data_6G4O
# 
_entry.id   6G4O 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6G4O         
WWPDB D_1200009415 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6G4O 
_pdbx_database_status.recvd_initial_deposition_date   2018-03-28 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Santoni, G.'    1 ? 
'De la Mora, E.' 2 ? 
'de Souza, J.'   3 ? 
'Silman, I.'     4 ? 
'Sussman, J.'    5 ? 
'Baati, R.'      6 ? 
'Weik, M.'       7 ? 
'Nachon, F.'     8 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'J. Med. Chem.' 
_citation.journal_id_ASTM           JMCMAR 
_citation.journal_id_CSD            0151 
_citation.journal_id_ISSN           1520-4804 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            61 
_citation.language                  ? 
_citation.page_first                7630 
_citation.page_last                 7639 
_citation.title                     
'Structure-Based Optimization of Nonquaternary Reactivators of Acetylcholinesterase Inhibited by Organophosphorus Nerve Agents.' 
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1021/acs.jmedchem.8b00592 
_citation.pdbx_database_id_PubMed   30125110 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Santoni, G.'    1  0000-0001-6215-998X 
primary 'de Sousa, J.'   2  ?                   
primary 'de la Mora, E.' 3  ?                   
primary 'Dias, J.'       4  ?                   
primary 'Jean, L.'       5  0000-0002-1745-4952 
primary 'Sussman, J.L.'  6  ?                   
primary 'Silman, I.'     7  ?                   
primary 'Renard, P.Y.'   8  ?                   
primary 'Brown, R.C.D.'  9  ?                   
primary 'Weik, M.'       10 ?                   
primary 'Baati, R.'      11 ?                   
primary 'Nachon, F.'     12 0000-0003-0293-2429 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6G4O 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     91.543 
_cell.length_a_esd                 ? 
_cell.length_b                     106.351 
_cell.length_b_esd                 ? 
_cell.length_c                     150.533 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6G4O 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat Acetylcholinesterase                                                                         60736.516 2   
3.1.1.7 ? ? ? 
2 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose                                                     221.208   5   ? ? ? 
? 
3 non-polymer syn 'ethoxy-~{N},~{N}-dimethyl-phosphonamidic acid'                                              153.117   2   ? ? ? 
? 
4 non-polymer syn '2-[(~{E})-hydroxyiminomethyl]-6-[4-(1,2,3,4-tetrahydroacridin-9-ylamino)butyl]pyridin-3-ol' 390.478   1   ? ? ? 
? 
5 non-polymer syn 'CHLORIDE ION'                                                                               35.453    8   ? ? ? 
? 
6 non-polymer syn 'TETRAETHYLENE GLYCOL'                                                                       194.226   1   ? ? ? 
? 
7 non-polymer syn 'SODIUM ION'                                                                                 22.990    1   ? ? ? 
? 
8 non-polymer syn 'HEXAETHYLENE GLYCOL'                                                                        282.331   1   ? ? ? 
? 
9 water       nat water                                                                                        18.015    233 ? ? ? 
? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        AChE 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATAC
;
_entity_poly.pdbx_seq_one_letter_code_can   
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATAC
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   ASP n 
1 3   HIS n 
1 4   SER n 
1 5   GLU n 
1 6   LEU n 
1 7   LEU n 
1 8   VAL n 
1 9   ASN n 
1 10  THR n 
1 11  LYS n 
1 12  SER n 
1 13  GLY n 
1 14  LYS n 
1 15  VAL n 
1 16  MET n 
1 17  GLY n 
1 18  THR n 
1 19  ARG n 
1 20  VAL n 
1 21  PRO n 
1 22  VAL n 
1 23  LEU n 
1 24  SER n 
1 25  SER n 
1 26  HIS n 
1 27  ILE n 
1 28  SER n 
1 29  ALA n 
1 30  PHE n 
1 31  LEU n 
1 32  GLY n 
1 33  ILE n 
1 34  PRO n 
1 35  PHE n 
1 36  ALA n 
1 37  GLU n 
1 38  PRO n 
1 39  PRO n 
1 40  VAL n 
1 41  GLY n 
1 42  ASN n 
1 43  MET n 
1 44  ARG n 
1 45  PHE n 
1 46  ARG n 
1 47  ARG n 
1 48  PRO n 
1 49  GLU n 
1 50  PRO n 
1 51  LYS n 
1 52  LYS n 
1 53  PRO n 
1 54  TRP n 
1 55  SER n 
1 56  GLY n 
1 57  VAL n 
1 58  TRP n 
1 59  ASN n 
1 60  ALA n 
1 61  SER n 
1 62  THR n 
1 63  TYR n 
1 64  PRO n 
1 65  ASN n 
1 66  ASN n 
1 67  CYS n 
1 68  GLN n 
1 69  GLN n 
1 70  TYR n 
1 71  VAL n 
1 72  ASP n 
1 73  GLU n 
1 74  GLN n 
1 75  PHE n 
1 76  PRO n 
1 77  GLY n 
1 78  PHE n 
1 79  SER n 
1 80  GLY n 
1 81  SER n 
1 82  GLU n 
1 83  MET n 
1 84  TRP n 
1 85  ASN n 
1 86  PRO n 
1 87  ASN n 
1 88  ARG n 
1 89  GLU n 
1 90  MET n 
1 91  SER n 
1 92  GLU n 
1 93  ASP n 
1 94  CYS n 
1 95  LEU n 
1 96  TYR n 
1 97  LEU n 
1 98  ASN n 
1 99  ILE n 
1 100 TRP n 
1 101 VAL n 
1 102 PRO n 
1 103 SER n 
1 104 PRO n 
1 105 ARG n 
1 106 PRO n 
1 107 LYS n 
1 108 SER n 
1 109 THR n 
1 110 THR n 
1 111 VAL n 
1 112 MET n 
1 113 VAL n 
1 114 TRP n 
1 115 ILE n 
1 116 TYR n 
1 117 GLY n 
1 118 GLY n 
1 119 GLY n 
1 120 PHE n 
1 121 TYR n 
1 122 SER n 
1 123 GLY n 
1 124 SER n 
1 125 SER n 
1 126 THR n 
1 127 LEU n 
1 128 ASP n 
1 129 VAL n 
1 130 TYR n 
1 131 ASN n 
1 132 GLY n 
1 133 LYS n 
1 134 TYR n 
1 135 LEU n 
1 136 ALA n 
1 137 TYR n 
1 138 THR n 
1 139 GLU n 
1 140 GLU n 
1 141 VAL n 
1 142 VAL n 
1 143 LEU n 
1 144 VAL n 
1 145 SER n 
1 146 LEU n 
1 147 SER n 
1 148 TYR n 
1 149 ARG n 
1 150 VAL n 
1 151 GLY n 
1 152 ALA n 
1 153 PHE n 
1 154 GLY n 
1 155 PHE n 
1 156 LEU n 
1 157 ALA n 
1 158 LEU n 
1 159 HIS n 
1 160 GLY n 
1 161 SER n 
1 162 GLN n 
1 163 GLU n 
1 164 ALA n 
1 165 PRO n 
1 166 GLY n 
1 167 ASN n 
1 168 VAL n 
1 169 GLY n 
1 170 LEU n 
1 171 LEU n 
1 172 ASP n 
1 173 GLN n 
1 174 ARG n 
1 175 MET n 
1 176 ALA n 
1 177 LEU n 
1 178 GLN n 
1 179 TRP n 
1 180 VAL n 
1 181 HIS n 
1 182 ASP n 
1 183 ASN n 
1 184 ILE n 
1 185 GLN n 
1 186 PHE n 
1 187 PHE n 
1 188 GLY n 
1 189 GLY n 
1 190 ASP n 
1 191 PRO n 
1 192 LYS n 
1 193 THR n 
1 194 VAL n 
1 195 THR n 
1 196 ILE n 
1 197 PHE n 
1 198 GLY n 
1 199 GLU n 
1 200 SER n 
1 201 ALA n 
1 202 GLY n 
1 203 GLY n 
1 204 ALA n 
1 205 SER n 
1 206 VAL n 
1 207 GLY n 
1 208 MET n 
1 209 HIS n 
1 210 ILE n 
1 211 LEU n 
1 212 SER n 
1 213 PRO n 
1 214 GLY n 
1 215 SER n 
1 216 ARG n 
1 217 ASP n 
1 218 LEU n 
1 219 PHE n 
1 220 ARG n 
1 221 ARG n 
1 222 ALA n 
1 223 ILE n 
1 224 LEU n 
1 225 GLN n 
1 226 SER n 
1 227 GLY n 
1 228 SER n 
1 229 PRO n 
1 230 ASN n 
1 231 CYS n 
1 232 PRO n 
1 233 TRP n 
1 234 ALA n 
1 235 SER n 
1 236 VAL n 
1 237 SER n 
1 238 VAL n 
1 239 ALA n 
1 240 GLU n 
1 241 GLY n 
1 242 ARG n 
1 243 ARG n 
1 244 ARG n 
1 245 ALA n 
1 246 VAL n 
1 247 GLU n 
1 248 LEU n 
1 249 GLY n 
1 250 ARG n 
1 251 ASN n 
1 252 LEU n 
1 253 ASN n 
1 254 CYS n 
1 255 ASN n 
1 256 LEU n 
1 257 ASN n 
1 258 SER n 
1 259 ASP n 
1 260 GLU n 
1 261 GLU n 
1 262 LEU n 
1 263 ILE n 
1 264 HIS n 
1 265 CYS n 
1 266 LEU n 
1 267 ARG n 
1 268 GLU n 
1 269 LYS n 
1 270 LYS n 
1 271 PRO n 
1 272 GLN n 
1 273 GLU n 
1 274 LEU n 
1 275 ILE n 
1 276 ASP n 
1 277 VAL n 
1 278 GLU n 
1 279 TRP n 
1 280 ASN n 
1 281 VAL n 
1 282 LEU n 
1 283 PRO n 
1 284 PHE n 
1 285 ASP n 
1 286 SER n 
1 287 ILE n 
1 288 PHE n 
1 289 ARG n 
1 290 PHE n 
1 291 SER n 
1 292 PHE n 
1 293 VAL n 
1 294 PRO n 
1 295 VAL n 
1 296 ILE n 
1 297 ASP n 
1 298 GLY n 
1 299 GLU n 
1 300 PHE n 
1 301 PHE n 
1 302 PRO n 
1 303 THR n 
1 304 SER n 
1 305 LEU n 
1 306 GLU n 
1 307 SER n 
1 308 MET n 
1 309 LEU n 
1 310 ASN n 
1 311 SER n 
1 312 GLY n 
1 313 ASN n 
1 314 PHE n 
1 315 LYS n 
1 316 LYS n 
1 317 THR n 
1 318 GLN n 
1 319 ILE n 
1 320 LEU n 
1 321 LEU n 
1 322 GLY n 
1 323 VAL n 
1 324 ASN n 
1 325 LYS n 
1 326 ASP n 
1 327 GLU n 
1 328 GLY n 
1 329 SER n 
1 330 PHE n 
1 331 PHE n 
1 332 LEU n 
1 333 LEU n 
1 334 TYR n 
1 335 GLY n 
1 336 ALA n 
1 337 PRO n 
1 338 GLY n 
1 339 PHE n 
1 340 SER n 
1 341 LYS n 
1 342 ASP n 
1 343 SER n 
1 344 GLU n 
1 345 SER n 
1 346 LYS n 
1 347 ILE n 
1 348 SER n 
1 349 ARG n 
1 350 GLU n 
1 351 ASP n 
1 352 PHE n 
1 353 MET n 
1 354 SER n 
1 355 GLY n 
1 356 VAL n 
1 357 LYS n 
1 358 LEU n 
1 359 SER n 
1 360 VAL n 
1 361 PRO n 
1 362 HIS n 
1 363 ALA n 
1 364 ASN n 
1 365 ASP n 
1 366 LEU n 
1 367 GLY n 
1 368 LEU n 
1 369 ASP n 
1 370 ALA n 
1 371 VAL n 
1 372 THR n 
1 373 LEU n 
1 374 GLN n 
1 375 TYR n 
1 376 THR n 
1 377 ASP n 
1 378 TRP n 
1 379 MET n 
1 380 ASP n 
1 381 ASP n 
1 382 ASN n 
1 383 ASN n 
1 384 GLY n 
1 385 ILE n 
1 386 LYS n 
1 387 ASN n 
1 388 ARG n 
1 389 ASP n 
1 390 GLY n 
1 391 LEU n 
1 392 ASP n 
1 393 ASP n 
1 394 ILE n 
1 395 VAL n 
1 396 GLY n 
1 397 ASP n 
1 398 HIS n 
1 399 ASN n 
1 400 VAL n 
1 401 ILE n 
1 402 CYS n 
1 403 PRO n 
1 404 LEU n 
1 405 MET n 
1 406 HIS n 
1 407 PHE n 
1 408 VAL n 
1 409 ASN n 
1 410 LYS n 
1 411 TYR n 
1 412 THR n 
1 413 LYS n 
1 414 PHE n 
1 415 GLY n 
1 416 ASN n 
1 417 GLY n 
1 418 THR n 
1 419 TYR n 
1 420 LEU n 
1 421 TYR n 
1 422 PHE n 
1 423 PHE n 
1 424 ASN n 
1 425 HIS n 
1 426 ARG n 
1 427 ALA n 
1 428 SER n 
1 429 ASN n 
1 430 LEU n 
1 431 VAL n 
1 432 TRP n 
1 433 PRO n 
1 434 GLU n 
1 435 TRP n 
1 436 MET n 
1 437 GLY n 
1 438 VAL n 
1 439 ILE n 
1 440 HIS n 
1 441 GLY n 
1 442 TYR n 
1 443 GLU n 
1 444 ILE n 
1 445 GLU n 
1 446 PHE n 
1 447 VAL n 
1 448 PHE n 
1 449 GLY n 
1 450 LEU n 
1 451 PRO n 
1 452 LEU n 
1 453 VAL n 
1 454 LYS n 
1 455 GLU n 
1 456 LEU n 
1 457 ASN n 
1 458 TYR n 
1 459 THR n 
1 460 ALA n 
1 461 GLU n 
1 462 GLU n 
1 463 GLU n 
1 464 ALA n 
1 465 LEU n 
1 466 SER n 
1 467 ARG n 
1 468 ARG n 
1 469 ILE n 
1 470 MET n 
1 471 HIS n 
1 472 TYR n 
1 473 TRP n 
1 474 ALA n 
1 475 THR n 
1 476 PHE n 
1 477 ALA n 
1 478 LYS n 
1 479 THR n 
1 480 GLY n 
1 481 ASN n 
1 482 PRO n 
1 483 ASN n 
1 484 GLU n 
1 485 PRO n 
1 486 HIS n 
1 487 SER n 
1 488 GLN n 
1 489 GLU n 
1 490 SER n 
1 491 LYS n 
1 492 TRP n 
1 493 PRO n 
1 494 LEU n 
1 495 PHE n 
1 496 THR n 
1 497 THR n 
1 498 LYS n 
1 499 GLU n 
1 500 GLN n 
1 501 LYS n 
1 502 PHE n 
1 503 ILE n 
1 504 ASP n 
1 505 LEU n 
1 506 ASN n 
1 507 THR n 
1 508 GLU n 
1 509 PRO n 
1 510 MET n 
1 511 LYS n 
1 512 VAL n 
1 513 HIS n 
1 514 GLN n 
1 515 ARG n 
1 516 LEU n 
1 517 ARG n 
1 518 VAL n 
1 519 GLN n 
1 520 MET n 
1 521 CYS n 
1 522 VAL n 
1 523 PHE n 
1 524 TRP n 
1 525 ASN n 
1 526 GLN n 
1 527 PHE n 
1 528 LEU n 
1 529 PRO n 
1 530 LYS n 
1 531 LEU n 
1 532 LEU n 
1 533 ASN n 
1 534 ALA n 
1 535 THR n 
1 536 ALA n 
1 537 CYS n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           1 
_entity_src_nat.pdbx_end_seq_num           537 
_entity_src_nat.common_name                'Pacific electric ray' 
_entity_src_nat.pdbx_organism_scientific   'Tetronarce californica' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      7787 
_entity_src_nat.genus                      ? 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_TETCF 
_struct_ref.pdbx_db_accession          P04058 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATAC
;
_struct_ref.pdbx_align_begin           22 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6G4O A 1 ? 537 ? P04058 22 ? 558 ? 1 537 
2 1 6G4O B 1 ? 537 ? P04058 22 ? 558 ? 1 537 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE                                                                                      ? 
'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'          y ARGININE                                                                                     ? 
'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'          y ASPARAGINE                                                                                   ? 
'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                                                                              ? 
'C4 H7 N O4'     133.103 
CL  non-polymer                  . 'CHLORIDE ION'                                                                               ? 
'Cl -1'          35.453  
CYS 'L-peptide linking'          y CYSTEINE                                                                                     ? 
'C3 H7 N O2 S'   121.158 
DQ5 non-polymer                  . '2-[(~{E})-hydroxyiminomethyl]-6-[4-(1,2,3,4-tetrahydroacridin-9-ylamino)butyl]pyridin-3-ol' ? 
'C23 H26 N4 O2'  390.478 
ELT non-polymer                  . 'ethoxy-~{N},~{N}-dimethyl-phosphonamidic acid'                                              ? 
'C4 H12 N O3 P'  153.117 
GLN 'L-peptide linking'          y GLUTAMINE                                                                                    ? 
'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                                                                              ? 
'C5 H9 N O4'     147.129 
GLY 'peptide linking'            y GLYCINE                                                                                      ? 
'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'          y HISTIDINE                                                                                    ? 
'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                  . WATER                                                                                        ? 
'H2 O'           18.015  
ILE 'L-peptide linking'          y ISOLEUCINE                                                                                   ? 
'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'          y LEUCINE                                                                                      ? 
'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'          y LYSINE                                                                                       ? 
'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'          y METHIONINE                                                                                   ? 
'C5 H11 N O2 S'  149.211 
NA  non-polymer                  . 'SODIUM ION'                                                                                 ? 
'Na 1'           22.990  
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose                                                     ? 
'C8 H15 N O6'    221.208 
P6G non-polymer                  . 'HEXAETHYLENE GLYCOL'                                                                        
'POLYETHYLENE GLYCOL PEG400' 'C12 H26 O7'     282.331 
PG4 non-polymer                  . 'TETRAETHYLENE GLYCOL'                                                                       ? 
'C8 H18 O5'      194.226 
PHE 'L-peptide linking'          y PHENYLALANINE                                                                                ? 
'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'          y PROLINE                                                                                      ? 
'C5 H9 N O2'     115.130 
SER 'L-peptide linking'          y SERINE                                                                                       ? 
'C3 H7 N O3'     105.093 
THR 'L-peptide linking'          y THREONINE                                                                                    ? 
'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                                                                                   ? 
'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'          y TYROSINE                                                                                     ? 
'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'          y VALINE                                                                                       ? 
'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6G4O 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.01 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         59.17 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              5.6 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
;150mM MES
36% PEG 200
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-06-26 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.12 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ESRF BEAMLINE ID23-1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.12 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   ID23-1 
_diffrn_source.pdbx_synchrotron_site       ESRF 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6G4O 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.78 
_reflns.d_resolution_low                 45.981 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       37192 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             98.69 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  4.6 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            9.2 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.99 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.78 
_reflns_shell.d_res_low                   2.879 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           3646 
_reflns_shell.percent_possible_all        98.48 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.85 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6G4O 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.780 
_refine.ls_d_res_low                             45.981 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     37171 
_refine.ls_number_reflns_R_free                  1863 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    98.64 
_refine.ls_percent_reflns_R_free                 5.01 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1910 
_refine.ls_R_factor_R_free                       0.2643 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1870 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      1ea5 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 30.02 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.39 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8454 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         156 
_refine_hist.number_atoms_solvent             233 
_refine_hist.number_atoms_total               8843 
_refine_hist.d_res_high                       2.780 
_refine_hist.d_res_low                        45.981 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.009  ? 8872  ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.087  ? 12047 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 19.511 ? 5212  ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.061  ? 1263  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.008  ? 1555  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.7800 2.8552  . . 141 2668 98.00 . . . 0.3381 . 0.2771 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.8552 2.9392  . . 137 2694 99.00 . . . 0.3791 . 0.2616 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.9392 3.0340  . . 130 2696 99.00 . . . 0.3328 . 0.2445 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.0340 3.1424  . . 149 2669 99.00 . . . 0.3020 . 0.2323 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.1424 3.2682  . . 149 2678 98.00 . . . 0.3466 . 0.2283 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.2682 3.4169  . . 137 2712 99.00 . . . 0.3292 . 0.2123 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.4169 3.5970  . . 129 2709 99.00 . . . 0.2841 . 0.1908 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.5970 3.8223  . . 144 2716 99.00 . . . 0.2631 . 0.1774 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.8223 4.1172  . . 150 2680 98.00 . . . 0.2350 . 0.1573 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.1172 4.5312  . . 141 2698 98.00 . . . 0.2318 . 0.1479 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.5312 5.1861  . . 141 2744 98.00 . . . 0.2175 . 0.1406 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.1861 6.5310  . . 161 2769 99.00 . . . 0.2297 . 0.1720 . . . . . . . . . . 
'X-RAY DIFFRACTION' 6.5310 45.9872 . . 154 2875 98.00 . . . 0.2312 . 0.1895 . . . . . . . . . . 
# 
_struct.entry_id                     6G4O 
_struct.title                        
'Non-aged form of Torpedo californica acetylcholinesterase inhibited by tabun analog NEDPA bound to uncharged reactivator 1' 
_struct.pdbx_descriptor              'Acetylcholinesterase (E.C.3.1.1.7)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6G4O 
_struct_keywords.text            'acetylcholinesterase, tabun, nerve agent, HYDROLASE' 
_struct_keywords.pdbx_keywords   HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 5 ? 
H N N 5 ? 
I N N 6 ? 
J N N 5 ? 
K N N 5 ? 
L N N 5 ? 
M N N 2 ? 
N N N 2 ? 
O N N 3 ? 
P N N 2 ? 
Q N N 5 ? 
R N N 7 ? 
S N N 5 ? 
T N N 5 ? 
U N N 8 ? 
V N N 9 ? 
W N N 9 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 VAL A 40  ? ARG A 44  ? VAL A 40  ARG A 44  5 ? 5  
HELX_P HELX_P2  AA2 PHE A 78  ? MET A 83  ? PHE A 78  MET A 83  1 ? 6  
HELX_P HELX_P3  AA3 GLY A 132 ? GLU A 140 ? GLY A 132 GLU A 140 1 ? 9  
HELX_P HELX_P4  AA4 GLY A 151 ? LEU A 156 ? GLY A 151 LEU A 156 1 ? 6  
HELX_P HELX_P5  AA5 ASN A 167 ? ILE A 184 ? ASN A 167 ILE A 184 1 ? 18 
HELX_P HELX_P6  AA6 GLN A 185 ? PHE A 187 ? GLN A 185 PHE A 187 5 ? 3  
HELX_P HELX_P7  AA7 SER A 200 ? SER A 212 ? SER A 200 SER A 212 1 ? 13 
HELX_P HELX_P8  AA8 SER A 212 ? ASP A 217 ? SER A 212 ASP A 217 1 ? 6  
HELX_P HELX_P9  AA9 SER A 237 ? ASN A 251 ? SER A 237 ASN A 251 1 ? 15 
HELX_P HELX_P10 AB1 ASP A 259 ? GLU A 268 ? ASP A 259 GLU A 268 1 ? 10 
HELX_P HELX_P11 AB2 LYS A 270 ? GLU A 278 ? LYS A 270 GLU A 278 1 ? 9  
HELX_P HELX_P12 AB3 TRP A 279 ? LEU A 282 ? TRP A 279 LEU A 282 5 ? 4  
HELX_P HELX_P13 AB4 SER A 304 ? GLY A 312 ? SER A 304 GLY A 312 1 ? 9  
HELX_P HELX_P14 AB5 GLY A 328 ? ALA A 336 ? GLY A 328 ALA A 336 1 ? 9  
HELX_P HELX_P15 AB6 SER A 348 ? VAL A 360 ? SER A 348 VAL A 360 1 ? 13 
HELX_P HELX_P16 AB7 ASN A 364 ? THR A 376 ? ASN A 364 THR A 376 1 ? 13 
HELX_P HELX_P17 AB8 ASN A 383 ? VAL A 400 ? ASN A 383 VAL A 400 1 ? 18 
HELX_P HELX_P18 AB9 VAL A 400 ? GLY A 415 ? VAL A 400 GLY A 415 1 ? 16 
HELX_P HELX_P19 AC1 PRO A 433 ? GLY A 437 ? PRO A 433 GLY A 437 5 ? 5  
HELX_P HELX_P20 AC2 GLU A 443 ? PHE A 448 ? GLU A 443 PHE A 448 1 ? 6  
HELX_P HELX_P21 AC3 GLY A 449 ? ASN A 457 ? GLY A 449 ASN A 457 5 ? 9  
HELX_P HELX_P22 AC4 THR A 459 ? GLY A 480 ? THR A 459 GLY A 480 1 ? 22 
HELX_P HELX_P23 AC5 ARG A 517 ? GLN A 526 ? ARG A 517 GLN A 526 1 ? 10 
HELX_P HELX_P24 AC6 GLN A 526 ? THR A 535 ? GLN A 526 THR A 535 1 ? 10 
HELX_P HELX_P25 AC7 VAL B 40  ? ARG B 44  ? VAL B 40  ARG B 44  5 ? 5  
HELX_P HELX_P26 AC8 PHE B 78  ? MET B 83  ? PHE B 78  MET B 83  1 ? 6  
HELX_P HELX_P27 AC9 LEU B 127 ? ASN B 131 ? LEU B 127 ASN B 131 5 ? 5  
HELX_P HELX_P28 AD1 GLY B 132 ? GLU B 140 ? GLY B 132 GLU B 140 1 ? 9  
HELX_P HELX_P29 AD2 VAL B 150 ? LEU B 156 ? VAL B 150 LEU B 156 1 ? 7  
HELX_P HELX_P30 AD3 ASN B 167 ? ILE B 184 ? ASN B 167 ILE B 184 1 ? 18 
HELX_P HELX_P31 AD4 GLN B 185 ? PHE B 187 ? GLN B 185 PHE B 187 5 ? 3  
HELX_P HELX_P32 AD5 SER B 200 ? SER B 212 ? SER B 200 SER B 212 1 ? 13 
HELX_P HELX_P33 AD6 SER B 212 ? ASP B 217 ? SER B 212 ASP B 217 1 ? 6  
HELX_P HELX_P34 AD7 VAL B 238 ? ASN B 251 ? VAL B 238 ASN B 251 1 ? 14 
HELX_P HELX_P35 AD8 SER B 258 ? LYS B 269 ? SER B 258 LYS B 269 1 ? 12 
HELX_P HELX_P36 AD9 LYS B 270 ? GLU B 278 ? LYS B 270 GLU B 278 1 ? 9  
HELX_P HELX_P37 AE1 TRP B 279 ? LEU B 282 ? TRP B 279 LEU B 282 5 ? 4  
HELX_P HELX_P38 AE2 SER B 304 ? GLY B 312 ? SER B 304 GLY B 312 1 ? 9  
HELX_P HELX_P39 AE3 GLY B 328 ? ALA B 336 ? GLY B 328 ALA B 336 1 ? 9  
HELX_P HELX_P40 AE4 SER B 348 ? VAL B 360 ? SER B 348 VAL B 360 1 ? 13 
HELX_P HELX_P41 AE5 ASN B 364 ? THR B 376 ? ASN B 364 THR B 376 1 ? 13 
HELX_P HELX_P42 AE6 ASN B 383 ? VAL B 400 ? ASN B 383 VAL B 400 1 ? 18 
HELX_P HELX_P43 AE7 VAL B 400 ? GLY B 415 ? VAL B 400 GLY B 415 1 ? 16 
HELX_P HELX_P44 AE8 PRO B 433 ? GLY B 437 ? PRO B 433 GLY B 437 5 ? 5  
HELX_P HELX_P45 AE9 GLU B 443 ? PHE B 448 ? GLU B 443 PHE B 448 1 ? 6  
HELX_P HELX_P46 AF1 GLY B 449 ? ASN B 457 ? GLY B 449 ASN B 457 5 ? 9  
HELX_P HELX_P47 AF2 THR B 459 ? GLY B 480 ? THR B 459 GLY B 480 1 ? 22 
HELX_P HELX_P48 AF3 ARG B 517 ? GLN B 526 ? ARG B 517 GLN B 526 1 ? 10 
HELX_P HELX_P49 AF4 GLN B 526 ? THR B 535 ? GLN B 526 THR B 535 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?   ? A CYS 67  SG  ? ? ? 1_555 A CYS 94  SG  ? ? A CYS 67  A CYS 94  1_555 ? ? ? ? ? ? ? 2.058 ? ?               
disulf2 disulf ?   ? A CYS 254 SG  ? ? ? 1_555 A CYS 265 SG  ? ? A CYS 254 A CYS 265 1_555 ? ? ? ? ? ? ? 2.040 ? ?               
disulf3 disulf ?   ? A CYS 402 SG  ? ? ? 1_555 A CYS 521 SG  ? ? A CYS 402 A CYS 521 1_555 ? ? ? ? ? ? ? 2.047 ? ?               
disulf4 disulf ?   ? B CYS 67  SG  ? ? ? 1_555 B CYS 94  SG  ? ? B CYS 67  B CYS 94  1_555 ? ? ? ? ? ? ? 2.041 ? ?               
disulf5 disulf ?   ? B CYS 254 SG  ? ? ? 1_555 B CYS 265 SG  ? ? B CYS 254 B CYS 265 1_555 ? ? ? ? ? ? ? 2.055 ? ?               
disulf6 disulf ?   ? B CYS 402 SG  ? ? ? 1_555 B CYS 521 SG  ? ? B CYS 402 B CYS 521 1_555 ? ? ? ? ? ? ? 2.111 ? ?               
covale1 covale one ? A ASN 59  ND2 ? ? ? 1_555 C NAG .   C1  ? ? A ASN 59  A NAG 601 1_555 ? ? ? ? ? ? ? 1.461 ? N-Glycosylation 
covale2 covale one ? A SER 200 OG  ? ? ? 1_555 E ELT .   P01 ? ? A SER 200 A ELT 603 1_555 ? ? ? ? ? ? ? 1.613 ? ?               
covale3 covale one ? A ASN 416 ND2 ? ? ? 1_555 D NAG .   C1  ? ? A ASN 416 A NAG 602 1_555 ? ? ? ? ? ? ? 1.459 ? N-Glycosylation 
covale4 covale one ? B ASN 59  ND2 ? ? ? 1_555 M NAG .   C1  ? ? B ASN 59  B NAG 601 1_555 ? ? ? ? ? ? ? 1.452 ? N-Glycosylation 
covale5 covale one ? B SER 200 OG  ? ? ? 1_555 O ELT .   P01 ? ? B SER 200 B ELT 603 1_555 ? ? ? ? ? ? ? 1.570 ? ?               
covale6 covale one ? B ASN 416 ND2 ? ? ? 1_555 N NAG .   C1  ? ? B ASN 416 B NAG 602 1_555 ? ? ? ? ? ? ? 1.447 ? N-Glycosylation 
covale7 covale one ? B ASN 457 ND2 ? ? ? 1_555 P NAG .   C1  ? ? B ASN 457 B NAG 604 1_555 ? ? ? ? ? ? ? 1.438 ? N-Glycosylation 
metalc1 metalc ?   ? B ASP 259 OD2 ? ? ? 1_555 R NA  .   NA  ? ? B ASP 259 B NA  606 1_555 ? ? ? ? ? ? ? 2.346 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 SER 103 A . ? SER 103 A PRO 104 A ? PRO 104 A 1 -1.41 
2 SER 103 B . ? SER 103 B PRO 104 B ? PRO 104 B 1 3.45  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3  ? 
AA2 ? 11 ? 
AA3 ? 2  ? 
AA4 ? 3  ? 
AA5 ? 11 ? 
AA6 ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1  2  ? anti-parallel 
AA1 2  3  ? parallel      
AA2 1  2  ? anti-parallel 
AA2 2  3  ? anti-parallel 
AA2 3  4  ? anti-parallel 
AA2 4  5  ? parallel      
AA2 5  6  ? parallel      
AA2 6  7  ? parallel      
AA2 7  8  ? parallel      
AA2 8  9  ? parallel      
AA2 9  10 ? parallel      
AA2 10 11 ? anti-parallel 
AA3 1  2  ? parallel      
AA4 1  2  ? anti-parallel 
AA4 2  3  ? parallel      
AA5 1  2  ? anti-parallel 
AA5 2  3  ? anti-parallel 
AA5 3  4  ? anti-parallel 
AA5 4  5  ? parallel      
AA5 5  6  ? parallel      
AA5 6  7  ? parallel      
AA5 7  8  ? parallel      
AA5 8  9  ? parallel      
AA5 9  10 ? parallel      
AA5 10 11 ? anti-parallel 
AA6 1  2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1  LEU A 7   ? THR A 10  ? LEU A 7   THR A 10  
AA1 2  GLY A 13  ? MET A 16  ? GLY A 13  MET A 16  
AA1 3  VAL A 57  ? ASN A 59  ? VAL A 57  ASN A 59  
AA2 1  THR A 18  ? VAL A 22  ? THR A 18  VAL A 22  
AA2 2  SER A 25  ? PRO A 34  ? SER A 25  PRO A 34  
AA2 3  TYR A 96  ? PRO A 102 ? TYR A 96  PRO A 102 
AA2 4  VAL A 142 ? SER A 145 ? VAL A 142 SER A 145 
AA2 5  THR A 109 ? ILE A 115 ? THR A 109 ILE A 115 
AA2 6  GLY A 189 ? GLU A 199 ? GLY A 189 GLU A 199 
AA2 7  ARG A 221 ? GLN A 225 ? ARG A 221 GLN A 225 
AA2 8  ILE A 319 ? ASN A 324 ? ILE A 319 ASN A 324 
AA2 9  THR A 418 ? PHE A 423 ? THR A 418 PHE A 423 
AA2 10 LYS A 501 ? LEU A 505 ? LYS A 501 LEU A 505 
AA2 11 VAL A 512 ? GLN A 514 ? VAL A 512 GLN A 514 
AA3 1  ASN A 66  ? CYS A 67  ? ASN A 66  CYS A 67  
AA3 2  MET A 90  ? SER A 91  ? MET A 90  SER A 91  
AA4 1  LEU B 7   ? ASN B 9   ? LEU B 7   ASN B 9   
AA4 2  LYS B 14  ? MET B 16  ? LYS B 14  MET B 16  
AA4 3  VAL B 57  ? ASN B 59  ? VAL B 57  ASN B 59  
AA5 1  THR B 18  ? VAL B 22  ? THR B 18  VAL B 22  
AA5 2  SER B 25  ? PRO B 34  ? SER B 25  PRO B 34  
AA5 3  TYR B 96  ? VAL B 101 ? TYR B 96  VAL B 101 
AA5 4  VAL B 142 ? SER B 145 ? VAL B 142 SER B 145 
AA5 5  THR B 109 ? ILE B 115 ? THR B 109 ILE B 115 
AA5 6  GLY B 189 ? GLU B 199 ? GLY B 189 GLU B 199 
AA5 7  ARG B 221 ? GLN B 225 ? ARG B 221 GLN B 225 
AA5 8  ILE B 319 ? ASN B 324 ? ILE B 319 ASN B 324 
AA5 9  THR B 418 ? PHE B 423 ? THR B 418 PHE B 423 
AA5 10 LYS B 501 ? LEU B 505 ? LYS B 501 LEU B 505 
AA5 11 VAL B 512 ? GLN B 514 ? VAL B 512 GLN B 514 
AA6 1  VAL B 236 ? SER B 237 ? VAL B 236 SER B 237 
AA6 2  VAL B 295 ? ILE B 296 ? VAL B 295 ILE B 296 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1  2  N VAL A 8   ? N VAL A 8   O VAL A 15  ? O VAL A 15  
AA1 2  3  N MET A 16  ? N MET A 16  O TRP A 58  ? O TRP A 58  
AA2 1  2  N VAL A 22  ? N VAL A 22  O SER A 25  ? O SER A 25  
AA2 2  3  N PHE A 30  ? N PHE A 30  O ILE A 99  ? O ILE A 99  
AA2 3  4  N TRP A 100 ? N TRP A 100 O LEU A 143 ? O LEU A 143 
AA2 4  5  O VAL A 144 ? O VAL A 144 N TRP A 114 ? N TRP A 114 
AA2 5  6  N VAL A 113 ? N VAL A 113 O PHE A 197 ? O PHE A 197 
AA2 6  7  N ILE A 196 ? N ILE A 196 O ILE A 223 ? O ILE A 223 
AA2 7  8  N LEU A 224 ? N LEU A 224 O LEU A 320 ? O LEU A 320 
AA2 8  9  N LEU A 321 ? N LEU A 321 O TYR A 419 ? O TYR A 419 
AA2 9  10 N PHE A 422 ? N PHE A 422 O ILE A 503 ? O ILE A 503 
AA2 10 11 N PHE A 502 ? N PHE A 502 O HIS A 513 ? O HIS A 513 
AA3 1  2  N ASN A 66  ? N ASN A 66  O SER A 91  ? O SER A 91  
AA4 1  2  N VAL B 8   ? N VAL B 8   O VAL B 15  ? O VAL B 15  
AA4 2  3  N MET B 16  ? N MET B 16  O TRP B 58  ? O TRP B 58  
AA5 1  2  N VAL B 20  ? N VAL B 20  O ILE B 27  ? O ILE B 27  
AA5 2  3  N SER B 28  ? N SER B 28  O VAL B 101 ? O VAL B 101 
AA5 3  4  N TRP B 100 ? N TRP B 100 O LEU B 143 ? O LEU B 143 
AA5 4  5  O VAL B 144 ? O VAL B 144 N TRP B 114 ? N TRP B 114 
AA5 5  6  N VAL B 111 ? N VAL B 111 O THR B 195 ? O THR B 195 
AA5 6  7  N GLY B 198 ? N GLY B 198 O GLN B 225 ? O GLN B 225 
AA5 7  8  N LEU B 224 ? N LEU B 224 O GLY B 322 ? O GLY B 322 
AA5 8  9  N VAL B 323 ? N VAL B 323 O PHE B 423 ? O PHE B 423 
AA5 9  10 N PHE B 422 ? N PHE B 422 O ILE B 503 ? O ILE B 503 
AA5 10 11 N PHE B 502 ? N PHE B 502 O HIS B 513 ? O HIS B 513 
AA6 1  2  N VAL B 236 ? N VAL B 236 O ILE B 296 ? O ILE B 296 
# 
_atom_sites.entry_id                    6G4O 
_atom_sites.fract_transf_matrix[1][1]   0.010924 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009403 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006643 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
NA 
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . SER A 1 4   ? -23.114 -13.011 -36.435 1.00 72.95  ? 4   SER A N   1 
ATOM   2    C  CA  . SER A 1 4   ? -21.978 -13.769 -35.920 1.00 76.85  ? 4   SER A CA  1 
ATOM   3    C  C   . SER A 1 4   ? -21.713 -13.481 -34.443 1.00 79.14  ? 4   SER A C   1 
ATOM   4    O  O   . SER A 1 4   ? -22.010 -12.388 -33.945 1.00 76.41  ? 4   SER A O   1 
ATOM   5    C  CB  . SER A 1 4   ? -20.714 -13.470 -36.720 1.00 72.64  ? 4   SER A CB  1 
ATOM   6    O  OG  . SER A 1 4   ? -19.586 -14.046 -36.080 1.00 70.88  ? 4   SER A OG  1 
ATOM   7    N  N   . GLU A 1 5   ? -21.139 -14.468 -33.749 1.00 75.47  ? 5   GLU A N   1 
ATOM   8    C  CA  . GLU A 1 5   ? -20.906 -14.316 -32.317 1.00 79.67  ? 5   GLU A CA  1 
ATOM   9    C  C   . GLU A 1 5   ? -19.973 -13.141 -32.033 1.00 81.53  ? 5   GLU A C   1 
ATOM   10   O  O   . GLU A 1 5   ? -20.238 -12.331 -31.134 1.00 84.51  ? 5   GLU A O   1 
ATOM   11   C  CB  . GLU A 1 5   ? -20.341 -15.615 -31.729 1.00 78.46  ? 5   GLU A CB  1 
ATOM   12   C  CG  . GLU A 1 5   ? -21.071 -16.086 -30.468 1.00 77.28  ? 5   GLU A CG  1 
ATOM   13   C  CD  . GLU A 1 5   ? -20.396 -17.257 -29.760 1.00 74.02  ? 5   GLU A CD  1 
ATOM   14   O  OE1 . GLU A 1 5   ? -20.060 -17.121 -28.555 1.00 76.04  ? 5   GLU A OE1 1 
ATOM   15   O  OE2 . GLU A 1 5   ? -20.220 -18.317 -30.398 1.00 68.94  1 5   GLU A OE2 1 
ATOM   16   N  N   . LEU A 1 6   ? -18.891 -13.019 -32.809 1.00 72.90  ? 6   LEU A N   1 
ATOM   17   C  CA  . LEU A 1 6   ? -17.879 -11.984 -32.643 1.00 57.13  ? 6   LEU A CA  1 
ATOM   18   C  C   . LEU A 1 6   ? -18.145 -10.736 -33.460 1.00 58.10  ? 6   LEU A C   1 
ATOM   19   O  O   . LEU A 1 6   ? -17.268 -9.872  -33.540 1.00 52.28  ? 6   LEU A O   1 
ATOM   20   C  CB  . LEU A 1 6   ? -16.504 -12.525 -33.017 1.00 62.34  ? 6   LEU A CB  1 
ATOM   21   C  CG  . LEU A 1 6   ? -16.315 -13.935 -32.473 1.00 67.97  ? 6   LEU A CG  1 
ATOM   22   C  CD1 . LEU A 1 6   ? -15.141 -14.649 -33.144 1.00 50.61  ? 6   LEU A CD1 1 
ATOM   23   C  CD2 . LEU A 1 6   ? -16.144 -13.852 -30.957 1.00 71.53  ? 6   LEU A CD2 1 
ATOM   24   N  N   . LEU A 1 7   ? -19.305 -10.630 -34.083 1.00 72.11  ? 7   LEU A N   1 
ATOM   25   C  CA  . LEU A 1 7   ? -19.726 -9.415  -34.766 1.00 76.71  ? 7   LEU A CA  1 
ATOM   26   C  C   . LEU A 1 7   ? -20.789 -8.787  -33.873 1.00 78.80  ? 7   LEU A C   1 
ATOM   27   O  O   . LEU A 1 7   ? -21.950 -9.207  -33.890 1.00 86.87  ? 7   LEU A O   1 
ATOM   28   C  CB  . LEU A 1 7   ? -20.243 -9.729  -36.169 1.00 81.64  ? 7   LEU A CB  1 
ATOM   29   C  CG  . LEU A 1 7   ? -20.578 -8.570  -37.116 1.00 90.96  ? 7   LEU A CG  1 
ATOM   30   C  CD1 . LEU A 1 7   ? -21.959 -7.940  -36.825 1.00 93.77  ? 7   LEU A CD1 1 
ATOM   31   C  CD2 . LEU A 1 7   ? -19.472 -7.520  -37.077 1.00 87.53  ? 7   LEU A CD2 1 
ATOM   32   N  N   . VAL A 1 8   ? -20.381 -7.811  -33.060 1.00 72.11  ? 8   VAL A N   1 
ATOM   33   C  CA  . VAL A 1 8   ? -21.277 -7.102  -32.151 1.00 65.50  ? 8   VAL A CA  1 
ATOM   34   C  C   . VAL A 1 8   ? -21.112 -5.608  -32.402 1.00 60.59  ? 8   VAL A C   1 
ATOM   35   O  O   . VAL A 1 8   ? -19.982 -5.115  -32.502 1.00 68.63  ? 8   VAL A O   1 
ATOM   36   C  CB  . VAL A 1 8   ? -20.991 -7.438  -30.670 1.00 59.80  ? 8   VAL A CB  1 
ATOM   37   C  CG1 . VAL A 1 8   ? -22.025 -6.782  -29.781 1.00 58.46  ? 8   VAL A CG1 1 
ATOM   38   C  CG2 . VAL A 1 8   ? -20.948 -8.959  -30.431 1.00 51.37  ? 8   VAL A CG2 1 
ATOM   39   N  N   . ASN A 1 9   ? -22.229 -4.888  -32.501 1.00 56.00  ? 9   ASN A N   1 
ATOM   40   C  CA  . ASN A 1 9   ? -22.224 -3.467  -32.846 1.00 62.82  ? 9   ASN A CA  1 
ATOM   41   C  C   . ASN A 1 9   ? -22.552 -2.668  -31.589 1.00 59.35  ? 9   ASN A C   1 
ATOM   42   O  O   . ASN A 1 9   ? -23.646 -2.803  -31.034 1.00 61.86  ? 9   ASN A O   1 
ATOM   43   C  CB  . ASN A 1 9   ? -23.222 -3.162  -33.972 1.00 65.74  ? 9   ASN A CB  1 
ATOM   44   C  CG  . ASN A 1 9   ? -23.434 -1.664  -34.201 1.00 78.20  ? 9   ASN A CG  1 
ATOM   45   O  OD1 . ASN A 1 9   ? -22.600 -0.839  -33.821 1.00 87.07  ? 9   ASN A OD1 1 
ATOM   46   N  ND2 . ASN A 1 9   ? -24.538 -1.315  -34.865 1.00 83.90  ? 9   ASN A ND2 1 
ATOM   47   N  N   . THR A 1 10  ? -21.602 -1.845  -31.151 1.00 53.71  ? 10  THR A N   1 
ATOM   48   C  CA  . THR A 1 10  ? -21.720 -1.014  -29.966 1.00 42.71  ? 10  THR A CA  1 
ATOM   49   C  C   . THR A 1 10  ? -22.153 0.400   -30.352 1.00 43.80  ? 10  THR A C   1 
ATOM   50   O  O   . THR A 1 10  ? -22.217 0.757   -31.526 1.00 49.39  ? 10  THR A O   1 
ATOM   51   C  CB  . THR A 1 10  ? -20.388 -0.983  -29.213 1.00 50.18  ? 10  THR A CB  1 
ATOM   52   O  OG1 . THR A 1 10  ? -19.516 -0.024  -29.819 1.00 54.58  ? 10  THR A OG1 1 
ATOM   53   C  CG2 . THR A 1 10  ? -19.718 -2.365  -29.245 1.00 40.73  ? 10  THR A CG2 1 
ATOM   54   N  N   . LYS A 1 11  ? -22.441 1.224   -29.344 1.00 56.56  ? 11  LYS A N   1 
ATOM   55   C  CA  . LYS A 1 11  ? -22.963 2.566   -29.593 1.00 59.08  ? 11  LYS A CA  1 
ATOM   56   C  C   . LYS A 1 11  ? -21.903 3.525   -30.117 1.00 65.04  ? 11  LYS A C   1 
ATOM   57   O  O   . LYS A 1 11  ? -22.215 4.691   -30.378 1.00 67.25  ? 11  LYS A O   1 
ATOM   58   C  CB  . LYS A 1 11  ? -23.559 3.149   -28.319 1.00 54.27  ? 11  LYS A CB  1 
ATOM   59   C  CG  . LYS A 1 11  ? -24.454 2.230   -27.535 1.00 56.11  ? 11  LYS A CG  1 
ATOM   60   C  CD  . LYS A 1 11  ? -25.865 2.725   -27.457 1.00 62.10  ? 11  LYS A CD  1 
ATOM   61   C  CE  . LYS A 1 11  ? -26.688 1.779   -26.599 1.00 62.55  ? 11  LYS A CE  1 
ATOM   62   N  NZ  . LYS A 1 11  ? -28.011 2.364   -26.286 1.00 69.41  1 11  LYS A NZ  1 
ATOM   63   N  N   . SER A 1 12  ? -20.659 3.081   -30.235 1.00 74.00  ? 12  SER A N   1 
ATOM   64   C  CA  . SER A 1 12  ? -19.592 3.878   -30.815 1.00 74.56  ? 12  SER A CA  1 
ATOM   65   C  C   . SER A 1 12  ? -19.110 3.309   -32.145 1.00 68.46  ? 12  SER A C   1 
ATOM   66   O  O   . SER A 1 12  ? -18.162 3.842   -32.722 1.00 74.91  ? 12  SER A O   1 
ATOM   67   C  CB  . SER A 1 12  ? -18.420 3.987   -29.824 1.00 77.95  ? 12  SER A CB  1 
ATOM   68   O  OG  . SER A 1 12  ? -18.791 4.565   -28.577 1.00 71.88  ? 12  SER A OG  1 
ATOM   69   N  N   . GLY A 1 13  ? -19.745 2.263   -32.653 1.00 55.04  ? 13  GLY A N   1 
ATOM   70   C  CA  . GLY A 1 13  ? -19.262 1.530   -33.806 1.00 50.95  ? 13  GLY A CA  1 
ATOM   71   C  C   . GLY A 1 13  ? -19.161 0.047   -33.509 1.00 54.97  ? 13  GLY A C   1 
ATOM   72   O  O   . GLY A 1 13  ? -19.353 -0.411  -32.384 1.00 44.98  ? 13  GLY A O   1 
ATOM   73   N  N   . LYS A 1 14  ? -18.844 -0.705  -34.561 1.00 57.25  ? 14  LYS A N   1 
ATOM   74   C  CA  . LYS A 1 14  ? -18.770 -2.153  -34.422 1.00 57.10  ? 14  LYS A CA  1 
ATOM   75   C  C   . LYS A 1 14  ? -17.364 -2.623  -34.076 1.00 65.02  ? 14  LYS A C   1 
ATOM   76   O  O   . LYS A 1 14  ? -16.358 -2.001  -34.431 1.00 64.99  ? 14  LYS A O   1 
ATOM   77   C  CB  . LYS A 1 14  ? -19.239 -2.876  -35.681 1.00 52.73  ? 14  LYS A CB  1 
ATOM   78   C  CG  . LYS A 1 14  ? -20.302 -2.170  -36.475 1.00 59.21  ? 14  LYS A CG  1 
ATOM   79   C  CD  . LYS A 1 14  ? -20.305 -2.691  -37.905 1.00 59.51  ? 14  LYS A CD  1 
ATOM   80   C  CE  . LYS A 1 14  ? -21.278 -1.924  -38.759 1.00 70.67  ? 14  LYS A CE  1 
ATOM   81   N  NZ  . LYS A 1 14  ? -22.629 -2.549  -38.661 1.00 80.51  1 14  LYS A NZ  1 
ATOM   82   N  N   . VAL A 1 15  ? -17.314 -3.739  -33.359 1.00 65.41  ? 15  VAL A N   1 
ATOM   83   C  CA  . VAL A 1 15  ? -16.079 -4.399  -32.981 1.00 57.23  ? 15  VAL A CA  1 
ATOM   84   C  C   . VAL A 1 15  ? -16.190 -5.849  -33.430 1.00 60.58  ? 15  VAL A C   1 
ATOM   85   O  O   . VAL A 1 15  ? -17.289 -6.404  -33.532 1.00 60.87  ? 15  VAL A O   1 
ATOM   86   C  CB  . VAL A 1 15  ? -15.802 -4.296  -31.451 1.00 56.79  ? 15  VAL A CB  1 
ATOM   87   C  CG1 . VAL A 1 15  ? -16.192 -2.922  -30.912 1.00 41.56  ? 15  VAL A CG1 1 
ATOM   88   C  CG2 . VAL A 1 15  ? -16.504 -5.397  -30.668 1.00 41.00  ? 15  VAL A CG2 1 
ATOM   89   N  N   . MET A 1 16  ? -15.041 -6.454  -33.732 1.00 69.35  ? 16  MET A N   1 
ATOM   90   C  CA  . MET A 1 16  ? -14.958 -7.879  -34.026 1.00 73.59  ? 16  MET A CA  1 
ATOM   91   C  C   . MET A 1 16  ? -13.882 -8.517  -33.162 1.00 77.40  ? 16  MET A C   1 
ATOM   92   O  O   . MET A 1 16  ? -12.735 -8.050  -33.141 1.00 77.77  ? 16  MET A O   1 
ATOM   93   C  CB  . MET A 1 16  ? -14.663 -8.154  -35.499 1.00 65.68  ? 16  MET A CB  1 
ATOM   94   C  CG  . MET A 1 16  ? -14.895 -9.601  -35.842 1.00 71.24  ? 16  MET A CG  1 
ATOM   95   S  SD  . MET A 1 16  ? -15.589 -9.821  -37.472 1.00 100.93 ? 16  MET A SD  1 
ATOM   96   C  CE  . MET A 1 16  ? -17.221 -10.463 -37.090 1.00 103.88 ? 16  MET A CE  1 
ATOM   97   N  N   . GLY A 1 17  ? -14.254 -9.592  -32.472 1.00 69.11  ? 17  GLY A N   1 
ATOM   98   C  CA  . GLY A 1 17  ? -13.396 -10.286 -31.536 1.00 53.01  ? 17  GLY A CA  1 
ATOM   99   C  C   . GLY A 1 17  ? -12.686 -11.480 -32.139 1.00 55.28  ? 17  GLY A C   1 
ATOM   100  O  O   . GLY A 1 17  ? -12.369 -11.517 -33.334 1.00 59.57  ? 17  GLY A O   1 
ATOM   101  N  N   . THR A 1 18  ? -12.435 -12.476 -31.300 1.00 55.16  ? 18  THR A N   1 
ATOM   102  C  CA  . THR A 1 18  ? -11.618 -13.621 -31.662 1.00 56.58  ? 18  THR A CA  1 
ATOM   103  C  C   . THR A 1 18  ? -12.068 -14.796 -30.818 1.00 42.27  ? 18  THR A C   1 
ATOM   104  O  O   . THR A 1 18  ? -12.408 -14.618 -29.648 1.00 40.73  ? 18  THR A O   1 
ATOM   105  C  CB  . THR A 1 18  ? -10.112 -13.342 -31.436 1.00 60.91  ? 18  THR A CB  1 
ATOM   106  O  OG1 . THR A 1 18  ? -9.368  -14.571 -31.445 1.00 62.60  ? 18  THR A OG1 1 
ATOM   107  C  CG2 . THR A 1 18  ? -9.857  -12.599 -30.114 1.00 47.70  ? 18  THR A CG2 1 
ATOM   108  N  N   . ARG A 1 19  ? -12.080 -15.986 -31.414 1.00 43.70  ? 19  ARG A N   1 
ATOM   109  C  CA  . ARG A 1 19  ? -12.309 -17.217 -30.660 1.00 53.33  ? 19  ARG A CA  1 
ATOM   110  C  C   . ARG A 1 19  ? -11.033 -17.591 -29.903 1.00 62.81  ? 19  ARG A C   1 
ATOM   111  O  O   . ARG A 1 19  ? -9.988  -17.796 -30.520 1.00 63.17  ? 19  ARG A O   1 
ATOM   112  C  CB  . ARG A 1 19  ? -12.727 -18.351 -31.593 1.00 59.55  ? 19  ARG A CB  1 
ATOM   113  C  CG  . ARG A 1 19  ? -12.458 -19.751 -31.058 1.00 63.81  ? 19  ARG A CG  1 
ATOM   114  C  CD  . ARG A 1 19  ? -13.453 -20.758 -31.630 1.00 75.76  ? 19  ARG A CD  1 
ATOM   115  N  NE  . ARG A 1 19  ? -14.716 -20.717 -30.890 1.00 81.15  ? 19  ARG A NE  1 
ATOM   116  C  CZ  . ARG A 1 19  ? -15.586 -21.722 -30.828 1.00 78.21  ? 19  ARG A CZ  1 
ATOM   117  N  NH1 . ARG A 1 19  ? -15.338 -22.860 -31.472 1.00 76.54  1 19  ARG A NH1 1 
ATOM   118  N  NH2 . ARG A 1 19  ? -16.700 -21.590 -30.114 1.00 72.94  ? 19  ARG A NH2 1 
ATOM   119  N  N   . VAL A 1 20  ? -11.114 -17.678 -28.583 1.00 61.90  ? 20  VAL A N   1 
ATOM   120  C  CA  . VAL A 1 20  ? -9.986  -17.970 -27.704 1.00 53.85  ? 20  VAL A CA  1 
ATOM   121  C  C   . VAL A 1 20  ? -10.160 -19.372 -27.127 1.00 55.44  ? 20  VAL A C   1 
ATOM   122  O  O   . VAL A 1 20  ? -11.251 -19.701 -26.638 1.00 59.94  ? 20  VAL A O   1 
ATOM   123  C  CB  . VAL A 1 20  ? -9.898  -16.936 -26.575 1.00 59.38  ? 20  VAL A CB  1 
ATOM   124  C  CG1 . VAL A 1 20  ? -8.859  -17.393 -25.552 1.00 62.41  ? 20  VAL A CG1 1 
ATOM   125  C  CG2 . VAL A 1 20  ? -9.488  -15.593 -27.125 1.00 58.65  ? 20  VAL A CG2 1 
ATOM   126  N  N   . PRO A 1 21  ? -9.134  -20.218 -27.179 1.00 55.13  ? 21  PRO A N   1 
ATOM   127  C  CA  . PRO A 1 21  ? -9.205  -21.510 -26.498 1.00 58.28  ? 21  PRO A CA  1 
ATOM   128  C  C   . PRO A 1 21  ? -9.320  -21.313 -24.995 1.00 54.23  ? 21  PRO A C   1 
ATOM   129  O  O   . PRO A 1 21  ? -8.777  -20.351 -24.434 1.00 53.10  ? 21  PRO A O   1 
ATOM   130  C  CB  . PRO A 1 21  ? -7.864  -22.175 -26.844 1.00 61.53  ? 21  PRO A CB  1 
ATOM   131  C  CG  . PRO A 1 21  ? -7.037  -21.100 -27.468 1.00 60.09  ? 21  PRO A CG  1 
ATOM   132  C  CD  . PRO A 1 21  ? -8.004  -20.170 -28.102 1.00 57.05  ? 21  PRO A CD  1 
ATOM   133  N  N   . VAL A 1 22  ? -10.023 -22.258 -24.337 1.00 50.94  ? 22  VAL A N   1 
ATOM   134  C  CA  . VAL A 1 22  ? -10.049 -22.319 -22.877 1.00 55.00  ? 22  VAL A CA  1 
ATOM   135  C  C   . VAL A 1 22  ? -10.414 -23.723 -22.415 1.00 67.23  ? 22  VAL A C   1 
ATOM   136  O  O   . VAL A 1 22  ? -11.558 -24.162 -22.577 1.00 72.96  ? 22  VAL A O   1 
ATOM   137  C  CB  . VAL A 1 22  ? -11.008 -21.268 -22.287 1.00 36.93  ? 22  VAL A CB  1 
ATOM   138  C  CG1 . VAL A 1 22  ? -12.373 -21.343 -22.938 1.00 37.96  ? 22  VAL A CG1 1 
ATOM   139  C  CG2 . VAL A 1 22  ? -11.094 -21.440 -20.749 1.00 35.81  ? 22  VAL A CG2 1 
ATOM   140  N  N   . LEU A 1 23  ? -9.442  -24.422 -21.821 1.00 70.35  ? 23  LEU A N   1 
ATOM   141  C  CA  . LEU A 1 23  ? -9.639  -25.728 -21.176 1.00 67.17  ? 23  LEU A CA  1 
ATOM   142  C  C   . LEU A 1 23  ? -10.520 -26.656 -22.016 1.00 74.79  ? 23  LEU A C   1 
ATOM   143  O  O   . LEU A 1 23  ? -11.656 -26.980 -21.654 1.00 79.11  ? 23  LEU A O   1 
ATOM   144  C  CB  . LEU A 1 23  ? -10.253 -25.567 -19.781 1.00 57.91  ? 23  LEU A CB  1 
ATOM   145  C  CG  . LEU A 1 23  ? -9.620  -24.545 -18.842 1.00 56.88  ? 23  LEU A CG  1 
ATOM   146  C  CD1 . LEU A 1 23  ? -10.364 -24.543 -17.513 1.00 43.12  ? 23  LEU A CD1 1 
ATOM   147  C  CD2 . LEU A 1 23  ? -8.136  -24.840 -18.641 1.00 62.47  ? 23  LEU A CD2 1 
ATOM   148  N  N   . SER A 1 24  ? -9.969  -27.057 -23.161 1.00 72.13  ? 24  SER A N   1 
ATOM   149  C  CA  . SER A 1 24  ? -10.601 -27.997 -24.082 1.00 74.79  ? 24  SER A CA  1 
ATOM   150  C  C   . SER A 1 24  ? -11.897 -27.461 -24.689 1.00 69.54  ? 24  SER A C   1 
ATOM   151  O  O   . SER A 1 24  ? -12.622 -28.216 -25.355 1.00 69.95  ? 24  SER A O   1 
ATOM   152  C  CB  . SER A 1 24  ? -10.882 -29.351 -23.411 1.00 77.41  ? 24  SER A CB  1 
ATOM   153  O  OG  . SER A 1 24  ? -9.792  -29.799 -22.618 1.00 71.71  ? 24  SER A OG  1 
ATOM   154  N  N   . SER A 1 25  ? -12.222 -26.192 -24.466 1.00 61.83  ? 25  SER A N   1 
ATOM   155  C  CA  . SER A 1 25  ? -13.360 -25.549 -25.112 1.00 51.49  ? 25  SER A CA  1 
ATOM   156  C  C   . SER A 1 25  ? -12.884 -24.185 -25.604 1.00 54.01  ? 25  SER A C   1 
ATOM   157  O  O   . SER A 1 25  ? -11.683 -23.936 -25.788 1.00 54.86  ? 25  SER A O   1 
ATOM   158  C  CB  . SER A 1 25  ? -14.563 -25.442 -24.170 1.00 54.50  ? 25  SER A CB  1 
ATOM   159  O  OG  . SER A 1 25  ? -15.611 -24.695 -24.761 1.00 47.47  ? 25  SER A OG  1 
ATOM   160  N  N   . HIS A 1 26  ? -13.832 -23.283 -25.842 1.00 57.12  ? 26  HIS A N   1 
ATOM   161  C  CA  . HIS A 1 26  ? -13.524 -21.958 -26.363 1.00 55.84  ? 26  HIS A CA  1 
ATOM   162  C  C   . HIS A 1 26  ? -14.463 -20.943 -25.725 1.00 52.57  ? 26  HIS A C   1 
ATOM   163  O  O   . HIS A 1 26  ? -15.550 -21.287 -25.248 1.00 55.15  ? 26  HIS A O   1 
ATOM   164  C  CB  . HIS A 1 26  ? -13.649 -21.903 -27.900 1.00 55.42  ? 26  HIS A CB  1 
ATOM   165  C  CG  . HIS A 1 26  ? -12.883 -22.973 -28.621 1.00 65.57  ? 26  HIS A CG  1 
ATOM   166  N  ND1 . HIS A 1 26  ? -11.665 -22.742 -29.230 1.00 70.56  ? 26  HIS A ND1 1 
ATOM   167  C  CD2 . HIS A 1 26  ? -13.163 -24.283 -28.830 1.00 62.38  ? 26  HIS A CD2 1 
ATOM   168  C  CE1 . HIS A 1 26  ? -11.228 -23.862 -29.780 1.00 60.43  ? 26  HIS A CE1 1 
ATOM   169  N  NE2 . HIS A 1 26  ? -12.115 -24.813 -29.547 1.00 61.91  ? 26  HIS A NE2 1 
ATOM   170  N  N   . ILE A 1 27  ? -14.020 -19.685 -25.693 1.00 42.78  ? 27  ILE A N   1 
ATOM   171  C  CA  . ILE A 1 27  ? -14.892 -18.556 -25.398 1.00 50.23  ? 27  ILE A CA  1 
ATOM   172  C  C   . ILE A 1 27  ? -14.565 -17.433 -26.376 1.00 50.28  ? 27  ILE A C   1 
ATOM   173  O  O   . ILE A 1 27  ? -13.622 -17.509 -27.163 1.00 50.05  ? 27  ILE A O   1 
ATOM   174  C  CB  . ILE A 1 27  ? -14.813 -18.066 -23.923 1.00 59.85  ? 27  ILE A CB  1 
ATOM   175  C  CG1 . ILE A 1 27  ? -13.392 -18.008 -23.356 1.00 73.18  ? 27  ILE A CG1 1 
ATOM   176  C  CG2 . ILE A 1 27  ? -15.606 -18.976 -23.008 1.00 68.38  ? 27  ILE A CG2 1 
ATOM   177  C  CD1 . ILE A 1 27  ? -12.452 -17.018 -23.984 1.00 78.67  ? 27  ILE A CD1 1 
ATOM   178  N  N   . SER A 1 28  ? -15.378 -16.390 -26.330 1.00 50.57  ? 28  SER A N   1 
ATOM   179  C  CA  . SER A 1 28  ? -15.201 -15.215 -27.169 1.00 45.98  ? 28  SER A CA  1 
ATOM   180  C  C   . SER A 1 28  ? -14.498 -14.124 -26.377 1.00 45.02  ? 28  SER A C   1 
ATOM   181  O  O   . SER A 1 28  ? -14.834 -13.865 -25.217 1.00 45.67  ? 28  SER A O   1 
ATOM   182  C  CB  . SER A 1 28  ? -16.550 -14.700 -27.689 1.00 39.60  ? 28  SER A CB  1 
ATOM   183  O  OG  . SER A 1 28  ? -17.402 -15.778 -28.039 1.00 50.97  ? 28  SER A OG  1 
ATOM   184  N  N   . ALA A 1 29  ? -13.527 -13.487 -27.014 1.00 41.55  ? 29  ALA A N   1 
ATOM   185  C  CA  . ALA A 1 29  ? -12.791 -12.377 -26.437 1.00 38.43  ? 29  ALA A CA  1 
ATOM   186  C  C   . ALA A 1 29  ? -12.962 -11.142 -27.315 1.00 38.97  ? 29  ALA A C   1 
ATOM   187  O  O   . ALA A 1 29  ? -12.843 -11.227 -28.538 1.00 46.71  ? 29  ALA A O   1 
ATOM   188  C  CB  . ALA A 1 29  ? -11.309 -12.733 -26.302 1.00 35.87  ? 29  ALA A CB  1 
ATOM   189  N  N   . PHE A 1 30  ? -13.239 -10.003 -26.692 1.00 39.22  ? 30  PHE A N   1 
ATOM   190  C  CA  . PHE A 1 30  ? -13.224 -8.701  -27.355 1.00 43.79  ? 30  PHE A CA  1 
ATOM   191  C  C   . PHE A 1 30  ? -12.182 -7.843  -26.646 1.00 52.84  ? 30  PHE A C   1 
ATOM   192  O  O   . PHE A 1 30  ? -12.444 -7.294  -25.571 1.00 58.62  ? 30  PHE A O   1 
ATOM   193  C  CB  . PHE A 1 30  ? -14.608 -8.068  -27.333 1.00 49.14  ? 30  PHE A CB  1 
ATOM   194  C  CG  . PHE A 1 30  ? -15.641 -8.915  -27.990 1.00 56.17  ? 30  PHE A CG  1 
ATOM   195  C  CD1 . PHE A 1 30  ? -16.306 -9.896  -27.271 1.00 54.85  ? 30  PHE A CD1 1 
ATOM   196  C  CD2 . PHE A 1 30  ? -15.908 -8.778  -29.342 1.00 50.53  ? 30  PHE A CD2 1 
ATOM   197  C  CE1 . PHE A 1 30  ? -17.243 -10.709 -27.878 1.00 45.83  ? 30  PHE A CE1 1 
ATOM   198  C  CE2 . PHE A 1 30  ? -16.842 -9.591  -29.953 1.00 49.51  ? 30  PHE A CE2 1 
ATOM   199  C  CZ  . PHE A 1 30  ? -17.507 -10.561 -29.216 1.00 48.92  ? 30  PHE A CZ  1 
ATOM   200  N  N   . LEU A 1 31  ? -11.007 -7.725  -27.255 1.00 50.44  ? 31  LEU A N   1 
ATOM   201  C  CA  . LEU A 1 31  ? -9.837  -7.136  -26.622 1.00 35.26  ? 31  LEU A CA  1 
ATOM   202  C  C   . LEU A 1 31  ? -9.514  -5.760  -27.183 1.00 41.60  ? 31  LEU A C   1 
ATOM   203  O  O   . LEU A 1 31  ? -9.540  -5.551  -28.399 1.00 55.24  ? 31  LEU A O   1 
ATOM   204  C  CB  . LEU A 1 31  ? -8.629  -8.056  -26.784 1.00 35.35  ? 31  LEU A CB  1 
ATOM   205  C  CG  . LEU A 1 31  ? -8.926  -9.479  -26.295 1.00 43.01  ? 31  LEU A CG  1 
ATOM   206  C  CD1 . LEU A 1 31  ? -7.719  -10.357 -26.438 1.00 35.18  ? 31  LEU A CD1 1 
ATOM   207  C  CD2 . LEU A 1 31  ? -9.392  -9.468  -24.823 1.00 41.78  ? 31  LEU A CD2 1 
ATOM   208  N  N   . GLY A 1 32  ? -9.201  -4.830  -26.283 1.00 38.96  ? 32  GLY A N   1 
ATOM   209  C  CA  . GLY A 1 32  ? -8.782  -3.483  -26.645 1.00 36.87  ? 32  GLY A CA  1 
ATOM   210  C  C   . GLY A 1 32  ? -9.862  -2.589  -27.228 1.00 48.19  ? 32  GLY A C   1 
ATOM   211  O  O   . GLY A 1 32  ? -9.601  -1.858  -28.192 1.00 58.21  ? 32  GLY A O   1 
ATOM   212  N  N   . ILE A 1 33  ? -11.065 -2.619  -26.666 1.00 48.04  ? 33  ILE A N   1 
ATOM   213  C  CA  . ILE A 1 33  ? -12.141 -1.736  -27.122 1.00 41.75  ? 33  ILE A CA  1 
ATOM   214  C  C   . ILE A 1 33  ? -11.927 -0.351  -26.518 1.00 41.99  ? 33  ILE A C   1 
ATOM   215  O  O   . ILE A 1 33  ? -11.736 -0.243  -25.302 1.00 43.52  ? 33  ILE A O   1 
ATOM   216  C  CB  . ILE A 1 33  ? -13.492 -2.305  -26.719 1.00 39.24  ? 33  ILE A CB  1 
ATOM   217  C  CG1 . ILE A 1 33  ? -13.570 -3.789  -27.087 1.00 36.43  ? 33  ILE A CG1 1 
ATOM   218  C  CG2 . ILE A 1 33  ? -14.588 -1.529  -27.387 1.00 40.01  ? 33  ILE A CG2 1 
