4968 S  SG  . CYS B 1 94  ? -3.076  4.721   -20.632 1.00 39.04  ? 94  CYS B SG  1 
ATOM   4969 N  N   . LEU B 1 95  ? -6.071  3.965   -22.913 1.00 20.03  ? 95  LEU B N   1 
ATOM   4970 C  CA  . LEU B 1 95  ? -7.367  3.803   -22.248 1.00 25.94  ? 95  LEU B CA  1 
ATOM   4971 C  C   . LEU B 1 95  ? -8.265  2.832   -23.021 1.00 28.09  ? 95  LEU B C   1 
ATOM   4972 O  O   . LEU B 1 95  ? -9.158  3.213   -23.778 1.00 33.57  ? 95  LEU B O   1 
ATOM   4973 C  CB  . LEU B 1 95  ? -8.028  5.163   -22.047 1.00 30.72  ? 95  LEU B CB  1 
ATOM   4974 C  CG  . LEU B 1 95  ? -7.462  5.910   -20.833 1.00 31.33  ? 95  LEU B CG  1 
ATOM   4975 C  CD1 . LEU B 1 95  ? -8.008  7.327   -20.684 1.00 26.92  ? 95  LEU B CD1 1 
ATOM   4976 C  CD2 . LEU B 1 95  ? -7.767  5.106   -19.591 1.00 30.95  ? 95  LEU B CD2 1 
ATOM   4977 N  N   . TYR B 1 96  ? -8.050  1.541   -22.770 1.00 23.27  ? 96  TYR B N   1 
ATOM   4978 C  CA  . TYR B 1 96  ? -8.752  0.471   -23.458 1.00 19.90  ? 96  TYR B CA  1 
ATOM   4979 C  C   . TYR B 1 96  ? -9.196  -0.582  -22.456 1.00 29.77  ? 96  TYR B C   1 
ATOM   4980 O  O   . TYR B 1 96  ? -8.469  -0.880  -21.503 1.00 32.19  ? 96  TYR B O   1 
ATOM   4981 C  CB  . TYR B 1 96  ? -7.863  -0.191  -24.519 1.00 27.66  ? 96  TYR B CB  1 
ATOM   4982 C  CG  . TYR B 1 96  ? -7.316  0.768   -25.546 1.00 33.01  ? 96  TYR B CG  1 
ATOM   4983 C  CD1 . TYR B 1 96  ? -7.861  0.814   -26.833 1.00 25.59  ? 96  TYR B CD1 1 
ATOM   4984 C  CD2 . TYR B 1 96  ? -6.230  1.605   -25.246 1.00 34.08  ? 96  TYR B CD2 1 
ATOM   4985 C  CE1 . TYR B 1 96  ? -7.382  1.685   -27.775 1.00 29.09  ? 96  TYR B CE1 1 
ATOM   4986 C  CE2 . TYR B 1 96  ? -5.735  2.487   -26.194 1.00 39.51  ? 96  TYR B CE2 1 
ATOM   4987 C  CZ  . TYR B 1 96  ? -6.315  2.515   -27.460 1.00 35.91  ? 96  TYR B CZ  1 
ATOM   4988 O  OH  . TYR B 1 96  ? -5.824  3.368   -28.418 1.00 28.51  ? 96  TYR B OH  1 
ATOM   4989 N  N   . LEU B 1 97  ? -10.382 -1.148  -22.676 1.00 26.54  ? 97  LEU B N   1 
ATOM   4990 C  CA  . LEU B 1 97  ? -10.864 -2.264  -21.880 1.00 22.61  ? 97  LEU B CA  1 
ATOM   4991 C  C   . LEU B 1 97  ? -10.754 -3.557  -22.679 1.00 24.22  ? 97  LEU B C   1 
ATOM   4992 O  O   . LEU B 1 97  ? -10.508 -3.547  -23.885 1.00 26.77  ? 97  LEU B O   1 
ATOM   4993 C  CB  . LEU B 1 97  ? -12.296 -2.023  -21.416 1.00 18.26  ? 97  LEU B CB  1 
ATOM   4994 C  CG  . LEU B 1 97  ? -13.318 -1.542  -22.436 1.00 34.56  ? 97  LEU B CG  1 
ATOM   4995 C  CD1 . LEU B 1 97  ? -13.764 -2.651  -23.379 1.00 37.14  ? 97  LEU B CD1 1 
ATOM   4996 C  CD2 . LEU B 1 97  ? -14.528 -0.972  -21.704 1.00 38.87  ? 97  LEU B CD2 1 
ATOM   4997 N  N   . ASN B 1 98  ? -10.927 -4.682  -21.989 1.00 20.79  ? 98  ASN B N   1 
ATOM   4998 C  CA  . ASN B 1 98  ? -10.887 -5.993  -22.620 1.00 27.08  ? 98  ASN B CA  1 
ATOM   4999 C  C   . ASN B 1 98  ? -12.081 -6.801  -22.158 1.00 33.63  ? 98  ASN B C   1 
ATOM   5000 O  O   . ASN B 1 98  ? -12.435 -6.758  -20.981 1.00 47.30  ? 98  ASN B O   1 
ATOM   5001 C  CB  . ASN B 1 98  ? -9.619  -6.735  -22.276 1.00 32.72  ? 98  ASN B CB  1 
ATOM   5002 C  CG  . ASN B 1 98  ? -8.394  -5.964  -22.661 1.00 40.45  ? 98  ASN B CG  1 
ATOM   5003 O  OD1 . ASN B 1 98  ? -8.075  -5.861  -23.840 1.00 50.71  ? 98  ASN B OD1 1 
ATOM   5004 N  ND2 . ASN B 1 98  ? -7.697  -5.404  -21.671 1.00 33.50  ? 98  ASN B ND2 1 
ATOM   5005 N  N   . ILE B 1 99  ? -12.705 -7.535  -23.075 1.00 30.33  ? 99  ILE B N   1 
ATOM   5006 C  CA  . ILE B 1 99  ? -13.886 -8.327  -22.759 1.00 25.51  ? 99  ILE B CA  1 
ATOM   5007 C  C   . ILE B 1 99  ? -13.608 -9.786  -23.089 1.00 25.25  ? 99  ILE B C   1 
ATOM   5008 O  O   . ILE B 1 99  ? -13.061 -10.096 -24.150 1.00 19.33  ? 99  ILE B O   1 
ATOM   5009 C  CB  . ILE B 1 99  ? -15.129 -7.833  -23.520 1.00 29.22  ? 99  ILE B CB  1 
ATOM   5010 C  CG1 . ILE B 1 99  ? -15.141 -6.302  -23.617 1.00 25.74  ? 99  ILE B CG1 1 
ATOM   5011 C  CG2 . ILE B 1 99  ? -16.402 -8.347  -22.825 1.00 30.39  ? 99  ILE B CG2 1 
ATOM   5012 C  CD1 . ILE B 1 99  ? -16.551 -5.698  -23.834 1.00 24.03  ? 99  ILE B CD1 1 
ATOM   5013 N  N   . TRP B 1 100 ? -14.005 -10.681 -22.191 1.00 29.29  ? 100 TRP B N   1 
ATOM   5014 C  CA  . TRP B 1 100 ? -14.043 -12.110 -22.473 1.00 32.53  ? 100 TRP B CA  1 
ATOM   5015 C  C   . TRP B 1 100 ? -15.490 -12.585 -22.378 1.00 37.97  ? 100 TRP B C   1 
ATOM   5016 O  O   . TRP B 1 100 ? -16.124 -12.457 -21.323 1.00 39.01  ? 100 TRP B O   1 
ATOM   5017 C  CB  . TRP B 1 100 ? -13.154 -12.889 -21.511 1.00 20.73  ? 100 TRP B CB  1 
ATOM   5018 C  CG  . TRP B 1 100 ? -11.692 -12.775 -21.764 1.00 22.18  ? 100 TRP B CG  1 
ATOM   5019 C  CD1 . TRP B 1 100 ? -10.931 -13.634 -22.496 1.00 23.32  ? 100 TRP B CD1 1 
ATOM   5020 C  CD2 . TRP B 1 100 ? -10.792 -11.794 -21.236 1.00 35.93  ? 100 TRP B CD2 1 
ATOM   5021 N  NE1 . TRP B 1 100 ? -9.621  -13.236 -22.490 1.00 32.10  ? 100 TRP B NE1 1 
ATOM   5022 C  CE2 . TRP B 1 100 ? -9.503  -12.114 -21.715 1.00 37.06  ? 100 TRP B CE2 1 
ATOM   5023 C  CE3 . TRP B 1 100 ? -10.947 -10.676 -20.412 1.00 44.45  ? 100 TRP B CE3 1 
ATOM   5024 C  CZ2 . TRP B 1 100 ? -8.372  -11.358 -21.395 1.00 31.60  ? 100 TRP B CZ2 1 
ATOM   5025 C  CZ3 . TRP B 1 100 ? -9.821  -9.919  -20.102 1.00 42.81  ? 100 TRP B CZ3 1 
ATOM   5026 C  CH2 . TRP B 1 100 ? -8.548  -10.267 -20.594 1.00 25.92  ? 100 TRP B CH2 1 
ATOM   5027 N  N   . VAL B 1 101 ? -16.010 -13.120 -23.473 1.00 31.28  ? 101 VAL B N   1 
ATOM   5028 C  CA  . VAL B 1 101 ? -17.401 -13.544 -23.575 1.00 22.34  ? 101 VAL B CA  1 
ATOM   5029 C  C   . VAL B 1 101 ? -17.426 -15.065 -23.725 1.00 23.57  ? 101 VAL B C   1 
ATOM   5030 O  O   . VAL B 1 101 ? -16.691 -15.597 -24.556 1.00 26.99  ? 101 VAL B O   1 
ATOM   5031 C  CB  . VAL B 1 101 ? -18.114 -12.890 -24.765 1.00 23.87  ? 101 VAL B CB  1 
ATOM   5032 C  CG1 . VAL B 1 101 ? -19.594 -13.248 -24.742 1.00 21.34  ? 101 VAL B CG1 1 
ATOM   5033 C  CG2 . VAL B 1 101 ? -17.887 -11.385 -24.768 1.00 23.56  ? 101 VAL B CG2 1 
ATOM   5034 N  N   . PRO B 1 102 ? -18.237 -15.772 -22.948 1.00 35.21  ? 102 PRO B N   1 
ATOM   5035 C  CA  . PRO B 1 102 ? -18.360 -17.221 -23.144 1.00 34.94  ? 102 PRO B CA  1 
ATOM   5036 C  C   . PRO B 1 102 ? -18.823 -17.528 -24.559 1.00 39.92  ? 102 PRO B C   1 
ATOM   5037 O  O   . PRO B 1 102 ? -19.355 -16.673 -25.272 1.00 41.56  ? 102 PRO B O   1 
ATOM   5038 C  CB  . PRO B 1 102 ? -19.409 -17.633 -22.106 1.00 30.98  ? 102 PRO B CB  1 
ATOM   5039 C  CG  . PRO B 1 102 ? -19.416 -16.517 -21.092 1.00 27.58  ? 102 PRO B CG  1 
ATOM   5040 C  CD  . PRO B 1 102 ? -19.079 -15.269 -21.852 1.00 33.77  ? 102 PRO B CD  1 
ATOM   5041 N  N   . SER B 1 103 ? -18.584 -18.760 -24.981 1.00 42.53  ? 103 SER B N   1 
ATOM   5042 C  CA  . SER B 1 103 ? -18.989 -19.149 -26.320 1.00 41.26  ? 103 SER B CA  1 
ATOM   5043 C  C   . SER B 1 103 ? -19.554 -20.556 -26.302 1.00 48.85  ? 103 SER B C   1 
ATOM   5044 O  O   . SER B 1 103 ? -18.854 -21.501 -25.920 1.00 47.24  ? 103 SER B O   1 
ATOM   5045 C  CB  . SER B 1 103 ? -17.827 -19.058 -27.305 1.00 41.21  ? 103 SER B CB  1 
ATOM   5046 O  OG  . SER B 1 103 ? -18.080 -19.870 -28.438 1.00 51.71  ? 103 SER B OG  1 
ATOM   5047 N  N   . PRO B 1 104 ? -20.813 -20.712 -26.756 1.00 51.67  ? 104 PRO B N   1 
ATOM   5048 C  CA  . PRO B 1 104 ? -21.750 -19.728 -27.324 1.00 44.81  ? 104 PRO B CA  1 
ATOM   5049 C  C   . PRO B 1 104 ? -22.060 -18.509 -26.462 1.00 44.30  ? 104 PRO B C   1 
ATOM   5050 O  O   . PRO B 1 104 ? -21.902 -18.546 -25.243 1.00 52.85  ? 104 PRO B O   1 
ATOM   5051 C  CB  . PRO B 1 104 ? -23.037 -20.537 -27.512 1.00 40.81  ? 104 PRO B CB  1 
ATOM   5052 C  CG  . PRO B 1 104 ? -22.696 -21.960 -27.222 1.00 46.13  ? 104 PRO B CG  1 
ATOM   5053 C  CD  . PRO B 1 104 ? -21.224 -22.079 -27.095 1.00 52.15  ? 104 PRO B CD  1 
ATOM   5054 N  N   . ARG B 1 105 ? -22.513 -17.446 -27.108 1.00 42.94  ? 105 ARG B N   1 
ATOM   5055 C  CA  . ARG B 1 105 ? -22.757 -16.191 -26.404 1.00 48.70  ? 105 ARG B CA  1 
ATOM   5056 C  C   . ARG B 1 105 ? -23.950 -16.307 -25.456 1.00 43.34  ? 105 ARG B C   1 
ATOM   5057 O  O   . ARG B 1 105 ? -25.025 -16.760 -25.860 1.00 38.69  ? 105 ARG B O   1 
ATOM   5058 C  CB  . ARG B 1 105 ? -22.987 -15.058 -27.400 1.00 24.20  ? 105 ARG B CB  1 
ATOM   5059 C  CG  . ARG B 1 105 ? -22.973 -13.682 -26.776 1.00 23.58  ? 105 ARG B CG  1 
ATOM   5060 C  CD  . ARG B 1 105 ? -22.221 -12.744 -27.681 1.00 34.19  ? 105 ARG B CD  1 
ATOM   5061 N  NE  . ARG B 1 105 ? -23.097 -12.017 -28.588 1.00 45.60  ? 105 ARG B NE  1 
ATOM   5062 C  CZ  . ARG B 1 105 ? -22.708 -11.435 -29.718 1.00 52.82  ? 105 ARG B CZ  1 
ATOM   5063 N  NH1 . ARG B 1 105 ? -21.456 -11.530 -30.124 1.00 50.15  ? 105 ARG B NH1 1 
ATOM   5064 N  NH2 . ARG B 1 105 ? -23.600 -10.788 -30.450 1.00 57.12  ? 105 ARG B NH2 1 
ATOM   5065 N  N   . PRO B 1 106 ? -23.811 -15.883 -24.207 1.00 41.36  ? 106 PRO B N   1 
ATOM   5066 C  CA  . PRO B 1 106 ? -24.970 -15.830 -23.313 1.00 43.53  ? 106 PRO B CA  1 
ATOM   5067 C  C   . PRO B 1 106 ? -25.960 -14.783 -23.785 1.00 45.63  ? 106 PRO B C   1 
ATOM   5068 O  O   . PRO B 1 106 ? -25.636 -13.900 -24.581 1.00 42.97  ? 106 PRO B O   1 
ATOM   5069 C  CB  . PRO B 1 106 ? -24.366 -15.442 -21.962 1.00 38.92  ? 106 PRO B CB  1 
ATOM   5070 C  CG  . PRO B 1 106 ? -22.889 -15.612 -22.127 1.00 41.01  ? 106 PRO B CG  1 
ATOM   5071 C  CD  . PRO B 1 106 ? -22.587 -15.399 -23.560 1.00 34.77  ? 106 PRO B CD  1 
ATOM   5072 N  N   . LYS B 1 107 ? -27.190 -14.887 -23.274 1.00 56.53  ? 107 LYS B N   1 
ATOM   5073 C  CA  . LYS B 1 107 ? -28.198 -13.896 -23.644 1.00 62.63  ? 107 LYS B CA  1 
ATOM   5074 C  C   . LYS B 1 107 ? -28.072 -12.645 -22.783 1.00 65.36  ? 107 LYS B C   1 
ATOM   5075 O  O   . LYS B 1 107 ? -27.914 -11.536 -23.304 1.00 68.04  ? 107 LYS B O   1 
ATOM   5076 C  CB  . LYS B 1 107 ? -29.608 -14.495 -23.556 1.00 49.86  ? 107 LYS B CB  1 
ATOM   5077 C  CG  . LYS B 1 107 ? -30.398 -14.315 -24.852 1.00 37.73  ? 107 LYS B CG  1 
ATOM   5078 C  CD  . LYS B 1 107 ? -31.647 -15.179 -24.931 1.00 48.32  ? 107 LYS B CD  1 
ATOM   5079 C  CE  . LYS B 1 107 ? -32.328 -15.017 -26.302 1.00 65.68  ? 107 LYS B CE  1 
ATOM   5080 N  NZ  . LYS B 1 107 ? -33.830 -15.076 -26.311 1.00 68.83  ? 107 LYS B NZ  1 
ATOM   5081 N  N   . SER B 1 108 ? -28.114 -12.806 -21.466 1.00 62.20  ? 108 SER B N   1 
ATOM   5082 C  CA  . SER B 1 108 ? -27.930 -11.676 -20.559 1.00 64.93  ? 108 SER B CA  1 
ATOM   5083 C  C   . SER B 1 108 ? -27.393 -12.269 -19.264 1.00 53.18  ? 108 SER B C   1 
ATOM   5084 O  O   . SER B 1 108 ? -28.165 -12.772 -18.443 1.00 59.21  ? 108 SER B O   1 
ATOM   5085 C  CB  . SER B 1 108 ? -29.226 -10.907 -20.339 1.00 76.96  ? 108 SER B CB  1 
ATOM   5086 O  OG  . SER B 1 108 ? -28.991 -9.687  -19.656 1.00 81.77  ? 108 SER B OG  1 
ATOM   5087 N  N   . THR B 1 109 ? -26.080 -12.211 -19.102 1.00 38.53  ? 109 THR B N   1 
ATOM   5088 C  CA  . THR B 1 109 ? -25.374 -12.914 -18.053 1.00 39.12  ? 109 THR B CA  1 
ATOM   5089 C  C   . THR B 1 109 ? -24.504 -11.929 -17.278 1.00 45.25  ? 109 THR B C   1 
ATOM   5090 O  O   . THR B 1 109 ? -24.297 -10.784 -17.704 1.00 39.37  ? 109 THR B O   1 
ATOM   5091 C  CB  . THR B 1 109 ? -24.527 -14.041 -18.648 1.00 46.25  ? 109 THR B CB  1 
ATOM   5092 O  OG1 . THR B 1 109 ? -24.087 -14.919 -17.606 1.00 61.17  ? 109 THR B OG1 1 
ATOM   5093 C  CG2 . THR B 1 109 ? -23.319 -13.448 -19.352 1.00 44.63  ? 109 THR B CG2 1 
ATOM   5094 N  N   . THR B 1 110 ? -23.990 -12.406 -16.136 1.00 44.17  ? 110 THR B N   1 
ATOM   5095 C  CA  . THR B 1 110 ? -23.287 -11.566 -15.172 1.00 42.39  ? 110 THR B CA  1 
ATOM   5096 C  C   . THR B 1 110 ? -21.979 -11.033 -15.745 1.00 30.91  ? 110 THR B C   1 
ATOM   5097 O  O   . THR B 1 110 ? -21.305 -11.690 -16.541 1.00 23.65  ? 110 THR B O   1 
ATOM   5098 C  CB  . THR B 1 110 ? -22.979 -12.349 -13.886 1.00 43.90  ? 110 THR B CB  1 
ATOM   5099 O  OG1 . THR B 1 110 ? -24.078 -13.211 -13.556 1.00 48.08  ? 110 THR B OG1 1 
ATOM   5100 C  CG2 . THR B 1 110 ? -22.708 -11.397 -12.723 1.00 33.47  ? 110 THR B CG2 1 
ATOM   5101 N  N   . VAL B 1 111 ? -21.608 -9.837  -15.299 1.00 30.92  ? 111 VAL B N   1 
ATOM   5102 C  CA  . VAL B 1 111 ? -20.398 -9.153  -15.736 1.00 24.01  ? 111 VAL B CA  1 
ATOM   5103 C  C   . VAL B 1 111 ? -19.547 -8.829  -14.517 1.00 29.12  ? 111 VAL B C   1 
ATOM   5104 O  O   . VAL B 1 111 ? -20.020 -8.177  -13.578 1.00 31.16  ? 111 VAL B O   1 
ATOM   5105 C  CB  . VAL B 1 111 ? -20.731 -7.857  -16.490 1.00 17.80  ? 111 VAL B CB  1 
ATOM   5106 C  CG1 . VAL B 1 111 ? -19.562 -7.435  -17.355 1.00 22.73  ? 111 VAL B CG1 1 
ATOM   5107 C  CG2 . VAL B 1 111 ? -21.972 -8.036  -17.291 1.00 18.49  ? 111 VAL B CG2 1 
ATOM   5108 N  N   . MET B 1 112 ? -18.288 -9.247  -14.550 1.00 16.50  ? 112 MET B N   1 
ATOM   5109 C  CA  . MET B 1 112 ? -17.300 -8.846  -13.561 1.00 15.97  ? 112 MET B CA  1 
ATOM   5110 C  C   . MET B 1 112 ? -16.224 -8.011  -14.236 1.00 23.35  ? 112 MET B C   1 
ATOM   5111 O  O   . MET B 1 112 ? -15.645 -8.438  -15.240 1.00 25.02  ? 112 MET B O   1 
ATOM   5112 C  CB  . MET B 1 112 ? -16.680 -10.067 -12.895 1.00 20.98  ? 112 MET B CB  1 
ATOM   5113 C  CG  . MET B 1 112 ? -17.684 -11.108 -12.510 1.00 41.88  ? 112 MET B CG  1 
ATOM   5114 S  SD  . MET B 1 112 ? -16.954 -12.122 -11.225 1.00 52.89  ? 112 MET B SD  1 
ATOM   5115 C  CE  . MET B 1 112 ? -16.580 -13.618 -12.101 1.00 56.33  ? 112 MET B CE  1 
ATOM   5116 N  N   . VAL B 1 113 ? -15.937 -6.845  -13.668 1.00 23.65  ? 113 VAL B N   1 
ATOM   5117 C  CA  . VAL B 1 113 ? -15.014 -5.871  -14.249 1.00 27.74  ? 113 VAL B CA  1 
ATOM   5118 C  C   . VAL B 1 113 ? -13.776 -5.773  -13.356 1.00 15.23  ? 113 VAL B C   1 
ATOM   5119 O  O   . VAL B 1 113 ? -13.835 -5.224  -12.251 1.00 23.92  ? 113 VAL B O   1 
ATOM   5120 C  CB  . VAL B 1 113 ? -15.686 -4.499  -14.423 1.00 27.28  ? 113 VAL B CB  1 
ATOM   5121 C  CG1 . VAL B 1 113 ? -14.674 -3.452  -14.815 1.00 24.04  ? 113 VAL B CG1 1 
ATOM   5122 C  CG2 . VAL B 1 113 ? -16.796 -4.569  -15.448 1.00 16.54  ? 113 VAL B CG2 1 
ATOM   5123 N  N   . TRP B 1 114 ? -12.643 -6.268  -13.836 1.00 21.45  ? 114 TRP B N   1 
ATOM   5124 C  CA  . TRP B 1 114 ? -11.408 -6.207  -13.060 1.00 19.97  ? 114 TRP B CA  1 
ATOM   5125 C  C   . TRP B 1 114 ? -10.768 -4.818  -13.090 1.00 22.40  ? 114 TRP B C   1 
ATOM   5126 O  O   . TRP B 1 114 ? -10.624 -4.196  -14.147 1.00 17.92  ? 114 TRP B O   1 
ATOM   5127 C  CB  . TRP B 1 114 ? -10.416 -7.234  -13.592 1.00 23.87  ? 114 TRP B CB  1 
ATOM   5128 C  CG  . TRP B 1 114 ? -9.150  -7.266  -12.822 1.00 31.05  ? 114 TRP B CG  1 
ATOM   5129 C  CD1 . TRP B 1 114 ? -7.905  -6.978  -13.283 1.00 28.49  ? 114 TRP B CD1 1 
ATOM   5130 C  CD2 . TRP B 1 114 ? -9.002  -7.598  -11.443 1.00 33.30  ? 114 TRP B CD2 1 
ATOM   5131 N  NE1 . TRP B 1 114 ? -6.986  -7.113  -12.279 1.00 32.05  ? 114 TRP B NE1 1 
ATOM   5132 C  CE2 . TRP B 1 114 ? -7.637  -7.491  -11.134 1.00 36.53  ? 114 TRP B CE2 1 
ATOM   5133 C  CE3 . TRP B 1 114 ? -9.895  -7.972  -10.437 1.00 36.06  ? 114 TRP B CE3 1 
ATOM   5134 C  CZ2 . TRP B 1 114 ? -7.140  -7.751  -9.862  1.00 42.89  ? 114 TRP B CZ2 1 
ATOM   5135 C  CZ3 . TRP B 1 114 ? -9.408  -8.225  -9.178  1.00 41.04  ? 114 TRP B CZ3 1 
ATOM   5136 C  CH2 . TRP B 1 114 ? -8.040  -8.115  -8.897  1.00 45.15  ? 114 TRP B CH2 1 
ATOM   5137 N  N   . ILE B 1 115 ? -10.336 -4.350  -11.925 1.00 26.04  ? 115 ILE B N   1 
ATOM   5138 C  CA  . ILE B 1 115 ? -9.677  -3.054  -11.784 1.00 25.93  ? 115 ILE B CA  1 
ATOM   5139 C  C   . ILE B 1 115 ? -8.287  -3.307  -11.212 1.00 22.48  ? 115 ILE B C   1 
ATOM   5140 O  O   . ILE B 1 115 ? -8.149  -3.581  -10.015 1.00 27.03  ? 115 ILE B O   1 
ATOM   5141 C  CB  . ILE B 1 115 ? -10.475 -2.110  -10.886 1.00 20.85  ? 115 ILE B CB  1 
ATOM   5142 C  CG1 . ILE B 1 115 ? -11.872 -1.926  -11.449 1.00 14.94  ? 115 ILE B CG1 1 
ATOM   5143 C  CG2 . ILE B 1 115 ? -9.778  -0.777  -10.782 1.00 14.78  ? 115 ILE B CG2 1 
ATOM   5144 C  CD1 . ILE B 1 115 ? -12.554 -0.687  -10.911 1.00 18.26  ? 115 ILE B CD1 1 
ATOM   5145 N  N   . TYR B 1 116 ? -7.251  -3.210  -12.042 1.00 20.99  ? 116 TYR B N   1 
ATOM   5146 C  CA  . TYR B 1 116 ? -5.918  -3.569  -11.566 1.00 20.74  ? 116 TYR B CA  1 
ATOM   5147 C  C   . TYR B 1 116 ? -5.428  -2.585  -10.503 1.00 25.29  ? 116 TYR B C   1 
ATOM   5148 O  O   . TYR B 1 116 ? -5.859  -1.427  -10.438 1.00 27.76  ? 116 TYR B O   1 
ATOM   5149 C  CB  . TYR B 1 116 ? -4.901  -3.644  -12.722 1.00 14.63  ? 116 TYR B CB  1 
ATOM   5150 C  CG  . TYR B 1 116 ? -4.686  -2.372  -13.533 1.00 20.04  ? 116 TYR B CG  1 
ATOM   5151 C  CD1 . TYR B 1 116 ? -4.151  -1.217  -12.957 1.00 15.95  ? 116 TYR B CD1 1 
ATOM   5152 C  CD2 . TYR B 1 116 ? -4.998  -2.339  -14.894 1.00 18.32  ? 116 TYR B CD2 1 
ATOM   5153 C  CE1 . TYR B 1 116 ? -3.956  -0.068  -13.701 1.00 23.03  ? 116 TYR B CE1 1 
ATOM   5154 C  CE2 . TYR B 1 116 ? -4.796  -1.199  -15.657 1.00 20.04  ? 116 TYR B CE2 1 
ATOM   5155 C  CZ  . TYR B 1 116 ? -4.283  -0.063  -15.062 1.00 27.70  ? 116 TYR B CZ  1 
ATOM   5156 O  OH  . TYR B 1 116 ? -4.102  1.071   -15.832 1.00 23.84  ? 116 TYR B OH  1 
ATOM   5157 N  N   . GLY B 1 117 ? -4.512  -3.066  -9.665  1.00 14.03  ? 117 GLY B N   1 
ATOM   5158 C  CA  . GLY B 1 117 ? -3.806  -2.241  -8.713  1.00 24.21  ? 117 GLY B CA  1 
ATOM   5159 C  C   . GLY B 1 117 ? -2.376  -1.954  -9.136  1.00 28.15  ? 117 GLY B C   1 
ATOM   5160 O  O   . GLY B 1 117 ? -2.001  -2.078  -10.308 1.00 30.56  ? 117 GLY B O   1 
ATOM   5161 N  N   . GLY B 1 118 ? -1.555  -1.579  -8.161  1.00 26.24  ? 118 GLY B N   1 
ATOM   5162 C  CA  . GLY B 1 118 ? -0.222  -1.111  -8.467  1.00 17.85  ? 118 GLY B CA  1 
ATOM   5163 C  C   . GLY B 1 118 ? 0.039   0.233   -7.818  1.00 18.59  ? 118 GLY B C   1 
ATOM   5164 O  O   . GLY B 1 118 ? 0.773   1.065   -8.362  1.00 17.04  ? 118 GLY B O   1 
ATOM   5165 N  N   . GLY B 1 119 ? -0.581  0.461   -6.657  1.00 20.42  ? 119 GLY B N   1 
ATOM   5166 C  CA  . GLY B 1 119 ? -0.336  1.670   -5.886  1.00 20.98  ? 119 GLY B CA  1 
ATOM   5167 C  C   . GLY B 1 119 ? -0.744  2.971   -6.540  1.00 18.51  ? 119 GLY B C   1 
ATOM   5168 O  O   . GLY B 1 119 ? -0.280  4.031   -6.120  1.00 21.08  ? 119 GLY B O   1 
ATOM   5169 N  N   . PHE B 1 120 ? -1.608  2.922   -7.553  1.00 23.01  ? 120 PHE B N   1 
ATOM   5170 C  CA  . PHE B 1 120 ? -1.940  4.046   -8.426  1.00 20.79  ? 120 PHE B CA  1 
ATOM   5171 C  C   . PHE B 1 120 ? -0.723  4.604   -9.166  1.00 19.98  ? 120 PHE B C   1 
ATOM   5172 O  O   . PHE B 1 120 ? -0.813  5.676   -9.777  1.00 17.14  ? 120 PHE B O   1 
ATOM   5173 C  CB  . PHE B 1 120 ? -2.656  5.174   -7.661  1.00 18.87  ? 120 PHE B CB  1 
ATOM   5174 C  CG  . PHE B 1 120 ? -3.873  4.721   -6.887  1.00 29.05  ? 120 PHE B CG  1 
ATOM   5175 C  CD1 . PHE B 1 120 ? -5.113  4.698   -7.486  1.00 28.19  ? 120 PHE B CD1 1 
ATOM   5176 C  CD2 . PHE B 1 120 ? -3.785  4.368   -5.543  1.00 37.36  ? 120 PHE B CD2 1 
ATOM   5177 C  CE1 . PHE B 1 120 ? -6.235  4.303   -6.776  1.00 29.09  ? 120 PHE B CE1 1 
ATOM   5178 C  CE2 . PHE B 1 120 ? -4.913  3.982   -4.836  1.00 30.35  ? 120 PHE B CE2 1 
ATOM   5179 C  CZ  . PHE B 1 120 ? -6.132  3.946   -5.457  1.00 21.10  ? 120 PHE B CZ  1 
ATOM   5180 N  N   . TYR B 1 121 ? 0.419   3.912   -9.121  1.00 19.00  ? 121 TYR B N   1 
ATOM   5181 C  CA  . TYR B 1 121 ? 1.593   4.319   -9.874  1.00 21.08  ? 121 TYR B CA  1 
ATOM   5182 C  C   . TYR B 1 121 ? 1.938   3.343   -10.991 1.00 26.73  ? 121 TYR B C   1 
ATOM   5183 O  O   . TYR B 1 121 ? 2.763   3.673   -11.849 1.00 27.45  ? 121 TYR B O   1 
ATOM   5184 C  CB  . TYR B 1 121 ? 2.803   4.508   -8.932  1.00 22.43  ? 121 TYR B CB  1 
ATOM   5185 C  CG  . TYR B 1 121 ? 3.522   3.252   -8.444  1.00 22.28  ? 121 TYR B CG  1 
ATOM   5186 C  CD1 . TYR B 1 121 ? 4.408   2.571   -9.267  1.00 27.34  ? 121 TYR B CD1 1 
ATOM   5187 C  CD2 . TYR B 1 121 ? 3.361   2.792   -7.145  1.00 32.06  ? 121 TYR B CD2 1 
ATOM   5188 C  CE1 . TYR B 1 121 ? 5.075   1.441   -8.838  1.00 39.41  ? 121 TYR B CE1 1 
ATOM   5189 C  CE2 . TYR B 1 121 ? 4.040   1.657   -6.690  1.00 38.65  ? 121 TYR B CE2 1 
ATOM   5190 C  CZ  . TYR B 1 121 ? 4.899   0.981   -7.547  1.00 41.89  ? 121 TYR B CZ  1 
ATOM   5191 O  OH  . TYR B 1 121 ? 5.601   -0.149  -7.137  1.00 33.50  ? 121 TYR B OH  1 
ATOM   5192 N  N   . SER B 1 122 ? 1.311   2.172   -11.018 1.00 24.36  ? 122 SER B N   1 
ATOM   5193 C  CA  . SER B 1 122 ? 1.679   1.115   -11.944 1.00 22.86  ? 122 SER B CA  1 
ATOM   5194 C  C   . SER B 1 122 ? 0.454   0.250   -12.200 1.00 20.48  ? 122 SER B C   1 
ATOM   5195 O  O   . SER B 1 122 ? -0.572  0.377   -11.530 1.00 20.81  ? 122 SER B O   1 
ATOM   5196 C  CB  . SER B 1 122 ? 2.834   0.269   -11.394 1.00 20.36  ? 122 SER B CB  1 
ATOM   5197 O  OG  . SER B 1 122 ? 2.483   -0.370  -10.162 1.00 25.30  ? 122 SER B OG  1 
ATOM   5198 N  N   . GLY B 1 123 ? 0.569   -0.644  -13.173 1.00 19.19  ? 123 GLY B N   1 
ATOM   5199 C  CA  . GLY B 1 123 ? -0.515  -1.562  -13.423 1.00 23.23  ? 123 GLY B CA  1 
ATOM   5200 C  C   . GLY B 1 123 ? -0.951  -1.616  -14.870 1.00 28.17  ? 123 GLY B C   1 
ATOM   5201 O  O   . GLY B 1 123 ? -0.984  -0.601  -15.572 1.00 23.43  ? 123 GLY B O   1 
ATOM   5202 N  N   . SER B 1 124 ? -1.320  -2.814  -15.307 1.00 35.28  ? 124 SER B N   1 
ATOM   5203 C  CA  . SER B 1 124 ? -1.692  -3.085  -16.683 1.00 40.97  ? 124 SER B CA  1 
ATOM   5204 C  C   . SER B 1 124 ? -2.915  -3.974  -16.697 1.00 41.66  ? 124 SER B C   1 
ATOM   5205 O  O   . SER B 1 124 ? -3.039  -4.884  -15.875 1.00 48.46  ? 124 SER B O   1 
ATOM   5206 C  CB  . SER B 1 124 ? -0.562  -3.773  -17.441 1.00 39.01  ? 124 SER B CB  1 
ATOM   5207 O  OG  . SER B 1 124 ? 0.603   -2.979  -17.402 1.00 38.95  ? 124 SER B OG  1 
ATOM   5208 N  N   . SER B 1 125 ? -3.825  -3.696  -17.622 1.00 39.30  ? 125 SER B N   1 
ATOM   5209 C  CA  . SER B 1 125 ? -4.911  -4.633  -17.844 1.00 34.82  ? 125 SER B CA  1 
ATOM   5210 C  C   . SER B 1 125 ? -4.456  -5.886  -18.575 1.00 37.00  ? 125 SER B C   1 
ATOM   5211 O  O   . SER B 1 125 ? -5.222  -6.851  -18.625 1.00 39.08  ? 125 SER B O   1 
ATOM   5212 C  CB  . SER B 1 125 ? -6.042  -3.951  -18.615 1.00 31.83  ? 125 SER B CB  1 
ATOM   5213 O  OG  . SER B 1 125 ? -5.596  -3.449  -19.860 1.00 40.79  ? 125 SER B OG  1 
ATOM   5214 N  N   . THR B 1 126 ? -3.224  -5.922  -19.092 1.00 31.88  ? 126 THR B N   1 
ATOM   5215 C  CA  . THR B 1 126 ? -2.834  -6.949  -20.049 1.00 30.09  ? 126 THR B CA  1 
ATOM   5216 C  C   . THR B 1 126 ? -1.840  -7.965  -19.488 1.00 35.24  ? 126 THR B C   1 
ATOM   5217 O  O   . THR B 1 126 ? -1.343  -8.816  -20.243 1.00 37.71  ? 126 THR B O   1 
ATOM   5218 C  CB  . THR B 1 126 ? -2.278  -6.277  -21.299 1.00 31.69  ? 126 THR B CB  1 
ATOM   5219 O  OG1 . THR B 1 126 ? -0.926  -5.874  -21.077 1.00 26.34  ? 126 THR B OG1 1 
ATOM   5220 C  CG2 . THR B 1 126 ? -3.125  -5.042  -21.614 1.00 42.30  ? 126 THR B CG2 1 
ATOM   5221 N  N   . LEU B 1 127 ? -1.573  -7.917  -18.181 1.00 25.83  ? 127 LEU B N   1 
ATOM   5222 C  CA  . LEU B 1 127 ? -0.692  -8.868  -17.510 1.00 18.54  ? 127 LEU B CA  1 
ATOM   5223 C  C   . LEU B 1 127 ? -1.148  -10.298 -17.742 1.00 26.01  ? 127 LEU B C   1 
ATOM   5224 O  O   . LEU B 1 127 ? -2.336  -10.565 -17.941 1.00 33.64  ? 127 LEU B O   1 
ATOM   5225 C  CB  . LEU B 1 127 ? -0.690  -8.597  -16.012 1.00 21.29  ? 127 LEU B CB  1 
ATOM   5226 C  CG  . LEU B 1 127 ? -0.065  -7.274  -15.582 1.00 31.25  ? 127 LEU B CG  1 
ATOM   5227 C  CD1 . LEU B 1 127 ? -0.014  -7.240  -14.086 1.00 37.33  ? 127 LEU B CD1 1 
ATOM   5228 C  CD2 . LEU B 1 127 ? 1.345   -7.146  -16.153 1.00 35.56  ? 127 LEU B CD2 1 
ATOM   5229 N  N   . ASP B 1 128 ? -0.190  -11.229 -17.689 1.00 28.81  ? 128 ASP B N   1 
ATOM   5230 C  CA  . ASP B 1 128 ? -0.538  -12.643 -17.802 1.00 33.13  ? 128 ASP B CA  1 
ATOM   5231 C  C   . ASP B 1 128 ? -1.506  -13.071 -16.702 1.00 34.77  ? 128 ASP B C   1 
ATOM   5232 O  O   . ASP B 1 128 ? -2.463  -13.810 -16.964 1.00 35.52  ? 128 ASP B O   1 
ATOM   5233 C  CB  . ASP B 1 128 ? 0.722   -13.506 -17.770 1.00 37.37  ? 128 ASP B CB  1 
ATOM   5234 C  CG  . ASP B 1 128 ? 1.324   -13.701 -19.145 1.00 56.27  ? 128 ASP B CG  1 
ATOM   5235 O  OD1 . ASP B 1 128 ? 1.148   -12.800 -19.996 1.00 64.74  ? 128 ASP B OD1 1 
ATOM   5236 O  OD2 . ASP B 1 128 ? 1.970   -14.749 -19.380 1.00 59.65  ? 128 ASP B OD2 1 
ATOM   5237 N  N   . VAL B 1 129 ? -1.293  -12.594 -15.472 1.00 29.00  ? 129 VAL B N   1 
ATOM   5238 C  CA  . VAL B 1 129 ? -2.080  -13.064 -14.337 1.00 27.64  ? 129 VAL B CA  1 
ATOM   5239 C  C   . VAL B 1 129 ? -3.517  -12.541 -14.364 1.00 37.51  ? 129 VAL B C   1 
ATOM   5240 O  O   . VAL B 1 129 ? -4.392  -13.122 -13.713 1.00 42.60  ? 129 VAL B O   1 
ATOM   5241 C  CB  . VAL B 1 129 ? -1.356  -12.677 -13.038 1.00 36.54  ? 129 VAL B CB  1 
ATOM   5242 C  CG1 . VAL B 1 129 ? -1.353  -11.173 -12.876 1.00 43.39  ? 129 VAL B CG1 1 
ATOM   5243 C  CG2 . VAL B 1 129 ? -1.958  -13.384 -11.830 1.00 39.13  ? 129 VAL B CG2 1 
ATOM   5244 N  N   . TYR B 1 130 ? -3.806  -11.480 -15.122 1.00 37.53  ? 130 TYR B N   1 
ATOM   5245 C  CA  . TYR B 1 130 ? -5.182  -11.044 -15.340 1.00 31.63  ? 130 TYR B CA  1 
ATOM   5246 C  C   . TYR B 1 130 ? -5.786  -11.604 -16.632 1.00 35.24  ? 130 TYR B C   1 
ATOM   5247 O  O   . TYR B 1 130 ? -6.732  -11.016 -17.167 1.00 38.15  ? 130 TYR B O   1 
ATOM   5248 C  CB  . TYR B 1 130 ? -5.270  -9.520  -15.377 1.00 26.66  ? 130 TYR B CB  1 
ATOM   5249 C  CG  . TYR B 1 130 ? -4.561  -8.815  -14.260 1.00 29.60  ? 130 TYR B CG  1 
ATOM   5250 C  CD1 . TYR B 1 130 ? -4.336  -9.442  -13.045 1.00 37.32  ? 130 TYR B CD1 1 
ATOM   5251 C  CD2 . TYR B 1 130 ? -4.093  -7.515  -14.437 1.00 28.13  ? 130 TYR B CD2 1 
ATOM   5252 C  CE1 . TYR B 1 130 ? -3.667  -8.783  -12.029 1.00 47.07  ? 130 TYR B CE1 1 
ATOM   5253 C  CE2 . TYR B 1 130 ? -3.430  -6.852  -13.441 1.00 37.73  ? 130 TYR B CE2 1 
ATOM   5254 C  CZ  . TYR B 1 130 ? -3.214  -7.487  -12.237 1.00 39.98  ? 130 TYR B CZ  1 
ATOM   5255 O  OH  . TYR B 1 130 ? -2.547  -6.830  -11.229 1.00 31.34  ? 130 TYR B OH  1 
ATOM   5256 N  N   . ASN B 1 131 ? -5.255  -12.699 -17.161 1.00 31.05  ? 131 ASN B N   1 
ATOM   5257 C  CA  . ASN B 1 131 ? -5.884  -13.315 -18.314 1.00 40.91  ? 131 ASN B CA  1 
ATOM   5258 C  C   . ASN B 1 131 ? -7.276  -13.778 -17.898 1.00 39.35  ? 131 ASN B C   1 
ATOM   5259 O  O   . ASN B 1 131 ? -7.417  -14.647 -17.033 1.00 39.59  ? 131 ASN B O   1 
ATOM   5260 C  CB  . ASN B 1 131 ? -5.030  -14.469 -18.832 1.00 48.39  ? 131 ASN B CB  1 
ATOM   5261 C  CG  . ASN B 1 131 ? -5.590  -15.092 -20.090 1.00 55.60  ? 131 ASN B CG  1 
ATOM   5262 O  OD1 . ASN B 1 131 ? -6.743  -14.854 -20.469 1.00 57.26  ? 131 ASN B OD1 1 
ATOM   5263 N  ND2 . ASN B 1 131 ? -4.755  -15.864 -20.777 1.00 55.46  ? 131 ASN B ND2 1 
ATOM   5264 N  N   . GLY B 1 132 ? -8.303  -13.170 -18.490 1.00 37.96  ? 132 GLY B N   1 
ATOM   5265 C  CA  . GLY B 1 132 ? -9.668  -13.427 -18.088 1.00 27.22  ? 132 GLY B CA  1 
ATOM   5266 C  C   . GLY B 1 132 ? -10.281 -14.683 -18.652 1.00 19.49  ? 132 GLY B C   1 
ATOM   5267 O  O   . GLY B 1 132 ? -11.337 -15.106 -18.176 1.00 24.11  ? 132 GLY B O   1 
ATOM   5268 N  N   . LYS B 1 133 ? -9.635  -15.310 -19.631 1.00 25.51  ? 133 LYS B N   1 
ATOM   5269 C  CA  . LYS B 1 133 ? -10.268 -16.427 -20.328 1.00 31.21  ? 133 LYS B CA  1 
ATOM   5270 C  C   . LYS B 1 133 ? -10.629 -17.553 -19.372 1.00 28.06  ? 133 LYS B C   1 
ATOM   5271 O  O   . LYS B 1 133 ? -11.665 -18.202 -19.542 1.00 32.10  ? 133 LYS B O   1 
ATOM   5272 C  CB  . LYS B 1 133 ? -9.366  -16.954 -21.455 1.00 31.08  ? 133 LYS B CB  1 
ATOM   5273 C  CG  . LYS B 1 133 ? -8.120  -17.771 -21.031 1.00 23.04  ? 133 LYS B CG  1 
ATOM   5274 C  CD  . LYS B 1 133 ? -7.586  -18.533 -22.249 1.00 27.72  ? 133 LYS B CD  1 
ATOM   5275 C  CE  . LYS B 1 133 ? -6.239  -19.213 -22.037 1.00 23.73  ? 133 LYS B CE  1 
ATOM   5276 N  NZ  . LYS B 1 133 ? -5.193  -18.570 -22.880 1.00 20.12  ? 133 LYS B NZ  1 
ATOM   5277 N  N   . TYR B 1 134 ? -9.804  -17.795 -18.353 1.00 23.39  ? 134 TYR B N   1 
ATOM   5278 C  CA  . TYR B 1 134 ? -10.060 -18.939 -17.486 1.00 17.87  ? 134 TYR B CA  1 
ATOM   5279 C  C   . TYR B 1 134 ? -11.331 -18.733 -16.670 1.00 36.75  ? 134 TYR B C   1 
ATOM   5280 O  O   . TYR B 1 134 ? -12.224 -19.589 -16.671 1.00 38.58  ? 134 TYR B O   1 
ATOM   5281 C  CB  . TYR B 1 134 ? -8.847  -19.212 -16.594 1.00 17.58  ? 134 TYR B CB  1 
ATOM   5282 C  CG  . TYR B 1 134 ? -7.568  -19.434 -17.394 1.00 31.94  ? 134 TYR B CG  1 
ATOM   5283 C  CD1 . TYR B 1 134 ? -7.362  -20.611 -18.103 1.00 25.00  ? 134 TYR B CD1 1 
ATOM   5284 C  CD2 . TYR B 1 134 ? -6.579  -18.455 -17.460 1.00 33.17  ? 134 TYR B CD2 1 
ATOM   5285 C  CE1 . TYR B 1 134 ? -6.220  -20.803 -18.840 1.00 19.03  ? 134 TYR B CE1 1 
ATOM   5286 C  CE2 . TYR B 1 134 ? -5.434  -18.646 -18.196 1.00 25.83  ? 134 TYR B CE2 1 
ATOM   5287 C  CZ  . TYR B 1 134 ? -5.260  -19.821 -18.888 1.00 31.78  ? 134 TYR B CZ  1 
ATOM   5288 O  OH  . TYR B 1 134 ? -4.118  -20.023 -19.647 1.00 41.85  ? 134 TYR B OH  1 
ATOM   5289 N  N   . LEU B 1 135 ? -11.462 -17.586 -16.006 1.00 27.79  ? 135 LEU B N   1 
ATOM   5290 C  CA  . LEU B 1 135 ? -12.602 -17.435 -15.113 1.00 28.74  ? 135 LEU B CA  1 
ATOM   5291 C  C   . LEU B 1 135 ? -13.904 -17.183 -15.874 1.00 21.09  ? 135 LEU B C   1 
ATOM   5292 O  O   . LEU B 1 135 ? -14.950 -17.700 -15.465 1.00 17.38  ? 135 LEU B O   1 
ATOM   5293 C  CB  . LEU B 1 135 ? -12.328 -16.329 -14.086 1.00 30.65  ? 135 LEU B CB  1 
ATOM   5294 C  CG  . LEU B 1 135 ? -13.500 -15.610 -13.394 1.00 27.29  ? 135 LEU B CG  1 
ATOM   5295 C  CD1 . LEU B 1 135 ? -14.267 -16.517 -12.413 1.00 18.47  ? 135 LEU B CD1 1 
ATOM   5296 C  CD2 . LEU B 1 135 ? -13.015 -14.368 -12.690 1.00 19.78  ? 135 LEU B CD2 1 
ATOM   5297 N  N   . ALA B 1 136 ? -13.873 -16.431 -16.983 1.00 25.34  ? 136 ALA B N   1 
ATOM   5298 C  CA  . ALA B 1 136 ? -15.082 -16.286 -17.801 1.00 29.83  ? 136 ALA B CA  1 
ATOM   5299 C  C   . ALA B 1 136 ? -15.544 -17.636 -18.333 1.00 26.41  ? 136 ALA B C   1 
ATOM   5300 O  O   . ALA B 1 136 ? -16.735 -17.964 -18.274 1.00 19.66  ? 136 ALA B O   1 
ATOM   5301 C  CB  . ALA B 1 136 ? -14.852 -15.316 -18.961 1.00 23.53  ? 136 ALA B CB  1 
ATOM   5302 N  N   . TYR B 1 137 ? -14.606 -18.436 -18.848 1.00 18.75  ? 137 TYR B N   1 
ATOM   5303 C  CA  . TYR B 1 137 ? -14.938 -19.771 -19.341 1.00 24.38  ? 137 TYR B CA  1 
ATOM   5304 C  C   . TYR B 1 137 ? -15.523 -20.660 -18.243 1.00 39.75  ? 137 TYR B C   1 
ATOM   5305 O  O   . TYR B 1 137 ? -16.516 -21.364 -18.466 1.00 39.86  ? 137 TYR B O   1 
ATOM   5306 C  CB  . TYR B 1 137 ? -13.695 -20.427 -19.940 1.00 25.89  ? 137 TYR B CB  1 
ATOM   5307 C  CG  . TYR B 1 137 ? -13.873 -21.884 -20.302 1.00 40.07  ? 137 TYR B CG  1 
ATOM   5308 C  CD1 . TYR B 1 137 ? -13.393 -22.897 -19.469 1.00 40.68  ? 137 TYR B CD1 1 
ATOM   5309 C  CD2 . TYR B 1 137 ? -14.526 -22.249 -21.474 1.00 43.35  ? 137 TYR B CD2 1 
ATOM   5310 C  CE1 . TYR B 1 137 ? -13.557 -24.231 -19.802 1.00 41.65  ? 137 TYR B CE1 1 
ATOM   5311 C  CE2 . TYR B 1 137 ? -14.696 -23.574 -21.815 1.00 44.19  ? 137 TYR B CE2 1 
ATOM   5312 C  CZ  . TYR B 1 137 ? -14.212 -24.562 -20.982 1.00 44.47  ? 137 TYR B CZ  1 
ATOM   5313 O  OH  . TYR B 1 137 ? -14.396 -25.876 -21.351 1.00 40.15  ? 137 TYR B OH  1 
ATOM   5314 N  N   . THR B 1 138 ? -14.908 -20.659 -17.053 1.00 42.98  ? 138 THR B N   1 
ATOM   5315 C  CA  . THR B 1 138 ? -15.232 -21.660 -16.036 1.00 33.95  ? 138 THR B CA  1 
ATOM   5316 C  C   . THR B 1 138 ? -16.540 -21.360 -15.310 1.00 33.66  ? 138 THR B C   1 
ATOM   5317 O  O   . THR B 1 138 ? -17.293 -22.283 -14.982 1.00 43.08  ? 138 THR B O   1 
ATOM   5318 C  CB  . THR B 1 138 ? -14.083 -21.777 -15.031 1.00 35.98  ? 138 THR B CB  1 
ATOM   5319 O  OG1 . THR B 1 138 ? -12.927 -22.324 -15.676 1.00 40.40  ? 138 THR B OG1 1 
ATOM   5320 C  CG2 . THR B 1 138 ? -14.462 -22.678 -13.872 1.00 41.18  ? 138 THR B CG2 1 
ATOM   5321 N  N   . GLU B 1 139 ? -16.834 -20.092 -15.041 1.00 18.38  ? 139 GLU B N   1 
ATOM   5322 C  CA  . GLU B 1 139 ? -18.056 -19.723 -14.344 1.00 24.50  ? 139 GLU B CA  1 
ATOM   5323 C  C   . GLU B 1 139 ? -19.058 -18.985 -15.223 1.00 32.66  ? 139 GLU B C   1 
ATOM   5324 O  O   . GLU B 1 139 ? -19.994 -18.373 -14.695 1.00 32.16  ? 139 GLU B O   1 
ATOM   5325 C  CB  . GLU B 1 139 ? -17.731 -18.906 -13.099 1.00 23.32  ? 139 GLU B CB  1 
ATOM   5326 C  CG  . GLU B 1 139 ? -16.563 -19.473 -12.358 1.00 31.44  ? 139 GLU B CG  1 
ATOM   5327 C  CD  . GLU B 1 139 ? -16.964 -20.644 -11.477 1.00 42.56  ? 139 GLU B CD  1 
ATOM   5328 O  OE1 . GLU B 1 139 ? -18.157 -20.747 -11.105 1.00 39.55  ? 139 GLU B OE1 1 
ATOM   5329 O  OE2 . GLU B 1 139 ? -16.086 -21.506 -11.207 1.00 61.99  ? 139 GLU B OE2 1 
ATOM   5330 N  N   . GLU B 1 140 ? -18.902 -19.057 -16.543 1.00 28.88  ? 140 GLU B N   1 
ATOM   5331 C  CA  . GLU B 1 140 ? -19.866 -18.534 -17.506 1.00 30.18  ? 140 GLU B CA  1 
ATOM   5332 C  C   . GLU B 1 140 ? -20.293 -17.114 -17.153 1.00 38.10  ? 140 GLU B C   1 
ATOM   5333 O  O   . GLU B 1 140 ? -21.456 -16.841 -16.846 1.00 50.22  ? 140 GLU B O   1 
ATOM   5334 C  CB  . GLU B 1 140 ? -21.083 -19.447 -17.614 1.00 39.52  ? 140 GLU B CB  1 
ATOM   5335 C  CG  . GLU B 1 140 ? -20.749 -20.889 -17.908 1.00 55.51  ? 140 GLU B CG  1 
ATOM   5336 C  CD  . GLU B 1 140 ? -21.972 -21.690 -18.308 1.00 70.56  ? 140 GLU B CD  1 
ATOM   5337 O  OE1 . GLU B 1 140 ? -22.207 -21.808 -19.533 1.00 75.56  ? 140 GLU B OE1 1 
ATOM   5338 O  OE2 . GLU B 1 140 ? -22.695 -22.185 -17.406 1.00 69.44  ? 140 GLU B OE2 1 
ATOM   5339 N  N   . VAL B 1 141 ? -19.314 -16.212 -17.166 1.00 18.56  ? 141 VAL B N   1 
ATOM   5340 C  CA  . VAL B 1 141 ? -19.571 -14.804 -16.916 1.00 18.24  ? 141 VAL B CA  1 
ATOM   5341 C  C   . VAL B 1 141 ? -18.850 -13.993 -17.985 1.00 18.27  ? 141 VAL B C   1 
ATOM   5342 O  O   . VAL B 1 141 ? -17.886 -14.450 -18.602 1.00 18.33  ? 141 VAL B O   1 
ATOM   5343 C  CB  . VAL B 1 141 ? -19.137 -14.365 -15.485 1.00 29.51  ? 141 VAL B CB  1 
ATOM   5344 C  CG1 . VAL B 1 141 ? -19.757 -15.262 -14.440 1.00 17.61  ? 141 VAL B CG1 1 
ATOM   5345 C  CG2 . VAL B 1 141 ? -17.627 -14.336 -15.323 1.00 17.12  ? 141 VAL B CG2 1 
ATOM   5346 N  N   . VAL B 1 142 ? -19.348 -12.782 -18.214 1.00 18.30  ? 142 VAL B N   1 
ATOM   5347 C  CA  . VAL B 1 142 ? -18.707 -11.820 -19.106 1.00 21.20  ? 142 VAL B CA  1 
ATOM   5348 C  C   . VAL B 1 142 ? -17.666 -11.083 -18.286 1.00 23.83  ? 142 VAL B C   1 
ATOM   5349 O  O   . VAL B 1 142 ? -18.017 -10.267 -17.433 1.00 38.74  ? 142 VAL B O   1 
ATOM   5350 C  CB  . VAL B 1 142 ? -19.711 -10.832 -19.707 1.00 18.76  ? 142 VAL B CB  1 
ATOM   5351 C  CG1 . VAL B 1 142 ? -18.983 -9.669  -20.304 1.00 18.72  ? 142 VAL B CG1 1 
ATOM   5352 C  CG2 . VAL B 1 142 ? -20.561 -11.512 -20.735 1.00 19.51  ? 142 VAL B CG2 1 
ATOM   5353 N  N   . LEU B 1 143 ? -16.388 -11.367 -18.540 1.00 29.15  ? 143 LEU B N   1 
ATOM   5354 C  CA  . LEU B 1 143 ? -15.289 -10.759 -17.800 1.00 23.61  ? 143 LEU B CA  1 
ATOM   5355 C  C   . LEU B 1 143 ? -14.749 -9.563  -18.575 1.00 21.08  ? 143 LEU B C   1 
ATOM   5356 O  O   . LEU B 1 143 ? -14.373 -9.691  -19.742 1.00 26.64  ? 143 LEU B O   1 
ATOM   5357 C  CB  . LEU B 1 143 ? -14.181 -11.775 -17.537 1.00 30.14  ? 143 LEU B CB  1 
ATOM   5358 C  CG  . LEU B 1 143 ? -13.360 -11.535 -16.266 1.00 34.97  ? 143 LEU B CG  1 
ATOM   5359 C  CD1 . LEU B 1 143 ? -12.542 -12.772 -15.947 1.00 38.56  ? 143 LEU B CD1 1 
ATOM   5360 C  CD2 . LEU B 1 143 ? -12.458 -10.309 -16.378 1.00 24.38  ? 143 LEU B CD2 1 
ATOM   5361 N  N   . VAL B 1 144 ? -14.711 -8.413  -17.918 1.00 24.60  ? 144 VAL B N   1 
ATOM   5362 C  CA  . VAL B 1 144 ? -14.169 -7.175  -18.459 1.00 21.78  ? 144 VAL B CA  1 
ATOM   5363 C  C   . VAL B 1 144 ? -12.979 -6.748  -17.611 1.00 20.17  ? 144 VAL B C   1 
ATOM   5364 O  O   . VAL B 1 144 ? -12.956 -6.937  -16.392 1.00 28.10  ? 144 VAL B O   1 
ATOM   5365 C  CB  . VAL B 1 144 ? -15.239 -6.061  -18.507 1.00 19.56  ? 144 VAL B CB  1 
ATOM   5366 C  CG1 . VAL B 1 144 ? -14.616 -4.691  -18.770 1.00 20.21  ? 144 VAL B CG1 1 
ATOM   5367 C  CG2 . VAL B 1 144 ? -16.258 -6.375  -19.563 1.00 22.57  ? 144 VAL B CG2 1 
ATOM   5368 N  N   . SER B 1 145 ? -11.989 -6.161  -18.273 1.00 28.94  ? 145 SER B N   1 
ATOM   5369 C  CA  . SER B 1 145 ? -10.740 -5.721  -17.659 1.00 26.48  ? 145 SER B CA  1 
ATOM   5370 C  C   . SER B 1 145 ? -10.420 -4.336  -18.213 1.00 23.75  ? 145 SER B C   1 
ATOM   5371 O  O   . SER B 1 145 ? -10.116 -4.203  -19.403 1.00 19.11  ? 145 SER B O   1 
ATOM   5372 C  CB  . SER B 1 145 ? -9.629  -6.724  -17.966 1.00 22.98  ? 145 SER B CB  1 
ATOM   5373 O  OG  . SER B 1 145 ? -8.376  -6.085  -18.047 1.00 36.25  ? 145 SER B OG  1 
ATOM   5374 N  N   . LEU B 1 146 ? -10.513 -3.307  -17.372 1.00 20.43  ? 146 LEU B N   1 
ATOM   5375 C  CA  . LEU B 1 146 ? -10.388 -1.929  -17.817 1.00 16.61  ? 146 LEU B CA  1 
ATOM   5376 C  C   . LEU B 1 146 ? -8.972  -1.427  -17.573 1.00 16.50  ? 146 LEU B C   1 
ATOM   5377 O  O   . LEU B 1 146 ? -8.112  -2.159  -17.092 1.00 35.15  ? 146 LEU B O   1 
ATOM   5378 C  CB  . LEU B 1 146 ? -11.424 -1.040  -17.117 1.00 16.63  ? 146 LEU B CB  1 
ATOM   5379 C  CG  . LEU B 1 146 ? -11.531 -0.969  -15.581 1.00 21.84  ? 146 LEU B CG  1 
ATOM   5380 C  CD1 . LEU B 1 146 ? -10.386 -0.175  -14.920 1.00 16.92  ? 146 LEU B CD1 1 
ATOM   5381 C  CD2 . LEU B 1 146 ? -12.887 -0.391  -15.159 1.00 16.33  ? 146 LEU B CD2 1 
ATOM   5382 N  N   . SER B 1 147 ? -8.741  -0.149  -17.891 1.00 30.08  ? 147 SER B N   1 
ATOM   5383 C  CA  . SER B 1 147 ? -7.461  0.529   -17.680 1.00 30.08  ? 147 SER B CA  1 
ATOM   5384 C  C   . SER B 1 147 ? -7.724  1.948   -17.184 1.00 26.88  ? 147 SER B C   1 
ATOM   5385 O  O   . SER B 1 147 ? -8.853  2.434   -17.225 1.00 25.14  ? 147 SER B O   1 
ATOM   5386 C  CB  . SER B 1 147 ? -6.632  0.560   -18.967 1.00 33.32  ? 147 SER B CB  1 
ATOM   5387 O  OG  . SER B 1 147 ? -7.461  0.959   -20.044 1.00 39.72  ? 147 SER B OG  1 
ATOM   5388 N  N   . TYR B 1 148 ? -6.673  2.618   -16.712 1.00 23.71  ? 148 TYR B N   1 
ATOM   5389 C  CA  . TYR B 1 148 ? -6.781  3.997   -16.224 1.00 26.37  ? 148 TYR B CA  1 
ATOM   5390 C  C   . TYR B 1 148 ? -5.380  4.552   -15.998 1.00 24.81  ? 148 TYR B C   1 
ATOM   5391 O  O   . TYR B 1 148 ? -4.475  3.827   -15.561 1.00 20.35  ? 148 TYR B O   1 
ATOM   5392 C  CB  . TYR B 1 148 ? -7.597  4.103   -14.917 1.00 25.53  ? 148 TYR B CB  1 
ATOM   5393 C  CG  . TYR B 1 148 ? -6.992  3.324   -13.757 1.00 29.91  ? 148 TYR B CG  1 
ATOM   5394 C  CD1 . TYR B 1 148 ? -7.168  1.943   -13.663 1.00 22.18  ? 148 TYR B CD1 1 
ATOM   5395 C  CD2 . TYR B 1 148 ? -6.235  3.962   -12.770 1.00 23.52  ? 148 TYR B CD2 1 
ATOM   5396 C  CE1 . TYR B 1 148 ? -6.614  1.218   -12.632 1.00 25.09  ? 148 TYR B CE1 1 
ATOM   5397 C  CE2 . TYR B 1 148 ? -5.668  3.234   -11.726 1.00 18.69  ? 148 TYR B CE2 1 
ATOM   5398 C  CZ  . TYR B 1 148 ? -5.858  1.857   -11.675 1.00 20.86  ? 148 TYR B CZ  1 
ATOM   5399 O  OH  . TYR B 1 148 ? -5.325  1.100   -10.657 1.00 19.73  ? 148 TYR B OH  1 
ATOM   5400 N  N   . ARG B 1 149 ? -5.215  5.843   -16.276 1.00 18.01  ? 149 ARG B N   1 
ATOM   5401 C  CA  . ARG B 1 149 ? -3.921  6.463   -16.054 1.00 27.03  ? 149 ARG B CA  1 
ATOM   5402 C  C   . ARG B 1 149 ? -3.500  6.371   -14.593 1.00 39.22  ? 149 ARG B C   1 
ATOM   5403 O  O   . ARG B 1 149 ? -4.306  6.561   -13.679 1.00 40.33  ? 149 ARG B O   1 
ATOM   5404 C  CB  . ARG B 1 149 ? -3.921  7.925   -16.488 1.00 24.56  ? 149 ARG B CB  1 
ATOM   5405 C  CG  . ARG B 1 149 ? -4.381  8.166   -17.883 1.00 28.56  ? 149 ARG B CG  1 
ATOM   5406 C  CD  . ARG B 1 149 ? -4.873  9.571   -18.038 1.00 34.53  ? 149 ARG B CD  1 
ATOM   5407 N  NE  . ARG B 1 149 ? -6.325  9.587   -18.089 1.00 45.67  ? 149 ARG B NE  1 
ATOM   5408 C  CZ  . ARG B 1 149 ? -7.055  10.689  -18.156 1.00 45.26  ? 149 ARG B CZ  1 
ATOM   5409 N  NH1 . ARG B 1 149 ? -6.448  11.865  -18.176 1.00 30.19  ? 149 ARG B NH1 1 
ATOM   5410 N  NH2 . ARG B 1 149 ? -8.380  10.593  -18.202 1.00 47.60  ? 149 ARG B NH2 1 
ATOM   5411 N  N   . VAL B 1 150 ? -2.208  6.124   -14.385 1.00 33.48  ? 150 VAL B N   1 
ATOM   5412 C  CA  . VAL B 1 150 ? -1.645  5.974   -13.060 1.00 32.27  ? 150 VAL B CA  1 
ATOM   5413 C  C   . VAL B 1 150 ? -0.553  7.022   -12.857 1.00 35.47  ? 150 VAL B C   1 
ATOM   5414 O  O   . VAL B 1 150 ? -0.157  7.734   -13.781 1.00 18.38  ? 150 VAL B O   1 
ATOM   5415 C  CB  . VAL B 1 150 ? -1.109  4.556   -12.830 1.00 37.72  ? 150 VAL B CB  1 
ATOM   5416 C  CG1 . VAL B 1 150 ? -2.263  3.566   -12.909 1.00 45.72  ? 150 VAL B CG1 1 
ATOM   5417 C  CG2 . VAL B 1 150 ? -0.019  4.228   -13.837 1.00 17.08  ? 150 VAL B CG2 1 
ATOM   5418 N  N   . GLY B 1 151 ? -0.097  7.121   -11.609 1.00 32.90  ? 151 GLY B N   1 
ATOM   5419 C  CA  . GLY B 1 151 ? 0.853   8.144   -11.217 1.00 32.07  ? 151 GLY B CA  1 
ATOM   5420 C  C   . GLY B 1 151 ? 0.421   9.527   -11.648 1.00 34.56  ? 151 GLY B C   1 
ATOM   5421 O  O   . GLY B 1 151 ? -0.773  9.864   -11.654 1.00 32.53  ? 151 GLY B O   1 
ATOM   5422 N  N   . ALA B 1 152 ? 1.409   10.339  -12.040 1.00 40.65  ? 152 ALA B N   1 
ATOM   5423 C  CA  . ALA B 1 152 ? 1.149   11.749  -12.317 1.00 40.96  ? 152 ALA B CA  1 
ATOM   5424 C  C   . ALA B 1 152 ? 0.117   11.924  -13.428 1.00 41.07  ? 152 ALA B C   1 
ATOM   5425 O  O   . ALA B 1 152 ? -0.793  12.757  -13.307 1.00 29.87  ? 152 ALA B O   1 
ATOM   5426 C  CB  . ALA B 1 152 ? 2.455   12.460  -12.668 1.00 31.39  ? 152 ALA B CB  1 
ATOM   5427 N  N   . PHE B 1 153 ? 0.236   11.137  -14.510 1.00 38.42  ? 153 PHE B N   1 
ATOM   5428 C  CA  . PHE B 1 153 ? -0.749  11.188  -15.589 1.00 36.29  ? 153 PHE B CA  1 
ATOM   5429 C  C   . PHE B 1 153 ? -2.160  10.971  -15.068 1.00 41.65  ? 153 PHE B C   1 
ATOM   5430 O  O   . PHE B 1 153 ? -3.107  11.560  -15.598 1.00 34.54  ? 153 PHE B O   1 
ATOM   5431 C  CB  . PHE B 1 153 ? -0.427  10.140  -16.660 1.00 32.24  ? 153 PHE B CB  1 
ATOM   5432 C  CG  . PHE B 1 153 ? 1.026   10.033  -16.965 1.00 35.80  ? 153 PHE B CG  1 
ATOM   5433 C  CD1 . PHE B 1 153 ? 1.778   9.051   -16.356 1.00 42.94  ? 153 PHE B CD1 1 
ATOM   5434 C  CD2 . PHE B 1 153 ? 1.651   10.922  -17.829 1.00 26.81  ? 153 PHE B CD2 1 
ATOM   5435 C  CE1 . PHE B 1 153 ? 3.112   8.937   -16.602 1.00 31.23  ? 153 PHE B CE1 1 
ATOM   5436 C  CE2 . PHE B 1 153 ? 2.998   10.814  -18.078 1.00 23.48  ? 153 PHE B CE2 1 
ATOM   5437 C  CZ  . PHE B 1 153 ? 3.731   9.814   -17.455 1.00 26.50  ? 153 PHE B CZ  1 
ATOM   5438 N  N   . GLY B 1 154 ? -2.318  10.155  -14.020 1.00 45.25  ? 154 GLY B N   1 
ATOM   5439 C  CA  . GLY B 1 154 ? -3.627  9.801   -13.506 1.00 33.05  ? 154 GLY B CA  1 
ATOM   5440 C  C   . GLY B 1 154 ? -4.088  10.617  -12.314 1.00 31.80  ? 154 GLY B C   1 
ATOM   5441 O  O   . GLY B 1 154 ? -5.290  10.658  -12.025 1.00 19.02  ? 154 GLY B O   1 
ATOM   5442 N  N   . PHE B 1 155 ? -3.157  11.261  -11.584 1.00 25.79  ? 155 PHE B N   1 
ATOM   5443 C  CA  . PHE B 1 155 ? -3.605  11.890  -10.346 1.00 29.61  ? 155 PHE B CA  1 
ATOM   5444 C  C   . PHE B 1 155 ? -2.890  13.183  -9.953  1.00 30.38  ? 155 PHE B C   1 
ATOM   5445 O  O   . PHE B 1 155 ? -3.008  13.597  -8.793  1.00 28.14  ? 155 PHE B O   1 
ATOM   5446 C  CB  . PHE B 1 155 ? -3.503  10.885  -9.224  1.00 18.62  ? 155 PHE B CB  1 
ATOM   5447 C  CG  . PHE B 1 155 ? -4.388  9.708   -9.413  1.00 18.02  ? 155 PHE B CG  1 
ATOM   5448 C  CD1 . PHE B 1 155 ? -5.678  9.748   -8.962  1.00 17.96  ? 155 PHE B CD1 1 
ATOM   5449 C  CD2 . PHE B 1 155 ? -3.930  8.560   -10.026 1.00 17.59  ? 155 PHE B CD2 1 
ATOM   5450 C  CE1 . PHE B 1 155 ? -6.508  8.677   -9.129  1.00 20.01  ? 155 PHE B CE1 1 
ATOM   5451 C  CE2 . PHE B 1 155 ? -4.758  7.489   -10.197 1.00 17.12  ? 155 PHE B CE2 1 
ATOM   5452 C  CZ  . PHE B 1 155 ? -6.048  7.543   -9.739  1.00 17.06  ? 155 PHE B CZ  1 
ATOM   5453 N  N   . LEU B 1 156 ? -2.174  13.846  -10.858 1.00 24.43  ? 156 LEU B N   1 
ATOM   5454 C  CA  . LEU B 1 156 ? -1.720  15.193  -10.550 1.00 23.63  ? 156 LEU B CA  1 
ATOM   5455 C  C   . LEU B 1 156 ? -2.922  16.018  -10.138 1.00 29.86  ? 156 LEU B C   1 
ATOM   5456 O  O   . LEU B 1 156 ? -4.003  15.887  -10.714 1.00 32.55  ? 156 LEU B O   1 
ATOM   5457 C  CB  . LEU B 1 156 ? -1.031  15.829  -11.755 1.00 33.36  ? 156 LEU B CB  1 
ATOM   5458 C  CG  . LEU B 1 156 ? -0.514  17.253  -11.530 1.00 37.08  ? 156 LEU B CG  1 
ATOM   5459 C  CD1 . LEU B 1 156 ? 0.938   17.232  -11.085 1.00 31.31  ? 156 LEU B CD1 1 
ATOM   5460 C  CD2 . LEU B 1 156 ? -0.674  18.074  -12.798 1.00 45.92  ? 156 LEU B CD2 1 
ATOM   5461 N  N   . ALA B 1 157 ? -2.750  16.850  -9.115  1.00 34.08  ? 157 ALA B N   1 
ATOM   5462 C  CA  . ALA B 1 157 ? -3.913  17.441  -8.456  1.00 32.87  ? 157 ALA B CA  1 
ATOM   5463 C  C   . ALA B 1 157 ? -3.654  18.885  -8.045  1.00 35.83  ? 157 ALA B C   1 
ATOM   5464 O  O   . ALA B 1 157 ? -3.001  19.139  -7.027  1.00 40.25  ? 157 ALA B O   1 
ATOM   5465 C  CB  . ALA B 1 157 ? -4.312  16.606  -7.254  1.00 34.96  ? 157 ALA B CB  1 
ATOM   5466 N  N   . LEU B 1 158 ? -4.226  19.815  -8.809  1.00 34.58  ? 158 LEU B N   1 
ATOM   5467 C  CA  . LEU B 1 158 ? -4.212  21.246  -8.518  1.00 33.59  ? 158 LEU B CA  1 
ATOM   5468 C  C   . LEU B 1 158 ? -5.661  21.721  -8.418  1.00 43.13  ? 158 LEU B C   1 
ATOM   5469 O  O   . LEU B 1 158 ? -6.271  22.126  -9.410  1.00 53.82  ? 158 LEU B O   1 
ATOM   5470 C  CB  . LEU B 1 158 ? -3.451  21.977  -9.594  1.00 39.02  ? 158 LEU B CB  1 
ATOM   5471 C  CG  . LEU B 1 158 ? -2.009  21.486  -9.755  1.00 45.69  ? 158 LEU B CG  1 
ATOM   5472 C  CD1 . LEU B 1 158 ? -1.547  21.599  -11.195 1.00 39.61  ? 158 LEU B CD1 1 
ATOM   5473 C  CD2 . LEU B 1 158 ? -1.065  22.248  -8.816  1.00 46.50  ? 158 LEU B CD2 1 
ATOM   5474 N  N   . HIS B 1 159 ? -6.217  21.675  -7.214  1.00 50.51  ? 159 HIS B N   1 
ATOM   5475 C  CA  . HIS B 1 159 ? -7.623  22.004  -7.038  1.00 49.81  ? 159 HIS B CA  1 
ATOM   5476 C  C   . HIS B 1 159 ? -7.902  23.463  -7.376  1.00 48.26  ? 159 HIS B C   1 
ATOM   5477 O  O   . HIS B 1 159 ? -7.115  24.358  -7.057  1.00 50.02  ? 159 HIS B O   1 
ATOM   5478 C  CB  . HIS B 1 159 ? -8.061  21.723  -5.612  1.00 55.97  ? 159 HIS B CB  1 
ATOM   5479 C  CG  . HIS B 1 159 ? -9.514  21.415  -5.501  1.00 62.96  ? 159 HIS B CG  1 
ATOM   5480 N  ND1 . HIS B 1 159 ? -10.276 21.783  -4.413  1.00 64.65  ? 159 HIS B ND1 1 
ATOM   5481 C  CD2 . HIS B 1 159 ? -10.349 20.769  -6.350  1.00 66.45  ? 159 HIS B CD2 1 
ATOM   5482 C  CE1 . HIS B 1 159 ? -11.520 21.379  -4.600  1.00 72.54  ? 159 HIS B CE1 1 
ATOM   5483 N  NE2 . HIS B 1 159 ? -11.590 20.759  -5.765  1.00 73.27  ? 159 HIS B NE2 1 
ATOM   5484 N  N   . GLY B 1 160 ? -9.048  23.700  -8.002  1.00 47.24  ? 160 GLY B N   1 
ATOM   5485 C  CA  . GLY B 1 160 ? -9.370  25.011  -8.526  1.00 50.28  ? 160 GLY B CA  1 
ATOM   5486 C  C   . GLY B 1 160 ? -9.110  25.065  -10.018 1.00 53.79  ? 160 GLY B C   1 
ATOM   5487 O  O   . GLY B 1 160 ? -9.914  25.599  -10.794 1.00 43.42  ? 160 GLY B O   1 
ATOM   5488 N  N   . SER B 1 161 ? -7.970  24.509  -10.424 1.00 57.24  ? 161 SER B N   1 
ATOM   5489 C  CA  . SER B 1 161 ? -7.686  24.333  -11.838 1.00 54.99  ? 161 SER B CA  1 
ATOM   5490 C  C   . SER B 1 161 ? -8.506  23.179  -12.388 1.00 54.14  ? 161 SER B C   1 
ATOM   5491 O  O   . SER B 1 161 ? -8.477  22.069  -11.852 1.00 50.29  ? 161 SER B O   1 
ATOM   5492 C  CB  . SER B 1 161 ? -6.201  24.068  -12.060 1.00 58.02  ? 161 SER B CB  1 
ATOM   5493 O  OG  . SER B 1 161 ? -5.923  23.933  -13.442 1.00 65.91  ? 161 SER B OG  1 
ATOM   5494 N  N   . GLN B 1 162 ? -9.252  23.444  -13.452 1.00 65.38  ? 162 GLN B N   1 
ATOM   5495 C  CA  . GLN B 1 162 ? -9.964  22.392  -14.155 1.00 73.23  ? 162 GLN B CA  1 
ATOM   5496 C  C   . GLN B 1 162 ? -9.165  21.840  -15.322 1.00 75.10  ? 162 GLN B C   1 
ATOM   5497 O  O   . GLN B 1 162 ? -9.627  20.908  -15.989 1.00 77.31  ? 162 GLN B O   1 
ATOM   5498 C  CB  . GLN B 1 162 ? -11.321 22.902  -14.632 1.00 73.18  ? 162 GLN B CB  1 
ATOM   5499 C  CG  . GLN B 1 162 ? -12.016 23.752  -13.606 1.00 82.25  ? 162 GLN B CG  1 
ATOM   5500 C  CD  . GLN B 1 162 ? -13.448 24.021  -13.979 1.00 99.29  ? 162 GLN B CD  1 
ATOM   5501 O  OE1 . GLN B 1 162 ? -14.036 23.286  -14.770 1.00 105.96 ? 162 GLN B OE1 1 
ATOM   5502 N  NE2 . GLN B 1 162 ? -14.019 25.088  -13.425 1.00 104.64 ? 162 GLN B NE2 1 
ATOM   5503 N  N   . GLU B 1 163 ? -7.981  22.396  -15.587 1.00 70.83  ? 163 GLU B N   1 
ATOM   5504 C  CA  . GLU B 1 163 ? -7.050  21.746  -16.498 1.00 59.20  ? 163 GLU B CA  1 
ATOM   5505 C  C   . GLU B 1 163 ? -6.369  20.547  -15.847 1.00 55.82  ? 163 GLU B C   1 
ATOM   5506 O  O   . GLU B 1 163 ? -5.900  19.651  -16.557 1.00 47.74  ? 163 GLU B O   1 
ATOM   5507 C  CB  . GLU B 1 163 ? -6.003  22.748  -16.997 1.00 48.24  ? 163 GLU B CB  1 
ATOM   5508 C  CG  . GLU B 1 163 ? -6.526  23.799  -17.977 1.00 57.13  ? 163 GLU B CG  1 
ATOM   5509 C  CD  . GLU B 1 163 ? -7.365  23.205  -19.111 1.00 72.28  ? 163 GLU B CD  1 
ATOM   5510 O  OE1 . GLU B 1 163 ? -8.615  23.312  -19.059 1.00 72.29  ? 163 GLU B OE1 1 
ATOM   5511 O  OE2 . GLU B 1 163 ? -6.778  22.618  -20.051 1.00 78.22  ? 163 GLU B OE2 1 
ATOM   5512 N  N   . ALA B 1 164 ? -6.321  20.505  -14.516 1.00 55.70  ? 164 ALA B N   1 
ATOM   5513 C  CA  . ALA B 1 164 ? -5.739  19.375  -13.789 1.00 46.90  ? 164 ALA B CA  1 
ATOM   5514 C  C   . ALA B 1 164 ? -6.416  19.273  -12.430 1.00 43.31  ? 164 ALA B C   1 
ATOM   5515 O  O   . ALA B 1 164 ? -5.884  19.724  -11.408 1.00 34.09  ? 164 ALA B O   1 
ATOM   5516 C  CB  . ALA B 1 164 ? -4.225  19.528  -13.651 1.00 38.41  ? 164 ALA B CB  1 
ATOM   5517 N  N   . PRO B 1 165 ? -7.611  18.668  -12.381 1.00 40.76  ? 165 PRO B N   1 
ATOM   5518 C  CA  . PRO B 1 165 ? -8.400  18.658  -11.139 1.00 39.91  ? 165 PRO B CA  1 
ATOM   5519 C  C   . PRO B 1 165 ? -7.980  17.590  -10.144 1.00 34.41  ? 165 PRO B C   1 
ATOM   5520 O  O   . PRO B 1 165 ? -8.110  17.766  -8.927  1.00 33.61  ? 165 PRO B O   1 
ATOM   5521 C  CB  . PRO B 1 165 ? -9.817  18.392  -11.644 1.00 39.94  ? 165 PRO B CB  1 
ATOM   5522 C  CG  . PRO B 1 165 ? -9.591  17.554  -12.871 1.00 34.09  ? 165 PRO B CG  1 
ATOM   5523 C  CD  . PRO B 1 165 ? -8.338  18.057  -13.505 1.00 31.34  ? 165 PRO B CD  1 
ATOM   5524 N  N   . GLY B 1 166 ? -7.481  16.474  -10.645 1.00 35.02  ? 166 GLY B N   1 
ATOM   5525 C  CA  . GLY B 1 166 ? -7.199  15.333  -9.804  1.00 32.96  ? 166 GLY B CA  1 
ATOM   5526 C  C   . GLY B 1 166 ? -8.264  14.264  -9.942  1.00 28.05  ? 166 GLY B C   1 
ATOM   5527 O  O   . GLY B 1 166 ? -9.337  14.466  -10.520 1.00 29.79  ? 166 GLY B O   1 
ATOM   5528 N  N   . ASN B 1 167 ? -7.941  13.092  -9.421  1.00 25.06  ? 167 ASN B N   1 
ATOM   5529 C  CA  . ASN B 1 167 ? -8.842  11.951  -9.464  1.00 27.79  ? 167 ASN B CA  1 
ATOM   5530 C  C   . ASN B 1 167 ? -9.164  11.513  -10.882 1.00 31.27  ? 167 ASN B C   1 
ATOM   5531 O  O   . ASN B 1 167 ? -10.010 10.634  -11.075 1.00 37.25  ? 167 ASN B O   1 
ATOM   5532 C  CB  . ASN B 1 167 ? -10.125 12.263  -8.699  1.00 24.77  ? 167 ASN B CB  1 
ATOM   5533 C  CG  . ASN B 1 167 ? -9.877  12.397  -7.226  1.00 36.07  ? 167 ASN B CG  1 
ATOM   5534 O  OD1 . ASN B 1 167 ? -10.479 13.234  -6.550  1.00 41.14  ? 167 ASN B OD1 1 
ATOM   5535 N  ND2 . ASN B 1 167 ? -8.998  11.547  -6.703  1.00 32.59  ? 167 ASN B ND2 1 
ATOM   5536 N  N   . VAL B 1 168 ? -8.499  12.083  -11.889 1.00 19.89  ? 168 VAL B N   1 
ATOM   5537 C  CA  . VAL B 1 168 ? -8.881  11.741  -13.247 1.00 34.52  ? 168 VAL B CA  1 
ATOM   5538 C  C   . VAL B 1 168 ? -8.585  10.273  -13.537 1.00 19.30  ? 168 VAL B C   1 
ATOM   5539 O  O   . VAL B 1 168 ? -9.232  9.669   -14.394 1.00 19.27  ? 168 VAL B O   1 
ATOM   5540 C  CB  . VAL B 1 168 ? -8.215  12.687  -14.273 1.00 29.76  ? 168 VAL B CB  1 
ATOM   5541 C  CG1 . VAL B 1 168 ? -8.526  14.149  -13.963 1.00 21.64  ? 168 VAL B CG1 1 
ATOM   5542 C  CG2 . VAL B 1 168 ? -6.730  12.454  -14.339 1.00 37.11  ? 168 VAL B CG2 1 
ATOM   5543 N  N   . GLY B 1 169 ? -7.650  9.662   -12.819 1.00 18.75  ? 169 GLY B N   1 
ATOM   5544 C  CA  . GLY B 1 169 ? -7.457  8.235   -12.979 1.00 22.47  ? 169 GLY B CA  1 
ATOM   5545 C  C   . GLY B 1 169 ? -8.695  7.457   -12.586 1.00 31.10  ? 169 GLY B C   1 
ATOM   5546 O  O   . GLY B 1 169 ? -9.069  6.482   -13.247 1.00 34.85  ? 169 GLY B O   1 
ATOM   5547 N  N   . LEU B 1 170 ? -9.353  7.884   -11.505 1.00 31.51  ? 170 LEU B N   1 
ATOM   5548 C  CA  . LEU B 1 170 ? -10.611 7.260   -11.117 1.00 33.83  ? 170 LEU B CA  1 
ATOM   5549 C  C   . LEU B 1 170 ? -11.714 7.538   -12.127 1.00 30.22  ? 170 LEU B C   1 
ATOM   5550 O  O   . LEU B 1 170 ? -12.623 6.716   -12.274 1.00 29.19  ? 170 LEU B O   1 
ATOM   5551 C  CB  . LEU B 1 170 ? -11.029 7.754   -9.738  1.00 29.98  ? 170 LEU B CB  1 
ATOM   5552 C  CG  . LEU B 1 170 ? -10.136 7.258   -8.617  1.00 23.09  ? 170 LEU B CG  1 
ATOM   5553 C  CD1 . LEU B 1 170 ? -10.392 8.047   -7.358  1.00 17.24  ? 170 LEU B CD1 1 
ATOM   5554 C  CD2 . LEU B 1 170 ? -10.403 5.773   -8.417  1.00 18.94  ? 170 LEU B CD2 1 
ATOM   5555 N  N   . LEU B 1 171 ? -11.659 8.687   -12.819 1.00 24.86  ? 171 LEU B N   1 
ATOM   5556 C  CA  . LEU B 1 171 ? -12.660 9.011   -13.834 1.00 21.66  ? 171 LEU B CA  1 
ATOM   5557 C  C   . LEU B 1 171 ? -12.472 8.199   -15.119 1.00 30.12  ? 171 LEU B C   1 
ATOM   5558 O  O   . LEU B 1 171 ? -13.462 7.845   -15.769 1.00 41.69  ? 171 LEU B O   1 
ATOM   5559 C  CB  . LEU B 1 171 ? -12.629 10.504  -14.128 1.00 20.06  ? 171 LEU B CB  1 
ATOM   5560 C  CG  . LEU B 1 171 ? -13.035 11.371  -12.938 1.00 33.88  ? 171 LEU B CG  1 
ATOM   5561 C  CD1 . LEU B 1 171 ? -12.705 12.839  -13.181 1.00 33.63  ? 171 LEU B CD1 1 
ATOM   5562 C  CD2 . LEU B 1 171 ? -14.525 11.201  -12.644 1.00 43.93  ? 171 LEU B CD2 1 
ATOM   5563 N  N   . ASP B 1 172 ? -11.226 7.910   -15.514 1.00 30.90  ? 172 ASP B N   1 
ATOM   5564 C  CA  . ASP B 1 172 ? -10.979 6.867   -16.512 1.00 27.76  ? 172 ASP B CA  1 
ATOM   5565 C  C   . ASP B 1 172 ? -11.757 5.601   -16.180 1.00 24.22  ? 172 ASP B C   1 
ATOM   5566 O  O   . ASP B 1 172 ? -12.374 4.985   -17.054 1.00 26.12  ? 172 ASP B O   1 
ATOM   5567 C  CB  . ASP B 1 172 ? -9.490  6.524   -16.577 1.00 38.62  ? 172 ASP B CB  1 
ATOM   5568 C  CG  . ASP B 1 172 ? -8.614  7.724   -16.829 1.00 45.18  ? 172 ASP B CG  1 
ATOM   5569 O  OD1 . ASP B 1 172 ? -7.404  7.531   -17.060 1.00 39.31  ? 172 ASP B OD1 1 
ATOM   5570 O  OD2 . ASP B 1 172 ? -9.131  8.854   -16.808 1.00 56.25  ? 172 ASP B OD2 1 
ATOM   5571 N  N   . GLN B 1 173 ? -11.703 5.177   -14.915 1.00 23.37  ? 173 GLN B N   1 
ATOM   5572 C  CA  . GLN B 1 173 ? -12.423 3.978   -14.512 1.00 22.44  ? 173 GLN B CA  1 
ATOM   5573 C  C   . GLN B 1 173 ? -13.915 4.141   -14.741 1.00 23.40  ? 173 GLN B C   1 
ATOM   5574 O  O   . GLN B 1 173 ? -14.571 3.262   -15.311 1.00 34.62  ? 173 GLN B O   1 
ATOM   5575 C  CB  . GLN B 1 173 ? -12.146 3.662   -13.044 1.00 29.20  ? 173 GLN B CB  1 
ATOM   5576 C  CG  . GLN B 1 173 ? -10.787 3.068   -12.757 1.00 32.14  ? 173 GLN B CG  1 
ATOM   5577 C  CD  . GLN B 1 173 ? -10.551 2.854   -11.265 1.00 34.58  ? 173 GLN B CD  1 
ATOM   5578 O  OE1 . GLN B 1 173 ? -11.497 2.695   -10.485 1.00 26.41  ? 173 GLN B OE1 1 
ATOM   5579 N  NE2 . GLN B 1 173 ? -9.280  2.878   -10.860 1.00 31.93  ? 173 GLN B NE2 1 
ATOM   5580 N  N   . ARG B 1 174 ? -14.475 5.264   -14.295 1.00 21.25  ? 174 ARG B N   1 
ATOM   5581 C  CA  . ARG B 1 174 ? -15.923 5.394   -14.343 1.00 24.73  ? 174 ARG B CA  1 
ATOM   5582 C  C   . ARG B 1 174 ? -16.393 5.529   -15.779 1.00 27.70  ? 174 ARG B C   1 
ATOM   5583 O  O   . ARG B 1 174 ? -17.489 5.078   -16.127 1.00 32.89  ? 174 ARG B O   1 
ATOM   5584 C  CB  . ARG B 1 174 ? -16.388 6.569   -13.472 1.00 18.80  ? 174 ARG B CB  1 
ATOM   5585 C  CG  . ARG B 1 174 ? -17.713 7.175   -13.905 1.00 19.52  ? 174 ARG B CG  1 
ATOM   5586 C  CD  . ARG B 1 174 ? -17.969 8.506   -13.256 1.00 33.60  ? 174 ARG B CD  1 
ATOM   5587 N  NE  . ARG B 1 174 ? -17.794 8.424   -11.813 1.00 35.61  ? 174 ARG B NE  1 
ATOM   5588 C  CZ  . ARG B 1 174 ? -17.830 9.463   -10.995 1.00 37.17  ? 174 ARG B CZ  1 
ATOM   5589 N  NH1 . ARG B 1 174 ? -18.012 10.673  -11.489 1.00 44.15  ? 174 ARG B NH1 1 
ATOM   5590 N  NH2 . ARG B 1 174 ? -17.652 9.267   -9.699  1.00 28.06  ? 174 ARG B NH2 1 
ATOM   5591 N  N   . MET B 1 175 ? -15.550 6.088   -16.639 1.00 29.17  ? 175 MET B N   1 
ATOM   5592 C  CA  . MET B 1 175 ? -15.913 6.173   -18.039 1.00 32.73  ? 175 MET B CA  1 
ATOM   5593 C  C   . MET B 1 175 ? -15.918 4.780   -18.660 1.00 26.05  ? 175 MET B C   1 
ATOM   5594 O  O   . MET B 1 175 ? -16.839 4.413   -19.408 1.00 25.70  ? 175 MET B O   1 
ATOM   5595 C  CB  . MET B 1 175 ? -14.957 7.122   -18.754 1.00 27.68  ? 175 MET B CB  1 
ATOM   5596 C  CG  . MET B 1 175 ? -15.145 7.130   -20.248 1.00 42.29  ? 175 MET B CG  1 
ATOM   5597 S  SD  . MET B 1 175 ? -14.786 8.744   -20.980 1.00 59.64  ? 175 MET B SD  1 
ATOM   5598 C  CE  . MET B 1 175 ? -15.809 9.835   -20.014 1.00 54.24  ? 175 MET B CE  1 
ATOM   5599 N  N   . ALA B 1 176 ? -14.921 3.969   -18.312 1.00 18.95  ? 176 ALA B N   1 
ATOM   5600 C  CA  . ALA B 1 176 ? -14.974 2.561   -18.674 1.00 24.93  ? 176 ALA B CA  1 
ATOM   5601 C  C   . ALA B 1 176 ? -16.214 1.902   -18.085 1.00 31.41  ? 176 ALA B C   1 
ATOM   5602 O  O   . ALA B 1 176 ? -16.862 1.082   -18.743 1.00 35.28  ? 176 ALA B O   1 
ATOM   5603 C  CB  . ALA B 1 176 ? -13.698 1.858   -18.208 1.00 18.21  ? 176 ALA B CB  1 
ATOM   5604 N  N   . LEU B 1 177 ? -16.577 2.267   -16.852 1.00 26.13  ? 177 LEU B N   1 
ATOM   5605 C  CA  . LEU B 1 177 ? -17.765 1.684   -16.241 1.00 27.17  ? 177 LEU B CA  1 
ATOM   5606 C  C   . LEU B 1 177 ? -19.034 2.068   -17.004 1.00 33.53  ? 177 LEU B C   1 
ATOM   5607 O  O   . LEU B 1 177 ? -19.942 1.241   -17.162 1.00 35.70  ? 177 LEU B O   1 
ATOM   5608 C  CB  . LEU B 1 177 ? -17.863 2.105   -14.778 1.00 28.43  ? 177 LEU B CB  1 
ATOM   5609 C  CG  . LEU B 1 177 ? -17.011 1.367   -13.749 1.00 31.22  ? 177 LEU B CG  1 
ATOM   5610 C  CD1 . LEU B 1 177 ? -17.199 2.033   -12.393 1.00 33.44  ? 177 LEU B CD1 1 
ATOM   5611 C  CD2 . LEU B 1 177 ? -17.367 -0.117  -13.694 1.00 19.15  ? 177 LEU B CD2 1 
ATOM   5612 N  N   . GLN B 1 178 ? -19.123 3.311   -17.492 1.00 19.51  ? 178 GLN B N   1 
ATOM   5613 C  CA  . GLN B 1 178 ? -20.307 3.647   -18.264 1.00 21.01  ? 178 GLN B CA  1 
ATOM   5614 C  C   . GLN B 1 178 ? -20.263 3.012   -19.648 1.00 24.86  ? 178 GLN B C   1 
ATOM   5615 O  O   . GLN B 1 178 ? -21.316 2.660   -20.200 1.00 25.00  ? 178 GLN B O   1 
ATOM   5616 C  CB  . GLN B 1 178 ? -20.511 5.156   -18.368 1.00 22.98  ? 178 GLN B CB  1 
ATOM   5617 C  CG  . GLN B 1 178 ? -21.727 5.473   -19.229 1.00 26.83  ? 178 GLN B CG  1 
ATOM   5618 C  CD  . GLN B 1 178 ? -22.865 5.935   -18.361 1.00 30.47  ? 178 GLN B CD  1 
ATOM   5619 O  OE1 . GLN B 1 178 ? -22.643 6.604   -17.355 1.00 34.09  ? 178 GLN B OE1 1 
ATOM   5620 N  NE2 . GLN B 1 178 ? -24.075 5.457   -18.659 1.00 34.80  ? 178 GLN B NE2 1 
ATOM   5621 N  N   . TRP B 1 179 ? -19.071 2.816   -20.211 1.00 20.34  ? 179 TRP B N   1 
ATOM   5622 C  CA  . TRP B 1 179 ? -19.006 2.075   -21.462 1.00 20.62  ? 179 TRP B CA  1 
ATOM   5623 C  C   . TRP B 1 179 ? -19.588 0.681   -21.301 1.00 20.35  ? 179 TRP B C   1 
ATOM   5624 O  O   . TRP B 1 179 ? -20.308 0.199   -22.183 1.00 30.95  ? 179 TRP B O   1 
ATOM   5625 C  CB  . TRP B 1 179 ? -17.575 1.979   -21.971 1.00 26.75  ? 179 TRP B CB  1 
ATOM   5626 C  CG  . TRP B 1 179 ? -17.526 1.454   -23.367 1.00 25.12  ? 179 TRP B CG  1 
ATOM   5627 C  CD1 . TRP B 1 179 ? -17.448 2.189   -24.509 1.00 24.33  ? 179 TRP B CD1 1 
ATOM   5628 C  CD2 . TRP B 1 179 ? -17.597 0.080   -23.777 1.00 20.79  ? 179 TRP B CD2 1 
ATOM   5629 N  NE1 . TRP B 1 179 ? -17.447 1.359   -25.610 1.00 29.56  ? 179 TRP B NE1 1 
ATOM   5630 C  CE2 . TRP B 1 179 ? -17.528 0.059   -25.184 1.00 28.70  ? 179 TRP B CE2 1 
ATOM   5631 C  CE3 . TRP B 1 179 ? -17.688 -1.134  -23.092 1.00 26.24  ? 179 TRP B CE3 1 
ATOM   5632 C  CZ2 . TRP B 1 179 ? -17.561 -1.125  -25.917 1.00 30.20  ? 179 TRP B CZ2 1 
ATOM   5633 C  CZ3 . TRP B 1 179 ? -17.717 -2.315  -23.826 1.00 22.88  ? 179 TRP B CZ3 1 
ATOM   5634 C  CH2 . TRP B 1 179 ? -17.652 -2.300  -25.219 1.00 26.08  ? 179 TRP B CH2 1 
ATOM   5635 N  N   . VAL B 1 180 ? -19.268 0.004   -20.198 1.00 19.63  ? 180 VAL B N   1 
ATOM   5636 C  CA  . VAL B 1 180 ? -19.888 -1.289  -19.943 1.00 19.44  ? 180 VAL B CA  1 
ATOM   5637 C  C   . VAL B 1 180 ? -21.394 -1.119  -19.824 1.00 29.30  ? 180 VAL B C   1 
ATOM   5638 O  O   . VAL B 1 180 ? -22.179 -1.920  -20.354 1.00 20.26  ? 180 VAL B O   1 
ATOM   5639 C  CB  . VAL B 1 180 ? -19.289 -1.935  -18.682 1.00 20.94  ? 180 VAL B CB  1 
ATOM   5640 C  CG1 . VAL B 1 180 ? -20.105 -3.153  -18.293 1.00 24.06  ? 180 VAL B CG1 1 
ATOM   5641 C  CG2 . VAL B 1 180 ? -17.842 -2.333  -18.910 1.00 18.27  ? 180 VAL B CG2 1 
ATOM   5642 N  N   . HIS B 1 181 ? -21.822 -0.054  -19.148 1.00 24.07  ? 181 HIS B N   1 
ATOM   5643 C  CA  . HIS B 1 181 ? -23.249 0.145   -18.945 1.00 34.07  ? 181 HIS B CA  1 
ATOM   5644 C  C   . HIS B 1 181 ? -23.963 0.224   -20.273 1.00 40.78  ? 181 HIS B C   1 
ATOM   5645 O  O   . HIS B 1 181 ? -25.017 -0.392  -20.463 1.00 52.50  ? 181 HIS B O   1 
ATOM   5646 C  CB  . HIS B 1 181 ? -23.500 1.413   -18.139 1.00 34.90  ? 181 HIS B CB  1 
ATOM   5647 C  CG  . HIS B 1 181 ? -24.933 1.615   -17.758 1.00 34.98  ? 181 HIS B CG  1 
ATOM   5648 N  ND1 . HIS B 1 181 ? -25.551 0.871   -16.774 1.00 36.94  ? 181 HIS B ND1 1 
ATOM   5649 C  CD2 . HIS B 1 181 ? -25.859 2.500   -18.200 1.00 35.65  ? 181 HIS B CD2 1 
ATOM   5650 C  CE1 . HIS B 1 181 ? -26.799 1.285   -16.634 1.00 40.10  ? 181 HIS B CE1 1 
ATOM   5651 N  NE2 . HIS B 1 181 ? -27.012 2.270   -17.490 1.00 41.36  ? 181 HIS B NE2 1 
ATOM   5652 N  N   . ASP B 1 182 ? -23.379 0.945   -21.218 1.00 40.73  ? 182 ASP B N   1 
ATOM   5653 C  CA  . ASP B 1 182 ? -24.065 1.193   -22.472 1.00 42.32  ? 182 ASP B CA  1 
ATOM   5654 C  C   . ASP B 1 182 ? -23.874 0.062   -23.473 1.00 43.23  ? 182 ASP B C   1 
ATOM   5655 O  O   . ASP B 1 182 ? -24.745 -0.156  -24.319 1.00 54.13  ? 182 ASP B O   1 
ATOM   5656 C  CB  . ASP B 1 182 ? -23.592 2.528   -23.046 1.00 44.46  ? 182 ASP B CB  1 
ATOM   5657 C  CG  . ASP B 1 182 ? -23.893 3.702   -22.112 1.00 53.92  ? 182 ASP B CG  1 
ATOM   5658 O  OD1 . ASP B 1 182 ? -24.724 3.540   -21.190 1.00 49.56  ? 182 ASP B OD1 1 
ATOM   5659 O  OD2 . ASP B 1 182 ? -23.300 4.787   -22.296 1.00 59.31  ? 182 ASP B OD2 1 
ATOM   5660 N  N   . ASN B 1 183 ? -22.783 -0.692  -23.388 1.00 34.31  ? 183 ASN B N   1 
ATOM   5661 C  CA  . ASN B 1 183 ? -22.470 -1.607  -24.467 1.00 26.46  ? 183 ASN B CA  1 
ATOM   5662 C  C   . ASN B 1 183 ? -22.374 -3.067  -24.076 1.00 32.01  ? 183 ASN B C   1 
ATOM   5663 O  O   . ASN B 1 183 ? -22.347 -3.916  -24.974 1.00 31.71  ? 183 ASN B O   1 
ATOM   5664 C  CB  . ASN B 1 183 ? -21.159 -1.194  -25.139 1.00 23.17  ? 183 ASN B CB  1 
ATOM   5665 C  CG  . ASN B 1 183 ? -21.287 0.120   -25.846 1.00 27.66  ? 183 ASN B CG  1 
ATOM   5666 O  OD1 . ASN B 1 183 ? -21.867 0.195   -26.935 1.00 32.10  ? 183 ASN B OD1 1 
ATOM   5667 N  ND2 . ASN B 1 183 ? -20.763 1.177   -25.233 1.00 22.70  ? 183 ASN B ND2 1 
ATOM   5668 N  N   . ILE B 1 184 ? -22.333 -3.396  -22.785 1.00 37.60  ? 184 ILE B N   1 
ATOM   5669 C  CA  . ILE B 1 184 ? -22.081 -4.786  -22.427 1.00 30.79  ? 184 ILE B CA  1 
ATOM   5670 C  C   . ILE B 1 184 ? -23.179 -5.687  -22.969 1.00 21.30  ? 184 ILE B C   1 
ATOM   5671 O  O   . ILE B 1 184 ? -22.922 -6.840  -23.333 1.00 22.05  ? 184 ILE B O   1 
ATOM   5672 C  CB  . ILE B 1 184 ? -21.899 -4.939  -20.900 1.00 22.38  ? 184 ILE B CB  1 
ATOM   5673 C  CG1 . ILE B 1 184 ? -21.157 -6.246  -20.603 1.00 23.08  ? 184 ILE B CG1 1 
ATOM   5674 C  CG2 . ILE B 1 184 ? -23.230 -4.855  -20.161 1.00 20.17  ? 184 ILE B CG2 1 
ATOM   5675 C  CD1 . ILE B 1 184 ? -19.831 -6.360  -21.359 1.00 19.41  ? 184 ILE B CD1 1 
ATOM   5676 N  N   . GLN B 1 185 ? -24.400 -5.164  -23.095 1.00 30.42  ? 185 GLN B N   1 
ATOM   5677 C  CA  . GLN B 1 185 ? -25.522 -5.980  -23.550 1.00 40.29  ? 185 GLN B CA  1 
ATOM   5678 C  C   . GLN B 1 185 ? -25.255 -6.633  -24.911 1.00 41.74  ? 185 GLN B C   1 
ATOM   5679 O  O   . GLN B 1 185 ? -25.774 -7.723  -25.186 1.00 42.84  ? 185 GLN B O   1 
ATOM   5680 C  CB  . GLN B 1 185 ? -26.793 -5.128  -23.594 1.00 43.75  ? 185 GLN B CB  1 
ATOM   5681 C  CG  . GLN B 1 185 ? -26.777 -4.006  -24.634 1.00 37.69  ? 185 GLN B CG  1 
ATOM   5682 C  CD  . GLN B 1 185 ? -27.951 -3.057  -24.474 1.00 34.52  ? 185 GLN B CD  1 
ATOM   5683 O  OE1 . GLN B 1 185 ? -28.004 -2.280  -23.516 1.00 35.32  ? 185 GLN B OE1 1 
ATOM   5684 N  NE2 . GLN B 1 185 ? -28.910 -3.127  -25.400 1.00 34.37  ? 185 GLN B NE2 1 
ATOM   5685 N  N   . PHE B 1 186 ? -24.434 -6.000  -25.759 1.00 32.83  ? 186 PHE B N   1 
ATOM   5686 C  CA  . PHE B 1 186 ? -24.094 -6.530  -27.076 1.00 38.23  ? 186 PHE B CA  1 
ATOM   5687 C  C   . PHE B 1 186 ? -23.099 -7.682  -27.038 1.00 41.41  ? 186 PHE B C   1 
ATOM   5688 O  O   . PHE B 1 186 ? -22.881 -8.338  -28.066 1.00 41.76  ? 186 PHE B O   1 
ATOM   5689 C  CB  . PHE B 1 186 ? -23.547 -5.405  -27.943 1.00 29.39  ? 186 PHE B CB  1 
ATOM   5690 C  CG  . PHE B 1 186 ? -24.466 -4.251  -28.038 1.00 32.78  ? 186 PHE B CG  1 
ATOM   5691 C  CD1 . PHE B 1 186 ? -24.127 -3.022  -27.500 1.00 41.83  ? 186 PHE B CD1 1 
ATOM   5692 C  CD2 . PHE B 1 186 ? -25.699 -4.397  -28.661 1.00 40.34  ? 186 PHE B CD2 1 
ATOM   5693 C  CE1 . PHE B 1 186 ? -25.016 -1.955  -27.596 1.00 51.01  ? 186 PHE B CE1 1 
ATOM   5694 C  CE2 . PHE B 1 186 ? -26.569 -3.345  -28.761 1.00 39.60  ? 186 PHE B CE2 1 
ATOM   5695 C  CZ  . PHE B 1 186 ? -26.239 -2.129  -28.226 1.00 30.29  ? 186 PHE B CZ  1 
ATOM   5696 N  N   . PHE B 1 187 ? -22.491 -7.945  -25.898 1.00 39.83  ? 187 PHE B N   1 
ATOM   5697 C  CA  . PHE B 1 187 ? -21.664 -9.123  -25.756 1.00 39.77  ? 187 PHE B CA  1 
ATOM   5698 C  C   . PHE B 1 187 ? -22.379 -10.187 -24.943 1.00 41.46  ? 187 PHE B C   1 
ATOM   5699 O  O   . PHE B 1 187 ? -21.767 -11.190 -24.567 1.00 43.47  ? 187 PHE B O   1 
ATOM   5700 C  CB  . PHE B 1 187 ? -20.316 -8.723  -25.158 1.00 30.26  ? 187 PHE B CB  1 
ATOM   5701 C  CG  . PHE B 1 187 ? -19.654 -7.571  -25.896 1.00 29.72  ? 187 PHE B CG  1 
ATOM   5702 C  CD1 . PHE B 1 187 ? -20.041 -6.250  -25.666 1.00 32.11  ? 187 PHE B CD1 1 
ATOM   5703 C  CD2 . PHE B 1 187 ? -18.671 -7.807  -26.840 1.00 21.80  ? 187 PHE B CD2 1 
ATOM   5704 C  CE1 . PHE B 1 187 ? -19.437 -5.193  -26.350 1.00 21.82  ? 187 PHE B CE1 1 
ATOM   5705 C  CE2 . PHE B 1 187 ? -18.075 -6.754  -27.509 1.00 26.61  ? 187 PHE B CE2 1 
ATOM   5706 C  CZ  . PHE B 1 187 ? -18.459 -5.448  -27.266 1.00 22.05  ? 187 PHE B CZ  1 
ATOM   5707 N  N   . GLY B 1 188 ? -23.686 -10.012 -24.730 1.00 34.04  ? 188 GLY B N   1 
ATOM   5708 C  CA  . GLY B 1 188 ? -24.467 -10.891 -23.896 1.00 32.17  ? 188 GLY B CA  1 
ATOM   5709 C  C   . GLY B 1 188 ? -24.298 -10.657 -22.416 1.00 27.65  ? 188 GLY B C   1 
ATOM   5710 O  O   . GLY B 1 188 ? -24.669 -11.530 -21.628 1.00 35.75  ? 188 GLY B O   1 
ATOM   5711 N  N   . GLY B 1 189 ? -23.724 -9.523  -22.014 1.00 24.19  ? 189 GLY B N   1 
ATOM   5712 C  CA  . GLY B 1 189 ? -23.647 -9.182  -20.612 1.00 40.47  ? 189 GLY B CA  1 
ATOM   5713 C  C   . GLY B 1 189 ? -24.863 -8.390  -20.159 1.00 47.64  ? 189 GLY B C   1 
ATOM   5714 O  O   . GLY B 1 189 ? -25.550 -7.765  -20.969 1.00 50.04  ? 189 GLY B O   1 
ATOM   5715 N  N   . ASP B 1 190 ? -25.130 -8.439  -18.853 1.00 34.44  ? 190 ASP B N   1 
ATOM   5716 C  CA  . ASP B 1 190 ? -26.259 -7.720  -18.272 1.00 27.73  ? 190 ASP B CA  1 
ATOM   5717 C  C   . ASP B 1 190 ? -25.755 -6.509  -17.498 1.00 26.66  ? 190 ASP B C   1 
ATOM   5718 O  O   . ASP B 1 190 ? -25.153 -6.679  -16.429 1.00 29.55  ? 190 ASP B O   1 
ATOM   5719 C  CB  . ASP B 1 190 ? -27.067 -8.648  -17.360 1.00 32.46  ? 190 ASP B CB  1 
ATOM   5720 C  CG  . ASP B 1 190 ? -28.211 -7.926  -16.625 1.00 50.61  ? 190 ASP B CG  1 
ATOM   5721 O  OD1 . ASP B 1 190 ? -28.516 -6.758  -16.959 1.00 46.14  ? 190 ASP B OD1 1 
ATOM   5722 O  OD2 . ASP B 1 190 ? -28.818 -8.537  -15.710 1.00 61.21  ? 190 ASP B OD2 1 
ATOM   5723 N  N   . PRO B 1 191 ? -25.994 -5.273  -17.955 1.00 30.31  ? 191 PRO B N   1 
ATOM   5724 C  CA  . PRO B 1 191 ? -25.546 -4.107  -17.173 1.00 32.36  ? 191 PRO B CA  1 
ATOM   5725 C  C   . PRO B 1 191 ? -26.229 -3.974  -15.820 1.00 34.27  ? 191 PRO B C   1 
ATOM   5726 O  O   . PRO B 1 191 ? -25.794 -3.148  -15.008 1.00 33.53  ? 191 PRO B O   1 
ATOM   5727 C  CB  . PRO B 1 191 ? -25.898 -2.924  -18.077 1.00 27.60  ? 191 PRO B CB  1 
ATOM   5728 C  CG  . PRO B 1 191 ? -27.082 -3.404  -18.817 1.00 21.48  ? 191 PRO B CG  1 