ATOM   219  C  CD1 . ILE A 1 33  ? -14.987 -4.339  -27.131 1.00 40.10  ? 33  ILE A CD1 1 
ATOM   220  N  N   . PRO A 1 34  ? -11.953 0.721   -27.311 1.00 45.11  ? 34  PRO A N   1 
ATOM   221  C  CA  . PRO A 1 34  ? -11.747 2.059   -26.741 1.00 47.97  ? 34  PRO A CA  1 
ATOM   222  C  C   . PRO A 1 34  ? -13.051 2.592   -26.178 1.00 38.90  ? 34  PRO A C   1 
ATOM   223  O  O   . PRO A 1 34  ? -14.071 2.599   -26.866 1.00 51.93  ? 34  PRO A O   1 
ATOM   224  C  CB  . PRO A 1 34  ? -11.286 2.887   -27.943 1.00 55.57  ? 34  PRO A CB  1 
ATOM   225  C  CG  . PRO A 1 34  ? -12.035 2.259   -29.091 1.00 54.92  ? 34  PRO A CG  1 
ATOM   226  C  CD  . PRO A 1 34  ? -12.186 0.778   -28.765 1.00 49.87  ? 34  PRO A CD  1 
ATOM   227  N  N   . PHE A 1 35  ? -13.018 3.034   -24.925 1.00 39.26  ? 35  PHE A N   1 
ATOM   228  C  CA  . PHE A 1 35  ? -14.189 3.606   -24.264 1.00 51.62  ? 35  PHE A CA  1 
ATOM   229  C  C   . PHE A 1 35  ? -14.032 5.102   -24.004 1.00 53.76  ? 35  PHE A C   1 
ATOM   230  O  O   . PHE A 1 35  ? -14.844 5.690   -23.280 1.00 52.41  ? 35  PHE A O   1 
ATOM   231  C  CB  . PHE A 1 35  ? -14.479 2.870   -22.950 1.00 43.46  ? 35  PHE A CB  1 
ATOM   232  C  CG  . PHE A 1 35  ? -13.351 2.923   -21.968 1.00 38.08  ? 35  PHE A CG  1 
ATOM   233  C  CD1 . PHE A 1 35  ? -13.103 4.077   -21.217 1.00 39.88  ? 35  PHE A CD1 1 
ATOM   234  C  CD2 . PHE A 1 35  ? -12.525 1.819   -21.787 1.00 39.16  ? 35  PHE A CD2 1 
ATOM   235  C  CE1 . PHE A 1 35  ? -12.050 4.115   -20.302 1.00 33.97  ? 35  PHE A CE1 1 
ATOM   236  C  CE2 . PHE A 1 35  ? -11.483 1.851   -20.873 1.00 32.85  ? 35  PHE A CE2 1 
ATOM   237  C  CZ  . PHE A 1 35  ? -11.249 2.998   -20.132 1.00 33.03  ? 35  PHE A CZ  1 
ATOM   238  N  N   . ALA A 1 36  ? -12.994 5.723   -24.556 1.00 51.84  ? 36  ALA A N   1 
ATOM   239  C  CA  . ALA A 1 36  ? -12.782 7.150   -24.370 1.00 48.68  ? 36  ALA A CA  1 
ATOM   240  C  C   . ALA A 1 36  ? -11.738 7.612   -25.367 1.00 44.84  ? 36  ALA A C   1 
ATOM   241  O  O   . ALA A 1 36  ? -10.836 6.853   -25.731 1.00 48.83  ? 36  ALA A O   1 
ATOM   242  C  CB  . ALA A 1 36  ? -12.339 7.474   -22.937 1.00 52.60  ? 36  ALA A CB  1 
ATOM   243  N  N   . GLU A 1 37  ? -11.873 8.859   -25.799 1.00 48.67  ? 37  GLU A N   1 
ATOM   244  C  CA  . GLU A 1 37  ? -10.891 9.436   -26.699 1.00 53.01  ? 37  GLU A CA  1 
ATOM   245  C  C   . GLU A 1 37  ? -9.520  9.451   -26.044 1.00 62.51  ? 37  GLU A C   1 
ATOM   246  O  O   . GLU A 1 37  ? -9.422  9.636   -24.827 1.00 64.80  ? 37  GLU A O   1 
ATOM   247  C  CB  . GLU A 1 37  ? -11.296 10.839  -27.141 1.00 47.26  ? 37  GLU A CB  1 
ATOM   248  C  CG  . GLU A 1 37  ? -12.633 10.746  -27.741 1.00 53.25  ? 37  GLU A CG  1 
ATOM   249  C  CD  . GLU A 1 37  ? -12.525 10.411  -29.208 1.00 67.24  ? 37  GLU A CD  1 
ATOM   250  O  OE1 . GLU A 1 37  ? -11.456 10.640  -29.819 1.00 74.28  ? 37  GLU A OE1 1 
ATOM   251  O  OE2 . GLU A 1 37  ? -13.448 9.739   -29.728 1.00 85.40  1 37  GLU A OE2 1 
ATOM   252  N  N   . PRO A 1 38  ? -8.462  9.193   -26.809 1.00 64.54  ? 38  PRO A N   1 
ATOM   253  C  CA  . PRO A 1 38  ? -7.109  9.177   -26.249 1.00 60.29  ? 38  PRO A CA  1 
ATOM   254  C  C   . PRO A 1 38  ? -6.829  10.452  -25.477 1.00 58.64  ? 38  PRO A C   1 
ATOM   255  O  O   . PRO A 1 38  ? -6.991  11.558  -26.013 1.00 67.90  ? 38  PRO A O   1 
ATOM   256  C  CB  . PRO A 1 38  ? -6.208  9.070   -27.491 1.00 56.23  ? 38  PRO A CB  1 
ATOM   257  C  CG  . PRO A 1 38  ? -7.112  8.706   -28.635 1.00 54.30  ? 38  PRO A CG  1 
ATOM   258  C  CD  . PRO A 1 38  ? -8.517  8.611   -28.164 1.00 51.04  ? 38  PRO A CD  1 
ATOM   259  N  N   . PRO A 1 39  ? -6.439  10.339  -24.220 1.00 49.90  ? 39  PRO A N   1 
ATOM   260  C  CA  . PRO A 1 39  ? -6.113  11.519  -23.384 1.00 56.27  ? 39  PRO A CA  1 
ATOM   261  C  C   . PRO A 1 39  ? -4.691  12.028  -23.633 1.00 59.25  ? 39  PRO A C   1 
ATOM   262  O  O   . PRO A 1 39  ? -3.740  11.759  -22.887 1.00 55.11  ? 39  PRO A O   1 
ATOM   263  C  CB  . PRO A 1 39  ? -6.287  10.984  -21.958 1.00 42.21  ? 39  PRO A CB  1 
ATOM   264  C  CG  . PRO A 1 39  ? -6.243  9.468   -22.067 1.00 41.01  ? 39  PRO A CG  1 
ATOM   265  C  CD  . PRO A 1 39  ? -6.193  9.073   -23.518 1.00 44.18  ? 39  PRO A CD  1 
ATOM   266  N  N   . VAL A 1 40  ? -4.536  12.801  -24.710 1.00 64.84  ? 40  VAL A N   1 
ATOM   267  C  CA  . VAL A 1 40  ? -3.225  13.159  -25.251 1.00 63.23  ? 40  VAL A CA  1 
ATOM   268  C  C   . VAL A 1 40  ? -3.193  14.638  -25.605 1.00 51.29  ? 40  VAL A C   1 
ATOM   269  O  O   . VAL A 1 40  ? -4.188  15.193  -26.076 1.00 57.38  ? 40  VAL A O   1 
ATOM   270  C  CB  . VAL A 1 40  ? -2.887  12.316  -26.495 1.00 59.18  ? 40  VAL A CB  1 
ATOM   271  C  CG1 . VAL A 1 40  ? -2.465  10.916  -26.083 1.00 61.29  ? 40  VAL A CG1 1 
ATOM   272  C  CG2 . VAL A 1 40  ? -4.089  12.254  -27.418 1.00 54.64  ? 40  VAL A CG2 1 
ATOM   273  N  N   . GLY A 1 41  ? -2.046  15.271  -25.396 1.00 52.52  ? 41  GLY A N   1 
ATOM   274  C  CA  . GLY A 1 41  ? -1.854  16.655  -25.791 1.00 63.05  ? 41  GLY A CA  1 
ATOM   275  C  C   . GLY A 1 41  ? -2.558  17.650  -24.898 1.00 64.11  ? 41  GLY A C   1 
ATOM   276  O  O   . GLY A 1 41  ? -2.279  17.715  -23.699 1.00 73.54  ? 41  GLY A O   1 
ATOM   277  N  N   . ASN A 1 42  ? -3.469  18.433  -25.474 1.00 58.44  ? 42  ASN A N   1 
ATOM   278  C  CA  . ASN A 1 42  ? -4.329  19.299  -24.678 1.00 71.03  ? 42  ASN A CA  1 
ATOM   279  C  C   . ASN A 1 42  ? -5.090  18.531  -23.607 1.00 77.13  ? 42  ASN A C   1 
ATOM   280  O  O   . ASN A 1 42  ? -5.497  19.130  -22.605 1.00 78.31  ? 42  ASN A O   1 
ATOM   281  C  CB  . ASN A 1 42  ? -5.331  20.004  -25.587 1.00 79.57  ? 42  ASN A CB  1 
ATOM   282  C  CG  . ASN A 1 42  ? -4.678  20.609  -26.800 1.00 96.26  ? 42  ASN A CG  1 
ATOM   283  O  OD1 . ASN A 1 42  ? -3.755  20.019  -27.374 1.00 99.01  ? 42  ASN A OD1 1 
ATOM   284  N  ND2 . ASN A 1 42  ? -5.167  21.783  -27.223 1.00 105.89 ? 42  ASN A ND2 1 
ATOM   285  N  N   . MET A 1 43  ? -5.284  17.223  -23.800 1.00 78.50  ? 43  MET A N   1 
ATOM   286  C  CA  . MET A 1 43  ? -6.149  16.397  -22.968 1.00 73.14  ? 43  MET A CA  1 
ATOM   287  C  C   . MET A 1 43  ? -5.380  15.553  -21.962 1.00 67.10  ? 43  MET A C   1 
ATOM   288  O  O   . MET A 1 43  ? -5.964  14.651  -21.353 1.00 62.95  ? 43  MET A O   1 
ATOM   289  C  CB  . MET A 1 43  ? -7.007  15.482  -23.846 1.00 74.97  ? 43  MET A CB  1 
ATOM   290  C  CG  . MET A 1 43  ? -7.968  16.208  -24.772 1.00 86.96  ? 43  MET A CG  1 
ATOM   291  S  SD  . MET A 1 43  ? -9.437  15.224  -25.140 1.00 98.30  ? 43  MET A SD  1 
ATOM   292  C  CE  . MET A 1 43  ? -8.810  14.095  -26.392 1.00 98.64  ? 43  MET A CE  1 
ATOM   293  N  N   . ARG A 1 44  ? -4.087  15.797  -21.783 1.00 68.58  ? 44  ARG A N   1 
ATOM   294  C  CA  . ARG A 1 44  ? -3.382  15.136  -20.699 1.00 69.35  ? 44  ARG A CA  1 
ATOM   295  C  C   . ARG A 1 44  ? -3.794  15.803  -19.384 1.00 70.39  ? 44  ARG A C   1 
ATOM   296  O  O   . ARG A 1 44  ? -4.100  17.001  -19.351 1.00 67.51  ? 44  ARG A O   1 
ATOM   297  C  CB  . ARG A 1 44  ? -1.869  15.195  -20.920 1.00 67.36  ? 44  ARG A CB  1 
ATOM   298  C  CG  . ARG A 1 44  ? -1.066  14.498  -19.829 1.00 69.52  ? 44  ARG A CG  1 
ATOM   299  C  CD  . ARG A 1 44  ? 0.423   14.829  -19.880 1.00 73.66  ? 44  ARG A CD  1 
ATOM   300  N  NE  . ARG A 1 44  ? 1.170   14.246  -20.996 1.00 81.00  ? 44  ARG A NE  1 
ATOM   301  C  CZ  . ARG A 1 44  ? 2.461   14.494  -21.231 1.00 71.02  ? 44  ARG A CZ  1 
ATOM   302  N  NH1 . ARG A 1 44  ? 3.128   15.337  -20.457 1.00 63.41  1 44  ARG A NH1 1 
ATOM   303  N  NH2 . ARG A 1 44  ? 3.088   13.930  -22.255 1.00 64.42  ? 44  ARG A NH2 1 
ATOM   304  N  N   . PHE A 1 45  ? -3.849  15.008  -18.312 1.00 66.52  ? 45  PHE A N   1 
ATOM   305  C  CA  . PHE A 1 45  ? -4.364  15.360  -16.986 1.00 66.51  ? 45  PHE A CA  1 
ATOM   306  C  C   . PHE A 1 45  ? -5.855  15.663  -16.967 1.00 64.77  ? 45  PHE A C   1 
ATOM   307  O  O   . PHE A 1 45  ? -6.384  16.030  -15.912 1.00 69.06  ? 45  PHE A O   1 
ATOM   308  C  CB  . PHE A 1 45  ? -3.674  16.574  -16.350 1.00 76.73  ? 45  PHE A CB  1 
ATOM   309  C  CG  . PHE A 1 45  ? -2.192  16.638  -16.554 1.00 85.11  ? 45  PHE A CG  1 
ATOM   310  C  CD1 . PHE A 1 45  ? -1.328  16.119  -15.604 1.00 85.49  ? 45  PHE A CD1 1 
ATOM   311  C  CD2 . PHE A 1 45  ? -1.657  17.319  -17.633 1.00 87.09  ? 45  PHE A CD2 1 
ATOM   312  C  CE1 . PHE A 1 45  ? 0.026   16.203  -15.770 1.00 78.64  ? 45  PHE A CE1 1 
ATOM   313  C  CE2 . PHE A 1 45  ? -0.302  17.415  -17.795 1.00 89.55  ? 45  PHE A CE2 1 
ATOM   314  C  CZ  . PHE A 1 45  ? 0.542   16.854  -16.862 1.00 85.30  ? 45  PHE A CZ  1 
ATOM   315  N  N   . ARG A 1 46  ? -6.547  15.524  -18.081 1.00 67.99  ? 46  ARG A N   1 
ATOM   316  C  CA  . ARG A 1 46  ? -7.888  16.046  -18.277 1.00 63.71  ? 46  ARG A CA  1 
ATOM   317  C  C   . ARG A 1 46  ? -8.934  14.985  -17.951 1.00 61.68  ? 46  ARG A C   1 
ATOM   318  O  O   . ARG A 1 46  ? -8.659  13.782  -17.955 1.00 58.26  ? 46  ARG A O   1 
ATOM   319  C  CB  . ARG A 1 46  ? -8.028  16.514  -19.726 1.00 69.46  ? 46  ARG A CB  1 
ATOM   320  C  CG  . ARG A 1 46  ? -9.166  17.430  -19.998 1.00 83.87  ? 46  ARG A CG  1 
ATOM   321  C  CD  . ARG A 1 46  ? -8.683  18.617  -20.806 1.00 94.94  ? 46  ARG A CD  1 
ATOM   322  N  NE  . ARG A 1 46  ? -9.605  19.731  -20.657 1.00 103.62 ? 46  ARG A NE  1 
ATOM   323  C  CZ  . ARG A 1 46  ? -10.516 20.061  -21.562 1.00 109.50 ? 46  ARG A CZ  1 
ATOM   324  N  NH1 . ARG A 1 46  ? -11.333 21.086  -21.339 1.00 112.04 1 46  ARG A NH1 1 
ATOM   325  N  NH2 . ARG A 1 46  ? -10.603 19.368  -22.690 1.00 109.85 ? 46  ARG A NH2 1 
ATOM   326  N  N   . ARG A 1 47  ? -10.139 15.440  -17.645 1.00 63.73  ? 47  ARG A N   1 
ATOM   327  C  CA  . ARG A 1 47  ? -11.231 14.493  -17.518 1.00 60.89  ? 47  ARG A CA  1 
ATOM   328  C  C   . ARG A 1 47  ? -11.399 13.753  -18.841 1.00 63.40  ? 47  ARG A C   1 
ATOM   329  O  O   . ARG A 1 47  ? -11.258 14.357  -19.911 1.00 69.32  ? 47  ARG A O   1 
ATOM   330  C  CB  . ARG A 1 47  ? -12.524 15.206  -17.138 1.00 56.63  ? 47  ARG A CB  1 
ATOM   331  C  CG  . ARG A 1 47  ? -12.504 15.749  -15.739 1.00 62.59  ? 47  ARG A CG  1 
ATOM   332  C  CD  . ARG A 1 47  ? -13.834 16.354  -15.402 1.00 67.74  ? 47  ARG A CD  1 
ATOM   333  N  NE  . ARG A 1 47  ? -13.704 17.733  -14.955 1.00 71.53  ? 47  ARG A NE  1 
ATOM   334  C  CZ  . ARG A 1 47  ? -13.652 18.088  -13.678 1.00 77.34  ? 47  ARG A CZ  1 
ATOM   335  N  NH1 . ARG A 1 47  ? -13.540 19.371  -13.349 1.00 76.72  1 47  ARG A NH1 1 
ATOM   336  N  NH2 . ARG A 1 47  ? -13.712 17.154  -12.731 1.00 78.77  ? 47  ARG A NH2 1 
ATOM   337  N  N   . PRO A 1 48  ? -11.673 12.456  -18.814 1.00 55.51  ? 48  PRO A N   1 
ATOM   338  C  CA  . PRO A 1 48  ? -11.836 11.732  -20.073 1.00 54.53  ? 48  PRO A CA  1 
ATOM   339  C  C   . PRO A 1 48  ? -13.103 12.188  -20.770 1.00 61.51  ? 48  PRO A C   1 
ATOM   340  O  O   . PRO A 1 48  ? -14.067 12.629  -20.134 1.00 62.53  ? 48  PRO A O   1 
ATOM   341  C  CB  . PRO A 1 48  ? -11.938 10.262  -19.646 1.00 39.16  ? 48  PRO A CB  1 
ATOM   342  C  CG  . PRO A 1 48  ? -12.055 10.273  -18.149 1.00 43.27  ? 48  PRO A CG  1 
ATOM   343  C  CD  . PRO A 1 48  ? -12.190 11.691  -17.676 1.00 39.72  ? 48  PRO A CD  1 
ATOM   344  N  N   . GLU A 1 49  ? -13.080 12.095  -22.098 1.00 58.33  ? 49  GLU A N   1 
ATOM   345  C  CA  . GLU A 1 49  ? -14.247 12.298  -22.939 1.00 57.75  ? 49  GLU A CA  1 
ATOM   346  C  C   . GLU A 1 49  ? -14.546 11.004  -23.685 1.00 56.73  ? 49  GLU A C   1 
ATOM   347  O  O   . GLU A 1 49  ? -13.622 10.262  -24.025 1.00 59.47  ? 49  GLU A O   1 
ATOM   348  C  CB  . GLU A 1 49  ? -14.027 13.447  -23.935 1.00 67.53  ? 49  GLU A CB  1 
ATOM   349  C  CG  . GLU A 1 49  ? -13.304 14.650  -23.346 1.00 80.59  ? 49  GLU A CG  1 
ATOM   350  C  CD  . GLU A 1 49  ? -14.241 15.768  -22.930 1.00 89.14  ? 49  GLU A CD  1 
ATOM   351  O  OE1 . GLU A 1 49  ? -13.791 16.682  -22.210 1.00 91.96  ? 49  GLU A OE1 1 
ATOM   352  O  OE2 . GLU A 1 49  ? -15.425 15.738  -23.319 1.00 96.03  1 49  GLU A OE2 1 
ATOM   353  N  N   . PRO A 1 50  ? -15.817 10.700  -23.948 1.00 61.20  ? 50  PRO A N   1 
ATOM   354  C  CA  . PRO A 1 50  ? -16.165 9.377   -24.485 1.00 60.45  ? 50  PRO A CA  1 
ATOM   355  C  C   . PRO A 1 50  ? -15.740 9.196   -25.933 1.00 64.47  ? 50  PRO A C   1 
ATOM   356  O  O   . PRO A 1 50  ? -15.665 10.147  -26.714 1.00 73.42  ? 50  PRO A O   1 
ATOM   357  C  CB  . PRO A 1 50  ? -17.690 9.325   -24.345 1.00 50.77  ? 50  PRO A CB  1 
ATOM   358  C  CG  . PRO A 1 50  ? -18.070 10.565  -23.573 1.00 45.28  ? 50  PRO A CG  1 
ATOM   359  C  CD  . PRO A 1 50  ? -17.002 11.559  -23.801 1.00 45.99  ? 50  PRO A CD  1 
ATOM   360  N  N   . LYS A 1 51  ? -15.462 7.940   -26.282 1.00 61.98  ? 51  LYS A N   1 
ATOM   361  C  CA  . LYS A 1 51  ? -14.941 7.592   -27.600 1.00 60.84  ? 51  LYS A CA  1 
ATOM   362  C  C   . LYS A 1 51  ? -15.904 8.024   -28.696 1.00 69.51  ? 51  LYS A C   1 
ATOM   363  O  O   . LYS A 1 51  ? -17.006 7.469   -28.801 1.00 75.44  ? 51  LYS A O   1 
ATOM   364  C  CB  . LYS A 1 51  ? -14.680 6.084   -27.691 1.00 55.82  ? 51  LYS A CB  1 
ATOM   365  C  CG  . LYS A 1 51  ? -14.048 5.635   -28.995 1.00 62.78  ? 51  LYS A CG  1 
ATOM   366  C  CD  . LYS A 1 51  ? -12.828 6.486   -29.312 1.00 64.60  ? 51  LYS A CD  1 
ATOM   367  C  CE  . LYS A 1 51  ? -11.911 5.810   -30.314 1.00 62.24  ? 51  LYS A CE  1 
ATOM   368  N  NZ  . LYS A 1 51  ? -10.848 6.745   -30.781 1.00 62.96  1 51  LYS A NZ  1 
ATOM   369  N  N   . LYS A 1 52  ? -15.506 9.019   -29.497 1.00 71.65  ? 52  LYS A N   1 
ATOM   370  C  CA  . LYS A 1 52  ? -16.339 9.449   -30.614 1.00 69.58  ? 52  LYS A CA  1 
ATOM   371  C  C   . LYS A 1 52  ? -16.557 8.276   -31.566 1.00 68.27  ? 52  LYS A C   1 
ATOM   372  O  O   . LYS A 1 52  ? -15.602 7.561   -31.904 1.00 63.36  ? 52  LYS A O   1 
ATOM   373  C  CB  . LYS A 1 52  ? -15.717 10.636  -31.365 1.00 63.25  ? 52  LYS A CB  1 
ATOM   374  C  CG  . LYS A 1 52  ? -15.135 11.744  -30.478 1.00 67.70  ? 52  LYS A CG  1 
ATOM   375  C  CD  . LYS A 1 52  ? -15.406 13.146  -31.004 1.00 80.95  ? 52  LYS A CD  1 
ATOM   376  C  CE  . LYS A 1 52  ? -14.458 14.154  -30.345 1.00 80.09  ? 52  LYS A CE  1 
ATOM   377  N  NZ  . LYS A 1 52  ? -13.320 14.518  -31.247 1.00 78.82  1 52  LYS A NZ  1 
ATOM   378  N  N   . PRO A 1 53  ? -17.791 8.067   -32.028 1.00 65.85  ? 53  PRO A N   1 
ATOM   379  C  CA  . PRO A 1 53  ? -18.124 6.832   -32.750 1.00 62.97  ? 53  PRO A CA  1 
ATOM   380  C  C   . PRO A 1 53  ? -17.400 6.701   -34.085 1.00 59.16  ? 53  PRO A C   1 
ATOM   381  O  O   . PRO A 1 53  ? -17.263 7.666   -34.845 1.00 61.35  ? 53  PRO A O   1 
ATOM   382  C  CB  . PRO A 1 53  ? -19.638 6.945   -32.948 1.00 64.79  ? 53  PRO A CB  1 
ATOM   383  C  CG  . PRO A 1 53  ? -19.896 8.437   -32.922 1.00 66.08  ? 53  PRO A CG  1 
ATOM   384  C  CD  . PRO A 1 53  ? -18.949 8.966   -31.894 1.00 60.44  ? 53  PRO A CD  1 
ATOM   385  N  N   . TRP A 1 54  ? -16.962 5.476   -34.371 1.00 58.40  ? 54  TRP A N   1 
ATOM   386  C  CA  . TRP A 1 54  ? -16.112 5.177   -35.513 1.00 65.04  ? 54  TRP A CA  1 
ATOM   387  C  C   . TRP A 1 54  ? -16.882 4.395   -36.575 1.00 69.34  ? 54  TRP A C   1 
ATOM   388  O  O   . TRP A 1 54  ? -17.751 3.567   -36.275 1.00 51.91  ? 54  TRP A O   1 
ATOM   389  C  CB  . TRP A 1 54  ? -14.859 4.386   -35.079 1.00 50.26  ? 54  TRP A CB  1 
ATOM   390  C  CG  . TRP A 1 54  ? -15.168 3.003   -34.583 1.00 55.13  ? 54  TRP A CG  1 
ATOM   391  C  CD1 . TRP A 1 54  ? -15.324 1.872   -35.338 1.00 60.76  ? 54  TRP A CD1 1 
ATOM   392  C  CD2 . TRP A 1 54  ? -15.379 2.600   -33.220 1.00 52.48  ? 54  TRP A CD2 1 
ATOM   393  N  NE1 . TRP A 1 54  ? -15.614 0.792   -34.528 1.00 47.56  ? 54  TRP A NE1 1 
ATOM   394  C  CE2 . TRP A 1 54  ? -15.655 1.214   -33.227 1.00 45.91  ? 54  TRP A CE2 1 
ATOM   395  C  CE3 . TRP A 1 54  ? -15.354 3.275   -31.990 1.00 53.08  ? 54  TRP A CE3 1 
ATOM   396  C  CZ2 . TRP A 1 54  ? -15.908 0.496   -32.055 1.00 46.62  ? 54  TRP A CZ2 1 
ATOM   397  C  CZ3 . TRP A 1 54  ? -15.606 2.556   -30.832 1.00 43.45  ? 54  TRP A CZ3 1 
ATOM   398  C  CH2 . TRP A 1 54  ? -15.886 1.185   -30.875 1.00 42.85  ? 54  TRP A CH2 1 
ATOM   399  N  N   . SER A 1 55  ? -16.549 4.666   -37.827 1.00 71.07  ? 55  SER A N   1 
ATOM   400  C  CA  . SER A 1 55  ? -17.019 3.837   -38.923 1.00 76.16  ? 55  SER A CA  1 
ATOM   401  C  C   . SER A 1 55  ? -16.109 2.622   -39.092 1.00 75.61  ? 55  SER A C   1 
ATOM   402  O  O   . SER A 1 55  ? -14.950 2.614   -38.669 1.00 78.13  ? 55  SER A O   1 
ATOM   403  C  CB  . SER A 1 55  ? -17.081 4.643   -40.215 1.00 78.23  ? 55  SER A CB  1 
ATOM   404  O  OG  . SER A 1 55  ? -17.565 5.947   -39.959 1.00 82.49  ? 55  SER A OG  1 
ATOM   405  N  N   . GLY A 1 56  ? -16.657 1.581   -39.705 1.00 69.24  ? 56  GLY A N   1 
ATOM   406  C  CA  . GLY A 1 56  ? -15.921 0.346   -39.864 1.00 58.84  ? 56  GLY A CA  1 
ATOM   407  C  C   . GLY A 1 56  ? -16.014 -0.574  -38.662 1.00 57.99  ? 56  GLY A C   1 
ATOM   408  O  O   . GLY A 1 56  ? -16.636 -0.285  -37.636 1.00 64.86  ? 56  GLY A O   1 
ATOM   409  N  N   . VAL A 1 57  ? -15.379 -1.726  -38.827 1.00 53.45  ? 57  VAL A N   1 
ATOM   410  C  CA  . VAL A 1 57  ? -15.300 -2.766  -37.813 1.00 51.50  ? 57  VAL A CA  1 
ATOM   411  C  C   . VAL A 1 57  ? -13.972 -2.632  -37.069 1.00 50.16  ? 57  VAL A C   1 
ATOM   412  O  O   . VAL A 1 57  ? -12.898 -2.577  -37.683 1.00 52.65  ? 57  VAL A O   1 
ATOM   413  C  CB  . VAL A 1 57  ? -15.436 -4.156  -38.456 1.00 52.37  ? 57  VAL A CB  1 
ATOM   414  C  CG1 . VAL A 1 57  ? -15.772 -5.199  -37.423 1.00 64.30  ? 57  VAL A CG1 1 
ATOM   415  C  CG2 . VAL A 1 57  ? -16.469 -4.119  -39.523 1.00 54.38  ? 57  VAL A CG2 1 
ATOM   416  N  N   . TRP A 1 58  ? -14.040 -2.589  -35.746 1.00 50.10  ? 58  TRP A N   1 
ATOM   417  C  CA  . TRP A 1 58  ? -12.850 -2.451  -34.922 1.00 52.32  ? 58  TRP A CA  1 
ATOM   418  C  C   . TRP A 1 58  ? -12.195 -3.819  -34.743 1.00 58.92  ? 58  TRP A C   1 
ATOM   419  O  O   . TRP A 1 58  ? -12.763 -4.701  -34.087 1.00 47.26  ? 58  TRP A O   1 
ATOM   420  C  CB  . TRP A 1 58  ? -13.221 -1.838  -33.577 1.00 47.89  ? 58  TRP A CB  1 
ATOM   421  C  CG  . TRP A 1 58  ? -12.034 -1.450  -32.776 1.00 52.69  ? 58  TRP A CG  1 
ATOM   422  C  CD1 . TRP A 1 58  ? -11.217 -2.279  -32.059 1.00 55.67  ? 58  TRP A CD1 1 
ATOM   423  C  CD2 . TRP A 1 58  ? -11.498 -0.132  -32.628 1.00 56.26  ? 58  TRP A CD2 1 
ATOM   424  N  NE1 . TRP A 1 58  ? -10.214 -1.554  -31.458 1.00 55.73  ? 58  TRP A NE1 1 
ATOM   425  C  CE2 . TRP A 1 58  ? -10.360 -0.234  -31.796 1.00 57.06  ? 58  TRP A CE2 1 
ATOM   426  C  CE3 . TRP A 1 58  ? -11.872 1.125   -33.112 1.00 49.00  ? 58  TRP A CE3 1 
ATOM   427  C  CZ2 . TRP A 1 58  ? -9.595  0.875   -31.437 1.00 51.42  ? 58  TRP A CZ2 1 
ATOM   428  C  CZ3 . TRP A 1 58  ? -11.106 2.227   -32.757 1.00 45.56  ? 58  TRP A CZ3 1 
ATOM   429  C  CH2 . TRP A 1 58  ? -9.980  2.094   -31.935 1.00 44.42  ? 58  TRP A CH2 1 
ATOM   430  N  N   . ASN A 1 59  ? -10.999 -4.004  -35.321 1.00 66.27  ? 59  ASN A N   1 
ATOM   431  C  CA  . ASN A 1 59  ? -10.232 -5.213  -35.033 1.00 64.19  ? 59  ASN A CA  1 
ATOM   432  C  C   . ASN A 1 59  ? -9.970  -5.253  -33.533 1.00 65.99  ? 59  ASN A C   1 
ATOM   433  O  O   . ASN A 1 59  ? -9.071  -4.571  -33.039 1.00 70.37  ? 59  ASN A O   1 
ATOM   434  C  CB  . ASN A 1 59  ? -8.920  -5.274  -35.837 1.00 62.62  ? 59  ASN A CB  1 
ATOM   435  C  CG  . ASN A 1 59  ? -8.257  -6.668  -35.789 1.00 67.48  ? 59  ASN A CG  1 
ATOM   436  O  OD1 . ASN A 1 59  ? -8.690  -7.526  -35.022 1.00 64.92  ? 59  ASN A OD1 1 
ATOM   437  N  ND2 . ASN A 1 59  ? -7.214  -6.898  -36.616 1.00 68.12  ? 59  ASN A ND2 1 
ATOM   438  N  N   . ALA A 1 60  ? -10.789 -6.004  -32.796 1.00 60.85  ? 60  ALA A N   1 
ATOM   439  C  CA  . ALA A 1 60  ? -10.636 -6.116  -31.350 1.00 63.44  ? 60  ALA A CA  1 
ATOM   440  C  C   . ALA A 1 60  ? -10.147 -7.503  -31.002 1.00 63.85  ? 60  ALA A C   1 
ATOM   441  O  O   . ALA A 1 60  ? -10.844 -8.263  -30.323 1.00 57.69  ? 60  ALA A O   1 
ATOM   442  C  CB  . ALA A 1 60  ? -11.951 -5.845  -30.621 1.00 65.58  ? 60  ALA A CB  1 
ATOM   443  N  N   . SER A 1 61  ? -8.961  -7.842  -31.481 1.00 65.93  ? 61  SER A N   1 
ATOM   444  C  CA  . SER A 1 61  ? -8.466  -9.201  -31.398 1.00 62.99  ? 61  SER A CA  1 
ATOM   445  C  C   . SER A 1 61  ? -7.142  -9.294  -30.662 1.00 61.33  ? 61  SER A C   1 
ATOM   446  O  O   . SER A 1 61  ? -6.647  -10.408 -30.440 1.00 57.16  ? 61  SER A O   1 
ATOM   447  C  CB  . SER A 1 61  ? -8.361  -9.798  -32.810 1.00 53.59  ? 61  SER A CB  1 
ATOM   448  O  OG  . SER A 1 61  ? -7.515  -9.002  -33.606 1.00 56.69  ? 61  SER A OG  1 
ATOM   449  N  N   . THR A 1 62  ? -6.578  -8.164  -30.242 1.00 53.27  ? 62  THR A N   1 
ATOM   450  C  CA  . THR A 1 62  ? -5.323  -8.149  -29.511 1.00 55.66  ? 62  THR A CA  1 
ATOM   451  C  C   . THR A 1 62  ? -5.410  -7.144  -28.369 1.00 56.41  ? 62  THR A C   1 
ATOM   452  O  O   . THR A 1 62  ? -6.110  -6.133  -28.470 1.00 51.87  ? 62  THR A O   1 
ATOM   453  C  CB  . THR A 1 62  ? -4.132  -7.807  -30.438 1.00 61.82  ? 62  THR A CB  1 
ATOM   454  O  OG1 . THR A 1 62  ? -4.414  -6.614  -31.185 1.00 67.41  ? 62  THR A OG1 1 
ATOM   455  C  CG2 . THR A 1 62  ? -3.850  -8.951  -31.394 1.00 58.30  ? 62  THR A CG2 1 
ATOM   456  N  N   . TYR A 1 63  ? -4.671  -7.428  -27.290 1.00 58.47  ? 63  TYR A N   1 
ATOM   457  C  CA  . TYR A 1 63  ? -4.671  -6.584  -26.100 1.00 54.23  ? 63  TYR A CA  1 
ATOM   458  C  C   . TYR A 1 63  ? -4.268  -5.148  -26.442 1.00 55.13  ? 63  TYR A C   1 
ATOM   459  O  O   . TYR A 1 63  ? -3.452  -4.918  -27.336 1.00 52.01  ? 63  TYR A O   1 
ATOM   460  C  CB  . TYR A 1 63  ? -3.707  -7.144  -25.059 1.00 44.61  ? 63  TYR A CB  1 
ATOM   461  C  CG  . TYR A 1 63  ? -4.325  -8.116  -24.071 1.00 47.73  ? 63  TYR A CG  1 
ATOM   462  C  CD1 . TYR A 1 63  ? -5.592  -7.909  -23.552 1.00 57.91  ? 63  TYR A CD1 1 
ATOM   463  C  CD2 . TYR A 1 63  ? -3.631  -9.246  -23.660 1.00 44.90  ? 63  TYR A CD2 1 
ATOM   464  C  CE1 . TYR A 1 63  ? -6.147  -8.802  -22.636 1.00 57.82  ? 63  TYR A CE1 1 
ATOM   465  C  CE2 . TYR A 1 63  ? -4.174  -10.141 -22.754 1.00 50.04  ? 63  TYR A CE2 1 
ATOM   466  C  CZ  . TYR A 1 63  ? -5.428  -9.917  -22.244 1.00 55.58  ? 63  TYR A CZ  1 
ATOM   467  O  OH  . TYR A 1 63  ? -5.954  -10.818 -21.345 1.00 56.99  ? 63  TYR A OH  1 
ATOM   468  N  N   . PRO A 1 64  ? -4.802  -4.162  -25.726 1.00 60.60  ? 64  PRO A N   1 
ATOM   469  C  CA  . PRO A 1 64  ? -4.456  -2.764  -26.025 1.00 58.66  ? 64  PRO A CA  1 
ATOM   470  C  C   . PRO A 1 64  ? -3.066  -2.371  -25.545 1.00 56.27  ? 64  PRO A C   1 
ATOM   471  O  O   . PRO A 1 64  ? -2.284  -3.214  -25.100 1.00 53.41  ? 64  PRO A O   1 
ATOM   472  C  CB  . PRO A 1 64  ? -5.535  -1.975  -25.274 1.00 67.42  ? 64  PRO A CB  1 
ATOM   473  C  CG  . PRO A 1 64  ? -5.898  -2.865  -24.113 1.00 69.62  ? 64  PRO A CG  1 
ATOM   474  C  CD  . PRO A 1 64  ? -5.796  -4.276  -24.641 1.00 67.07  ? 64  PRO A CD  1 
ATOM   475  N  N   . ASN A 1 65  ? -2.754  -1.082  -25.619 1.00 61.23  ? 65  ASN A N   1 
ATOM   476  C  CA  . ASN A 1 65  ? -1.536  -0.586  -25.004 1.00 68.70  ? 65  ASN A CA  1 
ATOM   477  C  C   . ASN A 1 65  ? -1.705  -0.476  -23.493 1.00 66.90  ? 65  ASN A C   1 
ATOM   478  O  O   . ASN A 1 65  ? -2.813  -0.569  -22.952 1.00 67.96  ? 65  ASN A O   1 
ATOM   479  C  CB  . ASN A 1 65  ? -1.149  0.769   -25.588 1.00 73.90  ? 65  ASN A CB  1 
ATOM   480  C  CG  . ASN A 1 65  ? -0.888  0.702   -27.073 1.00 68.19  ? 65  ASN A CG  1 
ATOM   481  O  OD1 . ASN A 1 65  ? 0.043   0.022   -27.514 1.00 52.65  ? 65  ASN A OD1 1 
ATOM   482  N  ND2 . ASN A 1 65  ? -1.705  1.407   -27.858 1.00 72.73  ? 65  ASN A ND2 1 
ATOM   483  N  N   . ASN A 1 66  ? -0.580  -0.274  -22.807 1.00 62.36  ? 66  ASN A N   1 
ATOM   484  C  CA  . ASN A 1 66  ? -0.558  -0.047  -21.368 1.00 50.79  ? 66  ASN A CA  1 
ATOM   485  C  C   . ASN A 1 66  ? -0.257  1.421   -21.087 1.00 56.05  ? 66  ASN A C   1 
ATOM   486  O  O   . ASN A 1 66  ? 0.455   2.075   -21.850 1.00 56.90  ? 66  ASN A O   1 
ATOM   487  C  CB  . ASN A 1 66  ? 0.474   -0.955  -20.700 1.00 45.92  ? 66  ASN A CB  1 
ATOM   488  C  CG  . ASN A 1 66  ? 0.140   -2.436  -20.859 1.00 50.68  ? 66  ASN A CG  1 
ATOM   489  O  OD1 . ASN A 1 66  ? 1.033   -3.290  -20.908 1.00 43.82  ? 66  ASN A OD1 1 
ATOM   490  N  ND2 . ASN A 1 66  ? -1.158  -2.746  -20.933 1.00 53.76  ? 66  ASN A ND2 1 
ATOM   491  N  N   . CYS A 1 67  ? -0.833  1.957   -20.013 1.00 58.75  ? 67  CYS A N   1 
ATOM   492  C  CA  . CYS A 1 67  ? -0.634  3.371   -19.710 1.00 64.12  ? 67  CYS A CA  1 
ATOM   493  C  C   . CYS A 1 67  ? 0.806   3.626   -19.273 1.00 69.26  ? 67  CYS A C   1 
ATOM   494  O  O   . CYS A 1 67  ? 1.444   2.771   -18.653 1.00 75.08  ? 67  CYS A O   1 
ATOM   495  C  CB  . CYS A 1 67  ? -1.611  3.828   -18.622 1.00 60.87  ? 67  CYS A CB  1 
ATOM   496  S  SG  . CYS A 1 67  ? -3.361  3.748   -19.094 1.00 60.95  ? 67  CYS A SG  1 
ATOM   497  N  N   . GLN A 1 68  ? 1.324   4.812   -19.607 1.00 65.95  ? 68  GLN A N   1 
ATOM   498  C  CA  . GLN A 1 68  ? 2.681   5.168   -19.190 1.00 52.50  ? 68  GLN A CA  1 
ATOM   499  C  C   . GLN A 1 68  ? 2.830   5.079   -17.680 1.00 50.43  ? 68  GLN A C   1 
ATOM   500  O  O   . GLN A 1 68  ? 2.032   5.632   -16.921 1.00 44.91  ? 68  GLN A O   1 
ATOM   501  C  CB  . GLN A 1 68  ? 3.080   6.567   -19.670 1.00 46.81  ? 68  GLN A CB  1 
ATOM   502  C  CG  . GLN A 1 68  ? 2.999   6.809   -21.162 1.00 58.13  ? 68  GLN A CG  1 
ATOM   503  C  CD  . GLN A 1 68  ? 4.101   6.052   -21.903 1.00 70.44  ? 68  GLN A CD  1 
ATOM   504  O  OE1 . GLN A 1 68  ? 5.267   6.092   -21.507 1.00 80.65  ? 68  GLN A OE1 1 
ATOM   505  N  NE2 . GLN A 1 68  ? 3.742   5.413   -23.019 1.00 69.58  ? 68  GLN A NE2 1 
ATOM   506  N  N   . GLN A 1 69  ? 3.863   4.373   -17.247 1.00 54.46  ? 69  GLN A N   1 
ATOM   507  C  CA  . GLN A 1 69  ? 3.993   4.042   -15.840 1.00 53.96  ? 69  GLN A CA  1 
ATOM   508  C  C   . GLN A 1 69  ? 5.437   3.651   -15.554 1.00 56.01  ? 69  GLN A C   1 
ATOM   509  O  O   . GLN A 1 69  ? 6.158   3.181   -16.440 1.00 67.04  ? 69  GLN A O   1 
ATOM   510  C  CB  . GLN A 1 69  ? 3.035   2.900   -15.469 1.00 46.65  ? 69  GLN A CB  1 
ATOM   511  C  CG  . GLN A 1 69  ? 3.305   1.603   -16.238 1.00 36.81  ? 69  GLN A CG  1 
ATOM   512  C  CD  . GLN A 1 69  ? 2.230   0.549   -16.044 1.00 31.92  ? 69  GLN A CD  1 
ATOM   513  O  OE1 . GLN A 1 69  ? 2.316   -0.287  -15.146 1.00 40.21  ? 69  GLN A OE1 1 
ATOM   514  N  NE2 . GLN A 1 69  ? 1.207   0.587   -16.883 1.00 34.89  ? 69  GLN A NE2 1 
ATOM   515  N  N   . TYR A 1 70  ? 5.853   3.879   -14.312 1.00 51.93  ? 70  TYR A N   1 
ATOM   516  C  CA  . TYR A 1 70  ? 7.134   3.371   -13.837 1.00 48.14  ? 70  TYR A CA  1 
ATOM   517  C  C   . TYR A 1 70  ? 7.215   1.866   -14.079 1.00 50.03  ? 70  TYR A C   1 
ATOM   518  O  O   . TYR A 1 70  ? 6.222   1.142   -13.946 1.00 44.83  ? 70  TYR A O   1 
ATOM   519  C  CB  . TYR A 1 70  ? 7.302   3.717   -12.346 1.00 45.63  ? 70  TYR A CB  1 
ATOM   520  C  CG  . TYR A 1 70  ? 8.392   2.963   -11.615 1.00 47.80  ? 70  TYR A CG  1 
ATOM   521  C  CD1 . TYR A 1 70  ? 9.662   3.506   -11.461 1.00 53.02  ? 70  TYR A CD1 1 
ATOM   522  C  CD2 . TYR A 1 70  ? 8.145   1.704   -11.069 1.00 44.98  ? 70  TYR A CD2 1 
ATOM   523  C  CE1 . TYR A 1 70  ? 10.659  2.805   -10.791 1.00 59.49  ? 70  TYR A CE1 1 
ATOM   524  C  CE2 . TYR A 1 70  ? 9.127   1.000   -10.399 1.00 47.52  ? 70  TYR A CE2 1 
ATOM   525  C  CZ  . TYR A 1 70  ? 10.382  1.554   -10.253 1.00 58.18  ? 70  TYR A CZ  1 
ATOM   526  O  OH  . TYR A 1 70  ? 11.357  0.842   -9.582  1.00 58.49  ? 70  TYR A OH  1 
ATOM   527  N  N   . VAL A 1 71  ? 8.401   1.401   -14.467 1.00 49.01  ? 71  VAL A N   1 
ATOM   528  C  CA  . VAL A 1 71  ? 8.626   -0.001  -14.804 1.00 49.22  ? 71  VAL A CA  1 
ATOM   529  C  C   . VAL A 1 71  ? 9.637   -0.560  -13.810 1.00 62.50  ? 71  VAL A C   1 
ATOM   530  O  O   . VAL A 1 71  ? 10.757  -0.045  -13.697 1.00 77.04  ? 71  VAL A O   1 
ATOM   531  C  CB  . VAL A 1 71  ? 9.109   -0.172  -16.255 1.00 52.67  ? 71  VAL A CB  1 
ATOM   532  C  CG1 . VAL A 1 71  ? 9.144   -1.642  -16.638 1.00 53.86  ? 71  VAL A CG1 1 
ATOM   533  C  CG2 . VAL A 1 71  ? 8.223   0.620   -17.235 1.00 49.68  ? 71  VAL A CG2 1 
ATOM   534  N  N   . ASP A 1 72  ? 9.244   -1.609  -13.096 1.00 58.29  ? 72  ASP A N   1 
ATOM   535  C  CA  . ASP A 1 72  ? 10.056  -2.163  -12.018 1.00 58.68  ? 72  ASP A CA  1 
ATOM   536  C  C   . ASP A 1 72  ? 11.205  -2.996  -12.581 1.00 52.52  ? 72  ASP A C   1 
ATOM   537  O  O   . ASP A 1 72  ? 10.983  -4.025  -13.227 1.00 56.40  ? 72  ASP A O   1 
ATOM   538  C  CB  . ASP A 1 72  ? 9.174   -3.003  -11.097 1.00 58.22  ? 72  ASP A CB  1 
ATOM   539  C  CG  . ASP A 1 72  ? 9.965   -3.721  -10.036 1.00 54.26  ? 72  ASP A CG  1 
ATOM   540  O  OD1 . ASP A 1 72  ? 11.074  -3.254  -9.715  1.00 64.73  ? 72  ASP A OD1 1 
ATOM   541  O  OD2 . ASP A 1 72  ? 9.483   -4.748  -9.524  1.00 40.58  1 72  ASP A OD2 1 
ATOM   542  N  N   . GLU A 1 73  ? 12.437  -2.565  -12.321 1.00 49.25  ? 73  GLU A N   1 
ATOM   543  C  CA  . GLU A 1 73  ? 13.611  -3.336  -12.718 1.00 46.49  ? 73  GLU A CA  1 
ATOM   544  C  C   . GLU A 1 73  ? 14.515  -3.687  -11.536 1.00 42.61  ? 73  GLU A C   1 
ATOM   545  O  O   . GLU A 1 73  ? 15.705  -3.944  -11.725 1.00 42.72  ? 73  GLU A O   1 
ATOM   546  C  CB  . GLU A 1 73  ? 14.395  -2.596  -13.803 1.00 47.62  ? 73  GLU A CB  1 
ATOM   547  C  CG  . GLU A 1 73  ? 13.544  -1.970  -14.896 1.00 56.78  ? 73  GLU A CG  1 
ATOM   548  C  CD  . GLU A 1 73  ? 14.207  -0.756  -15.524 1.00 74.77  ? 73  GLU A CD  1 
ATOM   549  O  OE1 . GLU A 1 73  ? 13.516  0.088   -16.151 1.00 86.23  ? 73  GLU A OE1 1 
ATOM   550  O  OE2 . GLU A 1 73  ? 15.442  -0.621  -15.382 1.00 88.16  1 73  GLU A OE2 1 
ATOM   551  N  N   . GLN A 1 74  ? 13.963  -3.734  -10.322 1.00 42.58  ? 74  GLN A N   1 
ATOM   552  C  CA  . GLN A 1 74  ? 14.736  -4.176  -9.167  1.00 44.70  ? 74  GLN A CA  1 
ATOM   553  C  C   . GLN A 1 74  ? 15.331  -5.560  -9.392  1.00 43.58  ? 74  GLN A C   1 
ATOM   554  O  O   . GLN A 1 74  ? 16.442  -5.841  -8.931  1.00 57.82  ? 74  GLN A O   1 
ATOM   555  C  CB  . GLN A 1 74  ? 13.852  -4.189  -7.913  1.00 49.73  ? 74  GLN A CB  1 
ATOM   556  C  CG  . GLN A 1 74  ? 14.619  -4.171  -6.608  1.00 54.26  ? 74  GLN A CG  1 
ATOM   557  C  CD  . GLN A 1 74  ? 15.147  -2.788  -6.296  1.00 71.35  ? 74  GLN A CD  1 
ATOM   558  O  OE1 . GLN A 1 74  ? 16.047  -2.291  -6.977  1.00 85.20  ? 74  GLN A OE1 1 
ATOM   559  N  NE2 . GLN A 1 74  ? 14.577  -2.145  -5.278  1.00 70.26  ? 74  GLN A NE2 1 
ATOM   560  N  N   . PHE A 1 75  ? 14.618  -6.427  -10.105 1.00 39.34  ? 75  PHE A N   1 
ATOM   561  C  CA  . PHE A 1 75  ? 15.031  -7.809  -10.336 1.00 45.34  ? 75  PHE A CA  1 
ATOM   562  C  C   . PHE A 1 75  ? 14.856  -8.125  -11.813 1.00 45.57  ? 75  PHE A C   1 
ATOM   563  O  O   . PHE A 1 75  ? 13.906  -8.824  -12.197 1.00 35.08  ? 75  PHE A O   1 
ATOM   564  C  CB  . PHE A 1 75  ? 14.220  -8.785  -9.483  1.00 51.24  ? 75  PHE A CB  1 
ATOM   565  C  CG  . PHE A 1 75  ? 14.193  -8.441  -8.028  1.00 50.22  ? 75  PHE A CG  1 
ATOM   566  C  CD1 . PHE A 1 75  ? 15.307  -8.632  -7.242  1.00 41.89  ? 75  PHE A CD1 1 
ATOM   567  C  CD2 . PHE A 1 75  ? 13.040  -7.954  -7.439  1.00 50.71  ? 75  PHE A CD2 1 
ATOM   568  C  CE1 . PHE A 1 75  ? 15.284  -8.325  -5.922  1.00 39.83  ? 75  PHE A CE1 1 
ATOM   569  C  CE2 . PHE A 1 75  ? 13.012  -7.657  -6.113  1.00 45.26  ? 75  PHE A CE2 1 
ATOM   570  C  CZ  . PHE A 1 75  ? 14.134  -7.838  -5.350  1.00 43.87  ? 75  PHE A CZ  1 
ATOM   571  N  N   . PRO A 1 76  ? 15.765  -7.647  -12.663 1.00 55.17  ? 76  PRO A N   1 
ATOM   572  C  CA  . PRO A 1 76  ? 15.654  -7.916  -14.102 1.00 56.29  ? 76  PRO A CA  1 
ATOM   573  C  C   . PRO A 1 76  ? 15.440  -9.399  -14.380 1.00 50.15  ? 76  PRO A C   1 
ATOM   574  O  O   . PRO A 1 76  ? 16.174  -10.256 -13.875 1.00 50.87  ? 76  PRO A O   1 
ATOM   575  C  CB  . PRO A 1 76  ? 17.005  -7.428  -14.653 1.00 57.58  ? 76  PRO A CB  1 
ATOM   576  C  CG  . PRO A 1 76  ? 17.572  -6.493  -13.596 1.00 48.71  ? 76  PRO A CG  1 
ATOM   577  C  CD  . PRO A 1 76  ? 17.071  -7.051  -12.304 1.00 52.67  ? 76  PRO A CD  1 
ATOM   578  N  N   . GLY A 1 77  ? 14.407  -9.706  -15.169 1.00 43.97  ? 77  GLY A N   1 
ATOM   579  C  CA  . GLY A 1 77  ? 14.175  -11.083 -15.588 1.00 47.74  ? 77  GLY A CA  1 
ATOM   580  C  C   . GLY A 1 77  ? 13.669  -12.034 -14.522 1.00 54.86  ? 77  GLY A C   1 
ATOM   581  O  O   . GLY A 1 77  ? 13.627  -13.247 -14.761 1.00 51.38  ? 77  GLY A O   1 
ATOM   582  N  N   . PHE A 1 78  ? 13.291  -11.529 -13.349 1.00 55.11  ? 78  PHE A N   1 
ATOM   583  C  CA  . PHE A 1 78  ? 12.704  -12.365 -12.314 1.00 42.74  ? 78  PHE A CA  1 
ATOM   584  C  C   . PHE A 1 78  ? 11.209  -12.471 -12.564 1.00 41.68  ? 78  PHE A C   1 
ATOM   585  O  O   . PHE A 1 78  ? 10.508  -11.455 -12.574 1.00 45.28  ? 78  PHE A O   1 
ATOM   586  C  CB  . PHE A 1 78  ? 12.979  -11.783 -10.935 1.00 40.41  ? 78  PHE A CB  1 
ATOM   587  C  CG  . PHE A 1 78  ? 12.348  -12.559 -9.824  1.00 46.52  ? 78  PHE A CG  1 
ATOM   588  C  CD1 . PHE A 1 78  ? 12.710  -13.873 -9.591  1.00 41.40  ? 78  PHE A CD1 1 
ATOM   589  C  CD2 . PHE A 1 78  ? 11.372  -11.973 -9.016  1.00 48.23  ? 78  PHE A CD2 1 
ATOM   590  C  CE1 . PHE A 1 78  ? 12.121  -14.590 -8.559  1.00 50.56  ? 78  PHE A CE1 1 
ATOM   591  C  CE2 . PHE A 1 78  ? 10.780  -12.682 -7.984  1.00 45.76  ? 78  PHE A CE2 1 
ATOM   592  C  CZ  . PHE A 1 78  ? 11.152  -13.995 -7.752  1.00 45.81  ? 78  PHE A CZ  1 
ATOM   593  N  N   . SER A 1 79  ? 10.720  -13.700 -12.747 1.00 43.03  ? 79  SER A N   1 
ATOM   594  C  CA  . SER A 1 79  ? 9.341   -13.893 -13.187 1.00 41.02  ? 79  SER A CA  1 
ATOM   595  C  C   . SER A 1 79  ? 8.338   -13.320 -12.183 1.00 39.46  ? 79  SER A C   1 
ATOM   596  O  O   . SER A 1 79  ? 7.304   -12.771 -12.577 1.00 40.75  ? 79  SER A O   1 
ATOM   597  C  CB  . SER A 1 79  ? 9.085   -15.382 -13.433 1.00 44.25  ? 79  SER A CB  1 
ATOM   598  O  OG  . SER A 1 79  ? 9.016   -16.119 -12.217 1.00 46.51  ? 79  SER A OG  1 
ATOM   599  N  N   . GLY A 1 80  ? 8.642   -13.408 -10.885 1.00 37.69  ? 80  GLY A N   1 
ATOM   600  C  CA  . GLY A 1 80  ? 7.722   -12.954 -9.854  1.00 41.40  ? 80  GLY A CA  1 
ATOM   601  C  C   . GLY A 1 80  ? 7.524   -11.451 -9.784  1.00 47.01  ? 80  GLY A C   1 
ATOM   602  O  O   . GLY A 1 80  ? 6.563   -10.995 -9.158  1.00 51.55  ? 80  GLY A O   1 
ATOM   603  N  N   . SER A 1 81  ? 8.423   -10.666 -10.373 1.00 43.84  ? 81  SER A N   1 
ATOM   604  C  CA  . SER A 1 81  ? 8.216   -9.226  -10.443 1.00 43.11  ? 81  SER A CA  1 
ATOM   605  C  C   . SER A 1 81  ? 7.890   -8.761  -11.843 1.00 51.95  ? 81  SER A C   1 
ATOM   606  O  O   . SER A 1 81  ? 7.228   -7.733  -12.005 1.00 49.63  ? 81  SER A O   1 
ATOM   607  C  CB  . SER A 1 81  ? 9.452   -8.458  -9.967  1.00 43.73  ? 81  SER A CB  1 
ATOM   608  O  OG  . SER A 1 81  ? 10.506  -8.570  -10.910 1.00 54.06  ? 81  SER A OG  1 
ATOM   609  N  N   . GLU A 1 82  ? 8.357   -9.492  -12.854 1.00 50.75  ? 82  GLU A N   1 
ATOM   610  C  CA  . GLU A 1 82  ? 8.026   -9.166  -14.228 1.00 49.58  ? 82  GLU A CA  1 
ATOM   611  C  C   . GLU A 1 82  ? 6.582   -9.493  -14.567 1.00 55.93  ? 82  GLU A C   1 
ATOM   612  O  O   . GLU A 1 82  ? 6.046   -8.915  -15.517 1.00 64.70  ? 82  GLU A O   1 
ATOM   613  C  CB  . GLU A 1 82  ? 8.971   -9.898  -15.173 1.00 55.88  ? 82  GLU A CB  1 
ATOM   614  C  CG  . GLU A 1 82  ? 10.425  -9.618  -14.860 1.00 68.56  ? 82  GLU A CG  1 
ATOM   615  C  CD  . GLU A 1 82  ? 11.079  -8.650  -15.809 1.00 76.07  ? 82  GLU A CD  1 
ATOM   616  O  OE1 . GLU A 1 82  ? 11.548  -7.583  -15.350 1.00 79.00  ? 82  GLU A OE1 1 
ATOM   617  O  OE2 . GLU A 1 82  ? 11.156  -8.981  -17.007 1.00 80.79  1 82  GLU A OE2 1 
ATOM   618  N  N   . MET A 1 83  ? 5.929   -10.379 -13.807 1.00 51.77  ? 83  MET A N   1 
ATOM   619  C  CA  . MET A 1 83  ? 4.532   -10.692 -14.091 1.00 32.04  ? 83  MET A CA  1 
ATOM   620  C  C   . MET A 1 83  ? 3.615   -9.485  -13.878 1.00 35.86  ? 83  MET A C   1 
ATOM   621  O  O   . MET A 1 83  ? 2.480   -9.495  -14.364 1.00 44.20  ? 83  MET A O   1 
ATOM   622  C  CB  . MET A 1 83  ? 4.070   -11.894 -13.247 1.00 27.30  ? 83  MET A CB  1 
ATOM   623  C  CG  . MET A 1 83  ? 4.034   -11.675 -11.735 1.00 44.87  ? 83  MET A CG  1 
ATOM   624  S  SD  . MET A 1 83  ? 3.324   -13.076 -10.802 1.00 59.24  ? 83  MET A SD  1 
ATOM   625  C  CE  . MET A 1 83  ? 2.781   -14.147 -12.131 1.00 59.17  ? 83  MET A CE  1 
ATOM   626  N  N   . TRP A 1 84  ? 4.086   -8.436  -13.196 1.00 27.32  ? 84  TRP A N   1 
ATOM   627  C  CA  . TRP A 1 84  ? 3.306   -7.228  -12.956 1.00 27.10  ? 84  TRP A CA  1 
ATOM   628  C  C   . TRP A 1 84  ? 3.733   -6.057  -13.822 1.00 35.35  ? 84  TRP A C   1 
ATOM   629  O  O   . TRP A 1 84  ? 3.024   -5.050  -13.868 1.00 41.17  ? 84  TRP A O   1 
ATOM   630  C  CB  . TRP A 1 84  ? 3.396   -6.812  -11.473 1.00 39.21  ? 84  TRP A CB  1 
ATOM   631  C  CG  . TRP A 1 84  ? 3.284   -7.964  -10.536 1.00 37.48  ? 84  TRP A CG  1 
ATOM   632  C  CD1 . TRP A 1 84  ? 4.300   -8.592  -9.888  1.00 45.15  ? 84  TRP A CD1 1 
ATOM   633  C  CD2 . TRP A 1 84  ? 2.086   -8.640  -10.150 1.00 50.97  ? 84  TRP A CD2 1 
ATOM   634  N  NE1 . TRP A 1 84  ? 3.819   -9.614  -9.104  1.00 46.07  ? 84  TRP A NE1 1 
ATOM   635  C  CE2 . TRP A 1 84  ? 2.463   -9.674  -9.254  1.00 48.64  ? 84  TRP A CE2 1 
ATOM   636  C  CE3 . TRP A 1 84  ? 0.725   -8.474  -10.471 1.00 45.70  ? 84  TRP A CE3 1 
ATOM   637  C  CZ2 . TRP A 1 84  ? 1.541   -10.540 -8.684  1.00 53.09  ? 84  TRP A CZ2 1 
ATOM   638  C  CZ3 . TRP A 1 84  ? -0.198  -9.338  -9.897  1.00 49.69  ? 84  TRP A CZ3 1 
ATOM   639  C  CH2 . TRP A 1 84  ? 0.220   -10.361 -9.013  1.00 58.50  ? 84  TRP A CH2 1 
ATOM   640  N  N   . ASN A 1 85  ? 4.856   -6.161  -14.525 1.00 49.18  ? 85  ASN A N   1 
ATOM   641  C  CA  . ASN A 1 85  ? 5.275   -5.105  -15.444 1.00 44.28  ? 85  ASN A CA  1 
ATOM   642  C  C   . ASN A 1 85  ? 4.369   -5.083  -16.677 1.00 47.50  ? 85  ASN A C   1 
ATOM   643  O  O   . ASN A 1 85  ? 3.773   -6.103  -17.035 1.00 54.87  ? 85  ASN A O   1 
ATOM   644  C  CB  . ASN A 1 85  ? 6.718   -5.333  -15.866 1.00 47.38  ? 85  ASN A CB  1 
ATOM   645  C  CG  . ASN A 1 85  ? 7.714   -5.009  -14.774 1.00 54.73  ? 85  ASN A CG  1 
ATOM   646  O  OD1 . ASN A 1 85  ? 8.566   -5.841  -14.434 1.00 55.63  ? 85  ASN A OD1 1 
ATOM   647  N  ND2 . ASN A 1 85  ? 7.623   -3.804  -14.221 1.00 57.21  ? 85  ASN A ND2 1 
ATOM   648  N  N   . PRO A 1 86  ? 4.257   -3.933  -17.340 1.00 45.47  ? 86  PRO A N   1 
ATOM   649  C  CA  . PRO A 1 86  ? 3.530   -3.877  -18.614 1.00 39.60  ? 86  PRO A CA  1 
ATOM   650  C  C   . PRO A 1 86  ? 4.087   -4.867  -19.631 1.00 38.11  ? 86  PRO A C   1 
ATOM   651  O  O   . PRO A 1 86  ? 5.289   -4.925  -19.880 1.00 44.87  ? 86  PRO A O   1 
ATOM   652  C  CB  . PRO A 1 86  ? 3.712   -2.423  -19.065 1.00 36.61  ? 86  PRO A CB  1 
ATOM   653  C  CG  . PRO A 1 86  ? 4.316   -1.684  -17.898 1.00 37.09  ? 86  PRO A CG  1 
ATOM   654  C  CD  . PRO A 1 86  ? 4.952   -2.682  -17.013 1.00 43.11  ? 86  PRO A CD  1 
ATOM   655  N  N   . ASN A 1 87  ? 3.197   -5.662  -20.219 1.00 45.39  ? 87  ASN A N   1 
ATOM   656  C  CA  . ASN A 1 87  ? 3.567   -6.658  -21.226 1.00 45.31  ? 87  ASN A CA  1 
ATOM   657  C  C   . ASN A 1 87  ? 3.225   -6.235  -22.646 1.00 48.76  ? 87  ASN A C   1 
ATOM   658  O  O   . ASN A 1 87  ? 3.406   -7.030  -23.574 1.00 57.45  ? 87  ASN A O   1 
ATOM   659  C  CB  . ASN A 1 87  ? 2.881   -7.993  -20.929 1.00 39.28  ? 87  ASN A CB  1 
ATOM   660  C  CG  . ASN A 1 87  ? 1.380   -7.855  -20.803 1.00 39.71  ? 87  ASN A CG  1 
ATOM   661  O  OD1 . ASN A 1 87  ? 0.822   -6.756  -20.916 1.00 37.29  ? 87  ASN A OD1 1 
ATOM   662  N  ND2 . ASN A 1 87  ? 0.714   -8.974  -20.566 1.00 46.10  ? 87  ASN A ND2 1 
ATOM   663  N  N   . ARG A 1 88  ? 2.693   -5.032  -22.831 1.00 40.01  ? 88  ARG A N   1 
ATOM   664  C  CA  . ARG A 1 88  ? 2.467   -4.467  -24.150 1.00 45.10  ? 88  ARG A CA  1 
ATOM   665  C  C   . ARG A 1 88  ? 3.141   -3.104  -24.191 1.00 45.28  ? 88  ARG A C   1 
ATOM   666  O  O   . ARG A 1 88  ? 3.591   -2.581  -23.168 1.00 49.68  ? 88  ARG A O   1 
ATOM   667  C  CB  . ARG A 1 88  ? 0.964   -4.372  -24.493 1.00 55.57  ? 88  ARG A CB  1 
ATOM   668  C  CG  . ARG A 1 88  ? 0.228   -5.731  -24.513 1.00 55.43  ? 88  ARG A CG  1 
ATOM   669  C  CD  . ARG A 1 88  ? 0.916   -6.683  -25.484 1.00 58.93  ? 88  ARG A CD  1 
ATOM   670  N  NE  . ARG A 1 88  ? 0.002   -7.488  -26.281 1.00 64.62  ? 88  ARG A NE  1 
ATOM   671  C  CZ  . ARG A 1 88  ? -0.377  -7.155  -27.513 1.00 67.63  ? 88  ARG A CZ  1 
ATOM   672  N  NH1 . ARG A 1 88  ? 0.062   -6.020  -28.049 1.00 50.84  1 88  ARG A NH1 1 
ATOM   673  N  NH2 . ARG A 1 88  ? -1.210  -7.935  -28.200 1.00 75.66  ? 88  ARG A NH2 1 
ATOM   674  N  N   . GLU A 1 89  ? 3.251   -2.542  -25.392 1.00 47.81  ? 89  GLU A N   1 
ATOM   675  C  CA  . GLU A 1 89  ? 3.827   -1.213  -25.507 1.00 47.44  ? 89  GLU A CA  1 
ATOM   676  C  C   . GLU A 1 89  ? 3.046   -0.251  -24.621 1.00 49.67  ? 89  GLU A C   1 
ATOM   677  O  O   . GLU A 1 89  ? 1.823   -0.370  -24.460 1.00 56.33  ? 89  GLU A O   1 
ATOM   678  C  CB  . GLU A 1 89  ? 3.835   -0.739  -26.970 1.00 41.84  ? 89  GLU A CB  1 
ATOM   679  C  CG  . GLU A 1 89  ? 5.139   -0.040  -27.370 1.00 61.79  ? 89  GLU A CG  1 
ATOM   680  C  CD  . GLU A 1 89  ? 6.336   -1.013  -27.470 1.00 82.00  ? 89  GLU A CD  1 
ATOM   681  O  OE1 . GLU A 1 89  ? 6.230   -2.007  -28.221 1.00 88.27  ? 89  GLU A OE1 1 
ATOM   682  O  OE2 . GLU A 1 89  ? 7.363   -0.801  -26.773 1.00 80.58  1 89  GLU A OE2 1 
ATOM   683  N  N   . MET A 1 90  ? 3.768   0.667   -23.992 1.00 42.17  ? 90  MET A N   1 
ATOM   684  C  CA  . MET A 1 90  ? 3.145   1.727   -23.215 1.00 51.83  ? 90  MET A CA  1 
ATOM   685  C  C   . MET A 1 90  ? 2.774   2.885   -24.135 1.00 54.44  ? 90  MET A C   1 
ATOM   686  O  O   . MET A 1 90  ? 3.569   3.284   -24.994 1.00 52.98  ? 90  MET A O   1 
ATOM   687  C  CB  . MET A 1 90  ? 4.073   2.209   -22.095 1.00 52.44  ? 90  MET A CB  1 
ATOM   688  C  CG  . MET A 1 90  ? 4.018   1.358   -20.828 1.00 56.95  ? 90  MET A CG  1 
ATOM   689  S  SD  . MET A 1 90  ? 5.010   2.062   -19.498 1.00 68.11  ? 90  MET A SD  1 
ATOM   690  C  CE  . MET A 1 90  ? 6.412   2.708   -20.416 1.00 63.49  ? 90  MET A CE  1 
ATOM   691  N  N   . SER A 1 91  ? 1.557   3.402   -23.974 1.00 57.75  ? 91  SER A N   1 
ATOM   692  C  CA  . SER A 1 91  ? 1.143   4.619   -24.655 1.00 59.59  ? 91  SER A CA  1 
ATOM   693  C  C   . SER A 1 91  ? 0.261   5.410   -23.700 1.00 53.09  ? 91  SER A C   1 
ATOM   694  O  O   . SER A 1 91  ? -0.267  4.868   -22.730 1.00 59.94  ? 91  SER A O   1 
ATOM   695  C  CB  . SER A 1 91  ? 0.407   4.314   -25.978 1.00 55.16  ? 91  SER A CB  1 
ATOM   696  O  OG  . SER A 1 91  ? -0.415  5.407   -26.356 1.00 56.35  ? 91  SER A OG  1 
ATOM   697  N  N   . GLU A 1 92  ? 0.146   6.714   -23.947 1.00 41.55  ? 92  GLU A N   1 
ATOM   698  C  CA  . GLU A 1 92  ? -0.911  7.475   -23.295 1.00 52.65  ? 92  GLU A CA  1 
ATOM   699  C  C   . GLU A 1 92  ? -2.283  7.123   -23.868 1.00 62.76  ? 92  GLU A C   1 
ATOM   700  O  O   . GLU A 1 92  ? -3.291  7.181   -23.148 1.00 62.47  ? 92  GLU A O   1 
ATOM   701  C  CB  . GLU A 1 92  ? -0.678  8.977   -23.431 1.00 47.96  ? 92  GLU A CB  1 
ATOM   702  C  CG  . GLU A 1 92  ? 0.679   9.483   -23.035 1.00 51.80  ? 92  GLU A CG  1 
ATOM   703  C  CD  . GLU A 1 92  ? 0.656   10.986  -22.738 1.00 62.87  ? 92  GLU A CD  1 
ATOM   704  O  OE1 . GLU A 1 92  ? -0.052  11.399  -21.780 1.00 62.27  ? 92  GLU A OE1 1 
ATOM   705  O  OE2 . GLU A 1 92  ? 1.304   11.771  -23.487 1.00 64.21  1 92  GLU A OE2 1 
ATOM   706  N  N   . ASP A 1 93  ? -2.343  6.770   -25.157 1.00 62.41  ? 93  ASP A N   1 
ATOM   707  C  CA  . ASP A 1 93  ? -3.546  6.201   -25.769 1.00 59.79  ? 93  ASP A CA  1 
ATOM   708  C  C   . ASP A 1 93  ? -3.756  4.789   -25.216 1.00 65.00  ? 93  ASP A C   1 
ATOM   709  O  O   . ASP A 1 93  ? -3.427  3.782   -25.850 1.00 62.45  ? 93  ASP A O   1 
ATOM   710  C  CB  . ASP A 1 93  ? -3.408  6.185   -27.288 1.00 56.11  ? 93  ASP A CB  1 
ATOM   711  C  CG  . ASP A 1 93  ? -4.668  5.685   -28.002 1.00 69.09  ? 93  ASP A CG  1 
ATOM   712  O  OD1 . ASP A 1 93  ? -4.547  5.241   -29.173 1.00 67.79  ? 93  ASP A OD1 1 
ATOM   713  O  OD2 . ASP A 1 93  ? -5.779  5.747   -27.413 1.00 71.54  1 93  ASP A OD2 1 
ATOM   714  N  N   . CYS A 1 94  ? -4.330  4.713   -24.004 1.00 66.46  ? 94  CYS A N   1 
ATOM   715  C  CA  . CYS A 1 94  ? -4.375  3.454   -23.265 1.00 59.07  ? 94  CYS A CA  1 
ATOM   716  C  C   . CYS A 1 94  ? -5.732  3.147   -22.642 1.00 50.72  ? 94  CYS A C   1 
ATOM   717  O  O   . CYS A 1 94  ? -5.841  2.169   -21.902 1.00 48.48  ? 94  CYS A O   1 
ATOM   718  C  CB  . CYS A 1 94  ? -3.303  3.436   -22.165 1.00 52.73  ? 94  CYS A CB  1 
ATOM   719  S  SG  . CYS A 1 94  ? -3.482  4.719   -20.904 1.00 59.54  ? 94  CYS A SG  1 
ATOM   720  N  N   . LEU A 1 95  ? -6.767  3.935   -22.926 1.00 49.84  ? 95  LEU A N   1 
ATOM   721  C  CA  . LEU A 1 95  ? -8.094  3.734   -22.333 1.00 46.89  ? 95  LEU A CA  1 
ATOM   722  C  C   . LEU A 1 95  ? -8.889  2.742   -23.165 1.00 44.96  ? 95  LEU A C   1 
ATOM   723  O  O   . LEU A 1 95  ? -9.607  3.104   -24.098 1.00 47.85  ? 95  LEU A O   1 
ATOM   724  C  CB  . LEU A 1 95  ? -8.816  5.062   -22.204 1.00 47.67  ? 95  LEU A CB  1 
ATOM   725  C  CG  . LEU A 1 95  ? -8.006  5.940   -21.257 1.00 47.66  ? 95  LEU A CG  1 
ATOM   726  C  CD1 . LEU A 1 95  ? -8.796  7.185   -21.000 1.00 44.72  ? 95  LEU A CD1 1 
ATOM   727  C  CD2 . LEU A 1 95  ? -7.699  5.170   -19.940 1.00 34.61  ? 95  LEU A CD2 1 
ATOM   728  N  N   . TYR A 1 96  ? -8.745  1.469   -22.818 1.00 42.72  ? 96  TYR A N   1 
ATOM   729  C  CA  . TYR A 1 96  ? -9.458  0.385   -23.471 1.00 50.43  ? 96  TYR A CA  1 
ATOM   730  C  C   . TYR A 1 96  ? -9.938  -0.598  -22.413 1.00 53.29  ? 96  TYR A C   1 
ATOM   731  O  O   . TYR A 1 96  ? -9.450  -0.610  -21.280 1.00 60.95  ? 96  TYR A O   1 
ATOM   732  C  CB  . TYR A 1 96  ? -8.585  -0.327  -24.520 1.00 45.08  ? 96  TYR A CB  1 
ATOM   733  C  CG  . TYR A 1 96  ? -8.005  0.634   -25.521 1.00 51.56  ? 96  TYR A CG  1 
ATOM   734  C  CD1 . TYR A 1 96  ? -8.547  0.756   -26.787 1.00 55.79  ? 96  TYR A CD1 1 
ATOM   735  C  CD2 . TYR A 1 96  ? -6.912  1.426   -25.200 1.00 58.46  ? 96  TYR A CD2 1 
ATOM   736  C  CE1 . TYR A 1 96  ? -8.025  1.651   -27.705 1.00 55.12  ? 96  TYR A CE1 1 
ATOM   737  C  CE2 . TYR A 1 96  ? -6.386  2.325   -26.103 1.00 57.66  ? 96  TYR A CE2 1 
ATOM   738  C  CZ  . TYR A 1 96  ? -6.946  2.428   -27.356 1.00 53.73  ? 96  TYR A CZ  1 
ATOM   739  O  OH  . TYR A 1 96  ? -6.427  3.310   -28.271 1.00 49.88  ? 96  TYR A OH  1 
ATOM   740  N  N   . LEU A 1 97  ? -10.912 -1.421  -22.790 1.00 40.12  ? 97  LEU A N   1 
ATOM   741  C  CA  . LEU A 1 97  ? -11.386 -2.485  -21.924 1.00 39.14  ? 97  LEU A CA  1 
ATOM   742  C  C   . LEU A 1 97  ? -11.386 -3.793  -22.703 1.00 38.88  ? 97  LEU A C   1 
ATOM   743  O  O   . LEU A 1 97  ? -11.334 -3.798  -23.936 1.00 39.89  ? 97  LEU A O   1 
ATOM   744  C  CB  . LEU A 1 97  ? -12.776 -2.174  -21.377 1.00 33.96  ? 97  LEU A CB  1 
ATOM   745  C  CG  . LEU A 1 97  ? -13.833 -1.886  -22.443 1.00 32.63  ? 97  LEU A CG  1 
ATOM   746  C  CD1 . LEU A 1 97  ? -14.644 -3.137  -22.761 1.00 32.70  ? 97  LEU A CD1 1 
ATOM   747  C  CD2 . LEU A 1 97  ? -14.713 -0.737  -22.025 1.00 32.90  ? 97  LEU A CD2 1 
ATOM   748  N  N   . ASN A 1 98  ? -11.453 -4.904  -21.966 1.00 31.15  ? 98  ASN A N   1 
ATOM   749  C  CA  . ASN A 1 98  ? -11.429 -6.242  -22.541 1.00 40.66  ? 98  ASN A CA  1 
ATOM   750  C  C   . ASN A 1 98  ? -12.609 -7.038  -22.018 1.00 50.13  ? 98  ASN A C   1 
ATOM   751  O  O   . ASN A 1 98  ? -12.911 -6.981  -20.824 1.00 65.08  ? 98  ASN A O   1 
ATOM   752  C  CB  . ASN A 1 98  ? -10.127 -6.961  -22.198 1.00 40.87  ? 98  ASN A CB  1 
ATOM   753  C  CG  . ASN A 1 98  ? -8.909  -6.135  -22.554 1.00 42.05  ? 98  ASN A CG  1 
ATOM   754  O  OD1 . ASN A 1 98  ? -8.677  -5.818  -23.725 1.00 46.91  ? 98  ASN A OD1 1 
ATOM   755  N  ND2 . ASN A 1 98  ? -8.135  -5.760  -21.544 1.00 30.47  ? 98  ASN A ND2 1 
ATOM   756  N  N   . ILE A 1 99  ? -13.276 -7.783  -22.900 1.00 40.71  ? 99  ILE A N   1 
ATOM   757  C  CA  . ILE A 1 99  ? -14.473 -8.538  -22.529 1.00 44.47  ? 99  ILE A CA  1 
ATOM   758  C  C   . ILE A 1 99  ? -14.284 -10.010 -22.887 1.00 48.36  ? 99  ILE A C   1 
ATOM   759  O  O   . ILE A 1 99  ? -13.838 -10.333 -23.995 1.00 48.19  ? 99  ILE A O   1 
ATOM   760  C  CB  . ILE A 1 99  ? -15.732 -7.980  -23.215 1.00 40.40  ? 99  ILE A CB  1 
ATOM   761  C  CG1 . ILE A 1 99  ? -15.675 -6.454  -23.317 1.00 33.00  ? 99  ILE A CG1 1 
ATOM   762  C  CG2 . ILE A 1 99  ? -16.960 -8.404  -22.451 1.00 47.84  ? 99  ILE A CG2 1 
ATOM   763  C  CD1 . ILE A 1 99  ? -16.969 -5.827  -23.817 1.00 33.86  ? 99  ILE A CD1 1 
ATOM   764  N  N   . TRP A 1 100 ? -14.627 -10.901 -21.952 1.00 45.61  ? 100 TRP A N   1 
ATOM   765  C  CA  . TRP A 1 100 ? -14.694 -12.338 -22.215 1.00 46.69  ? 100 TRP A CA  1 
ATOM   766  C  C   . TRP A 1 100 ? -16.128 -12.803 -22.079 1.00 52.53  ? 100 TRP A C   1 
ATOM   767  O  O   . TRP A 1 100 ? -16.752 -12.592 -21.038 1.00 62.65  ? 100 TRP A O   1 
ATOM   768  C  CB  . TRP A 1 100 ? -13.819 -13.153 -21.267 1.00 37.10  ? 100 TRP A CB  1 
ATOM   769  C  CG  . TRP A 1 100 ? -12.399 -13.037 -21.558 1.00 40.44  ? 100 TRP A CG  1 
ATOM   770  C  CD1 . TRP A 1 100 ? -11.642 -13.891 -22.292 1.00 41.68  ? 100 TRP A CD1 1 
ATOM   771  C  CD2 . TRP A 1 100 ? -11.530 -11.986 -21.127 1.00 43.52  ? 100 TRP A CD2 1 
ATOM   772  N  NE1 . TRP A 1 100 ? -10.341 -13.440 -22.340 1.00 46.96  ? 100 TRP A NE1 1 
ATOM   773  C  CE2 . TRP A 1 100 ? -10.253 -12.272 -21.627 1.00 44.42  ? 100 TRP A CE2 1 
ATOM   774  C  CE3 . TRP A 1 100 ? -11.711 -10.832 -20.359 1.00 43.21  ? 100 TRP A CE3 1 
ATOM   775  C  CZ2 . TRP A 1 100 ? -9.161  -11.447 -21.385 1.00 46.10  ? 100 TRP A CZ2 1 
ATOM   776  C  CZ3 . TRP A 1 100 ? -10.630 -10.010 -20.132 1.00 42.14  ? 100 TRP A CZ3 1 
ATOM   777  C  CH2 . TRP A 1 100 ? -9.372  -10.323 -20.640 1.00 43.57  ? 100 TRP A CH2 1 
ATOM   778  N  N   . VAL A 1 101 ? -16.646 -13.449 -23.122 1.00 54.11  ? 101 VAL A N   1 
ATOM   779  C  CA  . VAL A 1 101 ? -18.048 -13.782 -23.224 1.00 48.79  ? 101 VAL A CA  1 
ATOM   780  C  C   . VAL A 1 101 ? -18.190 -15.285 -23.470 1.00 41.51  ? 101 VAL A C   1 
ATOM   781  O  O   . VAL A 1 101 ? -17.660 -15.776 -24.478 1.00 46.28  ? 101 VAL A O   1 
ATOM   782  C  CB  . VAL A 1 101 ? -18.727 -12.982 -24.338 1.00 36.34  ? 101 VAL A CB  1 
ATOM   783  C  CG1 . VAL A 1 101 ? -20.238 -13.175 -24.290 1.00 37.14  ? 101 VAL A CG1 1 
ATOM   784  C  CG2 . VAL A 1 101 ? -18.349 -11.508 -24.211 1.00 35.52  ? 101 VAL A CG2 1 
ATOM   785  N  N   . PRO A 1 102 ? -18.832 -16.038 -22.597 1.00 37.74  ? 102 PRO A N   1 
ATOM   786  C  CA  . PRO A 1 102 ? -18.939 -17.489 -22.804 1.00 40.01  ? 102 PRO A CA  1 
ATOM   787  C  C   . PRO A 1 102 ? -19.512 -17.816 -24.179 1.00 50.25  ? 102 PRO A C   1 
ATOM   788  O  O   . PRO A 1 102 ? -20.319 -17.066 -24.735 1.00 53.55  ? 102 PRO A O   1 
ATOM   789  C  CB  . PRO A 1 102 ? -19.883 -17.955 -21.678 1.00 45.24  ? 102 PRO A CB  1 
ATOM   790  C  CG  . PRO A 1 102 ? -20.337 -16.707 -20.939 1.00 36.42  ? 102 PRO A CG  1 
ATOM   791  C  CD  . PRO A 1 102 ? -19.332 -15.629 -21.273 1.00 39.81  ? 102 PRO A CD  1 
ATOM   792  N  N   . SER A 1 103 ? -19.065 -18.933 -24.744 1.00 58.30  ? 103 SER A N   1 
ATOM   793  C  CA  . SER A 1 103 ? -19.634 -19.385 -26.002 1.00 64.01  ? 103 SER A CA  1 
ATOM   794  C  C   . SER A 1 103 ? -20.379 -20.691 -25.808 1.00 64.00  ? 103 SER A C   1 
ATOM   795  O  O   . SER A 1 103 ? -19.846 -21.636 -25.234 1.00 73.25  ? 103 SER A O   1 
ATOM   796  C  CB  . SER A 1 103 ? -18.563 -19.571 -27.074 1.00 69.53  ? 103 SER A CB  1 
ATOM   797  O  OG  . SER A 1 103 ? -19.105 -20.251 -28.189 1.00 74.24  ? 103 SER A OG  1 
ATOM   798  N  N   . PRO A 1 104 ? -21.641 -20.747 -26.261 1.00 58.50  ? 104 PRO A N   1 
ATOM   799  C  CA  . PRO A 1 104 ? -22.444 -19.697 -26.911 1.00 52.81  ? 104 PRO A CA  1 
ATOM   800  C  C   . PRO A 1 104 ? -22.706 -18.446 -26.079 1.00 56.12  ? 104 PRO A C   1 
ATOM   801  O  O   . PRO A 1 104 ? -22.613 -18.463 -24.849 1.00 66.20  ? 104 PRO A O   1 
ATOM   802  C  CB  . PRO A 1 104 ? -23.769 -20.388 -27.220 1.00 47.13  ? 104 PRO A CB  1 
ATOM   803  C  CG  . PRO A 1 104 ? -23.577 -21.812 -26.933 1.00 50.80  ? 104 PRO A CG  1 
ATOM   804  C  CD  . PRO A 1 104 ? -22.410 -21.973 -26.041 1.00 55.84  ? 104 PRO A CD  1 
ATOM   805  N  N   . ARG A 1 105 ? -23.023 -17.372 -26.776 1.00 46.17  ? 105 ARG A N   1 
ATOM   806  C  CA  . ARG A 1 105 ? -23.263 -16.085 -26.146 1.00 46.44  ? 105 ARG A CA  1 
ATOM   807  C  C   . ARG A 1 105 ? -24.472 -16.157 -25.212 1.00 50.45  ? 105 ARG A C   1 
ATOM   808  O  O   . ARG A 1 105 ? -25.577 -16.496 -25.662 1.00 54.77  ? 105 ARG A O   1 
ATOM   809  C  CB  . ARG A 1 105 ? -23.491 -14.999 -27.203 1.00 42.83  ? 105 ARG A CB  1 
ATOM   810  C  CG  . ARG A 1 105 ? -24.216 -13.754 -26.672 1.00 42.08  ? 105 ARG A CG  1 
ATOM   811  C  CD  . ARG A 1 105 ? -23.676 -12.459 -27.189 1.00 41.63  ? 105 ARG A CD  1 
ATOM   812  N  NE  . ARG A 1 105 ? -23.653 -12.516 -28.651 1.00 63.27  ? 105 ARG A NE  1 
ATOM   813  C  CZ  . ARG A 1 105 ? -23.515 -11.481 -29.463 1.00 58.90  ? 105 ARG A CZ  1 
ATOM   814  N  NH1 . ARG A 1 105 ? -23.416 -10.262 -28.968 1.00 57.66  1 105 ARG A NH1 1 
ATOM   815  N  NH2 . ARG A 1 105 ? -23.493 -11.693 -30.760 1.00 56.16  ? 105 ARG A NH2 1 
ATOM   816  N  N   . PRO A 1 106 ? -24.317 -15.830 -23.935 1.00 48.69  ? 106 PRO A N   1 
ATOM   817  C  CA  . PRO A 1 106 ? -25.453 -15.859 -23.009 1.00 44.23  ? 106 PRO A CA  1 
ATOM   818  C  C   . PRO A 1 106 ? -26.481 -14.787 -23.334 1.00 51.32  ? 106 PRO A C   1 
ATOM   819  O  O   . PRO A 1 106 ? -26.232 -13.828 -24.068 1.00 56.45  ? 106 PRO A O   1 
ATOM   820  C  CB  . PRO A 1 106 ? -24.795 -15.585 -21.655 1.00 48.04  ? 106 PRO A CB  1 
ATOM   821  C  CG  . PRO A 1 106 ? -23.601 -14.726 -22.007 1.00 50.13  ? 106 PRO A CG  1 
ATOM   822  C  CD  . PRO A 1 106 ? -23.102 -15.274 -23.318 1.00 51.37  ? 106 PRO A CD  1 
ATOM   823  N  N   . LYS A 1 107 ? -27.658 -14.962 -22.759 1.00 57.41  ? 107 LYS A N   1 
ATOM   824  C  CA  . LYS A 1 107 ? -28.726 -13.978 -22.847 1.00 60.62  ? 107 LYS A CA  1 
ATOM   825  C  C   . LYS A 1 107 ? -28.842 -13.351 -21.465 1.00 66.54  ? 107 LYS A C   1 
ATOM   826  O  O   . LYS A 1 107 ? -29.181 -14.042 -20.500 1.00 73.42  ? 107 LYS A O   1 
ATOM   827  C  CB  . LYS A 1 107 ? -30.034 -14.629 -23.299 1.00 61.80  ? 107 LYS A CB  1 
ATOM   828  C  CG  . LYS A 1 107 ? -31.097 -13.641 -23.719 1.00 66.16  ? 107 LYS A CG  1 
ATOM   829  C  CD  . LYS A 1 107 ? -31.753 -13.981 -25.069 1.00 64.96  ? 107 LYS A CD  1 
ATOM   830  C  CE  . LYS A 1 107 ? -32.626 -15.247 -25.011 1.00 60.76  ? 107 LYS A CE  1 
ATOM   831  N  NZ  . LYS A 1 107 ? -32.860 -15.888 -26.350 1.00 50.59  1 107 LYS A NZ  1 
ATOM   832  N  N   . SER A 1 108 ? -28.492 -12.065 -21.360 1.00 64.51  ? 108 SER A N   1 
ATOM   833  C  CA  . SER A 1 108 ? -28.617 -11.314 -20.114 1.00 62.87  ? 108 SER A CA  1 
ATOM   834  C  C   . SER A 1 108 ? -28.026 -12.061 -18.915 1.00 59.30  ? 108 SER A C   1 
ATOM   835  O  O   . SER A 1 108 ? -28.766 -12.667 -18.132 1.00 75.52  ? 108 SER A O   1 
ATOM   836  C  CB  . SER A 1 108 ? -30.099 -10.973 -19.900 1.00 66.83  ? 108 SER A CB  1 
ATOM   837  O  OG  . SER A 1 108 ? -30.385 -10.567 -18.576 1.00 69.61  ? 108 SER A OG  1 
ATOM   838  N  N   . THR A 1 109 ? -26.703 -12.034 -18.755 1.00 46.12  ? 109 THR A N   1 
ATOM   839  C  CA  . THR A 1 109 ? -26.050 -12.748 -17.660 1.00 50.08  ? 109 THR A CA  1 
ATOM   840  C  C   . THR A 1 109 ? -25.149 -11.792 -16.879 1.00 42.20  ? 109 THR A C   1 
ATOM   841  O  O   . THR A 1 109 ? -24.869 -10.668 -17.313 1.00 34.51  ? 109 THR A O   1 
ATOM   842  C  CB  . THR A 1 109 ? -25.240 -13.963 -18.164 1.00 53.50  ? 109 THR A CB  1 
ATOM   843  O  OG1 . THR A 1 109 ? -24.900 -14.816 -17.068 1.00 63.94  ? 109 THR A OG1 1 
ATOM   844  C  CG2 . THR A 1 109 ? -23.962 -13.504 -18.794 1.00 52.78  ? 109 THR A CG2 1 
ATOM   845  N  N   . THR A 1 110 ? -24.720 -12.264 -15.702 1.00 34.29  ? 110 THR A N   1 
ATOM   846  C  CA  . THR A 1 110 ? -23.912 -11.482 -14.769 1.00 40.25  ? 110 THR A CA  1 
ATOM   847  C  C   . THR A 1 110 ? -22.596 -11.030 -15.391 1.00 39.81  ? 110 THR A C   1 
ATOM   848  O  O   . THR A 1 110 ? -21.844 -11.841 -15.941 1.00 40.58  ? 110 THR A O   1 
ATOM   849  C  CB  . THR A 1 110 ? -23.618 -12.321 -13.519 1.00 41.91  ? 110 THR A CB  1 
ATOM   850  O  OG1 . THR A 1 110 ? -24.846 -12.823 -12.993 1.00 50.32  ? 110 THR A OG1 1 
ATOM   851  C  CG2 . THR A 1 110 ? -22.901 -11.494 -12.444 1.00 40.08  ? 110 THR A CG2 1 
ATOM   852  N  N   . VAL A 1 111 ? -22.306 -9.735  -15.278 1.00 36.33  ? 111 VAL A N   1 
ATOM   853  C  CA  . VAL A 1 111 ? -21.014 -9.179  -15.663 1.00 44.83  ? 111 VAL A CA  1 
ATOM   854  C  C   . VAL A 1 111 ? -20.226 -8.792  -14.409 1.00 46.76  ? 111 VAL A C   1 
ATOM   855  O  O   . VAL A 1 111 ? -20.782 -8.204  -13.467 1.00 37.74  ? 111 VAL A O   1 
ATOM   856  C  CB  . VAL A 1 111 ? -21.173 -7.991  -16.627 1.00 48.61  ? 111 VAL A CB  1 
ATOM   857  C  CG1 . VAL A 1 111 ? -22.170 -7.007  -16.098 1.00 52.83  ? 111 VAL A CG1 1 
ATOM   858  C  CG2 . VAL A 1 111 ? -19.836 -7.302  -16.822 1.00 48.63  ? 111 VAL A CG2 1 
ATOM   859  N  N   . MET A 1 112 ? -18.943 -9.183  -14.384 1.00 44.04  ? 112 MET A N   1 
ATOM   860  C  CA  . MET A 1 112 ? -17.938 -8.717  -13.433 1.00 28.38  ? 112 MET A CA  1 
ATOM   861  C  C   . MET A 1 112 ? -16.889 -7.880  -14.153 1.00 34.50  ? 112 MET A C   1 
ATOM   862  O  O   . MET A 1 112 ? -16.309 -8.322  -15.148 1.00 30.88  ? 112 MET A O   1 
ATOM   863  C  CB  . MET A 1 112 ? -17.238 -9.872  -12.696 1.00 31.17  ? 112 MET A CB  1 
ATOM   864  C  CG  . MET A 1 112 ? -18.132 -10.765 -11.838 1.00 46.19  ? 112 MET A CG  1 
ATOM   865  S  SD  . MET A 1 112 ? -17.486 -12.414 -11.467 1.00 46.53  ? 112 MET A SD  1 
ATOM   866  C  CE  . MET A 1 112 ? -16.144 -12.057 -10.362 1.00 53.69  ? 112 MET A CE  1 
ATOM   867  N  N   . VAL A 1 113 ? -16.615 -6.698  -13.617 1.00 33.51  ? 113 VAL A N   1 
ATOM   868  C  CA  . VAL A 1 113 ? -15.627 -5.774  -14.160 1.00 30.03  ? 113 VAL A CA  1 
ATOM   869  C  C   . VAL A 1 113 ? -14.427 -5.722  -13.217 1.00 32.66  ? 113 VAL A C   1 
ATOM   870  O  O   . VAL A 1 113 ? -14.568 -5.345  -12.049 1.00 35.49  ? 113 VAL A O   1 
ATOM   871  C  CB  . VAL A 1 113 ? -16.230 -4.378  -14.350 1.00 32.64  ? 113 VAL A CB  1 
ATOM   872  C  CG1 . VAL A 1 113 ? -15.159 -3.381  -14.786 1.00 31.18  ? 113 VAL A CG1 1 
ATOM   873  C  CG2 . VAL A 1 113 ? -17.360 -4.443  -15.331 1.00 28.88  ? 113 VAL A CG2 1 
ATOM   874  N  N   . TRP A 1 114 ? -13.243 -6.057  -13.736 1.00 36.06  ? 114 TRP A N   1 
ATOM   875  C  CA  . TRP A 1 114 ? -12.003 -6.081  -12.958 1.00 37.77  ? 114 TRP A CA  1 
ATOM   876  C  C   . TRP A 1 114 ? -11.264 -4.747  -13.054 1.00 37.47  ? 114 TRP A C   1 
ATOM   877  O  O   . TRP A 1 114 ? -11.108 -4.191  -14.152 1.00 33.90  ? 114 TRP A O   1 
ATOM   878  C  CB  . TRP A 1 114 ? -11.094 -7.211  -13.441 1.00 38.37  ? 114 TRP A CB  1 
ATOM   879  C  CG  . TRP A 1 114 ? -9.734  -7.182  -12.837 1.00 51.57  ? 114 TRP A CG  1 
ATOM   880  C  CD1 . TRP A 1 114 ? -8.556  -6.853  -13.453 1.00 48.93  ? 114 TRP A CD1 1 
ATOM   881  C  CD2 . TRP A 1 114 ? -9.403  -7.474  -11.478 1.00 57.79  ? 114 TRP A CD2 1 
ATOM   882  N  NE1 . TRP A 1 114 ? -7.506  -6.935  -12.558 1.00 30.04  ? 114 TRP A NE1 1 
ATOM   883  C  CE2 . TRP A 1 114 ? -8.003  -7.315  -11.339 1.00 45.32  ? 114 TRP A CE2 1 
ATOM   884  C  CE3 . TRP A 1 114 ? -10.152 -7.860  -10.361 1.00 56.29  ? 114 TRP A CE3 1 
ATOM   885  C  CZ2 . TRP A 1 114 ? -7.345  -7.525  -10.123 1.00 41.13  ? 114 TRP A CZ2 1 
ATOM   886  C  CZ3 . TRP A 1 114 ? -9.489  -8.077  -9.156  1.00 47.85  ? 114 TRP A CZ3 1 
ATOM   887  C  CH2 . TRP A 1 114 ? -8.104  -7.898  -9.048  1.00 35.39  ? 114 TRP A CH2 1 
ATOM   888  N  N   . ILE A 1 115 ? -10.802 -4.247  -11.903 1.00 30.09  ? 115 ILE A N   1 
ATOM   889  C  CA  . ILE A 1 115 ? -10.043 -2.994  -11.806 1.00 31.20  ? 115 ILE A CA  1 
ATOM   890  C  C   . ILE A 1 115 ? -8.660  -3.324  -11.244 1.00 27.44  ? 115 ILE A C   1 
ATOM   891  O  O   . ILE A 1 115 ? -8.542  -3.694  -10.069 1.00 36.98  ? 115 ILE A O   1 
ATOM   892  C  CB  . ILE A 1 115 ? -10.760 -1.967  -10.916 1.00 26.46  ? 115 ILE A CB  1 
ATOM   893  C  CG1 . ILE A 1 115 ? -12.236 -1.894  -11.273 1.00 31.89  ? 115 ILE A CG1 1 
ATOM   894  C  CG2 . ILE A 1 115 ? -10.171 -0.597  -11.102 1.00 30.13  ? 115 ILE A CG2 1 
ATOM   895  C  CD1 . ILE A 1 115 ? -12.945 -0.662  -10.723 1.00 29.44  ? 115 ILE A CD1 1 
ATOM   896  N  N   . TYR A 1 116 ? -7.612  -3.195  -12.058 1.00 25.97  ? 116 TYR A N   1 
ATOM   897  C  CA  . TYR A 1 116 ? -6.284  -3.572  -11.567 1.00 36.87  ? 116 TYR A CA  1 
ATOM   898  C  C   . TYR A 1 116 ? -5.749  -2.591  -10.514 1.00 31.75  ? 116 TYR A C   1 
ATOM   899  O  O   . TYR A 1 116 ? -6.072  -1.396  -10.505 1.00 29.43  ? 116 TYR A O   1 
ATOM   900  C  CB  . TYR A 1 116 ? -5.262  -3.677  -12.703 1.00 26.04  ? 116 TYR A CB  1 
ATOM   901  C  CG  . TYR A 1 116 ? -5.103  -2.426  -13.551 1.00 33.01  ? 116 TYR A CG  1 
ATOM   902  C  CD1 . TYR A 1 116 ? -4.583  -1.249  -13.023 1.00 27.19  ? 116 TYR A CD1 1 
ATOM   903  C  CD2 . TYR A 1 116 ? -5.435  -2.444  -14.903 1.00 27.32  ? 116 TYR A CD2 1 
ATOM   904  C  CE1 . TYR A 1 116 ? -4.443  -0.121  -13.801 1.00 28.08  ? 116 TYR A CE1 1 
ATOM   905  C  CE2 . TYR A 1 116 ? -5.289  -1.329  -15.691 1.00 32.19  ? 116 TYR A CE2 1 
ATOM   906  C  CZ  . TYR A 1 116 ? -4.797  -0.165  -15.143 1.00 32.95  ? 116 TYR A CZ  1 
ATOM   907  O  OH  . TYR A 1 116 ? -4.671  0.946   -15.955 1.00 34.93  ? 116 TYR A OH  1 
ATOM   908  N  N   . GLY A 1 117 ? -4.893  -3.105  -9.636  1.00 25.53  ? 117 GLY A N   1 
ATOM   909  C  CA  . GLY A 1 117 ? -4.133  -2.280  -8.725  1.00 42.19  ? 117 GLY A CA  1 
ATOM   910  C  C   . GLY A 1 117 ? -2.714  -2.025  -9.205  1.00 46.06  ? 117 GLY A C   1 
ATOM   911  O  O   . GLY A 1 117 ? -2.402  -2.097  -10.399 1.00 40.85  ? 117 GLY A O   1 
ATOM   912  N  N   . GLY A 1 118 ? -1.833  -1.742  -8.247  1.00 43.02  ? 118 GLY A N   1 
ATOM   913  C  CA  . GLY A 1 118 ? -0.494  -1.297  -8.558  1.00 39.49  ? 118 GLY A CA  1 
ATOM   914  C  C   . GLY A 1 118 ? -0.244  0.121   -8.076  1.00 39.64  ? 118 GLY A C   1 
ATOM   915  O  O   . GLY A 1 118 ? 0.599   0.839   -8.630  1.00 37.94  ? 118 GLY A O   1 
ATOM   916  N  N   . GLY A 1 119 ? -1.014  0.550   -7.077  1.00 37.64  ? 119 GLY A N   1 
ATOM   917  C  CA  . GLY A 1 119 ? -0.692  1.745   -6.322  1.00 36.59  ? 119 GLY A CA  1 
ATOM   918  C  C   . GLY A 1 119 ? -0.987  3.070   -6.979  1.00 47.15  ? 119 GLY A C   1 
ATOM   919  O  O   . GLY A 1 119 ? -0.440  4.090   -6.544  1.00 56.51  ? 119 GLY A O   1 
ATOM   920  N  N   . PHE A 1 120 ? -1.842  3.100   -7.998  1.00 46.46  ? 120 PHE A N   1 
ATOM   921  C  CA  . PHE A 1 120 ? -2.127  4.302   -8.781  1.00 50.18  ? 120 PHE A CA  1 
ATOM   922  C  C   . PHE A 1 120 ? -0.886  4.893   -9.441  1.00 50.15  ? 120 PHE A C   1 
ATOM   923  O  O   . PHE A 1 120 ? -0.927  6.042   -9.906  1.00 46.54  ? 120 PHE A O   1 
ATOM   924  C  CB  . PHE A 1 120 ? -2.813  5.381   -7.937  1.00 51.77  ? 120 PHE A CB  1 
ATOM   925  C  CG  . PHE A 1 120 ? -4.064  4.917   -7.255  1.00 56.90  ? 120 PHE A CG  1 
ATOM   926  C  CD1 . PHE A 1 120 ? -5.229  4.714   -7.980  1.00 60.61  ? 120 PHE A CD1 1 
ATOM   927  C  CD2 . PHE A 1 120 ? -4.091  4.708   -5.890  1.00 52.26  ? 120 PHE A CD2 1 
ATOM   928  C  CE1 . PHE A 1 120 ? -6.390  4.305   -7.352  1.00 55.78  ? 120 PHE A CE1 1 
ATOM   929  C  CE2 . PHE A 1 120 ? -5.247  4.300   -5.266  1.00 50.61  ? 120 PHE A CE2 1 
ATOM   930  C  CZ  . PHE A 1 120 ? -6.398  4.096   -5.996  1.00 47.57  ? 120 PHE A CZ  1 
ATOM   931  N  N   . TYR A 1 121 ? 0.224   4.153   -9.467  1.00 40.60  ? 121 TYR A N   1 
ATOM   932  C  CA  . TYR A 1 121 ? 1.374   4.517   -10.271 1.00 38.44  ? 121 TYR A CA  1 
ATOM   933  C  C   . TYR A 1 121 ? 1.635   3.511   -11.376 1.00 43.56  ? 121 TYR A C   1 
ATOM   934  O  O   . TYR A 1 121 ? 2.477   3.778   -12.242 1.00 49.66  ? 121 TYR A O   1 
ATOM   935  C  CB  . TYR A 1 121 ? 2.634   4.657   -9.389  1.00 53.93  ? 121 TYR A CB  1 
ATOM   936  C  CG  . TYR A 1 121 ? 3.259   3.342   -8.919  1.00 46.11  ? 121 TYR A CG  1 
ATOM   937  C  CD1 . TYR A 1 121 ? 4.211   2.687   -9.686  1.00 39.41  ? 121 TYR A CD1 1 
ATOM   938  C  CD2 . TYR A 1 121 ? 2.904   2.775   -7.709  1.00 39.70  ? 121 TYR A CD2 1 
ATOM   939  C  CE1 . TYR A 1 121 ? 4.775   1.501   -9.271  1.00 42.76  ? 121 TYR A CE1 1 
ATOM   940  C  CE2 . TYR A 1 121 ? 3.472   1.587   -7.283  1.00 46.64  ? 121 TYR A CE2 1 
ATOM   941  C  CZ  . TYR A 1 121 ? 4.408   0.952   -8.068  1.00 48.66  ? 121 TYR A CZ  1 
ATOM   942  O  OH  . TYR A 1 121 ? 4.975   -0.239  -7.647  1.00 52.49  ? 121 TYR A OH  1 
ATOM   943  N  N   . SER A 1 122 ? 0.949   2.364   -11.364 1.00 42.61  ? 122 SER A N   1 
ATOM   944  C  CA  . SER A 1 122 ? 1.257   1.269   -12.282 1.00 51.29  ? 122 SER A CA  1 
ATOM   945  C  C   . SER A 1 122 ? 0.027   0.385   -12.431 1.00 44.68  ? 122 SER A C   1 
ATOM   946  O  O   . SER A 1 122 ? -0.988  0.580   -11.759 1.00 43.22  ? 122 SER A O   1 
ATOM   947  C  CB  . SER A 1 122 ? 2.460   0.454   -11.794 1.00 51.05  ? 122 SER A CB  1 
ATOM   948  O  OG  . SER A 1 122 ? 2.154   -0.217  -10.579 1.00 52.75  ? 122 SER A OG  1 
ATOM   949  N  N   . GLY A 1 123 ? 0.132   -0.607  -13.314 1.00 44.75  ? 123 GLY A N   1 
ATOM   950  C  CA  . GLY A 1 123 ? -0.985  -1.501  -13.546 1.00 51.61  ? 123 GLY A CA  1 
ATOM   951  C  C   . GLY A 1 123 ? -1.425  -1.637  -14.993 1.00 54.71  ? 123 GLY A C   1 
ATOM   952  O  O   . GLY A 1 123 ? -1.480  -0.661  -15.751 1.00 40.87  ? 123 GLY A O   1 
ATOM   953  N  N   . SER A 1 124 ? -1.761  -2.862  -15.379 1.00 59.94  ? 124 SER A N   1 
ATOM   954  C  CA  . SER A 1 124 ? -2.187  -3.157  -16.732 1.00 59.91  ? 124 SER A CA  1 
ATOM   955  C  C   . SER A 1 124 ? -3.342  -4.146  -16.689 1.00 65.75  ? 124 SER A C   1 
ATOM   956  O  O   . SER A 1 124 ? -3.406  -5.006  -15.805 1.00 66.63  ? 124 SER A O   1 
ATOM   957  C  CB  . SER A 1 124 ? -1.031  -3.715  -17.547 1.00 59.24  ? 124 SER A CB  1 
ATOM   958  O  OG  . SER A 1 124 ? 0.197   -3.337  -16.951 1.00 70.54  ? 124 SER A OG  1 
ATOM   959  N  N   . SER A 1 125 ? -4.277  -3.988  -17.639 1.00 53.43  ? 125 SER A N   1 
ATOM   960  C  CA  . SER A 1 125 ? -5.355  -4.949  -17.835 1.00 37.30  ? 125 SER A CA  1 
ATOM   961  C  C   . SER A 1 125 ? -4.873  -6.235  -18.496 1.00 40.17  ? 125 SER A C   1 
ATOM   962  O  O   . SER A 1 125 ? -5.585  -7.248  -18.477 1.00 35.03  ? 125 SER A O   1 
ATOM   963  C  CB  . SER A 1 125 ? -6.445  -4.321  -18.692 1.00 37.38  ? 125 SER A CB  1 
ATOM   964  O  OG  . SER A 1 125 ? -6.026  -4.219  -20.056 1.00 32.82  ? 125 SER A OG  1 
ATOM   965  N  N   . THR A 1 126 ? -3.664  -6.227  -19.045 1.00 42.85  ? 126 THR A N   1 
ATOM   966  C  CA  . THR A 1 126 ? -3.229  -7.241  -19.987 1.00 42.08  ? 126 THR A CA  1 
ATOM   967  C  C   . THR A 1 126 ? -2.220  -8.209  -19.393 1.00 40.80  ? 126 THR A C   1 
ATOM   968  O  O   . THR A 1 126 ? -1.509  -8.889  -20.141 1.00 40.80  ? 126 THR A O   1 
ATOM   969  C  CB  . THR A 1 126 ? -2.660  -6.548  -21.218 1.00 46.11  ? 126 THR A CB  1 
ATOM   970  O  OG1 . THR A 1 126 ? -1.515  -5.776  -20.842 1.00 37.41  ? 126 THR A OG1 1 
ATOM   971  C  CG2 . THR A 1 126 ? -3.713  -5.608  -21.787 1.00 57.42  ? 126 THR A CG2 1 
ATOM   972  N  N   . LEU A 1 127 ? -2.149  -8.290  -18.069 1.00 36.71  ? 127 LEU A N   1 
ATOM   973  C  CA  . LEU A 1 127 ? -1.269  -9.253  -17.439 1.00 27.95  ? 127 LEU A CA  1 
ATOM   974  C  C   . LEU A 1 127 ? -1.796  -10.660 -17.663 1.00 43.73  ? 127 LEU A C   1 
ATOM   975  O  O   . LEU A 1 127 ? -2.946  -10.863 -18.065 1.00 68.57  ? 127 LEU A O   1 
ATOM   976  C  CB  . LEU A 1 127 ? -1.156  -8.967  -15.949 1.00 28.44  ? 127 LEU A CB  1 
ATOM   977  C  CG  . LEU A 1 127 ? -0.662  -7.552  -15.600 1.00 28.77  ? 127 LEU A CG  1 
ATOM   978  C  CD1 . LEU A 1 127 ? -0.313  -7.468  -14.116 1.00 33.78  ? 127 LEU A CD1 1 
ATOM   979  C  CD2 . LEU A 1 127 ? 0.528   -7.149  -16.450 1.00 27.96  ? 127 LEU A CD2 1 
ATOM   980  N  N   . ASP A 1 128 ? -0.937  -11.642 -17.401 1.00 44.01  ? 128 ASP A N   1 
ATOM   981  C  CA  . ASP A 1 128 ? -1.362  -13.030 -17.536 1.00 40.71  ? 128 ASP A CA  1 
ATOM   982  C  C   . ASP A 1 128 ? -2.316  -13.418 -16.420 1.00 44.77  ? 128 ASP A C   1 
ATOM   983  O  O   . ASP A 1 128 ? -3.267  -14.174 -16.649 1.00 52.34  ? 128 ASP A O   1 
ATOM   984  C  CB  . ASP A 1 128 ? -0.153  -13.960 -17.552 1.00 47.49  ? 128 ASP A CB  1 
ATOM   985  C  CG  . ASP A 1 128 ? 0.860   -13.590 -18.620 1.00 58.74  ? 128 ASP A CG  1 
ATOM   986  O  OD1 . ASP A 1 128 ? 1.652   -12.645 -18.399 1.00 70.23  ? 128 ASP A OD1 1 
ATOM   987  O  OD2 . ASP A 1 128 ? 0.879   -14.260 -19.672 1.00 56.20  1 128 ASP A OD2 1 
ATOM   988  N  N   . VAL A 1 129 ? -2.087  -12.903 -15.207 1.00 45.59  ? 129 VAL A N   1 
ATOM   989  C  CA  . VAL A 1 129 ? -2.944  -13.245 -14.074 1.00 43.09  ? 129 VAL A CA  1 
ATOM   990  C  C   . VAL A 1 129 ? -4.317  -12.598 -14.160 1.00 40.53  ? 129 VAL A C   1 
ATOM   991  O  O   . VAL A 1 129 ? -5.232  -13.037 -13.458 1.00 57.51  ? 129 VAL A O   1 
ATOM   992  C  CB  . VAL A 1 129 ? -2.297  -12.844 -12.736 1.00 36.46  ? 129 VAL A CB  1 
ATOM   993  C  CG1 . VAL A 1 129 ? -1.243  -13.847 -12.340 1.00 25.96  ? 129 VAL A CG1 1 
ATOM   994  C  CG2 . VAL A 1 129 ? -1.726  -11.442 -12.832 1.00 25.62  ? 129 VAL A CG2 1 
ATOM   995  N  N   . TYR A 1 130 ? -4.493  -11.546 -14.966 1.00 33.33  ? 130 TYR A N   1 
ATOM   996  C  CA  . TYR A 1 130 ? -5.806  -10.928 -15.145 1.00 39.41  ? 130 TYR A CA  1 
ATOM   997  C  C   . TYR A 1 130 ? -6.535  -11.442 -16.387 1.00 44.01  ? 130 TYR A C   1 
ATOM   998  O  O   . TYR A 1 130 ? -7.384  -10.732 -16.927 1.00 52.14  ? 130 TYR A O   1 
ATOM   999  C  CB  . TYR A 1 130 ? -5.695  -9.401  -15.235 1.00 38.15  ? 130 TYR A CB  1 
ATOM   1000 C  CG  . TYR A 1 130 ? -4.964  -8.686  -14.106 1.00 41.55  ? 130 TYR A CG  1 
ATOM   1001 C  CD1 . TYR A 1 130 ? -4.852  -9.247  -12.839 1.00 47.41  ? 130 TYR A CD1 1 
ATOM   1002 C  CD2 . TYR A 1 130 ? -4.398  -7.425  -14.316 1.00 37.40  ? 130 TYR A CD2 1 
ATOM   1003 C  CE1 . TYR A 1 130 ? -4.185  -8.575  -11.814 1.00 46.68  ? 130 TYR A CE1 1 
ATOM   1004 C  CE2 . TYR A 1 130 ? -3.733  -6.747  -13.307 1.00 34.22  ? 130 TYR A CE2 1 
ATOM   1005 C  CZ  . TYR A 1 130 ? -3.629  -7.324  -12.056 1.00 42.74  ? 130 TYR A CZ  1 
ATOM   1006 O  OH  . TYR A 1 130 ? -2.981  -6.650  -11.039 1.00 40.51  ? 130 TYR A OH  1 
ATOM   1007 N  N   . ASN A 1 131 ? -6.204  -12.637 -16.869 1.00 42.34  ? 131 ASN A N   1 
ATOM   1008 C  CA  . ASN A 1 131 ? -6.780  -13.157 -18.105 1.00 45.26  ? 131 ASN A CA  1 
ATOM   1009 C  C   . ASN A 1 131 ? -8.115  -13.809 -17.780 1.00 43.48  ? 131 ASN A C   1 
ATOM   1010 O  O   . ASN A 1 131 ? -8.156  -14.896 -17.201 1.00 54.57  ? 131 ASN A O   1 
ATOM   1011 C  CB  . ASN A 1 131 ? -5.820  -14.141 -18.769 1.00 51.86  ? 131 ASN A CB  1 
ATOM   1012 C  CG  . ASN A 1 131 ? -6.410  -14.815 -20.010 1.00 60.83  ? 131 ASN A CG  1 
ATOM   1013 O  OD1 . ASN A 1 131 ? -7.538  -14.539 -20.428 1.00 74.73  ? 131 ASN A OD1 1 
ATOM   1014 N  ND2 . ASN A 1 131 ? -5.638  -15.715 -20.597 1.00 57.48  ? 131 ASN A ND2 1 
ATOM   1015 N  N   . GLY A 1 132 ? -9.202  -13.157 -18.176 1.00 40.30  ? 132 GLY A N   1 
ATOM   1016 C  CA  . GLY A 1 132 ? -10.537 -13.583 -17.833 1.00 43.28  ? 132 GLY A CA  1 
ATOM   1017 C  C   . GLY A 1 132 ? -11.055 -14.816 -18.533 1.00 49.71  ? 132 GLY A C   1 
ATOM   1018 O  O   . GLY A 1 132 ? -12.176 -15.236 -18.232 1.00 51.18  ? 132 GLY A O   1 
ATOM   1019 N  N   . LYS A 1 133 ? -10.283 -15.429 -19.439 1.00 45.95  ? 133 LYS A N   1 
ATOM   1020 C  CA  . LYS A 1 133 ? -10.823 -16.548 -20.213 1.00 51.44  ? 133 LYS A CA  1 
ATOM   1021 C  C   . LYS A 1 133 ? -11.246 -17.711 -19.320 1.00 54.32  ? 133 LYS A C   1 
ATOM   1022 O  O   . LYS A 1 133 ? -12.140 -18.478 -19.691 1.00 50.55  ? 133 LYS A O   1 
ATOM   1023 C  CB  . LYS A 1 133 ? -9.804  -17.011 -21.257 1.00 50.09  ? 133 LYS A CB  1 
ATOM   1024 C  CG  . LYS A 1 133 ? -8.965  -18.206 -20.846 1.00 42.01  ? 133 LYS A CG  1 
ATOM   1025 C  CD  . LYS A 1 133 ? -7.567  -18.085 -21.423 1.00 46.20  ? 133 LYS A CD  1 
ATOM   1026 C  CE  . LYS A 1 133 ? -7.109  -19.307 -22.218 1.00 43.67  ? 133 LYS A CE  1 
ATOM   1027 N  NZ  . LYS A 1 133 ? -5.984  -18.929 -23.126 1.00 37.82  1 133 LYS A NZ  1 
ATOM   1028 N  N   . TYR A 1 134 ? -10.639 -17.845 -18.137 1.00 51.74  ? 134 TYR A N   1 
ATOM   1029 C  CA  . TYR A 1 134 ? -10.948 -18.953 -17.239 1.00 44.06  ? 134 TYR A CA  1 
ATOM   1030 C  C   . TYR A 1 134 ? -12.140 -18.654 -16.356 1.00 41.91  ? 134 TYR A C   1 
ATOM   1031 O  O   . TYR A 1 134 ? -12.956 -19.544 -16.082 1.00 47.42  ? 134 TYR A O   1 
ATOM   1032 C  CB  . TYR A 1 134 ? -9.742  -19.278 -16.359 1.00 42.11  ? 134 TYR A CB  1 
ATOM   1033 C  CG  . TYR A 1 134 ? -8.485  -19.521 -17.149 1.00 42.33  ? 134 TYR A CG  1 
ATOM   1034 C  CD1 . TYR A 1 134 ? -7.428  -18.617 -17.097 1.00 40.57  ? 134 TYR A CD1 1 
ATOM   1035 C  CD2 . TYR A 1 134 ? -8.355  -20.653 -17.955 1.00 43.33  ? 134 TYR A CD2 1 
ATOM   1036 C  CE1 . TYR A 1 134 ? -6.278  -18.829 -17.830 1.00 45.23  ? 134 TYR A CE1 1 
ATOM   1037 C  CE2 . TYR A 1 134 ? -7.215  -20.873 -18.689 1.00 46.42  ? 134 TYR A CE2 1 
ATOM   1038 C  CZ  . TYR A 1 134 ? -6.173  -19.959 -18.624 1.00 48.82  ? 134 TYR A CZ  1 
ATOM   1039 O  OH  . TYR A 1 134 ? -5.028  -20.176 -19.361 1.00 52.13  ? 134 TYR A OH  1 
ATOM   1040 N  N   . LEU A 1 135 ? -12.250 -17.417 -15.891 1.00 37.75  ? 135 LEU A N   1 
ATOM   1041 C  CA  . LEU A 1 135 ? -13.337 -17.097 -14.979 1.00 40.50  ? 135 LEU A CA  1 
ATOM   1042 C  C   . LEU A 1 135 ? -14.644 -16.973 -15.737 1.00 48.02  ? 135 LEU A C   1 
ATOM   1043 O  O   . LEU A 1 135 ? -15.673 -17.500 -15.297 1.00 50.35  ? 135 LEU A O   1 
ATOM   1044 C  CB  . LEU A 1 135 ? -13.011 -15.820 -14.207 1.00 42.40  ? 135 LEU A CB  1 
ATOM   1045 C  CG  . LEU A 1 135 ? -14.059 -15.223 -13.277 1.00 48.33  ? 135 LEU A CG  1 
ATOM   1046 C  CD1 . LEU A 1 135 ? -14.594 -16.265 -12.293 1.00 40.17  ? 135 LEU A CD1 1 
ATOM   1047 C  CD2 . LEU A 1 135 ? -13.420 -14.064 -12.540 1.00 49.81  ? 135 LEU A CD2 1 
ATOM   1048 N  N   . ALA A 1 136 ? -14.607 -16.313 -16.897 1.00 52.30  ? 136 ALA A N   1 
ATOM   1049 C  CA  . ALA A 1 136 ? -15.775 -16.268 -17.765 1.00 35.57  ? 136 ALA A CA  1 
ATOM   1050 C  C   . ALA A 1 136 ? -16.238 -17.673 -18.108 1.00 35.17  ? 136 ALA A C   1 
ATOM   1051 O  O   . ALA A 1 136 ? -17.402 -18.025 -17.887 1.00 33.71  ? 136 ALA A O   1 
ATOM   1052 C  CB  . ALA A 1 136 ? -15.458 -15.478 -19.028 1.00 31.96  ? 136 ALA A CB  1 
ATOM   1053 N  N   . TYR A 1 137 ? -15.329 -18.507 -18.607 1.00 33.49  ? 137 TYR A N   1 
ATOM   1054 C  CA  . TYR A 1 137 ? -15.723 -19.843 -19.039 1.00 40.56  ? 137 TYR A CA  1 
ATOM   1055 C  C   . TYR A 1 137 ? -16.239 -20.679 -17.870 1.00 49.89  ? 137 TYR A C   1 
ATOM   1056 O  O   . TYR A 1 137 ? -17.376 -21.160 -17.886 1.00 49.01  ? 137 TYR A O   1 
ATOM   1057 C  CB  . TYR A 1 137 ? -14.553 -20.541 -19.727 1.00 39.82  ? 137 TYR A CB  1 
ATOM   1058 C  CG  . TYR A 1 137 ? -14.817 -21.998 -20.015 1.00 48.46  ? 137 TYR A CG  1 
ATOM   1059 C  CD1 . TYR A 1 137 ? -14.215 -23.000 -19.258 1.00 52.80  ? 137 TYR A CD1 1 
ATOM   1060 C  CD2 . TYR A 1 137 ? -15.680 -22.374 -21.035 1.00 51.71  ? 137 TYR A CD2 1 
ATOM   1061 C  CE1 . TYR A 1 137 ? -14.460 -24.343 -19.519 1.00 58.66  ? 137 TYR A CE1 1 
ATOM   1062 C  CE2 . TYR A 1 137 ? -15.935 -23.708 -21.304 1.00 59.14  ? 137 TYR A CE2 1 
ATOM   1063 C  CZ  . TYR A 1 137 ? -15.325 -24.692 -20.545 1.00 60.73  ? 137 TYR A CZ  1 
ATOM   1064 O  OH  . TYR A 1 137 ? -15.581 -26.020 -20.825 1.00 52.24  ? 137 TYR A OH  1 
ATOM   1065 N  N   . THR A 1 138 ? -15.415 -20.860 -16.839 1.00 57.65  ? 138 THR A N   1 
ATOM   1066 C  CA  . THR A 1 138 ? -15.765 -21.808 -15.783 1.00 56.00  ? 138 THR A CA  1 
ATOM   1067 C  C   . THR A 1 138 ? -17.018 -21.392 -15.016 1.00 48.29  ? 138 THR A C   1 
ATOM   1068 O  O   . THR A 1 138 ? -17.779 -22.256 -14.571 1.00 35.77  ? 138 THR A O   1 
ATOM   1069 C  CB  . THR A 1 138 ? -14.582 -21.990 -14.828 1.00 59.23  ? 138 THR A CB  1 
ATOM   1070 O  OG1 . THR A 1 138 ? -13.570 -22.756 -15.485 1.00 73.73  ? 138 THR A OG1 1 
ATOM   1071 C  CG2 . THR A 1 138 ? -14.998 -22.735 -13.571 1.00 48.63  ? 138 THR A CG2 1 
ATOM   1072 N  N   . GLU A 1 139 ? -17.267 -20.094 -14.865 1.00 33.70  ? 139 GLU A N   1 
ATOM   1073 C  CA  . GLU A 1 139 ? -18.422 -19.634 -14.111 1.00 46.55  ? 139 GLU A CA  1 
ATOM   1074 C  C   . GLU A 1 139 ? -19.517 -19.049 -14.988 1.00 45.62  ? 139 GLU A C   1 
ATOM   1075 O  O   . GLU A 1 139 ? -20.529 -18.584 -14.455 1.00 39.19  ? 139 GLU A O   1 
ATOM   1076 C  CB  . GLU A 1 139 ? -17.993 -18.610 -13.056 1.00 52.87  ? 139 GLU A CB  1 
ATOM   1077 C  CG  . GLU A 1 139 ? -17.081 -19.210 -11.974 1.00 57.13  ? 139 GLU A CG  1 
ATOM   1078 C  CD  . GLU A 1 139 ? -17.778 -20.281 -11.131 1.00 56.69  ? 139 GLU A CD  1 
ATOM   1079 O  OE1 . GLU A 1 139 ? -19.000 -20.153 -10.897 1.00 49.03  ? 139 GLU A OE1 1 
ATOM   1080 O  OE2 . GLU A 1 139 ? -17.107 -21.248 -10.697 1.00 58.99  1 139 GLU A OE2 1 
ATOM   1081 N  N   . GLU A 1 140 ? -19.347 -19.071 -16.312 1.00 44.00  ? 140 GLU A N   1 
ATOM   1082 C  CA  . GLU A 1 140 ? -20.368 -18.607 -17.247 1.00 41.70  ? 140 GLU A CA  1 
ATOM   1083 C  C   . GLU A 1 140 ? -20.824 -17.186 -16.924 1.00 39.91  ? 140 GLU A C   1 
ATOM   1084 O  O   . GLU A 1 140 ? -22.015 -16.871 -16.926 1.00 40.77  ? 140 GLU A O   1 
ATOM   1085 C  CB  . GLU A 1 140 ? -21.546 -19.570 -17.277 1.00 49.45  ? 140 GLU A CB  1 
ATOM   1086 C  CG  . GLU A 1 140 ? -21.619 -20.384 -18.545 1.00 68.65  ? 140 GLU A CG  1 
ATOM   1087 C  CD  . GLU A 1 140 ? -22.818 -21.304 -18.548 1.00 87.04  ? 140 GLU A CD  1 
ATOM   1088 O  OE1 . GLU A 1 140 ? -23.201 -21.764 -17.448 1.00 85.48  ? 140 GLU A OE1 1 
ATOM   1089 O  OE2 . GLU A 1 140 ? -23.386 -21.552 -19.639 1.00 94.42  1 140 GLU A OE2 1 
ATOM   1090 N  N   . VAL A 1 141 ? -19.864 -16.315 -16.651 1.00 33.34  ? 141 VAL A N   1 
ATOM   1091 C  CA  . VAL A 1 141 ? -20.129 -14.896 -16.473 1.00 45.30  ? 141 VAL A CA  1 
ATOM   1092 C  C   . VAL A 1 141 ? -19.436 -14.152 -17.604 1.00 41.01  ? 141 VAL A C   1 
ATOM   1093 O  O   . VAL A 1 141 ? -18.492 -14.651 -18.219 1.00 40.36  ? 141 VAL A O   1 
ATOM   1094 C  CB  . VAL A 1 141 ? -19.639 -14.368 -15.104 1.00 46.33  ? 141 VAL A CB  1 
ATOM   1095 C  CG1 . VAL A 1 141 ? -20.245 -15.173 -13.959 1.00 47.94  ? 141 VAL A CG1 1 
ATOM   1096 C  CG2 . VAL A 1 141 ? -18.106 -14.391 -15.040 1.00 52.27  ? 141 VAL A CG2 1 
ATOM   1097 N  N   . VAL A 1 142 ? -19.908 -12.937 -17.863 1.00 32.29  ? 142 VAL A N   1 
ATOM   1098 C  CA  . VAL A 1 142 ? -19.260 -12.019 -18.793 1.00 32.11  ? 142 VAL A CA  1 
ATOM   1099 C  C   . VAL A 1 142 ? -18.236 -11.214 -18.006 1.00 39.65  ? 142 VAL A C   1 
ATOM   1100 O  O   . VAL A 1 142 ? -18.595 -10.531 -17.044 1.00 39.67  ? 142 VAL A O   1 
ATOM   1101 C  CB  . VAL A 1 142 ? -20.290 -11.100 -19.468 1.00 37.63  ? 142 VAL A CB  1 
ATOM   1102 C  CG1 . VAL A 1 142 ? -19.651 -9.801  -19.918 1.00 37.49  ? 142 VAL A CG1 1 
ATOM   1103 C  CG2 . VAL A 1 142 ? -20.924 -11.808 -20.654 1.00 37.48  ? 142 VAL A CG2 1 
ATOM   1104 N  N   . LEU A 1 143 ? -16.959 -11.289 -18.396 1.00 43.51  ? 143 LEU A N   1 
ATOM   1105 C  CA  . LEU A 1 143 ? -15.892 -10.648 -17.627 1.00 35.23  ? 143 LEU A CA  1 
ATOM   1106 C  C   . LEU A 1 143 ? -15.289 -9.475  -18.394 1.00 32.64  ? 143 LEU A C   1 
ATOM   1107 O  O   . LEU A 1 143 ? -14.817 -9.640  -19.521 1.00 32.70  ? 143 LEU A O   1 
ATOM   1108 C  CB  . LEU A 1 143 ? -14.799 -11.641 -17.252 1.00 31.92  ? 143 LEU A CB  1 
ATOM   1109 C  CG  . LEU A 1 143 ? -14.049 -10.921 -16.123 1.00 37.28  ? 143 LEU A CG  1 
ATOM   1110 C  CD1 . LEU A 1 143 ? -14.724 -11.212 -14.784 1.00 46.92  ? 143 LEU A CD1 1 
ATOM   1111 C  CD2 . LEU A 1 143 ? -12.605 -11.255 -16.074 1.00 33.85  ? 143 LEU A CD2 1 
ATOM   1112 N  N   . VAL A 1 144 ? -15.305 -8.296  -17.771 1.00 32.48  ? 144 VAL A N   1 
ATOM   1113 C  CA  . VAL A 1 144 ? -14.677 -7.081  -18.283 1.00 36.48  ? 144 VAL A CA  1 
ATOM   1114 C  C   . VAL A 1 144 ? -13.466 -6.779  -17.412 1.00 43.79  ? 144 VAL A C   1 
ATOM   1115 O  O   . VAL A 1 144 ? -13.523 -6.909  -16.185 1.00 60.58  ? 144 VAL A O   1 
ATOM   1116 C  CB  . VAL A 1 144 ? -15.637 -5.867  -18.272 1.00 38.67  ? 144 VAL A CB  1 
ATOM   1117 C  CG1 . VAL A 1 144 ? -14.912 -4.573  -18.693 1.00 29.63  ? 144 VAL A CG1 1 
ATOM   1118 C  CG2 . VAL A 1 144 ? -16.906 -6.121  -19.111 1.00 32.83  ? 144 VAL A CG2 1 
ATOM   1119 N  N   . SER A 1 145 ? -12.368 -6.383  -18.038 1.00 42.80  ? 145 SER A N   1 
ATOM   1120 C  CA  . SER A 1 145 ? -11.277 -5.725  -17.340 1.00 41.72  ? 145 SER A CA  1 
ATOM   1121 C  C   . SER A 1 145 ? -11.057 -4.377  -18.005 1.00 36.93  ? 145 SER A C   1 
ATOM   1122 O  O   . SER A 1 145 ? -10.917 -4.307  -19.228 1.00 29.21  ? 145 SER A O   1 
ATOM   1123 C  CB  . SER A 1 145 ? -9.992  -6.561  -17.368 1.00 44.52  ? 145 SER A CB  1 
ATOM   1124 O  OG  . SER A 1 145 ? -9.550  -6.799  -18.684 1.00 34.08  ? 145 SER A OG  1 
ATOM   1125 N  N   . LEU A 1 146 ? -11.052 -3.314  -17.209 1.00 33.43  ? 146 LEU A N   1 
ATOM   1126 C  CA  . LEU A 1 146 ? -10.895 -1.969  -17.728 1.00 28.98  ? 146 LEU A CA  1 
ATOM   1127 C  C   . LEU A 1 146 ? -9.441  -1.505  -17.631 1.00 36.71  ? 146 LEU A C   1 
ATOM   1128 O  O   . LEU A 1 146 ? -8.511  -2.285  -17.385 1.00 37.04  ? 146 LEU A O   1 
ATOM   1129 C  CB  . LEU A 1 146 ? -11.833 -1.016  -16.990 1.00 31.44  ? 146 LEU A CB  1 
ATOM   1130 C  CG  . LEU A 1 146 ? -11.895 -1.040  -15.464 1.00 34.06  ? 146 LEU A CG  1 
ATOM   1131 C  CD1 . LEU A 1 146 ? -10.703 -0.328  -14.889 1.00 42.83  ? 146 LEU A CD1 1 
ATOM   1132 C  CD2 . LEU A 1 146 ? -13.199 -0.394  -14.977 1.00 28.69  ? 146 LEU A CD2 1 
ATOM   1133 N  N   . SER A 1 147 ? -9.242  -0.212  -17.852 1.00 36.93  ? 147 SER A N   1 
ATOM   1134 C  CA  . SER A 1 147 ? -7.955  0.426   -17.651 1.00 42.25  ? 147 SER A CA  1 
ATOM   1135 C  C   . SER A 1 147 ? -8.229  1.881   -17.334 1.00 45.51  ? 147 SER A C   1 
ATOM   1136 O  O   . SER A 1 147 ? -9.309  2.404   -17.614 1.00 53.52  ? 147 SER A O   1 
ATOM   1137 C  CB  . SER A 1 147 ? -7.035  0.295   -18.871 1.00 43.35  ? 147 SER A CB  1 
ATOM   1138 O  OG  . SER A 1 147 ? -7.642  0.860   -20.015 1.00 46.30  ? 147 SER A OG  1 
ATOM   1139 N  N   . TYR A 1 148 ? -7.243  2.518   -16.724 1.00 37.72  ? 148 TYR A N   1 
ATOM   1140 C  CA  . TYR A 1 148 ? -7.365  3.900   -16.298 1.00 35.29  ? 148 TYR A CA  1 
ATOM   1141 C  C   . TYR A 1 148 ? -5.950  4.430   -16.196 1.00 32.02  ? 148 TYR A C   1 
ATOM   1142 O  O   . TYR A 1 148 ? -5.009  3.654   -16.022 1.00 39.48  ? 148 TYR A O   1 
ATOM   1143 C  CB  . TYR A 1 148 ? -8.112  4.016   -14.964 1.00 33.87  ? 148 TYR A CB  1 
ATOM   1144 C  CG  . TYR A 1 148 ? -7.457  3.226   -13.849 1.00 38.50  ? 148 TYR A CG  1 
ATOM   1145 C  CD1 . TYR A 1 148 ? -7.761  1.886   -13.658 1.00 28.97  ? 148 TYR A CD1 1 
ATOM   1146 C  CD2 . TYR A 1 148 ? -6.517  3.821   -13.002 1.00 30.20  ? 148 TYR A CD2 1 
ATOM   1147 C  CE1 . TYR A 1 148 ? -7.164  1.167   -12.658 1.00 32.40  ? 148 TYR A CE1 1 
ATOM   1148 C  CE2 . TYR A 1 148 ? -5.915  3.113   -12.004 1.00 36.40  ? 148 TYR A CE2 1 
ATOM   1149 C  CZ  . TYR A 1 148 ? -6.234  1.778   -11.832 1.00 39.56  ? 148 TYR A CZ  1 
ATOM   1150 O  OH  . TYR A 1 148 ? -5.635  1.049   -10.823 1.00 36.69  ? 148 TYR A OH  1 
ATOM   1151 N  N   . ARG A 1 149 ? -5.792  5.740   -16.340 1.00 43.61  ? 149 ARG A N   1 
ATOM   1152 C  CA  . ARG A 1 149 ? -4.437  6.275   -16.332 1.00 42.81  ? 149 ARG A CA  1 
ATOM   1153 C  C   . ARG A 1 149 ? -3.898  6.305   -14.916 1.00 50.16  ? 149 ARG A C   1 
ATOM   1154 O  O   . ARG A 1 149 ? -4.623  6.595   -13.960 1.00 55.56  ? 149 ARG A O   1 
ATOM   1155 C  CB  . ARG A 1 149 ? -4.366  7.680   -16.936 1.00 43.19  ? 149 ARG A CB  1 
ATOM   1156 C  CG  . ARG A 1 149 ? -5.367  7.948   -18.010 1.00 46.72  ? 149 ARG A CG  1 
ATOM   1157 C  CD  . ARG A 1 149 ? -5.356  9.395   -18.339 1.00 51.65  ? 149 ARG A CD  1 
ATOM   1158 N  NE  . ARG A 1 149 ? -6.732  9.877   -18.243 1.00 57.34  ? 149 ARG A NE  1 
ATOM   1159 C  CZ  . ARG A 1 149 ? -7.120  11.139  -18.363 1.00 55.04  ? 149 ARG A CZ  1 
ATOM   1160 N  NH1 . ARG A 1 149 ? -6.223  12.087  -18.609 1.00 51.06  1 149 ARG A NH1 1 
ATOM   1161 N  NH2 . ARG A 1 149 ? -8.410  11.421  -18.232 1.00 48.73  ? 149 ARG A NH2 1 
ATOM   1162 N  N   . VAL A 1 150 ? -2.606  6.016   -14.790 1.00 48.62  ? 150 VAL A N   1 
ATOM   1163 C  CA  . VAL A 1 150 ? -1.938  6.010   -13.502 1.00 41.10  ? 150 VAL A CA  1 
ATOM   1164 C  C   . VAL A 1 150 ? -0.858  7.080   -13.505 1.00 34.55  ? 150 VAL A C   1 
ATOM   1165 O  O   . VAL A 1 150 ? -0.548  7.681   -14.530 1.00 45.64  ? 150 VAL A O   1 
ATOM   1166 C  CB  . VAL A 1 150 ? -1.360  4.629   -13.166 1.00 45.93  ? 150 VAL A CB  1 
ATOM   1167 C  CG1 . VAL A 1 150 ? -2.509  3.653   -12.907 1.00 43.36  ? 150 VAL A CG1 1 
ATOM   1168 C  CG2 . VAL A 1 150 ? -0.453  4.139   -14.299 1.00 32.23  ? 150 VAL A CG2 1 
ATOM   1169 N  N   . GLY A 1 151 ? -0.296  7.314   -12.326 1.00 45.92  ? 151 GLY A N   1 
ATOM   1170 C  CA  . GLY A 1 151 ? 0.707   8.333   -12.130 1.00 52.12  ? 151 GLY A CA  1 
ATOM   1171 C  C   . GLY A 1 151 ? 0.131   9.718   -12.356 1.00 51.96  ? 151 GLY A C   1 
ATOM   1172 O  O   . GLY A 1 151 ? -1.083  9.920   -12.433 1.00 56.75  ? 151 GLY A O   1 
ATOM   1173 N  N   . ALA A 1 152 ? 1.048   10.683  -12.475 1.00 49.83  ? 152 ALA A N   1 
ATOM   1174 C  CA  . ALA A 1 152 ? 0.667   12.059  -12.777 1.00 53.35  ? 152 ALA A CA  1 
ATOM   1175 C  C   . ALA A 1 152 ? -0.275  12.140  -13.973 1.00 54.09  ? 152 ALA A C   1 
ATOM   1176 O  O   . ALA A 1 152 ? -1.134  13.032  -14.036 1.00 57.27  ? 152 ALA A O   1 
ATOM   1177 C  CB  . ALA A 1 152 ? 1.917   12.903  -13.032 1.00 53.05  ? 152 ALA A CB  1 
ATOM   1178 N  N   . PHE A 1 153 ? -0.141  11.215  -14.923 1.00 49.77  ? 153 PHE A N   1 
ATOM   1179 C  CA  . PHE A 1 153 ? -1.094  11.156  -16.022 1.00 61.80  ? 153 PHE A CA  1 
ATOM   1180 C  C   . PHE A 1 153 ? -2.513  10.911  -15.531 1.00 59.03  ? 153 PHE A C   1 
ATOM   1181 O  O   . PHE A 1 153 ? -3.466  11.335  -16.189 1.00 64.30  ? 153 PHE A O   1 
ATOM   1182 C  CB  . PHE A 1 153 ? -0.681  10.069  -17.010 1.00 59.60  ? 153 PHE A CB  1 
ATOM   1183 C  CG  . PHE A 1 153 ? 0.754   10.145  -17.392 1.00 60.86  ? 153 PHE A CG  1 
ATOM   1184 C  CD1 . PHE A 1 153 ? 1.173   11.036  -18.367 1.00 63.65  ? 153 PHE A CD1 1 
ATOM   1185 C  CD2 . PHE A 1 153 ? 1.698   9.347   -16.758 1.00 58.48  ? 153 PHE A CD2 1 
ATOM   1186 C  CE1 . PHE A 1 153 ? 2.510   11.121  -18.717 1.00 64.51  ? 153 PHE A CE1 1 
ATOM   1187 C  CE2 . PHE A 1 153 ? 3.029   9.425   -17.105 1.00 61.46  ? 153 PHE A CE2 1 
ATOM   1188 C  CZ  . PHE A 1 153 ? 3.438   10.313  -18.086 1.00 63.05  ? 153 PHE A CZ  1 
ATOM   1189 N  N   . GLY A 1 154 ? -2.670  10.265  -14.384 1.00 57.35  ? 154 GLY A N   1 
ATOM   1190 C  CA  . GLY A 1 154 ? -3.988  9.930   -13.895 1.00 59.39  ? 154 GLY A CA  1 
ATOM   1191 C  C   . GLY A 1 154 ? -4.398  10.628  -12.614 1.00 53.75  ? 154 GLY A C   1 
ATOM   1192 O  O   . GLY A 1 154 ? -5.591  10.675  -12.300 1.00 44.58  ? 154 GLY A O   1 
ATOM   1193 N  N   . PHE A 1 155 ? -3.442  11.169  -11.847 1.00 52.53  ? 155 PHE A N   1 
ATOM   1194 C  CA  . PHE A 1 155 ? -3.836  11.718  -10.554 1.00 51.62  ? 155 PHE A CA  1 
ATOM   1195 C  C   . PHE A 1 155 ? -3.110  13.006  -10.169 1.00 52.87  ? 155 PHE A C   1 
ATOM   1196 O  O   . PHE A 1 155 ? -3.064  13.353  -8.979  1.00 48.00  ? 155 PHE A O   1 
ATOM   1197 C  CB  . PHE A 1 155 ? -3.666  10.653  -9.497  1.00 36.84  ? 155 PHE A CB  1 
ATOM   1198 C  CG  . PHE A 1 155 ? -4.591  9.500   -9.694  1.00 43.41  ? 155 PHE A CG  1 
ATOM   1199 C  CD1 . PHE A 1 155 ? -4.199  8.392   -10.430 1.00 42.56  ? 155 PHE A CD1 1 
ATOM   1200 C  CD2 . PHE A 1 155 ? -5.883  9.544   -9.187  1.00 42.86  ? 155 PHE A CD2 1 
ATOM   1201 C  CE1 . PHE A 1 155 ? -5.076  7.331   -10.633 1.00 42.74  ? 155 PHE A CE1 1 
ATOM   1202 C  CE2 . PHE A 1 155 ? -6.762  8.482   -9.377  1.00 42.39  ? 155 PHE A CE2 1 
ATOM   1203 C  CZ  . PHE A 1 155 ? -6.356  7.378   -10.097 1.00 43.75  ? 155 PHE A CZ  1 
ATOM   1204 N  N   . LEU A 1 156 ? -2.572  13.738  -11.136 1.00 49.07  ? 156 LEU A N   1 
ATOM   1205 C  CA  . LEU A 1 156 ? -2.094  15.077  -10.839 1.00 54.66  ? 156 LEU A CA  1 
ATOM   1206 C  C   . LEU A 1 156 ? -3.287  15.954  -10.487 1.00 51.99  ? 156 LEU A C   1 
ATOM   1207 O  O   . LEU A 1 156 ? -4.303  15.946  -11.186 1.00 59.70  ? 156 LEU A O   1 
ATOM   1208 C  CB  . LEU A 1 156 ? -1.318  15.634  -12.030 1.00 55.97  ? 156 LEU A CB  1 
ATOM   1209 C  CG  . LEU A 1 156 ? -0.522  16.907  -11.739 1.00 56.20  ? 156 LEU A CG  1 
ATOM   1210 C  CD1 . LEU A 1 156 ? 0.770   16.917  -12.522 1.00 57.95  ? 156 LEU A CD1 1 
ATOM   1211 C  CD2 . LEU A 1 156 ? -1.341  18.151  -12.082 1.00 49.82  ? 156 LEU A CD2 1 
ATOM   1212 N  N   . ALA A 1 157 ? -3.190  16.680  -9.380  1.00 48.36  ? 157 ALA A N   1 
ATOM   1213 C  CA  . ALA A 1 157 ? -4.335  17.409  -8.844  1.00 58.71  ? 157 ALA A CA  1 
ATOM   1214 C  C   . ALA A 1 157 ? -3.939  18.844  -8.542  1.00 68.81  ? 157 ALA A C   1 
ATOM   1215 O  O   . ALA A 1 157 ? -3.045  19.092  -7.728  1.00 74.88  ? 157 ALA A O   1 
ATOM   1216 C  CB  . ALA A 1 157 ? -4.895  16.739  -7.583  1.00 53.89  ? 157 ALA A CB  1 
ATOM   1217 N  N   . LEU A 1 158 ? -4.612  19.780  -9.192  1.00 68.97  ? 158 LEU A N   1 
ATOM   1218 C  CA  . LEU A 1 158 ? -4.458  21.207  -8.939  1.00 69.86  ? 158 LEU A CA  1 
ATOM   1219 C  C   . LEU A 1 158 ? -5.864  21.756  -8.764  1.00 69.00  ? 158 LEU A C   1 
ATOM   1220 O  O   . LEU A 1 158 ? -6.397  22.391  -9.678  1.00 76.70  ? 158 LEU A O   1 
ATOM   1221 C  CB  . LEU A 1 158 ? -3.731  21.877  -10.074 1.00 71.13  ? 158 LEU A CB  1 
ATOM   1222 C  CG  . LEU A 1 158 ? -2.277  21.480  -10.272 1.00 64.24  ? 158 LEU A CG  1 
ATOM   1223 C  CD1 . LEU A 1 158 ? -1.915  21.791  -11.688 1.00 62.66  ? 158 LEU A CD1 1 
ATOM   1224 C  CD2 . LEU A 1 158 ? -1.388  22.259  -9.313  1.00 65.37  ? 158 LEU A CD2 1 
ATOM   1225 N  N   . HIS A 1 159 ? -6.464  21.479  -7.608  1.00 60.34  ? 159 HIS A N   1 
ATOM   1226 C  CA  . HIS A 1 159 ? -7.858  21.831  -7.387  1.00 63.69  ? 159 HIS A CA  1 
ATOM   1227 C  C   . HIS A 1 159 ? -8.067  23.322  -7.599  1.00 64.09  ? 159 HIS A C   1 
ATOM   1228 O  O   . HIS A 1 159 ? -7.261  24.146  -7.160  1.00 59.13  ? 159 HIS A O   1 
ATOM   1229 C  CB  . HIS A 1 159 ? -8.284  21.428  -5.984  1.00 71.06  ? 159 HIS A CB  1 
ATOM   1230 C  CG  . HIS A 1 159 ? -9.743  21.625  -5.694  1.00 76.29  ? 159 HIS A CG  1 
ATOM   1231 N  ND1 . HIS A 1 159 ? -10.718 20.764  -6.151  1.00 73.89  ? 159 HIS A ND1 1 
ATOM   1232 C  CD2 . HIS A 1 159 ? -10.386 22.575  -4.971  1.00 79.30  ? 159 HIS A CD2 1 
ATOM   1233 C  CE1 . HIS A 1 159 ? -11.901 21.185  -5.737  1.00 82.50  ? 159 HIS A CE1 1 
ATOM   1234 N  NE2 . HIS A 1 159 ? -11.728 22.281  -5.018  1.00 84.78  ? 159 HIS A NE2 1 
ATOM   1235 N  N   . GLY A 1 160 ? -9.168  23.656  -8.282  1.00 68.15  ? 160 GLY A N   1 
ATOM   1236 C  CA  . GLY A 1 160 ? -9.387  24.960  -8.857  1.00 67.51  ? 160 GLY A CA  1 
ATOM   1237 C  C   . GLY A 1 160 ? -9.158  25.008  -10.353 1.00 59.69  ? 160 GLY A C   1 
ATOM   1238 O  O   . GLY A 1 160 ? -9.607  25.950  -11.012 1.00 61.65  ? 160 GLY A O   1 
ATOM   1239 N  N   . SER A 1 161 ? -8.477  24.017  -10.899 1.00 59.21  ? 161 SER A N   1 
ATOM   1240 C  CA  . SER A 1 161 ? -8.228  23.932  -12.325 1.00 70.78  ? 161 SER A CA  1 
ATOM   1241 C  C   . SER A 1 161 ? -9.126  22.868  -12.934 1.00 74.28  ? 161 SER A C   1 
ATOM   1242 O  O   . SER A 1 161 ? -9.360  21.812  -12.332 1.00 71.63  ? 161 SER A O   1 
ATOM   1243 C  CB  . SER A 1 161 ? -6.761  23.598  -12.602 1.00 80.27  ? 161 SER A CB  1 
ATOM   1244 O  OG  . SER A 1 161 ? -6.617  22.920  -13.838 1.00 82.68  ? 161 SER A OG  1 
ATOM   1245 N  N   . GLN A 1 162 ? -9.632  23.155  -14.129 1.00 78.11  ? 162 GLN A N   1 
ATOM   1246 C  CA  . GLN A 1 162 ? -10.377 22.164  -14.887 1.00 80.29  ? 162 GLN A CA  1 
ATOM   1247 C  C   . GLN A 1 162 ? -9.534  21.497  -15.964 1.00 77.59  ? 162 GLN A C   1 
ATOM   1248 O  O   . GLN A 1 162 ? -9.993  20.524  -16.573 1.00 77.61  ? 162 GLN A O   1 
ATOM   1249 C  CB  . GLN A 1 162 ? -11.639 22.795  -15.507 1.00 84.56  ? 162 GLN A CB  1 
ATOM   1250 C  CG  . GLN A 1 162 ? -12.501 23.557  -14.497 1.00 81.51  ? 162 GLN A CG  1 
ATOM   1251 C  CD  . GLN A 1 162 ? -13.286 22.621  -13.585 1.00 79.58  ? 162 GLN A CD  1 
ATOM   1252 O  OE1 . GLN A 1 162 ? -13.880 21.642  -14.042 1.00 78.88  ? 162 GLN A OE1 1 
ATOM   1253 N  NE2 . GLN A 1 162 ? -13.258 22.901  -12.280 1.00 73.80  ? 162 GLN A NE2 1 
ATOM   1254 N  N   . GLU A 1 163 ? -8.309  21.983  -16.199 1.00 79.81  ? 163 GLU A N   1 
ATOM   1255 C  CA  . GLU A 1 163 ? -7.380  21.294  -17.091 1.00 74.59  ? 163 GLU A CA  1 
ATOM   1256 C  C   . GLU A 1 163 ? -6.693  20.112  -16.404 1.00 69.27  ? 163 GLU A C   1 
ATOM   1257 O  O   . GLU A 1 163 ? -6.336  19.134  -17.073 1.00 68.16  ? 163 GLU A O   1 
ATOM   1258 C  CB  . GLU A 1 163 ? -6.347  22.288  -17.632 1.00 76.55  ? 163 GLU A CB  1 
ATOM   1259 C  CG  . GLU A 1 163 ? -6.901  23.302  -18.641 1.00 80.83  ? 163 GLU A CG  1 
ATOM   1260 C  CD  . GLU A 1 163 ? -7.010  22.749  -20.061 1.00 83.96  ? 163 GLU A CD  1 
ATOM   1261 O  OE1 . GLU A 1 163 ? -6.754  21.544  -20.270 1.00 85.27  ? 163 GLU A OE1 1 
ATOM   1262 O  OE2 . GLU A 1 163 ? -7.356  23.524  -20.975 1.00 87.13  1 163 GLU A OE2 1 
ATOM   1263 N  N   . ALA A 1 164 ? -6.496  20.184  -15.086 1.00 67.09  ? 164 ALA A N   1 
ATOM   1264 C  CA  . ALA A 1 164 ? -6.017  19.046  -14.298 1.00 64.78  ? 164 ALA A CA  1 
ATOM   1265 C  C   . ALA A 1 164 ? -6.650  19.130  -12.923 1.00 73.07  ? 164 ALA A C   1 
ATOM   1266 O  O   . ALA A 1 164 ? -6.086  19.714  -11.991 1.00 77.99  ? 164 ALA A O   1 
ATOM   1267 C  CB  . ALA A 1 164 ? -4.495  19.027  -14.187 1.00 50.13  ? 164 ALA A CB  1 
ATOM   1268 N  N   . PRO A 1 165 ? -7.833  18.562  -12.763 1.00 68.05  ? 165 PRO A N   1 
ATOM   1269 C  CA  . PRO A 1 165 ? -8.540  18.674  -11.484 1.00 64.83  ? 165 PRO A CA  1 
ATOM   1270 C  C   . PRO A 1 165 ? -8.144  17.591  -10.498 1.00 52.22  ? 165 PRO A C   1 
ATOM   1271 O  O   . PRO A 1 165 ? -8.300  17.756  -9.283  1.00 49.44  ? 165 PRO A O   1 
ATOM   1272 C  CB  . PRO A 1 165 ? -10.009 18.542  -11.901 1.00 69.85  ? 165 PRO A CB  1 
ATOM   1273 C  CG  . PRO A 1 165 ? -9.961  17.620  -13.077 1.00 68.54  ? 165 PRO A CG  1 
ATOM   1274 C  CD  . PRO A 1 165 ? -8.659  17.917  -13.797 1.00 69.70  ? 165 PRO A CD  1 
ATOM   1275 N  N   . GLY A 1 166 ? -7.626  16.480  -11.003 1.00 50.00  ? 166 GLY A N   1 
ATOM   1276 C  CA  . GLY A 1 166 ? -7.358  15.335  -10.164 1.00 58.34  ? 166 GLY A CA  1 
ATOM   1277 C  C   . GLY A 1 166 ? -8.520  14.363  -10.149 1.00 59.89  ? 166 GLY A C   1 
ATOM   1278 O  O   . GLY A 1 166 ? -9.622  14.645  -10.620 1.00 70.94  ? 166 GLY A O   1 
ATOM   1279 N  N   . ASN A 1 167 ? -8.258  13.179  -9.604  1.00 56.70  ? 167 ASN A N   1 
ATOM   1280 C  CA  . ASN A 1 167 ? -9.184  12.053  -9.653  1.00 56.06  ? 167 ASN A CA  1 
ATOM   1281 C  C   . ASN A 1 167 ? -9.529  11.650  -11.073 1.00 48.74  ? 167 ASN A C   1 
ATOM   1282 O  O   . ASN A 1 167 ? -10.445 10.842  -11.278 1.00 51.05  ? 167 ASN A O   1 
ATOM   1283 C  CB  . ASN A 1 167 ? -10.482 12.348  -8.901  1.00 57.33  ? 167 ASN A CB  1 
ATOM   1284 C  CG  . ASN A 1 167 ? -10.254 12.629  -7.458  1.00 59.42  ? 167 ASN A CG  1 
ATOM   1285 O  OD1 . ASN A 1 167 ? -9.384  12.021  -6.833  1.00 62.90  ? 167 ASN A OD1 1 
ATOM   1286 N  ND2 . ASN A 1 167 ? -11.027 13.565  -6.905  1.00 52.00  ? 167 ASN A ND2 1 
ATOM   1287 N  N   . VAL A 1 168 ? -8.841  12.208  -12.067 1.00 42.08  ? 168 VAL A N   1 
ATOM   1288 C  CA  . VAL A 1 168 ? -9.285  11.992  -13.433 1.00 41.86  ? 168 VAL A CA  1 
ATOM   1289 C  C   . VAL A 1 168 ? -9.144  10.528  -13.812 1.00 43.27  ? 168 VAL A C   1 
ATOM   1290 O  O   . VAL A 1 168 ? -9.929  10.034  -14.615 1.00 50.75  ? 168 VAL A O   1 
ATOM   1291 C  CB  . VAL A 1 168 ? -8.542  12.919  -14.414 1.00 40.03  ? 168 VAL A CB  1 
ATOM   1292 C  CG1 . VAL A 1 168 ? -8.558  14.365  -13.895 1.00 41.84  ? 168 VAL A CG1 1 
ATOM   1293 C  CG2 . VAL A 1 168 ? -7.107  12.424  -14.651 1.00 41.94  ? 168 VAL A CG2 1 
ATOM   1294 N  N   . GLY A 1 169 ? -8.223  9.793   -13.192 1.00 35.84  ? 169 GLY A N   1 
ATOM   1295 C  CA  . GLY A 1 169 ? -8.098  8.380   -13.490 1.00 37.01  ? 169 GLY A CA  1 
ATOM   1296 C  C   . GLY A 1 169 ? -9.177  7.542   -12.849 1.00 46.30  ? 169 GLY A C   1 
ATOM   1297 O  O   . GLY A 1 169 ? -9.452  6.429   -13.306 1.00 47.69  ? 169 GLY A O   1 
ATOM   1298 N  N   . LEU A 1 170 ? -9.783  8.044   -11.770 1.00 56.56  ? 170 LEU A N   1 
ATOM   1299 C  CA  . LEU A 1 170 ? -11.009 7.434   -11.276 1.00 47.01  ? 170 LEU A CA  1 
ATOM   1300 C  C   . LEU A 1 170 ? -12.144 7.643   -12.262 1.00 43.45  ? 170 LEU A C   1 
ATOM   1301 O  O   . LEU A 1 170 ? -12.974 6.744   -12.440 1.00 43.68  ? 170 LEU A O   1 
ATOM   1302 C  CB  . LEU A 1 170 ? -11.376 7.999   -9.907  1.00 39.73  ? 170 LEU A CB  1 
ATOM   1303 C  CG  . LEU A 1 170 ? -10.498 7.384   -8.816  1.00 39.08  ? 170 LEU A CG  1 
ATOM   1304 C  CD1 . LEU A 1 170 ? -10.729 8.096   -7.504  1.00 45.50  ? 170 LEU A CD1 1 
ATOM   1305 C  CD2 . LEU A 1 170 ? -10.757 5.892   -8.701  1.00 34.10  ? 170 LEU A CD2 1 
ATOM   1306 N  N   . LEU A 1 171 ? -12.165 8.805   -12.936 1.00 36.83  ? 171 LEU A N   1 
ATOM   1307 C  CA  . LEU A 1 171 ? -13.163 9.073   -13.968 1.00 43.40  ? 171 LEU A CA  1 
ATOM   1308 C  C   . LEU A 1 171 ? -13.013 8.181   -15.200 1.00 49.12  ? 171 LEU A C   1 
ATOM   1309 O  O   . LEU A 1 171 ? -14.028 7.796   -15.796 1.00 53.31  ? 171 LEU A O   1 
ATOM   1310 C  CB  . LEU A 1 171 ? -13.120 10.532  -14.385 1.00 39.31  ? 171 LEU A CB  1 
ATOM   1311 C  CG  . LEU A 1 171 ? -13.409 11.489  -13.247 1.00 38.15  ? 171 LEU A CG  1 
ATOM   1312 C  CD1 . LEU A 1 171 ? -12.805 12.822  -13.623 1.00 40.14  ? 171 LEU A CD1 1 
ATOM   1313 C  CD2 . LEU A 1 171 ? -14.930 11.588  -12.962 1.00 38.23  ? 171 LEU A CD2 1 
ATOM   1314 N  N   . ASP A 1 172 ? -11.784 7.850   -15.613 1.00 34.61  ? 172 ASP A N   1 
ATOM   1315 C  CA  . ASP A 1 172 ? -11.627 6.852   -16.674 1.00 48.77  ? 172 ASP A CA  1 
ATOM   1316 C  C   . ASP A 1 172 ? -12.337 5.553   -16.308 1.00 45.25  ? 172 ASP A C   1 
ATOM   1317 O  O   . ASP A 1 172 ? -13.060 4.978   -17.136 1.00 48.91  ? 172 ASP A O   1 
ATOM   1318 C  CB  . ASP A 1 172 ? -10.146 6.570   -16.980 1.00 50.06  ? 172 ASP A CB  1 
ATOM   1319 C  CG  . ASP A 1 172 ? -9.343  7.829   -17.284 1.00 64.35  ? 172 ASP A CG  1 
ATOM   1320 O  OD1 . ASP A 1 172 ? -9.386  8.784   -16.510 1.00 68.20  ? 172 ASP A OD1 1 
ATOM   1321 O  OD2 . ASP A 1 172 ? -8.655  7.883   -18.314 1.00 72.20  1 172 ASP A OD2 1 
ATOM   1322 N  N   . GLN A 1 173 ? -12.143 5.073   -15.071 1.00 35.52  ? 173 GLN A N   1 
ATOM   1323 C  CA  . GLN A 1 173 ? -12.833 3.856   -14.648 1.00 35.19  ? 173 GLN A CA  1 
ATOM   1324 C  C   . GLN A 1 173 ? -14.350 4.024   -14.703 1.00 42.84  ? 173 GLN A C   1 
ATOM   1325 O  O   . GLN A 1 173 ? -15.071 3.098   -15.092 1.00 42.57  ? 173 GLN A O   1 
ATOM   1326 C  CB  . GLN A 1 173 ? -12.426 3.435   -13.233 1.00 40.94  ? 173 GLN A CB  1 
ATOM   1327 C  CG  . GLN A 1 173 ? -10.964 3.237   -12.914 1.00 42.40  ? 173 GLN A CG  1 
ATOM   1328 C  CD  . GLN A 1 173 ? -10.724 3.082   -11.399 1.00 37.96  ? 173 GLN A CD  1 
ATOM   1329 O  OE1 . GLN A 1 173 ? -11.616 3.323   -10.597 1.00 35.33  ? 173 GLN A OE1 1 
ATOM   1330 N  NE2 . GLN A 1 173 ? -9.526  2.663   -11.022 1.00 28.84  ? 173 GLN A NE2 1 
ATOM   1331 N  N   . ARG A 1 174 ? -14.864 5.190   -14.298 1.00 40.67  ? 174 ARG A N   1 
ATOM   1332 C  CA  . ARG A 1 174 ? -16.308 5.369   -14.349 1.00 34.75  ? 174 ARG A CA  1 
ATOM   1333 C  C   . ARG A 1 174 ? -16.780 5.450   -15.792 1.00 37.84  ? 174 ARG A C   1 
ATOM   1334 O  O   . ARG A 1 174 ? -17.869 4.964   -16.119 1.00 44.15  ? 174 ARG A O   1 
ATOM   1335 C  CB  . ARG A 1 174 ? -16.723 6.611   -13.550 1.00 33.72  ? 174 ARG A CB  1 
ATOM   1336 C  CG  . ARG A 1 174 ? -18.027 7.282   -14.012 1.00 34.83  ? 174 ARG A CG  1 
ATOM   1337 C  CD  . ARG A 1 174 ? -18.197 8.642   -13.383 1.00 36.00  ? 174 ARG A CD  1 
ATOM   1338 N  NE  . ARG A 1 174 ? -18.055 8.571   -11.932 1.00 35.63  ? 174 ARG A NE  1 