ATOM   5729 C  CD  . PRO B 1 191 ? -26.810 -4.861  -19.109 1.00 21.28  ? 191 PRO B CD  1 
ATOM   5730 N  N   . LYS B 1 192 ? -27.286 -4.737  -15.562 1.00 32.83  ? 192 LYS B N   1 
ATOM   5731 C  CA  . LYS B 1 192 ? -27.960 -4.728  -14.275 1.00 36.98  ? 192 LYS B CA  1 
ATOM   5732 C  C   . LYS B 1 192 ? -27.337 -5.693  -13.273 1.00 37.76  ? 192 LYS B C   1 
ATOM   5733 O  O   . LYS B 1 192 ? -27.769 -5.734  -12.119 1.00 40.23  ? 192 LYS B O   1 
ATOM   5734 C  CB  . LYS B 1 192 ? -29.440 -5.054  -14.470 1.00 50.41  ? 192 LYS B CB  1 
ATOM   5735 C  CG  . LYS B 1 192 ? -30.276 -3.821  -14.735 1.00 57.14  ? 192 LYS B CG  1 
ATOM   5736 C  CD  . LYS B 1 192 ? -31.734 -4.144  -15.021 1.00 50.29  ? 192 LYS B CD  1 
ATOM   5737 C  CE  . LYS B 1 192 ? -32.475 -2.875  -15.413 1.00 51.24  ? 192 LYS B CE  1 
ATOM   5738 N  NZ  . LYS B 1 192 ? -31.762 -2.048  -16.444 1.00 49.83  ? 192 LYS B NZ  1 
ATOM   5739 N  N   . THR B 1 193 ? -26.331 -6.460  -13.681 1.00 32.96  ? 193 THR B N   1 
ATOM   5740 C  CA  . THR B 1 193 ? -25.647 -7.392  -12.803 1.00 30.62  ? 193 THR B CA  1 
ATOM   5741 C  C   . THR B 1 193 ? -24.130 -7.246  -13.018 1.00 26.99  ? 193 THR B C   1 
ATOM   5742 O  O   . THR B 1 193 ? -23.419 -8.163  -13.425 1.00 26.44  ? 193 THR B O   1 
ATOM   5743 C  CB  . THR B 1 193 ? -26.155 -8.810  -13.067 1.00 34.39  ? 193 THR B CB  1 
ATOM   5744 O  OG1 . THR B 1 193 ? -27.501 -8.737  -13.538 1.00 48.89  ? 193 THR B OG1 1 
ATOM   5745 C  CG2 . THR B 1 193 ? -26.161 -9.642  -11.789 1.00 24.04  ? 193 THR B CG2 1 
ATOM   5746 N  N   . VAL B 1 194 ? -23.615 -6.050  -12.755 1.00 23.54  ? 194 VAL B N   1 
ATOM   5747 C  CA  . VAL B 1 194 ? -22.189 -5.762  -12.884 1.00 38.36  ? 194 VAL B CA  1 
ATOM   5748 C  C   . VAL B 1 194 ? -21.524 -5.805  -11.510 1.00 36.71  ? 194 VAL B C   1 
ATOM   5749 O  O   . VAL B 1 194 ? -22.047 -5.277  -10.519 1.00 22.64  ? 194 VAL B O   1 
ATOM   5750 C  CB  . VAL B 1 194 ? -21.950 -4.403  -13.578 1.00 40.71  ? 194 VAL B CB  1 
ATOM   5751 C  CG1 . VAL B 1 194 ? -20.569 -3.843  -13.228 1.00 35.71  ? 194 VAL B CG1 1 
ATOM   5752 C  CG2 . VAL B 1 194 ? -22.065 -4.564  -15.085 1.00 30.42  ? 194 VAL B CG2 1 
ATOM   5753 N  N   . THR B 1 195 ? -20.352 -6.420  -11.460 1.00 38.89  ? 195 THR B N   1 
ATOM   5754 C  CA  . THR B 1 195 ? -19.563 -6.533  -10.243 1.00 30.11  ? 195 THR B CA  1 
ATOM   5755 C  C   . THR B 1 195 ? -18.173 -5.972  -10.522 1.00 28.59  ? 195 THR B C   1 
ATOM   5756 O  O   . THR B 1 195 ? -17.367 -6.609  -11.207 1.00 18.25  ? 195 THR B O   1 
ATOM   5757 C  CB  . THR B 1 195 ? -19.496 -7.989  -9.806  1.00 25.12  ? 195 THR B CB  1 
ATOM   5758 O  OG1 . THR B 1 195 ? -20.824 -8.460  -9.538  1.00 38.38  ? 195 THR B OG1 1 
ATOM   5759 C  CG2 . THR B 1 195 ? -18.641 -8.132  -8.590  1.00 20.38  ? 195 THR B CG2 1 
ATOM   5760 N  N   . ILE B 1 196 ? -17.893 -4.771  -10.016 1.00 29.30  ? 196 ILE B N   1 
ATOM   5761 C  CA  . ILE B 1 196 ? -16.528 -4.266  -10.060 1.00 24.79  ? 196 ILE B CA  1 
ATOM   5762 C  C   . ILE B 1 196 ? -15.687 -5.015  -9.033  1.00 28.16  ? 196 ILE B C   1 
ATOM   5763 O  O   . ILE B 1 196 ? -16.172 -5.389  -7.952  1.00 35.54  ? 196 ILE B O   1 
ATOM   5764 C  CB  . ILE B 1 196 ? -16.515 -2.751  -9.807  1.00 17.61  ? 196 ILE B CB  1 
ATOM   5765 C  CG1 . ILE B 1 196 ? -16.916 -2.428  -8.375  1.00 15.30  ? 196 ILE B CG1 1 
ATOM   5766 C  CG2 . ILE B 1 196 ? -17.534 -2.088  -10.684 1.00 17.66  ? 196 ILE B CG2 1 
ATOM   5767 C  CD1 . ILE B 1 196 ? -16.956 -0.957  -8.107  1.00 15.55  ? 196 ILE B CD1 1 
ATOM   5768 N  N   . PHE B 1 197 ? -14.426 -5.265  -9.364  1.00 25.54  ? 197 PHE B N   1 
ATOM   5769 C  CA  . PHE B 1 197 ? -13.542 -5.860  -8.368  1.00 30.47  ? 197 PHE B CA  1 
ATOM   5770 C  C   . PHE B 1 197 ? -12.091 -5.577  -8.723  1.00 31.29  ? 197 PHE B C   1 
ATOM   5771 O  O   . PHE B 1 197 ? -11.718 -5.545  -9.898  1.00 43.82  ? 197 PHE B O   1 
ATOM   5772 C  CB  . PHE B 1 197 ? -13.799 -7.367  -8.200  1.00 28.56  ? 197 PHE B CB  1 
ATOM   5773 C  CG  . PHE B 1 197 ? -13.364 -8.220  -9.354  1.00 27.02  ? 197 PHE B CG  1 
ATOM   5774 C  CD1 . PHE B 1 197 ? -13.728 -7.919  -10.646 1.00 29.17  ? 197 PHE B CD1 1 
ATOM   5775 C  CD2 . PHE B 1 197 ? -12.634 -9.379  -9.127  1.00 34.46  ? 197 PHE B CD2 1 
ATOM   5776 C  CE1 . PHE B 1 197 ? -13.329 -8.737  -11.695 1.00 32.35  ? 197 PHE B CE1 1 
ATOM   5777 C  CE2 . PHE B 1 197 ? -12.243 -10.208 -10.172 1.00 22.47  ? 197 PHE B CE2 1 
ATOM   5778 C  CZ  . PHE B 1 197 ? -12.585 -9.886  -11.450 1.00 20.91  ? 197 PHE B CZ  1 
ATOM   5779 N  N   . GLY B 1 198 ? -11.290 -5.340  -7.696  1.00 28.52  ? 198 GLY B N   1 
ATOM   5780 C  CA  . GLY B 1 198 ? -9.903  -4.965  -7.890  1.00 27.43  ? 198 GLY B CA  1 
ATOM   5781 C  C   . GLY B 1 198 ? -9.090  -5.243  -6.647  1.00 26.97  ? 198 GLY B C   1 
ATOM   5782 O  O   . GLY B 1 198 ? -9.616  -5.478  -5.556  1.00 22.86  ? 198 GLY B O   1 
ATOM   5783 N  N   . GLU B 1 199 ? -7.780  -5.198  -6.827  1.00 30.40  ? 199 GLU B N   1 
ATOM   5784 C  CA  . GLU B 1 199 ? -6.833  -5.566  -5.791  1.00 27.42  ? 199 GLU B CA  1 
ATOM   5785 C  C   . GLU B 1 199 ? -5.925  -4.388  -5.500  1.00 23.83  ? 199 GLU B C   1 
ATOM   5786 O  O   . GLU B 1 199 ? -5.492  -3.688  -6.422  1.00 21.93  ? 199 GLU B O   1 
ATOM   5787 C  CB  . GLU B 1 199 ? -6.001  -6.773  -6.216  1.00 36.49  ? 199 GLU B CB  1 
ATOM   5788 C  CG  . GLU B 1 199 ? -5.342  -7.502  -5.076  1.00 50.95  ? 199 GLU B CG  1 
ATOM   5789 C  CD  . GLU B 1 199 ? -3.913  -7.044  -4.841  1.00 63.46  ? 199 GLU B CD  1 
ATOM   5790 O  OE1 . GLU B 1 199 ? -3.389  -6.269  -5.679  1.00 56.96  ? 199 GLU B OE1 1 
ATOM   5791 O  OE2 . GLU B 1 199 ? -3.315  -7.473  -3.823  1.00 72.39  ? 199 GLU B OE2 1 
ATOM   5792 N  N   . SER B 1 200 ? -5.643  -4.182  -4.211  1.00 26.32  ? 200 SER B N   1 
ATOM   5793 C  CA  . SER B 1 200 ? -4.713  -3.156  -3.735  1.00 26.16  ? 200 SER B CA  1 
ATOM   5794 C  C   . SER B 1 200 ? -5.236  -1.808  -4.216  1.00 26.33  ? 200 SER B C   1 
ATOM   5795 O  O   . SER B 1 200 ? -6.340  -1.410  -3.802  1.00 16.65  ? 200 SER B O   1 
ATOM   5796 C  CB  . SER B 1 200 ? -3.299  -3.532  -4.187  1.00 31.39  ? 200 SER B CB  1 
ATOM   5797 O  OG  . SER B 1 200 ? -2.340  -2.593  -3.736  1.00 40.43  ? 200 SER B OG  1 
ATOM   5798 N  N   . ALA B 1 201 ? -4.517  -1.086  -5.078  1.00 31.16  ? 201 ALA B N   1 
ATOM   5799 C  CA  . ALA B 1 201 ? -5.080  0.123   -5.656  1.00 24.05  ? 201 ALA B CA  1 
ATOM   5800 C  C   . ALA B 1 201 ? -6.419  -0.161  -6.316  1.00 19.48  ? 201 ALA B C   1 
ATOM   5801 O  O   . ALA B 1 201 ? -7.319  0.680   -6.277  1.00 23.35  ? 201 ALA B O   1 
ATOM   5802 C  CB  . ALA B 1 201 ? -4.098  0.727   -6.657  1.00 28.77  ? 201 ALA B CB  1 
ATOM   5803 N  N   . GLY B 1 202 ? -6.580  -1.349  -6.897  1.00 13.87  ? 202 GLY B N   1 
ATOM   5804 C  CA  . GLY B 1 202 ? -7.872  -1.709  -7.458  1.00 29.86  ? 202 GLY B CA  1 
ATOM   5805 C  C   . GLY B 1 202 ? -8.955  -1.782  -6.400  1.00 31.72  ? 202 GLY B C   1 
ATOM   5806 O  O   . GLY B 1 202 ? -10.013 -1.152  -6.530  1.00 28.03  ? 202 GLY B O   1 
ATOM   5807 N  N   . GLY B 1 203 ? -8.696  -2.541  -5.329  1.00 26.55  ? 203 GLY B N   1 
ATOM   5808 C  CA  . GLY B 1 203 ? -9.670  -2.648  -4.256  1.00 29.92  ? 203 GLY B CA  1 
ATOM   5809 C  C   . GLY B 1 203 ? -10.009 -1.304  -3.641  1.00 33.82  ? 203 GLY B C   1 
ATOM   5810 O  O   . GLY B 1 203 ? -11.172 -1.026  -3.331  1.00 33.43  ? 203 GLY B O   1 
ATOM   5811 N  N   . ALA B 1 204 ? -8.999  -0.451  -3.453  1.00 26.12  ? 204 ALA B N   1 
ATOM   5812 C  CA  . ALA B 1 204 ? -9.277  0.897   -2.980  1.00 31.03  ? 204 ALA B CA  1 
ATOM   5813 C  C   . ALA B 1 204 ? -10.244 1.601   -3.918  1.00 35.39  ? 204 ALA B C   1 
ATOM   5814 O  O   . ALA B 1 204 ? -11.204 2.240   -3.470  1.00 32.72  ? 204 ALA B O   1 
ATOM   5815 C  CB  . ALA B 1 204 ? -7.978  1.689   -2.856  1.00 36.55  ? 204 ALA B CB  1 
ATOM   5816 N  N   . SER B 1 205 ? -10.014 1.466   -5.226  1.00 35.95  ? 205 SER B N   1 
ATOM   5817 C  CA  . SER B 1 205 ? -10.884 2.083   -6.220  1.00 34.19  ? 205 SER B CA  1 
ATOM   5818 C  C   . SER B 1 205 ? -12.304 1.539   -6.126  1.00 31.21  ? 205 SER B C   1 
ATOM   5819 O  O   . SER B 1 205 ? -13.275 2.310   -6.040  1.00 21.11  ? 205 SER B O   1 
ATOM   5820 C  CB  . SER B 1 205 ? -10.321 1.837   -7.616  1.00 32.08  ? 205 SER B CB  1 
ATOM   5821 O  OG  . SER B 1 205 ? -8.952  2.157   -7.656  1.00 37.10  ? 205 SER B OG  1 
ATOM   5822 N  N   . VAL B 1 206 ? -12.441 0.206   -6.193  1.00 27.94  ? 206 VAL B N   1 
ATOM   5823 C  CA  . VAL B 1 206 ? -13.734 -0.428  -5.961  1.00 14.71  ? 206 VAL B CA  1 
ATOM   5824 C  C   . VAL B 1 206 ? -14.392 0.232   -4.768  1.00 17.02  ? 206 VAL B C   1 
ATOM   5825 O  O   . VAL B 1 206 ? -15.537 0.696   -4.837  1.00 17.70  ? 206 VAL B O   1 
ATOM   5826 C  CB  . VAL B 1 206 ? -13.562 -1.942  -5.748  1.00 14.36  ? 206 VAL B CB  1 
ATOM   5827 C  CG1 . VAL B 1 206 ? -14.732 -2.519  -5.019  1.00 14.44  ? 206 VAL B CG1 1 
ATOM   5828 C  CG2 . VAL B 1 206 ? -13.389 -2.632  -7.068  1.00 30.04  ? 206 VAL B CG2 1 
ATOM   5829 N  N   . GLY B 1 207 ? -13.634 0.358   -3.680  1.00 16.69  ? 207 GLY B N   1 
ATOM   5830 C  CA  . GLY B 1 207 ? -14.116 1.108   -2.539  1.00 22.32  ? 207 GLY B CA  1 
ATOM   5831 C  C   . GLY B 1 207 ? -14.623 2.481   -2.921  1.00 24.87  ? 207 GLY B C   1 
ATOM   5832 O  O   . GLY B 1 207 ? -15.745 2.845   -2.581  1.00 36.93  ? 207 GLY B O   1 
ATOM   5833 N  N   . MET B 1 208 ? -13.828 3.252   -3.671  1.00 22.09  ? 208 MET B N   1 
ATOM   5834 C  CA  . MET B 1 208 ? -14.213 4.651   -3.854  1.00 26.76  ? 208 MET B CA  1 
ATOM   5835 C  C   . MET B 1 208 ? -15.348 4.825   -4.848  1.00 27.82  ? 208 MET B C   1 
ATOM   5836 O  O   . MET B 1 208 ? -15.961 5.899   -4.892  1.00 30.12  ? 208 MET B O   1 
ATOM   5837 C  CB  . MET B 1 208 ? -13.032 5.539   -4.282  1.00 24.94  ? 208 MET B CB  1 
ATOM   5838 C  CG  . MET B 1 208 ? -11.737 5.273   -3.557  1.00 20.21  ? 208 MET B CG  1 
ATOM   5839 S  SD  . MET B 1 208 ? -10.265 6.046   -4.234  1.00 30.28  ? 208 MET B SD  1 
ATOM   5840 C  CE  . MET B 1 208 ? -9.317  6.401   -2.744  1.00 22.36  ? 208 MET B CE  1 
ATOM   5841 N  N   . HIS B 1 209 ? -15.660 3.817   -5.645  1.00 22.06  ? 209 HIS B N   1 
ATOM   5842 C  CA  . HIS B 1 209 ? -16.864 3.988   -6.430  1.00 24.05  ? 209 HIS B CA  1 
ATOM   5843 C  C   . HIS B 1 209 ? -18.097 3.776   -5.570  1.00 33.91  ? 209 HIS B C   1 
ATOM   5844 O  O   . HIS B 1 209 ? -19.146 4.375   -5.838  1.00 37.13  ? 209 HIS B O   1 
ATOM   5845 C  CB  . HIS B 1 209 ? -16.836 3.061   -7.640  1.00 30.05  ? 209 HIS B CB  1 
ATOM   5846 C  CG  . HIS B 1 209 ? -15.788 3.435   -8.638  1.00 29.73  ? 209 HIS B CG  1 
ATOM   5847 N  ND1 . HIS B 1 209 ? -15.939 4.492   -9.509  1.00 21.53  ? 209 HIS B ND1 1 
ATOM   5848 C  CD2 . HIS B 1 209 ? -14.555 2.923   -8.872  1.00 16.12  ? 209 HIS B CD2 1 
ATOM   5849 C  CE1 . HIS B 1 209 ? -14.853 4.600   -10.255 1.00 26.98  ? 209 HIS B CE1 1 
ATOM   5850 N  NE2 . HIS B 1 209 ? -13.998 3.661   -9.887  1.00 21.59  ? 209 HIS B NE2 1 
ATOM   5851 N  N   . ILE B 1 210 ? -17.993 2.981   -4.502  1.00 16.60  ? 210 ILE B N   1 
ATOM   5852 C  CA  . ILE B 1 210 ? -19.168 2.886   -3.656  1.00 28.06  ? 210 ILE B CA  1 
ATOM   5853 C  C   . ILE B 1 210 ? -19.354 4.158   -2.827  1.00 33.77  ? 210 ILE B C   1 
ATOM   5854 O  O   . ILE B 1 210 ? -20.480 4.449   -2.402  1.00 51.32  ? 210 ILE B O   1 
ATOM   5855 C  CB  . ILE B 1 210 ? -19.140 1.627   -2.777  1.00 18.79  ? 210 ILE B CB  1 
ATOM   5856 C  CG1 . ILE B 1 210 ? -18.317 1.832   -1.546  1.00 19.45  ? 210 ILE B CG1 1 
ATOM   5857 C  CG2 . ILE B 1 210 ? -18.573 0.434   -3.510  1.00 26.56  ? 210 ILE B CG2 1 
ATOM   5858 C  CD1 . ILE B 1 210 ? -18.375 0.624   -0.716  1.00 35.10  ? 210 ILE B CD1 1 
ATOM   5859 N  N   . LEU B 1 211 ? -18.297 4.953   -2.619  1.00 26.55  ? 211 LEU B N   1 
ATOM   5860 C  CA  . LEU B 1 211 ? -18.497 6.278   -2.030  1.00 17.97  ? 211 LEU B CA  1 
ATOM   5861 C  C   . LEU B 1 211 ? -19.009 7.301   -3.032  1.00 23.64  ? 211 LEU B C   1 
ATOM   5862 O  O   . LEU B 1 211 ? -19.884 8.099   -2.698  1.00 44.69  ? 211 LEU B O   1 
ATOM   5863 C  CB  . LEU B 1 211 ? -17.221 6.836   -1.400  1.00 29.14  ? 211 LEU B CB  1 
ATOM   5864 C  CG  . LEU B 1 211 ? -16.511 6.163   -0.223  1.00 36.14  ? 211 LEU B CG  1 
ATOM   5865 C  CD1 . LEU B 1 211 ? -17.568 5.747   0.828   1.00 31.77  ? 211 LEU B CD1 1 
ATOM   5866 C  CD2 . LEU B 1 211 ? -15.565 5.050   -0.609  1.00 30.78  ? 211 LEU B CD2 1 
ATOM   5867 N  N   . SER B 1 212 ? -18.471 7.322   -4.230  1.00 33.96  ? 212 SER B N   1 
ATOM   5868 C  CA  . SER B 1 212 ? -18.690 8.465   -5.100  1.00 42.92  ? 212 SER B CA  1 
ATOM   5869 C  C   . SER B 1 212 ? -20.057 8.390   -5.748  1.00 43.77  ? 212 SER B C   1 
ATOM   5870 O  O   . SER B 1 212 ? -20.392 7.381   -6.376  1.00 49.50  ? 212 SER B O   1 
ATOM   5871 C  CB  . SER B 1 212 ? -17.611 8.585   -6.159  1.00 44.23  ? 212 SER B CB  1 
ATOM   5872 O  OG  . SER B 1 212 ? -17.677 9.830   -6.844  1.00 45.18  ? 212 SER B OG  1 
ATOM   5873 N  N   . PRO B 1 213 ? -20.870 9.437   -5.596  1.00 41.75  ? 213 PRO B N   1 
ATOM   5874 C  CA  . PRO B 1 213 ? -22.220 9.435   -6.218  1.00 39.45  ? 213 PRO B CA  1 
ATOM   5875 C  C   . PRO B 1 213 ? -22.223 9.225   -7.721  1.00 39.79  ? 213 PRO B C   1 
ATOM   5876 O  O   . PRO B 1 213 ? -23.009 8.407   -8.230  1.00 45.36  ? 213 PRO B O   1 
ATOM   5877 C  CB  . PRO B 1 213 ? -22.789 10.810  -5.828  1.00 33.95  ? 213 PRO B CB  1 
ATOM   5878 C  CG  . PRO B 1 213 ? -22.009 11.181  -4.557  1.00 25.42  ? 213 PRO B CG  1 
ATOM   5879 C  CD  . PRO B 1 213 ? -20.653 10.566  -4.653  1.00 30.11  ? 213 PRO B CD  1 
ATOM   5880 N  N   . GLY B 1 214 ? -21.341 9.922   -8.442  1.00 36.07  ? 214 GLY B N   1 
ATOM   5881 C  CA  . GLY B 1 214 ? -21.157 9.716   -9.872  1.00 30.13  ? 214 GLY B CA  1 
ATOM   5882 C  C   . GLY B 1 214 ? -20.791 8.292   -10.263 1.00 30.08  ? 214 GLY B C   1 
ATOM   5883 O  O   . GLY B 1 214 ? -20.730 7.984   -11.460 1.00 20.30  ? 214 GLY B O   1 
ATOM   5884 N  N   . SER B 1 215 ? -20.556 7.419   -9.286  1.00 25.70  ? 215 SER B N   1 
ATOM   5885 C  CA  . SER B 1 215 ? -20.231 6.037   -9.565  1.00 18.94  ? 215 SER B CA  1 
ATOM   5886 C  C   . SER B 1 215 ? -21.260 5.038   -9.066  1.00 22.73  ? 215 SER B C   1 
ATOM   5887 O  O   . SER B 1 215 ? -21.289 3.914   -9.581  1.00 19.89  ? 215 SER B O   1 
ATOM   5888 C  CB  . SER B 1 215 ? -18.872 5.670   -8.950  1.00 35.16  ? 215 SER B CB  1 
ATOM   5889 O  OG  . SER B 1 215 ? -17.789 6.348   -9.572  1.00 39.00  ? 215 SER B OG  1 
ATOM   5890 N  N   . ARG B 1 216 ? -22.108 5.410   -8.101  1.00 35.61  ? 216 ARG B N   1 
ATOM   5891 C  CA  . ARG B 1 216 ? -22.925 4.424   -7.396  1.00 38.58  ? 216 ARG B CA  1 
ATOM   5892 C  C   . ARG B 1 216 ? -23.754 3.600   -8.357  1.00 40.16  ? 216 ARG B C   1 
ATOM   5893 O  O   . ARG B 1 216 ? -23.956 2.400   -8.146  1.00 52.78  ? 216 ARG B O   1 
ATOM   5894 C  CB  . ARG B 1 216 ? -23.852 5.109   -6.393  1.00 46.64  ? 216 ARG B CB  1 
ATOM   5895 C  CG  . ARG B 1 216 ? -23.177 6.127   -5.506  1.00 54.43  ? 216 ARG B CG  1 
ATOM   5896 C  CD  . ARG B 1 216 ? -23.001 5.607   -4.098  1.00 52.18  ? 216 ARG B CD  1 
ATOM   5897 N  NE  . ARG B 1 216 ? -22.353 6.566   -3.210  1.00 48.65  ? 216 ARG B NE  1 
ATOM   5898 C  CZ  . ARG B 1 216 ? -23.016 7.482   -2.512  1.00 48.91  ? 216 ARG B CZ  1 
ATOM   5899 N  NH1 . ARG B 1 216 ? -22.369 8.318   -1.715  1.00 45.66  ? 216 ARG B NH1 1 
ATOM   5900 N  NH2 . ARG B 1 216 ? -24.332 7.569   -2.627  1.00 52.73  ? 216 ARG B NH2 1 
ATOM   5901 N  N   . ASP B 1 217 ? -24.230 4.221   -9.427  1.00 39.31  ? 217 ASP B N   1 
ATOM   5902 C  CA  . ASP B 1 217 ? -25.224 3.602   -10.281 1.00 36.97  ? 217 ASP B CA  1 
ATOM   5903 C  C   . ASP B 1 217 ? -24.623 2.859   -11.457 1.00 30.28  ? 217 ASP B C   1 
ATOM   5904 O  O   . ASP B 1 217 ? -25.373 2.430   -12.332 1.00 25.23  ? 217 ASP B O   1 
ATOM   5905 C  CB  . ASP B 1 217 ? -26.220 4.654   -10.764 1.00 40.96  ? 217 ASP B CB  1 
ATOM   5906 C  CG  . ASP B 1 217 ? -27.235 5.025   -9.681  1.00 51.53  ? 217 ASP B CG  1 
ATOM   5907 O  OD1 . ASP B 1 217 ? -27.290 4.299   -8.662  1.00 47.80  ? 217 ASP B OD1 1 
ATOM   5908 O  OD2 . ASP B 1 217 ? -27.970 6.029   -9.835  1.00 57.26  ? 217 ASP B OD2 1 
ATOM   5909 N  N   . LEU B 1 218 ? -23.303 2.646   -11.478 1.00 36.12  ? 218 LEU B N   1 
ATOM   5910 C  CA  . LEU B 1 218 ? -22.643 1.997   -12.609 1.00 34.06  ? 218 LEU B CA  1 
ATOM   5911 C  C   . LEU B 1 218 ? -22.221 0.560   -12.337 1.00 35.47  ? 218 LEU B C   1 
ATOM   5912 O  O   . LEU B 1 218 ? -21.475 -0.022  -13.137 1.00 25.94  ? 218 LEU B O   1 
ATOM   5913 C  CB  . LEU B 1 218 ? -21.435 2.810   -13.063 1.00 23.72  ? 218 LEU B CB  1 
ATOM   5914 C  CG  . LEU B 1 218 ? -21.826 4.182   -13.591 1.00 22.94  ? 218 LEU B CG  1 
ATOM   5915 C  CD1 . LEU B 1 218 ? -20.606 4.886   -14.090 1.00 29.03  ? 218 LEU B CD1 1 
ATOM   5916 C  CD2 . LEU B 1 218 ? -22.825 4.040   -14.714 1.00 20.20  ? 218 LEU B CD2 1 
ATOM   5917 N  N   . PHE B 1 219 ? -22.686 -0.026  -11.246 1.00 37.76  ? 219 PHE B N   1 
ATOM   5918 C  CA  . PHE B 1 219 ? -22.400 -1.421  -10.950 1.00 29.74  ? 219 PHE B CA  1 
ATOM   5919 C  C   . PHE B 1 219 ? -23.389 -1.864  -9.900  1.00 26.98  ? 219 PHE B C   1 
ATOM   5920 O  O   . PHE B 1 219 ? -24.135 -1.057  -9.344  1.00 29.65  ? 219 PHE B O   1 
ATOM   5921 C  CB  . PHE B 1 219 ? -20.982 -1.615  -10.442 1.00 31.09  ? 219 PHE B CB  1 
ATOM   5922 C  CG  . PHE B 1 219 ? -20.677 -0.818  -9.212  1.00 29.28  ? 219 PHE B CG  1 
ATOM   5923 C  CD1 . PHE B 1 219 ? -20.411 0.539   -9.309  1.00 27.53  ? 219 PHE B CD1 1 
ATOM   5924 C  CD2 . PHE B 1 219 ? -20.650 -1.419  -7.959  1.00 25.00  ? 219 PHE B CD2 1 
ATOM   5925 C  CE1 . PHE B 1 219 ? -20.124 1.287   -8.175  1.00 29.28  ? 219 PHE B CE1 1 
ATOM   5926 C  CE2 . PHE B 1 219 ? -20.347 -0.682  -6.819  1.00 16.49  ? 219 PHE B CE2 1 
ATOM   5927 C  CZ  . PHE B 1 219 ? -20.089 0.674   -6.924  1.00 21.04  ? 219 PHE B CZ  1 
ATOM   5928 N  N   . ARG B 1 220 ? -23.374 -3.157  -9.615  1.00 27.95  ? 220 ARG B N   1 
ATOM   5929 C  CA  . ARG B 1 220 ? -24.340 -3.712  -8.675  1.00 26.29  ? 220 ARG B CA  1 
ATOM   5930 C  C   . ARG B 1 220 ? -23.704 -4.083  -7.341  1.00 24.12  ? 220 ARG B C   1 
ATOM   5931 O  O   . ARG B 1 220 ? -24.201 -3.683  -6.288  1.00 23.89  ? 220 ARG B O   1 
ATOM   5932 C  CB  . ARG B 1 220 ? -25.030 -4.930  -9.295  1.00 22.26  ? 220 ARG B CB  1 
ATOM   5933 C  CG  . ARG B 1 220 ? -25.910 -5.655  -8.330  1.00 35.57  ? 220 ARG B CG  1 
ATOM   5934 C  CD  . ARG B 1 220 ? -27.308 -5.667  -8.856  1.00 47.24  ? 220 ARG B CD  1 
ATOM   5935 N  NE  . ARG B 1 220 ? -28.243 -6.043  -7.810  1.00 58.47  ? 220 ARG B NE  1 
ATOM   5936 C  CZ  . ARG B 1 220 ? -29.312 -6.796  -8.005  1.00 65.51  ? 220 ARG B CZ  1 
ATOM   5937 N  NH1 . ARG B 1 220 ? -29.556 -7.265  -9.216  1.00 63.24  ? 220 ARG B NH1 1 
ATOM   5938 N  NH2 . ARG B 1 220 ? -30.104 -7.073  -6.974  1.00 67.88  ? 220 ARG B NH2 1 
ATOM   5939 N  N   . ARG B 1 221 ? -22.594 -4.807  -7.378  1.00 16.68  ? 221 ARG B N   1 
ATOM   5940 C  CA  . ARG B 1 221 ? -21.895 -5.325  -6.221  1.00 16.25  ? 221 ARG B CA  1 
ATOM   5941 C  C   . ARG B 1 221 ? -20.427 -4.947  -6.318  1.00 29.46  ? 221 ARG B C   1 
ATOM   5942 O  O   . ARG B 1 221 ? -19.977 -4.341  -7.298  1.00 40.31  ? 221 ARG B O   1 
ATOM   5943 C  CB  . ARG B 1 221 ? -22.031 -6.848  -6.147  1.00 26.45  ? 221 ARG B CB  1 
ATOM   5944 C  CG  . ARG B 1 221 ? -23.342 -7.319  -5.626  1.00 22.14  ? 221 ARG B CG  1 
ATOM   5945 C  CD  . ARG B 1 221 ? -23.885 -8.522  -6.360  1.00 28.45  ? 221 ARG B CD  1 
ATOM   5946 N  NE  . ARG B 1 221 ? -25.293 -8.635  -5.975  1.00 41.95  ? 221 ARG B NE  1 
ATOM   5947 C  CZ  . ARG B 1 221 ? -26.258 -9.217  -6.676  1.00 36.93  ? 221 ARG B CZ  1 
ATOM   5948 N  NH1 . ARG B 1 221 ? -26.008 -9.772  -7.849  1.00 23.07  ? 221 ARG B NH1 1 
ATOM   5949 N  NH2 . ARG B 1 221 ? -27.479 -9.227  -6.173  1.00 45.60  ? 221 ARG B NH2 1 
ATOM   5950 N  N   . ALA B 1 222 ? -19.664 -5.381  -5.319  1.00 27.22  ? 222 ALA B N   1 
ATOM   5951 C  CA  . ALA B 1 222 ? -18.282 -4.953  -5.169  1.00 32.19  ? 222 ALA B CA  1 
ATOM   5952 C  C   . ALA B 1 222 ? -17.493 -6.025  -4.437  1.00 30.75  ? 222 ALA B C   1 
ATOM   5953 O  O   . ALA B 1 222 ? -17.887 -6.455  -3.349  1.00 29.15  ? 222 ALA B O   1 
ATOM   5954 C  CB  . ALA B 1 222 ? -18.203 -3.624  -4.407  1.00 21.09  ? 222 ALA B CB  1 
ATOM   5955 N  N   . ILE B 1 223 ? -16.386 -6.451  -5.034  1.00 22.54  ? 223 ILE B N   1 
ATOM   5956 C  CA  . ILE B 1 223 ? -15.411 -7.296  -4.363  1.00 19.60  ? 223 ILE B CA  1 
ATOM   5957 C  C   . ILE B 1 223 ? -14.159 -6.468  -4.116  1.00 17.54  ? 223 ILE B C   1 
ATOM   5958 O  O   . ILE B 1 223 ? -13.669 -5.797  -5.033  1.00 18.82  ? 223 ILE B O   1 
ATOM   5959 C  CB  . ILE B 1 223 ? -15.090 -8.542  -5.196  1.00 21.55  ? 223 ILE B CB  1 
ATOM   5960 C  CG1 . ILE B 1 223 ? -16.339 -9.406  -5.347  1.00 20.52  ? 223 ILE B CG1 1 
ATOM   5961 C  CG2 . ILE B 1 223 ? -13.922 -9.307  -4.582  1.00 20.22  ? 223 ILE B CG2 1 
ATOM   5962 C  CD1 . ILE B 1 223 ? -16.093 -10.671 -6.178  1.00 25.57  ? 223 ILE B CD1 1 
ATOM   5963 N  N   . LEU B 1 224 ? -13.650 -6.494  -2.880  1.00 22.80  ? 224 LEU B N   1 
ATOM   5964 C  CA  . LEU B 1 224 ? -12.426 -5.777  -2.520  1.00 28.62  ? 224 LEU B CA  1 
ATOM   5965 C  C   . LEU B 1 224 ? -11.373 -6.759  -2.021  1.00 26.65  ? 224 LEU B C   1 
ATOM   5966 O  O   . LEU B 1 224 ? -11.632 -7.541  -1.106  1.00 30.08  ? 224 LEU B O   1 
ATOM   5967 C  CB  . LEU B 1 224 ? -12.675 -4.691  -1.463  1.00 13.67  ? 224 LEU B CB  1 
ATOM   5968 C  CG  . LEU B 1 224 ? -13.587 -3.513  -1.829  1.00 13.97  ? 224 LEU B CG  1 
ATOM   5969 C  CD1 . LEU B 1 224 ? -15.058 -3.849  -1.677  1.00 14.23  ? 224 LEU B CD1 1 
ATOM   5970 C  CD2 . LEU B 1 224 ? -13.263 -2.271  -1.047  1.00 14.12  ? 224 LEU B CD2 1 
ATOM   5971 N  N   . GLN B 1 225 ? -10.178 -6.712  -2.606  1.00 24.13  ? 225 GLN B N   1 
ATOM   5972 C  CA  . GLN B 1 225 ? -9.097  -7.615  -2.225  1.00 25.02  ? 225 GLN B CA  1 
ATOM   5973 C  C   . GLN B 1 225 ? -7.878  -6.803  -1.800  1.00 26.34  ? 225 GLN B C   1 
ATOM   5974 O  O   . GLN B 1 225 ? -7.274  -6.114  -2.630  1.00 35.90  ? 225 GLN B O   1 
ATOM   5975 C  CB  . GLN B 1 225 ? -8.747  -8.546  -3.388  1.00 33.04  ? 225 GLN B CB  1 
ATOM   5976 C  CG  . GLN B 1 225 ? -9.956  -9.134  -4.109  1.00 33.56  ? 225 GLN B CG  1 
ATOM   5977 C  CD  . GLN B 1 225 ? -9.584  -9.834  -5.409  1.00 39.42  ? 225 GLN B CD  1 
ATOM   5978 O  OE1 . GLN B 1 225 ? -10.438 -10.097 -6.259  1.00 39.42  ? 225 GLN B OE1 1 
ATOM   5979 N  NE2 . GLN B 1 225 ? -8.302  -10.148 -5.561  1.00 48.39  ? 225 GLN B NE2 1 
ATOM   5980 N  N   . SER B 1 226 ? -7.509  -6.892  -0.518  1.00 23.90  ? 226 SER B N   1 
ATOM   5981 C  CA  . SER B 1 226 ? -6.297  -6.236  0.011   1.00 28.82  ? 226 SER B CA  1 
ATOM   5982 C  C   . SER B 1 226 ? -6.243  -4.750  -0.350  1.00 27.19  ? 226 SER B C   1 
ATOM   5983 O  O   . SER B 1 226 ? -5.214  -4.232  -0.786  1.00 27.80  ? 226 SER B O   1 
ATOM   5984 C  CB  . SER B 1 226 ? -5.021  -6.926  -0.482  1.00 31.31  ? 226 SER B CB  1 
ATOM   5985 O  OG  . SER B 1 226 ? -5.093  -8.340  -0.436  1.00 37.40  ? 226 SER B OG  1 
ATOM   5986 N  N   . GLY B 1 227 ? -7.368  -4.062  -0.170  1.00 20.81  ? 227 GLY B N   1 
ATOM   5987 C  CA  . GLY B 1 227 ? -7.469  -2.653  -0.503  1.00 13.40  ? 227 GLY B CA  1 
ATOM   5988 C  C   . GLY B 1 227 ? -8.777  -2.047  -0.029  1.00 35.05  ? 227 GLY B C   1 
ATOM   5989 O  O   . GLY B 1 227 ? -9.822  -2.714  -0.026  1.00 29.74  ? 227 GLY B O   1 
ATOM   5990 N  N   . SER B 1 228 ? -8.734  -0.784  0.387   1.00 35.97  ? 228 SER B N   1 
ATOM   5991 C  CA  . SER B 1 228 ? -9.895  -0.134  0.975   1.00 36.27  ? 228 SER B CA  1 
ATOM   5992 C  C   . SER B 1 228 ? -9.819  1.341   0.664   1.00 27.91  ? 228 SER B C   1 
ATOM   5993 O  O   . SER B 1 228 ? -8.721  1.896   0.564   1.00 14.54  ? 228 SER B O   1 
ATOM   5994 C  CB  . SER B 1 228 ? -9.973  -0.321  2.499   1.00 38.76  ? 228 SER B CB  1 
ATOM   5995 O  OG  . SER B 1 228 ? -10.103 -1.682  2.830   1.00 42.44  ? 228 SER B OG  1 
ATOM   5996 N  N   . PRO B 1 229 ? -10.958 2.008   0.529   1.00 23.89  ? 229 PRO B N   1 
ATOM   5997 C  CA  . PRO B 1 229 ? -10.905 3.442   0.242   1.00 26.62  ? 229 PRO B CA  1 
ATOM   5998 C  C   . PRO B 1 229 ? -10.165 4.218   1.308   1.00 20.84  ? 229 PRO B C   1 
ATOM   5999 O  O   . PRO B 1 229 ? -9.465  5.185   0.992   1.00 28.48  ? 229 PRO B O   1 
ATOM   6000 C  CB  . PRO B 1 229 ? -12.385 3.835   0.151   1.00 24.07  ? 229 PRO B CB  1 
ATOM   6001 C  CG  . PRO B 1 229 ? -13.135 2.719   0.762   1.00 25.01  ? 229 PRO B CG  1 
ATOM   6002 C  CD  . PRO B 1 229 ? -12.334 1.493   0.567   1.00 21.09  ? 229 PRO B CD  1 
ATOM   6003 N  N   . ASN B 1 230 ? -10.269 3.800   2.561   1.00 29.64  ? 230 ASN B N   1 
ATOM   6004 C  CA  . ASN B 1 230 ? -9.697  4.540   3.678   1.00 32.08  ? 230 ASN B CA  1 
ATOM   6005 C  C   . ASN B 1 230 ? -8.242  4.176   3.948   1.00 29.57  ? 230 ASN B C   1 
ATOM   6006 O  O   . ASN B 1 230 ? -7.737  4.485   5.031   1.00 36.76  ? 230 ASN B O   1 
ATOM   6007 C  CB  . ASN B 1 230 ? -10.533 4.304   4.940   1.00 21.39  ? 230 ASN B CB  1 
ATOM   6008 C  CG  . ASN B 1 230 ? -10.680 2.824   5.254   1.00 31.45  ? 230 ASN B CG  1 
ATOM   6009 O  OD1 . ASN B 1 230 ? -11.035 2.024   4.372   1.00 33.05  ? 230 ASN B OD1 1 
ATOM   6010 N  ND2 . ASN B 1 230 ? -10.383 2.442   6.500   1.00 15.67  ? 230 ASN B ND2 1 
ATOM   6011 N  N   . CYS B 1 231 ? -7.565  3.522   3.004   1.00 26.83  ? 231 CYS B N   1 
ATOM   6012 C  CA  . CYS B 1 231 ? -6.181  3.125   3.237   1.00 30.78  ? 231 CYS B CA  1 
ATOM   6013 C  C   . CYS B 1 231 ? -5.302  4.363   3.435   1.00 29.87  ? 231 CYS B C   1 
ATOM   6014 O  O   . CYS B 1 231 ? -5.521  5.397   2.785   1.00 28.07  ? 231 CYS B O   1 
ATOM   6015 C  CB  . CYS B 1 231 ? -5.653  2.273   2.077   1.00 31.60  ? 231 CYS B CB  1 
ATOM   6016 S  SG  . CYS B 1 231 ? -6.186  0.525   2.077   1.00 31.01  ? 231 CYS B SG  1 
ATOM   6017 N  N   . PRO B 1 232 ? -4.313  4.306   4.334   1.00 24.29  ? 232 PRO B N   1 
ATOM   6018 C  CA  . PRO B 1 232 ? -3.501  5.507   4.593   1.00 21.83  ? 232 PRO B CA  1 
ATOM   6019 C  C   . PRO B 1 232 ? -2.709  5.945   3.384   1.00 24.73  ? 232 PRO B C   1 
ATOM   6020 O  O   . PRO B 1 232 ? -2.400  7.137   3.255   1.00 26.49  ? 232 PRO B O   1 
ATOM   6021 C  CB  . PRO B 1 232 ? -2.578  5.072   5.740   1.00 16.08  ? 232 PRO B CB  1 
ATOM   6022 C  CG  . PRO B 1 232 ? -2.456  3.596   5.562   1.00 35.56  ? 232 PRO B CG  1 
ATOM   6023 C  CD  . PRO B 1 232 ? -3.822  3.134   5.076   1.00 27.74  ? 232 PRO B CD  1 
ATOM   6024 N  N   . TRP B 1 233 ? -2.373  5.011   2.493   1.00 15.62  ? 233 TRP B N   1 
ATOM   6025 C  CA  . TRP B 1 233 ? -1.662  5.338   1.267   1.00 18.47  ? 233 TRP B CA  1 
ATOM   6026 C  C   . TRP B 1 233 ? -2.585  5.695   0.106   1.00 20.21  ? 233 TRP B C   1 
ATOM   6027 O  O   . TRP B 1 233 ? -2.105  6.170   -0.927  1.00 15.89  ? 233 TRP B O   1 
ATOM   6028 C  CB  . TRP B 1 233 ? -0.778  4.166   0.856   1.00 15.31  ? 233 TRP B CB  1 
ATOM   6029 C  CG  . TRP B 1 233 ? -1.483  2.869   0.918   1.00 27.11  ? 233 TRP B CG  1 
ATOM   6030 C  CD1 . TRP B 1 233 ? -1.435  1.971   1.930   1.00 38.65  ? 233 TRP B CD1 1 
ATOM   6031 C  CD2 . TRP B 1 233 ? -2.366  2.319   -0.064  1.00 31.70  ? 233 TRP B CD2 1 
ATOM   6032 N  NE1 . TRP B 1 233 ? -2.211  0.877   1.638   1.00 36.71  ? 233 TRP B NE1 1 
ATOM   6033 C  CE2 . TRP B 1 233 ? -2.793  1.063   0.416   1.00 33.11  ? 233 TRP B CE2 1 
ATOM   6034 C  CE3 . TRP B 1 233 ? -2.830  2.759   -1.305  1.00 26.31  ? 233 TRP B CE3 1 
ATOM   6035 C  CZ2 . TRP B 1 233 ? -3.669  0.246   -0.293  1.00 26.72  ? 233 TRP B CZ2 1 
ATOM   6036 C  CZ3 . TRP B 1 233 ? -3.698  1.938   -2.014  1.00 29.86  ? 233 TRP B CZ3 1 
ATOM   6037 C  CH2 . TRP B 1 233 ? -4.110  0.698   -1.504  1.00 25.58  ? 233 TRP B CH2 1 
ATOM   6038 N  N   . ALA B 1 234 ? -3.889  5.499   0.260   1.00 23.42  ? 234 ALA B N   1 
ATOM   6039 C  CA  . ALA B 1 234 ? -4.820  5.551   -0.852  1.00 18.73  ? 234 ALA B CA  1 
ATOM   6040 C  C   . ALA B 1 234 ? -5.268  6.959   -1.223  1.00 30.04  ? 234 ALA B C   1 
ATOM   6041 O  O   . ALA B 1 234 ? -5.819  7.143   -2.317  1.00 33.73  ? 234 ALA B O   1 
ATOM   6042 C  CB  . ALA B 1 234 ? -6.041  4.696   -0.537  1.00 18.39  ? 234 ALA B CB  1 
ATOM   6043 N  N   . SER B 1 235 ? -5.038  7.963   -0.383  1.00 34.78  ? 235 SER B N   1 
ATOM   6044 C  CA  . SER B 1 235 ? -5.516  9.292   -0.747  1.00 32.64  ? 235 SER B CA  1 
ATOM   6045 C  C   . SER B 1 235 ? -4.693  10.359  -0.040  1.00 24.71  ? 235 SER B C   1 
ATOM   6046 O  O   . SER B 1 235 ? -3.833  10.064  0.791   1.00 29.23  ? 235 SER B O   1 
ATOM   6047 C  CB  . SER B 1 235 ? -6.993  9.446   -0.415  1.00 32.83  ? 235 SER B CB  1 
ATOM   6048 O  OG  . SER B 1 235 ? -7.190  9.348   0.985   1.00 44.18  ? 235 SER B OG  1 
ATOM   6049 N  N   . VAL B 1 236 ? -4.967  11.610  -0.398  1.00 18.46  ? 236 VAL B N   1 
ATOM   6050 C  CA  . VAL B 1 236 ? -4.287  12.774  0.158   1.00 31.11  ? 236 VAL B CA  1 
ATOM   6051 C  C   . VAL B 1 236 ? -5.269  13.940  0.149   1.00 31.93  ? 236 VAL B C   1 
ATOM   6052 O  O   . VAL B 1 236 ? -6.351  13.864  -0.440  1.00 40.51  ? 236 VAL B O   1 
ATOM   6053 C  CB  . VAL B 1 236 ? -3.008  13.161  -0.624  1.00 19.38  ? 236 VAL B CB  1 
ATOM   6054 C  CG1 . VAL B 1 236 ? -1.920  12.128  -0.449  1.00 18.82  ? 236 VAL B CG1 1 
ATOM   6055 C  CG2 . VAL B 1 236 ? -3.327  13.353  -2.080  1.00 19.46  ? 236 VAL B CG2 1 
ATOM   6056 N  N   . SER B 1 237 ? -4.891  15.028  0.814   1.00 22.01  ? 237 SER B N   1 
ATOM   6057 C  CA  . SER B 1 237 ? -5.699  16.232  0.775   1.00 32.78  ? 237 SER B CA  1 
ATOM   6058 C  C   . SER B 1 237 ? -5.299  17.071  -0.433  1.00 39.54  ? 237 SER B C   1 
ATOM   6059 O  O   . SER B 1 237 ? -4.299  16.802  -1.102  1.00 43.62  ? 237 SER B O   1 
ATOM   6060 C  CB  . SER B 1 237 ? -5.542  17.044  2.058   1.00 28.80  ? 237 SER B CB  1 
ATOM   6061 O  OG  . SER B 1 237 ? -4.229  17.577  2.145   1.00 28.54  ? 237 SER B OG  1 
ATOM   6062 N  N   . VAL B 1 238 ? -6.106  18.097  -0.716  1.00 39.06  ? 238 VAL B N   1 
ATOM   6063 C  CA  . VAL B 1 238 ? -5.776  19.015  -1.801  1.00 36.22  ? 238 VAL B CA  1 
ATOM   6064 C  C   . VAL B 1 238 ? -4.470  19.721  -1.501  1.00 29.56  ? 238 VAL B C   1 
ATOM   6065 O  O   . VAL B 1 238 ? -3.632  19.912  -2.389  1.00 35.22  ? 238 VAL B O   1 
ATOM   6066 C  CB  . VAL B 1 238 ? -6.920  20.023  -2.039  1.00 42.84  ? 238 VAL B CB  1 
ATOM   6067 C  CG1 . VAL B 1 238 ? -8.054  19.371  -2.836  1.00 50.08  ? 238 VAL B CG1 1 
ATOM   6068 C  CG2 . VAL B 1 238 ? -7.431  20.588  -0.719  1.00 35.83  ? 238 VAL B CG2 1 
ATOM   6069 N  N   . ALA B 1 239 ? -4.265  20.096  -0.238  1.00 41.59  ? 239 ALA B N   1 
ATOM   6070 C  CA  . ALA B 1 239 ? -3.047  20.799  0.143   1.00 42.71  ? 239 ALA B CA  1 
ATOM   6071 C  C   . ALA B 1 239 ? -1.816  19.949  -0.148  1.00 36.49  ? 239 ALA B C   1 
ATOM   6072 O  O   . ALA B 1 239 ? -0.866  20.410  -0.790  1.00 43.35  ? 239 ALA B O   1 
ATOM   6073 C  CB  . ALA B 1 239 ? -3.114  21.193  1.616   1.00 25.34  ? 239 ALA B CB  1 
ATOM   6074 N  N   . GLU B 1 240 ? -1.825  18.693  0.299   1.00 23.27  ? 240 GLU B N   1 
ATOM   6075 C  CA  . GLU B 1 240 ? -0.714  17.811  -0.028  1.00 37.90  ? 240 GLU B CA  1 
ATOM   6076 C  C   . GLU B 1 240 ? -0.650  17.557  -1.525  1.00 47.70  ? 240 GLU B C   1 
ATOM   6077 O  O   . GLU B 1 240 ? 0.429   17.621  -2.128  1.00 50.65  ? 240 GLU B O   1 
ATOM   6078 C  CB  . GLU B 1 240 ? -0.835  16.489  0.732   1.00 37.21  ? 240 GLU B CB  1 
ATOM   6079 C  CG  . GLU B 1 240 ? 0.334   15.540  0.474   1.00 35.77  ? 240 GLU B CG  1 
ATOM   6080 C  CD  . GLU B 1 240 ? 1.584   15.966  1.208   1.00 43.28  ? 240 GLU B CD  1 
ATOM   6081 O  OE1 . GLU B 1 240 ? 1.539   16.029  2.451   1.00 55.01  ? 240 GLU B OE1 1 
ATOM   6082 O  OE2 . GLU B 1 240 ? 2.603   16.251  0.550   1.00 42.19  ? 240 GLU B OE2 1 
ATOM   6083 N  N   . GLY B 1 241 ? -1.800  17.285  -2.141  1.00 51.21  ? 241 GLY B N   1 
ATOM   6084 C  CA  . GLY B 1 241 ? -1.805  16.973  -3.558  1.00 49.84  ? 241 GLY B CA  1 
ATOM   6085 C  C   . GLY B 1 241 ? -1.257  18.108  -4.397  1.00 45.52  ? 241 GLY B C   1 
ATOM   6086 O  O   . GLY B 1 241 ? -0.630  17.875  -5.436  1.00 40.77  ? 241 GLY B O   1 
ATOM   6087 N  N   . ARG B 1 242 ? -1.477  19.354  -3.953  1.00 40.74  ? 242 ARG B N   1 
ATOM   6088 C  CA  . ARG B 1 242 ? -0.952  20.478  -4.711  1.00 38.82  ? 242 ARG B CA  1 
ATOM   6089 C  C   . ARG B 1 242 ? 0.532   20.660  -4.427  1.00 46.78  ? 242 ARG B C   1 
ATOM   6090 O  O   . ARG B 1 242 ? 1.332   20.839  -5.354  1.00 53.07  ? 242 ARG B O   1 
ATOM   6091 C  CB  . ARG B 1 242 ? -1.725  21.773  -4.427  1.00 25.73  ? 242 ARG B CB  1 
ATOM   6092 C  CG  . ARG B 1 242 ? -0.862  23.054  -4.537  1.00 34.66  ? 242 ARG B CG  1 
ATOM   6093 C  CD  . ARG B 1 242 ? -1.640  24.387  -4.385  1.00 41.53  ? 242 ARG B CD  1 
ATOM   6094 N  NE  . ARG B 1 242 ? -2.835  24.425  -5.247  1.00 48.38  ? 242 ARG B NE  1 
ATOM   6095 C  CZ  . ARG B 1 242 ? -2.915  24.956  -6.472  1.00 47.20  ? 242 ARG B CZ  1 
ATOM   6096 N  NH1 . ARG B 1 242 ? -4.077  24.911  -7.127  1.00 46.81  ? 242 ARG B NH1 1 
ATOM   6097 N  NH2 . ARG B 1 242 ? -1.860  25.527  -7.035  1.00 45.00  ? 242 ARG B NH2 1 
ATOM   6098 N  N   . ARG B 1 243 ? 0.931   20.573  -3.158  1.00 47.95  ? 243 ARG B N   1 
ATOM   6099 C  CA  . ARG B 1 243 ? 2.343   20.751  -2.858  1.00 43.70  ? 243 ARG B CA  1 
ATOM   6100 C  C   . ARG B 1 243 ? 3.172   19.694  -3.578  1.00 37.72  ? 243 ARG B C   1 
ATOM   6101 O  O   . ARG B 1 243 ? 4.277   19.979  -4.056  1.00 36.04  ? 243 ARG B O   1 
ATOM   6102 C  CB  . ARG B 1 243 ? 2.577   20.716  -1.351  1.00 35.95  ? 243 ARG B CB  1 
ATOM   6103 C  CG  . ARG B 1 243 ? 4.057   20.635  -0.994  1.00 41.60  ? 243 ARG B CG  1 
ATOM   6104 C  CD  . ARG B 1 243 ? 4.398   19.875  0.269   1.00 45.58  ? 243 ARG B CD  1 
ATOM   6105 N  NE  . ARG B 1 243 ? 4.237   18.434  0.104   1.00 51.18  ? 243 ARG B NE  1 
ATOM   6106 C  CZ  . ARG B 1 243 ? 5.197   17.585  -0.243  1.00 52.25  ? 243 ARG B CZ  1 
ATOM   6107 N  NH1 . ARG B 1 243 ? 6.430   18.009  -0.490  1.00 48.51  ? 243 ARG B NH1 1 
ATOM   6108 N  NH2 . ARG B 1 243 ? 4.896   16.299  -0.349  1.00 52.35  ? 243 ARG B NH2 1 
ATOM   6109 N  N   . ARG B 1 244 ? 2.624   18.485  -3.737  1.00 23.54  ? 244 ARG B N   1 
ATOM   6110 C  CA  . ARG B 1 244 ? 3.343   17.478  -4.512  1.00 30.78  ? 244 ARG B CA  1 
ATOM   6111 C  C   . ARG B 1 244 ? 3.303   17.782  -6.009  1.00 42.60  ? 244 ARG B C   1 
ATOM   6112 O  O   . ARG B 1 244 ? 4.280   17.535  -6.727  1.00 49.75  ? 244 ARG B O   1 
ATOM   6113 C  CB  . ARG B 1 244 ? 2.802   16.076  -4.247  1.00 21.87  ? 244 ARG B CB  1 
ATOM   6114 C  CG  . ARG B 1 244 ? 2.702   15.683  -2.821  1.00 26.39  ? 244 ARG B CG  1 
ATOM   6115 C  CD  . ARG B 1 244 ? 2.080   14.326  -2.701  1.00 33.21  ? 244 ARG B CD  1 
ATOM   6116 N  NE  . ARG B 1 244 ? 2.375   13.761  -1.384  1.00 46.84  ? 244 ARG B NE  1 
ATOM   6117 C  CZ  . ARG B 1 244 ? 2.094   12.520  -1.007  1.00 41.43  ? 244 ARG B CZ  1 
ATOM   6118 N  NH1 . ARG B 1 244 ? 1.546   11.685  -1.871  1.00 20.43  ? 244 ARG B NH1 1 
ATOM   6119 N  NH2 . ARG B 1 244 ? 2.403   12.129  0.223   1.00 41.48  ? 244 ARG B NH2 1 
ATOM   6120 N  N   . ALA B 1 245 ? 2.179   18.292  -6.509  1.00 30.73  ? 245 ALA B N   1 
ATOM   6121 C  CA  . ALA B 1 245 ? 2.174   18.765  -7.883  1.00 24.05  ? 245 ALA B CA  1 
ATOM   6122 C  C   . ALA B 1 245 ? 3.228   19.843  -8.079  1.00 38.47  ? 245 ALA B C   1 
ATOM   6123 O  O   . ALA B 1 245 ? 3.994   19.812  -9.050  1.00 47.95  ? 245 ALA B O   1 
ATOM   6124 C  CB  . ALA B 1 245 ? 0.792   19.292  -8.246  1.00 38.05  ? 245 ALA B CB  1 
ATOM   6125 N  N   . VAL B 1 246 ? 3.300   20.793  -7.147  1.00 37.18  ? 246 VAL B N   1 
ATOM   6126 C  CA  . VAL B 1 246 ? 4.244   21.895  -7.284  1.00 45.05  ? 246 VAL B CA  1 
ATOM   6127 C  C   . VAL B 1 246 ? 5.676   21.393  -7.147  1.00 44.83  ? 246 VAL B C   1 
ATOM   6128 O  O   . VAL B 1 246 ? 6.578   21.848  -7.861  1.00 46.76  ? 246 VAL B O   1 
ATOM   6129 C  CB  . VAL B 1 246 ? 3.927   23.002  -6.261  1.00 38.44  ? 246 VAL B CB  1 
ATOM   6130 C  CG1 . VAL B 1 246 ? 5.002   24.057  -6.285  1.00 38.02  ? 246 VAL B CG1 1 
ATOM   6131 C  CG2 . VAL B 1 246 ? 2.566   23.627  -6.555  1.00 34.62  ? 246 VAL B CG2 1 
ATOM   6132 N  N   . GLU B 1 247 ? 5.912   20.451  -6.236  1.00 38.00  ? 247 GLU B N   1 
ATOM   6133 C  CA  . GLU B 1 247 ? 7.276   19.973  -6.053  1.00 46.68  ? 247 GLU B CA  1 
ATOM   6134 C  C   . GLU B 1 247 ? 7.730   19.165  -7.254  1.00 46.69  ? 247 GLU B C   1 
ATOM   6135 O  O   . GLU B 1 247 ? 8.931   19.084  -7.534  1.00 49.74  ? 247 GLU B O   1 
ATOM   6136 C  CB  . GLU B 1 247 ? 7.389   19.157  -4.764  1.00 49.88  ? 247 GLU B CB  1 
ATOM   6137 C  CG  . GLU B 1 247 ? 8.812   18.723  -4.405  1.00 53.18  ? 247 GLU B CG  1 
ATOM   6138 C  CD  . GLU B 1 247 ? 9.741   19.893  -4.037  1.00 60.01  ? 247 GLU B CD  1 
ATOM   6139 O  OE1 . GLU B 1 247 ? 9.277   21.059  -3.969  1.00 58.09  ? 247 GLU B OE1 1 
ATOM   6140 O  OE2 . GLU B 1 247 ? 10.948  19.634  -3.806  1.00 60.84  ? 247 GLU B OE2 1 
ATOM   6141 N  N   . LEU B 1 248 ? 6.785   18.575  -7.981  1.00 47.63  ? 248 LEU B N   1 
ATOM   6142 C  CA  . LEU B 1 248 ? 7.128   17.954  -9.251  1.00 52.14  ? 248 LEU B CA  1 
ATOM   6143 C  C   . LEU B 1 248 ? 7.622   18.998  -10.246 1.00 53.43  ? 248 LEU B C   1 
ATOM   6144 O  O   . LEU B 1 248 ? 8.652   18.801  -10.902 1.00 61.33  ? 248 LEU B O   1 
ATOM   6145 C  CB  . LEU B 1 248 ? 5.921   17.196  -9.798  1.00 49.51  ? 248 LEU B CB  1 
ATOM   6146 C  CG  . LEU B 1 248 ? 6.092   16.505  -11.143 1.00 38.12  ? 248 LEU B CG  1 
ATOM   6147 C  CD1 . LEU B 1 248 ? 6.773   15.163  -10.951 1.00 34.53  ? 248 LEU B CD1 1 
ATOM   6148 C  CD2 . LEU B 1 248 ? 4.726   16.334  -11.772 1.00 29.00  ? 248 LEU B CD2 1 
ATOM   6149 N  N   . GLY B 1 249 ? 6.912   20.124  -10.356 1.00 43.26  ? 249 GLY B N   1 
ATOM   6150 C  CA  . GLY B 1 249 ? 7.379   21.194  -11.223 1.00 38.11  ? 249 GLY B CA  1 
ATOM   6151 C  C   . GLY B 1 249 ? 8.758   21.691  -10.835 1.00 37.40  ? 249 GLY B C   1 
ATOM   6152 O  O   . GLY B 1 249 ? 9.606   21.932  -11.695 1.00 43.56  ? 249 GLY B O   1 
ATOM   6153 N  N   . ARG B 1 250 ? 9.002   21.839  -9.531  1.00 43.19  ? 250 ARG B N   1 
ATOM   6154 C  CA  . ARG B 1 250 ? 10.317  22.264  -9.061  1.00 47.19  ? 250 ARG B CA  1 
ATOM   6155 C  C   . ARG B 1 250 ? 11.390  21.291  -9.516  1.00 42.83  ? 250 ARG B C   1 
ATOM   6156 O  O   . ARG B 1 250 ? 12.509  21.694  -9.851  1.00 40.70  ? 250 ARG B O   1 
ATOM   6157 C  CB  . ARG B 1 250 ? 10.317  22.380  -7.535  1.00 44.01  ? 250 ARG B CB  1 
ATOM   6158 C  CG  . ARG B 1 250 ? 11.335  23.358  -6.967  1.00 47.48  ? 250 ARG B CG  1 
ATOM   6159 C  CD  . ARG B 1 250 ? 11.502  23.148  -5.475  1.00 58.02  ? 250 ARG B CD  1 
ATOM   6160 N  NE  . ARG B 1 250 ? 12.082  21.835  -5.187  1.00 70.20  ? 250 ARG B NE  1 
ATOM   6161 C  CZ  . ARG B 1 250 ? 13.342  21.622  -4.807  1.00 73.49  ? 250 ARG B CZ  1 
ATOM   6162 N  NH1 . ARG B 1 250 ? 13.762  20.381  -4.584  1.00 70.49  ? 250 ARG B NH1 1 
ATOM   6163 N  NH2 . ARG B 1 250 ? 14.181  22.642  -4.634  1.00 71.79  ? 250 ARG B NH2 1 
ATOM   6164 N  N   . ASN B 1 251 ? 11.058  20.004  -9.552  1.00 40.01  ? 251 ASN B N   1 
ATOM   6165 C  CA  . ASN B 1 251 ? 12.015  19.000  -9.985  1.00 45.59  ? 251 ASN B CA  1 
ATOM   6166 C  C   . ASN B 1 251 ? 12.270  19.031  -11.486 1.00 43.70  ? 251 ASN B C   1 
ATOM   6167 O  O   . ASN B 1 251 ? 13.172  18.331  -11.950 1.00 38.22  ? 251 ASN B O   1 
ATOM   6168 C  CB  . ASN B 1 251 ? 11.537  17.608  -9.565  1.00 47.19  ? 251 ASN B CB  1 
ATOM   6169 C  CG  . ASN B 1 251 ? 12.106  17.172  -8.225  1.00 46.67  ? 251 ASN B CG  1 
ATOM   6170 O  OD1 . ASN B 1 251 ? 12.844  16.186  -8.142  1.00 43.85  ? 251 ASN B OD1 1 
ATOM   6171 N  ND2 . ASN B 1 251 ? 11.775  17.914  -7.167  1.00 44.54  ? 251 ASN B ND2 1 
ATOM   6172 N  N   . LEU B 1 252 ? 11.513  19.817  -12.256 1.00 48.08  ? 252 LEU B N   1 
ATOM   6173 C  CA  . LEU B 1 252 ? 11.731  19.889  -13.696 1.00 47.43  ? 252 LEU B CA  1 
ATOM   6174 C  C   . LEU B 1 252 ? 11.955  21.314  -14.208 1.00 54.60  ? 252 LEU B C   1 
ATOM   6175 O  O   . LEU B 1 252 ? 11.902  21.533  -15.429 1.00 55.34  ? 252 LEU B O   1 
ATOM   6176 C  CB  . LEU B 1 252 ? 10.567  19.224  -14.446 1.00 33.93  ? 252 LEU B CB  1 
ATOM   6177 C  CG  . LEU B 1 252 ? 10.249  17.786  -14.030 1.00 26.70  ? 252 LEU B CG  1 
ATOM   6178 C  CD1 . LEU B 1 252 ? 9.088   17.233  -14.826 1.00 39.16  ? 252 LEU B CD1 1 
ATOM   6179 C  CD2 . LEU B 1 252 ? 11.435  16.891  -14.170 1.00 26.56  ? 252 LEU B CD2 1 
ATOM   6180 N  N   . ASN B 1 253 ? 12.236  22.275  -13.314 1.00 54.27  ? 253 ASN B N   1 
ATOM   6181 C  CA  . ASN B 1 253 ? 12.537  23.671  -13.657 1.00 63.75  ? 253 ASN B CA  1 
ATOM   6182 C  C   . ASN B 1 253 ? 11.331  24.398  -14.249 1.00 60.49  ? 253 ASN B C   1 
ATOM   6183 O  O   . ASN B 1 253 ? 11.483  25.298  -15.079 1.00 53.93  ? 253 ASN B O   1 
ATOM   6184 C  CB  . ASN B 1 253 ? 13.732  23.786  -14.616 1.00 72.12  ? 253 ASN B CB  1 
ATOM   6185 C  CG  . ASN B 1 253 ? 15.044  23.384  -13.971 1.00 74.88  ? 253 ASN B CG  1 
ATOM   6186 O  OD1 . ASN B 1 253 ? 15.248  23.572  -12.770 1.00 73.32  ? 253 ASN B OD1 1 
ATOM   6187 N  ND2 . ASN B 1 253 ? 15.944  22.828  -14.772 1.00 76.95  ? 253 ASN B ND2 1 
ATOM   6188 N  N   . CYS B 1 254 ? 10.132  24.034  -13.814 1.00 57.80  ? 254 CYS B N   1 
ATOM   6189 C  CA  . CYS B 1 254 ? 8.914   24.601  -14.364 1.00 56.61  ? 254 CYS B CA  1 
ATOM   6190 C  C   . CYS B 1 254 ? 8.599   25.967  -13.761 1.00 59.09  ? 254 CYS B C   1 
ATOM   6191 O  O   . CYS B 1 254 ? 9.061   26.324  -12.673 1.00 65.13  ? 254 CYS B O   1 
ATOM   6192 C  CB  . CYS B 1 254 ? 7.751   23.647  -14.133 1.00 60.94  ? 254 CYS B CB  1 
ATOM   6193 S  SG  . CYS B 1 254 ? 7.764   22.360  -15.342 1.00 69.17  ? 254 CYS B SG  1 
ATOM   6194 N  N   . ASN B 1 255 ? 7.789   26.735  -14.488 1.00 55.72  ? 255 ASN B N   1 
ATOM   6195 C  CA  . ASN B 1 255 ? 7.315   28.011  -13.974 1.00 53.96  ? 255 ASN B CA  1 
ATOM   6196 C  C   . ASN B 1 255 ? 6.266   27.756  -12.897 1.00 57.32  ? 255 ASN B C   1 
ATOM   6197 O  O   . ASN B 1 255 ? 5.283   27.045  -13.138 1.00 60.21  ? 255 ASN B O   1 
ATOM   6198 C  CB  . ASN B 1 255 ? 6.745   28.856  -15.102 1.00 50.79  ? 255 ASN B CB  1 
ATOM   6199 C  CG  . ASN B 1 255 ? 6.981   30.328  -14.886 1.00 65.26  ? 255 ASN B CG  1 
ATOM   6200 O  OD1 . ASN B 1 255 ? 6.104   31.043  -14.406 1.00 66.23  ? 255 ASN B OD1 1 
ATOM   6201 N  ND2 . ASN B 1 255 ? 8.185   30.790  -15.220 1.00 74.87  ? 255 ASN B ND2 1 
ATOM   6202 N  N   . LEU B 1 256 ? 6.472   28.324  -11.706 1.00 49.57  ? 256 LEU B N   1 
ATOM   6203 C  CA  . LEU B 1 256 ? 5.716   27.903  -10.531 1.00 53.83  ? 256 LEU B CA  1 
ATOM   6204 C  C   . LEU B 1 256 ? 4.823   29.003  -9.966  1.00 64.13  ? 256 LEU B C   1 
ATOM   6205 O  O   . LEU B 1 256 ? 4.408   28.923  -8.804  1.00 65.69  ? 256 LEU B O   1 
ATOM   6206 C  CB  . LEU B 1 256 ? 6.672   27.383  -9.456  1.00 54.15  ? 256 LEU B CB  1 
ATOM   6207 C  CG  . LEU B 1 256 ? 7.398   26.109  -9.895  1.00 65.41  ? 256 LEU B CG  1 
ATOM   6208 C  CD1 . LEU B 1 256 ? 8.699   25.904  -9.138  1.00 68.04  ? 256 LEU B CD1 1 
ATOM   6209 C  CD2 . LEU B 1 256 ? 6.486   24.901  -9.726  1.00 73.13  ? 256 LEU B CD2 1 
ATOM   6210 N  N   . ASN B 1 257 ? 4.486   30.009  -10.769 1.00 65.72  ? 257 ASN B N   1 
ATOM   6211 C  CA  . ASN B 1 257 ? 3.720   31.142  -10.267 1.00 68.52  ? 257 ASN B CA  1 
ATOM   6212 C  C   . ASN B 1 257 ? 2.219   30.901  -10.347 1.00 73.35  ? 257 ASN B C   1 
ATOM   6213 O  O   . ASN B 1 257 ? 1.506   31.070  -9.353  1.00 78.42  ? 257 ASN B O   1 
ATOM   6214 C  CB  . ASN B 1 257 ? 4.117   32.393  -11.040 1.00 70.24  ? 257 ASN B CB  1 
ATOM   6215 C  CG  . ASN B 1 257 ? 5.614   32.516  -11.170 1.00 79.45  ? 257 ASN B CG  1 
ATOM   6216 O  OD1 . ASN B 1 257 ? 6.301   32.906  -10.224 1.00 81.49  ? 257 ASN B OD1 1 
ATOM   6217 N  ND2 . ASN B 1 257 ? 6.139   32.146  -12.334 1.00 83.01  ? 257 ASN B ND2 1 
ATOM   6218 N  N   . SER B 1 258 ? 1.726   30.513  -11.515 1.00 71.25  ? 258 SER B N   1 
ATOM   6219 C  CA  . SER B 1 258 ? 0.348   30.080  -11.673 1.00 58.81  ? 258 SER B CA  1 
ATOM   6220 C  C   . SER B 1 258 ? 0.322   28.590  -11.946 1.00 51.06  ? 258 SER B C   1 
ATOM   6221 O  O   . SER B 1 258 ? 1.344   27.964  -12.229 1.00 48.85  ? 258 SER B O   1 
ATOM   6222 C  CB  . SER B 1 258 ? -0.341  30.805  -12.826 1.00 59.31  ? 258 SER B CB  1 
ATOM   6223 O  OG  . SER B 1 258 ? -0.144  30.065  -14.016 1.00 61.98  ? 258 SER B OG  1 
ATOM   6224 N  N   . ASP B 1 259 ? -0.878  28.027  -11.881 1.00 55.36  ? 259 ASP B N   1 
ATOM   6225 C  CA  . ASP B 1 259 ? -1.041  26.649  -12.310 1.00 58.69  ? 259 ASP B CA  1 
ATOM   6226 C  C   . ASP B 1 259 ? -0.976  26.548  -13.823 1.00 63.12  ? 259 ASP B C   1 
ATOM   6227 O  O   . ASP B 1 259 ? -0.285  25.678  -14.364 1.00 67.53  ? 259 ASP B O   1 
ATOM   6228 C  CB  . ASP B 1 259 ? -2.350  26.082  -11.779 1.00 64.13  ? 259 ASP B CB  1 
ATOM   6229 C  CG  . ASP B 1 259 ? -2.395  26.069  -10.278 1.00 74.87  ? 259 ASP B CG  1 
ATOM   6230 O  OD1 . ASP B 1 259 ? -3.503  25.934  -9.715  1.00 73.16  ? 259 ASP B OD1 1 
ATOM   6231 O  OD2 . ASP B 1 259 ? -1.311  26.209  -9.665  1.00 85.05  ? 259 ASP B OD2 1 
ATOM   6232 N  N   . GLU B 1 260 ? -1.663  27.447  -14.525 1.00 61.75  ? 260 GLU B N   1 
ATOM   6233 C  CA  . GLU B 1 260 ? -1.729  27.366  -15.978 1.00 68.94  ? 260 GLU B CA  1 
ATOM   6234 C  C   . GLU B 1 260 ? -0.336  27.234  -16.581 1.00 62.83  ? 260 GLU B C   1 
ATOM   6235 O  O   . GLU B 1 260 ? -0.125  26.406  -17.471 1.00 61.28  ? 260 GLU B O   1 
ATOM   6236 C  CB  . GLU B 1 260 ? -2.454  28.581  -16.560 1.00 84.73  ? 260 GLU B CB  1 
ATOM   6237 C  CG  . GLU B 1 260 ? -3.090  28.312  -17.928 1.00 98.25  ? 260 GLU B CG  1 
ATOM   6238 C  CD  . GLU B 1 260 ? -3.947  27.045  -17.943 1.00 106.56 ? 260 GLU B CD  1 
ATOM   6239 O  OE1 . GLU B 1 260 ? -5.055  27.058  -17.363 1.00 104.70 ? 260 GLU B OE1 1 
ATOM   6240 O  OE2 . GLU B 1 260 ? -3.507  26.030  -18.527 1.00 111.77 ? 260 GLU B OE2 1 
ATOM   6241 N  N   . GLU B 1 261 ? 0.625   28.015  -16.078 1.00 64.06  ? 261 GLU B N   1 
ATOM   6242 C  CA  . GLU B 1 261 ? 2.009   27.860  -16.521 1.00 67.80  ? 261 GLU B CA  1 
ATOM   6243 C  C   . GLU B 1 261 ? 2.605   26.564  -16.002 1.00 66.00  ? 261 GLU B C   1 
ATOM   6244 O  O   . GLU B 1 261 ? 3.310   25.858  -16.734 1.00 69.46  ? 261 GLU B O   1 
ATOM   6245 C  CB  . GLU B 1 261 ? 2.855   29.042  -16.059 1.00 73.94  ? 261 GLU B CB  1 
ATOM   6246 C  CG  . GLU B 1 261 ? 2.170   30.382  -16.210 1.00 87.04  ? 261 GLU B CG  1 
ATOM   6247 C  CD  . GLU B 1 261 ? 3.078   31.540  -15.861 1.00 94.11  ? 261 GLU B CD  1 
ATOM   6248 O  OE1 . GLU B 1 261 ? 3.418   31.684  -14.664 1.00 97.34  ? 261 GLU B OE1 1 
ATOM   6249 O  OE2 . GLU B 1 261 ? 3.448   32.303  -16.781 1.00 92.87  ? 261 GLU B OE2 1 
ATOM   6250 N  N   . LEU B 1 262 ? 2.352   26.255  -14.731 1.00 57.63  ? 262 LEU B N   1 
ATOM   6251 C  CA  . LEU B 1 262 ? 2.766   24.978  -14.174 1.00 45.20  ? 262 LEU B CA  1 
ATOM   6252 C  C   . LEU B 1 262 ? 2.294   23.824  -15.050 1.00 39.49  ? 262 LEU B C   1 
ATOM   6253 O  O   . LEU B 1 262 ? 3.109   23.024  -15.524 1.00 32.46  ? 262 LEU B O   1 
ATOM   6254 C  CB  . LEU B 1 262 ? 2.240   24.849  -12.743 1.00 40.88  ? 262 LEU B CB  1 
ATOM   6255 C  CG  . LEU B 1 262 ? 2.549   23.562  -11.979 1.00 34.82  ? 262 LEU B CG  1 
ATOM   6256 C  CD1 . LEU B 1 262 ? 3.961   23.065  -12.224 1.00 35.94  ? 262 LEU B CD1 1 
ATOM   6257 C  CD2 . LEU B 1 262 ? 2.330   23.815  -10.510 1.00 42.26  ? 262 LEU B CD2 1 
ATOM   6258 N  N   . ILE B 1 263 ? 0.976   23.724  -15.287 1.00 39.59  ? 263 ILE B N   1 
ATOM   6259 C  CA  . ILE B 1 263 ? 0.485   22.600  -16.083 1.00 42.74  ? 263 ILE B CA  1 
ATOM   6260 C  C   . ILE B 1 263 ? 1.024   22.672  -17.504 1.00 51.58  ? 263 ILE B C   1 
ATOM   6261 O  O   . ILE B 1 263 ? 1.389   21.645  -18.088 1.00 48.10  ? 263 ILE B O   1 
ATOM   6262 C  CB  . ILE B 1 263 ? -1.052  22.499  -16.072 1.00 45.22  ? 263 ILE B CB  1 
ATOM   6263 C  CG1 . ILE B 1 263 ? -1.595  22.327  -14.663 1.00 62.51  ? 263 ILE B CG1 1 
ATOM   6264 C  CG2 . ILE B 1 263 ? -1.513  21.294  -16.851 1.00 38.19  ? 263 ILE B CG2 1 
ATOM   6265 C  CD1 . ILE B 1 263 ? -2.116  23.539  -14.070 1.00 70.26  ? 263 ILE B CD1 1 
ATOM   6266 N  N   . HIS B 1 264 ? 1.099   23.878  -18.075 1.00 55.19  ? 264 HIS B N   1 
ATOM   6267 C  CA  . HIS B 1 264 ? 1.707   24.079  -19.385 1.00 52.88  ? 264 HIS B CA  1 
ATOM   6268 C  C   . HIS B 1 264 ? 3.053   23.375  -19.432 1.00 55.36  ? 264 HIS B C   1 
ATOM   6269 O  O   . HIS B 1 264 ? 3.180   22.320  -20.058 1.00 56.37  ? 264 HIS B O   1 
ATOM   6270 C  CB  . HIS B 1 264 ? 1.877   25.569  -19.679 1.00 62.22  ? 264 HIS B CB  1 
ATOM   6271 C  CG  . HIS B 1 264 ? 2.199   25.873  -21.106 1.00 75.40  ? 264 HIS B CG  1 
ATOM   6272 N  ND1 . HIS B 1 264 ? 1.352   25.546  -22.143 1.00 88.95  ? 264 HIS B ND1 1 
ATOM   6273 C  CD2 . HIS B 1 264 ? 3.268   26.486  -21.670 1.00 78.03  ? 264 HIS B CD2 1 
ATOM   6274 C  CE1 . HIS B 1 264 ? 1.887   25.940  -23.285 1.00 92.52  ? 264 HIS B CE1 1 
ATOM   6275 N  NE2 . HIS B 1 264 ? 3.050   26.511  -23.026 1.00 87.63  ? 264 HIS B NE2 1 
ATOM   6276 N  N   . CYS B 1 265 ? 4.034   23.930  -18.718 1.00 54.82  ? 265 CYS B N   1 
ATOM   6277 C  CA  . CYS B 1 265 ? 5.364   23.357  -18.549 1.00 55.91  ? 265 CYS B CA  1 
ATOM   6278 C  C   . CYS B 1 265 ? 5.367   21.837  -18.445 1.00 50.17  ? 265 CYS B C   1 
ATOM   6279 O  O   . CYS B 1 265 ? 6.221   21.174  -19.045 1.00 54.31  ? 265 CYS B O   1 
ATOM   6280 C  CB  . CYS B 1 265 ? 6.012   23.938  -17.298 1.00 74.53  ? 265 CYS B CB  1 
ATOM   6281 S  SG  . CYS B 1 265 ? 7.738   23.448  -17.074 1.00 98.47  ? 265 CYS B SG  1 
ATOM   6282 N  N   . LEU B 1 266 ? 4.416   21.273  -17.692 1.00 43.20  ? 266 LEU B N   1 
ATOM   6283 C  CA  . LEU B 1 266 ? 4.416   19.834  -17.452 1.00 41.78  ? 266 LEU B CA  1 
ATOM   6284 C  C   . LEU B 1 266 ? 3.977   19.028  -18.678 1.00 54.18  ? 266 LEU B C   1 
ATOM   6285 O  O   . LEU B 1 266 ? 4.511   17.936  -18.919 1.00 55.24  ? 266 LEU B O   1 
ATOM   6286 C  CB  . LEU B 1 266 ? 3.538   19.507  -16.252 1.00 35.24  ? 266 LEU B CB  1 
ATOM   6287 C  CG  . LEU B 1 266 ? 4.379   19.361  -14.979 1.00 38.89  ? 266 LEU B CG  1 
ATOM   6288 C  CD1 . LEU B 1 266 ? 3.510   19.214  -13.733 1.00 25.81  ? 266 LEU B CD1 1 
ATOM   6289 C  CD2 . LEU B 1 266 ? 5.357   18.194  -15.112 1.00 46.11  ? 266 LEU B CD2 1 
ATOM   6290 N  N   . ARG B 1 267 ? 3.012   19.529  -19.464 1.00 58.29  ? 267 ARG B N   1 
ATOM   6291 C  CA  . ARG B 1 267 ? 2.560   18.778  -20.635 1.00 45.80  ? 267 ARG B CA  1 
ATOM   6292 C  C   . ARG B 1 267 ? 3.543   18.838  -21.793 1.00 49.48  ? 267 ARG B C   1 
ATOM   6293 O  O   . ARG B 1 267 ? 3.368   18.097  -22.768 1.00 56.34  ? 267 ARG B O   1 
ATOM   6294 C  CB  . ARG B 1 267 ? 1.205   19.271  -21.130 1.00 33.44  ? 267 ARG B CB  1 
ATOM   6295 C  CG  . ARG B 1 267 ? 0.300   19.815  -20.076 1.00 29.30  ? 267 ARG B CG  1 
ATOM   6296 C  CD  . ARG B 1 267 ? -0.991  20.310  -20.672 1.00 35.80  ? 267 ARG B CD  1 
ATOM   6297 N  NE  . ARG B 1 267 ? -2.074  20.053  -19.738 1.00 44.76  ? 267 ARG B NE  1 
ATOM   6298 C  CZ  . ARG B 1 267 ? -3.350  20.315  -19.956 1.00 46.02  ? 267 ARG B CZ  1 
ATOM   6299 N  NH1 . ARG B 1 267 ? -3.708  20.862  -21.093 1.00 52.57  ? 267 ARG B NH1 1 
ATOM   6300 N  NH2 . ARG B 1 267 ? -4.243  20.030  -19.017 1.00 42.82  ? 267 ARG B NH2 1 
ATOM   6301 N  N   . GLU B 1 268 ? 4.539   19.720  -21.742 1.00 42.20  ? 268 GLU B N   1 
ATOM   6302 C  CA  . GLU B 1 268 ? 5.593   19.670  -22.743 1.00 55.41  ? 268 GLU B CA  1 
ATOM   6303 C  C   . GLU B 1 268 ? 6.668   18.654  -22.400 1.00 60.08  ? 268 GLU B C   1 
ATOM   6304 O  O   . GLU B 1 268 ? 7.365   18.173  -23.303 1.00 61.71  ? 268 GLU B O   1 
ATOM   6305 C  CB  . GLU B 1 268 ? 6.235   21.049  -22.938 1.00 68.87  ? 268 GLU B CB  1 
ATOM   6306 C  CG  . GLU B 1 268 ? 5.527   21.957  -23.945 1.00 84.88  ? 268 GLU B CG  1 
ATOM   6307 C  CD  . GLU B 1 268 ? 4.405   22.758  -23.330 1.00 99.48  ? 268 GLU B CD  1 
ATOM   6308 O  OE1 . GLU B 1 268 ? 3.765   22.240  -22.402 1.00 109.02 ? 268 GLU B OE1 1 
ATOM   6309 O  OE2 . GLU B 1 268 ? 4.171   23.905  -23.765 1.00 100.82 ? 268 GLU B OE2 1 
ATOM   6310 N  N   . LYS B 1 269 ? 6.805   18.312  -21.125 1.00 59.90  ? 269 LYS B N   1 
ATOM   6311 C  CA  . LYS B 1 269 ? 7.753   17.285  -20.738 1.00 53.48  ? 269 LYS B CA  1 
ATOM   6312 C  C   . LYS B 1 269 ? 7.359   15.943  -21.349 1.00 50.29  ? 269 LYS B C   1 
ATOM   6313 O  O   . LYS B 1 269 ? 6.172   15.617  -21.475 1.00 42.77  ? 269 LYS B O   1 
ATOM   6314 C  CB  . LYS B 1 269 ? 7.825   17.192  -19.215 1.00 46.84  ? 269 LYS B CB  1 
ATOM   6315 C  CG  . LYS B 1 269 ? 8.306   18.487  -18.552 1.00 57.15  ? 269 LYS B CG  1 
ATOM   6316 C  CD  . LYS B 1 269 ? 9.809   18.699  -18.779 1.00 66.87  ? 269 LYS B CD  1 
ATOM   6317 C  CE  . LYS B 1 269 ? 10.220  20.168  -18.674 1.00 69.61  ? 269 LYS B CE  1 
ATOM   6318 N  NZ  . LYS B 1 269 ? 9.748   20.974  -19.851 1.00 70.63  ? 269 LYS B NZ  1 
ATOM   6319 N  N   . LYS B 1 270 ? 8.367   15.177  -21.768 1.00 51.88  ? 270 LYS B N   1 
ATOM   6320 C  CA  . LYS B 1 270 ? 8.121   13.821  -22.250 1.00 52.44  ? 270 LYS B CA  1 
ATOM   6321 C  C   . LYS B 1 270 ? 7.719   12.918  -21.079 1.00 47.33  ? 270 LYS B C   1 
ATOM   6322 O  O   . LYS B 1 270 ? 8.194   13.100  -19.949 1.00 37.22  ? 270 LYS B O   1 
ATOM   6323 C  CB  . LYS B 1 270 ? 9.365   13.272  -22.962 1.00 56.70  ? 270 LYS B CB  1 
ATOM   6324 C  CG  . LYS B 1 270 ? 9.530   13.806  -24.391 1.00 58.00  ? 270 LYS B CG  1 
ATOM   6325 C  CD  . LYS B 1 270 ? 10.794  13.293  -25.078 1.00 60.43  ? 270 LYS B CD  1 
ATOM   6326 C  CE  . LYS B 1 270 ? 10.701  11.806  -25.406 1.00 60.95  ? 270 LYS B CE  1 
ATOM   6327 N  NZ  . LYS B 1 270 ? 11.889  11.343  -26.180 1.00 59.01  ? 270 LYS B NZ  1 
ATOM   6328 N  N   . PRO B 1 271 ? 6.838   11.947  -21.318 1.00 49.48  ? 271 PRO B N   1 
ATOM   6329 C  CA  . PRO B 1 271 ? 6.275   11.186  -20.190 1.00 49.12  ? 271 PRO B CA  1 
ATOM   6330 C  C   . PRO B 1 271 ? 7.324   10.619  -19.257 1.00 43.14  ? 271 PRO B C   1 
ATOM   6331 O  O   . PRO B 1 271 ? 7.157   10.717  -18.035 1.00 35.98  ? 271 PRO B O   1 
ATOM   6332 C  CB  . PRO B 1 271 ? 5.447   10.085  -20.870 1.00 47.64  ? 271 PRO B CB  1 
ATOM   6333 C  CG  . PRO B 1 271 ? 5.423   10.415  -22.317 1.00 55.15  ? 271 PRO B CG  1 
ATOM   6334 C  CD  . PRO B 1 271 ? 6.562   11.327  -22.612 1.00 48.98  ? 271 PRO B CD  1 
ATOM   6335 N  N   . GLN B 1 272 ? 8.424   10.073  -19.784 1.00 45.44  ? 272 GLN B N   1 
ATOM   6336 C  CA  . GLN B 1 272 ? 9.392   9.457   -18.886 1.00 39.95  ? 272 GLN B CA  1 
ATOM   6337 C  C   . GLN B 1 272 ? 10.125  10.495  -18.044 1.00 36.96  ? 272 GLN B C   1 
ATOM   6338 O  O   . GLN B 1 272 ? 10.524  10.184  -16.916 1.00 43.92  ? 272 GLN B O   1 
ATOM   6339 C  CB  . GLN B 1 272 ? 10.366  8.573   -19.672 1.00 30.37  ? 272 GLN B CB  1 
ATOM   6340 C  CG  . GLN B 1 272 ? 11.275  7.818   -18.753 1.00 45.35  ? 272 GLN B CG  1 
ATOM   6341 C  CD  . GLN B 1 272 ? 10.577  6.591   -18.195 1.00 49.90  ? 272 GLN B CD  1 
ATOM   6342 O  OE1 . GLN B 1 272 ? 10.778  6.226   -17.034 1.00 61.13  ? 272 GLN B OE1 1 
ATOM   6343 N  NE2 . GLN B 1 272 ? 9.751   5.946   -19.025 1.00 41.99  ? 272 GLN B NE2 1 
ATOM   6344 N  N   . GLU B 1 273 ? 10.220  11.740  -18.520 1.00 24.49  ? 273 GLU B N   1 
ATOM   6345 C  CA  . GLU B 1 273 ? 10.733  12.810  -17.667 1.00 36.24  ? 273 GLU B CA  1 
ATOM   6346 C  C   . GLU B 1 273 ? 9.863   13.020  -16.432 1.00 42.04  ? 273 GLU B C   1 
ATOM   6347 O  O   . GLU B 1 273 ? 10.345  13.518  -15.409 1.00 54.26  ? 273 GLU B O   1 
ATOM   6348 C  CB  . GLU B 1 273 ? 10.839  14.125  -18.436 1.00 40.50  ? 273 GLU B CB  1 
ATOM   6349 C  CG  . GLU B 1 273 ? 11.754  14.100  -19.638 1.00 56.64  ? 273 GLU B CG  1 
ATOM   6350 C  CD  . GLU B 1 273 ? 11.804  15.448  -20.332 1.00 78.64  ? 273 GLU B CD  1 
ATOM   6351 O  OE1 . GLU B 1 273 ? 11.957  16.467  -19.619 1.00 81.19  ? 273 GLU B OE1 1 
ATOM   6352 O  OE2 . GLU B 1 273 ? 11.670  15.491  -21.581 1.00 88.25  ? 273 GLU B OE2 1 
ATOM   6353 N  N   . LEU B 1 274 ? 8.582   12.681  -16.509 1.00 37.08  ? 274 LEU B N   1 
ATOM   6354 C  CA  . LEU B 1 274 ? 7.766   12.738  -15.305 1.00 36.76  ? 274 LEU B CA  1 
ATOM   6355 C  C   . LEU B 1 274 ? 8.024   11.526  -14.424 1.00 39.86  ? 274 LEU B C   1 
ATOM   6356 O  O   . LEU B 1 274 ? 8.121   11.644  -13.198 1.00 46.33  ? 274 LEU B O   1 
ATOM   6357 C  CB  . LEU B 1 274 ? 6.288   12.820  -15.676 1.00 40.42  ? 274 LEU B CB  1 
ATOM   6358 C  CG  . LEU B 1 274 ? 5.676   14.191  -15.948 1.00 36.59  ? 274 LEU B CG  1 
ATOM   6359 C  CD1 . LEU B 1 274 ? 6.659   15.111  -16.666 1.00 24.61  ? 274 LEU B CD1 1 
ATOM   6360 C  CD2 . LEU B 1 274 ? 4.370   14.014  -16.736 1.00 23.37  ? 274 LEU B CD2 1 
ATOM   6361 N  N   . ILE B 1 275 ? 8.164   10.359  -15.044 1.00 39.86  ? 275 ILE B N   1 
ATOM   6362 C  CA  . ILE B 1 275 ? 8.376   9.129   -14.298 1.00 35.41  ? 275 ILE B CA  1 
ATOM   6363 C  C   . ILE B 1 275 ? 9.704   9.172   -13.559 1.00 43.39  ? 275 ILE B C   1 
ATOM   6364 O  O   . ILE B 1 275 ? 9.793   8.763   -12.397 1.00 43.37  ? 275 ILE B O   1 
ATOM   6365 C  CB  . ILE B 1 275 ? 8.309   7.927   -15.253 1.00 44.85  ? 275 ILE B CB  1 
ATOM   6366 C  CG1 . ILE B 1 275 ? 6.969   7.887   -15.995 1.00 37.07  ? 275 ILE B CG1 1 
ATOM   6367 C  CG2 . ILE B 1 275 ? 8.473   6.644   -14.473 1.00 53.11  ? 275 ILE B CG2 1 
ATOM   6368 C  CD1 . ILE B 1 275 ? 5.817   8.214   -15.114 1.00 40.93  ? 275 ILE B CD1 1 
ATOM   6369 N  N   . ASP B 1 276 ? 10.759  9.660   -14.221 1.00 59.75  ? 276 ASP B N   1 
ATOM   6370 C  CA  . ASP B 1 276 ? 12.109  9.590   -13.665 1.00 56.72  ? 276 ASP B CA  1 
ATOM   6371 C  C   . ASP B 1 276 ? 12.256  10.389  -12.382 1.00 50.99  ? 276 ASP B C   1 
ATOM   6372 O  O   . ASP B 1 276 ? 13.154  10.091  -11.587 1.00 56.40  ? 276 ASP B O   1 
ATOM   6373 C  CB  . ASP B 1 276 ? 13.142  10.070  -14.692 1.00 63.09  ? 276 ASP B CB  1 
ATOM   6374 C  CG  . ASP B 1 276 ? 13.504  8.996   -15.709 1.00 76.55  ? 276 ASP B CG  1 
ATOM   6375 O  OD1 . ASP B 1 276 ? 14.453  9.211   -16.495 1.00 80.22  ? 276 ASP B OD1 1 
ATOM   6376 O  OD2 . ASP B 1 276 ? 12.849  7.931   -15.714 1.00 83.89  ? 276 ASP B OD2 1 
ATOM   6377 N  N   . VAL B 1 277 ? 11.408  11.393  -12.163 1.00 51.94  ? 277 VAL B N   1 
ATOM   6378 C  CA  . VAL B 1 277 ? 11.427  12.163  -10.922 1.00 49.36  ? 277 VAL B CA  1 
ATOM   6379 C  C   . VAL B 1 277 ? 10.250  11.851  -10.017 1.00 40.87  ? 277 VAL B C   1 
ATOM   6380 O  O   . VAL B 1 277 ? 10.279  12.258  -8.846  1.00 40.01  ? 277 VAL B O   1 
ATOM   6381 C  CB  . VAL B 1 277 ? 11.478  13.685  -11.184 1.00 46.36  ? 277 VAL B CB  1 
ATOM   6382 C  CG1 . VAL B 1 277 ? 12.787  14.087  -11.827 1.00 24.66  ? 277 VAL B CG1 1 
ATOM   6383 C  CG2 . VAL B 1 277 ? 10.292  14.125  -12.018 1.00 47.99  ? 277 VAL B CG2 1 
ATOM   6384 N  N   . GLU B 1 278 ? 9.213   11.170  -10.521 1.00 42.96  ? 278 GLU B N   1 
ATOM   6385 C  CA  . GLU B 1 278 ? 8.010   10.788  -9.779  1.00 39.28  ? 278 GLU B CA  1 
ATOM   6386 C  C   . GLU B 1 278 ? 8.217   10.696  -8.270  1.00 37.38  ? 278 GLU B C   1 
ATOM   6387 O  O   . GLU B 1 278 ? 7.558   11.406  -7.509  1.00 40.45  ? 278 GLU B O   1 
ATOM   6388 C  CB  . GLU B 1 278 ? 7.474   9.449   -10.300 1.00 42.08  ? 278 GLU B CB  1 
ATOM   6389 C  CG  . GLU B 1 278 ? 6.562   8.728   -9.320  1.00 55.31  ? 278 GLU B CG  1 
ATOM   6390 C  CD  . GLU B 1 278 ? 5.462   7.911   -9.987  1.00 64.59  ? 278 GLU B CD  1 
ATOM   6391 O  OE1 . GLU B 1 278 ? 5.253   8.049   -11.220 1.00 61.78  ? 278 GLU B OE1 1 
ATOM   6392 O  OE2 . GLU B 1 278 ? 4.814   7.117   -9.262  1.00 64.96  ? 278 GLU B OE2 1 
ATOM   6393 N  N   . TRP B 1 279 ? 9.157   9.869   -7.827  1.00 38.36  ? 279 TRP B N   1 
ATOM   6394 C  CA  . TRP B 1 279 ? 9.279   9.582   -6.404  1.00 41.25  ? 279 TRP B CA  1 
ATOM   6395 C  C   . TRP B 1 279 ? 9.872   10.722  -5.581  1.00 38.87  ? 279 TRP B C   1 
ATOM   6396 O  O   . TRP B 1 279 ? 9.687   10.733  -4.360  1.00 42.35  ? 279 TRP B O   1 
ATOM   6397 C  CB  . TRP B 1 279 ? 10.128  8.334   -6.204  1.00 42.34  ? 279 TRP B CB  1 
ATOM   6398 C  CG  . TRP B 1 279 ? 9.510   7.140   -6.801  1.00 41.81  ? 279 TRP B CG  1 
ATOM   6399 C  CD1 . TRP B 1 279 ? 9.730   6.642   -8.050  1.00 41.86  ? 279 TRP B CD1 1 
ATOM   6400 C  CD2 . TRP B 1 279 ? 8.544   6.285   -6.188  1.00 38.56  ? 279 TRP B CD2 1 
ATOM   6401 N  NE1 . TRP B 1 279 ? 8.969   5.517   -8.249  1.00 34.83  ? 279 TRP B NE1 1 
ATOM   6402 C  CE2 . TRP B 1 279 ? 8.229   5.277   -7.121  1.00 32.89  ? 279 TRP B CE2 1 
ATOM   6403 C  CE3 . TRP B 1 279 ? 7.924   6.265   -4.935  1.00 38.76  ? 279 TRP B CE3 1 
ATOM   6404 C  CZ2 . TRP B 1 279 ? 7.318   4.262   -6.843  1.00 35.73  ? 279 TRP B CZ2 1 
ATOM   6405 C  CZ3 . TRP B 1 279 ? 7.015   5.257   -4.661  1.00 41.94  ? 279 TRP B CZ3 1 
ATOM   6406 C  CH2 . TRP B 1 279 ? 6.719   4.271   -5.612  1.00 42.79  ? 279 TRP B CH2 1 
ATOM   6407 N  N   . ASN B 1 280 ? 10.563  11.680  -6.201  1.00 36.82  ? 280 ASN B N   1 
ATOM   6408 C  CA  . ASN B 1 280 ? 11.278  12.735  -5.445  1.00 47.12  ? 280 ASN B CA  1 
ATOM   6409 C  C   . ASN B 1 280 ? 10.345  13.668  -4.648  1.00 36.18  ? 280 ASN B C   1 
ATOM   6410 O  O   . ASN B 1 280 ? 10.788  14.654  -4.039  1.00 33.76  ? 280 ASN B O   1 
ATOM   6411 C  CB  . ASN B 1 280 ? 12.141  13.578  -6.391  1.00 47.05  ? 280 ASN B CB  1 
ATOM   6412 C  CG  . ASN B 1 280 ? 13.300  12.800  -6.976  1.00 47.58  ? 280 ASN B CG  1 
ATOM   6413 O  OD1 . ASN B 1 280 ? 13.374  11.578  -6.850  1.00 52.53  ? 280 ASN B OD1 1 
ATOM   6414 N  ND2 . ASN B 1 280 ? 14.215  13.507  -7.621  1.00 52.28  ? 280 ASN B ND2 1 
ATOM   6415 N  N   . VAL B 1 281 ? 9.060   13.343  -4.627  1.00 29.37  ? 281 VAL B N   1 
ATOM   6416 C  CA  . VAL B 1 281 ? 8.028   14.279  -4.214  1.00 33.72  ? 281 VAL B CA  1 
ATOM   6417 C  C   . VAL B 1 281 ? 7.340   13.859  -2.914  1.00 30.76  ? 281 VAL B C   1 
ATOM   6418 O  O   . VAL B 1 281 ? 6.699   14.705  -2.268  1.00 24.71  ? 281 VAL B O   1 
ATOM   6419 C  CB  . VAL B 1 281 ? 7.003   14.454  -5.354  1.00 38.04  ? 281 VAL B CB  1 
ATOM   6420 C  CG1 . VAL B 1 281 ? 5.929   15.359  -4.962  1.00 41.16  ? 281 VAL B CG1 1 
ATOM   6421 C  CG2 . VAL B 1 281 ? 7.690   15.001  -6.599  1.00 44.81  ? 281 VAL B CG2 1 
ATOM   6422 N  N   . LEU B 1 282 ? 7.485   12.595  -2.488  1.00 25.55  ? 282 LEU B N   1 
ATOM   6423 C  CA  . LEU B 1 282 ? 6.973   12.135  -1.202  1.00 24.29  ? 282 LEU B CA  1 
ATOM   6424 C  C   . LEU B 1 282 ? 7.504   12.995  -0.062  1.00 30.91  ? 282 LEU B C   1 
ATOM   6425 O  O   . LEU B 1 282 ? 8.567   13.618  -0.191  1.00 32.95  ? 282 LEU B O   1 
ATOM   6426 C  CB  . LEU B 1 282 ? 7.319   10.660  -0.971  1.00 19.56  ? 282 LEU B CB  1 
ATOM   6427 C  CG  . LEU B 1 282 ? 6.704   9.693   -1.992  1.00 32.51  ? 282 LEU B CG  1 
ATOM   6428 C  CD1 . LEU B 1 282 ? 7.332   8.307   -1.934  1.00 26.18  ? 282 LEU B CD1 1 
ATOM   6429 C  CD2 . LEU B 1 282 ? 5.184   9.598   -1.821  1.00 36.71  ? 282 LEU B CD2 1 
ATOM   6430 N  N   . PRO B 1 283 ? 6.791   13.063  1.067   1.00 39.06  ? 283 PRO B N   1 
ATOM   6431 C  CA  . PRO B 1 283 ? 7.185   14.007  2.114   1.00 39.85  ? 283 PRO B CA  1 
ATOM   6432 C  C   . PRO B 1 283 ? 8.219   13.430  3.065   1.00 32.25  ? 283 PRO B C   1 
ATOM   6433 O  O   . PRO B 1 283 ? 8.917   14.190  3.741   1.00 34.12  ? 283 PRO B O   1 
ATOM   6434 C  CB  . PRO B 1 283 ? 5.860   14.307  2.840   1.00 43.91  ? 283 PRO B CB  1 
ATOM   6435 C  CG  . PRO B 1 283 ? 4.815   13.431  2.199   1.00 45.92  ? 283 PRO B CG  1 
ATOM   6436 C  CD  . PRO B 1 283 ? 5.542   12.376  1.426   1.00 42.90  ? 283 PRO B CD  1 
ATOM   6437 N  N   . PHE B 1 284 ? 8.323   12.104  3.138   1.00 29.94  ? 284 PHE B N   1 
ATOM   6438 C  CA  . PHE B 1 284 ? 9.244   11.454  4.060   1.00 39.35  ? 284 PHE B CA  1 
ATOM   6439 C  C   . PHE B 1 284 ? 9.836   10.209  3.422   1.00 48.04  ? 284 PHE B C   1 
ATOM   6440 O  O   . PHE B 1 284 ? 9.203   9.556   2.590   1.00 55.11  ? 284 PHE B O   1 
ATOM   6441 C  CB  . PHE B 1 284 ? 8.579   11.010  5.374   1.00 42.90  ? 284 PHE B CB  1 
ATOM   6442 C  CG  . PHE B 1 284 ? 7.424   11.857  5.809   1.00 46.21  ? 284 PHE B CG  1 
ATOM   6443 C  CD1 . PHE B 1 284 ? 7.632   13.016  6.539   1.00 55.09  ? 284 PHE B CD1 1 
ATOM   6444 C  CD2 . PHE B 1 284 ? 6.123   11.464  5.536   1.00 47.11  ? 284 PHE B CD2 1 
ATOM   6445 C  CE1 . PHE B 1 284 ? 6.563   13.786  6.961   1.00 56.97  ? 284 PHE B CE1 1 
ATOM   6446 C  CE2 . PHE B 1 284 ? 5.048   12.228  5.953   1.00 49.21  ? 284 PHE B CE2 1 
ATOM   6447 C  CZ  . PHE B 1 284 ? 5.267   13.389  6.666   1.00 53.38  ? 284 PHE B CZ  1 
ATOM   6448 N  N   . ASP B 1 285 ? 11.045  9.860   3.851   1.00 57.69  ? 285 ASP B N   1 
ATOM   6449 C  CA  . ASP B 1 285 ? 11.570  8.540   3.533   1.00 69.15  ? 285 ASP B CA  1 
ATOM   6450 C  C   . ASP B 1 285 ? 10.618  7.516   4.144   1.00 56.51  ? 285 ASP B C   1 
ATOM   6451 O  O   . ASP B 1 285 ? 10.484  7.435   5.369   1.00 51.65  ? 285 ASP B O   1 
ATOM   6452 C  CB  . ASP B 1 285 ? 13.009  8.382   4.049   1.00 78.06  ? 285 ASP B CB  1 
ATOM   6453 C  CG  . ASP B 1 285 ? 13.810  7.328   3.274   1.00 85.99  ? 285 ASP B CG  1 
ATOM   6454 O  OD1 . ASP B 1 285 ? 13.308  6.807   2.242   1.00 87.07  ? 285 ASP B OD1 1 
ATOM   6455 O  OD2 . ASP B 1 285 ? 14.955  7.037   3.696   1.00 84.98  ? 285 ASP B OD2 1 
ATOM   6456 N  N   . SER B 1 286 ? 9.921   6.754   3.307   1.00 40.09  ? 286 SER B N   1 
ATOM   6457 C  CA  . SER B 1 286 ? 8.855   5.910   3.807   1.00 25.16  ? 286 SER B CA  1 
ATOM   6458 C  C   . SER B 1 286 ? 8.798   4.627   2.992   1.00 24.13  ? 286 SER B C   1 
ATOM   6459 O  O   . SER B 1 286 ? 9.552   4.440   2.037   1.00 37.60  ? 286 SER B O   1 
ATOM   6460 C  CB  . SER B 1 286 ? 7.537   6.665   3.752   1.00 34.18  ? 286 SER B CB  1 
ATOM   6461 O  OG  . SER B 1 286 ? 7.276   7.054   2.418   1.00 42.64  ? 286 SER B OG  1 
ATOM   6462 N  N   . ILE B 1 287 ? 7.909   3.725   3.408   1.00 23.40  ? 287 ILE B N   1 
ATOM   6463 C  CA  . ILE B 1 287 ? 7.517   2.549   2.643   1.00 21.43  ? 287 ILE B CA  1 
ATOM   6464 C  C   . ILE B 1 287 ? 5.997   2.509   2.569   1.00 24.59  ? 287 ILE B C   1 
ATOM   6465 O  O   . ILE B 1 287 ? 5.301   3.049   3.434   1.00 42.10  ? 287 ILE B O   1 
ATOM   6466 C  CB  . ILE B 1 287 ? 8.055   1.252   3.265   1.00 24.12  ? 287 ILE B CB  1 
ATOM   6467 C  CG1 . ILE B 1 287 ? 7.321   0.986   4.566   1.00 30.51  ? 287 ILE B CG1 1 
ATOM   6468 C  CG2 . ILE B 1 287 ? 9.563   1.351   3.488   1.00 24.90  ? 287 ILE B CG2 1 
ATOM   6469 C  CD1 . ILE B 1 287 ? 7.945   -0.074  5.398   1.00 40.55  ? 287 ILE B CD1 1 
ATOM   6470 N  N   . PHE B 1 288 ? 5.481   1.878   1.515   1.00 22.70  ? 288 PHE B N   1 
ATOM   6471 C  CA  . PHE B 1 288 ? 4.034   1.788   1.264   1.00 30.55  ? 288 PHE B CA  1 
ATOM   6472 C  C   . PHE B 1 288 ? 3.371   3.166   1.141   1.00 32.26  ? 288 PHE B C   1 
ATOM   6473 O  O   . PHE B 1 288 ? 2.253   3.378   1.621   1.00 27.49  ? 288 PHE B O   1 
ATOM   6474 C  CB  . PHE B 1 288 ? 3.342   0.949   2.350   1.00 24.31  ? 288 PHE B CB  1 
ATOM   6475 C  CG  . PHE B 1 288 ? 2.232   0.071   1.832   1.00 22.20  ? 288 PHE B CG  1 
ATOM   6476 C  CD1 . PHE B 1 288 ? 1.309   0.553   0.920   1.00 25.59  ? 288 PHE B CD1 1 
ATOM   6477 C  CD2 . PHE B 1 288 ? 2.142   -1.257  2.219   1.00 20.58  ? 288 PHE B CD2 1 
ATOM   6478 C  CE1 . PHE B 1 288 ? 0.294   -0.261  0.438   1.00 18.63  ? 288 PHE B CE1 1 
ATOM   6479 C  CE2 . PHE B 1 288 ? 1.132   -2.071  1.736   1.00 14.02  ? 288 PHE B CE2 1 
ATOM   6480 C  CZ  . PHE B 1 288 ? 0.214   -1.573  0.846   1.00 13.93  ? 288 PHE B CZ  1 
ATOM   6481 N  N   . ARG B 1 289 ? 4.054   4.119   0.496   1.00 25.37  ? 289 ARG B N   1 
ATOM   6482 C  CA  . ARG B 1 289 ? 3.436   5.397   0.156   1.00 25.70  ? 289 ARG B CA  1 
ATOM   6483 C  C   . ARG B 1 289 ? 3.811   5.789   -1.266  1.00 31.26  ? 289 ARG B C   1 
ATOM   6484 O  O   . ARG B 1 289 ? 4.913   5.483   -1.735  1.00 28.03  ? 289 ARG B O   1 
ATOM   6485 C  CB  . ARG B 1 289 ? 3.802   6.537   1.127   1.00 16.89  ? 289 ARG B CB  1 
ATOM   6486 C  CG  . ARG B 1 289 ? 3.553   6.234   2.565   1.00 16.83  ? 289 ARG B CG  1 
ATOM   6487 C  CD  . ARG B 1 289 ? 2.240   6.911   2.994   1.00 21.56  ? 289 ARG B CD  1 
ATOM   6488 N  NE  . ARG B 1 289 ? 1.955   6.670   4.407   1.00 23.88  ? 289 ARG B NE  1 
ATOM   6489 C  CZ  . ARG B 1 289 ? 1.652   5.481   4.915   1.00 21.20  ? 289 ARG B CZ  1 
ATOM   6490 N  NH1 . ARG B 1 289 ? 1.649   4.414   4.145   1.00 16.00  ? 289 ARG B NH1 1 
ATOM   6491 N  NH2 . ARG B 1 289 ? 1.415   5.371   6.207   1.00 35.65  ? 289 ARG B NH2 1 
ATOM   6492 N  N   . PHE B 1 290 ? 2.875   6.459   -1.952  1.00 28.59  ? 290 PHE B N   1 
ATOM   6493 C  CA  . PHE B 1 290 ? 2.993   6.699   -3.379  1.00 20.03  ? 290 PHE B CA  1 
ATOM   6494 C  C   . PHE B 1 290 ? 2.659   8.143   -3.716  1.00 25.06  ? 290 PHE B C   1 
ATOM   6495 O  O   . PHE B 1 290 ? 1.849   8.785   -3.041  1.00 23.37  ? 290 PHE B O   1 
ATOM   6496 C  CB  . PHE B 1 290 ? 2.113   5.746   -4.148  1.00 18.45  ? 290 PHE B CB  1 
ATOM   6497 C  CG  . PHE B 1 290 ? 1.973   4.411   -3.500  1.00 15.73  ? 290 PHE B CG  1 
ATOM   6498 C  CD1 . PHE B 1 290 ? 0.831   4.086   -2.819  1.00 29.85  ? 290 PHE B CD1 1 
ATOM   6499 C  CD2 . PHE B 1 290 ? 3.003   3.497   -3.538  1.00 15.72  ? 290 PHE B CD2 1 
ATOM   6500 C  CE1 . PHE B 1 290 ? 0.698   2.860   -2.234  1.00 33.83  ? 290 PHE B CE1 1 
ATOM   6501 C  CE2 . PHE B 1 290 ? 2.877   2.280   -2.936  1.00 17.10  ? 290 PHE B CE2 1 
ATOM   6502 C  CZ  . PHE B 1 290 ? 1.733   1.955   -2.290  1.00 25.11  ? 290 PHE B CZ  1 
ATOM   6503 N  N   . SER B 1 291 ? 3.281   8.626   -4.801  1.00 27.49  ? 291 SER B N   1 
ATOM   6504 C  CA  . SER B 1 291 ? 3.384   10.061  -5.060  1.00 31.21  ? 291 SER B CA  1 
ATOM   6505 C  C   . SER B 1 291 ? 2.040   10.689  -5.418  1.00 37.38  ? 291 SER B C   1 
ATOM   6506 O  O   . SER B 1 291 ? 1.602   11.652  -4.772  1.00 41.40  ? 291 SER B O   1 
ATOM   6507 C  CB  . SER B 1 291 ? 4.406   10.310  -6.160  1.00 32.59  ? 291 SER B CB  1 
ATOM   6508 O  OG  . SER B 1 291 ? 5.713   10.244  -5.624  1.00 40.86  ? 291 SER B OG  1 
ATOM   6509 N  N   . PHE B 1 292 ? 1.375   10.181  -6.455  1.00 30.00  ? 292 PHE B N   1 
ATOM   6510 C  CA  . PHE B 1 292 ? 0.104   10.750  -6.895  1.00 37.52  ? 292 PHE B CA  1 
ATOM   6511 C  C   . PHE B 1 292 ? -1.000  9.709   -6.770  1.00 39.96  ? 292 PHE B C   1 
ATOM   6512 O  O   . PHE B 1 292 ? -0.972  8.671   -7.439  1.00 50.03  ? 292 PHE B O   1 
ATOM   6513 C  CB  . PHE B 1 292 ? 0.219   11.319  -8.314  1.00 36.02  ? 292 PHE B CB  1 
ATOM   6514 C  CG  . PHE B 1 292 ? 1.441   12.165  -8.509  1.00 19.67  ? 292 PHE B CG  1 
ATOM   6515 C  CD1 . PHE B 1 292 ? 1.361   13.546  -8.402  1.00 28.81  ? 292 PHE B CD1 1 
ATOM   6516 C  CD2 . PHE B 1 292 ? 2.663   11.590  -8.776  1.00 19.60  ? 292 PHE B CD2 1 
ATOM   6517 C  CE1 . PHE B 1 292 ? 2.486   14.336  -8.552  1.00 23.57  ? 292 PHE B CE1 1 
ATOM   6518 C  CE2 . PHE B 1 292 ? 3.781   12.370  -8.933  1.00 20.27  ? 292 PHE B CE2 1 
ATOM   6519 C  CZ  . PHE B 1 292 ? 3.689   13.748  -8.826  1.00 26.16  ? 292 PHE B CZ  1 
ATOM   6520 N  N   . VAL B 1 293 ? -1.959  9.994   -5.899  1.00 37.66  ? 293 VAL B N   1 
ATOM   6521 C  CA  . VAL B 1 293 ? -3.016  9.072   -5.497  1.00 32.25  ? 293 VAL B CA  1 
ATOM   6522 C  C   . VAL B 1 293 ? -4.274  9.923   -5.520  1.00 25.17  ? 293 VAL B C   1 
ATOM   6523 O  O   . VAL B 1 293 ? -4.169  11.144  -5.701  1.00 29.29  ? 293 VAL B O   1 
ATOM   6524 C  CB  . VAL B 1 293 ? -2.750  8.476   -4.097  1.00 31.22  ? 293 VAL B CB  1 
ATOM   6525 C  CG1 . VAL B 1 293 ? -1.595  7.468   -4.120  1.00 32.18  ? 293 VAL B CG1 1 
ATOM   6526 C  CG2 . VAL B 1 293 ? -2.460  9.590   -3.085  1.00 17.42  ? 293 VAL B CG2 1 
ATOM   6527 N  N   . PRO B 1 294 ? -5.452  9.352   -5.370  1.00 19.61  ? 294 PRO B N   1 
ATOM   6528 C  CA  . PRO B 1 294 ? -6.660  10.175  -5.256  1.00 20.23  ? 294 PRO B CA  1 
ATOM   6529 C  C   . PRO B 1 294 ? -6.590  11.283  -4.210  1.00 27.37  ? 294 PRO B C   1 
ATOM   6530 O  O   . PRO B 1 294 ? -5.836  11.208  -3.231  1.00 33.87  ? 294 PRO B O   1 
ATOM   6531 C  CB  . PRO B 1 294 ? -7.733  9.140   -4.911  1.00 23.82  ? 294 PRO B CB  1 
ATOM   6532 C  CG  . PRO B 1 294 ? -7.218  7.819   -5.489  1.00 20.00  ? 294 PRO B CG  1 
ATOM   6533 C  CD  . PRO B 1 294 ? -5.761  7.981   -5.811  1.00 26.54  ? 294 PRO B CD  1 
ATOM   6534 N  N   . VAL B 1 295 ? -7.377  12.339  -4.445  1.00 36.40  ? 295 VAL B N   1 
ATOM   6535 C  CA  . VAL B 1 295 ? -7.481  13.518  -3.587  1.00 37.64  ? 295 VAL B CA  1 
ATOM   6536 C  C   . VAL B 1 295 ? -8.894  13.568  -3.033  1.00 39.68  ? 295 VAL B C   1 
ATOM   6537 O  O   . VAL B 1 295 ? -9.854  13.296  -3.760  1.00 37.73  ? 295 VAL B O   1 
ATOM   6538 C  CB  . VAL B 1 295 ? -7.207  14.810  -4.383  1.00 34.53  ? 295 VAL B CB  1 
ATOM   6539 C  CG1 . VAL B 1 295 ? -6.727  15.932  -3.469  1.00 34.92  ? 295 VAL B CG1 1 
ATOM   6540 C  CG2 . VAL B 1 295 ? -6.251  14.530  -5.493  1.00 36.31  ? 295 VAL B CG2 1 
ATOM   6541 N  N   . ILE B 1 296 ? -9.030  13.927  -1.760  1.00 41.60  ? 296 ILE B N   1 
ATOM   6542 C  CA  . ILE B 1 296 ? -10.359 14.197  -1.223  1.00 41.57  ? 296 ILE B CA  1 
ATOM   6543 C  C   . ILE B 1 296 ? -10.704 15.627  -1.620  1.00 42.07  ? 296 ILE B C   1 
ATOM   6544 O  O   . ILE B 1 296 ? -10.383 16.589  -0.911  1.00 39.08  ? 296 ILE B O   1 
ATOM   6545 C  CB  . ILE B 1 296 ? -10.449 13.929  0.291   1.00 30.41  ? 296 ILE B CB  1 
ATOM   6546 C  CG1 . ILE B 1 296 ? -10.647 12.435  0.523   1.00 28.15  ? 296 ILE B CG1 1 
ATOM   6547 C  CG2 . ILE B 1 296 ? -11.704 14.496  0.868   1.00 40.13  ? 296 ILE B CG2 1 
ATOM   6548 C  CD1 . ILE B 1 296 ? -9.463  11.598  0.381   1.00 18.78  ? 296 ILE B CD1 1 
ATOM   6549 N  N   . ASP B 1 297 ? -11.326 15.756  -2.804  1.00 41.73  ? 297 ASP B N   1 
ATOM   6550 C  CA  . ASP B 1 297 ? -11.478 17.016  -3.530  1.00 41.86  ? 297 ASP B CA  1 
ATOM   6551 C  C   . ASP B 1 297 ? -12.780 17.734  -3.227  1.00 45.54  ? 297 ASP B C   1 
ATOM   6552 O  O   . ASP B 1 297 ? -12.845 18.961  -3.360  1.00 53.29  ? 297 ASP B O   1 
ATOM   6553 C  CB  . ASP B 1 297 ? -11.379 16.781  -5.048  1.00 49.64  ? 297 ASP B CB  1 
ATOM   6554 C  CG  . ASP B 1 297 ? -12.496 15.888  -5.595  1.00 51.49  ? 297 ASP B CG  1 
ATOM   6555 O  OD1 . ASP B 1 297 ? -13.210 15.258  -4.775  1.00 57.92  ? 297 ASP B OD1 1 
ATOM   6556 O  OD2 . ASP B 1 297 ? -12.634 15.784  -6.843  1.00 41.74  ? 297 ASP B OD2 1 
ATOM   6557 N  N   . GLY B 1 298 ? -13.814 17.009  -2.814  1.00 44.23  ? 298 GLY B N   1 
ATOM   6558 C  CA  . GLY B 1 298 ? -15.124 17.593  -2.634  1.00 44.80  ? 298 GLY B CA  1 
ATOM   6559 C  C   . GLY B 1 298 ? -16.055 17.443  -3.815  1.00 40.93  ? 298 GLY B C   1 
ATOM   6560 O  O   . GLY B 1 298 ? -17.154 18.007  -3.789  1.00 46.90  ? 298 GLY B O   1 
ATOM   6561 N  N   . GLU B 1 299 ? -15.652 16.711  -4.855  1.00 37.33  ? 299 GLU B N   1 
ATOM   6562 C  CA  . GLU B 1 299 ? -16.515 16.474  -6.009  1.00 41.20  ? 299 GLU B CA  1 
ATOM   6563 C  C   . GLU B 1 299 ? -16.682 14.978  -6.241  1.00 40.83  ? 299 GLU B C   1 
ATOM   6564 O  O   . GLU B 1 299 ? -17.780 14.448  -6.046  1.00 47.55  ? 299 GLU B O   1 
ATOM   6565 C  CB  . GLU B 1 299 ? -15.953 17.192  -7.235  1.00 47.27  ? 299 GLU B CB  1 
ATOM   6566 C  CG  . GLU B 1 299 ? -15.657 18.659  -6.966  1.00 62.51  ? 299 GLU B CG  1 
ATOM   6567 C  CD  . GLU B 1 299 ? -14.987 19.370  -8.134  1.00 66.84  ? 299 GLU B CD  1 
ATOM   6568 O  OE1 . GLU B 1 299 ? -15.132 18.906  -9.295  1.00 67.50  ? 299 GLU B OE1 1 
ATOM   6569 O  OE2 . GLU B 1 299 ? -14.322 20.404  -7.876  1.00 58.54  ? 299 GLU B OE2 1 
ATOM   6570 N  N   . PHE B 1 300 ? -15.635 14.282  -6.669  1.00 37.08  ? 300 PHE B N   1 
ATOM   6571 C  CA  . PHE B 1 300 ? -15.676 12.828  -6.646  1.00 32.65  ? 300 PHE B CA  1 
ATOM   6572 C  C   . PHE B 1 300 ? -16.006 12.331  -5.246  1.00 36.38  ? 300 PHE B C   1 
ATOM   6573 O  O   . PHE B 1 300 ? -16.867 11.462  -5.074  1.00 40.09  ? 300 PHE B O   1 
ATOM   6574 C  CB  . PHE B 1 300 ? -14.334 12.278  -7.128  1.00 27.67  ? 300 PHE B CB  1 
ATOM   6575 C  CG  . PHE B 1 300 ? -14.396 10.874  -7.624  1.00 26.04  ? 300 PHE B CG  1 
ATOM   6576 C  CD1 . PHE B 1 300 ? -14.373 9.807   -6.731  1.00 26.70  ? 300 PHE B CD1 1 
ATOM   6577 C  CD2 . PHE B 1 300 ? -14.469 10.616  -8.990  1.00 27.12  ? 300 PHE B CD2 1 
ATOM   6578 C  CE1 . PHE B 1 300 ? -14.413 8.503   -7.190  1.00 28.60  ? 300 PHE B CE1 1 
ATOM   6579 C  CE2 . PHE B 1 300 ? -14.520 9.322   -9.464  1.00 29.40  ? 300 PHE B CE2 1 
ATOM   6580 C  CZ  . PHE B 1 300 ? -14.495 8.258   -8.566  1.00 35.25  ? 300 PHE B CZ  1 
ATOM   6581 N  N   . PHE B 1 301 ? -15.350 12.899  -4.231  1.00 38.23  ? 301 PHE B N   1 
ATOM   6582 C  CA  . PHE B 1 301 ? -15.599 12.588  -2.827  1.00 35.24  ? 301 PHE B CA  1 
ATOM   6583 C  C   . PHE B 1 301 ? -16.298 13.771  -2.167  1.00 37.96  ? 301 PHE B C   1 
ATOM   6584 O  O   . PHE B 1 301 ? -15.638 14.759  -1.815  1.00 39.12  ? 301 PHE B O   1 
ATOM   6585 C  CB  . PHE B 1 301 ? -14.283 12.277  -2.113  1.00 37.35  ? 301 PHE B CB  1 
ATOM   6586 C  CG  . PHE B 1 301 ? -13.532 11.127  -2.705  1.00 38.76  ? 301 PHE B CG  1 
ATOM   6587 C  CD1 . PHE B 1 301 ? -13.954 9.826   -2.496  1.00 42.34  ? 301 PHE B CD1 1 
ATOM   6588 C  CD2 . PHE B 1 301 ? -12.408 11.342  -3.477  1.00 39.65  ? 301 PHE B CD2 1 
ATOM   6589 C  CE1 . PHE B 1 301 ? -13.260 8.749   -3.042  1.00 37.02  ? 301 PHE B CE1 1 
ATOM   6590 C  CE2 . PHE B 1 301 ? -11.712 10.271  -4.026  1.00 36.54  ? 301 PHE B CE2 1 
ATOM   6591 C  CZ  . PHE B 1 301 ? -12.141 8.970   -3.807  1.00 27.97  ? 301 PHE B CZ  1 
ATOM   6592 N  N   . PRO B 1 302 ? -17.620 13.729  -1.979  1.00 42.10  ? 302 PRO B N   1 
ATOM   6593 C  CA  . PRO B 1 302 ? -18.327 14.922  -1.474  1.00 44.34  ? 302 PRO B CA  1 
ATOM   6594 C  C   . PRO B 1 302 ? -17.838 15.445  -0.128  1.00 43.64  ? 302 PRO B C   1 
ATOM   6595 O  O   . PRO B 1 302 ? -17.764 16.665  0.044   1.00 40.27  ? 302 PRO B O   1 
ATOM   6596 C  CB  . PRO B 1 302 ? -19.779 14.441  -1.409  1.00 47.18  ? 302 PRO B CB  1 
ATOM   6597 C  CG  . PRO B 1 302 ? -19.865 13.452  -2.530  1.00 45.09  ? 302 PRO B CG  1 
ATOM   6598 C  CD  . PRO B 1 302 ? -18.559 12.715  -2.491  1.00 42.50  ? 302 PRO B CD  1 
ATOM   6599 N  N   . THR B 1 303 ? -17.525 14.582  0.834   1.00 46.73  ? 303 THR B N   1 
ATOM   6600 C  CA  . THR B 1 303 ? -16.873 15.006  2.077   1.00 36.32  ? 303 THR B CA  1 
ATOM   6601 C  C   . THR B 1 303 ? -15.750 14.029  2.377   1.00 38.30  ? 303 THR B C   1 
ATOM   6602 O  O   . THR B 1 303 ? -15.355 13.217  1.530   1.00 34.19  ? 303 THR B O   1 
ATOM   6603 C  CB  . THR B 1 303 ? -17.822 15.053  3.281   1.00 38.85  ? 303 THR B CB  1 
ATOM   6604 O  OG1 . THR B 1 303 ? -18.688 13.914  3.255   1.00 53.01  ? 303 THR B OG1 1 
ATOM   6605 C  CG2 . THR B 1 303 ? -18.632 16.333  3.306   1.00 39.52  ? 303 THR B CG2 1 
ATOM   6606 N  N   . SER B 1 304 ? -15.254 14.098  3.610   1.00 39.39  ? 304 SER B N   1 
ATOM   6607 C  CA  . SER B 1 304 ? -14.207 13.198  4.058   1.00 30.32  ? 304 SER B CA  1 
ATOM   6608 C  C   . SER B 1 304 ? -14.717 11.761  4.089   1.00 37.41  ? 304 SER B C   1 
ATOM   6609 O  O   . SER B 1 304 ? -15.914 11.501  4.266   1.00 36.32  ? 304 SER B O   1 
ATOM   6610 C  CB  . SER B 1 304 ? -13.738 13.600  5.442   1.00 28.05  ? 304 SER B CB  1 
ATOM   6611 O  OG  . SER B 1 304 ? -14.651 13.110  6.406   1.00 35.10  ? 304 SER B OG  1 
ATOM   6612 N  N   . LEU B 1 305 ? -13.785 10.819  3.926   1.00 33.84  ? 305 LEU B N   1 
ATOM   6613 C  CA  . LEU B 1 305 ? -14.173 9.415   3.882   1.00 27.17  ? 305 LEU B CA  1 
ATOM   6614 C  C   . LEU B 1 305 ? -14.827 8.979   5.184   1.00 28.45  ? 305 LEU B C   1 
ATOM   6615 O  O   . LEU B 1 305 ? -15.796 8.210   5.168   1.00 31.62  ? 305 LEU B O   1 
ATOM   6616 C  CB  . LEU B 1 305 ? -12.966 8.536   3.563   1.00 18.04  ? 305 LEU B CB  1 
ATOM   6617 C  CG  . LEU B 1 305 ? -12.372 8.658   2.159   1.00 17.81  ? 305 LEU B CG  1 
ATOM   6618 C  CD1 . LEU B 1 305 ? -11.231 7.646   1.933   1.00 17.11  ? 305 LEU B CD1 1 
ATOM   6619 C  CD2 . LEU B 1 305 ? -13.475 8.507   1.104   1.00 17.85  ? 305 LEU B CD2 1 
ATOM   6620 N  N   . GLU B 1 306 ? -14.327 9.472   6.322   1.00 27.86  ? 306 GLU B N   1 
ATOM   6621 C  CA  . GLU B 1 306 ? -14.889 9.056   7.607   1.00 35.66  ? 306 GLU B CA  1 
ATOM   6622 C  C   . GLU B 1 306 ? -16.335 9.519   7.757   1.00 35.39  ? 306 GLU B C   1 
ATOM   6623 O  O   . GLU B 1 306 ? -17.212 8.735   8.147   1.00 31.73  ? 306 GLU B O   1 
ATOM   6624 C  CB  . GLU B 1 306 ? -14.038 9.585   8.756   1.00 41.15  ? 306 GLU B CB  1 
ATOM   6625 C  CG  . GLU B 1 306 ? -13.193 8.521   9.406   1.00 44.56  ? 306 GLU B CG  1 
ATOM   6626 C  CD  . GLU B 1 306 ? -14.022 7.358   9.910   1.00 53.90  ? 306 GLU B CD  1 
ATOM   6627 O  OE1 . GLU B 1 306 ? -13.664 6.206   9.591   1.00 67.05  ? 306 GLU B OE1 1 
ATOM   6628 O  OE2 . GLU B 1 306 ? -15.023 7.591   10.625  1.00 46.64  ? 306 GLU B OE2 1 
ATOM   6629 N  N   . SER B 1 307 ? -16.602 10.791  7.446   1.00 36.81  ? 307 SER B N   1 
ATOM   6630 C  CA  . SER B 1 307 ? -17.967 11.305  7.537   1.00 46.67  ? 307 SER B CA  1 
ATOM   6631 C  C   . SER B 1 307 ? -18.927 10.479  6.690   1.00 49.55  ? 307 SER B C   1 
ATOM   6632 O  O   . SER B 1 307 ? -20.058 10.206  7.113   1.00 52.21  ? 307 SER B O   1 
ATOM   6633 C  CB  . SER B 1 307 ? -18.007 12.776  7.121   1.00 40.46  ? 307 SER B CB  1 
ATOM   6634 O  OG  . SER B 1 307 ? -17.318 12.967  5.901   1.00 42.78  ? 307 SER B OG  1 
ATOM   6635 N  N   . MET B 1 308 ? -18.486 10.051  5.503   1.00 48.71  ? 308 MET B N   1 
ATOM   6636 C  CA  . MET B 1 308 ? -19.350 9.249   4.639   1.00 47.64  ? 308 MET B CA  1 
ATOM   6637 C  C   . MET B 1 308 ? -19.570 7.860   5.220   1.00 40.41  ? 308 MET B C   1 
ATOM   6638 O  O   . MET B 1 308 ? -20.696 7.349   5.201   1.00 40.61  ? 308 MET B O   1 
ATOM   6639 C  CB  . MET B 1 308 ? -18.758 9.164   3.233   1.00 47.51  ? 308 MET B CB  1 
ATOM   6640 C  CG  . MET B 1 308 ? -18.559 10.535  2.596   1.00 54.17  ? 308 MET B CG  1 
ATOM   6641 S  SD  . MET B 1 308 ? -17.816 10.544  0.949   1.00 55.61  ? 308 MET B SD  1 
ATOM   6642 C  CE  . MET B 1 308 ? -19.119 9.791   -0.020  1.00 57.71  ? 308 MET B CE  1 
ATOM   6643 N  N   . LEU B 1 309 ? -18.510 7.246   5.754   1.00 30.08  ? 309 LEU B N   1 
ATOM   6644 C  CA  . LEU B 1 309 ? -18.655 5.963   6.433   1.00 30.58  ? 309 LEU B CA  1 
ATOM   6645 C  C   . LEU B 1 309 ? -19.601 6.056   7.634   1.00 45.95  ? 309 LEU B C   1 
ATOM   6646 O  O   . LEU B 1 309 ? -20.431 5.163   7.847   1.00 55.15  ? 309 LEU B O   1 
ATOM   6647 C  CB  . LEU B 1 309 ? -17.283 5.460   6.866   1.00 28.99  ? 309 LEU B CB  1 
ATOM   6648 C  CG  . LEU B 1 309 ? -16.350 5.132   5.698   1.00 35.55  ? 309 LEU B CG  1 
ATOM   6649 C  CD1 . LEU B 1 309 ? -14.936 4.798   6.159   1.00 23.24  ? 309 LEU B CD1 1 
ATOM   6650 C  CD2 . LEU B 1 309 ? -16.919 3.983   4.904   1.00 43.63  ? 309 LEU B CD2 1 
ATOM   6651 N  N   . ASN B 1 310 ? -19.497 7.123   8.433   1.00 39.66  ? 310 ASN B N   1 
ATOM   6652 C  CA  . ASN B 1 310 ? -20.368 7.234   9.601   1.00 41.23  ? 310 ASN B CA  1 
ATOM   6653 C  C   . ASN B 1 310 ? -21.793 7.558   9.192   1.00 43.97  ? 310 ASN B C   1 
ATOM   6654 O  O   . ASN B 1 310 ? -22.743 6.913   9.649   1.00 52.16  ? 310 ASN B O   1 
ATOM   6655 C  CB  . ASN B 1 310 ? -19.860 8.305   10.559  1.00 48.49  ? 310 ASN B CB  1 
ATOM   6656 C  CG  . ASN B 1 310 ? -18.422 8.131   10.893  1.00 49.00  ? 310 ASN B CG  1 
ATOM   6657 O  OD1 . ASN B 1 310 ? -17.928 7.008   10.977  1.00 46.80  ? 310 ASN B OD1 1 
ATOM   6658 N  ND2 . ASN B 1 310 ? -17.720 9.243   11.062  1.00 53.64  ? 310 ASN B ND2 1 
ATOM   6659 N  N   . SER B 1 311 ? -21.966 8.575   8.346   1.00 40.70  ? 311 SER B N   1 
ATOM   6660 C  CA  . SER B 1 311 ? -23.310 9.008   7.991   1.00 38.85  ? 311 SER B CA  1 
ATOM   6661 C  C   . SER B 1 311 ? -24.041 7.999   7.120   1.00 43.74  ? 311 SER B C   1 
ATOM   6662 O  O   . SER B 1 311 ? -25.251 8.151   6.913   1.00 48.46  ? 311 SER B O   1 
ATOM   6663 C  CB  . SER B 1 311 ? -23.265 10.347  7.266   1.00 37.45  ? 311 SER B CB  1 
ATOM   6664 O  OG  . SER B 1 311 ? -23.002 10.143  5.889   1.00 41.00  ? 311 SER B OG  1 
ATOM   6665 N  N   . GLY B 1 312 ? -23.349 6.978   6.617   1.00 39.15  ? 312 GLY B N   1 
ATOM   6666 C  CA  . GLY B 1 312 ? -23.957 6.053   5.685   1.00 42.58  ? 312 GLY B CA  1 
ATOM   6667 C  C   . GLY B 1 312 ? -23.992 6.542   4.256   1.00 47.20  ? 312 GLY B C   1 
ATOM   6668 O  O   . GLY B 1 312 ? -24.674 5.936   3.424   1.00 45.98  ? 312 GLY B O   1 
ATOM   6669 N  N   . ASN B 1 313 ? -23.259 7.608   3.940   1.00 45.41  ? 313 ASN B N   1 
ATOM   6670 C  CA  . ASN B 1 313 ? -23.342 8.262   2.637   1.00 32.54  ? 313 ASN B CA  1 
ATOM   6671 C  C   . ASN B 1 313 ? -22.485 7.506   1.614   1.00 31.87  ? 313 ASN B C   1 
ATOM   6672 O  O   . ASN B 1 313 ? -21.425 7.947   1.167   1.00 43.89  ? 313 ASN B O   1 
ATOM   6673 C  CB  . ASN B 1 313 ? -22.929 9.720   2.780   1.00 35.18  ? 313 ASN B CB  1 
ATOM   6674 C  CG  . ASN B 1 313 ? -22.870 10.447  1.456   1.00 35.28  ? 313 ASN B CG  1 
ATOM   6675 O  OD1 . ASN B 1 313 ? -23.478 10.020  0.472   1.00 38.18  ? 313 ASN B OD1 1 
ATOM   6676 N  ND2 . ASN B 1 313 ? -22.123 11.550  1.420   1.00 27.49  ? 313 ASN B ND2 1 
ATOM   6677 N  N   . PHE B 1 314 ? -22.971 6.334   1.236   1.00 26.73  ? 314 PHE B N   1 
ATOM   6678 C  CA  . PHE B 1 314 ? -22.344 5.541   0.189   1.00 28.17  ? 314 PHE B CA  1 
ATOM   6679 C  C   . PHE B 1 314 ? -23.420 4.631   -0.379  1.00 19.20  ? 314 PHE B C   1 
ATOM   6680 O  O   . PHE B 1 314 ? -24.605 4.791   -0.067  1.00 25.43  ? 314 PHE B O   1 
ATOM   6681 C  CB  . PHE B 1 314 ? -21.135 4.774   0.729   1.00 38.45  ? 314 PHE B CB  1 
ATOM   6682 C  CG  . PHE B 1 314 ? -21.414 4.002   1.979   1.00 33.99  ? 314 PHE B CG  1 
ATOM   6683 C  CD1 . PHE B 1 314 ? -21.928 2.717   1.915   1.00 27.29  ? 314 PHE B CD1 1 
ATOM   6684 C  CD2 . PHE B 1 314 ? -21.139 4.549   3.220   1.00 25.36  ? 314 PHE B CD2 1 
ATOM   6685 C  CE1 . PHE B 1 314 ? -22.183 2.006   3.071   1.00 21.83  ? 314 PHE B CE1 1 
ATOM   6686 C  CE2 . PHE B 1 314 ? -21.375 3.834   4.373   1.00 25.98  ? 314 PHE B CE2 1 
ATOM   6687 C  CZ  . PHE B 1 314 ? -21.898 2.557   4.298   1.00 25.05  ? 314 PHE B CZ  1 
ATOM   6688 N  N   . LYS B 1 315 ? -23.028 3.680   -1.225  1.00 27.58  ? 315 LYS B N   1 
ATOM   6689 C  CA  . LYS B 1 315 ? -24.032 2.827   -1.850  1.00 30.94  ? 315 LYS B CA  1 
ATOM   6690 C  C   . LYS B 1 315 ? -24.249 1.582   -1.006  1.00 24.74  ? 315 LYS B C   1 
ATOM   6691 O  O   . LYS B 1 315 ? -23.301 0.977   -0.493  1.00 22.87  ? 315 LYS B O   1 
ATOM   6692 C  CB  . LYS B 1 315 ? -23.668 2.436   -3.287  1.00 30.26  ? 315 LYS B CB  1 
ATOM   6693 C  CG  . LYS B 1 315 ? -22.994 1.103   -3.434  1.00 35.64  ? 315 LYS B CG  1 
ATOM   6694 C  CD  . LYS B 1 315 ? -23.062 0.573   -4.852  1.00 32.38  ? 315 LYS B CD  1 
ATOM   6695 C  CE  . LYS B 1 315 ? -24.417 0.710   -5.461  1.00 34.35  ? 315 LYS B CE  1 
ATOM   6696 N  NZ  . LYS B 1 315 ? -24.375 0.096   -6.807  1.00 43.16  ? 315 LYS B NZ  1 
ATOM   6697 N  N   . LYS B 1 316 ? -25.510 1.223   -0.845  1.00 31.50  ? 316 LYS B N   1 
ATOM   6698 C  CA  . LYS B 1 316 ? -25.893 0.096   -0.016  1.00 30.55  ? 316 LYS B CA  1 
ATOM   6699 C  C   . LYS B 1 316 ? -26.053 -1.127  -0.910  1.00 32.85  ? 316 LYS B C   1 
ATOM   6700 O  O   . LYS B 1 316 ? -27.003 -1.219  -1.696  1.00 39.21  ? 316 LYS B O   1 
ATOM   6701 C  CB  . LYS B 1 316 ? -27.172 0.407   0.749   1.00 29.50  ? 316 LYS B CB  1 
ATOM   6702 C  CG  . LYS B 1 316 ? -26.986 1.277   1.973   1.00 32.94  ? 316 LYS B CG  1 
ATOM   6703 C  CD  . LYS B 1 316 ? -26.883 2.735   1.618   1.00 35.82  ? 316 LYS B CD  1 
ATOM   6704 C  CE  . LYS B 1 316 ? -26.594 3.553   2.864   1.00 41.02  ? 316 LYS B CE  1 
ATOM   6705 N  NZ  . LYS B 1 316 ? -27.302 4.874   2.873   1.00 39.72  ? 316 LYS B NZ  1 
ATOM   6706 N  N   . THR B 1 317 ? -25.120 -2.061  -0.800  1.00 27.89  ? 317 THR B N   1 
ATOM   6707 C  CA  . THR B 1 317 ? -25.193 -3.273  -1.598  1.00 27.32  ? 317 THR B CA  1 
ATOM   6708 C  C   . THR B 1 317 ? -24.560 -4.384  -0.777  1.00 23.74  ? 317 THR B C   1 
ATOM   6709 O  O   . THR B 1 317 ? -24.489 -4.279  0.452   1.00 31.11  ? 317 THR B O   1 
ATOM   6710 C  CB  . THR B 1 317 ? -24.523 -3.058  -2.967  1.00 29.20  ? 317 THR B CB  1 
ATOM   6711 O  OG1 . THR B 1 317 ? -24.654 -4.247  -3.760  1.00 33.87  ? 317 THR B OG1 1 
ATOM   6712 C  CG2 . THR B 1 317 ? -23.050 -2.700  -2.794  1.00 21.96  ? 317 THR B CG2 1 
ATOM   6713 N  N   . GLN B 1 318 ? -24.120 -5.447  -1.452  1.00 19.09  ? 318 GLN B N   1 
ATOM   6714 C  CA  . GLN B 1 318 ? -23.340 -6.521  -0.852  1.00 25.50  ? 318 GLN B CA  1 
ATOM   6715 C  C   . GLN B 1 318 ? -21.885 -6.405  -1.293  1.00 30.94  ? 318 GLN B C   1 
ATOM   6716 O  O   . GLN B 1 318 ? -21.602 -6.188  -2.478  1.00 29.51  ? 318 GLN B O   1 
ATOM   6717 C  CB  . GLN B 1 318 ? -23.872 -7.899  -1.244  1.00 16.76  ? 318 GLN B CB  1 
ATOM   6718 C  CG  . GLN B 1 318 ? -25.318 -8.046  -1.100  1.00 27.93  ? 318 GLN B CG  1 
ATOM   6719 C  CD  . GLN B 1 318 ? -26.014 -7.628  -2.352  1.00 44.20  ? 318 GLN B CD  1 
ATOM   6720 O  OE1 . GLN B 1 318 ? -25.512 -7.884  -3.449  1.00 49.56  ? 318 GLN B OE1 1 
ATOM   6721 N  NE2 . GLN B 1 318 ? -27.194 -7.008  -2.212  1.00 45.27  ? 318 GLN B NE2 1 
ATOM   6722 N  N   . ILE B 1 319 ? -20.965 -6.551  -0.342  1.00 30.56  ? 319 ILE B N   1 
ATOM   6723 C  CA  . ILE B 1 319 ? -19.544 -6.537  -0.650  1.00 22.34  ? 319 ILE B CA  1 
ATOM   6724 C  C   . ILE B 1 319 ? -18.931 -7.866  -0.238  1.00 27.56  ? 319 ILE B C   1 
ATOM   6725 O  O   . ILE B 1 319 ? -19.405 -8.561  0.667   1.00 35.73  ? 319 ILE B O   1 
ATOM   6726 C  CB  . ILE B 1 319 ? -18.809 -5.368  0.033   1.00 24.28  ? 319 ILE B CB  1 
ATOM   6727 C  CG1 . ILE B 1 319 ? -19.005 -5.448  1.547   1.00 30.77  ? 319 ILE B CG1 1 
ATOM   6728 C  CG2 . ILE B 1 319 ? -19.316 -4.043  -0.495  1.00 15.40  ? 319 ILE B CG2 1 
ATOM   6729 C  CD1 . ILE B 1 319 ? -18.216 -4.433  2.301   1.00 27.46  ? 319 ILE B CD1 1 
ATOM   6730 N  N   . LEU B 1 320 ? -17.859 -8.205  -0.931  1.00 26.49  ? 320 LEU B N   1 
ATOM   6731 C  CA  . LEU B 1 320 ? -17.040 -9.385  -0.709  1.00 19.69  ? 320 LEU B CA  1 
ATOM   6732 C  C   . LEU B 1 320 ? -15.612 -8.879  -0.568  1.00 16.83  ? 320 LEU B C   1 
ATOM   6733 O  O   . LEU B 1 320 ? -15.095 -8.242  -1.490  1.00 17.44  ? 320 LEU B O   1 
ATOM   6734 C  CB  . LEU B 1 320 ? -17.167 -10.325 -1.906  1.00 22.21  ? 320 LEU B CB  1 
ATOM   6735 C  CG  . LEU B 1 320 ? -16.763 -11.803 -1.898  1.00 29.96  ? 320 LEU B CG  1 
ATOM   6736 C  CD1 . LEU B 1 320 ? -15.251 -11.932 -1.700  1.00 27.45  ? 320 LEU B CD1 1 
ATOM   6737 C  CD2 . LEU B 1 320 ? -17.528 -12.719 -0.966  1.00 31.90  ? 320 LEU B CD2 1 
ATOM   6738 N  N   . LEU B 1 321 ? -14.977 -9.119  0.571   1.00 22.64  ? 321 LEU B N   1 
ATOM   6739 C  CA  . LEU B 1 321 ? -13.665 -8.503  0.738   1.00 20.48  ? 321 LEU B CA  1 
ATOM   6740 C  C   . LEU B 1 321 ? -12.810 -9.305  1.698   1.00 18.65  ? 321 LEU B C   1 
ATOM   6741 O  O   . LEU B 1 321 ? -13.289 -10.201 2.395   1.00 23.87  ? 321 LEU B O   1 
ATOM   6742 C  CB  . LEU B 1 321 ? -13.769 -7.049  1.197   1.00 19.89  ? 321 LEU B CB  1 
ATOM   6743 C  CG  . LEU B 1 321 ? -14.140 -6.719  2.632   1.00 26.39  ? 321 LEU B CG  1 
ATOM   6744 C  CD1 . LEU B 1 321 ? -14.207 -5.201  2.743   1.00 25.49  ? 321 LEU B CD1 1 
ATOM   6745 C  CD2 . LEU B 1 321 ? -15.466 -7.382  3.057   1.00 21.16  ? 321 LEU B CD2 1 
ATOM   6746 N  N   . GLY B 1 322 ? -11.526 -8.972  1.714   1.00 25.79  ? 322 GLY B N   1 
ATOM   6747 C  CA  . GLY B 1 322 ? -10.582 -9.698  2.539   1.00 27.22  ? 322 GLY B CA  1 
ATOM   6748 C  C   . GLY B 1 322 ? -9.154  -9.340  2.192   1.00 26.68  ? 322 GLY B C   1 
ATOM   6749 O  O   . GLY B 1 322 ? -8.877  -8.461  1.364   1.00 32.03  ? 322 GLY B O   1 
ATOM   6750 N  N   . VAL B 1 323 ? -8.243  -10.056 2.848   1.00 28.37  ? 323 VAL B N   1 
ATOM   6751 C  CA  . VAL B 1 323 ? -6.826  -9.722  2.863   1.00 13.22  ? 323 VAL B CA  1 
ATOM   6752 C  C   . VAL B 1 323 ? -6.028  -11.013 2.835   1.00 21.70  ? 323 VAL B C   1 
ATOM   6753 O  O   . VAL B 1 323 ? -6.547  -12.104 3.097   1.00 17.99  ? 323 VAL B O   1 
ATOM   6754 C  CB  . VAL B 1 323 ? -6.427  -8.915  4.114   1.00 21.31  ? 323 VAL B CB  1 
ATOM   6755 C  CG1 . VAL B 1 323 ? -7.205  -7.588  4.201   1.00 23.95  ? 323 VAL B CG1 1 
ATOM   6756 C  CG2 . VAL B 1 323 ? -6.666  -9.765  5.354   1.00 13.53  ? 323 VAL B CG2 1 
ATOM   6757 N  N   . ASN B 1 324 ? -4.744  -10.876 2.524   1.00 25.48  ? 324 ASN B N   1 
ATOM   6758 C  CA  . ASN B 1 324 ? -3.812  -11.985 2.629   1.00 28.55  ? 324 ASN B CA  1 
ATOM   6759 C  C   . ASN B 1 324 ? -3.015  -11.868 3.918   1.00 33.89  ? 324 ASN B C   1 
ATOM   6760 O  O   . ASN B 1 324 ? -2.986  -10.820 4.571   1.00 35.25  ? 324 ASN B O   1 
ATOM   6761 C  CB  . ASN B 1 324 ? -2.884  -12.065 1.408   1.00 37.69  ? 324 ASN B CB  1 
ATOM   6762 C  CG  . ASN B 1 324 ? -3.625  -11.923 0.090   1.00 41.61  ? 324 ASN B CG  1 
ATOM   6763 O  OD1 . ASN B 1 324 ? -4.807  -12.253 -0.005  1.00 44.96  ? 324 ASN B OD1 1 
ATOM   6764 N  ND2 . ASN B 1 324 ? -2.911  -11.504 -0.952  1.00 39.92  ? 324 ASN B ND2 1 
ATOM   6765 N  N   . LYS B 1 325 ? -2.358  -12.976 4.276   1.00 33.90  ? 325 LYS B N   1 
ATOM   6766 C  CA  . LYS B 1 325 ? -1.788  -13.115 5.615   1.00 33.69  ? 325 LYS B CA  1 
ATOM   6767 C  C   . LYS B 1 325 ? -0.605  -12.184 5.843   1.00 31.30  ? 325 LYS B C   1 
ATOM   6768 O  O   . LYS B 1 325 ? -0.383  -11.745 6.977   1.00 37.17  ? 325 LYS B O   1 
ATOM   6769 C  CB  . LYS B 1 325 ? -1.377  -14.569 5.853   1.00 31.97  ? 325 LYS B CB  1 
ATOM   6770 C  CG  . LYS B 1 325 ? -0.620  -14.845 7.141   1.00 33.87  ? 325 LYS B CG  1 
ATOM   6771 C  CD  . LYS B 1 325 ? -0.183  -16.309 7.195   1.00 44.86  ? 325 LYS B CD  1 
ATOM   6772 C  CE  . LYS B 1 325 ? 1.080   -16.508 8.047   1.00 54.57  ? 325 LYS B CE  1 
ATOM   6773 N  NZ  . LYS B 1 325 ? 2.089   -17.389 7.356   1.00 52.35  ? 325 LYS B NZ  1 
ATOM   6774 N  N   . ASP B 1 326 ? 0.155   -11.862 4.792   1.00 29.73  ? 326 ASP B N   1 
ATOM   6775 C  CA  . ASP B 1 326 ? 1.402   -11.103 4.926   1.00 39.90  ? 326 ASP B CA  1 
ATOM   6776 C  C   . ASP B 1 326 ? 1.462   -9.992  3.879   1.00 37.58  ? 326 ASP B C   1 
ATOM   6777 O  O   . ASP B 1 326 ? 2.345   -9.956  3.022   1.00 27.04  ? 326 ASP B O   1 
ATOM   6778 C  CB  . ASP B 1 326 ? 2.631   -12.008 4.812   1.00 43.45  ? 326 ASP B CB  1 
ATOM   6779 C  CG  . ASP B 1 326 ? 2.449   -13.347 5.529   1.00 46.60  ? 326 ASP B CG  1 
ATOM   6780 O  OD1 . ASP B 1 326 ? 1.869   -14.274 4.920   1.00 46.37  ? 326 ASP B OD1 1 
ATOM   6781 O  OD2 . ASP B 1 326 ? 2.877   -13.471 6.707   1.00 44.77  ? 326 ASP B OD2 1 
ATOM   6782 N  N   . GLU B 1 327 ? 0.521   -9.051  3.993   1.00 38.35  ? 327 GLU B N   1 
ATOM   6783 C  CA  . GLU B 1 327 ? 0.449   -7.930  3.063   1.00 36.06  ? 327 GLU B CA  1 
ATOM   6784 C  C   . GLU B 1 327 ? 1.767   -7.171  2.971   1.00 35.66  ? 327 GLU B C   1 
ATOM   6785 O  O   . GLU B 1 327 ? 2.130   -6.677  1.900   1.00 31.73  ? 327 GLU B O   1 
ATOM   6786 C  CB  . GLU B 1 327 ? -0.659  -6.980  3.500   1.00 42.57  ? 327 GLU B CB  1 
ATOM   6787 C  CG  . GLU B 1 327 ? -2.054  -7.494  3.211   1.00 60.40  ? 327 GLU B CG  1 
ATOM   6788 C  CD  . GLU B 1 327 ? -2.310  -7.760  1.746   1.00 63.36  ? 327 GLU B CD  1 
ATOM   6789 O  OE1 . GLU B 1 327 ? -3.209  -8.582  1.461   1.00 55.20  ? 327 GLU B OE1 1 
ATOM   6790 O  OE2 . GLU B 1 327 ? -1.636  -7.143  0.885   1.00 71.84  ? 327 GLU B OE2 1 
ATOM   6791 N  N   . GLY B 1 328 ? 2.497   -7.057  4.082   1.00 31.37  ? 328 GLY B N   1 
ATOM   6792 C  CA  . GLY B 1 328 ? 3.606   -6.131  4.069   1.00 23.77  ? 328 GLY B CA  1 
ATOM   6793 C  C   . GLY B 1 328 ? 4.947   -6.683  3.628   1.00 27.44  ? 328 GLY B C   1 
ATOM   6794 O  O   . GLY B 1 328 ? 5.889   -5.904  3.410   1.00 16.78  ? 328 GLY B O   1 
ATOM   6795 N  N   . SER B 1 329 ? 5.057   -8.004  3.478   1.00 33.44  ? 329 SER B N   1 
ATOM   6796 C  CA  . SER B 1 329 ? 6.369   -8.606  3.278   1.00 25.94  ? 329 SER B CA  1 
ATOM   6797 C  C   . SER B 1 329 ? 7.022   -8.093  2.002   1.00 36.00  ? 329 SER B C   1 
ATOM   6798 O  O   . SER B 1 329 ? 8.238   -7.850  1.973   1.00 40.58  ? 329 SER B O   1 
ATOM   6799 C  CB  . SER B 1 329 ? 6.252   -10.125 3.249   1.00 16.05  ? 329 SER B CB  1 
ATOM   6800 O  OG  . SER B 1 329 ? 5.769   -10.547 1.992   1.00 37.07  ? 329 SER B OG  1 
ATOM   6801 N  N   . PHE B 1 330 ? 6.230   -7.915  0.938   1.00 28.15  ? 330 PHE B N   1 
ATOM   6802 C  CA  . PHE B 1 330 ? 6.779   -7.376  -0.304  1.00 39.32  ? 330 PHE B CA  1 
ATOM   6803 C  C   . PHE B 1 330 ? 7.374   -5.990  -0.076  1.00 39.34  ? 330 PHE B C   1 
ATOM   6804 O  O   . PHE B 1 330 ? 8.474   -5.684  -0.563  1.00 29.78  ? 330 PHE B O   1 
ATOM   6805 C  CB  . PHE B 1 330 ? 5.689   -7.345  -1.385  1.00 44.37  ? 330 PHE B CB  1 
ATOM   6806 C  CG  . PHE B 1 330 ? 6.159   -6.849  -2.741  1.00 59.10  ? 330 PHE B CG  1 
ATOM   6807 C  CD1 . PHE B 1 330 ? 6.359   -5.499  -2.999  1.00 70.00  ? 330 PHE B CD1 1 
ATOM   6808 C  CD2 . PHE B 1 330 ? 6.405   -7.752  -3.762  1.00 69.65  ? 330 PHE B CD2 1 
ATOM   6809 C  CE1 . PHE B 1 330 ? 6.795   -5.071  -4.250  1.00 76.14  ? 330 PHE B CE1 1 
ATOM   6810 C  CE2 . PHE B 1 330 ? 6.837   -7.329  -5.011  1.00 70.24  ? 330 PHE B CE2 1 
ATOM   6811 C  CZ  . PHE B 1 330 ? 7.030   -5.991  -5.255  1.00 74.13  ? 330 PHE B CZ  1 
ATOM   6812 N  N   . PHE B 1 331 ? 6.680   -5.149  0.692   1.00 35.80  ? 331 PHE B N   1 
ATOM   6813 C  CA  . PHE B 1 331 ? 7.093   -3.761  0.840   1.00 33.54  ? 331 PHE B CA  1 
ATOM   6814 C  C   . PHE B 1 331 ? 8.300   -3.579  1.749   1.00 38.32  ? 331 PHE B C   1 
ATOM   6815 O  O   . PHE B 1 331 ? 9.018   -2.584  1.605   1.00 46.72  ? 331 PHE B O   1 
ATOM   6816 C  CB  . PHE B 1 331 ? 5.934   -2.927  1.367   1.00 27.25  ? 331 PHE B CB  1 
ATOM   6817 C  CG  . PHE B 1 331 ? 4.768   -2.862  0.435   1.00 30.42  ? 331 PHE B CG  1 
ATOM   6818 C  CD1 . PHE B 1 331 ? 3.830   -3.886  0.395   1.00 29.75  ? 331 PHE B CD1 1 
ATOM   6819 C  CD2 . PHE B 1 331 ? 4.602   -1.766  -0.399  1.00 33.59  ? 331 PHE B CD2 1 
ATOM   6820 C  CE1 . PHE B 1 331 ? 2.749   -3.819  -0.470  1.00 32.28  ? 331 PHE B CE1 1 
ATOM   6821 C  CE2 . PHE B 1 331 ? 3.530   -1.684  -1.258  1.00 29.21  ? 331 PHE B CE2 1 
ATOM   6822 C  CZ  . PHE B 1 331 ? 2.599   -2.713  -1.300  1.00 33.39  ? 331 PHE B CZ  1 
ATOM   6823 N  N   . LEU B 1 332 ? 8.539   -4.487  2.693   1.00 25.80  ? 332 LEU B N   1 
ATOM   6824 C  CA  . LEU B 1 332 ? 9.783   -4.373  3.444   1.00 29.50  ? 332 LEU B CA  1 
ATOM   6825 C  C   . LEU B 1 332 ? 10.979  -4.836  2.633   1.00 37.11  ? 332 LEU B C   1 
ATOM   6826 O  O   . LEU B 1 332 ? 12.075  -4.291  2.793   1.00 49.58  ? 332 LEU B O   1 
ATOM   6827 C  CB  . LEU B 1 332 ? 9.708   -5.147  4.758   1.00 27.24  ? 332 LEU B CB  1 
ATOM   6828 C  CG  . LEU B 1 332 ? 8.492   -4.761  5.596   1.00 24.24  ? 332 LEU B CG  1 
ATOM   6829 C  CD1 . LEU B 1 332 ? 8.066   -5.897  6.511   1.00 23.81  ? 332 LEU B CD1 1 
ATOM   6830 C  CD2 . LEU B 1 332 ? 8.796   -3.509  6.386   1.00 18.67  ? 332 LEU B CD2 1 
ATOM   6831 N  N   . LEU B 1 333 ? 10.789  -5.821  1.755   1.00 42.06  ? 333 LEU B N   1 
ATOM   6832 C  CA  . LEU B 1 333 ? 11.880  -6.267  0.894   1.00 42.38  ? 333 LEU B CA  1 
ATOM   6833 C  C   . LEU B 1 333 ? 12.408  -5.139  0.022   1.00 38.34  ? 333 LEU B C   1 
ATOM   6834 O  O   . LEU B 1 333 ? 13.595  -5.115  -0.310  1.00 43.47  ? 333 LEU B O   1 
ATOM   6835 C  CB  . LEU B 1 333 ? 11.408  -7.429  0.021   1.00 46.51  ? 333 LEU B CB  1 
ATOM   6836 C  CG  . LEU B 1 333 ? 12.333  -7.920  -1.096  1.00 46.93  ? 333 LEU B CG  1 
ATOM   6837 C  CD1 . LEU B 1 333 ? 13.596  -8.531  -0.525  1.00 50.39  ? 333 LEU B CD1 1 
ATOM   6838 C  CD2 . LEU B 1 333 ? 11.616  -8.927  -1.967  1.00 43.70  ? 333 LEU B CD2 1 
ATOM   6839 N  N   . TYR B 1 334 ? 11.557  -4.195  -0.352  1.00 38.88  ? 334 TYR B N   1 
ATOM   6840 C  CA  . TYR B 1 334 ? 11.974  -3.126  -1.246  1.00 32.57  ? 334 TYR B CA  1 
ATOM   6841 C  C   . TYR B 1 334 ? 12.448  -1.873  -0.522  1.00 29.72  ? 334 TYR B C   1 
ATOM   6842 O  O   . TYR B 1 334 ? 13.113  -1.038  -1.140  1.00 35.83  ? 334 TYR B O   1 
ATOM   6843 C  CB  . TYR B 1 334 ? 10.825  -2.752  -2.199  1.00 30.93  ? 334 TYR B CB  1 
ATOM   6844 C  CG  . TYR B 1 334 ? 10.733  -3.615  -3.451  1.00 30.44  ? 334 TYR B CG  1 
ATOM   6845 C  CD1 . TYR B 1 334 ? 10.369  -4.954  -3.376  1.00 33.08  ? 334 TYR B CD1 1 
ATOM   6846 C  CD2 . TYR B 1 334 ? 11.017  -3.086  -4.708  1.00 34.66  ? 334 TYR B CD2 1 
ATOM   6847 C  CE1 . TYR B 1 334 ? 10.286  -5.740  -4.514  1.00 34.81  ? 334 TYR B CE1 1 
ATOM   6848 C  CE2 . TYR B 1 334 ? 10.939  -3.867  -5.855  1.00 34.04  ? 334 TYR B CE2 1 
ATOM   6849 C  CZ  . TYR B 1 334 ? 10.569  -5.190  -5.752  1.00 33.06  ? 334 TYR B CZ  1 
ATOM   6850 O  OH  . TYR B 1 334 ? 10.484  -5.967  -6.884  1.00 16.47  ? 334 TYR B OH  1 
ATOM   6851 N  N   . GLY B 1 335 ? 12.156  -1.715  0.761   1.00 36.92  ? 335 GLY B N   1 
ATOM   6852 C  CA  . GLY B 1 335 ? 12.379  -0.405  1.340   1.00 36.26  ? 335 GLY B CA  1 
ATOM   6853 C  C   . GLY B 1 335 ? 12.995  -0.348  2.719   1.00 30.08  ? 335 GLY B C   1 
ATOM   6854 O  O   . GLY B 1 335 ? 13.407  0.733   3.153   1.00 39.41  ? 335 GLY B O   1 
ATOM   6855 N  N   . ALA B 1 336 ? 13.078  -1.481  3.420   1.00 28.07  ? 336 ALA B N   1 
ATOM   6856 C  CA  . ALA B 1 336 ? 13.493  -1.416  4.823   1.00 31.60  ? 336 ALA B CA  1 
ATOM   6857 C  C   . ALA B 1 336 ? 14.797  -2.179  5.062   1.00 30.11  ? 336 ALA B C   1 
ATOM   6858 O  O   . ALA B 1 336 ? 15.005  -3.250  4.490   1.00 28.26  ? 336 ALA B O   1 
ATOM   6859 C  CB  . ALA B 1 336 ? 12.392  -1.984  5.735   1.00 21.31  ? 336 ALA B CB  1 
ATOM   6860 N  N   . PRO B 1 337 ? 15.676  -1.651  5.903   1.00 25.85  ? 337 PRO B N   1 
ATOM   6861 C  CA  . PRO B 1 337 ? 17.027  -2.226  6.017   1.00 26.58  ? 337 PRO B CA  1 
ATOM   6862 C  C   . PRO B 1 337 ? 17.018  -3.644  6.562   1.00 25.98  ? 337 PRO B C   1 
ATOM   6863 O  O   . PRO B 1 337 ? 16.246  -3.985  7.462   1.00 31.10  ? 337 PRO B O   1 
ATOM   6864 C  CB  . PRO B 1 337 ? 17.741  -1.271  6.986   1.00 30.43  ? 337 PRO B CB  1 
ATOM   6865 C  CG  . PRO B 1 337 ? 16.676  -0.424  7.585   1.00 31.90  ? 337 PRO B CG  1 
ATOM   6866 C  CD  . PRO B 1 337 ? 15.521  -0.401  6.652   1.00 25.42  ? 337 PRO B CD  1 
ATOM   6867 N  N   . GLY B 1 338 ? 17.897  -4.476  5.996   1.00 28.26  ? 338 GLY B N   1 
ATOM   6868 C  CA  . GLY B 1 338 ? 18.109  -5.845  6.453   1.00 33.80  ? 338 GLY B CA  1 
ATOM   6869 C  C   . GLY B 1 338 ? 17.249  -6.897  5.784   1.00 36.08  ? 338 GLY B C   1 
ATOM   6870 O  O   . GLY B 1 338 ? 17.494  -8.094  5.980   1.00 27.75  ? 338 GLY B O   1 
ATOM   6871 N  N   . PHE B 1 339 ? 16.237  -6.498  5.023   1.00 41.86  ? 339 PHE B N   1 
ATOM   6872 C  CA  . PHE B 1 339 ? 15.479  -7.459  4.245   1.00 32.33  ? 339 PHE B CA  1 
ATOM   6873 C  C   . PHE B 1 339 ? 16.223  -7.746  2.955   1.00 33.24  ? 339 PHE B C   1 
ATOM   6874 O  O   . PHE B 1 339 ? 16.632  -6.824  2.239   1.00 36.35  ? 339 PHE B O   1 
ATOM   6875 C  CB  . PHE B 1 339 ? 14.079  -6.930  3.952   1.00 37.04  ? 339 PHE B CB  1 
ATOM   6876 C  CG  . PHE B 1 339 ? 13.247  -6.748  5.177   1.00 34.24  ? 339 PHE B CG  1 
ATOM   6877 C  CD1 . PHE B 1 339 ? 12.495  -7.801  5.675   1.00 34.22  ? 339 PHE B CD1 1 
ATOM   6878 C  CD2 . PHE B 1 339 ? 13.244  -5.541  5.851   1.00 24.47  ? 339 PHE B CD2 1 
ATOM   6879 C  CE1 . PHE B 1 339 ? 11.744  -7.650  6.820   1.00 37.51  ? 339 PHE B CE1 1 
ATOM   6880 C  CE2 . PHE B 1 339 ? 12.497  -5.380  7.001   1.00 30.37  ? 339 PHE B CE2 1 
ATOM   6881 C  CZ  . PHE B 1 339 ? 11.743  -6.436  7.488   1.00 38.27  ? 339 PHE B CZ  1 
ATOM   6882 N  N   . SER B 1 340 ? 16.426  -9.022  2.678   1.00 27.16  ? 340 SER B N   1 
ATOM   6883 C  CA  . SER B 1 340 ? 17.018  -9.454  1.430   1.00 32.16  ? 340 SER B CA  1 
ATOM   6884 C  C   . SER B 1 340 ? 16.147  -10.547 0.844   1.00 29.68  ? 340 SER B C   1 
ATOM   6885 O  O   . SER B 1 340 ? 15.486  -11.291 1.574   1.00 33.45  ? 340 SER B O   1 
ATOM   6886 C  CB  . SER B 1 340 ? 18.450  -9.965  1.624   1.00 52.88  ? 340 SER B CB  1 
ATOM   6887 O  OG  . SER B 1 340 ? 19.000  -10.405 0.391   1.00 61.68  ? 340 SER B OG  1 
ATOM   6888 N  N   . LYS B 1 341 ? 16.152  -10.630 -0.486  1.00 31.12  ? 341 LYS B N   1 
ATOM   6889 C  CA  . LYS B 1 341 ? 15.368  -11.646 -1.184  1.00 35.27  ? 341 LYS B CA  1 
ATOM   6890 C  C   . LYS B 1 341 ? 15.952  -13.039 -0.992  1.00 30.15  ? 341 LYS B C   1 
ATOM   6891 O  O   . LYS B 1 341 ? 15.210  -14.029 -1.030  1.00 32.02  ? 341 LYS B O   1 
ATOM   6892 C  CB  . LYS B 1 341 ? 15.284  -11.287 -2.675  1.00 48.87  ? 341 LYS B CB  1 
ATOM   6893 C  CG  . LYS B 1 341 ? 15.040  -12.440 -3.654  1.00 50.73  ? 341 LYS B CG  1 
ATOM   6894 C  CD  . LYS B 1 341 ? 14.659  -11.902 -5.042  1.00 47.74  ? 341 LYS B CD  1 
ATOM   6895 C  CE  . LYS B 1 341 ? 15.720  -12.175 -6.103  1.00 43.46  ? 341 LYS B CE  1 
ATOM   6896 N  NZ  . LYS B 1 341 ? 15.791  -13.617 -6.482  1.00 38.53  ? 341 LYS B NZ  1 
ATOM   6897 N  N   . ASP B 1 342 ? 17.267  -13.135 -0.764  1.00 23.16  ? 342 ASP B N   1 
ATOM   6898 C  CA  . ASP B 1 342 ? 17.978  -14.406 -0.750  1.00 39.04  ? 342 ASP B CA  1 
ATOM   6899 C  C   . ASP B 1 342 ? 18.328  -14.863 0.662   1.00 41.76  ? 342 ASP B C   1 
ATOM   6900 O  O   . ASP B 1 342 ? 19.197  -15.721 0.841   1.00 41.85  ? 342 ASP B O   1 
ATOM   6901 C  CB  . ASP B 1 342 ? 19.238  -14.305 -1.615  1.00 43.38  ? 342 ASP B CB  1 
ATOM   6902 C  CG  . ASP B 1 342 ? 18.937  -13.790 -3.015  1.00 54.17  ? 342 ASP B CG  1 
ATOM   6903 O  OD1 . ASP B 1 342 ? 18.042  -14.369 -3.678  1.00 55.00  ? 342 ASP B OD1 1 
ATOM   6904 O  OD2 . ASP B 1 342 ? 19.578  -12.800 -3.446  1.00 54.70  ? 342 ASP B OD2 1 
ATOM   6905 N  N   . SER B 1 343 ? 17.648  -14.324 1.662   1.00 45.84  ? 343 SER B N   1 
ATOM   6906 C  CA  . SER B 1 343 ? 17.995  -14.506 3.058   1.00 42.86  ? 343 SER B CA  1 
ATOM   6907 C  C   . SER B 1 343 ? 16.727  -14.810 3.844   1.00 42.93  ? 343 SER B C   1 
ATOM   6908 O  O   . SER B 1 343 ? 15.617  -14.775 3.307   1.00 44.06  ? 343 SER B O   1 
ATOM   6909 C  CB  . SER B 1 343 ? 18.695  -13.250 3.594   1.00 45.32  ? 343 SER B CB  1 
ATOM   6910 O  OG  . SER B 1 343 ? 18.720  -13.228 5.005   1.00 58.01  ? 343 SER B OG  1 
ATOM   6911 N  N   . GLU B 1 344 ? 16.898  -15.142 5.123   1.00 40.27  ? 344 GLU B N   1 
ATOM   6912 C  CA  . GLU B 1 344 ? 15.778  -15.158 6.056   1.00 31.29  ? 344 GLU B CA  1 
ATOM   6913 C  C   . GLU B 1 344 ? 15.483  -13.782 6.623   1.00 23.54  ? 344 GLU B C   1 
ATOM   6914 O  O   . GLU B 1 344 ? 14.558  -13.653 7.427   1.00 27.73  ? 344 GLU B O   1 
ATOM   6915 C  CB  . GLU B 1 344 ? 16.041  -16.096 7.227   1.00 41.85  ? 344 GLU B CB  1 
ATOM   6916 C  CG  . GLU B 1 344 ? 16.247  -17.543 6.900   1.00 57.25  ? 344 GLU B CG  1 
ATOM   6917 C  CD  . GLU B 1 344 ? 16.764  -18.292 8.114   1.00 75.16  ? 344 GLU B CD  1 
ATOM   6918 O  OE1 . GLU B 1 344 ? 16.064  -19.211 8.593   1.00 72.81  ? 344 GLU B OE1 1 
ATOM   6919 O  OE2 . GLU B 1 344 ? 17.864  -17.934 8.603   1.00 82.89  ? 344 GLU B OE2 1 
ATOM   6920 N  N   . SER B 1 345 ? 16.267  -12.775 6.261   1.00 19.46  ? 345 SER B N   1 
ATOM   6921 C  CA  . SER B 1 345 ? 16.045  -11.399 6.689   1.00 34.02  ? 345 SER B CA  1 
ATOM   6922 C  C   . SER B 1 345 ? 15.755  -11.311 8.185   1.00 37.87  ? 345 SER B C   1 
ATOM   6923 O  O   . SER B 1 345 ? 14.815  -10.644 8.627   1.00 30.62  ? 345 SER B O   1 
ATOM   6924 C  CB  . SER B 1 345 ? 14.927  -10.750 5.877   1.00 31.01  ? 345 SER B CB  1 
ATOM   6925 O  OG  . SER B 1 345 ? 15.348  -10.495 4.551   1.00 39.59  ? 345 SER B OG  1 
ATOM   6926 N  N   . LYS B 1 346 ? 16.561  -12.015 8.975   1.00 33.56  ? 346 LYS B N   1 
ATOM   6927 C  CA  . LYS B 1 346 ? 16.496  -11.815 10.413  1.00 29.84  ? 346 LYS B CA  1 
ATOM   6928 C  C   . LYS B 1 346 ? 16.874  -10.373 10.713  1.00 29.35  ? 346 LYS B C   1 
ATOM   6929 O  O   . LYS B 1 346 ? 17.901  -9.874  10.249  1.00 41.47  ? 346 LYS B O   1 
ATOM   6930 C  CB  . LYS B 1 346 ? 17.421  -12.790 11.137  1.00 32.65  ? 346 LYS B CB  1 
ATOM   6931 C  CG  . LYS B 1 346 ? 17.051  -14.258 10.944  1.00 37.76  ? 346 LYS B CG  1 
ATOM   6932 C  CD  . LYS B 1 346 ? 18.058  -15.193 11.614  1.00 48.89  ? 346 LYS B CD  1 
ATOM   6933 C  CE  . LYS B 1 346 ? 17.994  -15.132 13.150  1.00 63.49  ? 346 LYS B CE  1 
ATOM   6934 N  NZ  . LYS B 1 346 ? 18.738  -13.992 13.811  1.00 67.79  ? 346 LYS B NZ  1 
ATOM   6935 N  N   . ILE B 1 347 ? 16.021  -9.683  11.444  1.00 24.19  ? 347 ILE B N   1 
ATOM   6936 C  CA  . ILE B 1 347 ? 16.151  -8.247  11.606  1.00 34.56  ? 347 ILE B CA  1 
ATOM   6937 C  C   . ILE B 1 347 ? 16.758  -7.956  12.967  1.00 42.20  ? 347 ILE B C   1 
ATOM   6938 O  O   . ILE B 1 347 ? 16.163  -8.273  14.005  1.00 49.80  ? 347 ILE B O   1 
ATOM   6939 C  CB  . ILE B 1 347 ? 14.796  -7.546  11.439  1.00 40.93  ? 347 ILE B CB  1 
ATOM   6940 C  CG1 . ILE B 1 347 ? 14.299  -7.720  10.005  1.00 46.57  ? 347 ILE B CG1 1 
ATOM   6941 C  CG2 . ILE B 1 347 ? 14.915  -6.074  11.757  1.00 42.85  ? 347 ILE B CG2 1 
ATOM   6942 C  CD1 . ILE B 1 347 ? 15.326  -7.394  8.931   1.00 50.53  ? 347 ILE B CD1 1 
ATOM   6943 N  N   . SER B 1 348 ? 17.944  -7.354  12.965  1.00 40.17  ? 348 SER B N   1 
ATOM   6944 C  CA  . SER B 1 348 ? 18.472  -6.775  14.191  1.00 29.17  ? 348 SER B CA  1 
ATOM   6945 C  C   . SER B 1 348 ? 17.573  -5.646  14.673  1.00 35.10  ? 348 SER B C   1 
ATOM   6946 O  O   . SER B 1 348 ? 16.842  -5.020  13.900  1.00 44.51  ? 348 SER B O   1 
ATOM   6947 C  CB  . SER B 1 348 ? 19.853  -6.193  13.977  1.00 23.45  ? 348 SER B CB  1 
ATOM   6948 O  OG  . SER B 1 348 ? 19.715  -4.862  13.502  1.00 22.53  ? 348 SER B OG  1 
ATOM   6949 N  N   . ARG B 1 349 ? 17.698  -5.331  15.959  1.00 34.02  ? 349 ARG B N   1 
ATOM   6950 C  CA  . ARG B 1 349 ? 16.734  -4.430  16.564  1.00 40.51  ? 349 ARG B CA  1 
ATOM   6951 C  C   . ARG B 1 349 ? 16.949  -2.993  16.105  1.00 39.35  ? 349 ARG B C   1 
ATOM   6952 O  O   . ARG B 1 349 ? 15.977  -2.266  15.852  1.00 36.11  ? 349 ARG B O   1 
ATOM   6953 C  CB  . ARG B 1 349 ? 16.774  -4.538  18.087  1.00 48.47  ? 349 ARG B CB  1 
ATOM   6954 C  CG  . ARG B 1 349 ? 15.832  -3.537  18.720  1.00 50.97  ? 349 ARG B CG  1 
ATOM   6955 C  CD  . ARG B 1 349 ? 14.967  -4.218  19.712  1.00 46.46  ? 349 ARG B CD  1 
ATOM   6956 N  NE  . ARG B 1 349 ? 14.007  -3.271  20.242  1.00 51.58  ? 349 ARG B NE  1 
ATOM   6957 C  CZ  . ARG B 1 349 ? 12.712  -3.316  19.984  1.00 51.07  ? 349 ARG B CZ  1 
ATOM   6958 N  NH1 . ARG B 1 349 ? 12.254  -4.262  19.176  1.00 25.65  ? 349 ARG B NH1 1 
ATOM   6959 N  NH2 . ARG B 1 349 ? 11.913  -2.410  20.543  1.00 62.55  ? 349 ARG B NH2 1 
ATOM   6960 N  N   . GLU B 1 350 ? 18.206  -2.569  15.951  1.00 41.09  ? 350 GLU B N   1 
ATOM   6961 C  CA  . GLU B 1 350 ? 18.441  -1.228  15.416  1.00 46.44  ? 350 GLU B CA  1 
ATOM   6962 C  C   . GLU B 1 350 ? 17.879  -1.077  14.002  1.00 41.04  ? 350 GLU B C   1 
ATOM   6963 O  O   . GLU B 1 350 ? 17.417  0.010   13.633  1.00 36.10  ? 350 GLU B O   1 
ATOM   6964 C  CB  . GLU B 1 350 ? 19.930  -0.892  15.449  1.00 47.84  ? 350 GLU B CB  1 
ATOM   6965 C  CG  . GLU B 1 350 ? 20.733  -1.479  14.316  1.00 61.23  ? 350 GLU B CG  1 
ATOM   6966 C  CD  . GLU B 1 350 ? 21.897  -0.594  13.924  1.00 75.64  ? 350 GLU B CD  1 
ATOM   6967 O  OE1 . GLU B 1 350 ? 22.328  0.226   14.764  1.00 80.73  ? 350 GLU B OE1 1 
ATOM   6968 O  OE2 . GLU B 1 350 ? 22.360  -0.699  12.765  1.00 77.80  ? 350 GLU B OE2 1 
ATOM   6969 N  N   . ASP B 1 351 ? 17.895  -2.149  13.201  1.00 34.21  ? 351 ASP B N   1 
ATOM   6970 C  CA  . ASP B 1 351 ? 17.180  -2.115  11.931  1.00 37.57  ? 351 ASP B CA  1 
ATOM   6971 C  C   . ASP B 1 351 ? 15.671  -2.193  12.133  1.00 44.63  ? 351 ASP B C   1 
ATOM   6972 O  O   . ASP B 1 351 ? 14.906  -1.638  11.331  1.00 45.27  ? 351 ASP B O   1 
ATOM   6973 C  CB  . ASP B 1 351 ? 17.645  -3.250  11.017  1.00 41.16  ? 351 ASP B CB  1 
ATOM   6974 C  CG  . ASP B 1 351 ? 18.918  -2.903  10.265  1.00 57.19  ? 351 ASP B CG  1 
ATOM   6975 O  OD1 . ASP B 1 351 ? 19.403  -1.755  10.433  1.00 64.47  ? 351 ASP B OD1 1 
ATOM   6976 O  OD2 . ASP B 1 351 ? 19.412  -3.760  9.487   1.00 50.59  ? 351 ASP B OD2 1 
ATOM   6977 N  N   . PHE B 1 352 ? 15.228  -2.868  13.195  1.00 38.76  ? 352 PHE B N   1 
ATOM   6978 C  CA  . PHE B 1 352 ? 13.799  -2.965  13.460  1.00 32.66  ? 352 PHE B CA  1 
ATOM   6979 C  C   . PHE B 1 352 ? 13.192  -1.595  13.680  1.00 24.65  ? 352 PHE B C   1 
ATOM   6980 O  O   . PHE B 1 352 ? 12.041  -1.347  13.308  1.00 22.84  ? 352 PHE B O   1 
ATOM   6981 C  CB  . PHE B 1 352 ? 13.548  -3.852  14.680  1.00 34.75  ? 352 PHE B CB  1 
ATOM   6982 C  CG  . PHE B 1 352 ? 12.134  -3.824  15.179  1.00 25.23  ? 352 PHE B CG  1 
ATOM   6983 C  CD1 . PHE B 1 352 ? 11.220  -4.757  14.744  1.00 24.21  ? 352 PHE B CD1 1 
ATOM   6984 C  CD2 . PHE B 1 352 ? 11.727  -2.871  16.103  1.00 28.75  ? 352 PHE B CD2 1 
ATOM   6985 C  CE1 . PHE B 1 352 ? 9.917   -4.730  15.206  1.00 31.99  ? 352 PHE B CE1 1 
ATOM   6986 C  CE2 . PHE B 1 352 ? 10.421  -2.839  16.566  1.00 27.79  ? 352 PHE B CE2 1 
ATOM   6987 C  CZ  . PHE B 1 352 ? 9.519   -3.768  16.121  1.00 26.76  ? 352 PHE B CZ  1 
ATOM   6988 N  N   . MET B 1 353 ? 13.927  -0.697  14.306  1.00 23.80  ? 353 MET B N   1 
ATOM   6989 C  CA  . MET B 1 353 ? 13.301  0.576   14.590  1.00 38.44  ? 353 MET B CA  1 
ATOM   6990 C  C   . MET B 1 353 ? 13.487  1.579   13.474  1.00 36.14  ? 353 MET B C   1 
ATOM   6991 O  O   . MET B 1 353 ? 12.633  2.463   13.318  1.00 33.26  ? 353 MET B O   1 
ATOM   6992 C  CB  . MET B 1 353 ? 13.791  1.092   15.937  1.00 55.33  ? 353 MET B CB  1 
ATOM   6993 C  CG  . MET B 1 353 ? 13.079  0.314   17.035  1.00 64.43  ? 353 MET B CG  1 
ATOM   6994 S  SD  . MET B 1 353 ? 13.801  0.473   18.645  1.00 72.92  ? 353 MET B SD  1 
ATOM   6995 C  CE  . MET B 1 353 ? 15.543  0.594   18.209  1.00 66.74  ? 353 MET B CE  1 
ATOM   6996 N  N   . SER B 1 354 ? 14.544  1.428   12.669  1.00 39.85  ? 354 SER B N   1 
ATOM   6997 C  CA  . SER B 1 354 ? 14.536  2.020   11.334  1.00 35.69  ? 354 SER B CA  1 
ATOM   6998 C  C   . SER B 1 354 ? 13.313  1.567   10.560  1.00 33.32  ? 354 SER B C   1 
ATOM   6999 O  O   . SER B 1 354 ? 12.664  2.372   9.878   1.00 27.20  ? 354 SER B O   1 
ATOM   7000 C  CB  . SER B 1 354 ? 15.805  1.647   10.586  1.00 20.74  ? 354 SER B CB  1 
ATOM   7001 O  OG  . SER B 1 354 ? 16.892  2.424   11.060  1.00 22.84  ? 354 SER B OG  1 
ATOM   7002 N  N   . GLY B 1 355 ? 12.968  0.285   10.697  1.00 35.46  ? 355 GLY B N   1 
ATOM   7003 C  CA  . GLY B 1 355 ? 11.771  -0.238  10.065  1.00 18.46  ? 355 GLY B CA  1 
ATOM   7004 C  C   . GLY B 1 355 ? 10.503  0.479   10.481  1.00 20.78  ? 355 GLY B C   1 
ATOM   7005 O  O   . GLY B 1 355 ? 9.723   0.916   9.633   1.00 25.49  ? 355 GLY B O   1 
ATOM   7006 N  N   . VAL B 1 356 ? 10.257  0.596   11.787  1.00 27.54  ? 356 VAL B N   1 
ATOM   7007 C  CA  . VAL B 1 356 ? 8.953   1.142   12.153  1.00 34.70  ? 356 VAL B CA  1 
ATOM   7008 C  C   . VAL B 1 356 ? 8.895   2.613   11.782  1.00 33.28  ? 356 VAL B C   1 
ATOM   7009 O  O   . VAL B 1 356 ? 7.833   3.117   11.394  1.00 30.72  ? 356 VAL B O   1 
ATOM   7010 C  CB  . VAL B 1 356 ? 8.592   0.909   13.643  1.00 29.49  ? 356 VAL B CB  1 
ATOM   7011 C  CG1 . VAL B 1 356 ? 9.432   -0.206  14.265  1.00 25.67  ? 356 VAL B CG1 1 
ATOM   7012 C  CG2 . VAL B 1 356 ? 8.646   2.219   14.447  1.00 19.34  ? 356 VAL B CG2 1 
ATOM   7013 N  N   . LYS B 1 357 ? 10.030  3.314   11.843  1.00 19.25  ? 357 LYS B N   1 
ATOM   7014 C  CA  . LYS B 1 357 ? 10.027  4.721   11.457  1.00 27.50  ? 357 LYS B CA  1 
ATOM   7015 C  C   . LYS B 1 357 ? 9.654   4.855   9.985   1.00 37.25  ? 357 LYS B C   1 
ATOM   7016 O  O   . LYS B 1 357 ? 8.757   5.621   9.615   1.00 47.82  ? 357 LYS B O   1 
ATOM   7017 C  CB  . LYS B 1 357 ? 11.393  5.351   11.749  1.00 20.40  ? 357 LYS B CB  1 
ATOM   7018 C  CG  . LYS B 1 357 ? 11.643  6.708   11.081  1.00 24.87  ? 357 LYS B CG  1 
ATOM   7019 C  CD  . LYS B 1 357 ? 10.886  7.836   11.792  1.00 29.54  ? 357 LYS B CD  1 
ATOM   7020 C  CE  . LYS B 1 357 ? 11.687  9.164   11.873  1.00 35.54  ? 357 LYS B CE  1 
ATOM   7021 N  NZ  . LYS B 1 357 ? 10.947  10.303  12.558  1.00 37.69  ? 357 LYS B NZ  1 
ATOM   7022 N  N   . LEU B 1 358 ? 10.320  4.081   9.132   1.00 34.78  ? 358 LEU B N   1 
ATOM   7023 C  CA  . LEU B 1 358 ? 9.938   3.989   7.732   1.00 34.06  ? 358 LEU B CA  1 
ATOM   7024 C  C   . LEU B 1 358 ? 8.485   3.552   7.575   1.00 37.04  ? 358 LEU B C   1 
ATOM   7025 O  O   . LEU B 1 358 ? 7.819   3.936   6.602   1.00 33.98  ? 358 LEU B O   1 
ATOM   7026 C  CB  . LEU B 1 358 ? 10.873  2.995   7.041   1.00 31.34  ? 358 LEU B CB  1 
ATOM   7027 C  CG  . LEU B 1 358 ? 11.917  3.415   6.001   1.00 20.22  ? 358 LEU B CG  1 
ATOM   7028 C  CD1 . LEU B 1 358 ? 12.260  4.886   6.098   1.00 19.28  ? 358 LEU B CD1 1 
ATOM   7029 C  CD2 . LEU B 1 358 ? 13.173  2.546   6.110   1.00 18.91  ? 358 LEU B CD2 1 
ATOM   7030 N  N   . SER B 1 359 ? 7.980   2.735   8.505   1.00 34.11  ? 359 SER B N   1 
ATOM   7031 C  CA  . SER B 1 359 ? 6.653   2.152   8.332   1.00 29.80  ? 359 SER B CA  1 
ATOM   7032 C  C   . SER B 1 359 ? 5.547   3.110   8.736   1.00 26.20  ? 359 SER B C   1 
ATOM   7033 O  O   . SER B 1 359 ? 4.470   3.084   8.139   1.00 33.82  ? 359 SER B O   1 
ATOM   7034 C  CB  . SER B 1 359 ? 6.532   0.862   9.132   1.00 38.10  ? 359 SER B CB  1 
ATOM   7035 O  OG  . SER B 1 359 ? 7.493   -0.088  8.705   1.00 48.34  ? 359 SER B OG  1 
ATOM   7036 N  N   . VAL B 1 360 ? 5.778   3.955   9.733   1.00 22.71  ? 360 VAL B N   1 
ATOM   7037 C  CA  . VAL B 1 360 ? 4.760   4.923   10.128  1.00 27.20  ? 360 VAL B CA  1 
ATOM   7038 C  C   . VAL B 1 360 ? 5.319   6.329   9.944   1.00 25.54  ? 360 VAL B C   1 
ATOM   7039 O  O   . VAL B 1 360 ? 5.522   7.058   10.925  1.00 23.95  ? 360 VAL B O   1 
ATOM   7040 C  CB  . VAL B 1 360 ? 4.290   4.686   11.570  1.00 30.00  ? 360 VAL B CB  1 
ATOM   7041 C  CG1 . VAL B 1 360 ? 2.940   5.364   11.791  1.00 28.84  ? 360 VAL B CG1 1 
ATOM   7042 C  CG2 . VAL B 1 360 ? 4.220   3.192   11.873  1.00 17.70  ? 360 VAL B CG2 1 
ATOM   7043 N  N   . PRO B 1 361 ? 5.526   6.767   8.705   1.00 31.16  ? 361 PRO B N   1 
ATOM   7044 C  CA  . PRO B 1 361 ? 6.246   8.032   8.475   1.00 30.97  ? 361 PRO B CA  1 
ATOM   7045 C  C   . PRO B 1 361 ? 5.572   9.264   9.064   1.00 31.55  ? 361 PRO B C   1 
ATOM   7046 O  O   . PRO B 1 361 ? 6.249   10.269  9.303   1.00 31.92  ? 361 PRO B O   1 
ATOM   7047 C  CB  . PRO B 1 361 ? 6.301   8.117   6.946   1.00 46.04  ? 361 PRO B CB  1 
ATOM   7048 C  CG  . PRO B 1 361 ? 5.044   7.376   6.502   1.00 45.26  ? 361 PRO B CG  1 
ATOM   7049 C  CD  . PRO B 1 361 ? 4.896   6.241   7.480   1.00 39.22  ? 361 PRO B CD  1 
ATOM   7050 N  N   . HIS B 1 362 ? 4.268   9.244   9.288   1.00 40.74  ? 362 HIS B N   1 
ATOM   7051 C  CA  . HIS B 1 362 ? 3.592   10.429  9.794   1.00 44.27  ? 362 HIS B CA  1 
ATOM   7052 C  C   . HIS B 1 362 ? 3.548   10.489  11.317  1.00 40.49  ? 362 HIS B C   1 
ATOM   7053 O  O   . HIS B 1 362 ? 2.993   11.443  11.872  1.00 42.97  ? 362 HIS B O   1 
ATOM   7054 C  CB  . HIS B 1 362 ? 2.178   10.500  9.213   1.00 46.11  ? 362 HIS B CB  1 
ATOM   7055 C  CG  . HIS B 1 362 ? 1.373   9.258   9.425   1.00 54.61  ? 362 HIS B CG  1 
ATOM   7056 N  ND1 . HIS B 1 362 ? 1.661   8.068   8.791   1.00 59.91  ? 362 HIS B ND1 1 
ATOM   7057 C  CD2 . HIS B 1 362 ? 0.276   9.025   10.185  1.00 63.04  ? 362 HIS B CD2 1 
ATOM   7058 C  CE1 . HIS B 1 362 ? 0.783   7.152   9.159   1.00 66.43  ? 362 HIS B CE1 1 
ATOM   7059 N  NE2 . HIS B 1 362 ? -0.070  7.707   10.003  1.00 66.92  ? 362 HIS B NE2 1 
ATOM   7060 N  N   . ALA B 1 363 ? 4.135   9.515   12.002  1.00 33.34  ? 363 ALA B N   1 
ATOM   7061 C  CA  . ALA B 1 363 ? 4.042   9.449   13.452  1.00 36.54  ? 363 ALA B CA  1 
ATOM   7062 C  C   . ALA B 1 363 ? 5.001   10.425  14.127  1.00 39.27  ? 363 ALA B C   1 
ATOM   7063 O  O   . ALA B 1 363 ? 6.182   10.503  13.767  1.00 35.85  ? 363 ALA B O   1 
ATOM   7064 C  CB  . ALA B 1 363 ? 4.349   8.030   13.929  1.00 34.74  ? 363 ALA B CB  1 
ATOM   7065 N  N   . ASN B 1 364 ? 4.497   11.149  15.135  1.00 34.57  ? 364 ASN B N   1 
ATOM   7066 C  CA  . ASN B 1 364 ? 5.409   11.814  16.057  1.00 26.29  ? 364 ASN B CA  1 
ATOM   7067 C  C   . ASN B 1 364 ? 6.194   10.753  16.835  1.00 30.73  ? 364 ASN B C   1 
ATOM   7068 O  O   . ASN B 1 364 ? 5.900   9.553   16.789  1.00 29.74  ? 364 ASN B O   1 
ATOM   7069 C  CB  . ASN B 1 364 ? 4.662   12.745  17.022  1.00 25.06  ? 364 ASN B CB  1 
ATOM   7070 C  CG  . ASN B 1 364 ? 3.623   12.025  17.884  1.00 31.85  ? 364 ASN B CG  1 
ATOM   7071 O  OD1 . ASN B 1 364 ? 3.860   10.930  18.407  1.00 34.09  ? 364 ASN B OD1 1 
ATOM   7072 N  ND2 . ASN B 1 364 ? 2.472   12.658  18.052  1.00 32.29  ? 364 ASN B ND2 1 
ATOM   7073 N  N   . ASP B 1 365 ? 7.201   11.193  17.576  1.00 43.07  ? 365 ASP B N   1 
ATOM   7074 C  CA  . ASP B 1 365 ? 8.028   10.208  18.262  1.00 56.44  ? 365 ASP B CA  1 
ATOM   7075 C  C   . ASP B 1 365 ? 7.223   9.438   19.301  1.00 44.54  ? 365 ASP B C   1 
ATOM   7076 O  O   . ASP B 1 365 ? 7.353   8.216   19.408  1.00 43.20  ? 365 ASP B O   1 
ATOM   7077 C  CB  . ASP B 1 365 ? 9.257   10.875  18.875  1.00 74.96  ? 365 ASP B CB  1 
ATOM   7078 C  CG  . ASP B 1 365 ? 10.345  11.132  17.836  1.00 95.75  ? 365 ASP B CG  1 
ATOM   7079 O  OD1 . ASP B 1 365 ? 10.014  11.570  16.704  1.00 100.54 ? 365 ASP B OD1 1 
ATOM   7080 O  OD2 . ASP B 1 365 ? 11.525  10.844  18.127  1.00 102.58 ? 365 ASP B OD2 1 
ATOM   7081 N  N   . LEU B 1 366 ? 6.350   10.120  20.041  1.00 34.92  ? 366 LEU B N   1 
ATOM   7082 C  CA  . LEU B 1 366 ? 5.484   9.401   20.969  1.00 33.64  ? 366 LEU B CA  1 
ATOM   7083 C  C   . LEU B 1 366 ? 4.672   8.321   20.252  1.00 34.52  ? 366 LEU B C   1 
ATOM   7084 O  O   . LEU B 1 366 ? 4.507   7.208   20.771  1.00 24.34  ? 366 LEU B O   1 
ATOM   7085 C  CB  . LEU B 1 366 ? 4.568   10.383  21.695  1.00 32.41  ? 366 LEU B CB  1 
ATOM   7086 C  CG  . LEU B 1 366 ? 3.598   9.709   22.651  1.00 29.21  ? 366 LEU B CG  1 
ATOM   7087 C  CD1 . LEU B 1 366 ? 4.373   8.876   23.661  1.00 25.24  ? 366 LEU B CD1 1 
ATOM   7088 C  CD2 . LEU B 1 366 ? 2.759   10.744  23.354  1.00 39.68  ? 366 LEU B CD2 1 
ATOM   7089 N  N   . GLY B 1 367 ? 4.169   8.624   19.050  1.00 36.86  ? 367 GLY B N   1 
ATOM   7090 C  CA  . GLY B 1 367 ? 3.565   7.588   18.228  1.00 33.10  ? 367 GLY B CA  1 
ATOM   7091 C  C   . GLY B 1 367 ? 4.528   6.471   17.880  1.00 21.21  ? 367 GLY B C   1 
ATOM   7092 O  O   . GLY B 1 367 ? 4.148   5.296   17.861  1.00 20.66  ? 367 GLY B O   1 
ATOM   7093 N  N   . LEU B 1 368 ? 5.791   6.811   17.631  1.00 24.04  ? 368 LEU B N   1 
ATOM   7094 C  CA  . LEU B 1 368 ? 6.782   5.783   17.331  1.00 27.46  ? 368 LEU B CA  1 
ATOM   7095 C  C   . LEU B 1 368 ? 6.922   4.778   18.478  1.00 27.51  ? 368 LEU B C   1 
ATOM   7096 O  O   . LEU B 1 368 ? 6.842   3.562   18.261  1.00 27.39  ? 368 LEU B O   1 
ATOM   7097 C  CB  . LEU B 1 368 ? 8.117   6.443   16.979  1.00 27.35  ? 368 LEU B CB  1 
ATOM   7098 C  CG  . LEU B 1 368 ? 8.123   7.065   15.577  1.00 27.26  ? 368 LEU B CG  1 
ATOM   7099 C  CD1 . LEU B 1 368 ? 9.365   7.902   15.328  1.00 21.97  ? 368 LEU B CD1 1 
ATOM   7100 C  CD2 . LEU B 1 368 ? 8.024   5.949   14.537  1.00 20.46  ? 368 LEU B CD2 1 
ATOM   7101 N  N   . ASP B 1 369 ? 7.102   5.252   19.714  1.00 26.45  ? 369 ASP B N   1 
ATOM   7102 C  CA  . ASP B 1 369 ? 7.251   4.290   20.801  1.00 26.57  ? 369 ASP B CA  1 
ATOM   7103 C  C   . ASP B 1 369 ? 5.984   3.464   20.978  1.00 29.49  ? 369 ASP B C   1 
ATOM   7104 O  O   . ASP B 1 369 ? 6.057   2.263   21.267  1.00 30.80  ? 369 ASP B O   1 
ATOM   7105 C  CB  . ASP B 1 369 ? 7.628   4.981   22.108  1.00 40.16  ? 369 ASP B CB  1 
ATOM   7106 C  CG  . ASP B 1 369 ? 8.647   6.083   21.920  1.00 57.38  ? 369 ASP B CG  1 
ATOM   7107 O  OD1 . ASP B 1 369 ? 9.837   5.870   22.239  1.00 64.55  ? 369 ASP B OD1 1 
ATOM   7108 O  OD2 . ASP B 1 369 ? 8.251   7.184   21.505  1.00 66.23  ? 369 ASP B OD2 1 
ATOM   7109 N  N   . ALA B 1 370 ? 4.816   4.089   20.805  1.00 30.83  ? 370 ALA B N   1 
ATOM   7110 C  CA  . ALA B 1 370 ? 3.554   3.355   20.856  1.00 21.29  ? 370 ALA B CA  1 
ATOM   7111 C  C   . ALA B 1 370 ? 3.555   2.186   19.883  1.00 21.71  ? 370 ALA B C   1 
ATOM   7112 O  O   . ALA B 1 370 ? 3.312   1.039   20.276  1.00 27.49  ? 370 ALA B O   1 
ATOM   7113 C  CB  . ALA B 1 370 ? 2.388   4.293   20.561  1.00 21.29  ? 370 ALA B CB  1 
ATOM   7114 N  N   . VAL B 1 371 ? 3.831   2.451   18.603  1.00 25.81  ? 371 VAL B N   1 
ATOM   7115 C  CA  . VAL B 1 371 ? 3.928   1.362   17.635  1.00 19.23  ? 371 VAL B CA  1 
ATOM   7116 C  C   . VAL B 1 371 ? 4.990   0.358   18.069  1.00 27.63  ? 371 VAL B C   1 
ATOM   7117 O  O   . VAL B 1 371 ? 4.775   -0.862  18.012  1.00 20.28  ? 371 VAL B O   1 
ATOM   7118 C  CB  . VAL B 1 371 ? 4.211   1.914   16.223  1.00 19.70  ? 371 VAL B CB  1 
ATOM   7119 C  CG1 . VAL B 1 371 ? 4.465   0.772   15.236  1.00 18.20  ? 371 VAL B CG1 1 
ATOM   7120 C  CG2 . VAL B 1 371 ? 3.050   2.778   15.742  1.00 18.71  ? 371 VAL B CG2 1 
ATOM   7121 N  N   . THR B 1 372 ? 6.143   0.851   18.531  1.00 27.09  ? 372 THR B N   1 
ATOM   7122 C  CA  . THR B 1 372 ? 7.243   -0.058  18.847  1.00 29.19  ? 372 THR B CA  1 
ATOM   7123 C  C   . THR B 1 372 ? 6.860   -1.026  19.960  1.00 26.31  ? 372 THR B C   1 
ATOM   7124 O  O   . THR B 1 372 ? 7.021   -2.245  19.820  1.00 26.60  ? 372 THR B O   1 
ATOM   7125 C  CB  . THR B 1 372 ? 8.512   0.710   19.218  1.00 29.07  ? 372 THR B CB  1 
ATOM   7126 O  OG1 . THR B 1 372 ? 8.717   1.818   18.327  1.00 20.79  ? 372 THR B OG1 1 
ATOM   7127 C  CG2 . THR B 1 372 ? 9.686   -0.215  19.096  1.00 31.82  ? 372 THR B CG2 1 
ATOM   7128 N  N   . LEU B 1 373 ? 6.316   -0.510  21.061  1.00 26.13  ? 373 LEU B N   1 
ATOM   7129 C  CA  . LEU B 1 373 ? 6.003   -1.396  22.175  1.00 33.09  ? 373 LEU B CA  1 
ATOM   7130 C  C   . LEU B 1 373 ? 4.843   -2.328  21.852  1.00 26.89  ? 373 LEU B C   1 
ATOM   7131 O  O   . LEU B 1 373 ? 4.716   -3.390  22.471  1.00 20.77  ? 373 LEU B O   1 
ATOM   7132 C  CB  . LEU B 1 373 ? 5.716   -0.589  23.444  1.00 39.91  ? 373 LEU B CB  1 
ATOM   7133 C  CG  . LEU B 1 373 ? 4.985   -1.263  24.622  1.00 39.67  ? 373 LEU B CG  1 
ATOM   7134 C  CD1 . LEU B 1 373 ? 5.900   -2.207  25.384  1.00 31.67  ? 373 LEU B CD1 1 
ATOM   7135 C  CD2 . LEU B 1 373 ? 4.412   -0.241  25.567  1.00 23.08  ? 373 LEU B CD2 1 
ATOM   7136 N  N   . GLN B 1 374 ? 4.009   -1.993  20.874  1.00 24.01  ? 374 GLN B N   1 
ATOM   7137 C  CA  . GLN B 1 374 ? 2.904   -2.913  20.647  1.00 28.83  ? 374 GLN B CA  1 
ATOM   7138 C  C   . GLN B 1 374 ? 3.281   -4.077  19.736  1.00 25.84  ? 374 GLN B C   1 
ATOM   7139 O  O   . GLN B 1 374 ? 2.548   -5.071  19.682  1.00 26.18  ? 374 GLN B O   1 
ATOM   7140 C  CB  . GLN B 1 374 ? 1.684   -2.151  20.119  1.00 31.94  ? 374 GLN B CB  1 
ATOM   7141 C  CG  . GLN B 1 374 ? 0.451   -3.015  19.954  1.00 36.50  ? 374 GLN B CG  1 
ATOM   7142 C  CD  . GLN B 1 374 ? -0.684  -2.643  20.899  1.00 52.55  ? 374 GLN B CD  1 
ATOM   7143 O  OE1 . GLN B 1 374 ? -0.561  -1.710  21.708  1.00 53.98  ? 374 GLN B OE1 1 
ATOM   7144 N  NE2 . GLN B 1 374 ? -1.790  -3.403  20.826  1.00 53.93  ? 374 GLN B NE2 1 
ATOM   7145 N  N   . TYR B 1 375 ? 4.435   -4.034  19.082  1.00 21.63  ? 375 TYR B N   1 
ATOM   7146 C  CA  . TYR B 1 375 ? 4.844   -5.169  18.265  1.00 28.12  ? 375 TYR B CA  1 
ATOM   7147 C  C   . TYR B 1 375 ? 6.180   -5.765  18.718  1.00 32.24  ? 375 TYR B C   1 
ATOM   7148 O  O   . TYR B 1 375 ? 6.912   -6.332  17.905  1.00 29.97  ? 375 TYR B O   1 
ATOM   7149 C  CB  . TYR B 1 375 ? 4.904   -4.764  16.792  1.00 30.83  ? 375 TYR B CB  1 
ATOM   7150 C  CG  . TYR B 1 375 ? 3.556   -4.568  16.118  1.00 24.86  ? 375 TYR B CG  1 
ATOM   7151 C  CD1 . TYR B 1 375 ? 2.908   -3.328  16.125  1.00 19.25  ? 375 TYR B CD1 1 
ATOM   7152 C  CD2 . TYR B 1 375 ? 2.943   -5.622  15.460  1.00 24.22  ? 375 TYR B CD2 1 
ATOM   7153 C  CE1 . TYR B 1 375 ? 1.680   -3.157  15.500  1.00 18.71  ? 375 TYR B CE1 1 
ATOM   7154 C  CE2 . TYR B 1 375 ? 1.723   -5.466  14.842  1.00 26.25  ? 375 TYR B CE2 1 
ATOM   7155 C  CZ  . TYR B 1 375 ? 1.098   -4.238  14.847  1.00 25.00  ? 375 TYR B CZ  1 
ATOM   7156 O  OH  . TYR B 1 375 ? -0.127  -4.125  14.218  1.00 16.24  ? 375 TYR B OH  1 
ATOM   7157 N  N   . THR B 1 376 ? 6.508   -5.675  20.008  1.00 28.95  ? 376 THR B N   1 
ATOM   7158 C  CA  . THR B 1 376 ? 7.811   -6.112  20.501  1.00 24.88  ? 376 THR B CA  1 
ATOM   7159 C  C   . THR B 1 376 ? 7.666   -7.088  21.654  1.00 32.20  ? 376 THR B C   1 
ATOM   7160 O  O   . THR B 1 376 ? 7.028   -6.772  22.663  1.00 47.83  ? 376 THR B O   1 
ATOM   7161 C  CB  . THR B 1 376 ? 8.656   -4.926  20.968  1.00 26.40  ? 376 THR B CB  1 
ATOM   7162 O  OG1 . THR B 1 376 ? 8.981   -4.093  19.849  1.00 34.12  ? 376 THR B OG1 1 
ATOM   7163 C  CG2 . THR B 1 376 ? 9.926   -5.408  21.639  1.00 21.48  ? 376 THR B CG2 1 
ATOM   7164 N  N   . ASP B 1 377 ? 8.291   -8.254  21.519  1.00 29.13  ? 377 ASP B N   1 
ATOM   7165 C  CA  . ASP B 1 377 ? 8.352   -9.241  22.595  1.00 36.89  ? 377 ASP B CA  1 
ATOM   7166 C  C   . ASP B 1 377 ? 9.525   -8.857  23.495  1.00 34.88  ? 377 ASP B C   1 
ATOM   7167 O  O   . ASP B 1 377 ? 10.671  -9.217  23.222  1.00 40.54  ? 377 ASP B O   1 
ATOM   7168 C  CB  . ASP B 1 377 ? 8.494   -10.648 22.013  1.00 51.54  ? 377 ASP B CB  1 
ATOM   7169 C  CG  . ASP B 1 377 ? 8.529   -11.736 23.081  1.00 68.08  ? 377 ASP B CG  1 
ATOM   7170 O  OD1 . ASP B 1 377 ? 7.783   -11.629 24.069  1.00 71.35  ? 377 ASP B OD1 1 
ATOM   7171 O  OD2 . ASP B 1 377 ? 9.295   -12.719 22.916  1.00 77.62  ? 377 ASP B OD2 1 
ATOM   7172 N  N   . TRP B 1 378 ? 9.247   -8.117  24.575  1.00 31.64  ? 378 TRP B N   1 
ATOM   7173 C  CA  . TRP B 1 378 ? 10.364  -7.623  25.390  1.00 23.62  ? 378 TRP B CA  1 
ATOM   7174 C  C   . TRP B 1 378 ? 11.011  -8.704  26.232  1.00 37.19  ? 378 TRP B C   1 
ATOM   7175 O  O   . TRP B 1 378 ? 11.892  -8.385  27.047  1.00 45.72  ? 378 TRP B O   1 
ATOM   7176 C  CB  . TRP B 1 378 ? 9.921   -6.448  26.269  1.00 28.76  ? 378 TRP B CB  1 
ATOM   7177 C  CG  . TRP B 1 378 ? 9.986   -5.127  25.545  1.00 33.66  ? 378 TRP B CG  1 
ATOM   7178 C  CD1 . TRP B 1 378 ? 8.934   -4.406  25.047  1.00 41.06  ? 378 TRP B CD1 1 
ATOM   7179 C  CD2 . TRP B 1 378 ? 11.165  -4.392  25.210  1.00 42.31  ? 378 TRP B CD2 1 
ATOM   7180 N  NE1 . TRP B 1 378 ? 9.386   -3.260  24.430  1.00 36.06  ? 378 TRP B NE1 1 
ATOM   7181 C  CE2 . TRP B 1 378 ? 10.752  -3.232  24.511  1.00 38.35  ? 378 TRP B CE2 1 
ATOM   7182 C  CE3 . TRP B 1 378 ? 12.535  -4.599  25.432  1.00 51.97  ? 378 TRP B CE3 1 
ATOM   7183 C  CZ2 . TRP B 1 378 ? 11.655  -2.284  24.039  1.00 41.34  ? 378 TRP B CZ2 1 
ATOM   7184 C  CZ3 . TRP B 1 378 ? 13.434  -3.649  24.970  1.00 49.24  ? 378 TRP B CZ3 1 
ATOM   7185 C  CH2 . TRP B 1 378 ? 12.988  -2.505  24.283  1.00 49.14  ? 378 TRP B CH2 1 
ATOM   7186 N  N   . MET B 1 379 ? 10.660  -9.978  26.099  1.00 26.59  ? 379 MET B N   1 
ATOM   7187 C  CA  . MET B 1 379 ? 11.526  -11.035 26.597  1.00 41.65  ? 379 MET B CA  1 
ATOM   7188 C  C   . MET B 1 379 ? 12.487  -11.552 25.530  1.00 51.10  ? 379 MET B C   1 
ATOM   7189 O  O   . MET B 1 379 ? 13.113  -12.597 25.733  1.00 53.67  ? 379 MET B O   1 
ATOM   7190 C  CB  . MET B 1 379 ? 10.695  -12.193 27.136  1.00 50.95  ? 379 MET B CB  1 
ATOM   7191 C  CG  . MET B 1 379 ? 10.254  -12.023 28.559  1.00 64.43  ? 379 MET B CG  1 
ATOM   7192 S  SD  . MET B 1 379 ? 9.223   -13.421 29.006  1.00 75.23  ? 379 MET B SD  1 
ATOM   7193 C  CE  . MET B 1 379 ? 8.011   -13.365 27.677  1.00 57.87  ? 379 MET B CE  1 
ATOM   7194 N  N   . ASP B 1 380 ? 12.623  -10.838 24.410  1.00 48.30  ? 380 ASP B N   1 
ATOM   7195 C  CA  . ASP B 1 380 ? 13.256  -11.378 23.215  1.00 52.59  ? 380 ASP B CA  1 
ATOM   7196 C  C   . ASP B 1 380 ? 13.376  -10.290 22.145  1.00 54.21  ? 380 ASP B C   1 
ATOM   7197 O  O   . ASP B 1 380 ? 13.013  -10.511 20.981  1.00 55.81  ? 380 ASP B O   1 
ATOM   7198 C  CB  . ASP B 1 380 ? 12.437  -12.570 22.689  1.00 54.64  ? 380 ASP B CB  1 
ATOM   7199 C  CG  . ASP B 1 380 ? 13.302  -13.737 22.198  1.00 58.74  ? 380 ASP B CG  1 
ATOM   7200 O  OD1 . ASP B 1 380 ? 14.506  -13.543 21.910  1.00 62.63  ? 380 ASP B OD1 1 
ATOM   7201 O  OD2 . ASP B 1 380 ? 12.759  -14.858 22.080  1.00 58.08  ? 380 ASP B OD2 1 
ATOM   7202 N  N   . ASP B 1 381 ? 13.881  -9.109  22.513  1.00 47.70  ? 381 ASP B N   1 
ATOM   7203 C  CA  . ASP B 1 381 ? 13.868  -7.992  21.571  1.00 51.19  ? 381 ASP B CA  1 
ATOM   7204 C  C   . ASP B 1 381 ? 14.901  -8.118  20.451  1.00 60.87  ? 381 ASP B C   1 
ATOM   7205 O  O   . ASP B 1 381 ? 14.713  -7.502  19.395  1.00 70.11  ? 381 ASP B O   1 
ATOM   7206 C  CB  . ASP B 1 381 ? 14.058  -6.671  22.318  1.00 42.80  ? 381 ASP B CB  1 
ATOM   7207 C  CG  . ASP B 1 381 ? 15.144  -6.746  23.349  1.00 52.14  ? 381 ASP B CG  1 
ATOM   7208 O  OD1 . ASP B 1 381 ? 14.909  -7.393  24.391  1.00 55.42  ? 381 ASP B OD1 1 
ATOM   7209 O  OD2 . ASP B 1 381 ? 16.227  -6.161  23.123  1.00 58.78  ? 381 ASP B OD2 1 
ATOM   7210 N  N   . ASN B 1 382 ? 15.978  -8.891  20.642  1.00 56.76  ? 382 ASN B N   1 
ATOM   7211 C  CA  . ASN B 1 382 ? 16.954  -9.154  19.587  1.00 48.10  ? 382 ASN B CA  1 
ATOM   7212 C  C   . ASN B 1 382 ? 16.719  -10.496 18.908  1.00 52.50  ? 382 ASN B C   1 
ATOM   7213 O  O   . ASN B 1 382 ? 17.672  -11.135 18.449  1.00 54.61  ? 382 ASN B O   1 
ATOM   7214 C  CB  . ASN B 1 382 ? 18.380  -9.097  20.130  1.00 44.71  ? 382 ASN B CB  1 
ATOM   7215 C  CG  . ASN B 1 382 ? 18.594  -7.937  21.075  1.00 51.12  ? 382 ASN B CG  1 
ATOM   7216 O  OD1 . ASN B 1 382 ? 18.851  -6.811  20.645  1.00 54.18  ? 382 ASN B OD1 1 
ATOM   7217 N  ND2 . ASN B 1 382 ? 18.481  -8.202  22.376  1.00 52.85  ? 382 ASN B ND2 1 
ATOM   7218 N  N   . ASN B 1 383 ? 15.469  -10.951 18.863  1.00 56.54  ? 383 ASN B N   1 
ATOM   7219 C  CA  . ASN B 1 383 ? 15.113  -12.178 18.158  1.00 48.47  ? 383 ASN B CA  1 
ATOM   7220 C  C   . ASN B 1 383 ? 14.806  -11.783 16.724  1.00 43.05  ? 383 ASN B C   1 
ATOM   7221 O  O   . ASN B 1 383 ? 13.655  -11.531 16.360  1.00 41.29  ? 383 ASN B O   1 
ATOM   7222 C  CB  . ASN B 1 383 ? 13.929  -12.874 18.819  1.00 45.68  ? 383 ASN B CB  1 
ATOM   7223 C  CG  . ASN B 1 383 ? 13.637  -14.238 18.210  1.00 44.91  ? 383 ASN B CG  1 
ATOM   7224 O  OD1 . ASN B 1 383 ? 13.847  -14.459 17.013  1.00 52.64  ? 383 ASN B OD1 1 
ATOM   7225 N  ND2 . ASN B 1 383 ? 13.162  -15.166 19.038  1.00 34.68  ? 383 ASN B ND2 1 
ATOM   7226 N  N   . GLY B 1 384 ? 15.859  -11.729 15.911  1.00 38.62  ? 384 GLY B N   1 
ATOM   7227 C  CA  . GLY B 1 384 ? 15.782  -11.469 14.486  1.00 33.48  ? 384 GLY B CA  1 
ATOM   7228 C  C   . GLY B 1 384 ? 14.504  -11.902 13.794  1.00 31.44  ? 384 GLY B C   1 
ATOM   7229 O  O   . GLY B 1 384 ? 13.915  -11.118 13.045  1.00 36.47  ? 384 GLY B O   1 
ATOM   7230 N  N   . ILE B 1 385 ? 14.047  -13.130 14.049  1.00 23.54  ? 385 ILE B N   1 
ATOM   7231 C  CA  . ILE B 1 385 ? 12.795  -13.577 13.446  1.00 31.34  ? 385 ILE B CA  1 
ATOM   7232 C  C   . ILE B 1 385 ? 11.649  -12.683 13.885  1.00 27.91  ? 385 ILE B C   1 
ATOM   7233 O  O   . ILE B 1 385 ? 11.010  -12.013 13.067  1.00 32.46  ? 385 ILE B O   1 
ATOM   7234 C  CB  . ILE B 1 385 ? 12.496  -15.040 13.797  1.00 30.00  ? 385 ILE B CB  1 
ATOM   7235 C  CG1 . ILE B 1 385 ? 13.618  -15.948 13.308  1.00 37.97  ? 385 ILE B CG1 1 
ATOM   7236 C  CG2 . ILE B 1 385 ? 11.208  -15.430 13.122  1.00 19.26  ? 385 ILE B CG2 1 
ATOM   7237 C  CD1 . ILE B 1 385 ? 13.773  -15.963 11.813  1.00 40.73  ? 385 ILE B CD1 1 
ATOM   7238 N  N   . LYS B 1 386 ? 11.370  -12.677 15.189  1.00 23.59  ? 386 LYS B N   1 
ATOM   7239 C  CA  . LYS B 1 386 ? 10.223  -11.938 15.698  1.00 19.15  ? 386 LYS B CA  1 
ATOM   7240 C  C   . LYS B 1 386 ? 10.298  -10.468 15.324  1.00 30.20  ? 386 LYS B C   1 
ATOM   7241 O  O   . LYS B 1 386 ? 9.257   -9.835  15.108  1.00 38.52  ? 386 LYS B O   1 
ATOM   7242 C  CB  . LYS B 1 386 ? 10.113  -12.090 17.215  1.00 19.71  ? 386 LYS B CB  1 
ATOM   7243 C  CG  . LYS B 1 386 ? 10.171  -13.511 17.742  1.00 20.16  ? 386 LYS B CG  1 
ATOM   7244 C  CD  . LYS B 1 386 ? 10.105  -13.526 19.270  1.00 33.10  ? 386 LYS B CD  1 
ATOM   7245 C  CE  . LYS B 1 386 ? 10.135  -14.946 19.842  1.00 42.43  ? 386 LYS B CE  1 
ATOM   7246 N  NZ  . LYS B 1 386 ? 9.495   -15.071 21.185  1.00 42.63  ? 386 LYS B NZ  1 
ATOM   7247 N  N   . ASN B 1 387 ? 11.504  -9.902  15.226  1.00 19.25  ? 387 ASN B N   1 
ATOM   7248 C  CA  . ASN B 1 387 ? 11.573  -8.515  14.790  1.00 29.07  ? 387 ASN B CA  1 
ATOM   7249 C  C   . ASN B 1 387 ? 11.137  -8.390  13.339  1.00 37.36  ? 387 ASN B C   1 
ATOM   7250 O  O   . ASN B 1 387 ? 10.385  -7.471  12.982  1.00 34.86  ? 387 ASN B O   1 