ATOM   1339 C  CZ  . ARG A 1 174 ? -18.111 9.605   -11.101 1.00 43.21  ? 174 ARG A CZ  1 
ATOM   1340 N  NH1 . ARG A 1 174 ? -18.223 10.837  -11.567 1.00 44.98  1 174 ARG A NH1 1 
ATOM   1341 N  NH2 . ARG A 1 174 ? -18.002 9.385   -9.807  1.00 41.16  ? 174 ARG A NH2 1 
ATOM   1342 N  N   . MET A 1 175 ? -15.968 6.023   -16.678 1.00 39.85  ? 175 MET A N   1 
ATOM   1343 C  CA  . MET A 1 175 ? -16.382 6.060   -18.071 1.00 45.14  ? 175 MET A CA  1 
ATOM   1344 C  C   . MET A 1 175 ? -16.403 4.664   -18.673 1.00 44.18  ? 175 MET A C   1 
ATOM   1345 O  O   . MET A 1 175 ? -17.342 4.312   -19.399 1.00 39.48  ? 175 MET A O   1 
ATOM   1346 C  CB  . MET A 1 175 ? -15.490 6.986   -18.884 1.00 40.46  ? 175 MET A CB  1 
ATOM   1347 C  CG  . MET A 1 175 ? -16.169 7.354   -20.174 1.00 45.89  ? 175 MET A CG  1 
ATOM   1348 S  SD  . MET A 1 175 ? -15.334 8.698   -20.978 1.00 55.20  ? 175 MET A SD  1 
ATOM   1349 C  CE  . MET A 1 175 ? -15.501 9.957   -19.708 1.00 39.20  ? 175 MET A CE  1 
ATOM   1350 N  N   . ALA A 1 176 ? -15.388 3.849   -18.372 1.00 43.35  ? 176 ALA A N   1 
ATOM   1351 C  CA  . ALA A 1 176 ? -15.470 2.437   -18.720 1.00 41.15  ? 176 ALA A CA  1 
ATOM   1352 C  C   . ALA A 1 176 ? -16.689 1.789   -18.072 1.00 42.10  ? 176 ALA A C   1 
ATOM   1353 O  O   . ALA A 1 176 ? -17.385 0.990   -18.706 1.00 37.95  ? 176 ALA A O   1 
ATOM   1354 C  CB  . ALA A 1 176 ? -14.188 1.712   -18.318 1.00 31.51  ? 176 ALA A CB  1 
ATOM   1355 N  N   . LEU A 1 177 ? -16.980 2.139   -16.817 1.00 31.74  ? 177 LEU A N   1 
ATOM   1356 C  CA  . LEU A 1 177 ? -18.178 1.611   -16.173 1.00 40.38  ? 177 LEU A CA  1 
ATOM   1357 C  C   . LEU A 1 177 ? -19.433 2.092   -16.893 1.00 40.70  ? 177 LEU A C   1 
ATOM   1358 O  O   . LEU A 1 177 ? -20.354 1.311   -17.159 1.00 42.17  ? 177 LEU A O   1 
ATOM   1359 C  CB  . LEU A 1 177 ? -18.210 2.011   -14.699 1.00 31.30  ? 177 LEU A CB  1 
ATOM   1360 C  CG  . LEU A 1 177 ? -17.344 1.234   -13.714 1.00 30.27  ? 177 LEU A CG  1 
ATOM   1361 C  CD1 . LEU A 1 177 ? -17.768 1.597   -12.307 1.00 30.31  ? 177 LEU A CD1 1 
ATOM   1362 C  CD2 . LEU A 1 177 ? -17.456 -0.270  -13.954 1.00 29.67  ? 177 LEU A CD2 1 
ATOM   1363 N  N   . GLN A 1 178 ? -19.479 3.379   -17.234 1.00 34.64  ? 178 GLN A N   1 
ATOM   1364 C  CA  . GLN A 1 178 ? -20.590 3.865   -18.031 1.00 37.02  ? 178 GLN A CA  1 
ATOM   1365 C  C   . GLN A 1 178 ? -20.672 3.123   -19.355 1.00 42.47  ? 178 GLN A C   1 
ATOM   1366 O  O   . GLN A 1 178 ? -21.766 2.746   -19.799 1.00 53.16  ? 178 GLN A O   1 
ATOM   1367 C  CB  . GLN A 1 178 ? -20.477 5.368   -18.256 1.00 35.79  ? 178 GLN A CB  1 
ATOM   1368 C  CG  . GLN A 1 178 ? -21.551 5.839   -19.206 1.00 37.09  ? 178 GLN A CG  1 
ATOM   1369 C  CD  . GLN A 1 178 ? -22.797 6.199   -18.437 1.00 37.57  ? 178 GLN A CD  1 
ATOM   1370 O  OE1 . GLN A 1 178 ? -23.696 5.384   -18.332 1.00 53.62  ? 178 GLN A OE1 1 
ATOM   1371 N  NE2 . GLN A 1 178 ? -22.828 7.388   -17.837 1.00 38.57  ? 178 GLN A NE2 1 
ATOM   1372 N  N   . TRP A 1 179 ? -19.524 2.861   -19.977 1.00 34.70  ? 179 TRP A N   1 
ATOM   1373 C  CA  . TRP A 1 179 ? -19.532 2.170   -21.258 1.00 38.01  ? 179 TRP A CA  1 
ATOM   1374 C  C   . TRP A 1 179 ? -20.164 0.790   -21.126 1.00 36.07  ? 179 TRP A C   1 
ATOM   1375 O  O   . TRP A 1 179 ? -20.934 0.366   -21.993 1.00 35.40  ? 179 TRP A O   1 
ATOM   1376 C  CB  . TRP A 1 179 ? -18.107 2.075   -21.805 1.00 40.76  ? 179 TRP A CB  1 
ATOM   1377 C  CG  . TRP A 1 179 ? -18.027 1.473   -23.167 1.00 39.45  ? 179 TRP A CG  1 
ATOM   1378 C  CD1 . TRP A 1 179 ? -17.900 2.140   -24.345 1.00 36.92  ? 179 TRP A CD1 1 
ATOM   1379 C  CD2 . TRP A 1 179 ? -18.065 0.080   -23.494 1.00 37.70  ? 179 TRP A CD2 1 
ATOM   1380 N  NE1 . TRP A 1 179 ? -17.884 1.252   -25.394 1.00 43.64  ? 179 TRP A NE1 1 
ATOM   1381 C  CE2 . TRP A 1 179 ? -17.979 -0.021  -24.900 1.00 36.43  ? 179 TRP A CE2 1 
ATOM   1382 C  CE3 . TRP A 1 179 ? -18.175 -1.094  -22.734 1.00 37.21  ? 179 TRP A CE3 1 
ATOM   1383 C  CZ2 . TRP A 1 179 ? -17.992 -1.249  -25.569 1.00 43.29  ? 179 TRP A CZ2 1 
ATOM   1384 C  CZ3 . TRP A 1 179 ? -18.183 -2.321  -23.398 1.00 43.89  ? 179 TRP A CZ3 1 
ATOM   1385 C  CH2 . TRP A 1 179 ? -18.088 -2.385  -24.807 1.00 48.28  ? 179 TRP A CH2 1 
ATOM   1386 N  N   . VAL A 1 180 ? -19.849 0.075   -20.046 1.00 36.85  ? 180 VAL A N   1 
ATOM   1387 C  CA  . VAL A 1 180 ? -20.468 -1.224  -19.801 1.00 35.80  ? 180 VAL A CA  1 
ATOM   1388 C  C   . VAL A 1 180 ? -21.964 -1.051  -19.582 1.00 43.16  ? 180 VAL A C   1 
ATOM   1389 O  O   . VAL A 1 180 ? -22.781 -1.842  -20.069 1.00 36.67  ? 180 VAL A O   1 
ATOM   1390 C  CB  . VAL A 1 180 ? -19.786 -1.910  -18.601 1.00 41.56  ? 180 VAL A CB  1 
ATOM   1391 C  CG1 . VAL A 1 180 ? -20.528 -3.161  -18.170 1.00 31.81  ? 180 VAL A CG1 1 
ATOM   1392 C  CG2 . VAL A 1 180 ? -18.320 -2.248  -18.938 1.00 49.19  ? 180 VAL A CG2 1 
ATOM   1393 N  N   . HIS A 1 181 ? -22.348 0.005   -18.867 1.00 43.68  ? 181 HIS A N   1 
ATOM   1394 C  CA  . HIS A 1 181 ? -23.761 0.245   -18.617 1.00 46.87  ? 181 HIS A CA  1 
ATOM   1395 C  C   . HIS A 1 181 ? -24.498 0.519   -19.912 1.00 54.87  ? 181 HIS A C   1 
ATOM   1396 O  O   . HIS A 1 181 ? -25.690 0.212   -20.033 1.00 61.51  ? 181 HIS A O   1 
ATOM   1397 C  CB  . HIS A 1 181 ? -23.910 1.409   -17.640 1.00 44.42  ? 181 HIS A CB  1 
ATOM   1398 C  CG  . HIS A 1 181 ? -25.322 1.850   -17.429 1.00 42.63  ? 181 HIS A CG  1 
ATOM   1399 N  ND1 . HIS A 1 181 ? -25.930 2.801   -18.220 1.00 49.95  ? 181 HIS A ND1 1 
ATOM   1400 C  CD2 . HIS A 1 181 ? -26.243 1.480   -16.510 1.00 36.03  ? 181 HIS A CD2 1 
ATOM   1401 C  CE1 . HIS A 1 181 ? -27.165 2.996   -17.802 1.00 41.60  ? 181 HIS A CE1 1 
ATOM   1402 N  NE2 . HIS A 1 181 ? -27.381 2.205   -16.765 1.00 42.84  ? 181 HIS A NE2 1 
ATOM   1403 N  N   . ASP A 1 182 ? -23.799 1.066   -20.900 1.00 58.51  ? 182 ASP A N   1 
ATOM   1404 C  CA  . ASP A 1 182 ? -24.419 1.403   -22.169 1.00 51.68  ? 182 ASP A CA  1 
ATOM   1405 C  C   . ASP A 1 182 ? -24.306 0.289   -23.207 1.00 51.97  ? 182 ASP A C   1 
ATOM   1406 O  O   . ASP A 1 182 ? -25.151 0.213   -24.104 1.00 53.97  ? 182 ASP A O   1 
ATOM   1407 C  CB  . ASP A 1 182 ? -23.799 2.689   -22.725 1.00 39.42  ? 182 ASP A CB  1 
ATOM   1408 C  CG  . ASP A 1 182 ? -24.268 3.921   -21.985 1.00 48.92  ? 182 ASP A CG  1 
ATOM   1409 O  OD1 . ASP A 1 182 ? -25.218 3.799   -21.179 1.00 52.60  ? 182 ASP A OD1 1 
ATOM   1410 O  OD2 . ASP A 1 182 ? -23.693 5.013   -22.203 1.00 58.91  1 182 ASP A OD2 1 
ATOM   1411 N  N   . ASN A 1 183 ? -23.299 -0.581  -23.111 1.00 46.83  ? 183 ASN A N   1 
ATOM   1412 C  CA  . ASN A 1 183 ? -22.984 -1.487  -24.206 1.00 45.61  ? 183 ASN A CA  1 
ATOM   1413 C  C   . ASN A 1 183 ? -22.888 -2.958  -23.825 1.00 53.35  ? 183 ASN A C   1 
ATOM   1414 O  O   . ASN A 1 183 ? -22.650 -3.780  -24.715 1.00 61.05  ? 183 ASN A O   1 
ATOM   1415 C  CB  . ASN A 1 183 ? -21.667 -1.063  -24.879 1.00 37.52  ? 183 ASN A CB  1 
ATOM   1416 C  CG  . ASN A 1 183 ? -21.759 0.316   -25.528 1.00 43.22  ? 183 ASN A CG  1 
ATOM   1417 O  OD1 . ASN A 1 183 ? -22.224 0.441   -26.653 1.00 45.31  ? 183 ASN A OD1 1 
ATOM   1418 N  ND2 . ASN A 1 183 ? -21.316 1.348   -24.824 1.00 39.55  ? 183 ASN A ND2 1 
ATOM   1419 N  N   . ILE A 1 184 ? -23.072 -3.325  -22.550 1.00 49.72  ? 184 ILE A N   1 
ATOM   1420 C  CA  . ILE A 1 184 ? -22.841 -4.719  -22.182 1.00 40.83  ? 184 ILE A CA  1 
ATOM   1421 C  C   . ILE A 1 184 ? -24.050 -5.575  -22.518 1.00 36.27  ? 184 ILE A C   1 
ATOM   1422 O  O   . ILE A 1 184 ? -23.905 -6.793  -22.687 1.00 43.49  ? 184 ILE A O   1 
ATOM   1423 C  CB  . ILE A 1 184 ? -22.423 -4.866  -20.702 1.00 34.82  ? 184 ILE A CB  1 
ATOM   1424 C  CG1 . ILE A 1 184 ? -21.783 -6.233  -20.461 1.00 33.50  ? 184 ILE A CG1 1 
ATOM   1425 C  CG2 . ILE A 1 184 ? -23.633 -4.836  -19.777 1.00 34.23  ? 184 ILE A CG2 1 
ATOM   1426 C  CD1 . ILE A 1 184 ? -20.336 -6.298  -20.853 1.00 32.99  ? 184 ILE A CD1 1 
ATOM   1427 N  N   . GLN A 1 185 ? -25.235 -4.972  -22.669 1.00 44.92  ? 185 GLN A N   1 
ATOM   1428 C  CA  . GLN A 1 185 ? -26.392 -5.755  -23.101 1.00 47.62  ? 185 GLN A CA  1 
ATOM   1429 C  C   . GLN A 1 185 ? -26.087 -6.510  -24.393 1.00 54.69  ? 185 GLN A C   1 
ATOM   1430 O  O   . GLN A 1 185 ? -26.463 -7.681  -24.534 1.00 49.43  ? 185 GLN A O   1 
ATOM   1431 C  CB  . GLN A 1 185 ? -27.628 -4.864  -23.284 1.00 45.52  ? 185 GLN A CB  1 
ATOM   1432 C  CG  . GLN A 1 185 ? -27.437 -3.385  -22.957 1.00 55.58  ? 185 GLN A CG  1 
ATOM   1433 C  CD  . GLN A 1 185 ? -28.471 -2.485  -23.646 1.00 54.13  ? 185 GLN A CD  1 
ATOM   1434 O  OE1 . GLN A 1 185 ? -29.171 -2.920  -24.558 1.00 61.82  ? 185 GLN A OE1 1 
ATOM   1435 N  NE2 . GLN A 1 185 ? -28.548 -1.223  -23.227 1.00 40.43  ? 185 GLN A NE2 1 
ATOM   1436 N  N   . PHE A 1 186 ? -25.360 -5.865  -25.327 1.00 60.48  ? 186 PHE A N   1 
ATOM   1437 C  CA  . PHE A 1 186 ? -25.090 -6.444  -26.648 1.00 57.39  ? 186 PHE A CA  1 
ATOM   1438 C  C   . PHE A 1 186 ? -24.135 -7.632  -26.572 1.00 61.11  ? 186 PHE A C   1 
ATOM   1439 O  O   . PHE A 1 186 ? -24.171 -8.515  -27.439 1.00 59.86  ? 186 PHE A O   1 
ATOM   1440 C  CB  . PHE A 1 186 ? -24.485 -5.395  -27.581 1.00 45.02  ? 186 PHE A CB  1 
ATOM   1441 C  CG  . PHE A 1 186 ? -25.222 -4.094  -27.607 1.00 41.48  ? 186 PHE A CG  1 
ATOM   1442 C  CD1 . PHE A 1 186 ? -24.553 -2.905  -27.365 1.00 47.99  ? 186 PHE A CD1 1 
ATOM   1443 C  CD2 . PHE A 1 186 ? -26.566 -4.043  -27.896 1.00 47.93  ? 186 PHE A CD2 1 
ATOM   1444 C  CE1 . PHE A 1 186 ? -25.216 -1.690  -27.393 1.00 44.92  ? 186 PHE A CE1 1 
ATOM   1445 C  CE2 . PHE A 1 186 ? -27.245 -2.829  -27.918 1.00 48.80  ? 186 PHE A CE2 1 
ATOM   1446 C  CZ  . PHE A 1 186 ? -26.565 -1.650  -27.665 1.00 42.73  ? 186 PHE A CZ  1 
ATOM   1447 N  N   . PHE A 1 187 ? -23.258 -7.661  -25.575 1.00 51.54  ? 187 PHE A N   1 
ATOM   1448 C  CA  . PHE A 1 187 ? -22.338 -8.774  -25.420 1.00 55.71  ? 187 PHE A CA  1 
ATOM   1449 C  C   . PHE A 1 187 ? -22.936 -9.892  -24.586 1.00 55.06  ? 187 PHE A C   1 
ATOM   1450 O  O   . PHE A 1 187 ? -22.203 -10.803 -24.174 1.00 46.91  ? 187 PHE A O   1 
ATOM   1451 C  CB  . PHE A 1 187 ? -21.021 -8.277  -24.820 1.00 50.12  ? 187 PHE A CB  1 
ATOM   1452 C  CG  . PHE A 1 187 ? -20.340 -7.261  -25.675 1.00 42.68  ? 187 PHE A CG  1 
ATOM   1453 C  CD1 . PHE A 1 187 ? -20.579 -5.913  -25.471 1.00 44.86  ? 187 PHE A CD1 1 
ATOM   1454 C  CD2 . PHE A 1 187 ? -19.474 -7.639  -26.687 1.00 38.26  ? 187 PHE A CD2 1 
ATOM   1455 C  CE1 . PHE A 1 187 ? -19.973 -4.951  -26.262 1.00 46.21  ? 187 PHE A CE1 1 
ATOM   1456 C  CE2 . PHE A 1 187 ? -18.874 -6.682  -27.487 1.00 44.91  ? 187 PHE A CE2 1 
ATOM   1457 C  CZ  . PHE A 1 187 ? -19.123 -5.329  -27.269 1.00 40.66  ? 187 PHE A CZ  1 
ATOM   1458 N  N   . GLY A 1 188 ? -24.257 -9.862  -24.377 1.00 48.52  ? 188 GLY A N   1 
ATOM   1459 C  CA  . GLY A 1 188 ? -24.937 -10.821 -23.540 1.00 49.10  ? 188 GLY A CA  1 
ATOM   1460 C  C   . GLY A 1 188 ? -24.780 -10.559 -22.067 1.00 49.78  ? 188 GLY A C   1 
ATOM   1461 O  O   . GLY A 1 188 ? -25.038 -11.462 -21.264 1.00 49.56  ? 188 GLY A O   1 
ATOM   1462 N  N   . GLY A 1 189 ? -24.321 -9.357  -21.690 1.00 45.82  ? 189 GLY A N   1 
ATOM   1463 C  CA  . GLY A 1 189 ? -24.255 -8.975  -20.301 1.00 50.47  ? 189 GLY A CA  1 
ATOM   1464 C  C   . GLY A 1 189 ? -25.567 -8.397  -19.800 1.00 61.87  ? 189 GLY A C   1 
ATOM   1465 O  O   . GLY A 1 189 ? -26.424 -7.976  -20.581 1.00 80.02  ? 189 GLY A O   1 
ATOM   1466 N  N   . ASP A 1 190 ? -25.718 -8.400  -18.475 1.00 46.17  ? 190 ASP A N   1 
ATOM   1467 C  CA  . ASP A 1 190 ? -26.878 -7.831  -17.800 1.00 35.66  ? 190 ASP A CA  1 
ATOM   1468 C  C   . ASP A 1 190 ? -26.433 -6.532  -17.140 1.00 43.96  ? 190 ASP A C   1 
ATOM   1469 O  O   . ASP A 1 190 ? -25.821 -6.563  -16.058 1.00 34.69  ? 190 ASP A O   1 
ATOM   1470 C  CB  . ASP A 1 190 ? -27.415 -8.818  -16.755 1.00 58.67  ? 190 ASP A CB  1 
ATOM   1471 C  CG  . ASP A 1 190 ? -28.584 -8.274  -15.933 1.00 54.64  ? 190 ASP A CG  1 
ATOM   1472 O  OD1 . ASP A 1 190 ? -29.154 -9.081  -15.165 1.00 51.25  ? 190 ASP A OD1 1 
ATOM   1473 O  OD2 . ASP A 1 190 ? -28.964 -7.086  -16.079 1.00 46.14  1 190 ASP A OD2 1 
ATOM   1474 N  N   . PRO A 1 191 ? -26.688 -5.371  -17.743 1.00 45.91  ? 191 PRO A N   1 
ATOM   1475 C  CA  . PRO A 1 191 ? -26.243 -4.110  -17.116 1.00 48.94  ? 191 PRO A CA  1 
ATOM   1476 C  C   . PRO A 1 191 ? -26.815 -3.889  -15.714 1.00 50.14  ? 191 PRO A C   1 
ATOM   1477 O  O   . PRO A 1 191 ? -26.197 -3.190  -14.905 1.00 42.28  ? 191 PRO A O   1 
ATOM   1478 C  CB  . PRO A 1 191 ? -26.733 -3.033  -18.098 1.00 39.91  ? 191 PRO A CB  1 
ATOM   1479 C  CG  . PRO A 1 191 ? -27.674 -3.735  -19.020 1.00 42.13  ? 191 PRO A CG  1 
ATOM   1480 C  CD  . PRO A 1 191 ? -27.260 -5.159  -19.075 1.00 38.66  ? 191 PRO A CD  1 
ATOM   1481 N  N   . LYS A 1 192 ? -27.980 -4.464  -15.406 1.00 49.45  ? 192 LYS A N   1 
ATOM   1482 C  CA  . LYS A 1 192 ? -28.591 -4.301  -14.094 1.00 52.90  ? 192 LYS A CA  1 
ATOM   1483 C  C   . LYS A 1 192 ? -27.863 -5.064  -12.986 1.00 53.93  ? 192 LYS A C   1 
ATOM   1484 O  O   . LYS A 1 192 ? -28.190 -4.858  -11.806 1.00 54.84  ? 192 LYS A O   1 
ATOM   1485 C  CB  . LYS A 1 192 ? -30.064 -4.738  -14.134 1.00 54.05  ? 192 LYS A CB  1 
ATOM   1486 C  CG  . LYS A 1 192 ? -30.994 -3.775  -14.882 1.00 64.10  ? 192 LYS A CG  1 
ATOM   1487 C  CD  . LYS A 1 192 ? -32.352 -3.615  -14.199 1.00 71.29  ? 192 LYS A CD  1 
ATOM   1488 C  CE  . LYS A 1 192 ? -32.220 -2.896  -12.849 1.00 77.01  ? 192 LYS A CE  1 
ATOM   1489 N  NZ  . LYS A 1 192 ? -31.727 -1.485  -12.939 1.00 71.87  1 192 LYS A NZ  1 
ATOM   1490 N  N   . THR A 1 193 ? -26.905 -5.956  -13.318 1.00 39.71  ? 193 THR A N   1 
ATOM   1491 C  CA  . THR A 1 193 ? -26.122 -6.676  -12.301 1.00 44.24  ? 193 THR A CA  1 
ATOM   1492 C  C   . THR A 1 193 ? -24.619 -6.650  -12.677 1.00 50.36  ? 193 THR A C   1 
ATOM   1493 O  O   . THR A 1 193 ? -24.009 -7.671  -13.021 1.00 52.36  ? 193 THR A O   1 
ATOM   1494 C  CB  . THR A 1 193 ? -26.650 -8.124  -12.104 1.00 45.35  ? 193 THR A CB  1 
ATOM   1495 O  OG1 . THR A 1 193 ? -25.933 -9.040  -12.933 1.00 60.20  ? 193 THR A OG1 1 
ATOM   1496 C  CG2 . THR A 1 193 ? -28.100 -8.225  -12.486 1.00 44.85  ? 193 THR A CG2 1 
ATOM   1497 N  N   . VAL A 1 194 ? -24.006 -5.460  -12.602 1.00 45.87  ? 194 VAL A N   1 
ATOM   1498 C  CA  . VAL A 1 194 ? -22.564 -5.313  -12.787 1.00 44.51  ? 194 VAL A CA  1 
ATOM   1499 C  C   . VAL A 1 194 ? -21.912 -5.437  -11.420 1.00 50.53  ? 194 VAL A C   1 
ATOM   1500 O  O   . VAL A 1 194 ? -22.448 -4.955  -10.419 1.00 51.95  ? 194 VAL A O   1 
ATOM   1501 C  CB  . VAL A 1 194 ? -22.209 -3.961  -13.449 1.00 43.02  ? 194 VAL A CB  1 
ATOM   1502 C  CG1 . VAL A 1 194 ? -20.695 -3.759  -13.519 1.00 35.45  ? 194 VAL A CG1 1 
ATOM   1503 C  CG2 . VAL A 1 194 ? -22.846 -3.831  -14.841 1.00 37.46  ? 194 VAL A CG2 1 
ATOM   1504 N  N   . THR A 1 195 ? -20.759 -6.090  -11.369 1.00 48.13  ? 195 THR A N   1 
ATOM   1505 C  CA  . THR A 1 195 ? -20.040 -6.312  -10.122 1.00 34.22  ? 195 THR A CA  1 
ATOM   1506 C  C   . THR A 1 195 ? -18.613 -5.829  -10.310 1.00 38.93  ? 195 THR A C   1 
ATOM   1507 O  O   . THR A 1 195 ? -17.842 -6.457  -11.039 1.00 42.77  ? 195 THR A O   1 
ATOM   1508 C  CB  . THR A 1 195 ? -20.090 -7.790  -9.745  1.00 35.30  ? 195 THR A CB  1 
ATOM   1509 O  OG1 . THR A 1 195 ? -21.461 -8.215  -9.682  1.00 58.78  ? 195 THR A OG1 1 
ATOM   1510 C  CG2 . THR A 1 195 ? -19.434 -8.023  -8.436  1.00 28.46  ? 195 THR A CG2 1 
ATOM   1511 N  N   . ILE A 1 196 ? -18.271 -4.696  -9.701  1.00 37.00  ? 196 ILE A N   1 
ATOM   1512 C  CA  . ILE A 1 196 ? -16.917 -4.166  -9.808  1.00 32.67  ? 196 ILE A CA  1 
ATOM   1513 C  C   . ILE A 1 196 ? -16.040 -4.836  -8.762  1.00 40.01  ? 196 ILE A C   1 
ATOM   1514 O  O   . ILE A 1 196 ? -16.453 -5.051  -7.617  1.00 49.29  ? 196 ILE A O   1 
ATOM   1515 C  CB  . ILE A 1 196 ? -16.887 -2.634  -9.658  1.00 28.85  ? 196 ILE A CB  1 
ATOM   1516 C  CG1 . ILE A 1 196 ? -17.494 -2.173  -8.330  1.00 32.77  ? 196 ILE A CG1 1 
ATOM   1517 C  CG2 . ILE A 1 196 ? -17.580 -1.974  -10.805 1.00 28.45  ? 196 ILE A CG2 1 
ATOM   1518 C  CD1 . ILE A 1 196 ? -17.218 -0.701  -8.046  1.00 30.48  ? 196 ILE A CD1 1 
ATOM   1519 N  N   . PHE A 1 197 ? -14.833 -5.206  -9.167  1.00 37.92  ? 197 PHE A N   1 
ATOM   1520 C  CA  . PHE A 1 197 ? -13.902 -5.808  -8.232  1.00 42.38  ? 197 PHE A CA  1 
ATOM   1521 C  C   . PHE A 1 197 ? -12.474 -5.567  -8.679  1.00 42.59  ? 197 PHE A C   1 
ATOM   1522 O  O   . PHE A 1 197 ? -12.162 -5.522  -9.872  1.00 39.37  ? 197 PHE A O   1 
ATOM   1523 C  CB  . PHE A 1 197 ? -14.144 -7.301  -8.050  1.00 40.74  ? 197 PHE A CB  1 
ATOM   1524 C  CG  . PHE A 1 197 ? -13.735 -8.160  -9.215  1.00 34.64  ? 197 PHE A CG  1 
ATOM   1525 C  CD1 . PHE A 1 197 ? -12.915 -9.264  -9.007  1.00 26.00  ? 197 PHE A CD1 1 
ATOM   1526 C  CD2 . PHE A 1 197 ? -14.234 -7.932  -10.492 1.00 36.91  ? 197 PHE A CD2 1 
ATOM   1527 C  CE1 . PHE A 1 197 ? -12.578 -10.112 -10.044 1.00 26.51  ? 197 PHE A CE1 1 
ATOM   1528 C  CE2 . PHE A 1 197 ? -13.884 -8.774  -11.552 1.00 36.99  ? 197 PHE A CE2 1 
ATOM   1529 C  CZ  . PHE A 1 197 ? -13.054 -9.868  -11.320 1.00 27.86  ? 197 PHE A CZ  1 
ATOM   1530 N  N   . GLY A 1 198 ? -11.616 -5.414  -7.690  1.00 43.84  ? 198 GLY A N   1 
ATOM   1531 C  CA  . GLY A 1 198 ? -10.234 -5.065  -7.934  1.00 50.38  ? 198 GLY A CA  1 
ATOM   1532 C  C   . GLY A 1 198 ? -9.448  -5.268  -6.667  1.00 44.48  ? 198 GLY A C   1 
ATOM   1533 O  O   . GLY A 1 198 ? -10.006 -5.412  -5.573  1.00 43.67  ? 198 GLY A O   1 
ATOM   1534 N  N   . GLU A 1 199 ? -8.138  -5.256  -6.827  1.00 44.35  ? 199 GLU A N   1 
ATOM   1535 C  CA  . GLU A 1 199 ? -7.230  -5.623  -5.757  1.00 33.87  ? 199 GLU A CA  1 
ATOM   1536 C  C   . GLU A 1 199 ? -6.283  -4.469  -5.479  1.00 31.74  ? 199 GLU A C   1 
ATOM   1537 O  O   . GLU A 1 199 ? -5.873  -3.762  -6.402  1.00 27.74  ? 199 GLU A O   1 
ATOM   1538 C  CB  . GLU A 1 199 ? -6.478  -6.888  -6.133  1.00 26.07  ? 199 GLU A CB  1 
ATOM   1539 C  CG  . GLU A 1 199 ? -5.626  -7.441  -5.059  1.00 39.50  ? 199 GLU A CG  1 
ATOM   1540 C  CD  . GLU A 1 199 ? -4.239  -6.868  -5.130  1.00 50.60  ? 199 GLU A CD  1 
ATOM   1541 O  OE1 . GLU A 1 199 ? -3.922  -6.256  -6.167  1.00 49.06  ? 199 GLU A OE1 1 
ATOM   1542 O  OE2 . GLU A 1 199 ? -3.475  -7.008  -4.156  1.00 56.37  1 199 GLU A OE2 1 
ATOM   1543 N  N   . SER A 1 200 ? -5.971  -4.265  -4.196  1.00 40.63  ? 200 SER A N   1 
ATOM   1544 C  CA  . SER A 1 200 ? -5.058  -3.218  -3.749  1.00 31.45  ? 200 SER A CA  1 
ATOM   1545 C  C   . SER A 1 200 ? -5.596  -1.848  -4.154  1.00 40.26  ? 200 SER A C   1 
ATOM   1546 O  O   . SER A 1 200 ? -6.653  -1.428  -3.675  1.00 50.66  ? 200 SER A O   1 
ATOM   1547 C  CB  . SER A 1 200 ? -3.672  -3.469  -4.326  1.00 36.64  ? 200 SER A CB  1 
ATOM   1548 O  OG  . SER A 1 200 ? -2.688  -2.761  -3.617  1.00 54.10  ? 200 SER A OG  1 
ATOM   1549 N  N   . ALA A 1 201 ? -4.907  -1.145  -5.053  1.00 39.07  ? 201 ALA A N   1 
ATOM   1550 C  CA  . ALA A 1 201 ? -5.480  0.081   -5.609  1.00 36.66  ? 201 ALA A CA  1 
ATOM   1551 C  C   . ALA A 1 201 ? -6.773  -0.202  -6.370  1.00 40.62  ? 201 ALA A C   1 
ATOM   1552 O  O   . ALA A 1 201 ? -7.610  0.696   -6.533  1.00 27.21  ? 201 ALA A O   1 
ATOM   1553 C  CB  . ALA A 1 201 ? -4.461  0.775   -6.520  1.00 36.39  ? 201 ALA A CB  1 
ATOM   1554 N  N   . GLY A 1 202 ? -6.943  -1.435  -6.859  1.00 38.12  ? 202 GLY A N   1 
ATOM   1555 C  CA  . GLY A 1 202 ? -8.241  -1.842  -7.366  1.00 31.40  ? 202 GLY A CA  1 
ATOM   1556 C  C   . GLY A 1 202 ? -9.266  -1.900  -6.251  1.00 44.71  ? 202 GLY A C   1 
ATOM   1557 O  O   . GLY A 1 202 ? -10.371 -1.357  -6.368  1.00 51.96  ? 202 GLY A O   1 
ATOM   1558 N  N   . GLY A 1 203 ? -8.903  -2.544  -5.142  1.00 41.56  ? 203 GLY A N   1 
ATOM   1559 C  CA  . GLY A 1 203 ? -9.773  -2.532  -3.983  1.00 38.74  ? 203 GLY A CA  1 
ATOM   1560 C  C   . GLY A 1 203 ? -10.179 -1.130  -3.571  1.00 36.19  ? 203 GLY A C   1 
ATOM   1561 O  O   . GLY A 1 203 ? -11.351 -0.868  -3.287  1.00 35.97  ? 203 GLY A O   1 
ATOM   1562 N  N   . ALA A 1 204 ? -9.222  -0.205  -3.535  1.00 28.90  ? 204 ALA A N   1 
ATOM   1563 C  CA  . ALA A 1 204 ? -9.559  1.143   -3.098  1.00 35.69  ? 204 ALA A CA  1 
ATOM   1564 C  C   . ALA A 1 204 ? -10.488 1.818   -4.092  1.00 42.54  ? 204 ALA A C   1 
ATOM   1565 O  O   . ALA A 1 204 ? -11.421 2.520   -3.691  1.00 54.49  ? 204 ALA A O   1 
ATOM   1566 C  CB  . ALA A 1 204 ? -8.292  1.972   -2.893  1.00 46.84  ? 204 ALA A CB  1 
ATOM   1567 N  N   . SER A 1 205 ? -10.264 1.605   -5.394  1.00 38.85  ? 205 SER A N   1 
ATOM   1568 C  CA  . SER A 1 205 ? -11.159 2.183   -6.398  1.00 38.77  ? 205 SER A CA  1 
ATOM   1569 C  C   . SER A 1 205 ? -12.588 1.683   -6.238  1.00 43.85  ? 205 SER A C   1 
ATOM   1570 O  O   . SER A 1 205 ? -13.535 2.479   -6.234  1.00 46.94  ? 205 SER A O   1 
ATOM   1571 C  CB  . SER A 1 205 ? -10.640 1.918   -7.812  1.00 33.56  ? 205 SER A CB  1 
ATOM   1572 O  OG  . SER A 1 205 ? -9.252  2.219   -7.903  1.00 33.82  ? 205 SER A OG  1 
ATOM   1573 N  N   . VAL A 1 206 ? -12.762 0.368   -6.089  1.00 41.19  ? 206 VAL A N   1 
ATOM   1574 C  CA  . VAL A 1 206 ? -14.093 -0.190  -5.876  1.00 37.80  ? 206 VAL A CA  1 
ATOM   1575 C  C   . VAL A 1 206 ? -14.755 0.463   -4.667  1.00 46.92  ? 206 VAL A C   1 
ATOM   1576 O  O   . VAL A 1 206 ? -15.951 0.787   -4.690  1.00 62.07  ? 206 VAL A O   1 
ATOM   1577 C  CB  . VAL A 1 206 ? -13.994 -1.721  -5.741  1.00 34.21  ? 206 VAL A CB  1 
ATOM   1578 C  CG1 . VAL A 1 206 ? -15.200 -2.283  -5.073  1.00 41.03  ? 206 VAL A CG1 1 
ATOM   1579 C  CG2 . VAL A 1 206 ? -13.863 -2.354  -7.106  1.00 33.66  ? 206 VAL A CG2 1 
ATOM   1580 N  N   . GLY A 1 207 ? -13.982 0.705   -3.608  1.00 39.50  ? 207 GLY A N   1 
ATOM   1581 C  CA  . GLY A 1 207 ? -14.534 1.383   -2.452  1.00 36.68  ? 207 GLY A CA  1 
ATOM   1582 C  C   . GLY A 1 207 ? -14.895 2.823   -2.737  1.00 42.98  ? 207 GLY A C   1 
ATOM   1583 O  O   . GLY A 1 207 ? -15.861 3.355   -2.177  1.00 46.10  ? 207 GLY A O   1 
ATOM   1584 N  N   . MET A 1 208 ? -14.142 3.472   -3.617  1.00 40.79  ? 208 MET A N   1 
ATOM   1585 C  CA  . MET A 1 208 ? -14.393 4.882   -3.870  1.00 45.56  ? 208 MET A CA  1 
ATOM   1586 C  C   . MET A 1 208 ? -15.591 5.074   -4.781  1.00 46.69  ? 208 MET A C   1 
ATOM   1587 O  O   . MET A 1 208 ? -16.257 6.114   -4.712  1.00 55.07  ? 208 MET A O   1 
ATOM   1588 C  CB  . MET A 1 208 ? -13.139 5.534   -4.452  1.00 42.03  ? 208 MET A CB  1 
ATOM   1589 C  CG  . MET A 1 208 ? -11.989 5.539   -3.468  1.00 36.06  ? 208 MET A CG  1 
ATOM   1590 S  SD  . MET A 1 208 ? -10.449 6.265   -4.061  1.00 43.82  ? 208 MET A SD  1 
ATOM   1591 C  CE  . MET A 1 208 ? -10.093 5.193   -5.420  1.00 51.16  ? 208 MET A CE  1 
ATOM   1592 N  N   . HIS A 1 209 ? -15.890 4.082   -5.618  1.00 31.20  ? 209 HIS A N   1 
ATOM   1593 C  CA  . HIS A 1 209 ? -17.091 4.156   -6.433  1.00 37.78  ? 209 HIS A CA  1 
ATOM   1594 C  C   . HIS A 1 209 ? -18.332 3.841   -5.606  1.00 55.49  ? 209 HIS A C   1 
ATOM   1595 O  O   . HIS A 1 209 ? -19.433 4.310   -5.926  1.00 59.08  ? 209 HIS A O   1 
ATOM   1596 C  CB  . HIS A 1 209 ? -16.950 3.217   -7.632  1.00 35.07  ? 209 HIS A CB  1 
ATOM   1597 C  CG  . HIS A 1 209 ? -15.936 3.681   -8.625  1.00 37.09  ? 209 HIS A CG  1 
ATOM   1598 N  ND1 . HIS A 1 209 ? -15.965 4.944   -9.163  1.00 31.56  ? 209 HIS A ND1 1 
ATOM   1599 C  CD2 . HIS A 1 209 ? -14.861 3.068   -9.169  1.00 29.87  ? 209 HIS A CD2 1 
ATOM   1600 C  CE1 . HIS A 1 209 ? -14.951 5.096   -9.993  1.00 46.12  ? 209 HIS A CE1 1 
ATOM   1601 N  NE2 . HIS A 1 209 ? -14.269 3.967   -10.024 1.00 38.95  ? 209 HIS A NE2 1 
ATOM   1602 N  N   . ILE A 1 210 ? -18.166 3.056   -4.537  1.00 50.32  ? 210 ILE A N   1 
ATOM   1603 C  CA  . ILE A 1 210 ? -19.222 2.917   -3.539  1.00 43.71  ? 210 ILE A CA  1 
ATOM   1604 C  C   . ILE A 1 210 ? -19.504 4.259   -2.871  1.00 49.49  ? 210 ILE A C   1 
ATOM   1605 O  O   . ILE A 1 210 ? -20.662 4.591   -2.571  1.00 55.01  ? 210 ILE A O   1 
ATOM   1606 C  CB  . ILE A 1 210 ? -18.842 1.831   -2.514  1.00 38.43  ? 210 ILE A CB  1 
ATOM   1607 C  CG1 . ILE A 1 210 ? -19.139 0.454   -3.074  1.00 44.25  ? 210 ILE A CG1 1 
ATOM   1608 C  CG2 . ILE A 1 210 ? -19.564 1.977   -1.204  1.00 32.88  ? 210 ILE A CG2 1 
ATOM   1609 C  CD1 . ILE A 1 210 ? -18.309 -0.600  -2.444  1.00 52.81  ? 210 ILE A CD1 1 
ATOM   1610 N  N   . LEU A 1 211 ? -18.455 5.069   -2.666  1.00 45.44  ? 211 LEU A N   1 
ATOM   1611 C  CA  . LEU A 1 211 ? -18.587 6.345   -1.968  1.00 43.28  ? 211 LEU A CA  1 
ATOM   1612 C  C   . LEU A 1 211 ? -19.065 7.461   -2.891  1.00 45.72  ? 211 LEU A C   1 
ATOM   1613 O  O   . LEU A 1 211 ? -19.963 8.233   -2.532  1.00 50.26  ? 211 LEU A O   1 
ATOM   1614 C  CB  . LEU A 1 211 ? -17.252 6.728   -1.337  1.00 40.23  ? 211 LEU A CB  1 
ATOM   1615 C  CG  . LEU A 1 211 ? -16.822 6.061   -0.036  1.00 35.10  ? 211 LEU A CG  1 
ATOM   1616 C  CD1 . LEU A 1 211 ? -15.488 6.618   0.319   1.00 35.27  ? 211 LEU A CD1 1 
ATOM   1617 C  CD2 . LEU A 1 211 ? -17.797 6.375   1.056   1.00 36.40  ? 211 LEU A CD2 1 
ATOM   1618 N  N   . SER A 1 212 ? -18.485 7.565   -4.072  1.00 47.68  ? 212 SER A N   1 
ATOM   1619 C  CA  . SER A 1 212 ? -18.778 8.699   -4.948  1.00 47.01  ? 212 SER A CA  1 
ATOM   1620 C  C   . SER A 1 212 ? -20.178 8.581   -5.532  1.00 50.38  ? 212 SER A C   1 
ATOM   1621 O  O   . SER A 1 212 ? -20.492 7.561   -6.151  1.00 58.27  ? 212 SER A O   1 
ATOM   1622 C  CB  . SER A 1 212 ? -17.742 8.765   -6.075  1.00 43.48  ? 212 SER A CB  1 
ATOM   1623 O  OG  . SER A 1 212 ? -18.068 9.779   -7.009  1.00 46.04  ? 212 SER A OG  1 
ATOM   1624 N  N   . PRO A 1 213 ? -21.029 9.601   -5.379  1.00 52.02  ? 213 PRO A N   1 
ATOM   1625 C  CA  . PRO A 1 213 ? -22.371 9.545   -5.992  1.00 52.93  ? 213 PRO A CA  1 
ATOM   1626 C  C   . PRO A 1 213 ? -22.358 9.385   -7.507  1.00 55.35  ? 213 PRO A C   1 
ATOM   1627 O  O   . PRO A 1 213 ? -23.217 8.674   -8.052  1.00 53.40  ? 213 PRO A O   1 
ATOM   1628 C  CB  . PRO A 1 213 ? -23.016 10.869  -5.564  1.00 42.41  ? 213 PRO A CB  1 
ATOM   1629 C  CG  . PRO A 1 213 ? -22.100 11.474  -4.555  1.00 45.93  ? 213 PRO A CG  1 
ATOM   1630 C  CD  . PRO A 1 213 ? -20.745 10.885  -4.733  1.00 47.93  ? 213 PRO A CD  1 
ATOM   1631 N  N   . GLY A 1 214 ? -21.402 10.002  -8.201  1.00 56.57  ? 214 GLY A N   1 
ATOM   1632 C  CA  . GLY A 1 214 ? -21.313 9.870   -9.643  1.00 56.32  ? 214 GLY A CA  1 
ATOM   1633 C  C   . GLY A 1 214 ? -21.050 8.472   -10.157 1.00 36.64  ? 214 GLY A C   1 
ATOM   1634 O  O   . GLY A 1 214 ? -21.100 8.252   -11.369 1.00 36.51  ? 214 GLY A O   1 
ATOM   1635 N  N   . SER A 1 215 ? -20.771 7.519   -9.283  1.00 35.63  ? 215 SER A N   1 
ATOM   1636 C  CA  . SER A 1 215 ? -20.430 6.173   -9.706  1.00 39.00  ? 215 SER A CA  1 
ATOM   1637 C  C   . SER A 1 215 ? -21.375 5.112   -9.180  1.00 43.87  ? 215 SER A C   1 
ATOM   1638 O  O   . SER A 1 215 ? -21.297 3.968   -9.638  1.00 48.88  ? 215 SER A O   1 
ATOM   1639 C  CB  . SER A 1 215 ? -19.004 5.810   -9.250  1.00 47.08  ? 215 SER A CB  1 
ATOM   1640 O  OG  . SER A 1 215 ? -18.024 6.724   -9.729  1.00 33.75  ? 215 SER A OG  1 
ATOM   1641 N  N   . ARG A 1 216 ? -22.261 5.453   -8.241  1.00 48.09  ? 216 ARG A N   1 
ATOM   1642 C  CA  . ARG A 1 216 ? -23.035 4.431   -7.545  1.00 57.39  ? 216 ARG A CA  1 
ATOM   1643 C  C   . ARG A 1 216 ? -23.928 3.652   -8.495  1.00 59.20  ? 216 ARG A C   1 
ATOM   1644 O  O   . ARG A 1 216 ? -24.072 2.429   -8.361  1.00 60.02  ? 216 ARG A O   1 
ATOM   1645 C  CB  . ARG A 1 216 ? -23.867 5.075   -6.443  1.00 57.61  ? 216 ARG A CB  1 
ATOM   1646 C  CG  . ARG A 1 216 ? -23.014 5.600   -5.319  1.00 59.22  ? 216 ARG A CG  1 
ATOM   1647 C  CD  . ARG A 1 216 ? -23.810 6.486   -4.403  1.00 62.18  ? 216 ARG A CD  1 
ATOM   1648 N  NE  . ARG A 1 216 ? -22.948 7.102   -3.406  1.00 65.11  ? 216 ARG A NE  1 
ATOM   1649 C  CZ  . ARG A 1 216 ? -23.382 7.923   -2.459  1.00 68.30  ? 216 ARG A CZ  1 
ATOM   1650 N  NH1 . ARG A 1 216 ? -22.525 8.442   -1.582  1.00 67.52  1 216 ARG A NH1 1 
ATOM   1651 N  NH2 . ARG A 1 216 ? -24.676 8.215   -2.390  1.00 66.84  ? 216 ARG A NH2 1 
ATOM   1652 N  N   . ASP A 1 217 ? -24.528 4.334   -9.464  1.00 56.00  ? 217 ASP A N   1 
ATOM   1653 C  CA  . ASP A 1 217 ? -25.532 3.701   -10.302 1.00 54.78  ? 217 ASP A CA  1 
ATOM   1654 C  C   . ASP A 1 217 ? -24.936 2.959   -11.488 1.00 51.41  ? 217 ASP A C   1 
ATOM   1655 O  O   . ASP A 1 217 ? -25.698 2.380   -12.275 1.00 52.79  ? 217 ASP A O   1 
ATOM   1656 C  CB  . ASP A 1 217 ? -26.545 4.742   -10.789 1.00 64.33  ? 217 ASP A CB  1 
ATOM   1657 C  CG  . ASP A 1 217 ? -27.166 5.540   -9.647  1.00 72.94  ? 217 ASP A CG  1 
ATOM   1658 O  OD1 . ASP A 1 217 ? -28.348 5.297   -9.319  1.00 74.21  ? 217 ASP A OD1 1 
ATOM   1659 O  OD2 . ASP A 1 217 ? -26.471 6.408   -9.073  1.00 82.01  1 217 ASP A OD2 1 
ATOM   1660 N  N   . LEU A 1 218 ? -23.604 2.941   -11.628 1.00 40.07  ? 218 LEU A N   1 
ATOM   1661 C  CA  . LEU A 1 218 ? -22.947 2.268   -12.741 1.00 36.80  ? 218 LEU A CA  1 
ATOM   1662 C  C   . LEU A 1 218 ? -22.411 0.894   -12.366 1.00 41.39  ? 218 LEU A C   1 
ATOM   1663 O  O   . LEU A 1 218 ? -21.557 0.345   -13.076 1.00 46.33  ? 218 LEU A O   1 
ATOM   1664 C  CB  . LEU A 1 218 ? -21.821 3.133   -13.298 1.00 34.02  ? 218 LEU A CB  1 
ATOM   1665 C  CG  . LEU A 1 218 ? -22.210 4.549   -13.685 1.00 34.45  ? 218 LEU A CG  1 
ATOM   1666 C  CD1 . LEU A 1 218 ? -20.956 5.365   -13.829 1.00 35.05  ? 218 LEU A CD1 1 
ATOM   1667 C  CD2 . LEU A 1 218 ? -22.986 4.543   -14.974 1.00 35.18  ? 218 LEU A CD2 1 
ATOM   1668 N  N   . PHE A 1 219 ? -22.883 0.334   -11.264 1.00 32.15  ? 219 PHE A N   1 
ATOM   1669 C  CA  . PHE A 1 219 ? -22.528 -1.023  -10.871 1.00 38.24  ? 219 PHE A CA  1 
ATOM   1670 C  C   . PHE A 1 219 ? -23.466 -1.424  -9.750  1.00 35.28  ? 219 PHE A C   1 
ATOM   1671 O  O   . PHE A 1 219 ? -24.132 -0.578  -9.139  1.00 39.62  ? 219 PHE A O   1 
ATOM   1672 C  CB  . PHE A 1 219 ? -21.069 -1.151  -10.414 1.00 36.55  ? 219 PHE A CB  1 
ATOM   1673 C  CG  . PHE A 1 219 ? -20.780 -0.436  -9.139  1.00 30.51  ? 219 PHE A CG  1 
ATOM   1674 C  CD1 . PHE A 1 219 ? -20.522 0.929   -9.152  1.00 30.98  ? 219 PHE A CD1 1 
ATOM   1675 C  CD2 . PHE A 1 219 ? -20.810 -1.112  -7.919  1.00 37.26  ? 219 PHE A CD2 1 
ATOM   1676 C  CE1 . PHE A 1 219 ? -20.273 1.619   -7.974  1.00 31.25  ? 219 PHE A CE1 1 
ATOM   1677 C  CE2 . PHE A 1 219 ? -20.572 -0.430  -6.727  1.00 37.25  ? 219 PHE A CE2 1 
ATOM   1678 C  CZ  . PHE A 1 219 ? -20.296 0.944   -6.757  1.00 31.05  ? 219 PHE A CZ  1 
ATOM   1679 N  N   . ARG A 1 220 ? -23.500 -2.723  -9.483  1.00 31.49  ? 220 ARG A N   1 
ATOM   1680 C  CA  . ARG A 1 220 ? -24.539 -3.285  -8.636  1.00 43.51  ? 220 ARG A CA  1 
ATOM   1681 C  C   . ARG A 1 220 ? -24.021 -3.689  -7.260  1.00 46.24  ? 220 ARG A C   1 
ATOM   1682 O  O   . ARG A 1 220 ? -24.635 -3.331  -6.243  1.00 38.04  ? 220 ARG A O   1 
ATOM   1683 C  CB  . ARG A 1 220 ? -25.191 -4.473  -9.348  1.00 44.53  ? 220 ARG A CB  1 
ATOM   1684 C  CG  . ARG A 1 220 ? -25.955 -5.370  -8.447  1.00 52.16  ? 220 ARG A CG  1 
ATOM   1685 C  CD  . ARG A 1 220 ? -27.339 -4.938  -8.357  1.00 82.23  ? 220 ARG A CD  1 
ATOM   1686 N  NE  . ARG A 1 220 ? -27.932 -5.573  -7.181  1.00 98.18  ? 220 ARG A NE  1 
ATOM   1687 C  CZ  . ARG A 1 220 ? -29.146 -6.095  -7.132  1.00 92.64  ? 220 ARG A CZ  1 
ATOM   1688 N  NH1 . ARG A 1 220 ? -29.876 -6.105  -8.237  1.00 85.98  1 220 ARG A NH1 1 
ATOM   1689 N  NH2 . ARG A 1 220 ? -29.574 -6.624  -5.995  1.00 89.36  ? 220 ARG A NH2 1 
ATOM   1690 N  N   . ARG A 1 221 ? -22.914 -4.433  -7.209  1.00 40.04  ? 221 ARG A N   1 
ATOM   1691 C  CA  . ARG A 1 221 ? -22.203 -4.726  -5.972  1.00 42.20  ? 221 ARG A CA  1 
ATOM   1692 C  C   . ARG A 1 221 ? -20.711 -4.627  -6.223  1.00 45.01  ? 221 ARG A C   1 
ATOM   1693 O  O   . ARG A 1 221 ? -20.263 -4.260  -7.318  1.00 44.22  ? 221 ARG A O   1 
ATOM   1694 C  CB  . ARG A 1 221 ? -22.530 -6.116  -5.443  1.00 38.94  ? 221 ARG A CB  1 
ATOM   1695 C  CG  . ARG A 1 221 ? -23.757 -6.661  -5.998  1.00 32.88  ? 221 ARG A CG  1 
ATOM   1696 C  CD  . ARG A 1 221 ? -23.868 -8.079  -5.620  1.00 44.78  ? 221 ARG A CD  1 
ATOM   1697 N  NE  . ARG A 1 221 ? -24.749 -8.745  -6.568  1.00 55.91  ? 221 ARG A NE  1 
ATOM   1698 C  CZ  . ARG A 1 221 ? -26.068 -8.810  -6.460  1.00 47.54  ? 221 ARG A CZ  1 
ATOM   1699 N  NH1 . ARG A 1 221 ? -26.687 -8.260  -5.414  1.00 36.91  1 221 ARG A NH1 1 
ATOM   1700 N  NH2 . ARG A 1 221 ? -26.739 -9.448  -7.400  1.00 46.57  ? 221 ARG A NH2 1 
ATOM   1701 N  N   . ALA A 1 222 ? -19.951 -5.035  -5.203  1.00 43.31  ? 222 ALA A N   1 
ATOM   1702 C  CA  . ALA A 1 222 ? -18.534 -4.721  -5.128  1.00 38.92  ? 222 ALA A CA  1 
ATOM   1703 C  C   . ALA A 1 222 ? -17.761 -5.796  -4.374  1.00 28.10  ? 222 ALA A C   1 
ATOM   1704 O  O   . ALA A 1 222 ? -18.204 -6.276  -3.330  1.00 37.67  ? 222 ALA A O   1 
ATOM   1705 C  CB  . ALA A 1 222 ? -18.354 -3.366  -4.453  1.00 31.37  ? 222 ALA A CB  1 
ATOM   1706 N  N   . ILE A 1 223 ? -16.599 -6.154  -4.910  1.00 35.15  ? 223 ILE A N   1 
ATOM   1707 C  CA  . ILE A 1 223 ? -15.633 -7.034  -4.259  1.00 29.78  ? 223 ILE A CA  1 
ATOM   1708 C  C   . ILE A 1 223 ? -14.325 -6.267  -4.117  1.00 30.33  ? 223 ILE A C   1 
ATOM   1709 O  O   . ILE A 1 223 ? -13.781 -5.772  -5.111  1.00 44.97  ? 223 ILE A O   1 
ATOM   1710 C  CB  . ILE A 1 223 ? -15.413 -8.324  -5.053  1.00 33.55  ? 223 ILE A CB  1 
ATOM   1711 C  CG1 . ILE A 1 223 ? -16.740 -9.042  -5.300  1.00 39.31  ? 223 ILE A CG1 1 
ATOM   1712 C  CG2 . ILE A 1 223 ? -14.406 -9.214  -4.344  1.00 42.83  ? 223 ILE A CG2 1 
ATOM   1713 C  CD1 . ILE A 1 223 ? -16.570 -10.392 -5.992  1.00 40.75  ? 223 ILE A CD1 1 
ATOM   1714 N  N   . LEU A 1 224 ? -13.828 -6.155  -2.891  1.00 30.14  ? 224 LEU A N   1 
ATOM   1715 C  CA  . LEU A 1 224 ? -12.588 -5.433  -2.600  1.00 40.32  ? 224 LEU A CA  1 
ATOM   1716 C  C   . LEU A 1 224 ? -11.567 -6.402  -2.025  1.00 41.62  ? 224 LEU A C   1 
ATOM   1717 O  O   . LEU A 1 224 ? -11.731 -6.885  -0.901  1.00 36.05  ? 224 LEU A O   1 
ATOM   1718 C  CB  . LEU A 1 224 ? -12.811 -4.280  -1.622  1.00 27.06  ? 224 LEU A CB  1 
ATOM   1719 C  CG  . LEU A 1 224 ? -13.910 -3.264  -1.913  1.00 34.68  ? 224 LEU A CG  1 
ATOM   1720 C  CD1 . LEU A 1 224 ? -15.297 -3.788  -1.552  1.00 30.70  ? 224 LEU A CD1 1 
ATOM   1721 C  CD2 . LEU A 1 224 ? -13.602 -1.963  -1.180  1.00 37.61  ? 224 LEU A CD2 1 
ATOM   1722 N  N   . GLN A 1 225 ? -10.503 -6.659  -2.771  1.00 38.02  ? 225 GLN A N   1 
ATOM   1723 C  CA  . GLN A 1 225 ? -9.444  -7.545  -2.317  1.00 35.89  ? 225 GLN A CA  1 
ATOM   1724 C  C   . GLN A 1 225 ? -8.275  -6.684  -1.868  1.00 44.96  ? 225 GLN A C   1 
ATOM   1725 O  O   . GLN A 1 225 ? -7.707  -5.939  -2.675  1.00 54.36  ? 225 GLN A O   1 
ATOM   1726 C  CB  . GLN A 1 225 ? -9.028  -8.505  -3.429  1.00 37.62  ? 225 GLN A CB  1 
ATOM   1727 C  CG  . GLN A 1 225 ? -10.178 -8.803  -4.379  1.00 43.12  ? 225 GLN A CG  1 
ATOM   1728 C  CD  . GLN A 1 225 ? -9.909  -9.932  -5.345  1.00 44.62  ? 225 GLN A CD  1 
ATOM   1729 O  OE1 . GLN A 1 225 ? -8.881  -10.606 -5.280  1.00 40.88  ? 225 GLN A OE1 1 
ATOM   1730 N  NE2 . GLN A 1 225 ? -10.851 -10.154 -6.247  1.00 55.02  ? 225 GLN A NE2 1 
ATOM   1731 N  N   . SER A 1 226 ? -7.955  -6.750  -0.574  1.00 37.94  ? 226 SER A N   1 
ATOM   1732 C  CA  . SER A 1 226 ? -6.723  -6.170  -0.032  1.00 28.80  ? 226 SER A CA  1 
ATOM   1733 C  C   . SER A 1 226 ? -6.645  -4.680  -0.328  1.00 31.38  ? 226 SER A C   1 
ATOM   1734 O  O   . SER A 1 226 ? -5.586  -4.142  -0.650  1.00 43.56  ? 226 SER A O   1 
ATOM   1735 C  CB  . SER A 1 226 ? -5.495  -6.881  -0.588  1.00 25.37  ? 226 SER A CB  1 
ATOM   1736 O  OG  . SER A 1 226 ? -5.300  -8.124  0.053   1.00 37.53  ? 226 SER A OG  1 
ATOM   1737 N  N   . GLY A 1 227 ? -7.782  -4.007  -0.235  1.00 32.73  ? 227 GLY A N   1 
ATOM   1738 C  CA  . GLY A 1 227 ? -7.837  -2.604  -0.592  1.00 38.33  ? 227 GLY A CA  1 
ATOM   1739 C  C   . GLY A 1 227 ? -9.070  -1.950  -0.026  1.00 42.59  ? 227 GLY A C   1 
ATOM   1740 O  O   . GLY A 1 227 ? -10.108 -2.592  0.166   1.00 46.89  ? 227 GLY A O   1 
ATOM   1741 N  N   . SER A 1 228 ? -8.961  -0.649  0.210   1.00 40.81  ? 228 SER A N   1 
ATOM   1742 C  CA  . SER A 1 228 ? -9.974  0.027   0.991   1.00 43.54  ? 228 SER A CA  1 
ATOM   1743 C  C   . SER A 1 228 ? -9.877  1.494   0.640   1.00 37.71  ? 228 SER A C   1 
ATOM   1744 O  O   . SER A 1 228 ? -8.763  1.991   0.436   1.00 39.92  ? 228 SER A O   1 
ATOM   1745 C  CB  . SER A 1 228 ? -9.742  -0.187  2.491   1.00 54.96  ? 228 SER A CB  1 
ATOM   1746 O  OG  . SER A 1 228 ? -10.912 0.078   3.229   1.00 61.89  ? 228 SER A OG  1 
ATOM   1747 N  N   . PRO A 1 229 ? -10.990 2.208   0.532   1.00 36.45  ? 229 PRO A N   1 
ATOM   1748 C  CA  . PRO A 1 229 ? -10.887 3.612   0.119   1.00 36.13  ? 229 PRO A CA  1 
ATOM   1749 C  C   . PRO A 1 229 ? -10.241 4.490   1.181   1.00 43.12  ? 229 PRO A C   1 
ATOM   1750 O  O   . PRO A 1 229 ? -9.588  5.476   0.828   1.00 48.13  ? 229 PRO A O   1 
ATOM   1751 C  CB  . PRO A 1 229 ? -12.341 4.018   -0.168  1.00 32.85  ? 229 PRO A CB  1 
ATOM   1752 C  CG  . PRO A 1 229 ? -13.185 3.026   0.555   1.00 34.49  ? 229 PRO A CG  1 
ATOM   1753 C  CD  . PRO A 1 229 ? -12.371 1.782   0.814   1.00 35.52  ? 229 PRO A CD  1 
ATOM   1754 N  N   . ASN A 1 230 ? -10.364 4.157   2.465   1.00 43.80  ? 230 ASN A N   1 
ATOM   1755 C  CA  . ASN A 1 230 ? -9.752  4.969   3.512   1.00 48.93  ? 230 ASN A CA  1 
ATOM   1756 C  C   . ASN A 1 230 ? -8.295  4.607   3.803   1.00 48.87  ? 230 ASN A C   1 
ATOM   1757 O  O   . ASN A 1 230 ? -7.692  5.253   4.660   1.00 55.60  ? 230 ASN A O   1 
ATOM   1758 C  CB  . ASN A 1 230 ? -10.571 4.888   4.811   1.00 44.78  ? 230 ASN A CB  1 
ATOM   1759 C  CG  . ASN A 1 230 ? -10.811 3.459   5.263   1.00 53.26  ? 230 ASN A CG  1 
ATOM   1760 O  OD1 . ASN A 1 230 ? -10.944 2.559   4.440   1.00 56.44  ? 230 ASN A OD1 1 
ATOM   1761 N  ND2 . ASN A 1 230 ? -10.881 3.248   6.579   1.00 56.45  ? 230 ASN A ND2 1 
ATOM   1762 N  N   . CYS A 1 231 ? -7.703  3.615   3.112   1.00 42.90  ? 231 CYS A N   1 
ATOM   1763 C  CA  . CYS A 1 231 ? -6.286  3.296   3.296   1.00 47.71  ? 231 CYS A CA  1 
ATOM   1764 C  C   . CYS A 1 231 ? -5.455  4.577   3.266   1.00 60.10  ? 231 CYS A C   1 
ATOM   1765 O  O   . CYS A 1 231 ? -5.820  5.534   2.570   1.00 68.49  ? 231 CYS A O   1 
ATOM   1766 C  CB  . CYS A 1 231 ? -5.786  2.317   2.226   1.00 46.36  ? 231 CYS A CB  1 
ATOM   1767 S  SG  . CYS A 1 231 ? -6.375  0.603   2.390   1.00 57.76  ? 231 CYS A SG  1 
ATOM   1768 N  N   . PRO A 1 232 ? -4.349  4.651   4.011   1.00 62.39  ? 232 PRO A N   1 
ATOM   1769 C  CA  . PRO A 1 232 ? -3.626  5.928   4.093   1.00 52.97  ? 232 PRO A CA  1 
ATOM   1770 C  C   . PRO A 1 232 ? -2.859  6.254   2.831   1.00 52.53  ? 232 PRO A C   1 
ATOM   1771 O  O   . PRO A 1 232 ? -2.636  7.436   2.542   1.00 62.37  ? 232 PRO A O   1 
ATOM   1772 C  CB  . PRO A 1 232 ? -2.693  5.721   5.286   1.00 60.13  ? 232 PRO A CB  1 
ATOM   1773 C  CG  . PRO A 1 232 ? -2.431  4.244   5.281   1.00 63.50  ? 232 PRO A CG  1 
ATOM   1774 C  CD  . PRO A 1 232 ? -3.676  3.578   4.767   1.00 63.52  ? 232 PRO A CD  1 
ATOM   1775 N  N   . TRP A 1 233 ? -2.461  5.244   2.062   1.00 49.17  ? 233 TRP A N   1 
ATOM   1776 C  CA  . TRP A 1 233 ? -1.745  5.473   0.813   1.00 51.32  ? 233 TRP A CA  1 
ATOM   1777 C  C   . TRP A 1 233 ? -2.669  5.813   -0.354  1.00 56.21  ? 233 TRP A C   1 
ATOM   1778 O  O   . TRP A 1 233 ? -2.171  6.180   -1.427  1.00 51.50  ? 233 TRP A O   1 
ATOM   1779 C  CB  . TRP A 1 233 ? -0.904  4.238   0.460   1.00 40.02  ? 233 TRP A CB  1 
ATOM   1780 C  CG  . TRP A 1 233 ? -1.688  2.971   0.557   1.00 48.48  ? 233 TRP A CG  1 
ATOM   1781 C  CD1 . TRP A 1 233 ? -1.730  2.118   1.614   1.00 59.27  ? 233 TRP A CD1 1 
ATOM   1782 C  CD2 . TRP A 1 233 ? -2.573  2.430   -0.429  1.00 56.39  ? 233 TRP A CD2 1 
ATOM   1783 N  NE1 . TRP A 1 233 ? -2.572  1.069   1.348   1.00 63.94  ? 233 TRP A NE1 1 
ATOM   1784 C  CE2 . TRP A 1 233 ? -3.105  1.238   0.099   1.00 65.97  ? 233 TRP A CE2 1 
ATOM   1785 C  CE3 . TRP A 1 233 ? -2.970  2.837   -1.707  1.00 52.79  ? 233 TRP A CE3 1 
ATOM   1786 C  CZ2 . TRP A 1 233 ? -4.011  0.443   -0.610  1.00 65.35  ? 233 TRP A CZ2 1 
ATOM   1787 C  CZ3 . TRP A 1 233 ? -3.866  2.050   -2.406  1.00 53.99  ? 233 TRP A CZ3 1 
ATOM   1788 C  CH2 . TRP A 1 233 ? -4.371  0.862   -1.859  1.00 57.03  ? 233 TRP A CH2 1 
ATOM   1789 N  N   . ALA A 1 234 ? -3.992  5.722   -0.172  1.00 57.34  ? 234 ALA A N   1 
ATOM   1790 C  CA  . ALA A 1 234 ? -4.933  5.809   -1.285  1.00 57.39  ? 234 ALA A CA  1 
ATOM   1791 C  C   . ALA A 1 234 ? -5.421  7.223   -1.588  1.00 59.23  ? 234 ALA A C   1 
ATOM   1792 O  O   . ALA A 1 234 ? -5.862  7.474   -2.717  1.00 60.74  ? 234 ALA A O   1 
ATOM   1793 C  CB  . ALA A 1 234 ? -6.139  4.908   -1.023  1.00 62.18  ? 234 ALA A CB  1 
ATOM   1794 N  N   . SER A 1 235 ? -5.357  8.156   -0.639  1.00 55.81  ? 235 SER A N   1 
ATOM   1795 C  CA  . SER A 1 235 ? -5.758  9.523   -0.936  1.00 50.96  ? 235 SER A CA  1 
ATOM   1796 C  C   . SER A 1 235 ? -4.796  10.525  -0.306  1.00 51.10  ? 235 SER A C   1 
ATOM   1797 O  O   . SER A 1 235 ? -4.015  10.204  0.598   1.00 56.71  ? 235 SER A O   1 
ATOM   1798 C  CB  . SER A 1 235 ? -7.204  9.806   -0.482  1.00 52.12  ? 235 SER A CB  1 
ATOM   1799 O  OG  . SER A 1 235 ? -7.428  9.441   0.870   1.00 57.78  ? 235 SER A OG  1 
ATOM   1800 N  N   . VAL A 1 236 ? -4.850  11.747  -0.839  1.00 44.56  ? 236 VAL A N   1 
ATOM   1801 C  CA  . VAL A 1 236 ? -4.213  12.926  -0.275  1.00 41.21  ? 236 VAL A CA  1 
ATOM   1802 C  C   . VAL A 1 236 ? -5.273  14.010  -0.103  1.00 57.32  ? 236 VAL A C   1 
ATOM   1803 O  O   . VAL A 1 236 ? -6.365  13.954  -0.678  1.00 55.82  ? 236 VAL A O   1 
ATOM   1804 C  CB  . VAL A 1 236 ? -3.053  13.453  -1.148  1.00 47.59  ? 236 VAL A CB  1 
ATOM   1805 C  CG1 . VAL A 1 236 ? -1.953  12.407  -1.305  1.00 49.87  ? 236 VAL A CG1 1 
ATOM   1806 C  CG2 . VAL A 1 236 ? -3.561  13.905  -2.500  1.00 44.25  ? 236 VAL A CG2 1 
ATOM   1807 N  N   . SER A 1 237 ? -4.942  15.006  0.709   1.00 63.94  ? 237 SER A N   1 
ATOM   1808 C  CA  . SER A 1 237 ? -5.778  16.191  0.745   1.00 63.90  ? 237 SER A CA  1 
ATOM   1809 C  C   . SER A 1 237 ? -5.532  17.039  -0.501  1.00 67.93  ? 237 SER A C   1 
ATOM   1810 O  O   . SER A 1 237 ? -4.632  16.779  -1.304  1.00 63.56  ? 237 SER A O   1 
ATOM   1811 C  CB  . SER A 1 237 ? -5.504  17.011  1.998   1.00 63.22  ? 237 SER A CB  1 
ATOM   1812 O  OG  . SER A 1 237 ? -4.279  17.712  1.861   1.00 68.84  ? 237 SER A OG  1 
ATOM   1813 N  N   . VAL A 1 238 ? -6.348  18.081  -0.646  1.00 71.68  ? 238 VAL A N   1 
ATOM   1814 C  CA  . VAL A 1 238 ? -6.257  18.952  -1.814  1.00 70.06  ? 238 VAL A CA  1 
ATOM   1815 C  C   . VAL A 1 238 ? -4.946  19.722  -1.812  1.00 63.13  ? 238 VAL A C   1 
ATOM   1816 O  O   . VAL A 1 238 ? -4.284  19.864  -2.849  1.00 62.45  ? 238 VAL A O   1 
ATOM   1817 C  CB  . VAL A 1 238 ? -7.463  19.905  -1.850  1.00 73.06  ? 238 VAL A CB  1 
ATOM   1818 C  CG1 . VAL A 1 238 ? -7.345  20.811  -3.014  1.00 72.19  ? 238 VAL A CG1 1 
ATOM   1819 C  CG2 . VAL A 1 238 ? -8.745  19.113  -1.952  1.00 72.71  ? 238 VAL A CG2 1 
ATOM   1820 N  N   . ALA A 1 239 ? -4.568  20.258  -0.654  1.00 63.94  ? 239 ALA A N   1 
ATOM   1821 C  CA  . ALA A 1 239 ? -3.335  21.022  -0.557  1.00 61.84  ? 239 ALA A CA  1 
ATOM   1822 C  C   . ALA A 1 239 ? -2.127  20.166  -0.903  1.00 61.53  ? 239 ALA A C   1 
ATOM   1823 O  O   . ALA A 1 239 ? -1.213  20.623  -1.598  1.00 62.52  ? 239 ALA A O   1 
ATOM   1824 C  CB  . ALA A 1 239 ? -3.211  21.592  0.849   1.00 61.01  ? 239 ALA A CB  1 
ATOM   1825 N  N   . GLU A 1 240 ? -2.112  18.918  -0.435  1.00 62.64  ? 240 GLU A N   1 
ATOM   1826 C  CA  . GLU A 1 240 ? -0.944  18.062  -0.618  1.00 63.66  ? 240 GLU A CA  1 
ATOM   1827 C  C   . GLU A 1 240 ? -0.766  17.666  -2.080  1.00 72.38  ? 240 GLU A C   1 
ATOM   1828 O  O   . GLU A 1 240 ? 0.341   17.745  -2.628  1.00 78.60  ? 240 GLU A O   1 
ATOM   1829 C  CB  . GLU A 1 240 ? -1.069  16.822  0.272   1.00 59.76  ? 240 GLU A CB  1 
ATOM   1830 C  CG  . GLU A 1 240 ? 0.016   15.785  0.068   1.00 60.86  ? 240 GLU A CG  1 
ATOM   1831 C  CD  . GLU A 1 240 ? 1.364   16.239  0.605   1.00 61.98  ? 240 GLU A CD  1 
ATOM   1832 O  OE1 . GLU A 1 240 ? 1.431   17.349  1.174   1.00 59.92  ? 240 GLU A OE1 1 
ATOM   1833 O  OE2 . GLU A 1 240 ? 2.349   15.476  0.471   1.00 59.00  1 240 GLU A OE2 1 
ATOM   1834 N  N   . GLY A 1 241 ? -1.848  17.229  -2.730  1.00 67.97  ? 241 GLY A N   1 
ATOM   1835 C  CA  . GLY A 1 241 ? -1.759  16.887  -4.137  1.00 59.83  ? 241 GLY A CA  1 
ATOM   1836 C  C   . GLY A 1 241 ? -1.341  18.064  -4.991  1.00 58.91  ? 241 GLY A C   1 
ATOM   1837 O  O   . GLY A 1 241 ? -0.747  17.880  -6.060  1.00 67.26  ? 241 GLY A O   1 
ATOM   1838 N  N   . ARG A 1 242 ? -1.644  19.284  -4.534  1.00 56.11  ? 242 ARG A N   1 
ATOM   1839 C  CA  . ARG A 1 242 ? -1.107  20.479  -5.175  1.00 64.34  ? 242 ARG A CA  1 
ATOM   1840 C  C   . ARG A 1 242 ? 0.408   20.538  -5.017  1.00 74.01  ? 242 ARG A C   1 
ATOM   1841 O  O   . ARG A 1 242 ? 1.147   20.576  -6.009  1.00 74.51  ? 242 ARG A O   1 
ATOM   1842 C  CB  . ARG A 1 242 ? -1.759  21.745  -4.602  1.00 55.42  ? 242 ARG A CB  1 
ATOM   1843 C  CG  . ARG A 1 242 ? -0.803  22.928  -4.461  1.00 59.69  ? 242 ARG A CG  1 
ATOM   1844 C  CD  . ARG A 1 242 ? -1.482  24.274  -4.604  1.00 72.54  ? 242 ARG A CD  1 
ATOM   1845 N  NE  . ARG A 1 242 ? -1.962  24.501  -5.977  1.00 79.94  ? 242 ARG A NE  1 
ATOM   1846 C  CZ  . ARG A 1 242 ? -3.234  24.621  -6.339  1.00 76.01  ? 242 ARG A CZ  1 
ATOM   1847 N  NH1 . ARG A 1 242 ? -3.532  24.837  -7.606  1.00 73.65  1 242 ARG A NH1 1 
ATOM   1848 N  NH2 . ARG A 1 242 ? -4.186  24.538  -5.427  1.00 76.52  ? 242 ARG A NH2 1 
ATOM   1849 N  N   . ARG A 1 243 ? 0.894   20.538  -3.769  1.00 73.91  ? 243 ARG A N   1 
ATOM   1850 C  CA  . ARG A 1 243 ? 2.315   20.781  -3.580  1.00 74.27  ? 243 ARG A CA  1 
ATOM   1851 C  C   . ARG A 1 243 ? 3.129   19.735  -4.319  1.00 69.40  ? 243 ARG A C   1 
ATOM   1852 O  O   . ARG A 1 243 ? 4.203   20.050  -4.847  1.00 80.38  ? 243 ARG A O   1 
ATOM   1853 C  CB  . ARG A 1 243 ? 2.672   20.836  -2.089  1.00 78.08  ? 243 ARG A CB  1 
ATOM   1854 C  CG  . ARG A 1 243 ? 2.339   19.602  -1.272  1.00 83.06  ? 243 ARG A CG  1 
ATOM   1855 C  CD  . ARG A 1 243 ? 3.057   19.603  0.081   1.00 83.97  ? 243 ARG A CD  1 
ATOM   1856 N  NE  . ARG A 1 243 ? 4.463   19.203  -0.011  1.00 80.46  ? 243 ARG A NE  1 
ATOM   1857 C  CZ  . ARG A 1 243 ? 4.882   17.956  -0.225  1.00 76.52  ? 243 ARG A CZ  1 
ATOM   1858 N  NH1 . ARG A 1 243 ? 4.007   16.970  -0.385  1.00 67.34  1 243 ARG A NH1 1 
ATOM   1859 N  NH2 . ARG A 1 243 ? 6.182   17.697  -0.290  1.00 79.43  ? 243 ARG A NH2 1 
ATOM   1860 N  N   . ARG A 1 244 ? 2.598   18.511  -4.443  1.00 54.28  ? 244 ARG A N   1 
ATOM   1861 C  CA  . ARG A 1 244 ? 3.299   17.497  -5.233  1.00 57.58  ? 244 ARG A CA  1 
ATOM   1862 C  C   . ARG A 1 244 ? 3.246   17.817  -6.724  1.00 57.72  ? 244 ARG A C   1 
ATOM   1863 O  O   . ARG A 1 244 ? 4.233   17.624  -7.445  1.00 50.45  ? 244 ARG A O   1 
ATOM   1864 C  CB  . ARG A 1 244 ? 2.734   16.104  -4.965  1.00 51.05  ? 244 ARG A CB  1 
ATOM   1865 C  CG  . ARG A 1 244 ? 2.647   15.747  -3.508  1.00 49.73  ? 244 ARG A CG  1 
ATOM   1866 C  CD  . ARG A 1 244 ? 2.092   14.361  -3.347  1.00 50.12  ? 244 ARG A CD  1 
ATOM   1867 N  NE  . ARG A 1 244 ? 2.225   13.900  -1.957  1.00 60.94  ? 244 ARG A NE  1 
ATOM   1868 C  CZ  . ARG A 1 244 ? 1.865   12.701  -1.507  1.00 68.25  ? 244 ARG A CZ  1 
ATOM   1869 N  NH1 . ARG A 1 244 ? 1.334   11.817  -2.335  1.00 60.20  1 244 ARG A NH1 1 
ATOM   1870 N  NH2 . ARG A 1 244 ? 2.031   12.412  -0.229  1.00 79.04  ? 244 ARG A NH2 1 
ATOM   1871 N  N   . ALA A 1 245 ? 2.112   18.303  -7.218  1.00 58.66  ? 245 ALA A N   1 
ATOM   1872 C  CA  . ALA A 1 245 ? 2.128   18.836  -8.573  1.00 64.79  ? 245 ALA A CA  1 
ATOM   1873 C  C   . ALA A 1 245 ? 3.116   19.998  -8.680  1.00 71.54  ? 245 ALA A C   1 
ATOM   1874 O  O   . ALA A 1 245 ? 3.962   20.028  -9.584  1.00 54.85  ? 245 ALA A O   1 
ATOM   1875 C  CB  . ALA A 1 245 ? 0.721   19.259  -8.989  1.00 56.63  ? 245 ALA A CB  1 
ATOM   1876 N  N   . VAL A 1 246 ? 3.046   20.951  -7.740  1.00 80.21  ? 246 VAL A N   1 
ATOM   1877 C  CA  . VAL A 1 246 ? 3.879   22.149  -7.838  1.00 85.54  ? 246 VAL A CA  1 
ATOM   1878 C  C   . VAL A 1 246 ? 5.345   21.769  -7.868  1.00 96.09  ? 246 VAL A C   1 
ATOM   1879 O  O   . VAL A 1 246 ? 6.147   22.367  -8.601  1.00 92.39  ? 246 VAL A O   1 
ATOM   1880 C  CB  . VAL A 1 246 ? 3.584   23.128  -6.684  1.00 76.16  ? 246 VAL A CB  1 
ATOM   1881 C  CG1 . VAL A 1 246 ? 4.467   24.355  -6.807  1.00 63.82  ? 246 VAL A CG1 1 
ATOM   1882 C  CG2 . VAL A 1 246 ? 2.123   23.551  -6.692  1.00 74.64  ? 246 VAL A CG2 1 
ATOM   1883 N  N   . GLU A 1 247 ? 5.712   20.751  -7.093  1.00 101.66 ? 247 GLU A N   1 
ATOM   1884 C  CA  . GLU A 1 247 ? 7.121   20.449  -6.911  1.00 105.90 ? 247 GLU A CA  1 
ATOM   1885 C  C   . GLU A 1 247 ? 7.627   19.583  -8.060  1.00 94.50  ? 247 GLU A C   1 
ATOM   1886 O  O   . GLU A 1 247 ? 8.734   19.807  -8.579  1.00 101.81 ? 247 GLU A O   1 
ATOM   1887 C  CB  . GLU A 1 247 ? 7.316   19.795  -5.535  1.00 112.05 ? 247 GLU A CB  1 
ATOM   1888 C  CG  . GLU A 1 247 ? 8.765   19.709  -5.030  1.00 123.21 ? 247 GLU A CG  1 
ATOM   1889 C  CD  . GLU A 1 247 ? 9.582   18.553  -5.570  1.00 134.08 ? 247 GLU A CD  1 
ATOM   1890 O  OE1 . GLU A 1 247 ? 9.183   17.898  -6.566  1.00 140.86 ? 247 GLU A OE1 1 
ATOM   1891 O  OE2 . GLU A 1 247 ? 10.671  18.291  -4.996  1.00 131.65 1 247 GLU A OE2 1 
ATOM   1892 N  N   . LEU A 1 248 ? 6.816   18.601  -8.489  1.00 83.30  ? 248 LEU A N   1 
ATOM   1893 C  CA  . LEU A 1 248 ? 7.122   17.895  -9.730  1.00 79.37  ? 248 LEU A CA  1 
ATOM   1894 C  C   . LEU A 1 248 ? 7.368   18.879  -10.866 1.00 78.50  ? 248 LEU A C   1 
ATOM   1895 O  O   . LEU A 1 248 ? 8.204   18.627  -11.749 1.00 85.16  ? 248 LEU A O   1 
ATOM   1896 C  CB  . LEU A 1 248 ? 5.990   16.940  -10.096 1.00 72.35  ? 248 LEU A CB  1 
ATOM   1897 C  CG  . LEU A 1 248 ? 6.093   16.233  -11.475 1.00 57.38  ? 248 LEU A CG  1 
ATOM   1898 C  CD1 . LEU A 1 248 ? 5.915   14.706  -11.413 1.00 52.16  ? 248 LEU A CD1 1 
ATOM   1899 C  CD2 . LEU A 1 248 ? 5.157   16.821  -12.511 1.00 55.14  ? 248 LEU A CD2 1 