ATOM   7251 C  CB  . ASN B 1 387 ? 12.972  -7.939  14.989  1.00 35.53  ? 387 ASN B CB  1 
ATOM   7252 C  CG  . ASN B 1 387 ? 13.414  -7.964  16.443  1.00 54.84  ? 387 ASN B CG  1 
ATOM   7253 O  OD1 . ASN B 1 387 ? 13.890  -8.981  16.941  1.00 63.13  ? 387 ASN B OD1 1 
ATOM   7254 N  ND2 . ASN B 1 387 ? 13.213  -6.849  17.145  1.00 59.16  ? 387 ASN B ND2 1 
ATOM   7255 N  N   . ARG B 1 388 ? 11.557  -9.332  12.494  1.00 33.63  ? 388 ARG B N   1 
ATOM   7256 C  CA  . ARG B 1 388 ? 11.165  -9.249  11.094  1.00 30.23  ? 388 ARG B CA  1 
ATOM   7257 C  C   . ARG B 1 388 ? 9.703   -9.628  10.932  1.00 26.02  ? 388 ARG B C   1 
ATOM   7258 O  O   . ARG B 1 388 ? 8.929   -8.903  10.294  1.00 31.43  ? 388 ARG B O   1 
ATOM   7259 C  CB  . ARG B 1 388 ? 12.061  -10.132 10.230  1.00 29.43  ? 388 ARG B CB  1 
ATOM   7260 C  CG  . ARG B 1 388 ? 11.481  -10.545 8.884   1.00 28.22  ? 388 ARG B CG  1 
ATOM   7261 C  CD  . ARG B 1 388 ? 11.997  -11.906 8.491   1.00 25.15  ? 388 ARG B CD  1 
ATOM   7262 N  NE  . ARG B 1 388 ? 11.136  -12.955 8.989   1.00 22.77  ? 388 ARG B NE  1 
ATOM   7263 C  CZ  . ARG B 1 388 ? 11.389  -14.252 8.889   1.00 27.51  ? 388 ARG B CZ  1 
ATOM   7264 N  NH1 . ARG B 1 388 ? 10.513  -15.121 9.361   1.00 40.23  ? 388 ARG B NH1 1 
ATOM   7265 N  NH2 . ARG B 1 388 ? 12.545  -14.663 8.423   1.00 25.11  ? 388 ARG B NH2 1 
ATOM   7266 N  N   . ASP B 1 389 ? 9.305   -10.763 11.509  1.00 19.73  ? 389 ASP B N   1 
ATOM   7267 C  CA  . ASP B 1 389 ? 7.884   -11.073 11.623  1.00 23.37  ? 389 ASP B CA  1 
ATOM   7268 C  C   . ASP B 1 389 ? 7.115   -9.878  12.167  1.00 32.78  ? 389 ASP B C   1 
ATOM   7269 O  O   . ASP B 1 389 ? 6.069   -9.499  11.624  1.00 29.65  ? 389 ASP B O   1 
ATOM   7270 C  CB  . ASP B 1 389 ? 7.671   -12.285 12.529  1.00 24.87  ? 389 ASP B CB  1 
ATOM   7271 C  CG  . ASP B 1 389 ? 7.846   -13.605 11.795  1.00 45.00  ? 389 ASP B CG  1 
ATOM   7272 O  OD1 . ASP B 1 389 ? 7.910   -13.595 10.538  1.00 52.61  ? 389 ASP B OD1 1 
ATOM   7273 O  OD2 . ASP B 1 389 ? 7.911   -14.655 12.482  1.00 45.27  ? 389 ASP B OD2 1 
ATOM   7274 N  N   . GLY B 1 390 ? 7.633   -9.268  13.242  1.00 31.22  ? 390 GLY B N   1 
ATOM   7275 C  CA  . GLY B 1 390 ? 6.971   -8.108  13.821  1.00 25.14  ? 390 GLY B CA  1 
ATOM   7276 C  C   . GLY B 1 390 ? 6.763   -6.991  12.820  1.00 22.61  ? 390 GLY B C   1 
ATOM   7277 O  O   . GLY B 1 390 ? 5.642   -6.524  12.617  1.00 21.74  ? 390 GLY B O   1 
ATOM   7278 N  N   . LEU B 1 391 ? 7.846   -6.566  12.163  1.00 25.82  ? 391 LEU B N   1 
ATOM   7279 C  CA  . LEU B 1 391 ? 7.775   -5.469  11.201  1.00 29.02  ? 391 LEU B CA  1 
ATOM   7280 C  C   . LEU B 1 391 ? 6.823   -5.785  10.050  1.00 34.06  ? 391 LEU B C   1 
ATOM   7281 O  O   . LEU B 1 391 ? 6.116   -4.899  9.545   1.00 24.79  ? 391 LEU B O   1 
ATOM   7282 C  CB  . LEU B 1 391 ? 9.177   -5.189  10.680  1.00 34.30  ? 391 LEU B CB  1 
ATOM   7283 C  CG  . LEU B 1 391 ? 9.510   -3.772  10.256  1.00 46.26  ? 391 LEU B CG  1 
ATOM   7284 C  CD1 . LEU B 1 391 ? 9.051   -2.788  11.314  1.00 45.83  ? 391 LEU B CD1 1 
ATOM   7285 C  CD2 . LEU B 1 391 ? 11.012  -3.684  10.037  1.00 53.95  ? 391 LEU B CD2 1 
ATOM   7286 N  N   . ASP B 1 392 ? 6.807   -7.043  9.609   1.00 35.23  ? 392 ASP B N   1 
ATOM   7287 C  CA  . ASP B 1 392 ? 5.817   -7.494  8.639   1.00 23.99  ? 392 ASP B CA  1 
ATOM   7288 C  C   . ASP B 1 392 ? 4.405   -7.130  9.085   1.00 24.87  ? 392 ASP B C   1 
ATOM   7289 O  O   . ASP B 1 392 ? 3.655   -6.473  8.355   1.00 35.83  ? 392 ASP B O   1 
ATOM   7290 C  CB  . ASP B 1 392 ? 5.951   -9.002  8.463   1.00 36.42  ? 392 ASP B CB  1 
ATOM   7291 C  CG  . ASP B 1 392 ? 5.651   -9.449  7.067   1.00 51.81  ? 392 ASP B CG  1 
ATOM   7292 O  OD1 . ASP B 1 392 ? 6.565   -9.325  6.236   1.00 57.89  ? 392 ASP B OD1 1 
ATOM   7293 O  OD2 . ASP B 1 392 ? 4.522   -9.922  6.797   1.00 60.20  ? 392 ASP B OD2 1 
ATOM   7294 N  N   . ASP B 1 393 ? 4.029   -7.547  10.294  1.00 20.67  ? 393 ASP B N   1 
ATOM   7295 C  CA  . ASP B 1 393 ? 2.687   -7.266  10.793  1.00 25.31  ? 393 ASP B CA  1 
ATOM   7296 C  C   . ASP B 1 393 ? 2.400   -5.768  10.821  1.00 22.87  ? 393 ASP B C   1 
ATOM   7297 O  O   . ASP B 1 393 ? 1.315   -5.336  10.424  1.00 33.41  ? 393 ASP B O   1 
ATOM   7298 C  CB  . ASP B 1 393 ? 2.501   -7.885  12.182  1.00 37.05  ? 393 ASP B CB  1 
ATOM   7299 C  CG  . ASP B 1 393 ? 2.455   -9.419  12.145  1.00 52.77  ? 393 ASP B CG  1 
ATOM   7300 O  OD1 . ASP B 1 393 ? 2.050   -9.996  11.103  1.00 55.68  ? 393 ASP B OD1 1 
ATOM   7301 O  OD2 . ASP B 1 393 ? 2.829   -10.050 13.160  1.00 58.04  ? 393 ASP B OD2 1 
ATOM   7302 N  N   . ILE B 1 394 ? 3.369   -4.962  11.262  1.00 20.89  ? 394 ILE B N   1 
ATOM   7303 C  CA  . ILE B 1 394 ? 3.196   -3.506  11.351  1.00 23.61  ? 394 ILE B CA  1 
ATOM   7304 C  C   . ILE B 1 394 ? 2.710   -2.916  10.030  1.00 29.98  ? 394 ILE B C   1 
ATOM   7305 O  O   . ILE B 1 394 ? 1.685   -2.221  9.986   1.00 36.00  ? 394 ILE B O   1 
ATOM   7306 C  CB  . ILE B 1 394 ? 4.499   -2.833  11.807  1.00 25.44  ? 394 ILE B CB  1 
ATOM   7307 C  CG1 . ILE B 1 394 ? 4.974   -3.421  13.145  1.00 26.00  ? 394 ILE B CG1 1 
ATOM   7308 C  CG2 . ILE B 1 394 ? 4.360   -1.330  11.754  1.00 16.55  ? 394 ILE B CG2 1 
ATOM   7309 C  CD1 . ILE B 1 394 ? 5.990   -2.572  13.865  1.00 28.54  ? 394 ILE B CD1 1 
ATOM   7310 N  N   . VAL B 1 395 ? 3.433   -3.174  8.930   1.00 15.32  ? 395 VAL B N   1 
ATOM   7311 C  CA  . VAL B 1 395 ? 3.026   -2.531  7.679   1.00 25.48  ? 395 VAL B CA  1 
ATOM   7312 C  C   . VAL B 1 395 ? 1.838   -3.263  7.067   1.00 29.97  ? 395 VAL B C   1 
ATOM   7313 O  O   . VAL B 1 395 ? 0.982   -2.649  6.421   1.00 40.58  ? 395 VAL B O   1 
ATOM   7314 C  CB  . VAL B 1 395 ? 4.196   -2.420  6.688   1.00 32.93  ? 395 VAL B CB  1 
ATOM   7315 C  CG1 . VAL B 1 395 ? 5.453   -1.925  7.392   1.00 38.84  ? 395 VAL B CG1 1 
ATOM   7316 C  CG2 . VAL B 1 395 ? 4.459   -3.700  6.041   1.00 42.17  ? 395 VAL B CG2 1 
ATOM   7317 N  N   . GLY B 1 396 ? 1.740   -4.577  7.287   1.00 23.71  ? 396 GLY B N   1 
ATOM   7318 C  CA  . GLY B 1 396 ? 0.535   -5.291  6.892   1.00 14.22  ? 396 GLY B CA  1 
ATOM   7319 C  C   . GLY B 1 396 ? -0.697  -4.764  7.604   1.00 32.47  ? 396 GLY B C   1 
ATOM   7320 O  O   . GLY B 1 396 ? -1.701  -4.429  6.970   1.00 28.85  ? 396 GLY B O   1 
ATOM   7321 N  N   . ASP B 1 397 ? -0.635  -4.678  8.940   1.00 29.98  ? 397 ASP B N   1 
ATOM   7322 C  CA  . ASP B 1 397 ? -1.785  -4.197  9.706   1.00 14.71  ? 397 ASP B CA  1 
ATOM   7323 C  C   . ASP B 1 397 ? -2.063  -2.728  9.432   1.00 18.51  ? 397 ASP B C   1 
ATOM   7324 O  O   . ASP B 1 397 ? -3.224  -2.322  9.287   1.00 15.11  ? 397 ASP B O   1 
ATOM   7325 C  CB  . ASP B 1 397 ? -1.570  -4.394  11.198  1.00 22.78  ? 397 ASP B CB  1 
ATOM   7326 C  CG  . ASP B 1 397 ? -1.480  -5.853  11.591  1.00 36.51  ? 397 ASP B CG  1 
ATOM   7327 O  OD1 . ASP B 1 397 ? -1.651  -6.720  10.699  1.00 41.92  ? 397 ASP B OD1 1 
ATOM   7328 O  OD2 . ASP B 1 397 ? -1.218  -6.113  12.799  1.00 28.24  ? 397 ASP B OD2 1 
ATOM   7329 N  N   . HIS B 1 398 ? -1.017  -1.909  9.351   1.00 19.64  ? 398 HIS B N   1 
ATOM   7330 C  CA  . HIS B 1 398 ? -1.259  -0.472  9.290   1.00 23.87  ? 398 HIS B CA  1 
ATOM   7331 C  C   . HIS B 1 398 ? -1.793  -0.041  7.919   1.00 29.49  ? 398 HIS B C   1 
ATOM   7332 O  O   . HIS B 1 398 ? -2.606  0.885   7.834   1.00 37.67  ? 398 HIS B O   1 
ATOM   7333 C  CB  . HIS B 1 398 ? 0.020   0.274   9.655   1.00 15.63  ? 398 HIS B CB  1 
ATOM   7334 C  CG  . HIS B 1 398 ? -0.008  1.731   9.322   1.00 23.33  ? 398 HIS B CG  1 
ATOM   7335 N  ND1 . HIS B 1 398 ? 0.752   2.285   8.309   1.00 17.02  ? 398 HIS B ND1 1 
ATOM   7336 C  CD2 . HIS B 1 398 ? -0.730  2.746   9.853   1.00 16.29  ? 398 HIS B CD2 1 
ATOM   7337 C  CE1 . HIS B 1 398 ? 0.522   3.584   8.251   1.00 16.46  ? 398 HIS B CE1 1 
ATOM   7338 N  NE2 . HIS B 1 398 ? -0.376  3.888   9.172   1.00 16.53  ? 398 HIS B NE2 1 
ATOM   7339 N  N   . ASN B 1 399 ? -1.365  -0.699  6.836   1.00 28.52  ? 399 ASN B N   1 
ATOM   7340 C  CA  . ASN B 1 399 ? -1.675  -0.227  5.488   1.00 27.52  ? 399 ASN B CA  1 
ATOM   7341 C  C   . ASN B 1 399 ? -2.791  -0.996  4.798   1.00 25.25  ? 399 ASN B C   1 
ATOM   7342 O  O   . ASN B 1 399 ? -3.365  -0.492  3.820   1.00 18.57  ? 399 ASN B O   1 
ATOM   7343 C  CB  . ASN B 1 399 ? -0.419  -0.255  4.600   1.00 14.47  ? 399 ASN B CB  1 
ATOM   7344 C  CG  . ASN B 1 399 ? 0.732   0.519   5.211   1.00 29.20  ? 399 ASN B CG  1 
ATOM   7345 O  OD1 . ASN B 1 399 ? 1.537   -0.010  5.990   1.00 26.77  ? 399 ASN B OD1 1 
ATOM   7346 N  ND2 . ASN B 1 399 ? 0.754   1.819   4.933   1.00 23.71  ? 399 ASN B ND2 1 
ATOM   7347 N  N   . VAL B 1 400 ? -3.121  -2.190  5.269   1.00 22.93  ? 400 VAL B N   1 
ATOM   7348 C  CA  . VAL B 1 400 ? -4.150  -2.973  4.596   1.00 25.03  ? 400 VAL B CA  1 
ATOM   7349 C  C   . VAL B 1 400 ? -5.166  -3.502  5.612   1.00 29.04  ? 400 VAL B C   1 
ATOM   7350 O  O   . VAL B 1 400 ? -6.286  -2.979  5.717   1.00 13.93  ? 400 VAL B O   1 
ATOM   7351 C  CB  . VAL B 1 400 ? -3.490  -4.106  3.782   1.00 20.40  ? 400 VAL B CB  1 
ATOM   7352 C  CG1 . VAL B 1 400 ? -4.522  -5.030  3.166   1.00 22.18  ? 400 VAL B CG1 1 
ATOM   7353 C  CG2 . VAL B 1 400 ? -2.652  -3.508  2.699   1.00 13.50  ? 400 VAL B CG2 1 
ATOM   7354 N  N   . ILE B 1 401 ? -4.767  -4.527  6.372   1.00 20.25  ? 401 ILE B N   1 
ATOM   7355 C  CA  . ILE B 1 401 ? -5.620  -5.249  7.309   1.00 23.23  ? 401 ILE B CA  1 
ATOM   7356 C  C   . ILE B 1 401 ? -6.575  -4.339  8.065   1.00 28.86  ? 401 ILE B C   1 
ATOM   7357 O  O   . ILE B 1 401 ? -7.804  -4.479  7.981   1.00 39.40  ? 401 ILE B O   1 
ATOM   7358 C  CB  . ILE B 1 401 ? -4.761  -6.009  8.328   1.00 31.81  ? 401 ILE B CB  1 
ATOM   7359 C  CG1 . ILE B 1 401 ? -3.873  -7.047  7.663   1.00 30.91  ? 401 ILE B CG1 1 
ATOM   7360 C  CG2 . ILE B 1 401 ? -5.643  -6.651  9.377   1.00 40.64  ? 401 ILE B CG2 1 
ATOM   7361 C  CD1 . ILE B 1 401 ? -4.518  -8.382  7.573   1.00 29.99  ? 401 ILE B CD1 1 
ATOM   7362 N  N   . CYS B 1 402 ? -6.004  -3.436  8.842   1.00 14.50  ? 402 CYS B N   1 
ATOM   7363 C  CA  . CYS B 1 402 ? -6.804  -2.700  9.805   1.00 28.87  ? 402 CYS B CA  1 
ATOM   7364 C  C   . CYS B 1 402 ? -7.636  -1.632  9.102   1.00 35.71  ? 402 CYS B C   1 
ATOM   7365 O  O   . CYS B 1 402 ? -8.827  -1.511  9.409   1.00 37.43  ? 402 CYS B O   1 
ATOM   7366 C  CB  . CYS B 1 402 ? -5.944  -2.114  10.934  1.00 23.22  ? 402 CYS B CB  1 
ATOM   7367 S  SG  . CYS B 1 402 ? -5.369  -3.414  12.100  1.00 25.52  ? 402 CYS B SG  1 
ATOM   7368 N  N   . PRO B 1 403 ? -7.089  -0.861  8.163   1.00 33.59  ? 403 PRO B N   1 
ATOM   7369 C  CA  . PRO B 1 403 ? -7.966  0.010   7.358   1.00 33.69  ? 403 PRO B CA  1 
ATOM   7370 C  C   . PRO B 1 403 ? -9.174  -0.718  6.775   1.00 24.80  ? 403 PRO B C   1 
ATOM   7371 O  O   . PRO B 1 403 ? -10.292 -0.196  6.808   1.00 14.99  ? 403 PRO B O   1 
ATOM   7372 C  CB  . PRO B 1 403 ? -7.014  0.498   6.279   1.00 30.77  ? 403 PRO B CB  1 
ATOM   7373 C  CG  . PRO B 1 403 ? -5.663  0.448   6.908   1.00 28.65  ? 403 PRO B CG  1 
ATOM   7374 C  CD  . PRO B 1 403 ? -5.656  -0.702  7.829   1.00 24.09  ? 403 PRO B CD  1 
ATOM   7375 N  N   . LEU B 1 404 ? -8.956  -1.898  6.195   1.00 24.74  ? 404 LEU B N   1 
ATOM   7376 C  CA  . LEU B 1 404 ? -10.053 -2.653  5.610   1.00 26.82  ? 404 LEU B CA  1 
ATOM   7377 C  C   . LEU B 1 404 ? -11.089 -3.034  6.666   1.00 32.81  ? 404 LEU B C   1 
ATOM   7378 O  O   . LEU B 1 404 ? -12.293 -2.831  6.458   1.00 35.88  ? 404 LEU B O   1 
ATOM   7379 C  CB  . LEU B 1 404 ? -9.494  -3.878  4.889   1.00 28.49  ? 404 LEU B CB  1 
ATOM   7380 C  CG  . LEU B 1 404 ? -10.510 -4.740  4.144   1.00 29.36  ? 404 LEU B CG  1 
ATOM   7381 C  CD1 . LEU B 1 404 ? -9.993  -5.132  2.762   1.00 27.49  ? 404 LEU B CD1 1 
ATOM   7382 C  CD2 . LEU B 1 404 ? -10.844 -5.978  4.965   1.00 26.99  ? 404 LEU B CD2 1 
ATOM   7383 N  N   . MET B 1 405 ? -10.643 -3.558  7.818   1.00 32.09  ? 405 MET B N   1 
ATOM   7384 C  CA  . MET B 1 405 ? -11.596 -3.892  8.880   1.00 35.48  ? 405 MET B CA  1 
ATOM   7385 C  C   . MET B 1 405 ? -12.377 -2.673  9.345   1.00 30.92  ? 405 MET B C   1 
ATOM   7386 O  O   . MET B 1 405 ? -13.571 -2.768  9.643   1.00 37.48  ? 405 MET B O   1 
ATOM   7387 C  CB  . MET B 1 405 ? -10.934 -4.530  10.095  1.00 27.30  ? 405 MET B CB  1 
ATOM   7388 C  CG  . MET B 1 405 ? -10.050 -5.686  9.819   1.00 29.30  ? 405 MET B CG  1 
ATOM   7389 S  SD  . MET B 1 405 ? -11.094 -7.049  9.237   1.00 26.88  ? 405 MET B SD  1 
ATOM   7390 C  CE  . MET B 1 405 ? -12.436 -7.098  10.391  1.00 33.44  ? 405 MET B CE  1 
ATOM   7391 N  N   . HIS B 1 406 ? -11.714 -1.531  9.475   1.00 16.86  ? 406 HIS B N   1 
ATOM   7392 C  CA  . HIS B 1 406 ? -12.448 -0.305  9.746   1.00 20.96  ? 406 HIS B CA  1 
ATOM   7393 C  C   . HIS B 1 406 ? -13.555 -0.104  8.725   1.00 34.86  ? 406 HIS B C   1 
ATOM   7394 O  O   . HIS B 1 406 ? -14.685 0.269   9.068   1.00 40.90  ? 406 HIS B O   1 
ATOM   7395 C  CB  . HIS B 1 406 ? -11.492 0.871   9.721   1.00 22.79  ? 406 HIS B CB  1 
ATOM   7396 C  CG  . HIS B 1 406 ? -12.120 2.137   10.175  1.00 40.30  ? 406 HIS B CG  1 
ATOM   7397 N  ND1 . HIS B 1 406 ? -12.842 2.228   11.347  1.00 54.40  ? 406 HIS B ND1 1 
ATOM   7398 C  CD2 . HIS B 1 406 ? -12.171 3.359   9.605   1.00 51.40  ? 406 HIS B CD2 1 
ATOM   7399 C  CE1 . HIS B 1 406 ? -13.287 3.461   11.501  1.00 59.22  ? 406 HIS B CE1 1 
ATOM   7400 N  NE2 . HIS B 1 406 ? -12.894 4.167   10.455  1.00 58.77  ? 406 HIS B NE2 1 
ATOM   7401 N  N   . PHE B 1 407 ? -13.235 -0.335  7.450   1.00 37.07  ? 407 PHE B N   1 
ATOM   7402 C  CA  . PHE B 1 407 ? -14.230 -0.162  6.402   1.00 36.44  ? 407 PHE B CA  1 
ATOM   7403 C  C   . PHE B 1 407 ? -15.303 -1.236  6.496   1.00 29.77  ? 407 PHE B C   1 
ATOM   7404 O  O   . PHE B 1 407 ? -16.496 -0.949  6.357   1.00 26.91  ? 407 PHE B O   1 
ATOM   7405 C  CB  . PHE B 1 407 ? -13.538 -0.162  5.034   1.00 30.89  ? 407 PHE B CB  1 
ATOM   7406 C  CG  . PHE B 1 407 ? -14.480 -0.112  3.870   1.00 22.40  ? 407 PHE B CG  1 
ATOM   7407 C  CD1 . PHE B 1 407 ? -14.859 -1.276  3.211   1.00 18.75  ? 407 PHE B CD1 1 
ATOM   7408 C  CD2 . PHE B 1 407 ? -15.008 1.105   3.447   1.00 20.97  ? 407 PHE B CD2 1 
ATOM   7409 C  CE1 . PHE B 1 407 ? -15.741 -1.224  2.135   1.00 20.01  ? 407 PHE B CE1 1 
ATOM   7410 C  CE2 . PHE B 1 407 ? -15.898 1.169   2.373   1.00 15.77  ? 407 PHE B CE2 1 
ATOM   7411 C  CZ  . PHE B 1 407 ? -16.264 0.005   1.722   1.00 15.43  ? 407 PHE B CZ  1 
ATOM   7412 N  N   . VAL B 1 408 ? -14.905 -2.471  6.785   1.00 28.13  ? 408 VAL B N   1 
ATOM   7413 C  CA  . VAL B 1 408 ? -15.884 -3.544  6.777   1.00 29.55  ? 408 VAL B CA  1 
ATOM   7414 C  C   . VAL B 1 408 ? -16.860 -3.391  7.938   1.00 35.75  ? 408 VAL B C   1 
ATOM   7415 O  O   . VAL B 1 408 ? -18.030 -3.772  7.824   1.00 40.27  ? 408 VAL B O   1 
ATOM   7416 C  CB  . VAL B 1 408 ? -15.173 -4.911  6.788   1.00 25.79  ? 408 VAL B CB  1 
ATOM   7417 C  CG1 . VAL B 1 408 ? -14.784 -5.299  8.182   1.00 21.38  ? 408 VAL B CG1 1 
ATOM   7418 C  CG2 . VAL B 1 408 ? -16.066 -5.948  6.231   1.00 28.07  ? 408 VAL B CG2 1 
ATOM   7419 N  N   . ASN B 1 409 ? -16.420 -2.812  9.057   1.00 35.82  ? 409 ASN B N   1 
ATOM   7420 C  CA  . ASN B 1 409 ? -17.357 -2.556  10.146  1.00 27.16  ? 409 ASN B CA  1 
ATOM   7421 C  C   . ASN B 1 409 ? -18.207 -1.326  9.850   1.00 29.47  ? 409 ASN B C   1 
ATOM   7422 O  O   . ASN B 1 409 ? -19.424 -1.352  10.053  1.00 32.72  ? 409 ASN B O   1 
ATOM   7423 C  CB  . ASN B 1 409 ? -16.613 -2.400  11.478  1.00 18.06  ? 409 ASN B CB  1 
ATOM   7424 C  CG  . ASN B 1 409 ? -16.244 -3.746  12.117  1.00 27.38  ? 409 ASN B CG  1 
ATOM   7425 O  OD1 . ASN B 1 409 ? -15.126 -4.255  11.949  1.00 28.98  ? 409 ASN B OD1 1 
ATOM   7426 N  ND2 . ASN B 1 409 ? -17.177 -4.312  12.880  1.00 33.10  ? 409 ASN B ND2 1 
ATOM   7427 N  N   . LYS B 1 410 ? -17.590 -0.250  9.345   1.00 32.55  ? 410 LYS B N   1 
ATOM   7428 C  CA  . LYS B 1 410 ? -18.352 0.950   9.008   1.00 30.08  ? 410 LYS B CA  1 
ATOM   7429 C  C   . LYS B 1 410 ? -19.405 0.656   7.951   1.00 20.39  ? 410 LYS B C   1 
ATOM   7430 O  O   . LYS B 1 410 ? -20.528 1.165   8.018   1.00 18.65  ? 410 LYS B O   1 
ATOM   7431 C  CB  . LYS B 1 410 ? -17.412 2.043   8.515   1.00 29.55  ? 410 LYS B CB  1 
ATOM   7432 C  CG  . LYS B 1 410 ? -16.609 2.686   9.607   1.00 37.96  ? 410 LYS B CG  1 
ATOM   7433 C  CD  . LYS B 1 410 ? -17.492 3.509   10.524  1.00 48.84  ? 410 LYS B CD  1 
ATOM   7434 C  CE  . LYS B 1 410 ? -16.675 4.035   11.709  1.00 60.12  ? 410 LYS B CE  1 
ATOM   7435 N  NZ  . LYS B 1 410 ? -17.399 5.005   12.582  1.00 62.93  ? 410 LYS B NZ  1 
ATOM   7436 N  N   . TYR B 1 411 ? -19.054 -0.171  6.972   1.00 19.94  ? 411 TYR B N   1 
ATOM   7437 C  CA  . TYR B 1 411 ? -19.952 -0.445  5.862   1.00 22.19  ? 411 TYR B CA  1 
ATOM   7438 C  C   . TYR B 1 411 ? -21.102 -1.339  6.305   1.00 29.27  ? 411 TYR B C   1 
ATOM   7439 O  O   . TYR B 1 411 ? -22.263 -1.099  5.942   1.00 22.71  ? 411 TYR B O   1 
ATOM   7440 C  CB  . TYR B 1 411 ? -19.170 -1.090  4.710   1.00 16.44  ? 411 TYR B CB  1 
ATOM   7441 C  CG  . TYR B 1 411 ? -20.026 -1.288  3.493   1.00 26.74  ? 411 TYR B CG  1 
ATOM   7442 C  CD1 . TYR B 1 411 ? -20.144 -0.287  2.545   1.00 27.66  ? 411 TYR B CD1 1 
ATOM   7443 C  CD2 . TYR B 1 411 ? -20.764 -2.458  3.315   1.00 27.66  ? 411 TYR B CD2 1 
ATOM   7444 C  CE1 . TYR B 1 411 ? -20.958 -0.444  1.446   1.00 32.56  ? 411 TYR B CE1 1 
ATOM   7445 C  CE2 . TYR B 1 411 ? -21.575 -2.631  2.216   1.00 26.93  ? 411 TYR B CE2 1 
ATOM   7446 C  CZ  . TYR B 1 411 ? -21.670 -1.617  1.283   1.00 42.62  ? 411 TYR B CZ  1 
ATOM   7447 O  OH  . TYR B 1 411 ? -22.478 -1.768  0.173   1.00 56.40  ? 411 TYR B OH  1 
ATOM   7448 N  N   . THR B 1 412 ? -20.787 -2.373  7.096   1.00 24.65  ? 412 THR B N   1 
ATOM   7449 C  CA  . THR B 1 412 ? -21.769 -3.365  7.515   1.00 23.67  ? 412 THR B CA  1 
ATOM   7450 C  C   . THR B 1 412 ? -22.933 -2.754  8.284   1.00 25.39  ? 412 THR B C   1 
ATOM   7451 O  O   . THR B 1 412 ? -24.020 -3.341  8.305   1.00 28.91  ? 412 THR B O   1 
ATOM   7452 C  CB  . THR B 1 412 ? -21.059 -4.429  8.347   1.00 22.34  ? 412 THR B CB  1 
ATOM   7453 O  OG1 . THR B 1 412 ? -20.018 -4.995  7.553   1.00 23.78  ? 412 THR B OG1 1 
ATOM   7454 C  CG2 . THR B 1 412 ? -21.998 -5.537  8.781   1.00 26.34  ? 412 THR B CG2 1 
ATOM   7455 N  N   . LYS B 1 413 ? -22.744 -1.578  8.884   1.00 18.59  ? 413 LYS B N   1 
ATOM   7456 C  CA  . LYS B 1 413 ? -23.845 -0.872  9.520   1.00 24.71  ? 413 LYS B CA  1 
ATOM   7457 C  C   . LYS B 1 413 ? -24.914 -0.397  8.536   1.00 20.26  ? 413 LYS B C   1 
ATOM   7458 O  O   . LYS B 1 413 ? -25.966 0.069   8.977   1.00 22.01  ? 413 LYS B O   1 
ATOM   7459 C  CB  . LYS B 1 413 ? -23.315 0.332   10.305  1.00 32.70  ? 413 LYS B CB  1 
ATOM   7460 C  CG  . LYS B 1 413 ? -22.303 0.002   11.389  1.00 41.72  ? 413 LYS B CG  1 
ATOM   7461 C  CD  . LYS B 1 413 ? -21.889 1.281   12.135  1.00 53.22  ? 413 LYS B CD  1 
ATOM   7462 C  CE  . LYS B 1 413 ? -20.963 1.015   13.339  1.00 52.67  ? 413 LYS B CE  1 
ATOM   7463 N  NZ  . LYS B 1 413 ? -21.565 0.176   14.423  1.00 49.40  ? 413 LYS B NZ  1 
ATOM   7464 N  N   . PHE B 1 414 ? -24.680 -0.485  7.232   1.00 31.35  ? 414 PHE B N   1 
ATOM   7465 C  CA  . PHE B 1 414 ? -25.614 0.062   6.248   1.00 33.22  ? 414 PHE B CA  1 
ATOM   7466 C  C   . PHE B 1 414 ? -25.816 -0.814  5.016   1.00 26.51  ? 414 PHE B C   1 
ATOM   7467 O  O   . PHE B 1 414 ? -26.885 -0.731  4.402   1.00 29.34  ? 414 PHE B O   1 
ATOM   7468 C  CB  . PHE B 1 414 ? -25.150 1.445   5.770   1.00 37.74  ? 414 PHE B CB  1 
ATOM   7469 C  CG  . PHE B 1 414 ? -25.162 2.528   6.825   1.00 38.60  ? 414 PHE B CG  1 
ATOM   7470 C  CD1 . PHE B 1 414 ? -26.317 3.245   7.092   1.00 41.79  ? 414 PHE B CD1 1 
ATOM   7471 C  CD2 . PHE B 1 414 ? -23.993 2.892   7.484   1.00 43.26  ? 414 PHE B CD2 1 
ATOM   7472 C  CE1 . PHE B 1 414 ? -26.319 4.279   8.034   1.00 42.09  ? 414 PHE B CE1 1 
ATOM   7473 C  CE2 . PHE B 1 414 ? -23.988 3.921   8.423   1.00 39.04  ? 414 PHE B CE2 1 
ATOM   7474 C  CZ  . PHE B 1 414 ? -25.154 4.613   8.697   1.00 37.19  ? 414 PHE B CZ  1 
ATOM   7475 N  N   . GLY B 1 415 ? -24.836 -1.622  4.600   1.00 18.55  ? 415 GLY B N   1 
ATOM   7476 C  CA  . GLY B 1 415 ? -24.994 -2.470  3.436   1.00 18.26  ? 415 GLY B CA  1 
ATOM   7477 C  C   . GLY B 1 415 ? -25.969 -3.616  3.655   1.00 26.68  ? 415 GLY B C   1 
ATOM   7478 O  O   . GLY B 1 415 ? -26.496 -3.840  4.744   1.00 39.34  ? 415 GLY B O   1 
ATOM   7479 N  N   . ASN B 1 416 ? -26.194 -4.367  2.577   1.00 25.28  ? 416 ASN B N   1 
ATOM   7480 C  CA  . ASN B 1 416 ? -27.152 -5.466  2.521   1.00 30.48  ? 416 ASN B CA  1 
ATOM   7481 C  C   . ASN B 1 416 ? -26.470 -6.830  2.466   1.00 28.08  ? 416 ASN B C   1 
ATOM   7482 O  O   . ASN B 1 416 ? -27.044 -7.802  1.960   1.00 26.35  ? 416 ASN B O   1 
ATOM   7483 C  CB  . ASN B 1 416 ? -28.073 -5.287  1.312   1.00 32.55  ? 416 ASN B CB  1 
ATOM   7484 C  CG  . ASN B 1 416 ? -29.337 -6.165  1.388   1.00 29.58  ? 416 ASN B CG  1 
ATOM   7485 O  OD1 . ASN B 1 416 ? -29.521 -7.071  0.568   1.00 43.61  ? 416 ASN B OD1 1 
ATOM   7486 N  ND2 . ASN B 1 416 ? -30.203 -5.908  2.382   1.00 22.73  ? 416 ASN B ND2 1 
ATOM   7487 N  N   . GLY B 1 417 ? -25.237 -6.913  2.945   1.00 17.76  ? 417 GLY B N   1 
ATOM   7488 C  CA  . GLY B 1 417 ? -24.548 -8.187  2.950   1.00 33.42  ? 417 GLY B CA  1 
ATOM   7489 C  C   . GLY B 1 417 ? -23.042 -8.067  2.864   1.00 33.73  ? 417 GLY B C   1 
ATOM   7490 O  O   . GLY B 1 417 ? -22.508 -7.651  1.837   1.00 42.18  ? 417 GLY B O   1 
ATOM   7491 N  N   . THR B 1 418 ? -22.335 -8.436  3.923   1.00 31.01  ? 418 THR B N   1 
ATOM   7492 C  CA  . THR B 1 418 ? -20.882 -8.378  3.942   1.00 24.41  ? 418 THR B CA  1 
ATOM   7493 C  C   . THR B 1 418 ? -20.344 -9.796  4.059   1.00 15.90  ? 418 THR B C   1 
ATOM   7494 O  O   . THR B 1 418 ? -20.815 -10.568 4.902   1.00 18.26  ? 418 THR B O   1 
ATOM   7495 C  CB  . THR B 1 418 ? -20.401 -7.519  5.116   1.00 35.02  ? 418 THR B CB  1 
ATOM   7496 O  OG1 . THR B 1 418 ? -20.850 -6.168  4.951   1.00 32.97  ? 418 THR B OG1 1 
ATOM   7497 C  CG2 . THR B 1 418 ? -18.895 -7.525  5.198   1.00 35.41  ? 418 THR B CG2 1 
ATOM   7498 N  N   . TYR B 1 419 ? -19.378 -10.152 3.218   1.00 15.47  ? 419 TYR B N   1 
ATOM   7499 C  CA  . TYR B 1 419 ? -18.693 -11.435 3.366   1.00 25.03  ? 419 TYR B CA  1 
ATOM   7500 C  C   . TYR B 1 419 ? -17.190 -11.206 3.377   1.00 26.62  ? 419 TYR B C   1 
ATOM   7501 O  O   . TYR B 1 419 ? -16.628 -10.691 2.405   1.00 28.25  ? 419 TYR B O   1 
ATOM   7502 C  CB  . TYR B 1 419 ? -19.078 -12.415 2.261   1.00 20.04  ? 419 TYR B CB  1 
ATOM   7503 C  CG  . TYR B 1 419 ? -20.517 -12.852 2.293   1.00 19.15  ? 419 TYR B CG  1 
ATOM   7504 C  CD1 . TYR B 1 419 ? -21.498 -12.124 1.626   1.00 29.35  ? 419 TYR B CD1 1 
ATOM   7505 C  CD2 . TYR B 1 419 ? -20.900 -14.001 2.978   1.00 21.41  ? 419 TYR B CD2 1 
ATOM   7506 C  CE1 . TYR B 1 419 ? -22.832 -12.527 1.649   1.00 31.26  ? 419 TYR B CE1 1 
ATOM   7507 C  CE2 . TYR B 1 419 ? -22.221 -14.413 3.002   1.00 27.09  ? 419 TYR B CE2 1 
ATOM   7508 C  CZ  . TYR B 1 419 ? -23.180 -13.670 2.331   1.00 29.93  ? 419 TYR B CZ  1 
ATOM   7509 O  OH  . TYR B 1 419 ? -24.489 -14.068 2.354   1.00 35.75  ? 419 TYR B OH  1 
ATOM   7510 N  N   . LEU B 1 420 ? -16.543 -11.604 4.466   1.00 25.95  ? 420 LEU B N   1 
ATOM   7511 C  CA  . LEU B 1 420 ? -15.170 -11.210 4.748   1.00 28.62  ? 420 LEU B CA  1 
ATOM   7512 C  C   . LEU B 1 420 ? -14.233 -12.411 4.775   1.00 22.41  ? 420 LEU B C   1 
ATOM   7513 O  O   . LEU B 1 420 ? -14.545 -13.445 5.375   1.00 27.21  ? 420 LEU B O   1 
ATOM   7514 C  CB  . LEU B 1 420 ? -15.096 -10.484 6.083   1.00 27.99  ? 420 LEU B CB  1 
ATOM   7515 C  CG  . LEU B 1 420 ? -13.674 -10.075 6.436   1.00 30.01  ? 420 LEU B CG  1 
ATOM   7516 C  CD1 . LEU B 1 420 ? -13.228 -8.879  5.575   1.00 20.56  ? 420 LEU B CD1 1 
ATOM   7517 C  CD2 . LEU B 1 420 ? -13.581 -9.796  7.927   1.00 29.06  ? 420 LEU B CD2 1 
ATOM   7518 N  N   . TYR B 1 421 ? -13.067 -12.269 4.153   1.00 16.97  ? 421 TYR B N   1 
ATOM   7519 C  CA  . TYR B 1 421 ? -12.193 -13.416 3.967   1.00 23.20  ? 421 TYR B CA  1 
ATOM   7520 C  C   . TYR B 1 421 ? -10.773 -13.107 4.403   1.00 19.16  ? 421 TYR B C   1 
ATOM   7521 O  O   . TYR B 1 421 ? -10.338 -11.954 4.442   1.00 13.82  ? 421 TYR B O   1 
ATOM   7522 C  CB  . TYR B 1 421 ? -12.189 -13.900 2.504   1.00 20.34  ? 421 TYR B CB  1 
ATOM   7523 C  CG  . TYR B 1 421 ? -11.382 -13.071 1.519   1.00 17.07  ? 421 TYR B CG  1 
ATOM   7524 C  CD1 . TYR B 1 421 ? -9.986  -13.074 1.535   1.00 28.25  ? 421 TYR B CD1 1 
ATOM   7525 C  CD2 . TYR B 1 421 ? -12.014 -12.319 0.549   1.00 13.70  ? 421 TYR B CD2 1 
ATOM   7526 C  CE1 . TYR B 1 421 ? -9.260  -12.316 0.645   1.00 23.70  ? 421 TYR B CE1 1 
ATOM   7527 C  CE2 . TYR B 1 421 ? -11.300 -11.567 -0.347  1.00 13.49  ? 421 TYR B CE2 1 
ATOM   7528 C  CZ  . TYR B 1 421 ? -9.930  -11.574 -0.299  1.00 23.51  ? 421 TYR B CZ  1 
ATOM   7529 O  OH  . TYR B 1 421 ? -9.233  -10.824 -1.209  1.00 37.39  ? 421 TYR B OH  1 
ATOM   7530 N  N   . PHE B 1 422 ? -10.036 -14.183 4.660   1.00 25.41  ? 422 PHE B N   1 
ATOM   7531 C  CA  . PHE B 1 422 ? -8.625  -14.111 5.046   1.00 34.73  ? 422 PHE B CA  1 
ATOM   7532 C  C   . PHE B 1 422 ? -7.877  -15.154 4.222   1.00 32.42  ? 422 PHE B C   1 
ATOM   7533 O  O   . PHE B 1 422 ? -7.853  -16.337 4.580   1.00 29.08  ? 422 PHE B O   1 
ATOM   7534 C  CB  . PHE B 1 422 ? -8.452  -14.355 6.540   1.00 28.22  ? 422 PHE B CB  1 
ATOM   7535 C  CG  . PHE B 1 422 ? -7.072  -14.101 7.039   1.00 34.01  ? 422 PHE B CG  1 
ATOM   7536 C  CD1 . PHE B 1 422 ? -6.612  -12.800 7.216   1.00 41.99  ? 422 PHE B CD1 1 
ATOM   7537 C  CD2 . PHE B 1 422 ? -6.232  -15.156 7.364   1.00 37.66  ? 422 PHE B CD2 1 
ATOM   7538 C  CE1 . PHE B 1 422 ? -5.322  -12.552 7.694   1.00 35.32  ? 422 PHE B CE1 1 
ATOM   7539 C  CE2 . PHE B 1 422 ? -4.944  -14.914 7.843   1.00 36.27  ? 422 PHE B CE2 1 
ATOM   7540 C  CZ  . PHE B 1 422 ? -4.490  -13.610 8.000   1.00 29.47  ? 422 PHE B CZ  1 
ATOM   7541 N  N   . PHE B 1 423 ? -7.282  -14.720 3.116   1.00 23.77  ? 423 PHE B N   1 
ATOM   7542 C  CA  . PHE B 1 423 ? -6.499  -15.631 2.297   1.00 25.19  ? 423 PHE B CA  1 
ATOM   7543 C  C   . PHE B 1 423 ? -5.146  -15.804 2.951   1.00 25.67  ? 423 PHE B C   1 
ATOM   7544 O  O   . PHE B 1 423 ? -4.487  -14.814 3.278   1.00 28.98  ? 423 PHE B O   1 
ATOM   7545 C  CB  . PHE B 1 423 ? -6.352  -15.075 0.886   1.00 22.09  ? 423 PHE B CB  1 
ATOM   7546 C  CG  . PHE B 1 423 ? -5.628  -15.982 -0.063  1.00 23.60  ? 423 PHE B CG  1 
ATOM   7547 C  CD1 . PHE B 1 423 ? -6.338  -16.735 -0.988  1.00 27.06  ? 423 PHE B CD1 1 
ATOM   7548 C  CD2 . PHE B 1 423 ? -4.241  -16.038 -0.081  1.00 20.90  ? 423 PHE B CD2 1 
ATOM   7549 C  CE1 . PHE B 1 423 ? -5.683  -17.561 -1.891  1.00 17.59  ? 423 PHE B CE1 1 
ATOM   7550 C  CE2 . PHE B 1 423 ? -3.576  -16.873 -0.973  1.00 18.12  ? 423 PHE B CE2 1 
ATOM   7551 C  CZ  . PHE B 1 423 ? -4.301  -17.632 -1.882  1.00 17.77  ? 423 PHE B CZ  1 
ATOM   7552 N  N   . ASN B 1 424 ? -4.735  -17.053 3.166   1.00 21.54  ? 424 ASN B N   1 
ATOM   7553 C  CA  . ASN B 1 424 ? -3.441  -17.289 3.803   1.00 27.20  ? 424 ASN B CA  1 
ATOM   7554 C  C   . ASN B 1 424 ? -2.822  -18.579 3.289   1.00 31.09  ? 424 ASN B C   1 
ATOM   7555 O  O   . ASN B 1 424 ? -2.183  -19.322 4.042   1.00 35.42  ? 424 ASN B O   1 
ATOM   7556 C  CB  . ASN B 1 424 ? -3.546  -17.303 5.336   1.00 18.04  ? 424 ASN B CB  1 
ATOM   7557 C  CG  . ASN B 1 424 ? -4.504  -18.364 5.873   1.00 22.99  ? 424 ASN B CG  1 
ATOM   7558 O  OD1 . ASN B 1 424 ? -5.222  -19.017 5.125   1.00 35.89  ? 424 ASN B OD1 1 
ATOM   7559 N  ND2 . ASN B 1 424 ? -4.518  -18.525 7.191   1.00 25.13  ? 424 ASN B ND2 1 
ATOM   7560 N  N   . HIS B 1 425 ? -2.987  -18.855 2.002   1.00 25.19  ? 425 HIS B N   1 
ATOM   7561 C  CA  . HIS B 1 425 ? -2.342  -20.002 1.379   1.00 26.45  ? 425 HIS B CA  1 
ATOM   7562 C  C   . HIS B 1 425 ? -1.039  -19.564 0.724   1.00 31.35  ? 425 HIS B C   1 
ATOM   7563 O  O   . HIS B 1 425 ? -1.030  -18.629 -0.086  1.00 37.39  ? 425 HIS B O   1 
ATOM   7564 C  CB  . HIS B 1 425 ? -3.230  -20.665 0.334   1.00 23.25  ? 425 HIS B CB  1 
ATOM   7565 C  CG  . HIS B 1 425 ? -2.596  -21.865 -0.292  1.00 24.62  ? 425 HIS B CG  1 
ATOM   7566 N  ND1 . HIS B 1 425 ? -2.425  -23.055 0.384   1.00 31.96  ? 425 HIS B ND1 1 
ATOM   7567 C  CD2 . HIS B 1 425 ? -2.063  -22.050 -1.522  1.00 26.16  ? 425 HIS B CD2 1 
ATOM   7568 C  CE1 . HIS B 1 425 ? -1.827  -23.928 -0.409  1.00 36.37  ? 425 HIS B CE1 1 
ATOM   7569 N  NE2 . HIS B 1 425 ? -1.599  -23.343 -1.572  1.00 35.00  ? 425 HIS B NE2 1 
ATOM   7570 N  N   . ARG B 1 426 ? 0.056   -20.245 1.058   1.00 24.07  ? 426 ARG B N   1 
ATOM   7571 C  CA  . ARG B 1 426 ? 1.337   -19.998 0.404   1.00 27.48  ? 426 ARG B CA  1 
ATOM   7572 C  C   . ARG B 1 426 ? 1.448   -20.934 -0.788  1.00 31.47  ? 426 ARG B C   1 
ATOM   7573 O  O   . ARG B 1 426 ? 1.608   -22.148 -0.618  1.00 32.17  ? 426 ARG B O   1 
ATOM   7574 C  CB  . ARG B 1 426 ? 2.510   -20.185 1.365   1.00 21.27  ? 426 ARG B CB  1 
ATOM   7575 C  CG  . ARG B 1 426 ? 3.862   -20.392 0.693   1.00 23.33  ? 426 ARG B CG  1 
ATOM   7576 C  CD  . ARG B 1 426 ? 4.737   -19.140 0.768   1.00 42.27  ? 426 ARG B CD  1 
ATOM   7577 N  NE  . ARG B 1 426 ? 6.021   -19.305 0.058   1.00 53.70  ? 426 ARG B NE  1 
ATOM   7578 C  CZ  . ARG B 1 426 ? 7.012   -18.412 0.024   1.00 48.01  ? 426 ARG B CZ  1 
ATOM   7579 N  NH1 . ARG B 1 426 ? 8.112   -18.702 -0.651  1.00 33.18  ? 426 ARG B NH1 1 
ATOM   7580 N  NH2 . ARG B 1 426 ? 6.892   -17.247 0.640   1.00 57.24  ? 426 ARG B NH2 1 
ATOM   7581 N  N   . ALA B 1 427 ? 1.369   -20.366 -1.995  1.00 24.64  ? 427 ALA B N   1 
ATOM   7582 C  CA  . ALA B 1 427 ? 1.387   -21.177 -3.210  1.00 33.29  ? 427 ALA B CA  1 
ATOM   7583 C  C   . ALA B 1 427 ? 2.656   -22.025 -3.298  1.00 35.62  ? 427 ALA B C   1 
ATOM   7584 O  O   . ALA B 1 427 ? 3.770   -21.546 -3.052  1.00 46.22  ? 427 ALA B O   1 
ATOM   7585 C  CB  . ALA B 1 427 ? 1.261   -20.281 -4.443  1.00 43.74  ? 427 ALA B CB  1 
ATOM   7586 N  N   . SER B 1 428 ? 2.475   -23.299 -3.657  1.00 26.04  ? 428 SER B N   1 
ATOM   7587 C  CA  . SER B 1 428 ? 3.581   -24.252 -3.620  1.00 34.44  ? 428 SER B CA  1 
ATOM   7588 C  C   . SER B 1 428 ? 4.707   -23.828 -4.551  1.00 53.37  ? 428 SER B C   1 
ATOM   7589 O  O   . SER B 1 428 ? 5.890   -23.917 -4.194  1.00 64.67  ? 428 SER B O   1 
ATOM   7590 C  CB  . SER B 1 428 ? 3.085   -25.658 -3.982  1.00 47.45  ? 428 SER B CB  1 
ATOM   7591 O  OG  . SER B 1 428 ? 2.577   -25.739 -5.315  1.00 49.59  ? 428 SER B OG  1 
ATOM   7592 N  N   . ASN B 1 429 ? 4.356   -23.351 -5.748  1.00 52.44  ? 429 ASN B N   1 
ATOM   7593 C  CA  . ASN B 1 429 ? 5.323   -22.946 -6.760  1.00 44.27  ? 429 ASN B CA  1 
ATOM   7594 C  C   . ASN B 1 429 ? 5.700   -21.470 -6.663  1.00 41.57  ? 429 ASN B C   1 
ATOM   7595 O  O   . ASN B 1 429 ? 5.980   -20.840 -7.693  1.00 41.15  ? 429 ASN B O   1 
ATOM   7596 C  CB  . ASN B 1 429 ? 4.763   -23.247 -8.144  1.00 46.99  ? 429 ASN B CB  1 
ATOM   7597 C  CG  . ASN B 1 429 ? 3.485   -22.482 -8.423  1.00 45.03  ? 429 ASN B CG  1 
ATOM   7598 O  OD1 . ASN B 1 429 ? 2.854   -21.944 -7.504  1.00 47.39  ? 429 ASN B OD1 1 
ATOM   7599 N  ND2 . ASN B 1 429 ? 3.095   -22.425 -9.693  1.00 32.22  ? 429 ASN B ND2 1 
ATOM   7600 N  N   . LEU B 1 430 ? 5.703   -20.900 -5.458  1.00 39.20  ? 430 LEU B N   1 
ATOM   7601 C  CA  . LEU B 1 430 ? 6.061   -19.500 -5.287  1.00 38.74  ? 430 LEU B CA  1 
ATOM   7602 C  C   . LEU B 1 430 ? 7.574   -19.314 -5.420  1.00 43.66  ? 430 LEU B C   1 
ATOM   7603 O  O   . LEU B 1 430 ? 8.369   -20.075 -4.852  1.00 41.51  ? 430 LEU B O   1 
ATOM   7604 C  CB  . LEU B 1 430 ? 5.564   -18.997 -3.931  1.00 40.52  ? 430 LEU B CB  1 
ATOM   7605 C  CG  . LEU B 1 430 ? 5.143   -17.528 -3.869  1.00 42.76  ? 430 LEU B CG  1 
ATOM   7606 C  CD1 . LEU B 1 430 ? 4.188   -17.207 -5.008  1.00 43.89  ? 430 LEU B CD1 1 
ATOM   7607 C  CD2 . LEU B 1 430 ? 4.483   -17.237 -2.543  1.00 50.57  ? 430 LEU B CD2 1 
ATOM   7608 N  N   . VAL B 1 431 ? 7.969   -18.297 -6.186  1.00 44.03  ? 431 VAL B N   1 
ATOM   7609 C  CA  . VAL B 1 431 ? 9.382   -18.076 -6.466  1.00 44.23  ? 431 VAL B CA  1 
ATOM   7610 C  C   . VAL B 1 431 ? 10.072  -17.347 -5.325  1.00 40.05  ? 431 VAL B C   1 
ATOM   7611 O  O   . VAL B 1 431 ? 11.281  -17.511 -5.128  1.00 47.64  ? 431 VAL B O   1 
ATOM   7612 C  CB  . VAL B 1 431 ? 9.534   -17.298 -7.779  1.00 47.48  ? 431 VAL B CB  1 
ATOM   7613 C  CG1 . VAL B 1 431 ? 9.374   -18.230 -8.977  1.00 48.05  ? 431 VAL B CG1 1 
ATOM   7614 C  CG2 . VAL B 1 431 ? 8.512   -16.167 -7.817  1.00 48.26  ? 431 VAL B CG2 1 
ATOM   7615 N  N   . TRP B 1 432 ? 9.333   -16.534 -4.573  1.00 28.07  ? 432 TRP B N   1 
ATOM   7616 C  CA  . TRP B 1 432 ? 9.908   -15.740 -3.498  1.00 24.83  ? 432 TRP B CA  1 
ATOM   7617 C  C   . TRP B 1 432 ? 10.270  -16.590 -2.271  1.00 28.13  ? 432 TRP B C   1 
ATOM   7618 O  O   . TRP B 1 432 ? 9.767   -17.703 -2.101  1.00 24.80  ? 432 TRP B O   1 
ATOM   7619 C  CB  . TRP B 1 432 ? 8.921   -14.678 -3.082  1.00 28.73  ? 432 TRP B CB  1 
ATOM   7620 C  CG  . TRP B 1 432 ? 8.490   -13.737 -4.140  1.00 35.95  ? 432 TRP B CG  1 
ATOM   7621 C  CD1 . TRP B 1 432 ? 7.356   -13.818 -4.883  1.00 30.49  ? 432 TRP B CD1 1 
ATOM   7622 C  CD2 . TRP B 1 432 ? 9.129   -12.506 -4.512  1.00 30.55  ? 432 TRP B CD2 1 
ATOM   7623 N  NE1 . TRP B 1 432 ? 7.260   -12.728 -5.712  1.00 27.06  ? 432 TRP B NE1 1 
ATOM   7624 C  CE2 . TRP B 1 432 ? 8.334   -11.907 -5.498  1.00 22.35  ? 432 TRP B CE2 1 
ATOM   7625 C  CE3 . TRP B 1 432 ? 10.300  -11.858 -4.107  1.00 28.04  ? 432 TRP B CE3 1 
ATOM   7626 C  CZ2 . TRP B 1 432 ? 8.673   -10.705 -6.092  1.00 24.29  ? 432 TRP B CZ2 1 
ATOM   7627 C  CZ3 . TRP B 1 432 ? 10.628  -10.662 -4.693  1.00 16.44  ? 432 TRP B CZ3 1 
ATOM   7628 C  CH2 . TRP B 1 432 ? 9.822   -10.099 -5.676  1.00 24.89  ? 432 TRP B CH2 1 
ATOM   7629 N  N   . PRO B 1 433 ? 11.116  -16.062 -1.379  1.00 29.59  ? 433 PRO B N   1 
ATOM   7630 C  CA  . PRO B 1 433 ? 11.552  -16.832 -0.204  1.00 28.96  ? 433 PRO B CA  1 
ATOM   7631 C  C   . PRO B 1 433 ? 10.478  -16.952 0.865   1.00 29.19  ? 433 PRO B C   1 
ATOM   7632 O  O   . PRO B 1 433 ? 9.600   -16.097 1.004   1.00 30.24  ? 433 PRO B O   1 
ATOM   7633 C  CB  . PRO B 1 433 ? 12.724  -16.005 0.327   1.00 30.16  ? 433 PRO B CB  1 
ATOM   7634 C  CG  . PRO B 1 433 ? 12.287  -14.616 0.028   1.00 29.32  ? 433 PRO B CG  1 
ATOM   7635 C  CD  . PRO B 1 433 ? 11.687  -14.705 -1.358  1.00 29.41  ? 433 PRO B CD  1 
ATOM   7636 N  N   . GLU B 1 434 ? 10.581  -18.017 1.664   1.00 25.83  ? 434 GLU B N   1 
ATOM   7637 C  CA  . GLU B 1 434 ? 9.419   -18.356 2.467   1.00 32.12  ? 434 GLU B CA  1 
ATOM   7638 C  C   . GLU B 1 434 ? 9.172   -17.341 3.586   1.00 30.35  ? 434 GLU B C   1 
ATOM   7639 O  O   . GLU B 1 434 ? 8.026   -17.211 4.045   1.00 24.28  ? 434 GLU B O   1 
ATOM   7640 C  CB  . GLU B 1 434 ? 9.505   -19.807 2.980   1.00 46.24  ? 434 GLU B CB  1 
ATOM   7641 C  CG  . GLU B 1 434 ? 8.167   -20.205 3.681   1.00 78.24  ? 434 GLU B CG  1 
ATOM   7642 C  CD  . GLU B 1 434 ? 7.514   -21.504 3.165   1.00 95.57  ? 434 GLU B CD  1 
ATOM   7643 O  OE1 . GLU B 1 434 ? 6.491   -21.944 3.751   1.00 92.23  ? 434 GLU B OE1 1 
ATOM   7644 O  OE2 . GLU B 1 434 ? 8.002   -22.078 2.163   1.00 106.63 ? 434 GLU B OE2 1 
ATOM   7645 N  N   . TRP B 1 435 ? 10.177  -16.541 3.964   1.00 28.78  ? 435 TRP B N   1 
ATOM   7646 C  CA  . TRP B 1 435 ? 9.911   -15.526 4.978   1.00 28.15  ? 435 TRP B CA  1 
ATOM   7647 C  C   . TRP B 1 435 ? 8.876   -14.507 4.526   1.00 28.82  ? 435 TRP B C   1 
ATOM   7648 O  O   . TRP B 1 435 ? 8.347   -13.775 5.369   1.00 41.27  ? 435 TRP B O   1 
ATOM   7649 C  CB  . TRP B 1 435 ? 11.195  -14.794 5.406   1.00 17.45  ? 435 TRP B CB  1 
ATOM   7650 C  CG  . TRP B 1 435 ? 11.778  -13.812 4.416   1.00 30.92  ? 435 TRP B CG  1 
ATOM   7651 C  CD1 . TRP B 1 435 ? 12.827  -14.031 3.570   1.00 40.51  ? 435 TRP B CD1 1 
ATOM   7652 C  CD2 . TRP B 1 435 ? 11.358  -12.456 4.181   1.00 24.67  ? 435 TRP B CD2 1 
ATOM   7653 N  NE1 . TRP B 1 435 ? 13.083  -12.905 2.814   1.00 41.37  ? 435 TRP B NE1 1 
ATOM   7654 C  CE2 . TRP B 1 435 ? 12.195  -11.924 3.167   1.00 32.22  ? 435 TRP B CE2 1 
ATOM   7655 C  CE3 . TRP B 1 435 ? 10.360  -11.646 4.717   1.00 17.86  ? 435 TRP B CE3 1 
ATOM   7656 C  CZ2 . TRP B 1 435 ? 12.058  -10.617 2.684   1.00 23.49  ? 435 TRP B CZ2 1 
ATOM   7657 C  CZ3 . TRP B 1 435 ? 10.223  -10.352 4.233   1.00 29.83  ? 435 TRP B CZ3 1 
ATOM   7658 C  CH2 . TRP B 1 435 ? 11.068  -9.850  3.227   1.00 27.71  ? 435 TRP B CH2 1 
ATOM   7659 N  N   . MET B 1 436 ? 8.565   -14.444 3.234   1.00 25.04  ? 436 MET B N   1 
ATOM   7660 C  CA  . MET B 1 436 ? 7.593   -13.473 2.756   1.00 31.66  ? 436 MET B CA  1 
ATOM   7661 C  C   . MET B 1 436 ? 6.160   -13.964 2.902   1.00 29.74  ? 436 MET B C   1 
ATOM   7662 O  O   . MET B 1 436 ? 5.238   -13.147 2.877   1.00 30.47  ? 436 MET B O   1 
ATOM   7663 C  CB  . MET B 1 436 ? 7.859   -13.113 1.285   1.00 42.71  ? 436 MET B CB  1 
ATOM   7664 C  CG  . MET B 1 436 ? 9.328   -12.777 0.949   1.00 50.24  ? 436 MET B CG  1 
ATOM   7665 S  SD  . MET B 1 436 ? 9.625   -11.271 -0.019  1.00 44.36  ? 436 MET B SD  1 
ATOM   7666 C  CE  . MET B 1 436 ? 8.571   -11.542 -1.395  1.00 49.40  ? 436 MET B CE  1 
ATOM   7667 N  N   . GLY B 1 437 ? 5.948   -15.271 3.032   1.00 32.89  ? 437 GLY B N   1 
ATOM   7668 C  CA  . GLY B 1 437 ? 4.615   -15.770 3.341   1.00 37.46  ? 437 GLY B CA  1 
ATOM   7669 C  C   . GLY B 1 437 ? 3.616   -15.581 2.213   1.00 47.64  ? 437 GLY B C   1 
ATOM   7670 O  O   . GLY B 1 437 ? 3.922   -15.781 1.029   1.00 57.78  ? 437 GLY B O   1 
ATOM   7671 N  N   . VAL B 1 438 ? 2.392   -15.205 2.589   1.00 39.20  ? 438 VAL B N   1 
ATOM   7672 C  CA  . VAL B 1 438 ? 1.288   -15.050 1.636   1.00 30.24  ? 438 VAL B CA  1 
ATOM   7673 C  C   . VAL B 1 438 ? 1.334   -13.604 1.154   1.00 26.07  ? 438 VAL B C   1 
ATOM   7674 O  O   . VAL B 1 438 ? 0.662   -12.718 1.680   1.00 27.85  ? 438 VAL B O   1 
ATOM   7675 C  CB  . VAL B 1 438 ? -0.053  -15.433 2.249   1.00 27.02  ? 438 VAL B CB  1 
ATOM   7676 C  CG1 . VAL B 1 438 ? -1.177  -15.168 1.277   1.00 30.27  ? 438 VAL B CG1 1 
ATOM   7677 C  CG2 . VAL B 1 438 ? -0.019  -16.902 2.629   1.00 21.63  ? 438 VAL B CG2 1 
ATOM   7678 N  N   . ILE B 1 439 ? 2.128   -13.387 0.104   1.00 25.16  ? 439 ILE B N   1 
ATOM   7679 C  CA  . ILE B 1 439 ? 2.517   -12.056 -0.339  1.00 22.09  ? 439 ILE B CA  1 
ATOM   7680 C  C   . ILE B 1 439 ? 1.319   -11.277 -0.864  1.00 22.46  ? 439 ILE B C   1 
ATOM   7681 O  O   . ILE B 1 439 ? 0.428   -11.825 -1.530  1.00 16.89  ? 439 ILE B O   1 
ATOM   7682 C  CB  . ILE B 1 439 ? 3.604   -12.191 -1.419  1.00 31.66  ? 439 ILE B CB  1 
ATOM   7683 C  CG1 . ILE B 1 439 ? 4.819   -12.908 -0.835  1.00 35.75  ? 439 ILE B CG1 1 
ATOM   7684 C  CG2 . ILE B 1 439 ? 3.992   -10.830 -2.019  1.00 25.75  ? 439 ILE B CG2 1 
ATOM   7685 C  CD1 . ILE B 1 439 ? 5.736   -13.439 -1.878  1.00 32.73  ? 439 ILE B CD1 1 
ATOM   7686 N  N   . HIS B 1 440 ? 1.297   -9.984  -0.549  1.00 26.05  ? 440 HIS B N   1 
ATOM   7687 C  CA  . HIS B 1 440 ? 0.461   -9.000  -1.221  1.00 24.59  ? 440 HIS B CA  1 
ATOM   7688 C  C   . HIS B 1 440 ? 0.385   -9.291  -2.715  1.00 28.36  ? 440 HIS B C   1 
ATOM   7689 O  O   . HIS B 1 440 ? 1.393   -9.224  -3.427  1.00 35.86  ? 440 HIS B O   1 
ATOM   7690 C  CB  . HIS B 1 440 ? 1.032   -7.603  -0.956  1.00 25.95  ? 440 HIS B CB  1 
ATOM   7691 C  CG  . HIS B 1 440 ? 0.260   -6.478  -1.579  1.00 38.06  ? 440 HIS B CG  1 
ATOM   7692 N  ND1 . HIS B 1 440 ? -0.858  -5.921  -0.987  1.00 34.98  ? 440 HIS B ND1 1 
ATOM   7693 C  CD2 . HIS B 1 440 ? 0.489   -5.753  -2.703  1.00 43.55  ? 440 HIS B CD2 1 
ATOM   7694 C  CE1 . HIS B 1 440 ? -1.300  -4.923  -1.733  1.00 36.51  ? 440 HIS B CE1 1 
ATOM   7695 N  NE2 . HIS B 1 440 ? -0.502  -4.802  -2.781  1.00 43.19  ? 440 HIS B NE2 1 
ATOM   7696 N  N   . GLY B 1 441 ? -0.797  -9.656  -3.192  1.00 28.66  ? 441 GLY B N   1 
ATOM   7697 C  CA  . GLY B 1 441 ? -1.047  -9.788  -4.612  1.00 24.47  ? 441 GLY B CA  1 
ATOM   7698 C  C   . GLY B 1 441 ? -1.175  -11.202 -5.132  1.00 21.80  ? 441 GLY B C   1 
ATOM   7699 O  O   . GLY B 1 441 ? -1.530  -11.368 -6.300  1.00 21.20  ? 441 GLY B O   1 
ATOM   7700 N  N   . TYR B 1 442 ? -0.949  -12.228 -4.315  1.00 27.82  ? 442 TYR B N   1 
ATOM   7701 C  CA  . TYR B 1 442 ? -0.828  -13.585 -4.833  1.00 24.12  ? 442 TYR B CA  1 
ATOM   7702 C  C   . TYR B 1 442 ? -2.046  -14.445 -4.556  1.00 27.45  ? 442 TYR B C   1 
ATOM   7703 O  O   . TYR B 1 442 ? -1.993  -15.657 -4.776  1.00 28.41  ? 442 TYR B O   1 
ATOM   7704 C  CB  . TYR B 1 442 ? 0.441   -14.239 -4.298  1.00 26.35  ? 442 TYR B CB  1 
ATOM   7705 C  CG  . TYR B 1 442 ? 1.641   -13.657 -4.996  1.00 34.08  ? 442 TYR B CG  1 
ATOM   7706 C  CD1 . TYR B 1 442 ? 2.333   -14.378 -5.970  1.00 29.56  ? 442 TYR B CD1 1 
ATOM   7707 C  CD2 . TYR B 1 442 ? 2.037   -12.352 -4.735  1.00 36.13  ? 442 TYR B CD2 1 
ATOM   7708 C  CE1 . TYR B 1 442 ? 3.409   -13.827 -6.628  1.00 22.12  ? 442 TYR B CE1 1 
ATOM   7709 C  CE2 . TYR B 1 442 ? 3.097   -11.799 -5.380  1.00 34.95  ? 442 TYR B CE2 1 
ATOM   7710 C  CZ  . TYR B 1 442 ? 3.777   -12.536 -6.324  1.00 29.72  ? 442 TYR B CZ  1 
ATOM   7711 O  OH  . TYR B 1 442 ? 4.833   -11.950 -6.949  1.00 34.32  ? 442 TYR B OH  1 
ATOM   7712 N  N   . GLU B 1 443 ? -3.145  -13.849 -4.095  1.00 32.36  ? 443 GLU B N   1 
ATOM   7713 C  CA  . GLU B 1 443 ? -4.449  -14.491 -4.237  1.00 34.92  ? 443 GLU B CA  1 
ATOM   7714 C  C   . GLU B 1 443 ? -4.972  -14.398 -5.672  1.00 33.12  ? 443 GLU B C   1 
ATOM   7715 O  O   . GLU B 1 443 ? -5.835  -15.187 -6.065  1.00 25.80  ? 443 GLU B O   1 
ATOM   7716 C  CB  . GLU B 1 443 ? -5.448  -13.845 -3.275  1.00 32.74  ? 443 GLU B CB  1 
ATOM   7717 C  CG  . GLU B 1 443 ? -5.901  -12.440 -3.709  1.00 41.42  ? 443 GLU B CG  1 
ATOM   7718 C  CD  . GLU B 1 443 ? -4.815  -11.395 -3.558  1.00 48.18  ? 443 GLU B CD  1 
ATOM   7719 O  OE1 . GLU B 1 443 ? -4.981  -10.455 -2.751  1.00 60.83  ? 443 GLU B OE1 1 
ATOM   7720 O  OE2 . GLU B 1 443 ? -3.783  -11.517 -4.239  1.00 43.53  ? 443 GLU B OE2 1 
ATOM   7721 N  N   . ILE B 1 444 ? -4.438  -13.464 -6.460  1.00 32.50  ? 444 ILE B N   1 
ATOM   7722 C  CA  . ILE B 1 444 ? -4.993  -13.138 -7.768  1.00 25.36  ? 444 ILE B CA  1 
ATOM   7723 C  C   . ILE B 1 444 ? -4.943  -14.345 -8.701  1.00 39.24  ? 444 ILE B C   1 
ATOM   7724 O  O   . ILE B 1 444 ? -5.880  -14.594 -9.473  1.00 32.73  ? 444 ILE B O   1 
ATOM   7725 C  CB  . ILE B 1 444 ? -4.246  -11.923 -8.347  1.00 15.90  ? 444 ILE B CB  1 
ATOM   7726 C  CG1 . ILE B 1 444 ? -4.485  -10.702 -7.447  1.00 25.92  ? 444 ILE B CG1 1 
ATOM   7727 C  CG2 . ILE B 1 444 ? -4.670  -11.656 -9.770  1.00 17.27  ? 444 ILE B CG2 1 
ATOM   7728 C  CD1 . ILE B 1 444 ? -4.051  -9.376  -8.040  1.00 24.36  ? 444 ILE B CD1 1 
ATOM   7729 N  N   . GLU B 1 445 ? -3.862  -15.121 -8.635  1.00 41.54  ? 445 GLU B N   1 
ATOM   7730 C  CA  . GLU B 1 445 ? -3.754  -16.305 -9.480  1.00 32.63  ? 445 GLU B CA  1 
ATOM   7731 C  C   . GLU B 1 445 ? -4.902  -17.272 -9.236  1.00 37.56  ? 445 GLU B C   1 
ATOM   7732 O  O   . GLU B 1 445 ? -5.305  -18.006 -10.148 1.00 46.55  ? 445 GLU B O   1 
ATOM   7733 C  CB  . GLU B 1 445 ? -2.425  -17.001 -9.212  1.00 29.64  ? 445 GLU B CB  1 
ATOM   7734 C  CG  . GLU B 1 445 ? -1.368  -16.064 -8.700  1.00 36.62  ? 445 GLU B CG  1 
ATOM   7735 C  CD  . GLU B 1 445 ? -0.022  -16.718 -8.588  1.00 53.55  ? 445 GLU B CD  1 
ATOM   7736 O  OE1 . GLU B 1 445 ? 0.017   -17.886 -8.140  1.00 56.52  ? 445 GLU B OE1 1 
ATOM   7737 O  OE2 . GLU B 1 445 ? 0.990   -16.067 -8.935  1.00 61.20  ? 445 GLU B OE2 1 
ATOM   7738 N  N   . PHE B 1 446 ? -5.434  -17.300 -8.012  1.00 32.65  ? 446 PHE B N   1 
ATOM   7739 C  CA  . PHE B 1 446 ? -6.537  -18.205 -7.713  1.00 31.35  ? 446 PHE B CA  1 
ATOM   7740 C  C   . PHE B 1 446 ? -7.880  -17.614 -8.126  1.00 27.49  ? 446 PHE B C   1 
ATOM   7741 O  O   . PHE B 1 446 ? -8.740  -18.339 -8.636  1.00 19.58  ? 446 PHE B O   1 
ATOM   7742 C  CB  . PHE B 1 446 ? -6.526  -18.561 -6.230  1.00 30.12  ? 446 PHE B CB  1 
ATOM   7743 C  CG  . PHE B 1 446 ? -5.357  -19.396 -5.835  1.00 26.07  ? 446 PHE B CG  1 
ATOM   7744 C  CD1 . PHE B 1 446 ? -4.124  -18.812 -5.601  1.00 23.18  ? 446 PHE B CD1 1 
ATOM   7745 C  CD2 . PHE B 1 446 ? -5.478  -20.772 -5.737  1.00 28.29  ? 446 PHE B CD2 1 
ATOM   7746 C  CE1 . PHE B 1 446 ? -3.029  -19.583 -5.260  1.00 18.86  ? 446 PHE B CE1 1 
ATOM   7747 C  CE2 . PHE B 1 446 ? -4.391  -21.548 -5.405  1.00 31.93  ? 446 PHE B CE2 1 
ATOM   7748 C  CZ  . PHE B 1 446 ? -3.163  -20.947 -5.160  1.00 28.05  ? 446 PHE B CZ  1 
ATOM   7749 N  N   . VAL B 1 447 ? -8.076  -16.308 -7.916  1.00 14.51  ? 447 VAL B N   1 
ATOM   7750 C  CA  . VAL B 1 447 ? -9.258  -15.628 -8.437  1.00 20.15  ? 447 VAL B CA  1 
ATOM   7751 C  C   . VAL B 1 447 ? -9.416  -15.885 -9.935  1.00 32.63  ? 447 VAL B C   1 
ATOM   7752 O  O   . VAL B 1 447 ? -10.534 -16.089 -10.434 1.00 36.22  ? 447 VAL B O   1 
ATOM   7753 C  CB  . VAL B 1 447 ? -9.174  -14.118 -8.131  1.00 25.44  ? 447 VAL B CB  1 
ATOM   7754 C  CG1 . VAL B 1 447 ? -10.284 -13.336 -8.831  1.00 19.17  ? 447 VAL B CG1 1 
ATOM   7755 C  CG2 . VAL B 1 447 ? -9.219  -13.877 -6.633  1.00 35.45  ? 447 VAL B CG2 1 
ATOM   7756 N  N   . PHE B 1 448 ? -8.299  -15.899 -10.670 1.00 14.92  ? 448 PHE B N   1 
ATOM   7757 C  CA  . PHE B 1 448 ? -8.306  -15.940 -12.126 1.00 15.27  ? 448 PHE B CA  1 
ATOM   7758 C  C   . PHE B 1 448 ? -7.995  -17.329 -12.668 1.00 26.58  ? 448 PHE B C   1 
ATOM   7759 O  O   . PHE B 1 448 ? -7.784  -17.478 -13.880 1.00 28.97  ? 448 PHE B O   1 
ATOM   7760 C  CB  . PHE B 1 448 ? -7.309  -14.916 -12.691 1.00 15.17  ? 448 PHE B CB  1 
ATOM   7761 C  CG  . PHE B 1 448 ? -7.828  -13.498 -12.737 1.00 23.43  ? 448 PHE B CG  1 
ATOM   7762 C  CD1 . PHE B 1 448 ? -7.845  -12.711 -11.603 1.00 28.37  ? 448 PHE B CD1 1 
ATOM   7763 C  CD2 . PHE B 1 448 ? -8.258  -12.938 -13.924 1.00 38.70  ? 448 PHE B CD2 1 
ATOM   7764 C  CE1 . PHE B 1 448 ? -8.308  -11.398 -11.645 1.00 29.94  ? 448 PHE B CE1 1 
ATOM   7765 C  CE2 . PHE B 1 448 ? -8.728  -11.623 -13.966 1.00 39.29  ? 448 PHE B CE2 1 
ATOM   7766 C  CZ  . PHE B 1 448 ? -8.749  -10.856 -12.824 1.00 26.66  ? 448 PHE B CZ  1 
ATOM   7767 N  N   . GLY B 1 449 ? -7.928  -18.340 -11.801 1.00 21.26  ? 449 GLY B N   1 
ATOM   7768 C  CA  . GLY B 1 449 ? -7.937  -19.718 -12.261 1.00 27.95  ? 449 GLY B CA  1 
ATOM   7769 C  C   . GLY B 1 449 ? -6.667  -20.243 -12.904 1.00 32.27  ? 449 GLY B C   1 
ATOM   7770 O  O   . GLY B 1 449 ? -6.706  -21.299 -13.547 1.00 24.79  ? 449 GLY B O   1 
ATOM   7771 N  N   . LEU B 1 450 ? -5.534  -19.559 -12.741 1.00 29.71  ? 450 LEU B N   1 
ATOM   7772 C  CA  . LEU B 1 450 ? -4.291  -20.100 -13.282 1.00 31.21  ? 450 LEU B CA  1 
ATOM   7773 C  C   . LEU B 1 450 ? -3.902  -21.475 -12.745 1.00 36.04  ? 450 LEU B C   1 
ATOM   7774 O  O   . LEU B 1 450 ? -3.354  -22.262 -13.534 1.00 38.39  ? 450 LEU B O   1 
ATOM   7775 C  CB  . LEU B 1 450 ? -3.134  -19.108 -13.090 1.00 24.31  ? 450 LEU B CB  1 
ATOM   7776 C  CG  . LEU B 1 450 ? -3.464  -17.735 -13.671 1.00 24.35  ? 450 LEU B CG  1 
ATOM   7777 C  CD1 . LEU B 1 450 ? -2.505  -16.666 -13.207 1.00 23.39  ? 450 LEU B CD1 1 
ATOM   7778 C  CD2 . LEU B 1 450 ? -3.463  -17.821 -15.179 1.00 37.59  ? 450 LEU B CD2 1 
ATOM   7779 N  N   . PRO B 1 451 ? -4.143  -21.843 -11.481 1.00 39.09  ? 451 PRO B N   1 
ATOM   7780 C  CA  . PRO B 1 451 ? -3.853  -23.227 -11.069 1.00 33.89  ? 451 PRO B CA  1 
ATOM   7781 C  C   . PRO B 1 451 ? -4.497  -24.283 -11.964 1.00 41.36  ? 451 PRO B C   1 
ATOM   7782 O  O   . PRO B 1 451 ? -4.115  -25.457 -11.929 1.00 48.55  ? 451 PRO B O   1 
ATOM   7783 C  CB  . PRO B 1 451 ? -4.430  -23.292 -9.655  1.00 33.07  ? 451 PRO B CB  1 
ATOM   7784 C  CG  . PRO B 1 451 ? -4.346  -21.897 -9.165  1.00 34.99  ? 451 PRO B CG  1 
ATOM   7785 C  CD  . PRO B 1 451 ? -4.586  -21.017 -10.341 1.00 31.45  ? 451 PRO B CD  1 
ATOM   7786 N  N   . LEU B 1 452 ? -5.482  -23.881 -12.768 1.00 42.25  ? 452 LEU B N   1 
ATOM   7787 C  CA  . LEU B 1 452 ? -6.166  -24.825 -13.644 1.00 38.64  ? 452 LEU B CA  1 
ATOM   7788 C  C   . LEU B 1 452 ? -5.324  -25.203 -14.851 1.00 37.45  ? 452 LEU B C   1 
ATOM   7789 O  O   . LEU B 1 452 ? -5.532  -26.281 -15.418 1.00 38.48  ? 452 LEU B O   1 
ATOM   7790 C  CB  . LEU B 1 452 ? -7.510  -24.254 -14.105 1.00 27.25  ? 452 LEU B CB  1 
ATOM   7791 C  CG  . LEU B 1 452 ? -8.675  -24.306 -13.111 1.00 26.37  ? 452 LEU B CG  1 
ATOM   7792 C  CD1 . LEU B 1 452 ? -8.317  -23.744 -11.750 1.00 26.81  ? 452 LEU B CD1 1 
ATOM   7793 C  CD2 . LEU B 1 452 ? -9.861  -23.562 -13.661 1.00 37.23  ? 452 LEU B CD2 1 
ATOM   7794 N  N   . VAL B 1 453 ? -4.388  -24.340 -15.247 1.00 36.88  ? 453 VAL B N   1 
ATOM   7795 C  CA  . VAL B 1 453 ? -3.399  -24.668 -16.268 1.00 38.17  ? 453 VAL B CA  1 
ATOM   7796 C  C   . VAL B 1 453 ? -2.431  -25.697 -15.692 1.00 48.56  ? 453 VAL B C   1 
ATOM   7797 O  O   . VAL B 1 453 ? -1.810  -25.469 -14.645 1.00 52.29  ? 453 VAL B O   1 
ATOM   7798 C  CB  . VAL B 1 453 ? -2.656  -23.405 -16.729 1.00 38.71  ? 453 VAL B CB  1 
ATOM   7799 C  CG1 . VAL B 1 453 ? -1.958  -23.642 -18.056 1.00 50.59  ? 453 VAL B CG1 1 
ATOM   7800 C  CG2 . VAL B 1 453 ? -3.598  -22.212 -16.817 1.00 18.98  ? 453 VAL B CG2 1 
ATOM   7801 N  N   . LYS B 1 454 ? -2.294  -26.840 -16.372 1.00 50.99  ? 454 LYS B N   1 
ATOM   7802 C  CA  . LYS B 1 454 ? -1.452  -27.905 -15.827 1.00 51.10  ? 454 LYS B CA  1 
ATOM   7803 C  C   . LYS B 1 454 ? 0.031   -27.583 -15.969 1.00 44.86  ? 454 LYS B C   1 
ATOM   7804 O  O   . LYS B 1 454 ? 0.816   -27.869 -15.058 1.00 47.29  ? 454 LYS B O   1 
ATOM   7805 C  CB  . LYS B 1 454 ? -1.780  -29.241 -16.493 1.00 60.35  ? 454 LYS B CB  1 
ATOM   7806 C  CG  . LYS B 1 454 ? -3.087  -29.859 -16.006 1.00 72.57  ? 454 LYS B CG  1 
ATOM   7807 C  CD  . LYS B 1 454 ? -3.001  -30.238 -14.534 1.00 78.31  ? 454 LYS B CD  1 
ATOM   7808 C  CE  . LYS B 1 454 ? -4.361  -30.185 -13.856 1.00 77.61  ? 454 LYS B CE  1 
ATOM   7809 N  NZ  . LYS B 1 454 ? -4.211  -29.725 -12.444 1.00 75.43  ? 454 LYS B NZ  1 
ATOM   7810 N  N   . GLU B 1 455 ? 0.435   -26.977 -17.093 1.00 45.55  ? 455 GLU B N   1 
ATOM   7811 C  CA  . GLU B 1 455 ? 1.850   -26.669 -17.306 1.00 49.07  ? 455 GLU B CA  1 
ATOM   7812 C  C   . GLU B 1 455 ? 2.398   -25.669 -16.285 1.00 50.64  ? 455 GLU B C   1 
ATOM   7813 O  O   . GLU B 1 455 ? 3.620   -25.576 -16.123 1.00 49.62  ? 455 GLU B O   1 
ATOM   7814 C  CB  . GLU B 1 455 ? 2.080   -26.157 -18.737 1.00 43.32  ? 455 GLU B CB  1 
ATOM   7815 C  CG  . GLU B 1 455 ? 0.953   -25.296 -19.301 1.00 56.67  ? 455 GLU B CG  1 
ATOM   7816 C  CD  . GLU B 1 455 ? 0.029   -26.055 -20.264 1.00 72.59  ? 455 GLU B CD  1 
ATOM   7817 O  OE1 . GLU B 1 455 ? -0.496  -25.426 -21.215 1.00 84.51  ? 455 GLU B OE1 1 
ATOM   7818 O  OE2 . GLU B 1 455 ? -0.168  -27.279 -20.076 1.00 66.72  ? 455 GLU B OE2 1 
ATOM   7819 N  N   . LEU B 1 456 ? 1.533   -24.934 -15.585 1.00 50.62  ? 456 LEU B N   1 
ATOM   7820 C  CA  . LEU B 1 456 ? 1.988   -24.032 -14.533 1.00 46.74  ? 456 LEU B CA  1 
ATOM   7821 C  C   . LEU B 1 456 ? 2.315   -24.752 -13.240 1.00 53.40  ? 456 LEU B C   1 
ATOM   7822 O  O   . LEU B 1 456 ? 2.660   -24.085 -12.258 1.00 51.66  ? 456 LEU B O   1 
ATOM   7823 C  CB  . LEU B 1 456 ? 0.944   -22.954 -14.261 1.00 38.22  ? 456 LEU B CB  1 
ATOM   7824 C  CG  . LEU B 1 456 ? 0.915   -21.860 -15.326 1.00 35.95  ? 456 LEU B CG  1 
ATOM   7825 C  CD1 . LEU B 1 456 ? -0.268  -20.946 -15.096 1.00 30.61  ? 456 LEU B CD1 1 
ATOM   7826 C  CD2 . LEU B 1 456 ? 2.216   -21.078 -15.293 1.00 34.42  ? 456 LEU B CD2 1 
ATOM   7827 N  N   . ASN B 1 457 ? 2.183   -26.079 -13.222 1.00 62.12  ? 457 ASN B N   1 
ATOM   7828 C  CA  . ASN B 1 457 ? 2.634   -26.956 -12.137 1.00 57.66  ? 457 ASN B CA  1 
ATOM   7829 C  C   . ASN B 1 457 ? 2.133   -26.484 -10.764 1.00 49.16  ? 457 ASN B C   1 
ATOM   7830 O  O   . ASN B 1 457 ? 2.904   -26.181 -9.849  1.00 47.61  ? 457 ASN B O   1 
ATOM   7831 C  CB  . ASN B 1 457 ? 4.164   -27.105 -12.171 1.00 54.28  ? 457 ASN B CB  1 
ATOM   7832 C  CG  . ASN B 1 457 ? 4.648   -28.078 -13.259 1.00 57.41  ? 457 ASN B CG  1 
ATOM   7833 O  OD1 . ASN B 1 457 ? 3.865   -28.840 -13.830 1.00 57.45  ? 457 ASN B OD1 1 
ATOM   7834 N  ND2 . ASN B 1 457 ? 5.949   -28.056 -13.534 1.00 64.62  ? 457 ASN B ND2 1 
ATOM   7835 N  N   . TYR B 1 458 ? 0.812   -26.429 -10.628 1.00 40.35  ? 458 TYR B N   1 
ATOM   7836 C  CA  . TYR B 1 458 ? 0.185   -26.260 -9.326  1.00 29.55  ? 458 TYR B CA  1 
ATOM   7837 C  C   . TYR B 1 458 ? -0.235  -27.616 -8.779  1.00 33.44  ? 458 TYR B C   1 
ATOM   7838 O  O   . TYR B 1 458 ? -0.456  -28.573 -9.527  1.00 38.70  ? 458 TYR B O   1 
ATOM   7839 C  CB  . TYR B 1 458 ? -1.037  -25.354 -9.403  1.00 26.86  ? 458 TYR B CB  1 
ATOM   7840 C  CG  . TYR B 1 458 ? -0.743  -23.882 -9.427  1.00 26.50  ? 458 TYR B CG  1 
ATOM   7841 C  CD1 . TYR B 1 458 ? -0.240  -23.273 -10.560 1.00 35.05  ? 458 TYR B CD1 1 
ATOM   7842 C  CD2 . TYR B 1 458 ? -1.005  -23.094 -8.325  1.00 27.15  ? 458 TYR B CD2 1 
ATOM   7843 C  CE1 . TYR B 1 458 ? 0.013   -21.918 -10.590 1.00 33.82  ? 458 TYR B CE1 1 
ATOM   7844 C  CE2 . TYR B 1 458 ? -0.750  -21.739 -8.345  1.00 35.07  ? 458 TYR B CE2 1 
ATOM   7845 C  CZ  . TYR B 1 458 ? -0.243  -21.156 -9.480  1.00 32.63  ? 458 TYR B CZ  1 
ATOM   7846 O  OH  . TYR B 1 458 ? 0.012   -19.805 -9.499  1.00 35.66  ? 458 TYR B OH  1 
ATOM   7847 N  N   . THR B 1 459 ? -0.338  -27.695 -7.457  1.00 34.58  ? 459 THR B N   1 
ATOM   7848 C  CA  . THR B 1 459 ? -0.780  -28.937 -6.844  1.00 43.48  ? 459 THR B CA  1 
ATOM   7849 C  C   . THR B 1 459 ? -2.268  -29.130 -7.098  1.00 40.89  ? 459 THR B C   1 
ATOM   7850 O  O   . THR B 1 459 ? -3.017  -28.166 -7.283  1.00 46.18  ? 459 THR B O   1 
ATOM   7851 C  CB  . THR B 1 459 ? -0.499  -28.936 -5.341  1.00 45.61  ? 459 THR B CB  1 
ATOM   7852 O  OG1 . THR B 1 459 ? -1.316  -27.945 -4.696  1.00 43.67  ? 459 THR B OG1 1 
ATOM   7853 C  CG2 . THR B 1 459 ? 0.976   -28.655 -5.070  1.00 43.40  ? 459 THR B CG2 1 
ATOM   7854 N  N   . ALA B 1 460 ? -2.692  -30.395 -7.126  1.00 27.87  ? 460 ALA B N   1 
ATOM   7855 C  CA  . ALA B 1 460 ? -4.111  -30.671 -7.305  1.00 28.26  ? 460 ALA B CA  1 
ATOM   7856 C  C   . ALA B 1 460 ? -4.945  -29.957 -6.253  1.00 41.12  ? 460 ALA B C   1 
ATOM   7857 O  O   . ALA B 1 460 ? -6.050  -29.481 -6.545  1.00 53.92  ? 460 ALA B O   1 
ATOM   7858 C  CB  . ALA B 1 460 ? -4.371  -32.173 -7.265  1.00 27.13  ? 460 ALA B CB  1 
ATOM   7859 N  N   . GLU B 1 461 ? -4.418  -29.854 -5.023  1.00 41.70  ? 461 GLU B N   1 
ATOM   7860 C  CA  . GLU B 1 461 ? -5.121  -29.153 -3.951  1.00 34.41  ? 461 GLU B CA  1 
ATOM   7861 C  C   . GLU B 1 461 ? -5.206  -27.655 -4.221  1.00 30.55  ? 461 GLU B C   1 
ATOM   7862 O  O   . GLU B 1 461 ? -6.145  -26.997 -3.765  1.00 34.54  ? 461 GLU B O   1 
ATOM   7863 C  CB  . GLU B 1 461 ? -4.434  -29.393 -2.603  1.00 44.02  ? 461 GLU B CB  1 
ATOM   7864 C  CG  . GLU B 1 461 ? -4.063  -30.844 -2.279  1.00 69.74  ? 461 GLU B CG  1 
ATOM   7865 C  CD  . GLU B 1 461 ? -2.736  -31.303 -2.902  1.00 89.60  ? 461 GLU B CD  1 
ATOM   7866 O  OE1 . GLU B 1 461 ? -1.700  -31.278 -2.194  1.00 88.52  ? 461 GLU B OE1 1 
ATOM   7867 O  OE2 . GLU B 1 461 ? -2.731  -31.704 -4.091  1.00 99.97  ? 461 GLU B OE2 1 
ATOM   7868 N  N   . GLU B 1 462 ? -4.239  -27.097 -4.947  1.00 29.26  ? 462 GLU B N   1 
ATOM   7869 C  CA  . GLU B 1 462 ? -4.320  -25.689 -5.316  1.00 28.28  ? 462 GLU B CA  1 
ATOM   7870 C  C   . GLU B 1 462 ? -5.363  -25.452 -6.397  1.00 30.62  ? 462 GLU B C   1 
ATOM   7871 O  O   . GLU B 1 462 ? -6.028  -24.407 -6.393  1.00 17.24  ? 462 GLU B O   1 
ATOM   7872 C  CB  . GLU B 1 462 ? -2.950  -25.186 -5.767  1.00 28.47  ? 462 GLU B CB  1 
ATOM   7873 C  CG  . GLU B 1 462 ? -2.194  -24.495 -4.644  1.00 33.40  ? 462 GLU B CG  1 
ATOM   7874 C  CD  . GLU B 1 462 ? -0.698  -24.613 -4.771  1.00 31.94  ? 462 GLU B CD  1 
ATOM   7875 O  OE1 . GLU B 1 462 ? -0.223  -25.244 -5.740  1.00 33.24  ? 462 GLU B OE1 1 
ATOM   7876 O  OE2 . GLU B 1 462 ? -0.001  -24.054 -3.902  1.00 35.19  ? 462 GLU B OE2 1 
ATOM   7877 N  N   . GLU B 1 463 ? -5.498  -26.405 -7.333  1.00 34.71  ? 463 GLU B N   1 
ATOM   7878 C  CA  . GLU B 1 463 ? -6.529  -26.310 -8.362  1.00 34.75  ? 463 GLU B CA  1 
ATOM   7879 C  C   . GLU B 1 463 ? -7.910  -26.243 -7.739  1.00 38.87  ? 463 GLU B C   1 
ATOM   7880 O  O   . GLU B 1 463 ? -8.756  -25.449 -8.170  1.00 39.83  ? 463 GLU B O   1 
ATOM   7881 C  CB  . GLU B 1 463 ? -6.452  -27.504 -9.316  1.00 35.49  ? 463 GLU B CB  1 
ATOM   7882 C  CG  . GLU B 1 463 ? -7.496  -27.459 -10.449 1.00 36.08  ? 463 GLU B CG  1 
ATOM   7883 C  CD  . GLU B 1 463 ? -7.615  -28.778 -11.225 1.00 46.34  ? 463 GLU B CD  1 
ATOM   7884 O  OE1 . GLU B 1 463 ? -6.653  -29.577 -11.226 1.00 53.00  ? 463 GLU B OE1 1 
ATOM   7885 O  OE2 . GLU B 1 463 ? -8.696  -29.045 -11.805 1.00 49.54  ? 463 GLU B OE2 1 
ATOM   7886 N  N   . ALA B 1 464 ? -8.159  -27.079 -6.727  1.00 38.94  ? 464 ALA B N   1 
ATOM   7887 C  CA  . ALA B 1 464 ? -9.465  -27.085 -6.078  1.00 36.36  ? 464 ALA B CA  1 
ATOM   7888 C  C   . ALA B 1 464 ? -9.738  -25.754 -5.392  1.00 38.41  ? 464 ALA B C   1 
ATOM   7889 O  O   . ALA B 1 464 ? -10.850 -25.217 -5.471  1.00 35.15  ? 464 ALA B O   1 
ATOM   7890 C  CB  . ALA B 1 464 ? -9.551  -28.241 -5.081  1.00 19.20  ? 464 ALA B CB  1 
ATOM   7891 N  N   . LEU B 1 465 ? -8.732  -25.194 -4.726  1.00 34.75  ? 465 LEU B N   1 
ATOM   7892 C  CA  . LEU B 1 465 ? -8.966  -23.932 -4.045  1.00 33.63  ? 465 LEU B CA  1 
ATOM   7893 C  C   . LEU B 1 465 ? -9.248  -22.825 -5.055  1.00 34.11  ? 465 LEU B C   1 
ATOM   7894 O  O   . LEU B 1 465 ? -10.118 -21.977 -4.828  1.00 36.90  ? 465 LEU B O   1 
ATOM   7895 C  CB  . LEU B 1 465 ? -7.781  -23.598 -3.136  1.00 23.33  ? 465 LEU B CB  1 
ATOM   7896 C  CG  . LEU B 1 465 ? -7.733  -22.170 -2.594  1.00 23.52  ? 465 LEU B CG  1 
ATOM   7897 C  CD1 . LEU B 1 465 ? -8.749  -22.034 -1.487  1.00 18.21  ? 465 LEU B CD1 1 
ATOM   7898 C  CD2 . LEU B 1 465 ? -6.353  -21.784 -2.082  1.00 15.74  ? 465 LEU B CD2 1 
ATOM   7899 N  N   . SER B 1 466 ? -8.580  -22.851 -6.207  1.00 31.36  ? 466 SER B N   1 
ATOM   7900 C  CA  . SER B 1 466 ? -8.893  -21.857 -7.225  1.00 26.55  ? 466 SER B CA  1 
ATOM   7901 C  C   . SER B 1 466 ? -10.318 -22.021 -7.731  1.00 27.05  ? 466 SER B C   1 
ATOM   7902 O  O   . SER B 1 466 ? -11.062 -21.039 -7.841  1.00 28.44  ? 466 SER B O   1 
ATOM   7903 C  CB  . SER B 1 466 ? -7.914  -21.959 -8.383  1.00 24.49  ? 466 SER B CB  1 
ATOM   7904 O  OG  . SER B 1 466 ? -8.214  -20.951 -9.326  1.00 27.94  ? 466 SER B OG  1 
ATOM   7905 N  N   . ARG B 1 467 ? -10.715 -23.260 -8.029  1.00 28.30  ? 467 ARG B N   1 
ATOM   7906 C  CA  . ARG B 1 467 ? -12.049 -23.512 -8.565  1.00 31.82  ? 467 ARG B CA  1 
ATOM   7907 C  C   . ARG B 1 467 ? -13.143 -23.034 -7.616  1.00 30.23  ? 467 ARG B C   1 
ATOM   7908 O  O   . ARG B 1 467 ? -14.101 -22.370 -8.043  1.00 28.76  ? 467 ARG B O   1 
ATOM   7909 C  CB  . ARG B 1 467 ? -12.219 -24.996 -8.861  1.00 37.32  ? 467 ARG B CB  1 
ATOM   7910 C  CG  . ARG B 1 467 ? -11.301 -25.506 -9.938  1.00 41.92  ? 467 ARG B CG  1 
ATOM   7911 C  CD  . ARG B 1 467 ? -11.650 -26.944 -10.313 1.00 42.67  ? 467 ARG B CD  1 
ATOM   7912 N  NE  . ARG B 1 467 ? -11.298 -27.222 -11.699 1.00 37.52  ? 467 ARG B NE  1 
ATOM   7913 C  CZ  . ARG B 1 467 ? -11.999 -26.778 -12.733 1.00 37.66  ? 467 ARG B CZ  1 
ATOM   7914 N  NH1 . ARG B 1 467 ? -13.086 -26.041 -12.524 1.00 37.22  ? 467 ARG B NH1 1 
ATOM   7915 N  NH2 . ARG B 1 467 ? -11.612 -27.069 -13.969 1.00 41.32  ? 467 ARG B NH2 1 
ATOM   7916 N  N   . ARG B 1 468 ? -13.029 -23.353 -6.329  1.00 30.45  ? 468 ARG B N   1 
ATOM   7917 C  CA  . ARG B 1 468 ? -14.071 -22.882 -5.430  1.00 41.51  ? 468 ARG B CA  1 
ATOM   7918 C  C   . ARG B 1 468 ? -13.905 -21.420 -5.042  1.00 30.88  ? 468 ARG B C   1 
ATOM   7919 O  O   . ARG B 1 468 ? -14.872 -20.821 -4.548  1.00 33.69  ? 468 ARG B O   1 
ATOM   7920 C  CB  . ARG B 1 468 ? -14.159 -23.757 -4.183  1.00 46.29  ? 468 ARG B CB  1 
ATOM   7921 C  CG  . ARG B 1 468 ? -12.938 -23.803 -3.339  1.00 49.92  ? 468 ARG B CG  1 
ATOM   7922 C  CD  . ARG B 1 468 ? -13.195 -24.735 -2.180  1.00 51.74  ? 468 ARG B CD  1 
ATOM   7923 N  NE  . ARG B 1 468 ? -13.530 -23.998 -0.975  1.00 52.25  ? 468 ARG B NE  1 
ATOM   7924 C  CZ  . ARG B 1 468 ? -12.635 -23.652 -0.061  1.00 54.15  ? 468 ARG B CZ  1 
ATOM   7925 N  NH1 . ARG B 1 468 ? -11.360 -23.986 -0.231  1.00 45.74  ? 468 ARG B NH1 1 
ATOM   7926 N  NH2 . ARG B 1 468 ? -13.013 -22.980 1.019   1.00 59.61  ? 468 ARG B NH2 1 
ATOM   7927 N  N   . ILE B 1 469 ? -12.733 -20.822 -5.274  1.00 18.40  ? 469 ILE B N   1 
ATOM   7928 C  CA  . ILE B 1 469 ? -12.620 -19.383 -5.066  1.00 19.72  ? 469 ILE B CA  1 
ATOM   7929 C  C   . ILE B 1 469 ? -13.329 -18.634 -6.178  1.00 18.85  ? 469 ILE B C   1 
ATOM   7930 O  O   . ILE B 1 469 ? -14.109 -17.710 -5.918  1.00 22.85  ? 469 ILE B O   1 
ATOM   7931 C  CB  . ILE B 1 469 ? -11.160 -18.928 -4.959  1.00 31.96  ? 469 ILE B CB  1 
ATOM   7932 C  CG1 . ILE B 1 469 ? -10.584 -19.217 -3.570  1.00 36.57  ? 469 ILE B CG1 1 
ATOM   7933 C  CG2 . ILE B 1 469 ? -11.087 -17.435 -5.257  1.00 28.36  ? 469 ILE B CG2 1 
ATOM   7934 C  CD1 . ILE B 1 469 ? -9.107  -18.828 -3.438  1.00 33.68  ? 469 ILE B CD1 1 
ATOM   7935 N  N   . MET B 1 470 ? -13.074 -19.012 -7.438  1.00 22.61  ? 470 MET B N   1 
ATOM   7936 C  CA  . MET B 1 470 ? -13.809 -18.356 -8.519  1.00 20.52  ? 470 MET B CA  1 
ATOM   7937 C  C   . MET B 1 470 ? -15.307 -18.569 -8.386  1.00 23.66  ? 470 MET B C   1 
ATOM   7938 O  O   . MET B 1 470 ? -16.096 -17.657 -8.666  1.00 25.42  ? 470 MET B O   1 
ATOM   7939 C  CB  . MET B 1 470 ? -13.345 -18.788 -9.902  1.00 19.06  ? 470 MET B CB  1 
ATOM   7940 C  CG  . MET B 1 470 ? -11.874 -19.053 -10.085 1.00 36.21  ? 470 MET B CG  1 
ATOM   7941 S  SD  . MET B 1 470 ? -11.471 -19.331 -11.835 1.00 41.81  ? 470 MET B SD  1 
ATOM   7942 C  CE  . MET B 1 470 ? -11.829 -21.069 -11.979 1.00 38.16  ? 470 MET B CE  1 
ATOM   7943 N  N   . HIS B 1 471 ? -15.728 -19.742 -7.927  1.00 26.26  ? 471 HIS B N   1 
ATOM   7944 C  CA  . HIS B 1 471 ? -17.155 -19.940 -7.728  1.00 30.59  ? 471 HIS B CA  1 
ATOM   7945 C  C   . HIS B 1 471 ? -17.709 -18.979 -6.673  1.00 37.81  ? 471 HIS B C   1 
ATOM   7946 O  O   . HIS B 1 471 ? -18.722 -18.310 -6.906  1.00 38.87  ? 471 HIS B O   1 
ATOM   7947 C  CB  . HIS B 1 471 ? -17.424 -21.384 -7.370  1.00 24.01  ? 471 HIS B CB  1 
ATOM   7948 C  CG  . HIS B 1 471 ? -18.822 -21.787 -7.664  1.00 29.34  ? 471 HIS B CG  1 
ATOM   7949 N  ND1 . HIS B 1 471 ? -19.279 -22.009 -8.942  1.00 31.59  ? 471 HIS B ND1 1 
ATOM   7950 C  CD2 . HIS B 1 471 ? -19.889 -21.947 -6.849  1.00 35.33  ? 471 HIS B CD2 1 
ATOM   7951 C  CE1 . HIS B 1 471 ? -20.560 -22.331 -8.901  1.00 30.62  ? 471 HIS B CE1 1 
ATOM   7952 N  NE2 . HIS B 1 471 ? -20.954 -22.298 -7.642  1.00 32.02  ? 471 HIS B NE2 1 
ATOM   7953 N  N   . TYR B 1 472 ? -17.056 -18.899 -5.505  1.00 36.26  ? 472 TYR B N   1 
ATOM   7954 C  CA  . TYR B 1 472 ? -17.386 -17.856 -4.532  1.00 30.23  ? 472 TYR B CA  1 
ATOM   7955 C  C   . TYR B 1 472 ? -17.513 -16.504 -5.218  1.00 26.31  ? 472 TYR B C   1 
ATOM   7956 O  O   . TYR B 1 472 ? -18.545 -15.830 -5.132  1.00 33.68  ? 472 TYR B O   1 
ATOM   7957 C  CB  . TYR B 1 472 ? -16.315 -17.765 -3.439  1.00 26.36  ? 472 TYR B CB  1 
ATOM   7958 C  CG  . TYR B 1 472 ? -16.274 -18.887 -2.431  1.00 25.83  ? 472 TYR B CG  1 
ATOM   7959 C  CD1 . TYR B 1 472 ? -17.415 -19.584 -2.084  1.00 26.58  ? 472 TYR B CD1 1 
ATOM   7960 C  CD2 . TYR B 1 472 ? -15.075 -19.234 -1.805  1.00 30.20  ? 472 TYR B CD2 1 
ATOM   7961 C  CE1 . TYR B 1 472 ? -17.361 -20.613 -1.148  1.00 33.40  ? 472 TYR B CE1 1 
ATOM   7962 C  CE2 . TYR B 1 472 ? -15.005 -20.262 -0.867  1.00 21.36  ? 472 TYR B CE2 1 
ATOM   7963 C  CZ  . TYR B 1 472 ? -16.152 -20.947 -0.546  1.00 35.03  ? 472 TYR B CZ  1 
ATOM   7964 O  OH  . TYR B 1 472 ? -16.108 -21.969 0.378   1.00 48.36  ? 472 TYR B OH  1 
ATOM   7965 N  N   . TRP B 1 473 ? -16.458 -16.103 -5.923  1.00 27.03  ? 473 TRP B N   1 
ATOM   7966 C  CA  . TRP B 1 473 ? -16.457 -14.810 -6.599  1.00 36.31  ? 473 TRP B CA  1 
ATOM   7967 C  C   . TRP B 1 473 ? -17.605 -14.706 -7.590  1.00 34.86  ? 473 TRP B C   1 
ATOM   7968 O  O   . TRP B 1 473 ? -18.372 -13.739 -7.575  1.00 34.18  ? 473 TRP B O   1 
ATOM   7969 C  CB  . TRP B 1 473 ? -15.120 -14.601 -7.306  1.00 26.30  ? 473 TRP B CB  1 
ATOM   7970 C  CG  . TRP B 1 473 ? -14.112 -13.847 -6.507  1.00 17.19  ? 473 TRP B CG  1 
ATOM   7971 C  CD1 . TRP B 1 473 ? -13.410 -12.755 -6.913  1.00 18.50  ? 473 TRP B CD1 1 
ATOM   7972 C  CD2 . TRP B 1 473 ? -13.705 -14.108 -5.165  1.00 24.86  ? 473 TRP B CD2 1 
ATOM   7973 N  NE1 . TRP B 1 473 ? -12.580 -12.324 -5.915  1.00 27.82  ? 473 TRP B NE1 1 
ATOM   7974 C  CE2 . TRP B 1 473 ? -12.741 -13.140 -4.827  1.00 30.25  ? 473 TRP B CE2 1 
ATOM   7975 C  CE3 . TRP B 1 473 ? -14.060 -15.064 -4.211  1.00 31.12  ? 473 TRP B CE3 1 
ATOM   7976 C  CZ2 . TRP B 1 473 ? -12.118 -13.107 -3.578  1.00 24.86  ? 473 TRP B CZ2 1 
ATOM   7977 C  CZ3 . TRP B 1 473 ? -13.440 -15.030 -2.969  1.00 27.30  ? 473 TRP B CZ3 1 
ATOM   7978 C  CH2 . TRP B 1 473 ? -12.484 -14.058 -2.666  1.00 23.43  ? 473 TRP B CH2 1 
ATOM   7979 N  N   . ALA B 1 474 ? -17.749 -15.708 -8.450  1.00 29.80  ? 474 ALA B N   1 
ATOM   7980 C  CA  . ALA B 1 474 ? -18.757 -15.629 -9.495  1.00 28.60  ? 474 ALA B CA  1 
ATOM   7981 C  C   . ALA B 1 474 ? -20.158 -15.790 -8.925  1.00 30.15  ? 474 ALA B C   1 
ATOM   7982 O  O   . ALA B 1 474 ? -21.070 -15.033 -9.281  1.00 33.26  ? 474 ALA B O   1 
ATOM   7983 C  CB  . ALA B 1 474 ? -18.477 -16.684 -10.559 1.00 36.04  ? 474 ALA B CB  1 
ATOM   7984 N  N   . THR B 1 475 ? -20.357 -16.788 -8.054  1.00 27.26  ? 475 THR B N   1 
ATOM   7985 C  CA  . THR B 1 475 ? -21.664 -16.961 -7.425  1.00 25.39  ? 475 THR B CA  1 
ATOM   7986 C  C   . THR B 1 475 ? -22.071 -15.703 -6.678  1.00 27.37  ? 475 THR B C   1 
ATOM   7987 O  O   . THR B 1 475 ? -23.233 -15.293 -6.723  1.00 24.38  ? 475 THR B O   1 
ATOM   7988 C  CB  . THR B 1 475 ? -21.648 -18.152 -6.475  1.00 27.26  ? 475 THR B CB  1 
ATOM   7989 O  OG1 . THR B 1 475 ? -21.149 -19.299 -7.175  1.00 37.50  ? 475 THR B OG1 1 
ATOM   7990 C  CG2 . THR B 1 475 ? -23.043 -18.436 -5.915  1.00 17.92  ? 475 THR B CG2 1 
ATOM   7991 N  N   . PHE B 1 476 ? -21.117 -15.049 -6.014  1.00 35.05  ? 476 PHE B N   1 
ATOM   7992 C  CA  . PHE B 1 476 ? -21.449 -13.792 -5.355  1.00 28.36  ? 476 PHE B CA  1 
ATOM   7993 C  C   . PHE B 1 476 ? -21.820 -12.725 -6.379  1.00 21.80  ? 476 PHE B C   1 
ATOM   7994 O  O   . PHE B 1 476 ? -22.753 -11.944 -6.162  1.00 19.05  ? 476 PHE B O   1 
ATOM   7995 C  CB  . PHE B 1 476 ? -20.289 -13.337 -4.452  1.00 22.31  ? 476 PHE B CB  1 
ATOM   7996 C  CG  . PHE B 1 476 ? -20.359 -11.883 -4.046  1.00 25.31  ? 476 PHE B CG  1 
ATOM   7997 C  CD1 . PHE B 1 476 ? -21.061 -11.523 -2.909  1.00 15.77  ? 476 PHE B CD1 1 
ATOM   7998 C  CD2 . PHE B 1 476 ? -19.683 -10.898 -4.746  1.00 15.33  ? 476 PHE B CD2 1 
ATOM   7999 C  CE1 . PHE B 1 476 ? -21.151 -10.216 -2.511  1.00 15.71  ? 476 PHE B CE1 1 
ATOM   8000 C  CE2 . PHE B 1 476 ? -19.762 -9.584  -4.334  1.00 29.34  ? 476 PHE B CE2 1 
ATOM   8001 C  CZ  . PHE B 1 476 ? -20.506 -9.246  -3.204  1.00 15.47  ? 476 PHE B CZ  1 
ATOM   8002 N  N   . ALA B 1 477 ? -21.132 -12.708 -7.526  1.00 33.01  ? 477 ALA B N   1 
ATOM   8003 C  CA  . ALA B 1 477 ? -21.371 -11.662 -8.520  1.00 31.54  ? 477 ALA B CA  1 
ATOM   8004 C  C   . ALA B 1 477 ? -22.792 -11.708 -9.074  1.00 32.31  ? 477 ALA B C   1 
ATOM   8005 O  O   . ALA B 1 477 ? -23.348 -10.658 -9.422  1.00 35.07  ? 477 ALA B O   1 
ATOM   8006 C  CB  . ALA B 1 477 ? -20.354 -11.768 -9.660  1.00 16.17  ? 477 ALA B CB  1 
ATOM   8007 N  N   . LYS B 1 478 ? -23.393 -12.902 -9.177  1.00 23.48  ? 478 LYS B N   1 
ATOM   8008 C  CA  . LYS B 1 478 ? -24.776 -13.011 -9.651  1.00 30.95  ? 478 LYS B CA  1 
ATOM   8009 C  C   . LYS B 1 478 ? -25.793 -12.940 -8.511  1.00 31.81  ? 478 LYS B C   1 
ATOM   8010 O  O   . LYS B 1 478 ? -26.707 -12.109 -8.541  1.00 34.89  ? 478 LYS B O   1 
ATOM   8011 C  CB  . LYS B 1 478 ? -24.983 -14.305 -10.449 1.00 36.81  ? 478 LYS B CB  1 
ATOM   8012 C  CG  . LYS B 1 478 ? -24.216 -15.504 -9.952  1.00 45.46  ? 478 LYS B CG  1 
ATOM   8013 C  CD  . LYS B 1 478 ? -24.087 -16.579 -11.037 1.00 52.16  ? 478 LYS B CD  1 
ATOM   8014 C  CE  . LYS B 1 478 ? -22.741 -16.438 -11.771 1.00 40.80  ? 478 LYS B CE  1 
ATOM   8015 N  NZ  . LYS B 1 478 ? -22.162 -17.709 -12.306 1.00 26.08  ? 478 LYS B NZ  1 
ATOM   8016 N  N   . THR B 1 479 ? -25.646 -13.803 -7.499  1.00 28.69  ? 479 THR B N   1 
ATOM   8017 C  CA  . THR B 1 479 ? -26.641 -13.904 -6.442  1.00 23.23  ? 479 THR B CA  1 
ATOM   8018 C  C   . THR B 1 479 ? -26.470 -12.824 -5.380  1.00 24.20  ? 479 THR B C   1 
ATOM   8019 O  O   . THR B 1 479 ? -27.407 -12.562 -4.621  1.00 23.89  ? 479 THR B O   1 
ATOM   8020 C  CB  . THR B 1 479 ? -26.555 -15.260 -5.742  1.00 37.90  ? 479 THR B CB  1 
ATOM   8021 O  OG1 . THR B 1 479 ? -25.230 -15.458 -5.251  1.00 55.79  ? 479 THR B OG1 1 
ATOM   8022 C  CG2 . THR B 1 479 ? -26.848 -16.395 -6.743  1.00 19.10  ? 479 THR B CG2 1 
ATOM   8023 N  N   . GLY B 1 480 ? -25.305 -12.186 -5.305  1.00 33.06  ? 480 GLY B N   1 
ATOM   8024 C  CA  . GLY B 1 480 ? -25.022 -11.352 -4.154  1.00 31.00  ? 480 GLY B CA  1 
ATOM   8025 C  C   . GLY B 1 480 ? -24.648 -12.115 -2.904  1.00 25.37  ? 480 GLY B C   1 
ATOM   8026 O  O   . GLY B 1 480 ? -24.621 -11.517 -1.824  1.00 18.83  ? 480 GLY B O   1 
ATOM   8027 N  N   . ASN B 1 481 ? -24.343 -13.416 -3.019  1.00 18.23  ? 481 ASN B N   1 
ATOM   8028 C  CA  . ASN B 1 481 ? -24.025 -14.278 -1.883  1.00 22.32  ? 481 ASN B CA  1 
ATOM   8029 C  C   . ASN B 1 481 ? -23.070 -15.360 -2.373  1.00 24.45  ? 481 ASN B C   1 
ATOM   8030 O  O   . ASN B 1 481 ? -23.404 -16.086 -3.320  1.00 28.40  ? 481 ASN B O   1 
ATOM   8031 C  CB  . ASN B 1 481 ? -25.299 -14.887 -1.268  1.00 25.78  ? 481 ASN B CB  1 
ATOM   8032 C  CG  . ASN B 1 481 ? -25.043 -16.097 -0.354  1.00 25.08  ? 481 ASN B CG  1 
ATOM   8033 O  OD1 . ASN B 1 481 ? -24.021 -16.782 -0.414  1.00 33.26  ? 481 ASN B OD1 1 
ATOM   8034 N  ND2 . ASN B 1 481 ? -26.002 -16.351 0.514   1.00 31.08  ? 481 ASN B ND2 1 
ATOM   8035 N  N   . PRO B 1 482 ? -21.925 -15.525 -1.705  1.00 27.59  ? 482 PRO B N   1 
ATOM   8036 C  CA  . PRO B 1 482 ? -20.932 -16.516 -2.145  1.00 20.22  ? 482 PRO B CA  1 
ATOM   8037 C  C   . PRO B 1 482 ? -21.492 -17.907 -2.310  1.00 19.57  ? 482 PRO B C   1 
ATOM   8038 O  O   . PRO B 1 482 ? -20.984 -18.663 -3.145  1.00 21.25  ? 482 PRO B O   1 
ATOM   8039 C  CB  . PRO B 1 482 ? -19.885 -16.497 -1.016  1.00 23.65  ? 482 PRO B CB  1 
ATOM   8040 C  CG  . PRO B 1 482 ? -20.074 -15.215 -0.309  1.00 24.54  ? 482 PRO B CG  1 
ATOM   8041 C  CD  . PRO B 1 482 ? -21.535 -14.854 -0.454  1.00 30.32  ? 482 PRO B CD  1 
ATOM   8042 N  N   . ASN B 1 483 ? -22.500 -18.283 -1.529  1.00 17.52  ? 483 ASN B N   1 
ATOM   8043 C  CA  . ASN B 1 483 ? -22.884 -19.680 -1.436  1.00 18.09  ? 483 ASN B CA  1 
ATOM   8044 C  C   . ASN B 1 483 ? -24.022 -19.991 -2.381  1.00 34.46  ? 483 ASN B C   1 
ATOM   8045 O  O   . ASN B 1 483 ? -24.785 -19.110 -2.783  1.00 42.56  ? 483 ASN B O   1 
ATOM   8046 C  CB  . ASN B 1 483 ? -23.294 -20.043 -0.004  1.00 35.61  ? 483 ASN B CB  1 
ATOM   8047 C  CG  . ASN B 1 483 ? -22.392 -19.424 1.033   1.00 29.81  ? 483 ASN B CG  1 
ATOM   8048 O  OD1 . ASN B 1 483 ? -21.342 -19.977 1.339   1.00 29.55  ? 483 ASN B OD1 1 
ATOM   8049 N  ND2 . ASN B 1 483 ? -22.806 -18.296 1.604   1.00 17.80  ? 483 ASN B ND2 1 
ATOM   8050 N  N   . GLU B 1 484 ? -24.119 -21.268 -2.748  1.00 30.44  ? 484 GLU B N   1 
ATOM   8051 C  CA  . GLU B 1 484 ? -25.326 -21.780 -3.372  1.00 40.35  ? 484 GLU B CA  1 
ATOM   8052 C  C   . GLU B 1 484 ? -26.267 -22.240 -2.274  1.00 57.56  ? 484 GLU B C   1 
ATOM   8053 O  O   . GLU B 1 484 ? -25.915 -23.160 -1.523  1.00 60.50  ? 484 GLU B O   1 
ATOM   8054 C  CB  . GLU B 1 484 ? -25.009 -22.924 -4.309  1.00 45.64  ? 484 GLU B CB  1 
ATOM   8055 C  CG  . GLU B 1 484 ? -24.738 -22.469 -5.720  1.00 58.72  ? 484 GLU B CG  1 
ATOM   8056 C  CD  . GLU B 1 484 ? -23.743 -23.353 -6.436  1.00 65.69  ? 484 GLU B CD  1 
ATOM   8057 O  OE1 . GLU B 1 484 ? -22.833 -23.895 -5.757  1.00 67.13  ? 484 GLU B OE1 1 
ATOM   8058 O  OE2 . GLU B 1 484 ? -23.883 -23.509 -7.674  1.00 62.71  ? 484 GLU B OE2 1 
ATOM   8059 N  N   . PRO B 1 485 ? -27.436 -21.620 -2.114  1.00 69.59  ? 485 PRO B N   1 
ATOM   8060 C  CA  . PRO B 1 485 ? -28.323 -22.013 -1.015  1.00 67.99  ? 485 PRO B CA  1 
ATOM   8061 C  C   . PRO B 1 485 ? -28.791 -23.452 -1.187  1.00 71.76  ? 485 PRO B C   1 
ATOM   8062 O  O   . PRO B 1 485 ? -28.843 -23.986 -2.300  1.00 58.41  ? 485 PRO B O   1 
ATOM   8063 C  CB  . PRO B 1 485 ? -29.484 -21.018 -1.118  1.00 62.11  ? 485 PRO B CB  1 
ATOM   8064 C  CG  . PRO B 1 485 ? -29.494 -20.601 -2.555  1.00 70.02  ? 485 PRO B CG  1 
ATOM   8065 C  CD  . PRO B 1 485 ? -28.063 -20.645 -3.024  1.00 70.88  ? 485 PRO B CD  1 
ATOM   8066 N  N   . HIS B 1 486 ? -29.118 -24.076 -0.059  1.00 83.66  ? 486 HIS B N   1 
ATOM   8067 C  CA  . HIS B 1 486 ? -29.489 -25.492 0.027   1.00 94.33  ? 486 HIS B CA  1 
ATOM   8068 C  C   . HIS B 1 486 ? -28.636 -26.367 -0.905  1.00 87.40  ? 486 HIS B C   1 
ATOM   8069 O  O   . HIS B 1 486 ? -29.130 -27.094 -1.765  1.00 88.28  ? 486 HIS B O   1 
ATOM   8070 C  CB  . HIS B 1 486 ? -30.998 -25.695 -0.205  1.00 100.70 ? 486 HIS B CB  1 
ATOM   8071 C  CG  . HIS B 1 486 ? -31.535 -25.110 -1.480  1.00 103.70 ? 486 HIS B CG  1 
ATOM   8072 N  ND1 . HIS B 1 486 ? -30.935 -25.296 -2.707  1.00 103.20 ? 486 HIS B ND1 1 
ATOM   8073 C  CD2 . HIS B 1 486 ? -32.646 -24.371 -1.716  1.00 100.63 ? 486 HIS B CD2 1 
ATOM   8074 C  CE1 . HIS B 1 486 ? -31.641 -24.680 -3.639  1.00 98.73  ? 486 HIS B CE1 1 
ATOM   8075 N  NE2 . HIS B 1 486 ? -32.684 -24.110 -3.064  1.00 95.36  ? 486 HIS B NE2 1 
ATOM   8076 N  N   . SER B 1 487 ? -27.323 -26.273 -0.705  1.00 80.81  ? 487 SER B N   1 
ATOM   8077 C  CA  . SER B 1 487 ? -26.338 -27.168 -1.293  1.00 69.81  ? 487 SER B CA  1 
ATOM   8078 C  C   . SER B 1 487 ? -25.425 -27.680 -0.182  1.00 73.65  ? 487 SER B C   1 
ATOM   8079 O  O   . SER B 1 487 ? -25.401 -27.145 0.931   1.00 76.66  ? 487 SER B O   1 
ATOM   8080 C  CB  . SER B 1 487 ? -25.515 -26.468 -2.371  1.00 65.55  ? 487 SER B CB  1 
ATOM   8081 O  OG  . SER B 1 487 ? -24.436 -25.783 -1.764  1.00 67.10  ? 487 SER B OG  1 
ATOM   8082 N  N   . GLN B 1 488 ? -24.644 -28.712 -0.497  1.00 72.86  ? 488 GLN B N   1 
ATOM   8083 C  CA  . GLN B 1 488 ? -24.004 -29.494 0.557   1.00 77.61  ? 488 GLN B CA  1 
ATOM   8084 C  C   . GLN B 1 488 ? -22.734 -28.840 1.097   1.00 73.56  ? 488 GLN B C   1 
ATOM   8085 O  O   . GLN B 1 488 ? -22.420 -29.002 2.282   1.00 72.04  ? 488 GLN B O   1 
ATOM   8086 C  CB  . GLN B 1 488 ? -23.690 -30.907 0.053   1.00 81.50  ? 488 GLN B CB  1 
ATOM   8087 C  CG  . GLN B 1 488 ? -24.836 -31.621 -0.634  1.00 86.83  ? 488 GLN B CG  1 
ATOM   8088 C  CD  . GLN B 1 488 ? -25.019 -31.174 -2.075  1.00 98.72  ? 488 GLN B CD  1 
ATOM   8089 O  OE1 . GLN B 1 488 ? -24.185 -30.440 -2.619  1.00 104.45 ? 488 GLN B OE1 1 
ATOM   8090 N  NE2 . GLN B 1 488 ? -26.112 -31.617 -2.703  1.00 98.37  ? 488 GLN B NE2 1 
ATOM   8091 N  N   . GLU B 1 489 ? -22.007 -28.099 0.262   1.00 70.76  ? 489 GLU B N   1 
ATOM   8092 C  CA  . GLU B 1 489 ? -20.719 -27.538 0.661   1.00 68.02  ? 489 GLU B CA  1 
ATOM   8093 C  C   . GLU B 1 489 ? -20.865 -26.633 1.881   1.00 67.64  ? 489 GLU B C   1 
ATOM   8094 O  O   . GLU B 1 489 ? -21.897 -25.985 2.075   1.00 67.37  ? 489 GLU B O   1 
ATOM   8095 C  CB  . GLU B 1 489 ? -20.112 -26.747 -0.495  1.00 70.42  ? 489 GLU B CB  1 
ATOM   8096 C  CG  . GLU B 1 489 ? -20.288 -27.361 -1.892  1.00 79.17  ? 489 GLU B CG  1 
ATOM   8097 C  CD  . GLU B 1 489 ? -19.448 -28.622 -2.146  1.00 84.58  ? 489 GLU B CD  1 
ATOM   8098 O  OE1 . GLU B 1 489 ? -18.830 -28.712 -3.236  1.00 83.42  ? 489 GLU B OE1 1 
ATOM   8099 O  OE2 . GLU B 1 489 ? -19.401 -29.530 -1.280  1.00 89.38  ? 489 GLU B OE2 1 
ATOM   8100 N  N   . SER B 1 490 ? -19.823 -26.600 2.718   1.00 64.31  ? 490 SER B N   1 
ATOM   8101 C  CA  . SER B 1 490 ? -19.861 -25.763 3.915   1.00 58.69  ? 490 SER B CA  1 
ATOM   8102 C  C   . SER B 1 490 ? -20.050 -24.303 3.516   1.00 45.11  ? 490 SER B C   1 
ATOM   8103 O  O   . SER B 1 490 ? -19.592 -23.869 2.457   1.00 50.48  ? 490 SER B O   1 
ATOM   8104 C  CB  . SER B 1 490 ? -18.581 -25.938 4.749   1.00 56.85  ? 490 SER B CB  1 
ATOM   8105 O  OG  . SER B 1 490 ? -17.485 -26.426 3.982   1.00 49.07  ? 490 SER B OG  1 
ATOM   8106 N  N   . LYS B 1 491 ? -20.731 -23.539 4.370   1.00 32.33  ? 491 LYS B N   1 
ATOM   8107 C  CA  . LYS B 1 491 ? -21.278 -22.246 3.973   1.00 30.57  ? 491 LYS B CA  1 
ATOM   8108 C  C   . LYS B 1 491 ? -20.552 -21.081 4.643   1.00 37.91  ? 491 LYS B C   1 
ATOM   8109 O  O   . LYS B 1 491 ? -20.452 -21.010 5.874   1.00 38.96  ? 491 LYS B O   1 
ATOM   8110 C  CB  . LYS B 1 491 ? -22.779 -22.192 4.243   1.00 19.39  ? 491 LYS B CB  1 
ATOM   8111 C  CG  . LYS B 1 491 ? -23.526 -23.382 3.647   1.00 37.28  ? 491 LYS B CG  1 
ATOM   8112 C  CD  . LYS B 1 491 ? -24.725 -22.947 2.816   1.00 47.37  ? 491 LYS B CD  1 
ATOM   8113 C  CE  . LYS B 1 491 ? -25.238 -24.120 1.991   1.00 53.57  ? 491 LYS B CE  1 
ATOM   8114 N  NZ  . LYS B 1 491 ? -25.877 -25.148 2.874   1.00 57.68  ? 491 LYS B NZ  1 
ATOM   8115 N  N   . TRP B 1 492 ? -20.047 -20.170 3.811   1.00 34.92  ? 492 TRP B N   1 
ATOM   8116 C  CA  . TRP B 1 492 ? -19.400 -18.914 4.169   1.00 28.28  ? 492 TRP B CA  1 
ATOM   8117 C  C   . TRP B 1 492 ? -20.385 -17.978 4.843   1.00 28.65  ? 492 TRP B C   1 
ATOM   8118 O  O   . TRP B 1 492 ? -21.291 -17.478 4.183   1.00 26.01  ? 492 TRP B O   1 
ATOM   8119 C  CB  . TRP B 1 492 ? -18.831 -18.277 2.892   1.00 21.93  ? 492 TRP B CB  1 
ATOM   8120 C  CG  . TRP B 1 492 ? -18.057 -17.007 3.059   1.00 19.17  ? 492 TRP B CG  1 
ATOM   8121 C  CD1 . TRP B 1 492 ? -18.072 -16.150 4.133   1.00 30.12  ? 492 TRP B CD1 1 
ATOM   8122 C  CD2 . TRP B 1 492 ? -17.149 -16.457 2.119   1.00 16.57  ? 492 TRP B CD2 1 
ATOM   8123 N  NE1 . TRP B 1 492 ? -17.228 -15.094 3.898   1.00 27.09  ? 492 TRP B NE1 1 
ATOM   8124 C  CE2 . TRP B 1 492 ? -16.646 -15.262 2.670   1.00 23.42  ? 492 TRP B CE2 1 
ATOM   8125 C  CE3 . TRP B 1 492 ? -16.701 -16.865 0.860   1.00 15.45  ? 492 TRP B CE3 1 
ATOM   8126 C  CZ2 . TRP B 1 492 ? -15.727 -14.467 2.001   1.00 26.95  ? 492 TRP B CZ2 1 
ATOM   8127 C  CZ3 . TRP B 1 492 ? -15.804 -16.070 0.186   1.00 15.02  ? 492 TRP B CZ3 1 
ATOM   8128 C  CH2 . TRP B 1 492 ? -15.321 -14.883 0.758   1.00 25.71  ? 492 TRP B CH2 1 
ATOM   8129 N  N   . PRO B 1 493 ? -20.239 -17.704 6.129   1.00 23.80  ? 493 PRO B N   1 
ATOM   8130 C  CA  . PRO B 1 493 ? -21.280 -16.976 6.854   1.00 26.02  ? 493 PRO B CA  1 
ATOM   8131 C  C   . PRO B 1 493 ? -21.171 -15.487 6.619   1.00 25.90  ? 493 PRO B C   1 
ATOM   8132 O  O   . PRO B 1 493 ? -20.078 -14.948 6.450   1.00 25.33  ? 493 PRO B O   1 
ATOM   8133 C  CB  . PRO B 1 493 ? -21.003 -17.307 8.331   1.00 24.58  ? 493 PRO B CB  1 
ATOM   8134 C  CG  . PRO B 1 493 ? -19.650 -17.791 8.368   1.00 38.12  ? 493 PRO B CG  1 
ATOM   8135 C  CD  . PRO B 1 493 ? -19.271 -18.317 7.028   1.00 28.56  ? 493 PRO B CD  1 
ATOM   8136 N  N   . LEU B 1 494 ? -22.334 -14.833 6.605   1.00 29.55  ? 494 LEU B N   1 
ATOM   8137 C  CA  . LEU B 1 494 ? -22.381 -13.377 6.564   1.00 30.97  ? 494 LEU B CA  1 
ATOM   8138 C  C   . LEU B 1 494 ? -21.552 -12.776 7.694   1.00 30.96  ? 494 LEU B C   1 
ATOM   8139 O  O   . LEU B 1 494 ? -21.467 -13.325 8.796   1.00 30.34  ? 494 LEU B O   1 
ATOM   8140 C  CB  . LEU B 1 494 ? -23.815 -12.870 6.697   1.00 42.31  ? 494 LEU B CB  1 
ATOM   8141 C  CG  . LEU B 1 494 ? -24.826 -12.758 5.555   1.00 47.88  ? 494 LEU B CG  1 
ATOM   8142 C  CD1 . LEU B 1 494 ? -25.621 -14.047 5.344   1.00 44.67  ? 494 LEU B CD1 1 
ATOM   8143 C  CD2 . LEU B 1 494 ? -25.761 -11.585 5.851   1.00 44.12  ? 494 LEU B CD2 1 
ATOM   8144 N  N   . PHE B 1 495 ? -20.957 -11.623 7.410   1.00 27.80  ? 495 PHE B N   1 
ATOM   8145 C  CA  . PHE B 1 495 ? -20.327 -10.779 8.420   1.00 24.17  ? 495 PHE B CA  1 
ATOM   8146 C  C   . PHE B 1 495 ? -21.378 -9.852  9.021   1.00 26.56  ? 495 PHE B C   1 
ATOM   8147 O  O   . PHE B 1 495 ? -21.896 -8.969  8.330   1.00 36.24  ? 495 PHE B O   1 
ATOM   8148 C  CB  . PHE B 1 495 ? -19.200 -9.971  7.789   1.00 16.23  ? 495 PHE B CB  1 
ATOM   8149 C  CG  . PHE B 1 495 ? -18.514 -9.041  8.731   1.00 29.98  ? 495 PHE B CG  1 
ATOM   8150 C  CD1 . PHE B 1 495 ? -17.366 -9.440  9.391   1.00 28.24  ? 495 PHE B CD1 1 
ATOM   8151 C  CD2 . PHE B 1 495 ? -18.980 -7.754  8.923   1.00 38.57  ? 495 PHE B CD2 1 
ATOM   8152 C  CE1 . PHE B 1 495 ? -16.702 -8.584  10.224  1.00 27.84  ? 495 PHE B CE1 1 
ATOM   8153 C  CE2 . PHE B 1 495 ? -18.316 -6.893  9.786   1.00 39.66  ? 495 PHE B CE2 1 
ATOM   8154 C  CZ  . PHE B 1 495 ? -17.178 -7.316  10.436  1.00 24.70  ? 495 PHE B CZ  1 
ATOM   8155 N  N   . THR B 1 496 ? -21.671 -10.023 10.308  1.00 21.54  ? 496 THR B N   1 
ATOM   8156 C  CA  . THR B 1 496 ? -22.668 -9.208  10.993  1.00 27.00  ? 496 THR B CA  1 
ATOM   8157 C  C   . THR B 1 496 ? -22.001 -8.269  11.986  1.00 20.84  ? 496 THR B C   1 
ATOM   8158 O  O   . THR B 1 496 ? -20.938 -8.574  12.517  1.00 23.06  ? 496 THR B O   1 
ATOM   8159 C  CB  . THR B 1 496 ? -23.678 -10.079 11.742  1.00 27.90  ? 496 THR B CB  1 
ATOM   8160 O  OG1 . THR B 1 496 ? -23.021 -10.718 12.846  1.00 30.37  ? 496 THR B OG1 1 
ATOM   8161 C  CG2 . THR B 1 496 ? -24.234 -11.138 10.816  1.00 24.66  ? 496 THR B CG2 1 
ATOM   8162 N  N   . THR B 1 497 ? -22.670 -7.145  12.273  1.00 32.15  ? 497 THR B N   1 
ATOM   8163 C  CA  . THR B 1 497 ? -22.123 -6.135  13.182  1.00 39.93  ? 497 THR B CA  1 
ATOM   8164 C  C   . THR B 1 497 ? -21.789 -6.702  14.556  1.00 35.27  ? 497 THR B C   1 
ATOM   8165 O  O   . THR B 1 497 ? -20.908 -6.175  15.242  1.00 33.91  ? 497 THR B O   1 
ATOM   8166 C  CB  . THR B 1 497 ? -23.109 -4.972  13.348  1.00 50.46  ? 497 THR B CB  1 
ATOM   8167 O  OG1 . THR B 1 497 ? -23.364 -4.363  12.076  1.00 65.49  ? 497 THR B OG1 1 
ATOM   8168 C  CG2 . THR B 1 497 ? -22.552 -3.907  14.313  1.00 38.07  ? 497 THR B CG2 1 
ATOM   8169 N  N   . LYS B 1 498 ? -22.474 -7.760  14.982  1.00 36.58  ? 498 LYS B N   1 
ATOM   8170 C  CA  . LYS B 1 498 ? -22.287 -8.275  16.334  1.00 38.69  ? 498 LYS B CA  1 
ATOM   8171 C  C   . LYS B 1 498 ? -21.305 -9.434  16.377  1.00 37.60  ? 498 LYS B C   1 
ATOM   8172 O  O   . LYS B 1 498 ? -20.411 -9.453  17.231  1.00 46.41  ? 498 LYS B O   1 
ATOM   8173 C  CB  . LYS B 1 498 ? -23.620 -8.718  16.955  1.00 37.03  ? 498 LYS B CB  1 
ATOM   8174 C  CG  . LYS B 1 498 ? -23.456 -9.311  18.360  1.00 40.99  ? 498 LYS B CG  1 
ATOM   8175 C  CD  . LYS B 1 498 ? -24.473 -10.396 18.666  1.00 48.60  ? 498 LYS B CD  1 
ATOM   8176 C  CE  . LYS B 1 498 ? -25.620 -9.882  19.526  1.00 49.63  ? 498 LYS B CE  1 
ATOM   8177 N  NZ  . LYS B 1 498 ? -26.389 -11.011 20.128  1.00 43.20  ? 498 LYS B NZ  1 
ATOM   8178 N  N   . GLU B 1 499 ? -21.447 -10.404 15.476  1.00 24.49  ? 499 GLU B N   1 
ATOM   8179 C  CA  . GLU B 1 499 ? -20.556 -11.552 15.533  1.00 30.40  ? 499 GLU B CA  1 
ATOM   8180 C  C   . GLU B 1 499 ? -19.346 -11.396 14.627  1.00 24.90  ? 499 GLU B C   1 
ATOM   8181 O  O   . GLU B 1 499 ? -18.362 -12.112 14.817  1.00 28.87  ? 499 GLU B O   1 
ATOM   8182 C  CB  . GLU B 1 499 ? -21.298 -12.848 15.185  1.00 36.99  ? 499 GLU B CB  1 
ATOM   8183 C  CG  . GLU B 1 499 ? -22.476 -13.185 16.087  1.00 52.10  ? 499 GLU B CG  1 
ATOM   8184 C  CD  . GLU B 1 499 ? -23.731 -12.399 15.713  1.00 77.09  ? 499 GLU B CD  1 
ATOM   8185 O  OE1 . GLU B 1 499 ? -24.757 -12.499 16.426  1.00 71.51  ? 499 GLU B OE1 1 
ATOM   8186 O  OE2 . GLU B 1 499 ? -23.689 -11.679 14.690  1.00 91.74  ? 499 GLU B OE2 1 
ATOM   8187 N  N   . GLN B 1 500 ? -19.394 -10.463 13.681  1.00 18.09  ? 500 GLN B N   1 
ATOM   8188 C  CA  . GLN B 1 500 ? -18.318 -10.187 12.742  1.00 32.66  ? 500 GLN B CA  1 
ATOM   8189 C  C   . GLN B 1 500 ? -17.470 -11.417 12.434  1.00 30.41  ? 500 GLN B C   1 
ATOM   8190 O  O   . GLN B 1 500 ? -16.292 -11.480 12.799  1.00 23.06  ? 500 GLN B O   1 
ATOM   8191 C  CB  . GLN B 1 500 ? -17.468 -9.011  13.247  1.00 17.29  ? 500 GLN B CB  1 
ATOM   8192 C  CG  . GLN B 1 500 ? -16.955 -9.031  14.624  1.00 31.65  ? 500 GLN B CG  1 
ATOM   8193 C  CD  . GLN B 1 500 ? -16.700 -7.617  15.149  1.00 48.00  ? 500 GLN B CD  1 
ATOM   8194 O  OE1 . GLN B 1 500 ? -17.409 -7.141  16.030  1.00 62.38  ? 500 GLN B OE1 1 
ATOM   8195 N  NE2 . GLN B 1 500 ? -15.672 -6.951  14.621  1.00 37.80  ? 500 GLN B NE2 1 
ATOM   8196 N  N   . LYS B 1 501 ? -18.083 -12.406 11.788  1.00 24.10  ? 501 LYS B N   1 
ATOM   8197 C  CA  . LYS B 1 501 ? -17.426 -13.636 11.368  1.00 20.71  ? 501 LYS B CA  1 
ATOM   8198 C  C   . LYS B 1 501 ? -16.714 -13.451 10.032  1.00 20.24  ? 501 LYS B C   1 
ATOM   8199 O  O   . LYS B 1 501 ? -17.024 -12.543 9.257   1.00 21.56  ? 501 LYS B O   1 
ATOM   8200 C  CB  . LYS B 1 501 ? -18.429 -14.789 11.235  1.00 22.04  ? 501 LYS B CB  1 
ATOM   8201 C  CG  . LYS B 1 501 ? -19.329 -15.015 12.433  1.00 26.49  ? 501 LYS B CG  1 
ATOM   8202 C  CD  . LYS B 1 501 ? -19.902 -16.423 12.420  1.00 18.58  ? 501 LYS B CD  1 
ATOM   8203 C  CE  . LYS B 1 501 ? -21.196 -16.526 13.202  1.00 21.09  ? 501 LYS B CE  1 
ATOM   8204 N  NZ  . LYS B 1 501 ? -21.726 -17.921 13.152  1.00 27.40  ? 501 LYS B NZ  1 
ATOM   8205 N  N   . PHE B 1 502 ? -15.759 -14.348 9.766   1.00 24.01  ? 502 PHE B N   1 
ATOM   8206 C  CA  . PHE B 1 502 ? -15.045 -14.414 8.492   1.00 15.71  ? 502 PHE B CA  1 
ATOM   8207 C  C   . PHE B 1 502 ? -14.431 -15.803 8.368   1.00 18.38  ? 502 PHE B C   1 
ATOM   8208 O  O   . PHE B 1 502 ? -14.359 -16.559 9.340   1.00 27.12  ? 502 PHE B O   1 
ATOM   8209 C  CB  . PHE B 1 502 ? -13.962 -13.343 8.382   1.00 16.37  ? 502 PHE B CB  1 
ATOM   8210 C  CG  . PHE B 1 502 ? -12.790 -13.583 9.296   1.00 36.26  ? 502 PHE B CG  1 
ATOM   8211 C  CD1 . PHE B 1 502 ? -11.650 -14.242 8.840   1.00 36.24  ? 502 PHE B CD1 1 
ATOM   8212 C  CD2 . PHE B 1 502 ? -12.827 -13.152 10.613  1.00 35.88  ? 502 PHE B CD2 1 
ATOM   8213 C  CE1 . PHE B 1 502 ? -10.582 -14.474 9.683   1.00 30.13  ? 502 PHE B CE1 1 
ATOM   8214 C  CE2 . PHE B 1 502 ? -11.763 -13.365 11.441  1.00 35.74  ? 502 PHE B CE2 1 
ATOM   8215 C  CZ  . PHE B 1 502 ? -10.636 -14.032 10.975  1.00 34.14  ? 502 PHE B CZ  1 
ATOM   8216 N  N   . ILE B 1 503 ? -13.973 -16.134 7.164   1.00 15.52  ? 503 ILE B N   1 
ATOM   8217 C  CA  . ILE B 1 503 ? -13.417 -17.458 6.927   1.00 31.26  ? 503 ILE B CA  1 
ATOM   8218 C  C   . ILE B 1 503 ? -12.022 -17.382 6.313   1.00 24.90  ? 503 ILE B C   1 
ATOM   8219 O  O   . ILE B 1 503 ? -11.585 -16.348 5.796   1.00 17.77  ? 503 ILE B O   1 
ATOM   8220 C  CB  . ILE B 1 503 ? -14.325 -18.305 6.029   1.00 28.41  ? 503 ILE B CB  1 
ATOM   8221 C  CG1 . ILE B 1 503 ? -14.385 -17.696 4.627   1.00 21.24  ? 503 ILE B CG1 1 
ATOM   8222 C  CG2 . ILE B 1 503 ? -15.668 -18.468 6.676   1.00 20.87  ? 503 ILE B CG2 1 
ATOM   8223 C  CD1 . ILE B 1 503 ? -14.228 -18.740 3.587   1.00 22.90  ? 503 ILE B CD1 1 
ATOM   8224 N  N   . ASP B 1 504 ? -11.330 -18.521 6.380   1.00 20.78  ? 504 ASP B N   1 
ATOM   8225 C  CA  . ASP B 1 504 ? -10.002 -18.685 5.813   1.00 31.22  ? 504 ASP B CA  1 
ATOM   8226 C  C   . ASP B 1 504 ? -10.138 -19.250 4.412   1.00 37.90  ? 504 ASP B C   1 
ATOM   8227 O  O   . ASP B 1 504 ? -10.837 -20.244 4.203   1.00 47.27  ? 504 ASP B O   1 
ATOM   8228 C  CB  . ASP B 1 504 ? -9.135  -19.638 6.645   1.00 45.63  ? 504 ASP B CB  1 
ATOM   8229 C  CG  . ASP B 1 504 ? -8.812  -19.103 8.039   1.00 65.45  ? 504 ASP B CG  1 
ATOM   8230 O  OD1 . ASP B 1 504 ? -8.375  -19.904 8.895   1.00 69.24  ? 504 ASP B OD1 1 
ATOM   8231 O  OD2 . ASP B 1 504 ? -9.000  -17.894 8.289   1.00 72.23  ? 504 ASP B OD2 1 
ATOM   8232 N  N   . LEU B 1 505 ? -9.464  -18.627 3.461   1.00 26.82  ? 505 LEU B N   1 
ATOM   8233 C  CA  . LEU B 1 505 ? -9.314  -19.204 2.136   1.00 28.50  ? 505 LEU B CA  1 
ATOM   8234 C  C   . LEU B 1 505 ? -8.010  -19.996 2.098   1.00 28.03  ? 505 LEU B C   1 
ATOM   8235 O  O   . LEU B 1 505 ? -6.922  -19.414 2.215   1.00 27.30  ? 505 LEU B O   1 
ATOM   8236 C  CB  . LEU B 1 505 ? -9.321  -18.103 1.083   1.00 31.64  ? 505 LEU B CB  1 
ATOM   8237 C  CG  . LEU B 1 505 ? -10.659 -17.829 0.404   1.00 25.99  ? 505 LEU B CG  1 
ATOM   8238 C  CD1 . LEU B 1 505 ? -11.759 -18.779 0.848   1.00 18.52  ? 505 LEU B CD1 1 
ATOM   8239 C  CD2 . LEU B 1 505 ? -11.044 -16.417 0.691   1.00 20.87  ? 505 LEU B CD2 1 
ATOM   8240 N  N   . ASN B 1 506 ? -8.114  -21.313 1.933   1.00 23.33  ? 506 ASN B N   1 
ATOM   8241 C  CA  . ASN B 1 506 ? -6.938  -22.158 1.717   1.00 28.84  ? 506 ASN B CA  1 
ATOM   8242 C  C   . ASN B 1 506 ? -7.376  -23.596 1.438   1.00 32.50  ? 506 ASN B C   1 
ATOM   8243 O  O   . ASN B 1 506 ? -8.567  -23.921 1.391   1.00 36.86  ? 506 ASN B O   1 
ATOM   8244 C  CB  . ASN B 1 506 ? -5.996  -22.124 2.916   1.00 32.59  ? 506 ASN B CB  1 
ATOM   8245 C  CG  . ASN B 1 506 ? -6.726  -22.340 4.217   1.00 26.73  ? 506 ASN B CG  1 
ATOM   8246 O  OD1 . ASN B 1 506 ? -7.314  -23.409 4.445   1.00 26.33  ? 506 ASN B OD1 1 
ATOM   8247 N  ND2 . ASN B 1 506 ? -6.716  -21.320 5.076   1.00 18.41  ? 506 ASN B ND2 1 
ATOM   8248 N  N   . THR B 1 507 ? -6.383  -24.468 1.300   1.00 31.15  ? 507 THR B N   1 
ATOM   8249 C  CA  . THR B 1 507 ? -6.615  -25.850 0.913   1.00 42.33  ? 507 THR B CA  1 
ATOM   8250 C  C   . THR B 1 507 ? -7.352  -26.674 1.969   1.00 42.91  ? 507 THR B C   1 
ATOM   8251 O  O   . THR B 1 507 ? -7.801  -27.782 1.655   1.00 41.44  ? 507 THR B O   1 
ATOM   8252 C  CB  . THR B 1 507 ? -5.271  -26.495 0.584   1.00 48.42  ? 507 THR B CB  1 
ATOM   8253 O  OG1 . THR B 1 507 ? -4.354  -26.245 1.653   1.00 63.79  ? 507 THR B OG1 1 
ATOM   8254 C  CG2 . THR B 1 507 ? -4.709  -25.879 -0.680  1.00 42.41  ? 507 THR B CG2 1 
ATOM   8255 N  N   . GLU B 1 508 ? -7.504  -26.179 3.186   1.00 40.82  ? 508 GLU B N   1 
ATOM   8256 C  CA  . GLU B 1 508 ? -8.115  -27.031 4.195   1.00 38.85  ? 508 GLU B CA  1 
ATOM   8257 C  C   . GLU B 1 508 ? -9.624  -26.800 4.271   1.00 38.69  ? 508 GLU B C   1 
ATOM   8258 O  O   . GLU B 1 508 ? -10.134 -25.778 3.796   1.00 36.76  ? 508 GLU B O   1 
ATOM   8259 C  CB  . GLU B 1 508 ? -7.463  -26.771 5.548   1.00 43.46  ? 508 GLU B CB  1 
ATOM   8260 C  CG  . GLU B 1 508 ? -5.932  -26.893 5.533   1.00 56.50  ? 508 GLU B CG  1 
ATOM   8261 C  CD  . GLU B 1 508 ? -5.292  -26.558 6.885   1.00 64.70  ? 508 GLU B CD  1 
ATOM   8262 O  OE1 . GLU B 1 508 ? -5.948  -25.864 7.693   1.00 65.07  ? 508 GLU B OE1 1 
ATOM   8263 O  OE2 . GLU B 1 508 ? -4.141  -26.990 7.145   1.00 65.55  ? 508 GLU B OE2 1 
ATOM   8264 N  N   . PRO B 1 509 ? -10.371 -27.767 4.815   1.00 34.61  ? 509 PRO B N   1 
ATOM   8265 C  CA  . PRO B 1 509 ? -11.794 -27.543 5.117   1.00 30.05  ? 509 PRO B CA  1 
ATOM   8266 C  C   . PRO B 1 509 ? -12.034 -26.205 5.806   1.00 33.64  ? 509 PRO B C   1 
ATOM   8267 O  O   . PRO B 1 509 ? -11.207 -25.723 6.584   1.00 36.34  ? 509 PRO B O   1 
ATOM   8268 C  CB  . PRO B 1 509 ? -12.150 -28.714 6.044   1.00 24.52  ? 509 PRO B CB  1 
ATOM   8269 C  CG  . PRO B 1 509 ? -10.941 -29.659 6.007   1.00 29.80  ? 509 PRO B CG  1 
ATOM   8270 C  CD  . PRO B 1 509 ? -10.038 -29.192 4.900   1.00 31.21  ? 509 PRO B CD  1 
ATOM   8271 N  N   . MET B 1 510 ? -13.190 -25.614 5.520   1.00 32.03  ? 510 MET B N   1 
ATOM   8272 C  CA  . MET B 1 510 ? -13.398 -24.208 5.826   1.00 32.79  ? 510 MET B CA  1 
ATOM   8273 C  C   . MET B 1 510 ? -13.512 -23.987 7.323   1.00 44.69  ? 510 MET B C   1 
ATOM   8274 O  O   . MET B 1 510 ? -14.138 -24.778 8.029   1.00 50.70  ? 510 MET B O   1 
ATOM   8275 C  CB  . MET B 1 510 ? -14.655 -23.696 5.140   1.00 43.18  ? 510 MET B CB  1 
ATOM   8276 C  CG  . MET B 1 510 ? -14.871 -22.211 5.337   1.00 50.59  ? 510 MET B CG  1 
ATOM   8277 S  SD  . MET B 1 510 ? -16.597 -21.768 5.199   1.00 56.04  ? 510 MET B SD  1 
ATOM   8278 C  CE  . MET B 1 510 ? -16.800 -21.775 3.418   1.00 60.79  ? 510 MET B CE  1 
ATOM   8279 N  N   . LYS B 1 511 ? -12.894 -22.905 7.805   1.00 51.31  ? 511 LYS B N   1 
ATOM   8280 C  CA  . LYS B 1 511 ? -12.999 -22.457 9.189   1.00 48.86  ? 511 LYS B CA  1 
ATOM   8281 C  C   . LYS B 1 511 ? -13.746 -21.135 9.258   1.00 49.05  ? 511 LYS B C   1 
ATOM   8282 O  O   . LYS B 1 511 ? -13.611 -20.281 8.379   1.00 56.48  ? 511 LYS B O   1 
ATOM   8283 C  CB  . LYS B 1 511 ? -11.626 -22.247 9.824   1.00 45.86  ? 511 LYS B CB  1 
ATOM   8284 C  CG  . LYS B 1 511 ? -10.727 -23.443 9.860   1.00 53.76  ? 511 LYS B CG  1 
ATOM   8285 C  CD  . LYS B 1 511 ? -10.230 -23.697 11.254  1.00 62.95  ? 511 LYS B CD  1 
ATOM   8286 C  CE  . LYS B 1 511 ? -9.126  -24.725 11.227  1.00 72.66  ? 511 LYS B CE  1 
ATOM   8287 N  NZ  . LYS B 1 511 ? -8.083  -24.390 10.202  1.00 79.38  ? 511 LYS B NZ  1 
ATOM   8288 N  N   . VAL B 1 512 ? -14.508 -20.955 10.319  1.00 39.63  ? 512 VAL B N   1 
ATOM   8289 C  CA  . VAL B 1 512 ? -15.077 -19.655 10.632  1.00 31.13  ? 512 VAL B CA  1 
ATOM   8290 C  C   . VAL B 1 512 ? -14.303 -19.078 11.798  1.00 23.60  ? 512 VAL B C   1 
ATOM   8291 O  O   . VAL B 1 512 ? -13.978 -19.794 12.747  1.00 30.26  ? 512 VAL B O   1 
ATOM   8292 C  CB  . VAL B 1 512 ? -16.573 -19.755 10.965  1.00 29.56  ? 512 VAL B CB  1 
ATOM   8293 C  CG1 . VAL B 1 512 ? -17.183 -18.361 10.974  1.00 26.55  ? 512 VAL B CG1 1 
ATOM   8294 C  CG2 . VAL B 1 512 ? -17.262 -20.649 9.965   1.00 34.12  ? 512 VAL B CG2 1 
ATOM   8295 N  N   . HIS B 1 513 ? -13.978 -17.794 11.720  1.00 17.09  ? 513 HIS B N   1 
ATOM   8296 C  CA  . HIS B 1 513 ? -13.391 -17.098 12.849  1.00 28.17  ? 513 HIS B CA  1 
ATOM   8297 C  C   . HIS B 1 513 ? -14.166 -15.819 13.092  1.00 32.66  ? 513 HIS B C   1 
ATOM   8298 O  O   . HIS B 1 513 ? -15.048 -15.447 12.315  1.00 37.64  ? 513 HIS B O   1 
ATOM   8299 C  CB  . HIS B 1 513 ? -11.916 -16.748 12.643  1.00 24.42  ? 513 HIS B CB  1 
ATOM   8300 C  CG  . HIS B 1 513 ? -11.032 -17.925 12.426  1.00 32.93  ? 513 HIS B CG  1 
ATOM   8301 N  ND1 . HIS B 1 513 ? -10.611 -18.309 11.172  1.00 48.57  ? 513 HIS B ND1 1 
ATOM   8302 C  CD2 . HIS B 1 513 ? -10.481 -18.801 13.297  1.00 35.81  ? 513 HIS B CD2 1 
ATOM   8303 C  CE1 . HIS B 1 513 ? -9.827  -19.365 11.276  1.00 46.24  ? 513 HIS B CE1 1 
ATOM   8304 N  NE2 . HIS B 1 513 ? -9.734  -19.686 12.555  1.00 40.35  ? 513 HIS B NE2 1 
ATOM   8305 N  N   . GLN B 1 514 ? -13.784 -15.132 14.169  1.00 29.26  ? 514 GLN B N   1 
ATOM   8306 C  CA  . GLN B 1 514 ? -14.498 -13.989 14.715  1.00 17.45  ? 514 GLN B CA  1 
ATOM   8307 C  C   . GLN B 1 514 ? -13.480 -12.899 14.985  1.00 17.19  ? 514 GLN B C   1 
ATOM   8308 O  O   . GLN B 1 514 ? -12.395 -13.187 15.485  1.00 42.43  ? 514 GLN B O   1 
ATOM   8309 C  CB  . GLN B 1 514 ? -15.205 -14.368 16.016  1.00 41.56  ? 514 GLN B CB  1 
ATOM   8310 C  CG  . GLN B 1 514 ? -16.229 -15.460 15.909  1.00 47.75  ? 514 GLN B CG  1 
ATOM   8311 C  CD  . GLN B 1 514 ? -17.542 -15.070 16.565  1.00 57.88  ? 514 GLN B CD  1 
ATOM   8312 O  OE1 . GLN B 1 514 ? -17.872 -13.888 16.668  1.00 63.09  ? 514 GLN B OE1 1 
ATOM   8313 N  NE2 . GLN B 1 514 ? -18.301 -16.070 17.012  1.00 57.47  ? 514 GLN B NE2 1 
ATOM   8314 N  N   . ARG B 1 515 ? -13.822 -11.657 14.652  1.00 17.01  ? 515 ARG B N   1 
ATOM   8315 C  CA  . ARG B 1 515 ? -12.930 -10.515 14.858  1.00 22.41  ? 515 ARG B CA  1 
ATOM   8316 C  C   . ARG B 1 515 ? -11.540 -10.708 14.254  1.00 33.67  ? 515 ARG B C   1 
ATOM   8317 O  O   . ARG B 1 515 ? -10.627 -11.237 14.895  1.00 38.13  ? 515 ARG B O   1 
ATOM   8318 C  CB  . ARG B 1 515 ? -12.844 -10.183 16.348  1.00 17.40  ? 515 ARG B CB  1 
ATOM   8319 C  CG  . ARG B 1 515 ? -14.215 -10.032 16.909  1.00 33.19  ? 515 ARG B CG  1 
ATOM   8320 C  CD  . ARG B 1 515 ? -14.318 -10.086 18.388  1.00 36.99  ? 515 ARG B CD  1 
ATOM   8321 N  NE  . ARG B 1 515 ? -15.448 -9.245  18.786  1.00 51.53  ? 515 ARG B NE  1 
ATOM   8322 C  CZ  . ARG B 1 515 ? -15.475 -8.512  19.887  1.00 57.11  ? 515 ARG B CZ  1 
ATOM   8323 N  NH1 . ARG B 1 515 ? -14.416 -8.504  20.671  1.00 62.30  ? 515 ARG B NH1 1 
ATOM   8324 N  NH2 . ARG B 1 515 ? -16.547 -7.787  20.168  1.00 49.85  ? 515 ARG B NH2 1 
ATOM   8325 N  N   . LEU B 1 516 ? -11.368 -10.258 13.018  1.00 43.73  ? 516 LEU B N   1 
ATOM   8326 C  CA  . LEU B 1 516 ? -10.092 -10.385 12.330  1.00 35.12  ? 516 LEU B CA  1 
ATOM   8327 C  C   . LEU B 1 516 ? -9.106  -9.374  12.907  1.00 38.07  ? 516 LEU B C   1 
ATOM   8328 O  O   . LEU B 1 516 ? -9.271  -8.164  12.716  1.00 32.05  ? 516 LEU B O   1 
ATOM   8329 C  CB  . LEU B 1 516 ? -10.317 -10.168 10.844  1.00 32.38  ? 516 LEU B CB  1 
ATOM   8330 C  CG  . LEU B 1 516 ? -9.305  -10.676 9.836   1.00 37.48  ? 516 LEU B CG  1 
ATOM   8331 C  CD1 . LEU B 1 516 ? -10.082 -11.146 8.623   1.00 37.77  ? 516 LEU B CD1 1 
ATOM   8332 C  CD2 . LEU B 1 516 ? -8.339  -9.563  9.463   1.00 28.22  ? 516 LEU B CD2 1 
ATOM   8333 N  N   . ARG B 1 517 ? -8.113  -9.876  13.653  1.00 43.30  ? 517 ARG B N   1 
ATOM   8334 C  CA  . ARG B 1 517 ? -7.005  -9.084  14.201  1.00 28.81  ? 517 ARG B CA  1 
ATOM   8335 C  C   . ARG B 1 517 ? -7.502  -7.846  14.927  1.00 16.12  ? 517 ARG B C   1 
ATOM   8336 O  O   . ARG B 1 517 ? -7.034  -6.728  14.712  1.00 16.05  ? 517 ARG B O   1 
ATOM   8337 C  CB  . ARG B 1 517 ? -5.999  -8.704  13.114  1.00 27.40  ? 517 ARG B CB  1 
ATOM   8338 C  CG  . ARG B 1 517 ? -5.150  -9.867  12.596  1.00 32.12  ? 517 ARG B CG  1 
ATOM   8339 C  CD  . ARG B 1 517 ? -4.061  -9.392  11.623  1.00 27.06  ? 517 ARG B CD  1 
ATOM   8340 N  NE  . ARG B 1 517 ? -3.061  -8.561  12.286  1.00 32.80  ? 517 ARG B NE  1 
ATOM   8341 C  CZ  . ARG B 1 517 ? -2.062  -9.054  13.019  1.00 38.96  ? 517 ARG B CZ  1 
ATOM   8342 N  NH1 . ARG B 1 517 ? -1.951  -10.365 13.189  1.00 40.13  ? 517 ARG B NH1 1 
ATOM   8343 N  NH2 . ARG B 1 517 ? -1.184  -8.241  13.601  1.00 32.77  ? 517 ARG B NH2 1 
ATOM   8344 N  N   . VAL B 1 518 ? -8.451  -8.058  15.825  1.00 28.59  ? 518 VAL B N   1 
ATOM   8345 C  CA  . VAL B 1 518 ? -9.076  -6.918  16.478  1.00 35.93  ? 518 VAL B CA  1 
ATOM   8346 C  C   . VAL B 1 518 ? -8.055  -6.166  17.344  1.00 44.72  ? 518 VAL B C   1 
ATOM   8347 O  O   . VAL B 1 518 ? -7.927  -4.941  17.234  1.00 47.07  ? 518 VAL B O   1 
ATOM   8348 C  CB  . VAL B 1 518 ? -10.326 -7.367  17.260  1.00 29.85  ? 518 VAL B CB  1 
ATOM   8349 C  CG1 . VAL B 1 518 ? -9.999  -8.496  18.222  1.00 40.24  ? 518 VAL B CG1 1 
ATOM   8350 C  CG2 . VAL B 1 518 ? -10.997 -6.180  17.928  1.00 31.67  ? 518 VAL B CG2 1 
ATOM   8351 N  N   . GLN B 1 519 ? -7.281  -6.882  18.183  1.00 17.51  ? 519 GLN B N   1 
ATOM   8352 C  CA  . GLN B 1 519 ? -6.433  -6.181  19.159  1.00 27.38  ? 519 GLN B CA  1 
ATOM   8353 C  C   . GLN B 1 519 ? -5.492  -5.196  18.485  1.00 33.69  ? 519 GLN B C   1 
ATOM   8354 O  O   . GLN B 1 519 ? -5.370  -4.045  18.916  1.00 35.33  ? 519 GLN B O   1 
ATOM   8355 C  CB  . GLN B 1 519 ? -5.592  -7.134  20.015  1.00 23.45  ? 519 GLN B CB  1 
ATOM   8356 C  CG  . GLN B 1 519 ? -6.238  -7.416  21.338  1.00 26.29  ? 519 GLN B CG  1 
ATOM   8357 C  CD  . GLN B 1 519 ? -5.862  -6.403  22.366  1.00 27.63  ? 519 GLN B CD  1 
ATOM   8358 O  OE1 . GLN B 1 519 ? -5.134  -5.453  22.075  1.00 34.59  ? 519 GLN B OE1 1 
ATOM   8359 N  NE2 . GLN B 1 519 ? -6.495  -6.500  23.534  1.00 30.41  ? 519 GLN B NE2 1 
ATOM   8360 N  N   . MET B 1 520 ? -4.776  -5.643  17.452  1.00 17.16  ? 520 MET B N   1 
ATOM   8361 C  CA  . MET B 1 520 ? -3.939  -4.699  16.729  1.00 23.07  ? 520 MET B CA  1 
ATOM   8362 C  C   . MET B 1 520 ? -4.789  -3.659  16.028  1.00 19.89  ? 520 MET B C   1 
ATOM   8363 O  O   . MET B 1 520 ? -4.438  -2.473  16.006  1.00 28.40  ? 520 MET B O   1 
ATOM   8364 C  CB  . MET B 1 520 ? -3.030  -5.408  15.730  1.00 27.94  ? 520 MET B CB  1 
ATOM   8365 C  CG  . MET B 1 520 ? -2.408  -6.720  16.163  1.00 35.98  ? 520 MET B CG  1 
ATOM   8366 S  SD  . MET B 1 520 ? -1.214  -6.494  17.521  1.00 52.87  ? 520 MET B SD  1 
ATOM   8367 C  CE  . MET B 1 520 ? -0.573  -4.871  17.273  1.00 44.04  ? 520 MET B CE  1 
ATOM   8368 N  N   . CYS B 1 521 ? -5.929  -4.072  15.484  1.00 16.53  ? 521 CYS B N   1 
ATOM   8369 C  CA  . CYS B 1 521 ? -6.764  -3.090  14.822  1.00 16.45  ? 521 CYS B CA  1 
ATOM   8370 C  C   . CYS B 1 521 ? -7.340  -2.062  15.788  1.00 32.13  ? 521 CYS B C   1 
ATOM   8371 O  O   . CYS B 1 521 ? -7.382  -0.881  15.440  1.00 17.15  ? 521 CYS B O   1 
ATOM   8372 C  CB  . CYS B 1 521 ? -7.839  -3.774  13.984  1.00 24.39  ? 521 CYS B CB  1 
ATOM   8373 S  SG  . CYS B 1 521 ? -7.083  -4.637  12.545  1.00 46.70  ? 521 CYS B SG  1 
ATOM   8374 N  N   . VAL B 1 522 ? -7.747  -2.445  17.002  1.00 35.79  ? 522 VAL B N   1 
ATOM   8375 C  CA  . VAL B 1 522 ? -8.132  -1.432  17.979  1.00 34.16  ? 522 VAL B CA  1 
ATOM   8376 C  C   . VAL B 1 522 ? -7.014  -0.412  18.160  1.00 33.96  ? 522 VAL B C   1 
ATOM   8377 O  O   . VAL B 1 522 ? -7.267  0.793   18.278  1.00 38.09  ? 522 VAL B O   1 
ATOM   8378 C  CB  . VAL B 1 522 ? -8.503  -2.113  19.299  1.00 35.11  ? 522 VAL B CB  1 
ATOM   8379 C  CG1 . VAL B 1 522 ? -8.905  -1.062  20.327  1.00 19.49  ? 522 VAL B CG1 1 
ATOM   8380 C  CG2 . VAL B 1 522 ? -9.633  -3.109  19.063  1.00 47.85  ? 522 VAL B CG2 1 
ATOM   8381 N  N   . PHE B 1 523 ? -5.764  -0.878  18.206  1.00 23.86  ? 523 PHE B N   1 
ATOM   8382 C  CA  . PHE B 1 523 ? -4.643  0.049   18.291  1.00 25.22  ? 523 PHE B CA  1 
ATOM   8383 C  C   . PHE B 1 523 ? -4.596  0.965   17.073  1.00 21.32  ? 523 PHE B C   1 
ATOM   8384 O  O   . PHE B 1 523 ? -4.549  2.195   17.199  1.00 19.08  ? 523 PHE B O   1 
ATOM   8385 C  CB  . PHE B 1 523 ? -3.344  -0.736  18.439  1.00 18.35  ? 523 PHE B CB  1 
ATOM   8386 C  CG  . PHE B 1 523 ? -2.125  0.112   18.331  1.00 35.14  ? 523 PHE B CG  1 
ATOM   8387 C  CD1 . PHE B 1 523 ? -1.664  0.793   19.434  1.00 38.66  ? 523 PHE B CD1 1 
ATOM   8388 C  CD2 . PHE B 1 523 ? -1.426  0.224   17.137  1.00 36.19  ? 523 PHE B CD2 1 
ATOM   8389 C  CE1 . PHE B 1 523 ? -0.541  1.581   19.353  1.00 43.18  ? 523 PHE B CE1 1 
ATOM   8390 C  CE2 . PHE B 1 523 ? -0.305  1.018   17.051  1.00 29.27  ? 523 PHE B CE2 1 
ATOM   8391 C  CZ  . PHE B 1 523 ? 0.142   1.694   18.158  1.00 34.67  ? 523 PHE B CZ  1 
ATOM   8392 N  N   . TRP B 1 524 ? -4.627  0.377   15.880  1.00 18.03  ? 524 TRP B N   1 
ATOM   8393 C  CA  . TRP B 1 524 ? -4.394  1.153   14.669  1.00 22.20  ? 524 TRP B CA  1 
ATOM   8394 C  C   . TRP B 1 524 ? -5.571  2.059   14.329  1.00 31.55  ? 524 TRP B C   1 
ATOM   8395 O  O   . TRP B 1 524 ? -5.384  3.074   13.645  1.00 28.11  ? 524 TRP B O   1 
ATOM   8396 C  CB  . TRP B 1 524 ? -4.100  0.222   13.498  1.00 16.56  ? 524 TRP B CB  1 
ATOM   8397 C  CG  . TRP B 1 524 ? -2.722  -0.369  13.506  1.00 28.35  ? 524 TRP B CG  1 
ATOM   8398 C  CD1 . TRP B 1 524 ? -2.386  -1.682  13.704  1.00 34.34  ? 524 TRP B CD1 1 
ATOM   8399 C  CD2 . TRP B 1 524 ? -1.491  0.327   13.293  1.00 25.33  ? 524 TRP B CD2 1 
ATOM   8400 N  NE1 . TRP B 1 524 ? -1.017  -1.841  13.630  1.00 25.95  ? 524 TRP B NE1 1 
ATOM   8401 C  CE2 . TRP B 1 524 ? -0.449  -0.622  13.381  1.00 16.50  ? 524 TRP B CE2 1 
ATOM   8402 C  CE3 . TRP B 1 524 ? -1.166  1.662   13.040  1.00 29.61  ? 524 TRP B CE3 1 
ATOM   8403 C  CZ2 . TRP B 1 524 ? 0.884   -0.275  13.229  1.00 18.11  ? 524 TRP B CZ2 1 
ATOM   8404 C  CZ3 . TRP B 1 524 ? 0.167   2.003   12.882  1.00 26.46  ? 524 TRP B CZ3 1 
ATOM   8405 C  CH2 . TRP B 1 524 ? 1.171   1.041   12.976  1.00 21.85  ? 524 TRP B CH2 1 
ATOM   8406 N  N   . ASN B 1 525 ? -6.777  1.724   14.791  1.00 30.20  ? 525 ASN B N   1 
ATOM   8407 C  CA  . ASN B 1 525 ? -7.972  2.444   14.372  1.00 28.46  ? 525 ASN B CA  1 
ATOM   8408 C  C   . ASN B 1 525 ? -8.500  3.411   15.412  1.00 32.16  ? 525 ASN B C   1 
ATOM   8409 O  O   . ASN B 1 525 ? -9.046  4.460   15.049  1.00 23.67  ? 525 ASN B O   1 
ATOM   8410 C  CB  . ASN B 1 525 ? -9.087  1.467   14.011  1.00 24.60  ? 525 ASN B CB  1 
ATOM   8411 C  CG  . ASN B 1 525 ? -8.767  0.683   12.779  1.00 39.28  ? 525 ASN B CG  1 
ATOM   8412 O  OD1 . ASN B 1 525 ? -9.219  -0.455  12.616  1.00 47.31  ? 525 ASN B OD1 1 
ATOM   8413 N  ND2 . ASN B 1 525 ? -7.934  1.263   11.912  1.00 48.32  ? 525 ASN B ND2 1 
ATOM   8414 N  N   . GLN B 1 526 ? -8.372  3.094   16.689  1.00 30.53  ? 526 GLN B N   1 
ATOM   8415 C  CA  . GLN B 1 526 ? -8.900  3.984   17.704  1.00 33.19  ? 526 GLN B CA  1 
ATOM   8416 C  C   . GLN B 1 526 ? -7.826  4.659   18.540  1.00 42.48  ? 526 GLN B C   1 
ATOM   8417 O  O   . GLN B 1 526 ? -7.922  5.870   18.781  1.00 54.14  ? 526 GLN B O   1 
ATOM   8418 C  CB  . GLN B 1 526 ? -9.874  3.227   18.613  1.00 40.73  ? 526 GLN B CB  1 
ATOM   8419 C  CG  . GLN B 1 526 ? -11.325 3.240   18.118  1.00 49.79  ? 526 GLN B CG  1 
ATOM   8420 C  CD  . GLN B 1 526 ? -11.636 2.125   17.122  1.00 67.96  ? 526 GLN B CD  1 
ATOM   8421 O  OE1 . GLN B 1 526 ? -11.531 0.940   17.446  1.00 77.04  ? 526 GLN B OE1 1 
ATOM   8422 N  NE2 . GLN B 1 526 ? -12.019 2.505   15.901  1.00 67.51  ? 526 GLN B NE2 1 
ATOM   8423 N  N   . PHE B 1 527 ? -6.790  3.932   18.974  1.00 35.48  ? 527 PHE B N   1 
ATOM   8424 C  CA  . PHE B 1 527 ? -5.866  4.526   19.936  1.00 30.00  ? 527 PHE B CA  1 
ATOM   8425 C  C   . PHE B 1 527 ? -4.789  5.361   19.253  1.00 32.33  ? 527 PHE B C   1 
ATOM   8426 O  O   . PHE B 1 527 ? -4.618  6.544   19.569  1.00 34.30  ? 527 PHE B O   1 
ATOM   8427 C  CB  . PHE B 1 527 ? -5.219  3.456   20.820  1.00 29.82  ? 527 PHE B CB  1 
ATOM   8428 C  CG  . PHE B 1 527 ? -4.131  4.001   21.719  1.00 33.81  ? 527 PHE B CG  1 
ATOM   8429 C  CD1 . PHE B 1 527 ? -4.442  4.893   22.724  1.00 28.95  ? 527 PHE B CD1 1 
ATOM   8430 C  CD2 . PHE B 1 527 ? -2.809  3.627   21.552  1.00 33.95  ? 527 PHE B CD2 1 
ATOM   8431 C  CE1 . PHE B 1 527 ? -3.472  5.409   23.531  1.00 22.95  ? 527 PHE B CE1 1 
ATOM   8432 C  CE2 . PHE B 1 527 ? -1.835  4.130   22.377  1.00 29.52  ? 527 PHE B CE2 1 
ATOM   8433 C  CZ  . PHE B 1 527 ? -2.169  5.028   23.369  1.00 22.72  ? 527 PHE B CZ  1 
ATOM   8434 N  N   . LEU B 1 528 ? -4.024  4.765   18.339  1.00 31.85  ? 528 LEU B N   1 
ATOM   8435 C  CA  . LEU B 1 528 ? -2.947  5.548   17.733  1.00 33.11  ? 528 LEU B CA  1 
ATOM   8436 C  C   . LEU B 1 528 ? -3.444  6.831   17.094  1.00 34.94  ? 528 LEU B C   1 
ATOM   8437 O  O   . LEU B 1 528 ? -2.834  7.886   17.349  1.00 31.47  ? 528 LEU B O   1 
ATOM   8438 C  CB  . LEU B 1 528 ? -2.137  4.711   16.738  1.00 26.87  ? 528 LEU B CB  1 
ATOM   8439 C  CG  . LEU B 1 528 ? -0.960  5.507   16.135  1.00 31.36  ? 528 LEU B CG  1 
ATOM   8440 C  CD1 . LEU B 1 528 ? -0.044  6.131   17.205  1.00 20.15  ? 528 LEU B CD1 1 
ATOM   8441 C  CD2 . LEU B 1 528 ? -0.138  4.690   15.153  1.00 35.95  ? 528 LEU B CD2 1 
ATOM   8442 N  N   . PRO B 1 529 ? -4.526  6.832   16.302  1.00 33.93  ? 529 PRO B N   1 
ATOM   8443 C  CA  . PRO B 1 529 ? -5.007  8.110   15.763  1.00 27.87  ? 529 PRO B CA  1 
ATOM   8444 C  C   . PRO B 1 529 ? -5.303  9.109   16.858  1.00 21.27  ? 529 PRO B C   1 
ATOM   8445 O  O   . PRO B 1 529 ? -4.999  10.300  16.713  1.00 21.82  ? 529 PRO B O   1 
ATOM   8446 C  CB  . PRO B 1 529 ? -6.274  7.719   14.990  1.00 25.29  ? 529 PRO B CB  1 
ATOM   8447 C  CG  . PRO B 1 529 ? -6.330  6.258   14.978  1.00 30.99  ? 529 PRO B CG  1 
ATOM   8448 C  CD  . PRO B 1 529 ? -5.109  5.684   15.583  1.00 33.82  ? 529 PRO B CD  1 
ATOM   8449 N  N   . LYS B 1 530 ? -5.850  8.640   17.980  1.00 25.33  ? 530 LYS B N   1 
ATOM   8450 C  CA  . LYS B 1 530 ? -6.078  9.526   19.117  1.00 34.81  ? 530 LYS B CA  1 
ATOM   8451 C  C   . LYS B 1 530 ? -4.768  10.079  19.665  1.00 32.24  ? 530 LYS B C   1 
ATOM   8452 O  O   . LYS B 1 530 ? -4.698  11.254  20.050  1.00 33.21  ? 530 LYS B O   1 
ATOM   8453 C  CB  . LYS B 1 530 ? -6.840  8.773   20.209  1.00 36.12  ? 530 LYS B CB  1 
ATOM   8454 C  CG  . LYS B 1 530 ? -7.807  9.622   21.024  1.00 49.50  ? 530 LYS B CG  1 
ATOM   8455 C  CD  . LYS B 1 530 ? -8.925  8.735   21.564  1.00 61.27  ? 530 LYS B CD  1 
ATOM   8456 C  CE  . LYS B 1 530 ? -8.387  7.356   21.966  1.00 65.74  ? 530 LYS B CE  1 
ATOM   8457 N  NZ  . LYS B 1 530 ? -9.441  6.494   22.581  1.00 68.84  ? 530 LYS B NZ  1 
ATOM   8458 N  N   . LEU B 1 531 ? -3.727  9.239   19.719  1.00 28.92  ? 531 LEU B N   1 
ATOM   8459 C  CA  . LEU B 1 531 ? -2.438  9.664   20.260  1.00 38.96  ? 531 LEU B CA  1 
ATOM   8460 C  C   . LEU B 1 531 ? -1.847  10.801  19.439  1.00 38.19  ? 531 LEU B C   1 
ATOM   8461 O  O   . LEU B 1 531 ? -1.219  11.716  19.989  1.00 35.38  ? 531 LEU B O   1 
ATOM   8462 C  CB  . LEU B 1 531 ? -1.483  8.470   20.300  1.00 38.83  ? 531 LEU B CB  1 
ATOM   8463 C  CG  . LEU B 1 531 ? -0.124  8.603   20.985  1.00 40.56  ? 531 LEU B CG  1 
ATOM   8464 C  CD1 . LEU B 1 531 ? 0.398   7.234   21.360  1.00 35.72  ? 531 LEU B CD1 1 
ATOM   8465 C  CD2 . LEU B 1 531 ? 0.897   9.302   20.104  1.00 44.20  ? 531 LEU B CD2 1 
ATOM   8466 N  N   . LEU B 1 532 ? -2.049  10.758  18.120  1.00 38.04  ? 532 LEU B N   1 
ATOM   8467 C  CA  . LEU B 1 532 ? -1.425  11.700  17.199  1.00 43.82  ? 532 LEU B CA  1 
ATOM   8468 C  C   . LEU B 1 532 ? -2.145  13.042  17.165  1.00 48.05  ? 532 LEU B C   1 
ATOM   8469 O  O   . LEU B 1 532 ? -1.516  14.072  16.889  1.00 50.78  ? 532 LEU B O   1 
ATOM   8470 C  CB  . LEU B 1 532 ? -1.377  11.082  15.801  1.00 37.89  ? 532 LEU B CB  1 
ATOM   8471 C  CG  . LEU B 1 532 ? -0.385  9.919   15.679  1.00 34.04  ? 532 LEU B CG  1 
ATOM   8472 C  CD1 . LEU B 1 532 ? -0.438  9.239   14.293  1.00 22.97  ? 532 LEU B CD1 1 
ATOM   8473 C  CD2 . LEU B 1 532 ? 1.035   10.407  16.037  1.00 30.74  ? 532 LEU B CD2 1 
ATOM   8474 N  N   . ASN B 1 533 ? -3.453  13.054  17.427  1.00 46.80  ? 533 ASN B N   1 
ATOM   8475 C  CA  . ASN B 1 533 ? -4.161  14.321  17.553  1.00 52.98  ? 533 ASN B CA  1 
ATOM   8476 C  C   . ASN B 1 533 ? -3.585  15.152  18.686  1.00 58.16  ? 533 ASN B C   1 
ATOM   8477 O  O   . ASN B 1 533 ? -3.305  16.346  18.520  1.00 61.60  ? 533 ASN B O   1 
ATOM   8478 C  CB  . ASN B 1 533 ? -5.647  14.068  17.783  1.00 58.58  ? 533 ASN B CB  1 
ATOM   8479 C  CG  . ASN B 1 533 ? -6.467  14.380  16.569  1.00 63.97  ? 533 ASN B CG  1 
ATOM   8480 O  OD1 . ASN B 1 533 ? -5.946  14.401  15.449  1.00 53.18  ? 533 ASN B OD1 1 
ATOM   8481 N  ND2 . ASN B 1 533 ? -7.762  14.624  16.771  1.00 73.29  ? 533 ASN B ND2 1 
ATOM   8482 N  N   . ALA B 1 534 ? -3.377  14.527  19.840  1.00 62.42  ? 534 ALA B N   1 
ATOM   8483 C  CA  . ALA B 1 534 ? -2.940  15.249  21.024  1.00 71.77  ? 534 ALA B CA  1 
ATOM   8484 C  C   . ALA B 1 534 ? -1.498  15.738  20.899  1.00 77.75  ? 534 ALA B C   1 
ATOM   8485 O  O   . ALA B 1 534 ? -0.675  15.158  20.181  1.00 70.72  ? 534 ALA B O   1 
ATOM   8486 C  CB  . ALA B 1 534 ? -3.069  14.357  22.260  1.00 72.08  ? 534 ALA B CB  1 
ATOM   8487 N  N   . THR B 1 535 ? -1.212  16.838  21.596  1.00 87.36  ? 535 THR B N   1 
ATOM   8488 C  CA  . THR B 1 535 ? 0.148   17.170  22.038  1.00 91.80  ? 535 THR B CA  1 
ATOM   8489 C  C   . THR B 1 535 ? 0.071   17.743  23.451  1.00 82.82  ? 535 THR B C   1 
ATOM   8490 O  O   . THR B 1 535 ? -0.875  18.457  23.787  1.00 75.90  ? 535 THR B O   1 
ATOM   8491 C  CB  . THR B 1 535 ? 0.878   18.196  21.134  1.00 97.12  ? 535 THR B CB  1 
ATOM   8492 O  OG1 . THR B 1 535 ? 0.139   19.423  21.093  1.00 104.05 ? 535 THR B OG1 1 
ATOM   8493 C  CG2 . THR B 1 535 ? 1.092   17.655  19.718  1.00 93.94  ? 535 THR B CG2 1 
HETATM 8494 C  C1  . NAG C 2 .   ? 6.182   -6.078  84.876  1.00 59.16  ? 601 NAG A C1  1 
HETATM 8495 C  C2  . NAG C 2 .   ? 5.922   -6.597  86.292  1.00 68.74  ? 601 NAG A C2  1 
HETATM 8496 C  C3  . NAG C 2 .   ? 4.926   -7.759  86.256  1.00 76.23  ? 601 NAG A C3  1 
HETATM 8497 C  C4  . NAG C 2 .   ? 3.645   -7.345  85.546  1.00 72.71  ? 601 NAG A C4  1 
HETATM 8498 C  C5  . NAG C 2 .   ? 3.978   -6.837  84.145  1.00 67.07  ? 601 NAG A C5  1 
HETATM 8499 C  C6  . NAG C 2 .   ? 2.774   -6.327  83.377  1.00 64.20  ? 601 NAG A C6  1 
HETATM 8500 C  C7  . NAG C 2 .   ? 7.833   -6.251  87.806  1.00 67.05  ? 601 NAG A C7  1 
HETATM 8501 C  C8  . NAG C 2 .   ? 9.079   -6.862  88.374  1.00 71.62  ? 601 NAG A C8  1 
HETATM 8502 N  N2  . NAG C 2 .   ? 7.156   -7.011  86.939  1.00 68.15  ? 601 NAG A N2  1 
HETATM 8503 O  O3  . NAG C 2 .   ? 4.624   -8.180  87.581  1.00 82.79  ? 601 NAG A O3  1 
HETATM 8504 O  O4  . NAG C 2 .   ? 2.743   -8.447  85.496  1.00 66.25  ? 601 NAG A O4  1 
HETATM 8505 O  O5  . NAG C 2 .   ? 4.916   -5.750  84.237  1.00 60.11  ? 601 NAG A O5  1 
HETATM 8506 O  O6  . NAG C 2 .   ? 1.633   -6.139  84.206  1.00 61.80  ? 601 NAG A O6  1 
HETATM 8507 O  O7  . NAG C 2 .   ? 7.467   -5.118  88.109  1.00 58.77  ? 601 NAG A O7  1 
HETATM 8508 C  C1  . NAG D 2 .   ? 31.290  -6.073  45.514  1.00 37.75  ? 602 NAG A C1  1 
HETATM 8509 C  C2  . NAG D 2 .   ? 31.416  -6.743  44.128  1.00 46.36  ? 602 NAG A C2  1 
HETATM 8510 C  C3  . NAG D 2 .   ? 32.751  -7.495  44.002  1.00 62.67  ? 602 NAG A C3  1 
HETATM 8511 C  C4  . NAG D 2 .   ? 33.929  -6.601  44.368  1.00 65.48  ? 602 NAG A C4  1 
HETATM 8512 C  C5  . NAG D 2 .   ? 33.725  -6.025  45.767  1.00 52.82  ? 602 NAG A C5  1 
HETATM 8513 C  C6  . NAG D 2 .   ? 34.817  -5.058  46.181  1.00 52.03  ? 602 NAG A C6  1 
HETATM 8514 C  C7  . NAG D 2 .   ? 29.141  -7.288  43.315  1.00 38.94  ? 602 NAG A C7  1 
HETATM 8515 C  C8  . NAG D 2 .   ? 28.122  -8.378  43.150  1.00 31.46  ? 602 NAG A C8  1 
HETATM 8516 N  N2  . NAG D 2 .   ? 30.301  -7.650  43.884  1.00 37.80  ? 602 NAG A N2  1 
HETATM 8517 O  O3  . NAG D 2 .   ? 32.919  -7.955  42.666  1.00 65.26  ? 602 NAG A O3  1 
HETATM 8518 O  O4  . NAG D 2 .   ? 35.152  -7.331  44.275  1.00 64.66  ? 602 NAG A O4  1 
HETATM 8519 O  O5  . NAG D 2 .   ? 32.490  -5.295  45.801  1.00 39.76  ? 602 NAG A O5  1 
HETATM 8520 O  O6  . NAG D 2 .   ? 34.433  -3.696  46.033  1.00 45.00  ? 602 NAG A O6  1 
HETATM 8521 O  O7  . NAG D 2 .   ? 28.918  -6.133  42.953  1.00 41.32  ? 602 NAG A O7  1 
HETATM 8522 C  C1  . E2W E 3 .   ? -9.497  3.533   51.951  0.99 60.67  ? 603 E2W A C1  1 
HETATM 8523 C  C10 . E2W E 3 .   ? -14.189 5.031   50.368  0.99 52.80  ? 603 E2W A C10 1 
HETATM 8524 C  C11 . E2W E 3 .   ? -13.460 8.507   53.381  0.99 28.12  ? 603 E2W A C11 1 
HETATM 8525 C  C12 . E2W E 3 .   ? -14.012 9.507   52.433  0.99 17.43  ? 603 E2W A C12 1 
HETATM 8526 C  C13 . E2W E 3 .   ? -12.917 10.068  51.544  0.99 48.15  ? 603 E2W A C13 1 
HETATM 8527 C  C14 . E2W E 3 .   ? -12.128 8.948   50.821  0.99 43.96  ? 603 E2W A C14 1 
HETATM 8528 C  C15 . E2W E 3 .   ? -14.067 5.732   55.329  0.99 59.17  ? 603 E2W A C15 1 
HETATM 8529 C  C16 . E2W E 3 .   ? -14.233 4.592   56.395  0.99 48.61  ? 603 E2W A C16 1 
HETATM 8530 C  C17 . E2W E 3 .   ? -15.190 3.418   56.024  0.99 43.13  ? 603 E2W A C17 1 
HETATM 8531 C  C18 . E2W E 3 .   ? -15.865 3.441   54.642  0.99 35.71  ? 603 E2W A C18 1 
HETATM 8532 C  C19 . E2W E 3 .   ? -14.966 3.249   53.471  0.99 46.44  ? 603 E2W A C19 1 
HETATM 8533 C  C2  . E2W E 3 .   ? -9.975  3.379   53.255  0.99 71.42  ? 603 E2W A C2  1 
HETATM 8534 C  C20 . E2W E 3 .   ? -14.112 2.127   53.450  0.99 51.41  ? 603 E2W A C20 1 
HETATM 8535 C  C21 . E2W E 3 .   ? -13.261 1.951   52.373  0.99 55.54  ? 603 E2W A C21 1 
HETATM 8536 C  C22 . E2W E 3 .   ? -13.267 2.896   51.350  0.99 56.97  ? 603 E2W A C22 1 
HETATM 8537 C  C23 . E2W E 3 .   ? -14.149 4.016   51.430  0.99 47.37  ? 603 E2W A C23 1 
HETATM 8538 C  C3  . E2W E 3 .   ? -10.817 4.292   53.826  0.99 59.60  ? 603 E2W A C3  1 
HETATM 8539 C  C4  . E2W E 3 .   ? -11.224 5.423   53.095  0.99 56.19  ? 603 E2W A C4  1 
HETATM 8540 C  C5  . E2W E 3 .   ? -10.764 5.615   51.784  0.99 53.06  ? 603 E2W A C5  1 
HETATM 8541 C  C6  . E2W E 3 .   ? -9.882  4.636   51.228  0.99 55.56  ? 603 E2W A C6  1 
HETATM 8542 C  C7  . E2W E 3 .   ? -12.108 6.386   53.673  0.99 56.66  ? 603 E2W A C7  1 
HETATM 8543 C  C8  . E2W E 3 .   ? -12.526 7.456   52.876  0.99 42.69  ? 603 E2W A C8  1 
HETATM 8544 C  C9  . E2W E 3 .   ? -12.009 7.599   51.539  0.99 47.51  ? 603 E2W A C9  1 
HETATM 8545 N  N10 . E2W E 3 .   ? -11.135 6.713   51.010  0.99 49.74  ? 603 E2W A N10 1 
HETATM 8546 N  N11 . E2W E 3 .   ? -12.649 6.078   54.956  0.99 66.47  ? 603 E2W A N11 1 
HETATM 8547 N  N24 . E2W E 3 .   ? -14.972 4.187   52.477  0.99 42.47  ? 603 E2W A N24 1 
HETATM 8548 N  N25 . E2W E 3 .   ? -13.779 5.047   49.138  0.99 63.44  ? 603 E2W A N25 1 
HETATM 8549 O  O25 . E2W E 3 .   ? -13.162 3.966   48.657  0.99 66.69  ? 603 E2W A O25 1 
HETATM 8550 O  O26 . E2W E 3 .   ? -12.454 2.789   50.253  0.99 59.28  ? 603 E2W A O26 1 
HETATM 8551 CL CL2 . E2W E 3 .   ? -9.493  2.011   54.168  0.99 87.16  ? 603 E2W A CL2 1 
HETATM 8552 C  C1  . NAG F 2 .   ? -5.823  -8.253  -36.542 1.00 59.97  ? 601 NAG B C1  1 
HETATM 8553 C  C2  . NAG F 2 .   ? -5.800  -8.853  -37.946 1.00 57.43  ? 601 NAG B C2  1 
HETATM 8554 C  C3  . NAG F 2 .   ? -5.243  -10.272 -37.896 1.00 57.63  ? 601 NAG B C3  1 
HETATM 8555 C  C4  . NAG F 2 .   ? -3.853  -10.272 -37.277 1.00 71.69  ? 601 NAG B C4  1 
HETATM 8556 C  C5  . NAG F 2 .   ? -3.908  -9.639  -35.883 1.00 75.87  ? 601 NAG B C5  1 
HETATM 8557 C  C6  . NAG F 2 .   ? -2.546  -9.480  -35.234 1.00 72.53  ? 601 NAG B C6  1 
HETATM 8558 C  C7  . NAG F 2 .   ? -7.522  -7.942  -39.457 1.00 58.89  ? 601 NAG B C7  1 
HETATM 8559 C  C8  . NAG F 2 .   ? -8.918  -8.105  -39.983 1.00 43.96  ? 601 NAG B C8  1 
HETATM 8560 N  N2  . NAG F 2 .   ? -7.124  -8.848  -38.552 1.00 64.01  ? 601 NAG B N2  1 
HETATM 8561 O  O3  . NAG F 2 .   ? -5.197  -10.817 -39.208 1.00 53.16  ? 601 NAG B O3  1 
HETATM 8562 O  O4  . NAG F 2 .   ? -3.348  -11.604 -37.219 1.00 70.00  ? 601 NAG B O4  1 
HETATM 8563 O  O5  . NAG F 2 .   ? -4.487  -8.323  -35.957 1.00 72.39  ? 601 NAG B O5  1 
HETATM 8564 O  O6  . NAG F 2 .   ? -1.499  -9.296  -36.181 1.00 66.83  ? 601 NAG B O6  1 
HETATM 8565 O  O7  . NAG F 2 .   ? -6.793  -7.029  -39.828 1.00 63.07  ? 601 NAG B O7  1 
HETATM 8566 C  C1  . NAG G 2 .   ? -31.426 -6.688  2.494   1.00 30.87  ? 602 NAG B C1  1 
HETATM 8567 C  C2  . NAG G 2 .   ? -31.498 -7.510  3.809   1.00 41.89  ? 602 NAG B C2  1 
HETATM 8568 C  C3  . NAG G 2 .   ? -32.856 -8.247  3.934   1.00 59.09  ? 602 NAG B C3  1 
HETATM 8569 C  C4  . NAG G 2 .   ? -34.027 -7.304  3.670   1.00 63.31  ? 602 NAG B C4  1 
HETATM 8570 C  C5  . NAG G 2 .   ? -33.831 -6.665  2.302   1.00 49.06  ? 602 NAG B C5  1 
HETATM 8571 C  C6  . NAG G 2 .   ? -34.933 -5.698  1.926   1.00 41.53  ? 602 NAG B C6  1 
HETATM 8572 C  C7  . NAG G 2 .   ? -29.271 -8.234  4.593   1.00 33.89  ? 602 NAG B C7  1 
HETATM 8573 C  C8  . NAG G 2 .   ? -28.225 -9.302  4.524   1.00 19.41  ? 602 NAG B C8  1 
HETATM 8574 N  N2  . NAG G 2 .   ? -30.380 -8.447  3.863   1.00 28.66  ? 602 NAG B N2  1 
HETATM 8575 O  O3  . NAG G 2 .   ? -32.985 -8.860  5.215   1.00 60.20  ? 602 NAG B O3  1 
HETATM 8576 O  O4  . NAG G 2 .   ? -35.271 -8.000  3.724   1.00 64.11  ? 602 NAG B O4  1 
HETATM 8577 O  O5  . NAG G 2 .   ? -32.603 -5.921  2.333   1.00 37.51  ? 602 NAG B O5  1 
HETATM 8578 O  O6  . NAG G 2 .   ? -34.405 -4.566  1.249   1.00 41.39  ? 602 NAG B O6  1 
HETATM 8579 O  O7  . NAG G 2 .   ? -29.125 -7.220  5.287   1.00 31.76  ? 602 NAG B O7  1 
HETATM 8580 C  C1  . E2W H 3 .   ? 9.449   2.971   -3.926  1.00 44.63  ? 603 E2W B C1  1 
HETATM 8581 C  C10 . E2W H 3 .   ? 12.704  1.375   -3.139  1.00 85.74  ? 603 E2W B C10 1 
HETATM 8582 C  C11 . E2W H 3 .   ? 13.713  7.477   -5.806  1.00 37.96  ? 603 E2W B C11 1 
HETATM 8583 C  C12 . E2W H 3 .   ? 14.352  8.541   -4.929  1.00 36.40  ? 603 E2W B C12 1 
HETATM 8584 C  C13 . E2W H 3 .   ? 13.418  9.091   -3.904  1.00 46.31  ? 603 E2W B C13 1 
HETATM 8585 C  C14 . E2W H 3 .   ? 12.803  7.952   -3.098  1.00 47.25  ? 603 E2W B C14 1 
HETATM 8586 C  C15 . E2W H 3 .   ? 13.938  4.614   -7.772  1.00 63.67  ? 603 E2W B C15 1 
HETATM 8587 C  C16 . E2W H 3 .   ? 14.196  3.063   -7.857  1.00 59.91  ? 603 E2W B C16 1 
HETATM 8588 C  C17 . E2W H 3 .   ? 15.347  2.593   -6.974  1.00 48.11  ? 603 E2W B C17 1 
HETATM 8589 C  C18 . E2W H 3 .   ? 15.852  3.622   -5.962  1.00 55.37  ? 603 E2W B C18 1 
HETATM 8590 C  C19 . E2W H 3 .   ? 15.184  3.580   -4.643  1.00 65.31  ? 603 E2W B C19 1 
HETATM 8591 C  C2  . E2W H 3 .   ? 9.882   2.676   -5.214  1.00 59.60  ? 603 E2W B C2  1 
HETATM 8592 C  C20 . E2W H 3 .   ? 15.465  4.533   -3.652  1.00 75.63  ? 603 E2W B C20 1 
HETATM 8593 C  C21 . E2W H 3 .   ? 14.811  4.445   -2.427  1.00 78.53  ? 603 E2W B C21 1 
HETATM 8594 C  C22 . E2W H 3 .   ? 13.905  3.417   -2.238  1.00 79.77  ? 603 E2W B C22 1 
HETATM 8595 C  C23 . E2W H 3 .   ? 13.671  2.489   -3.284  1.00 78.27  ? 603 E2W B C23 1 
HETATM 8596 C  C3  . E2W H 3 .   ? 10.799  3.445   -5.872  1.00 46.26  ? 603 E2W B C3  1 
HETATM 8597 C  C4  . E2W H 3 .   ? 11.321  4.577   -5.238  1.00 38.64  ? 603 E2W B C4  1 
HETATM 8598 C  C5  . E2W H 3 .   ? 10.905  4.914   -3.946  1.00 39.70  ? 603 E2W B C5  1 
HETATM 8599 C  C6  . E2W H 3 .   ? 9.951   4.074   -3.295  1.00 40.85  ? 603 E2W B C6  1 
HETATM 8600 C  C7  . E2W H 3 .   ? 12.272  5.395   -5.891  1.00 48.31  ? 603 E2W B C7  1 
HETATM 8601 C  C8  . E2W H 3 .   ? 12.726  6.527   -5.211  1.00 47.74  ? 603 E2W B C8  1 
HETATM 8602 C  C9  . E2W H 3 .   ? 12.178  6.851   -3.917  1.00 45.29  ? 603 E2W B C9  1 
HETATM 8603 N  N10 . E2W H 3 .   ? 11.383  6.018   -3.266  1.00 42.53  ? 603 E2W B N10 1 
HETATM 8604 N  N11 . E2W H 3 .   ? 12.617  5.038   -7.219  1.00 61.27  ? 603 E2W B N11 1 
HETATM 8605 N  N24 . E2W H 3 .   ? 14.304  2.585   -4.459  1.00 70.53  ? 603 E2W B N24 1 
HETATM 8606 N  N25 . E2W H 3 .   ? 11.798  1.030   -2.261  1.00 88.78  ? 603 E2W B N25 1 
HETATM 8607 O  O25 . E2W H 3 .   ? 11.633  1.765   -1.167  1.00 88.22  ? 603 E2W B O25 1 
HETATM 8608 O  O26 . E2W H 3 .   ? 13.221  3.257   -1.079  1.00 87.80  ? 603 E2W B O26 1 
HETATM 8609 CL CL2 . E2W H 3 .   ? 9.248   1.308   -5.993  1.00 79.13  ? 603 E2W B CL2 1 
HETATM 8610 CL CL  . CL  I 4 .   ? 5.910   -15.939 8.052   1.00 63.20  ? 604 CL  B CL  1 
HETATM 8611 O  O   . HOH J 5 .   ? 25.008  1.860   82.192  1.00 36.98  ? 701 HOH A O   1 
HETATM 8612 O  O   . HOH J 5 .   ? 28.243  -22.931 47.257  1.00 54.53  ? 702 HOH A O   1 
HETATM 8613 O  O   . HOH J 5 .   ? 7.209   -9.392  48.384  1.00 52.89  ? 703 HOH A O   1 
HETATM 8614 O  O   . HOH J 5 .   ? -0.046  -21.237 45.816  1.00 30.63  ? 704 HOH A O   1 
HETATM 8615 O  O   . HOH J 5 .   ? -2.512  -16.339 42.576  1.00 47.11  ? 705 HOH A O   1 
HETATM 8616 O  O   . HOH J 5 .   ? 9.071   26.446  62.130  1.00 30.15  ? 706 HOH A O   1 
HETATM 8617 O  O   . HOH J 5 .   ? 29.638  -3.963  43.318  1.00 28.95  ? 707 HOH A O   1 
HETATM 8618 O  O   . HOH J 5 .   ? -4.129  -7.619  46.875  1.00 28.11  ? 708 HOH A O   1 
HETATM 8619 O  O   . HOH J 5 .   ? 7.936   7.234   45.800  1.00 29.86  ? 709 HOH A O   1 
HETATM 8620 O  O   . HOH J 5 .   ? 28.099  -14.974 69.118  1.00 41.31  ? 710 HOH A O   1 
HETATM 8621 O  O   . HOH J 5 .   ? -2.602  -11.006 38.982  1.00 41.86  ? 711 HOH A O   1 
HETATM 8622 O  O   . HOH J 5 .   ? 20.644  -19.461 36.855  1.00 60.29  ? 712 HOH A O   1 
HETATM 8623 O  O   . HOH J 5 .   ? -8.062  6.958   69.082  1.00 46.92  ? 713 HOH A O   1 
HETATM 8624 O  O   . HOH J 5 .   ? -9.369  4.737   64.495  1.00 51.08  ? 714 HOH A O   1 
HETATM 8625 O  O   . HOH J 5 .   ? 9.189   6.738   73.895  1.00 33.53  ? 715 HOH A O   1 
HETATM 8626 O  O   . HOH J 5 .   ? 23.359  8.026   68.746  1.00 36.00  ? 716 HOH A O   1 
HETATM 8627 O  O   . HOH J 5 .   ? 3.420   14.267  65.989  1.00 25.83  ? 717 HOH A O   1 
HETATM 8628 O  O   . HOH J 5 .   ? -21.699 -1.757  36.798  1.00 36.90  ? 718 HOH A O   1 
HETATM 8629 O  O   . HOH J 5 .   ? 15.331  16.999  42.562  1.00 35.49  ? 719 HOH A O   1 
HETATM 8630 O  O   . HOH J 5 .   ? 6.488   -7.895  66.683  1.00 33.68  ? 720 HOH A O   1 
HETATM 8631 O  O   . HOH J 5 .   ? -2.969  9.452   72.046  1.00 40.34  ? 721 HOH A O   1 
HETATM 8632 O  O   . HOH J 5 .   ? -2.067  9.580   55.663  1.00 18.06  ? 722 HOH A O   1 
HETATM 8633 O  O   . HOH J 5 .   ? -2.715  -14.892 58.784  1.00 38.80  ? 723 HOH A O   1 
HETATM 8634 O  O   . HOH J 5 .   ? -4.193  8.195   54.113  1.00 43.93  ? 724 HOH A O   1 
HETATM 8635 O  O   . HOH J 5 .   ? -7.164  -27.073 63.782  1.00 24.08  ? 725 HOH A O   1 
HETATM 8636 O  O   . HOH J 5 .   ? -10.203 5.485   48.198  1.00 36.48  ? 726 HOH A O   1 
HETATM 8637 O  O   . HOH J 5 .   ? 2.959   -23.175 45.873  1.00 43.19  ? 727 HOH A O   1 
HETATM 8638 O  O   . HOH J 5 .   ? -8.538  -14.647 23.580  1.00 20.18  ? 728 HOH A O   1 
HETATM 8639 O  O   . HOH J 5 .   ? -17.713 -3.523  45.263  1.00 55.32  ? 729 HOH A O   1 
HETATM 8640 O  O   . HOH J 5 .   ? 20.263  -16.616 82.521  1.00 40.35  ? 730 HOH A O   1 
HETATM 8641 O  O   . HOH J 5 .   ? 3.068   19.839  74.815  1.00 45.52  ? 731 HOH A O   1 
HETATM 8642 O  O   . HOH J 5 .   ? -0.225  7.632   54.724  1.00 7.51   ? 732 HOH A O   1 
HETATM 8643 O  O   . HOH J 5 .   ? 4.027   -4.084  56.693  1.00 25.90  ? 733 HOH A O   1 
HETATM 8644 O  O   . HOH J 5 .   ? -20.068 -5.230  30.799  1.00 20.92  ? 734 HOH A O   1 
HETATM 8645 O  O   . HOH J 5 .   ? 2.361   2.411   56.912  1.00 31.62  ? 735 HOH A O   1 
HETATM 8646 O  O   . HOH J 5 .   ? 0.700   -4.018  83.000  1.00 26.70  ? 736 HOH A O   1 
HETATM 8647 O  O   . HOH J 5 .   ? 1.668   -12.572 55.952  1.00 44.89  ? 737 HOH A O   1 
HETATM 8648 O  O   . HOH J 5 .   ? -8.016  -11.281 40.085  1.00 33.21  ? 738 HOH A O   1 
HETATM 8649 O  O   . HOH J 5 .   ? 24.489  -4.657  24.849  1.00 43.02  ? 739 HOH A O   1 
HETATM 8650 O  O   . HOH J 5 .   ? 20.991  -11.837 36.689  1.00 21.00  ? 740 HOH A O   1 
HETATM 8651 O  O   . HOH J 5 .   ? 24.885  -11.151 33.513  1.00 51.78  ? 741 HOH A O   1 
HETATM 8652 O  O   . HOH J 5 .   ? 8.419   -1.848  62.603  1.00 36.54  ? 742 HOH A O   1 
HETATM 8653 O  O   . HOH J 5 .   ? 6.445   7.595   72.753  1.00 38.75  ? 743 HOH A O   1 
HETATM 8654 O  O   . HOH J 5 .   ? 5.887   17.354  60.320  1.00 39.93  ? 744 HOH A O   1 
HETATM 8655 O  O   . HOH J 5 .   ? 11.982  16.966  57.885  1.00 50.00  ? 745 HOH A O   1 
HETATM 8656 O  O   . HOH J 5 .   ? 16.286  -4.347  30.043  1.00 23.30  ? 746 HOH A O   1 
HETATM 8657 O  O   . HOH J 5 .   ? -12.221 -5.152  58.838  1.00 34.94  ? 747 HOH A O   1 
HETATM 8658 O  O   . HOH J 5 .   ? 18.505  -14.107 75.605  1.00 25.45  ? 748 HOH A O   1 
HETATM 8659 O  O   . HOH J 5 .   ? -3.975  2.488   42.047  1.00 32.51  ? 749 HOH A O   1 
HETATM 8660 O  O   . HOH J 5 .   ? -7.298  4.863   47.866  1.00 17.87  ? 750 HOH A O   1 
HETATM 8661 O  O   . HOH J 5 .   ? 3.587   30.540  60.171  1.00 19.19  ? 751 HOH A O   1 
HETATM 8662 O  O   . HOH J 5 .   ? 23.551  -8.314  81.939  1.00 33.85  ? 752 HOH A O   1 
HETATM 8663 O  O   . HOH J 5 .   ? 9.487   16.622  31.930  1.00 26.31  ? 753 HOH A O   1 
HETATM 8664 O  O   . HOH J 5 .   ? -13.973 -1.919  39.338  1.00 51.60  ? 754 HOH A O   1 
HETATM 8665 O  O   . HOH J 5 .   ? -2.200  -1.840  63.100  1.00 24.01  ? 755 HOH A O   1 
HETATM 8666 O  O   . HOH J 5 .   ? -8.169  -21.108 51.622  1.00 43.81  ? 756 HOH A O   1 
HETATM 8667 O  O   . HOH J 5 .   ? -9.429  31.292  63.507  1.00 25.14  ? 757 HOH A O   1 
HETATM 8668 O  O   . HOH J 5 .   ? -4.053  7.263   60.587  1.00 35.98  ? 758 HOH A O   1 
HETATM 8669 O  O   . HOH J 5 .   ? -9.372  -0.681  24.274  1.00 21.94  ? 759 HOH A O   1 
HETATM 8670 O  O   . HOH J 5 .   ? 2.114   14.071  53.324  1.00 21.99  ? 760 HOH A O   1 
HETATM 8671 O  O   . HOH J 5 .   ? 32.789  -15.310 76.486  1.00 37.83  ? 761 HOH A O   1 
HETATM 8672 O  O   . HOH J 5 .   ? 0.079   27.604  52.792  1.00 26.65  ? 762 HOH A O   1 
HETATM 8673 O  O   . HOH J 5 .   ? -13.083 -15.739 44.366  1.00 30.73  ? 763 HOH A O   1 
HETATM 8674 O  O   . HOH J 5 .   ? -1.903  11.287  45.296  1.00 46.22  ? 764 HOH A O   1 
HETATM 8675 O  O   . HOH J 5 .   ? 4.456   -7.826  32.291  1.00 34.15  ? 765 HOH A O   1 
HETATM 8676 O  O   . HOH J 5 .   ? -15.098 -2.525  46.423  1.00 48.30  ? 766 HOH A O   1 
HETATM 8677 O  O   . HOH J 5 .   ? 20.561  6.021   74.044  1.00 26.58  ? 767 HOH A O   1 
HETATM 8678 O  O   . HOH J 5 .   ? -2.716  -1.887  58.783  1.00 21.91  ? 768 HOH A O   1 
HETATM 8679 O  O   . HOH J 5 .   ? 10.689  19.546  64.272  1.00 48.88  ? 769 HOH A O   1 
HETATM 8680 O  O   . HOH J 5 .   ? 5.758   13.677  55.254  1.00 41.84  ? 770 HOH A O   1 
HETATM 8681 O  O   . HOH J 5 .   ? -22.572 -6.891  26.472  1.00 24.66  ? 771 HOH A O   1 
HETATM 8682 O  O   . HOH J 5 .   ? -7.848  9.769   35.631  1.00 58.26  ? 772 HOH A O   1 
HETATM 8683 O  O   . HOH J 5 .   ? 2.727   -10.922 68.527  1.00 42.78  ? 773 HOH A O   1 
HETATM 8684 O  O   . HOH J 5 .   ? -17.208 -14.129 32.470  1.00 17.46  ? 774 HOH A O   1 
HETATM 8685 O  O   . HOH J 5 .   ? -1.709  -10.286 63.577  1.00 26.29  ? 775 HOH A O   1 
HETATM 8686 O  O   . HOH J 5 .   ? -17.795 -0.420  50.520  1.00 33.45  ? 776 HOH A O   1 
HETATM 8687 O  O   . HOH J 5 .   ? -0.528  8.505   48.171  1.00 5.86   ? 777 HOH A O   1 
HETATM 8688 O  O   . HOH J 5 .   ? 31.541  -25.008 50.264  1.00 26.54  ? 778 HOH A O   1 
HETATM 8689 O  O   . HOH J 5 .   ? -16.048 -15.682 47.785  1.00 38.41  ? 779 HOH A O   1 
HETATM 8690 O  O   . HOH J 5 .   ? -11.448 -9.044  29.014  1.00 52.67  ? 780 HOH A O   1 
HETATM 8691 O  O   . HOH J 5 .   ? 26.425  -11.151 47.204  1.00 24.84  ? 781 HOH A O   1 
HETATM 8692 O  O   . HOH J 5 .   ? 28.859  -1.356  45.009  1.00 23.78  ? 782 HOH A O   1 
HETATM 8693 O  O   . HOH J 5 .   ? -3.827  10.451  60.546  1.00 24.04  ? 783 HOH A O   1 
HETATM 8694 O  O   . HOH J 5 .   ? 8.536   15.348  68.904  1.00 24.21  ? 784 HOH A O   1 
HETATM 8695 O  O   . HOH J 5 .   ? 28.267  -10.805 63.238  1.00 51.65  ? 785 HOH A O   1 
HETATM 8696 O  O   . HOH J 5 .   ? -6.273  10.723  45.411  1.00 37.25  ? 786 HOH A O   1 
HETATM 8697 O  O   . HOH J 5 .   ? 2.585   19.234  42.924  1.00 35.91  ? 787 HOH A O   1 
HETATM 8698 O  O   . HOH J 5 .   ? 6.404   15.001  75.930  1.00 28.40  ? 788 HOH A O   1 
HETATM 8699 O  O   . HOH J 5 .   ? 5.595   11.872  33.397  1.00 27.49  ? 789 HOH A O   1 
HETATM 8700 O  O   . HOH J 5 .   ? -14.292 28.376  59.618  1.00 40.04  ? 790 HOH A O   1 
HETATM 8701 O  O   . HOH J 5 .   ? -4.063  -7.952  25.798  1.00 8.72   ? 791 HOH A O   1 
HETATM 8702 O  O   . HOH J 5 .   ? 17.037  5.973   31.988  1.00 35.53  ? 792 HOH A O   1 
HETATM 8703 O  O   . HOH J 5 .   ? -1.360  15.362  43.925  1.00 43.43  ? 793 HOH A O   1 
HETATM 8704 O  O   . HOH J 5 .   ? 22.404  -18.055 31.522  1.00 33.31  ? 794 HOH A O   1 
HETATM 8705 O  O   . HOH J 5 .   ? 4.696   0.363   69.126  1.00 26.84  ? 795 HOH A O   1 
HETATM 8706 O  O   . HOH J 5 .   ? 3.920   3.508   37.838  1.00 26.99  ? 796 HOH A O   1 
HETATM 8707 O  O   . HOH J 5 .   ? 2.635   -4.045  24.777  1.00 44.01  ? 797 HOH A O   1 
HETATM 8708 O  O   . HOH J 5 .   ? 8.927   19.254  46.307  1.00 16.42  ? 798 HOH A O   1 
HETATM 8709 O  O   . HOH J 5 .   ? 13.923  -23.972 78.893  1.00 55.16  ? 799 HOH A O   1 
HETATM 8710 O  O   . HOH J 5 .   ? -6.903  2.419   49.050  1.00 21.64  ? 800 HOH A O   1 
HETATM 8711 O  O   . HOH J 5 .   ? -4.689  -11.529 37.597  1.00 29.14  ? 801 HOH A O   1 
HETATM 8712 O  O   . HOH J 5 .   ? -4.641  -8.188  28.343  1.00 34.92  ? 802 HOH A O   1 
HETATM 8713 O  O   . HOH J 5 .   ? -19.371 -5.861  37.937  1.00 20.41  ? 803 HOH A O   1 
HETATM 8714 O  O   . HOH J 5 .   ? -1.086  28.532  55.364  1.00 31.24  ? 804 HOH A O   1 
HETATM 8715 O  O   . HOH J 5 .   ? 0.689   8.297   64.716  1.00 28.97  ? 805 HOH A O   1 
HETATM 8716 O  O   . HOH J 5 .   ? -0.311  16.949  30.763  1.00 23.33  ? 806 HOH A O   1 
HETATM 8717 O  O   . HOH J 5 .   ? -8.538  1.033   47.968  1.00 35.53  ? 807 HOH A O   1 
HETATM 8718 O  O   . HOH J 5 .   ? -18.870 1.676   63.935  1.00 27.85  ? 808 HOH A O   1 
HETATM 8719 O  O   . HOH J 5 .   ? -3.412  -18.192 59.371  1.00 28.00  ? 809 HOH A O   1 
HETATM 8720 O  O   . HOH J 5 .   ? 27.532  4.239   49.862  1.00 33.51  ? 810 HOH A O   1 
HETATM 8721 O  O   . HOH J 5 .   ? -3.483  -9.643  69.535  1.00 46.96  ? 811 HOH A O   1 
HETATM 8722 O  O   . HOH J 5 .   ? -18.363 -8.395  50.760  1.00 38.54  ? 812 HOH A O   1 
HETATM 8723 O  O   . HOH J 5 .   ? 8.420   0.903   83.325  1.00 11.45  ? 813 HOH A O   1 
HETATM 8724 O  O   . HOH J 5 .   ? 1.748   29.803  68.212  1.00 48.21  ? 814 HOH A O   1 
HETATM 8725 O  O   . HOH J 5 .   ? -7.355  -1.383  54.274  1.00 47.91  ? 815 HOH A O   1 
HETATM 8726 O  O   . HOH J 5 .   ? -2.379  -28.957 57.161  1.00 36.34  ? 816 HOH A O   1 
HETATM 8727 O  O   . HOH J 5 .   ? -20.683 -12.061 30.680  1.00 39.46  ? 817 HOH A O   1 
HETATM 8728 O  O   . HOH J 5 .   ? -0.164  -7.611  40.796  1.00 57.37  ? 818 HOH A O   1 
HETATM 8729 O  O   . HOH J 5 .   ? 26.007  -16.573 77.164  1.00 14.48  ? 819 HOH A O   1 
HETATM 8730 O  O   . HOH J 5 .   ? -6.638  32.238  54.626  1.00 31.92  ? 820 HOH A O   1 
HETATM 8731 O  O   . HOH J 5 .   ? -0.397  -16.837 52.338  1.00 40.51  ? 821 HOH A O   1 
HETATM 8732 O  O   . HOH J 5 .   ? 21.795  13.642  43.203  1.00 48.59  ? 822 HOH A O   1 
HETATM 8733 O  O   . HOH J 5 .   ? 6.089   -1.251  77.779  1.00 40.76  ? 823 HOH A O   1 
HETATM 8734 O  O   . HOH J 5 .   ? -11.260 -19.335 51.659  1.00 29.47  ? 824 HOH A O   1 
HETATM 8735 O  O   . HOH J 5 .   ? -11.684 17.223  76.290  1.00 49.81  ? 825 HOH A O   1 
HETATM 8736 O  O   . HOH J 5 .   ? -16.631 23.619  56.898  1.00 26.51  ? 826 HOH A O   1 
HETATM 8737 O  O   . HOH J 5 .   ? 17.797  -21.212 52.674  1.00 41.77  ? 827 HOH A O   1 
HETATM 8738 O  O   . HOH J 5 .   ? 22.880  -13.059 86.775  1.00 43.79  ? 828 HOH A O   1 
HETATM 8739 O  O   . HOH J 5 .   ? 25.535  -6.277  37.110  1.00 2.12   ? 829 HOH A O   1 
HETATM 8740 O  O   . HOH J 5 .   ? 16.324  11.046  63.810  1.00 18.67  ? 830 HOH A O   1 
HETATM 8741 O  O   . HOH J 5 .   ? 26.078  -1.058  59.615  1.00 36.16  ? 831 HOH A O   1 
HETATM 8742 O  O   . HOH J 5 .   ? 28.251  -18.950 49.093  1.00 38.76  ? 832 HOH A O   1 
HETATM 8743 O  O   . HOH J 5 .   ? -6.993  -10.226 30.401  1.00 37.90  ? 833 HOH A O   1 
HETATM 8744 O  O   . HOH J 5 .   ? 0.037   28.135  72.878  1.00 41.11  ? 834 HOH A O   1 
HETATM 8745 O  O   . HOH J 5 .   ? -0.621  -2.930  59.365  1.00 61.34  ? 835 HOH A O   1 
HETATM 8746 O  O   . HOH J 5 .   ? -19.495 -11.995 33.000  1.00 26.15  ? 836 HOH A O   1 
HETATM 8747 O  O   . HOH J 5 .   ? -6.456  0.147   51.763  1.00 16.72  ? 837 HOH A O   1 
HETATM 8748 O  O   . HOH J 5 .   ? 5.914   24.057  47.060  1.00 28.34  ? 838 HOH A O   1 
HETATM 8749 O  O   . HOH J 5 .   ? 25.343  7.255   78.746  1.00 32.30  ? 839 HOH A O   1 
HETATM 8750 O  O   . HOH J 5 .   ? 5.900   18.199  75.252  1.00 28.44  ? 840 HOH A O   1 
HETATM 8751 O  O   . HOH J 5 .   ? 12.448  21.113  47.514  1.00 35.12  ? 841 HOH A O   1 
HETATM 8752 O  O   . HOH J 5 .   ? 12.886  -1.353  34.476  1.00 32.30  ? 842 HOH A O   1 
HETATM 8753 O  O   . HOH J 5 .   ? 13.149  18.581  45.901  1.00 31.85  ? 843 HOH A O   1 
HETATM 8754 O  O   . HOH J 5 .   ? -1.345  1.143   24.628  1.00 41.02  ? 844 HOH A O   1 
HETATM 8755 O  O   . HOH J 5 .   ? -7.374  -3.465  71.726  1.00 14.12  ? 845 HOH A O   1 
HETATM 8756 O  O   . HOH J 5 .   ? 16.491  1.226   34.350  1.00 34.07  ? 846 HOH A O   1 
HETATM 8757 O  O   . HOH J 5 .   ? 10.458  7.340   81.738  1.00 51.06  ? 847 HOH A O   1 
HETATM 8758 O  O   . HOH J 5 .   ? 6.442   -13.072 72.243  1.00 27.24  ? 848 HOH A O   1 
HETATM 8759 O  O   . HOH J 5 .   ? 11.002  13.851  43.472  1.00 17.79  ? 849 HOH A O   1 
HETATM 8760 O  O   . HOH J 5 .   ? 9.134   -27.056 76.679  1.00 50.04  ? 850 HOH A O   1 
HETATM 8761 O  O   . HOH J 5 .   ? -5.118  16.665  72.475  1.00 11.54  ? 851 HOH A O   1 
HETATM 8762 O  O   . HOH J 5 .   ? 19.076  11.999  75.898  1.00 44.30  ? 852 HOH A O   1 
HETATM 8763 O  O   . HOH J 5 .   ? -2.886  31.566  65.650  1.00 43.10  ? 853 HOH A O   1 
HETATM 8764 O  O   . HOH J 5 .   ? 4.707   -21.031 70.040  1.00 24.31  ? 854 HOH A O   1 
HETATM 8765 O  O   . HOH J 5 .   ? -5.837  -14.616 39.807  1.00 30.29  ? 855 HOH A O   1 
HETATM 8766 O  O   . HOH J 5 .   ? -0.993  21.700  45.117  1.00 20.95  ? 856 HOH A O   1 
HETATM 8767 O  O   . HOH J 5 .   ? 14.286  5.187   28.302  1.00 30.10  ? 857 HOH A O   1 
HETATM 8768 O  O   . HOH J 5 .   ? 0.237   -4.048  55.556  1.00 11.52  ? 858 HOH A O   1 
HETATM 8769 O  O   . HOH J 5 .   ? 14.471  -3.241  32.023  1.00 27.75  ? 859 HOH A O   1 
HETATM 8770 O  O   . HOH J 5 .   ? 12.788  1.342   34.214  1.00 31.81  ? 860 HOH A O   1 
HETATM 8771 O  O   . HOH J 5 .   ? -2.394  -0.848  53.223  1.00 29.15  ? 861 HOH A O   1 
HETATM 8772 O  O   . HOH J 5 .   ? 10.776  3.173   85.156  1.00 10.48  ? 862 HOH A O   1 
HETATM 8773 O  O   . HOH J 5 .   ? -11.717 -21.436 54.034  1.00 31.22  ? 863 HOH A O   1 