ATOM   1900 N  N   . GLY A 1 249 ? 6.642   19.999  -10.867 1.00 69.85  ? 249 GLY A N   1 
ATOM   1901 C  CA  . GLY A 1 249 ? 6.982   21.080  -11.768 1.00 69.87  ? 249 GLY A CA  1 
ATOM   1902 C  C   . GLY A 1 249 ? 8.388   21.587  -11.528 1.00 71.17  ? 249 GLY A C   1 
ATOM   1903 O  O   . GLY A 1 249 ? 9.212   21.630  -12.444 1.00 70.25  ? 249 GLY A O   1 
ATOM   1904 N  N   . ARG A 1 250 ? 8.693   21.946  -10.279 1.00 74.46  ? 250 ARG A N   1 
ATOM   1905 C  CA  . ARG A 1 250 ? 10.026  22.450  -9.969  1.00 84.25  ? 250 ARG A CA  1 
ATOM   1906 C  C   . ARG A 1 250 ? 11.092  21.369  -10.153 1.00 86.64  ? 250 ARG A C   1 
ATOM   1907 O  O   . ARG A 1 250 ? 12.206  21.673  -10.590 1.00 84.97  ? 250 ARG A O   1 
ATOM   1908 C  CB  . ARG A 1 250 ? 10.055  23.025  -8.548  1.00 86.06  ? 250 ARG A CB  1 
ATOM   1909 C  CG  . ARG A 1 250 ? 11.433  23.094  -7.918  1.00 92.86  ? 250 ARG A CG  1 
ATOM   1910 C  CD  . ARG A 1 250 ? 11.418  23.909  -6.640  1.00 98.25  ? 250 ARG A CD  1 
ATOM   1911 N  NE  . ARG A 1 250 ? 11.232  23.073  -5.455  1.00 102.54 ? 250 ARG A NE  1 
ATOM   1912 C  CZ  . ARG A 1 250 ? 12.217  22.454  -4.805  1.00 98.88  ? 250 ARG A CZ  1 
ATOM   1913 N  NH1 . ARG A 1 250 ? 11.950  21.721  -3.729  1.00 89.89  1 250 ARG A NH1 1 
ATOM   1914 N  NH2 . ARG A 1 250 ? 13.470  22.565  -5.229  1.00 100.08 ? 250 ARG A NH2 1 
ATOM   1915 N  N   . ASN A 1 251 ? 10.767  20.103  -9.861  1.00 91.54  ? 251 ASN A N   1 
ATOM   1916 C  CA  . ASN A 1 251 ? 11.690  19.003  -10.148 1.00 94.07  ? 251 ASN A CA  1 
ATOM   1917 C  C   . ASN A 1 251 ? 11.870  18.724  -11.640 1.00 96.85  ? 251 ASN A C   1 
ATOM   1918 O  O   . ASN A 1 251 ? 12.600  17.788  -11.983 1.00 100.21 ? 251 ASN A O   1 
ATOM   1919 C  CB  . ASN A 1 251 ? 11.266  17.696  -9.467  1.00 88.47  ? 251 ASN A CB  1 
ATOM   1920 C  CG  . ASN A 1 251 ? 12.018  17.428  -8.173  1.00 92.70  ? 251 ASN A CG  1 
ATOM   1921 O  OD1 . ASN A 1 251 ? 11.425  17.311  -7.113  1.00 88.53  ? 251 ASN A OD1 1 
ATOM   1922 N  ND2 . ASN A 1 251 ? 13.338  17.355  -8.258  1.00 103.39 ? 251 ASN A ND2 1 
ATOM   1923 N  N   . LEU A 1 252 ? 11.226  19.471  -12.536 1.00 91.02  ? 252 LEU A N   1 
ATOM   1924 C  CA  . LEU A 1 252 ? 11.621  19.458  -13.939 1.00 82.36  ? 252 LEU A CA  1 
ATOM   1925 C  C   . LEU A 1 252 ? 11.704  20.879  -14.479 1.00 78.31  ? 252 LEU A C   1 
ATOM   1926 O  O   . LEU A 1 252 ? 11.619  21.086  -15.694 1.00 70.92  ? 252 LEU A O   1 
ATOM   1927 C  CB  . LEU A 1 252 ? 10.684  18.584  -14.782 1.00 81.13  ? 252 LEU A CB  1 
ATOM   1928 C  CG  . LEU A 1 252 ? 11.272  17.175  -14.984 1.00 79.19  ? 252 LEU A CG  1 
ATOM   1929 C  CD1 . LEU A 1 252 ? 10.508  16.370  -16.022 1.00 75.34  ? 252 LEU A CD1 1 
ATOM   1930 C  CD2 . LEU A 1 252 ? 12.760  17.242  -15.342 1.00 77.79  ? 252 LEU A CD2 1 
ATOM   1931 N  N   . ASN A 1 253 ? 11.888  21.846  -13.579 1.00 83.59  ? 253 ASN A N   1 
ATOM   1932 C  CA  . ASN A 1 253 ? 12.121  23.256  -13.889 1.00 90.51  ? 253 ASN A CA  1 
ATOM   1933 C  C   . ASN A 1 253 ? 11.056  23.798  -14.841 1.00 92.34  ? 253 ASN A C   1 
ATOM   1934 O  O   . ASN A 1 253 ? 11.278  24.043  -16.027 1.00 92.60  ? 253 ASN A O   1 
ATOM   1935 C  CB  . ASN A 1 253 ? 13.533  23.465  -14.435 1.00 96.01  ? 253 ASN A CB  1 
ATOM   1936 C  CG  . ASN A 1 253 ? 14.550  23.574  -13.332 1.00 104.55 ? 253 ASN A CG  1 
ATOM   1937 O  OD1 . ASN A 1 253 ? 15.554  22.862  -13.317 1.00 108.70 ? 253 ASN A OD1 1 
ATOM   1938 N  ND2 . ASN A 1 253 ? 14.282  24.459  -12.377 1.00 106.71 ? 253 ASN A ND2 1 
ATOM   1939 N  N   . CYS A 1 254 ? 9.882   23.987  -14.254 1.00 89.62  ? 254 CYS A N   1 
ATOM   1940 C  CA  . CYS A 1 254 ? 8.708   24.504  -14.932 1.00 88.95  ? 254 CYS A CA  1 
ATOM   1941 C  C   . CYS A 1 254 ? 8.340   25.871  -14.371 1.00 87.32  ? 254 CYS A C   1 
ATOM   1942 O  O   . CYS A 1 254 ? 8.837   26.297  -13.324 1.00 90.49  ? 254 CYS A O   1 
ATOM   1943 C  CB  . CYS A 1 254 ? 7.535   23.527  -14.784 1.00 87.90  ? 254 CYS A CB  1 
ATOM   1944 S  SG  . CYS A 1 254 ? 7.602   22.151  -15.944 1.00 83.54  ? 254 CYS A SG  1 
ATOM   1945 N  N   . ASN A 1 255 ? 7.459   26.560  -15.086 1.00 82.58  ? 255 ASN A N   1 
ATOM   1946 C  CA  . ASN A 1 255 ? 6.882   27.797  -14.587 1.00 88.21  ? 255 ASN A CA  1 
ATOM   1947 C  C   . ASN A 1 255 ? 5.998   27.511  -13.377 1.00 94.28  ? 255 ASN A C   1 
ATOM   1948 O  O   . ASN A 1 255 ? 5.204   26.564  -13.385 1.00 98.67  ? 255 ASN A O   1 
ATOM   1949 C  CB  . ASN A 1 255 ? 6.068   28.457  -15.690 1.00 93.63  ? 255 ASN A CB  1 
ATOM   1950 C  CG  . ASN A 1 255 ? 6.161   29.948  -15.643 1.00 104.14 ? 255 ASN A CG  1 
ATOM   1951 O  OD1 . ASN A 1 255 ? 6.135   30.539  -14.570 1.00 106.30 ? 255 ASN A OD1 1 
ATOM   1952 N  ND2 . ASN A 1 255 ? 6.332   30.571  -16.809 1.00 109.71 ? 255 ASN A ND2 1 
ATOM   1953 N  N   . LEU A 1 256 ? 6.125   28.337  -12.332 1.00 93.13  ? 256 LEU A N   1 
ATOM   1954 C  CA  . LEU A 1 256 ? 5.481   28.032  -11.058 1.00 94.47  ? 256 LEU A CA  1 
ATOM   1955 C  C   . LEU A 1 256 ? 4.556   29.117  -10.518 1.00 102.90 ? 256 LEU A C   1 
ATOM   1956 O  O   . LEU A 1 256 ? 3.830   28.845  -9.553  1.00 102.70 ? 256 LEU A O   1 
ATOM   1957 C  CB  . LEU A 1 256 ? 6.535   27.709  -9.981  1.00 91.90  ? 256 LEU A CB  1 
ATOM   1958 C  CG  . LEU A 1 256 ? 6.656   26.246  -9.517  1.00 85.17  ? 256 LEU A CG  1 
ATOM   1959 C  CD1 . LEU A 1 256 ? 6.781   25.278  -10.693 1.00 84.96  ? 256 LEU A CD1 1 
ATOM   1960 C  CD2 . LEU A 1 256 ? 7.807   26.043  -8.515  1.00 77.19  ? 256 LEU A CD2 1 
ATOM   1961 N  N   . ASN A 1 257 ? 4.530   30.318  -11.115 1.00 108.65 ? 257 ASN A N   1 
ATOM   1962 C  CA  . ASN A 1 257 ? 3.738   31.417  -10.559 1.00 119.36 ? 257 ASN A CA  1 
ATOM   1963 C  C   . ASN A 1 257 ? 2.233   31.165  -10.586 1.00 118.43 ? 257 ASN A C   1 
ATOM   1964 O  O   . ASN A 1 257 ? 1.488   31.969  -10.013 1.00 121.85 ? 257 ASN A O   1 
ATOM   1965 C  CB  . ASN A 1 257 ? 4.011   32.733  -11.297 1.00 130.12 ? 257 ASN A CB  1 
ATOM   1966 C  CG  . ASN A 1 257 ? 5.355   32.810  -11.884 1.00 137.76 ? 257 ASN A CG  1 
ATOM   1967 O  OD1 . ASN A 1 257 ? 5.507   32.630  -13.045 1.00 137.94 ? 257 ASN A OD1 1 
ATOM   1968 N  ND2 . ASN A 1 257 ? 6.344   33.084  -11.083 1.00 143.31 ? 257 ASN A ND2 1 
ATOM   1969 N  N   . SER A 1 258 ? 1.761   30.097  -11.231 1.00 112.33 ? 258 SER A N   1 
ATOM   1970 C  CA  . SER A 1 258 ? 0.324   29.866  -11.309 1.00 105.23 ? 258 SER A CA  1 
ATOM   1971 C  C   . SER A 1 258 ? 0.017   28.389  -11.471 1.00 96.87  ? 258 SER A C   1 
ATOM   1972 O  O   . SER A 1 258 ? 0.693   27.530  -10.888 1.00 90.66  ? 258 SER A O   1 
ATOM   1973 C  CB  . SER A 1 258 ? -0.304  30.626  -12.485 1.00 99.71  ? 258 SER A CB  1 
ATOM   1974 O  OG  . SER A 1 258 ? -0.152  29.900  -13.699 1.00 88.39  ? 258 SER A OG  1 
ATOM   1975 N  N   . ASP A 1 259 ? -1.021  28.108  -12.264 1.00 94.54  ? 259 ASP A N   1 
ATOM   1976 C  CA  . ASP A 1 259 ? -1.333  26.761  -12.724 1.00 95.04  ? 259 ASP A CA  1 
ATOM   1977 C  C   . ASP A 1 259 ? -1.183  26.680  -14.238 1.00 98.06  ? 259 ASP A C   1 
ATOM   1978 O  O   . ASP A 1 259 ? -0.344  25.920  -14.725 1.00 102.04 ? 259 ASP A O   1 
ATOM   1979 C  CB  . ASP A 1 259 ? -2.744  26.343  -12.302 1.00 93.72  ? 259 ASP A CB  1 
ATOM   1980 C  CG  . ASP A 1 259 ? -2.815  25.846  -10.867 1.00 96.12  ? 259 ASP A CG  1 
ATOM   1981 O  OD1 . ASP A 1 259 ? -1.753  25.631  -10.243 1.00 99.19  ? 259 ASP A OD1 1 
ATOM   1982 O  OD2 . ASP A 1 259 ? -3.946  25.661  -10.366 1.00 94.28  1 259 ASP A OD2 1 
ATOM   1983 N  N   . GLU A 1 260 ? -1.956  27.474  -14.992 1.00 95.77  ? 260 GLU A N   1 
ATOM   1984 C  CA  . GLU A 1 260 ? -2.062  27.393  -16.448 1.00 94.15  ? 260 GLU A CA  1 
ATOM   1985 C  C   . GLU A 1 260 ? -0.701  27.235  -17.112 1.00 98.03  ? 260 GLU A C   1 
ATOM   1986 O  O   . GLU A 1 260 ? -0.579  26.534  -18.122 1.00 96.76  ? 260 GLU A O   1 
ATOM   1987 C  CB  . GLU A 1 260 ? -2.775  28.630  -17.018 1.00 97.45  ? 260 GLU A CB  1 
ATOM   1988 C  CG  . GLU A 1 260 ? -3.414  28.424  -18.413 1.00 104.35 ? 260 GLU A CG  1 
ATOM   1989 C  CD  . GLU A 1 260 ? -2.718  29.197  -19.549 1.00 111.07 ? 260 GLU A CD  1 
ATOM   1990 O  OE1 . GLU A 1 260 ? -3.266  29.254  -20.685 1.00 107.11 ? 260 GLU A OE1 1 
ATOM   1991 O  OE2 . GLU A 1 260 ? -1.622  29.763  -19.319 1.00 118.86 1 260 GLU A OE2 1 
ATOM   1992 N  N   . GLU A 1 261 ? 0.333   27.855  -16.537 1.00 100.54 ? 261 GLU A N   1 
ATOM   1993 C  CA  . GLU A 1 261 ? 1.676   27.721  -17.090 1.00 109.28 ? 261 GLU A CA  1 
ATOM   1994 C  C   . GLU A 1 261 ? 2.363   26.445  -16.615 1.00 108.19 ? 261 GLU A C   1 
ATOM   1995 O  O   . GLU A 1 261 ? 3.082   25.801  -17.390 1.00 113.68 ? 261 GLU A O   1 
ATOM   1996 C  CB  . GLU A 1 261 ? 2.509   28.945  -16.725 1.00 120.40 ? 261 GLU A CB  1 
ATOM   1997 C  CG  . GLU A 1 261 ? 2.475   29.270  -15.252 1.00 124.70 ? 261 GLU A CG  1 
ATOM   1998 C  CD  . GLU A 1 261 ? 2.487   30.758  -15.000 1.00 131.26 ? 261 GLU A CD  1 
ATOM   1999 O  OE1 . GLU A 1 261 ? 2.250   31.524  -15.959 1.00 130.70 ? 261 GLU A OE1 1 
ATOM   2000 O  OE2 . GLU A 1 261 ? 2.714   31.166  -13.843 1.00 136.45 1 261 GLU A OE2 1 
ATOM   2001 N  N   . LEU A 1 262 ? 2.172   26.073  -15.345 1.00 98.70  ? 262 LEU A N   1 
ATOM   2002 C  CA  . LEU A 1 262 ? 2.754   24.827  -14.863 1.00 80.43  ? 262 LEU A CA  1 
ATOM   2003 C  C   . LEU A 1 262 ? 2.122   23.628  -15.545 1.00 81.30  ? 262 LEU A C   1 
ATOM   2004 O  O   . LEU A 1 262 ? 2.773   22.585  -15.692 1.00 82.00  ? 262 LEU A O   1 
ATOM   2005 C  CB  . LEU A 1 262 ? 2.613   24.722  -13.342 1.00 70.66  ? 262 LEU A CB  1 
ATOM   2006 C  CG  . LEU A 1 262 ? 2.581   23.340  -12.666 1.00 68.24  ? 262 LEU A CG  1 
ATOM   2007 C  CD1 . LEU A 1 262 ? 3.922   22.623  -12.793 1.00 71.82  ? 262 LEU A CD1 1 
ATOM   2008 C  CD2 . LEU A 1 262 ? 2.207   23.478  -11.198 1.00 62.09  ? 262 LEU A CD2 1 
ATOM   2009 N  N   . ILE A 1 263 ? 0.871   23.750  -15.987 1.00 88.33  ? 263 ILE A N   1 
ATOM   2010 C  CA  . ILE A 1 263 ? 0.298   22.607  -16.681 1.00 93.77  ? 263 ILE A CA  1 
ATOM   2011 C  C   . ILE A 1 263 ? 0.710   22.627  -18.149 1.00 101.42 ? 263 ILE A C   1 
ATOM   2012 O  O   . ILE A 1 263 ? 0.895   21.566  -18.757 1.00 99.51  ? 263 ILE A O   1 
ATOM   2013 C  CB  . ILE A 1 263 ? -1.227  22.562  -16.541 1.00 86.61  ? 263 ILE A CB  1 
ATOM   2014 C  CG1 . ILE A 1 263 ? -1.655  22.725  -15.092 1.00 85.10  ? 263 ILE A CG1 1 
ATOM   2015 C  CG2 . ILE A 1 263 ? -1.679  21.169  -16.897 1.00 84.52  ? 263 ILE A CG2 1 
ATOM   2016 C  CD1 . ILE A 1 263 ? -3.084  22.270  -14.856 1.00 87.48  ? 263 ILE A CD1 1 
ATOM   2017 N  N   . HIS A 1 264 ? 0.870   23.819  -18.736 1.00 105.27 ? 264 HIS A N   1 
ATOM   2018 C  CA  . HIS A 1 264 ? 1.451   23.915  -20.073 1.00 105.08 ? 264 HIS A CA  1 
ATOM   2019 C  C   . HIS A 1 264 ? 2.817   23.248  -20.115 1.00 107.57 ? 264 HIS A C   1 
ATOM   2020 O  O   . HIS A 1 264 ? 3.114   22.469  -21.030 1.00 110.06 ? 264 HIS A O   1 
ATOM   2021 C  CB  . HIS A 1 264 ? 1.575   25.382  -20.502 1.00 101.92 ? 264 HIS A CB  1 
ATOM   2022 C  CG  . HIS A 1 264 ? 1.705   25.576  -21.982 1.00 104.52 ? 264 HIS A CG  1 
ATOM   2023 N  ND1 . HIS A 1 264 ? 2.262   26.708  -22.538 1.00 108.45 ? 264 HIS A ND1 1 
ATOM   2024 C  CD2 . HIS A 1 264 ? 1.324   24.795  -23.020 1.00 105.15 ? 264 HIS A CD2 1 
ATOM   2025 C  CE1 . HIS A 1 264 ? 2.225   26.612  -23.855 1.00 110.56 ? 264 HIS A CE1 1 
ATOM   2026 N  NE2 . HIS A 1 264 ? 1.659   25.461  -24.173 1.00 108.24 ? 264 HIS A NE2 1 
ATOM   2027 N  N   . CYS A 1 265 ? 3.652   23.533  -19.115 1.00 104.56 ? 265 CYS A N   1 
ATOM   2028 C  CA  . CYS A 1 265 ? 4.998   22.986  -19.062 1.00 101.93 ? 265 CYS A CA  1 
ATOM   2029 C  C   . CYS A 1 265 ? 4.999   21.468  -18.939 1.00 101.03 ? 265 CYS A C   1 
ATOM   2030 O  O   . CYS A 1 265 ? 5.974   20.831  -19.345 1.00 107.49 ? 265 CYS A O   1 
ATOM   2031 C  CB  . CYS A 1 265 ? 5.761   23.620  -17.895 1.00 106.65 ? 265 CYS A CB  1 
ATOM   2032 S  SG  . CYS A 1 265 ? 7.504   23.135  -17.728 1.00 118.79 ? 265 CYS A SG  1 
ATOM   2033 N  N   . LEU A 1 266 ? 3.929   20.870  -18.409 1.00 92.55  ? 266 LEU A N   1 
ATOM   2034 C  CA  . LEU A 1 266 ? 3.900   19.428  -18.219 1.00 79.65  ? 266 LEU A CA  1 
ATOM   2035 C  C   . LEU A 1 266 ? 3.253   18.664  -19.371 1.00 75.81  ? 266 LEU A C   1 
ATOM   2036 O  O   . LEU A 1 266 ? 3.429   17.441  -19.447 1.00 78.17  ? 266 LEU A O   1 
ATOM   2037 C  CB  . LEU A 1 266 ? 3.183   19.071  -16.909 1.00 72.64  ? 266 LEU A CB  1 
ATOM   2038 C  CG  . LEU A 1 266 ? 3.743   19.599  -15.591 1.00 68.17  ? 266 LEU A CG  1 
ATOM   2039 C  CD1 . LEU A 1 266 ? 2.950   19.035  -14.446 1.00 62.65  ? 266 LEU A CD1 1 
ATOM   2040 C  CD2 . LEU A 1 266 ? 5.187   19.225  -15.443 1.00 72.45  ? 266 LEU A CD2 1 
ATOM   2041 N  N   . ARG A 1 267 ? 2.510   19.328  -20.263 1.00 70.35  ? 267 ARG A N   1 
ATOM   2042 C  CA  . ARG A 1 267 ? 1.981   18.636  -21.434 1.00 72.15  ? 267 ARG A CA  1 
ATOM   2043 C  C   . ARG A 1 267 ? 2.950   18.638  -22.603 1.00 81.81  ? 267 ARG A C   1 
ATOM   2044 O  O   . ARG A 1 267 ? 2.733   17.903  -23.576 1.00 79.36  ? 267 ARG A O   1 
ATOM   2045 C  CB  . ARG A 1 267 ? 0.659   19.248  -21.911 1.00 74.75  ? 267 ARG A CB  1 
ATOM   2046 C  CG  . ARG A 1 267 ? -0.421  19.460  -20.879 1.00 69.11  ? 267 ARG A CG  1 
ATOM   2047 C  CD  . ARG A 1 267 ? -1.330  20.534  -21.398 1.00 75.69  ? 267 ARG A CD  1 
ATOM   2048 N  NE  . ARG A 1 267 ? -2.730  20.132  -21.245 1.00 87.44  ? 267 ARG A NE  1 
ATOM   2049 C  CZ  . ARG A 1 267 ? -3.534  20.495  -20.252 1.00 87.12  ? 267 ARG A CZ  1 
ATOM   2050 N  NH1 . ARG A 1 267 ? -3.092  21.306  -19.310 1.00 86.96  1 267 ARG A NH1 1 
ATOM   2051 N  NH2 . ARG A 1 267 ? -4.781  20.060  -20.230 1.00 85.86  ? 267 ARG A NH2 1 
ATOM   2052 N  N   . GLU A 1 268 ? 3.995   19.460  -22.535 1.00 90.58  ? 268 GLU A N   1 
ATOM   2053 C  CA  . GLU A 1 268 ? 5.047   19.456  -23.534 1.00 91.55  ? 268 GLU A CA  1 
ATOM   2054 C  C   . GLU A 1 268 ? 6.102   18.397  -23.259 1.00 86.62  ? 268 GLU A C   1 
ATOM   2055 O  O   . GLU A 1 268 ? 6.772   17.955  -24.199 1.00 94.06  ? 268 GLU A O   1 
ATOM   2056 C  CB  . GLU A 1 268 ? 5.697   20.838  -23.604 1.00 100.79 ? 268 GLU A CB  1 
ATOM   2057 C  CG  . GLU A 1 268 ? 5.063   21.754  -24.631 1.00 115.50 ? 268 GLU A CG  1 
ATOM   2058 C  CD  . GLU A 1 268 ? 5.382   21.328  -26.048 1.00 126.26 ? 268 GLU A CD  1 
ATOM   2059 O  OE1 . GLU A 1 268 ? 4.477   20.801  -26.730 1.00 125.70 ? 268 GLU A OE1 1 
ATOM   2060 O  OE2 . GLU A 1 268 ? 6.545   21.505  -26.471 1.00 131.99 1 268 GLU A OE2 1 
ATOM   2061 N  N   . LYS A 1 269 ? 6.244   17.969  -22.004 1.00 78.29  ? 269 LYS A N   1 
ATOM   2062 C  CA  . LYS A 1 269 ? 7.240   16.968  -21.640 1.00 77.64  ? 269 LYS A CA  1 
ATOM   2063 C  C   . LYS A 1 269 ? 6.817   15.575  -22.095 1.00 76.51  ? 269 LYS A C   1 
ATOM   2064 O  O   . LYS A 1 269 ? 5.632   15.236  -22.117 1.00 77.12  ? 269 LYS A O   1 
ATOM   2065 C  CB  . LYS A 1 269 ? 7.476   16.972  -20.125 1.00 77.21  ? 269 LYS A CB  1 
ATOM   2066 C  CG  . LYS A 1 269 ? 7.827   18.348  -19.556 1.00 81.55  ? 269 LYS A CG  1 
ATOM   2067 C  CD  . LYS A 1 269 ? 9.151   18.352  -18.798 1.00 86.34  ? 269 LYS A CD  1 
ATOM   2068 C  CE  . LYS A 1 269 ? 9.902   19.677  -18.998 1.00 87.97  ? 269 LYS A CE  1 
ATOM   2069 N  NZ  . LYS A 1 269 ? 11.321  19.603  -18.515 1.00 82.12  1 269 LYS A NZ  1 
ATOM   2070 N  N   . LYS A 1 270 ? 7.812   14.762  -22.458 1.00 77.76  ? 270 LYS A N   1 
ATOM   2071 C  CA  . LYS A 1 270 ? 7.566   13.390  -22.878 1.00 81.13  ? 270 LYS A CA  1 
ATOM   2072 C  C   . LYS A 1 270 ? 7.117   12.551  -21.676 1.00 78.20  ? 270 LYS A C   1 
ATOM   2073 O  O   . LYS A 1 270 ? 7.312   12.949  -20.524 1.00 77.35  ? 270 LYS A O   1 
ATOM   2074 C  CB  . LYS A 1 270 ? 8.827   12.799  -23.516 1.00 86.52  ? 270 LYS A CB  1 
ATOM   2075 C  CG  . LYS A 1 270 ? 9.436   13.606  -24.673 1.00 89.20  ? 270 LYS A CG  1 
ATOM   2076 C  CD  . LYS A 1 270 ? 9.401   12.820  -25.983 1.00 93.44  ? 270 LYS A CD  1 
ATOM   2077 C  CE  . LYS A 1 270 ? 10.001  11.421  -25.826 1.00 96.25  ? 270 LYS A CE  1 
ATOM   2078 N  NZ  . LYS A 1 270 ? 9.735   10.540  -27.003 1.00 98.74  1 270 LYS A NZ  1 
ATOM   2079 N  N   . PRO A 1 271 ? 6.489   11.382  -21.917 1.00 74.97  ? 271 PRO A N   1 
ATOM   2080 C  CA  . PRO A 1 271 ? 5.917   10.624  -20.793 1.00 71.02  ? 271 PRO A CA  1 
ATOM   2081 C  C   . PRO A 1 271 ? 6.939   10.227  -19.737 1.00 70.04  ? 271 PRO A C   1 
ATOM   2082 O  O   . PRO A 1 271 ? 6.772   10.550  -18.551 1.00 59.51  ? 271 PRO A O   1 
ATOM   2083 C  CB  . PRO A 1 271 ? 5.315   9.390   -21.475 1.00 65.36  ? 271 PRO A CB  1 
ATOM   2084 C  CG  . PRO A 1 271 ? 5.064   9.807   -22.874 1.00 64.36  ? 271 PRO A CG  1 
ATOM   2085 C  CD  . PRO A 1 271 ? 6.188   10.739  -23.211 1.00 70.62  ? 271 PRO A CD  1 
ATOM   2086 N  N   . GLN A 1 272 ? 8.006   9.535   -20.159 1.00 76.41  ? 272 GLN A N   1 
ATOM   2087 C  CA  . GLN A 1 272 ? 8.995   9.068   -19.194 1.00 76.08  ? 272 GLN A CA  1 
ATOM   2088 C  C   . GLN A 1 272 ? 9.653   10.220  -18.452 1.00 74.09  ? 272 GLN A C   1 
ATOM   2089 O  O   . GLN A 1 272 ? 10.204  10.006  -17.367 1.00 75.12  ? 272 GLN A O   1 
ATOM   2090 C  CB  . GLN A 1 272 ? 10.053  8.194   -19.878 1.00 46.05  ? 272 GLN A CB  1 
ATOM   2091 C  CG  . GLN A 1 272 ? 9.665   6.725   -20.025 1.00 44.18  ? 272 GLN A CG  1 
ATOM   2092 C  CD  . GLN A 1 272 ? 9.716   5.949   -18.713 1.00 69.31  ? 272 GLN A CD  1 
ATOM   2093 O  OE1 . GLN A 1 272 ? 10.017  6.506   -17.656 1.00 72.52  ? 272 GLN A OE1 1 
ATOM   2094 N  NE2 . GLN A 1 272 ? 9.405   4.655   -18.776 1.00 73.79  ? 272 GLN A NE2 1 
ATOM   2095 N  N   . GLU A 1 273 ? 9.580   11.437  -18.995 1.00 72.24  ? 273 GLU A N   1 
ATOM   2096 C  CA  . GLU A 1 273 ? 10.175  12.582  -18.318 1.00 77.41  ? 273 GLU A CA  1 
ATOM   2097 C  C   . GLU A 1 273 ? 9.571   12.769  -16.937 1.00 69.14  ? 273 GLU A C   1 
ATOM   2098 O  O   . GLU A 1 273 ? 10.292  12.999  -15.962 1.00 72.04  ? 273 GLU A O   1 
ATOM   2099 C  CB  . GLU A 1 273 ? 9.983   13.843  -19.158 1.00 88.89  ? 273 GLU A CB  1 
ATOM   2100 C  CG  . GLU A 1 273 ? 10.355  13.678  -20.614 1.00 95.75  ? 273 GLU A CG  1 
ATOM   2101 C  CD  . GLU A 1 273 ? 11.379  14.684  -21.114 1.00 102.78 ? 273 GLU A CD  1 
ATOM   2102 O  OE1 . GLU A 1 273 ? 11.820  15.544  -20.312 1.00 107.30 ? 273 GLU A OE1 1 
ATOM   2103 O  OE2 . GLU A 1 273 ? 11.741  14.634  -22.323 1.00 100.13 1 273 GLU A OE2 1 
ATOM   2104 N  N   . LEU A 1 274 ? 8.250   12.655  -16.826 1.00 67.45  ? 274 LEU A N   1 
ATOM   2105 C  CA  . LEU A 1 274 ? 7.637   12.783  -15.510 1.00 67.69  ? 274 LEU A CA  1 
ATOM   2106 C  C   . LEU A 1 274 ? 7.818   11.514  -14.696 1.00 64.98  ? 274 LEU A C   1 
ATOM   2107 O  O   . LEU A 1 274 ? 8.052   11.579  -13.484 1.00 68.70  ? 274 LEU A O   1 
ATOM   2108 C  CB  . LEU A 1 274 ? 6.158   13.128  -15.645 1.00 69.28  ? 274 LEU A CB  1 
ATOM   2109 C  CG  . LEU A 1 274 ? 5.924   14.378  -16.492 1.00 74.42  ? 274 LEU A CG  1 
ATOM   2110 C  CD1 . LEU A 1 274 ? 5.319   14.000  -17.824 1.00 73.85  ? 274 LEU A CD1 1 
ATOM   2111 C  CD2 . LEU A 1 274 ? 5.035   15.359  -15.759 1.00 74.64  ? 274 LEU A CD2 1 
ATOM   2112 N  N   . ILE A 1 275 ? 7.739   10.358  -15.350 1.00 58.62  ? 275 ILE A N   1 
ATOM   2113 C  CA  . ILE A 1 275 ? 7.949   9.096   -14.653 1.00 54.38  ? 275 ILE A CA  1 
ATOM   2114 C  C   . ILE A 1 275 ? 9.351   9.037   -14.065 1.00 65.35  ? 275 ILE A C   1 
ATOM   2115 O  O   . ILE A 1 275 ? 9.556   8.516   -12.962 1.00 70.46  ? 275 ILE A O   1 
ATOM   2116 C  CB  . ILE A 1 275 ? 7.686   7.924   -15.609 1.00 48.28  ? 275 ILE A CB  1 
ATOM   2117 C  CG1 . ILE A 1 275 ? 6.316   8.081   -16.252 1.00 46.38  ? 275 ILE A CG1 1 
ATOM   2118 C  CG2 . ILE A 1 275 ? 7.751   6.619   -14.871 1.00 40.52  ? 275 ILE A CG2 1 
ATOM   2119 C  CD1 . ILE A 1 275 ? 6.016   7.003   -17.232 1.00 44.51  ? 275 ILE A CD1 1 
ATOM   2120 N  N   . ASP A 1 276 ? 10.344  9.563   -14.791 1.00 69.02  ? 276 ASP A N   1 
ATOM   2121 C  CA  . ASP A 1 276 ? 11.706  9.557   -14.266 1.00 74.43  ? 276 ASP A CA  1 
ATOM   2122 C  C   . ASP A 1 276 ? 11.803  10.375  -12.982 1.00 73.68  ? 276 ASP A C   1 
ATOM   2123 O  O   . ASP A 1 276 ? 12.559  10.019  -12.072 1.00 81.13  ? 276 ASP A O   1 
ATOM   2124 C  CB  . ASP A 1 276 ? 12.689  10.081  -15.325 1.00 84.92  ? 276 ASP A CB  1 
ATOM   2125 C  CG  . ASP A 1 276 ? 12.984  9.056   -16.438 1.00 87.70  ? 276 ASP A CG  1 
ATOM   2126 O  OD1 . ASP A 1 276 ? 12.697  7.851   -16.252 1.00 90.73  ? 276 ASP A OD1 1 
ATOM   2127 O  OD2 . ASP A 1 276 ? 13.510  9.466   -17.502 1.00 77.99  1 276 ASP A OD2 1 
ATOM   2128 N  N   . VAL A 1 277 ? 11.024  11.452  -12.875 1.00 72.00  ? 277 VAL A N   1 
ATOM   2129 C  CA  . VAL A 1 277 ? 11.060  12.329  -11.711 1.00 64.81  ? 277 VAL A CA  1 
ATOM   2130 C  C   . VAL A 1 277 ? 9.867   12.107  -10.793 1.00 62.02  ? 277 VAL A C   1 
ATOM   2131 O  O   . VAL A 1 277 ? 9.717   12.815  -9.788  1.00 53.11  ? 277 VAL A O   1 
ATOM   2132 C  CB  . VAL A 1 277 ? 11.128  13.800  -12.164 1.00 69.47  ? 277 VAL A CB  1 
ATOM   2133 C  CG1 . VAL A 1 277 ? 11.645  14.682  -11.045 1.00 75.39  ? 277 VAL A CG1 1 
ATOM   2134 C  CG2 . VAL A 1 277 ? 11.978  13.935  -13.420 1.00 68.85  ? 277 VAL A CG2 1 
ATOM   2135 N  N   . GLU A 1 278 ? 9.013   11.134  -11.117 1.00 64.61  ? 278 GLU A N   1 
ATOM   2136 C  CA  . GLU A 1 278 ? 7.792   10.829  -10.380 1.00 64.86  ? 278 GLU A CA  1 
ATOM   2137 C  C   . GLU A 1 278 ? 7.926   10.931  -8.863  1.00 60.22  ? 278 GLU A C   1 
ATOM   2138 O  O   . GLU A 1 278 ? 7.169   11.657  -8.211  1.00 63.95  ? 278 GLU A O   1 
ATOM   2139 C  CB  . GLU A 1 278 ? 7.338   9.421   -10.765 1.00 72.37  ? 278 GLU A CB  1 
ATOM   2140 C  CG  . GLU A 1 278 ? 5.963   9.058   -10.285 1.00 78.96  ? 278 GLU A CG  1 
ATOM   2141 C  CD  . GLU A 1 278 ? 5.273   8.131   -11.251 1.00 88.36  ? 278 GLU A CD  1 
ATOM   2142 O  OE1 . GLU A 1 278 ? 5.345   6.906   -11.039 1.00 89.99  ? 278 GLU A OE1 1 
ATOM   2143 O  OE2 . GLU A 1 278 ? 4.682   8.626   -12.236 1.00 94.79  1 278 GLU A OE2 1 
ATOM   2144 N  N   . TRP A 1 279 ? 8.888   10.204  -8.284  1.00 57.39  ? 279 TRP A N   1 
ATOM   2145 C  CA  . TRP A 1 279 ? 8.912   9.988   -6.839  1.00 59.34  ? 279 TRP A CA  1 
ATOM   2146 C  C   . TRP A 1 279 ? 9.573   11.114  -6.062  1.00 68.87  ? 279 TRP A C   1 
ATOM   2147 O  O   . TRP A 1 279 ? 9.464   11.128  -4.831  1.00 65.10  ? 279 TRP A O   1 
ATOM   2148 C  CB  . TRP A 1 279 ? 9.609   8.664   -6.491  1.00 52.13  ? 279 TRP A CB  1 
ATOM   2149 C  CG  . TRP A 1 279 ? 9.202   7.523   -7.375  1.00 51.51  ? 279 TRP A CG  1 
ATOM   2150 C  CD1 . TRP A 1 279 ? 9.652   7.259   -8.644  1.00 57.60  ? 279 TRP A CD1 1 
ATOM   2151 C  CD2 . TRP A 1 279 ? 8.207   6.533   -7.091  1.00 41.02  ? 279 TRP A CD2 1 
ATOM   2152 N  NE1 . TRP A 1 279 ? 9.022   6.151   -9.151  1.00 51.85  ? 279 TRP A NE1 1 
ATOM   2153 C  CE2 . TRP A 1 279 ? 8.128   5.688   -8.222  1.00 47.61  ? 279 TRP A CE2 1 
ATOM   2154 C  CE3 . TRP A 1 279 ? 7.372   6.274   -5.987  1.00 42.48  ? 279 TRP A CE3 1 
ATOM   2155 C  CZ2 . TRP A 1 279 ? 7.252   4.602   -8.283  1.00 55.64  ? 279 TRP A CZ2 1 
ATOM   2156 C  CZ3 . TRP A 1 279 ? 6.495   5.188   -6.050  1.00 43.30  ? 279 TRP A CZ3 1 
ATOM   2157 C  CH2 . TRP A 1 279 ? 6.448   4.370   -7.195  1.00 51.38  ? 279 TRP A CH2 1 
ATOM   2158 N  N   . ASN A 1 280 ? 10.204  12.070  -6.734  1.00 77.69  ? 280 ASN A N   1 
ATOM   2159 C  CA  . ASN A 1 280 ? 10.944  13.106  -6.025  1.00 83.36  ? 280 ASN A CA  1 
ATOM   2160 C  C   . ASN A 1 280 ? 10.044  14.086  -5.266  1.00 86.91  ? 280 ASN A C   1 
ATOM   2161 O  O   . ASN A 1 280 ? 10.555  15.100  -4.769  1.00 96.37  ? 280 ASN A O   1 
ATOM   2162 C  CB  . ASN A 1 280 ? 11.836  13.855  -7.017  1.00 87.21  ? 280 ASN A CB  1 
ATOM   2163 C  CG  . ASN A 1 280 ? 13.002  13.010  -7.502  1.00 90.00  ? 280 ASN A CG  1 
ATOM   2164 O  OD1 . ASN A 1 280 ? 12.954  11.779  -7.462  1.00 89.30  ? 280 ASN A OD1 1 
ATOM   2165 N  ND2 . ASN A 1 280 ? 14.058  13.669  -7.960  1.00 95.44  ? 280 ASN A ND2 1 
ATOM   2166 N  N   . VAL A 1 281 ? 8.744   13.825  -5.129  1.00 77.78  ? 281 VAL A N   1 
ATOM   2167 C  CA  . VAL A 1 281 ? 7.810   14.783  -4.560  1.00 69.32  ? 281 VAL A CA  1 
ATOM   2168 C  C   . VAL A 1 281 ? 7.175   14.272  -3.275  1.00 71.35  ? 281 VAL A C   1 
ATOM   2169 O  O   . VAL A 1 281 ? 6.252   14.901  -2.751  1.00 75.66  ? 281 VAL A O   1 
ATOM   2170 C  CB  . VAL A 1 281 ? 6.729   15.161  -5.588  1.00 62.16  ? 281 VAL A CB  1 
ATOM   2171 C  CG1 . VAL A 1 281 ? 7.363   15.495  -6.918  1.00 61.93  ? 281 VAL A CG1 1 
ATOM   2172 C  CG2 . VAL A 1 281 ? 5.776   14.008  -5.770  1.00 58.41  ? 281 VAL A CG2 1 
ATOM   2173 N  N   . LEU A 1 282 ? 7.651   13.146  -2.750  1.00 70.02  ? 282 LEU A N   1 
ATOM   2174 C  CA  . LEU A 1 282 ? 7.023   12.532  -1.579  1.00 75.40  ? 282 LEU A CA  1 
ATOM   2175 C  C   . LEU A 1 282 ? 7.478   13.236  -0.304  1.00 83.16  ? 282 LEU A C   1 
ATOM   2176 O  O   . LEU A 1 282 ? 8.678   13.472  -0.125  1.00 78.60  ? 282 LEU A O   1 
ATOM   2177 C  CB  . LEU A 1 282 ? 7.355   11.045  -1.516  1.00 72.72  ? 282 LEU A CB  1 
ATOM   2178 C  CG  . LEU A 1 282 ? 6.722   10.254  -2.664  1.00 72.89  ? 282 LEU A CG  1 
ATOM   2179 C  CD1 . LEU A 1 282 ? 7.659   9.177   -3.179  1.00 71.28  ? 282 LEU A CD1 1 
ATOM   2180 C  CD2 . LEU A 1 282 ? 5.388   9.659   -2.241  1.00 69.39  ? 282 LEU A CD2 1 
ATOM   2181 N  N   . PRO A 1 283 ? 6.557   13.567  0.609   1.00 92.26  ? 283 PRO A N   1 
ATOM   2182 C  CA  . PRO A 1 283 ? 6.901   14.471  1.715   1.00 98.17  ? 283 PRO A CA  1 
ATOM   2183 C  C   . PRO A 1 283 ? 7.872   13.849  2.699   1.00 102.49 ? 283 PRO A C   1 
ATOM   2184 O  O   . PRO A 1 283 ? 8.939   14.405  2.974   1.00 108.72 ? 283 PRO A O   1 
ATOM   2185 C  CB  . PRO A 1 283 ? 5.543   14.756  2.369   1.00 97.82  ? 283 PRO A CB  1 
ATOM   2186 C  CG  . PRO A 1 283 ? 4.704   13.562  2.037   1.00 93.41  ? 283 PRO A CG  1 
ATOM   2187 C  CD  . PRO A 1 283 ? 5.166   13.084  0.688   1.00 92.02  ? 283 PRO A CD  1 
ATOM   2188 N  N   . PHE A 1 284 ? 7.501   12.697  3.238   1.00 104.82 ? 284 PHE A N   1 
ATOM   2189 C  CA  . PHE A 1 284 ? 8.338   11.970  4.173   1.00 111.80 ? 284 PHE A CA  1 
ATOM   2190 C  C   . PHE A 1 284 ? 9.143   10.926  3.409   1.00 122.26 ? 284 PHE A C   1 
ATOM   2191 O  O   . PHE A 1 284 ? 8.742   10.485  2.326   1.00 121.79 ? 284 PHE A O   1 
ATOM   2192 C  CB  . PHE A 1 284 ? 7.474   11.314  5.255   1.00 107.16 ? 284 PHE A CB  1 
ATOM   2193 C  CG  . PHE A 1 284 ? 6.221   12.093  5.589   1.00 110.16 ? 284 PHE A CG  1 
ATOM   2194 C  CD1 . PHE A 1 284 ? 4.976   11.520  5.423   1.00 113.05 ? 284 PHE A CD1 1 
ATOM   2195 C  CD2 . PHE A 1 284 ? 6.286   13.397  6.059   1.00 113.69 ? 284 PHE A CD2 1 
ATOM   2196 C  CE1 . PHE A 1 284 ? 3.820   12.219  5.722   1.00 113.97 ? 284 PHE A CE1 1 
ATOM   2197 C  CE2 . PHE A 1 284 ? 5.129   14.107  6.356   1.00 113.02 ? 284 PHE A CE2 1 
ATOM   2198 C  CZ  . PHE A 1 284 ? 3.898   13.515  6.186   1.00 113.69 ? 284 PHE A CZ  1 
ATOM   2199 N  N   . ASP A 1 285 ? 10.309  10.569  3.958   1.00 132.50 ? 285 ASP A N   1 
ATOM   2200 C  CA  . ASP A 1 285 ? 11.124  9.514   3.362   1.00 139.59 ? 285 ASP A CA  1 
ATOM   2201 C  C   . ASP A 1 285 ? 10.267  8.289   3.073   1.00 130.52 ? 285 ASP A C   1 
ATOM   2202 O  O   . ASP A 1 285 ? 10.155  7.843   1.925   1.00 131.73 ? 285 ASP A O   1 
ATOM   2203 C  CB  . ASP A 1 285 ? 12.292  9.163   4.287   1.00 151.50 ? 285 ASP A CB  1 
ATOM   2204 C  CG  . ASP A 1 285 ? 13.180  10.361  4.596   1.00 161.01 ? 285 ASP A CG  1 
ATOM   2205 O  OD1 . ASP A 1 285 ? 12.737  11.511  4.386   1.00 165.30 ? 285 ASP A OD1 1 
ATOM   2206 O  OD2 . ASP A 1 285 ? 14.327  10.150  5.050   1.00 161.95 ? 285 ASP A OD2 1 
ATOM   2207 N  N   . SER A 1 286 ? 9.646   7.740   4.118   1.00 109.05 ? 286 SER A N   1 
ATOM   2208 C  CA  . SER A 1 286 ? 8.433   6.945   3.979   1.00 90.03  ? 286 SER A CA  1 
ATOM   2209 C  C   . SER A 1 286 ? 8.583   5.706   3.102   1.00 90.09  ? 286 SER A C   1 
ATOM   2210 O  O   . SER A 1 286 ? 8.264   4.592   3.536   1.00 77.40  ? 286 SER A O   1 
ATOM   2211 C  CB  . SER A 1 286 ? 7.319   7.834   3.427   1.00 72.47  ? 286 SER A CB  1 
ATOM   2212 O  OG  . SER A 1 286 ? 6.386   7.045   2.721   1.00 55.85  ? 286 SER A OG  1 
ATOM   2213 N  N   . ILE A 1 287 ? 8.986   5.897   1.845   1.00 104.68 ? 287 ILE A N   1 
ATOM   2214 C  CA  . ILE A 1 287 ? 9.241   4.798   0.919   1.00 104.59 ? 287 ILE A CA  1 
ATOM   2215 C  C   . ILE A 1 287 ? 7.931   4.101   0.545   1.00 98.58  ? 287 ILE A C   1 
ATOM   2216 O  O   . ILE A 1 287 ? 7.800   3.568   -0.564  1.00 99.84  ? 287 ILE A O   1 
ATOM   2217 C  CB  . ILE A 1 287 ? 10.260  3.804   1.521   1.00 110.13 ? 287 ILE A CB  1 
ATOM   2218 C  CG1 . ILE A 1 287 ? 11.541  4.520   1.976   1.00 107.02 ? 287 ILE A CG1 1 
ATOM   2219 C  CG2 . ILE A 1 287 ? 10.615  2.728   0.534   1.00 115.43 ? 287 ILE A CG2 1 
ATOM   2220 C  CD1 . ILE A 1 287 ? 12.295  5.229   0.880   1.00 102.29 ? 287 ILE A CD1 1 
ATOM   2221 N  N   . PHE A 1 288 ? 6.942   4.133   1.447   1.00 92.18  ? 288 PHE A N   1 
ATOM   2222 C  CA  . PHE A 1 288 ? 5.705   3.358   1.349   1.00 79.51  ? 288 PHE A CA  1 
ATOM   2223 C  C   . PHE A 1 288 ? 4.523   4.149   0.792   1.00 72.24  ? 288 PHE A C   1 
ATOM   2224 O  O   . PHE A 1 288 ? 3.374   3.703   0.911   1.00 64.39  ? 288 PHE A O   1 
ATOM   2225 C  CB  . PHE A 1 288 ? 5.338   2.805   2.723   1.00 67.73  ? 288 PHE A CB  1 
ATOM   2226 C  CG  . PHE A 1 288 ? 6.439   2.024   3.367   1.00 65.63  ? 288 PHE A CG  1 
ATOM   2227 C  CD1 . PHE A 1 288 ? 6.676   2.121   4.721   1.00 66.88  ? 288 PHE A CD1 1 
ATOM   2228 C  CD2 . PHE A 1 288 ? 7.216   1.175   2.622   1.00 68.64  ? 288 PHE A CD2 1 
ATOM   2229 C  CE1 . PHE A 1 288 ? 7.666   1.393   5.311   1.00 70.73  ? 288 PHE A CE1 1 
ATOM   2230 C  CE2 . PHE A 1 288 ? 8.216   0.452   3.211   1.00 77.67  ? 288 PHE A CE2 1 
ATOM   2231 C  CZ  . PHE A 1 288 ? 8.438   0.559   4.556   1.00 76.66  ? 288 PHE A CZ  1 
ATOM   2232 N  N   . ARG A 1 289 ? 4.773   5.310   0.204   1.00 69.78  ? 289 ARG A N   1 
ATOM   2233 C  CA  . ARG A 1 289 ? 3.738   6.139   -0.385  1.00 62.49  ? 289 ARG A CA  1 
ATOM   2234 C  C   . ARG A 1 289 ? 3.843   6.082   -1.901  1.00 61.42  ? 289 ARG A C   1 
ATOM   2235 O  O   . ARG A 1 289 ? 4.710   5.411   -2.469  1.00 62.01  ? 289 ARG A O   1 
ATOM   2236 C  CB  . ARG A 1 289 ? 3.835   7.586   0.112   1.00 65.96  ? 289 ARG A CB  1 
ATOM   2237 C  CG  . ARG A 1 289 ? 3.683   7.779   1.620   1.00 72.77  ? 289 ARG A CG  1 
ATOM   2238 C  CD  . ARG A 1 289 ? 2.819   6.691   2.262   1.00 80.97  ? 289 ARG A CD  1 
ATOM   2239 N  NE  . ARG A 1 289 ? 2.037   7.166   3.419   1.00 92.08  ? 289 ARG A NE  1 
ATOM   2240 C  CZ  . ARG A 1 289 ? 1.317   6.388   4.228   1.00 92.54  ? 289 ARG A CZ  1 
ATOM   2241 N  NH1 . ARG A 1 289 ? 1.274   5.076   4.029   1.00 88.04  ? 289 ARG A NH1 1 
ATOM   2242 N  NH2 . ARG A 1 289 ? 0.661   6.934   5.241   1.00 93.38  ? 289 ARG A NH2 1 
ATOM   2243 N  N   . PHE A 1 290 ? 2.931   6.794   -2.559  1.00 60.70  ? 290 PHE A N   1 
ATOM   2244 C  CA  . PHE A 1 290 ? 2.917   6.879   -4.007  1.00 47.26  ? 290 PHE A CA  1 
ATOM   2245 C  C   . PHE A 1 290 ? 2.612   8.311   -4.409  1.00 53.59  ? 290 PHE A C   1 
ATOM   2246 O  O   . PHE A 1 290 ? 1.789   8.980   -3.775  1.00 50.95  ? 290 PHE A O   1 
ATOM   2247 C  CB  . PHE A 1 290 ? 1.910   5.905   -4.581  1.00 48.25  ? 290 PHE A CB  1 
ATOM   2248 C  CG  . PHE A 1 290 ? 2.055   4.525   -4.032  1.00 47.95  ? 290 PHE A CG  1 
ATOM   2249 C  CD1 . PHE A 1 290 ? 1.273   4.099   -2.979  1.00 45.17  ? 290 PHE A CD1 1 
ATOM   2250 C  CD2 . PHE A 1 290 ? 3.000   3.662   -4.544  1.00 49.51  ? 290 PHE A CD2 1 
ATOM   2251 C  CE1 . PHE A 1 290 ? 1.422   2.827   -2.459  1.00 39.38  ? 290 PHE A CE1 1 
ATOM   2252 C  CE2 . PHE A 1 290 ? 3.145   2.385   -4.033  1.00 45.68  ? 290 PHE A CE2 1 
ATOM   2253 C  CZ  . PHE A 1 290 ? 2.356   1.969   -2.985  1.00 36.47  ? 290 PHE A CZ  1 
ATOM   2254 N  N   . SER A 1 291 ? 3.293   8.769   -5.463  1.00 64.36  ? 291 SER A N   1 
ATOM   2255 C  CA  . SER A 1 291 ? 3.338   10.192  -5.783  1.00 70.31  ? 291 SER A CA  1 
ATOM   2256 C  C   . SER A 1 291 ? 1.940   10.755  -6.020  1.00 67.59  ? 291 SER A C   1 
ATOM   2257 O  O   . SER A 1 291 ? 1.515   11.700  -5.347  1.00 72.00  ? 291 SER A O   1 
ATOM   2258 C  CB  . SER A 1 291 ? 4.235   10.421  -7.003  1.00 74.62  ? 291 SER A CB  1 
ATOM   2259 O  OG  . SER A 1 291 ? 5.537   9.901   -6.801  1.00 73.10  ? 291 SER A OG  1 
ATOM   2260 N  N   . PHE A 1 292 ? 1.202   10.179  -6.964  1.00 60.34  ? 292 PHE A N   1 
ATOM   2261 C  CA  . PHE A 1 292 ? -0.049  10.769  -7.423  1.00 54.66  ? 292 PHE A CA  1 
ATOM   2262 C  C   . PHE A 1 292 ? -1.192  9.776   -7.255  1.00 53.50  ? 292 PHE A C   1 
ATOM   2263 O  O   . PHE A 1 292 ? -1.192  8.693   -7.857  1.00 47.94  ? 292 PHE A O   1 
ATOM   2264 C  CB  . PHE A 1 292 ? 0.103   11.249  -8.865  1.00 58.58  ? 292 PHE A CB  1 
ATOM   2265 C  CG  . PHE A 1 292 ? 1.071   12.387  -9.000  1.00 66.65  ? 292 PHE A CG  1 
ATOM   2266 C  CD1 . PHE A 1 292 ? 0.654   13.703  -8.857  1.00 75.58  ? 292 PHE A CD1 1 
ATOM   2267 C  CD2 . PHE A 1 292 ? 2.412   12.142  -9.216  1.00 56.92  ? 292 PHE A CD2 1 
ATOM   2268 C  CE1 . PHE A 1 292 ? 1.565   14.746  -8.961  1.00 72.83  ? 292 PHE A CE1 1 
ATOM   2269 C  CE2 . PHE A 1 292 ? 3.314   13.177  -9.314  1.00 49.90  ? 292 PHE A CE2 1 
ATOM   2270 C  CZ  . PHE A 1 292 ? 2.898   14.474  -9.189  1.00 53.71  ? 292 PHE A CZ  1 
ATOM   2271 N  N   . VAL A 1 293 ? -2.153  10.155  -6.423  1.00 49.02  ? 293 VAL A N   1 
ATOM   2272 C  CA  . VAL A 1 293 ? -3.231  9.288   -5.977  1.00 48.86  ? 293 VAL A CA  1 
ATOM   2273 C  C   . VAL A 1 293 ? -4.494  10.143  -5.901  1.00 53.94  ? 293 VAL A C   1 
ATOM   2274 O  O   . VAL A 1 293 ? -4.425  11.382  -6.002  1.00 54.51  ? 293 VAL A O   1 
ATOM   2275 C  CB  . VAL A 1 293 ? -2.905  8.633   -4.624  1.00 48.89  ? 293 VAL A CB  1 
ATOM   2276 C  CG1 . VAL A 1 293 ? -1.760  7.641   -4.759  1.00 59.28  ? 293 VAL A CG1 1 
ATOM   2277 C  CG2 . VAL A 1 293 ? -2.573  9.690   -3.599  1.00 45.45  ? 293 VAL A CG2 1 
ATOM   2278 N  N   . PRO A 1 294 ? -5.667  9.522   -5.738  1.00 42.09  ? 294 PRO A N   1 
ATOM   2279 C  CA  . PRO A 1 294 ? -6.916  10.290  -5.663  1.00 36.54  ? 294 PRO A CA  1 
ATOM   2280 C  C   . PRO A 1 294 ? -6.853  11.396  -4.624  1.00 50.84  ? 294 PRO A C   1 
ATOM   2281 O  O   . PRO A 1 294 ? -6.198  11.264  -3.596  1.00 62.91  ? 294 PRO A O   1 
ATOM   2282 C  CB  . PRO A 1 294 ? -7.945  9.226   -5.279  1.00 37.98  ? 294 PRO A CB  1 
ATOM   2283 C  CG  . PRO A 1 294 ? -7.394  7.964   -5.888  1.00 34.47  ? 294 PRO A CG  1 
ATOM   2284 C  CD  . PRO A 1 294 ? -5.921  8.064   -5.850  1.00 39.07  ? 294 PRO A CD  1 
ATOM   2285 N  N   . VAL A 1 295 ? -7.540  12.494  -4.900  1.00 55.68  ? 295 VAL A N   1 
ATOM   2286 C  CA  . VAL A 1 295 ? -7.580  13.638  -3.998  1.00 60.27  ? 295 VAL A CA  1 
ATOM   2287 C  C   . VAL A 1 295 ? -9.006  13.799  -3.482  1.00 60.20  ? 295 VAL A C   1 
ATOM   2288 O  O   . VAL A 1 295 ? -9.967  13.534  -4.212  1.00 67.66  ? 295 VAL A O   1 
ATOM   2289 C  CB  . VAL A 1 295 ? -7.074  14.927  -4.692  1.00 64.87  ? 295 VAL A CB  1 
ATOM   2290 C  CG1 . VAL A 1 295 ? -7.720  15.103  -6.082  1.00 57.64  ? 295 VAL A CG1 1 
ATOM   2291 C  CG2 . VAL A 1 295 ? -7.288  16.152  -3.811  1.00 67.66  ? 295 VAL A CG2 1 
ATOM   2292 N  N   . ILE A 1 296 ? -9.144  14.177  -2.205  1.00 56.71  ? 296 ILE A N   1 
ATOM   2293 C  CA  . ILE A 1 296 ? -10.443 14.496  -1.614  1.00 51.93  ? 296 ILE A CA  1 
ATOM   2294 C  C   . ILE A 1 296 ? -10.817 15.898  -2.060  1.00 58.23  ? 296 ILE A C   1 
ATOM   2295 O  O   . ILE A 1 296 ? -10.620 16.867  -1.321  1.00 52.99  ? 296 ILE A O   1 
ATOM   2296 C  CB  . ILE A 1 296 ? -10.415 14.388  -0.078  1.00 51.05  ? 296 ILE A CB  1 
ATOM   2297 C  CG1 . ILE A 1 296 ? -9.888  13.018  0.358   1.00 47.47  ? 296 ILE A CG1 1 
ATOM   2298 C  CG2 . ILE A 1 296 ? -11.808 14.670  0.536   1.00 46.83  ? 296 ILE A CG2 1 
ATOM   2299 C  CD1 . ILE A 1 296 ? -10.845 11.883  0.096   1.00 39.85  ? 296 ILE A CD1 1 
ATOM   2300 N  N   . ASP A 1 297 ? -11.370 16.001  -3.270  1.00 68.20  ? 297 ASP A N   1 
ATOM   2301 C  CA  . ASP A 1 297 ? -11.573 17.255  -3.984  1.00 69.20  ? 297 ASP A CA  1 
ATOM   2302 C  C   . ASP A 1 297 ? -12.861 17.973  -3.608  1.00 67.66  ? 297 ASP A C   1 
ATOM   2303 O  O   . ASP A 1 297 ? -13.045 19.131  -3.997  1.00 65.57  ? 297 ASP A O   1 
ATOM   2304 C  CB  . ASP A 1 297 ? -11.572 16.993  -5.497  1.00 71.45  ? 297 ASP A CB  1 
ATOM   2305 C  CG  . ASP A 1 297 ? -12.623 15.968  -5.915  1.00 76.60  ? 297 ASP A CG  1 
ATOM   2306 O  OD1 . ASP A 1 297 ? -13.154 15.247  -5.033  1.00 71.12  ? 297 ASP A OD1 1 
ATOM   2307 O  OD2 . ASP A 1 297 ? -12.907 15.874  -7.130  1.00 81.24  1 297 ASP A OD2 1 
ATOM   2308 N  N   . GLY A 1 298 ? -13.760 17.327  -2.881  1.00 58.87  ? 298 GLY A N   1 
ATOM   2309 C  CA  . GLY A 1 298 ? -15.020 17.969  -2.611  1.00 59.03  ? 298 GLY A CA  1 
ATOM   2310 C  C   . GLY A 1 298 ? -16.048 17.836  -3.708  1.00 64.60  ? 298 GLY A C   1 
ATOM   2311 O  O   . GLY A 1 298 ? -17.093 18.500  -3.637  1.00 70.03  ? 298 GLY A O   1 
ATOM   2312 N  N   . GLU A 1 299 ? -15.801 17.008  -4.727  1.00 61.63  ? 299 GLU A N   1 
ATOM   2313 C  CA  . GLU A 1 299 ? -16.883 16.775  -5.676  1.00 59.38  ? 299 GLU A CA  1 
ATOM   2314 C  C   . GLU A 1 299 ? -16.903 15.351  -6.246  1.00 49.70  ? 299 GLU A C   1 
ATOM   2315 O  O   . GLU A 1 299 ? -17.969 14.735  -6.267  1.00 50.80  ? 299 GLU A O   1 
ATOM   2316 C  CB  . GLU A 1 299 ? -16.859 17.853  -6.762  1.00 67.39  ? 299 GLU A CB  1 
ATOM   2317 C  CG  . GLU A 1 299 ? -16.288 17.477  -8.092  1.00 81.76  ? 299 GLU A CG  1 
ATOM   2318 C  CD  . GLU A 1 299 ? -16.253 18.666  -9.022  1.00 97.39  ? 299 GLU A CD  1 
ATOM   2319 O  OE1 . GLU A 1 299 ? -15.509 18.607  -10.027 1.00 100.93 ? 299 GLU A OE1 1 
ATOM   2320 O  OE2 . GLU A 1 299 ? -16.967 19.660  -8.734  1.00 101.82 1 299 GLU A OE2 1 
ATOM   2321 N  N   . PHE A 1 300 ? -15.781 14.773  -6.677  1.00 49.05  ? 300 PHE A N   1 
ATOM   2322 C  CA  . PHE A 1 300 ? -15.797 13.322  -6.840  1.00 46.63  ? 300 PHE A CA  1 
ATOM   2323 C  C   . PHE A 1 300 ? -16.086 12.660  -5.501  1.00 53.00  ? 300 PHE A C   1 
ATOM   2324 O  O   . PHE A 1 300 ? -16.868 11.709  -5.418  1.00 51.48  ? 300 PHE A O   1 
ATOM   2325 C  CB  . PHE A 1 300 ? -14.480 12.790  -7.410  1.00 40.91  ? 300 PHE A CB  1 
ATOM   2326 C  CG  . PHE A 1 300 ? -14.529 11.312  -7.742  1.00 41.34  ? 300 PHE A CG  1 
ATOM   2327 C  CD1 . PHE A 1 300 ? -14.399 10.348  -6.748  1.00 37.78  ? 300 PHE A CD1 1 
ATOM   2328 C  CD2 . PHE A 1 300 ? -14.722 10.883  -9.054  1.00 37.69  ? 300 PHE A CD2 1 
ATOM   2329 C  CE1 . PHE A 1 300 ? -14.465 8.972   -7.062  1.00 40.22  ? 300 PHE A CE1 1 
ATOM   2330 C  CE2 . PHE A 1 300 ? -14.773 9.513   -9.371  1.00 35.46  ? 300 PHE A CE2 1 
ATOM   2331 C  CZ  . PHE A 1 300 ? -14.652 8.558   -8.378  1.00 34.45  ? 300 PHE A CZ  1 
ATOM   2332 N  N   . PHE A 1 301 ? -15.437 13.142  -4.444  1.00 60.33  ? 301 PHE A N   1 
ATOM   2333 C  CA  . PHE A 1 301 ? -15.798 12.813  -3.072  1.00 59.99  ? 301 PHE A CA  1 
ATOM   2334 C  C   . PHE A 1 301 ? -16.412 14.053  -2.441  1.00 58.01  ? 301 PHE A C   1 
ATOM   2335 O  O   . PHE A 1 301 ? -15.698 15.045  -2.236  1.00 62.22  ? 301 PHE A O   1 
ATOM   2336 C  CB  . PHE A 1 301 ? -14.578 12.358  -2.271  1.00 52.11  ? 301 PHE A CB  1 
ATOM   2337 C  CG  . PHE A 1 301 ? -13.875 11.186  -2.857  1.00 48.93  ? 301 PHE A CG  1 
ATOM   2338 C  CD1 . PHE A 1 301 ? -14.390 9.911   -2.701  1.00 51.34  ? 301 PHE A CD1 1 
ATOM   2339 C  CD2 . PHE A 1 301 ? -12.680 11.349  -3.541  1.00 58.39  ? 301 PHE A CD2 1 
ATOM   2340 C  CE1 . PHE A 1 301 ? -13.732 8.806   -3.232  1.00 57.84  ? 301 PHE A CE1 1 
ATOM   2341 C  CE2 . PHE A 1 301 ? -12.012 10.250  -4.081  1.00 60.43  ? 301 PHE A CE2 1 
ATOM   2342 C  CZ  . PHE A 1 301 ? -12.539 8.976   -3.925  1.00 58.23  ? 301 PHE A CZ  1 
ATOM   2343 N  N   . PRO A 1 302 ? -17.714 14.065  -2.143  1.00 50.15  ? 302 PRO A N   1 
ATOM   2344 C  CA  . PRO A 1 302 ? -18.333 15.305  -1.642  1.00 51.99  ? 302 PRO A CA  1 
ATOM   2345 C  C   . PRO A 1 302 ? -17.696 15.831  -0.364  1.00 64.97  ? 302 PRO A C   1 
ATOM   2346 O  O   . PRO A 1 302 ? -17.627 17.055  -0.189  1.00 68.14  ? 302 PRO A O   1 
ATOM   2347 C  CB  . PRO A 1 302 ? -19.799 14.911  -1.413  1.00 50.86  ? 302 PRO A CB  1 
ATOM   2348 C  CG  . PRO A 1 302 ? -19.993 13.586  -2.049  1.00 53.20  ? 302 PRO A CG  1 
ATOM   2349 C  CD  . PRO A 1 302 ? -18.698 13.069  -2.589  1.00 48.83  ? 302 PRO A CD  1 
ATOM   2350 N  N   . THR A 1 303 ? -17.237 14.952  0.534   1.00 66.35  ? 303 THR A N   1 
ATOM   2351 C  CA  . THR A 1 303 ? -16.684 15.361  1.828   1.00 63.95  ? 303 THR A CA  1 
ATOM   2352 C  C   . THR A 1 303 ? -15.547 14.420  2.212   1.00 69.57  ? 303 THR A C   1 
ATOM   2353 O  O   . THR A 1 303 ? -15.051 13.637  1.394   1.00 71.30  ? 303 THR A O   1 
ATOM   2354 C  CB  . THR A 1 303 ? -17.746 15.360  2.939   1.00 60.18  ? 303 THR A CB  1 
ATOM   2355 O  OG1 . THR A 1 303 ? -18.337 14.058  3.044   1.00 62.62  ? 303 THR A OG1 1 
ATOM   2356 C  CG2 . THR A 1 303 ? -18.818 16.410  2.696   1.00 49.89  ? 303 THR A CG2 1 
ATOM   2357 N  N   . SER A 1 304 ? -15.133 14.504  3.477   1.00 70.32  ? 304 SER A N   1 
ATOM   2358 C  CA  . SER A 1 304 ? -14.155 13.567  4.006   1.00 64.29  ? 304 SER A CA  1 
ATOM   2359 C  C   . SER A 1 304 ? -14.753 12.170  4.046   1.00 55.77  ? 304 SER A C   1 
ATOM   2360 O  O   . SER A 1 304 ? -15.953 11.994  4.274   1.00 56.64  ? 304 SER A O   1 
ATOM   2361 C  CB  . SER A 1 304 ? -13.709 13.974  5.409   1.00 63.44  ? 304 SER A CB  1 
ATOM   2362 O  OG  . SER A 1 304 ? -14.605 13.493  6.399   1.00 62.07  ? 304 SER A OG  1 
ATOM   2363 N  N   . LEU A 1 305 ? -13.911 11.166  3.809   1.00 41.82  ? 305 LEU A N   1 
ATOM   2364 C  CA  . LEU A 1 305 ? -14.440 9.812   3.749   1.00 40.34  ? 305 LEU A CA  1 
ATOM   2365 C  C   . LEU A 1 305 ? -15.009 9.375   5.086   1.00 56.73  ? 305 LEU A C   1 
ATOM   2366 O  O   . LEU A 1 305 ? -16.152 8.907   5.139   1.00 68.70  ? 305 LEU A O   1 
ATOM   2367 C  CB  . LEU A 1 305 ? -13.396 8.823   3.244   1.00 46.05  ? 305 LEU A CB  1 
ATOM   2368 C  CG  . LEU A 1 305 ? -12.597 9.338   2.040   1.00 46.74  ? 305 LEU A CG  1 
ATOM   2369 C  CD1 . LEU A 1 305 ? -11.412 8.438   1.717   1.00 36.74  ? 305 LEU A CD1 1 
ATOM   2370 C  CD2 . LEU A 1 305 ? -13.514 9.550   0.830   1.00 52.08  ? 305 LEU A CD2 1 
ATOM   2371 N  N   . GLU A 1 306 ? -14.262 9.570   6.178   1.00 55.49  ? 306 GLU A N   1 
ATOM   2372 C  CA  . GLU A 1 306 ? -14.776 9.194   7.496   1.00 53.25  ? 306 GLU A CA  1 
ATOM   2373 C  C   . GLU A 1 306 ? -16.177 9.757   7.730   1.00 53.82  ? 306 GLU A C   1 
ATOM   2374 O  O   . GLU A 1 306 ? -17.082 9.028   8.159   1.00 53.11  ? 306 GLU A O   1 
ATOM   2375 C  CB  . GLU A 1 306 ? -13.818 9.659   8.587   1.00 48.86  ? 306 GLU A CB  1 
ATOM   2376 C  CG  . GLU A 1 306 ? -14.200 9.196   9.976   1.00 63.81  ? 306 GLU A CG  1 
ATOM   2377 C  CD  . GLU A 1 306 ? -13.974 7.699   10.181  1.00 72.65  ? 306 GLU A CD  1 
ATOM   2378 O  OE1 . GLU A 1 306 ? -14.306 7.193   11.278  1.00 78.54  ? 306 GLU A OE1 1 
ATOM   2379 O  OE2 . GLU A 1 306 ? -13.459 7.030   9.253   1.00 62.89  1 306 GLU A OE2 1 
ATOM   2380 N  N   . SER A 1 307 ? -16.391 11.039  7.415   1.00 52.26  ? 307 SER A N   1 
ATOM   2381 C  CA  . SER A 1 307 ? -17.730 11.607  7.567   1.00 59.27  ? 307 SER A CA  1 
ATOM   2382 C  C   . SER A 1 307 ? -18.726 10.940  6.624   1.00 64.35  ? 307 SER A C   1 
ATOM   2383 O  O   . SER A 1 307 ? -19.882 10.715  6.999   1.00 62.53  ? 307 SER A O   1 
ATOM   2384 C  CB  . SER A 1 307 ? -17.710 13.122  7.349   1.00 50.82  ? 307 SER A CB  1 
ATOM   2385 O  OG  . SER A 1 307 ? -17.121 13.471  6.112   1.00 51.37  ? 307 SER A OG  1 
ATOM   2386 N  N   . MET A 1 308 ? -18.297 10.600  5.402   1.00 65.14  ? 308 MET A N   1 
ATOM   2387 C  CA  . MET A 1 308 ? -19.182 9.868   4.503   1.00 60.26  ? 308 MET A CA  1 
ATOM   2388 C  C   . MET A 1 308 ? -19.536 8.495   5.055   1.00 66.55  ? 308 MET A C   1 
ATOM   2389 O  O   . MET A 1 308 ? -20.651 8.015   4.825   1.00 74.28  ? 308 MET A O   1 
ATOM   2390 C  CB  . MET A 1 308 ? -18.553 9.737   3.118   1.00 57.45  ? 308 MET A CB  1 
ATOM   2391 C  CG  . MET A 1 308 ? -18.572 11.035  2.332   1.00 66.10  ? 308 MET A CG  1 
ATOM   2392 S  SD  . MET A 1 308 ? -17.652 11.016  0.774   1.00 69.17  ? 308 MET A SD  1 
ATOM   2393 C  CE  . MET A 1 308 ? -18.553 9.792   -0.167  1.00 69.79  ? 308 MET A CE  1 
ATOM   2394 N  N   . LEU A 1 309 ? -18.623 7.845   5.794   1.00 59.07  ? 309 LEU A N   1 
ATOM   2395 C  CA  . LEU A 1 309 ? -18.961 6.524   6.326   1.00 60.15  ? 309 LEU A CA  1 
ATOM   2396 C  C   . LEU A 1 309 ? -19.737 6.588   7.649   1.00 65.95  ? 309 LEU A C   1 
ATOM   2397 O  O   . LEU A 1 309 ? -20.615 5.742   7.892   1.00 65.67  ? 309 LEU A O   1 
ATOM   2398 C  CB  . LEU A 1 309 ? -17.713 5.650   6.488   1.00 55.39  ? 309 LEU A CB  1 
ATOM   2399 C  CG  . LEU A 1 309 ? -16.774 5.469   5.284   1.00 51.55  ? 309 LEU A CG  1 
ATOM   2400 C  CD1 . LEU A 1 309 ? -15.296 5.950   5.542   1.00 44.38  ? 309 LEU A CD1 1 
ATOM   2401 C  CD2 . LEU A 1 309 ? -16.890 4.038   4.710   1.00 50.94  ? 309 LEU A CD2 1 
ATOM   2402 N  N   . ASN A 1 310 ? -19.432 7.556   8.527   1.00 64.86  ? 310 ASN A N   1 
ATOM   2403 C  CA  . ASN A 1 310 ? -20.299 7.750   9.689   1.00 63.72  ? 310 ASN A CA  1 
ATOM   2404 C  C   . ASN A 1 310 ? -21.690 8.176   9.266   1.00 56.67  ? 310 ASN A C   1 
ATOM   2405 O  O   . ASN A 1 310 ? -22.685 7.768   9.882   1.00 56.36  ? 310 ASN A O   1 
ATOM   2406 C  CB  . ASN A 1 310 ? -19.753 8.792   10.668  1.00 66.61  ? 310 ASN A CB  1 
ATOM   2407 C  CG  . ASN A 1 310 ? -18.343 8.518   11.104  1.00 61.08  ? 310 ASN A CG  1 
ATOM   2408 O  OD1 . ASN A 1 310 ? -17.943 7.369   11.253  1.00 66.93  ? 310 ASN A OD1 1 
ATOM   2409 N  ND2 . ASN A 1 310 ? -17.599 9.578   11.385  1.00 52.56  ? 310 ASN A ND2 1 
ATOM   2410 N  N   . SER A 1 311 ? -21.780 9.027   8.238   1.00 56.69  ? 311 SER A N   1 
ATOM   2411 C  CA  . SER A 1 311 ? -23.081 9.497   7.782   1.00 64.17  ? 311 SER A CA  1 
ATOM   2412 C  C   . SER A 1 311 ? -23.796 8.459   6.934   1.00 57.27  ? 311 SER A C   1 
ATOM   2413 O  O   . SER A 1 311 ? -25.012 8.568   6.730   1.00 56.40  ? 311 SER A O   1 
ATOM   2414 C  CB  . SER A 1 311 ? -22.945 10.789  6.977   1.00 66.72  ? 311 SER A CB  1 
ATOM   2415 O  OG  . SER A 1 311 ? -22.276 10.546  5.748   1.00 71.48  ? 311 SER A OG  1 
ATOM   2416 N  N   . GLY A 1 312 ? -23.074 7.458   6.448   1.00 46.99  ? 312 GLY A N   1 
ATOM   2417 C  CA  . GLY A 1 312 ? -23.675 6.500   5.552   1.00 47.60  ? 312 GLY A CA  1 
ATOM   2418 C  C   . GLY A 1 312 ? -23.944 7.061   4.178   1.00 49.91  ? 312 GLY A C   1 
ATOM   2419 O  O   . GLY A 1 312 ? -24.881 6.623   3.517   1.00 46.98  ? 312 GLY A O   1 
ATOM   2420 N  N   . ASN A 1 313 ? -23.153 8.037   3.735   1.00 55.68  ? 313 ASN A N   1 
ATOM   2421 C  CA  . ASN A 1 313 ? -23.296 8.606   2.394   1.00 56.89  ? 313 ASN A CA  1 
ATOM   2422 C  C   . ASN A 1 313 ? -22.478 7.757   1.416   1.00 58.26  ? 313 ASN A C   1 
ATOM   2423 O  O   . ASN A 1 313 ? -21.399 8.134   0.947   1.00 63.37  ? 313 ASN A O   1 
ATOM   2424 C  CB  . ASN A 1 313 ? -22.878 10.074  2.395   1.00 63.56  ? 313 ASN A CB  1 
ATOM   2425 C  CG  . ASN A 1 313 ? -23.059 10.747  1.039   1.00 73.87  ? 313 ASN A CG  1 
ATOM   2426 O  OD1 . ASN A 1 313 ? -23.711 10.210  0.146   1.00 85.88  ? 313 ASN A OD1 1 
ATOM   2427 N  ND2 . ASN A 1 313 ? -22.476 11.927  0.882   1.00 71.40  ? 313 ASN A ND2 1 
ATOM   2428 N  N   . PHE A 1 314 ? -23.012 6.577   1.114   1.00 50.94  ? 314 PHE A N   1 
ATOM   2429 C  CA  . PHE A 1 314 ? -22.446 5.703   0.095   1.00 50.52  ? 314 PHE A CA  1 
ATOM   2430 C  C   . PHE A 1 314 ? -23.543 4.772   -0.409  1.00 49.09  ? 314 PHE A C   1 
ATOM   2431 O  O   . PHE A 1 314 ? -24.682 4.804   0.063   1.00 41.58  ? 314 PHE A O   1 
ATOM   2432 C  CB  . PHE A 1 314 ? -21.250 4.921   0.632   1.00 44.17  ? 314 PHE A CB  1 
ATOM   2433 C  CG  . PHE A 1 314 ? -21.486 4.301   1.969   1.00 45.56  ? 314 PHE A CG  1 
ATOM   2434 C  CD1 . PHE A 1 314 ? -22.201 3.123   2.086   1.00 47.05  ? 314 PHE A CD1 1 
ATOM   2435 C  CD2 . PHE A 1 314 ? -20.983 4.893   3.117   1.00 47.58  ? 314 PHE A CD2 1 
ATOM   2436 C  CE1 . PHE A 1 314 ? -22.429 2.556   3.335   1.00 54.19  ? 314 PHE A CE1 1 
ATOM   2437 C  CE2 . PHE A 1 314 ? -21.194 4.322   4.368   1.00 50.00  ? 314 PHE A CE2 1 
ATOM   2438 C  CZ  . PHE A 1 314 ? -21.920 3.151   4.474   1.00 54.12  ? 314 PHE A CZ  1 
ATOM   2439 N  N   . LYS A 1 315 ? -23.191 3.950   -1.392  1.00 49.28  ? 315 LYS A N   1 
ATOM   2440 C  CA  . LYS A 1 315 ? -24.107 2.940   -1.907  1.00 46.02  ? 315 LYS A CA  1 
ATOM   2441 C  C   . LYS A 1 315 ? -24.350 1.857   -0.855  1.00 51.55  ? 315 LYS A C   1 
ATOM   2442 O  O   . LYS A 1 315 ? -23.398 1.315   -0.277  1.00 53.47  ? 315 LYS A O   1 
ATOM   2443 C  CB  . LYS A 1 315 ? -23.514 2.333   -3.181  1.00 46.06  ? 315 LYS A CB  1 
ATOM   2444 C  CG  . LYS A 1 315 ? -24.352 1.262   -3.849  1.00 51.47  ? 315 LYS A CG  1 
ATOM   2445 C  CD  . LYS A 1 315 ? -23.697 0.794   -5.152  1.00 49.80  ? 315 LYS A CD  1 
ATOM   2446 C  CE  . LYS A 1 315 ? -24.659 -0.031  -5.970  1.00 40.23  ? 315 LYS A CE  1 
ATOM   2447 N  NZ  . LYS A 1 315 ? -25.648 0.910   -6.538  1.00 47.81  1 315 LYS A NZ  1 
ATOM   2448 N  N   . LYS A 1 316 ? -25.619 1.549   -0.574  1.00 43.71  ? 316 LYS A N   1 
ATOM   2449 C  CA  . LYS A 1 316 ? -25.938 0.422   0.300   1.00 43.18  ? 316 LYS A CA  1 
ATOM   2450 C  C   . LYS A 1 316 ? -26.213 -0.770  -0.598  1.00 47.46  ? 316 LYS A C   1 
ATOM   2451 O  O   . LYS A 1 316 ? -27.240 -0.819  -1.280  1.00 61.99  ? 316 LYS A O   1 
ATOM   2452 C  CB  . LYS A 1 316 ? -27.125 0.671   1.229   1.00 43.33  ? 316 LYS A CB  1 
ATOM   2453 C  CG  . LYS A 1 316 ? -27.551 2.090   1.452   1.00 40.22  ? 316 LYS A CG  1 
ATOM   2454 C  CD  . LYS A 1 316 ? -26.543 3.009   2.096   1.00 40.30  ? 316 LYS A CD  1 
ATOM   2455 C  CE  . LYS A 1 316 ? -27.323 4.137   2.804   1.00 53.17  ? 316 LYS A CE  1 
ATOM   2456 N  NZ  . LYS A 1 316 ? -26.641 5.464   2.825   1.00 53.15  1 316 LYS A NZ  1 
ATOM   2457 N  N   . THR A 1 317 ? -25.299 -1.727  -0.601  1.00 42.80  ? 317 THR A N   1 
ATOM   2458 C  CA  . THR A 1 317 ? -25.506 -2.912  -1.415  1.00 36.97  ? 317 THR A CA  1 
ATOM   2459 C  C   . THR A 1 317 ? -24.880 -4.101  -0.703  1.00 35.87  ? 317 THR A C   1 