HETATM 8774 O  O   . HOH J 5 .   ? -21.971 -6.256  37.030  1.00 23.77  ? 864 HOH A O   1 
HETATM 8775 O  O   . HOH J 5 .   ? 1.204   12.285  43.892  1.00 23.65  ? 865 HOH A O   1 
HETATM 8776 O  O   . HOH J 5 .   ? -11.797 30.446  60.140  1.00 23.00  ? 866 HOH A O   1 
HETATM 8777 O  O   . HOH J 5 .   ? 14.096  19.283  65.196  1.00 34.43  ? 867 HOH A O   1 
HETATM 8778 O  O   . HOH J 5 .   ? -18.638 -16.236 32.529  1.00 31.91  ? 868 HOH A O   1 
HETATM 8779 O  O   . HOH J 5 .   ? 21.910  -5.051  88.039  1.00 19.50  ? 869 HOH A O   1 
HETATM 8780 O  O   . HOH J 5 .   ? 5.181   26.278  49.204  1.00 57.19  ? 870 HOH A O   1 
HETATM 8781 O  O   . HOH J 5 .   ? 12.616  18.534  42.986  1.00 21.36  ? 871 HOH A O   1 
HETATM 8782 O  O   . HOH J 5 .   ? -2.688  -3.428  55.207  1.00 27.69  ? 872 HOH A O   1 
HETATM 8783 O  O   . HOH K 5 .   ? -5.138  -7.666  16.751  1.00 27.53  ? 701 HOH B O   1 
HETATM 8784 O  O   . HOH K 5 .   ? -7.477  -9.015  -17.630 1.00 52.77  ? 702 HOH B O   1 
HETATM 8785 O  O   . HOH K 5 .   ? -27.936 -23.737 -4.307  1.00 51.59  ? 703 HOH B O   1 
HETATM 8786 O  O   . HOH K 5 .   ? -3.278  -24.069 2.252   1.00 27.47  ? 704 HOH B O   1 
HETATM 8787 O  O   . HOH K 5 .   ? 18.264  -9.638  7.983   1.00 35.26  ? 705 HOH B O   1 
HETATM 8788 O  O   . HOH K 5 .   ? 5.407   21.955  -3.677  1.00 59.12  ? 706 HOH B O   1 
HETATM 8789 O  O   . HOH K 5 .   ? 9.032   11.474  14.613  1.00 48.48  ? 707 HOH B O   1 
HETATM 8790 O  O   . HOH K 5 .   ? 0.075   22.525  -0.774  1.00 41.16  ? 708 HOH B O   1 
HETATM 8791 O  O   . HOH K 5 .   ? -30.437 -1.360  -25.014 1.00 37.96  ? 709 HOH B O   1 
HETATM 8792 O  O   . HOH K 5 .   ? -9.438  14.555  15.095  1.00 34.69  ? 710 HOH B O   1 
HETATM 8793 O  O   . HOH K 5 .   ? -8.007  16.703  17.891  1.00 41.41  ? 711 HOH B O   1 
HETATM 8794 O  O   . HOH K 5 .   ? -10.445 -25.849 -1.422  1.00 40.38  ? 712 HOH B O   1 
HETATM 8795 O  O   . HOH K 5 .   ? -1.569  -13.207 -7.865  1.00 48.97  ? 713 HOH B O   1 
HETATM 8796 O  O   . HOH K 5 .   ? 15.213  -1.514  21.455  1.00 30.46  ? 714 HOH B O   1 
HETATM 8797 O  O   . HOH K 5 .   ? -6.803  -10.729 -0.793  1.00 10.15  ? 715 HOH B O   1 
HETATM 8798 O  O   . HOH K 5 .   ? -26.671 -18.011 -3.939  1.00 47.46  ? 716 HOH B O   1 
HETATM 8799 O  O   . HOH K 5 .   ? -12.757 0.878   13.415  1.00 13.52  ? 717 HOH B O   1 
HETATM 8800 O  O   . HOH K 5 .   ? -3.288  12.770  -18.614 1.00 32.65  ? 718 HOH B O   1 
HETATM 8801 O  O   . HOH K 5 .   ? -27.498 -1.343  -15.094 1.00 19.99  ? 719 HOH B O   1 
HETATM 8802 O  O   . HOH K 5 .   ? -5.878  16.270  -12.544 1.00 36.43  ? 720 HOH B O   1 
HETATM 8803 O  O   . HOH K 5 .   ? 0.315   6.584   -6.980  1.00 21.26  ? 721 HOH B O   1 
HETATM 8804 O  O   . HOH K 5 .   ? -9.431  -15.711 -16.012 1.00 33.06  ? 722 HOH B O   1 
HETATM 8805 O  O   . HOH K 5 .   ? 12.179  -6.123  -10.744 1.00 43.62  ? 723 HOH B O   1 
HETATM 8806 O  O   . HOH K 5 .   ? 19.332  -6.723  17.290  1.00 32.31  ? 724 HOH B O   1 
HETATM 8807 O  O   . HOH K 5 .   ? 2.148   -2.973  -15.392 1.00 21.30  ? 725 HOH B O   1 
HETATM 8808 O  O   . HOH K 5 .   ? 10.721  5.212   -0.078  1.00 46.98  ? 726 HOH B O   1 
HETATM 8809 O  O   . HOH K 5 .   ? 18.437  -10.543 -3.099  1.00 36.15  ? 727 HOH B O   1 
HETATM 8810 O  O   . HOH K 5 .   ? -4.120  -13.118 -35.306 1.00 34.08  ? 728 HOH B O   1 
HETATM 8811 O  O   . HOH K 5 .   ? -9.575  3.963   22.228  1.00 52.77  ? 729 HOH B O   1 
HETATM 8812 O  O   . HOH K 5 .   ? -25.165 -2.932  -22.103 1.00 28.84  ? 730 HOH B O   1 
HETATM 8813 O  O   . HOH K 5 .   ? 8.475   -14.811 24.142  1.00 30.71  ? 731 HOH B O   1 
HETATM 8814 O  O   . HOH K 5 .   ? 3.863   -8.892  1.003   1.00 27.38  ? 732 HOH B O   1 
HETATM 8815 O  O   . HOH K 5 .   ? -10.175 21.205  -10.123 1.00 42.17  ? 733 HOH B O   1 
HETATM 8816 O  O   . HOH K 5 .   ? 12.275  -0.573  -7.714  1.00 61.56  ? 734 HOH B O   1 
HETATM 8817 O  O   . HOH K 5 .   ? -4.071  -5.497  -8.830  1.00 26.29  ? 735 HOH B O   1 
HETATM 8818 O  O   . HOH K 5 .   ? -1.929  24.824  -20.224 1.00 81.62  ? 736 HOH B O   1 
HETATM 8819 O  O   . HOH K 5 .   ? -7.712  6.712   2.232   1.00 46.09  ? 737 HOH B O   1 
HETATM 8820 O  O   . HOH K 5 .   ? -1.994  -4.333  -11.791 1.00 26.36  ? 738 HOH B O   1 
HETATM 8821 O  O   . HOH K 5 .   ? -8.583  25.684  -14.640 1.00 27.03  ? 739 HOH B O   1 
HETATM 8822 O  O   . HOH K 5 .   ? -4.906  25.744  -20.729 1.00 43.85  ? 740 HOH B O   1 
HETATM 8823 O  O   . HOH K 5 .   ? -6.194  5.926   -25.178 1.00 35.83  ? 741 HOH B O   1 
HETATM 8824 O  O   . HOH K 5 .   ? 2.111   8.341   -8.179  1.00 31.16  ? 742 HOH B O   1 
HETATM 8825 O  O   . HOH K 5 .   ? -2.009  -28.319 -12.145 1.00 63.54  ? 743 HOH B O   1 
HETATM 8826 O  O   . HOH K 5 .   ? -17.215 -6.528  22.380  1.00 25.36  ? 744 HOH B O   1 
HETATM 8827 O  O   . HOH K 5 .   ? -20.820 -1.009  -15.493 1.00 32.85  ? 745 HOH B O   1 
HETATM 8828 O  O   . HOH K 5 .   ? -25.824 -12.493 0.712   1.00 37.02  ? 746 HOH B O   1 
HETATM 8829 O  O   . HOH K 5 .   ? -24.068 -1.205  -15.485 1.00 35.39  ? 747 HOH B O   1 
HETATM 8830 O  O   . HOH K 5 .   ? -14.081 6.902   -38.251 1.00 40.64  ? 748 HOH B O   1 
HETATM 8831 O  O   . HOH K 5 .   ? -18.587 11.446  -13.978 1.00 28.84  ? 749 HOH B O   1 
HETATM 8832 O  O   . HOH K 5 .   ? 1.087   12.730  20.883  1.00 30.63  ? 750 HOH B O   1 
HETATM 8833 O  O   . HOH K 5 .   ? -12.527 -16.324 16.211  1.00 27.03  ? 751 HOH B O   1 
HETATM 8834 O  O   . HOH K 5 .   ? 2.108   9.227   5.200   1.00 22.35  ? 752 HOH B O   1 
HETATM 8835 O  O   . HOH K 5 .   ? 3.120   -19.280 -7.656  1.00 14.25  ? 753 HOH B O   1 
HETATM 8836 O  O   . HOH K 5 .   ? -2.254  1.084   -9.563  1.00 22.11  ? 754 HOH B O   1 
HETATM 8837 O  O   . HOH K 5 .   ? 7.327   17.017  -25.726 1.00 51.24  ? 755 HOH B O   1 
HETATM 8838 O  O   . HOH K 5 .   ? 0.668   26.450  -6.967  1.00 44.67  ? 756 HOH B O   1 
HETATM 8839 O  O   . HOH K 5 .   ? 15.790  -15.805 21.212  1.00 25.80  ? 757 HOH B O   1 
HETATM 8840 O  O   . HOH K 5 .   ? -20.929 -12.260 11.627  1.00 17.74  ? 758 HOH B O   1 
HETATM 8841 O  O   . HOH K 5 .   ? 14.051  -2.888  8.594   1.00 29.15  ? 759 HOH B O   1 
HETATM 8842 O  O   . HOH K 5 .   ? -7.842  -3.427  -14.716 1.00 29.34  ? 760 HOH B O   1 
HETATM 8843 O  O   . HOH K 5 .   ? 7.489   13.850  18.017  1.00 36.41  ? 761 HOH B O   1 
HETATM 8844 O  O   . HOH K 5 .   ? -2.566  -1.573  -20.054 1.00 28.39  ? 762 HOH B O   1 
HETATM 8845 O  O   . HOH K 5 .   ? 4.267   1.751   5.779   1.00 31.51  ? 763 HOH B O   1 
HETATM 8846 O  O   . HOH K 5 .   ? -3.500  18.298  21.412  1.00 53.25  ? 764 HOH B O   1 
HETATM 8847 O  O   . HOH K 5 .   ? -23.629 -5.333  4.473   1.00 21.40  ? 765 HOH B O   1 
HETATM 8848 O  O   . HOH K 5 .   ? -20.639 -3.263  11.606  1.00 38.95  ? 766 HOH B O   1 
HETATM 8849 O  O   . HOH K 5 .   ? -4.831  19.575  -4.837  1.00 30.09  ? 767 HOH B O   1 
HETATM 8850 O  O   . HOH K 5 .   ? 17.571  -14.110 16.308  1.00 36.40  ? 768 HOH B O   1 
HETATM 8851 O  O   . HOH K 5 .   ? -20.351 -15.898 18.857  1.00 39.20  ? 769 HOH B O   1 
HETATM 8852 O  O   . HOH K 5 .   ? 0.223   7.589   -0.456  1.00 27.44  ? 770 HOH B O   1 
HETATM 8853 O  O   . HOH K 5 .   ? -0.077  -2.173  -5.348  1.00 30.60  ? 771 HOH B O   1 
HETATM 8854 O  O   . HOH K 5 .   ? 11.016  -17.882 9.619   1.00 22.89  ? 772 HOH B O   1 
HETATM 8855 O  O   . HOH K 5 .   ? -7.479  -12.598 14.037  1.00 21.91  ? 773 HOH B O   1 
HETATM 8856 O  O   . HOH K 5 .   ? -21.249 12.034  4.730   1.00 42.30  ? 774 HOH B O   1 
HETATM 8857 O  O   . HOH K 5 .   ? 21.546  -11.821 -1.665  1.00 45.34  ? 775 HOH B O   1 
HETATM 8858 O  O   . HOH K 5 .   ? -20.203 -19.867 11.769  1.00 30.11  ? 776 HOH B O   1 
HETATM 8859 O  O   . HOH K 5 .   ? -4.904  -0.720  -22.018 1.00 13.50  ? 777 HOH B O   1 
HETATM 8860 O  O   . HOH K 5 .   ? 11.047  -9.698  19.103  1.00 48.06  ? 778 HOH B O   1 
HETATM 8861 O  O   . HOH K 5 .   ? -27.971 7.201   4.354   1.00 22.07  ? 779 HOH B O   1 
HETATM 8862 O  O   . HOH K 5 .   ? 6.562   -8.363  -23.290 1.00 28.81  ? 780 HOH B O   1 
HETATM 8863 O  O   . HOH K 5 .   ? 6.462   12.195  11.481  1.00 41.49  ? 781 HOH B O   1 
HETATM 8864 O  O   . HOH K 5 .   ? 13.163  24.437  -10.332 1.00 46.32  ? 782 HOH B O   1 
HETATM 8865 O  O   . HOH K 5 .   ? -25.221 -2.509  -12.278 1.00 24.25  ? 783 HOH B O   1 
HETATM 8866 O  O   . HOH K 5 .   ? 19.047  -13.162 7.849   1.00 23.79  ? 784 HOH B O   1 
HETATM 8867 O  O   . HOH K 5 .   ? -12.915 25.102  -10.775 1.00 43.81  ? 785 HOH B O   1 
HETATM 8868 O  O   . HOH K 5 .   ? -24.275 -16.604 13.267  1.00 24.51  ? 786 HOH B O   1 
HETATM 8869 O  O   . HOH K 5 .   ? 22.240  -12.894 -4.524  1.00 23.04  ? 787 HOH B O   1 
HETATM 8870 O  O   . HOH K 5 .   ? 16.286  -11.285 22.258  1.00 37.18  ? 788 HOH B O   1 
HETATM 8871 O  O   . HOH K 5 .   ? 7.936   9.042   11.977  1.00 36.47  ? 789 HOH B O   1 
HETATM 8872 O  O   . HOH K 5 .   ? -2.155  0.479   -17.997 1.00 18.88  ? 790 HOH B O   1 
HETATM 8873 O  O   . HOH K 5 .   ? 1.731   -11.561 -15.512 1.00 21.46  ? 791 HOH B O   1 
HETATM 8874 O  O   . HOH K 5 .   ? 9.731   -7.102  17.951  1.00 58.66  ? 792 HOH B O   1 
HETATM 8875 O  O   . HOH K 5 .   ? -23.229 6.498   -11.094 1.00 32.10  ? 793 HOH B O   1 
HETATM 8876 O  O   . HOH K 5 .   ? -13.538 -8.274  12.792  1.00 34.08  ? 794 HOH B O   1 
HETATM 8877 O  O   . HOH K 5 .   ? -8.564  -12.127 16.815  1.00 30.80  ? 795 HOH B O   1 
HETATM 8878 O  O   . HOH K 5 .   ? -29.407 -0.850  -17.789 1.00 40.17  ? 796 HOH B O   1 
HETATM 8879 O  O   . HOH K 5 .   ? -34.411 -1.695  2.015   1.00 41.26  ? 797 HOH B O   1 
HETATM 8880 O  O   . HOH K 5 .   ? -23.966 -18.002 -14.650 1.00 16.13  ? 798 HOH B O   1 
HETATM 8881 O  O   . HOH K 5 .   ? -29.543 -3.833  4.408   1.00 27.31  ? 799 HOH B O   1 
HETATM 8882 O  O   . HOH K 5 .   ? -20.033 12.392  -7.409  1.00 40.62  ? 800 HOH B O   1 
HETATM 8883 O  O   . HOH K 5 .   ? -26.045 -1.680  -31.778 1.00 43.08  ? 801 HOH B O   1 
HETATM 8884 O  O   . HOH K 5 .   ? -0.463  27.786  -21.298 1.00 37.97  ? 802 HOH B O   1 
HETATM 8885 O  O   . HOH K 5 .   ? 1.068   16.007  -22.905 1.00 43.21  ? 803 HOH B O   1 
HETATM 8886 O  O   . HOH K 5 .   ? -10.958 11.869  3.861   1.00 19.63  ? 804 HOH B O   1 
HETATM 8887 O  O   . HOH K 5 .   ? -28.137 -11.415 -14.803 1.00 49.10  ? 805 HOH B O   1 
HETATM 8888 O  O   . HOH K 5 .   ? -15.645 -17.634 -30.368 1.00 38.74  ? 806 HOH B O   1 
HETATM 8889 O  O   . HOH K 5 .   ? -9.038  4.531   8.245   1.00 12.70  ? 807 HOH B O   1 
HETATM 8890 O  O   . HOH K 5 .   ? -29.961 -9.537  -4.443  1.00 9.80   ? 808 HOH B O   1 
HETATM 8891 O  O   . HOH K 5 .   ? 7.433   26.491  -17.508 1.00 39.75  ? 809 HOH B O   1 
HETATM 8892 O  O   . HOH K 5 .   ? 14.586  -5.760  -16.537 1.00 58.61  ? 810 HOH B O   1 
HETATM 8893 O  O   . HOH K 5 .   ? -18.977 10.678  -28.929 1.00 26.13  ? 811 HOH B O   1 
HETATM 8894 O  O   . HOH K 5 .   ? -11.282 -1.505  15.601  1.00 19.52  ? 812 HOH B O   1 
HETATM 8895 O  O   . HOH K 5 .   ? -25.907 -2.640  12.208  1.00 35.81  ? 813 HOH B O   1 
HETATM 8896 O  O   . HOH K 5 .   ? 13.210  -17.035 3.817   1.00 34.14  ? 814 HOH B O   1 
HETATM 8897 O  O   . HOH K 5 .   ? 21.711  -4.413  7.540   1.00 20.05  ? 815 HOH B O   1 
HETATM 8898 O  O   . HOH K 5 .   ? 20.716  -4.204  16.703  1.00 20.45  ? 816 HOH B O   1 
HETATM 8899 O  O   . HOH K 5 .   ? -0.413  7.218   -19.258 1.00 60.14  ? 817 HOH B O   1 
HETATM 8900 O  O   . HOH K 5 .   ? -19.545 5.973   -37.312 1.00 43.14  ? 818 HOH B O   1 
HETATM 8901 O  O   . HOH K 5 .   ? 12.177  9.263   15.512  1.00 50.00  ? 819 HOH B O   1 
HETATM 8902 O  O   . HOH K 5 .   ? -11.876 4.880   23.701  1.00 30.82  ? 820 HOH B O   1 
HETATM 8903 O  O   . HOH K 5 .   ? -11.263 10.125  6.228   1.00 15.80  ? 821 HOH B O   1 
HETATM 8904 O  O   . HOH K 5 .   ? -16.756 -29.438 -5.479  1.00 13.32  ? 822 HOH B O   1 
HETATM 8905 O  O   . HOH K 5 .   ? -13.537 -25.616 -16.012 1.00 25.16  ? 823 HOH B O   1 
HETATM 8906 O  O   . HOH K 5 .   ? 1.712   19.570  25.240  1.00 46.79  ? 824 HOH B O   1 
HETATM 8907 O  O   . HOH K 5 .   ? 4.440   16.318  -25.166 1.00 41.73  ? 825 HOH B O   1 
HETATM 8908 O  O   . HOH K 5 .   ? -1.963  19.607  -27.998 1.00 46.23  ? 826 HOH B O   1 
HETATM 8909 O  O   . HOH K 5 .   ? -20.717 -23.590 -24.415 1.00 43.64  ? 827 HOH B O   1 
HETATM 8910 O  O   . HOH K 5 .   ? -4.498  -22.458 -21.667 1.00 19.80  ? 828 HOH B O   1 
HETATM 8911 O  O   . HOH K 5 .   ? 2.407   -16.578 -11.753 1.00 28.86  ? 829 HOH B O   1 
HETATM 8912 O  O   . HOH K 5 .   ? 12.591  -18.749 -7.780  1.00 17.16  ? 830 HOH B O   1 
HETATM 8913 O  O   . HOH K 5 .   ? -33.219 -27.535 -2.953  1.00 35.24  ? 831 HOH B O   1 
HETATM 8914 O  O   . HOH K 5 .   ? -26.745 6.220   -4.289  1.00 21.98  ? 832 HOH B O   1 
HETATM 8915 O  O   . HOH K 5 .   ? -0.291  -27.834 -1.617  1.00 16.15  ? 833 HOH B O   1 
HETATM 8916 O  O   . HOH K 5 .   ? 4.019   -11.971 9.396   1.00 54.19  ? 834 HOH B O   1 
HETATM 8917 O  O   . HOH K 5 .   ? 3.693   -8.250  -5.641  1.00 48.79  ? 835 HOH B O   1 
HETATM 8918 O  O   . HOH K 5 .   ? 6.384   -10.568 16.566  1.00 10.56  ? 836 HOH B O   1 
HETATM 8919 O  O   . HOH K 5 .   ? -29.733 -2.837  -2.616  1.00 34.85  ? 837 HOH B O   1 
HETATM 8920 O  O   . HOH K 5 .   ? -10.770 0.860   -38.007 1.00 29.71  ? 838 HOH B O   1 
HETATM 8921 O  O   . HOH K 5 .   ? -10.995 -28.685 1.077   1.00 10.50  ? 839 HOH B O   1 
HETATM 8922 O  O   . HOH K 5 .   ? 1.522   0.228   23.516  1.00 33.31  ? 840 HOH B O   1 
HETATM 8923 O  O   . HOH K 5 .   ? 3.493   -32.191 -13.794 1.00 38.50  ? 841 HOH B O   1 
HETATM 8924 O  O   . HOH K 5 .   ? -17.438 -20.891 -33.232 1.00 36.05  ? 842 HOH B O   1 
HETATM 8925 O  O   . HOH K 5 .   ? -8.205  -0.924  -35.179 1.00 26.31  ? 843 HOH B O   1 
HETATM 8926 O  O   . HOH K 5 .   ? -15.547 -29.449 -2.634  1.00 22.28  ? 844 HOH B O   1 
HETATM 8927 O  O   . HOH K 5 .   ? 6.850   -1.111  -4.101  1.00 15.18  ? 845 HOH B O   1 
HETATM 8928 O  O   . HOH K 5 .   ? 11.984  -20.802 -4.275  1.00 23.22  ? 846 HOH B O   1 
HETATM 8929 O  O   . HOH K 5 .   ? -14.400 -3.855  15.546  1.00 23.49  ? 847 HOH B O   1 
HETATM 8930 O  O   . HOH K 5 .   ? 9.934   -18.500 21.642  1.00 39.73  ? 848 HOH B O   1 
HETATM 8931 O  O   . HOH K 5 .   ? -1.610  -33.721 -7.399  1.00 26.70  ? 849 HOH B O   1 
HETATM 8932 O  O   . HOH K 5 .   ? -25.782 -6.525  10.667  1.00 6.31   ? 850 HOH B O   1 
HETATM 8933 O  O   . HOH K 5 .   ? 4.193   -8.652  21.676  1.00 26.26  ? 851 HOH B O   1 
HETATM 8934 O  O   . HOH K 5 .   ? -12.909 -1.925  13.530  1.00 17.21  ? 852 HOH B O   1 
HETATM 8935 O  O   . HOH K 5 .   ? -16.218 -4.179  17.664  1.00 15.42  ? 853 HOH B O   1 
HETATM 8936 O  O   . HOH K 5 .   ? -16.044 -25.331 -6.334  1.00 23.51  ? 854 HOH B O   1 
HETATM 8937 O  O   . HOH K 5 .   ? -5.143  10.251  4.167   1.00 26.05  ? 855 HOH B O   1 
HETATM 8938 O  O   . HOH K 5 .   ? -18.506 8.861   -38.301 1.00 41.29  ? 856 HOH B O   1 
HETATM 8939 O  O   . HOH K 5 .   ? -26.141 -19.213 2.889   1.00 0.52   ? 857 HOH B O   1 
HETATM 8940 O  O   . HOH K 5 .   ? -31.251 -28.385 1.066   1.00 48.68  ? 858 HOH B O   1 
HETATM 8941 O  O   . HOH K 5 .   ? -5.668  -14.676 -24.237 1.00 28.00  ? 859 HOH B O   1 
HETATM 8942 O  O   . HOH K 5 .   ? -10.826 -29.246 -8.333  1.00 21.72  ? 860 HOH B O   1 
HETATM 8943 O  O   . HOH K 5 .   ? -23.756 -18.156 -19.588 1.00 34.19  ? 861 HOH B O   1 
HETATM 8944 O  O   . HOH K 5 .   ? 11.574  29.101  -14.725 1.00 25.01  ? 862 HOH B O   1 
HETATM 8945 O  O   . HOH K 5 .   ? 7.404   -4.869  -23.563 1.00 24.43  ? 863 HOH B O   1 
HETATM 8946 O  O   . HOH K 5 .   ? 9.112   24.851  -4.403  1.00 13.61  ? 864 HOH B O   1 
HETATM 8947 O  O   . HOH K 5 .   ? 1.425   19.451  -25.795 1.00 21.22  ? 865 HOH B O   1 
HETATM 8948 O  O   . HOH K 5 .   ? 4.867   -9.904  -25.692 1.00 36.51  ? 866 HOH B O   1 
HETATM 8949 O  O   . HOH K 5 .   ? -6.967  -16.576 11.323  1.00 44.57  ? 867 HOH B O   1 
HETATM 8950 O  O   . HOH K 5 .   ? 6.458   27.463  -21.293 1.00 60.23  ? 868 HOH B O   1 
HETATM 8951 O  O   . HOH K 5 .   ? 12.743  13.414  14.281  1.00 40.33  ? 869 HOH B O   1 
HETATM 8952 O  O   . HOH K 5 .   ? -2.731  -24.103 4.762   1.00 19.28  ? 870 HOH B O   1 
HETATM 8953 O  O   . HOH K 5 .   ? -13.202 -0.697  20.698  1.00 31.52  ? 871 HOH B O   1 
HETATM 8954 O  O   . HOH K 5 .   ? -15.823 14.723  -33.324 1.00 19.14  ? 872 HOH B O   1 
HETATM 8955 O  O   . HOH K 5 .   ? -12.811 19.293  0.884   1.00 18.09  ? 873 HOH B O   1 
HETATM 8956 O  O   . HOH K 5 .   ? -32.978 -23.302 1.027   1.00 48.68  ? 874 HOH B O   1 
HETATM 8957 O  O   . HOH K 5 .   ? -11.451 -3.640  13.930  1.00 11.00  ? 875 HOH B O   1 
HETATM 8958 O  O   . HOH K 5 .   ? 0.348   22.487  -25.065 1.00 43.90  ? 876 HOH B O   1 
HETATM 8959 O  O   . HOH K 5 .   ? 0.614   -5.368  -6.986  1.00 32.95  ? 877 HOH B O   1 
HETATM 8960 O  O   . HOH K 5 .   ? -12.983 17.755  3.087   1.00 37.01  ? 878 HOH B O   1 
HETATM 8961 O  O   . HOH K 5 .   ? 1.867   21.630  -26.666 1.00 38.57  ? 879 HOH B O   1 
HETATM 8962 O  O   . HOH K 5 .   ? -24.567 2.913   11.957  1.00 55.03  ? 880 HOH B O   1 
HETATM 8963 O  O   . HOH K 5 .   ? -26.680 -3.381  14.763  1.00 34.51  ? 881 HOH B O   1 
HETATM 8964 O  O   . HOH K 5 .   ? 3.289   -5.380  -7.173  1.00 28.06  ? 882 HOH B O   1 
HETATM 8965 O  O   . HOH K 5 .   ? -13.800 25.445  -7.906  1.00 35.40  ? 883 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N  N   . SER A 4   ? 1.1363 1.1502 0.9604 0.1074  -0.0828 0.0043  4   SER A N   
2    C  CA  . SER A 4   ? 1.2076 1.2061 1.0281 0.1067  -0.0759 0.0119  4   SER A CA  
3    C  C   . SER A 4   ? 1.1255 1.1242 0.9634 0.1015  -0.0717 0.0090  4   SER A C   
4    O  O   . SER A 4   ? 1.1039 1.1150 0.9567 0.0988  -0.0740 0.0017  4   SER A O   
5    C  CB  . SER A 4   ? 1.1795 1.1677 0.9860 0.1022  -0.0688 0.0169  4   SER A CB  
6    O  OG  . SER A 4   ? 1.1038 1.0775 0.9085 0.0999  -0.0619 0.0237  4   SER A OG  
7    N  N   . GLU A 5   ? 0.9640 0.9487 0.7995 0.0999  -0.0654 0.0148  5   GLU A N   
8    C  CA  . GLU A 5   ? 0.8724 0.8552 0.7219 0.0949  -0.0608 0.0127  5   GLU A CA  
9    C  C   . GLU A 5   ? 0.8383 0.8207 0.6914 0.0851  -0.0539 0.0105  5   GLU A C   
10   O  O   . GLU A 5   ? 0.8625 0.8514 0.7297 0.0801  -0.0523 0.0050  5   GLU A O   
11   C  CB  . GLU A 5   ? 0.8930 0.8602 0.7381 0.0983  -0.0582 0.0196  5   GLU A CB  
12   C  CG  . GLU A 5   ? 0.8726 0.8318 0.7249 0.0910  -0.0507 0.0197  5   GLU A CG  
13   C  CD  . GLU A 5   ? 0.9715 0.9147 0.8198 0.0947  -0.0492 0.0255  5   GLU A CD  
14   O  OE1 . GLU A 5   ? 0.8687 0.8108 0.7280 0.0940  -0.0477 0.0227  5   GLU A OE1 
15   O  OE2 . GLU A 5   ? 1.0931 1.0245 0.9268 0.0986  -0.0495 0.0329  5   GLU A OE2 
16   N  N   . LEU A 6   ? 0.7393 0.7144 0.5797 0.0823  -0.0497 0.0148  6   LEU A N   
17   C  CA  . LEU A 6   ? 0.5822 0.5582 0.4253 0.0738  -0.0435 0.0126  6   LEU A CA  
18   C  C   . LEU A 6   ? 0.4758 0.4642 0.3208 0.0720  -0.0463 0.0058  6   LEU A C   
19   O  O   . LEU A 6   ? 0.3915 0.3812 0.2381 0.0659  -0.0418 0.0036  6   LEU A O   
20   C  CB  . LEU A 6   ? 0.7107 0.6750 0.5399 0.0716  -0.0374 0.0201  6   LEU A CB  
21   C  CG  . LEU A 6   ? 0.7688 0.7180 0.5939 0.0725  -0.0343 0.0276  6   LEU A CG  
22   C  CD1 . LEU A 6   ? 0.6949 0.6339 0.5044 0.0709  -0.0293 0.0358  6   LEU A CD1 
23   C  CD2 . LEU A 6   ? 0.8010 0.7475 0.6395 0.0666  -0.0300 0.0253  6   LEU A CD2 
24   N  N   . LEU A 7   ? 0.5859 0.5833 0.4307 0.0774  -0.0540 0.0023  7   LEU A N   
25   C  CA  . LEU A 7   ? 0.6447 0.6535 0.4924 0.0756  -0.0577 -0.0050 7   LEU A CA  
26   C  C   . LEU A 7   ? 0.6486 0.6683 0.5134 0.0748  -0.0622 -0.0115 7   LEU A C   
27   O  O   . LEU A 7   ? 0.7589 0.7826 0.6274 0.0804  -0.0675 -0.0112 7   LEU A O   
28   C  CB  . LEU A 7   ? 0.7468 0.7584 0.5800 0.0816  -0.0633 -0.0045 7   LEU A CB  
29   C  CG  . LEU A 7   ? 0.8053 0.8271 0.6400 0.0793  -0.0670 -0.0126 7   LEU A CG  
30   C  CD1 . LEU A 7   ? 0.7759 0.7942 0.5939 0.0798  -0.0646 -0.0111 7   LEU A CD1 
31   C  CD2 . LEU A 7   ? 0.8543 0.8871 0.6931 0.0842  -0.0769 -0.0174 7   LEU A CD2 
32   N  N   . VAL A 8   ? 0.5763 0.6010 0.4518 0.0680  -0.0600 -0.0170 8   VAL A N   
33   C  CA  . VAL A 8   ? 0.5184 0.5532 0.4109 0.0655  -0.0629 -0.0228 8   VAL A CA  
34   C  C   . VAL A 8   ? 0.4516 0.4943 0.3473 0.0613  -0.0657 -0.0299 8   VAL A C   
35   O  O   . VAL A 8   ? 0.4080 0.4465 0.2977 0.0577  -0.0620 -0.0306 8   VAL A O   
36   C  CB  . VAL A 8   ? 0.5615 0.5925 0.4648 0.0605  -0.0566 -0.0219 8   VAL A CB  
37   C  CG1 . VAL A 8   ? 0.4767 0.5189 0.3970 0.0567  -0.0586 -0.0280 8   VAL A CG1 
38   C  CG2 . VAL A 8   ? 0.5920 0.6147 0.4926 0.0651  -0.0547 -0.0158 8   VAL A CG2 
39   N  N   . ASN A 9   ? 0.3919 0.4462 0.2970 0.0620  -0.0725 -0.0352 9   ASN A N   
40   C  CA  . ASN A 9   ? 0.4138 0.4751 0.3215 0.0583  -0.0765 -0.0422 9   ASN A CA  
41   C  C   . ASN A 9   ? 0.4527 0.5209 0.3785 0.0517  -0.0760 -0.0468 9   ASN A C   
42   O  O   . ASN A 9   ? 0.6112 0.6896 0.5486 0.0525  -0.0803 -0.0489 9   ASN A O   
43   C  CB  . ASN A 9   ? 0.3744 0.4434 0.2767 0.0638  -0.0855 -0.0449 9   ASN A CB  
44   C  CG  . ASN A 9   ? 0.5958 0.6730 0.5037 0.0595  -0.0908 -0.0531 9   ASN A CG  
45   O  OD1 . ASN A 9   ? 0.7921 0.8647 0.6954 0.0555  -0.0885 -0.0561 9   ASN A OD1 
46   N  ND2 . ASN A 9   ? 0.6261 0.7153 0.5437 0.0606  -0.0982 -0.0570 9   ASN A ND2 
47   N  N   . THR A 10  ? 0.4088 0.4720 0.3370 0.0454  -0.0704 -0.0478 10  THR A N   
48   C  CA  . THR A 10  ? 0.3702 0.4382 0.3136 0.0387  -0.0692 -0.0516 10  THR A CA  
49   C  C   . THR A 10  ? 0.4834 0.5579 0.4305 0.0353  -0.0751 -0.0586 10  THR A C   
50   O  O   . THR A 10  ? 0.5523 0.6269 0.4894 0.0381  -0.0798 -0.0611 10  THR A O   
51   C  CB  . THR A 10  ? 0.2958 0.3552 0.2390 0.0338  -0.0615 -0.0498 10  THR A CB  
52   O  OG1 . THR A 10  ? 0.3869 0.4424 0.3223 0.0319  -0.0616 -0.0530 10  THR A OG1 
53   C  CG2 . THR A 10  ? 0.2745 0.3251 0.2098 0.0369  -0.0558 -0.0431 10  THR A CG2 
54   N  N   . LYS A 11  ? 0.4176 0.4968 0.3788 0.0288  -0.0747 -0.0618 11  LYS A N   
55   C  CA  . LYS A 11  ? 0.4840 0.5687 0.4509 0.0242  -0.0802 -0.0685 11  LYS A CA  
56   C  C   . LYS A 11  ? 0.4364 0.5122 0.3944 0.0217  -0.0790 -0.0715 11  LYS A C   
57   O  O   . LYS A 11  ? 0.4631 0.5412 0.4224 0.0189  -0.0844 -0.0776 11  LYS A O   
58   C  CB  . LYS A 11  ? 0.5115 0.6033 0.4961 0.0175  -0.0794 -0.0700 11  LYS A CB  
59   C  CG  . LYS A 11  ? 0.4097 0.5101 0.4035 0.0203  -0.0788 -0.0667 11  LYS A CG  
60   C  CD  . LYS A 11  ? 0.3120 0.4219 0.3231 0.0139  -0.0787 -0.0687 11  LYS A CD  
61   C  CE  . LYS A 11  ? 0.3982 0.5233 0.4192 0.0168  -0.0840 -0.0697 11  LYS A CE  
62   N  NZ  . LYS A 11  ? 0.5619 0.6956 0.5986 0.0128  -0.0802 -0.0686 11  LYS A NZ  
63   N  N   . SER A 12  ? 0.4197 0.4856 0.3686 0.0229  -0.0724 -0.0678 12  SER A N   
64   C  CA  . SER A 12  ? 0.5237 0.5818 0.4630 0.0221  -0.0710 -0.0705 12  SER A CA  
65   C  C   . SER A 12  ? 0.4328 0.4871 0.3550 0.0286  -0.0711 -0.0688 12  SER A C   
66   O  O   . SER A 12  ? 0.3576 0.4073 0.2705 0.0291  -0.0711 -0.0721 12  SER A O   
67   C  CB  . SER A 12  ? 0.6821 0.7333 0.6246 0.0180  -0.0633 -0.0681 12  SER A CB  
68   O  OG  . SER A 12  ? 0.7920 0.8466 0.7494 0.0122  -0.0628 -0.0689 12  SER A OG  
69   N  N   . GLY A 13  ? 0.3607 0.4164 0.2778 0.0338  -0.0711 -0.0637 13  GLY A N   
70   C  CA  . GLY A 13  ? 0.3100 0.3619 0.2101 0.0399  -0.0711 -0.0612 13  GLY A CA  
71   C  C   . GLY A 13  ? 0.4110 0.4605 0.3068 0.0442  -0.0680 -0.0534 13  GLY A C   
72   O  O   . GLY A 13  ? 0.5036 0.5536 0.4091 0.0429  -0.0655 -0.0502 13  GLY A O   
73   N  N   . LYS A 14  ? 0.4012 0.4475 0.2813 0.0497  -0.0683 -0.0504 14  LYS A N   
74   C  CA  . LYS A 14  ? 0.4402 0.4820 0.3136 0.0541  -0.0655 -0.0424 14  LYS A CA  
75   C  C   . LYS A 14  ? 0.4361 0.4692 0.3063 0.0514  -0.0562 -0.0374 14  LYS A C   
76   O  O   . LYS A 14  ? 0.3255 0.3562 0.1917 0.0488  -0.0525 -0.0393 14  LYS A O   
77   C  CB  . LYS A 14  ? 0.4409 0.4826 0.2979 0.0611  -0.0696 -0.0405 14  LYS A CB  
78   C  CG  . LYS A 14  ? 0.4440 0.4939 0.2995 0.0631  -0.0786 -0.0476 14  LYS A CG  
79   C  CD  . LYS A 14  ? 0.4868 0.5389 0.3310 0.0709  -0.0844 -0.0446 14  LYS A CD  
80   C  CE  . LYS A 14  ? 0.4722 0.5293 0.3065 0.0737  -0.0916 -0.0508 14  LYS A CE  
81   N  NZ  . LYS A 14  ? 0.4539 0.5171 0.2831 0.0806  -0.0999 -0.0499 14  LYS A NZ  
82   N  N   . VAL A 15  ? 0.4113 0.4400 0.2837 0.0521  -0.0528 -0.0311 15  VAL A N   
83   C  CA  . VAL A 15  ? 0.4102 0.4307 0.2797 0.0495  -0.0445 -0.0256 15  VAL A CA  
84   C  C   . VAL A 15  ? 0.4754 0.4894 0.3355 0.0541  -0.0434 -0.0178 15  VAL A C   
85   O  O   . VAL A 15  ? 0.5450 0.5604 0.4066 0.0584  -0.0481 -0.0166 15  VAL A O   
86   C  CB  . VAL A 15  ? 0.3865 0.4066 0.2708 0.0437  -0.0405 -0.0264 15  VAL A CB  
87   C  CG1 . VAL A 15  ? 0.3016 0.3263 0.1938 0.0389  -0.0410 -0.0332 15  VAL A CG1 
88   C  CG2 . VAL A 15  ? 0.4263 0.4494 0.3206 0.0452  -0.0438 -0.0261 15  VAL A CG2 
89   N  N   . MET A 16  ? 0.4767 0.4834 0.3269 0.0532  -0.0372 -0.0125 16  MET A N   
90   C  CA  . MET A 16  ? 0.4993 0.4977 0.3391 0.0567  -0.0353 -0.0042 16  MET A CA  
91   C  C   . MET A 16  ? 0.4687 0.4596 0.3131 0.0516  -0.0278 0.0003  16  MET A C   
92   O  O   . MET A 16  ? 0.3866 0.3768 0.2299 0.0472  -0.0221 0.0005  16  MET A O   
93   C  CB  . MET A 16  ? 0.5599 0.5566 0.3820 0.0602  -0.0347 -0.0010 16  MET A CB  
94   C  CG  . MET A 16  ? 0.6675 0.6542 0.4775 0.0625  -0.0312 0.0087  16  MET A CG  
95   S  SD  . MET A 16  ? 0.8702 0.8538 0.6752 0.0708  -0.0387 0.0125  16  MET A SD  
96   C  CE  . MET A 16  ? 0.9182 0.8902 0.7031 0.0734  -0.0342 0.0237  16  MET A CE  
97   N  N   . GLY A 17  ? 0.4194 0.4051 0.2691 0.0525  -0.0282 0.0033  17  GLY A N   
98   C  CA  . GLY A 17  ? 0.4094 0.3873 0.2636 0.0479  -0.0221 0.0071  17  GLY A CA  
99   C  C   . GLY A 17  ? 0.6029 0.5702 0.4444 0.0483  -0.0178 0.0155  17  GLY A C   
100  O  O   . GLY A 17  ? 0.6436 0.6105 0.4721 0.0508  -0.0177 0.0186  17  GLY A O   
101  N  N   . THR A 18  ? 0.6466 0.6049 0.4918 0.0455  -0.0143 0.0194  18  THR A N   
102  C  CA  . THR A 18  ? 0.7159 0.6625 0.5508 0.0445  -0.0099 0.0278  18  THR A CA  
103  C  C   . THR A 18  ? 0.6993 0.6352 0.5383 0.0450  -0.0101 0.0307  18  THR A C   
104  O  O   . THR A 18  ? 0.7378 0.6760 0.5892 0.0434  -0.0109 0.0260  18  THR A O   
105  C  CB  . THR A 18  ? 0.7982 0.7450 0.6329 0.0371  -0.0025 0.0294  18  THR A CB  
106  O  OG1 . THR A 18  ? 0.8656 0.8002 0.6935 0.0347  0.0019  0.0375  18  THR A OG1 
107  C  CG2 . THR A 18  ? 0.8233 0.7753 0.6731 0.0315  -0.0005 0.0235  18  THR A CG2 
108  N  N   . ARG A 19  ? 0.6469 0.5705 0.4747 0.0474  -0.0094 0.0385  19  ARG A N   
109  C  CA  . ARG A 19  ? 0.5373 0.4482 0.3666 0.0489  -0.0100 0.0417  19  ARG A CA  
110  C  C   . ARG A 19  ? 0.5874 0.4894 0.4185 0.0406  -0.0032 0.0452  19  ARG A C   
111  O  O   . ARG A 19  ? 0.6664 0.5604 0.4874 0.0378  0.0009  0.0523  19  ARG A O   
112  C  CB  . ARG A 19  ? 0.4296 0.3312 0.2456 0.0566  -0.0137 0.0483  19  ARG A CB  
113  C  CG  . ARG A 19  ? 0.4462 0.3297 0.2574 0.0569  -0.0122 0.0550  19  ARG A CG  
114  C  CD  . ARG A 19  ? 0.5402 0.4164 0.3402 0.0663  -0.0175 0.0600  19  ARG A CD  
115  N  NE  . ARG A 19  ? 0.8059 0.6818 0.6143 0.0727  -0.0228 0.0558  19  ARG A NE  
116  C  CZ  . ARG A 19  ? 0.9416 0.8023 0.7466 0.0771  -0.0244 0.0600  19  ARG A CZ  
117  N  NH1 . ARG A 19  ? 1.0259 0.8695 0.8189 0.0751  -0.0211 0.0688  19  ARG A NH1 
118  N  NH2 . ARG A 19  ? 0.7652 0.6279 0.5787 0.0835  -0.0290 0.0553  19  ARG A NH2 
119  N  N   . VAL A 20  ? 0.6397 0.5439 0.4837 0.0362  -0.0018 0.0400  20  VAL A N   
120  C  CA  . VAL A 20  ? 0.5333 0.4313 0.3812 0.0279  0.0039  0.0417  20  VAL A CA  
121  C  C   . VAL A 20  ? 0.5436 0.4256 0.3907 0.0290  0.0032  0.0447  20  VAL A C   
122  O  O   . VAL A 20  ? 0.6365 0.5168 0.4864 0.0355  -0.0015 0.0421  20  VAL A O   
123  C  CB  . VAL A 20  ? 0.4246 0.3338 0.2862 0.0227  0.0056  0.0343  20  VAL A CB  
124  C  CG1 . VAL A 20  ? 0.4031 0.3272 0.2658 0.0231  0.0050  0.0302  20  VAL A CG1 
125  C  CG2 . VAL A 20  ? 0.4402 0.3504 0.3117 0.0256  0.0019  0.0287  20  VAL A CG2 
126  N  N   . PRO A 21  ? 0.5364 0.4065 0.3799 0.0229  0.0077  0.0501  21  PRO A N   
127  C  CA  . PRO A 21  ? 0.5447 0.3982 0.3878 0.0235  0.0069  0.0522  21  PRO A CA  
128  C  C   . PRO A 21  ? 0.6500 0.5052 0.5058 0.0184  0.0081  0.0459  21  PRO A C   
129  O  O   . PRO A 21  ? 0.5877 0.4524 0.4505 0.0115  0.0116  0.0430  21  PRO A O   
130  C  CB  . PRO A 21  ? 0.5402 0.3802 0.3728 0.0185  0.0111  0.0615  21  PRO A CB  
131  C  CG  . PRO A 21  ? 0.6023 0.4549 0.4368 0.0113  0.0162  0.0615  21  PRO A CG  
132  C  CD  . PRO A 21  ? 0.5818 0.4527 0.4207 0.0156  0.0136  0.0550  21  PRO A CD  
133  N  N   . VAL A 22  ? 0.6644 0.5108 0.5228 0.0227  0.0051  0.0435  22  VAL A N   
134  C  CA  . VAL A 22  ? 0.5558 0.4010 0.4243 0.0187  0.0059  0.0379  22  VAL A CA  
135  C  C   . VAL A 22  ? 0.4860 0.3112 0.3498 0.0215  0.0044  0.0403  22  VAL A C   
136  O  O   . VAL A 22  ? 0.4447 0.2657 0.3056 0.0307  0.0001  0.0401  22  VAL A O   
137  C  CB  . VAL A 22  ? 0.5593 0.4196 0.4385 0.0225  0.0032  0.0295  22  VAL A CB  
138  C  CG1 . VAL A 22  ? 0.5044 0.3686 0.3811 0.0328  -0.0020 0.0290  22  VAL A CG1 
139  C  CG2 . VAL A 22  ? 0.5446 0.4005 0.4315 0.0209  0.0033  0.0243  22  VAL A CG2 
140  N  N   . LEU A 23  ? 0.5970 0.4099 0.4599 0.0137  0.0077  0.0429  23  LEU A N   
141  C  CA  . LEU A 23  ? 0.7715 0.5633 0.6304 0.0145  0.0067  0.0446  23  LEU A CA  
142  C  C   . LEU A 23  ? 0.7958 0.5743 0.6442 0.0241  0.0029  0.0497  23  LEU A C   
143  O  O   . LEU A 23  ? 0.8873 0.6689 0.7378 0.0335  -0.0013 0.0455  23  LEU A O   
144  C  CB  . LEU A 23  ? 0.7698 0.5622 0.6378 0.0162  0.0049  0.0360  23  LEU A CB  
145  C  CG  . LEU A 23  ? 0.8314 0.6391 0.7110 0.0103  0.0068  0.0288  23  LEU A CG  
146  C  CD1 . LEU A 23  ? 0.4043 0.2148 0.2904 0.0165  0.0039  0.0211  23  LEU A CD1 
147  C  CD2 . LEU A 23  ? 0.8466 0.6471 0.7278 -0.0007 0.0104  0.0297  23  LEU A CD2 
148  N  N   . SER A 24  ? 0.7678 0.5317 0.6050 0.0219  0.0044  0.0586  24  SER A N   
149  C  CA  . SER A 24  ? 0.9706 0.7184 0.7973 0.0311  0.0006  0.0638  24  SER A CA  
150  C  C   . SER A 24  ? 0.9851 0.7456 0.8093 0.0417  -0.0036 0.0634  24  SER A C   
151  O  O   . SER A 24  ? 0.9176 0.6676 0.7336 0.0509  -0.0075 0.0672  24  SER A O   
152  C  CB  . SER A 24  ? 0.9976 0.7304 0.8269 0.0352  -0.0022 0.0593  24  SER A CB  
153  O  OG  . SER A 24  ? 1.0442 0.7607 0.8641 0.0453  -0.0064 0.0634  24  SER A OG  
154  N  N   . SER A 25  ? 1.0186 0.8013 0.8497 0.0407  -0.0030 0.0589  25  SER A N   
155  C  CA  . SER A 25  ? 0.9015 0.6980 0.7327 0.0501  -0.0076 0.0567  25  SER A CA  
156  C  C   . SER A 25  ? 0.7686 0.5860 0.6043 0.0458  -0.0057 0.0540  25  SER A C   
157  O  O   . SER A 25  ? 0.7833 0.6033 0.6194 0.0366  -0.0007 0.0557  25  SER A O   
158  C  CB  . SER A 25  ? 0.8593 0.6599 0.6995 0.0578  -0.0119 0.0491  25  SER A CB  
159  O  OG  . SER A 25  ? 0.7791 0.5966 0.6222 0.0652  -0.0160 0.0459  25  SER A OG  
160  N  N   . HIS A 26  ? 0.6217 0.4541 0.4608 0.0527  -0.0099 0.0498  26  HIS A N   
161  C  CA  . HIS A 26  ? 0.6603 0.5112 0.5022 0.0503  -0.0092 0.0472  26  HIS A CA  
162  C  C   . HIS A 26  ? 0.6562 0.5232 0.5090 0.0553  -0.0134 0.0390  26  HIS A C   
163  O  O   . HIS A 26  ? 0.7180 0.5831 0.5732 0.0629  -0.0176 0.0369  26  HIS A O   
164  C  CB  . HIS A 26  ? 0.8175 0.6687 0.6463 0.0536  -0.0103 0.0536  26  HIS A CB  
165  C  CG  . HIS A 26  ? 0.9526 0.7859 0.7684 0.0512  -0.0072 0.0632  26  HIS A CG  
166  N  ND1 . HIS A 26  ? 1.0245 0.8588 0.8335 0.0444  -0.0022 0.0683  26  HIS A ND1 
167  C  CD2 . HIS A 26  ? 0.9553 0.7692 0.7634 0.0547  -0.0084 0.0690  26  HIS A CD2 
168  C  CE1 . HIS A 26  ? 1.0213 0.8381 0.8193 0.0431  -0.0001 0.0771  26  HIS A CE1 
169  N  NE2 . HIS A 26  ? 1.0419 0.8452 0.8389 0.0492  -0.0040 0.0778  26  HIS A NE2 
170  N  N   . ILE A 27  ? 0.5548 0.4377 0.4141 0.0510  -0.0122 0.0344  27  ILE A N   
171  C  CA  . ILE A 27  ? 0.3755 0.2751 0.2444 0.0546  -0.0160 0.0273  27  ILE A CA  
172  C  C   . ILE A 27  ? 0.4843 0.3966 0.3521 0.0515  -0.0154 0.0260  27  ILE A C   
173  O  O   . ILE A 27  ? 0.4035 0.3123 0.2639 0.0468  -0.0116 0.0302  27  ILE A O   
174  C  CB  . ILE A 27  ? 0.4616 0.3667 0.3443 0.0513  -0.0147 0.0206  27  ILE A CB  
175  C  CG1 . ILE A 27  ? 0.3614 0.2666 0.2471 0.0413  -0.0090 0.0200  27  ILE A CG1 
176  C  CG2 . ILE A 27  ? 0.5406 0.4347 0.4249 0.0558  -0.0159 0.0203  27  ILE A CG2 
177  C  CD1 . ILE A 27  ? 0.5586 0.4737 0.4571 0.0380  -0.0081 0.0132  27  ILE A CD1 
178  N  N   . SER A 28  ? 0.5431 0.4701 0.4186 0.0538  -0.0190 0.0200  28  SER A N   
179  C  CA  . SER A 28  ? 0.4569 0.3956 0.3313 0.0519  -0.0196 0.0178  28  SER A CA  
180  C  C   . SER A 28  ? 0.5113 0.4581 0.3959 0.0444  -0.0160 0.0127  28  SER A C   
181  O  O   . SER A 28  ? 0.5784 0.5273 0.4735 0.0423  -0.0153 0.0089  28  SER A O   
182  C  CB  . SER A 28  ? 0.4145 0.3642 0.2909 0.0587  -0.0263 0.0142  28  SER A CB  
183  O  OG  . SER A 28  ? 0.5560 0.4985 0.4217 0.0662  -0.0299 0.0194  28  SER A OG  
184  N  N   . ALA A 29  ? 0.3661 0.3178 0.2470 0.0408  -0.0139 0.0126  29  ALA A N   
185  C  CA  . ALA A 29  ? 0.3580 0.3174 0.2474 0.0344  -0.0110 0.0080  29  ALA A CA  
186  C  C   . ALA A 29  ? 0.4015 0.3706 0.2883 0.0349  -0.0129 0.0050  29  ALA A C   
187  O  O   . ALA A 29  ? 0.5469 0.5144 0.4224 0.0376  -0.0134 0.0082  29  ALA A O   
188  C  CB  . ALA A 29  ? 0.3841 0.3367 0.2721 0.0278  -0.0046 0.0113  29  ALA A CB  
189  N  N   . PHE A 30  ? 0.2961 0.2747 0.1928 0.0323  -0.0139 -0.0012 30  PHE A N   
190  C  CA  . PHE A 30  ? 0.4000 0.3869 0.2952 0.0323  -0.0158 -0.0051 30  PHE A CA  
191  C  C   . PHE A 30  ? 0.3829 0.3730 0.2851 0.0260  -0.0117 -0.0081 30  PHE A C   
192  O  O   . PHE A 30  ? 0.5014 0.4965 0.4145 0.0237  -0.0126 -0.0124 30  PHE A O   
193  C  CB  . PHE A 30  ? 0.4059 0.4013 0.3064 0.0360  -0.0224 -0.0099 30  PHE A CB  
194  C  CG  . PHE A 30  ? 0.4470 0.4402 0.3437 0.0426  -0.0268 -0.0073 30  PHE A CG  
195  C  CD1 . PHE A 30  ? 0.5684 0.5632 0.4552 0.0479  -0.0312 -0.0063 30  PHE A CD1 
196  C  CD2 . PHE A 30  ? 0.4506 0.4406 0.3536 0.0440  -0.0268 -0.0062 30  PHE A CD2 
197  C  CE1 . PHE A 30  ? 0.4921 0.4853 0.3756 0.0546  -0.0357 -0.0038 30  PHE A CE1 
198  C  CE2 . PHE A 30  ? 0.5377 0.5260 0.4377 0.0509  -0.0310 -0.0041 30  PHE A CE2 
199  C  CZ  . PHE A 30  ? 0.5061 0.4960 0.3964 0.0562  -0.0356 -0.0026 30  PHE A CZ  
200  N  N   . LEU A 31  ? 0.3603 0.3482 0.2562 0.0236  -0.0072 -0.0056 31  LEU A N   
201  C  CA  . LEU A 31  ? 0.2755 0.2653 0.1773 0.0180  -0.0027 -0.0072 31  LEU A CA  
202  C  C   . LEU A 31  ? 0.2724 0.2691 0.1737 0.0179  -0.0035 -0.0119 31  LEU A C   
203  O  O   . LEU A 31  ? 0.2812 0.2793 0.1733 0.0213  -0.0050 -0.0119 31  LEU A O   
204  C  CB  . LEU A 31  ? 0.3814 0.3651 0.2782 0.0150  0.0031  -0.0015 31  LEU A CB  
205  C  CG  . LEU A 31  ? 0.5038 0.4783 0.3994 0.0155  0.0034  0.0031  31  LEU A CG  
206  C  CD1 . LEU A 31  ? 0.4713 0.4390 0.3610 0.0121  0.0088  0.0092  31  LEU A CD1 
207  C  CD2 . LEU A 31  ? 0.6209 0.5950 0.5278 0.0134  0.0027  0.0003  31  LEU A CD2 
208  N  N   . GLY A 32  ? 0.4306 0.4311 0.3412 0.0142  -0.0025 -0.0158 32  GLY A N   
209  C  CA  . GLY A 32  ? 0.4313 0.4367 0.3416 0.0140  -0.0029 -0.0202 32  GLY A CA  
210  C  C   . GLY A 32  ? 0.5247 0.5340 0.4352 0.0168  -0.0089 -0.0253 32  GLY A C   
211  O  O   . GLY A 32  ? 0.5866 0.5981 0.4914 0.0185  -0.0100 -0.0283 32  GLY A O   
212  N  N   . ILE A 33  ? 0.4986 0.5094 0.4159 0.0171  -0.0130 -0.0268 33  ILE A N   
213  C  CA  . ILE A 33  ? 0.3796 0.3953 0.2987 0.0191  -0.0192 -0.0316 33  ILE A CA  
214  C  C   . ILE A 33  ? 0.3267 0.3452 0.2534 0.0155  -0.0199 -0.0369 33  ILE A C   
215  O  O   . ILE A 33  ? 0.3332 0.3520 0.2694 0.0117  -0.0180 -0.0370 33  ILE A O   
216  C  CB  . ILE A 33  ? 0.4032 0.4209 0.3279 0.0207  -0.0229 -0.0311 33  ILE A CB  
217  C  CG1 . ILE A 33  ? 0.3732 0.3858 0.2902 0.0243  -0.0218 -0.0253 33  ILE A CG1 
218  C  CG2 . ILE A 33  ? 0.2581 0.2819 0.1843 0.0226  -0.0296 -0.0359 33  ILE A CG2 
219  C  CD1 . ILE A 33  ? 0.2644 0.2792 0.1861 0.0274  -0.0258 -0.0250 33  ILE A CD1 
220  N  N   . PRO A 34  ? 0.3709 0.3909 0.2934 0.0166  -0.0226 -0.0412 34  PRO A N   
221  C  CA  . PRO A 34  ? 0.2918 0.3127 0.2211 0.0134  -0.0237 -0.0463 34  PRO A CA  
222  C  C   . PRO A 34  ? 0.3180 0.3426 0.2583 0.0108  -0.0276 -0.0484 34  PRO A C   
223  O  O   . PRO A 34  ? 0.3868 0.4149 0.3279 0.0128  -0.0315 -0.0482 34  PRO A O   
224  C  CB  . PRO A 34  ? 0.4282 0.4492 0.3488 0.0162  -0.0270 -0.0509 34  PRO A CB  
225  C  CG  . PRO A 34  ? 0.3796 0.4012 0.2892 0.0211  -0.0283 -0.0483 34  PRO A CG  
226  C  CD  . PRO A 34  ? 0.2758 0.2959 0.1861 0.0213  -0.0250 -0.0417 34  PRO A CD  
227  N  N   . PHE A 35  ? 0.4077 0.4321 0.3570 0.0064  -0.0264 -0.0500 35  PHE A N   
228  C  CA  . PHE A 35  ? 0.3334 0.3618 0.2934 0.0032  -0.0297 -0.0521 35  PHE A CA  
229  C  C   . PHE A 35  ? 0.3870 0.4141 0.3518 -0.0006 -0.0313 -0.0564 35  PHE A C   
230  O  O   . PHE A 35  ? 0.4722 0.5029 0.4452 -0.0036 -0.0348 -0.0586 35  PHE A O   
231  C  CB  . PHE A 35  ? 0.2444 0.2743 0.2121 0.0012  -0.0263 -0.0482 35  PHE A CB  
232  C  CG  . PHE A 35  ? 0.3555 0.3823 0.3271 -0.0024 -0.0217 -0.0469 35  PHE A CG  
233  C  CD1 . PHE A 35  ? 0.3837 0.4113 0.3633 -0.0067 -0.0224 -0.0490 35  PHE A CD1 
234  C  CD2 . PHE A 35  ? 0.3784 0.4017 0.3460 -0.0018 -0.0167 -0.0432 35  PHE A CD2 
235  C  CE1 . PHE A 35  ? 0.4139 0.4387 0.3965 -0.0095 -0.0185 -0.0475 35  PHE A CE1 
236  C  CE2 . PHE A 35  ? 0.3277 0.3490 0.2991 -0.0049 -0.0129 -0.0422 35  PHE A CE2 
237  C  CZ  . PHE A 35  ? 0.3741 0.3962 0.3527 -0.0084 -0.0139 -0.0443 35  PHE A CZ  
238  N  N   . ALA A 36  ? 0.3714 0.3934 0.3316 -0.0004 -0.0290 -0.0575 36  ALA A N   
239  C  CA  . ALA A 36  ? 0.3878 0.4067 0.3509 -0.0031 -0.0312 -0.0619 36  ALA A CA  
240  C  C   . ALA A 36  ? 0.4157 0.4305 0.3684 0.0006  -0.0317 -0.0653 36  ALA A C   
241  O  O   . ALA A 36  ? 0.5221 0.5372 0.4662 0.0046  -0.0292 -0.0634 36  ALA A O   
242  C  CB  . ALA A 36  ? 0.3513 0.3676 0.3214 -0.0069 -0.0274 -0.0599 36  ALA A CB  
243  N  N   . GLU A 37  ? 0.4211 0.4319 0.3746 -0.0007 -0.0349 -0.0704 37  GLU A N   
244  C  CA  . GLU A 37  ? 0.4189 0.4251 0.3629 0.0031  -0.0346 -0.0739 37  GLU A CA  
245  C  C   . GLU A 37  ? 0.4651 0.4693 0.4085 0.0041  -0.0282 -0.0708 37  GLU A C   
246  O  O   . GLU A 37  ? 0.5390 0.5428 0.4904 0.0006  -0.0257 -0.0677 37  GLU A O   
247  C  CB  . GLU A 37  ? 0.2644 0.2653 0.2094 0.0016  -0.0398 -0.0805 37  GLU A CB  
248  C  CG  . GLU A 37  ? 0.2762 0.2792 0.2177 0.0023  -0.0466 -0.0854 37  GLU A CG  
249  C  CD  . GLU A 37  ? 0.6282 0.6323 0.5560 0.0088  -0.0468 -0.0872 37  GLU A CD  
250  O  OE1 . GLU A 37  ? 0.7046 0.7144 0.6291 0.0108  -0.0480 -0.0850 37  GLU A OE1 
251  O  OE2 . GLU A 37  ? 0.6806 0.6799 0.6004 0.0123  -0.0457 -0.0906 37  GLU A OE2 
252  N  N   . PRO A 38  ? 0.4784 0.4823 0.4126 0.0088  -0.0254 -0.0712 38  PRO A N   
253  C  CA  . PRO A 38  ? 0.4777 0.4815 0.4121 0.0097  -0.0193 -0.0682 38  PRO A CA  
254  C  C   . PRO A 38  ? 0.4665 0.4652 0.4067 0.0080  -0.0196 -0.0705 38  PRO A C   
255  O  O   . PRO A 38  ? 0.6063 0.5999 0.5434 0.0098  -0.0227 -0.0760 38  PRO A O   
256  C  CB  . PRO A 38  ? 0.4375 0.4426 0.3604 0.0153  -0.0172 -0.0697 38  PRO A CB  
257  C  CG  . PRO A 38  ? 0.4432 0.4508 0.3599 0.0167  -0.0203 -0.0696 38  PRO A CG  
258  C  CD  . PRO A 38  ? 0.4631 0.4689 0.3860 0.0134  -0.0269 -0.0730 38  PRO A CD  
259  N  N   . PRO A 39  ? 0.4741 0.4733 0.4214 0.0051  -0.0170 -0.0669 39  PRO A N   
260  C  CA  . PRO A 39  ? 0.4046 0.3983 0.3577 0.0031  -0.0178 -0.0682 39  PRO A CA  
261  C  C   . PRO A 39  ? 0.4274 0.4193 0.3774 0.0072  -0.0147 -0.0694 39  PRO A C   
262  O  O   . PRO A 39  ? 0.4755 0.4694 0.4295 0.0068  -0.0109 -0.0659 39  PRO A O   
263  C  CB  . PRO A 39  ? 0.2939 0.2903 0.2557 -0.0016 -0.0157 -0.0630 39  PRO A CB  
264  C  CG  . PRO A 39  ? 0.2905 0.2931 0.2500 -0.0006 -0.0120 -0.0588 39  PRO A CG  
265  C  CD  . PRO A 39  ? 0.4760 0.4800 0.4269 0.0029  -0.0135 -0.0610 39  PRO A CD  
266  N  N   . VAL A 40  ? 0.3730 0.3615 0.3158 0.0116  -0.0166 -0.0748 40  VAL A N   
267  C  CA  . VAL A 40  ? 0.4250 0.4138 0.3633 0.0170  -0.0133 -0.0764 40  VAL A CA  
268  C  C   . VAL A 40  ? 0.5380 0.5177 0.4738 0.0198  -0.0171 -0.0829 40  VAL A C   
269  O  O   . VAL A 40  ? 0.6413 0.6149 0.5766 0.0177  -0.0225 -0.0868 40  VAL A O   
270  C  CB  . VAL A 40  ? 0.4420 0.4374 0.3714 0.0214  -0.0101 -0.0764 40  VAL A CB  
271  C  CG1 . VAL A 40  ? 0.4573 0.4598 0.3890 0.0185  -0.0065 -0.0698 40  VAL A CG1 
272  C  CG2 . VAL A 40  ? 0.2769 0.2698 0.1980 0.0235  -0.0148 -0.0816 40  VAL A CG2 
273  N  N   . GLY A 41  ? 0.4890 0.4681 0.4234 0.0246  -0.0144 -0.0843 41  GLY A N   
274  C  CA  . GLY A 41  ? 0.2893 0.2586 0.2210 0.0282  -0.0177 -0.0904 41  GLY A CA  
275  C  C   . GLY A 41  ? 0.5292 0.4890 0.4681 0.0229  -0.0219 -0.0901 41  GLY A C   
276  O  O   . GLY A 41  ? 0.4536 0.4151 0.4002 0.0188  -0.0202 -0.0845 41  GLY A O   
277  N  N   . ASN A 42  ? 0.6322 0.5820 0.5681 0.0226  -0.0275 -0.0960 42  ASN A N   
278  C  CA  . ASN A 42  ? 0.7201 0.6603 0.6623 0.0166  -0.0320 -0.0960 42  ASN A CA  
279  C  C   . ASN A 42  ? 0.6006 0.5466 0.5511 0.0090  -0.0314 -0.0897 42  ASN A C   
280  O  O   . ASN A 42  ? 0.5027 0.4430 0.4598 0.0037  -0.0333 -0.0876 42  ASN A O   
281  C  CB  . ASN A 42  ? 0.9249 0.8563 0.8624 0.0160  -0.0384 -0.1034 42  ASN A CB  
282  C  CG  . ASN A 42  ? 1.0862 1.0046 1.0191 0.0207  -0.0409 -0.1094 42  ASN A CG  
283  O  OD1 . ASN A 42  ? 1.1125 1.0299 1.0446 0.0261  -0.0376 -0.1085 42  ASN A OD1 
284  N  ND2 . ASN A 42  ? 1.1246 1.0329 1.0548 0.0189  -0.0472 -0.1158 42  ASN A ND2 
285  N  N   . MET A 43  ? 0.2803 0.2372 0.2302 0.0087  -0.0286 -0.0866 43  MET A N   
286  C  CA  . MET A 43  ? 0.4024 0.3647 0.3593 0.0024  -0.0285 -0.0818 43  MET A CA  
287  C  C   . MET A 43  ? 0.5626 0.5312 0.5246 0.0013  -0.0232 -0.0751 43  MET A C   
288  O  O   . MET A 43  ? 0.5998 0.5734 0.5672 -0.0033 -0.0224 -0.0709 43  MET A O   
289  C  CB  . MET A 43  ? 0.3789 0.3480 0.3320 0.0025  -0.0298 -0.0829 43  MET A CB  
290  C  CG  . MET A 43  ? 0.3754 0.3391 0.3276 0.0002  -0.0364 -0.0885 43  MET A CG  
291  S  SD  . MET A 43  ? 0.6238 0.5958 0.5714 0.0009  -0.0390 -0.0900 43  MET A SD  
292  C  CE  . MET A 43  ? 0.5887 0.5706 0.5435 -0.0024 -0.0346 -0.0817 43  MET A CE  
293  N  N   . ARG A 44  ? 0.6203 0.5888 0.5808 0.0055  -0.0199 -0.0743 44  ARG A N   
294  C  CA  . ARG A 44  ? 0.4704 0.4438 0.4362 0.0041  -0.0158 -0.0685 44  ARG A CA  
295  C  C   . ARG A 44  ? 0.4681 0.4357 0.4407 -0.0008 -0.0176 -0.0660 44  ARG A C   
296  O  O   . ARG A 44  ? 0.3810 0.3389 0.3535 -0.0008 -0.0208 -0.0686 44  ARG A O   
297  C  CB  . ARG A 44  ? 0.2503 0.2259 0.2136 0.0100  -0.0123 -0.0688 44  ARG A CB  
298  C  CG  . ARG A 44  ? 0.3609 0.3430 0.3296 0.0088  -0.0083 -0.0632 44  ARG A CG  
299  C  CD  . ARG A 44  ? 0.4037 0.3893 0.3709 0.0148  -0.0053 -0.0639 44  ARG A CD  
300  N  NE  . ARG A 44  ? 0.4253 0.4185 0.3872 0.0183  -0.0022 -0.0651 44  ARG A NE  
301  C  CZ  . ARG A 44  ? 0.4211 0.4197 0.3810 0.0237  0.0010  -0.0662 44  ARG A CZ  
302  N  NH1 . ARG A 44  ? 0.3438 0.3408 0.3066 0.0271  0.0011  -0.0667 44  ARG A NH1 
303  N  NH2 . ARG A 44  ? 0.5816 0.5873 0.5365 0.0261  0.0041  -0.0666 44  ARG A NH2 
304  N  N   . PHE A 45  ? 0.5147 0.4880 0.4927 -0.0050 -0.0154 -0.0608 45  PHE A N   
305  C  CA  . PHE A 45  ? 0.5426 0.5130 0.5268 -0.0100 -0.0159 -0.0571 45  PHE A CA  
306  C  C   . PHE A 45  ? 0.5199 0.4872 0.5073 -0.0154 -0.0195 -0.0580 45  PHE A C   
307  O  O   . PHE A 45  ? 0.5683 0.5316 0.5603 -0.0197 -0.0202 -0.0554 45  PHE A O   
308  C  CB  . PHE A 45  ? 0.4265 0.3890 0.4110 -0.0081 -0.0165 -0.0568 45  PHE A CB  
309  C  CG  . PHE A 45  ? 0.3773 0.3435 0.3596 -0.0023 -0.0134 -0.0563 45  PHE A CG  
310  C  CD1 . PHE A 45  ? 0.3048 0.2651 0.2834 0.0034  -0.0145 -0.0600 45  PHE A CD1 
311  C  CD2 . PHE A 45  ? 0.4119 0.3880 0.3963 -0.0026 -0.0095 -0.0525 45  PHE A CD2 
312  C  CE1 . PHE A 45  ? 0.3622 0.3278 0.3398 0.0088  -0.0115 -0.0596 45  PHE A CE1 
313  C  CE2 . PHE A 45  ? 0.3518 0.3328 0.3353 0.0020  -0.0067 -0.0521 45  PHE A CE2 
314  C  CZ  . PHE A 45  ? 0.3868 0.3633 0.3672 0.0078  -0.0076 -0.0555 45  PHE A CZ  
315  N  N   . ARG A 46  ? 0.3893 0.3586 0.3746 -0.0155 -0.0217 -0.0614 46  ARG A N   
316  C  CA  . ARG A 46  ? 0.3819 0.3492 0.3712 -0.0208 -0.0256 -0.0628 46  ARG A CA  
317  C  C   . ARG A 46  ? 0.5029 0.4803 0.4953 -0.0232 -0.0249 -0.0609 46  ARG A C   
318  O  O   . ARG A 46  ? 0.2986 0.2826 0.2884 -0.0202 -0.0221 -0.0594 46  ARG A O   
319  C  CB  . ARG A 46  ? 0.4756 0.4358 0.4606 -0.0194 -0.0304 -0.0692 46  ARG A CB  
320  C  CG  . ARG A 46  ? 0.7571 0.7060 0.7385 -0.0163 -0.0315 -0.0717 46  ARG A CG  
321  C  CD  . ARG A 46  ? 0.8150 0.7538 0.7939 -0.0171 -0.0371 -0.0779 46  ARG A CD  
322  N  NE  . ARG A 46  ? 0.7271 0.6707 0.7044 -0.0179 -0.0402 -0.0818 46  ARG A NE  
323  C  CZ  . ARG A 46  ? 0.7233 0.6642 0.6930 -0.0135 -0.0430 -0.0880 46  ARG A CZ  
324  N  NH1 . ARG A 46  ? 0.6253 0.5714 0.5939 -0.0146 -0.0462 -0.0910 46  ARG A NH1 
325  N  NH2 . ARG A 46  ? 0.6844 0.6179 0.6476 -0.0075 -0.0425 -0.0913 46  ARG A NH2 
326  N  N   . ARG A 47  ? 0.5848 0.5628 0.5832 -0.0287 -0.0276 -0.0608 47  ARG A N   
327  C  CA  . ARG A 47  ? 0.4885 0.4762 0.4910 -0.0309 -0.0275 -0.0595 47  ARG A CA  
328  C  C   . ARG A 47  ? 0.4332 0.4246 0.4298 -0.0264 -0.0291 -0.0627 47  ARG A C   
329  O  O   . ARG A 47  ? 0.3038 0.2901 0.2949 -0.0240 -0.0322 -0.0674 47  ARG A O   
330  C  CB  . ARG A 47  ? 0.5594 0.5476 0.5695 -0.0373 -0.0309 -0.0601 47  ARG A CB  
331  C  CG  . ARG A 47  ? 0.6382 0.6216 0.6532 -0.0421 -0.0295 -0.0565 47  ARG A CG  
332  C  CD  . ARG A 47  ? 0.6753 0.6613 0.6988 -0.0494 -0.0319 -0.0562 47  ARG A CD  
333  N  NE  . ARG A 47  ? 0.6492 0.6359 0.6777 -0.0536 -0.0284 -0.0506 47  ARG A NE  
334  C  CZ  . ARG A 47  ? 0.7071 0.6840 0.7353 -0.0561 -0.0282 -0.0486 47  ARG A CZ  
335  N  NH1 . ARG A 47  ? 0.6523 0.6312 0.6842 -0.0597 -0.0248 -0.0431 47  ARG A NH1 
336  N  NH2 . ARG A 47  ? 0.7149 0.6798 0.7385 -0.0546 -0.0314 -0.0520 47  ARG A NH2 
337  N  N   . PRO A 48  ? 0.3993 0.3989 0.3961 -0.0250 -0.0270 -0.0603 48  PRO A N   
338  C  CA  . PRO A 48  ? 0.2223 0.2252 0.2129 -0.0209 -0.0287 -0.0626 48  PRO A CA  
339  C  C   . PRO A 48  ? 0.4458 0.4491 0.4378 -0.0227 -0.0347 -0.0672 48  PRO A C   
340  O  O   . PRO A 48  ? 0.3175 0.3215 0.3174 -0.0280 -0.0369 -0.0675 48  PRO A O   
341  C  CB  . PRO A 48  ? 0.2139 0.2246 0.2066 -0.0203 -0.0259 -0.0586 48  PRO A CB  
342  C  CG  . PRO A 48  ? 0.3797 0.3911 0.3783 -0.0234 -0.0222 -0.0545 48  PRO A CG  
343  C  CD  . PRO A 48  ? 0.4169 0.4224 0.4190 -0.0270 -0.0233 -0.0554 48  PRO A CD  
344  N  N   . GLU A 49  ? 0.5313 0.5342 0.5153 -0.0184 -0.0372 -0.0709 49  GLU A N   
345  C  CA  . GLU A 49  ? 0.5023 0.5077 0.4864 -0.0191 -0.0433 -0.0753 49  GLU A CA  
346  C  C   . GLU A 49  ? 0.5429 0.5559 0.5230 -0.0151 -0.0436 -0.0741 49  GLU A C   
347  O  O   . GLU A 49  ? 0.6306 0.6432 0.6029 -0.0104 -0.0401 -0.0720 49  GLU A O   
348  C  CB  . GLU A 49  ? 0.5339 0.5316 0.5108 -0.0171 -0.0471 -0.0816 49  GLU A CB  
349  C  CG  . GLU A 49  ? 0.6982 0.6859 0.6762 -0.0190 -0.0461 -0.0825 49  GLU A CG  
350  C  CD  . GLU A 49  ? 0.8157 0.8003 0.8026 -0.0260 -0.0500 -0.0841 49  GLU A CD  
351  O  OE1 . GLU A 49  ? 0.8416 0.8173 0.8302 -0.0282 -0.0493 -0.0839 49  GLU A OE1 
352  O  OE2 . GLU A 49  ? 0.9020 0.8931 0.8942 -0.0294 -0.0538 -0.0852 49  GLU A OE2 
353  N  N   . PRO A 50  ? 0.4763 0.4966 0.4617 -0.0168 -0.0475 -0.0749 50  PRO A N   
354  C  CA  . PRO A 50  ? 0.4155 0.4427 0.3974 -0.0125 -0.0477 -0.0728 50  PRO A CA  
355  C  C   . PRO A 50  ? 0.5293 0.5540 0.4985 -0.0069 -0.0496 -0.0756 50  PRO A C   
356  O  O   . PRO A 50  ? 0.5394 0.5605 0.5046 -0.0068 -0.0538 -0.0811 50  PRO A O   
357  C  CB  . PRO A 50  ? 0.2396 0.2754 0.2307 -0.0155 -0.0526 -0.0743 50  PRO A CB  
358  C  CG  . PRO A 50  ? 0.3129 0.3455 0.3102 -0.0214 -0.0560 -0.0783 50  PRO A CG  
359  C  CD  . PRO A 50  ? 0.2432 0.2659 0.2384 -0.0228 -0.0521 -0.0775 50  PRO A CD  
360  N  N   . LYS A 51  ? 0.5531 0.5794 0.5155 -0.0022 -0.0463 -0.0716 51  LYS A N   
361  C  CA  . LYS A 51  ? 0.5602 0.5846 0.5094 0.0034  -0.0470 -0.0730 51  LYS A CA  
362  C  C   . LYS A 51  ? 0.6216 0.6492 0.5682 0.0045  -0.0546 -0.0783 51  LYS A C   
363  O  O   . LYS A 51  ? 0.6705 0.7049 0.6234 0.0035  -0.0584 -0.0782 51  LYS A O   
364  C  CB  . LYS A 51  ? 0.5178 0.5443 0.4617 0.0073  -0.0430 -0.0671 51  LYS A CB  
365  C  CG  . LYS A 51  ? 0.4141 0.4384 0.3434 0.0129  -0.0420 -0.0669 51  LYS A CG  
366  C  CD  . LYS A 51  ? 0.3315 0.3507 0.2554 0.0134  -0.0410 -0.0712 51  LYS A CD  
367  C  CE  . LYS A 51  ? 0.4610 0.4793 0.3705 0.0190  -0.0394 -0.0711 51  LYS A CE  
368  N  NZ  . LYS A 51  ? 0.5629 0.5823 0.4684 0.0209  -0.0339 -0.0638 51  LYS A NZ  
369  N  N   . LYS A 52  ? 0.6467 0.6697 0.5843 0.0067  -0.0569 -0.0834 52  LYS A N   
370  C  CA  . LYS A 52  ? 0.5658 0.5914 0.4991 0.0083  -0.0645 -0.0891 52  LYS A CA  
371  C  C   . LYS A 52  ? 0.4496 0.4803 0.3736 0.0141  -0.0654 -0.0863 52  LYS A C   
372  O  O   . LYS A 52  ? 0.3629 0.3917 0.2790 0.0179  -0.0598 -0.0815 52  LYS A O   
373  C  CB  . LYS A 52  ? 0.6850 0.7034 0.6100 0.0096  -0.0666 -0.0958 52  LYS A CB  
374  C  CG  . LYS A 52  ? 0.8804 0.8921 0.8138 0.0042  -0.0660 -0.0983 52  LYS A CG  
375  C  CD  . LYS A 52  ? 1.0125 1.0166 0.9394 0.0049  -0.0704 -0.1065 52  LYS A CD  
376  C  CE  . LYS A 52  ? 1.0331 1.0307 0.9706 -0.0018 -0.0721 -0.1090 52  LYS A CE  
377  N  NZ  . LYS A 52  ? 1.0481 1.0522 0.9987 -0.0083 -0.0761 -0.1082 52  LYS A NZ  
378  N  N   . PRO A 53  ? 0.5151 0.5522 0.4403 0.0149  -0.0722 -0.0887 53  PRO A N   
379  C  CA  . PRO A 53  ? 0.5039 0.5458 0.4210 0.0207  -0.0734 -0.0851 53  PRO A CA  
380  C  C   . PRO A 53  ? 0.4917 0.5297 0.3912 0.0267  -0.0725 -0.0858 53  PRO A C   
381  O  O   . PRO A 53  ? 0.5986 0.6331 0.4917 0.0272  -0.0749 -0.0919 53  PRO A O   
382  C  CB  . PRO A 53  ? 0.5003 0.5505 0.4233 0.0198  -0.0821 -0.0892 53  PRO A CB  
383  C  CG  . PRO A 53  ? 0.6121 0.6634 0.5508 0.0122  -0.0831 -0.0919 53  PRO A CG  
384  C  CD  . PRO A 53  ? 0.4892 0.5306 0.4259 0.0096  -0.0787 -0.0936 53  PRO A CD  
385  N  N   . TRP A 54  ? 0.3357 0.3742 0.2272 0.0313  -0.0688 -0.0793 54  TRP A N   
386  C  CA  . TRP A 54  ? 0.3708 0.4066 0.2451 0.0370  -0.0671 -0.0786 54  TRP A CA  
387  C  C   . TRP A 54  ? 0.5267 0.5672 0.3917 0.0424  -0.0728 -0.0777 54  TRP A C   
388  O  O   . TRP A 54  ? 0.5602 0.6059 0.4319 0.0427  -0.0761 -0.0752 54  TRP A O   
389  C  CB  . TRP A 54  ? 0.3577 0.3894 0.2279 0.0379  -0.0579 -0.0712 54  TRP A CB  
390  C  CG  . TRP A 54  ? 0.4167 0.4500 0.2918 0.0380  -0.0559 -0.0638 54  TRP A CG  
391  C  CD1 . TRP A 54  ? 0.4922 0.5258 0.3580 0.0428  -0.0556 -0.0582 54  TRP A CD1 
392  C  CD2 . TRP A 54  ? 0.4062 0.4402 0.2961 0.0335  -0.0538 -0.0614 54  TRP A CD2 
393  N  NE1 . TRP A 54  ? 0.3615 0.3952 0.2356 0.0416  -0.0537 -0.0527 54  TRP A NE1 
394  C  CE2 . TRP A 54  ? 0.4450 0.4794 0.3338 0.0360  -0.0525 -0.0547 54  TRP A CE2 
395  C  CE3 . TRP A 54  ? 0.4331 0.4670 0.3363 0.0277  -0.0529 -0.0640 54  TRP A CE3 
396  C  CZ2 . TRP A 54  ? 0.5003 0.5355 0.4010 0.0333  -0.0503 -0.0514 54  TRP A CZ2 
397  C  CZ3 . TRP A 54  ? 0.4695 0.5048 0.3841 0.0248  -0.0506 -0.0602 54  TRP A CZ3 
398  C  CH2 . TRP A 54  ? 0.4850 0.5211 0.3983 0.0277  -0.0493 -0.0543 54  TRP A CH2 
399  N  N   . SER A 55  ? 0.5255 0.5646 0.3746 0.0472  -0.0736 -0.0797 55  SER A N   
400  C  CA  . SER A 55  ? 0.4679 0.5106 0.3048 0.0533  -0.0786 -0.0785 55  SER A CA  
401  C  C   . SER A 55  ? 0.4864 0.5260 0.3117 0.0574  -0.0718 -0.0695 55  SER A C   
402  O  O   . SER A 55  ? 0.5582 0.5932 0.3812 0.0563  -0.0637 -0.0663 55  SER A O   
403  C  CB  . SER A 55  ? 0.4763 0.5193 0.3014 0.0561  -0.0841 -0.0867 55  SER A CB  
404  O  OG  . SER A 55  ? 0.5164 0.5538 0.3378 0.0551  -0.0786 -0.0895 55  SER A OG  
405  N  N   . GLY A 56  ? 0.3801 0.4224 0.1984 0.0622  -0.0753 -0.0653 56  GLY A N   
406  C  CA  . GLY A 56  ? 0.4623 0.5005 0.2705 0.0656  -0.0691 -0.0558 56  GLY A CA  
407  C  C   . GLY A 56  ? 0.5822 0.6174 0.4029 0.0618  -0.0636 -0.0495 56  GLY A C   
408  O  O   . GLY A 56  ? 0.7626 0.8004 0.5993 0.0577  -0.0654 -0.0519 56  GLY A O   
409  N  N   . VAL A 57  ? 0.4911 0.5209 0.3042 0.0629  -0.0565 -0.0413 57  VAL A N   
410  C  CA  . VAL A 57  ? 0.4483 0.4741 0.2699 0.0605  -0.0518 -0.0344 57  VAL A CA  
411  C  C   . VAL A 57  ? 0.4852 0.5071 0.3112 0.0553  -0.0430 -0.0329 57  VAL A C   
412  O  O   . VAL A 57  ? 0.3628 0.3820 0.1779 0.0561  -0.0375 -0.0299 57  VAL A O   
413  C  CB  . VAL A 57  ? 0.5510 0.5724 0.3609 0.0654  -0.0509 -0.0257 57  VAL A CB  
414  C  CG1 . VAL A 57  ? 0.5897 0.6058 0.4087 0.0628  -0.0465 -0.0194 57  VAL A CG1 
415  C  CG2 . VAL A 57  ? 0.3878 0.4137 0.1922 0.0714  -0.0599 -0.0271 57  VAL A CG2 
416  N  N   . TRP A 58  ? 0.4955 0.5177 0.3374 0.0502  -0.0417 -0.0346 58  TRP A N   
417  C  CA  . TRP A 58  ? 0.4138 0.4326 0.2615 0.0453  -0.0339 -0.0327 58  TRP A CA  
418  C  C   . TRP A 58  ? 0.3737 0.3868 0.2181 0.0451  -0.0283 -0.0238 58  TRP A C   
419  O  O   . TRP A 58  ? 0.4423 0.4534 0.2916 0.0456  -0.0298 -0.0205 58  TRP A O   
420  C  CB  . TRP A 58  ? 0.3748 0.3955 0.2395 0.0401  -0.0347 -0.0368 58  TRP A CB  
421  C  CG  . TRP A 58  ? 0.3996 0.4182 0.2698 0.0355  -0.0280 -0.0366 58  TRP A CG  
422  C  CD1 . TRP A 58  ? 0.4462 0.4610 0.3190 0.0328  -0.0215 -0.0308 58  TRP A CD1 
423  C  CD2 . TRP A 58  ? 0.4547 0.4746 0.3283 0.0332  -0.0274 -0.0425 58  TRP A CD2 
424  N  NE1 . TRP A 58  ? 0.3486 0.3635 0.2266 0.0291  -0.0171 -0.0327 58  TRP A NE1 
425  C  CE2 . TRP A 58  ? 0.3649 0.3826 0.2433 0.0296  -0.0205 -0.0397 58  TRP A CE2 
426  C  CE3 . TRP A 58  ? 0.4353 0.4574 0.3083 0.0339  -0.0324 -0.0500 58  TRP A CE3 
427  C  CZ2 . TRP A 58  ? 0.2883 0.3063 0.1708 0.0274  -0.0184 -0.0439 58  TRP A CZ2 
428  C  CZ3 . TRP A 58  ? 0.3759 0.3969 0.2527 0.0315  -0.0302 -0.0543 58  TRP A CZ3 
429  C  CH2 . TRP A 58  ? 0.3758 0.3949 0.2572 0.0286  -0.0232 -0.0511 58  TRP A CH2 
430  N  N   . ASN A 59  ? 0.3553 0.3658 0.1916 0.0444  -0.0217 -0.0202 59  ASN A N   
431  C  CA  . ASN A 59  ? 0.5671 0.5717 0.4001 0.0432  -0.0159 -0.0116 59  ASN A CA  
432  C  C   . ASN A 59  ? 0.6284 0.6312 0.4761 0.0375  -0.0124 -0.0113 59  ASN A C   
433  O  O   . ASN A 59  ? 0.5225 0.5274 0.3763 0.0336  -0.0087 -0.0140 59  ASN A O   
434  C  CB  . ASN A 59  ? 0.6620 0.6662 0.4824 0.0437  -0.0099 -0.0081 59  ASN A CB  
435  C  CG  . ASN A 59  ? 0.7344 0.7323 0.5508 0.0416  -0.0035 0.0012  59  ASN A CG  
436  O  OD1 . ASN A 59  ? 0.7043 0.6981 0.5305 0.0375  -0.0012 0.0037  59  ASN A OD1 
437  N  ND2 . ASN A 59  ? 0.7614 0.7582 0.5627 0.0440  -0.0002 0.0064  59  ASN A ND2 
438  N  N   . ALA A 60  ? 0.5631 0.5621 0.4163 0.0374  -0.0142 -0.0084 60  ALA A N   
439  C  CA  . ALA A 60  ? 0.4300 0.4273 0.2963 0.0326  -0.0116 -0.0084 60  ALA A CA  
440  C  C   . ALA A 60  ? 0.5390 0.5278 0.4022 0.0315  -0.0074 -0.0007 60  ALA A C   
441  O  O   . ALA A 60  ? 0.5956 0.5804 0.4638 0.0320  -0.0091 0.0009  60  ALA A O   
442  C  CB  . ALA A 60  ? 0.3903 0.3910 0.2673 0.0333  -0.0173 -0.0129 60  ALA A CB  
443  N  N   . SER A 61  ? 0.5927 0.5789 0.4474 0.0301  -0.0020 0.0039  61  SER A N   
444  C  CA  . SER A 61  ? 0.6218 0.5993 0.4723 0.0282  0.0023  0.0116  61  SER A CA  
445  C  C   . SER A 61  ? 0.5538 0.5309 0.4106 0.0215  0.0090  0.0130  61  SER A C   
446  O  O   . SER A 61  ? 0.5279 0.4975 0.3828 0.0186  0.0128  0.0190  61  SER A O   
447  C  CB  . SER A 61  ? 0.5574 0.5316 0.3918 0.0317  0.0035  0.0176  61  SER A CB  
448  O  OG  . SER A 61  ? 0.6067 0.5881 0.4354 0.0319  0.0059  0.0153  61  SER A OG  
449  N  N   . THR A 62  ? 0.4824 0.4671 0.3460 0.0190  0.0104  0.0077  62  THR A N   
450  C  CA  . THR A 62  ? 0.6240 0.6098 0.4949 0.0129  0.0161  0.0084  62  THR A CA  
451  C  C   . THR A 62  ? 0.6788 0.6699 0.5624 0.0110  0.0143  0.0017  62  THR A C   
452  O  O   . THR A 62  ? 0.6622 0.6582 0.5470 0.0137  0.0104  -0.0039 62  THR A O   
453  C  CB  . THR A 62  ? 0.5227 0.5131 0.3872 0.0117  0.0216  0.0105  62  THR A CB  
454  O  OG1 . THR A 62  ? 0.5091 0.5079 0.3760 0.0134  0.0206  0.0039  62  THR A OG1 
455  C  CG2 . THR A 62  ? 0.4715 0.4588 0.3211 0.0152  0.0224  0.0160  62  THR A CG2 
456  N  N   . TYR A 63  ? 0.5994 0.5890 0.4919 0.0060  0.0170  0.0023  63  TYR A N   
457  C  CA  . TYR A 63  ? 0.4583 0.4523 0.3625 0.0033  0.0165  -0.0027 63  TYR A CA  
458  C  C   . TYR A 63  ? 0.2636 0.2652 0.1683 0.0044  0.0165  -0.0075 63  TYR A C   
459  O  O   . TYR A 63  ? 0.3327 0.3371 0.2303 0.0056  0.0193  -0.0064 63  TYR A O   
460  C  CB  . TYR A 63  ? 0.4157 0.4080 0.3260 -0.0025 0.0210  -0.0003 63  TYR A CB  
461  C  CG  . TYR A 63  ? 0.4579 0.4429 0.3722 -0.0042 0.0198  0.0015  63  TYR A CG  
462  C  CD1 . TYR A 63  ? 0.5144 0.4988 0.4338 -0.0021 0.0154  -0.0020 63  TYR A CD1 
463  C  CD2 . TYR A 63  ? 0.4687 0.4475 0.3819 -0.0080 0.0233  0.0064  63  TYR A CD2 
464  C  CE1 . TYR A 63  ? 0.4954 0.4735 0.4182 -0.0030 0.0146  -0.0010 63  TYR A CE1 
465  C  CE2 . TYR A 63  ? 0.5542 0.5253 0.4704 -0.0093 0.0221  0.0073  63  TYR A CE2 
466  C  CZ  . TYR A 63  ? 0.4976 0.4684 0.4183 -0.0063 0.0179  0.0034  63  TYR A CZ  
467  O  OH  . TYR A 63  ? 0.5107 0.4742 0.4341 -0.0069 0.0169  0.0039  63  TYR A OH  
468  N  N   . PRO A 64  ? 0.3516 0.3563 0.2643 0.0042  0.0135  -0.0129 64  PRO A N   
469  C  CA  . PRO A 64  ? 0.3322 0.3424 0.2453 0.0055  0.0131  -0.0177 64  PRO A CA  
470  C  C   . PRO A 64  ? 0.3450 0.3586 0.2638 0.0022  0.0176  -0.0177 64  PRO A C   
471  O  O   . PRO A 64  ? 0.3333 0.3457 0.2549 -0.0015 0.0211  -0.0138 64  PRO A O   
472  C  CB  . PRO A 64  ? 0.5176 0.5282 0.4373 0.0060  0.0077  -0.0227 64  PRO A CB  
473  C  CG  . PRO A 64  ? 0.5441 0.5519 0.4714 0.0029  0.0079  -0.0206 64  PRO A CG  
474  C  CD  . PRO A 64  ? 0.5212 0.5243 0.4425 0.0030  0.0103  -0.0149 64  PRO A CD  
475  N  N   . ASN A 65  ? 0.3554 0.3732 0.2762 0.0034  0.0172  -0.0223 65  ASN A N   
476  C  CA  . ASN A 65  ? 0.3924 0.4141 0.3195 0.0009  0.0208  -0.0226 65  ASN A CA  
477  C  C   . ASN A 65  ? 0.4100 0.4305 0.3475 -0.0025 0.0192  -0.0238 65  ASN A C   
478  O  O   . ASN A 65  ? 0.5102 0.5278 0.4505 -0.0024 0.0151  -0.0255 65  ASN A O   
479  C  CB  . ASN A 65  ? 0.4780 0.5040 0.4034 0.0041  0.0210  -0.0271 65  ASN A CB  
480  C  CG  . ASN A 65  ? 0.4359 0.4648 0.3507 0.0076  0.0238  -0.0260 65  ASN A CG  
481  O  OD1 . ASN A 65  ? 0.2987 0.3284 0.2095 0.0061  0.0278  -0.0207 65  ASN A OD1 
482  N  ND2 . ASN A 65  ? 0.4261 0.4563 0.3361 0.0120  0.0219  -0.0310 65  ASN A ND2 
483  N  N   . ASN A 66  ? 0.3082 0.3319 0.2515 -0.0054 0.0225  -0.0228 66  ASN A N   
484  C  CA  . ASN A 66  ? 0.2117 0.2353 0.1641 -0.0083 0.0213  -0.0239 66  ASN A CA  
485  C  C   . ASN A 66  ? 0.2521 0.2781 0.2078 -0.0064 0.0197  -0.0283 66  ASN A C   
486  O  O   . ASN A 66  ? 0.2132 0.2420 0.1650 -0.0032 0.0207  -0.0302 66  ASN A O   
487  C  CB  . ASN A 66  ? 0.2090 0.2348 0.1658 -0.0124 0.0251  -0.0207 66  ASN A CB  
488  C  CG  . ASN A 66  ? 0.3924 0.4148 0.3450 -0.0144 0.0271  -0.0161 66  ASN A CG  
489  O  OD1 . ASN A 66  ? 0.5801 0.5975 0.5343 -0.0164 0.0259  -0.0148 66  ASN A OD1 
490  N  ND2 . ASN A 66  ? 0.6293 0.6541 0.5762 -0.0137 0.0305  -0.0136 66  ASN A ND2 
491  N  N   . CYS A 67  ? 0.3092 0.3336 0.2714 -0.0081 0.0173  -0.0299 67  CYS A N   
492  C  CA  . CYS A 67  ? 0.4663 0.4913 0.4314 -0.0065 0.0155  -0.0335 67  CYS A CA  
493  C  C   . CYS A 67  ? 0.4688 0.4987 0.4376 -0.0067 0.0185  -0.0331 67  CYS A C   
494  O  O   . CYS A 67  ? 0.3767 0.4101 0.3476 -0.0092 0.0217  -0.0300 67  CYS A O   
495  C  CB  . CYS A 67  ? 0.4892 0.5110 0.4597 -0.0085 0.0121  -0.0347 67  CYS A CB  
496  S  SG  . CYS A 67  ? 0.6472 0.6654 0.6150 -0.0081 0.0083  -0.0357 67  CYS A SG  
497  N  N   . GLN A 68  ? 0.4455 0.4757 0.4153 -0.0039 0.0173  -0.0363 68  GLN A N   
498  C  CA  . GLN A 68  ? 0.3651 0.4006 0.3387 -0.0029 0.0196  -0.0364 68  GLN A CA  
499  C  C   . GLN A 68  ? 0.5111 0.5473 0.4918 -0.0065 0.0192  -0.0345 68  GLN A C   
500  O  O   . GLN A 68  ? 0.5676 0.5993 0.5509 -0.0076 0.0162  -0.0353 68  GLN A O   
501  C  CB  . GLN A 68  ? 0.2648 0.2987 0.2369 0.0019  0.0178  -0.0406 68  GLN A CB  
502  C  CG  . GLN A 68  ? 0.4550 0.4888 0.4193 0.0060  0.0182  -0.0431 68  GLN A CG  
503  C  CD  . GLN A 68  ? 0.5228 0.5650 0.4853 0.0085  0.0230  -0.0423 68  GLN A CD  
504  O  OE1 . GLN A 68  ? 0.6150 0.6636 0.5827 0.0063  0.0261  -0.0393 68  GLN A OE1 
505  N  NE2 . GLN A 68  ? 0.6987 0.7415 0.6538 0.0132  0.0236  -0.0451 68  GLN A NE2 
506  N  N   . GLN A 69  ? 0.3892 0.4316 0.3732 -0.0086 0.0223  -0.0320 69  GLN A N   
507  C  CA  . GLN A 69  ? 0.3665 0.4095 0.3563 -0.0123 0.0217  -0.0304 69  GLN A CA  
508  C  C   . GLN A 69  ? 0.4775 0.5292 0.4718 -0.0136 0.0246  -0.0288 69  GLN A C   
509  O  O   . GLN A 69  ? 0.4154 0.4727 0.4085 -0.0128 0.0279  -0.0281 69  GLN A O   
510  C  CB  . GLN A 69  ? 0.2051 0.2438 0.1939 -0.0161 0.0213  -0.0284 69  GLN A CB  
511  C  CG  . GLN A 69  ? 0.2629 0.3034 0.2492 -0.0180 0.0244  -0.0259 69  GLN A CG  
512  C  CD  . GLN A 69  ? 0.2552 0.2899 0.2395 -0.0206 0.0236  -0.0242 69  GLN A CD  
513  O  OE1 . GLN A 69  ? 0.2591 0.2930 0.2465 -0.0241 0.0237  -0.0230 69  GLN A OE1 
514  N  NE2 . GLN A 69  ? 0.3320 0.3625 0.3108 -0.0186 0.0226  -0.0245 69  GLN A NE2 
515  N  N   . TYR A 70  ? 0.4199 0.4733 0.4196 -0.0157 0.0234  -0.0283 70  TYR A N   
516  C  CA  . TYR A 70  ? 0.3719 0.4340 0.3768 -0.0176 0.0254  -0.0270 70  TYR A CA  
517  C  C   . TYR A 70  ? 0.3312 0.3945 0.3358 -0.0225 0.0280  -0.0244 70  TYR A C   
518  O  O   . TYR A 70  ? 0.4119 0.4682 0.4134 -0.0249 0.0273  -0.0235 70  TYR A O   
519  C  CB  . TYR A 70  ? 0.4567 0.5195 0.4663 -0.0188 0.0227  -0.0271 70  TYR A CB  
520  C  CG  . TYR A 70  ? 0.4382 0.5097 0.4537 -0.0220 0.0238  -0.0259 70  TYR A CG  
521  C  CD1 . TYR A 70  ? 0.3543 0.4349 0.3748 -0.0194 0.0239  -0.0265 70  TYR A CD1 
522  C  CD2 . TYR A 70  ? 0.4854 0.5558 0.5017 -0.0276 0.0242  -0.0245 70  TYR A CD2 
523  C  CE1 . TYR A 70  ? 0.3979 0.4876 0.4246 -0.0227 0.0243  -0.0256 70  TYR A CE1 
524  C  CE2 . TYR A 70  ? 0.5366 0.6146 0.5583 -0.0311 0.0246  -0.0238 70  TYR A CE2 
525  C  CZ  . TYR A 70  ? 0.5069 0.5951 0.5341 -0.0289 0.0246  -0.0243 70  TYR A CZ  
526  O  OH  . TYR A 70  ? 0.5773 0.6741 0.6107 -0.0328 0.0246  -0.0238 70  TYR A OH  
527  N  N   . VAL A 71  ? 0.2552 0.3276 0.2634 -0.0239 0.0310  -0.0232 71  VAL A N   
528  C  CA  . VAL A 71  ? 0.3135 0.3868 0.3212 -0.0288 0.0339  -0.0204 71  VAL A CA  
529  C  C   . VAL A 71  ? 0.3668 0.4471 0.3818 -0.0336 0.0342  -0.0195 71  VAL A C   
530  O  O   . VAL A 71  ? 0.4603 0.5517 0.4809 -0.0329 0.0357  -0.0197 71  VAL A O   
531  C  CB  . VAL A 71  ? 0.1848 0.2627 0.1891 -0.0270 0.0380  -0.0191 71  VAL A CB  
532  C  CG1 . VAL A 71  ? 0.2583 0.3378 0.2629 -0.0329 0.0413  -0.0154 71  VAL A CG1 
533  C  CG2 . VAL A 71  ? 0.2039 0.2737 0.1998 -0.0229 0.0370  -0.0201 71  VAL A CG2 
534  N  N   . ASP A 72  ? 0.3620 0.4363 0.3771 -0.0381 0.0326  -0.0189 72  ASP A N   
535  C  CA  . ASP A 72  ? 0.2898 0.3695 0.3114 -0.0430 0.0320  -0.0187 72  ASP A CA  
536  C  C   . ASP A 72  ? 0.3459 0.4340 0.3712 -0.0471 0.0358  -0.0164 72  ASP A C   
537  O  O   . ASP A 72  ? 0.3548 0.4382 0.3764 -0.0501 0.0383  -0.0139 72  ASP A O   
538  C  CB  . ASP A 72  ? 0.3586 0.4288 0.3780 -0.0469 0.0298  -0.0189 72  ASP A CB  
539  C  CG  . ASP A 72  ? 0.5742 0.6485 0.5991 -0.0530 0.0293  -0.0188 72  ASP A CG  
540  O  OD1 . ASP A 72  ? 0.7512 0.8368 0.7827 -0.0533 0.0290  -0.0195 72  ASP A OD1 
541  O  OD2 . ASP A 72  ? 0.6537 0.7201 0.6764 -0.0572 0.0288  -0.0184 72  ASP A OD2 
542  N  N   . GLU A 73  ? 0.4490 0.5499 0.4819 -0.0471 0.0362  -0.0171 73  GLU A N   
543  C  CA  . GLU A 73  ? 0.5217 0.6333 0.5602 -0.0517 0.0399  -0.0149 73  GLU A CA  
544  C  C   . GLU A 73  ? 0.3491 0.4680 0.3960 -0.0573 0.0380  -0.0156 73  GLU A C   
545  O  O   . GLU A 73  ? 0.3144 0.4461 0.3687 -0.0605 0.0404  -0.0145 73  GLU A O   
546  C  CB  . GLU A 73  ? 0.6912 0.8148 0.7321 -0.0464 0.0430  -0.0151 73  GLU A CB  
547  C  CG  . GLU A 73  ? 0.7732 0.8902 0.8055 -0.0402 0.0442  -0.0154 73  GLU A CG  
548  C  CD  . GLU A 73  ? 0.9193 1.0474 0.9537 -0.0337 0.0463  -0.0170 73  GLU A CD  
549  O  OE1 . GLU A 73  ? 0.9280 1.0698 0.9685 -0.0353 0.0499  -0.0157 73  GLU A OE1 
550  O  OE2 . GLU A 73  ? 0.9997 1.1230 1.0298 -0.0269 0.0442  -0.0196 73  GLU A OE2 
551  N  N   . GLN A 74  ? 0.2599 0.3718 0.3060 -0.0586 0.0337  -0.0175 74  GLN A N   
552  C  CA  . GLN A 74  ? 0.3986 0.5175 0.4520 -0.0638 0.0313  -0.0186 74  GLN A CA  
553  C  C   . GLN A 74  ? 0.3979 0.5176 0.4543 -0.0724 0.0338  -0.0164 74  GLN A C   
554  O  O   . GLN A 74  ? 0.4708 0.6030 0.5360 -0.0769 0.0340  -0.0164 74  GLN A O   
555  C  CB  . GLN A 74  ? 0.4729 0.5830 0.5232 -0.0637 0.0265  -0.0210 74  GLN A CB  
556  C  CG  . GLN A 74  ? 0.4865 0.6056 0.5438 -0.0672 0.0232  -0.0229 74  GLN A CG  
557  C  CD  . GLN A 74  ? 0.7559 0.8854 0.8171 -0.0610 0.0210  -0.0242 74  GLN A CD  
558  O  OE1 . GLN A 74  ? 0.8269 0.9625 0.8895 -0.0559 0.0233  -0.0234 74  GLN A OE1 
559  N  NE2 . GLN A 74  ? 0.8993 1.0300 0.9614 -0.0609 0.0165  -0.0263 74  GLN A NE2 
560  N  N   . PHE A 75  ? 0.2115 0.3180 0.2609 -0.0749 0.0355  -0.0145 75  PHE A N   
561  C  CA  . PHE A 75  ? 0.2373 0.3410 0.2881 -0.0833 0.0376  -0.0120 75  PHE A CA  
562  C  C   . PHE A 75  ? 0.4228 0.5228 0.4682 -0.0827 0.0425  -0.0079 75  PHE A C   
563  O  O   . PHE A 75  ? 0.5527 0.6381 0.5896 -0.0824 0.0427  -0.0065 75  PHE A O   
564  C  CB  . PHE A 75  ? 0.2769 0.3661 0.3235 -0.0872 0.0342  -0.0136 75  PHE A CB  
565  C  CG  . PHE A 75  ? 0.3503 0.4430 0.4010 -0.0879 0.0293  -0.0176 75  PHE A CG  
566  C  CD1 . PHE A 75  ? 0.3129 0.4161 0.3724 -0.0942 0.0281  -0.0186 75  PHE A CD1 
567  C  CD2 . PHE A 75  ? 0.3984 0.4843 0.4439 -0.0824 0.0259  -0.0204 75  PHE A CD2 
568  C  CE1 . PHE A 75  ? 0.4357 0.5425 0.4981 -0.0945 0.0232  -0.0225 75  PHE A CE1 
569  C  CE2 . PHE A 75  ? 0.3956 0.4849 0.4437 -0.0828 0.0215  -0.0238 75  PHE A CE2 
570  C  CZ  . PHE A 75  ? 0.3803 0.4798 0.4365 -0.0886 0.0199  -0.0250 75  PHE A CZ  
571  N  N   . PRO A 76  ? 0.4347 0.5481 0.4845 -0.0822 0.0466  -0.0060 76  PRO A N   
572  C  CA  . PRO A 76  ? 0.4475 0.5584 0.4913 -0.0815 0.0517  -0.0019 76  PRO A CA  
573  C  C   . PRO A 76  ? 0.3934 0.4956 0.4353 -0.0900 0.0537  0.0021  76  PRO A C   
574  O  O   . PRO A 76  ? 0.4122 0.5175 0.4611 -0.0979 0.0531  0.0022  76  PRO A O   
575  C  CB  . PRO A 76  ? 0.5187 0.6488 0.5694 -0.0796 0.0556  -0.0012 76  PRO A CB  
576  C  CG  . PRO A 76  ? 0.5015 0.6422 0.5605 -0.0769 0.0518  -0.0054 76  PRO A CG  
577  C  CD  . PRO A 76  ? 0.4739 0.6062 0.5342 -0.0819 0.0469  -0.0074 76  PRO A CD  
578  N  N   . GLY A 77  ? 0.4351 0.5254 0.4670 -0.0884 0.0558  0.0053  77  GLY A N   
579  C  CA  . GLY A 77  ? 0.5411 0.6191 0.5689 -0.0954 0.0572  0.0094  77  GLY A CA  
580  C  C   . GLY A 77  ? 0.5592 0.6207 0.5835 -0.0970 0.0524  0.0072  77  GLY A C   
581  O  O   . GLY A 77  ? 0.5817 0.6284 0.5987 -0.0991 0.0530  0.0102  77  GLY A O   
582  N  N   . PHE A 78  ? 0.4981 0.5615 0.5266 -0.0955 0.0478  0.0020  78  PHE A N   
583  C  CA  . PHE A 78  ? 0.4758 0.5253 0.5016 -0.0973 0.0434  -0.0007 78  PHE A CA  
584  C  C   . PHE A 78  ? 0.5533 0.5884 0.5687 -0.0907 0.0421  -0.0007 78  PHE A C   
585  O  O   . PHE A 78  ? 0.5222 0.5601 0.5354 -0.0833 0.0410  -0.0028 78  PHE A O   
586  C  CB  . PHE A 78  ? 0.5312 0.5879 0.5633 -0.0965 0.0391  -0.0060 78  PHE A CB  
587  C  CG  . PHE A 78  ? 0.5636 0.6079 0.5933 -0.0988 0.0348  -0.0093 78  PHE A CG  
588  C  CD1 . PHE A 78  ? 0.4911 0.5279 0.5219 -0.1072 0.0345  -0.0085 78  PHE A CD1 
589  C  CD2 . PHE A 78  ? 0.5971 0.6372 0.6233 -0.0929 0.0312  -0.0132 78  PHE A CD2 
590  C  CE1 . PHE A 78  ? 0.4469 0.4717 0.4748 -0.1088 0.0305  -0.0122 78  PHE A CE1 
591  C  CE2 . PHE A 78  ? 0.6456 0.6750 0.6691 -0.0946 0.0276  -0.0165 78  PHE A CE2 
592  C  CZ  . PHE A 78  ? 0.5251 0.5467 0.5493 -0.1023 0.0272  -0.0163 78  PHE A CZ  
593  N  N   . SER A 79  ? 0.6268 0.6464 0.6361 -0.0935 0.0421  0.0015  79  SER A N   
594  C  CA  . SER A 79  ? 0.4931 0.4997 0.4928 -0.0873 0.0410  0.0019  79  SER A CA  
595  C  C   . SER A 79  ? 0.3994 0.4036 0.3986 -0.0820 0.0366  -0.0034 79  SER A C   
596  O  O   . SER A 79  ? 0.4327 0.4344 0.4271 -0.0751 0.0358  -0.0040 79  SER A O   
597  C  CB  . SER A 79  ? 0.4727 0.4627 0.4665 -0.0912 0.0414  0.0053  79  SER A CB  
598  O  OG  . SER A 79  ? 0.4427 0.4272 0.4402 -0.0978 0.0391  0.0030  79  SER A OG  
599  N  N   . GLY A 80  ? 0.3829 0.3885 0.3872 -0.0854 0.0338  -0.0073 80  GLY A N   
600  C  CA  . GLY A 80  ? 0.3570 0.3601 0.3601 -0.0808 0.0300  -0.0120 80  GLY A CA  
601  C  C   . GLY A 80  ? 0.3333 0.3470 0.3381 -0.0746 0.0296  -0.0135 80  GLY A C   
602  O  O   . GLY A 80  ? 0.4344 0.4447 0.4362 -0.0694 0.0274  -0.0159 80  GLY A O   
603  N  N   . SER A 81  ? 0.3389 0.3652 0.3485 -0.0749 0.0317  -0.0122 81  SER A N   
604  C  CA  . SER A 81  ? 0.3878 0.4224 0.3982 -0.0687 0.0313  -0.0135 81  SER A CA  
605  C  C   . SER A 81  ? 0.3946 0.4292 0.4005 -0.0647 0.0341  -0.0106 81  SER A C   
606  O  O   . SER A 81  ? 0.4218 0.4566 0.4251 -0.0588 0.0331  -0.0119 81  SER A O   
607  C  CB  . SER A 81  ? 0.4134 0.4625 0.4320 -0.0702 0.0312  -0.0147 81  SER A CB  
608  O  OG  . SER A 81  ? 0.4586 0.5141 0.4816 -0.0756 0.0342  -0.0121 81  SER A OG  
609  N  N   . GLU A 82  ? 0.4414 0.4756 0.4460 -0.0681 0.0376  -0.0067 82  GLU A N   
610  C  CA  . GLU A 82  ? 0.4293 0.4634 0.4284 -0.0643 0.0403  -0.0038 82  GLU A CA  
611  C  C   . GLU A 82  ? 0.4294 0.4511 0.4202 -0.0599 0.0385  -0.0037 82  GLU A C   
612  O  O   . GLU A 82  ? 0.4131 0.4356 0.3995 -0.0545 0.0388  -0.0035 82  GLU A O   
613  C  CB  . GLU A 82  ? 0.4657 0.5012 0.4645 -0.0697 0.0447  0.0009  82  GLU A CB  
614  C  CG  . GLU A 82  ? 0.7344 0.7809 0.7328 -0.0670 0.0486  0.0029  82  GLU A CG  
615  C  CD  . GLU A 82  ? 0.8593 0.9222 0.8674 -0.0686 0.0500  0.0015  82  GLU A CD  
616  O  OE1 . GLU A 82  ? 0.8211 0.8893 0.8350 -0.0756 0.0522  0.0035  82  GLU A OE1 
617  O  OE2 . GLU A 82  ? 0.9704 1.0408 0.9806 -0.0630 0.0488  -0.0017 82  GLU A OE2 
618  N  N   . MET A 83  ? 0.3545 0.3653 0.3434 -0.0616 0.0363  -0.0044 83  MET A N   
619  C  CA  . MET A 83  ? 0.4621 0.4620 0.4439 -0.0572 0.0346  -0.0042 83  MET A CA  
620  C  C   . MET A 83  ? 0.4129 0.4156 0.3945 -0.0509 0.0320  -0.0076 83  MET A C   
621  O  O   . MET A 83  ? 0.4872 0.4840 0.4636 -0.0466 0.0308  -0.0073 83  MET A O   
622  C  CB  . MET A 83  ? 0.5897 0.5778 0.5701 -0.0598 0.0327  -0.0049 83  MET A CB  
623  C  CG  . MET A 83  ? 0.6007 0.5918 0.5866 -0.0610 0.0301  -0.0095 83  MET A CG  
624  S  SD  . MET A 83  ? 0.5900 0.5673 0.5728 -0.0613 0.0272  -0.0120 83  MET A SD  
625  C  CE  . MET A 83  ? 0.6827 0.6550 0.6594 -0.0532 0.0262  -0.0116 83  MET A CE  
626  N  N   . TRP A 84  ? 0.3951 0.4067 0.3824 -0.0504 0.0310  -0.0106 84  TRP A N   
627  C  CA  . TRP A 84  ? 0.4137 0.4276 0.4011 -0.0452 0.0287  -0.0135 84  TRP A CA  
628  C  C   . TRP A 84  ? 0.3798 0.4019 0.3677 -0.0421 0.0297  -0.0136 84  TRP A C   
629  O  O   . TRP A 84  ? 0.2748 0.2980 0.2625 -0.0381 0.0277  -0.0158 84  TRP A O   
630  C  CB  . TRP A 84  ? 0.3851 0.4013 0.3772 -0.0461 0.0263  -0.0168 84  TRP A CB  
631  C  CG  . TRP A 84  ? 0.4247 0.4342 0.4167 -0.0495 0.0253  -0.0175 84  TRP A CG  
632  C  CD1 . TRP A 84  ? 0.4853 0.4959 0.4805 -0.0548 0.0257  -0.0176 84  TRP A CD1 
633  C  CD2 . TRP A 84  ? 0.4577 0.4585 0.4462 -0.0476 0.0237  -0.0187 84  TRP A CD2 
634  N  NE1 . TRP A 84  ? 0.5238 0.5256 0.5170 -0.0564 0.0242  -0.0190 84  TRP A NE1 
635  C  CE2 . TRP A 84  ? 0.5081 0.5038 0.4971 -0.0516 0.0231  -0.0197 84  TRP A CE2 
636  C  CE3 . TRP A 84  ? 0.2681 0.2653 0.2533 -0.0427 0.0224  -0.0192 84  TRP A CE3 
637  C  CZ2 . TRP A 84  ? 0.4989 0.4857 0.4848 -0.0504 0.0217  -0.0213 84  TRP A CZ2 
638  C  CZ3 . TRP A 84  ? 0.2282 0.2180 0.2112 -0.0415 0.0211  -0.0206 84  TRP A CZ3 
639  C  CH2 . TRP A 84  ? 0.4533 0.4376 0.4363 -0.0450 0.0208  -0.0217 84  TRP A CH2 
640  N  N   . ASN A 85  ? 0.3914 0.4192 0.3799 -0.0438 0.0329  -0.0114 85  ASN A N   
641  C  CA  . ASN A 85  ? 0.1967 0.2318 0.1846 -0.0401 0.0342  -0.0117 85  ASN A CA  
642  C  C   . ASN A 85  ? 0.2019 0.2323 0.1819 -0.0362 0.0346  -0.0105 85  ASN A C   
643  O  O   . ASN A 85  ? 0.4562 0.4791 0.4313 -0.0373 0.0350  -0.0078 85  ASN A O   
644  C  CB  . ASN A 85  ? 0.3736 0.4180 0.3652 -0.0431 0.0379  -0.0098 85  ASN A CB  
645  C  CG  . ASN A 85  ? 0.5293 0.5814 0.5293 -0.0456 0.0371  -0.0117 85  ASN A CG  
646  O  OD1 . ASN A 85  ? 0.6907 0.7444 0.6947 -0.0512 0.0380  -0.0104 85  ASN A OD1 
647  N  ND2 . ASN A 85  ? 0.4213 0.4781 0.4241 -0.0416 0.0351  -0.0147 85  ASN A ND2 
648  N  N   . PRO A 86  ? 0.2002 0.2346 0.1784 -0.0315 0.0342  -0.0124 86  PRO A N   
649  C  CA  . PRO A 86  ? 0.2786 0.3099 0.2489 -0.0278 0.0344  -0.0115 86  PRO A CA  
650  C  C   . PRO A 86  ? 0.3683 0.3995 0.3339 -0.0299 0.0384  -0.0070 86  PRO A C   
651  O  O   . PRO A 86  ? 0.4934 0.5314 0.4624 -0.0330 0.0419  -0.0053 86  PRO A O   
652  C  CB  . PRO A 86  ? 0.2039 0.2412 0.1742 -0.0232 0.0340  -0.0147 86  PRO A CB  
653  C  CG  . PRO A 86  ? 0.1960 0.2377 0.1742 -0.0240 0.0327  -0.0173 86  PRO A CG  
654  C  CD  . PRO A 86  ? 0.2774 0.3177 0.2605 -0.0291 0.0327  -0.0158 86  PRO A CD  
655  N  N   . ASN A 87  ? 0.4629 0.4867 0.4206 -0.0283 0.0378  -0.0047 87  ASN A N   
656  C  CA  . ASN A 87  ? 0.3782 0.4003 0.3297 -0.0300 0.0415  0.0004  87  ASN A CA  
657  C  C   . ASN A 87  ? 0.3714 0.3949 0.3138 -0.0250 0.0423  0.0010  87  ASN A C   
658  O  O   . ASN A 87  ? 0.5474 0.5692 0.4831 -0.0259 0.0454  0.0057  87  ASN A O   
659  C  CB  . ASN A 87  ? 0.2549 0.2657 0.2035 -0.0326 0.0405  0.0037  87  ASN A CB  
660  C  CG  . ASN A 87  ? 0.4151 0.4190 0.3610 -0.0283 0.0357  0.0013  87  ASN A CG  
661  O  OD1 . ASN A 87  ? 0.4608 0.4682 0.4092 -0.0249 0.0329  -0.0031 87  ASN A OD1 
662  N  ND2 . ASN A 87  ? 0.5016 0.4956 0.4426 -0.0283 0.0348  0.0043  87  ASN A ND2 
663  N  N   . ARG A 88  ? 0.3617 0.3878 0.3033 -0.0200 0.0395  -0.0035 88  ARG A N   
664  C  CA  . ARG A 88  ? 0.3839 0.4124 0.3170 -0.0150 0.0400  -0.0041 88  ARG A CA  
665  C  C   . ARG A 88  ? 0.4245 0.4615 0.3612 -0.0122 0.0403  -0.0088 88  ARG A C   
666  O  O   . ARG A 88  ? 0.4949 0.5356 0.4404 -0.0141 0.0402  -0.0109 88  ARG A O   
667  C  CB  . ARG A 88  ? 0.3386 0.3602 0.2655 -0.0109 0.0351  -0.0057 88  ARG A CB  
668  C  CG  . ARG A 88  ? 0.3536 0.3661 0.2774 -0.0123 0.0339  -0.0016 88  ARG A CG  
669  C  CD  . ARG A 88  ? 0.4825 0.4924 0.3958 -0.0118 0.0368  0.0040  88  ARG A CD  
670  N  NE  . ARG A 88  ? 0.6503 0.6503 0.5614 -0.0137 0.0360  0.0084  88  ARG A NE  
671  C  CZ  . ARG A 88  ? 0.7890 0.7854 0.7018 -0.0191 0.0395  0.0130  88  ARG A CZ  
672  N  NH1 . ARG A 88  ? 0.8613 0.8647 0.7787 -0.0236 0.0441  0.0141  88  ARG A NH1 
673  N  NH2 . ARG A 88  ? 0.7658 0.7515 0.6758 -0.0200 0.0381  0.0164  88  ARG A NH2 
674  N  N   . GLU A 89  ? 0.4067 0.4462 0.3359 -0.0072 0.0405  -0.0107 89  GLU A N   
675  C  CA  . GLU A 89  ? 0.4395 0.4852 0.3711 -0.0036 0.0402  -0.0158 89  GLU A CA  
676  C  C   . GLU A 89  ? 0.3682 0.4100 0.3061 -0.0030 0.0349  -0.0204 89  GLU A C   
677  O  O   . GLU A 89  ? 0.4851 0.5201 0.4232 -0.0039 0.0312  -0.0205 89  GLU A O   
678  C  CB  . GLU A 89  ? 0.6158 0.6631 0.5368 0.0021  0.0405  -0.0177 89  GLU A CB  
679  C  CG  . GLU A 89  ? 0.7834 0.8397 0.7047 0.0056  0.0438  -0.0207 89  GLU A CG  
680  C  CD  . GLU A 89  ? 0.9337 0.9905 0.8436 0.0118  0.0433  -0.0238 89  GLU A CD  
681  O  OE1 . GLU A 89  ? 0.9420 0.9971 0.8422 0.0124  0.0445  -0.0204 89  GLU A OE1 
682  O  OE2 . GLU A 89  ? 0.9528 1.0111 0.8629 0.0163  0.0414  -0.0298 89  GLU A OE2 
683  N  N   . MET A 90  ? 0.4108 0.4573 0.3540 -0.0013 0.0349  -0.0241 90  MET A N   
684  C  CA  . MET A 90  ? 0.3925 0.4354 0.3413 -0.0008 0.0304  -0.0281 90  MET A CA  
685  C  C   . MET A 90  ? 0.4117 0.4537 0.3563 0.0047  0.0279  -0.0334 90  MET A C   
686  O  O   . MET A 90  ? 0.4818 0.5292 0.4256 0.0080  0.0302  -0.0355 90  MET A O   
687  C  CB  . MET A 90  ? 0.3401 0.3874 0.2985 -0.0032 0.0315  -0.0280 90  MET A CB  
688  C  CG  . MET A 90  ? 0.4633 0.5095 0.4271 -0.0089 0.0321  -0.0244 90  MET A CG  
689  S  SD  . MET A 90  ? 0.4951 0.5470 0.4696 -0.0110 0.0324  -0.0251 90  MET A SD  
690  C  CE  . MET A 90  ? 0.2097 0.2706 0.1841 -0.0060 0.0351  -0.0275 90  MET A CE  
691  N  N   . SER A 91  ? 0.3443 0.3796 0.2864 0.0056  0.0230  -0.0360 91  SER A N   
692  C  CA  . SER A 91  ? 0.3847 0.4174 0.3233 0.0099  0.0196  -0.0415 91  SER A CA  
693  C  C   . SER A 91  ? 0.3935 0.4207 0.3383 0.0082  0.0148  -0.0441 91  SER A C   
694  O  O   . SER A 91  ? 0.3509 0.3762 0.3009 0.0042  0.0137  -0.0416 91  SER A O   
695  C  CB  . SER A 91  ? 0.2399 0.2704 0.1683 0.0128  0.0178  -0.0426 91  SER A CB  
696  O  OG  . SER A 91  ? 0.4039 0.4316 0.3287 0.0167  0.0141  -0.0487 91  SER A OG  
697  N  N   . GLU A 92  ? 0.3674 0.3918 0.3116 0.0113  0.0121  -0.0491 92  GLU A N   
698  C  CA  . GLU A 92  ? 0.3748 0.3928 0.3229 0.0095  0.0070  -0.0516 92  GLU A CA  
699  C  C   . GLU A 92  ? 0.3866 0.4019 0.3308 0.0087  0.0034  -0.0523 92  GLU A C   
700  O  O   . GLU A 92  ? 0.3770 0.3893 0.3261 0.0056  0.0001  -0.0523 92  GLU A O   
701  C  CB  . GLU A 92  ? 0.3697 0.3838 0.3173 0.0128  0.0047  -0.0568 92  GLU A CB  
702  C  CG  . GLU A 92  ? 0.4523 0.4673 0.4061 0.0131  0.0064  -0.0562 92  GLU A CG  
703  C  CD  . GLU A 92  ? 0.6534 0.6612 0.6073 0.0158  0.0028  -0.0611 92  GLU A CD  
704  O  OE1 . GLU A 92  ? 0.7679 0.7755 0.7165 0.0212  0.0033  -0.0651 92  GLU A OE1 
705  O  OE2 . GLU A 92  ? 0.5901 0.5920 0.5489 0.0125  -0.0005 -0.0611 92  GLU A OE2 
706  N  N   . ASP A 93  ? 0.4453 0.4622 0.3808 0.0119  0.0039  -0.0528 93  ASP A N   
707  C  CA  . ASP A 93  ? 0.5082 0.5239 0.4394 0.0118  0.0007  -0.0528 93  ASP A CA  
708  C  C   . ASP A 93  ? 0.5095 0.5270 0.4431 0.0088  0.0029  -0.0469 93  ASP A C   
709  O  O   . ASP A 93  ? 0.6008 0.6206 0.5287 0.0098  0.0063  -0.0434 93  ASP A O   
710  C  CB  . ASP A 93  ? 0.6099 0.6267 0.5297 0.0167  0.0006  -0.0551 93  ASP A CB  
711  C  CG  . ASP A 93  ? 0.6867 0.7031 0.6008 0.0173  -0.0027 -0.0545 93  ASP A CG  
712  O  OD1 . ASP A 93  ? 0.7322 0.7465 0.6511 0.0150  -0.0073 -0.0556 93  ASP A OD1 
713  O  OD2 . ASP A 93  ? 0.6979 0.7165 0.6025 0.0203  -0.0006 -0.0526 93  ASP A OD2 
714  N  N   . CYS A 94  ? 0.5011 0.5172 0.4428 0.0050  0.0014  -0.0456 94  CYS A N   
715  C  CA  . CYS A 94  ? 0.4710 0.4879 0.4156 0.0022  0.0038  -0.0406 94  CYS A CA  
716  C  C   . CYS A 94  ? 0.3968 0.4124 0.3460 0.0002  0.0003  -0.0402 94  CYS A C   
717  O  O   . CYS A 94  ? 0.2285 0.2440 0.1801 -0.0016 0.0020  -0.0366 94  CYS A O   
718  C  CB  . CYS A 94  ? 0.4601 0.4786 0.4111 -0.0005 0.0075  -0.0385 94  CYS A CB  
719  S  SG  . CYS A 94  ? 0.4740 0.4907 0.4347 -0.0034 0.0051  -0.0406 94  CYS A SG  
720  N  N   . LEU A 95  ? 0.4556 0.4704 0.4062 0.0005  -0.0044 -0.0441 95  LEU A N   
721  C  CA  . LEU A 95  ? 0.2152 0.2306 0.1718 -0.0016 -0.0075 -0.0439 95  LEU A CA  
722  C  C   . LEU A 95  ? 0.2204 0.2367 0.1719 0.0010  -0.0096 -0.0428 95  LEU A C   
723  O  O   . LEU A 95  ? 0.4325 0.4498 0.3820 0.0026  -0.0141 -0.0459 95  LEU A O   
724  C  CB  . LEU A 95  ? 0.2984 0.3130 0.2601 -0.0033 -0.0114 -0.0482 95  LEU A CB  
725  C  CG  . LEU A 95  ? 0.2898 0.3027 0.2571 -0.0060 -0.0092 -0.0480 95  LEU A CG  
726  C  CD1 . LEU A 95  ? 0.2839 0.2948 0.2566 -0.0085 -0.0129 -0.0512 95  LEU A CD1 
727  C  CD2 . LEU A 95  ? 0.2223 0.2368 0.1945 -0.0084 -0.0059 -0.0438 95  LEU A CD2 
728  N  N   . TYR A 96  ? 0.2794 0.2952 0.2290 0.0013  -0.0066 -0.0383 96  TYR A N   
729  C  CA  . TYR A 96  ? 0.2256 0.2411 0.1700 0.0041  -0.0081 -0.0361 96  TYR A CA  
730  C  C   . TYR A 96  ? 0.4195 0.4343 0.3692 0.0026  -0.0069 -0.0329 96  TYR A C   
731  O  O   . TYR A 96  ? 0.4824 0.4965 0.4376 -0.0005 -0.0039 -0.0319 96  TYR A O   
732  C  CB  . TYR A 96  ? 0.3818 0.3956 0.3157 0.0067  -0.0053 -0.0333 96  TYR A CB  
733  C  CG  . TYR A 96  ? 0.3810 0.3958 0.3086 0.0088  -0.0055 -0.0365 96  TYR A CG  
734  C  CD1 . TYR A 96  ? 0.2777 0.2931 0.1964 0.0128  -0.0087 -0.0381 96  TYR A CD1 
735  C  CD2 . TYR A 96  ? 0.2823 0.2977 0.2125 0.0073  -0.0027 -0.0382 96  TYR A CD2 
736  C  CE1 . TYR A 96  ? 0.2586 0.2747 0.1707 0.0152  -0.0089 -0.0416 96  TYR A CE1 
737  C  CE2 . TYR A 96  ? 0.2870 0.3031 0.2113 0.0100  -0.0029 -0.0417 96  TYR A CE2 
738  C  CZ  . TYR A 96  ? 0.4019 0.4182 0.3169 0.0139  -0.0059 -0.0435 96  TYR A CZ  
739  O  OH  . TYR A 96  ? 0.5096 0.5265 0.4177 0.0170  -0.0061 -0.0475 96  TYR A OH  
740  N  N   . LEU A 97  ? 0.3115 0.3263 0.2590 0.0054  -0.0094 -0.0316 97  LEU A N   
741  C  CA  . LEU A 97  ? 0.2881 0.3013 0.2393 0.0052  -0.0084 -0.0289 97  LEU A CA  
742  C  C   . LEU A 97  ? 0.3145 0.3232 0.2572 0.0089  -0.0082 -0.0248 97  LEU A C   
743  O  O   . LEU A 97  ? 0.4088 0.4169 0.3429 0.0117  -0.0093 -0.0241 97  LEU A O   
744  C  CB  . LEU A 97  ? 0.2178 0.2359 0.1776 0.0051  -0.0120 -0.0315 97  LEU A CB  
745  C  CG  . LEU A 97  ? 0.3866 0.4096 0.3463 0.0080  -0.0176 -0.0343 97  LEU A CG  
746  C  CD1 . LEU A 97  ? 0.4618 0.4838 0.4169 0.0129  -0.0195 -0.0316 97  LEU A CD1 
747  C  CD2 . LEU A 97  ? 0.2737 0.3033 0.2443 0.0052  -0.0202 -0.0378 97  LEU A CD2 
748  N  N   . ASN A 98  ? 0.2322 0.2372 0.1766 0.0089  -0.0067 -0.0220 98  ASN A N   
749  C  CA  . ASN A 98  ? 0.4126 0.4115 0.3491 0.0122  -0.0064 -0.0175 98  ASN A CA  
750  C  C   . ASN A 98  ? 0.3522 0.3503 0.2927 0.0150  -0.0087 -0.0174 98  ASN A C   
751  O  O   . ASN A 98  ? 0.4807 0.4805 0.4295 0.0129  -0.0078 -0.0191 98  ASN A O   
752  C  CB  . ASN A 98  ? 0.4338 0.4258 0.3665 0.0092  -0.0012 -0.0134 98  ASN A CB  
753  C  CG  . ASN A 98  ? 0.3618 0.3565 0.2954 0.0053  0.0021  -0.0144 98  ASN A CG  
754  O  OD1 . ASN A 98  ? 0.4164 0.4126 0.3572 0.0015  0.0041  -0.0159 98  ASN A OD1 
755  N  ND2 . ASN A 98  ? 0.2569 0.2526 0.1829 0.0067  0.0027  -0.0136 98  ASN A ND2 
756  N  N   . ILE A 99  ? 0.3251 0.3205 0.2591 0.0202  -0.0115 -0.0150 99  ILE A N   
757  C  CA  . ILE A 99  ? 0.2905 0.2856 0.2276 0.0244  -0.0142 -0.0149 99  ILE A CA  
758  C  C   . ILE A 99  ? 0.2729 0.2570 0.2009 0.0275  -0.0131 -0.0094 99  ILE A C   
759  O  O   . ILE A 99  ? 0.3136 0.2940 0.2316 0.0295  -0.0135 -0.0061 99  ILE A O   
760  C  CB  . ILE A 99  ? 0.3501 0.3536 0.2890 0.0287  -0.0201 -0.0177 99  ILE A CB  
761  C  CG1 . ILE A 99  ? 0.3018 0.3136 0.2451 0.0252  -0.0214 -0.0222 99  ILE A CG1 
762  C  CG2 . ILE A 99  ? 0.4450 0.4524 0.3921 0.0319  -0.0224 -0.0192 99  ILE A CG2 
763  C  CD1 . ILE A 99  ? 0.3592 0.3801 0.3053 0.0283  -0.0276 -0.0257 99  ILE A CD1 
764  N  N   . TRP A 100 ? 0.3597 0.3382 0.2908 0.0280  -0.0118 -0.0085 100 TRP A N   
765  C  CA  . TRP A 100 ? 0.4301 0.3976 0.3535 0.0323  -0.0122 -0.0039 100 TRP A CA  
766  C  C   . TRP A 100 ? 0.5795 0.5505 0.5062 0.0394  -0.0169 -0.0055 100 TRP A C   
767  O  O   . TRP A 100 ? 0.6207 0.5989 0.5576 0.0393  -0.0176 -0.0097 100 TRP A O   
768  C  CB  . TRP A 100 ? 0.3271 0.2842 0.2506 0.0286  -0.0079 -0.0020 100 TRP A CB  
769  C  CG  . TRP A 100 ? 0.3303 0.2841 0.2502 0.0223  -0.0035 0.0004  100 TRP A CG  
770  C  CD1 . TRP A 100 ? 0.4236 0.3677 0.3340 0.0211  -0.0011 0.0061  100 TRP A CD1 
771  C  CD2 . TRP A 100 ? 0.3007 0.2616 0.2267 0.0163  -0.0008 -0.0025 100 TRP A CD2 
772  N  NE1 . TRP A 100 ? 0.4770 0.4230 0.3879 0.0146  0.0031  0.0066  100 TRP A NE1 
773  C  CE2 . TRP A 100 ? 0.4621 0.4181 0.3824 0.0119  0.0031  0.0012  100 TRP A CE2 
774  C  CE3 . TRP A 100 ? 0.3994 0.3702 0.3350 0.0142  -0.0013 -0.0077 100 TRP A CE3 
775  C  CZ2 . TRP A 100 ? 0.5316 0.4931 0.4560 0.0063  0.0063  -0.0004 100 TRP A CZ2 
776  C  CZ3 . TRP A 100 ? 0.5550 0.5296 0.4937 0.0086  0.0017  -0.0090 100 TRP A CZ3 
777  C  CH2 . TRP A 100 ? 0.4883 0.4586 0.4217 0.0050  0.0053  -0.0056 100 TRP A CH2 
778  N  N   . VAL A 101 ? 0.5553 0.5221 0.4737 0.0455  -0.0202 -0.0021 101 VAL A N   
779  C  CA  . VAL A 101 ? 0.4372 0.4074 0.3581 0.0532  -0.0251 -0.0032 101 VAL A CA  
780  C  C   . VAL A 101 ? 0.3670 0.3221 0.2798 0.0580  -0.0248 0.0019  101 VAL A C   
781  O  O   . VAL A 101 ? 0.4928 0.4376 0.3942 0.0575  -0.0235 0.0074  101 VAL A O   
782  C  CB  . VAL A 101 ? 0.4639 0.4435 0.3823 0.0576  -0.0305 -0.0040 101 VAL A CB  
783  C  CG1 . VAL A 101 ? 0.3112 0.2958 0.2336 0.0658  -0.0358 -0.0052 101 VAL A CG1 
784  C  CG2 . VAL A 101 ? 0.4855 0.4781 0.4114 0.0525  -0.0310 -0.0092 101 VAL A CG2 
785  N  N   . PRO A 102 ? 0.3909 0.3439 0.3087 0.0624  -0.0258 0.0004  102 PRO A N   
786  C  CA  . PRO A 102 ? 0.4408 0.3785 0.3502 0.0683  -0.0267 0.0051  102 PRO A CA  
787  C  C   . PRO A 102 ? 0.4110 0.3484 0.3115 0.0753  -0.0315 0.0089  102 PRO A C   
788  O  O   . PRO A 102 ? 0.3621 0.3136 0.2664 0.0782  -0.0357 0.0060  102 PRO A O   
789  C  CB  . PRO A 102 ? 0.3369 0.2770 0.2553 0.0731  -0.0277 0.0010  102 PRO A CB  
790  C  CG  . PRO A 102 ? 0.4160 0.3741 0.3473 0.0699  -0.0277 -0.0053 102 PRO A CG  
791  C  CD  . PRO A 102 ? 0.3725 0.3352 0.3033 0.0615  -0.0253 -0.0054 102 PRO A CD  
792  N  N   . SER A 103 ? 0.4392 0.3605 0.3275 0.0776  -0.0311 0.0155  103 SER A N   
793  C  CA  . SER A 103 ? 0.6126 0.5315 0.4907 0.0852  -0.0358 0.0200  103 SER A CA  
794  C  C   . SER A 103 ? 0.6789 0.5860 0.5545 0.0938  -0.0383 0.0222  103 SER A C   
795  O  O   . SER A 103 ? 0.7406 0.6322 0.6135 0.0918  -0.0349 0.0245  103 SER A O   
796  C  CB  . SER A 103 ? 0.6852 0.5949 0.5494 0.0815  -0.0333 0.0267  103 SER A CB  
797  O  OG  . SER A 103 ? 0.6742 0.5873 0.5292 0.0880  -0.0382 0.0297  103 SER A OG  
798  N  N   . PRO A 104 ? 0.7002 0.6147 0.5768 0.1035  -0.0445 0.0213  104 PRO A N   
799  C  CA  . PRO A 104 ? 0.6940 0.6263 0.5732 0.1063  -0.0496 0.0186  104 PRO A CA  
800  C  C   . PRO A 104 ? 0.6724 0.6243 0.5677 0.1017  -0.0493 0.0104  104 PRO A C   
801  O  O   . PRO A 104 ? 0.7760 0.7288 0.6811 0.0995  -0.0463 0.0067  104 PRO A O   
802  C  CB  . PRO A 104 ? 0.6182 0.5503 0.4951 0.1186  -0.0561 0.0202  104 PRO A CB  
803  C  CG  . PRO A 104 ? 0.5809 0.4994 0.4592 0.1222  -0.0543 0.0209  104 PRO A CG  
804  C  CD  . PRO A 104 ? 0.6081 0.5117 0.4824 0.1130  -0.0473 0.0232  104 PRO A CD  
805  N  N   . ARG A 105 ? 0.5376 0.5040 0.4350 0.1001  -0.0522 0.0077  105 ARG A N   
806  C  CA  . ARG A 105 ? 0.4888 0.4726 0.4009 0.0952  -0.0521 0.0005  105 ARG A CA  
807  C  C   . ARG A 105 ? 0.5430 0.5372 0.4677 0.1011  -0.0550 -0.0037 105 ARG A C   
808  O  O   . ARG A 105 ? 0.6803 0.6810 0.6051 0.1096  -0.0610 -0.0037 105 ARG A O   
809  C  CB  . ARG A 105 ? 0.3786 0.3748 0.2896 0.0935  -0.0559 -0.0017 105 ARG A CB  
810  C  CG  . ARG A 105 ? 0.3771 0.3917 0.3034 0.0895  -0.0574 -0.0090 105 ARG A CG  
811  C  CD  . ARG A 105 ? 0.6345 0.6537 0.5598 0.0815  -0.0561 -0.0113 105 ARG A CD  
812  N  NE  . ARG A 105 ? 0.8025 0.8173 0.7135 0.0831  -0.0583 -0.0081 105 ARG A NE  
813  C  CZ  . ARG A 105 ? 0.8331 0.8581 0.7426 0.0852  -0.0643 -0.0108 105 ARG A CZ  
814  N  NH1 . ARG A 105 ? 0.8555 0.8962 0.7777 0.0855  -0.0689 -0.0165 105 ARG A NH1 
815  N  NH2 . ARG A 105 ? 0.8462 0.8663 0.7413 0.0867  -0.0656 -0.0077 105 ARG A NH2 
816  N  N   . PRO A 106 ? 0.5062 0.5028 0.4414 0.0975  -0.0509 -0.0074 106 PRO A N   
817  C  CA  . PRO A 106 ? 0.5668 0.5760 0.5149 0.1028  -0.0531 -0.0119 106 PRO A CA  
818  C  C   . PRO A 106 ? 0.5686 0.5993 0.5280 0.1005  -0.0566 -0.0168 106 PRO A C   
819  O  O   . PRO A 106 ? 0.5579 0.5926 0.5158 0.0940  -0.0568 -0.0176 106 PRO A O   
820  C  CB  . PRO A 106 ? 0.4655 0.4700 0.4195 0.0982  -0.0469 -0.0140 106 PRO A CB  
821  C  CG  . PRO A 106 ? 0.4089 0.4086 0.3593 0.0876  -0.0424 -0.0132 106 PRO A CG  
822  C  CD  . PRO A 106 ? 0.4468 0.4361 0.3829 0.0883  -0.0441 -0.0078 106 PRO A CD  
823  N  N   . LYS A 107 ? 0.5934 0.6383 0.5644 0.1060  -0.0596 -0.0204 107 LYS A N   
824  C  CA  . LYS A 107 ? 0.6900 0.7565 0.6742 0.1031  -0.0626 -0.0255 107 LYS A CA  
825  C  C   . LYS A 107 ? 0.8049 0.8798 0.8024 0.0974  -0.0575 -0.0296 107 LYS A C   
826  O  O   . LYS A 107 ? 0.9340 1.0080 0.9358 0.1020  -0.0552 -0.0303 107 LYS A O   
827  C  CB  . LYS A 107 ? 0.6803 0.7599 0.6695 0.1129  -0.0698 -0.0266 107 LYS A CB  
828  C  CG  . LYS A 107 ? 0.6477 0.7214 0.6361 0.1235  -0.0701 -0.0250 107 LYS A CG  
829  C  CD  . LYS A 107 ? 0.6916 0.7831 0.6894 0.1329  -0.0768 -0.0273 107 LYS A CD  
830  C  CE  . LYS A 107 ? 0.7632 0.8516 0.7500 0.1397  -0.0840 -0.0238 107 LYS A CE  
831  N  NZ  . LYS A 107 ? 0.7563 0.8609 0.7514 0.1504  -0.0909 -0.0256 107 LYS A NZ  
832  N  N   . SER A 108 ? 0.6459 0.7282 0.6491 0.0877  -0.0557 -0.0322 108 SER A N   
833  C  CA  . SER A 108 ? 0.6139 0.7057 0.6296 0.0817  -0.0512 -0.0358 108 SER A CA  
834  C  C   . SER A 108 ? 0.6202 0.7000 0.6333 0.0820  -0.0450 -0.0347 108 SER A C   
835  O  O   . SER A 108 ? 0.6433 0.7277 0.6626 0.0876  -0.0440 -0.0363 108 SER A O   
836  C  CB  . SER A 108 ? 0.6696 0.7825 0.7002 0.0855  -0.0545 -0.0395 108 SER A CB  
837  O  OG  . SER A 108 ? 0.7466 0.8710 0.7896 0.0783  -0.0505 -0.0427 108 SER A OG  
838  N  N   . THR A 109 ? 0.5556 0.6205 0.5599 0.0761  -0.0409 -0.0325 109 THR A N   
839  C  CA  . THR A 109 ? 0.4529 0.5064 0.4547 0.0753  -0.0354 -0.0319 109 THR A CA  
840  C  C   . THR A 109 ? 0.4018 0.4570 0.4076 0.0653  -0.0304 -0.0336 109 THR A C   
841  O  O   . THR A 109 ? 0.4451 0.5070 0.4538 0.0589  -0.0311 -0.0344 109 THR A O   
842  C  CB  . THR A 109 ? 0.4982 0.5308 0.4854 0.0779  -0.0347 -0.0273 109 THR A CB  
843  O  OG1 . THR A 109 ? 0.5468 0.5691 0.5326 0.0792  -0.0307 -0.0275 109 THR A OG1 
844  C  CG2 . THR A 109 ? 0.4855 0.5102 0.4650 0.0698  -0.0329 -0.0249 109 THR A CG2 
845  N  N   . THR A 110 ? 0.3854 0.4340 0.3912 0.0642  -0.0257 -0.0341 110 THR A N   
846  C  CA  . THR A 110 ? 0.3878 0.4376 0.3969 0.0556  -0.0211 -0.0355 110 THR A CA  
847  C  C   . THR A 110 ? 0.3960 0.4370 0.3977 0.0487  -0.0202 -0.0331 110 THR A C   
848  O  O   . THR A 110 ? 0.4150 0.4444 0.4067 0.0504  -0.0214 -0.0299 110 THR A O   
849  C  CB  . THR A 110 ? 0.4075 0.4492 0.4150 0.0568  -0.0168 -0.0364 110 THR A CB  
850  O  OG1 . THR A 110 ? 0.4465 0.4943 0.4588 0.0654  -0.0181 -0.0384 110 THR A OG1 
851  C  CG2 . THR A 110 ? 0.3633 0.4103 0.3762 0.0492  -0.0124 -0.0384 110 THR A CG2 
852  N  N   . VAL A 111 ? 0.4138 0.4605 0.4203 0.0410  -0.0179 -0.0345 111 VAL A N   
853  C  CA  . VAL A 111 ? 0.4215 0.4616 0.4222 0.0347  -0.0169 -0.0329 111 VAL A CA  
854  C  C   . VAL A 111 ? 0.3749 0.4116 0.3767 0.0284  -0.0121 -0.0333 111 VAL A C   
855  O  O   . VAL A 111 ? 0.3289 0.3747 0.3389 0.0258  -0.0103 -0.0357 111 VAL A O   
856  C  CB  . VAL A 111 ? 0.2183 0.2685 0.2231 0.0318  -0.0202 -0.0342 111 VAL A CB  
857  C  CG1 . VAL A 111 ? 0.2166 0.2598 0.2151 0.0264  -0.0191 -0.0329 111 VAL A CG1 
858  C  CG2 . VAL A 111 ? 0.2522 0.3064 0.2557 0.0381  -0.0255 -0.0340 111 VAL A CG2 
859  N  N   . MET A 112 ? 0.2629 0.2872 0.2564 0.0259  -0.0099 -0.0310 112 MET A N   
860  C  CA  . MET A 112 ? 0.3304 0.3512 0.3241 0.0199  -0.0058 -0.0312 112 MET A CA  
861  C  C   . MET A 112 ? 0.3135 0.3323 0.3039 0.0147  -0.0055 -0.0299 112 MET A C   
862  O  O   . MET A 112 ? 0.2165 0.2273 0.1991 0.0152  -0.0058 -0.0273 112 MET A O   
863  C  CB  . MET A 112 ? 0.3737 0.3824 0.3617 0.0212  -0.0035 -0.0301 112 MET A CB  
864  C  CG  . MET A 112 ? 0.4962 0.5064 0.4872 0.0269  -0.0036 -0.0321 112 MET A CG  
865  S  SD  . MET A 112 ? 0.5205 0.5143 0.5040 0.0297  -0.0019 -0.0314 112 MET A SD  
866  C  CE  . MET A 112 ? 0.4041 0.3983 0.3899 0.0230  0.0023  -0.0337 112 MET A CE  
867  N  N   . VAL A 113 ? 0.2946 0.3207 0.2907 0.0099  -0.0048 -0.0316 113 VAL A N   
868  C  CA  . VAL A 113 ? 0.3055 0.3302 0.2994 0.0053  -0.0043 -0.0310 113 VAL A CA  
869  C  C   . VAL A 113 ? 0.2863 0.3057 0.2788 0.0011  -0.0004 -0.0303 113 VAL A C   
870  O  O   . VAL A 113 ? 0.2327 0.2558 0.2302 -0.0011 0.0013  -0.0317 113 VAL A O   
871  C  CB  . VAL A 113 ? 0.3066 0.3408 0.3071 0.0026  -0.0062 -0.0332 113 VAL A CB  
872  C  CG1 . VAL A 113 ? 0.1892 0.2208 0.1875 -0.0019 -0.0053 -0.0330 113 VAL A CG1 
873  C  CG2 . VAL A 113 ? 0.3030 0.3426 0.3045 0.0062  -0.0107 -0.0342 113 VAL A CG2 
874  N  N   . TRP A 114 ? 0.2988 0.3104 0.2847 -0.0002 0.0009  -0.0282 114 TRP A N   
875  C  CA  . TRP A 114 ? 0.2839 0.2916 0.2689 -0.0044 0.0041  -0.0276 114 TRP A CA  
876  C  C   . TRP A 114 ? 0.2597 0.2716 0.2470 -0.0083 0.0045  -0.0282 114 TRP A C   
877  O  O   . TRP A 114 ? 0.2658 0.2793 0.2515 -0.0078 0.0028  -0.0282 114 TRP A O   
878  C  CB  . TRP A 114 ? 0.3510 0.3494 0.3290 -0.0045 0.0055  -0.0248 114 TRP A CB  
879  C  CG  . TRP A 114 ? 0.4859 0.4818 0.4638 -0.0093 0.0084  -0.0243 114 TRP A CG  
880  C  CD1 . TRP A 114 ? 0.5293 0.5245 0.5048 -0.0122 0.0099  -0.0228 114 TRP A CD1 
881  C  CD2 . TRP A 114 ? 0.4229 0.4173 0.4031 -0.0114 0.0101  -0.0255 114 TRP A CD2 
882  N  NE1 . TRP A 114 ? 0.5002 0.4942 0.4772 -0.0161 0.0121  -0.0229 114 TRP A NE1 
883  C  CE2 . TRP A 114 ? 0.4584 0.4515 0.4379 -0.0158 0.0120  -0.0246 114 TRP A CE2 
884  C  CE3 . TRP A 114 ? 0.4213 0.4160 0.4039 -0.0098 0.0100  -0.0275 114 TRP A CE3 
885  C  CZ2 . TRP A 114 ? 0.5281 0.5201 0.5092 -0.0188 0.0134  -0.0257 114 TRP A CZ2 
886  C  CZ3 . TRP A 114 ? 0.4866 0.4795 0.4700 -0.0126 0.0117  -0.0288 114 TRP A CZ3 
887  C  CH2 . TRP A 114 ? 0.4914 0.4828 0.4739 -0.0172 0.0132  -0.0279 114 TRP A CH2 
888  N  N   . ILE A 115 ? 0.2771 0.2902 0.2674 -0.0117 0.0065  -0.0289 115 ILE A N   
889  C  CA  . ILE A 115 ? 0.3746 0.3906 0.3669 -0.0150 0.0069  -0.0293 115 ILE A CA  
890  C  C   . ILE A 115 ? 0.4561 0.4688 0.4467 -0.0178 0.0094  -0.0282 115 ILE A C   
891  O  O   . ILE A 115 ? 0.4125 0.4250 0.4048 -0.0192 0.0107  -0.0287 115 ILE A O   
892  C  CB  . ILE A 115 ? 0.3573 0.3796 0.3559 -0.0165 0.0063  -0.0309 115 ILE A CB  
893  C  CG1 . ILE A 115 ? 0.1755 0.2024 0.1769 -0.0144 0.0035  -0.0321 115 ILE A CG1 
894  C  CG2 . ILE A 115 ? 0.4006 0.4240 0.4006 -0.0196 0.0067  -0.0309 115 ILE A CG2 
895  C  CD1 . ILE A 115 ? 0.2245 0.2578 0.2324 -0.0168 0.0031  -0.0332 115 ILE A CD1 
896  N  N   . TYR A 116 ? 0.4354 0.4462 0.4228 -0.0186 0.0101  -0.0270 116 TYR A N   
897  C  CA  . TYR A 116 ? 0.3748 0.3840 0.3616 -0.0215 0.0124  -0.0261 116 TYR A CA  
898  C  C   . TYR A 116 ? 0.4056 0.4191 0.3967 -0.0238 0.0126  -0.0272 116 TYR A C   
899  O  O   . TYR A 116 ? 0.4016 0.4182 0.3951 -0.0235 0.0113  -0.0282 116 TYR A O   
900  C  CB  . TYR A 116 ? 0.2717 0.2796 0.2547 -0.0216 0.0135  -0.0244 116 TYR A CB  
901  C  CG  . TYR A 116 ? 0.2167 0.2281 0.1995 -0.0206 0.0127  -0.0253 116 TYR A CG  
902  C  CD1 . TYR A 116 ? 0.1776 0.1924 0.1637 -0.0221 0.0130  -0.0263 116 TYR A CD1 
903  C  CD2 . TYR A 116 ? 0.2330 0.2439 0.2119 -0.0178 0.0114  -0.0252 116 TYR A CD2 
904  C  CE1 . TYR A 116 ? 0.2346 0.2513 0.2203 -0.0208 0.0121  -0.0275 116 TYR A CE1 
905  C  CE2 . TYR A 116 ? 0.2974 0.3107 0.2755 -0.0166 0.0104  -0.0267 116 TYR A CE2 
906  C  CZ  . TYR A 116 ? 0.3675 0.3833 0.3492 -0.0181 0.0108  -0.0280 116 TYR A CZ  
907  O  OH  . TYR A 116 ? 0.4330 0.4500 0.4136 -0.0165 0.0096  -0.0299 116 TYR A OH  
908  N  N   . GLY A 117 ? 0.3214 0.3345 0.3131 -0.0263 0.0140  -0.0269 117 GLY A N   
909  C  CA  . GLY A 117 ? 0.2322 0.2489 0.2269 -0.0282 0.0142  -0.0274 117 GLY A CA  
910  C  C   . GLY A 117 ? 0.3597 0.3778 0.3542 -0.0296 0.0153  -0.0265 117 GLY A C   
911  O  O   . GLY A 117 ? 0.4225 0.4399 0.4148 -0.0288 0.0160  -0.0256 117 GLY A O   
912  N  N   . GLY A 118 ? 0.4730 0.4939 0.4698 -0.0314 0.0154  -0.0267 118 GLY A N   
913  C  CA  . GLY A 118 ? 0.4221 0.4462 0.4200 -0.0323 0.0162  -0.0261 118 GLY A CA  
914  C  C   . GLY A 118 ? 0.3604 0.3880 0.3607 -0.0316 0.0151  -0.0264 118 GLY A C   
915  O  O   . GLY A 118 ? 0.3044 0.3344 0.3055 -0.0303 0.0152  -0.0263 118 GLY A O   
916  N  N   . GLY A 119 ? 0.2765 0.3040 0.2776 -0.0322 0.0142  -0.0268 119 GLY A N   
917  C  CA  . GLY A 119 ? 0.1611 0.1908 0.1638 -0.0319 0.0131  -0.0265 119 GLY A CA  
918  C  C   . GLY A 119 ? 0.1614 0.1897 0.1644 -0.0299 0.0120  -0.0265 119 GLY A C   
919  O  O   . GLY A 119 ? 0.2179 0.2470 0.2219 -0.0293 0.0110  -0.0259 119 GLY A O   
920  N  N   . PHE A 120 ? 0.2898 0.3158 0.2918 -0.0289 0.0118  -0.0271 120 PHE A N   
921  C  CA  . PHE A 120 ? 0.2652 0.2892 0.2670 -0.0270 0.0104  -0.0279 120 PHE A CA  
922  C  C   . PHE A 120 ? 0.2848 0.3097 0.2859 -0.0248 0.0106  -0.0284 120 PHE A C   
923  O  O   . PHE A 120 ? 0.2344 0.2570 0.2349 -0.0229 0.0093  -0.0295 120 PHE A O   
924  C  CB  . PHE A 120 ? 0.2523 0.2749 0.2558 -0.0279 0.0089  -0.0274 120 PHE A CB  
925  C  CG  . PHE A 120 ? 0.3900 0.4131 0.3946 -0.0298 0.0091  -0.0271 120 PHE A CG  
926  C  CD1 . PHE A 120 ? 0.2418 0.2642 0.2471 -0.0296 0.0081  -0.0281 120 PHE A CD1 
927  C  CD2 . PHE A 120 ? 0.4227 0.4479 0.4276 -0.0313 0.0101  -0.0261 120 PHE A CD2 
928  C  CE1 . PHE A 120 ? 0.3027 0.3271 0.3099 -0.0310 0.0084  -0.0279 120 PHE A CE1 
929  C  CE2 . PHE A 120 ? 0.3489 0.3755 0.3548 -0.0325 0.0106  -0.0260 120 PHE A CE2 
930  C  CZ  . PHE A 120 ? 0.1616 0.1882 0.1691 -0.0322 0.0099  -0.0269 120 PHE A CZ  
931  N  N   . TYR A 121 ? 0.2712 0.2995 0.2725 -0.0251 0.0123  -0.0278 121 TYR A N   
932  C  CA  . TYR A 121 ? 0.2627 0.2938 0.2641 -0.0228 0.0130  -0.0282 121 TYR A CA  
933  C  C   . TYR A 121 ? 0.2954 0.3283 0.2947 -0.0226 0.0152  -0.0280 121 TYR A C   
934  O  O   . TYR A 121 ? 0.3435 0.3797 0.3425 -0.0205 0.0164  -0.0284 121 TYR A O   
935  C  CB  . TYR A 121 ? 0.3423 0.3781 0.3468 -0.0231 0.0131  -0.0275 121 TYR A CB  
936  C  CG  . TYR A 121 ? 0.3413 0.3814 0.3473 -0.0261 0.0147  -0.0265 121 TYR A CG  
937  C  CD1 . TYR A 121 ? 0.2118 0.2564 0.2186 -0.0263 0.0168  -0.0262 121 TYR A CD1 
938  C  CD2 . TYR A 121 ? 0.3356 0.3753 0.3424 -0.0289 0.0140  -0.0260 121 TYR A CD2 
939  C  CE1 . TYR A 121 ? 0.2534 0.3013 0.2620 -0.0298 0.0180  -0.0254 121 TYR A CE1 
940  C  CE2 . TYR A 121 ? 0.4122 0.4549 0.4202 -0.0318 0.0149  -0.0258 121 TYR A CE2 
941  C  CZ  . TYR A 121 ? 0.4450 0.4914 0.4542 -0.0326 0.0168  -0.0254 121 TYR A CZ  
942  O  OH  . TYR A 121 ? 0.5128 0.5618 0.5237 -0.0364 0.0177  -0.0251 121 TYR A OH  
943  N  N   . SER A 122 ? 0.1834 0.2139 0.1809 -0.0245 0.0158  -0.0273 122 SER A N   
944  C  CA  . SER A 122 ? 0.2844 0.3156 0.2794 -0.0249 0.0180  -0.0262 122 SER A CA  
945  C  C   . SER A 122 ? 0.3364 0.3628 0.3289 -0.0259 0.0177  -0.0256 122 SER A C   
946  O  O   . SER A 122 ? 0.3476 0.3717 0.3412 -0.0266 0.0162  -0.0261 122 SER A O   
947  C  CB  . SER A 122 ? 0.1703 0.2064 0.1681 -0.0275 0.0201  -0.0249 122 SER A CB  
948  O  OG  . SER A 122 ? 0.3012 0.3352 0.3000 -0.0308 0.0199  -0.0243 122 SER A OG  
949  N  N   . GLY A 123 ? 0.2999 0.3249 0.2886 -0.0256 0.0192  -0.0242 123 GLY A N   
950  C  CA  . GLY A 123 ? 0.2638 0.2837 0.2497 -0.0260 0.0189  -0.0233 123 GLY A CA  
951  C  C   . GLY A 123 ? 0.2413 0.2595 0.2220 -0.0230 0.0186  -0.0230 123 GLY A C   
952  O  O   . GLY A 123 ? 0.2655 0.2855 0.2451 -0.0205 0.0176  -0.0246 123 GLY A O   
953  N  N   . SER A 124 ? 0.2140 0.2279 0.1907 -0.0230 0.0192  -0.0209 124 SER A N   
954  C  CA  . SER A 124 ? 0.3384 0.3506 0.3089 -0.0201 0.0190  -0.0199 124 SER A CA  
955  C  C   . SER A 124 ? 0.5345 0.5415 0.5024 -0.0185 0.0170  -0.0193 124 SER A C   
956  O  O   . SER A 124 ? 0.5937 0.5972 0.5633 -0.0200 0.0171  -0.0186 124 SER A O   
957  C  CB  . SER A 124 ? 0.3684 0.3811 0.3353 -0.0214 0.0225  -0.0169 124 SER A CB  
958  O  OG  . SER A 124 ? 0.5497 0.5688 0.5187 -0.0215 0.0242  -0.0178 124 SER A OG  
959  N  N   . SER A 125 ? 0.5512 0.5578 0.5148 -0.0150 0.0150  -0.0199 125 SER A N   
960  C  CA  . SER A 125 ? 0.5161 0.5185 0.4769 -0.0127 0.0130  -0.0189 125 SER A CA  
961  C  C   . SER A 125 ? 0.4580 0.4548 0.4124 -0.0127 0.0150  -0.0147 125 SER A C   
962  O  O   . SER A 125 ? 0.3484 0.3403 0.3003 -0.0106 0.0135  -0.0134 125 SER A O   
963  C  CB  . SER A 125 ? 0.4746 0.4792 0.4331 -0.0089 0.0095  -0.0210 125 SER A CB  
964  O  OG  . SER A 125 ? 0.4465 0.4484 0.3968 -0.0062 0.0095  -0.0186 125 SER A OG  
965  N  N   . THR A 126 ? 0.3452 0.3428 0.2973 -0.0149 0.0184  -0.0124 126 THR A N   
966  C  CA  . THR A 126 ? 0.3785 0.3713 0.3230 -0.0146 0.0204  -0.0080 126 THR A CA  
967  C  C   . THR A 126 ? 0.3889 0.3777 0.3345 -0.0194 0.0237  -0.0048 126 THR A C   
968  O  O   . THR A 126 ? 0.4874 0.4725 0.4272 -0.0205 0.0262  -0.0004 126 THR A O   
969  C  CB  . THR A 126 ? 0.3599 0.3572 0.2988 -0.0128 0.0219  -0.0073 126 THR A CB  
970  O  OG1 . THR A 126 ? 0.2908 0.2947 0.2341 -0.0154 0.0247  -0.0085 126 THR A OG1 
971  C  CG2 . THR A 126 ? 0.3277 0.3276 0.2643 -0.0081 0.0180  -0.0108 126 THR A CG2 
972  N  N   . LEU A 127 ? 0.3592 0.3483 0.3119 -0.0226 0.0236  -0.0067 127 LEU A N   
973  C  CA  . LEU A 127 ? 0.3236 0.3091 0.2781 -0.0277 0.0261  -0.0046 127 LEU A CA  
974  C  C   . LEU A 127 ? 0.4244 0.3986 0.3740 -0.0274 0.0256  -0.0016 127 LEU A C   
975  O  O   . LEU A 127 ? 0.5388 0.5087 0.4857 -0.0230 0.0228  -0.0022 127 LEU A O   
976  C  CB  . LEU A 127 ? 0.3300 0.3185 0.2923 -0.0304 0.0254  -0.0080 127 LEU A CB  
977  C  CG  . LEU A 127 ? 0.3644 0.3627 0.3319 -0.0301 0.0252  -0.0110 127 LEU A CG  
978  C  CD1 . LEU A 127 ? 0.4470 0.4472 0.4209 -0.0326 0.0243  -0.0137 127 LEU A CD1 
979  C  CD2 . LEU A 127 ? 0.3830 0.3873 0.3502 -0.0318 0.0284  -0.0092 127 LEU A CD2 
980  N  N   . ASP A 128 ? 0.3234 0.2929 0.2725 -0.0324 0.0282  0.0015  128 ASP A N   
981  C  CA  . ASP A 128 ? 0.4012 0.3581 0.3451 -0.0325 0.0278  0.0046  128 ASP A CA  
982  C  C   . ASP A 128 ? 0.5410 0.4923 0.4880 -0.0312 0.0249  0.0011  128 ASP A C   
983  O  O   . ASP A 128 ? 0.6870 0.6285 0.6293 -0.0281 0.0232  0.0023  128 ASP A O   
984  C  CB  . ASP A 128 ? 0.5316 0.4844 0.4745 -0.0391 0.0314  0.0088  128 ASP A CB  
985  C  CG  . ASP A 128 ? 0.7210 0.6801 0.6604 -0.0400 0.0349  0.0128  128 ASP A CG  
986  O  OD1 . ASP A 128 ? 0.8237 0.7850 0.7575 -0.0347 0.0342  0.0135  128 ASP A OD1 
987  O  OD2 . ASP A 128 ? 0.7212 0.6838 0.6634 -0.0460 0.0384  0.0149  128 ASP A OD2 
988  N  N   . VAL A 129 ? 0.5089 0.4665 0.4631 -0.0331 0.0243  -0.0033 129 VAL A N   
989  C  CA  . VAL A 129 ? 0.5347 0.4882 0.4912 -0.0315 0.0220  -0.0069 129 VAL A CA  
990  C  C   . VAL A 129 ? 0.5217 0.4771 0.4775 -0.0248 0.0192  -0.0088 129 VAL A C   
991  O  O   . VAL A 129 ? 0.4586 0.4086 0.4140 -0.0217 0.0174  -0.0105 129 VAL A O   
992  C  CB  . VAL A 129 ? 0.4981 0.4585 0.4617 -0.0351 0.0221  -0.0108 129 VAL A CB  
993  C  CG1 . VAL A 129 ? 0.4252 0.3777 0.3894 -0.0395 0.0222  -0.0115 129 VAL A CG1 
994  C  CG2 . VAL A 129 ? 0.5126 0.4835 0.4796 -0.0379 0.0239  -0.0102 129 VAL A CG2 
995  N  N   . TYR A 130 ? 0.4231 0.3865 0.3790 -0.0224 0.0188  -0.0090 130 TYR A N   
996  C  CA  . TYR A 130 ? 0.3885 0.3547 0.3445 -0.0168 0.0159  -0.0108 130 TYR A CA  
997  C  C   . TYR A 130 ? 0.5300 0.4905 0.4787 -0.0124 0.0147  -0.0075 130 TYR A C   
998  O  O   . TYR A 130 ? 0.6348 0.5990 0.5832 -0.0077 0.0120  -0.0088 130 TYR A O   
999  C  CB  . TYR A 130 ? 0.3914 0.3684 0.3516 -0.0165 0.0153  -0.0133 130 TYR A CB  
1000 C  CG  . TYR A 130 ? 0.4296 0.4123 0.3961 -0.0205 0.0165  -0.0158 130 TYR A CG  
1001 C  CD1 . TYR A 130 ? 0.3777 0.3577 0.3470 -0.0229 0.0169  -0.0173 130 TYR A CD1 
1002 C  CD2 . TYR A 130 ? 0.3937 0.3840 0.3626 -0.0215 0.0170  -0.0167 130 TYR A CD2 
1003 C  CE1 . TYR A 130 ? 0.4175 0.4030 0.3918 -0.0262 0.0176  -0.0193 130 TYR A CE1 
1004 C  CE2 . TYR A 130 ? 0.4167 0.4118 0.3908 -0.0246 0.0177  -0.0185 130 TYR A CE2 
1005 C  CZ  . TYR A 130 ? 0.5119 0.5050 0.4887 -0.0270 0.0180  -0.0196 130 TYR A CZ  
1006 O  OH  . TYR A 130 ? 0.5089 0.5073 0.4903 -0.0297 0.0184  -0.0212 130 TYR A OH  
1007 N  N   . ASN A 131 ? 0.4493 0.4011 0.3921 -0.0141 0.0165  -0.0032 131 ASN A N   
1008 C  CA  . ASN A 131 ? 0.4879 0.4328 0.4225 -0.0099 0.0153  0.0007  131 ASN A CA  
1009 C  C   . ASN A 131 ? 0.5245 0.4646 0.4589 -0.0041 0.0119  -0.0008 131 ASN A C   
1010 O  O   . ASN A 131 ? 0.5519 0.4832 0.4864 -0.0045 0.0120  -0.0010 131 ASN A O   
1011 C  CB  . ASN A 131 ? 0.5883 0.5233 0.5170 -0.0137 0.0182  0.0061  131 ASN A CB  
1012 C  CG  . ASN A 131 ? 0.6435 0.5726 0.5623 -0.0098 0.0176  0.0112  131 ASN A CG  
1013 O  OD1 . ASN A 131 ? 0.6565 0.5857 0.5726 -0.0033 0.0142  0.0106  131 ASN A OD1 
1014 N  ND2 . ASN A 131 ? 0.6440 0.5684 0.5573 -0.0138 0.0210  0.0165  131 ASN A ND2 
1015 N  N   . GLY A 132 ? 0.4259 0.3720 0.3601 0.0013  0.0089  -0.0022 132 GLY A N   
1016 C  CA  . GLY A 132 ? 0.4121 0.3576 0.3486 0.0069  0.0057  -0.0045 132 GLY A CA  
1017 C  C   . GLY A 132 ? 0.4107 0.3460 0.3398 0.0126  0.0036  -0.0010 132 GLY A C   
1018 O  O   . GLY A 132 ? 0.3323 0.2678 0.2637 0.0181  0.0008  -0.0031 132 GLY A O   
1019 N  N   . LYS A 133 ? 0.3602 0.2869 0.2805 0.0117  0.0049  0.0045  133 LYS A N   
1020 C  CA  . LYS A 133 ? 0.3921 0.3084 0.3044 0.0177  0.0026  0.0084  133 LYS A CA  
1021 C  C   . LYS A 133 ? 0.4220 0.3272 0.3351 0.0199  0.0018  0.0076  133 LYS A C   
1022 O  O   . LYS A 133 ? 0.4802 0.3813 0.3908 0.0273  -0.0015 0.0080  133 LYS A O   
1023 C  CB  . LYS A 133 ? 0.4624 0.3706 0.3645 0.0154  0.0048  0.0152  133 LYS A CB  
1024 C  CG  . LYS A 133 ? 0.4617 0.3601 0.3626 0.0079  0.0091  0.0181  133 LYS A CG  
1025 C  CD  . LYS A 133 ? 0.5905 0.4834 0.4815 0.0059  0.0116  0.0253  133 LYS A CD  
1026 C  CE  . LYS A 133 ? 0.5657 0.4501 0.4560 -0.0024 0.0160  0.0287  133 LYS A CE  
1027 N  NZ  . LYS A 133 ? 0.4299 0.3190 0.3156 -0.0067 0.0199  0.0333  133 LYS A NZ  
1028 N  N   . TYR A 134 ? 0.4364 0.3371 0.3531 0.0141  0.0046  0.0060  134 TYR A N   
1029 C  CA  . TYR A 134 ? 0.3902 0.2788 0.3066 0.0161  0.0039  0.0047  134 TYR A CA  
1030 C  C   . TYR A 134 ? 0.4764 0.3723 0.3994 0.0223  0.0013  -0.0010 134 TYR A C   
1031 O  O   . TYR A 134 ? 0.3993 0.2878 0.3198 0.0293  -0.0012 -0.0011 134 TYR A O   
1032 C  CB  . TYR A 134 ? 0.3245 0.2078 0.2432 0.0078  0.0072  0.0037  134 TYR A CB  
1033 C  CG  . TYR A 134 ? 0.3912 0.2720 0.3059 0.0008  0.0103  0.0089  134 TYR A CG  
1034 C  CD1 . TYR A 134 ? 0.4274 0.2932 0.3335 -0.0001 0.0111  0.0150  134 TYR A CD1 
1035 C  CD2 . TYR A 134 ? 0.4318 0.3255 0.3513 -0.0046 0.0127  0.0078  134 TYR A CD2 
1036 C  CE1 . TYR A 134 ? 0.4344 0.2992 0.3370 -0.0067 0.0144  0.0201  134 TYR A CE1 
1037 C  CE2 . TYR A 134 ? 0.4494 0.3425 0.3657 -0.0105 0.0159  0.0124  134 TYR A CE2 
1038 C  CZ  . TYR A 134 ? 0.4751 0.3541 0.3830 -0.0118 0.0170  0.0186  134 TYR A CZ  
1039 O  OH  . TYR A 134 ? 0.3397 0.2189 0.2446 -0.0180 0.0207  0.0236  134 TYR A OH  
1040 N  N   . LEU A 135 ? 0.4998 0.4104 0.4313 0.0201  0.0019  -0.0055 135 LEU A N   
1041 C  CA  . LEU A 135 ? 0.4543 0.3725 0.3927 0.0248  0.0002  -0.0108 135 LEU A CA  
1042 C  C   . LEU A 135 ? 0.4689 0.3942 0.4077 0.0326  -0.0034 -0.0107 135 LEU A C   
1043 O  O   . LEU A 135 ? 0.5914 0.5154 0.5315 0.0395  -0.0055 -0.0126 135 LEU A O   
1044 C  CB  . LEU A 135 ? 0.4520 0.3827 0.3986 0.0196  0.0021  -0.0150 135 LEU A CB  
1045 C  CG  . LEU A 135 ? 0.3728 0.3169 0.3279 0.0226  0.0011  -0.0199 135 LEU A CG  
1046 C  CD1 . LEU A 135 ? 0.3727 0.3114 0.3286 0.0269  0.0010  -0.0231 135 LEU A CD1 
1047 C  CD2 . LEU A 135 ? 0.2919 0.2457 0.2527 0.0159  0.0033  -0.0221 135 LEU A CD2 
1048 N  N   . ALA A 136 ? 0.5449 0.4777 0.4825 0.0319  -0.0045 -0.0086 136 ALA A N   
1049 C  CA  . ALA A 136 ? 0.5207 0.4601 0.4579 0.0390  -0.0086 -0.0083 136 ALA A CA  
1050 C  C   . ALA A 136 ? 0.4718 0.3984 0.4014 0.0463  -0.0109 -0.0049 136 ALA A C   
1051 O  O   . ALA A 136 ? 0.3151 0.2458 0.2474 0.0540  -0.0142 -0.0066 136 ALA A O   
1052 C  CB  . ALA A 136 ? 0.2914 0.2370 0.2253 0.0369  -0.0093 -0.0061 136 ALA A CB  
1053 N  N   . TYR A 137 ? 0.4047 0.3158 0.3252 0.0438  -0.0091 0.0000  137 TYR A N   
1054 C  CA  . TYR A 137 ? 0.4015 0.2979 0.3135 0.0503  -0.0112 0.0042  137 TYR A CA  
1055 C  C   . TYR A 137 ? 0.4541 0.3431 0.3688 0.0547  -0.0118 0.0010  137 TYR A C   
1056 O  O   . TYR A 137 ? 0.4240 0.3110 0.3376 0.0639  -0.0153 0.0009  137 TYR A O   
1057 C  CB  . TYR A 137 ? 0.3560 0.2375 0.2578 0.0452  -0.0086 0.0107  137 TYR A CB  
1058 C  CG  . TYR A 137 ? 0.5095 0.3713 0.4024 0.0500  -0.0099 0.0151  137 TYR A CG  
1059 C  CD1 . TYR A 137 ? 0.6296 0.4866 0.5143 0.0576  -0.0134 0.0199  137 TYR A CD1 
1060 C  CD2 . TYR A 137 ? 0.5311 0.3786 0.4234 0.0469  -0.0079 0.0145  137 TYR A CD2 
1061 C  CE1 . TYR A 137 ? 0.5483 0.3859 0.4242 0.0623  -0.0148 0.0243  137 TYR A CE1 
1062 C  CE2 . TYR A 137 ? 0.5481 0.3758 0.4320 0.0511  -0.0092 0.0185  137 TYR A CE2 
1063 C  CZ  . TYR A 137 ? 0.5061 0.3286 0.3817 0.0589  -0.0126 0.0237  137 TYR A CZ  
1064 O  OH  . TYR A 137 ? 0.4434 0.2450 0.3101 0.0634  -0.0140 0.0281  137 TYR A OH  
1065 N  N   . THR A 138 ? 0.4548 0.3395 0.3727 0.0489  -0.0085 -0.0018 138 THR A N   
1066 C  CA  . THR A 138 ? 0.5076 0.3818 0.4258 0.0529  -0.0088 -0.0047 138 THR A CA  
1067 C  C   . THR A 138 ? 0.4529 0.3408 0.3800 0.0594  -0.0105 -0.0108 138 THR A C   
1068 O  O   . THR A 138 ? 0.5460 0.4271 0.4725 0.0668  -0.0120 -0.0129 138 THR A O   
1069 C  CB  . THR A 138 ? 0.5273 0.3936 0.4460 0.0447  -0.0053 -0.0066 138 THR A CB  
1070 O  OG1 . THR A 138 ? 0.7024 0.5851 0.6299 0.0392  -0.0032 -0.0108 138 THR A OG1 
1071 C  CG2 . THR A 138 ? 0.4241 0.2771 0.3349 0.0378  -0.0033 -0.0005 138 THR A CG2 
1072 N  N   . GLU A 139 ? 0.3289 0.2357 0.2643 0.0568  -0.0100 -0.0138 139 GLU A N   
1073 C  CA  . GLU A 139 ? 0.4627 0.3839 0.4075 0.0617  -0.0109 -0.0193 139 GLU A CA  
1074 C  C   . GLU A 139 ? 0.5831 0.5195 0.5322 0.0665  -0.0144 -0.0190 139 GLU A C   
1075 O  O   . GLU A 139 ? 0.5563 0.5087 0.5151 0.0684  -0.0147 -0.0233 139 GLU A O   
1076 C  CB  . GLU A 139 ? 0.4921 0.4226 0.4442 0.0546  -0.0074 -0.0236 139 GLU A CB  
1077 C  CG  . GLU A 139 ? 0.5771 0.4934 0.5253 0.0506  -0.0047 -0.0249 139 GLU A CG  
1078 C  CD  . GLU A 139 ? 0.5948 0.5050 0.5431 0.0580  -0.0053 -0.0289 139 GLU A CD  
1079 O  OE1 . GLU A 139 ? 0.6504 0.5739 0.6057 0.0634  -0.0058 -0.0327 139 GLU A OE1 
1080 O  OE2 . GLU A 139 ? 0.5524 0.4443 0.4936 0.0584  -0.0051 -0.0282 139 GLU A OE2 
1081 N  N   . GLU A 140 ? 0.6306 0.5624 0.5726 0.0684  -0.0169 -0.0141 140 GLU A N   
1082 C  CA  . GLU A 140 ? 0.5499 0.4939 0.4940 0.0737  -0.0212 -0.0135 140 GLU A CA  
1083 C  C   . GLU A 140 ? 0.4869 0.4513 0.4419 0.0697  -0.0211 -0.0176 140 GLU A C   
1084 O  O   . GLU A 140 ? 0.5287 0.5071 0.4916 0.0747  -0.0238 -0.0205 140 GLU A O   
1085 C  CB  . GLU A 140 ? 0.5859 0.5284 0.5300 0.0851  -0.0249 -0.0139 140 GLU A CB  
1086 C  CG  . GLU A 140 ? 0.8155 0.7425 0.7472 0.0903  -0.0278 -0.0077 140 GLU A CG  
1087 C  CD  . GLU A 140 ? 0.9295 0.8456 0.8580 0.1008  -0.0302 -0.0073 140 GLU A CD  
1088 O  OE1 . GLU A 140 ? 0.8804 0.7937 0.8032 0.1086  -0.0346 -0.0037 140 GLU A OE1 
1089 O  OE2 . GLU A 140 ? 0.9051 0.8148 0.8360 0.1016  -0.0279 -0.0107 140 GLU A OE2 
1090 N  N   . VAL A 141 ? 0.3933 0.3593 0.3486 0.0606  -0.0180 -0.0175 141 VAL A N   
1091 C  CA  . VAL A 141 ? 0.4003 0.3826 0.3647 0.0555  -0.0175 -0.0208 141 VAL A CA  
1092 C  C   . VAL A 141 ? 0.4810 0.4642 0.4406 0.0511  -0.0183 -0.0182 141 VAL A C   
1093 O  O   . VAL A 141 ? 0.4823 0.4535 0.4322 0.0496  -0.0173 -0.0140 141 VAL A O   
1094 C  CB  . VAL A 141 ? 0.4180 0.4019 0.3877 0.0489  -0.0130 -0.0238 141 VAL A CB  
1095 C  CG1 . VAL A 141 ? 0.5893 0.5747 0.5640 0.0537  -0.0123 -0.0272 141 VAL A CG1 
1096 C  CG2 . VAL A 141 ? 0.2875 0.2573 0.2498 0.0430  -0.0097 -0.0211 141 VAL A CG2 
1097 N  N   . VAL A 142 ? 0.4750 0.4726 0.4413 0.0491  -0.0200 -0.0208 142 VAL A N   
1098 C  CA  . VAL A 142 ? 0.3921 0.3916 0.3549 0.0443  -0.0204 -0.0198 142 VAL A CA  
1099 C  C   . VAL A 142 ? 0.4104 0.4107 0.3769 0.0361  -0.0160 -0.0213 142 VAL A C   
1100 O  O   . VAL A 142 ? 0.4327 0.4423 0.4085 0.0336  -0.0151 -0.0248 142 VAL A O   
1101 C  CB  . VAL A 142 ? 0.3639 0.3773 0.3316 0.0463  -0.0251 -0.0222 142 VAL A CB  
1102 C  CG1 . VAL A 142 ? 0.2504 0.2674 0.2171 0.0402  -0.0249 -0.0230 142 VAL A CG1 
1103 C  CG2 . VAL A 142 ? 0.3829 0.3945 0.3444 0.0543  -0.0298 -0.0198 142 VAL A CG2 
1104 N  N   . LEU A 143 ? 0.3867 0.3779 0.3459 0.0320  -0.0132 -0.0184 143 LEU A N   
1105 C  CA  . LEU A 143 ? 0.2886 0.2800 0.2506 0.0247  -0.0093 -0.0195 143 LEU A CA  
1106 C  C   . LEU A 143 ? 0.3505 0.3465 0.3111 0.0211  -0.0096 -0.0197 143 LEU A C   
1107 O  O   . LEU A 143 ? 0.4392 0.4304 0.3914 0.0219  -0.0100 -0.0167 143 LEU A O   
1108 C  CB  . LEU A 143 ? 0.3923 0.3709 0.3486 0.0221  -0.0057 -0.0166 143 LEU A CB  
1109 C  CG  . LEU A 143 ? 0.5534 0.5344 0.5141 0.0151  -0.0022 -0.0183 143 LEU A CG  
1110 C  CD1 . LEU A 143 ? 0.6715 0.6553 0.6392 0.0149  -0.0011 -0.0216 143 LEU A CD1 
1111 C  CD2 . LEU A 143 ? 0.5124 0.4842 0.4672 0.0107  0.0011  -0.0152 143 LEU A CD2 
1112 N  N   . VAL A 144 ? 0.4245 0.4295 0.3928 0.0173  -0.0094 -0.0230 144 VAL A N   
1113 C  CA  . VAL A 144 ? 0.4129 0.4211 0.3806 0.0133  -0.0091 -0.0239 144 VAL A CA  
1114 C  C   . VAL A 144 ? 0.3750 0.3805 0.3443 0.0078  -0.0049 -0.0238 144 VAL A C   
1115 O  O   . VAL A 144 ? 0.5629 0.5683 0.5370 0.0063  -0.0030 -0.0247 144 VAL A O   
1116 C  CB  . VAL A 144 ? 0.4022 0.4214 0.3773 0.0128  -0.0124 -0.0277 144 VAL A CB  
1117 C  CG1 . VAL A 144 ? 0.3564 0.3775 0.3321 0.0081  -0.0116 -0.0293 144 VAL A CG1 
1118 C  CG2 . VAL A 144 ? 0.4592 0.4820 0.4320 0.0180  -0.0173 -0.0280 144 VAL A CG2 
1119 N  N   . SER A 145 ? 0.3027 0.3064 0.2678 0.0051  -0.0033 -0.0229 145 SER A N   
1120 C  CA  . SER A 145 ? 0.2967 0.3004 0.2645 0.0000  0.0000  -0.0233 145 SER A CA  
1121 C  C   . SER A 145 ? 0.2259 0.2340 0.1937 -0.0014 -0.0009 -0.0252 145 SER A C   
1122 O  O   . SER A 145 ? 0.2949 0.3019 0.2562 0.0004  -0.0017 -0.0242 145 SER A O   
1123 C  CB  . SER A 145 ? 0.3263 0.3224 0.2889 -0.0018 0.0035  -0.0200 145 SER A CB  
1124 O  OG  . SER A 145 ? 0.5097 0.5056 0.4673 -0.0029 0.0048  -0.0187 145 SER A OG  
1125 N  N   . LEU A 146 ? 0.2751 0.2879 0.2496 -0.0043 -0.0010 -0.0277 146 LEU A N   
1126 C  CA  . LEU A 146 ? 0.2950 0.3110 0.2700 -0.0053 -0.0025 -0.0300 146 LEU A CA  
1127 C  C   . LEU A 146 ? 0.2707 0.2850 0.2445 -0.0080 0.0007  -0.0295 146 LEU A C   
1128 O  O   . LEU A 146 ? 0.1957 0.2070 0.1682 -0.0094 0.0038  -0.0272 146 LEU A O   
1129 C  CB  . LEU A 146 ? 0.1926 0.2143 0.1757 -0.0068 -0.0048 -0.0329 146 LEU A CB  
1130 C  CG  . LEU A 146 ? 0.1863 0.2099 0.1762 -0.0096 -0.0029 -0.0329 146 LEU A CG  
1131 C  CD1 . LEU A 146 ? 0.2062 0.2287 0.1976 -0.0132 -0.0007 -0.0330 146 LEU A CD1 
1132 C  CD2 . LEU A 146 ? 0.1882 0.2185 0.1853 -0.0099 -0.0055 -0.0349 146 LEU A CD2 
1133 N  N   . SER A 147 ? 0.2348 0.2510 0.2092 -0.0086 -0.0005 -0.0319 147 SER A N   
1134 C  CA  . SER A 147 ? 0.4182 0.4338 0.3927 -0.0106 0.0020  -0.0320 147 SER A CA  
1135 C  C   . SER A 147 ? 0.4804 0.4978 0.4599 -0.0121 0.0000  -0.0349 147 SER A C   
1136 O  O   . SER A 147 ? 0.4233 0.4421 0.4045 -0.0117 -0.0035 -0.0372 147 SER A O   
1137 C  CB  . SER A 147 ? 0.4981 0.5126 0.4654 -0.0086 0.0033  -0.0314 147 SER A CB  
1138 O  OG  . SER A 147 ? 0.5294 0.5447 0.4936 -0.0062 0.0002  -0.0344 147 SER A OG  
1139 N  N   . TYR A 148 ? 0.5045 0.5216 0.4863 -0.0140 0.0019  -0.0348 148 TYR A N   
1140 C  CA  . TYR A 148 ? 0.4624 0.4793 0.4480 -0.0155 0.0003  -0.0369 148 TYR A CA  
1141 C  C   . TYR A 148 ? 0.3701 0.3862 0.3547 -0.0153 0.0025  -0.0368 148 TYR A C   
1142 O  O   . TYR A 148 ? 0.2567 0.2737 0.2404 -0.0156 0.0055  -0.0346 148 TYR A O   
1143 C  CB  . TYR A 148 ? 0.4584 0.4769 0.4507 -0.0186 0.0001  -0.0363 148 TYR A CB  
1144 C  CG  . TYR A 148 ? 0.3673 0.3864 0.3611 -0.0200 0.0032  -0.0338 148 TYR A CG  
1145 C  CD1 . TYR A 148 ? 0.2034 0.2226 0.1957 -0.0193 0.0045  -0.0323 148 TYR A CD1 
1146 C  CD2 . TYR A 148 ? 0.3141 0.3331 0.3103 -0.0219 0.0045  -0.0331 148 TYR A CD2 
1147 C  CE1 . TYR A 148 ? 0.1729 0.1919 0.1661 -0.0208 0.0070  -0.0306 148 TYR A CE1 
1148 C  CE2 . TYR A 148 ? 0.2761 0.2959 0.2732 -0.0233 0.0069  -0.0313 148 TYR A CE2 
1149 C  CZ  . TYR A 148 ? 0.3203 0.3401 0.3160 -0.0229 0.0081  -0.0303 148 TYR A CZ  
1150 O  OH  . TYR A 148 ? 0.3716 0.3915 0.3679 -0.0245 0.0100  -0.0292 148 TYR A OH  
1151 N  N   . ARG A 149 ? 0.1869 0.2011 0.1719 -0.0148 0.0007  -0.0392 149 ARG A N   
1152 C  CA  . ARG A 149 ? 0.2465 0.2602 0.2310 -0.0138 0.0024  -0.0393 149 ARG A CA  
1153 C  C   . ARG A 149 ? 0.4510 0.4658 0.4403 -0.0164 0.0041  -0.0370 149 ARG A C   
1154 O  O   . ARG A 149 ? 0.3844 0.3988 0.3776 -0.0190 0.0031  -0.0362 149 ARG A O   
1155 C  CB  . ARG A 149 ? 0.2786 0.2885 0.2623 -0.0123 -0.0003 -0.0427 149 ARG A CB  
1156 C  CG  . ARG A 149 ? 0.3935 0.4022 0.3720 -0.0097 -0.0025 -0.0458 149 ARG A CG  
1157 C  CD  . ARG A 149 ? 0.4076 0.4111 0.3862 -0.0093 -0.0060 -0.0495 149 ARG A CD  
1158 N  NE  . ARG A 149 ? 0.4475 0.4501 0.4300 -0.0127 -0.0094 -0.0502 149 ARG A NE  
1159 C  CZ  . ARG A 149 ? 0.4647 0.4626 0.4482 -0.0138 -0.0132 -0.0534 149 ARG A CZ  
1160 N  NH1 . ARG A 149 ? 0.4616 0.4542 0.4419 -0.0113 -0.0142 -0.0564 149 ARG A NH1 
1161 N  NH2 . ARG A 149 ? 0.4133 0.4121 0.4014 -0.0175 -0.0159 -0.0537 149 ARG A NH2 
1162 N  N   . VAL A 150 ? 0.4187 0.4356 0.4076 -0.0155 0.0066  -0.0359 150 VAL A N   
1163 C  CA  . VAL A 150 ? 0.3049 0.3239 0.2977 -0.0175 0.0081  -0.0338 150 VAL A CA  
1164 C  C   . VAL A 150 ? 0.3436 0.3628 0.3371 -0.0154 0.0081  -0.0345 150 VAL A C   
1165 O  O   . VAL A 150 ? 0.3143 0.3321 0.3052 -0.0122 0.0074  -0.0368 150 VAL A O   
1166 C  CB  . VAL A 150 ? 0.2939 0.3162 0.2863 -0.0187 0.0109  -0.0317 150 VAL A CB  
1167 C  CG1 . VAL A 150 ? 0.2381 0.2591 0.2285 -0.0195 0.0106  -0.0312 150 VAL A CG1 
1168 C  CG2 . VAL A 150 ? 0.2752 0.3007 0.2654 -0.0167 0.0130  -0.0317 150 VAL A CG2 
1169 N  N   . GLY A 151 ? 0.3293 0.3504 0.3261 -0.0168 0.0086  -0.0328 151 GLY A N   
1170 C  CA  . GLY A 151 ? 0.2524 0.2735 0.2505 -0.0145 0.0081  -0.0331 151 GLY A CA  
1171 C  C   . GLY A 151 ? 0.3300 0.3444 0.3271 -0.0129 0.0053  -0.0350 151 GLY A C   
1172 O  O   . GLY A 151 ? 0.4119 0.4223 0.4088 -0.0150 0.0036  -0.0354 151 GLY A O   
1173 N  N   . ALA A 152 ? 0.3798 0.3930 0.3765 -0.0091 0.0047  -0.0362 152 ALA A N   
1174 C  CA  . ALA A 152 ? 0.3776 0.3826 0.3731 -0.0075 0.0017  -0.0382 152 ALA A CA  
1175 C  C   . ALA A 152 ? 0.3902 0.3913 0.3825 -0.0075 0.0002  -0.0412 152 ALA A C   
1176 O  O   . ALA A 152 ? 0.3096 0.3037 0.3020 -0.0090 -0.0027 -0.0423 152 ALA A O   
1177 C  CB  . ALA A 152 ? 0.2552 0.2594 0.2500 -0.0021 0.0014  -0.0396 152 ALA A CB  
1178 N  N   . PHE A 153 ? 0.3658 0.3714 0.3554 -0.0061 0.0020  -0.0424 153 PHE A N   
1179 C  CA  . PHE A 153 ? 0.4198 0.4226 0.4058 -0.0060 0.0003  -0.0451 153 PHE A CA  
1180 C  C   . PHE A 153 ? 0.5689 0.5695 0.5575 -0.0106 -0.0018 -0.0441 153 PHE A C   
1181 O  O   . PHE A 153 ? 0.4681 0.4639 0.4561 -0.0114 -0.0049 -0.0466 153 PHE A O   
1182 C  CB  . PHE A 153 ? 0.3105 0.3193 0.2929 -0.0045 0.0029  -0.0450 153 PHE A CB  
1183 C  CG  . PHE A 153 ? 0.3482 0.3613 0.3289 -0.0004 0.0057  -0.0455 153 PHE A CG  
1184 C  CD1 . PHE A 153 ? 0.3052 0.3157 0.2820 0.0044  0.0047  -0.0495 153 PHE A CD1 
1185 C  CD2 . PHE A 153 ? 0.4136 0.4338 0.3969 -0.0014 0.0092  -0.0425 153 PHE A CD2 
1186 C  CE1 . PHE A 153 ? 0.3401 0.3561 0.3158 0.0087  0.0077  -0.0501 153 PHE A CE1 
1187 C  CE2 . PHE A 153 ? 0.3392 0.3653 0.3221 0.0021  0.0119  -0.0429 153 PHE A CE2 
1188 C  CZ  . PHE A 153 ? 0.3367 0.3612 0.3159 0.0074  0.0114  -0.0466 153 PHE A CZ  
1189 N  N   . GLY A 154 ? 0.6393 0.6439 0.6311 -0.0138 0.0000  -0.0408 154 GLY A N   
1190 C  CA  . GLY A 154 ? 0.4511 0.4556 0.4458 -0.0178 -0.0013 -0.0398 154 GLY A CA  
1191 C  C   . GLY A 154 ? 0.3369 0.3382 0.3355 -0.0208 -0.0024 -0.0381 154 GLY A C   
1192 O  O   . GLY A 154 ? 0.2651 0.2655 0.2663 -0.0240 -0.0040 -0.0381 154 GLY A O   
1193 N  N   . PHE A 155 ? 0.2450 0.2452 0.2441 -0.0199 -0.0015 -0.0365 155 PHE A N   
1194 C  CA  . PHE A 155 ? 0.3368 0.3347 0.3388 -0.0231 -0.0021 -0.0338 155 PHE A CA  
1195 C  C   . PHE A 155 ? 0.4261 0.4177 0.4275 -0.0214 -0.0035 -0.0333 155 PHE A C   
1196 O  O   . PHE A 155 ? 0.4533 0.4428 0.4563 -0.0238 -0.0036 -0.0303 155 PHE A O   
1197 C  CB  . PHE A 155 ? 0.1828 0.1867 0.1864 -0.0248 0.0005  -0.0308 155 PHE A CB  
1198 C  CG  . PHE A 155 ? 0.1779 0.1866 0.1821 -0.0262 0.0016  -0.0312 155 PHE A CG  
1199 C  CD1 . PHE A 155 ? 0.1774 0.1867 0.1840 -0.0292 0.0010  -0.0309 155 PHE A CD1 
1200 C  CD2 . PHE A 155 ? 0.2470 0.2593 0.2493 -0.0243 0.0034  -0.0317 155 PHE A CD2 
1201 C  CE1 . PHE A 155 ? 0.1738 0.1874 0.1810 -0.0296 0.0017  -0.0313 155 PHE A CE1 
1202 C  CE2 . PHE A 155 ? 0.2214 0.2365 0.2235 -0.0251 0.0042  -0.0318 155 PHE A CE2 
1203 C  CZ  . PHE A 155 ? 0.1715 0.1873 0.1761 -0.0274 0.0032  -0.0317 155 PHE A CZ  
1204 N  N   . LEU A 156 ? 0.2519 0.2400 0.2507 -0.0171 -0.0045 -0.0361 156 LEU A N   
1205 C  CA  . LEU A 156 ? 0.3487 0.3289 0.3467 -0.0151 -0.0064 -0.0360 156 LEU A CA  
1206 C  C   . LEU A 156 ? 0.3768 0.3490 0.3759 -0.0193 -0.0091 -0.0356 156 LEU A C   
1207 O  O   . LEU A 156 ? 0.4149 0.3864 0.4145 -0.0216 -0.0104 -0.0380 156 LEU A O   
1208 C  CB  . LEU A 156 ? 0.4476 0.4254 0.4424 -0.0092 -0.0072 -0.0399 156 LEU A CB  
1209 C  CG  . LEU A 156 ? 0.4800 0.4479 0.4735 -0.0062 -0.0096 -0.0403 156 LEU A CG  
1210 C  CD1 . LEU A 156 ? 0.5312 0.5023 0.5234 0.0005  -0.0085 -0.0415 156 LEU A CD1 
1211 C  CD2 . LEU A 156 ? 0.2543 0.2120 0.2455 -0.0064 -0.0130 -0.0443 156 LEU A CD2 
1212 N  N   . ALA A 157 ? 0.5025 0.4692 0.5024 -0.0208 -0.0098 -0.0323 157 ALA A N   
1213 C  CA  . ALA A 157 ? 0.4794 0.4402 0.4813 -0.0264 -0.0114 -0.0306 157 ALA A CA  
1214 C  C   . ALA A 157 ? 0.4334 0.3822 0.4337 -0.0258 -0.0138 -0.0289 157 ALA A C   
1215 O  O   . ALA A 157 ? 0.4048 0.3528 0.4043 -0.0245 -0.0130 -0.0250 157 ALA A O   
1216 C  CB  . ALA A 157 ? 0.3617 0.3299 0.3666 -0.0311 -0.0090 -0.0264 157 ALA A CB  
1217 N  N   . LEU A 158 ? 0.4040 0.3430 0.4037 -0.0267 -0.0169 -0.0320 158 LEU A N   
1218 C  CA  . LEU A 158 ? 0.4184 0.3435 0.4167 -0.0274 -0.0196 -0.0305 158 LEU A CA  
1219 C  C   . LEU A 158 ? 0.4227 0.3444 0.4246 -0.0356 -0.0208 -0.0291 158 LEU A C   
1220 O  O   . LEU A 158 ? 0.4831 0.3992 0.4855 -0.0376 -0.0237 -0.0333 158 LEU A O   
1221 C  CB  . LEU A 158 ? 0.4389 0.3545 0.4333 -0.0216 -0.0225 -0.0358 158 LEU A CB  
1222 C  CG  . LEU A 158 ? 0.4162 0.3367 0.4078 -0.0132 -0.0211 -0.0377 158 LEU A CG  
1223 C  CD1 . LEU A 158 ? 0.4377 0.3501 0.4255 -0.0078 -0.0237 -0.0438 158 LEU A CD1 
1224 C  CD2 . LEU A 158 ? 0.3949 0.3132 0.3857 -0.0102 -0.0206 -0.0329 158 LEU A CD2 
1225 N  N   . HIS A 159 ? 0.4559 0.3819 0.4604 -0.0405 -0.0185 -0.0234 159 HIS A N   
1226 C  CA  . HIS A 159 ? 0.4590 0.3855 0.4681 -0.0486 -0.0188 -0.0219 159 HIS A CA  
1227 C  C   . HIS A 159 ? 0.5043 0.4152 0.5131 -0.0520 -0.0224 -0.0220 159 HIS A C   
1228 O  O   . HIS A 159 ? 0.5058 0.4057 0.5111 -0.0503 -0.0233 -0.0188 159 HIS A O   
1229 C  CB  . HIS A 159 ? 0.3818 0.3161 0.3931 -0.0528 -0.0152 -0.0155 159 HIS A CB  
1230 C  CG  . HIS A 159 ? 0.4654 0.4036 0.4826 -0.0609 -0.0147 -0.0140 159 HIS A CG  
1231 N  ND1 . HIS A 159 ? 0.4706 0.4042 0.4893 -0.0671 -0.0139 -0.0083 159 HIS A ND1 
1232 C  CD2 . HIS A 159 ? 0.4951 0.4419 0.5173 -0.0639 -0.0149 -0.0174 159 HIS A CD2 
1233 C  CE1 . HIS A 159 ? 0.5222 0.4624 0.5472 -0.0738 -0.0134 -0.0083 159 HIS A CE1 
1234 N  NE2 . HIS A 159 ? 0.5542 0.5026 0.5817 -0.0717 -0.0142 -0.0139 159 HIS A NE2 
1235 N  N   . GLY A 160 ? 0.4427 0.3525 0.4551 -0.0566 -0.0249 -0.0257 160 GLY A N   
1236 C  CA  . GLY A 160 ? 0.3860 0.2802 0.3980 -0.0601 -0.0290 -0.0271 160 GLY A CA  
1237 C  C   . GLY A 160 ? 0.5105 0.4012 0.5207 -0.0565 -0.0328 -0.0354 160 GLY A C   
1238 O  O   . GLY A 160 ? 0.6353 0.5240 0.6488 -0.0617 -0.0359 -0.0389 160 GLY A O   
1239 N  N   . SER A 161 ? 0.5698 0.4607 0.5746 -0.0477 -0.0325 -0.0386 161 SER A N   
1240 C  CA  . SER A 161 ? 0.5200 0.4111 0.5218 -0.0432 -0.0350 -0.0464 161 SER A CA  
1241 C  C   . SER A 161 ? 0.5039 0.4096 0.5098 -0.0462 -0.0342 -0.0484 161 SER A C   
1242 O  O   . SER A 161 ? 0.5668 0.4851 0.5759 -0.0475 -0.0304 -0.0445 161 SER A O   
1243 C  CB  . SER A 161 ? 0.4450 0.3379 0.4411 -0.0334 -0.0333 -0.0483 161 SER A CB  
1244 O  OG  . SER A 161 ? 0.4547 0.3510 0.4477 -0.0290 -0.0346 -0.0551 161 SER A OG  
1245 N  N   . GLN A 162 ? 0.6111 0.5145 0.6166 -0.0470 -0.0380 -0.0546 162 GLN A N   
1246 C  CA  . GLN A 162 ? 0.6667 0.5834 0.6743 -0.0475 -0.0379 -0.0573 162 GLN A CA  
1247 C  C   . GLN A 162 ? 0.6059 0.5266 0.6069 -0.0391 -0.0372 -0.0616 162 GLN A C   
1248 O  O   . GLN A 162 ? 0.5717 0.5033 0.5730 -0.0382 -0.0366 -0.0633 162 GLN A O   
1249 C  CB  . GLN A 162 ? 0.7057 0.6201 0.7172 -0.0537 -0.0428 -0.0615 162 GLN A CB  
1250 C  CG  . GLN A 162 ? 0.7913 0.7022 0.8101 -0.0632 -0.0433 -0.0569 162 GLN A CG  
1251 C  CD  . GLN A 162 ? 0.7905 0.7136 0.8148 -0.0664 -0.0380 -0.0496 162 GLN A CD  
1252 O  OE1 . GLN A 162 ? 0.6694 0.6067 0.6956 -0.0649 -0.0356 -0.0493 162 GLN A OE1 
1253 N  NE2 . GLN A 162 ? 0.7700 0.6868 0.7961 -0.0706 -0.0363 -0.0436 162 GLN A NE2 
1254 N  N   . GLU A 163 ? 0.6186 0.5311 0.6137 -0.0326 -0.0370 -0.0631 163 GLU A N   
1255 C  CA  . GLU A 163 ? 0.5672 0.4848 0.5564 -0.0245 -0.0354 -0.0665 163 GLU A CA  
1256 C  C   . GLU A 163 ? 0.6481 0.5775 0.6383 -0.0222 -0.0300 -0.0615 163 GLU A C   
1257 O  O   . GLU A 163 ? 0.6405 0.5789 0.6281 -0.0185 -0.0281 -0.0630 163 GLU A O   
1258 C  CB  . GLU A 163 ? 0.5424 0.4478 0.5254 -0.0181 -0.0371 -0.0704 163 GLU A CB  
1259 C  CG  . GLU A 163 ? 0.6063 0.4992 0.5867 -0.0195 -0.0428 -0.0769 163 GLU A CG  
1260 C  CD  . GLU A 163 ? 0.7310 0.6306 0.7094 -0.0198 -0.0451 -0.0824 163 GLU A CD  
1261 O  OE1 . GLU A 163 ? 0.7301 0.6384 0.7039 -0.0138 -0.0427 -0.0841 163 GLU A OE1 
1262 O  OE2 . GLU A 163 ? 0.6987 0.5952 0.6801 -0.0260 -0.0493 -0.0848 163 GLU A OE2 
1263 N  N   . ALA A 164 ? 0.6492 0.5785 0.6428 -0.0244 -0.0277 -0.0556 164 ALA A N   
1264 C  CA  . ALA A 164 ? 0.5419 0.4825 0.5372 -0.0235 -0.0231 -0.0510 164 ALA A CA  
1265 C  C   . ALA A 164 ? 0.5869 0.5300 0.5877 -0.0301 -0.0218 -0.0452 164 ALA A C   
1266 O  O   . ALA A 164 ? 0.5893 0.5294 0.5904 -0.0301 -0.0205 -0.0410 164 ALA A O   
1267 C  CB  . ALA A 164 ? 0.4210 0.3609 0.4131 -0.0171 -0.0211 -0.0500 164 ALA A CB  
1268 N  N   . PRO A 165 ? 0.5020 0.4515 0.5070 -0.0353 -0.0220 -0.0450 165 PRO A N   
1269 C  CA  . PRO A 165 ? 0.4347 0.3881 0.4451 -0.0414 -0.0202 -0.0398 165 PRO A CA  
1270 C  C   . PRO A 165 ? 0.3820 0.3450 0.3929 -0.0401 -0.0159 -0.0357 165 PRO A C   
1271 O  O   . PRO A 165 ? 0.3447 0.3080 0.3574 -0.0430 -0.0141 -0.0309 165 PRO A O   
1272 C  CB  . PRO A 165 ? 0.3502 0.3092 0.3653 -0.0461 -0.0220 -0.0419 165 PRO A CB  
1273 C  CG  . PRO A 165 ? 0.2679 0.2293 0.2792 -0.0414 -0.0235 -0.0472 165 PRO A CG  
1274 C  CD  . PRO A 165 ? 0.2947 0.2469 0.2997 -0.0358 -0.0246 -0.0499 165 PRO A CD  
1275 N  N   . GLY A 166 ? 0.3179 0.2882 0.3267 -0.0360 -0.0142 -0.0374 166 GLY A N   
1276 C  CA  . GLY A 166 ? 0.3474 0.3265 0.3569 -0.0354 -0.0105 -0.0342 166 GLY A CA  
1277 C  C   . GLY A 166 ? 0.3580 0.3461 0.3710 -0.0381 -0.0095 -0.0342 166 GLY A C   
1278 O  O   . GLY A 166 ? 0.4666 0.4553 0.4830 -0.0415 -0.0115 -0.0355 166 GLY A O   
1279 N  N   . ASN A 167 ? 0.2768 0.2721 0.2892 -0.0364 -0.0066 -0.0328 167 ASN A N   
1280 C  CA  . ASN A 167 ? 0.3107 0.3139 0.3256 -0.0376 -0.0055 -0.0330 167 ASN A CA  
1281 C  C   . ASN A 167 ? 0.3214 0.3257 0.3351 -0.0356 -0.0077 -0.0368 167 ASN A C   
1282 O  O   . ASN A 167 ? 0.2229 0.2331 0.2392 -0.0365 -0.0079 -0.0374 167 ASN A O   
1283 C  CB  . ASN A 167 ? 0.2697 0.2762 0.2901 -0.0427 -0.0052 -0.0308 167 ASN A CB  
1284 C  CG  . ASN A 167 ? 0.3172 0.3229 0.3376 -0.0444 -0.0029 -0.0267 167 ASN A CG  
1285 O  OD1 . ASN A 167 ? 0.5027 0.5052 0.5252 -0.0483 -0.0033 -0.0245 167 ASN A OD1 
1286 N  ND2 . ASN A 167 ? 0.1839 0.1922 0.2015 -0.0417 -0.0006 -0.0256 167 ASN A ND2 
1287 N  N   . VAL A 168 ? 0.1943 0.1933 0.2037 -0.0324 -0.0094 -0.0396 168 VAL A N   
1288 C  CA  . VAL A 168 ? 0.3165 0.3165 0.3234 -0.0302 -0.0116 -0.0432 168 VAL A CA  
1289 C  C   . VAL A 168 ? 0.1907 0.1966 0.1951 -0.0274 -0.0092 -0.0424 168 VAL A C   
1290 O  O   . VAL A 168 ? 0.1913 0.2000 0.1943 -0.0260 -0.0106 -0.0442 168 VAL A O   
1291 C  CB  . VAL A 168 ? 0.2047 0.1973 0.2070 -0.0274 -0.0139 -0.0468 168 VAL A CB  
1292 C  CG1 . VAL A 168 ? 0.2116 0.1968 0.2166 -0.0308 -0.0164 -0.0471 168 VAL A CG1 
1293 C  CG2 . VAL A 168 ? 0.2715 0.2631 0.2695 -0.0231 -0.0113 -0.0461 168 VAL A CG2 
1294 N  N   . GLY A 169 ? 0.1858 0.1935 0.1897 -0.0267 -0.0058 -0.0396 169 GLY A N   
1295 C  CA  . GLY A 169 ? 0.3495 0.3618 0.3517 -0.0250 -0.0035 -0.0385 169 GLY A CA  
1296 C  C   . GLY A 169 ? 0.3277 0.3448 0.3338 -0.0270 -0.0036 -0.0376 169 GLY A C   
1297 O  O   . GLY A 169 ? 0.3774 0.3971 0.3820 -0.0251 -0.0038 -0.0381 169 GLY A O   
1298 N  N   . LEU A 170 ? 0.3338 0.3524 0.3448 -0.0304 -0.0032 -0.0361 170 LEU A N   
1299 C  CA  . LEU A 170 ? 0.2736 0.2980 0.2889 -0.0319 -0.0032 -0.0356 170 LEU A CA  
1300 C  C   . LEU A 170 ? 0.3149 0.3410 0.3323 -0.0322 -0.0068 -0.0382 170 LEU A C   
1301 O  O   . LEU A 170 ? 0.3790 0.4102 0.3980 -0.0309 -0.0074 -0.0388 170 LEU A O   
1302 C  CB  . LEU A 170 ? 0.2559 0.2825 0.2757 -0.0355 -0.0015 -0.0333 170 LEU A CB  
1303 C  CG  . LEU A 170 ? 0.2424 0.2687 0.2603 -0.0354 0.0017  -0.0309 170 LEU A CG  
1304 C  CD1 . LEU A 170 ? 0.2085 0.2341 0.2288 -0.0389 0.0024  -0.0285 170 LEU A CD1 
1305 C  CD2 . LEU A 170 ? 0.2502 0.2812 0.2681 -0.0339 0.0038  -0.0305 170 LEU A CD2 
1306 N  N   . LEU A 171 ? 0.2273 0.2488 0.2447 -0.0336 -0.0094 -0.0401 171 LEU A N   
1307 C  CA  . LEU A 171 ? 0.3604 0.3830 0.3790 -0.0339 -0.0135 -0.0433 171 LEU A CA  
1308 C  C   . LEU A 171 ? 0.4407 0.4640 0.4536 -0.0291 -0.0147 -0.0452 171 LEU A C   
1309 O  O   . LEU A 171 ? 0.4881 0.5160 0.5024 -0.0284 -0.0173 -0.0468 171 LEU A O   
1310 C  CB  . LEU A 171 ? 0.4226 0.4382 0.4411 -0.0361 -0.0163 -0.0454 171 LEU A CB  
1311 C  CG  . LEU A 171 ? 0.3826 0.3979 0.4076 -0.0418 -0.0160 -0.0432 171 LEU A CG  
1312 C  CD1 . LEU A 171 ? 0.2845 0.2901 0.3084 -0.0438 -0.0184 -0.0447 171 LEU A CD1 
1313 C  CD2 . LEU A 171 ? 0.2603 0.2842 0.2928 -0.0451 -0.0174 -0.0435 171 LEU A CD2 
1314 N  N   . ASP A 172 ? 0.3829 0.4022 0.3892 -0.0258 -0.0127 -0.0447 172 ASP A N   
1315 C  CA  . ASP A 172 ? 0.2730 0.2932 0.2732 -0.0216 -0.0127 -0.0452 172 ASP A CA  
1316 C  C   . ASP A 172 ? 0.3155 0.3413 0.3179 -0.0208 -0.0120 -0.0435 172 ASP A C   
1317 O  O   . ASP A 172 ? 0.2570 0.2855 0.2582 -0.0186 -0.0146 -0.0447 172 ASP A O   
1318 C  CB  . ASP A 172 ? 0.3049 0.3219 0.2993 -0.0191 -0.0093 -0.0437 172 ASP A CB  
1319 C  CG  . ASP A 172 ? 0.4329 0.4450 0.4243 -0.0182 -0.0099 -0.0458 172 ASP A CG  
1320 O  OD1 . ASP A 172 ? 0.5053 0.5150 0.4968 -0.0186 -0.0134 -0.0491 172 ASP A OD1 
1321 O  OD2 . ASP A 172 ? 0.3885 0.3993 0.3775 -0.0168 -0.0069 -0.0445 172 ASP A OD2 
1322 N  N   . GLN A 173 ? 0.3762 0.4034 0.3815 -0.0220 -0.0087 -0.0407 173 GLN A N   
1323 C  CA  . GLN A 173 ? 0.4618 0.4930 0.4680 -0.0202 -0.0079 -0.0394 173 GLN A CA  
1324 C  C   . GLN A 173 ? 0.4098 0.4477 0.4227 -0.0213 -0.0105 -0.0406 173 GLN A C   
1325 O  O   . GLN A 173 ? 0.4531 0.4946 0.4663 -0.0185 -0.0112 -0.0404 173 GLN A O   
1326 C  CB  . GLN A 173 ? 0.5573 0.5879 0.5639 -0.0209 -0.0039 -0.0368 173 GLN A CB  
1327 C  CG  . GLN A 173 ? 0.6428 0.6724 0.6522 -0.0243 -0.0020 -0.0359 173 GLN A CG  
1328 C  CD  . GLN A 173 ? 0.5863 0.6157 0.5950 -0.0244 0.0015  -0.0338 173 GLN A CD  
1329 O  OE1 . GLN A 173 ? 0.6645 0.6970 0.6752 -0.0238 0.0024  -0.0334 173 GLN A OE1 
1330 N  NE2 . GLN A 173 ? 0.3541 0.3801 0.3602 -0.0249 0.0032  -0.0329 173 GLN A NE2 
1331 N  N   . ARG A 174 ? 0.2546 0.2941 0.2729 -0.0252 -0.0120 -0.0418 174 ARG A N   
1332 C  CA  . ARG A 174 ? 0.3125 0.3596 0.3379 -0.0267 -0.0148 -0.0432 174 ARG A CA  
1333 C  C   . ARG A 174 ? 0.3642 0.4122 0.3872 -0.0243 -0.0195 -0.0461 174 ARG A C   
1334 O  O   . ARG A 174 ? 0.3961 0.4514 0.4228 -0.0228 -0.0218 -0.0470 174 ARG A O   
1335 C  CB  . ARG A 174 ? 0.2913 0.3397 0.3236 -0.0325 -0.0149 -0.0431 174 ARG A CB  
1336 C  CG  . ARG A 174 ? 0.2435 0.3003 0.2839 -0.0350 -0.0182 -0.0449 174 ARG A CG  
1337 C  CD  . ARG A 174 ? 0.2260 0.2828 0.2727 -0.0416 -0.0187 -0.0447 174 ARG A CD  
1338 N  NE  . ARG A 174 ? 0.1969 0.2535 0.2456 -0.0443 -0.0141 -0.0412 174 ARG A NE  
1339 C  CZ  . ARG A 174 ? 0.3707 0.4266 0.4241 -0.0501 -0.0136 -0.0398 174 ARG A CZ  
1340 N  NH1 . ARG A 174 ? 0.4818 0.5365 0.5390 -0.0541 -0.0175 -0.0419 174 ARG A NH1 
1341 N  NH2 . ARG A 174 ? 0.1787 0.2345 0.2325 -0.0519 -0.0094 -0.0362 174 ARG A NH2 
1342 N  N   . MET A 175 ? 0.3658 0.4072 0.3823 -0.0234 -0.0210 -0.0478 175 MET A N   
1343 C  CA  . MET A 175 ? 0.3015 0.3435 0.3140 -0.0206 -0.0255 -0.0508 175 MET A CA  
1344 C  C   . MET A 175 ? 0.2701 0.3141 0.2777 -0.0153 -0.0253 -0.0493 175 MET A C   
1345 O  O   . MET A 175 ? 0.3778 0.4272 0.3864 -0.0131 -0.0290 -0.0507 175 MET A O   
1346 C  CB  . MET A 175 ? 0.3109 0.3450 0.3162 -0.0200 -0.0265 -0.0530 175 MET A CB  
1347 C  CG  . MET A 175 ? 0.4765 0.5111 0.4768 -0.0173 -0.0315 -0.0567 175 MET A CG  
1348 S  SD  . MET A 175 ? 0.6058 0.6332 0.6032 -0.0192 -0.0349 -0.0616 175 MET A SD  
1349 C  CE  . MET A 175 ? 0.4598 0.4884 0.4693 -0.0267 -0.0358 -0.0618 175 MET A CE  
1350 N  N   . ALA A 176 ? 0.1940 0.2336 0.1963 -0.0132 -0.0211 -0.0463 176 ALA A N   
1351 C  CA  . ALA A 176 ? 0.3790 0.4187 0.3765 -0.0085 -0.0204 -0.0442 176 ALA A CA  
1352 C  C   . ALA A 176 ? 0.3451 0.3919 0.3495 -0.0076 -0.0212 -0.0436 176 ALA A C   
1353 O  O   . ALA A 176 ? 0.4139 0.4634 0.4164 -0.0034 -0.0237 -0.0435 176 ALA A O   
1354 C  CB  . ALA A 176 ? 0.3429 0.3765 0.3352 -0.0079 -0.0155 -0.0410 176 ALA A CB  
1355 N  N   . LEU A 177 ? 0.3191 0.3695 0.3315 -0.0111 -0.0190 -0.0431 177 LEU A N   
1356 C  CA  . LEU A 177 ? 0.2317 0.2904 0.2514 -0.0100 -0.0194 -0.0431 177 LEU A CA  
1357 C  C   . LEU A 177 ? 0.2849 0.3518 0.3097 -0.0098 -0.0247 -0.0458 177 LEU A C   
1358 O  O   . LEU A 177 ? 0.1905 0.2632 0.2169 -0.0056 -0.0269 -0.0460 177 LEU A O   
1359 C  CB  . LEU A 177 ? 0.2136 0.2752 0.2403 -0.0142 -0.0158 -0.0421 177 LEU A CB  
1360 C  CG  . LEU A 177 ? 0.3606 0.4167 0.3834 -0.0132 -0.0111 -0.0397 177 LEU A CG  
1361 C  CD1 . LEU A 177 ? 0.1722 0.2318 0.2010 -0.0170 -0.0077 -0.0389 177 LEU A CD1 
1362 C  CD2 . LEU A 177 ? 0.3652 0.4205 0.3846 -0.0076 -0.0109 -0.0387 177 LEU A CD2 
1363 N  N   . GLN A 178 ? 0.1894 0.2566 0.2167 -0.0141 -0.0272 -0.0482 178 GLN A N   
1364 C  CA  . GLN A 178 ? 0.2463 0.3206 0.2779 -0.0146 -0.0330 -0.0515 178 GLN A CA  
1365 C  C   . GLN A 178 ? 0.2872 0.3598 0.3103 -0.0090 -0.0369 -0.0525 178 GLN A C   
1366 O  O   . GLN A 178 ? 0.2101 0.2906 0.2367 -0.0072 -0.0418 -0.0546 178 GLN A O   
1367 C  CB  . GLN A 178 ? 0.2869 0.3590 0.3215 -0.0207 -0.0348 -0.0540 178 GLN A CB  
1368 C  CG  . GLN A 178 ? 0.3913 0.4709 0.4318 -0.0226 -0.0411 -0.0578 178 GLN A CG  
1369 C  CD  . GLN A 178 ? 0.5363 0.6270 0.5902 -0.0274 -0.0408 -0.0575 178 GLN A CD  
1370 O  OE1 . GLN A 178 ? 0.5335 0.6356 0.5939 -0.0255 -0.0433 -0.0583 178 GLN A OE1 
1371 N  NE2 . GLN A 178 ? 0.5759 0.6638 0.6341 -0.0333 -0.0374 -0.0560 178 GLN A NE2 
1372 N  N   . TRP A 179 ? 0.3466 0.4097 0.3587 -0.0060 -0.0348 -0.0510 179 TRP A N   
1373 C  CA  . TRP A 179 ? 0.2276 0.2892 0.2307 -0.0002 -0.0377 -0.0509 179 TRP A CA  
1374 C  C   . TRP A 179 ? 0.2447 0.3095 0.2481 0.0049  -0.0373 -0.0482 179 TRP A C   
1375 O  O   . TRP A 179 ? 0.2913 0.3607 0.2932 0.0093  -0.0418 -0.0489 179 TRP A O   
1376 C  CB  . TRP A 179 ? 0.2139 0.2654 0.2054 0.0012  -0.0350 -0.0495 179 TRP A CB  
1377 C  CG  . TRP A 179 ? 0.2233 0.2730 0.2043 0.0066  -0.0380 -0.0494 179 TRP A CG  
1378 C  CD1 . TRP A 179 ? 0.2305 0.2793 0.2054 0.0074  -0.0419 -0.0527 179 TRP A CD1 
1379 C  CD2 . TRP A 179 ? 0.2940 0.3419 0.2685 0.0121  -0.0375 -0.0458 179 TRP A CD2 
1380 N  NE1 . TRP A 179 ? 0.4594 0.5069 0.4241 0.0131  -0.0436 -0.0512 179 TRP A NE1 
1381 C  CE2 . TRP A 179 ? 0.3939 0.4403 0.3581 0.0159  -0.0410 -0.0466 179 TRP A CE2 
1382 C  CE3 . TRP A 179 ? 0.2877 0.3341 0.2632 0.0143  -0.0344 -0.0419 179 TRP A CE3 
1383 C  CZ2 . TRP A 179 ? 0.3886 0.4323 0.3438 0.0217  -0.0414 -0.0430 179 TRP A CZ2 
1384 C  CZ3 . TRP A 179 ? 0.2340 0.2767 0.2009 0.0199  -0.0350 -0.0387 179 TRP A CZ3 
1385 C  CH2 . TRP A 179 ? 0.3415 0.3829 0.2983 0.0235  -0.0384 -0.0389 179 TRP A CH2 
1386 N  N   . VAL A 180 ? 0.2823 0.3445 0.2875 0.0047  -0.0323 -0.0452 180 VAL A N   
1387 C  CA  . VAL A 180 ? 0.4172 0.4819 0.4234 0.0097  -0.0319 -0.0432 180 VAL A CA  
1388 C  C   . VAL A 180 ? 0.4067 0.4842 0.4233 0.0106  -0.0358 -0.0455 180 VAL A C   
1389 O  O   . VAL A 180 ? 0.3501 0.4315 0.3661 0.0164  -0.0388 -0.0451 180 VAL A O   
1390 C  CB  . VAL A 180 ? 0.4295 0.4896 0.4369 0.0085  -0.0260 -0.0407 180 VAL A CB  
1391 C  CG1 . VAL A 180 ? 0.4182 0.4824 0.4291 0.0135  -0.0259 -0.0397 180 VAL A CG1 