ATOM   2460 O  O   . THR A 1 317 ? -24.934 -4.176  0.531   1.00 42.19  ? 317 THR A O   1 
ATOM   2461 C  CB  . THR A 1 317 ? -24.951 -2.701  -2.826  1.00 38.67  ? 317 THR A CB  1 
ATOM   2462 O  OG1 . THR A 1 317 ? -24.990 -3.938  -3.546  1.00 52.91  ? 317 THR A OG1 1 
ATOM   2463 C  CG2 . THR A 1 317 ? -23.520 -2.160  -2.795  1.00 41.94  ? 317 THR A CG2 1 
ATOM   2464 N  N   . GLN A 1 318 ? -24.336 -5.050  -1.455  1.00 33.57  ? 318 GLN A N   1 
ATOM   2465 C  CA  . GLN A 1 318 ? -23.598 -6.164  -0.883  1.00 38.84  ? 318 GLN A CA  1 
ATOM   2466 C  C   . GLN A 1 318 ? -22.122 -5.931  -1.178  1.00 37.74  ? 318 GLN A C   1 
ATOM   2467 O  O   . GLN A 1 318 ? -21.775 -5.450  -2.260  1.00 52.54  ? 318 GLN A O   1 
ATOM   2468 C  CB  . GLN A 1 318 ? -24.039 -7.509  -1.470  1.00 37.78  ? 318 GLN A CB  1 
ATOM   2469 C  CG  . GLN A 1 318 ? -25.410 -7.970  -1.082  1.00 45.94  ? 318 GLN A CG  1 
ATOM   2470 C  CD  . GLN A 1 318 ? -26.496 -7.397  -2.001  1.00 67.75  ? 318 GLN A CD  1 
ATOM   2471 O  OE1 . GLN A 1 318 ? -26.228 -6.507  -2.823  1.00 74.87  ? 318 GLN A OE1 1 
ATOM   2472 N  NE2 . GLN A 1 318 ? -27.723 -7.938  -1.890  1.00 68.77  ? 318 GLN A NE2 1 
ATOM   2473 N  N   . ILE A 1 319 ? -21.247 -6.235  -0.225  1.00 31.72  ? 319 ILE A N   1 
ATOM   2474 C  CA  . ILE A 1 319 ? -19.812 -6.218  -0.497  1.00 31.76  ? 319 ILE A CA  1 
ATOM   2475 C  C   . ILE A 1 319 ? -19.203 -7.502  0.036   1.00 35.23  ? 319 ILE A C   1 
ATOM   2476 O  O   . ILE A 1 319 ? -19.663 -8.049  1.043   1.00 33.16  ? 319 ILE A O   1 
ATOM   2477 C  CB  . ILE A 1 319 ? -19.107 -4.992  0.105   1.00 30.62  ? 319 ILE A CB  1 
ATOM   2478 C  CG1 . ILE A 1 319 ? -19.455 -4.876  1.580   1.00 35.51  ? 319 ILE A CG1 1 
ATOM   2479 C  CG2 . ILE A 1 319 ? -19.476 -3.736  -0.642  1.00 30.74  ? 319 ILE A CG2 1 
ATOM   2480 C  CD1 . ILE A 1 319 ? -18.325 -4.403  2.400   1.00 40.93  ? 319 ILE A CD1 1 
ATOM   2481 N  N   . LEU A 1 320 ? -18.215 -8.013  -0.685  1.00 29.49  ? 320 LEU A N   1 
ATOM   2482 C  CA  . LEU A 1 320 ? -17.423 -9.161  -0.277  1.00 29.33  ? 320 LEU A CA  1 
ATOM   2483 C  C   . LEU A 1 320 ? -15.965 -8.712  -0.293  1.00 36.77  ? 320 LEU A C   1 
ATOM   2484 O  O   . LEU A 1 320 ? -15.491 -8.153  -1.288  1.00 37.53  ? 320 LEU A O   1 
ATOM   2485 C  CB  . LEU A 1 320 ? -17.665 -10.347 -1.221  1.00 29.15  ? 320 LEU A CB  1 
ATOM   2486 C  CG  . LEU A 1 320 ? -16.951 -11.677 -0.935  1.00 39.62  ? 320 LEU A CG  1 
ATOM   2487 C  CD1 . LEU A 1 320 ? -17.792 -12.924 -1.297  1.00 29.81  ? 320 LEU A CD1 1 
ATOM   2488 C  CD2 . LEU A 1 320 ? -15.583 -11.698 -1.624  1.00 37.43  ? 320 LEU A CD2 1 
ATOM   2489 N  N   . LEU A 1 321 ? -15.258 -8.898  0.809   1.00 41.06  ? 321 LEU A N   1 
ATOM   2490 C  CA  . LEU A 1 321 ? -13.955 -8.262  0.890   1.00 42.69  ? 321 LEU A CA  1 
ATOM   2491 C  C   . LEU A 1 321 ? -13.071 -9.061  1.824   1.00 41.13  ? 321 LEU A C   1 
ATOM   2492 O  O   . LEU A 1 321 ? -13.516 -10.012 2.466   1.00 45.85  ? 321 LEU A O   1 
ATOM   2493 C  CB  . LEU A 1 321 ? -14.072 -6.786  1.307   1.00 38.10  ? 321 LEU A CB  1 
ATOM   2494 C  CG  . LEU A 1 321 ? -14.539 -6.327  2.687   1.00 31.67  ? 321 LEU A CG  1 
ATOM   2495 C  CD1 . LEU A 1 321 ? -14.580 -4.801  2.731   1.00 29.74  ? 321 LEU A CD1 1 
ATOM   2496 C  CD2 . LEU A 1 321 ? -15.893 -6.926  3.027   1.00 30.23  ? 321 LEU A CD2 1 
ATOM   2497 N  N   . GLY A 1 322 ? -11.799 -8.689  1.866   1.00 37.38  ? 322 GLY A N   1 
ATOM   2498 C  CA  . GLY A 1 322 ? -10.843 -9.460  2.628   1.00 33.48  ? 322 GLY A CA  1 
ATOM   2499 C  C   . GLY A 1 322 ? -9.438  -8.986  2.358   1.00 34.31  ? 322 GLY A C   1 
ATOM   2500 O  O   . GLY A 1 322 ? -9.209  -8.005  1.641   1.00 40.11  ? 322 GLY A O   1 
ATOM   2501 N  N   . VAL A 1 323 ? -8.493  -9.711  2.958   1.00 33.36  ? 323 VAL A N   1 
ATOM   2502 C  CA  . VAL A 1 323 ? -7.069  -9.407  2.876   1.00 27.03  ? 323 VAL A CA  1 
ATOM   2503 C  C   . VAL A 1 323 ? -6.283  -10.711 2.747   1.00 31.61  ? 323 VAL A C   1 
ATOM   2504 O  O   . VAL A 1 323 ? -6.793  -11.807 2.995   1.00 29.99  ? 323 VAL A O   1 
ATOM   2505 C  CB  . VAL A 1 323 ? -6.574  -8.605  4.104   1.00 33.01  ? 323 VAL A CB  1 
ATOM   2506 C  CG1 . VAL A 1 323 ? -7.337  -7.288  4.229   1.00 38.35  ? 323 VAL A CG1 1 
ATOM   2507 C  CG2 . VAL A 1 323 ? -6.692  -9.438  5.389   1.00 28.36  ? 323 VAL A CG2 1 
ATOM   2508 N  N   . ASN A 1 324 ? -5.025  -10.587 2.336   1.00 34.29  ? 324 ASN A N   1 
ATOM   2509 C  CA  . ASN A 1 324 ? -4.103  -11.704 2.436   1.00 36.42  ? 324 ASN A CA  1 
ATOM   2510 C  C   . ASN A 1 324 ? -3.339  -11.615 3.745   1.00 38.13  ? 324 ASN A C   1 
ATOM   2511 O  O   . ASN A 1 324 ? -3.329  -10.573 4.409   1.00 34.54  ? 324 ASN A O   1 
ATOM   2512 C  CB  . ASN A 1 324 ? -3.149  -11.746 1.251   1.00 46.24  ? 324 ASN A CB  1 
ATOM   2513 C  CG  . ASN A 1 324 ? -3.859  -11.964 -0.046  1.00 46.94  ? 324 ASN A CG  1 
ATOM   2514 O  OD1 . ASN A 1 324 ? -5.023  -12.345 -0.072  1.00 49.17  ? 324 ASN A OD1 1 
ATOM   2515 N  ND2 . ASN A 1 324 ? -3.152  -11.754 -1.141  1.00 50.93  ? 324 ASN A ND2 1 
ATOM   2516 N  N   . LYS A 1 325 ? -2.705  -12.734 4.123   1.00 36.87  ? 325 LYS A N   1 
ATOM   2517 C  CA  . LYS A 1 325 ? -2.065  -12.797 5.438   1.00 46.81  ? 325 LYS A CA  1 
ATOM   2518 C  C   . LYS A 1 325 ? -0.981  -11.737 5.580   1.00 48.40  ? 325 LYS A C   1 
ATOM   2519 O  O   . LYS A 1 325 ? -0.929  -11.030 6.590   1.00 53.53  ? 325 LYS A O   1 
ATOM   2520 C  CB  . LYS A 1 325 ? -1.480  -14.184 5.711   1.00 41.61  ? 325 LYS A CB  1 
ATOM   2521 C  CG  . LYS A 1 325 ? -0.854  -14.357 7.095   1.00 37.17  ? 325 LYS A CG  1 
ATOM   2522 C  CD  . LYS A 1 325 ? -0.905  -15.832 7.494   1.00 49.04  ? 325 LYS A CD  1 
ATOM   2523 C  CE  . LYS A 1 325 ? 0.503   -16.427 7.491   1.00 70.96  ? 325 LYS A CE  1 
ATOM   2524 N  NZ  . LYS A 1 325 ? 0.503   -17.920 7.273   1.00 80.05  1 325 LYS A NZ  1 
ATOM   2525 N  N   . ASP A 1 326 ? -0.122  -11.586 4.572   1.00 47.66  ? 326 ASP A N   1 
ATOM   2526 C  CA  . ASP A 1 326 ? 1.064   -10.740 4.713   1.00 48.23  ? 326 ASP A CA  1 
ATOM   2527 C  C   . ASP A 1 326 ? 1.064   -9.668  3.633   1.00 40.81  ? 326 ASP A C   1 
ATOM   2528 O  O   . ASP A 1 326 ? 1.818   -9.731  2.665   1.00 49.67  ? 326 ASP A O   1 
ATOM   2529 C  CB  . ASP A 1 326 ? 2.362   -11.616 4.698   1.00 46.23  ? 326 ASP A CB  1 
ATOM   2530 C  CG  . ASP A 1 326 ? 2.387   -12.643 5.849   1.00 56.70  ? 326 ASP A CG  1 
ATOM   2531 O  OD1 . ASP A 1 326 ? 2.545   -12.235 7.027   1.00 62.48  ? 326 ASP A OD1 1 
ATOM   2532 O  OD2 . ASP A 1 326 ? 2.240   -13.860 5.586   1.00 56.68  1 326 ASP A OD2 1 
ATOM   2533 N  N   . GLU A 1 327 ? 0.241   -8.645  3.838   1.00 28.51  ? 327 GLU A N   1 
ATOM   2534 C  CA  . GLU A 1 327 ? 0.212   -7.489  2.953   1.00 36.72  ? 327 GLU A CA  1 
ATOM   2535 C  C   . GLU A 1 327 ? 1.474   -6.631  3.012   1.00 44.38  ? 327 GLU A C   1 
ATOM   2536 O  O   . GLU A 1 327 ? 1.611   -5.731  2.177   1.00 51.51  ? 327 GLU A O   1 
ATOM   2537 C  CB  . GLU A 1 327 ? -0.984  -6.612  3.299   1.00 38.15  ? 327 GLU A CB  1 
ATOM   2538 C  CG  . GLU A 1 327 ? -2.286  -7.351  3.255   1.00 49.32  ? 327 GLU A CG  1 
ATOM   2539 C  CD  . GLU A 1 327 ? -2.905  -7.346  1.895   1.00 60.76  ? 327 GLU A CD  1 
ATOM   2540 O  OE1 . GLU A 1 327 ? -2.465  -6.542  1.033   1.00 73.25  ? 327 GLU A OE1 1 
ATOM   2541 O  OE2 . GLU A 1 327 ? -3.808  -8.188  1.662   1.00 56.59  1 327 GLU A OE2 1 
ATOM   2542 N  N   . GLY A 1 328 ? 2.383   -6.863  3.962   1.00 39.77  ? 328 GLY A N   1 
ATOM   2543 C  CA  . GLY A 1 328 ? 3.532   -5.985  4.129   1.00 38.74  ? 328 GLY A CA  1 
ATOM   2544 C  C   . GLY A 1 328 ? 4.842   -6.407  3.465   1.00 42.62  ? 328 GLY A C   1 
ATOM   2545 O  O   . GLY A 1 328 ? 5.725   -5.567  3.230   1.00 35.79  ? 328 GLY A O   1 
ATOM   2546 N  N   . SER A 1 329 ? 4.976   -7.702  3.152   1.00 37.00  ? 329 SER A N   1 
ATOM   2547 C  CA  . SER A 1 329 ? 6.209   -8.250  2.589   1.00 37.02  ? 329 SER A CA  1 
ATOM   2548 C  C   . SER A 1 329 ? 6.765   -7.395  1.451   1.00 53.71  ? 329 SER A C   1 
ATOM   2549 O  O   . SER A 1 329 ? 7.908   -6.927  1.507   1.00 56.46  ? 329 SER A O   1 
ATOM   2550 C  CB  . SER A 1 329 ? 5.945   -9.668  2.096   1.00 42.99  ? 329 SER A CB  1 
ATOM   2551 O  OG  . SER A 1 329 ? 5.160   -10.373 3.032   1.00 55.61  ? 329 SER A OG  1 
ATOM   2552 N  N   . PHE A 1 330 ? 5.959   -7.182  0.405   1.00 58.66  ? 330 PHE A N   1 
ATOM   2553 C  CA  . PHE A 1 330 ? 6.459   -6.563  -0.823  1.00 59.35  ? 330 PHE A CA  1 
ATOM   2554 C  C   . PHE A 1 330 ? 7.114   -5.216  -0.573  1.00 56.40  ? 330 PHE A C   1 
ATOM   2555 O  O   . PHE A 1 330 ? 8.038   -4.836  -1.295  1.00 67.94  ? 330 PHE A O   1 
ATOM   2556 C  CB  . PHE A 1 330 ? 5.323   -6.387  -1.830  1.00 60.04  ? 330 PHE A CB  1 
ATOM   2557 C  CG  . PHE A 1 330 ? 5.430   -7.287  -3.017  1.00 48.11  ? 330 PHE A CG  1 
ATOM   2558 C  CD1 . PHE A 1 330 ? 4.307   -7.928  -3.518  1.00 45.32  ? 330 PHE A CD1 1 
ATOM   2559 C  CD2 . PHE A 1 330 ? 6.646   -7.491  -3.631  1.00 44.17  ? 330 PHE A CD2 1 
ATOM   2560 C  CE1 . PHE A 1 330 ? 4.399   -8.772  -4.606  1.00 47.13  ? 330 PHE A CE1 1 
ATOM   2561 C  CE2 . PHE A 1 330 ? 6.748   -8.324  -4.716  1.00 51.24  ? 330 PHE A CE2 1 
ATOM   2562 C  CZ  . PHE A 1 330 ? 5.620   -8.968  -5.206  1.00 55.29  ? 330 PHE A CZ  1 
ATOM   2563 N  N   . PHE A 1 331 ? 6.657   -4.481  0.429   1.00 52.14  ? 331 PHE A N   1 
ATOM   2564 C  CA  . PHE A 1 331 ? 7.044   -3.084  0.548   1.00 48.02  ? 331 PHE A CA  1 
ATOM   2565 C  C   . PHE A 1 331 ? 8.299   -2.927  1.364   1.00 51.47  ? 331 PHE A C   1 
ATOM   2566 O  O   . PHE A 1 331 ? 9.088   -2.014  1.092   1.00 60.37  ? 331 PHE A O   1 
ATOM   2567 C  CB  . PHE A 1 331 ? 5.892   -2.273  1.143   1.00 48.36  ? 331 PHE A CB  1 
ATOM   2568 C  CG  . PHE A 1 331 ? 4.632   -2.382  0.336   1.00 51.10  ? 331 PHE A CG  1 
ATOM   2569 C  CD1 . PHE A 1 331 ? 3.949   -3.599  0.250   1.00 48.66  ? 331 PHE A CD1 1 
ATOM   2570 C  CD2 . PHE A 1 331 ? 4.155   -1.297  -0.371  1.00 62.10  ? 331 PHE A CD2 1 
ATOM   2571 C  CE1 . PHE A 1 331 ? 2.827   -3.731  -0.519  1.00 62.44  ? 331 PHE A CE1 1 
ATOM   2572 C  CE2 . PHE A 1 331 ? 3.018   -1.417  -1.148  1.00 70.90  ? 331 PHE A CE2 1 
ATOM   2573 C  CZ  . PHE A 1 331 ? 2.347   -2.637  -1.220  1.00 68.89  ? 331 PHE A CZ  1 
ATOM   2574 N  N   . LEU A 1 332 ? 8.514   -3.832  2.325   1.00 46.10  ? 332 LEU A N   1 
ATOM   2575 C  CA  . LEU A 1 332 ? 9.795   -3.896  3.022   1.00 39.60  ? 332 LEU A CA  1 
ATOM   2576 C  C   . LEU A 1 332 ? 10.892  -4.396  2.100   1.00 46.88  ? 332 LEU A C   1 
ATOM   2577 O  O   . LEU A 1 332 ? 11.982  -3.815  2.053   1.00 58.66  ? 332 LEU A O   1 
ATOM   2578 C  CB  . LEU A 1 332 ? 9.683   -4.803  4.247   1.00 40.99  ? 332 LEU A CB  1 
ATOM   2579 C  CG  . LEU A 1 332 ? 8.586   -4.348  5.200   1.00 40.12  ? 332 LEU A CG  1 
ATOM   2580 C  CD1 . LEU A 1 332 ? 8.281   -5.432  6.196   1.00 36.21  ? 332 LEU A CD1 1 
ATOM   2581 C  CD2 . LEU A 1 332 ? 9.022   -3.062  5.872   1.00 32.91  ? 332 LEU A CD2 1 
ATOM   2582 N  N   . LEU A 1 333 ? 10.618  -5.469  1.353   1.00 47.87  ? 333 LEU A N   1 
ATOM   2583 C  CA  . LEU A 1 333 ? 11.615  -6.026  0.442   1.00 48.95  ? 333 LEU A CA  1 
ATOM   2584 C  C   . LEU A 1 333 ? 12.202  -4.968  -0.483  1.00 45.26  ? 333 LEU A C   1 
ATOM   2585 O  O   . LEU A 1 333 ? 13.414  -4.945  -0.717  1.00 59.04  ? 333 LEU A O   1 
ATOM   2586 C  CB  . LEU A 1 333 ? 10.996  -7.152  -0.373  1.00 46.81  ? 333 LEU A CB  1 
ATOM   2587 C  CG  . LEU A 1 333 ? 11.754  -7.605  -1.614  1.00 48.06  ? 333 LEU A CG  1 
ATOM   2588 C  CD1 . LEU A 1 333 ? 13.101  -8.197  -1.266  1.00 54.31  ? 333 LEU A CD1 1 
ATOM   2589 C  CD2 . LEU A 1 333 ? 10.887  -8.629  -2.264  1.00 51.53  ? 333 LEU A CD2 1 
ATOM   2590 N  N   . TYR A 1 334 ? 11.369  -4.077  -1.003  1.00 34.93  ? 334 TYR A N   1 
ATOM   2591 C  CA  . TYR A 1 334 ? 11.835  -3.071  -1.945  1.00 37.82  ? 334 TYR A CA  1 
ATOM   2592 C  C   . TYR A 1 334 ? 12.359  -1.803  -1.287  1.00 49.14  ? 334 TYR A C   1 
ATOM   2593 O  O   . TYR A 1 334 ? 12.999  -1.002  -1.976  1.00 60.07  ? 334 TYR A O   1 
ATOM   2594 C  CB  . TYR A 1 334 ? 10.712  -2.685  -2.912  1.00 40.98  ? 334 TYR A CB  1 
ATOM   2595 C  CG  . TYR A 1 334 ? 10.527  -3.638  -4.058  1.00 41.56  ? 334 TYR A CG  1 
ATOM   2596 C  CD1 . TYR A 1 334 ? 10.273  -4.989  -3.828  1.00 40.53  ? 334 TYR A CD1 1 
ATOM   2597 C  CD2 . TYR A 1 334 ? 10.577  -3.186  -5.378  1.00 38.30  ? 334 TYR A CD2 1 
ATOM   2598 C  CE1 . TYR A 1 334 ? 10.093  -5.864  -4.878  1.00 42.50  ? 334 TYR A CE1 1 
ATOM   2599 C  CE2 . TYR A 1 334 ? 10.396  -4.057  -6.441  1.00 33.37  ? 334 TYR A CE2 1 
ATOM   2600 C  CZ  . TYR A 1 334 ? 10.156  -5.392  -6.186  1.00 35.51  ? 334 TYR A CZ  1 
ATOM   2601 O  OH  . TYR A 1 334 ? 9.970   -6.268  -7.227  1.00 31.71  ? 334 TYR A OH  1 
ATOM   2602 N  N   . GLY A 1 335 ? 12.120  -1.585  0.008   1.00 51.01  ? 335 GLY A N   1 
ATOM   2603 C  CA  . GLY A 1 335 ? 12.472  -0.289  0.571   1.00 56.11  ? 335 GLY A CA  1 
ATOM   2604 C  C   . GLY A 1 335 ? 12.867  -0.192  2.033   1.00 53.33  ? 335 GLY A C   1 
ATOM   2605 O  O   . GLY A 1 335 ? 12.797  0.900   2.604   1.00 54.76  ? 335 GLY A O   1 
ATOM   2606 N  N   . ALA A 1 336 ? 13.316  -1.290  2.645   1.00 50.48  ? 336 ALA A N   1 
ATOM   2607 C  CA  . ALA A 1 336 ? 13.658  -1.286  4.067   1.00 57.19  ? 336 ALA A CA  1 
ATOM   2608 C  C   . ALA A 1 336 ? 15.085  -1.771  4.297   1.00 72.81  ? 336 ALA A C   1 
ATOM   2609 O  O   . ALA A 1 336 ? 15.738  -2.245  3.355   1.00 74.69  ? 336 ALA A O   1 
ATOM   2610 C  CB  . ALA A 1 336 ? 12.672  -2.154  4.857   1.00 53.68  ? 336 ALA A CB  1 
ATOM   2611 N  N   . PRO A 1 337 ? 15.613  -1.653  5.524   1.00 82.24  ? 337 PRO A N   1 
ATOM   2612 C  CA  . PRO A 1 337 ? 16.939  -2.211  5.817   1.00 74.61  ? 337 PRO A CA  1 
ATOM   2613 C  C   . PRO A 1 337 ? 16.888  -3.681  6.203   1.00 70.22  ? 337 PRO A C   1 
ATOM   2614 O  O   . PRO A 1 337 ? 16.027  -4.120  6.966   1.00 88.54  ? 337 PRO A O   1 
ATOM   2615 C  CB  . PRO A 1 337 ? 17.406  -1.357  7.003   1.00 75.70  ? 337 PRO A CB  1 
ATOM   2616 C  CG  . PRO A 1 337 ? 16.146  -1.036  7.712   1.00 76.05  ? 337 PRO A CG  1 
ATOM   2617 C  CD  . PRO A 1 337 ? 15.126  -0.812  6.639   1.00 80.79  ? 337 PRO A CD  1 
ATOM   2618 N  N   . GLY A 1 338 ? 17.830  -4.450  5.661   1.00 51.40  ? 338 GLY A N   1 
ATOM   2619 C  CA  . GLY A 1 338 ? 17.984  -5.843  6.016   1.00 50.00  ? 338 GLY A CA  1 
ATOM   2620 C  C   . GLY A 1 338 ? 16.974  -6.784  5.399   1.00 60.12  ? 338 GLY A C   1 
ATOM   2621 O  O   . GLY A 1 338 ? 17.020  -7.991  5.679   1.00 61.83  ? 338 GLY A O   1 
ATOM   2622 N  N   . PHE A 1 339 ? 16.059  -6.280  4.583   1.00 57.75  ? 339 PHE A N   1 
ATOM   2623 C  CA  . PHE A 1 339 ? 15.124  -7.126  3.863   1.00 54.54  ? 339 PHE A CA  1 
ATOM   2624 C  C   . PHE A 1 339 ? 15.732  -7.483  2.517   1.00 67.49  ? 339 PHE A C   1 
ATOM   2625 O  O   . PHE A 1 339 ? 16.033  -6.598  1.708   1.00 75.05  ? 339 PHE A O   1 
ATOM   2626 C  CB  . PHE A 1 339 ? 13.780  -6.421  3.704   1.00 47.54  ? 339 PHE A CB  1 
ATOM   2627 C  CG  . PHE A 1 339 ? 12.991  -6.402  4.963   1.00 47.45  ? 339 PHE A CG  1 
ATOM   2628 C  CD1 . PHE A 1 339 ? 12.238  -7.504  5.332   1.00 48.49  ? 339 PHE A CD1 1 
ATOM   2629 C  CD2 . PHE A 1 339 ? 13.042  -5.313  5.807   1.00 40.54  ? 339 PHE A CD2 1 
ATOM   2630 C  CE1 . PHE A 1 339 ? 11.535  -7.507  6.507   1.00 53.89  ? 339 PHE A CE1 1 
ATOM   2631 C  CE2 . PHE A 1 339 ? 12.339  -5.308  6.985   1.00 47.49  ? 339 PHE A CE2 1 
ATOM   2632 C  CZ  . PHE A 1 339 ? 11.585  -6.408  7.344   1.00 52.56  ? 339 PHE A CZ  1 
ATOM   2633 N  N   . SER A 1 340 ? 15.929  -8.773  2.287   1.00 66.28  ? 340 SER A N   1 
ATOM   2634 C  CA  . SER A 1 340 ? 16.477  -9.255  1.032   1.00 68.63  ? 340 SER A CA  1 
ATOM   2635 C  C   . SER A 1 340 ? 15.627  -10.402 0.509   1.00 67.24  ? 340 SER A C   1 
ATOM   2636 O  O   . SER A 1 340 ? 15.094  -11.203 1.286   1.00 67.27  ? 340 SER A O   1 
ATOM   2637 C  CB  . SER A 1 340 ? 17.924  -9.718  1.193   1.00 67.08  ? 340 SER A CB  1 
ATOM   2638 O  OG  . SER A 1 340 ? 18.451  -10.136 -0.051  1.00 63.41  ? 340 SER A OG  1 
ATOM   2639 N  N   . LYS A 1 341 ? 15.508  -10.479 -0.821  1.00 60.72  ? 341 LYS A N   1 
ATOM   2640 C  CA  . LYS A 1 341 ? 14.760  -11.569 -1.432  1.00 56.04  ? 341 LYS A CA  1 
ATOM   2641 C  C   . LYS A 1 341 ? 15.547  -12.872 -1.454  1.00 61.93  ? 341 LYS A C   1 
ATOM   2642 O  O   . LYS A 1 341 ? 15.031  -13.880 -1.945  1.00 63.95  ? 341 LYS A O   1 
ATOM   2643 C  CB  . LYS A 1 341 ? 14.296  -11.170 -2.844  1.00 57.26  ? 341 LYS A CB  1 
ATOM   2644 C  CG  . LYS A 1 341 ? 14.998  -11.817 -4.046  1.00 58.68  ? 341 LYS A CG  1 
ATOM   2645 C  CD  . LYS A 1 341 ? 14.162  -11.617 -5.319  1.00 53.26  ? 341 LYS A CD  1 
ATOM   2646 C  CE  . LYS A 1 341 ? 14.805  -12.275 -6.529  1.00 51.27  ? 341 LYS A CE  1 
ATOM   2647 N  NZ  . LYS A 1 341 ? 14.956  -13.748 -6.344  1.00 53.56  1 341 LYS A NZ  1 
ATOM   2648 N  N   . ASP A 1 342 ? 16.752  -12.898 -0.883  1.00 75.14  ? 342 ASP A N   1 
ATOM   2649 C  CA  . ASP A 1 342 ? 17.583  -14.098 -0.890  1.00 79.18  ? 342 ASP A CA  1 
ATOM   2650 C  C   . ASP A 1 342 ? 17.927  -14.626 0.498   1.00 81.39  ? 342 ASP A C   1 
ATOM   2651 O  O   . ASP A 1 342 ? 17.962  -15.845 0.690   1.00 83.41  ? 342 ASP A O   1 
ATOM   2652 C  CB  . ASP A 1 342 ? 18.856  -13.827 -1.697  1.00 75.57  ? 342 ASP A CB  1 
ATOM   2653 C  CG  . ASP A 1 342 ? 18.546  -13.471 -3.153  1.00 80.56  ? 342 ASP A CG  1 
ATOM   2654 O  OD1 . ASP A 1 342 ? 17.485  -13.909 -3.670  1.00 80.06  ? 342 ASP A OD1 1 
ATOM   2655 O  OD2 . ASP A 1 342 ? 19.355  -12.750 -3.780  1.00 78.10  1 342 ASP A OD2 1 
ATOM   2656 N  N   . SER A 1 343 ? 18.157  -13.761 1.484   1.00 75.26  ? 343 SER A N   1 
ATOM   2657 C  CA  . SER A 1 343 ? 18.286  -14.236 2.853   1.00 68.52  ? 343 SER A CA  1 
ATOM   2658 C  C   . SER A 1 343 ? 16.900  -14.492 3.450   1.00 66.49  ? 343 SER A C   1 
ATOM   2659 O  O   . SER A 1 343 ? 15.860  -14.278 2.807   1.00 58.33  ? 343 SER A O   1 
ATOM   2660 C  CB  . SER A 1 343 ? 19.077  -13.235 3.700   1.00 65.04  ? 343 SER A CB  1 
ATOM   2661 O  OG  . SER A 1 343 ? 18.494  -11.937 3.683   1.00 58.71  ? 343 SER A OG  1 
ATOM   2662 N  N   . GLU A 1 344 ? 16.884  -14.974 4.698   1.00 60.92  ? 344 GLU A N   1 
ATOM   2663 C  CA  . GLU A 1 344 ? 15.653  -15.018 5.477   1.00 52.33  ? 344 GLU A CA  1 
ATOM   2664 C  C   . GLU A 1 344 ? 15.286  -13.654 6.037   1.00 52.10  ? 344 GLU A C   1 
ATOM   2665 O  O   . GLU A 1 344 ? 14.239  -13.527 6.686   1.00 58.20  ? 344 GLU A O   1 
ATOM   2666 C  CB  . GLU A 1 344 ? 15.770  -16.013 6.628   1.00 56.19  ? 344 GLU A CB  1 
ATOM   2667 C  CG  . GLU A 1 344 ? 15.966  -17.455 6.222   1.00 60.10  ? 344 GLU A CG  1 
ATOM   2668 C  CD  . GLU A 1 344 ? 16.331  -18.339 7.410   1.00 70.74  ? 344 GLU A CD  1 
ATOM   2669 O  OE1 . GLU A 1 344 ? 16.454  -17.816 8.545   1.00 61.11  ? 344 GLU A OE1 1 
ATOM   2670 O  OE2 . GLU A 1 344 ? 16.499  -19.562 7.207   1.00 80.67  1 344 GLU A OE2 1 
ATOM   2671 N  N   . SER A 1 345 ? 16.139  -12.648 5.827   1.00 42.56  ? 345 SER A N   1 
ATOM   2672 C  CA  . SER A 1 345 ? 15.793  -11.257 6.110   1.00 48.98  ? 345 SER A CA  1 
ATOM   2673 C  C   . SER A 1 345 ? 15.567  -11.030 7.598   1.00 56.25  ? 345 SER A C   1 
ATOM   2674 O  O   . SER A 1 345 ? 14.678  -10.271 7.987   1.00 63.86  ? 345 SER A O   1 
ATOM   2675 C  CB  . SER A 1 345 ? 14.551  -10.815 5.325   1.00 47.76  ? 345 SER A CB  1 
ATOM   2676 O  OG  . SER A 1 345 ? 14.627  -11.132 3.945   1.00 49.77  ? 345 SER A OG  1 
ATOM   2677 N  N   . LYS A 1 346 ? 16.349  -11.703 8.444   1.00 54.14  ? 346 LYS A N   1 
ATOM   2678 C  CA  . LYS A 1 346 ? 16.228  -11.472 9.878   1.00 48.43  ? 346 LYS A CA  1 
ATOM   2679 C  C   . LYS A 1 346 ? 16.665  -10.046 10.200  1.00 50.73  ? 346 LYS A C   1 
ATOM   2680 O  O   . LYS A 1 346 ? 17.676  -9.557  9.684   1.00 48.83  ? 346 LYS A O   1 
ATOM   2681 C  CB  . LYS A 1 346 ? 17.049  -12.487 10.666  1.00 49.05  ? 346 LYS A CB  1 
ATOM   2682 C  CG  . LYS A 1 346 ? 16.908  -13.931 10.204  1.00 51.99  ? 346 LYS A CG  1 
ATOM   2683 C  CD  . LYS A 1 346 ? 17.746  -14.855 11.072  1.00 60.78  ? 346 LYS A CD  1 
ATOM   2684 C  CE  . LYS A 1 346 ? 17.266  -16.294 10.989  1.00 71.30  ? 346 LYS A CE  1 
ATOM   2685 N  NZ  . LYS A 1 346 ? 17.600  -17.101 12.205  1.00 74.98  1 346 LYS A NZ  1 
ATOM   2686 N  N   . ILE A 1 347 ? 15.885  -9.367  11.031  1.00 45.89  ? 347 ILE A N   1 
ATOM   2687 C  CA  . ILE A 1 347 ? 15.980  -7.924  11.202  1.00 45.67  ? 347 ILE A CA  1 
ATOM   2688 C  C   . ILE A 1 347 ? 16.570  -7.648  12.577  1.00 54.91  ? 347 ILE A C   1 
ATOM   2689 O  O   . ILE A 1 347 ? 15.995  -8.045  13.598  1.00 69.09  ? 347 ILE A O   1 
ATOM   2690 C  CB  . ILE A 1 347 ? 14.605  -7.252  11.031  1.00 46.67  ? 347 ILE A CB  1 
ATOM   2691 C  CG1 . ILE A 1 347 ? 14.136  -7.399  9.594   1.00 49.20  ? 347 ILE A CG1 1 
ATOM   2692 C  CG2 . ILE A 1 347 ? 14.644  -5.762  11.354  1.00 43.07  ? 347 ILE A CG2 1 
ATOM   2693 C  CD1 . ILE A 1 347 ? 15.129  -6.841  8.621   1.00 49.16  ? 347 ILE A CD1 1 
ATOM   2694 N  N   . SER A 1 348 ? 17.721  -6.979  12.600  1.00 41.48  ? 348 SER A N   1 
ATOM   2695 C  CA  . SER A 1 348 ? 18.290  -6.459  13.830  1.00 43.30  ? 348 SER A CA  1 
ATOM   2696 C  C   . SER A 1 348 ? 17.371  -5.402  14.435  1.00 50.79  ? 348 SER A C   1 
ATOM   2697 O  O   . SER A 1 348 ? 16.589  -4.748  13.743  1.00 53.38  ? 348 SER A O   1 
ATOM   2698 C  CB  . SER A 1 348 ? 19.664  -5.850  13.563  1.00 57.52  ? 348 SER A CB  1 
ATOM   2699 O  OG  . SER A 1 348 ? 19.554  -4.647  12.821  1.00 57.99  ? 348 SER A OG  1 
ATOM   2700 N  N   . ARG A 1 349 ? 17.487  -5.226  15.751  1.00 50.21  ? 349 ARG A N   1 
ATOM   2701 C  CA  . ARG A 1 349 ? 16.623  -4.279  16.453  1.00 49.94  ? 349 ARG A CA  1 
ATOM   2702 C  C   . ARG A 1 349 ? 16.705  -2.873  15.851  1.00 54.38  ? 349 ARG A C   1 
ATOM   2703 O  O   . ARG A 1 349 ? 15.675  -2.231  15.615  1.00 56.02  ? 349 ARG A O   1 
ATOM   2704 C  CB  . ARG A 1 349 ? 16.975  -4.260  17.946  1.00 49.12  ? 349 ARG A CB  1 
ATOM   2705 C  CG  . ARG A 1 349 ? 16.337  -3.114  18.725  1.00 52.92  ? 349 ARG A CG  1 
ATOM   2706 C  CD  . ARG A 1 349 ? 15.305  -3.614  19.719  1.00 55.23  ? 349 ARG A CD  1 
ATOM   2707 N  NE  . ARG A 1 349 ? 14.219  -4.372  19.101  1.00 54.83  ? 349 ARG A NE  1 
ATOM   2708 C  CZ  . ARG A 1 349 ? 12.950  -3.968  19.095  1.00 60.12  ? 349 ARG A CZ  1 
ATOM   2709 N  NH1 . ARG A 1 349 ? 12.632  -2.816  19.680  1.00 60.71  1 349 ARG A NH1 1 
ATOM   2710 N  NH2 . ARG A 1 349 ? 12.000  -4.708  18.515  1.00 53.75  ? 349 ARG A NH2 1 
ATOM   2711 N  N   . GLU A 1 350 ? 17.916  -2.375  15.583  1.00 66.36  ? 350 GLU A N   1 
ATOM   2712 C  CA  . GLU A 1 350 ? 18.031  -0.996  15.110  1.00 74.92  ? 350 GLU A CA  1 
ATOM   2713 C  C   . GLU A 1 350 ? 17.456  -0.844  13.704  1.00 73.36  ? 350 GLU A C   1 
ATOM   2714 O  O   . GLU A 1 350 ? 16.831  0.180   13.396  1.00 62.01  ? 350 GLU A O   1 
ATOM   2715 C  CB  . GLU A 1 350 ? 19.486  -0.519  15.184  1.00 81.77  ? 350 GLU A CB  1 
ATOM   2716 C  CG  . GLU A 1 350 ? 20.480  -1.286  14.338  1.00 96.10  ? 350 GLU A CG  1 
ATOM   2717 C  CD  . GLU A 1 350 ? 21.034  -0.462  13.182  1.00 106.74 ? 350 GLU A CD  1 
ATOM   2718 O  OE1 . GLU A 1 350 ? 21.322  -1.059  12.111  1.00 111.29 ? 350 GLU A OE1 1 
ATOM   2719 O  OE2 . GLU A 1 350 ? 21.197  0.779   13.335  1.00 104.03 1 350 GLU A OE2 1 
ATOM   2720 N  N   . ASP A 1 351 ? 17.633  -1.858  12.848  1.00 78.12  ? 351 ASP A N   1 
ATOM   2721 C  CA  . ASP A 1 351 ? 16.951  -1.862  11.553  1.00 76.15  ? 351 ASP A CA  1 
ATOM   2722 C  C   . ASP A 1 351 ? 15.440  -1.887  11.737  1.00 68.82  ? 351 ASP A C   1 
ATOM   2723 O  O   . ASP A 1 351 ? 14.700  -1.255  10.968  1.00 65.94  ? 351 ASP A O   1 
ATOM   2724 C  CB  . ASP A 1 351 ? 17.405  -3.060  10.702  1.00 76.84  ? 351 ASP A CB  1 
ATOM   2725 C  CG  . ASP A 1 351 ? 18.644  -2.763  9.847   1.00 75.33  ? 351 ASP A CG  1 
ATOM   2726 O  OD1 . ASP A 1 351 ? 19.227  -1.660  9.973   1.00 76.42  ? 351 ASP A OD1 1 
ATOM   2727 O  OD2 . ASP A 1 351 ? 19.029  -3.648  9.043   1.00 68.68  1 351 ASP A OD2 1 
ATOM   2728 N  N   . PHE A 1 352 ? 14.968  -2.616  12.757  1.00 66.51  ? 352 PHE A N   1 
ATOM   2729 C  CA  . PHE A 1 352 ? 13.541  -2.648  13.081  1.00 52.25  ? 352 PHE A CA  1 
ATOM   2730 C  C   . PHE A 1 352 ? 13.041  -1.279  13.517  1.00 46.61  ? 352 PHE A C   1 
ATOM   2731 O  O   . PHE A 1 352 ? 11.953  -0.850  13.123  1.00 41.77  ? 352 PHE A O   1 
ATOM   2732 C  CB  . PHE A 1 352 ? 13.271  -3.691  14.174  1.00 50.02  ? 352 PHE A CB  1 
ATOM   2733 C  CG  . PHE A 1 352 ? 11.865  -3.672  14.715  1.00 54.59  ? 352 PHE A CG  1 
ATOM   2734 C  CD1 . PHE A 1 352 ? 10.927  -4.557  14.210  1.00 53.66  ? 352 PHE A CD1 1 
ATOM   2735 C  CD2 . PHE A 1 352 ? 11.493  -2.848  15.772  1.00 56.82  ? 352 PHE A CD2 1 
ATOM   2736 C  CE1 . PHE A 1 352 ? 9.643   -4.579  14.673  1.00 46.92  ? 352 PHE A CE1 1 
ATOM   2737 C  CE2 . PHE A 1 352 ? 10.182  -2.870  16.247  1.00 58.82  ? 352 PHE A CE2 1 
ATOM   2738 C  CZ  . PHE A 1 352 ? 9.263   -3.739  15.686  1.00 48.99  ? 352 PHE A CZ  1 
ATOM   2739 N  N   . MET A 1 353 ? 13.808  -0.587  14.355  1.00 48.73  ? 353 MET A N   1 
ATOM   2740 C  CA  A MET A 1 353 ? 13.441  0.775   14.719  0.61 48.25  ? 353 MET A CA  1 
ATOM   2741 C  CA  B MET A 1 353 ? 13.432  0.773   14.716  0.39 48.82  ? 353 MET A CA  1 
ATOM   2742 C  C   . MET A 1 353 ? 13.277  1.642   13.477  1.00 50.64  ? 353 MET A C   1 
ATOM   2743 O  O   . MET A 1 353 ? 12.329  2.428   13.380  1.00 45.06  ? 353 MET A O   1 
ATOM   2744 C  CB  A MET A 1 353 ? 14.489  1.361   15.672  0.61 50.65  ? 353 MET A CB  1 
ATOM   2745 C  CB  B MET A 1 353 ? 14.460  1.365   15.678  0.39 50.90  ? 353 MET A CB  1 
ATOM   2746 C  CG  A MET A 1 353 ? 13.944  1.667   17.076  0.61 51.76  ? 353 MET A CG  1 
ATOM   2747 C  CG  B MET A 1 353 ? 14.443  0.707   17.045  0.39 52.60  ? 353 MET A CG  1 
ATOM   2748 S  SD  A MET A 1 353 ? 15.195  2.033   18.330  0.61 53.67  ? 353 MET A SD  1 
ATOM   2749 S  SD  B MET A 1 353 ? 12.785  0.739   17.766  0.39 48.79  ? 353 MET A SD  1 
ATOM   2750 C  CE  A MET A 1 353 ? 15.857  0.396   18.639  0.61 51.57  ? 353 MET A CE  1 
ATOM   2751 C  CE  B MET A 1 353 ? 12.427  2.498   17.778  0.39 50.23  ? 353 MET A CE  1 
ATOM   2752 N  N   . SER A 1 354 ? 14.197  1.495   12.513  1.00 60.32  ? 354 SER A N   1 
ATOM   2753 C  CA  . SER A 1 354 ? 14.154  2.249   11.260  1.00 47.67  ? 354 SER A CA  1 
ATOM   2754 C  C   . SER A 1 354 ? 12.884  1.962   10.490  1.00 42.26  ? 354 SER A C   1 
ATOM   2755 O  O   . SER A 1 354 ? 12.240  2.879   9.972   1.00 42.28  ? 354 SER A O   1 
ATOM   2756 C  CB  . SER A 1 354 ? 15.360  1.891   10.394  1.00 43.87  ? 354 SER A CB  1 
ATOM   2757 O  OG  . SER A 1 354 ? 16.456  2.741   10.628  1.00 46.60  ? 354 SER A OG  1 
ATOM   2758 N  N   . GLY A 1 355 ? 12.544  0.679   10.354  1.00 47.81  ? 355 GLY A N   1 
ATOM   2759 C  CA  . GLY A 1 355 ? 11.281  0.313   9.733   1.00 39.20  ? 355 GLY A CA  1 
ATOM   2760 C  C   . GLY A 1 355 ? 10.090  1.033   10.338  1.00 39.64  ? 355 GLY A C   1 
ATOM   2761 O  O   . GLY A 1 355 ? 9.262   1.592   9.623   1.00 57.61  ? 355 GLY A O   1 
ATOM   2762 N  N   . VAL A 1 356 ? 10.001  1.054   11.669  1.00 40.81  ? 356 VAL A N   1 
ATOM   2763 C  CA  . VAL A 1 356 ? 8.844   1.653   12.323  1.00 51.48  ? 356 VAL A CA  1 
ATOM   2764 C  C   . VAL A 1 356 ? 8.741   3.130   11.982  1.00 53.88  ? 356 VAL A C   1 
ATOM   2765 O  O   . VAL A 1 356 ? 7.632   3.664   11.852  1.00 63.40  ? 356 VAL A O   1 
ATOM   2766 C  CB  . VAL A 1 356 ? 8.893   1.439   13.856  1.00 54.53  ? 356 VAL A CB  1 
ATOM   2767 C  CG1 . VAL A 1 356 ? 7.602   1.934   14.501  1.00 52.98  ? 356 VAL A CG1 1 
ATOM   2768 C  CG2 . VAL A 1 356 ? 9.140   -0.028  14.214  1.00 51.41  ? 356 VAL A CG2 1 
ATOM   2769 N  N   . LYS A 1 357 ? 9.875   3.827   11.843  1.00 43.50  ? 357 LYS A N   1 
ATOM   2770 C  CA  . LYS A 1 357 ? 9.768   5.242   11.505  1.00 44.62  ? 357 LYS A CA  1 
ATOM   2771 C  C   . LYS A 1 357 ? 9.398   5.419   10.041  1.00 52.85  ? 357 LYS A C   1 
ATOM   2772 O  O   . LYS A 1 357 ? 8.535   6.239   9.710   1.00 58.12  ? 357 LYS A O   1 
ATOM   2773 C  CB  . LYS A 1 357 ? 11.057  5.986   11.830  1.00 46.53  ? 357 LYS A CB  1 
ATOM   2774 C  CG  . LYS A 1 357 ? 11.006  7.442   11.377  1.00 54.14  ? 357 LYS A CG  1 
ATOM   2775 C  CD  . LYS A 1 357 ? 12.011  8.329   12.107  1.00 50.32  ? 357 LYS A CD  1 
ATOM   2776 C  CE  . LYS A 1 357 ? 11.573  9.794   12.088  1.00 59.93  ? 357 LYS A CE  1 
ATOM   2777 N  NZ  . LYS A 1 357 ? 10.884  10.215  13.342  1.00 70.01  1 357 LYS A NZ  1 
ATOM   2778 N  N   . LEU A 1 358 ? 10.023  4.645   9.153   1.00 60.74  ? 358 LEU A N   1 
ATOM   2779 C  CA  . LEU A 1 358 ? 9.530   4.559   7.782   1.00 68.98  ? 358 LEU A CA  1 
ATOM   2780 C  C   . LEU A 1 358 ? 8.071   4.117   7.764   1.00 74.89  ? 358 LEU A C   1 
ATOM   2781 O  O   . LEU A 1 358 ? 7.228   4.756   7.125   1.00 73.72  ? 358 LEU A O   1 
ATOM   2782 C  CB  . LEU A 1 358 ? 10.396  3.595   6.955   1.00 60.08  ? 358 LEU A CB  1 
ATOM   2783 C  CG  . LEU A 1 358 ? 11.895  3.890   6.792   1.00 54.44  ? 358 LEU A CG  1 
ATOM   2784 C  CD1 . LEU A 1 358 ? 12.649  2.701   6.167   1.00 49.88  ? 358 LEU A CD1 1 
ATOM   2785 C  CD2 . LEU A 1 358 ? 12.112  5.170   5.989   1.00 46.19  ? 358 LEU A CD2 1 
ATOM   2786 N  N   . SER A 1 359 ? 7.749   3.047   8.509   1.00 76.11  ? 359 SER A N   1 
ATOM   2787 C  CA  . SER A 1 359 ? 6.432   2.418   8.406   1.00 72.02  ? 359 SER A CA  1 
ATOM   2788 C  C   . SER A 1 359 ? 5.305   3.357   8.799   1.00 70.88  ? 359 SER A C   1 
ATOM   2789 O  O   . SER A 1 359 ? 4.213   3.270   8.228   1.00 73.02  ? 359 SER A O   1 
ATOM   2790 C  CB  . SER A 1 359 ? 6.359   1.148   9.255   1.00 70.35  ? 359 SER A CB  1 
ATOM   2791 O  OG  . SER A 1 359 ? 6.950   0.056   8.575   1.00 62.47  ? 359 SER A OG  1 
ATOM   2792 N  N   . VAL A 1 360 ? 5.523   4.243   9.766   1.00 58.33  ? 360 VAL A N   1 
ATOM   2793 C  CA  . VAL A 1 360 ? 4.508   5.268   9.976   1.00 59.54  ? 360 VAL A CA  1 
ATOM   2794 C  C   . VAL A 1 360 ? 5.070   6.628   9.577   1.00 76.52  ? 360 VAL A C   1 
ATOM   2795 O  O   . VAL A 1 360 ? 5.556   7.384   10.427  1.00 73.58  ? 360 VAL A O   1 
ATOM   2796 C  CB  . VAL A 1 360 ? 3.943   5.233   11.403  1.00 57.11  ? 360 VAL A CB  1 
ATOM   2797 C  CG1 . VAL A 1 360 ? 3.284   3.900   11.641  1.00 50.65  ? 360 VAL A CG1 1 
ATOM   2798 C  CG2 . VAL A 1 360 ? 5.017   5.413   12.426  1.00 75.42  ? 360 VAL A CG2 1 
ATOM   2799 N  N   . PRO A 1 361 ? 4.979   6.972   8.266   1.00 92.40  ? 361 PRO A N   1 
ATOM   2800 C  CA  . PRO A 1 361 ? 5.447   8.265   7.745   1.00 98.96  ? 361 PRO A CA  1 
ATOM   2801 C  C   . PRO A 1 361 ? 5.516   9.422   8.728   1.00 101.51 ? 361 PRO A C   1 
ATOM   2802 O  O   . PRO A 1 361 ? 6.539   10.104  8.834   1.00 109.12 ? 361 PRO A O   1 
ATOM   2803 C  CB  . PRO A 1 361 ? 4.401   8.573   6.662   1.00 103.44 ? 361 PRO A CB  1 
ATOM   2804 C  CG  . PRO A 1 361 ? 3.846   7.235   6.236   1.00 100.78 ? 361 PRO A CG  1 
ATOM   2805 C  CD  . PRO A 1 361 ? 4.336   6.183   7.201   1.00 95.31  ? 361 PRO A CD  1 
ATOM   2806 N  N   . HIS A 1 362 ? 4.428   9.620   9.467   1.00 92.49  ? 362 HIS A N   1 
ATOM   2807 C  CA  . HIS A 1 362 ? 4.106   10.889  10.100  1.00 85.15  ? 362 HIS A CA  1 
ATOM   2808 C  C   . HIS A 1 362 ? 4.447   10.951  11.572  1.00 78.40  ? 362 HIS A C   1 
ATOM   2809 O  O   . HIS A 1 362 ? 4.671   12.049  12.088  1.00 79.87  ? 362 HIS A O   1 
ATOM   2810 C  CB  . HIS A 1 362 ? 2.609   11.171  9.943   1.00 92.36  ? 362 HIS A CB  1 
ATOM   2811 C  CG  . HIS A 1 362 ? 1.762   9.932   9.957   1.00 97.31  ? 362 HIS A CG  1 
ATOM   2812 N  ND1 . HIS A 1 362 ? 1.688   9.065   8.885   1.00 98.91  ? 362 HIS A ND1 1 
ATOM   2813 C  CD2 . HIS A 1 362 ? 0.966   9.406   10.918  1.00 97.09  ? 362 HIS A CD2 1 
ATOM   2814 C  CE1 . HIS A 1 362 ? 0.879   8.064   9.183   1.00 94.14  ? 362 HIS A CE1 1 
ATOM   2815 N  NE2 . HIS A 1 362 ? 0.427   8.248   10.410  1.00 94.57  ? 362 HIS A NE2 1 
ATOM   2816 N  N   . ALA A 1 363 ? 4.507   9.803   12.246  1.00 76.75  ? 363 ALA A N   1 
ATOM   2817 C  CA  . ALA A 1 363 ? 4.440   9.758   13.704  1.00 77.70  ? 363 ALA A CA  1 
ATOM   2818 C  C   . ALA A 1 363 ? 5.514   10.609  14.374  1.00 74.93  ? 363 ALA A C   1 
ATOM   2819 O  O   . ALA A 1 363 ? 6.704   10.516  14.050  1.00 77.46  ? 363 ALA A O   1 
ATOM   2820 C  CB  . ALA A 1 363 ? 4.553   8.310   14.181  1.00 73.61  ? 363 ALA A CB  1 
ATOM   2821 N  N   . ASN A 1 364 ? 5.078   11.436  15.322  1.00 67.33  ? 364 ASN A N   1 
ATOM   2822 C  CA  . ASN A 1 364 ? 6.010   12.085  16.221  1.00 75.32  ? 364 ASN A CA  1 
ATOM   2823 C  C   . ASN A 1 364 ? 6.715   11.031  17.071  1.00 77.59  ? 364 ASN A C   1 
ATOM   2824 O  O   . ASN A 1 364 ? 6.377   9.839   17.049  1.00 54.92  ? 364 ASN A O   1 
ATOM   2825 C  CB  . ASN A 1 364 ? 5.292   13.096  17.112  1.00 76.96  ? 364 ASN A CB  1 
ATOM   2826 C  CG  . ASN A 1 364 ? 4.046   12.527  17.740  1.00 76.04  ? 364 ASN A CG  1 
ATOM   2827 O  OD1 . ASN A 1 364 ? 4.119   11.657  18.600  1.00 80.91  ? 364 ASN A OD1 1 
ATOM   2828 N  ND2 . ASN A 1 364 ? 2.893   13.022  17.320  1.00 78.53  ? 364 ASN A ND2 1 
ATOM   2829 N  N   . ASP A 1 365 ? 7.717   11.489  17.825  1.00 78.96  ? 365 ASP A N   1 
ATOM   2830 C  CA  . ASP A 1 365 ? 8.518   10.562  18.614  1.00 84.20  ? 365 ASP A CA  1 
ATOM   2831 C  C   . ASP A 1 365 ? 7.632   9.669   19.472  1.00 79.07  ? 365 ASP A C   1 
ATOM   2832 O  O   . ASP A 1 365 ? 7.835   8.450   19.525  1.00 78.11  ? 365 ASP A O   1 
ATOM   2833 C  CB  . ASP A 1 365 ? 9.513   11.339  19.471  1.00 95.75  ? 365 ASP A CB  1 
ATOM   2834 C  CG  . ASP A 1 365 ? 10.306  10.445  20.384  1.00 104.55 ? 365 ASP A CG  1 
ATOM   2835 O  OD1 . ASP A 1 365 ? 10.749  9.373   19.918  1.00 106.14 ? 365 ASP A OD1 1 
ATOM   2836 O  OD2 . ASP A 1 365 ? 10.475  10.814  21.569  1.00 110.14 1 365 ASP A OD2 1 
ATOM   2837 N  N   . LEU A 1 366 ? 6.603   10.251  20.097  1.00 71.65  ? 366 LEU A N   1 
ATOM   2838 C  CA  . LEU A 1 366 ? 5.741   9.477   20.983  1.00 63.41  ? 366 LEU A CA  1 
ATOM   2839 C  C   . LEU A 1 366 ? 4.947   8.431   20.211  1.00 63.75  ? 366 LEU A C   1 
ATOM   2840 O  O   . LEU A 1 366 ? 4.806   7.291   20.670  1.00 56.14  ? 366 LEU A O   1 
ATOM   2841 C  CB  . LEU A 1 366 ? 4.810   10.414  21.746  1.00 63.49  ? 366 LEU A CB  1 
ATOM   2842 C  CG  . LEU A 1 366 ? 3.787   9.734   22.660  1.00 66.51  ? 366 LEU A CG  1 
ATOM   2843 C  CD1 . LEU A 1 366 ? 4.511   9.265   23.917  1.00 63.81  ? 366 LEU A CD1 1 
ATOM   2844 C  CD2 . LEU A 1 366 ? 2.646   10.679  23.018  1.00 66.46  ? 366 LEU A CD2 1 
ATOM   2845 N  N   . GLY A 1 367 ? 4.451   8.789   19.022  1.00 68.47  ? 367 GLY A N   1 
ATOM   2846 C  CA  . GLY A 1 367 ? 3.751   7.823   18.189  1.00 57.71  ? 367 GLY A CA  1 
ATOM   2847 C  C   . GLY A 1 367 ? 4.612   6.645   17.766  1.00 51.16  ? 367 GLY A C   1 
ATOM   2848 O  O   . GLY A 1 367 ? 4.106   5.532   17.606  1.00 49.54  ? 367 GLY A O   1 
ATOM   2849 N  N   . LEU A 1 368 ? 5.917   6.868   17.575  1.00 52.37  ? 368 LEU A N   1 
ATOM   2850 C  CA  . LEU A 1 368 ? 6.836   5.773   17.263  1.00 55.49  ? 368 LEU A CA  1 
ATOM   2851 C  C   . LEU A 1 368 ? 7.007   4.826   18.447  1.00 54.78  ? 368 LEU A C   1 
ATOM   2852 O  O   . LEU A 1 368 ? 6.934   3.602   18.287  1.00 49.36  ? 368 LEU A O   1 
ATOM   2853 C  CB  . LEU A 1 368 ? 8.198   6.331   16.843  1.00 68.32  ? 368 LEU A CB  1 
ATOM   2854 C  CG  . LEU A 1 368 ? 8.334   6.977   15.468  1.00 66.09  ? 368 LEU A CG  1 
ATOM   2855 C  CD1 . LEU A 1 368 ? 9.792   7.341   15.232  1.00 51.04  ? 368 LEU A CD1 1 
ATOM   2856 C  CD2 . LEU A 1 368 ? 7.802   6.020   14.399  1.00 58.02  ? 368 LEU A CD2 1 
ATOM   2857 N  N   . ASP A 1 369 ? 7.277   5.373   19.640  1.00 54.23  ? 369 ASP A N   1 
ATOM   2858 C  CA  . ASP A 1 369 ? 7.379   4.541   20.839  1.00 58.97  ? 369 ASP A CA  1 
ATOM   2859 C  C   . ASP A 1 369 ? 6.093   3.762   21.111  1.00 61.06  ? 369 ASP A C   1 
ATOM   2860 O  O   . ASP A 1 369 ? 6.145   2.638   21.625  1.00 59.90  ? 369 ASP A O   1 
ATOM   2861 C  CB  . ASP A 1 369 ? 7.764   5.393   22.053  1.00 59.01  ? 369 ASP A CB  1 
ATOM   2862 C  CG  . ASP A 1 369 ? 9.142   6.028   21.911  1.00 80.32  ? 369 ASP A CG  1 
ATOM   2863 O  OD1 . ASP A 1 369 ? 9.519   6.875   22.751  1.00 93.03  ? 369 ASP A OD1 1 
ATOM   2864 O  OD2 . ASP A 1 369 ? 9.858   5.685   20.948  1.00 93.71  1 369 ASP A OD2 1 
ATOM   2865 N  N   . ALA A 1 370 ? 4.935   4.327   20.765  1.00 52.98  ? 370 ALA A N   1 
ATOM   2866 C  CA  . ALA A 1 370 ? 3.701   3.555   20.832  1.00 52.00  ? 370 ALA A CA  1 
ATOM   2867 C  C   . ALA A 1 370 ? 3.774   2.323   19.933  1.00 53.81  ? 370 ALA A C   1 
ATOM   2868 O  O   . ALA A 1 370 ? 3.662   1.184   20.407  1.00 49.21  ? 370 ALA A O   1 
ATOM   2869 C  CB  . ALA A 1 370 ? 2.508   4.438   20.466  1.00 52.08  ? 370 ALA A CB  1 
ATOM   2870 N  N   . VAL A 1 371 ? 3.986   2.534   18.626  1.00 56.36  ? 371 VAL A N   1 
ATOM   2871 C  CA  . VAL A 1 371 ? 4.037   1.420   17.676  1.00 50.18  ? 371 VAL A CA  1 
ATOM   2872 C  C   . VAL A 1 371 ? 5.143   0.435   18.039  1.00 50.34  ? 371 VAL A C   1 
ATOM   2873 O  O   . VAL A 1 371 ? 4.979   -0.782  17.883  1.00 44.45  ? 371 VAL A O   1 
ATOM   2874 C  CB  . VAL A 1 371 ? 4.215   1.931   16.234  1.00 44.27  ? 371 VAL A CB  1 
ATOM   2875 C  CG1 . VAL A 1 371 ? 4.122   0.751   15.254  1.00 42.08  ? 371 VAL A CG1 1 
ATOM   2876 C  CG2 . VAL A 1 371 ? 3.201   3.015   15.908  1.00 44.58  ? 371 VAL A CG2 1 
ATOM   2877 N  N   . THR A 1 372 ? 6.295   0.934   18.503  1.00 50.60  ? 372 THR A N   1 
ATOM   2878 C  CA  . THR A 1 372 ? 7.364   0.021   18.904  1.00 50.43  ? 372 THR A CA  1 
ATOM   2879 C  C   . THR A 1 372 ? 6.887   -0.906  20.011  1.00 52.63  ? 372 THR A C   1 
ATOM   2880 O  O   . THR A 1 372 ? 7.110   -2.121  19.958  1.00 46.99  ? 372 THR A O   1 
ATOM   2881 C  CB  . THR A 1 372 ? 8.624   0.773   19.359  1.00 48.86  ? 372 THR A CB  1 
ATOM   2882 O  OG1 . THR A 1 372 ? 8.933   1.855   18.480  1.00 48.75  ? 372 THR A OG1 1 
ATOM   2883 C  CG2 . THR A 1 372 ? 9.781   -0.167  19.384  1.00 48.62  ? 372 THR A CG2 1 
ATOM   2884 N  N   . LEU A 1 373 ? 6.211   -0.352  21.014  1.00 49.51  ? 373 LEU A N   1 
ATOM   2885 C  CA  . LEU A 1 373 ? 5.866   -1.168  22.166  1.00 60.49  ? 373 LEU A CA  1 
ATOM   2886 C  C   . LEU A 1 373 ? 4.807   -2.203  21.818  1.00 55.02  ? 373 LEU A C   1 
ATOM   2887 O  O   . LEU A 1 373 ? 4.765   -3.274  22.438  1.00 52.45  ? 373 LEU A O   1 
ATOM   2888 C  CB  . LEU A 1 373 ? 5.402   -0.272  23.313  1.00 65.66  ? 373 LEU A CB  1 
ATOM   2889 C  CG  . LEU A 1 373 ? 4.820   -0.928  24.558  1.00 58.81  ? 373 LEU A CG  1 
ATOM   2890 C  CD1 . LEU A 1 373 ? 5.922   -1.482  25.439  1.00 62.33  ? 373 LEU A CD1 1 
ATOM   2891 C  CD2 . LEU A 1 373 ? 4.015   0.097   25.296  1.00 57.76  ? 373 LEU A CD2 1 
ATOM   2892 N  N   . GLN A 1 374 ? 3.972   -1.926  20.811  1.00 47.58  ? 374 GLN A N   1 
ATOM   2893 C  CA  . GLN A 1 374 ? 2.865   -2.825  20.518  1.00 46.43  ? 374 GLN A CA  1 
ATOM   2894 C  C   . GLN A 1 374 ? 3.283   -4.011  19.657  1.00 53.64  ? 374 GLN A C   1 
ATOM   2895 O  O   . GLN A 1 374 ? 2.533   -4.987  19.573  1.00 61.70  ? 374 GLN A O   1 
ATOM   2896 C  CB  . GLN A 1 374 ? 1.714   -2.034  19.869  1.00 45.81  ? 374 GLN A CB  1 
ATOM   2897 C  CG  . GLN A 1 374 ? 0.379   -2.733  19.845  1.00 45.28  ? 374 GLN A CG  1 
ATOM   2898 C  CD  . GLN A 1 374 ? -0.375  -2.574  21.163  1.00 67.22  ? 374 GLN A CD  1 
ATOM   2899 O  OE1 . GLN A 1 374 ? 0.133   -1.965  22.128  1.00 56.26  ? 374 GLN A OE1 1 
ATOM   2900 N  NE2 . GLN A 1 374 ? -1.598  -3.125  21.213  1.00 70.52  ? 374 GLN A NE2 1 
ATOM   2901 N  N   . TYR A 1 375 ? 4.472   -3.989  19.060  1.00 47.46  ? 375 TYR A N   1 
ATOM   2902 C  CA  . TYR A 1 375 ? 4.890   -5.094  18.210  1.00 51.30  ? 375 TYR A CA  1 
ATOM   2903 C  C   . TYR A 1 375 ? 6.165   -5.777  18.661  1.00 50.48  ? 375 TYR A C   1 
ATOM   2904 O  O   . TYR A 1 375 ? 6.628   -6.691  17.974  1.00 61.76  ? 375 TYR A O   1 
ATOM   2905 C  CB  . TYR A 1 375 ? 5.058   -4.625  16.765  1.00 40.76  ? 375 TYR A CB  1 
ATOM   2906 C  CG  . TYR A 1 375 ? 3.730   -4.447  16.082  1.00 40.44  ? 375 TYR A CG  1 
ATOM   2907 C  CD1 . TYR A 1 375 ? 3.113   -5.524  15.442  1.00 38.39  ? 375 TYR A CD1 1 
ATOM   2908 C  CD2 . TYR A 1 375 ? 3.092   -3.210  16.070  1.00 40.22  ? 375 TYR A CD2 1 
ATOM   2909 C  CE1 . TYR A 1 375 ? 1.909   -5.374  14.817  1.00 44.45  ? 375 TYR A CE1 1 
ATOM   2910 C  CE2 . TYR A 1 375 ? 1.876   -3.049  15.445  1.00 47.71  ? 375 TYR A CE2 1 
ATOM   2911 C  CZ  . TYR A 1 375 ? 1.295   -4.130  14.820  1.00 45.88  ? 375 TYR A CZ  1 
ATOM   2912 O  OH  . TYR A 1 375 ? 0.103   -3.953  14.181  1.00 42.20  ? 375 TYR A OH  1 
ATOM   2913 N  N   . THR A 1 376 ? 6.724   -5.378  19.792  1.00 49.45  ? 376 THR A N   1 
ATOM   2914 C  CA  . THR A 1 376 ? 7.942   -5.945  20.350  1.00 45.73  ? 376 THR A CA  1 
ATOM   2915 C  C   . THR A 1 376 ? 7.608   -6.956  21.437  1.00 54.06  ? 376 THR A C   1 
ATOM   2916 O  O   . THR A 1 376 ? 6.676   -6.756  22.222  1.00 73.25  ? 376 THR A O   1 
ATOM   2917 C  CB  . THR A 1 376 ? 8.818   -4.829  20.936  1.00 51.86  ? 376 THR A CB  1 
ATOM   2918 O  OG1 . THR A 1 376 ? 8.932   -3.759  19.986  1.00 55.51  ? 376 THR A OG1 1 
ATOM   2919 C  CG2 . THR A 1 376 ? 10.202  -5.334  21.342  1.00 56.30  ? 376 THR A CG2 1 
ATOM   2920 N  N   . ASP A 1 377 ? 8.376   -8.043  21.471  1.00 51.23  ? 377 ASP A N   1 
ATOM   2921 C  CA  . ASP A 1 377 ? 8.392   -9.002  22.577  1.00 50.43  ? 377 ASP A CA  1 
ATOM   2922 C  C   . ASP A 1 377 ? 9.670   -8.735  23.367  1.00 52.73  ? 377 ASP A C   1 
ATOM   2923 O  O   . ASP A 1 377 ? 10.754  -9.140  22.945  1.00 61.63  ? 377 ASP A O   1 
ATOM   2924 C  CB  . ASP A 1 377 ? 8.343   -10.429 22.031  1.00 46.99  ? 377 ASP A CB  1 
ATOM   2925 C  CG  . ASP A 1 377 ? 8.519   -11.483 23.103  1.00 62.32  ? 377 ASP A CG  1 
ATOM   2926 O  OD1 . ASP A 1 377 ? 8.264   -11.187 24.284  1.00 73.67  ? 377 ASP A OD1 1 
ATOM   2927 O  OD2 . ASP A 1 377 ? 8.914   -12.617 22.758  1.00 58.19  1 377 ASP A OD2 1 
ATOM   2928 N  N   . TRP A 1 378 ? 9.562   -8.053  24.516  1.00 52.04  ? 378 TRP A N   1 
ATOM   2929 C  CA  . TRP A 1 378 ? 10.793  -7.609  25.162  1.00 53.46  ? 378 TRP A CA  1 
ATOM   2930 C  C   . TRP A 1 378 ? 11.465  -8.675  26.007  1.00 54.77  ? 378 TRP A C   1 
ATOM   2931 O  O   . TRP A 1 378 ? 12.483  -8.368  26.633  1.00 56.35  ? 378 TRP A O   1 
ATOM   2932 C  CB  . TRP A 1 378 ? 10.574  -6.382  26.031  1.00 55.34  ? 378 TRP A CB  1 
ATOM   2933 C  CG  . TRP A 1 378 ? 9.909   -5.275  25.364  1.00 54.49  ? 378 TRP A CG  1 
ATOM   2934 C  CD1 . TRP A 1 378 ? 8.595   -5.214  25.059  1.00 89.43  ? 378 TRP A CD1 1 
ATOM   2935 C  CD2 . TRP A 1 378 ? 10.483  -4.033  24.929  1.00 54.66  ? 378 TRP A CD2 1 
ATOM   2936 N  NE1 . TRP A 1 378 ? 8.295   -4.024  24.457  1.00 86.67  ? 378 TRP A NE1 1 
ATOM   2937 C  CE2 . TRP A 1 378 ? 9.437   -3.275  24.363  1.00 77.00  ? 378 TRP A CE2 1 
ATOM   2938 C  CE3 . TRP A 1 378 ? 11.769  -3.493  24.956  1.00 71.56  ? 378 TRP A CE3 1 
ATOM   2939 C  CZ2 . TRP A 1 378 ? 9.632   -2.005  23.827  1.00 70.37  ? 378 TRP A CZ2 1 
ATOM   2940 C  CZ3 . TRP A 1 378 ? 11.961  -2.238  24.430  1.00 77.85  ? 378 TRP A CZ3 1 
ATOM   2941 C  CH2 . TRP A 1 378 ? 10.890  -1.505  23.870  1.00 74.87  ? 378 TRP A CH2 1 
ATOM   2942 N  N   . MET A 1 379 ? 10.951  -9.900  26.058  1.00 54.34  ? 379 MET A N   1 
ATOM   2943 C  CA  . MET A 1 379 ? 11.805  -10.967 26.559  1.00 64.09  ? 379 MET A CA  1 
ATOM   2944 C  C   . MET A 1 379 ? 12.785  -11.457 25.510  1.00 68.91  ? 379 MET A C   1 
ATOM   2945 O  O   . MET A 1 379 ? 13.738  -12.162 25.859  1.00 77.69  ? 379 MET A O   1 
ATOM   2946 C  CB  . MET A 1 379 ? 10.985  -12.152 27.054  1.00 65.32  ? 379 MET A CB  1 
ATOM   2947 C  CG  . MET A 1 379 ? 9.707   -11.785 27.735  1.00 77.09  ? 379 MET A CG  1 
ATOM   2948 S  SD  . MET A 1 379 ? 9.108   -13.244 28.604  1.00 85.63  ? 379 MET A SD  1 
ATOM   2949 C  CE  . MET A 1 379 ? 8.004   -13.936 27.392  1.00 62.55  ? 379 MET A CE  1 
ATOM   2950 N  N   . ASP A 1 380 ? 12.578  -11.085 24.247  1.00 62.88  ? 380 ASP A N   1 
ATOM   2951 C  CA  . ASP A 1 380 ? 13.346  -11.609 23.127  1.00 65.76  ? 380 ASP A CA  1 
ATOM   2952 C  C   . ASP A 1 380 ? 13.317  -10.600 21.983  1.00 67.97  ? 380 ASP A C   1 
ATOM   2953 O  O   . ASP A 1 380 ? 12.848  -10.908 20.879  1.00 70.61  ? 380 ASP A O   1 
ATOM   2954 C  CB  . ASP A 1 380 ? 12.776  -12.967 22.700  1.00 68.67  ? 380 ASP A CB  1 
ATOM   2955 C  CG  . ASP A 1 380 ? 13.662  -13.698 21.714  1.00 77.83  ? 380 ASP A CG  1 
ATOM   2956 O  OD1 . ASP A 1 380 ? 14.847  -13.320 21.569  1.00 82.26  ? 380 ASP A OD1 1 
ATOM   2957 O  OD2 . ASP A 1 380 ? 13.169  -14.659 21.087  1.00 79.21  1 380 ASP A OD2 1 
ATOM   2958 N  N   . ASP A 1 381 ? 13.813  -9.386  22.242  1.00 64.55  ? 381 ASP A N   1 
ATOM   2959 C  CA  . ASP A 1 381 ? 13.720  -8.281  21.294  1.00 57.85  ? 381 ASP A CA  1 
ATOM   2960 C  C   . ASP A 1 381 ? 14.837  -8.270  20.252  1.00 58.63  ? 381 ASP A C   1 
ATOM   2961 O  O   . ASP A 1 381 ? 14.752  -7.501  19.288  1.00 53.31  ? 381 ASP A O   1 
ATOM   2962 C  CB  . ASP A 1 381 ? 13.715  -6.945  22.042  1.00 52.24  ? 381 ASP A CB  1 
ATOM   2963 C  CG  . ASP A 1 381 ? 14.906  -6.796  22.956  1.00 58.10  ? 381 ASP A CG  1 
ATOM   2964 O  OD1 . ASP A 1 381 ? 15.353  -7.819  23.514  1.00 56.19  ? 381 ASP A OD1 1 
ATOM   2965 O  OD2 . ASP A 1 381 ? 15.404  -5.660  23.100  1.00 68.75  1 381 ASP A OD2 1 
ATOM   2966 N  N   . ASN A 1 382 ? 15.881  -9.080  20.420  1.00 60.14  ? 382 ASN A N   1 
ATOM   2967 C  CA  . ASN A 1 382 ? 16.920  -9.225  19.408  1.00 65.75  ? 382 ASN A CA  1 
ATOM   2968 C  C   . ASN A 1 382 ? 16.716  -10.463 18.548  1.00 67.09  ? 382 ASN A C   1 
ATOM   2969 O  O   . ASN A 1 382 ? 17.645  -10.893 17.853  1.00 66.21  ? 382 ASN A O   1 
ATOM   2970 C  CB  . ASN A 1 382 ? 18.302  -9.257  20.063  1.00 62.46  ? 382 ASN A CB  1 
ATOM   2971 C  CG  . ASN A 1 382 ? 18.615  -7.981  20.810  1.00 72.49  ? 382 ASN A CG  1 
ATOM   2972 O  OD1 . ASN A 1 382 ? 17.941  -6.964  20.632  1.00 72.18  ? 382 ASN A OD1 1 
ATOM   2973 N  ND2 . ASN A 1 382 ? 19.635  -8.027  21.662  1.00 84.00  ? 382 ASN A ND2 1 
ATOM   2974 N  N   . ASN A 1 383 ? 15.528  -11.053 18.596  1.00 63.12  ? 383 ASN A N   1 
ATOM   2975 C  CA  . ASN A 1 383 ? 15.198  -12.172 17.728  1.00 58.98  ? 383 ASN A CA  1 
ATOM   2976 C  C   . ASN A 1 383 ? 14.999  -11.645 16.319  1.00 50.73  ? 383 ASN A C   1 
ATOM   2977 O  O   . ASN A 1 383 ? 14.001  -10.979 16.044  1.00 41.38  ? 383 ASN A O   1 
ATOM   2978 C  CB  . ASN A 1 383 ? 13.943  -12.867 18.239  1.00 60.74  ? 383 ASN A CB  1 
ATOM   2979 C  CG  . ASN A 1 383 ? 13.666  -14.173 17.535  1.00 59.05  ? 383 ASN A CG  1 
ATOM   2980 O  OD1 . ASN A 1 383 ? 12.953  -15.014 18.065  1.00 57.00  ? 383 ASN A OD1 1 
ATOM   2981 N  ND2 . ASN A 1 383 ? 14.216  -14.352 16.342  1.00 62.63  ? 383 ASN A ND2 1 
ATOM   2982 N  N   . GLY A 1 384 ? 15.952  -11.943 15.431  1.00 52.42  ? 384 GLY A N   1 
ATOM   2983 C  CA  . GLY A 1 384 ? 15.876  -11.427 14.075  1.00 44.46  ? 384 GLY A CA  1 
ATOM   2984 C  C   . GLY A 1 384 ? 14.565  -11.774 13.403  1.00 49.18  ? 384 GLY A C   1 
ATOM   2985 O  O   . GLY A 1 384 ? 13.953  -10.931 12.735  1.00 49.61  ? 384 GLY A O   1 
ATOM   2986 N  N   . ILE A 1 385 ? 14.088  -13.002 13.620  1.00 49.44  ? 385 ILE A N   1 
ATOM   2987 C  CA  . ILE A 1 385 ? 12.865  -13.452 12.971  1.00 40.48  ? 385 ILE A CA  1 
ATOM   2988 C  C   . ILE A 1 385 ? 11.675  -12.635 13.443  1.00 46.13  ? 385 ILE A C   1 
ATOM   2989 O  O   . ILE A 1 385 ? 11.019  -11.965 12.641  1.00 64.24  ? 385 ILE A O   1 
ATOM   2990 C  CB  . ILE A 1 385 ? 12.640  -14.952 13.198  1.00 40.65  ? 385 ILE A CB  1 
ATOM   2991 C  CG1 . ILE A 1 385 ? 13.777  -15.742 12.541  1.00 44.51  ? 385 ILE A CG1 1 
ATOM   2992 C  CG2 . ILE A 1 385 ? 11.304  -15.346 12.610  1.00 36.57  ? 385 ILE A CG2 1 
ATOM   2993 C  CD1 . ILE A 1 385 ? 13.488  -17.224 12.337  1.00 39.84  ? 385 ILE A CD1 1 
ATOM   2994 N  N   . LYS A 1 386 ? 11.365  -12.671 14.741  1.00 38.54  ? 386 LYS A N   1 
ATOM   2995 C  CA  . LYS A 1 386 ? 10.127  -11.974 15.079  1.00 48.15  ? 386 LYS A CA  1 
ATOM   2996 C  C   . LYS A 1 386 ? 10.263  -10.457 15.009  1.00 49.10  ? 386 LYS A C   1 
ATOM   2997 O  O   . LYS A 1 386 ? 9.234   -9.760  15.013  1.00 38.28  ? 386 LYS A O   1 
ATOM   2998 C  CB  . LYS A 1 386 ? 9.559   -12.396 16.438  1.00 39.73  ? 386 LYS A CB  1 
ATOM   2999 C  CG  . LYS A 1 386 ? 10.484  -12.802 17.522  1.00 41.34  ? 386 LYS A CG  1 
ATOM   3000 C  CD  . LYS A 1 386 ? 9.648   -13.338 18.679  1.00 42.50  ? 386 LYS A CD  1 
ATOM   3001 C  CE  . LYS A 1 386 ? 10.326  -14.434 19.501  1.00 53.10  ? 386 LYS A CE  1 
ATOM   3002 N  NZ  . LYS A 1 386 ? 9.698   -14.651 20.870  1.00 55.27  1 386 LYS A NZ  1 
ATOM   3003 N  N   . ASN A 1 387 ? 11.486  -9.930  14.878  1.00 39.03  ? 387 ASN A N   1 
ATOM   3004 C  CA  . ASN A 1 387 ? 11.624  -8.528  14.494  1.00 44.69  ? 387 ASN A CA  1 
ATOM   3005 C  C   . ASN A 1 387 ? 11.237  -8.330  13.032  1.00 48.24  ? 387 ASN A C   1 
ATOM   3006 O  O   . ASN A 1 387 ? 10.491  -7.397  12.698  1.00 37.03  ? 387 ASN A O   1 
ATOM   3007 C  CB  . ASN A 1 387 ? 13.043  -8.029  14.739  1.00 42.88  ? 387 ASN A CB  1 
ATOM   3008 C  CG  . ASN A 1 387 ? 13.313  -7.722  16.194  1.00 53.46  ? 387 ASN A CG  1 
ATOM   3009 O  OD1 . ASN A 1 387 ? 14.388  -8.032  16.702  1.00 61.23  ? 387 ASN A OD1 1 
ATOM   3010 N  ND2 . ASN A 1 387 ? 12.340  -7.121  16.876  1.00 63.15  ? 387 ASN A ND2 1 
ATOM   3011 N  N   . ARG A 1 388 ? 11.738  -9.197  12.145  1.00 45.06  ? 388 ARG A N   1 
ATOM   3012 C  CA  . ARG A 1 388 ? 11.255  -9.215  10.763  1.00 42.81  ? 388 ARG A CA  1 
ATOM   3013 C  C   . ARG A 1 388 ? 9.743   -9.347  10.711  1.00 39.07  ? 388 ARG A C   1 
ATOM   3014 O  O   . ARG A 1 388 ? 9.045   -8.499  10.146  1.00 33.79  ? 388 ARG A O   1 
ATOM   3015 C  CB  . ARG A 1 388 ? 11.893  -10.370 9.996   1.00 40.34  ? 388 ARG A CB  1 
ATOM   3016 C  CG  . ARG A 1 388 ? 11.397  -10.534 8.592   1.00 38.81  ? 388 ARG A CG  1 
ATOM   3017 C  CD  . ARG A 1 388 ? 11.863  -11.872 8.055   1.00 42.09  ? 388 ARG A CD  1 
ATOM   3018 N  NE  . ARG A 1 388 ? 10.900  -12.933 8.369   1.00 37.28  ? 388 ARG A NE  1 
ATOM   3019 C  CZ  . ARG A 1 388 ? 11.213  -14.199 8.623   1.00 38.49  ? 388 ARG A CZ  1 