1392 C  CG2 . VAL A 180 ? 0.2742 0.3225 0.2712 0.0086  -0.0226 -0.0380 180 VAL A CG2 
1393 N  N   . HIS A 181 ? 0.3609 0.4455 0.3873 0.0048  -0.0361 -0.0479 181 HIS A N   
1394 C  CA  . HIS A 181 ? 0.4191 0.5177 0.4571 0.0045  -0.0392 -0.0500 181 HIS A CA  
1395 C  C   . HIS A 181 ? 0.5064 0.6105 0.5433 0.0076  -0.0462 -0.0524 181 HIS A C   
1396 O  O   . HIS A 181 ? 0.5521 0.6674 0.5959 0.0111  -0.0494 -0.0533 181 HIS A O   
1397 C  CB  . HIS A 181 ? 0.4480 0.5517 0.4959 -0.0036 -0.0380 -0.0515 181 HIS A CB  
1398 C  CG  . HIS A 181 ? 0.3993 0.5186 0.4607 -0.0051 -0.0399 -0.0531 181 HIS A CG  
1399 N  ND1 . HIS A 181 ? 0.4106 0.5383 0.4790 -0.0088 -0.0452 -0.0563 181 HIS A ND1 
1400 C  CD2 . HIS A 181 ? 0.4293 0.5580 0.4990 -0.0036 -0.0371 -0.0521 181 HIS A CD2 
1401 C  CE1 . HIS A 181 ? 0.4281 0.5706 0.5092 -0.0098 -0.0455 -0.0569 181 HIS A CE1 
1402 N  NE2 . HIS A 181 ? 0.4401 0.5837 0.5220 -0.0064 -0.0404 -0.0544 181 HIS A NE2 
1403 N  N   . ASP A 182 ? 0.4673 0.5643 0.4954 0.0071  -0.0488 -0.0536 182 ASP A N   
1404 C  CA  . ASP A 182 ? 0.3905 0.4926 0.4167 0.0095  -0.0559 -0.0566 182 ASP A CA  
1405 C  C   . ASP A 182 ? 0.4073 0.5037 0.4207 0.0172  -0.0577 -0.0545 182 ASP A C   
1406 O  O   . ASP A 182 ? 0.6292 0.7307 0.6403 0.0205  -0.0640 -0.0566 182 ASP A O   
1407 C  CB  . ASP A 182 ? 0.3899 0.4886 0.4144 0.0039  -0.0584 -0.0603 182 ASP A CB  
1408 C  CG  . ASP A 182 ? 0.4530 0.5551 0.4889 -0.0044 -0.0566 -0.0617 182 ASP A CG  
1409 O  OD1 . ASP A 182 ? 0.3776 0.4896 0.4250 -0.0061 -0.0553 -0.0611 182 ASP A OD1 
1410 O  OD2 . ASP A 182 ? 0.5848 0.6793 0.6176 -0.0089 -0.0563 -0.0635 182 ASP A OD2 
1411 N  N   . ASN A 183 ? 0.3244 0.4103 0.3291 0.0201  -0.0527 -0.0504 183 ASN A N   
1412 C  CA  . ASN A 183 ? 0.2375 0.3168 0.2292 0.0267  -0.0542 -0.0478 183 ASN A CA  
1413 C  C   . ASN A 183 ? 0.4450 0.5188 0.4331 0.0319  -0.0509 -0.0431 183 ASN A C   
1414 O  O   . ASN A 183 ? 0.5821 0.6524 0.5610 0.0382  -0.0532 -0.0407 183 ASN A O   
1415 C  CB  . ASN A 183 ? 0.2411 0.3099 0.2211 0.0248  -0.0522 -0.0475 183 ASN A CB  
1416 C  CG  . ASN A 183 ? 0.3502 0.4221 0.3324 0.0202  -0.0557 -0.0526 183 ASN A CG  
1417 O  OD1 . ASN A 183 ? 0.3418 0.4168 0.3193 0.0226  -0.0615 -0.0552 183 ASN A OD1 
1418 N  ND2 . ASN A 183 ? 0.2652 0.3356 0.2537 0.0137  -0.0525 -0.0540 183 ASN A ND2 
1419 N  N   . ILE A 184 ? 0.3976 0.4703 0.3920 0.0298  -0.0458 -0.0418 184 ILE A N   
1420 C  CA  . ILE A 184 ? 0.3883 0.4544 0.3787 0.0348  -0.0429 -0.0379 184 ILE A CA  
1421 C  C   . ILE A 184 ? 0.3169 0.3892 0.3084 0.0425  -0.0478 -0.0376 184 ILE A C   
1422 O  O   . ILE A 184 ? 0.2510 0.3153 0.2346 0.0485  -0.0475 -0.0340 184 ILE A O   
1423 C  CB  . ILE A 184 ? 0.4173 0.4831 0.4154 0.0314  -0.0374 -0.0377 184 ILE A CB  
1424 C  CG1 . ILE A 184 ? 0.3813 0.4342 0.3713 0.0338  -0.0330 -0.0337 184 ILE A CG1 
1425 C  CG2 . ILE A 184 ? 0.2231 0.3016 0.2335 0.0333  -0.0389 -0.0398 184 ILE A CG2 
1426 C  CD1 . ILE A 184 ? 0.3378 0.3791 0.3159 0.0318  -0.0310 -0.0311 184 ILE A CD1 
1427 N  N   . GLN A 185 ? 0.4126 0.4991 0.4140 0.0426  -0.0526 -0.0413 185 GLN A N   
1428 C  CA  . GLN A 185 ? 0.5329 0.6274 0.5366 0.0504  -0.0578 -0.0413 185 GLN A CA  
1429 C  C   . GLN A 185 ? 0.5185 0.6061 0.5082 0.0563  -0.0619 -0.0389 185 GLN A C   
1430 O  O   . GLN A 185 ? 0.5179 0.6053 0.5045 0.0643  -0.0647 -0.0366 185 GLN A O   
1431 C  CB  . GLN A 185 ? 0.5705 0.6830 0.5881 0.0482  -0.0625 -0.0460 185 GLN A CB  
1432 C  CG  . GLN A 185 ? 0.5527 0.6688 0.5680 0.0448  -0.0679 -0.0491 185 GLN A CG  
1433 C  CD  . GLN A 185 ? 0.5540 0.6874 0.5845 0.0406  -0.0720 -0.0539 185 GLN A CD  
1434 O  OE1 . GLN A 185 ? 0.4577 0.5963 0.4993 0.0343  -0.0684 -0.0552 185 GLN A OE1 
1435 N  NE2 . GLN A 185 ? 0.5657 0.7082 0.5968 0.0439  -0.0797 -0.0564 185 GLN A NE2 
1436 N  N   . PHE A 186 ? 0.4379 0.5196 0.4188 0.0528  -0.0622 -0.0391 186 PHE A N   
1437 C  CA  . PHE A 186 ? 0.3872 0.4618 0.3532 0.0579  -0.0652 -0.0364 186 PHE A CA  
1438 C  C   . PHE A 186 ? 0.4645 0.5234 0.4189 0.0605  -0.0600 -0.0303 186 PHE A C   
1439 O  O   . PHE A 186 ? 0.5443 0.5960 0.4855 0.0652  -0.0617 -0.0268 186 PHE A O   
1440 C  CB  . PHE A 186 ? 0.2759 0.3508 0.2368 0.0534  -0.0671 -0.0395 186 PHE A CB  
1441 C  CG  . PHE A 186 ? 0.3501 0.4390 0.3227 0.0497  -0.0722 -0.0456 186 PHE A CG  
1442 C  CD1 . PHE A 186 ? 0.2782 0.3789 0.2549 0.0545  -0.0797 -0.0478 186 PHE A CD1 
1443 C  CD2 . PHE A 186 ? 0.3787 0.4689 0.3581 0.0414  -0.0700 -0.0492 186 PHE A CD2 
1444 C  CE1 . PHE A 186 ? 0.2721 0.3862 0.2604 0.0504  -0.0847 -0.0535 186 PHE A CE1 
1445 C  CE2 . PHE A 186 ? 0.3891 0.4913 0.3794 0.0374  -0.0749 -0.0546 186 PHE A CE2 
1446 C  CZ  . PHE A 186 ? 0.2635 0.3779 0.2586 0.0415  -0.0822 -0.0568 186 PHE A CZ  
1447 N  N   . PHE A 187 ? 0.6127 0.6659 0.5714 0.0574  -0.0539 -0.0290 187 PHE A N   
1448 C  CA  . PHE A 187 ? 0.5870 0.6257 0.5365 0.0597  -0.0496 -0.0235 187 PHE A CA  
1449 C  C   . PHE A 187 ? 0.4620 0.5004 0.4172 0.0647  -0.0491 -0.0226 187 PHE A C   
1450 O  O   . PHE A 187 ? 0.5250 0.5510 0.4750 0.0656  -0.0451 -0.0189 187 PHE A O   
1451 C  CB  . PHE A 187 ? 0.5864 0.6171 0.5343 0.0523  -0.0428 -0.0228 187 PHE A CB  
1452 C  CG  . PHE A 187 ? 0.5519 0.5824 0.4938 0.0480  -0.0427 -0.0239 187 PHE A CG  
1453 C  CD1 . PHE A 187 ? 0.5025 0.5426 0.4525 0.0433  -0.0444 -0.0292 187 PHE A CD1 
1454 C  CD2 . PHE A 187 ? 0.4061 0.4265 0.3344 0.0487  -0.0406 -0.0197 187 PHE A CD2 
1455 C  CE1 . PHE A 187 ? 0.3549 0.3939 0.2992 0.0400  -0.0443 -0.0308 187 PHE A CE1 
1456 C  CE2 . PHE A 187 ? 0.3384 0.3593 0.2612 0.0455  -0.0401 -0.0212 187 PHE A CE2 
1457 C  CZ  . PHE A 187 ? 0.3366 0.3664 0.2672 0.0414  -0.0421 -0.0270 187 PHE A CZ  
1458 N  N   . GLY A 188 ? 0.4129 0.4649 0.3789 0.0679  -0.0533 -0.0260 188 GLY A N   
1459 C  CA  . GLY A 188 ? 0.3585 0.4116 0.3308 0.0730  -0.0526 -0.0258 188 GLY A CA  
1460 C  C   . GLY A 188 ? 0.3477 0.4017 0.3291 0.0674  -0.0468 -0.0278 188 GLY A C   
1461 O  O   . GLY A 188 ? 0.2902 0.3405 0.2738 0.0710  -0.0445 -0.0272 188 GLY A O   
1462 N  N   . GLY A 189 ? 0.3842 0.4419 0.3699 0.0589  -0.0444 -0.0302 189 GLY A N   
1463 C  CA  . GLY A 189 ? 0.5154 0.5769 0.5107 0.0536  -0.0397 -0.0325 189 GLY A CA  
1464 C  C   . GLY A 189 ? 0.5269 0.6065 0.5367 0.0537  -0.0422 -0.0365 189 GLY A C   
1465 O  O   . GLY A 189 ? 0.5662 0.6561 0.5797 0.0535  -0.0471 -0.0386 189 GLY A O   
1466 N  N   . ASP A 190 ? 0.4810 0.5647 0.4987 0.0540  -0.0387 -0.0377 190 ASP A N   
1467 C  CA  . ASP A 190 ? 0.3926 0.4942 0.4249 0.0529  -0.0395 -0.0412 190 ASP A CA  
1468 C  C   . ASP A 190 ? 0.2915 0.3965 0.3295 0.0429  -0.0361 -0.0428 190 ASP A C   
1469 O  O   . ASP A 190 ? 0.3087 0.4077 0.3460 0.0396  -0.0307 -0.0422 190 ASP A O   
1470 C  CB  . ASP A 190 ? 0.4533 0.5582 0.4908 0.0587  -0.0370 -0.0418 190 ASP A CB  
1471 C  CG  . ASP A 190 ? 0.7460 0.8713 0.7992 0.0578  -0.0372 -0.0452 190 ASP A CG  
1472 O  OD1 . ASP A 190 ? 0.7969 0.9335 0.8573 0.0524  -0.0399 -0.0469 190 ASP A OD1 
1473 O  OD2 . ASP A 190 ? 0.8622 0.9925 0.9207 0.0626  -0.0348 -0.0462 190 ASP A OD2 
1474 N  N   . PRO A 191 ? 0.2391 0.3531 0.2825 0.0378  -0.0393 -0.0449 191 PRO A N   
1475 C  CA  . PRO A 191 ? 0.2179 0.3327 0.2654 0.0284  -0.0363 -0.0459 191 PRO A CA  
1476 C  C   . PRO A 191 ? 0.3841 0.5086 0.4428 0.0256  -0.0320 -0.0469 191 PRO A C   
1477 O  O   . PRO A 191 ? 0.4257 0.5500 0.4873 0.0181  -0.0289 -0.0471 191 PRO A O   
1478 C  CB  . PRO A 191 ? 0.2309 0.3540 0.2825 0.0248  -0.0418 -0.0484 191 PRO A CB  
1479 C  CG  . PRO A 191 ? 0.2444 0.3738 0.2955 0.0326  -0.0479 -0.0490 191 PRO A CG  
1480 C  CD  . PRO A 191 ? 0.2462 0.3732 0.2953 0.0407  -0.0459 -0.0470 191 PRO A CD  
1481 N  N   . LYS A 192 ? 0.4576 0.5907 0.5221 0.0318  -0.0318 -0.0474 192 LYS A N   
1482 C  CA  . LYS A 192 ? 0.5246 0.6680 0.5990 0.0303  -0.0274 -0.0484 192 LYS A CA  
1483 C  C   . LYS A 192 ? 0.5460 0.6784 0.6139 0.0327  -0.0219 -0.0471 192 LYS A C   
1484 O  O   . LYS A 192 ? 0.6317 0.7698 0.7052 0.0301  -0.0173 -0.0477 192 LYS A O   
1485 C  CB  . LYS A 192 ? 0.6074 0.7682 0.6926 0.0362  -0.0302 -0.0504 192 LYS A CB  
1486 C  CG  . LYS A 192 ? 0.6408 0.8134 0.7329 0.0345  -0.0366 -0.0521 192 LYS A CG  
1487 C  CD  . LYS A 192 ? 0.6565 0.8491 0.7616 0.0395  -0.0389 -0.0541 192 LYS A CD  
1488 C  CE  . LYS A 192 ? 0.6021 0.8122 0.7216 0.0312  -0.0399 -0.0561 192 LYS A CE  
1489 N  NZ  . LYS A 192 ? 0.5372 0.7536 0.6642 0.0257  -0.0330 -0.0557 192 LYS A NZ  
1490 N  N   . THR A 193 ? 0.4619 0.5790 0.5180 0.0374  -0.0223 -0.0453 193 THR A N   
1491 C  CA  . THR A 193 ? 0.4795 0.5849 0.5290 0.0394  -0.0177 -0.0444 193 THR A CA  
1492 C  C   . THR A 193 ? 0.4800 0.5695 0.5191 0.0342  -0.0160 -0.0422 193 THR A C   
1493 O  O   . THR A 193 ? 0.4254 0.5010 0.4544 0.0374  -0.0162 -0.0402 193 THR A O   
1494 C  CB  . THR A 193 ? 0.5299 0.6305 0.5752 0.0496  -0.0195 -0.0441 193 THR A CB  
1495 O  OG1 . THR A 193 ? 0.5664 0.6829 0.6213 0.0546  -0.0225 -0.0460 193 THR A OG1 
1496 C  CG2 . THR A 193 ? 0.4790 0.5718 0.5210 0.0523  -0.0150 -0.0446 193 THR A CG2 
1497 N  N   . VAL A 194 ? 0.4129 0.5047 0.4548 0.0261  -0.0142 -0.0423 194 VAL A N   
1498 C  CA  . VAL A 194 ? 0.3791 0.4586 0.4129 0.0209  -0.0127 -0.0406 194 VAL A CA  
1499 C  C   . VAL A 194 ? 0.4562 0.5320 0.4896 0.0172  -0.0074 -0.0405 194 VAL A C   
1500 O  O   . VAL A 194 ? 0.3395 0.4249 0.3805 0.0143  -0.0052 -0.0417 194 VAL A O   
1501 C  CB  . VAL A 194 ? 0.2627 0.3459 0.2987 0.0152  -0.0152 -0.0410 194 VAL A CB  
1502 C  CG1 . VAL A 194 ? 0.1878 0.2612 0.2178 0.0096  -0.0127 -0.0397 194 VAL A CG1 
1503 C  CG2 . VAL A 194 ? 0.2474 0.3303 0.2798 0.0191  -0.0203 -0.0409 194 VAL A CG2 
1504 N  N   . THR A 195 ? 0.5032 0.5655 0.5277 0.0173  -0.0056 -0.0390 195 THR A N   
1505 C  CA  . THR A 195 ? 0.3575 0.4152 0.3803 0.0137  -0.0013 -0.0390 195 THR A CA  
1506 C  C   . THR A 195 ? 0.3083 0.3573 0.3253 0.0085  -0.0006 -0.0372 195 THR A C   
1507 O  O   . THR A 195 ? 0.1942 0.2336 0.2038 0.0099  -0.0016 -0.0355 195 THR A O   
1508 C  CB  . THR A 195 ? 0.3296 0.3793 0.3476 0.0186  0.0004  -0.0393 195 THR A CB  
1509 O  OG1 . THR A 195 ? 0.3674 0.4253 0.3906 0.0248  -0.0004 -0.0412 195 THR A OG1 
1510 C  CG2 . THR A 195 ? 0.3195 0.3658 0.3360 0.0148  0.0043  -0.0399 195 THR A CG2 
1511 N  N   . ILE A 196 ? 0.3949 0.4475 0.4151 0.0027  0.0011  -0.0373 196 ILE A N   
1512 C  CA  . ILE A 196 ? 0.3790 0.4241 0.3943 -0.0019 0.0021  -0.0359 196 ILE A CA  
1513 C  C   . ILE A 196 ? 0.3137 0.3529 0.3256 -0.0029 0.0054  -0.0358 196 ILE A C   
1514 O  O   . ILE A 196 ? 0.4218 0.4652 0.4367 -0.0023 0.0074  -0.0370 196 ILE A O   
1515 C  CB  . ILE A 196 ? 0.2378 0.2886 0.2578 -0.0071 0.0018  -0.0361 196 ILE A CB  
1516 C  CG1 . ILE A 196 ? 0.1837 0.2417 0.2097 -0.0097 0.0043  -0.0367 196 ILE A CG1 
1517 C  CG2 . ILE A 196 ? 0.1813 0.2381 0.2050 -0.0062 -0.0020 -0.0370 196 ILE A CG2 
1518 C  CD1 . ILE A 196 ? 0.1870 0.2483 0.2167 -0.0152 0.0043  -0.0361 196 ILE A CD1 
1519 N  N   . PHE A 197 ? 0.2783 0.3083 0.2840 -0.0045 0.0061  -0.0343 197 PHE A N   
1520 C  CA  . PHE A 197 ? 0.3840 0.4084 0.3866 -0.0060 0.0087  -0.0344 197 PHE A CA  
1521 C  C   . PHE A 197 ? 0.4123 0.4311 0.4110 -0.0099 0.0093  -0.0328 197 PHE A C   
1522 O  O   . PHE A 197 ? 0.5796 0.5955 0.5755 -0.0097 0.0080  -0.0314 197 PHE A O   
1523 C  CB  . PHE A 197 ? 0.3170 0.3346 0.3159 -0.0016 0.0088  -0.0350 197 PHE A CB  
1524 C  CG  . PHE A 197 ? 0.3609 0.3697 0.3539 0.0005  0.0073  -0.0329 197 PHE A CG  
1525 C  CD1 . PHE A 197 ? 0.3491 0.3604 0.3421 0.0031  0.0047  -0.0319 197 PHE A CD1 
1526 C  CD2 . PHE A 197 ? 0.3618 0.3598 0.3490 0.0000  0.0084  -0.0320 197 PHE A CD2 
1527 C  CE1 . PHE A 197 ? 0.3204 0.3237 0.3070 0.0053  0.0035  -0.0295 197 PHE A CE1 
1528 C  CE2 . PHE A 197 ? 0.3037 0.2932 0.2851 0.0017  0.0074  -0.0294 197 PHE A CE2 
1529 C  CZ  . PHE A 197 ? 0.2974 0.2896 0.2782 0.0046  0.0051  -0.0280 197 PHE A CZ  
1530 N  N   . GLY A 198 ? 0.2860 0.3045 0.2849 -0.0133 0.0112  -0.0331 198 GLY A N   
1531 C  CA  . GLY A 198 ? 0.3905 0.4063 0.3874 -0.0170 0.0117  -0.0318 198 GLY A CA  
1532 C  C   . GLY A 198 ? 0.3082 0.3222 0.3040 -0.0196 0.0135  -0.0324 198 GLY A C   
1533 O  O   . GLY A 198 ? 0.2084 0.2243 0.2052 -0.0190 0.0144  -0.0340 198 GLY A O   
1534 N  N   . GLU A 199 ? 0.3283 0.3394 0.3222 -0.0223 0.0139  -0.0312 199 GLU A N   
1535 C  CA  . GLU A 199 ? 0.3030 0.3123 0.2957 -0.0250 0.0150  -0.0318 199 GLU A CA  
1536 C  C   . GLU A 199 ? 0.2511 0.2648 0.2457 -0.0279 0.0151  -0.0311 199 GLU A C   
1537 O  O   . GLU A 199 ? 0.2117 0.2265 0.2069 -0.0282 0.0147  -0.0298 199 GLU A O   
1538 C  CB  . GLU A 199 ? 0.3239 0.3257 0.3130 -0.0260 0.0153  -0.0311 199 GLU A CB  
1539 C  CG  . GLU A 199 ? 0.4995 0.4982 0.4872 -0.0283 0.0158  -0.0327 199 GLU A CG  
1540 C  CD  . GLU A 199 ? 0.6998 0.7014 0.6888 -0.0324 0.0161  -0.0320 199 GLU A CD  
1541 O  OE1 . GLU A 199 ? 0.6485 0.6534 0.6390 -0.0330 0.0162  -0.0302 199 GLU A OE1 
1542 O  OE2 . GLU A 199 ? 0.8635 0.8643 0.8520 -0.0346 0.0160  -0.0337 199 GLU A OE2 
1543 N  N   . SER A 200 ? 0.1731 0.1894 0.1684 -0.0295 0.0155  -0.0321 200 SER A N   
1544 C  CA  . SER A 200 ? 0.2207 0.2405 0.2172 -0.0318 0.0154  -0.0313 200 SER A CA  
1545 C  C   . SER A 200 ? 0.2504 0.2738 0.2495 -0.0313 0.0148  -0.0301 200 SER A C   
1546 O  O   . SER A 200 ? 0.2053 0.2316 0.2060 -0.0307 0.0149  -0.0302 200 SER A O   
1547 C  CB  . SER A 200 ? 0.2912 0.3093 0.2871 -0.0337 0.0154  -0.0305 200 SER A CB  
1548 O  OG  . SER A 200 ? 0.4291 0.4513 0.4266 -0.0351 0.0150  -0.0297 200 SER A OG  
1549 N  N   . ALA A 201 ? 0.2610 0.2843 0.2606 -0.0315 0.0142  -0.0290 201 ALA A N   
1550 C  CA  . ALA A 201 ? 0.2198 0.2447 0.2213 -0.0308 0.0133  -0.0284 201 ALA A CA  
1551 C  C   . ALA A 201 ? 0.2389 0.2637 0.2412 -0.0291 0.0127  -0.0291 201 ALA A C   
1552 O  O   . ALA A 201 ? 0.2874 0.3148 0.2922 -0.0293 0.0121  -0.0291 201 ALA A O   
1553 C  CB  . ALA A 201 ? 0.2921 0.3164 0.2933 -0.0305 0.0128  -0.0279 201 ALA A CB  
1554 N  N   . GLY A 202 ? 0.2403 0.2621 0.2403 -0.0275 0.0129  -0.0294 202 GLY A N   
1555 C  CA  . GLY A 202 ? 0.3367 0.3589 0.3373 -0.0252 0.0119  -0.0300 202 GLY A CA  
1556 C  C   . GLY A 202 ? 0.4722 0.4978 0.4753 -0.0246 0.0124  -0.0309 202 GLY A C   
1557 O  O   . GLY A 202 ? 0.4723 0.5015 0.4784 -0.0234 0.0114  -0.0315 202 GLY A O   
1558 N  N   . GLY A 203 ? 0.4297 0.4550 0.4319 -0.0255 0.0139  -0.0314 203 GLY A N   
1559 C  CA  . GLY A 203 ? 0.3066 0.3359 0.3105 -0.0248 0.0149  -0.0325 203 GLY A CA  
1560 C  C   . GLY A 203 ? 0.3659 0.4011 0.3733 -0.0270 0.0152  -0.0316 203 GLY A C   
1561 O  O   . GLY A 203 ? 0.1643 0.2049 0.1751 -0.0264 0.0157  -0.0319 203 GLY A O   
1562 N  N   . ALA A 204 ? 0.2271 0.2613 0.2336 -0.0294 0.0151  -0.0303 204 ALA A N   
1563 C  CA  . ALA A 204 ? 0.3114 0.3490 0.3205 -0.0316 0.0150  -0.0287 204 ALA A CA  
1564 C  C   . ALA A 204 ? 0.3202 0.3594 0.3332 -0.0315 0.0136  -0.0287 204 ALA A C   
1565 O  O   . ALA A 204 ? 0.2942 0.3381 0.3110 -0.0330 0.0139  -0.0281 204 ALA A O   
1566 C  CB  . ALA A 204 ? 0.3603 0.3953 0.3677 -0.0333 0.0144  -0.0273 204 ALA A CB  
1567 N  N   . SER A 205 ? 0.3956 0.4314 0.4075 -0.0300 0.0119  -0.0295 205 SER A N   
1568 C  CA  . SER A 205 ? 0.3311 0.3682 0.3458 -0.0296 0.0099  -0.0300 205 SER A CA  
1569 C  C   . SER A 205 ? 0.2581 0.3009 0.2766 -0.0285 0.0099  -0.0309 205 SER A C   
1570 O  O   . SER A 205 ? 0.2675 0.3150 0.2909 -0.0303 0.0090  -0.0309 205 SER A O   
1571 C  CB  . SER A 205 ? 0.2796 0.3123 0.2908 -0.0275 0.0085  -0.0307 205 SER A CB  
1572 O  OG  . SER A 205 ? 0.4061 0.4350 0.4145 -0.0283 0.0089  -0.0299 205 SER A OG  
1573 N  N   . VAL A 206 ? 0.1626 0.2053 0.1794 -0.0254 0.0107  -0.0319 206 VAL A N   
1574 C  CA  . VAL A 206 ? 0.1633 0.2121 0.1838 -0.0233 0.0110  -0.0330 206 VAL A CA  
1575 C  C   . VAL A 206 ? 0.2968 0.3526 0.3217 -0.0260 0.0129  -0.0323 206 VAL A C   
1576 O  O   . VAL A 206 ? 0.3077 0.3710 0.3386 -0.0267 0.0124  -0.0325 206 VAL A O   
1577 C  CB  . VAL A 206 ? 0.3233 0.3690 0.3401 -0.0196 0.0122  -0.0340 206 VAL A CB  
1578 C  CG1 . VAL A 206 ? 0.1674 0.2203 0.1881 -0.0171 0.0133  -0.0353 206 VAL A CG1 
1579 C  CG2 . VAL A 206 ? 0.1693 0.2088 0.1823 -0.0167 0.0103  -0.0341 206 VAL A CG2 
1580 N  N   . GLY A 207 ? 0.2053 0.2595 0.2275 -0.0278 0.0150  -0.0313 207 GLY A N   
1581 C  CA  . GLY A 207 ? 0.2262 0.2867 0.2513 -0.0305 0.0171  -0.0300 207 GLY A CA  
1582 C  C   . GLY A 207 ? 0.2883 0.3511 0.3181 -0.0344 0.0159  -0.0284 207 GLY A C   
1583 O  O   . GLY A 207 ? 0.3826 0.4532 0.4179 -0.0363 0.0169  -0.0277 207 GLY A O   
1584 N  N   . MET A 208 ? 0.3075 0.3637 0.3354 -0.0357 0.0136  -0.0278 208 MET A N   
1585 C  CA  . MET A 208 ? 0.3427 0.3990 0.3743 -0.0396 0.0122  -0.0265 208 MET A CA  
1586 C  C   . MET A 208 ? 0.3586 0.4201 0.3962 -0.0397 0.0101  -0.0280 208 MET A C   
1587 O  O   . MET A 208 ? 0.3320 0.3966 0.3747 -0.0437 0.0094  -0.0271 208 MET A O   
1588 C  CB  . MET A 208 ? 0.2334 0.2810 0.2611 -0.0400 0.0102  -0.0261 208 MET A CB  
1589 C  CG  . MET A 208 ? 0.3524 0.3961 0.3749 -0.0395 0.0118  -0.0248 208 MET A CG  
1590 S  SD  . MET A 208 ? 0.3928 0.4281 0.4114 -0.0389 0.0097  -0.0246 208 MET A SD  
1591 C  CE  . MET A 208 ? 0.2012 0.2355 0.2165 -0.0399 0.0115  -0.0219 208 MET A CE  
1592 N  N   . HIS A 209 ? 0.3429 0.4052 0.3799 -0.0357 0.0087  -0.0303 209 HIS A N   
1593 C  CA  . HIS A 209 ? 0.3833 0.4520 0.4261 -0.0354 0.0064  -0.0318 209 HIS A CA  
1594 C  C   . HIS A 209 ? 0.3587 0.4385 0.4082 -0.0360 0.0086  -0.0316 209 HIS A C   
1595 O  O   . HIS A 209 ? 0.3681 0.4552 0.4249 -0.0392 0.0076  -0.0315 209 HIS A O   
1596 C  CB  . HIS A 209 ? 0.3179 0.3842 0.3575 -0.0304 0.0041  -0.0338 209 HIS A CB  
1597 C  CG  . HIS A 209 ? 0.2402 0.2980 0.2747 -0.0302 0.0017  -0.0343 209 HIS A CG  
1598 N  ND1 . HIS A 209 ? 0.2307 0.2869 0.2670 -0.0333 -0.0009 -0.0349 209 HIS A ND1 
1599 C  CD2 . HIS A 209 ? 0.1644 0.2150 0.1919 -0.0274 0.0017  -0.0344 209 HIS A CD2 
1600 C  CE1 . HIS A 209 ? 0.3047 0.3534 0.3350 -0.0317 -0.0023 -0.0356 209 HIS A CE1 
1601 N  NE2 . HIS A 209 ? 0.2875 0.3334 0.3127 -0.0283 -0.0006 -0.0350 209 HIS A NE2 
1602 N  N   . ILE A 210 ? 0.2492 0.3308 0.2963 -0.0332 0.0118  -0.0315 210 ILE A N   
1603 C  CA  . ILE A 210 ? 0.1608 0.2533 0.2133 -0.0336 0.0148  -0.0311 210 ILE A CA  
1604 C  C   . ILE A 210 ? 0.1991 0.2955 0.2559 -0.0400 0.0163  -0.0284 210 ILE A C   
1605 O  O   . ILE A 210 ? 0.3900 0.4972 0.4546 -0.0423 0.0172  -0.0280 210 ILE A O   
1606 C  CB  . ILE A 210 ? 0.2569 0.3480 0.3039 -0.0300 0.0181  -0.0316 210 ILE A CB  
1607 C  CG1 . ILE A 210 ? 0.1625 0.2517 0.2074 -0.0237 0.0168  -0.0343 210 ILE A CG1 
1608 C  CG2 . ILE A 210 ? 0.3450 0.4465 0.3958 -0.0313 0.0221  -0.0307 210 ILE A CG2 
1609 C  CD1 . ILE A 210 ? 0.2909 0.3780 0.3307 -0.0200 0.0195  -0.0355 210 ILE A CD1 
1610 N  N   . LEU A 211 ? 0.2472 0.3349 0.2991 -0.0431 0.0164  -0.0263 211 LEU A N   
1611 C  CA  . LEU A 211 ? 0.3595 0.4488 0.4144 -0.0492 0.0176  -0.0230 211 LEU A CA  
1612 C  C   . LEU A 211 ? 0.3891 0.4772 0.4494 -0.0535 0.0141  -0.0230 211 LEU A C   
1613 O  O   . LEU A 211 ? 0.4676 0.5609 0.5338 -0.0589 0.0151  -0.0208 211 LEU A O   
1614 C  CB  . LEU A 211 ? 0.2624 0.3428 0.3098 -0.0504 0.0189  -0.0205 211 LEU A CB  
1615 C  CG  . LEU A 211 ? 0.4207 0.5029 0.4628 -0.0472 0.0223  -0.0205 211 LEU A CG  
1616 C  CD1 . LEU A 211 ? 0.3575 0.4306 0.3919 -0.0473 0.0222  -0.0189 211 LEU A CD1 
1617 C  CD2 . LEU A 211 ? 0.5675 0.6605 0.6130 -0.0491 0.0264  -0.0186 211 LEU A CD2 
1618 N  N   . SER A 212 ? 0.3650 0.4469 0.4235 -0.0514 0.0101  -0.0255 212 SER A N   
1619 C  CA  . SER A 212 ? 0.3917 0.4698 0.4534 -0.0556 0.0065  -0.0259 212 SER A CA  
1620 C  C   . SER A 212 ? 0.3555 0.4442 0.4264 -0.0573 0.0045  -0.0277 212 SER A C   
1621 O  O   . SER A 212 ? 0.3852 0.4785 0.4569 -0.0526 0.0030  -0.0305 212 SER A O   
1622 C  CB  . SER A 212 ? 0.3847 0.4521 0.4400 -0.0527 0.0031  -0.0280 212 SER A CB  
1623 O  OG  . SER A 212 ? 0.4467 0.5101 0.5046 -0.0563 -0.0007 -0.0292 212 SER A OG  
1624 N  N   . PRO A 213 ? 0.3821 0.4748 0.4601 -0.0639 0.0042  -0.0262 213 PRO A N   
1625 C  CA  . PRO A 213 ? 0.3405 0.4446 0.4285 -0.0659 0.0018  -0.0282 213 PRO A CA  
1626 C  C   . PRO A 213 ? 0.3779 0.4785 0.4651 -0.0634 -0.0040 -0.0325 213 PRO A C   
1627 O  O   . PRO A 213 ? 0.4702 0.5808 0.5629 -0.0611 -0.0061 -0.0350 213 PRO A O   
1628 C  CB  . PRO A 213 ? 0.1796 0.2858 0.2744 -0.0748 0.0025  -0.0253 213 PRO A CB  
1629 C  CG  . PRO A 213 ? 0.1830 0.2764 0.2702 -0.0768 0.0044  -0.0218 213 PRO A CG  
1630 C  CD  . PRO A 213 ? 0.2989 0.3867 0.3764 -0.0699 0.0064  -0.0220 213 PRO A CD  
1631 N  N   . GLY A 214 ? 0.3426 0.4296 0.4224 -0.0630 -0.0066 -0.0334 214 GLY A N   
1632 C  CA  . GLY A 214 ? 0.4097 0.4936 0.4873 -0.0600 -0.0119 -0.0375 214 GLY A CA  
1633 C  C   . GLY A 214 ? 0.3306 0.4157 0.4028 -0.0521 -0.0120 -0.0392 214 GLY A C   
1634 O  O   . GLY A 214 ? 0.2675 0.3512 0.3375 -0.0492 -0.0163 -0.0423 214 GLY A O   
1635 N  N   . SER A 215 ? 0.2177 0.3046 0.2873 -0.0485 -0.0077 -0.0373 215 SER A N   
1636 C  CA  . SER A 215 ? 0.1687 0.2548 0.2327 -0.0414 -0.0076 -0.0384 215 SER A CA  
1637 C  C   . SER A 215 ? 0.3119 0.4095 0.3810 -0.0381 -0.0058 -0.0385 215 SER A C   
1638 O  O   . SER A 215 ? 0.1659 0.2628 0.2310 -0.0320 -0.0065 -0.0395 215 SER A O   
1639 C  CB  . SER A 215 ? 0.3464 0.4223 0.4012 -0.0391 -0.0046 -0.0367 215 SER A CB  
1640 O  OG  . SER A 215 ? 0.3719 0.4378 0.4222 -0.0415 -0.0058 -0.0365 215 SER A OG  
1641 N  N   . ARG A 216 ? 0.4238 0.5319 0.5014 -0.0418 -0.0035 -0.0373 216 ARG A N   
1642 C  CA  . ARG A 216 ? 0.4838 0.6025 0.5654 -0.0381 -0.0005 -0.0372 216 ARG A CA  
1643 C  C   . ARG A 216 ? 0.4975 0.6247 0.5835 -0.0332 -0.0040 -0.0399 216 ARG A C   
1644 O  O   . ARG A 216 ? 0.5860 0.7186 0.6724 -0.0275 -0.0023 -0.0404 216 ARG A O   
1645 C  CB  . ARG A 216 ? 0.5553 0.6851 0.6456 -0.0433 0.0030  -0.0353 216 ARG A CB  
1646 C  CG  . ARG A 216 ? 0.5641 0.6878 0.6524 -0.0497 0.0056  -0.0321 216 ARG A CG  
1647 C  CD  . ARG A 216 ? 0.5842 0.7156 0.6743 -0.0502 0.0114  -0.0298 216 ARG A CD  
1648 N  NE  . ARG A 216 ? 0.5961 0.7289 0.6896 -0.0580 0.0137  -0.0262 216 ARG A NE  
1649 C  CZ  . ARG A 216 ? 0.4985 0.6237 0.5854 -0.0598 0.0168  -0.0231 216 ARG A CZ  
1650 N  NH1 . ARG A 216 ? 0.5345 0.6604 0.6242 -0.0669 0.0187  -0.0194 216 ARG A NH1 
1651 N  NH2 . ARG A 216 ? 0.5898 0.7057 0.6670 -0.0550 0.0174  -0.0237 216 ARG A NH2 
1652 N  N   . ASP A 217 ? 0.4044 0.5333 0.4937 -0.0350 -0.0091 -0.0418 217 ASP A N   
1653 C  CA  . ASP A 217 ? 0.3210 0.4598 0.4153 -0.0304 -0.0129 -0.0442 217 ASP A CA  
1654 C  C   . ASP A 217 ? 0.3190 0.4487 0.4036 -0.0237 -0.0161 -0.0454 217 ASP A C   
1655 O  O   . ASP A 217 ? 0.1714 0.3078 0.2583 -0.0187 -0.0196 -0.0471 217 ASP A O   
1656 C  CB  . ASP A 217 ? 0.3880 0.5359 0.4921 -0.0362 -0.0171 -0.0459 217 ASP A CB  
1657 C  CG  . ASP A 217 ? 0.6271 0.7891 0.7434 -0.0416 -0.0137 -0.0444 217 ASP A CG  
1658 O  OD1 . ASP A 217 ? 0.5905 0.7580 0.7078 -0.0389 -0.0086 -0.0429 217 ASP A OD1 
1659 O  OD2 . ASP A 217 ? 0.7564 0.9238 0.8808 -0.0488 -0.0160 -0.0449 217 ASP A OD2 
1660 N  N   . LEU A 218 ? 0.3646 0.4799 0.4386 -0.0231 -0.0148 -0.0443 218 LEU A N   
1661 C  CA  . LEU A 218 ? 0.3834 0.4894 0.4477 -0.0178 -0.0173 -0.0449 218 LEU A CA  
1662 C  C   . LEU A 218 ? 0.4476 0.5494 0.5059 -0.0114 -0.0146 -0.0436 218 LEU A C   
1663 O  O   . LEU A 218 ? 0.4677 0.5605 0.5171 -0.0074 -0.0159 -0.0432 218 LEU A O   
1664 C  CB  . LEU A 218 ? 0.3118 0.4054 0.3684 -0.0210 -0.0176 -0.0445 218 LEU A CB  
1665 C  CG  . LEU A 218 ? 0.2989 0.3951 0.3608 -0.0268 -0.0211 -0.0464 218 LEU A CG  
1666 C  CD1 . LEU A 218 ? 0.3266 0.4112 0.3827 -0.0306 -0.0202 -0.0458 218 LEU A CD1 
1667 C  CD2 . LEU A 218 ? 0.2002 0.2996 0.2616 -0.0239 -0.0271 -0.0492 218 LEU A CD2 
1668 N  N   . PHE A 219 ? 0.3957 0.5033 0.4583 -0.0105 -0.0107 -0.0429 219 PHE A N   
1669 C  CA  . PHE A 219 ? 0.3359 0.4388 0.3930 -0.0044 -0.0084 -0.0423 219 PHE A CA  
1670 C  C   . PHE A 219 ? 0.3331 0.4474 0.3979 -0.0026 -0.0055 -0.0429 219 PHE A C   
1671 O  O   . PHE A 219 ? 0.3186 0.4439 0.3924 -0.0070 -0.0045 -0.0431 219 PHE A O   
1672 C  CB  . PHE A 219 ? 0.2727 0.3625 0.3208 -0.0057 -0.0051 -0.0407 219 PHE A CB  
1673 C  CG  . PHE A 219 ? 0.2222 0.3134 0.2729 -0.0113 -0.0012 -0.0397 219 PHE A CG  
1674 C  CD1 . PHE A 219 ? 0.2243 0.3151 0.2771 -0.0175 -0.0018 -0.0391 219 PHE A CD1 
1675 C  CD2 . PHE A 219 ? 0.2079 0.3002 0.2583 -0.0099 0.0029  -0.0394 219 PHE A CD2 
1676 C  CE1 . PHE A 219 ? 0.2865 0.3778 0.3408 -0.0224 0.0016  -0.0377 219 PHE A CE1 
1677 C  CE2 . PHE A 219 ? 0.2125 0.3062 0.2643 -0.0147 0.0064  -0.0383 219 PHE A CE2 
1678 C  CZ  . PHE A 219 ? 0.2220 0.3151 0.2756 -0.0210 0.0057  -0.0371 219 PHE A CZ  
1679 N  N   . ARG A 220 ? 0.2481 0.3592 0.3089 0.0039  -0.0041 -0.0431 220 ARG A N   
1680 C  CA  . ARG A 220 ? 0.2805 0.4018 0.3473 0.0076  -0.0013 -0.0443 220 ARG A CA  
1681 C  C   . ARG A 220 ? 0.3483 0.4641 0.4106 0.0068  0.0039  -0.0439 220 ARG A C   
1682 O  O   . ARG A 220 ? 0.4495 0.5748 0.5175 0.0044  0.0074  -0.0441 220 ARG A O   
1683 C  CB  . ARG A 220 ? 0.3407 0.4626 0.4064 0.0166  -0.0041 -0.0455 220 ARG A CB  
1684 C  CG  . ARG A 220 ? 0.4476 0.5796 0.5190 0.0224  -0.0015 -0.0473 220 ARG A CG  
1685 C  CD  . ARG A 220 ? 0.6054 0.7573 0.6901 0.0223  -0.0030 -0.0486 220 ARG A CD  
1686 N  NE  . ARG A 220 ? 0.7217 0.8839 0.8116 0.0300  -0.0014 -0.0506 220 ARG A NE  
1687 C  CZ  . ARG A 220 ? 0.7461 0.9132 0.8384 0.0382  -0.0051 -0.0519 220 ARG A CZ  
1688 N  NH1 . ARG A 220 ? 0.6365 0.7991 0.7260 0.0396  -0.0108 -0.0512 220 ARG A NH1 
1689 N  NH2 . ARG A 220 ? 0.7707 0.9472 0.8679 0.0456  -0.0032 -0.0539 220 ARG A NH2 
1690 N  N   . ARG A 221 ? 0.2169 0.3179 0.2690 0.0086  0.0044  -0.0433 221 ARG A N   
1691 C  CA  . ARG A 221 ? 0.2619 0.3569 0.3090 0.0085  0.0085  -0.0434 221 ARG A CA  
1692 C  C   . ARG A 221 ? 0.3205 0.4020 0.3594 0.0041  0.0088  -0.0417 221 ARG A C   
1693 O  O   . ARG A 221 ? 0.4681 0.5451 0.5050 0.0017  0.0062  -0.0405 221 ARG A O   
1694 C  CB  . ARG A 221 ? 0.2910 0.3816 0.3343 0.0164  0.0090  -0.0452 221 ARG A CB  
1695 C  CG  . ARG A 221 ? 0.2395 0.3395 0.2888 0.0231  0.0067  -0.0467 221 ARG A CG  
1696 C  CD  . ARG A 221 ? 0.3592 0.4572 0.4061 0.0304  0.0087  -0.0490 221 ARG A CD  
1697 N  NE  . ARG A 221 ? 0.5397 0.6371 0.5866 0.0388  0.0054  -0.0498 221 ARG A NE  
1698 C  CZ  . ARG A 221 ? 0.5024 0.6146 0.5584 0.0434  0.0039  -0.0511 221 ARG A CZ  
1699 N  NH1 . ARG A 221 ? 0.3943 0.5233 0.4604 0.0395  0.0058  -0.0517 221 ARG A NH1 
1700 N  NH2 . ARG A 221 ? 0.4496 0.5597 0.5045 0.0518  0.0005  -0.0517 221 ARG A NH2 
1701 N  N   . ALA A 222 ? 0.2320 0.3077 0.2660 0.0035  0.0119  -0.0420 222 ALA A N   
1702 C  CA  . ALA A 222 ? 0.3268 0.3928 0.3547 -0.0013 0.0126  -0.0405 222 ALA A CA  
1703 C  C   . ALA A 222 ? 0.3620 0.4185 0.3829 0.0005  0.0144  -0.0415 222 ALA A C   
1704 O  O   . ALA A 222 ? 0.4557 0.5155 0.4769 0.0028  0.0168  -0.0434 222 ALA A O   
1705 C  CB  . ALA A 222 ? 0.1719 0.2440 0.2034 -0.0074 0.0144  -0.0393 222 ALA A CB  
1706 N  N   . ILE A 223 ? 0.3449 0.3901 0.3595 -0.0006 0.0133  -0.0404 223 ILE A N   
1707 C  CA  . ILE A 223 ? 0.2705 0.3064 0.2788 -0.0012 0.0148  -0.0410 223 ILE A CA  
1708 C  C   . ILE A 223 ? 0.2760 0.3100 0.2828 -0.0072 0.0154  -0.0394 223 ILE A C   
1709 O  O   . ILE A 223 ? 0.3442 0.3787 0.3522 -0.0097 0.0140  -0.0375 223 ILE A O   
1710 C  CB  . ILE A 223 ? 0.2217 0.2459 0.2242 0.0021  0.0133  -0.0409 223 ILE A CB  
1711 C  CG1 . ILE A 223 ? 0.2227 0.2482 0.2263 0.0091  0.0127  -0.0427 223 ILE A CG1 
1712 C  CG2 . ILE A 223 ? 0.1997 0.2139 0.1962 -0.0003 0.0144  -0.0413 223 ILE A CG2 
1713 C  CD1 . ILE A 223 ? 0.2051 0.2280 0.2080 0.0127  0.0097  -0.0411 223 ILE A CD1 
1714 N  N   . LEU A 224 ? 0.2931 0.3255 0.2972 -0.0092 0.0172  -0.0404 224 LEU A N   
1715 C  CA  . LEU A 224 ? 0.3204 0.3512 0.3229 -0.0143 0.0176  -0.0389 224 LEU A CA  
1716 C  C   . LEU A 224 ? 0.3759 0.3986 0.3728 -0.0149 0.0180  -0.0403 224 LEU A C   
1717 O  O   . LEU A 224 ? 0.4015 0.4239 0.3965 -0.0130 0.0192  -0.0429 224 LEU A O   
1718 C  CB  . LEU A 224 ? 0.2673 0.3066 0.2729 -0.0169 0.0192  -0.0384 224 LEU A CB  
1719 C  CG  . LEU A 224 ? 0.2618 0.3099 0.2736 -0.0179 0.0191  -0.0370 224 LEU A CG  
1720 C  CD1 . LEU A 224 ? 0.2647 0.3201 0.2804 -0.0142 0.0200  -0.0386 224 LEU A CD1 
1721 C  CD2 . LEU A 224 ? 0.4214 0.4736 0.4339 -0.0220 0.0205  -0.0353 224 LEU A CD2 
1722 N  N   . GLN A 225 ? 0.3625 0.3792 0.3571 -0.0177 0.0171  -0.0389 225 GLN A N   
1723 C  CA  . GLN A 225 ? 0.3279 0.3371 0.3181 -0.0192 0.0171  -0.0400 225 GLN A CA  
1724 C  C   . GLN A 225 ? 0.3081 0.3194 0.2984 -0.0238 0.0172  -0.0389 225 GLN A C   
1725 O  O   . GLN A 225 ? 0.2458 0.2581 0.2377 -0.0257 0.0166  -0.0366 225 GLN A O   
1726 C  CB  . GLN A 225 ? 0.2940 0.2941 0.2815 -0.0183 0.0161  -0.0390 225 GLN A CB  
1727 C  CG  . GLN A 225 ? 0.3236 0.3225 0.3114 -0.0131 0.0155  -0.0392 225 GLN A CG  
1728 C  CD  . GLN A 225 ? 0.4111 0.4010 0.3955 -0.0121 0.0144  -0.0372 225 GLN A CD  
1729 O  OE1 . GLN A 225 ? 0.2993 0.2889 0.2838 -0.0080 0.0134  -0.0364 225 GLN A OE1 
1730 N  NE2 . GLN A 225 ? 0.5657 0.5486 0.5471 -0.0158 0.0147  -0.0363 225 GLN A NE2 
1731 N  N   . SER A 226 ? 0.3524 0.3651 0.3409 -0.0251 0.0177  -0.0408 226 SER A N   
1732 C  CA  . SER A 226 ? 0.3850 0.3995 0.3731 -0.0289 0.0172  -0.0400 226 SER A CA  
1733 C  C   . SER A 226 ? 0.3502 0.3708 0.3418 -0.0302 0.0171  -0.0371 226 SER A C   
1734 O  O   . SER A 226 ? 0.4063 0.4271 0.3986 -0.0325 0.0164  -0.0356 226 SER A O   
1735 C  CB  . SER A 226 ? 0.3578 0.3661 0.3446 -0.0316 0.0163  -0.0399 226 SER A CB  
1736 O  OG  . SER A 226 ? 0.5422 0.5433 0.5256 -0.0310 0.0160  -0.0426 226 SER A OG  
1737 N  N   . GLY A 227 ? 0.3038 0.3293 0.2977 -0.0286 0.0179  -0.0365 227 GLY A N   
1738 C  CA  . GLY A 227 ? 0.3542 0.3841 0.3513 -0.0299 0.0176  -0.0339 227 GLY A CA  
1739 C  C   . GLY A 227 ? 0.4190 0.4547 0.4188 -0.0289 0.0187  -0.0336 227 GLY A C   
1740 O  O   . GLY A 227 ? 0.1957 0.2324 0.1961 -0.0263 0.0195  -0.0352 227 GLY A O   
1741 N  N   . SER A 228 ? 0.4674 0.5069 0.4690 -0.0309 0.0189  -0.0313 228 SER A N   
1742 C  CA  . SER A 228 ? 0.3564 0.4023 0.3609 -0.0310 0.0204  -0.0306 228 SER A CA  
1743 C  C   . SER A 228 ? 0.2200 0.2671 0.2268 -0.0338 0.0197  -0.0275 228 SER A C   
1744 O  O   . SER A 228 ? 0.1654 0.2090 0.1704 -0.0351 0.0185  -0.0262 228 SER A O   
1745 C  CB  . SER A 228 ? 0.3546 0.4040 0.3560 -0.0304 0.0225  -0.0316 228 SER A CB  
1746 O  OG  . SER A 228 ? 0.3531 0.4025 0.3513 -0.0326 0.0225  -0.0299 228 SER A OG  
1747 N  N   . PRO A 229 ? 0.2672 0.3190 0.2784 -0.0349 0.0204  -0.0263 229 PRO A N   
1748 C  CA  . PRO A 229 ? 0.3371 0.3877 0.3505 -0.0378 0.0191  -0.0237 229 PRO A CA  
1749 C  C   . PRO A 229 ? 0.3907 0.4404 0.4011 -0.0399 0.0197  -0.0209 229 PRO A C   
1750 O  O   . PRO A 229 ? 0.4356 0.4814 0.4464 -0.0414 0.0181  -0.0189 229 PRO A O   
1751 C  CB  . PRO A 229 ? 0.2301 0.2869 0.2495 -0.0390 0.0198  -0.0233 229 PRO A CB  
1752 C  CG  . PRO A 229 ? 0.1657 0.2287 0.1850 -0.0370 0.0224  -0.0248 229 PRO A CG  
1753 C  CD  . PRO A 229 ? 0.1696 0.2280 0.1845 -0.0336 0.0219  -0.0275 229 PRO A CD  
1754 N  N   . ASN A 230 ? 0.4584 0.5111 0.4652 -0.0395 0.0217  -0.0208 230 ASN A N   
1755 C  CA  . ASN A 230 ? 0.4316 0.4843 0.4347 -0.0413 0.0223  -0.0177 230 ASN A CA  
1756 C  C   . ASN A 230 ? 0.4756 0.5245 0.4737 -0.0401 0.0207  -0.0184 230 ASN A C   
1757 O  O   . ASN A 230 ? 0.4301 0.4799 0.4240 -0.0406 0.0210  -0.0164 230 ASN A O   
1758 C  CB  . ASN A 230 ? 0.1772 0.2368 0.1787 -0.0416 0.0256  -0.0171 230 ASN A CB  
1759 C  CG  . ASN A 230 ? 0.3567 0.4188 0.3564 -0.0384 0.0267  -0.0212 230 ASN A CG  
1760 O  OD1 . ASN A 230 ? 0.4370 0.4983 0.4398 -0.0366 0.0261  -0.0240 230 ASN A OD1 
1761 N  ND2 . ASN A 230 ? 0.2925 0.3567 0.2864 -0.0375 0.0281  -0.0219 230 ASN A ND2 
1762 N  N   . CYS A 231 ? 0.3883 0.4336 0.3869 -0.0386 0.0190  -0.0209 231 CYS A N   
1763 C  CA  . CYS A 231 ? 0.3748 0.4180 0.3698 -0.0380 0.0175  -0.0216 231 CYS A CA  
1764 C  C   . CYS A 231 ? 0.3846 0.4258 0.3792 -0.0387 0.0158  -0.0185 231 CYS A C   
1765 O  O   . CYS A 231 ? 0.3492 0.3882 0.3465 -0.0394 0.0152  -0.0166 231 CYS A O   
1766 C  CB  . CYS A 231 ? 0.3796 0.4197 0.3758 -0.0368 0.0164  -0.0244 231 CYS A CB  
1767 S  SG  . CYS A 231 ? 0.3316 0.3719 0.3268 -0.0353 0.0178  -0.0281 231 CYS A SG  
1768 N  N   . PRO A 232 ? 0.4224 0.4643 0.4133 -0.0383 0.0147  -0.0180 232 PRO A N   
1769 C  CA  . PRO A 232 ? 0.3678 0.4079 0.3579 -0.0381 0.0128  -0.0148 232 PRO A CA  
1770 C  C   . PRO A 232 ? 0.4000 0.4368 0.3935 -0.0370 0.0110  -0.0154 232 PRO A C   
1771 O  O   . PRO A 232 ? 0.4101 0.4439 0.4040 -0.0364 0.0097  -0.0129 232 PRO A O   
1772 C  CB  . PRO A 232 ? 0.3977 0.4406 0.3833 -0.0375 0.0117  -0.0150 232 PRO A CB  
1773 C  CG  . PRO A 232 ? 0.4948 0.5392 0.4804 -0.0375 0.0121  -0.0194 232 PRO A CG  
1774 C  CD  . PRO A 232 ? 0.4725 0.5165 0.4599 -0.0379 0.0145  -0.0207 232 PRO A CD  
1775 N  N   . TRP A 233 ? 0.2542 0.2912 0.2497 -0.0365 0.0110  -0.0184 233 TRP A N   
1776 C  CA  . TRP A 233 ? 0.4063 0.4412 0.4045 -0.0352 0.0099  -0.0190 233 TRP A CA  
1777 C  C   . TRP A 233 ? 0.3788 0.4105 0.3795 -0.0352 0.0103  -0.0193 233 TRP A C   
1778 O  O   . TRP A 233 ? 0.2190 0.2485 0.2213 -0.0338 0.0093  -0.0197 233 TRP A O   
1779 C  CB  . TRP A 233 ? 0.3274 0.3642 0.3263 -0.0351 0.0099  -0.0216 233 TRP A CB  
1780 C  CG  . TRP A 233 ? 0.2772 0.3139 0.2753 -0.0361 0.0114  -0.0237 233 TRP A CG  
1781 C  CD1 . TRP A 233 ? 0.2195 0.2578 0.2150 -0.0370 0.0117  -0.0251 233 TRP A CD1 
1782 C  CD2 . TRP A 233 ? 0.3729 0.4073 0.3724 -0.0358 0.0124  -0.0249 233 TRP A CD2 
1783 N  NE1 . TRP A 233 ? 0.2705 0.3071 0.2659 -0.0370 0.0131  -0.0272 233 TRP A NE1 
1784 C  CE2 . TRP A 233 ? 0.3134 0.3478 0.3113 -0.0362 0.0135  -0.0268 233 TRP A CE2 
1785 C  CE3 . TRP A 233 ? 0.2379 0.2701 0.2394 -0.0349 0.0122  -0.0247 233 TRP A CE3 
1786 C  CZ2 . TRP A 233 ? 0.2310 0.2633 0.2295 -0.0355 0.0143  -0.0281 233 TRP A CZ2 
1787 C  CZ3 . TRP A 233 ? 0.2668 0.2976 0.2687 -0.0345 0.0130  -0.0260 233 TRP A CZ3 
1788 C  CH2 . TRP A 233 ? 0.2489 0.2798 0.2495 -0.0346 0.0140  -0.0275 233 TRP A CH2 
1789 N  N   . ALA A 234 ? 0.3934 0.4254 0.3946 -0.0365 0.0116  -0.0192 234 ALA A N   
1790 C  CA  . ALA A 234 ? 0.3165 0.3471 0.3205 -0.0366 0.0117  -0.0202 234 ALA A CA  
1791 C  C   . ALA A 234 ? 0.2331 0.2609 0.2388 -0.0377 0.0108  -0.0184 234 ALA A C   
1792 O  O   . ALA A 234 ? 0.2617 0.2885 0.2699 -0.0380 0.0103  -0.0195 234 ALA A O   
1793 C  CB  . ALA A 234 ? 0.1647 0.1983 0.1692 -0.0370 0.0134  -0.0216 234 ALA A CB  
1794 N  N   . SER A 235 ? 0.2316 0.2576 0.2359 -0.0384 0.0102  -0.0155 235 SER A N   
1795 C  CA  . SER A 235 ? 0.2893 0.3108 0.2951 -0.0399 0.0091  -0.0137 235 SER A CA  
1796 C  C   . SER A 235 ? 0.3120 0.3290 0.3153 -0.0390 0.0076  -0.0109 235 SER A C   
1797 O  O   . SER A 235 ? 0.5100 0.5288 0.5106 -0.0372 0.0075  -0.0103 235 SER A O   
1798 C  CB  . SER A 235 ? 0.2979 0.3222 0.3056 -0.0433 0.0108  -0.0119 235 SER A CB  
1799 O  OG  . SER A 235 ? 0.3745 0.4051 0.3811 -0.0434 0.0132  -0.0123 235 SER A OG  
1800 N  N   . VAL A 236 ? 0.1881 0.1988 0.1923 -0.0400 0.0062  -0.0095 236 VAL A N   
1801 C  CA  . VAL A 236 ? 0.1955 0.2000 0.1970 -0.0389 0.0045  -0.0064 236 VAL A CA  
1802 C  C   . VAL A 236 ? 0.2917 0.2901 0.2944 -0.0425 0.0041  -0.0038 236 VAL A C   
1803 O  O   . VAL A 236 ? 0.5682 0.5667 0.5745 -0.0451 0.0042  -0.0055 236 VAL A O   
1804 C  CB  . VAL A 236 ? 0.2781 0.2788 0.2792 -0.0345 0.0023  -0.0086 236 VAL A CB  
1805 C  CG1 . VAL A 236 ? 0.1911 0.1982 0.1913 -0.0315 0.0027  -0.0100 236 VAL A CG1 
1806 C  CG2 . VAL A 236 ? 0.2178 0.2160 0.2214 -0.0340 0.0014  -0.0124 236 VAL A CG2 
1807 N  N   . SER A 237 ? 0.2111 0.2042 0.2107 -0.0429 0.0034  0.0007  237 SER A N   
1808 C  CA  . SER A 237 ? 0.3282 0.3130 0.3285 -0.0464 0.0025  0.0035  237 SER A CA  
1809 C  C   . SER A 237 ? 0.5305 0.5066 0.5321 -0.0443 -0.0006 0.0004  237 SER A C   
1810 O  O   . SER A 237 ? 0.5732 0.5492 0.5739 -0.0393 -0.0020 -0.0028 237 SER A O   
1811 C  CB  . SER A 237 ? 0.4830 0.4625 0.4785 -0.0465 0.0022  0.0094  237 SER A CB  
1812 O  OG  . SER A 237 ? 0.5667 0.5394 0.5596 -0.0412 -0.0008 0.0091  237 SER A OG  
1813 N  N   . VAL A 238 ? 0.5058 0.4746 0.5095 -0.0483 -0.0018 0.0012  238 VAL A N   
1814 C  CA  . VAL A 238 ? 0.3782 0.3372 0.3821 -0.0463 -0.0051 -0.0021 238 VAL A CA  
1815 C  C   . VAL A 238 ? 0.3528 0.3034 0.3521 -0.0410 -0.0071 -0.0005 238 VAL A C   
1816 O  O   . VAL A 238 ? 0.5011 0.4481 0.4996 -0.0360 -0.0092 -0.0045 238 VAL A O   
1817 C  CB  . VAL A 238 ? 0.4326 0.3844 0.4396 -0.0522 -0.0064 -0.0015 238 VAL A CB  
1818 C  CG1 . VAL A 238 ? 0.5803 0.5424 0.5925 -0.0574 -0.0042 -0.0022 238 VAL A CG1 
1819 C  CG2 . VAL A 238 ? 0.4382 0.3802 0.4427 -0.0552 -0.0068 0.0046  238 VAL A CG2 
1820 N  N   . ALA A 239 ? 0.3525 0.3008 0.3484 -0.0416 -0.0066 0.0052  239 ALA A N   
1821 C  CA  . ALA A 239 ? 0.4546 0.3947 0.4461 -0.0361 -0.0090 0.0072  239 ALA A CA  
1822 C  C   . ALA A 239 ? 0.5018 0.4498 0.4929 -0.0295 -0.0091 0.0038  239 ALA A C   
1823 O  O   . ALA A 239 ? 0.4162 0.3593 0.4065 -0.0239 -0.0114 0.0012  239 ALA A O   
1824 C  CB  . ALA A 239 ? 0.2685 0.2056 0.2558 -0.0380 -0.0083 0.0145  239 ALA A CB  
1825 N  N   . GLU A 240 ? 0.4585 0.4189 0.4501 -0.0301 -0.0067 0.0038  240 GLU A N   
1826 C  CA  . GLU A 240 ? 0.5004 0.4693 0.4925 -0.0250 -0.0066 0.0007  240 GLU A CA  
1827 C  C   . GLU A 240 ? 0.5122 0.4834 0.5076 -0.0236 -0.0065 -0.0052 240 GLU A C   
1828 O  O   . GLU A 240 ? 0.6105 0.5842 0.6062 -0.0184 -0.0073 -0.0081 240 GLU A O   
1829 C  CB  . GLU A 240 ? 0.4456 0.4259 0.4373 -0.0268 -0.0042 0.0019  240 GLU A CB  
1830 C  CG  . GLU A 240 ? 0.3457 0.3360 0.3393 -0.0240 -0.0035 -0.0022 240 GLU A CG  
1831 C  CD  . GLU A 240 ? 0.4525 0.4447 0.4450 -0.0185 -0.0055 -0.0018 240 GLU A CD  
1832 O  OE1 . GLU A 240 ? 0.4621 0.4617 0.4570 -0.0159 -0.0053 -0.0052 240 GLU A OE1 
1833 O  OE2 . GLU A 240 ? 0.4538 0.4403 0.4431 -0.0167 -0.0074 0.0021  240 GLU A OE2 
1834 N  N   . GLY A 241 ? 0.3949 0.3658 0.3926 -0.0278 -0.0056 -0.0071 241 GLY A N   
1835 C  CA  . GLY A 241 ? 0.4334 0.4047 0.4329 -0.0261 -0.0060 -0.0124 241 GLY A CA  
1836 C  C   . GLY A 241 ? 0.4299 0.3913 0.4279 -0.0219 -0.0088 -0.0145 241 GLY A C   
1837 O  O   . GLY A 241 ? 0.3904 0.3540 0.3882 -0.0172 -0.0091 -0.0183 241 GLY A O   
1838 N  N   . ARG A 242 ? 0.3904 0.3405 0.3869 -0.0235 -0.0108 -0.0119 242 ARG A N   
1839 C  CA  . ARG A 242 ? 0.3649 0.3035 0.3593 -0.0190 -0.0138 -0.0139 242 ARG A CA  
1840 C  C   . ARG A 242 ? 0.3610 0.3017 0.3536 -0.0117 -0.0144 -0.0137 242 ARG A C   
1841 O  O   . ARG A 242 ? 0.3686 0.3066 0.3604 -0.0059 -0.0157 -0.0177 242 ARG A O   
1842 C  CB  . ARG A 242 ? 0.2657 0.1908 0.2586 -0.0227 -0.0159 -0.0101 242 ARG A CB  
1843 C  CG  . ARG A 242 ? 0.2802 0.1905 0.2703 -0.0184 -0.0194 -0.0122 242 ARG A CG  
1844 C  CD  . ARG A 242 ? 0.2914 0.1892 0.2819 -0.0247 -0.0213 -0.0109 242 ARG A CD  
1845 N  NE  . ARG A 242 ? 0.4151 0.2999 0.4037 -0.0216 -0.0248 -0.0158 242 ARG A NE  
1846 C  CZ  . ARG A 242 ? 0.5691 0.4507 0.5594 -0.0251 -0.0263 -0.0206 242 ARG A CZ  
1847 N  NH1 . ARG A 242 ? 0.6707 0.5395 0.6584 -0.0218 -0.0298 -0.0254 242 ARG A NH1 
1848 N  NH2 . ARG A 242 ? 0.5083 0.3999 0.5028 -0.0314 -0.0245 -0.0209 242 ARG A NH2 
1849 N  N   . ARG A 243 ? 0.3232 0.2696 0.3152 -0.0115 -0.0134 -0.0093 243 ARG A N   
1850 C  CA  . ARG A 243 ? 0.3616 0.3098 0.3522 -0.0047 -0.0146 -0.0085 243 ARG A CA  
1851 C  C   . ARG A 243 ? 0.4547 0.4139 0.4479 -0.0005 -0.0133 -0.0133 243 ARG A C   
1852 O  O   . ARG A 243 ? 0.6128 0.5710 0.6059 0.0062  -0.0146 -0.0158 243 ARG A O   
1853 C  CB  . ARG A 243 ? 0.5362 0.4896 0.5254 -0.0060 -0.0141 -0.0031 243 ARG A CB  
1854 C  CG  . ARG A 243 ? 0.7444 0.6963 0.7315 0.0009  -0.0165 -0.0009 243 ARG A CG  
1855 C  CD  . ARG A 243 ? 0.6658 0.6304 0.6533 0.0018  -0.0159 0.0011  243 ARG A CD  
1856 N  NE  . ARG A 243 ? 0.5696 0.5472 0.5614 0.0038  -0.0144 -0.0035 243 ARG A NE  
1857 C  CZ  . ARG A 243 ? 0.5664 0.5546 0.5600 -0.0005 -0.0120 -0.0043 243 ARG A CZ  
1858 N  NH1 . ARG A 243 ? 0.6343 0.6218 0.6256 -0.0059 -0.0109 -0.0011 243 ARG A NH1 
1859 N  NH2 . ARG A 243 ? 0.5023 0.5013 0.4997 0.0007  -0.0106 -0.0080 243 ARG A NH2 
1860 N  N   . ARG A 244 ? 0.3514 0.3211 0.3470 -0.0043 -0.0106 -0.0147 244 ARG A N   
1861 C  CA  . ARG A 244 ? 0.4182 0.3981 0.4161 -0.0013 -0.0089 -0.0186 244 ARG A CA  
1862 C  C   . ARG A 244 ? 0.4607 0.4362 0.4582 0.0011  -0.0092 -0.0234 244 ARG A C   
1863 O  O   . ARG A 244 ? 0.5222 0.5025 0.5204 0.0063  -0.0087 -0.0265 244 ARG A O   
1864 C  CB  . ARG A 244 ? 0.3779 0.3684 0.3778 -0.0059 -0.0062 -0.0185 244 ARG A CB  
1865 C  CG  . ARG A 244 ? 0.4749 0.4676 0.4741 -0.0104 -0.0056 -0.0144 244 ARG A CG  
1866 C  CD  . ARG A 244 ? 0.4309 0.4327 0.4318 -0.0142 -0.0030 -0.0154 244 ARG A CD  
1867 N  NE  . ARG A 244 ? 0.3086 0.3147 0.3085 -0.0169 -0.0025 -0.0123 244 ARG A NE  
1868 C  CZ  . ARG A 244 ? 0.2162 0.2287 0.2168 -0.0203 -0.0005 -0.0128 244 ARG A CZ  
1869 N  NH1 . ARG A 244 ? 0.1852 0.2005 0.1876 -0.0214 0.0011  -0.0158 244 ARG A NH1 
1870 N  NH2 . ARG A 244 ? 0.2961 0.3118 0.2949 -0.0223 -0.0002 -0.0104 244 ARG A NH2 
1871 N  N   . ALA A 245 ? 0.3869 0.3543 0.3833 -0.0028 -0.0100 -0.0243 245 ALA A N   
1872 C  CA  . ALA A 245 ? 0.3528 0.3139 0.3477 -0.0002 -0.0113 -0.0291 245 ALA A CA  
1873 C  C   . ALA A 245 ? 0.4691 0.4235 0.4620 0.0071  -0.0133 -0.0305 245 ALA A C   
1874 O  O   . ALA A 245 ? 0.6284 0.5861 0.6208 0.0127  -0.0128 -0.0346 245 ALA A O   
1875 C  CB  . ALA A 245 ? 0.4399 0.3916 0.4342 -0.0056 -0.0129 -0.0293 245 ALA A CB  
1876 N  N   . VAL A 246 ? 0.3747 0.3205 0.3664 0.0075  -0.0155 -0.0267 246 VAL A N   
1877 C  CA  . VAL A 246 ? 0.4061 0.3436 0.3957 0.0149  -0.0180 -0.0277 246 VAL A CA  
1878 C  C   . VAL A 246 ? 0.2631 0.2126 0.2546 0.0216  -0.0167 -0.0284 246 VAL A C   
1879 O  O   . VAL A 246 ? 0.3053 0.2541 0.2961 0.0289  -0.0173 -0.0323 246 VAL A O   
1880 C  CB  . VAL A 246 ? 0.4307 0.3556 0.4180 0.0134  -0.0206 -0.0226 246 VAL A CB  
1881 C  CG1 . VAL A 246 ? 0.2909 0.2091 0.2761 0.0222  -0.0232 -0.0225 246 VAL A CG1 
1882 C  CG2 . VAL A 246 ? 0.2873 0.1984 0.2731 0.0075  -0.0224 -0.0230 246 VAL A CG2 
1883 N  N   . GLU A 247 ? 0.2532 0.2144 0.2474 0.0194  -0.0150 -0.0249 247 GLU A N   
1884 C  CA  . GLU A 247 ? 0.4968 0.4702 0.4939 0.0252  -0.0142 -0.0255 247 GLU A CA  
1885 C  C   . GLU A 247 ? 0.5135 0.4972 0.5127 0.0268  -0.0113 -0.0303 247 GLU A C   
1886 O  O   . GLU A 247 ? 0.5119 0.5031 0.5132 0.0333  -0.0107 -0.0325 247 GLU A O   
1887 C  CB  . GLU A 247 ? 0.2419 0.2249 0.2410 0.0221  -0.0136 -0.0210 247 GLU A CB  
1888 C  CG  . GLU A 247 ? 0.3815 0.3778 0.3844 0.0275  -0.0135 -0.0213 247 GLU A CG  
1889 C  CD  . GLU A 247 ? 0.6922 0.6830 0.6938 0.0347  -0.0169 -0.0193 247 GLU A CD  
1890 O  OE1 . GLU A 247 ? 0.8557 0.8308 0.8531 0.0362  -0.0192 -0.0185 247 GLU A OE1 
1891 O  OE2 . GLU A 247 ? 0.6881 0.6899 0.6931 0.0391  -0.0176 -0.0185 247 GLU A OE2 
1892 N  N   . LEU A 248 ? 0.4979 0.4822 0.4966 0.0211  -0.0094 -0.0317 248 LEU A N   
1893 C  CA  . LEU A 248 ? 0.4908 0.4826 0.4900 0.0227  -0.0068 -0.0359 248 LEU A CA  
1894 C  C   . LEU A 248 ? 0.4121 0.3974 0.4086 0.0299  -0.0080 -0.0405 248 LEU A C   
1895 O  O   . LEU A 248 ? 0.3562 0.3503 0.3537 0.0350  -0.0060 -0.0434 248 LEU A O   
1896 C  CB  . LEU A 248 ? 0.4148 0.4060 0.4129 0.0160  -0.0055 -0.0365 248 LEU A CB  
1897 C  CG  . LEU A 248 ? 0.3636 0.3609 0.3607 0.0177  -0.0030 -0.0405 248 LEU A CG  
1898 C  CD1 . LEU A 248 ? 0.2132 0.2250 0.2140 0.0166  0.0003  -0.0390 248 LEU A CD1 
1899 C  CD2 . LEU A 248 ? 0.3163 0.3087 0.3109 0.0129  -0.0032 -0.0419 248 LEU A CD2 
1900 N  N   . GLY A 249 ? 0.3506 0.3205 0.3435 0.0304  -0.0113 -0.0412 249 GLY A N   
1901 C  CA  . GLY A 249 ? 0.3836 0.3455 0.3735 0.0380  -0.0130 -0.0457 249 GLY A CA  
1902 C  C   . GLY A 249 ? 0.3254 0.2922 0.3173 0.0462  -0.0133 -0.0453 249 GLY A C   
1903 O  O   . GLY A 249 ? 0.4411 0.4104 0.4322 0.0538  -0.0127 -0.0497 249 GLY A O   
1904 N  N   . ARG A 250 ? 0.3016 0.2712 0.2962 0.0452  -0.0143 -0.0401 250 ARG A N   
1905 C  CA  . ARG A 250 ? 0.3068 0.2808 0.3035 0.0535  -0.0154 -0.0396 250 ARG A CA  
1906 C  C   . ARG A 250 ? 0.3534 0.3471 0.3552 0.0566  -0.0118 -0.0414 250 ARG A C   
1907 O  O   . ARG A 250 ? 0.3215 0.3201 0.3248 0.0653  -0.0117 -0.0442 250 ARG A O   
1908 C  CB  . ARG A 250 ? 0.3657 0.3373 0.3631 0.0518  -0.0178 -0.0334 250 ARG A CB  
1909 C  CG  . ARG A 250 ? 0.4475 0.4103 0.4432 0.0608  -0.0214 -0.0327 250 ARG A CG  
1910 C  CD  . ARG A 250 ? 0.4355 0.3962 0.4309 0.0595  -0.0239 -0.0262 250 ARG A CD  
1911 N  NE  . ARG A 250 ? 0.6470 0.6025 0.6403 0.0494  -0.0235 -0.0222 250 ARG A NE  
1912 C  CZ  . ARG A 250 ? 0.6558 0.5943 0.6444 0.0460  -0.0257 -0.0192 250 ARG A CZ  
1913 N  NH1 . ARG A 250 ? 0.6250 0.5622 0.6127 0.0368  -0.0246 -0.0157 250 ARG A NH1 
1914 N  NH2 . ARG A 250 ? 0.6223 0.5449 0.6071 0.0518  -0.0290 -0.0197 250 ARG A NH2 
1915 N  N   . ASN A 251 ? 0.4007 0.4060 0.4055 0.0496  -0.0088 -0.0398 251 ASN A N   
1916 C  CA  . ASN A 251 ? 0.4423 0.4658 0.4520 0.0510  -0.0050 -0.0414 251 ASN A CA  
1917 C  C   . ASN A 251 ? 0.5140 0.5384 0.5215 0.0563  -0.0028 -0.0469 251 ASN A C   
1918 O  O   . ASN A 251 ? 0.5278 0.5642 0.5388 0.0626  -0.0008 -0.0489 251 ASN A O   
1919 C  CB  . ASN A 251 ? 0.4762 0.5080 0.4880 0.0419  -0.0024 -0.0391 251 ASN A CB  
1920 C  CG  . ASN A 251 ? 0.5144 0.5542 0.5305 0.0388  -0.0032 -0.0349 251 ASN A CG  
1921 O  OD1 . ASN A 251 ? 0.4788 0.5339 0.5005 0.0389  -0.0013 -0.0346 251 ASN A OD1 
1922 N  ND2 . ASN A 251 ? 0.5239 0.5539 0.5374 0.0357  -0.0061 -0.0315 251 ASN A ND2 
1923 N  N   . LEU A 252 ? 0.5092 0.5221 0.5109 0.0541  -0.0032 -0.0495 252 LEU A N   
1924 C  CA  . LEU A 252 ? 0.5600 0.5736 0.5584 0.0591  -0.0013 -0.0549 252 LEU A CA  
1925 C  C   . LEU A 252 ? 0.5849 0.5859 0.5792 0.0679  -0.0044 -0.0590 252 LEU A C   
1926 O  O   . LEU A 252 ? 0.5269 0.5229 0.5161 0.0713  -0.0040 -0.0642 252 LEU A O   
1927 C  CB  . LEU A 252 ? 0.5422 0.5515 0.5362 0.0526  -0.0002 -0.0562 252 LEU A CB  
1928 C  CG  . LEU A 252 ? 0.4709 0.4926 0.4683 0.0453  0.0033  -0.0529 252 LEU A CG  
1929 C  CD1 . LEU A 252 ? 0.4623 0.4800 0.4550 0.0402  0.0041  -0.0542 252 LEU A CD1 
1930 C  CD2 . LEU A 252 ? 0.4710 0.5102 0.4728 0.0485  0.0074  -0.0530 252 LEU A CD2 
1931 N  N   . ASN A 253 ? 0.5542 0.5499 0.5502 0.0718  -0.0076 -0.0568 253 ASN A N   
1932 C  CA  . ASN A 253 ? 0.6037 0.5866 0.5960 0.0809  -0.0108 -0.0602 253 ASN A CA  
1933 C  C   . ASN A 253 ? 0.5700 0.5351 0.5549 0.0796  -0.0130 -0.0644 253 ASN A C   
1934 O  O   . ASN A 253 ? 0.6834 0.6442 0.6641 0.0865  -0.0131 -0.0705 253 ASN A O   
1935 C  CB  . ASN A 253 ? 0.6746 0.6700 0.6695 0.0914  -0.0085 -0.0641 253 ASN A CB  
1936 C  CG  . ASN A 253 ? 0.9342 0.9416 0.9362 0.0954  -0.0089 -0.0604 253 ASN A CG  
1937 O  OD1 . ASN A 253 ? 1.0936 1.0919 1.0956 0.0960  -0.0129 -0.0566 253 ASN A OD1 
1938 N  ND2 . ASN A 253 ? 0.9874 1.0158 0.9956 0.0979  -0.0048 -0.0611 253 ASN A ND2 
1939 N  N   . CYS A 254 ? 0.4294 0.3851 0.4130 0.0704  -0.0148 -0.0612 254 CYS A N   
1940 C  CA  . CYS A 254 ? 0.4728 0.4123 0.4505 0.0671  -0.0174 -0.0645 254 CYS A CA  
1941 C  C   . CYS A 254 ? 0.6468 0.5661 0.6216 0.0686  -0.0223 -0.0635 254 CYS A C   
1942 O  O   . CYS A 254 ? 0.7659 0.6834 0.7431 0.0698  -0.0238 -0.0586 254 CYS A O   
1943 C  CB  . CYS A 254 ? 0.5306 0.4725 0.5092 0.0561  -0.0163 -0.0617 254 CYS A CB  
1944 S  SG  . CYS A 254 ? 0.6173 0.5722 0.5945 0.0550  -0.0122 -0.0658 254 CYS A SG  
1945 N  N   . ASN A 255 ? 0.6459 0.5497 0.6154 0.0682  -0.0252 -0.0682 255 ASN A N   
1946 C  CA  . ASN A 255 ? 0.6131 0.4957 0.5797 0.0669  -0.0300 -0.0668 255 ASN A CA  
1947 C  C   . ASN A 255 ? 0.6058 0.4862 0.5751 0.0558  -0.0305 -0.0599 255 ASN A C   
1948 O  O   . ASN A 255 ? 0.6218 0.5102 0.5928 0.0481  -0.0285 -0.0592 255 ASN A O   
1949 C  CB  . ASN A 255 ? 0.6264 0.4932 0.5868 0.0680  -0.0331 -0.0740 255 ASN A CB  
1950 C  CG  . ASN A 255 ? 0.7520 0.5964 0.7090 0.0705  -0.0381 -0.0739 255 ASN A CG  
1951 O  OD1 . ASN A 255 ? 0.7633 0.5979 0.7214 0.0633  -0.0401 -0.0681 255 ASN A OD1 
1952 N  ND2 . ASN A 255 ? 0.8946 0.7301 0.8470 0.0808  -0.0400 -0.0802 255 ASN A ND2 
1953 N  N   . LEU A 256 ? 0.6576 0.5269 0.6267 0.0552  -0.0331 -0.0546 256 LEU A N   
1954 C  CA  . LEU A 256 ? 0.5643 0.4346 0.5361 0.0457  -0.0327 -0.0471 256 LEU A CA  
1955 C  C   . LEU A 256 ? 0.5904 0.4404 0.5596 0.0402  -0.0364 -0.0442 256 LEU A C   
1956 O  O   . LEU A 256 ? 0.7314 0.5816 0.7023 0.0331  -0.0360 -0.0373 256 LEU A O   
1957 C  CB  . LEU A 256 ? 0.4133 0.2946 0.3883 0.0486  -0.0313 -0.0411 256 LEU A CB  
1958 C  CG  . LEU A 256 ? 0.5491 0.4531 0.5285 0.0500  -0.0271 -0.0419 256 LEU A CG  
1959 C  CD1 . LEU A 256 ? 0.5228 0.4368 0.5054 0.0518  -0.0265 -0.0361 256 LEU A CD1 
1960 C  CD2 . LEU A 256 ? 0.6109 0.5237 0.5923 0.0410  -0.0243 -0.0421 256 LEU A CD2 
1961 N  N   . ASN A 257 ? 0.6009 0.4331 0.5657 0.0428  -0.0400 -0.0491 257 ASN A N   
1962 C  CA  . ASN A 257 ? 0.7647 0.5766 0.7273 0.0371  -0.0436 -0.0455 257 ASN A CA  
1963 C  C   . ASN A 257 ? 0.6827 0.4951 0.6479 0.0247  -0.0432 -0.0444 257 ASN A C   
1964 O  O   . ASN A 257 ? 0.7125 0.5204 0.6790 0.0170  -0.0433 -0.0375 257 ASN A O   
1965 C  CB  . ASN A 257 ? 0.8930 0.6837 0.8501 0.0434  -0.0481 -0.0511 257 ASN A CB  
1966 C  CG  . ASN A 257 ? 0.9947 0.7886 0.9497 0.0571  -0.0480 -0.0553 257 ASN A CG  
1967 O  OD1 . ASN A 257 ? 1.0146 0.8091 0.9673 0.0629  -0.0482 -0.0635 257 ASN A OD1 
1968 N  ND2 . ASN A 257 ? 1.0195 0.8172 0.9756 0.0624  -0.0476 -0.0496 257 ASN A ND2 
1969 N  N   . SER A 258 ? 0.5995 0.4181 0.5652 0.0228  -0.0426 -0.0508 258 SER A N   
1970 C  CA  . SER A 258 ? 0.6786 0.4994 0.6474 0.0116  -0.0425 -0.0500 258 SER A CA  
1971 C  C   . SER A 258 ? 0.5957 0.4364 0.5672 0.0105  -0.0389 -0.0526 258 SER A C   
1972 O  O   . SER A 258 ? 0.5839 0.4342 0.5540 0.0180  -0.0371 -0.0565 258 SER A O   
1973 C  CB  . SER A 258 ? 0.7584 0.5615 0.7248 0.0080  -0.0471 -0.0551 258 SER A CB  
1974 O  OG  . SER A 258 ? 0.7352 0.5363 0.6973 0.0156  -0.0485 -0.0641 258 SER A OG  
1975 N  N   . ASP A 259 ? 0.5230 0.3698 0.4985 0.0009  -0.0380 -0.0502 259 ASP A N   
1976 C  CA  . ASP A 259 ? 0.5122 0.3765 0.4902 -0.0008 -0.0350 -0.0522 259 ASP A CA  
1977 C  C   . ASP A 259 ? 0.5949 0.4589 0.5693 0.0036  -0.0365 -0.0606 259 ASP A C   
1978 O  O   . ASP A 259 ? 0.7466 0.6241 0.7205 0.0073  -0.0336 -0.0629 259 ASP A O   
1979 C  CB  . ASP A 259 ? 0.5842 0.4527 0.5670 -0.0113 -0.0346 -0.0490 259 ASP A CB  
1980 C  CG  . ASP A 259 ? 0.6341 0.5015 0.6196 -0.0161 -0.0332 -0.0408 259 ASP A CG  
1981 O  OD1 . ASP A 259 ? 0.6282 0.4940 0.6118 -0.0111 -0.0324 -0.0374 259 ASP A OD1 
1982 O  OD2 . ASP A 259 ? 0.7012 0.5701 0.6906 -0.0248 -0.0330 -0.0378 259 ASP A OD2 
1983 N  N   . GLU A 260 ? 0.5472 0.3956 0.5187 0.0027  -0.0409 -0.0653 260 GLU A N   
1984 C  CA  . GLU A 260 ? 0.5671 0.4145 0.5341 0.0069  -0.0427 -0.0739 260 GLU A CA  
1985 C  C   . GLU A 260 ? 0.6206 0.4725 0.5833 0.0182  -0.0406 -0.0771 260 GLU A C   
1986 O  O   . GLU A 260 ? 0.6642 0.5290 0.6253 0.0216  -0.0381 -0.0802 260 GLU A O   
1987 C  CB  . GLU A 260 ? 0.5454 0.3735 0.5097 0.0042  -0.0484 -0.0786 260 GLU A CB  
1988 C  CG  . GLU A 260 ? 0.7036 0.5339 0.6716 -0.0058 -0.0505 -0.0794 260 GLU A CG  
1989 C  CD  . GLU A 260 ? 0.8865 0.7326 0.8537 -0.0046 -0.0489 -0.0835 260 GLU A CD  
1990 O  OE1 . GLU A 260 ? 0.9137 0.7609 0.8747 0.0035  -0.0489 -0.0897 260 GLU A OE1 
1991 O  OE2 . GLU A 260 ? 0.9174 0.7748 0.8898 -0.0115 -0.0475 -0.0803 260 GLU A OE2 
1992 N  N   . GLU A 261 ? 0.5765 0.4189 0.5375 0.0242  -0.0414 -0.0758 261 GLU A N   
1993 C  CA  . GLU A 261 ? 0.6340 0.4829 0.5923 0.0352  -0.0391 -0.0784 261 GLU A CA  
1994 C  C   . GLU A 261 ? 0.5441 0.4139 0.5067 0.0354  -0.0338 -0.0738 261 GLU A C   
1995 O  O   . GLU A 261 ? 0.5075 0.3894 0.4687 0.0407  -0.0308 -0.0772 261 GLU A O   
1996 C  CB  . GLU A 261 ? 0.8099 0.6450 0.7664 0.0416  -0.0413 -0.0772 261 GLU A CB  
1997 C  CG  . GLU A 261 ? 1.0451 0.8573 0.9992 0.0378  -0.0466 -0.0781 261 GLU A CG  
1998 C  CD  . GLU A 261 ? 1.1570 0.9534 1.1079 0.0457  -0.0492 -0.0776 261 GLU A CD  
1999 O  OE1 . GLU A 261 ? 1.1146 0.9165 1.0637 0.0565  -0.0476 -0.0802 261 GLU A OE1 
2000 O  OE2 . GLU A 261 ? 1.2445 1.0235 1.1950 0.0410  -0.0526 -0.0740 261 GLU A OE2 
2001 N  N   . LEU A 262 ? 0.4936 0.3678 0.4612 0.0293  -0.0324 -0.0663 262 LEU A N   
2002 C  CA  . LEU A 262 ? 0.3645 0.2574 0.3361 0.0291  -0.0278 -0.0621 262 LEU A CA  
2003 C  C   . LEU A 262 ? 0.3894 0.2949 0.3610 0.0268  -0.0252 -0.0649 262 LEU A C   
2004 O  O   . LEU A 262 ? 0.4020 0.3203 0.3735 0.0314  -0.0218 -0.0661 262 LEU A O   
2005 C  CB  . LEU A 262 ? 0.3099 0.2044 0.2859 0.0220  -0.0271 -0.0543 262 LEU A CB  
2006 C  CG  . LEU A 262 ? 0.3593 0.2720 0.3394 0.0195  -0.0228 -0.0504 262 LEU A CG  
2007 C  CD1 . LEU A 262 ? 0.2872 0.2113 0.2677 0.0274  -0.0202 -0.0516 262 LEU A CD1 
2008 C  CD2 . LEU A 262 ? 0.4739 0.3866 0.4570 0.0139  -0.0225 -0.0432 262 LEU A CD2 
2009 N  N   . ILE A 263 ? 0.3937 0.2958 0.3655 0.0196  -0.0270 -0.0659 263 ILE A N   
2010 C  CA  . ILE A 263 ? 0.3698 0.2834 0.3414 0.0172  -0.0250 -0.0678 263 ILE A CA  
2011 C  C   . ILE A 263 ? 0.5489 0.4636 0.5146 0.0243  -0.0249 -0.0748 263 ILE A C   
2012 O  O   . ILE A 263 ? 0.5372 0.4648 0.5019 0.0265  -0.0214 -0.0753 263 ILE A O   
2013 C  CB  . ILE A 263 ? 0.3140 0.2240 0.2875 0.0085  -0.0274 -0.0674 263 ILE A CB  
2014 C  CG1 . ILE A 263 ? 0.3440 0.2574 0.3233 0.0018  -0.0260 -0.0601 263 ILE A CG1 
2015 C  CG2 . ILE A 263 ? 0.3691 0.2890 0.3411 0.0074  -0.0264 -0.0703 263 ILE A CG2 
2016 C  CD1 . ILE A 263 ? 0.5082 0.4173 0.4905 -0.0068 -0.0285 -0.0594 263 ILE A CD1 
2017 N  N   . HIS A 264 ? 0.5458 0.4465 0.5068 0.0280  -0.0288 -0.0804 264 HIS A N   
2018 C  CA  . HIS A 264 ? 0.4956 0.3974 0.4500 0.0355  -0.0286 -0.0875 264 HIS A CA  
2019 C  C   . HIS A 264 ? 0.5789 0.4922 0.5334 0.0434  -0.0240 -0.0868 264 HIS A C   
2020 O  O   . HIS A 264 ? 0.6835 0.6070 0.6345 0.0474  -0.0211 -0.0898 264 HIS A O   
2021 C  CB  . HIS A 264 ? 0.5779 0.4615 0.5272 0.0387  -0.0337 -0.0939 264 HIS A CB  
2022 C  CG  . HIS A 264 ? 0.7189 0.6030 0.6604 0.0470  -0.0337 -0.1020 264 HIS A CG  
2023 N  ND1 . HIS A 264 ? 0.7939 0.6681 0.7308 0.0559  -0.0352 -0.1071 264 HIS A ND1 
2024 C  CD2 . HIS A 264 ? 0.7876 0.6813 0.7246 0.0483  -0.0321 -0.1057 264 HIS A CD2 
2025 C  CE1 . HIS A 264 ? 0.8549 0.7330 0.7848 0.0623  -0.0343 -0.1139 264 HIS A CE1 
2026 N  NE2 . HIS A 264 ? 0.8777 0.7676 0.8072 0.0577  -0.0324 -0.1130 264 HIS A NE2 
2027 N  N   . CYS A 265 ? 0.5466 0.4595 0.5051 0.0455  -0.0232 -0.0825 265 CYS A N   
2028 C  CA  . CYS A 265 ? 0.5909 0.5172 0.5514 0.0520  -0.0189 -0.0810 265 CYS A CA  
2029 C  C   . CYS A 265 ? 0.5490 0.4927 0.5131 0.0475  -0.0143 -0.0769 265 CYS A C   
2030 O  O   . CYS A 265 ? 0.5082 0.4644 0.4714 0.0517  -0.0104 -0.0784 265 CYS A O   
2031 C  CB  . CYS A 265 ? 0.7711 0.6938 0.7357 0.0545  -0.0197 -0.0768 265 CYS A CB  
2032 S  SG  . CYS A 265 ? 1.0152 0.9553 0.9834 0.0631  -0.0151 -0.0756 265 CYS A SG  
2033 N  N   . LEU A 266 ? 0.5495 0.4943 0.5177 0.0388  -0.0146 -0.0718 266 LEU A N   
2034 C  CA  . LEU A 266 ? 0.6287 0.5882 0.6002 0.0346  -0.0106 -0.0678 266 LEU A CA  
2035 C  C   . LEU A 266 ? 0.7199 0.6842 0.6873 0.0331  -0.0094 -0.0707 266 LEU A C   
2036 O  O   . LEU A 266 ? 0.7530 0.7295 0.7217 0.0315  -0.0056 -0.0683 266 LEU A O   
2037 C  CB  . LEU A 266 ? 0.5934 0.5524 0.5699 0.0266  -0.0112 -0.0619 266 LEU A CB  
2038 C  CG  . LEU A 266 ? 0.7210 0.6847 0.7023 0.0273  -0.0099 -0.0569 266 LEU A CG  
2039 C  CD1 . LEU A 266 ? 0.6286 0.5899 0.6134 0.0197  -0.0109 -0.0517 266 LEU A CD1 
2040 C  CD2 . LEU A 266 ? 0.8236 0.8035 0.8076 0.0295  -0.0054 -0.0556 266 LEU A CD2 
2041 N  N   . ARG A 267 ? 0.6714 0.6260 0.6336 0.0335  -0.0128 -0.0758 267 ARG A N   
2042 C  CA  . ARG A 267 ? 0.5350 0.4940 0.4925 0.0326  -0.0123 -0.0786 267 ARG A CA  
2043 C  C   . ARG A 267 ? 0.5890 0.5546 0.5407 0.0403  -0.0093 -0.0827 267 ARG A C   
2044 O  O   . ARG A 267 ? 0.6037 0.5754 0.5509 0.0401  -0.0078 -0.0840 267 ARG A O   
2045 C  CB  . ARG A 267 ? 0.4164 0.3635 0.3708 0.0295  -0.0176 -0.0827 267 ARG A CB  
2046 C  CG  . ARG A 267 ? 0.2927 0.2392 0.2518 0.0207  -0.0193 -0.0788 267 ARG A CG  
2047 C  CD  . ARG A 267 ? 0.4051 0.3398 0.3624 0.0176  -0.0249 -0.0832 267 ARG A CD  
2048 N  NE  . ARG A 267 ? 0.5647 0.5000 0.5276 0.0091  -0.0265 -0.0796 267 ARG A NE  
2049 C  CZ  . ARG A 267 ? 0.6498 0.5755 0.6143 0.0042  -0.0311 -0.0815 267 ARG A CZ  
2050 N  NH1 . ARG A 267 ? 0.7316 0.6447 0.6921 0.0068  -0.0351 -0.0871 267 ARG A NH1 
2051 N  NH2 . ARG A 267 ? 0.5937 0.5223 0.5642 -0.0033 -0.0319 -0.0779 267 ARG A NH2 
2052 N  N   . GLU A 268 ? 0.5698 0.5346 0.5212 0.0474  -0.0085 -0.0848 268 GLU A N   
2053 C  CA  . GLU A 268 ? 0.6977 0.6704 0.6441 0.0553  -0.0050 -0.0887 268 GLU A CA  
2054 C  C   . GLU A 268 ? 0.5903 0.5796 0.5415 0.0560  0.0009  -0.0839 268 GLU A C   
2055 O  O   . GLU A 268 ? 0.6037 0.6028 0.5514 0.0611  0.0049  -0.0859 268 GLU A O   
2056 C  CB  . GLU A 268 ? 0.8944 0.8577 0.8376 0.0637  -0.0073 -0.0944 268 GLU A CB  
2057 C  CG  . GLU A 268 ? 1.0510 0.9956 0.9903 0.0624  -0.0137 -0.0990 268 GLU A CG  
2058 C  CD  . GLU A 268 ? 1.1961 1.1366 1.1258 0.0654  -0.0156 -0.1065 268 GLU A CD  
2059 O  OE1 . GLU A 268 ? 1.2027 1.1550 1.1280 0.0689  -0.0115 -0.1079 268 GLU A OE1 
2060 O  OE2 . GLU A 268 ? 1.2596 1.1850 1.1859 0.0641  -0.0212 -0.1110 268 GLU A OE2 
2061 N  N   . LYS A 269 ? 0.4782 0.4713 0.4371 0.0509  0.0016  -0.0778 269 LYS A N   
2062 C  CA  . LYS A 269 ? 0.3741 0.3826 0.3383 0.0506  0.0067  -0.0734 269 LYS A CA  
2063 C  C   . LYS A 269 ? 0.4017 0.4186 0.3638 0.0459  0.0100  -0.0711 269 LYS A C   
2064 O  O   . LYS A 269 ? 0.3717 0.3830 0.3318 0.0404  0.0078  -0.0703 269 LYS A O   
2065 C  CB  . LYS A 269 ? 0.3950 0.4040 0.3672 0.0463  0.0058  -0.0681 269 LYS A CB  
2066 C  CG  . LYS A 269 ? 0.4725 0.4711 0.4465 0.0498  0.0019  -0.0690 269 LYS A CG  
2067 C  CD  . LYS A 269 ? 0.6604 0.6684 0.6387 0.0565  0.0041  -0.0686 269 LYS A CD  
2068 C  CE  . LYS A 269 ? 0.7709 0.7680 0.7470 0.0645  0.0008  -0.0726 269 LYS A CE  
2069 N  NZ  . LYS A 269 ? 0.7621 0.7585 0.7317 0.0722  0.0018  -0.0794 269 LYS A NZ  
2070 N  N   . LYS A 270 ? 0.4964 0.5269 0.4591 0.0482  0.0152  -0.0700 270 LYS A N   
2071 C  CA  . LYS A 270 ? 0.6132 0.6518 0.5749 0.0432  0.0187  -0.0662 270 LYS A CA  
2072 C  C   . LYS A 270 ? 0.5992 0.6376 0.5675 0.0352  0.0179  -0.0607 270 LYS A C   
2073 O  O   . LYS A 270 ? 0.6288 0.6670 0.6037 0.0343  0.0167  -0.0588 270 LYS A O   
2074 C  CB  . LYS A 270 ? 0.6355 0.6892 0.5980 0.0463  0.0248  -0.0651 270 LYS A CB  
2075 C  CG  . LYS A 270 ? 0.7759 0.8314 0.7302 0.0539  0.0266  -0.0705 270 LYS A CG  
2076 C  CD  . LYS A 270 ? 0.8487 0.9187 0.8066 0.0594  0.0318  -0.0707 270 LYS A CD  
2077 C  CE  . LYS A 270 ? 0.8396 0.9109 0.7888 0.0681  0.0335  -0.0768 270 LYS A CE  
2078 N  NZ  . LYS A 270 ? 0.8308 0.9164 0.7845 0.0747  0.0382  -0.0778 270 LYS A NZ  
2079 N  N   . PRO A 271 ? 0.3965 0.4343 0.3625 0.0298  0.0182  -0.0582 271 PRO A N   
2080 C  CA  . PRO A 271 ? 0.4016 0.4381 0.3731 0.0227  0.0172  -0.0536 271 PRO A CA  
2081 C  C   . PRO A 271 ? 0.4812 0.5270 0.4603 0.0206  0.0200  -0.0497 271 PRO A C   
2082 O  O   . PRO A 271 ? 0.5334 0.5767 0.5177 0.0173  0.0180  -0.0476 271 PRO A O   
2083 C  CB  . PRO A 271 ? 0.2921 0.3285 0.2589 0.0191  0.0180  -0.0519 271 PRO A CB  
2084 C  CG  . PRO A 271 ? 0.3991 0.4331 0.3575 0.0238  0.0175  -0.0563 271 PRO A CG  
2085 C  CD  . PRO A 271 ? 0.3875 0.4258 0.3453 0.0304  0.0194  -0.0594 271 PRO A CD  
2086 N  N   . GLN A 272 ? 0.4479 0.5051 0.4279 0.0222  0.0246  -0.0487 272 GLN A N   
2087 C  CA  . GLN A 272 ? 0.4712 0.5380 0.4592 0.0193  0.0269  -0.0451 272 GLN A CA  
2088 C  C   . GLN A 272 ? 0.5030 0.5720 0.4966 0.0235  0.0253  -0.0464 272 GLN A C   
2089 O  O   . GLN A 272 ? 0.6793 0.7535 0.6797 0.0206  0.0253  -0.0437 272 GLN A O   
2090 C  CB  . GLN A 272 ? 0.2867 0.3657 0.2751 0.0184  0.0325  -0.0429 272 GLN A CB  
2091 C  CG  . GLN A 272 ? 0.4198 0.5063 0.4158 0.0123  0.0342  -0.0386 272 GLN A CG  
2092 C  CD  . GLN A 272 ? 0.5439 0.6267 0.5373 0.0056  0.0351  -0.0351 272 GLN A CD  
2093 O  OE1 . GLN A 272 ? 0.5922 0.6739 0.5791 0.0057  0.0372  -0.0346 272 GLN A OE1 
2094 N  NE2 . GLN A 272 ? 0.5680 0.6479 0.5658 0.0003  0.0330  -0.0329 272 GLN A NE2 
2095 N  N   . GLU A 273 ? 0.3252 0.3893 0.3155 0.0303  0.0236  -0.0507 273 GLU A N   
2096 C  CA  . GLU A 273 ? 0.4091 0.4712 0.4037 0.0343  0.0208  -0.0517 273 GLU A CA  
2097 C  C   . GLU A 273 ? 0.5018 0.5544 0.4984 0.0295  0.0167  -0.0493 273 GLU A C   
2098 O  O   . GLU A 273 ? 0.5442 0.5986 0.5459 0.0301  0.0151  -0.0477 273 GLU A O   
2099 C  CB  . GLU A 273 ? 0.4182 0.4733 0.4078 0.0423  0.0190  -0.0570 273 GLU A CB  
2100 C  CG  . GLU A 273 ? 0.5389 0.6035 0.5260 0.0486  0.0231  -0.0600 273 GLU A CG  
2101 C  CD  . GLU A 273 ? 0.6987 0.7536 0.6792 0.0564  0.0207  -0.0661 273 GLU A CD  
2102 O  OE1 . GLU A 273 ? 0.7443 0.7988 0.7173 0.0587  0.0223  -0.0694 273 GLU A OE1 
2103 O  OE2 . GLU A 273 ? 0.6095 0.6567 0.5917 0.0604  0.0170  -0.0677 273 GLU A OE2 
2104 N  N   . LEU A 274 ? 0.4178 0.4610 0.4103 0.0251  0.0148  -0.0491 274 LEU A N   
2105 C  CA  . LEU A 274 ? 0.2777 0.3134 0.2722 0.0203  0.0116  -0.0466 274 LEU A CA  
2106 C  C   . LEU A 274 ? 0.2724 0.3159 0.2719 0.0146  0.0134  -0.0424 274 LEU A C   
2107 O  O   . LEU A 274 ? 0.3130 0.3573 0.3167 0.0134  0.0119  -0.0402 274 LEU A O   
2108 C  CB  . LEU A 274 ? 0.2751 0.3003 0.2649 0.0172  0.0092  -0.0478 274 LEU A CB  
2109 C  CG  . LEU A 274 ? 0.3360 0.3492 0.3221 0.0205  0.0054  -0.0514 274 LEU A CG  
2110 C  CD1 . LEU A 274 ? 0.2296 0.2441 0.2125 0.0282  0.0063  -0.0557 274 LEU A CD1 
2111 C  CD2 . LEU A 274 ? 0.3237 0.3294 0.3061 0.0167  0.0033  -0.0526 274 LEU A CD2 
2112 N  N   . ILE A 275 ? 0.2517 0.3009 0.2503 0.0114  0.0165  -0.0412 275 ILE A N   
2113 C  CA  . ILE A 275 ? 0.2803 0.3358 0.2831 0.0058  0.0181  -0.0377 275 ILE A CA  
2114 C  C   . ILE A 275 ? 0.3662 0.4319 0.3755 0.0070  0.0190  -0.0366 275 ILE A C   
2115 O  O   . ILE A 275 ? 0.4165 0.4848 0.4298 0.0030  0.0183  -0.0342 275 ILE A O   
2116 C  CB  . ILE A 275 ? 0.2539 0.3131 0.2541 0.0029  0.0215  -0.0366 275 ILE A CB  
2117 C  CG1 . ILE A 275 ? 0.3852 0.4350 0.3792 0.0023  0.0199  -0.0378 275 ILE A CG1 
2118 C  CG2 . ILE A 275 ? 0.2804 0.3442 0.2846 -0.0032 0.0228  -0.0333 275 ILE A CG2 
2119 C  CD1 . ILE A 275 ? 0.4476 0.4999 0.4369 0.0015  0.0229  -0.0372 275 ILE A CD1 
2120 N  N   . ASP A 276 ? 0.4163 0.4884 0.4268 0.0128  0.0204  -0.0386 276 ASP A N   
2121 C  CA  . ASP A 276 ? 0.4603 0.5447 0.4778 0.0142  0.0215  -0.0377 276 ASP A CA  
2122 C  C   . ASP A 276 ? 0.5108 0.5926 0.5314 0.0163  0.0176  -0.0372 276 ASP A C   
2123 O  O   . ASP A 276 ? 0.4589 0.5511 0.4859 0.0168  0.0176  -0.0361 276 ASP A O   
2124 C  CB  . ASP A 276 ? 0.6622 0.7557 0.6803 0.0204  0.0246  -0.0400 276 ASP A CB  
2125 C  CG  . ASP A 276 ? 0.7674 0.8734 0.7881 0.0167  0.0297  -0.0382 276 ASP A CG  
2126 O  OD1 . ASP A 276 ? 0.8496 0.9611 0.8754 0.0106  0.0302  -0.0353 276 ASP A OD1 
2127 O  OD2 . ASP A 276 ? 0.6183 0.7284 0.6357 0.0199  0.0332  -0.0398 276 ASP A OD2 
2128 N  N   . VAL A 277 ? 0.4818 0.5504 0.4982 0.0174  0.0141  -0.0378 277 VAL A N   
2129 C  CA  . VAL A 277 ? 0.3383 0.4028 0.3564 0.0187  0.0103  -0.0364 277 VAL A CA  
2130 C  C   . VAL A 277 ? 0.3331 0.3883 0.3488 0.0129  0.0082  -0.0342 277 VAL A C   
2131 O  O   . VAL A 277 ? 0.2860 0.3360 0.3017 0.0135  0.0052  -0.0325 277 VAL A O   
2132 C  CB  . VAL A 277 ? 0.3012 0.3585 0.3170 0.0265  0.0080  -0.0389 277 VAL A CB  
2133 C  CG1 . VAL A 277 ? 0.2467 0.3143 0.2650 0.0333  0.0104  -0.0416 277 VAL A CG1 
2134 C  CG2 . VAL A 277 ? 0.2875 0.3305 0.2967 0.0261  0.0066  -0.0408 277 VAL A CG2 
2135 N  N   . GLU A 278 ? 0.4308 0.4840 0.4443 0.0075  0.0098  -0.0338 278 GLU A N   
2136 C  CA  . GLU A 278 ? 0.3888 0.4333 0.3999 0.0028  0.0081  -0.0322 278 GLU A CA  
2137 C  C   . GLU A 278 ? 0.3363 0.3836 0.3501 -0.0002 0.0067  -0.0294 278 GLU A C   
2138 O  O   . GLU A 278 ? 0.3905 0.4305 0.4024 -0.0020 0.0046  -0.0278 278 GLU A O   
2139 C  CB  . GLU A 278 ? 0.5286 0.5723 0.5374 -0.0016 0.0101  -0.0324 278 GLU A CB  
2140 C  CG  . GLU A 278 ? 0.6666 0.7094 0.6760 -0.0075 0.0099  -0.0301 278 GLU A CG  
2141 C  CD  . GLU A 278 ? 0.6683 0.7085 0.6749 -0.0107 0.0114  -0.0304 278 GLU A CD  
2142 O  OE1 . GLU A 278 ? 0.7097 0.7440 0.7148 -0.0133 0.0101  -0.0299 278 GLU A OE1 
2143 O  OE2 . GLU A 278 ? 0.5752 0.6196 0.5812 -0.0104 0.0138  -0.0310 278 GLU A OE2 
2144 N  N   . TRP A 279 ? 0.3739 0.4319 0.3920 -0.0010 0.0078  -0.0287 279 TRP A N   
2145 C  CA  . TRP A 279 ? 0.2995 0.3603 0.3194 -0.0038 0.0061  -0.0265 279 TRP A CA  
2146 C  C   . TRP A 279 ? 0.2563 0.3166 0.2769 0.0007  0.0031  -0.0254 279 TRP A C   
2147 O  O   . TRP A 279 ? 0.4802 0.5392 0.5000 -0.0012 0.0010  -0.0233 279 TRP A O   
2148 C  CB  . TRP A 279 ? 0.3363 0.4084 0.3607 -0.0072 0.0079  -0.0264 279 TRP A CB  
2149 C  CG  . TRP A 279 ? 0.3673 0.4382 0.3902 -0.0120 0.0106  -0.0267 279 TRP A CG  
2150 C  CD1 . TRP A 279 ? 0.3310 0.4054 0.3543 -0.0120 0.0137  -0.0276 279 TRP A CD1 
2151 C  CD2 . TRP A 279 ? 0.4514 0.5167 0.4716 -0.0169 0.0105  -0.0259 279 TRP A CD2 
2152 N  NE1 . TRP A 279 ? 0.3386 0.4093 0.3595 -0.0167 0.0153  -0.0271 279 TRP A NE1 
2153 C  CE2 . TRP A 279 ? 0.4626 0.5277 0.4818 -0.0196 0.0133  -0.0263 279 TRP A CE2 
2154 C  CE3 . TRP A 279 ? 0.4772 0.5380 0.4954 -0.0191 0.0086  -0.0249 279 TRP A CE3 
2155 C  CZ2 . TRP A 279 ? 0.5496 0.6098 0.5663 -0.0237 0.0138  -0.0259 279 TRP A CZ2 
2156 C  CZ3 . TRP A 279 ? 0.5174 0.5742 0.5333 -0.0233 0.0094  -0.0248 279 TRP A CZ3 
2157 C  CH2 . TRP A 279 ? 0.5599 0.6162 0.5752 -0.0253 0.0118  -0.0254 279 TRP A CH2 
2158 N  N   . ASN A 280 ? 0.2699 0.3306 0.2914 0.0070  0.0026  -0.0268 280 ASN A N   
2159 C  CA  . ASN A 280 ? 0.4582 0.5181 0.4803 0.0123  -0.0006 -0.0256 280 ASN A CA  
2160 C  C   . ASN A 280 ? 0.4000 0.4458 0.4168 0.0123  -0.0033 -0.0236 280 ASN A C   
2161 O  O   . ASN A 280 ? 0.4972 0.5398 0.5134 0.0171  -0.0061 -0.0222 280 ASN A O   
2162 C  CB  . ASN A 280 ? 0.4954 0.5583 0.5194 0.0199  -0.0004 -0.0280 280 ASN A CB  
2163 C  CG  . ASN A 280 ? 0.6073 0.6848 0.6367 0.0201  0.0029  -0.0298 280 ASN A CG  
2164 O  OD1 . ASN A 280 ? 0.6772 0.7612 0.7087 0.0140  0.0049  -0.0292 280 ASN A OD1 
2165 N  ND2 . ASN A 280 ? 0.7201 0.8026 0.7517 0.0271  0.0035  -0.0320 280 ASN A ND2 
2166 N  N   . VAL A 281 ? 0.1957 0.2333 0.2091 0.0074  -0.0025 -0.0233 281 VAL A N   
2167 C  CA  . VAL A 281 ? 0.3347 0.3597 0.3438 0.0066  -0.0047 -0.0211 281 VAL A CA  
2168 C  C   . VAL A 281 ? 0.3642 0.3895 0.3719 0.0014  -0.0051 -0.0178 281 VAL A C   
2169 O  O   . VAL A 281 ? 0.4360 0.4523 0.4403 0.0005  -0.0067 -0.0151 281 VAL A O   
2170 C  CB  . VAL A 281 ? 0.3351 0.3506 0.3415 0.0052  -0.0041 -0.0231 281 VAL A CB  
2171 C  CG1 . VAL A 281 ? 0.2700 0.2853 0.2767 0.0107  -0.0036 -0.0270 281 VAL A CG1 
2172 C  CG2 . VAL A 281 ? 0.3637 0.3819 0.3702 -0.0009 -0.0017 -0.0236 281 VAL A CG2 
2173 N  N   . LEU A 282 ? 0.2192 0.2541 0.2290 -0.0019 -0.0037 -0.0179 282 LEU A N   
2174 C  CA  . LEU A 282 ? 0.2414 0.2770 0.2492 -0.0063 -0.0040 -0.0155 282 LEU A CA  
2175 C  C   . LEU A 282 ? 0.3753 0.4108 0.3814 -0.0036 -0.0070 -0.0123 282 LEU A C   
2176 O  O   . LEU A 282 ? 0.4939 0.5356 0.5027 0.0009  -0.0086 -0.0126 282 LEU A O   
2177 C  CB  . LEU A 282 ? 0.3051 0.3505 0.3156 -0.0099 -0.0023 -0.0170 282 LEU A CB  
2178 C  CG  . LEU A 282 ? 0.3580 0.4033 0.3691 -0.0136 0.0006  -0.0192 282 LEU A CG  
2179 C  CD1 . LEU A 282 ? 0.2669 0.3212 0.2806 -0.0167 0.0016  -0.0203 282 LEU A CD1 
2180 C  CD2 . LEU A 282 ? 0.3659 0.4037 0.3734 -0.0172 0.0012  -0.0182 282 LEU A CD2 
2181 N  N   . PRO A 283 ? 0.4685 0.4984 0.4702 -0.0061 -0.0077 -0.0091 283 PRO A N   
2182 C  CA  . PRO A 283 ? 0.4375 0.4659 0.4362 -0.0032 -0.0106 -0.0054 283 PRO A CA  
2183 C  C   . PRO A 283 ? 0.4115 0.4507 0.4107 -0.0032 -0.0120 -0.0051 283 PRO A C   
2184 O  O   . PRO A 283 ? 0.4321 0.4713 0.4287 0.0001  -0.0149 -0.0021 283 PRO A O   
2185 C  CB  . PRO A 283 ? 0.4706 0.4899 0.4641 -0.0070 -0.0100 -0.0018 283 PRO A CB  
2186 C  CG  . PRO A 283 ? 0.5171 0.5397 0.5116 -0.0125 -0.0070 -0.0040 283 PRO A CG  
2187 C  CD  . PRO A 283 ? 0.5447 0.5701 0.5440 -0.0116 -0.0056 -0.0085 283 PRO A CD  
2188 N  N   . PHE A 284 ? 0.3937 0.4415 0.3958 -0.0067 -0.0