ATOM   3020 N  NH1 . ARG A 1 388 ? 10.260  -15.073 8.886   1.00 42.46  1 388 ARG A NH1 1 
ATOM   3021 N  NH2 . ARG A 1 388 ? 12.474  -14.591 8.599   1.00 41.98  ? 388 ARG A NH2 1 
ATOM   3022 N  N   . ASP A 1 389 ? 9.226   -10.434 11.272  1.00 37.42  ? 389 ASP A N   1 
ATOM   3023 C  CA  . ASP A 1 389 ? 7.794   -10.688 11.230  1.00 35.83  ? 389 ASP A CA  1 
ATOM   3024 C  C   . ASP A 1 389 ? 7.009   -9.577  11.912  1.00 44.90  ? 389 ASP A C   1 
ATOM   3025 O  O   . ASP A 1 389 ? 5.890   -9.268  11.491  1.00 48.84  ? 389 ASP A O   1 
ATOM   3026 C  CB  . ASP A 1 389 ? 7.503   -12.049 11.869  1.00 35.78  ? 389 ASP A CB  1 
ATOM   3027 C  CG  . ASP A 1 389 ? 7.953   -13.213 10.996  1.00 49.74  ? 389 ASP A CG  1 
ATOM   3028 O  OD1 . ASP A 1 389 ? 7.735   -14.377 11.388  1.00 57.51  ? 389 ASP A OD1 1 
ATOM   3029 O  OD2 . ASP A 1 389 ? 8.498   -12.968 9.898   1.00 56.11  1 389 ASP A OD2 1 
ATOM   3030 N  N   . GLY A 1 390 ? 7.575   -8.960  12.953  1.00 48.36  ? 390 GLY A N   1 
ATOM   3031 C  CA  . GLY A 1 390 ? 6.860   -7.898  13.640  1.00 48.00  ? 390 GLY A CA  1 
ATOM   3032 C  C   . GLY A 1 390 ? 6.697   -6.657  12.784  1.00 47.94  ? 390 GLY A C   1 
ATOM   3033 O  O   . GLY A 1 390 ? 5.619   -6.058  12.733  1.00 46.77  ? 390 GLY A O   1 
ATOM   3034 N  N   . LEU A 1 391 ? 7.761   -6.252  12.094  1.00 52.16  ? 391 LEU A N   1 
ATOM   3035 C  CA  . LEU A 1 391 ? 7.669   -5.063  11.256  1.00 51.27  ? 391 LEU A CA  1 
ATOM   3036 C  C   . LEU A 1 391 ? 6.844   -5.338  10.008  1.00 52.61  ? 391 LEU A C   1 
ATOM   3037 O  O   . LEU A 1 391 ? 6.115   -4.460  9.535   1.00 56.42  ? 391 LEU A O   1 
ATOM   3038 C  CB  . LEU A 1 391 ? 9.075   -4.593  10.900  1.00 53.26  ? 391 LEU A CB  1 
ATOM   3039 C  CG  . LEU A 1 391 ? 9.267   -3.522  9.838   1.00 59.34  ? 391 LEU A CG  1 
ATOM   3040 C  CD1 . LEU A 1 391 ? 8.392   -2.323  10.171  1.00 68.13  ? 391 LEU A CD1 1 
ATOM   3041 C  CD2 . LEU A 1 391 ? 10.719  -3.134  9.818   1.00 48.89  ? 391 LEU A CD2 1 
ATOM   3042 N  N   . ASP A 1 392 ? 6.931   -6.553  9.476   1.00 52.98  ? 392 ASP A N   1 
ATOM   3043 C  CA  . ASP A 1 392 ? 6.051   -6.935  8.384   1.00 60.00  ? 392 ASP A CA  1 
ATOM   3044 C  C   . ASP A 1 392 ? 4.591   -6.768  8.783   1.00 60.40  ? 392 ASP A C   1 
ATOM   3045 O  O   . ASP A 1 392 ? 3.776   -6.256  8.005   1.00 63.81  ? 392 ASP A O   1 
ATOM   3046 C  CB  . ASP A 1 392 ? 6.351   -8.371  7.970   1.00 69.58  ? 392 ASP A CB  1 
ATOM   3047 C  CG  . ASP A 1 392 ? 5.392   -8.879  6.941   1.00 76.42  ? 392 ASP A CG  1 
ATOM   3048 O  OD1 . ASP A 1 392 ? 5.730   -8.783  5.747   1.00 75.84  ? 392 ASP A OD1 1 
ATOM   3049 O  OD2 . ASP A 1 392 ? 4.303   -9.356  7.327   1.00 81.89  1 392 ASP A OD2 1 
ATOM   3050 N  N   . ASP A 1 393 ? 4.245   -7.177  10.003  1.00 59.90  ? 393 ASP A N   1 
ATOM   3051 C  CA  . ASP A 1 393 ? 2.881   -6.992  10.480  1.00 54.77  ? 393 ASP A CA  1 
ATOM   3052 C  C   . ASP A 1 393 ? 2.535   -5.516  10.603  1.00 52.20  ? 393 ASP A C   1 
ATOM   3053 O  O   . ASP A 1 393 ? 1.413   -5.110  10.287  1.00 50.92  ? 393 ASP A O   1 
ATOM   3054 C  CB  . ASP A 1 393 ? 2.688   -7.703  11.817  1.00 62.04  ? 393 ASP A CB  1 
ATOM   3055 C  CG  . ASP A 1 393 ? 2.276   -9.150  11.646  1.00 69.09  ? 393 ASP A CG  1 
ATOM   3056 O  OD1 . ASP A 1 393 ? 2.438   -9.686  10.525  1.00 75.44  ? 393 ASP A OD1 1 
ATOM   3057 O  OD2 . ASP A 1 393 ? 1.784   -9.748  12.624  1.00 69.81  1 393 ASP A OD2 1 
ATOM   3058 N  N   . ILE A 1 394 ? 3.485   -4.694  11.058  1.00 49.82  ? 394 ILE A N   1 
ATOM   3059 C  CA  . ILE A 1 394 ? 3.207   -3.266  11.187  1.00 37.08  ? 394 ILE A CA  1 
ATOM   3060 C  C   . ILE A 1 394 ? 2.729   -2.708  9.863   1.00 38.14  ? 394 ILE A C   1 
ATOM   3061 O  O   . ILE A 1 394 ? 1.695   -2.039  9.785   1.00 47.82  ? 394 ILE A O   1 
ATOM   3062 C  CB  . ILE A 1 394 ? 4.444   -2.509  11.686  1.00 39.10  ? 394 ILE A CB  1 
ATOM   3063 C  CG1 . ILE A 1 394 ? 4.742   -2.880  13.140  1.00 37.42  ? 394 ILE A CG1 1 
ATOM   3064 C  CG2 . ILE A 1 394 ? 4.235   -1.002  11.494  1.00 36.77  ? 394 ILE A CG2 1 
ATOM   3065 C  CD1 . ILE A 1 394 ? 6.147   -2.536  13.583  1.00 38.50  ? 394 ILE A CD1 1 
ATOM   3066 N  N   . VAL A 1 395 ? 3.461   -3.003  8.791   1.00 45.39  ? 395 VAL A N   1 
ATOM   3067 C  CA  . VAL A 1 395 ? 3.087   -2.480  7.481   1.00 36.76  ? 395 VAL A CA  1 
ATOM   3068 C  C   . VAL A 1 395 ? 1.741   -3.040  7.050   1.00 39.57  ? 395 VAL A C   1 
ATOM   3069 O  O   . VAL A 1 395 ? 0.825   -2.288  6.693   1.00 35.76  ? 395 VAL A O   1 
ATOM   3070 C  CB  . VAL A 1 395 ? 4.177   -2.794  6.455   1.00 38.82  ? 395 VAL A CB  1 
ATOM   3071 C  CG1 . VAL A 1 395 ? 3.742   -2.283  5.102   1.00 43.66  ? 395 VAL A CG1 1 
ATOM   3072 C  CG2 . VAL A 1 395 ? 5.523   -2.188  6.904   1.00 32.61  ? 395 VAL A CG2 1 
ATOM   3073 N  N   . GLY A 1 396 ? 1.604   -4.372  7.083   1.00 41.57  ? 396 GLY A N   1 
ATOM   3074 C  CA  . GLY A 1 396 ? 0.328   -5.000  6.763   1.00 32.78  ? 396 GLY A CA  1 
ATOM   3075 C  C   . GLY A 1 396 ? -0.828  -4.434  7.564   1.00 42.87  ? 396 GLY A C   1 
ATOM   3076 O  O   . GLY A 1 396 ? -1.851  -4.032  7.000   1.00 45.24  ? 396 GLY A O   1 
ATOM   3077 N  N   . ASP A 1 397 ? -0.671  -4.361  8.894   1.00 41.79  ? 397 ASP A N   1 
ATOM   3078 C  CA  . ASP A 1 397 ? -1.758  -3.887  9.748   1.00 32.66  ? 397 ASP A CA  1 
ATOM   3079 C  C   . ASP A 1 397 ? -2.094  -2.433  9.454   1.00 43.00  ? 397 ASP A C   1 
ATOM   3080 O  O   . ASP A 1 397 ? -3.268  -2.069  9.307   1.00 44.07  ? 397 ASP A O   1 
ATOM   3081 C  CB  . ASP A 1 397 ? -1.400  -4.044  11.226  1.00 42.76  ? 397 ASP A CB  1 
ATOM   3082 C  CG  . ASP A 1 397 ? -1.469  -5.486  11.702  1.00 53.76  ? 397 ASP A CG  1 
ATOM   3083 O  OD1 . ASP A 1 397 ? -2.360  -6.233  11.249  1.00 56.92  ? 397 ASP A OD1 1 
ATOM   3084 O  OD2 . ASP A 1 397 ? -0.628  -5.861  12.552  1.00 51.21  1 397 ASP A OD2 1 
ATOM   3085 N  N   . HIS A 1 398 ? -1.077  -1.580  9.369   1.00 36.80  ? 398 HIS A N   1 
ATOM   3086 C  CA  . HIS A 1 398 ? -1.356  -0.156  9.251   1.00 38.38  ? 398 HIS A CA  1 
ATOM   3087 C  C   . HIS A 1 398 ? -1.880  0.202   7.871   1.00 45.89  ? 398 HIS A C   1 
ATOM   3088 O  O   . HIS A 1 398 ? -2.765  1.051   7.748   1.00 52.67  ? 398 HIS A O   1 
ATOM   3089 C  CB  . HIS A 1 398 ? -0.104  0.659   9.555   1.00 35.23  ? 398 HIS A CB  1 
ATOM   3090 C  CG  . HIS A 1 398 ? -0.227  2.108   9.218   1.00 38.55  ? 398 HIS A CG  1 
ATOM   3091 N  ND1 . HIS A 1 398 ? 0.619   2.736   8.346   1.00 41.48  ? 398 HIS A ND1 1 
ATOM   3092 C  CD2 . HIS A 1 398 ? -1.070  3.066   9.660   1.00 45.44  ? 398 HIS A CD2 1 
ATOM   3093 C  CE1 . HIS A 1 398 ? 0.305   4.017   8.252   1.00 51.33  ? 398 HIS A CE1 1 
ATOM   3094 N  NE2 . HIS A 1 398 ? -0.720  4.247   9.045   1.00 50.47  ? 398 HIS A NE2 1 
ATOM   3095 N  N   . ASN A 1 399 ? -1.332  -0.408  6.821   1.00 44.89  ? 399 ASN A N   1 
ATOM   3096 C  CA  . ASN A 1 399 ? -1.580  0.063   5.463   1.00 44.31  ? 399 ASN A CA  1 
ATOM   3097 C  C   . ASN A 1 399 ? -2.734  -0.643  4.762   1.00 37.49  ? 399 ASN A C   1 
ATOM   3098 O  O   . ASN A 1 399 ? -3.203  -0.152  3.731   1.00 42.97  ? 399 ASN A O   1 
ATOM   3099 C  CB  . ASN A 1 399 ? -0.305  -0.078  4.620   1.00 30.93  ? 399 ASN A CB  1 
ATOM   3100 C  CG  . ASN A 1 399 ? 0.751   0.915   5.016   1.00 42.52  ? 399 ASN A CG  1 
ATOM   3101 O  OD1 . ASN A 1 399 ? 1.805   0.546   5.563   1.00 50.48  ? 399 ASN A OD1 1 
ATOM   3102 N  ND2 . ASN A 1 399 ? 0.481   2.197   4.755   1.00 37.72  ? 399 ASN A ND2 1 
ATOM   3103 N  N   . VAL A 1 400 ? -3.179  -1.789  5.265   1.00 35.13  ? 400 VAL A N   1 
ATOM   3104 C  CA  . VAL A 1 400 ? -4.240  -2.549  4.613   1.00 36.58  ? 400 VAL A CA  1 
ATOM   3105 C  C   . VAL A 1 400 ? -5.251  -3.042  5.640   1.00 39.98  ? 400 VAL A C   1 
ATOM   3106 O  O   . VAL A 1 400 ? -6.343  -2.482  5.786   1.00 45.03  ? 400 VAL A O   1 
ATOM   3107 C  CB  . VAL A 1 400 ? -3.651  -3.742  3.840   1.00 35.40  ? 400 VAL A CB  1 
ATOM   3108 C  CG1 . VAL A 1 400 ? -4.731  -4.411  2.995   1.00 32.80  ? 400 VAL A CG1 1 
ATOM   3109 C  CG2 . VAL A 1 400 ? -2.466  -3.300  3.003   1.00 28.36  ? 400 VAL A CG2 1 
ATOM   3110 N  N   . ILE A 1 401 ? -4.848  -4.074  6.382   1.00 40.39  ? 401 ILE A N   1 
ATOM   3111 C  CA  . ILE A 1 401 ? -5.758  -4.855  7.213   1.00 41.19  ? 401 ILE A CA  1 
ATOM   3112 C  C   . ILE A 1 401 ? -6.590  -3.960  8.122   1.00 41.60  ? 401 ILE A C   1 
ATOM   3113 O  O   . ILE A 1 401 ? -7.803  -4.142  8.252   1.00 51.51  ? 401 ILE A O   1 
ATOM   3114 C  CB  . ILE A 1 401 ? -4.955  -5.901  8.010   1.00 44.64  ? 401 ILE A CB  1 
ATOM   3115 C  CG1 . ILE A 1 401 ? -4.135  -6.740  7.020   1.00 39.72  ? 401 ILE A CG1 1 
ATOM   3116 C  CG2 . ILE A 1 401 ? -5.860  -6.756  8.894   1.00 39.92  ? 401 ILE A CG2 1 
ATOM   3117 C  CD1 . ILE A 1 401 ? -3.616  -8.020  7.566   1.00 39.34  ? 401 ILE A CD1 1 
ATOM   3118 N  N   . CYS A 1 402 ? -5.972  -2.987  8.758   1.00 39.41  ? 402 CYS A N   1 
ATOM   3119 C  CA  . CYS A 1 402 ? -6.802  -2.252  9.710   1.00 50.04  ? 402 CYS A CA  1 
ATOM   3120 C  C   . CYS A 1 402 ? -7.564  -1.120  9.036   1.00 44.96  ? 402 CYS A C   1 
ATOM   3121 O  O   . CYS A 1 402 ? -8.718  -0.857  9.411   1.00 44.42  ? 402 CYS A O   1 
ATOM   3122 C  CB  . CYS A 1 402 ? -5.975  -1.721  10.883  1.00 56.80  ? 402 CYS A CB  1 
ATOM   3123 S  SG  . CYS A 1 402 ? -5.403  -3.030  11.970  1.00 56.12  ? 402 CYS A SG  1 
ATOM   3124 N  N   . PRO A 1 403 ? -6.974  -0.420  8.059   1.00 46.04  ? 403 PRO A N   1 
ATOM   3125 C  CA  . PRO A 1 403 ? -7.799  0.471   7.219   1.00 51.67  ? 403 PRO A CA  1 
ATOM   3126 C  C   . PRO A 1 403 ? -9.042  -0.210  6.659   1.00 44.53  ? 403 PRO A C   1 
ATOM   3127 O  O   . PRO A 1 403 ? -10.105 0.412   6.565   1.00 33.09  ? 403 PRO A O   1 
ATOM   3128 C  CB  . PRO A 1 403 ? -6.833  0.879   6.104   1.00 49.43  ? 403 PRO A CB  1 
ATOM   3129 C  CG  . PRO A 1 403 ? -5.518  0.829   6.721   1.00 50.93  ? 403 PRO A CG  1 
ATOM   3130 C  CD  . PRO A 1 403 ? -5.539  -0.203  7.823   1.00 45.98  ? 403 PRO A CD  1 
ATOM   3131 N  N   . LEU A 1 404 ? -8.940  -1.492  6.314   1.00 36.16  ? 404 LEU A N   1 
ATOM   3132 C  CA  . LEU A 1 404 ? -10.080 -2.183  5.733   1.00 44.54  ? 404 LEU A CA  1 
ATOM   3133 C  C   . LEU A 1 404 ? -11.080 -2.632  6.796   1.00 48.66  ? 404 LEU A C   1 
ATOM   3134 O  O   . LEU A 1 404 ? -12.291 -2.474  6.603   1.00 60.03  ? 404 LEU A O   1 
ATOM   3135 C  CB  . LEU A 1 404 ? -9.591  -3.358  4.883   1.00 42.66  ? 404 LEU A CB  1 
ATOM   3136 C  CG  . LEU A 1 404 ? -10.628 -4.340  4.317   1.00 31.35  ? 404 LEU A CG  1 
ATOM   3137 C  CD1 . LEU A 1 404 ? -10.184 -4.856  2.959   1.00 30.97  ? 404 LEU A CD1 1 
ATOM   3138 C  CD2 . LEU A 1 404 ? -10.782 -5.534  5.262   1.00 29.81  ? 404 LEU A CD2 1 
ATOM   3139 N  N   . MET A 1 405 ? -10.618 -3.183  7.926   1.00 46.15  ? 405 MET A N   1 
ATOM   3140 C  CA  . MET A 1 405 ? -11.573 -3.495  8.986   1.00 47.68  ? 405 MET A CA  1 
ATOM   3141 C  C   . MET A 1 405 ? -12.335 -2.259  9.432   1.00 48.98  ? 405 MET A C   1 
ATOM   3142 O  O   . MET A 1 405 ? -13.553 -2.321  9.634   1.00 47.43  ? 405 MET A O   1 
ATOM   3143 C  CB  . MET A 1 405 ? -10.918 -4.171  10.181  1.00 48.79  ? 405 MET A CB  1 
ATOM   3144 C  CG  . MET A 1 405 ? -10.126 -5.400  9.829   1.00 50.17  ? 405 MET A CG  1 
ATOM   3145 S  SD  . MET A 1 405 ? -11.224 -6.742  9.243   1.00 42.24  ? 405 MET A SD  1 
ATOM   3146 C  CE  . MET A 1 405 ? -12.560 -6.824  10.420  1.00 34.76  ? 405 MET A CE  1 
ATOM   3147 N  N   . HIS A 1 406 ? -11.658 -1.117  9.545   1.00 42.88  ? 406 HIS A N   1 
ATOM   3148 C  CA  . HIS A 1 406 ? -12.388 0.125   9.758   1.00 37.56  ? 406 HIS A CA  1 
ATOM   3149 C  C   . HIS A 1 406 ? -13.513 0.282   8.733   1.00 41.90  ? 406 HIS A C   1 
ATOM   3150 O  O   . HIS A 1 406 ? -14.665 0.574   9.090   1.00 46.30  ? 406 HIS A O   1 
ATOM   3151 C  CB  . HIS A 1 406 ? -11.430 1.303   9.690   1.00 37.47  ? 406 HIS A CB  1 
ATOM   3152 C  CG  . HIS A 1 406 ? -12.038 2.570   10.195  1.00 44.82  ? 406 HIS A CG  1 
ATOM   3153 N  ND1 . HIS A 1 406 ? -12.362 2.756   11.523  1.00 50.48  ? 406 HIS A ND1 1 
ATOM   3154 C  CD2 . HIS A 1 406 ? -12.414 3.702   9.554   1.00 50.13  ? 406 HIS A CD2 1 
ATOM   3155 C  CE1 . HIS A 1 406 ? -12.893 3.956   11.681  1.00 58.09  ? 406 HIS A CE1 1 
ATOM   3156 N  NE2 . HIS A 1 406 ? -12.945 4.547   10.500  1.00 53.51  ? 406 HIS A NE2 1 
ATOM   3157 N  N   . PHE A 1 407 ? -13.194 0.070   7.448   1.00 48.11  ? 407 PHE A N   1 
ATOM   3158 C  CA  . PHE A 1 407 ? -14.173 0.254   6.376   1.00 50.70  ? 407 PHE A CA  1 
ATOM   3159 C  C   . PHE A 1 407 ? -15.343 -0.708  6.518   1.00 49.35  ? 407 PHE A C   1 
ATOM   3160 O  O   . PHE A 1 407 ? -16.509 -0.298  6.453   1.00 53.19  ? 407 PHE A O   1 
ATOM   3161 C  CB  . PHE A 1 407 ? -13.506 0.074   5.010   1.00 50.91  ? 407 PHE A CB  1 
ATOM   3162 C  CG  . PHE A 1 407 ? -14.468 0.110   3.849   1.00 49.11  ? 407 PHE A CG  1 
ATOM   3163 C  CD1 . PHE A 1 407 ? -14.877 1.319   3.300   1.00 50.25  ? 407 PHE A CD1 1 
ATOM   3164 C  CD2 . PHE A 1 407 ? -14.963 -1.070  3.305   1.00 42.77  ? 407 PHE A CD2 1 
ATOM   3165 C  CE1 . PHE A 1 407 ? -15.772 1.350   2.237   1.00 45.09  ? 407 PHE A CE1 1 
ATOM   3166 C  CE2 . PHE A 1 407 ? -15.850 -1.045  2.245   1.00 39.28  ? 407 PHE A CE2 1 
ATOM   3167 C  CZ  . PHE A 1 407 ? -16.255 0.167   1.711   1.00 40.86  ? 407 PHE A CZ  1 
ATOM   3168 N  N   . VAL A 1 408 ? -15.053 -1.997  6.698   1.00 42.27  ? 408 VAL A N   1 
ATOM   3169 C  CA  . VAL A 1 408 ? -16.133 -2.973  6.793   1.00 51.48  ? 408 VAL A CA  1 
ATOM   3170 C  C   . VAL A 1 408 ? -17.002 -2.700  8.018   1.00 56.22  ? 408 VAL A C   1 
ATOM   3171 O  O   . VAL A 1 408 ? -18.228 -2.850  7.969   1.00 51.59  ? 408 VAL A O   1 
ATOM   3172 C  CB  . VAL A 1 408 ? -15.572 -4.410  6.779   1.00 55.68  ? 408 VAL A CB  1 
ATOM   3173 C  CG1 . VAL A 1 408 ? -14.598 -4.638  7.894   1.00 49.63  ? 408 VAL A CG1 1 
ATOM   3174 C  CG2 . VAL A 1 408 ? -16.696 -5.392  6.900   1.00 66.91  ? 408 VAL A CG2 1 
ATOM   3175 N  N   . ASN A 1 409 ? -16.399 -2.256  9.125   1.00 64.08  ? 409 ASN A N   1 
ATOM   3176 C  CA  . ASN A 1 409 ? -17.224 -1.977  10.293  1.00 59.89  ? 409 ASN A CA  1 
ATOM   3177 C  C   . ASN A 1 409 ? -18.172 -0.810  10.039  1.00 59.64  ? 409 ASN A C   1 
ATOM   3178 O  O   . ASN A 1 409 ? -19.358 -0.893  10.381  1.00 56.22  ? 409 ASN A O   1 
ATOM   3179 C  CB  . ASN A 1 409 ? -16.373 -1.728  11.535  1.00 52.25  ? 409 ASN A CB  1 
ATOM   3180 C  CG  . ASN A 1 409 ? -15.703 -2.995  12.046  1.00 63.41  ? 409 ASN A CG  1 
ATOM   3181 O  OD1 . ASN A 1 409 ? -14.480 -3.135  12.002  1.00 81.31  ? 409 ASN A OD1 1 
ATOM   3182 N  ND2 . ASN A 1 409 ? -16.517 -3.960  12.462  1.00 50.61  ? 409 ASN A ND2 1 
ATOM   3183 N  N   . LYS A 1 410 ? -17.685 0.281   9.436   1.00 53.13  ? 410 LYS A N   1 
ATOM   3184 C  CA  . LYS A 1 410 ? -18.572 1.418   9.205   1.00 52.54  ? 410 LYS A CA  1 
ATOM   3185 C  C   . LYS A 1 410 ? -19.582 1.094   8.123   1.00 54.57  ? 410 LYS A C   1 
ATOM   3186 O  O   . LYS A 1 410 ? -20.769 1.433   8.249   1.00 52.10  ? 410 LYS A O   1 
ATOM   3187 C  CB  . LYS A 1 410 ? -17.771 2.660   8.829   1.00 54.09  ? 410 LYS A CB  1 
ATOM   3188 C  CG  . LYS A 1 410 ? -16.827 3.096   9.923   1.00 62.44  ? 410 LYS A CG  1 
ATOM   3189 C  CD  . LYS A 1 410 ? -17.541 3.137   11.267  1.00 65.82  ? 410 LYS A CD  1 
ATOM   3190 C  CE  . LYS A 1 410 ? -17.124 4.357   12.033  1.00 58.68  ? 410 LYS A CE  1 
ATOM   3191 N  NZ  . LYS A 1 410 ? -17.163 5.504   11.098  1.00 54.68  1 410 LYS A NZ  1 
ATOM   3192 N  N   . TYR A 1 411 ? -19.124 0.415   7.064   1.00 53.79  ? 411 TYR A N   1 
ATOM   3193 C  CA  . TYR A 1 411 ? -20.011 0.056   5.963   1.00 45.03  ? 411 TYR A CA  1 
ATOM   3194 C  C   . TYR A 1 411 ? -21.142 -0.836  6.453   1.00 42.66  ? 411 TYR A C   1 
ATOM   3195 O  O   . TYR A 1 411 ? -22.314 -0.596  6.146   1.00 48.32  ? 411 TYR A O   1 
ATOM   3196 C  CB  . TYR A 1 411 ? -19.239 -0.645  4.827   1.00 49.85  ? 411 TYR A CB  1 
ATOM   3197 C  CG  . TYR A 1 411 ? -20.167 -0.909  3.673   1.00 47.34  ? 411 TYR A CG  1 
ATOM   3198 C  CD1 . TYR A 1 411 ? -20.489 0.109   2.791   1.00 48.88  ? 411 TYR A CD1 1 
ATOM   3199 C  CD2 . TYR A 1 411 ? -20.795 -2.145  3.514   1.00 47.11  ? 411 TYR A CD2 1 
ATOM   3200 C  CE1 . TYR A 1 411 ? -21.393 -0.086  1.765   1.00 48.52  ? 411 TYR A CE1 1 
ATOM   3201 C  CE2 . TYR A 1 411 ? -21.713 -2.357  2.486   1.00 44.85  ? 411 TYR A CE2 1 
ATOM   3202 C  CZ  . TYR A 1 411 ? -22.002 -1.312  1.617   1.00 47.16  ? 411 TYR A CZ  1 
ATOM   3203 O  OH  . TYR A 1 411 ? -22.896 -1.463  0.586   1.00 34.74  ? 411 TYR A OH  1 
ATOM   3204 N  N   . THR A 1 412 ? -20.807 -1.863  7.237   1.00 39.83  ? 412 THR A N   1 
ATOM   3205 C  CA  . THR A 1 412 ? -21.765 -2.904  7.584   1.00 38.36  ? 412 THR A CA  1 
ATOM   3206 C  C   . THR A 1 412 ? -22.927 -2.392  8.420   1.00 40.24  ? 412 THR A C   1 
ATOM   3207 O  O   . THR A 1 412 ? -23.972 -3.047  8.454   1.00 40.95  ? 412 THR A O   1 
ATOM   3208 C  CB  . THR A 1 412 ? -21.030 -4.045  8.290   1.00 44.35  ? 412 THR A CB  1 
ATOM   3209 O  OG1 . THR A 1 412 ? -20.173 -4.692  7.337   1.00 36.52  ? 412 THR A OG1 1 
ATOM   3210 C  CG2 . THR A 1 412 ? -21.999 -5.080  8.876   1.00 44.76  ? 412 THR A CG2 1 
ATOM   3211 N  N   . LYS A 1 413 ? -22.798 -1.224  9.055   1.00 43.65  ? 413 LYS A N   1 
ATOM   3212 C  CA  . LYS A 1 413 ? -23.955 -0.645  9.735   1.00 60.18  ? 413 LYS A CA  1 
ATOM   3213 C  C   . LYS A 1 413 ? -25.076 -0.340  8.752   1.00 63.88  ? 413 LYS A C   1 
ATOM   3214 O  O   . LYS A 1 413 ? -26.258 -0.474  9.089   1.00 73.92  ? 413 LYS A O   1 
ATOM   3215 C  CB  . LYS A 1 413 ? -23.565 0.630   10.490  1.00 65.23  ? 413 LYS A CB  1 
ATOM   3216 C  CG  . LYS A 1 413 ? -22.611 0.428   11.661  1.00 65.61  ? 413 LYS A CG  1 
ATOM   3217 C  CD  . LYS A 1 413 ? -22.319 1.758   12.379  1.00 71.52  ? 413 LYS A CD  1 
ATOM   3218 C  CE  . LYS A 1 413 ? -21.432 1.561   13.623  1.00 76.43  ? 413 LYS A CE  1 
ATOM   3219 N  NZ  . LYS A 1 413 ? -20.042 2.134   13.494  1.00 73.63  1 413 LYS A NZ  1 
ATOM   3220 N  N   . PHE A 1 414 ? -24.724 0.029   7.525   1.00 55.61  ? 414 PHE A N   1 
ATOM   3221 C  CA  . PHE A 1 414 ? -25.657 0.557   6.544   1.00 51.62  ? 414 PHE A CA  1 
ATOM   3222 C  C   . PHE A 1 414 ? -25.922 -0.366  5.358   1.00 62.59  ? 414 PHE A C   1 
ATOM   3223 O  O   . PHE A 1 414 ? -26.999 -0.282  4.763   1.00 73.25  ? 414 PHE A O   1 
ATOM   3224 C  CB  . PHE A 1 414 ? -25.139 1.900   6.012   1.00 49.22  ? 414 PHE A CB  1 
ATOM   3225 C  CG  . PHE A 1 414 ? -25.258 3.041   6.987   1.00 48.63  ? 414 PHE A CG  1 
ATOM   3226 C  CD1 . PHE A 1 414 ? -26.497 3.531   7.348   1.00 52.09  ? 414 PHE A CD1 1 
ATOM   3227 C  CD2 . PHE A 1 414 ? -24.128 3.646   7.515   1.00 51.19  ? 414 PHE A CD2 1 
ATOM   3228 C  CE1 . PHE A 1 414 ? -26.615 4.591   8.238   1.00 54.75  ? 414 PHE A CE1 1 
ATOM   3229 C  CE2 . PHE A 1 414 ? -24.236 4.706   8.400   1.00 48.94  ? 414 PHE A CE2 1 
ATOM   3230 C  CZ  . PHE A 1 414 ? -25.476 5.179   8.760   1.00 46.80  ? 414 PHE A CZ  1 
ATOM   3231 N  N   . GLY A 1 415 ? -24.979 -1.228  4.984   1.00 52.51  ? 415 GLY A N   1 
ATOM   3232 C  CA  . GLY A 1 415 ? -25.131 -2.058  3.805   1.00 51.04  ? 415 GLY A CA  1 
ATOM   3233 C  C   . GLY A 1 415 ? -26.248 -3.092  3.925   1.00 58.50  ? 415 GLY A C   1 
ATOM   3234 O  O   . GLY A 1 415 ? -26.956 -3.196  4.928   1.00 72.39  ? 415 GLY A O   1 
ATOM   3235 N  N   . ASN A 1 416 ? -26.412 -3.866  2.848   1.00 52.84  ? 416 ASN A N   1 
ATOM   3236 C  CA  . ASN A 1 416 ? -27.375 -4.963  2.786   1.00 55.46  ? 416 ASN A CA  1 
ATOM   3237 C  C   . ASN A 1 416 ? -26.663 -6.314  2.769   1.00 48.81  ? 416 ASN A C   1 
ATOM   3238 O  O   . ASN A 1 416 ? -27.229 -7.327  2.323   1.00 44.02  ? 416 ASN A O   1 
ATOM   3239 C  CB  . ASN A 1 416 ? -28.299 -4.793  1.571   1.00 58.43  ? 416 ASN A CB  1 
ATOM   3240 C  CG  . ASN A 1 416 ? -29.527 -5.730  1.589   1.00 61.01  ? 416 ASN A CG  1 
ATOM   3241 O  OD1 . ASN A 1 416 ? -29.614 -6.641  0.759   1.00 69.45  ? 416 ASN A OD1 1 
ATOM   3242 N  ND2 . ASN A 1 416 ? -30.480 -5.498  2.514   1.00 56.42  ? 416 ASN A ND2 1 
ATOM   3243 N  N   . GLY A 1 417 ? -25.427 -6.345  3.261   1.00 42.73  ? 417 GLY A N   1 
ATOM   3244 C  CA  . GLY A 1 417 ? -24.705 -7.591  3.413   1.00 41.40  ? 417 GLY A CA  1 
ATOM   3245 C  C   . GLY A 1 417 ? -23.217 -7.380  3.325   1.00 44.82  ? 417 GLY A C   1 
ATOM   3246 O  O   . GLY A 1 417 ? -22.760 -6.520  2.567   1.00 58.72  ? 417 GLY A O   1 
ATOM   3247 N  N   . THR A 1 418 ? -22.449 -8.137  4.105   1.00 48.80  ? 418 THR A N   1 
ATOM   3248 C  CA  . THR A 1 418 ? -20.994 -8.040  4.107   1.00 34.16  ? 418 THR A CA  1 
ATOM   3249 C  C   . THR A 1 418 ? -20.426 -9.438  4.249   1.00 33.94  ? 418 THR A C   1 
ATOM   3250 O  O   . THR A 1 418 ? -20.892 -10.211 5.090   1.00 37.72  ? 418 THR A O   1 
ATOM   3251 C  CB  . THR A 1 418 ? -20.475 -7.170  5.253   1.00 41.96  ? 418 THR A CB  1 
ATOM   3252 O  OG1 . THR A 1 418 ? -20.804 -5.801  5.017   1.00 34.81  ? 418 THR A OG1 1 
ATOM   3253 C  CG2 . THR A 1 418 ? -18.966 -7.296  5.351   1.00 43.35  ? 418 THR A CG2 1 
ATOM   3254 N  N   . TYR A 1 419 ? -19.414 -9.757  3.450   1.00 32.69  ? 419 TYR A N   1 
ATOM   3255 C  CA  . TYR A 1 419 ? -18.735 -11.043 3.539   1.00 40.32  ? 419 TYR A CA  1 
ATOM   3256 C  C   . TYR A 1 419 ? -17.238 -10.805 3.600   1.00 53.10  ? 419 TYR A C   1 
ATOM   3257 O  O   . TYR A 1 419 ? -16.664 -10.181 2.698   1.00 60.95  ? 419 TYR A O   1 
ATOM   3258 C  CB  . TYR A 1 419 ? -19.101 -11.941 2.362   1.00 39.57  ? 419 TYR A CB  1 
ATOM   3259 C  CG  . TYR A 1 419 ? -20.553 -12.321 2.364   1.00 33.35  ? 419 TYR A CG  1 
ATOM   3260 C  CD1 . TYR A 1 419 ? -21.485 -11.567 1.669   1.00 33.44  ? 419 TYR A CD1 1 
ATOM   3261 C  CD2 . TYR A 1 419 ? -20.986 -13.433 3.061   1.00 34.49  ? 419 TYR A CD2 1 
ATOM   3262 C  CE1 . TYR A 1 419 ? -22.819 -11.916 1.675   1.00 42.89  ? 419 TYR A CE1 1 
ATOM   3263 C  CE2 . TYR A 1 419 ? -22.297 -13.787 3.085   1.00 41.36  ? 419 TYR A CE2 1 
ATOM   3264 C  CZ  . TYR A 1 419 ? -23.213 -13.032 2.392   1.00 50.29  ? 419 TYR A CZ  1 
ATOM   3265 O  OH  . TYR A 1 419 ? -24.525 -13.412 2.433   1.00 60.18  ? 419 TYR A OH  1 
ATOM   3266 N  N   . LEU A 1 420 ? -16.610 -11.310 4.654   1.00 51.31  ? 420 LEU A N   1 
ATOM   3267 C  CA  . LEU A 1 420 ? -15.217 -11.030 4.947   1.00 34.14  ? 420 LEU A CA  1 
ATOM   3268 C  C   . LEU A 1 420 ? -14.402 -12.312 4.848   1.00 38.70  ? 420 LEU A C   1 
ATOM   3269 O  O   . LEU A 1 420 ? -14.764 -13.325 5.461   1.00 35.82  ? 420 LEU A O   1 
ATOM   3270 C  CB  . LEU A 1 420 ? -15.104 -10.424 6.336   1.00 34.74  ? 420 LEU A CB  1 
ATOM   3271 C  CG  . LEU A 1 420 ? -13.800 -9.753  6.737   1.00 43.10  ? 420 LEU A CG  1 
ATOM   3272 C  CD1 . LEU A 1 420 ? -13.580 -8.504  5.886   1.00 42.02  ? 420 LEU A CD1 1 
ATOM   3273 C  CD2 . LEU A 1 420 ? -13.885 -9.424  8.223   1.00 38.25  ? 420 LEU A CD2 1 
ATOM   3274 N  N   . TYR A 1 421 ? -13.304 -12.266 4.076   1.00 39.41  ? 421 TYR A N   1 
ATOM   3275 C  CA  . TYR A 1 421 ? -12.399 -13.398 3.933   1.00 29.74  ? 421 TYR A CA  1 
ATOM   3276 C  C   . TYR A 1 421 ? -11.031 -13.021 4.473   1.00 40.19  ? 421 TYR A C   1 
ATOM   3277 O  O   . TYR A 1 421 ? -10.685 -11.846 4.594   1.00 41.28  ? 421 TYR A O   1 
ATOM   3278 C  CB  . TYR A 1 421 ? -12.284 -13.893 2.467   1.00 28.97  ? 421 TYR A CB  1 
ATOM   3279 C  CG  . TYR A 1 421 ? -11.491 -13.000 1.522   1.00 31.96  ? 421 TYR A CG  1 
ATOM   3280 C  CD1 . TYR A 1 421 ? -10.091 -13.031 1.503   1.00 38.64  ? 421 TYR A CD1 1 
ATOM   3281 C  CD2 . TYR A 1 421 ? -12.135 -12.144 0.632   1.00 27.53  ? 421 TYR A CD2 1 
ATOM   3282 C  CE1 . TYR A 1 421 ? -9.363  -12.205 0.661   1.00 37.75  ? 421 TYR A CE1 1 
ATOM   3283 C  CE2 . TYR A 1 421 ? -11.420 -11.324 -0.225  1.00 26.75  ? 421 TYR A CE2 1 
ATOM   3284 C  CZ  . TYR A 1 421 ? -10.033 -11.354 -0.203  1.00 43.57  ? 421 TYR A CZ  1 
ATOM   3285 O  OH  . TYR A 1 421 ? -9.312  -10.540 -1.051  1.00 46.95  ? 421 TYR A OH  1 
ATOM   3286 N  N   . PHE A 1 422 ? -10.250 -14.046 4.793   1.00 41.39  ? 422 PHE A N   1 
ATOM   3287 C  CA  . PHE A 1 422 ? -8.851  -13.885 5.173   1.00 47.54  ? 422 PHE A CA  1 
ATOM   3288 C  C   . PHE A 1 422 ? -8.072  -14.926 4.383   1.00 48.35  ? 422 PHE A C   1 
ATOM   3289 O  O   . PHE A 1 422 ? -8.163  -16.122 4.674   1.00 41.90  ? 422 PHE A O   1 
ATOM   3290 C  CB  . PHE A 1 422 ? -8.665  -14.057 6.686   1.00 39.45  ? 422 PHE A CB  1 
ATOM   3291 C  CG  . PHE A 1 422 ? -7.258  -13.866 7.161   1.00 30.29  ? 422 PHE A CG  1 
ATOM   3292 C  CD1 . PHE A 1 422 ? -6.469  -14.946 7.523   1.00 38.02  ? 422 PHE A CD1 1 
ATOM   3293 C  CD2 . PHE A 1 422 ? -6.709  -12.596 7.235   1.00 39.53  ? 422 PHE A CD2 1 
ATOM   3294 C  CE1 . PHE A 1 422 ? -5.163  -14.755 7.980   1.00 30.67  ? 422 PHE A CE1 1 
ATOM   3295 C  CE2 . PHE A 1 422 ? -5.405  -12.400 7.687   1.00 39.63  ? 422 PHE A CE2 1 
ATOM   3296 C  CZ  . PHE A 1 422 ? -4.637  -13.476 8.047   1.00 30.32  ? 422 PHE A CZ  1 
ATOM   3297 N  N   . PHE A 1 423 ? -7.334  -14.476 3.369   1.00 48.09  ? 423 PHE A N   1 
ATOM   3298 C  CA  . PHE A 1 423 ? -6.639  -15.370 2.451   1.00 41.18  ? 423 PHE A CA  1 
ATOM   3299 C  C   . PHE A 1 423 ? -5.238  -15.657 2.979   1.00 41.77  ? 423 PHE A C   1 
ATOM   3300 O  O   . PHE A 1 423 ? -4.400  -14.750 3.047   1.00 54.77  ? 423 PHE A O   1 
ATOM   3301 C  CB  . PHE A 1 423 ? -6.568  -14.752 1.056   1.00 41.82  ? 423 PHE A CB  1 
ATOM   3302 C  CG  . PHE A 1 423 ? -6.005  -15.679 0.022   1.00 41.58  ? 423 PHE A CG  1 
ATOM   3303 C  CD1 . PHE A 1 423 ? -6.826  -16.578 -0.635  1.00 39.67  ? 423 PHE A CD1 1 
ATOM   3304 C  CD2 . PHE A 1 423 ? -4.645  -15.679 -0.269  1.00 43.61  ? 423 PHE A CD2 1 
ATOM   3305 C  CE1 . PHE A 1 423 ? -6.309  -17.452 -1.576  1.00 41.71  ? 423 PHE A CE1 1 
ATOM   3306 C  CE2 . PHE A 1 423 ? -4.125  -16.551 -1.202  1.00 46.44  ? 423 PHE A CE2 1 
ATOM   3307 C  CZ  . PHE A 1 423 ? -4.958  -17.438 -1.859  1.00 48.00  ? 423 PHE A CZ  1 
ATOM   3308 N  N   . ASN A 1 424 ? -4.962  -16.920 3.314   1.00 35.69  ? 424 ASN A N   1 
ATOM   3309 C  CA  . ASN A 1 424 ? -3.682  -17.208 3.953   1.00 45.82  ? 424 ASN A CA  1 
ATOM   3310 C  C   . ASN A 1 424 ? -3.008  -18.473 3.422   1.00 50.99  ? 424 ASN A C   1 
ATOM   3311 O  O   . ASN A 1 424 ? -2.223  -19.106 4.141   1.00 52.95  ? 424 ASN A O   1 
ATOM   3312 C  CB  . ASN A 1 424 ? -3.863  -17.326 5.466   1.00 47.49  ? 424 ASN A CB  1 
ATOM   3313 C  CG  . ASN A 1 424 ? -4.777  -18.456 5.835   1.00 47.53  ? 424 ASN A CG  1 
ATOM   3314 O  OD1 . ASN A 1 424 ? -5.556  -18.939 5.000   1.00 54.09  ? 424 ASN A OD1 1 
ATOM   3315 N  ND2 . ASN A 1 424 ? -4.691  -18.899 7.072   1.00 42.04  ? 424 ASN A ND2 1 
ATOM   3316 N  N   . HIS A 1 425 ? -3.245  -18.838 2.170   1.00 55.02  ? 425 HIS A N   1 
ATOM   3317 C  CA  . HIS A 1 425 ? -2.534  -19.959 1.575   1.00 60.33  ? 425 HIS A CA  1 
ATOM   3318 C  C   . HIS A 1 425 ? -1.381  -19.414 0.737   1.00 58.66  ? 425 HIS A C   1 
ATOM   3319 O  O   . HIS A 1 425 ? -1.578  -18.543 -0.117  1.00 49.37  ? 425 HIS A O   1 
ATOM   3320 C  CB  . HIS A 1 425 ? -3.472  -20.830 0.743   1.00 58.36  ? 425 HIS A CB  1 
ATOM   3321 C  CG  . HIS A 1 425 ? -2.772  -21.758 -0.194  1.00 51.82  ? 425 HIS A CG  1 
ATOM   3322 N  ND1 . HIS A 1 425 ? -2.691  -23.109 0.029   1.00 51.31  ? 425 HIS A ND1 1 
ATOM   3323 C  CD2 . HIS A 1 425 ? -2.219  -21.553 -1.410  1.00 49.59  ? 425 HIS A CD2 1 
ATOM   3324 C  CE1 . HIS A 1 425 ? -2.068  -23.693 -0.980  1.00 54.00  ? 425 HIS A CE1 1 
ATOM   3325 N  NE2 . HIS A 1 425 ? -1.771  -22.771 -1.871  1.00 48.65  ? 425 HIS A NE2 1 
ATOM   3326 N  N   . ARG A 1 426 ? -0.175  -19.908 1.009   1.00 63.68  ? 426 ARG A N   1 
ATOM   3327 C  CA  . ARG A 1 426 ? 0.970   -19.632 0.157   1.00 52.95  ? 426 ARG A CA  1 
ATOM   3328 C  C   . ARG A 1 426 ? 0.967   -20.636 -0.982  1.00 48.56  ? 426 ARG A C   1 
ATOM   3329 O  O   . ARG A 1 426 ? 0.882   -21.850 -0.745  1.00 43.44  ? 426 ARG A O   1 
ATOM   3330 C  CB  . ARG A 1 426 ? 2.280   -19.725 0.943   1.00 55.52  ? 426 ARG A CB  1 
ATOM   3331 C  CG  . ARG A 1 426 ? 3.453   -19.184 0.161   1.00 63.15  ? 426 ARG A CG  1 
ATOM   3332 C  CD  . ARG A 1 426 ? 4.753   -19.333 0.903   1.00 70.46  ? 426 ARG A CD  1 
ATOM   3333 N  NE  . ARG A 1 426 ? 5.608   -18.174 0.661   1.00 71.06  ? 426 ARG A NE  1 
ATOM   3334 C  CZ  . ARG A 1 426 ? 6.681   -18.175 -0.120  1.00 68.83  ? 426 ARG A CZ  1 
ATOM   3335 N  NH1 . ARG A 1 426 ? 7.373   -17.055 -0.261  1.00 71.74  1 426 ARG A NH1 1 
ATOM   3336 N  NH2 . ARG A 1 426 ? 7.067   -19.289 -0.742  1.00 61.03  ? 426 ARG A NH2 1 
ATOM   3337 N  N   . ALA A 1 427 ? 1.046   -20.129 -2.214  1.00 43.66  ? 427 ALA A N   1 
ATOM   3338 C  CA  . ALA A 1 427 ? 0.945   -20.990 -3.385  1.00 37.92  ? 427 ALA A CA  1 
ATOM   3339 C  C   . ALA A 1 427 ? 2.124   -21.954 -3.456  1.00 45.53  ? 427 ALA A C   1 
ATOM   3340 O  O   . ALA A 1 427 ? 3.256   -21.609 -3.097  1.00 44.45  ? 427 ALA A O   1 
ATOM   3341 C  CB  . ALA A 1 427 ? 0.870   -20.146 -4.654  1.00 34.46  ? 427 ALA A CB  1 
ATOM   3342 N  N   . SER A 1 428 ? 1.845   -23.175 -3.931  1.00 49.88  ? 428 SER A N   1 
ATOM   3343 C  CA  . SER A 1 428 ? 2.875   -24.209 -4.027  1.00 58.04  ? 428 SER A CA  1 
ATOM   3344 C  C   . SER A 1 428 ? 3.999   -23.824 -4.989  1.00 55.63  ? 428 SER A C   1 
ATOM   3345 O  O   . SER A 1 428 ? 5.120   -24.316 -4.848  1.00 60.02  ? 428 SER A O   1 
ATOM   3346 C  CB  . SER A 1 428 ? 2.241   -25.544 -4.457  1.00 67.65  ? 428 SER A CB  1 
ATOM   3347 O  OG  . SER A 1 428 ? 2.342   -25.783 -5.861  1.00 69.17  ? 428 SER A OG  1 
ATOM   3348 N  N   . ASN A 1 429 ? 3.726   -22.964 -5.969  1.00 54.14  ? 429 ASN A N   1 
ATOM   3349 C  CA  . ASN A 1 429 ? 4.681   -22.627 -7.020  1.00 56.64  ? 429 ASN A CA  1 
ATOM   3350 C  C   . ASN A 1 429 ? 5.123   -21.164 -6.948  1.00 66.93  ? 429 ASN A C   1 
ATOM   3351 O  O   . ASN A 1 429 ? 5.423   -20.531 -7.967  1.00 70.22  ? 429 ASN A O   1 
ATOM   3352 C  CB  . ASN A 1 429 ? 4.105   -22.955 -8.398  1.00 49.01  ? 429 ASN A CB  1 
ATOM   3353 C  CG  . ASN A 1 429 ? 2.777   -22.253 -8.679  1.00 51.33  ? 429 ASN A CG  1 
ATOM   3354 O  OD1 . ASN A 1 429 ? 2.305   -21.418 -7.900  1.00 56.29  ? 429 ASN A OD1 1 
ATOM   3355 N  ND2 . ASN A 1 429 ? 2.178   -22.583 -9.815  1.00 50.26  ? 429 ASN A ND2 1 
ATOM   3356 N  N   . LEU A 1 430 ? 5.186   -20.618 -5.737  1.00 66.24  ? 430 LEU A N   1 
ATOM   3357 C  CA  . LEU A 1 430 ? 5.555   -19.222 -5.555  1.00 65.36  ? 430 LEU A CA  1 
ATOM   3358 C  C   . LEU A 1 430 ? 7.063   -19.069 -5.656  1.00 54.30  ? 430 LEU A C   1 
ATOM   3359 O  O   . LEU A 1 430 ? 7.820   -19.922 -5.185  1.00 47.19  ? 430 LEU A O   1 
ATOM   3360 C  CB  . LEU A 1 430 ? 5.059   -18.702 -4.203  1.00 72.91  ? 430 LEU A CB  1 
ATOM   3361 C  CG  . LEU A 1 430 ? 4.653   -17.229 -4.172  1.00 67.30  ? 430 LEU A CG  1 
ATOM   3362 C  CD1 . LEU A 1 430 ? 3.561   -17.040 -5.172  1.00 61.98  ? 430 LEU A CD1 1 
ATOM   3363 C  CD2 . LEU A 1 430 ? 4.190   -16.818 -2.794  1.00 68.96  ? 430 LEU A CD2 1 
ATOM   3364 N  N   . VAL A 1 431 ? 7.497   -17.974 -6.283  1.00 57.49  ? 431 VAL A N   1 
ATOM   3365 C  CA  . VAL A 1 431 ? 8.908   -17.785 -6.598  1.00 57.57  ? 431 VAL A CA  1 
ATOM   3366 C  C   . VAL A 1 431 ? 9.590   -16.849 -5.623  1.00 47.56  ? 431 VAL A C   1 
ATOM   3367 O  O   . VAL A 1 431 ? 10.802  -16.618 -5.746  1.00 39.84  ? 431 VAL A O   1 
ATOM   3368 C  CB  . VAL A 1 431 ? 9.090   -17.276 -8.045  1.00 57.91  ? 431 VAL A CB  1 
ATOM   3369 C  CG1 . VAL A 1 431 ? 8.844   -18.399 -9.040  1.00 53.72  ? 431 VAL A CG1 1 
ATOM   3370 C  CG2 . VAL A 1 431 ? 8.167   -16.100 -8.325  1.00 63.89  ? 431 VAL A CG2 1 
ATOM   3371 N  N   . TRP A 1 432 ? 8.839   -16.275 -4.662  1.00 43.31  ? 432 TRP A N   1 
ATOM   3372 C  CA  . TRP A 1 432 ? 9.421   -15.386 -3.674  1.00 40.61  ? 432 TRP A CA  1 
ATOM   3373 C  C   . TRP A 1 432 ? 9.765   -16.156 -2.404  1.00 52.53  ? 432 TRP A C   1 
ATOM   3374 O  O   . TRP A 1 432 ? 9.213   -17.233 -2.147  1.00 54.21  ? 432 TRP A O   1 
ATOM   3375 C  CB  . TRP A 1 432 ? 8.461   -14.248 -3.356  1.00 39.46  ? 432 TRP A CB  1 
ATOM   3376 C  CG  . TRP A 1 432 ? 8.120   -13.343 -4.500  1.00 42.12  ? 432 TRP A CG  1 
ATOM   3377 C  CD1 . TRP A 1 432 ? 7.095   -13.481 -5.381  1.00 48.75  ? 432 TRP A CD1 1 
ATOM   3378 C  CD2 . TRP A 1 432 ? 8.824   -12.161 -4.892  1.00 39.11  ? 432 TRP A CD2 1 
ATOM   3379 N  NE1 . TRP A 1 432 ? 7.104   -12.452 -6.290  1.00 49.50  ? 432 TRP A NE1 1 
ATOM   3380 C  CE2 . TRP A 1 432 ? 8.158   -11.627 -6.013  1.00 43.13  ? 432 TRP A CE2 1 
ATOM   3381 C  CE3 . TRP A 1 432 ? 9.950   -11.501 -4.402  1.00 33.52  ? 432 TRP A CE3 1 
ATOM   3382 C  CZ2 . TRP A 1 432 ? 8.588   -10.475 -6.658  1.00 44.90  ? 432 TRP A CZ2 1 
ATOM   3383 C  CZ3 . TRP A 1 432 ? 10.374  -10.361 -5.042  1.00 40.18  ? 432 TRP A CZ3 1 
ATOM   3384 C  CH2 . TRP A 1 432 ? 9.691   -9.854  -6.155  1.00 44.55  ? 432 TRP A CH2 1 
ATOM   3385 N  N   . PRO A 1 433 ? 10.689  -15.633 -1.587  1.00 51.92  ? 433 PRO A N   1 
ATOM   3386 C  CA  . PRO A 1 433 ? 11.124  -16.374 -0.394  1.00 43.35  ? 433 PRO A CA  1 
ATOM   3387 C  C   . PRO A 1 433 ? 10.007  -16.573 0.623   1.00 45.06  ? 433 PRO A C   1 
ATOM   3388 O  O   . PRO A 1 433 ? 9.073   -15.771 0.738   1.00 43.25  ? 433 PRO A O   1 
ATOM   3389 C  CB  . PRO A 1 433 ? 12.242  -15.498 0.179   1.00 40.63  ? 433 PRO A CB  1 
ATOM   3390 C  CG  . PRO A 1 433 ? 11.948  -14.143 -0.355  1.00 51.87  ? 433 PRO A CG  1 
ATOM   3391 C  CD  . PRO A 1 433 ? 11.425  -14.366 -1.734  1.00 51.07  ? 433 PRO A CD  1 
ATOM   3392 N  N   . GLU A 1 434 ? 10.148  -17.657 1.390   1.00 43.14  ? 434 GLU A N   1 
ATOM   3393 C  CA  . GLU A 1 434 ? 9.113   -18.085 2.317   1.00 43.16  ? 434 GLU A CA  1 
ATOM   3394 C  C   . GLU A 1 434 ? 8.778   -17.010 3.349   1.00 37.55  ? 434 GLU A C   1 
ATOM   3395 O  O   . GLU A 1 434 ? 7.612   -16.864 3.743   1.00 34.68  ? 434 GLU A O   1 
ATOM   3396 C  CB  . GLU A 1 434 ? 9.550   -19.376 2.998   1.00 55.12  ? 434 GLU A CB  1 
ATOM   3397 C  CG  . GLU A 1 434 ? 8.426   -20.036 3.778   1.00 84.74  ? 434 GLU A CG  1 
ATOM   3398 C  CD  . GLU A 1 434 ? 8.683   -21.509 4.052   1.00 97.93  ? 434 GLU A CD  1 
ATOM   3399 O  OE1 . GLU A 1 434 ? 8.074   -22.056 5.008   1.00 102.02 ? 434 GLU A OE1 1 
ATOM   3400 O  OE2 . GLU A 1 434 ? 9.497   -22.119 3.314   1.00 98.46  1 434 GLU A OE2 1 
ATOM   3401 N  N   . TRP A 1 435 ? 9.777   -16.233 3.776   1.00 30.10  ? 435 TRP A N   1 
ATOM   3402 C  CA  . TRP A 1 435 ? 9.558   -15.213 4.794   1.00 36.61  ? 435 TRP A CA  1 
ATOM   3403 C  C   . TRP A 1 435 ? 8.562   -14.164 4.349   1.00 37.09  ? 435 TRP A C   1 
ATOM   3404 O  O   . TRP A 1 435 ? 8.025   -13.441 5.193   1.00 56.74  ? 435 TRP A O   1 
ATOM   3405 C  CB  . TRP A 1 435 ? 10.866  -14.513 5.180   1.00 43.04  ? 435 TRP A CB  1 
ATOM   3406 C  CG  . TRP A 1 435 ? 11.414  -13.548 4.141   1.00 46.89  ? 435 TRP A CG  1 
ATOM   3407 C  CD1 . TRP A 1 435 ? 12.424  -13.795 3.239   1.00 52.03  ? 435 TRP A CD1 1 
ATOM   3408 C  CD2 . TRP A 1 435 ? 11.000  -12.191 3.907   1.00 39.56  ? 435 TRP A CD2 1 
ATOM   3409 N  NE1 . TRP A 1 435 ? 12.661  -12.680 2.472   1.00 44.91  ? 435 TRP A NE1 1 
ATOM   3410 C  CE2 . TRP A 1 435 ? 11.796  -11.686 2.851   1.00 42.15  ? 435 TRP A CE2 1 
ATOM   3411 C  CE3 . TRP A 1 435 ? 10.044  -11.354 4.488   1.00 31.83  ? 435 TRP A CE3 1 
ATOM   3412 C  CZ2 . TRP A 1 435 ? 11.655  -10.381 2.363   1.00 40.12  ? 435 TRP A CZ2 1 
ATOM   3413 C  CZ3 . TRP A 1 435 ? 9.904   -10.059 3.999   1.00 35.45  ? 435 TRP A CZ3 1 
ATOM   3414 C  CH2 . TRP A 1 435 ? 10.709  -9.586  2.949   1.00 41.23  ? 435 TRP A CH2 1 
ATOM   3415 N  N   . MET A 1 436 ? 8.323   -14.047 3.052   1.00 39.61  ? 436 MET A N   1 
ATOM   3416 C  CA  . MET A 1 436 ? 7.313   -13.125 2.557   1.00 40.36  ? 436 MET A CA  1 
ATOM   3417 C  C   . MET A 1 436 ? 5.898   -13.654 2.760   1.00 33.85  ? 436 MET A C   1 
ATOM   3418 O  O   . MET A 1 436 ? 4.939   -12.894 2.584   1.00 32.12  ? 436 MET A O   1 
ATOM   3419 C  CB  . MET A 1 436 ? 7.572   -12.823 1.075   1.00 35.84  ? 436 MET A CB  1 
ATOM   3420 C  CG  . MET A 1 436 ? 8.896   -12.110 0.844   1.00 39.87  ? 436 MET A CG  1 
ATOM   3421 S  SD  . MET A 1 436 ? 9.190   -11.462 -0.807  1.00 49.91  ? 436 MET A SD  1 
ATOM   3422 C  CE  . MET A 1 436 ? 7.854   -10.280 -0.950  1.00 40.16  ? 436 MET A CE  1 
ATOM   3423 N  N   . GLY A 1 437 ? 5.753   -14.932 3.116   1.00 29.96  ? 437 GLY A N   1 
ATOM   3424 C  CA  . GLY A 1 437 ? 4.448   -15.494 3.420   1.00 37.20  ? 437 GLY A CA  1 
ATOM   3425 C  C   . GLY A 1 437 ? 3.443   -15.374 2.287   1.00 42.08  ? 437 GLY A C   1 
ATOM   3426 O  O   . GLY A 1 437 ? 3.753   -15.585 1.102   1.00 47.60  ? 437 GLY A O   1 
ATOM   3427 N  N   . VAL A 1 438 ? 2.213   -15.026 2.653   1.00 41.30  ? 438 VAL A N   1 
ATOM   3428 C  CA  . VAL A 1 438 ? 1.100   -14.993 1.683   1.00 48.83  ? 438 VAL A CA  1 
ATOM   3429 C  C   . VAL A 1 438 ? 1.085   -13.585 1.096   1.00 46.74  ? 438 VAL A C   1 
ATOM   3430 O  O   . VAL A 1 438 ? 0.280   -12.721 1.456   1.00 38.89  ? 438 VAL A O   1 
ATOM   3431 C  CB  . VAL A 1 438 ? -0.227  -15.400 2.323   1.00 48.31  ? 438 VAL A CB  1 
ATOM   3432 C  CG1 . VAL A 1 438 ? -1.267  -15.673 1.266   1.00 49.25  ? 438 VAL A CG1 1 
ATOM   3433 C  CG2 . VAL A 1 438 ? -0.018  -16.635 3.198   1.00 48.68  ? 438 VAL A CG2 1 
ATOM   3434 N  N   . ILE A 1 439 ? 2.014   -13.352 0.160   1.00 48.10  ? 439 ILE A N   1 
ATOM   3435 C  CA  . ILE A 1 439 ? 2.216   -12.037 -0.439  1.00 49.51  ? 439 ILE A CA  1 
ATOM   3436 C  C   . ILE A 1 439 ? 0.924   -11.513 -1.056  1.00 51.66  ? 439 ILE A C   1 
ATOM   3437 O  O   . ILE A 1 439 ? 0.187   -12.248 -1.726  1.00 58.83  ? 439 ILE A O   1 
ATOM   3438 C  CB  . ILE A 1 439 ? 3.321   -12.141 -1.501  1.00 46.84  ? 439 ILE A CB  1 
ATOM   3439 C  CG1 . ILE A 1 439 ? 4.511   -12.897 -0.947  1.00 45.61  ? 439 ILE A CG1 1 
ATOM   3440 C  CG2 . ILE A 1 439 ? 3.800   -10.792 -1.910  1.00 49.82  ? 439 ILE A CG2 1 
ATOM   3441 C  CD1 . ILE A 1 439 ? 5.634   -12.983 -1.936  1.00 42.95  ? 439 ILE A CD1 1 
ATOM   3442 N  N   . HIS A 1 440 ? 0.643   -10.231 -0.846  1.00 41.07  ? 440 HIS A N   1 
ATOM   3443 C  CA  . HIS A 1 440 ? -0.526  -9.636  -1.479  1.00 35.93  ? 440 HIS A CA  1 
ATOM   3444 C  C   . HIS A 1 440 ? -0.374  -9.686  -2.991  1.00 44.24  ? 440 HIS A C   1 
ATOM   3445 O  O   . HIS A 1 440 ? 0.740   -9.628  -3.525  1.00 49.85  ? 440 HIS A O   1 
ATOM   3446 C  CB  . HIS A 1 440 ? -0.715  -8.190  -1.031  1.00 35.42  ? 440 HIS A CB  1 
ATOM   3447 C  CG  . HIS A 1 440 ? -0.116  -7.191  -1.967  1.00 38.65  ? 440 HIS A CG  1 
ATOM   3448 N  ND1 . HIS A 1 440 ? -0.823  -6.628  -3.006  1.00 44.48  ? 440 HIS A ND1 1 
ATOM   3449 C  CD2 . HIS A 1 440 ? 1.134   -6.680  -2.043  1.00 51.10  ? 440 HIS A CD2 1 
ATOM   3450 C  CE1 . HIS A 1 440 ? -0.039  -5.800  -3.674  1.00 51.01  ? 440 HIS A CE1 1 
ATOM   3451 N  NE2 . HIS A 1 440 ? 1.156   -5.815  -3.110  1.00 58.25  ? 440 HIS A NE2 1 
ATOM   3452 N  N   . GLY A 1 441 ? -1.522  -9.782  -3.683  1.00 40.18  ? 441 GLY A N   1 
ATOM   3453 C  CA  . GLY A 1 441 ? -1.573  -9.991  -5.116  1.00 29.34  ? 441 GLY A CA  1 
ATOM   3454 C  C   . GLY A 1 441 ? -1.675  -11.445 -5.545  1.00 38.31  ? 441 GLY A C   1 
ATOM   3455 O  O   . GLY A 1 441 ? -2.095  -11.718 -6.679  1.00 48.23  ? 441 GLY A O   1 
ATOM   3456 N  N   . TYR A 1 442 ? -1.323  -12.392 -4.672  1.00 31.02  ? 442 TYR A N   1 
ATOM   3457 C  CA  . TYR A 1 442 ? -1.259  -13.793 -5.050  1.00 31.89  ? 442 TYR A CA  1 
ATOM   3458 C  C   . TYR A 1 442 ? -2.520  -14.571 -4.644  1.00 43.68  ? 442 TYR A C   1 
ATOM   3459 O  O   . TYR A 1 442 ? -2.521  -15.807 -4.645  1.00 49.65  ? 442 TYR A O   1 
ATOM   3460 C  CB  . TYR A 1 442 ? 0.037   -14.399 -4.516  1.00 29.70  ? 442 TYR A CB  1 
ATOM   3461 C  CG  . TYR A 1 442 ? 1.252   -13.813 -5.264  1.00 52.99  ? 442 TYR A CG  1 
ATOM   3462 C  CD1 . TYR A 1 442 ? 1.695   -12.504 -5.042  1.00 51.16  ? 442 TYR A CD1 1 
ATOM   3463 C  CD2 . TYR A 1 442 ? 1.897   -14.549 -6.261  1.00 55.58  ? 442 TYR A CD2 1 
ATOM   3464 C  CE1 . TYR A 1 442 ? 2.784   -11.988 -5.753  1.00 49.95  ? 442 TYR A CE1 1 
ATOM   3465 C  CE2 . TYR A 1 442 ? 2.977   -14.047 -6.965  1.00 44.57  ? 442 TYR A CE2 1 
ATOM   3466 C  CZ  . TYR A 1 442 ? 3.418   -12.776 -6.711  1.00 43.08  ? 442 TYR A CZ  1 
ATOM   3467 O  OH  . TYR A 1 442 ? 4.478   -12.299 -7.443  1.00 40.87  ? 442 TYR A OH  1 
ATOM   3468 N  N   . GLU A 1 443 ? -3.605  -13.856 -4.344  1.00 39.01  ? 443 GLU A N   1 
ATOM   3469 C  CA  . GLU A 1 443 ? -4.961  -14.382 -4.415  1.00 35.05  ? 443 GLU A CA  1 
ATOM   3470 C  C   . GLU A 1 443 ? -5.544  -14.255 -5.827  1.00 38.91  ? 443 GLU A C   1 
ATOM   3471 O  O   . GLU A 1 443 ? -6.452  -15.011 -6.197  1.00 35.03  ? 443 GLU A O   1 
ATOM   3472 C  CB  . GLU A 1 443 ? -5.853  -13.620 -3.427  1.00 37.27  ? 443 GLU A CB  1 
ATOM   3473 C  CG  . GLU A 1 443 ? -6.236  -12.238 -3.971  1.00 45.62  ? 443 GLU A CG  1 
ATOM   3474 C  CD  . GLU A 1 443 ? -5.199  -11.195 -3.679  1.00 43.36  ? 443 GLU A CD  1 
ATOM   3475 O  OE1 . GLU A 1 443 ? -5.574  -10.064 -3.307  1.00 42.96  ? 443 GLU A OE1 1 
ATOM   3476 O  OE2 . GLU A 1 443 ? -4.003  -11.535 -3.774  1.00 44.91  1 443 GLU A OE2 1 
ATOM   3477 N  N   . ILE A 1 444 ? -5.045  -13.305 -6.621  1.00 34.82  ? 444 ILE A N   1 
ATOM   3478 C  CA  . ILE A 1 444 ? -5.595  -13.078 -7.955  1.00 31.49  ? 444 ILE A CA  1 
ATOM   3479 C  C   . ILE A 1 444 ? -5.459  -14.328 -8.815  1.00 29.86  ? 444 ILE A C   1 
ATOM   3480 O  O   . ILE A 1 444 ? -6.386  -14.705 -9.533  1.00 42.01  ? 444 ILE A O   1 
ATOM   3481 C  CB  . ILE A 1 444 ? -4.920  -11.858 -8.610  1.00 29.82  ? 444 ILE A CB  1 
ATOM   3482 C  CG1 . ILE A 1 444 ? -5.014  -10.643 -7.676  1.00 37.54  ? 444 ILE A CG1 1 
ATOM   3483 C  CG2 . ILE A 1 444 ? -5.592  -11.550 -9.897  1.00 26.02  ? 444 ILE A CG2 1 
ATOM   3484 C  CD1 . ILE A 1 444 ? -4.173  -9.449  -8.075  1.00 31.96  ? 444 ILE A CD1 1 
ATOM   3485 N  N   . GLU A 1 445 ? -4.314  -15.004 -8.740  1.00 37.94  ? 445 GLU A N   1 
ATOM   3486 C  CA  . GLU A 1 445 ? -4.122  -16.234 -9.499  1.00 35.56  ? 445 GLU A CA  1 
ATOM   3487 C  C   . GLU A 1 445 ? -5.287  -17.194 -9.324  1.00 42.19  ? 445 GLU A C   1 
ATOM   3488 O  O   . GLU A 1 445 ? -5.658  -17.917 -10.262 1.00 46.47  ? 445 GLU A O   1 
ATOM   3489 C  CB  . GLU A 1 445 ? -2.841  -16.918 -9.052  1.00 33.08  ? 445 GLU A CB  1 
ATOM   3490 C  CG  . GLU A 1 445 ? -1.779  -15.975 -8.587  1.00 32.54  ? 445 GLU A CG  1 
ATOM   3491 C  CD  . GLU A 1 445 ? -0.519  -16.726 -8.337  1.00 46.57  ? 445 GLU A CD  1 
ATOM   3492 O  OE1 . GLU A 1 445 ? -0.593  -17.981 -8.317  1.00 43.55  ? 445 GLU A OE1 1 
ATOM   3493 O  OE2 . GLU A 1 445 ? 0.536   -16.073 -8.188  1.00 60.60  1 445 GLU A OE2 1 
ATOM   3494 N  N   . PHE A 1 446 ? -5.864  -17.230 -8.119  1.00 31.96  ? 446 PHE A N   1 
ATOM   3495 C  CA  . PHE A 1 446 ? -6.942  -18.167 -7.842  1.00 31.38  ? 446 PHE A CA  1 
ATOM   3496 C  C   . PHE A 1 446 ? -8.286  -17.607 -8.289  1.00 35.18  ? 446 PHE A C   1 
ATOM   3497 O  O   . PHE A 1 446 ? -9.082  -18.330 -8.899  1.00 30.45  ? 446 PHE A O   1 
ATOM   3498 C  CB  . PHE A 1 446 ? -6.966  -18.521 -6.352  1.00 38.53  ? 446 PHE A CB  1 
ATOM   3499 C  CG  . PHE A 1 446 ? -5.783  -19.334 -5.889  1.00 27.27  ? 446 PHE A CG  1 
ATOM   3500 C  CD1 . PHE A 1 446 ? -4.612  -18.709 -5.471  1.00 34.76  ? 446 PHE A CD1 1 
ATOM   3501 C  CD2 . PHE A 1 446 ? -5.852  -20.720 -5.839  1.00 28.20  ? 446 PHE A CD2 1 
ATOM   3502 C  CE1 . PHE A 1 446 ? -3.499  -19.453 -5.039  1.00 33.06  ? 446 PHE A CE1 1 
ATOM   3503 C  CE2 . PHE A 1 446 ? -4.751  -21.482 -5.402  1.00 37.69  ? 446 PHE A CE2 1 
ATOM   3504 C  CZ  . PHE A 1 446 ? -3.567  -20.842 -5.002  1.00 32.34  ? 446 PHE A CZ  1 
ATOM   3505 N  N   . VAL A 1 447 ? -8.548  -16.325 -8.000  1.00 33.23  ? 447 VAL A N   1 
ATOM   3506 C  CA  . VAL A 1 447 ? -9.761  -15.668 -8.488  1.00 40.15  ? 447 VAL A CA  1 
ATOM   3507 C  C   . VAL A 1 447 ? -9.973  -15.959 -9.969  1.00 44.29  ? 447 VAL A C   1 
ATOM   3508 O  O   . VAL A 1 447 ? -11.087 -16.290 -10.405 1.00 50.53  ? 447 VAL A O   1 
ATOM   3509 C  CB  . VAL A 1 447 ? -9.695  -14.150 -8.224  1.00 40.67  ? 447 VAL A CB  1 
ATOM   3510 C  CG1 . VAL A 1 447 ? -10.987 -13.469 -8.688  1.00 47.53  ? 447 VAL A CG1 1 
ATOM   3511 C  CG2 . VAL A 1 447 ? -9.462  -13.875 -6.759  1.00 25.44  ? 447 VAL A CG2 1 
ATOM   3512 N  N   . PHE A 1 448 ? -8.897  -15.866 -10.758 1.00 35.57  ? 448 PHE A N   1 
ATOM   3513 C  CA  . PHE A 1 448 ? -8.924  -16.053 -12.203 1.00 39.54  ? 448 PHE A CA  1 
ATOM   3514 C  C   . PHE A 1 448 ? -8.648  -17.497 -12.617 1.00 33.74  ? 448 PHE A C   1 
ATOM   3515 O  O   . PHE A 1 448 ? -8.361  -17.757 -13.787 1.00 32.71  ? 448 PHE A O   1 
ATOM   3516 C  CB  . PHE A 1 448 ? -7.926  -15.104 -12.873 1.00 31.53  ? 448 PHE A CB  1 
ATOM   3517 C  CG  . PHE A 1 448 ? -8.402  -13.677 -12.946 1.00 33.60  ? 448 PHE A CG  1 
ATOM   3518 C  CD1 . PHE A 1 448 ? -8.013  -12.751 -12.002 1.00 32.55  ? 448 PHE A CD1 1 
ATOM   3519 C  CD2 . PHE A 1 448 ? -9.255  -13.261 -13.960 1.00 48.08  ? 448 PHE A CD2 1 
ATOM   3520 C  CE1 . PHE A 1 448 ? -8.453  -11.419 -12.058 1.00 40.91  ? 448 PHE A CE1 1 
ATOM   3521 C  CE2 . PHE A 1 448 ? -9.701  -11.931 -14.023 1.00 48.06  ? 448 PHE A CE2 1 
ATOM   3522 C  CZ  . PHE A 1 448 ? -9.296  -11.012 -13.066 1.00 45.38  ? 448 PHE A CZ  1 
ATOM   3523 N  N   . GLY A 1 449 ? -8.721  -18.434 -11.682 1.00 28.09  ? 449 GLY A N   1 
ATOM   3524 C  CA  . GLY A 1 449 ? -8.679  -19.849 -12.014 1.00 33.06  ? 449 GLY A CA  1 
ATOM   3525 C  C   . GLY A 1 449 ? -7.456  -20.364 -12.751 1.00 42.71  ? 449 GLY A C   1 
ATOM   3526 O  O   . GLY A 1 449 ? -7.560  -21.379 -13.454 1.00 41.01  ? 449 GLY A O   1 
ATOM   3527 N  N   . LEU A 1 450 ? -6.293  -19.725 -12.601 1.00 38.12  ? 450 LEU A N   1 
ATOM   3528 C  CA  . LEU A 1 450 ? -5.106  -20.313 -13.217 1.00 38.43  ? 450 LEU A CA  1 
ATOM   3529 C  C   . LEU A 1 450 ? -4.716  -21.692 -12.712 1.00 32.00  ? 450 LEU A C   1 
ATOM   3530 O  O   . LEU A 1 450 ? -4.161  -22.459 -13.526 1.00 39.92  ? 450 LEU A O   1 
ATOM   3531 C  CB  . LEU A 1 450 ? -3.888  -19.375 -13.143 1.00 38.69  ? 450 LEU A CB  1 
ATOM   3532 C  CG  . LEU A 1 450 ? -4.141  -17.905 -13.410 1.00 40.81  ? 450 LEU A CG  1 
ATOM   3533 C  CD1 . LEU A 1 450 ? -2.820  -17.175 -13.243 1.00 38.20  ? 450 LEU A CD1 1 
ATOM   3534 C  CD2 . LEU A 1 450 ? -4.747  -17.703 -14.785 1.00 39.59  ? 450 LEU A CD2 1 
ATOM   3535 N  N   . PRO A 1 451 ? -4.905  -22.051 -11.444 1.00 31.00  ? 451 PRO A N   1 
ATOM   3536 C  CA  . PRO A 1 451 ? -4.544  -23.412 -11.031 1.00 30.94  ? 451 PRO A CA  1 
ATOM   3537 C  C   . PRO A 1 451 ? -5.283  -24.506 -11.779 1.00 43.83  ? 451 PRO A C   1 
ATOM   3538 O  O   . PRO A 1 451 ? -4.881  -25.680 -11.690 1.00 41.75  ? 451 PRO A O   1 
ATOM   3539 C  CB  . PRO A 1 451 ? -4.867  -23.428 -9.540  1.00 30.60  ? 451 PRO A CB  1 
ATOM   3540 C  CG  . PRO A 1 451 ? -5.314  -22.054 -9.179  1.00 29.43  ? 451 PRO A CG  1 
ATOM   3541 C  CD  . PRO A 1 451 ? -5.009  -21.131 -10.293 1.00 34.21  ? 451 PRO A CD  1 
ATOM   3542 N  N   . LEU A 1 452 ? -6.346  -24.158 -12.515 1.00 46.34  ? 452 LEU A N   1 
ATOM   3543 C  CA  . LEU A 1 452 ? -7.063  -25.086 -13.380 1.00 42.16  ? 452 LEU A CA  1 
ATOM   3544 C  C   . LEU A 1 452 ? -6.246  -25.512 -14.592 1.00 47.25  ? 452 LEU A C   1 
ATOM   3545 O  O   . LEU A 1 452 ? -6.611  -26.500 -15.244 1.00 53.52  ? 452 LEU A O   1 
ATOM   3546 C  CB  . LEU A 1 452 ? -8.370  -24.450 -13.844 1.00 38.40  ? 452 LEU A CB  1 
ATOM   3547 C  CG  . LEU A 1 452 ? -9.567  -24.382 -12.894 1.00 43.86  ? 452 LEU A CG  1 
ATOM   3548 C  CD1 . LEU A 1 452 ? -9.332  -23.442 -11.723 1.00 45.05  ? 452 LEU A CD1 1 
ATOM   3549 C  CD2 . LEU A 1 452 ? -10.787 -23.960 -13.686 1.00 44.10  ? 452 LEU A CD2 1 
ATOM   3550 N  N   . VAL A 1 453 ? -5.160  -24.795 -14.891 1.00 48.74  ? 453 VAL A N   1 
ATOM   3551 C  CA  . VAL A 1 453 ? -4.291  -25.049 -16.037 1.00 52.44  ? 453 VAL A CA  1 
ATOM   3552 C  C   . VAL A 1 453 ? -3.167  -25.987 -15.606 1.00 56.63  ? 453 VAL A C   1 
ATOM   3553 O  O   . VAL A 1 453 ? -2.287  -25.584 -14.841 1.00 57.80  ? 453 VAL A O   1 
ATOM   3554 C  CB  . VAL A 1 453 ? -3.707  -23.731 -16.568 1.00 54.89  ? 453 VAL A CB  1 
ATOM   3555 C  CG1 . VAL A 1 453 ? -2.710  -24.000 -17.685 1.00 57.87  ? 453 VAL A CG1 1 
ATOM   3556 C  CG2 . VAL A 1 453 ? -4.810  -22.761 -16.989 1.00 45.99  ? 453 VAL A CG2 1 
ATOM   3557 N  N   . LYS A 1 454 ? -3.162  -27.223 -16.129 1.00 62.03  ? 454 LYS A N   1 
ATOM   3558 C  CA  . LYS A 1 454 ? -2.265  -28.247 -15.585 1.00 60.57  ? 454 LYS A CA  1 
ATOM   3559 C  C   . LYS A 1 454 ? -0.809  -27.912 -15.850 1.00 62.09  ? 454 LYS A C   1 
ATOM   3560 O  O   . LYS A 1 454 ? 0.057   -28.186 -15.009 1.00 59.51  ? 454 LYS A O   1 
ATOM   3561 C  CB  . LYS A 1 454 ? -2.588  -29.644 -16.140 1.00 66.71  ? 454 LYS A CB  1 
ATOM   3562 C  CG  . LYS A 1 454 ? -4.020  -30.116 -15.833 1.00 89.43  ? 454 LYS A CG  1 
ATOM   3563 C  CD  . LYS A 1 454 ? -4.122  -31.379 -14.952 1.00 87.10  ? 454 LYS A CD  1 
ATOM   3564 C  CE  . LYS A 1 454 ? -5.357  -31.298 -14.014 1.00 84.62  ? 454 LYS A CE  1 
ATOM   3565 N  NZ  . LYS A 1 454 ? -6.703  -31.137 -14.682 1.00 77.06  1 454 LYS A NZ  1 
ATOM   3566 N  N   . GLU A 1 455 ? -0.510  -27.313 -17.007 1.00 66.79  ? 455 GLU A N   1 
ATOM   3567 C  CA  . GLU A 1 455 ? 0.884   -26.984 -17.288 1.00 66.50  ? 455 GLU A CA  1 
ATOM   3568 C  C   . GLU A 1 455 ? 1.442   -25.969 -16.294 1.00 55.03  ? 455 GLU A C   1 
ATOM   3569 O  O   . GLU A 1 455 ? 2.663   -25.881 -16.141 1.00 65.96  ? 455 GLU A O   1 
ATOM   3570 C  CB  . GLU A 1 455 ? 1.050   -26.488 -18.730 1.00 74.64  ? 455 GLU A CB  1 
ATOM   3571 C  CG  . GLU A 1 455 ? -0.016  -25.499 -19.226 1.00 84.63  ? 455 GLU A CG  1 
ATOM   3572 C  CD  . GLU A 1 455 ? -1.091  -26.139 -20.113 1.00 85.67  ? 455 GLU A CD  1 
ATOM   3573 O  OE1 . GLU A 1 455 ? -1.807  -25.395 -20.835 1.00 77.26  ? 455 GLU A OE1 1 
ATOM   3574 O  OE2 . GLU A 1 455 ? -1.200  -27.386 -20.098 1.00 88.28  1 455 GLU A OE2 1 
ATOM   3575 N  N   . LEU A 1 456 ? 0.591   -25.228 -15.584 1.00 45.69  ? 456 LEU A N   1 
ATOM   3576 C  CA  . LEU A 1 456 ? 1.094   -24.282 -14.592 1.00 43.46  ? 456 LEU A CA  1 
ATOM   3577 C  C   . LEU A 1 456 ? 1.507   -24.940 -13.276 1.00 44.56  ? 456 LEU A C   1 
ATOM   3578 O  O   . LEU A 1 456 ? 1.868   -24.222 -12.338 1.00 35.45  ? 456 LEU A O   1 
ATOM   3579 C  CB  . LEU A 1 456 ? 0.061   -23.186 -14.335 1.00 37.40  ? 456 LEU A CB  1 
ATOM   3580 C  CG  . LEU A 1 456 ? -0.103  -22.257 -15.543 1.00 41.70  ? 456 LEU A CG  1 
ATOM   3581 C  CD1 . LEU A 1 456 ? -1.080  -21.116 -15.294 1.00 30.94  ? 456 LEU A CD1 1 
ATOM   3582 C  CD2 . LEU A 1 456 ? 1.242   -21.705 -15.933 1.00 51.13  ? 456 LEU A CD2 1 
ATOM   3583 N  N   . ASN A 1 457 ? 1.464   -26.274 -13.185 1.00 56.91  ? 457 ASN A N   1 
ATOM   3584 C  CA  . ASN A 1 457 ? 2.083   -27.028 -12.088 1.00 62.34  ? 457 ASN A CA  1 
ATOM   3585 C  C   . ASN A 1 457 ? 1.552   -26.607 -10.707 1.00 62.04  ? 457 ASN A C   1 
ATOM   3586 O  O   . ASN A 1 457 ? 2.276   -26.652 -9.708  1.00 67.54  ? 457 ASN A O   1 
ATOM   3587 C  CB  . ASN A 1 457 ? 3.619   -26.922 -12.147 1.00 59.86  ? 457 ASN A CB  1 
ATOM   3588 C  CG  . ASN A 1 457 ? 4.244   -27.777 -13.268 1.00 68.01  ? 457 ASN A CG  1 
ATOM   3589 O  OD1 . ASN A 1 457 ? 3.832   -28.914 -13.506 1.00 66.45  ? 457 ASN A OD1 1 
ATOM   3590 N  ND2 . ASN A 1 457 ? 5.251   -27.224 -13.950 1.00 77.27  ? 457 ASN A ND2 1 
ATOM   3591 N  N   . TYR A 1 458 ? 0.286   -26.201 -10.625 1.00 55.56  ? 458 TYR A N   1 
ATOM   3592 C  CA  . TYR A 1 458 ? -0.385  -26.099 -9.334  1.00 49.39  ? 458 TYR A CA  1 
ATOM   3593 C  C   . TYR A 1 458 ? -0.893  -27.469 -8.884  1.00 49.44  ? 458 TYR A C   1 
ATOM   3594 O  O   . TYR A 1 458 ? -1.100  -28.386 -9.689  1.00 55.85  ? 458 TYR A O   1 
ATOM   3595 C  CB  . TYR A 1 458 ? -1.591  -25.169 -9.383  1.00 38.99  ? 458 TYR A CB  1 
ATOM   3596 C  CG  . TYR A 1 458 ? -1.331  -23.700 -9.553  1.00 35.19  ? 458 TYR A CG  1 
ATOM   3597 C  CD1 . TYR A 1 458 ? -1.140  -23.150 -10.813 1.00 30.52  ? 458 TYR A CD1 1 
ATOM   3598 C  CD2 . TYR A 1 458 ? -1.369  -22.846 -8.463  1.00 31.62  ? 458 TYR A CD2 1 
ATOM   3599 C  CE1 . TYR A 1 458 ? -0.953  -21.779 -10.972 1.00 43.67  ? 458 TYR A CE1 1 
ATOM   3600 C  CE2 . TYR A 1 458 ? -1.181  -21.479 -8.608  1.00 31.28  ? 458 TYR A CE2 1 
ATOM   3601 C  CZ  . TYR A 1 458 ? -0.973  -20.948 -9.862  1.00 42.27  ? 458 TYR A CZ  1 
ATOM   3602 O  OH  . TYR A 1 458 ? -0.781  -19.586 -10.006 1.00 45.89  ? 458 TYR A OH  1 
ATOM   3603 N  N   . THR A 1 459 ? -1.153  -27.579 -7.587  1.00 39.93  ? 459 THR A N   1 
ATOM   3604 C  CA  . THR A 1 459 ? -1.542  -28.852 -7.008  1.00 49.92  ? 459 THR A CA  1 
ATOM   3605 C  C   . THR A 1 459 ? -3.023  -29.125 -7.270  1.00 58.46  ? 459 THR A C   1 
ATOM   3606 O  O   . THR A 1 459 ? -3.768  -28.273 -7.759  1.00 65.66  ? 459 THR A O   1 
ATOM   3607 C  CB  . THR A 1 459 ? -1.257  -28.862 -5.508  1.00 54.81  ? 459 THR A CB  1 
ATOM   3608 O  OG1 . THR A 1 459 ? -1.969  -27.790 -4.868  1.00 54.55  ? 459 THR A OG1 1 
ATOM   3609 C  CG2 . THR A 1 459 ? 0.246   -28.731 -5.234  1.00 46.54  ? 459 THR A CG2 1 
ATOM   3610 N  N   . ALA A 1 460 ? -3.465  -30.334 -6.931  1.00 53.07  ? 460 ALA A N   1 
ATOM   3611 C  CA  . ALA A 1 460 ? -4.889  -30.625 -7.019  1.00 53.19  ? 460 ALA A CA  1 
ATOM   3612 C  C   . ALA A 1 460 ? -5.687  -29.730 -6.076  1.00 60.45  ? 460 ALA A C   1 
ATOM   3613 O  O   . ALA A 1 460 ? -6.714  -29.163 -6.469  1.00 67.20  ? 460 ALA A O   1 
ATOM   3614 C  CB  . ALA A 1 460 ? -5.145  -32.101 -6.714  1.00 50.89  ? 460 ALA A CB  1 
ATOM   3615 N  N   . GLU A 1 461 ? -5.221  -29.580 -4.827  1.00 56.20  ? 461 GLU A N   1 
ATOM   3616 C  CA  . GLU A 1 461 ? -5.952  -28.808 -3.821  1.00 54.24  ? 461 GLU A CA  1 
ATOM   3617 C  C   . GLU A 1 461 ? -5.984  -27.316 -4.126  1.00 48.32  ? 461 GLU A C   1 
ATOM   3618 O  O   . GLU A 1 461 ? -6.852  -26.608 -3.603  1.00 46.19  ? 461 GLU A O   1 
ATOM   3619 C  CB  . GLU A 1 461 ? -5.358  -29.022 -2.422  1.00 62.33  ? 461 GLU A CB  1 
ATOM   3620 C  CG  . GLU A 1 461 ? -5.002  -30.463 -2.062  1.00 73.73  ? 461 GLU A CG  1 
ATOM   3621 C  CD  . GLU A 1 461 ? -3.695  -30.934 -2.685  1.00 84.34  ? 461 GLU A CD  1 
ATOM   3622 O  OE1 . GLU A 1 461 ? -3.328  -30.423 -3.760  1.00 84.50  ? 461 GLU A OE1 1 
ATOM   3623 O  OE2 . GLU A 1 461 ? -3.041  -31.824 -2.107  1.00 89.26  1 461 GLU A OE2 1 
ATOM   3624 N  N   . GLU A 1 462 ? -5.059  -26.822 -4.946  1.00 47.10  ? 462 GLU A N   1 
ATOM   3625 C  CA  . GLU A 1 462 ? -5.092  -25.431 -5.368  1.00 45.19  ? 462 GLU A CA  1 
ATOM   3626 C  C   . GLU A 1 462 ? -6.008  -25.216 -6.560  1.00 48.96  ? 462 GLU A C   1 
ATOM   3627 O  O   . GLU A 1 462 ? -6.633  -24.150 -6.662  1.00 42.03  ? 462 GLU A O   1 
ATOM   3628 C  CB  . GLU A 1 462 ? -3.680  -24.948 -5.698  1.00 47.71  ? 462 GLU A CB  1 
ATOM   3629 C  CG  . GLU A 1 462 ? -2.786  -24.741 -4.487  1.00 47.69  ? 462 GLU A CG  1 
ATOM   3630 C  CD  . GLU A 1 462 ? -1.326  -24.660 -4.870  1.00 49.62  ? 462 GLU A CD  1 
ATOM   3631 O  OE1 . GLU A 1 462 ? -0.969  -25.269 -5.900  1.00 56.58  ? 462 GLU A OE1 1 
ATOM   3632 O  OE2 . GLU A 1 462 ? -0.540  -23.997 -4.157  1.00 45.27  1 462 GLU A OE2 1 
ATOM   3633 N  N   . GLU A 1 463 ? -6.093  -26.197 -7.471  1.00 55.65  ? 463 GLU A N   1 
ATOM   3634 C  CA  . GLU A 1 463 ? -7.161  -26.180 -8.468  1.00 50.95  ? 463 GLU A CA  1 
ATOM   3635 C  C   . GLU A 1 463 ? -8.518  -26.235 -7.780  1.00 45.50  ? 463 GLU A C   1 
ATOM   3636 O  O   . GLU A 1 463 ? -9.404  -25.423 -8.065  1.00 39.28  ? 463 GLU A O   1 
ATOM   3637 C  CB  . GLU A 1 463 ? -7.011  -27.341 -9.461  1.00 51.83  ? 463 GLU A CB  1 
ATOM   3638 C  CG  . GLU A 1 463 ? -8.033  -27.263 -10.619 1.00 60.17  ? 463 GLU A CG  1 
ATOM   3639 C  CD  . GLU A 1 463 ? -8.343  -28.599 -11.318 1.00 69.37  ? 463 GLU A CD  1 
ATOM   3640 O  OE1 . GLU A 1 463 ? -7.402  -29.315 -11.723 1.00 76.38  ? 463 GLU A OE1 1 
ATOM   3641 O  OE2 . GLU A 1 463 ? -9.544  -28.919 -11.478 1.00 72.13  1 463 GLU A OE2 1 
ATOM   3642 N  N   . ALA A 1 464 ? -8.675  -27.171 -6.838  1.00 48.52  ? 464 ALA A N   1 
ATOM   3643 C  CA  . ALA A 1 464 ? -9.878  -27.241 -6.016  1.00 35.40  ? 464 ALA A CA  1 
ATOM   3644 C  C   . ALA A 1 464 ? -10.153 -25.921 -5.297  1.00 46.05  ? 464 ALA A C   1 
ATOM   3645 O  O   . ALA A 1 464 ? -11.296 -25.448 -5.262  1.00 48.35  ? 464 ALA A O   1 
ATOM   3646 C  CB  . ALA A 1 464 ? -9.751  -28.385 -5.014  1.00 36.73  ? 464 ALA A CB  1 
ATOM   3647 N  N   . LEU A 1 465 ? -9.123  -25.306 -4.710  1.00 46.67  ? 465 LEU A N   1 
ATOM   3648 C  CA  . LEU A 1 465 ? -9.359  -24.065 -3.973  1.00 49.85  ? 465 LEU A CA  1 
ATOM   3649 C  C   . LEU A 1 465 ? -9.772  -22.938 -4.912  1.00 49.29  ? 465 LEU A C   1 
ATOM   3650 O  O   . LEU A 1 465 ? -10.618 -22.106 -4.560  1.00 42.82  ? 465 LEU A O   1 
ATOM   3651 C  CB  . LEU A 1 465 ? -8.113  -23.674 -3.169  1.00 47.09  ? 465 LEU A CB  1 
ATOM   3652 C  CG  . LEU A 1 465 ? -7.986  -22.237 -2.627  1.00 35.83  ? 465 LEU A CG  1 
ATOM   3653 C  CD1 . LEU A 1 465 ? -8.964  -21.947 -1.517  1.00 30.53  ? 465 LEU A CD1 1 
ATOM   3654 C  CD2 . LEU A 1 465 ? -6.571  -22.007 -2.146  1.00 38.44  ? 465 LEU A CD2 1 
ATOM   3655 N  N   . SER A 1 466 ? -9.197  -22.909 -6.121  1.00 50.55  ? 466 SER A N   1 
ATOM   3656 C  CA  . SER A 1 466 ? -9.522  -21.862 -7.083  1.00 42.79  ? 466 SER A CA  1 
ATOM   3657 C  C   . SER A 1 466 ? -10.999 -21.897 -7.463  1.00 38.92  ? 466 SER A C   1 
ATOM   3658 O  O   . SER A 1 466 ? -11.671 -20.857 -7.483  1.00 41.26  ? 466 SER A O   1 
ATOM   3659 C  CB  . SER A 1 466 ? -8.654  -22.019 -8.327  1.00 41.33  ? 466 SER A CB  1 
ATOM   3660 O  OG  . SER A 1 466 ? -8.685  -20.846 -9.131  1.00 37.10  ? 466 SER A OG  1 
ATOM   3661 N  N   . ARG A 1 467 ? -11.525 -23.082 -7.766  1.00 35.06  ? 467 ARG A N   1 
ATOM   3662 C  CA  . ARG A 1 467 ? -12.903 -23.158 -8.232  1.00 38.45  ? 467 ARG A CA  1 
ATOM   3663 C  C   . ARG A 1 467 ? -13.884 -22.732 -7.145  1.00 42.65  ? 467 ARG A C   1 
ATOM   3664 O  O   . ARG A 1 467 ? -14.909 -22.109 -7.450  1.00 37.52  ? 467 ARG A O   1 
ATOM   3665 C  CB  . ARG A 1 467 ? -13.205 -24.569 -8.723  1.00 34.10  ? 467 ARG A CB  1 
ATOM   3666 C  CG  . ARG A 1 467 ? -12.070 -25.196 -9.484  1.00 36.08  ? 467 ARG A CG  1 
ATOM   3667 C  CD  . ARG A 1 467 ? -12.413 -26.594 -9.950  1.00 42.86  ? 467 ARG A CD  1 
ATOM   3668 N  NE  . ARG A 1 467 ? -12.959 -26.534 -11.308 1.00 53.97  ? 467 ARG A NE  1 
ATOM   3669 C  CZ  . ARG A 1 467 ? -12.419 -27.139 -12.355 1.00 59.08  ? 467 ARG A CZ  1 
ATOM   3670 N  NH1 . ARG A 1 467 ? -11.311 -27.845 -12.181 1.00 60.96  1 467 ARG A NH1 1 
ATOM   3671 N  NH2 . ARG A 1 467 ? -12.986 -27.024 -13.551 1.00 53.76  ? 467 ARG A NH2 1 
ATOM   3672 N  N   . ARG A 1 468 ? -13.578 -23.053 -5.882  1.00 43.05  ? 468 ARG A N   1 
ATOM   3673 C  CA  . ARG A 1 468 ? -14.389 -22.585 -4.762  1.00 36.02  ? 468 ARG A CA  1 
ATOM   3674 C  C   . ARG A 1 468 ? -14.418 -21.070 -4.697  1.00 34.91  ? 468 ARG A C   1 
ATOM   3675 O  O   . ARG A 1 468 ? -15.462 -20.475 -4.398  1.00 47.19  ? 468 ARG A O   1 
ATOM   3676 C  CB  . ARG A 1 468 ? -13.848 -23.146 -3.447  1.00 44.95  ? 468 ARG A CB  1 
ATOM   3677 C  CG  . ARG A 1 468 ? -14.315 -24.537 -3.141  1.00 59.11  ? 468 ARG A CG  1 
ATOM   3678 C  CD  . ARG A 1 468 ? -13.768 -25.026 -1.822  1.00 71.16  ? 468 ARG A CD  1 
ATOM   3679 N  NE  . ARG A 1 468 ? -13.851 -24.059 -0.726  1.00 79.54  ? 468 ARG A NE  1 
ATOM   3680 C  CZ  . ARG A 1 468 ? -12.833 -23.731 0.070   1.00 75.64  ? 468 ARG A CZ  1 
ATOM   3681 N  NH1 . ARG A 1 468 ? -11.643 -24.293 -0.098  1.00 69.29  1 468 ARG A NH1 1 
ATOM   3682 N  NH2 . ARG A 1 468 ? -13.012 -22.856 1.053   1.00 71.02  ? 468 ARG A NH2 1 
ATOM   3683 N  N   . ILE A 1 469 ? -13.277 -20.428 -4.947  1.00 32.23  ? 469 ILE A N   1 
ATOM   3684 C  CA  . ILE A 1 469 ? -13.207 -18.974 -4.865  1.00 39.25  ? 469 ILE A CA  1 
ATOM   3685 C  C   . ILE A 1 469 ? -13.931 -18.333 -6.045  1.00 41.02  ? 469 ILE A C   1 
ATOM   3686 O  O   . ILE A 1 469 ? -14.722 -17.395 -5.871  1.00 32.42  ? 469 ILE A O   1 
ATOM   3687 C  CB  . ILE A 1 469 ? -11.743 -18.504 -4.782  1.00 42.74  ? 469 ILE A CB  1 
ATOM   3688 C  CG1 . ILE A 1 469 ? -11.099 -18.947 -3.468  1.00 42.07  ? 469 ILE A CG1 1 
ATOM   3689 C  CG2 . ILE A 1 469 ? -11.670 -16.997 -4.936  1.00 44.02  ? 469 ILE A CG2 1 
ATOM   3690 C  CD1 . ILE A 1 469 ? -9.665  -18.464 -3.285  1.00 29.43  ? 469 ILE A CD1 1 
ATOM   3691 N  N   . MET A 1 470 ? -13.657 -18.802 -7.270  1.00 43.14  ? 470 MET A N   1 
ATOM   3692 C  CA  . MET A 1 470 ? -14.381 -18.245 -8.409  1.00 44.64  ? 470 MET A CA  1 
ATOM   3693 C  C   . MET A 1 470 ? -15.873 -18.433 -8.261  1.00 36.50  ? 470 MET A C   1 
ATOM   3694 O  O   . MET A 1 470 ? -16.641 -17.529 -8.608  1.00 35.24  ? 470 MET A O   1 
ATOM   3695 C  CB  . MET A 1 470 ? -13.933 -18.825 -9.746  1.00 48.87  ? 470 MET A CB  1 
ATOM   3696 C  CG  . MET A 1 470 ? -12.474 -19.074 -9.924  1.00 44.73  ? 470 MET A CG  1 
ATOM   3697 S  SD  . MET A 1 470 ? -12.118 -19.296 -11.685 1.00 42.62  ? 470 MET A SD  1 
ATOM   3698 C  CE  . MET A 1 470 ? -12.279 -21.084 -11.721 1.00 31.08  ? 470 MET A CE  1 
ATOM   3699 N  N   . HIS A 1 471 ? -16.314 -19.581 -7.735  1.00 31.27  ? 471 HIS A N   1 
ATOM   3700 C  CA  . HIS A 1 471 ? -17.746 -19.732 -7.512  1.00 45.63  ? 471 HIS A CA  1 
ATOM   3701 C  C   . HIS A 1 471 ? -18.237 -18.786 -6.421  1.00 45.99  ? 471 HIS A C   1 
ATOM   3702 O  O   . HIS A 1 471 ? -19.268 -18.127 -6.594  1.00 50.68  ? 471 HIS A O   1 
ATOM   3703 C  CB  . HIS A 1 471 ? -18.095 -21.172 -7.182  1.00 49.68  ? 471 HIS A CB  1 
ATOM   3704 C  CG  . HIS A 1 471 ? -19.533 -21.490 -7.447  1.00 59.32  ? 471 HIS A CG  1 
ATOM   3705 N  ND1 . HIS A 1 471 ? -20.106 -21.354 -8.695  1.00 61.77  ? 471 HIS A ND1 1 
ATOM   3706 C  CD2 . HIS A 1 471 ? -20.525 -21.902 -6.624  1.00 63.50  ? 471 HIS A CD2 1 
ATOM   3707 C  CE1 . HIS A 1 471 ? -21.385 -21.679 -8.630  1.00 61.78  ? 471 HIS A CE1 1 
ATOM   3708 N  NE2 . HIS A 1 471 ? -21.665 -22.018 -7.385  1.00 61.82  ? 471 HIS A NE2 1 
ATOM   3709 N  N   . TYR A 1 472 ? -17.509 -18.696 -5.297  1.00 42.18  ? 472 TYR A N   1 
ATOM   3710 C  CA  . TYR A 1 472 ? -17.807 -17.677 -4.288  1.00 45.74  ? 472 TYR A CA  1 
ATOM   3711 C  C   . TYR A 1 472 ? -17.930 -16.292 -4.923  1.00 42.79  ? 472 TYR A C   1 
ATOM   3712 O  O   . TYR A 1 472 ? -18.895 -15.559 -4.671  1.00 43.56  ? 472 TYR A O   1 
ATOM   3713 C  CB  . TYR A 1 472 ? -16.719 -17.651 -3.204  1.00 41.97  ? 472 TYR A CB  1 
ATOM   3714 C  CG  . TYR A 1 472 ? -16.743 -18.774 -2.187  1.00 41.25  ? 472 TYR A CG  1 
ATOM   3715 C  CD1 . TYR A 1 472 ? -17.899 -19.480 -1.914  1.00 37.54  ? 472 TYR A CD1 1 
ATOM   3716 C  CD2 . TYR A 1 472 ? -15.586 -19.121 -1.495  1.00 45.92  ? 472 TYR A CD2 1 
ATOM   3717 C  CE1 . TYR A 1 472 ? -17.899 -20.506 -0.971  1.00 46.40  ? 472 TYR A CE1 1 
ATOM   3718 C  CE2 . TYR A 1 472 ? -15.575 -20.151 -0.565  1.00 42.97  ? 472 TYR A CE2 1 
ATOM   3719 C  CZ  . TYR A 1 472 ? -16.731 -20.834 -0.306  1.00 44.84  ? 472 TYR A CZ  1 
ATOM   3720 O  OH  . TYR A 1 472 ? -16.717 -21.849 0.615   1.00 52.57  ? 472 TYR A OH  1 
ATOM   3721 N  N   . TRP A 1 473 ? -16.945 -15.911 -5.740  1.00 29.43  ? 473 TRP A N   1 
ATOM   3722 C  CA  . TRP A 1 473 ? -16.965 -14.599 -6.376  1.00 33.77  ? 473 TRP A CA  1 
ATOM   3723 C  C   . TRP A 1 473 ? -18.094 -14.492 -7.400  1.00 37.11  ? 473 TRP A C   1 
ATOM   3724 O  O   . TRP A 1 473 ? -18.742 -13.443 -7.523  1.00 31.96  ? 473 TRP A O   1 
ATOM   3725 C  CB  . TRP A 1 473 ? -15.627 -14.348 -7.062  1.00 29.21  ? 473 TRP A CB  1 
ATOM   3726 C  CG  . TRP A 1 473 ? -14.564 -13.642 -6.297  1.00 42.95  ? 473 TRP A CG  1 
ATOM   3727 C  CD1 . TRP A 1 473 ? -13.789 -12.601 -6.748  1.00 54.46  ? 473 TRP A CD1 1 
ATOM   3728 C  CD2 . TRP A 1 473 ? -14.094 -13.939 -4.979  1.00 41.14  ? 473 TRP A CD2 1 
ATOM   3729 N  NE1 . TRP A 1 473 ? -12.873 -12.228 -5.786  1.00 41.48  ? 473 TRP A NE1 1 
ATOM   3730 C  CE2 . TRP A 1 473 ? -13.039 -13.035 -4.693  1.00 33.40  ? 473 TRP A CE2 1 
ATOM   3731 C  CE3 . TRP A 1 473 ? -14.463 -14.864 -4.008  1.00 42.07  ? 473 TRP A CE3 1 
ATOM   3732 C  CZ2 . TRP A 1 473 ? -12.370 -13.033 -3.478  1.00 29.23  ? 473 TRP A CZ2 1 
ATOM   3733 C  CZ3 . TRP A 1 473 ? -13.786 -14.862 -2.805  1.00 46.30  ? 473 TRP A CZ3 1 
ATOM   3734 C  CH2 . TRP A 1 473 ? -12.753 -13.950 -2.549  1.00 36.69  ? 473 TRP A CH2 1 
ATOM   3735 N  N   . ALA A 1 474 ? -18.314 -15.553 -8.179  1.00 32.29  ? 474 ALA A N   1 
ATOM   3736 C  CA  . ALA A 1 474 ? -19.327 -15.493 -9.219  1.00 40.63  ? 474 ALA A CA  1 
ATOM   3737 C  C   . ALA A 1 474 ? -20.729 -15.531 -8.617  1.00 43.76  ? 474 ALA A C   1 
ATOM   3738 O  O   . ALA A 1 474 ? -21.598 -14.741 -8.998  1.00 41.92  ? 474 ALA A O   1 
ATOM   3739 C  CB  . ALA A 1 474 ? -19.126 -16.640 -10.212 1.00 50.66  ? 474 ALA A CB  1 
ATOM   3740 N  N   . THR A 1 475 ? -20.969 -16.449 -7.675  1.00 40.10  ? 475 THR A N   1 
ATOM   3741 C  CA  . THR A 1 475 ? -22.283 -16.532 -7.042  1.00 37.77  ? 475 THR A CA  1 
ATOM   3742 C  C   . THR A 1 475 ? -22.595 -15.255 -6.275  1.00 42.24  ? 475 THR A C   1 
ATOM   3743 O  O   . THR A 1 475 ? -23.752 -14.794 -6.258  1.00 33.60  ? 475 THR A O   1 
ATOM   3744 C  CB  . THR A 1 475 ? -22.345 -17.749 -6.120  1.00 37.28  ? 475 THR A CB  1 
ATOM   3745 O  OG1 . THR A 1 475 ? -22.088 -18.934 -6.884  1.00 41.14  ? 475 THR A OG1 1 
ATOM   3746 C  CG2 . THR A 1 475 ? -23.710 -17.875 -5.487  1.00 35.55  ? 475 THR A CG2 1 
ATOM   3747 N  N   . PHE A 1 476 ? -21.576 -14.664 -5.636  1.00 36.52  ? 476 PHE A N   1 
ATOM   3748 C  CA  . PHE A 1 476 ? -21.776 -13.353 -5.028  1.00 43.52  ? 476 PHE A CA  1 
ATOM   3749 C  C   . PHE A 1 476 ? -22.192 -12.348 -6.088  1.00 45.11  ? 476 PHE A C   1 
ATOM   3750 O  O   . PHE A 1 476 ? -23.105 -11.544 -5.871  1.00 48.98  ? 476 PHE A O   1 
ATOM   3751 C  CB  . PHE A 1 476 ? -20.518 -12.862 -4.289  1.00 38.53  ? 476 PHE A CB  1 
ATOM   3752 C  CG  . PHE A 1 476 ? -20.665 -11.460 -3.737  1.00 32.15  ? 476 PHE A CG  1 
ATOM   3753 C  CD1 . PHE A 1 476 ? -21.419 -11.225 -2.586  1.00 31.31  ? 476 PHE A CD1 1 
ATOM   3754 C  CD2 . PHE A 1 476 ? -20.096 -10.375 -4.389  1.00 29.67  ? 476 PHE A CD2 1 
ATOM   3755 C  CE1 . PHE A 1 476 ? -21.593 -9.922  -2.087  1.00 31.35  ? 476 PHE A CE1 1 
ATOM   3756 C  CE2 . PHE A 1 476 ? -20.260 -9.073  -3.899  1.00 34.61  ? 476 PHE A CE2 1 
ATOM   3757 C  CZ  . PHE A 1 476 ? -21.012 -8.846  -2.744  1.00 30.55  ? 476 PHE A CZ  1 
ATOM   3758 N  N   . ALA A 1 477 ? -21.561 -12.411 -7.259  1.00 48.27  ? 477 ALA A N   1 
ATOM   3759 C  CA  . ALA A 1 477 ? -21.856 -11.442 -8.306  1.00 48.91  ? 477 ALA A CA  1 
ATOM   3760 C  C   . ALA A 1 477 ? -23.257 -11.639 -8.884  1.00 53.56  ? 477 ALA A C   1 
ATOM   3761 O  O   . ALA A 1 477 ? -23.892 -10.660 -9.288  1.00 62.94  ? 477 ALA A O   1 
ATOM   3762 C  CB  . ALA A 1 477 ? -20.784 -11.519 -9.399  1.00 40.55  ? 477 ALA A CB  1 
ATOM   3763 N  N   . LYS A 1 478 ? -23.758 -12.883 -8.922  1.00 52.79  ? 478 LYS A N   1 
ATOM   3764 C  CA  . LYS A 1 478 ? -25.091 -13.155 -9.457  1.00 47.94  ? 478 LYS A CA  1 
ATOM   3765 C  C   . LYS A 1 478 ? -26.176 -12.925 -8.413  1.00 50.44  ? 478 LYS A C   1 
ATOM   3766 O  O   . LYS A 1 478 ? -27.239 -12.384 -8.729  1.00 50.89  ? 478 LYS A O   1 
ATOM   3767 C  CB  . LYS A 1 478 ? -25.185 -14.596 -9.975  1.00 46.39  ? 478 LYS A CB  1 
ATOM   3768 C  CG  . LYS A 1 478 ? -24.052 -14.994 -10.919 1.00 64.60  ? 478 LYS A CG  1 
ATOM   3769 C  CD  . LYS A 1 478 ? -23.977 -16.500 -11.166 1.00 68.14  ? 478 LYS A CD  1 
ATOM   3770 C  CE  . LYS A 1 478 ? -22.594 -16.908 -11.678 1.00 59.60  ? 478 LYS A CE  1 
ATOM   3771 N  NZ  . LYS A 1 478 ? -22.577 -18.330 -12.130 1.00 57.83  1 478 LYS A NZ  1 
ATOM   3772 N  N   . THR A 1 479 ? -25.934 -13.330 -7.167  1.00 47.94  ? 479 THR A N   1 
ATOM   3773 C  CA  . THR A 1 479 ? -26.991 -13.372 -6.170  1.00 42.84  ? 479 THR A CA  1 
ATOM   3774 C  C   . THR A 1 479 ? -26.800 -12.425 -4.994  1.00 43.19  ? 479 THR A C   1 
ATOM   3775 O  O   . THR A 1 479 ? -27.713 -12.310 -4.176  1.00 41.24  ? 479 THR A O   1 
ATOM   3776 C  CB  . THR A 1 479 ? -27.157 -14.799 -5.619  1.00 40.42  ? 479 THR A CB  1 
ATOM   3777 O  OG1 . THR A 1 479 ? -26.077 -15.096 -4.725  1.00 38.53  ? 479 THR A OG1 1 
ATOM   3778 C  CG2 . THR A 1 479 ? -27.194 -15.829 -6.737  1.00 39.05  ? 479 THR A CG2 1 
ATOM   3779 N  N   . GLY A 1 480 ? -25.663 -11.749 -4.871  1.00 47.27  ? 480 GLY A N   1 
ATOM   3780 C  CA  . GLY A 1 480 ? -25.403 -10.962 -3.678  1.00 46.04  ? 480 GLY A CA  1 
ATOM   3781 C  C   . GLY A 1 480 ? -24.841 -11.737 -2.500  1.00 44.75  ? 480 GLY A C   1 
ATOM   3782 O  O   . GLY A 1 480 ? -24.601 -11.135 -1.447  1.00 38.69  ? 480 GLY A O   1 
ATOM   3783 N  N   . ASN A 1 481 ? -24.597 -13.049 -2.652  1.00 47.47  ? 481 ASN A N   1 
ATOM   3784 C  CA  . ASN A 1 481 ? -24.188 -13.949 -1.578  1.00 46.81  ? 481 ASN A CA  1 
ATOM   3785 C  C   . ASN A 1 481 ? -23.440 -15.140 -2.182  1.00 52.05  ? 481 ASN A C   1 
ATOM   3786 O  O   . ASN A 1 481 ? -23.916 -15.732 -3.153  1.00 62.65  ? 481 ASN A O   1 
ATOM   3787 C  CB  . ASN A 1 481 ? -25.434 -14.344 -0.777  1.00 41.77  ? 481 ASN A CB  1 
ATOM   3788 C  CG  . ASN A 1 481 ? -25.274 -15.625 0.050   1.00 46.07  ? 481 ASN A CG  1 
ATOM   3789 O  OD1 . ASN A 1 481 ? -24.196 -16.202 0.175   1.00 51.83  ? 481 ASN A OD1 1 
ATOM   3790 N  ND2 . ASN A 1 481 ? -26.378 -16.045 0.664   1.00 43.61  ? 481 ASN A ND2 1 
ATOM   3791 N  N   . PRO A 1 482 ? -22.276 -15.522 -1.644  1.00 48.74  ? 482 PRO A N   1 
ATOM   3792 C  CA  . PRO A 1 482 ? -21.440 -16.531 -2.309  1.00 48.47  ? 482 PRO A CA  1 
ATOM   3793 C  C   . PRO A 1 482 ? -21.891 -17.979 -2.162  1.00 49.08  ? 482 PRO A C   1 
ATOM   3794 O  O   . PRO A 1 482 ? -21.201 -18.861 -2.689  1.00 57.51  ? 482 PRO A O   1 
ATOM   3795 C  CB  . PRO A 1 482 ? -20.075 -16.323 -1.637  1.00 45.17  ? 482 PRO A CB  1 
ATOM   3796 C  CG  . PRO A 1 482 ? -20.427 -15.787 -0.278  1.00 42.72  ? 482 PRO A CG  1 
ATOM   3797 C  CD  . PRO A 1 482 ? -21.568 -14.878 -0.516  1.00 38.49  ? 482 PRO A CD  1 
ATOM   3798 N  N   . ASN A 1 483 ? -23.004 -18.269 -1.494  1.00 36.35  ? 483 ASN A N   1 
ATOM   3799 C  CA  . ASN A 1 483 ? -23.406 -19.642 -1.217  1.00 47.25  ? 483 ASN A CA  1 
ATOM   3800 C  C   . ASN A 1 483 ? -24.617 -20.046 -2.053  1.00 60.09  ? 483 ASN A C   1 
ATOM   3801 O  O   . ASN A 1 483 ? -25.392 -19.201 -2.507  1.00 71.60  ? 483 ASN A O   1 
ATOM   3802 C  CB  . ASN A 1 483 ? -23.734 -19.838 0.278   1.00 52.91  ? 483 ASN A CB  1 
ATOM   3803 C  CG  . ASN A 1 483 ? -22.692 -19.235 1.219   1.00 44.96  ? 483 ASN A CG  1 
ATOM   3804 O  OD1 . ASN A 1 483 ? -21.749 -19.911 1.601   1.00 46.77  ? 483 ASN A OD1 1 
ATOM   3805 N  ND2 . ASN A 1 483 ? -22.890 -17.992 1.631   1.00 37.58  ? 483 ASN A ND2 1 
ATOM   3806 N  N   . GLU A 1 484 ? -24.784 -21.358 -2.240  1.00 65.43  ? 484 GLU A N   1 
ATOM   3807 C  CA  . GLU A 1 484 ? -25.996 -21.929 -2.837  1.00 78.34  ? 484 GLU A CA  1 
ATOM   3808 C  C   . GLU A 1 484 ? -26.630 -22.903 -1.852  1.00 88.13  ? 484 GLU A C   1 
ATOM   3809 O  O   . GLU A 1 484 ? -25.989 -23.904 -1.480  1.00 99.62  ? 484 GLU A O   1 
ATOM   3810 C  CB  . GLU A 1 484 ? -25.689 -22.656 -4.151  1.00 83.86  ? 484 GLU A CB  1 
ATOM   3811 C  CG  . GLU A 1 484 ? -25.261 -21.773 -5.303  1.00 90.58  ? 484 GLU A CG  1 
ATOM   3812 C  CD  . GLU A 1 484 ? -24.591 -22.566 -6.417  1.00 93.60  ? 484 GLU A CD  1 
ATOM   3813 O  OE1 . GLU A 1 484 ? -24.296 -23.761 -6.195  1.00 91.48  ? 484 GLU A OE1 1 
ATOM   3814 O  OE2 . GLU A 1 484 ? -24.349 -21.994 -7.506  1.00 94.69  1 484 GLU A OE2 1 
ATOM   3815 N  N   . PRO A 1 485 ? -27.869 -22.674 -1.397  1.00 80.31  ? 485 PRO A N   1 
ATOM   3816 C  CA  . PRO A 1 485 ? -28.586 -23.620 -0.520  1.00 76.92  ? 485 PRO A CA  1 
ATOM   3817 C  C   . PRO A 1 485 ? -28.843 -25.001 -1.151  1.00 67.96  ? 485 PRO A C   1 
ATOM   3818 O  O   . PRO A 1 485 ? -28.169 -25.986 -0.827  1.00 49.32  ? 485 PRO A O   1 
ATOM   3819 C  CB  . PRO A 1 485 ? -29.910 -22.897 -0.249  1.00 75.70  ? 485 PRO A CB  1 
ATOM   3820 C  CG  . PRO A 1 485 ? -29.571 -21.433 -0.395  1.00 71.77  ? 485 PRO A CG  1 
ATOM   3821 C  CD  . PRO A 1 485 ? -28.549 -21.371 -1.498  1.00 73.07  ? 485 PRO A CD  1 
ATOM   3822 N  N   . SER A 1 490 ? -21.424 -26.338 2.177   1.00 44.25  ? 490 SER A N   1 
ATOM   3823 C  CA  . SER A 1 490 ? -21.076 -25.695 3.457   1.00 65.57  ? 490 SER A CA  1 
ATOM   3824 C  C   . SER A 1 490 ? -20.982 -24.175 3.304   1.00 72.20  ? 490 SER A C   1 
ATOM   3825 O  O   . SER A 1 490 ? -20.380 -23.681 2.346   1.00 77.54  ? 490 SER A O   1 
ATOM   3826 C  CB  . SER A 1 490 ? -19.758 -26.238 4.016   1.00 68.44  ? 490 SER A CB  1 
ATOM   3827 O  OG  . SER A 1 490 ? -18.650 -25.745 3.287   1.00 75.68  ? 490 SER A OG  1 
ATOM   3828 N  N   . LYS A 1 491 ? -21.538 -23.436 4.266   1.00 69.80  ? 491 LYS A N   1 
ATOM   3829 C  CA  . LYS A 1 491 ? -22.044 -22.086 4.020   1.00 64.91  ? 491 LYS A CA  1 
ATOM   3830 C  C   . LYS A 1 491 ? -21.195 -21.007 4.706   1.00 59.62  ? 491 LYS A C   1 
ATOM   3831 O  O   . LYS A 1 491 ? -20.876 -21.111 5.893   1.00 41.03  ? 491 LYS A O   1 
ATOM   3832 C  CB  . LYS A 1 491 ? -23.532 -22.004 4.433   1.00 51.97  ? 491 LYS A CB  1 
ATOM   3833 C  CG  . LYS A 1 491 ? -24.542 -22.535 3.354   1.00 58.83  ? 491 LYS A CG  1 
ATOM   3834 C  CD  . LYS A 1 491 ? -24.503 -24.088 3.081   1.00 69.86  ? 491 LYS A CD  1 
ATOM   3835 C  CE  . LYS A 1 491 ? -25.486 -24.562 1.922   1.00 70.41  ? 491 LYS A CE  1 
ATOM   3836 N  NZ  . LYS A 1 491 ? -25.347 -25.992 1.370   1.00 65.36  1 491 LYS A NZ  1 
ATOM   3837 N  N   . TRP A 1 492 ? -20.853 -19.959 3.940   1.00 56.72  ? 492 TRP A N   1 
ATOM   3838 C  CA  . TRP A 1 492 ? -20.006 -18.849 4.398   1.00 51.55  ? 492 TRP A CA  1 
ATOM   3839 C  C   . TRP A 1 492 ? -20.845 -17.828 5.156   1.00 54.00  ? 492 TRP A C   1 
ATOM   3840 O  O   . TRP A 1 492 ? -21.723 -17.199 4.558   1.00 57.32  ? 492 TRP A O   1 
ATOM   3841 C  CB  . TRP A 1 492 ? -19.326 -18.198 3.183   1.00 54.88  ? 492 TRP A CB  1 
ATOM   3842 C  CG  . TRP A 1 492 ? -18.482 -16.913 3.368   1.00 49.04  ? 492 TRP A CG  1 
ATOM   3843 C  CD1 . TRP A 1 492 ? -18.428 -16.091 4.461   1.00 47.31  ? 492 TRP A CD1 1 
ATOM   3844 C  CD2 . TRP A 1 492 ? -17.598 -16.325 2.389   1.00 42.02  ? 492 TRP A CD2 1 
ATOM   3845 N  NE1 . TRP A 1 492 ? -17.578 -15.037 4.223   1.00 39.41  ? 492 TRP A NE1 1 
ATOM   3846 C  CE2 . TRP A 1 492 ? -17.050 -15.159 2.964   1.00 46.26  ? 492 TRP A CE2 1 
ATOM   3847 C  CE3 . TRP A 1 492 ? -17.216 -16.680 1.082   1.00 35.77  ? 492 TRP A CE3 1 
ATOM   3848 C  CZ2 . TRP A 1 492 ? -16.129 -14.344 2.281   1.00 48.41  ? 492 TRP A CZ2 1 
ATOM   3849 C  CZ3 . TRP A 1 492 ? -16.311 -15.873 0.402   1.00 30.81  ? 492 TRP A CZ3 1 
ATOM   3850 C  CH2 . TRP A 1 492 ? -15.773 -14.717 1.004   1.00 38.77  ? 492 TRP A CH2 1 
ATOM   3851 N  N   . PRO A 1 493 ? -20.598 -17.609 6.442   1.00 51.29  ? 493 PRO A N   1 
ATOM   3852 C  CA  . PRO A 1 493 ? -21.473 -16.726 7.217   1.00 49.21  ? 493 PRO A CA  1 
ATOM   3853 C  C   . PRO A 1 493 ? -21.304 -15.257 6.869   1.00 48.97  ? 493 PRO A C   1 
ATOM   3854 O  O   . PRO A 1 493 ? -20.207 -14.773 6.591   1.00 50.89  ? 493 PRO A O   1 
ATOM   3855 C  CB  . PRO A 1 493 ? -21.047 -16.991 8.664   1.00 43.82  ? 493 PRO A CB  1 
ATOM   3856 C  CG  . PRO A 1 493 ? -19.637 -17.399 8.540   1.00 48.63  ? 493 PRO A CG  1 
ATOM   3857 C  CD  . PRO A 1 493 ? -19.574 -18.232 7.287   1.00 49.77  ? 493 PRO A CD  1 
ATOM   3858 N  N   . LEU A 1 494 ? -22.427 -14.553 6.916   1.00 55.53  ? 494 LEU A N   1 
ATOM   3859 C  CA  . LEU A 1 494 ? -22.478 -13.103 6.821   1.00 51.35  ? 494 LEU A CA  1 
ATOM   3860 C  C   . LEU A 1 494 ? -21.759 -12.450 8.006   1.00 56.19  ? 494 LEU A C   1 
ATOM   3861 O  O   . LEU A 1 494 ? -21.747 -12.975 9.125   1.00 59.12  ? 494 LEU A O   1 
ATOM   3862 C  CB  . LEU A 1 494 ? -23.952 -12.678 6.767   1.00 39.63  ? 494 LEU A CB  1 
ATOM   3863 C  CG  . LEU A 1 494 ? -24.548 -11.382 6.216   1.00 39.32  ? 494 LEU A CG  1 
ATOM   3864 C  CD1 . LEU A 1 494 ? -24.082 -10.997 4.802   1.00 37.63  ? 494 LEU A CD1 1 
ATOM   3865 C  CD2 . LEU A 1 494 ? -26.062 -11.580 6.230   1.00 52.48  ? 494 LEU A CD2 1 
ATOM   3866 N  N   . PHE A 1 495 ? -21.156 -11.287 7.750   1.00 48.04  ? 495 PHE A N   1 
ATOM   3867 C  CA  . PHE A 1 495 ? -20.449 -10.514 8.768   1.00 50.92  ? 495 PHE A CA  1 
ATOM   3868 C  C   . PHE A 1 495 ? -21.396 -9.448  9.321   1.00 56.05  ? 495 PHE A C   1 
ATOM   3869 O  O   . PHE A 1 495 ? -21.807 -8.538  8.592   1.00 66.30  ? 495 PHE A O   1 
ATOM   3870 C  CB  . PHE A 1 495 ? -19.196 -9.889  8.151   1.00 49.76  ? 495 PHE A CB  1 
ATOM   3871 C  CG  . PHE A 1 495 ? -18.536 -8.811  8.983   1.00 51.19  ? 495 PHE A CG  1 
ATOM   3872 C  CD1 . PHE A 1 495 ? -19.039 -7.521  8.999   1.00 46.33  ? 495 PHE A CD1 1 
ATOM   3873 C  CD2 . PHE A 1 495 ? -17.357 -9.070  9.676   1.00 46.84  ? 495 PHE A CD2 1 
ATOM   3874 C  CE1 . PHE A 1 495 ? -18.429 -6.537  9.716   1.00 39.18  ? 495 PHE A CE1 1 
ATOM   3875 C  CE2 . PHE A 1 495 ? -16.736 -8.071  10.394  1.00 43.61  ? 495 PHE A CE2 1 
ATOM   3876 C  CZ  . PHE A 1 495 ? -17.276 -6.803  10.408  1.00 41.40  ? 495 PHE A CZ  1 
ATOM   3877 N  N   . THR A 1 496 ? -21.730 -9.548  10.605  1.00 55.48  ? 496 THR A N   1 
ATOM   3878 C  CA  . THR A 1 496 ? -22.705 -8.662  11.229  1.00 55.64  ? 496 THR A CA  1 
ATOM   3879 C  C   . THR A 1 496 ? -22.009 -7.682  12.157  1.00 55.86  ? 496 THR A C   1 
ATOM   3880 O  O   . THR A 1 496 ? -20.961 -7.989  12.725  1.00 42.53  ? 496 THR A O   1 
ATOM   3881 C  CB  . THR A 1 496 ? -23.736 -9.439  12.046  1.00 54.61  ? 496 THR A CB  1 
ATOM   3882 O  OG1 . THR A 1 496 ? -23.061 -10.397 12.873  1.00 53.35  ? 496 THR A OG1 1 
ATOM   3883 C  CG2 . THR A 1 496 ? -24.708 -10.153 11.120  1.00 44.15  ? 496 THR A CG2 1 
ATOM   3884 N  N   . THR A 1 497 ? -22.637 -6.514  12.339  1.00 60.60  ? 497 THR A N   1 
ATOM   3885 C  CA  . THR A 1 497 ? -22.072 -5.461  13.185  1.00 68.50  ? 497 THR A CA  1 
ATOM   3886 C  C   . THR A 1 497 ? -21.708 -5.967  14.582  1.00 69.09  ? 497 THR A C   1 
ATOM   3887 O  O   . THR A 1 497 ? -20.737 -5.489  15.186  1.00 74.94  ? 497 THR A O   1 
ATOM   3888 C  CB  . THR A 1 497 ? -23.054 -4.272  13.260  1.00 76.38  ? 497 THR A CB  1 
ATOM   3889 O  OG1 . THR A 1 497 ? -22.910 -3.448  12.119  1.00 81.33  ? 497 THR A OG1 1 
ATOM   3890 C  CG2 . THR A 1 497 ? -22.842 -3.426  14.487  1.00 69.36  ? 497 THR A CG2 1 
ATOM   3891 N  N   . LYS A 1 498 ? -22.423 -6.968  15.091  1.00 59.39  ? 498 LYS A N   1 
ATOM   3892 C  CA  . LYS A 1 498 ? -22.199 -7.368  16.470  1.00 63.97  ? 498 LYS A CA  1 
ATOM   3893 C  C   . LYS A 1 498 ? -21.375 -8.638  16.642  1.00 61.37  ? 498 LYS A C   1 
ATOM   3894 O  O   . LYS A 1 498 ? -20.921 -8.896  17.763  1.00 69.22  ? 498 LYS A O   1 
ATOM   3895 C  CB  . LYS A 1 498 ? -23.533 -7.551  17.208  1.00 70.99  ? 498 LYS A CB  1 
ATOM   3896 C  CG  . LYS A 1 498 ? -23.961 -8.998  17.388  1.00 70.64  ? 498 LYS A CG  1 
ATOM   3897 C  CD  . LYS A 1 498 ? -24.619 -9.221  18.749  1.00 71.75  ? 498 LYS A CD  1 
ATOM   3898 C  CE  . LYS A 1 498 ? -25.075 -10.678 18.943  1.00 75.28  ? 498 LYS A CE  1 
ATOM   3899 N  NZ  . LYS A 1 498 ? -25.803 -10.934 20.233  1.00 76.84  1 498 LYS A NZ  1 
ATOM   3900 N  N   . GLU A 1 499 ? -21.166 -9.446  15.596  1.00 57.09  ? 499 GLU A N   1 
ATOM   3901 C  CA  . GLU A 1 499 ? -20.399 -10.679 15.773  1.00 55.86  ? 499 GLU A CA  1 
ATOM   3902 C  C   . GLU A 1 499 ? -19.158 -10.809 14.896  1.00 44.04  ? 499 GLU A C   1 
ATOM   3903 O  O   . GLU A 1 499 ? -18.260 -11.583 15.248  1.00 43.94  ? 499 GLU A O   1 
ATOM   3904 C  CB  . GLU A 1 499 ? -21.294 -11.910 15.577  1.00 51.83  ? 499 GLU A CB  1 
ATOM   3905 C  CG  . GLU A 1 499 ? -22.280 -12.033 16.707  1.00 72.08  ? 499 GLU A CG  1 
ATOM   3906 C  CD  . GLU A 1 499 ? -22.929 -13.389 16.791  1.00 87.80  ? 499 GLU A CD  1 
ATOM   3907 O  OE1 . GLU A 1 499 ? -24.095 -13.457 17.239  1.00 90.84  ? 499 GLU A OE1 1 
ATOM   3908 O  OE2 . GLU A 1 499 ? -22.265 -14.382 16.421  1.00 92.97  1 499 GLU A OE2 1 
ATOM   3909 N  N   . GLN A 1 500 ? -19.081 -10.085 13.783  1.00 43.67  ? 500 GLN A N   1 
ATOM   3910 C  CA  . GLN A 1 500 ? -17.813 -9.786  13.110  1.00 40.67  ? 500 GLN A CA  1 
ATOM   3911 C  C   . GLN A 1 500 ? -17.124 -11.037 12.562  1.00 42.46  ? 500 GLN A C   1 
ATOM   3912 O  O   . GLN A 1 500 ? -15.895 -11.115 12.507  1.00 48.91  ? 500 GLN A O   1 
ATOM   3913 C  CB  . GLN A 1 500 ? -16.883 -9.027  14.049  1.00 47.68  ? 500 GLN A CB  1 
ATOM   3914 C  CG  . GLN A 1 500 ? -17.528 -7.868  14.737  1.00 64.44  ? 500 GLN A CG  1 
ATOM   3915 C  CD  . GLN A 1 500 ? -16.655 -6.635  14.723  1.00 83.96  ? 500 GLN A CD  1 
ATOM   3916 O  OE1 . GLN A 1 500 ? -15.427 -6.735  14.616  1.00 85.97  ? 500 GLN A OE1 1 
ATOM   3917 N  NE2 . GLN A 1 500 ? -17.281 -5.458  14.846  1.00 94.30  ? 500 GLN A NE2 1 
ATOM   3918 N  N   . LYS A 1 501 ? -17.915 -12.017 12.136  1.00 39.93  ? 501 LYS A N   1 
ATOM   3919 C  CA  . LYS A 1 501 ? -17.361 -13.269 11.646  1.00 47.17  ? 501 LYS A CA  1 
ATOM   3920 C  C   . LYS A 1 501 ? -16.797 -13.122 10.230  1.00 45.10  ? 501 LYS A C   1 
ATOM   3921 O  O   . LYS A 1 501 ? -17.235 -12.276 9.440   1.00 48.55  ? 501 LYS A O   1 
ATOM   3922 C  CB  . LYS A 1 501 ? -18.420 -14.375 11.689  1.00 48.55  ? 501 LYS A CB  1 
ATOM   3923 C  CG  . LYS A 1 501 ? -19.424 -14.231 12.826  1.00 53.47  ? 501 LYS A CG  1 
ATOM   3924 C  CD  . LYS A 1 501 ? -20.629 -15.167 12.680  1.00 54.11  ? 501 LYS A CD  1 
ATOM   3925 C  CE  . LYS A 1 501 ? -20.350 -16.537 13.314  1.00 59.16  ? 501 LYS A CE  1 
ATOM   3926 N  NZ  . LYS A 1 501 ? -21.263 -17.631 12.849  1.00 52.48  1 501 LYS A NZ  1 
ATOM   3927 N  N   . PHE A 1 502 ? -15.795 -13.954 9.933   1.00 41.33  ? 502 PHE A N   1 
ATOM   3928 C  CA  . PHE A 1 502 ? -15.160 -14.041 8.625   1.00 35.03  ? 502 PHE A CA  1 
ATOM   3929 C  C   . PHE A 1 502 ? -14.692 -15.480 8.427   1.00 42.89  ? 502 PHE A C   1 
ATOM   3930 O  O   . PHE A 1 502 ? -14.913 -16.347 9.279   1.00 44.88  ? 502 PHE A O   1 
ATOM   3931 C  CB  . PHE A 1 502 ? -14.012 -13.032 8.490   1.00 33.95  ? 502 PHE A CB  1 
ATOM   3932 C  CG  . PHE A 1 502 ? -12.853 -13.292 9.413   1.00 42.28  ? 502 PHE A CG  1 
ATOM   3933 C  CD1 . PHE A 1 502 ? -11.790 -14.078 9.012   1.00 40.97  ? 502 PHE A CD1 1 
ATOM   3934 C  CD2 . PHE A 1 502 ? -12.821 -12.739 10.679  1.00 39.41  ? 502 PHE A CD2 1 
ATOM   3935 C  CE1 . PHE A 1 502 ? -10.723 -14.313 9.865   1.00 33.97  ? 502 PHE A CE1 1 
ATOM   3936 C  CE2 . PHE A 1 502 ? -11.762 -12.967 11.514  1.00 43.47  ? 502 PHE A CE2 1 
ATOM   3937 C  CZ  . PHE A 1 502 ? -10.706 -13.746 11.102  1.00 35.02  ? 502 PHE A CZ  1 
ATOM   3938 N  N   . ILE A 1 503 ? -14.053 -15.746 7.286   1.00 45.45  ? 503 ILE A N   1 
ATOM   3939 C  CA  . ILE A 1 503 ? -13.616 -17.099 6.954   1.00 43.20  ? 503 ILE A CA  1 
ATOM   3940 C  C   . ILE A 1 503 ? -12.187 -17.069 6.440   1.00 43.91  ? 503 ILE A C   1 
ATOM   3941 O  O   . ILE A 1 503 ? -11.752 -16.102 5.803   1.00 42.88  ? 503 ILE A O   1 
ATOM   3942 C  CB  . ILE A 1 503 ? -14.520 -17.777 5.897   1.00 36.45  ? 503 ILE A CB  1 
ATOM   3943 C  CG1 . ILE A 1 503 ? -14.676 -16.885 4.681   1.00 36.03  ? 503 ILE A CG1 1 
ATOM   3944 C  CG2 . ILE A 1 503 ? -15.873 -18.107 6.454   1.00 39.16  ? 503 ILE A CG2 1 
ATOM   3945 C  CD1 . ILE A 1 503 ? -14.696 -17.671 3.413   1.00 48.68  ? 503 ILE A CD1 1 
ATOM   3946 N  N   . ASP A 1 504 ? -11.463 -18.152 6.704   1.00 46.81  ? 504 ASP A N   1 
ATOM   3947 C  CA  . ASP A 1 504 ? -10.210 -18.415 6.014   1.00 47.99  ? 504 ASP A CA  1 
ATOM   3948 C  C   . ASP A 1 504 ? -10.502 -18.942 4.612   1.00 47.19  ? 504 ASP A C   1 
ATOM   3949 O  O   . ASP A 1 504 ? -11.483 -19.652 4.384   1.00 65.47  ? 504 ASP A O   1 
ATOM   3950 C  CB  . ASP A 1 504 ? -9.358  -19.438 6.781   1.00 53.57  ? 504 ASP A CB  1 
ATOM   3951 C  CG  . ASP A 1 504 ? -8.886  -18.930 8.146   1.00 61.17  ? 504 ASP A CG  1 
ATOM   3952 O  OD1 . ASP A 1 504 ? -8.637  -17.714 8.300   1.00 69.88  ? 504 ASP A OD1 1 
ATOM   3953 O  OD2 . ASP A 1 504 ? -8.762  -19.763 9.068   1.00 56.85  1 504 ASP A OD2 1 
ATOM   3954 N  N   . LEU A 1 505 ? -9.650  -18.576 3.666   1.00 34.42  ? 505 LEU A N   1 
ATOM   3955 C  CA  . LEU A 1 505 ? -9.644  -19.172 2.337   1.00 39.91  ? 505 LEU A CA  1 
ATOM   3956 C  C   . LEU A 1 505 ? -8.333  -19.925 2.178   1.00 50.41  ? 505 LEU A C   1 
ATOM   3957 O  O   . LEU A 1 505 ? -7.263  -19.309 2.197   1.00 50.13  ? 505 LEU A O   1 
ATOM   3958 C  CB  . LEU A 1 505 ? -9.792  -18.102 1.248   1.00 32.01  ? 505 LEU A CB  1 
ATOM   3959 C  CG  . LEU A 1 505 ? -11.252 -17.685 1.084   1.00 33.89  ? 505 LEU A CG  1 
ATOM   3960 C  CD1 . LEU A 1 505 ? -11.417 -16.452 0.209   1.00 28.54  ? 505 LEU A CD1 1 
ATOM   3961 C  CD2 . LEU A 1 505 ? -12.051 -18.866 0.532   1.00 37.23  ? 505 LEU A CD2 1 
ATOM   3962 N  N   . ASN A 1 506 ? -8.409  -21.248 2.061   1.00 47.10  ? 506 ASN A N   1 
ATOM   3963 C  CA  . ASN A 1 506 ? -7.218  -22.049 1.808   1.00 38.39  ? 506 ASN A CA  1 
ATOM   3964 C  C   . ASN A 1 506 ? -7.644  -23.465 1.444   1.00 47.55  ? 506 ASN A C   1 
ATOM   3965 O  O   . ASN A 1 506 ? -8.833  -23.781 1.375   1.00 48.21  ? 506 ASN A O   1 
ATOM   3966 C  CB  . ASN A 1 506 ? -6.265  -22.038 3.000   1.00 36.70  ? 506 ASN A CB  1 
ATOM   3967 C  CG  . ASN A 1 506 ? -6.964  -22.263 4.312   1.00 39.88  ? 506 ASN A CG  1 
ATOM   3968 O  OD1 . ASN A 1 506 ? -7.835  -23.124 4.425   1.00 59.85  ? 506 ASN A OD1 1 
ATOM   3969 N  ND2 . ASN A 1 506 ? -6.582  -21.495 5.320   1.00 32.51  ? 506 ASN A ND2 1 
ATOM   3970 N  N   . THR A 1 507 ? -6.646  -24.319 1.203   1.00 60.06  ? 507 THR A N   1 
ATOM   3971 C  CA  . THR A 1 507 ? -6.891  -25.667 0.705   1.00 68.58  ? 507 THR A CA  1 
ATOM   3972 C  C   . THR A 1 507 ? -7.647  -26.529 1.693   1.00 68.44  ? 507 THR A C   1 
ATOM   3973 O  O   . THR A 1 507 ? -8.014  -27.660 1.356   1.00 77.02  ? 507 THR A O   1 
ATOM   3974 C  CB  . THR A 1 507 ? -5.575  -26.351 0.378   1.00 70.71  ? 507 THR A CB  1 
ATOM   3975 O  OG1 . THR A 1 507 ? -4.760  -26.394 1.556   1.00 65.17  ? 507 THR A OG1 1 
ATOM   3976 C  CG2 . THR A 1 507 ? -4.862  -25.592 -0.721  1.00 70.28  ? 507 THR A CG2 1 
ATOM   3977 N  N   . GLU A 1 508 ? -7.874  -26.044 2.875   1.00 58.06  ? 508 GLU A N   1 
ATOM   3978 C  CA  . GLU A 1 508 ? -8.480  -26.834 3.927   1.00 63.11  ? 508 GLU A CA  1 
ATOM   3979 C  C   . GLU A 1 508 ? -9.926  -26.436 4.137   1.00 53.30  ? 508 GLU A C   1 
ATOM   3980 O  O   . GLU A 1 508 ? -10.349 -25.346 3.737   1.00 49.89  ? 508 GLU A O   1 
ATOM   3981 C  CB  . GLU A 1 508 ? -7.703  -26.649 5.229   1.00 70.38  ? 508 GLU A CB  1 
ATOM   3982 C  CG  . GLU A 1 508 ? -6.225  -26.612 5.090   1.00 67.64  ? 508 GLU A CG  1 
ATOM   3983 C  CD  . GLU A 1 508 ? -5.598  -26.534 6.437   1.00 76.99  ? 508 GLU A CD  1 
ATOM   3984 O  OE1 . GLU A 1 508 ? -6.196  -25.851 7.295   1.00 65.70  ? 508 GLU A OE1 1 
ATOM   3985 O  OE2 . GLU A 1 508 ? -4.537  -27.165 6.662   1.00 95.52  1 508 GLU A OE2 1 
ATOM   3986 N  N   . PRO A 1 509 ? -10.703 -27.311 4.770   1.00 43.03  ? 509 PRO A N   1 
ATOM   3987 C  CA  . PRO A 1 509 ? -12.107 -27.007 5.039   1.00 42.72  ? 509 PRO A CA  1 
ATOM   3988 C  C   . PRO A 1 509 ? -12.294 -25.654 5.711   1.00 50.43  ? 509 PRO A C   1 
ATOM   3989 O  O   . PRO A 1 509 ? -11.555 -25.272 6.630   1.00 51.11  ? 509 PRO A O   1 
ATOM   3990 C  CB  . PRO A 1 509 ? -12.533 -28.154 5.943   1.00 41.99  ? 509 PRO A CB  1 
ATOM   3991 C  CG  . PRO A 1 509 ? -11.776 -29.297 5.358   1.00 44.51  ? 509 PRO A CG  1 
ATOM   3992 C  CD  . PRO A 1 509 ? -10.440 -28.745 4.889   1.00 40.83  ? 509 PRO A CD  1 
ATOM   3993 N  N   . MET A 1 510 ? -13.280 -24.915 5.198   1.00 55.13  ? 510 MET A N   1 
ATOM   3994 C  CA  . MET A 1 510 ? -13.578 -23.561 5.649   1.00 65.85  ? 510 MET A CA  1 
ATOM   3995 C  C   . MET A 1 510 ? -13.836 -23.543 7.149   1.00 57.75  ? 510 MET A C   1 
ATOM   3996 O  O   . MET A 1 510 ? -14.475 -24.449 7.693   1.00 57.21  ? 510 MET A O   1 
ATOM   3997 C  CB  . MET A 1 510 ? -14.795 -23.045 4.886   1.00 82.89  ? 510 MET A CB  1 
ATOM   3998 C  CG  . MET A 1 510 ? -15.172 -21.588 5.111   1.00 87.30  ? 510 MET A CG  1 
ATOM   3999 S  SD  . MET A 1 510 ? -16.950 -21.403 4.859   1.00 83.17  ? 510 MET A SD  1 
ATOM   4000 C  CE  . MET A 1 510 ? -17.575 -22.527 6.092   1.00 84.45  ? 510 MET A CE  1 
ATOM   4001 N  N   . LYS A 1 511 ? -13.328 -22.509 7.819   1.00 51.52  ? 511 LYS A N   1 
ATOM   4002 C  CA  . LYS A 1 511 ? -13.504 -22.372 9.257   1.00 54.36  ? 511 LYS A CA  1 
ATOM   4003 C  C   . LYS A 1 511 ? -13.767 -20.913 9.604   1.00 54.27  ? 511 LYS A C   1 
ATOM   4004 O  O   . LYS A 1 511 ? -13.231 -20.002 8.970   1.00 61.48  ? 511 LYS A O   1 
ATOM   4005 C  CB  . LYS A 1 511 ? -12.291 -22.926 10.031  1.00 57.64  ? 511 LYS A CB  1 
ATOM   4006 C  CG  . LYS A 1 511 ? -11.049 -22.060 10.026  1.00 64.16  ? 511 LYS A CG  1 
ATOM   4007 C  CD  . LYS A 1 511 ? -9.908  -22.751 10.788  1.00 70.91  ? 511 LYS A CD  1 
ATOM   4008 C  CE  . LYS A 1 511 ? -9.273  -23.879 9.959   1.00 70.89  ? 511 LYS A CE  1 
ATOM   4009 N  NZ  . LYS A 1 511 ? -8.156  -24.568 10.666  1.00 60.80  1 511 LYS A NZ  1 
ATOM   4010 N  N   . VAL A 1 512 ? -14.614 -20.702 10.616  1.00 54.75  ? 512 VAL A N   1 
ATOM   4011 C  CA  . VAL A 1 512 ? -15.111 -19.376 10.972  1.00 49.82  ? 512 VAL A CA  1 
ATOM   4012 C  C   . VAL A 1 512 ? -14.343 -18.831 12.166  1.00 47.74  ? 512 VAL A C   1 
ATOM   4013 O  O   . VAL A 1 512 ? -14.080 -19.549 13.142  1.00 47.18  ? 512 VAL A O   1 
ATOM   4014 C  CB  . VAL A 1 512 ? -16.620 -19.420 11.268  1.00 41.30  ? 512 VAL A CB  1 
ATOM   4015 C  CG1 . VAL A 1 512 ? -17.099 -18.077 11.763  1.00 41.34  ? 512 VAL A CG1 1 
ATOM   4016 C  CG2 . VAL A 1 512 ? -17.378 -19.847 10.036  1.00 40.89  ? 512 VAL A CG2 1 
ATOM   4017 N  N   . HIS A 1 513 ? -13.980 -17.556 12.085  1.00 43.52  ? 513 HIS A N   1 
ATOM   4018 C  CA  . HIS A 1 513 ? -13.392 -16.813 13.184  1.00 51.52  ? 513 HIS A CA  1 
ATOM   4019 C  C   . HIS A 1 513 ? -14.190 -15.534 13.362  1.00 49.71  ? 513 HIS A C   1 
ATOM   4020 O  O   . HIS A 1 513 ? -15.030 -15.196 12.524  1.00 43.92  ? 513 HIS A O   1 
ATOM   4021 C  CB  . HIS A 1 513 ? -11.928 -16.479 12.910  1.00 55.23  ? 513 HIS A CB  1 
ATOM   4022 C  CG  . HIS A 1 513 ? -11.139 -17.627 12.374  1.00 53.25  ? 513 HIS A CG  1 
ATOM   4023 N  ND1 . HIS A 1 513 ? -10.970 -18.801 13.073  1.00 56.47  ? 513 HIS A ND1 1 
ATOM   4024 C  CD2 . HIS A 1 513 ? -10.450 -17.774 11.219  1.00 58.08  ? 513 HIS A CD2 1 
ATOM   4025 C  CE1 . HIS A 1 513 ? -10.221 -19.627 12.366  1.00 53.87  ? 513 HIS A CE1 1 
ATOM   4026 N  NE2 . HIS A 1 513 ? -9.891  -19.028 11.238  1.00 54.61  ? 513 HIS A NE2 1 
ATOM   4027 N  N   . GLN A 1 514 ? -13.919 -14.811 14.455  1.00 51.89  ? 514 GLN A N   1 
ATOM   4028 C  CA  . GLN A 1 514 ? -14.523 -13.502 14.676  1.00 41.06  ? 514 GLN A CA  1 
ATOM   4029 C  C   . GLN A 1 514 ? -13.434 -12.463 14.915  1.00 47.10  ? 514 GLN A C   1 
ATOM   4030 O  O   . GLN A 1 514 ? -12.320 -12.797 15.314  1.00 48.40  ? 514 GLN A O   1 
ATOM   4031 C  CB  . GLN A 1 514 ? -15.507 -13.528 15.839  1.00 43.20  ? 514 GLN A CB  1 
ATOM   4032 C  CG  . GLN A 1 514 ? -16.161 -14.884 16.041  1.00 56.21  ? 514 GLN A CG  1 
ATOM   4033 C  CD  . GLN A 1 514 ? -17.554 -14.814 16.656  1.00 64.96  ? 514 GLN A CD  1 
ATOM   4034 O  OE1 . GLN A 1 514 ? -18.056 -13.735 16.987  1.00 70.59  ? 514 GLN A OE1 1 
ATOM   4035 N  NE2 . GLN A 1 514 ? -18.190 -15.981 16.799  1.00 73.76  ? 514 GLN A NE2 1 
ATOM   4036 N  N   . ARG A 1 515 ? -13.752 -11.204 14.605  1.00 53.76  ? 515 ARG A N   1 
ATOM   4037 C  CA  . ARG A 1 515 ? -12.874 -10.064 14.846  1.00 46.56  ? 515 ARG A CA  1 
ATOM   4038 C  C   . ARG A 1 515 ? -11.506 -10.254 14.231  1.00 49.26  ? 515 ARG A C   1 
ATOM   4039 O  O   . ARG A 1 515 ? -10.556 -10.672 14.901  1.00 53.52  ? 515 ARG A O   1 
ATOM   4040 C  CB  . ARG A 1 515 ? -12.735 -9.797  16.338  1.00 56.37  ? 515 ARG A CB  1 
ATOM   4041 C  CG  . ARG A 1 515 ? -13.974 -9.233  16.977  1.00 49.15  ? 515 ARG A CG  1 
ATOM   4042 C  CD  . ARG A 1 515 ? -14.115 -9.819  18.310  1.00 55.40  ? 515 ARG A CD  1 
ATOM   4043 N  NE  . ARG A 1 515 ? -14.943 -8.952  19.143  1.00 71.21  ? 515 ARG A NE  1 
ATOM   4044 C  CZ  . ARG A 1 515 ? -15.807 -9.391  20.038  1.00 75.89  ? 515 ARG A CZ  1 
ATOM   4045 N  NH1 . ARG A 1 515 ? -16.495 -8.522  20.745  1.00 79.37  1 515 ARG A NH1 1 
ATOM   4046 N  NH2 . ARG A 1 515 ? -15.962 -10.697 20.192  1.00 76.92  ? 515 ARG A NH2 1 
ATOM   4047 N  N   . LEU A 1 516 ? -11.392 -9.930  12.960  1.00 51.38  ? 516 LEU A N   1 
ATOM   4048 C  CA  . LEU A 1 516 ? -10.117 -10.085 12.291  1.00 45.34  ? 516 LEU A CA  1 
ATOM   4049 C  C   . LEU A 1 516 ? -9.119  -9.092  12.878  1.00 50.35  ? 516 LEU A C   1 
ATOM   4050 O  O   . LEU A 1 516 ? -9.317  -7.875  12.781  1.00 50.53  ? 516 LEU A O   1 
ATOM   4051 C  CB  . LEU A 1 516 ? -10.293 -9.883  10.794  1.00 42.25  ? 516 LEU A CB  1 
ATOM   4052 C  CG  . LEU A 1 516 ? -9.004  -10.212 10.064  1.00 46.14  ? 516 LEU A CG  1 
ATOM   4053 C  CD1 . LEU A 1 516 ? -9.289  -11.298 9.077   1.00 47.11  ? 516 LEU A CD1 1 
ATOM   4054 C  CD2 . LEU A 1 516 ? -8.484  -8.991  9.368   1.00 52.19  ? 516 LEU A CD2 1 
ATOM   4055 N  N   . ARG A 1 517 ? -8.075  -9.628  13.523  1.00 51.92  ? 517 ARG A N   1 
ATOM   4056 C  CA  . ARG A 1 517 ? -6.936  -8.864  14.039  1.00 43.96  ? 517 ARG A CA  1 
ATOM   4057 C  C   . ARG A 1 517 ? -7.391  -7.672  14.870  1.00 46.50  ? 517 ARG A C   1 
ATOM   4058 O  O   . ARG A 1 517 ? -6.859  -6.567  14.768  1.00 47.35  ? 517 ARG A O   1 
ATOM   4059 C  CB  . ARG A 1 517 ? -6.014  -8.432  12.909  1.00 36.88  ? 517 ARG A CB  1 
ATOM   4060 C  CG  . ARG A 1 517 ? -5.283  -9.617  12.315  1.00 47.75  ? 517 ARG A CG  1 
ATOM   4061 C  CD  . ARG A 1 517 ? -4.157  -9.226  11.379  1.00 50.15  ? 517 ARG A CD  1 
ATOM   4062 N  NE  . ARG A 1 517 ? -3.081  -8.525  12.071  1.00 53.10  ? 517 ARG A NE  1 
ATOM   4063 C  CZ  . ARG A 1 517 ? -2.215  -9.120  12.882  1.00 52.67  ? 517 ARG A CZ  1 
ATOM   4064 N  NH1 . ARG A 1 517 ? -2.324  -10.420 13.102  1.00 50.22  1 517 ARG A NH1 1 
ATOM   4065 N  NH2 . ARG A 1 517 ? -1.251  -8.417  13.464  1.00 47.91  ? 517 ARG A NH2 1 
ATOM   4066 N  N   . VAL A 1 518 ? -8.386  -7.923  15.721  1.00 39.10  ? 518 VAL A N   1 
ATOM   4067 C  CA  . VAL A 1 518 ? -9.016  -6.838  16.454  1.00 47.09  ? 518 VAL A CA  1 
ATOM   4068 C  C   . VAL A 1 518 ? -8.011  -6.139  17.365  1.00 57.54  ? 518 VAL A C   1 
ATOM   4069 O  O   . VAL A 1 518 ? -8.011  -4.904  17.463  1.00 59.31  ? 518 VAL A O   1 
ATOM   4070 C  CB  . VAL A 1 518 ? -10.237 -7.363  17.228  1.00 41.88  ? 518 VAL A CB  1 
ATOM   4071 C  CG1 . VAL A 1 518 ? -9.876  -8.620  18.023  1.00 49.23  ? 518 VAL A CG1 1 
ATOM   4072 C  CG2 . VAL A 1 518 ? -10.774 -6.290  18.122  1.00 43.58  ? 518 VAL A CG2 1 
ATOM   4073 N  N   . GLN A 1 519 ? -7.127  -6.901  18.032  1.00 54.41  ? 519 GLN A N   1 
ATOM   4074 C  CA  . GLN A 1 519 ? -6.237  -6.268  19.011  1.00 57.77  ? 519 GLN A CA  1 
ATOM   4075 C  C   . GLN A 1 519 ? -5.403  -5.185  18.362  1.00 54.44  ? 519 GLN A C   1 
ATOM   4076 O  O   . GLN A 1 519 ? -5.203  -4.111  18.934  1.00 43.72  ? 519 GLN A O   1 
ATOM   4077 C  CB  . GLN A 1 519 ? -5.301  -7.274  19.689  1.00 54.24  ? 519 GLN A CB  1 
ATOM   4078 C  CG  . GLN A 1 519 ? -5.788  -7.838  21.038  1.00 51.98  ? 519 GLN A CG  1 
ATOM   4079 C  CD  . GLN A 1 519 ? -5.968  -6.807  22.136  1.00 53.14  ? 519 GLN A CD  1 
ATOM   4080 O  OE1 . GLN A 1 519 ? -6.870  -6.932  22.958  1.00 59.18  ? 519 GLN A OE1 1 
ATOM   4081 N  NE2 . GLN A 1 519 ? -5.118  -5.792  22.160  1.00 51.93  ? 519 GLN A NE2 1 
ATOM   4082 N  N   . MET A 1 520 ? -4.906  -5.435  17.168  1.00 55.25  ? 520 MET A N   1 
ATOM   4083 C  CA  . MET A 1 520 ? -4.077  -4.390  16.615  1.00 55.67  ? 520 MET A CA  1 
ATOM   4084 C  C   . MET A 1 520 ? -4.912  -3.333  15.921  1.00 61.05  ? 520 MET A C   1 
ATOM   4085 O  O   . MET A 1 520 ? -4.533  -2.159  15.912  1.00 70.16  ? 520 MET A O   1 
ATOM   4086 C  CB  . MET A 1 520 ? -3.032  -4.985  15.692  1.00 54.68  ? 520 MET A CB  1 
ATOM   4087 C  CG  . MET A 1 520 ? -1.665  -4.648  16.205  1.00 63.93  ? 520 MET A CG  1 
ATOM   4088 S  SD  . MET A 1 520 ? -1.045  -5.656  17.551  1.00 70.17  ? 520 MET A SD  1 
ATOM   4089 C  CE  . MET A 1 520 ? -0.914  -7.220  16.683  1.00 60.48  ? 520 MET A CE  1 
ATOM   4090 N  N   . CYS A 1 521 ? -6.062  -3.709  15.380  1.00 52.99  ? 521 CYS A N   1 
ATOM   4091 C  CA  . CYS A 1 521 ? -6.891  -2.721  14.710  1.00 51.11  ? 521 CYS A CA  1 
ATOM   4092 C  C   . CYS A 1 521 ? -7.640  -1.825  15.686  1.00 55.28  ? 521 CYS A C   1 
ATOM   4093 O  O   . CYS A 1 521 ? -8.039  -0.720  15.302  1.00 53.26  ? 521 CYS A O   1 
ATOM   4094 C  CB  . CYS A 1 521 ? -7.866  -3.410  13.761  1.00 56.45  ? 521 CYS A CB  1 
ATOM   4095 S  SG  . CYS A 1 521 ? -7.039  -4.197  12.359  1.00 63.16  ? 521 CYS A SG  1 
ATOM   4096 N  N   . VAL A 1 522 ? -7.851  -2.258  16.933  1.00 56.43  ? 522 VAL A N   1 
ATOM   4097 C  CA  . VAL A 1 522 ? -8.184  -1.274  17.958  1.00 58.27  ? 522 VAL A CA  1 
ATOM   4098 C  C   . VAL A 1 522 ? -7.042  -0.273  18.071  1.00 53.56  ? 522 VAL A C   1 
ATOM   4099 O  O   . VAL A 1 522 ? -7.250  0.948   18.088  1.00 45.75  ? 522 VAL A O   1 
ATOM   4100 C  CB  . VAL A 1 522 ? -8.487  -1.945  19.317  1.00 61.32  ? 522 VAL A CB  1 
ATOM   4101 C  CG1 . VAL A 1 522 ? -8.860  -0.888  20.361  1.00 48.43  ? 522 VAL A CG1 1 
ATOM   4102 C  CG2 . VAL A 1 522 ? -9.589  -2.978  19.210  1.00 45.82  ? 522 VAL A CG2 1 
ATOM   4103 N  N   . PHE A 1 523 ? -5.809  -0.782  18.100  1.00 44.34  ? 523 PHE A N   1 
ATOM   4104 C  CA  . PHE A 1 523 ? -4.658  0.101   18.246  1.00 52.34  ? 523 PHE A CA  1 
ATOM   4105 C  C   . PHE A 1 523 ? -4.539  1.057   17.067  1.00 54.03  ? 523 PHE A C   1 
ATOM   4106 O  O   . PHE A 1 523 ? -4.290  2.256   17.253  1.00 56.21  ? 523 PHE A O   1 
ATOM   4107 C  CB  . PHE A 1 523 ? -3.379  -0.721  18.391  1.00 51.30  ? 523 PHE A CB  1 
ATOM   4108 C  CG  . PHE A 1 523 ? -2.130  0.099   18.329  1.00 51.96  ? 523 PHE A CG  1 
ATOM   4109 C  CD1 . PHE A 1 523 ? -1.690  0.792   19.440  1.00 59.96  ? 523 PHE A CD1 1 
ATOM   4110 C  CD2 . PHE A 1 523 ? -1.404  0.195   17.160  1.00 49.89  ? 523 PHE A CD2 1 
ATOM   4111 C  CE1 . PHE A 1 523 ? -0.540  1.551   19.388  1.00 52.77  ? 523 PHE A CE1 1 
ATOM   4112 C  CE2 . PHE A 1 523 ? -0.263  0.954   17.107  1.00 45.93  ? 523 PHE A CE2 1 
ATOM   4113 C  CZ  . PHE A 1 523 ? 0.167   1.634   18.222  1.00 45.94  ? 523 PHE A CZ  1 
ATOM   4114 N  N   . TRP A 1 524 ? -4.716  0.544   15.844  1.00 51.36  ? 524 TRP A N   1 
ATOM   4115 C  CA  . TRP A 1 524 ? -4.517  1.378   14.667  1.00 47.09  ? 524 TRP A CA  1 
ATOM   4116 C  C   . TRP A 1 524 ? -5.691  2.315   14.423  1.00 41.62  ? 524 TRP A C   1 
ATOM   4117 O  O   . TRP A 1 524 ? -5.485  3.479   14.070  1.00 42.13  ? 524 TRP A O   1 
ATOM   4118 C  CB  . TRP A 1 524 ? -4.258  0.508   13.429  1.00 50.54  ? 524 TRP A CB  1 
ATOM   4119 C  CG  . TRP A 1 524 ? -2.876  -0.116  13.415  1.00 49.89  ? 524 TRP A CG  1 
ATOM   4120 C  CD1 . TRP A 1 524 ? -2.564  -1.443  13.580  1.00 50.89  ? 524 TRP A CD1 1 
ATOM   4121 C  CD2 . TRP A 1 524 ? -1.628  0.569   13.256  1.00 38.78  ? 524 TRP A CD2 1 
ATOM   4122 N  NE1 . TRP A 1 524 ? -1.203  -1.619  13.531  1.00 49.63  ? 524 TRP A NE1 1 
ATOM   4123 C  CE2 . TRP A 1 524 ? -0.604  -0.403  13.331  1.00 42.32  ? 524 TRP A CE2 1 
ATOM   4124 C  CE3 . TRP A 1 524 ? -1.275  1.909   13.053  1.00 39.59  ? 524 TRP A CE3 1 
ATOM   4125 C  CZ2 . TRP A 1 524 ? 0.748   -0.077  13.208  1.00 38.47  ? 524 TRP A CZ2 1 
ATOM   4126 C  CZ3 . TRP A 1 524 ? 0.071   2.236   12.937  1.00 39.86  ? 524 TRP A CZ3 1 
ATOM   4127 C  CH2 . TRP A 1 524 ? 1.065   1.245   13.013  1.00 39.28  ? 524 TRP A CH2 1 
ATOM   4128 N  N   . ASN A 1 525 ? -6.927  1.851   14.609  1.00 48.69  ? 525 ASN A N   1 
ATOM   4129 C  CA  . ASN A 1 525 ? -8.069  2.679   14.235  1.00 47.87  ? 525 ASN A CA  1 
ATOM   4130 C  C   . ASN A 1 525 ? -8.571  3.581   15.357  1.00 49.93  ? 525 ASN A C   1 
ATOM   4131 O  O   . ASN A 1 525 ? -9.266  4.562   15.069  1.00 45.69  ? 525 ASN A O   1 
ATOM   4132 C  CB  . ASN A 1 525 ? -9.208  1.800   13.714  1.00 43.98  ? 525 ASN A CB  1 
ATOM   4133 C  CG  . ASN A 1 525 ? -8.751  0.885   12.597  1.00 46.82  ? 525 ASN A CG  1 
ATOM   4134 O  OD1 . ASN A 1 525 ? -9.087  -0.298  12.568  1.00 48.87  ? 525 ASN A OD1 1 
ATOM   4135 N  ND2 . ASN A 1 525 ? -7.950  1.424   11.684  1.00 45.73  ? 525 ASN A ND2 1 
ATOM   4136 N  N   . GLN A 1 526 ? -8.220  3.307   16.616  1.00 56.27  ? 526 GLN A N   1 
ATOM   4137 C  CA  . GLN A 1 526 ? -8.701  4.124   17.728  1.00 56.33  ? 526 GLN A CA  1 
ATOM   4138 C  C   . GLN A 1 526 ? -7.572  4.770   18.519  1.00 55.56  ? 526 GLN A C   1 
ATOM   4139 O  O   . GLN A 1 526 ? -7.601  5.986   18.758  1.00 57.62  ? 526 GLN A O   1 
ATOM   4140 C  CB  . GLN A 1 526 ? -9.602  3.294   18.678  1.00 49.03  ? 526 GLN A CB  1 
ATOM   4141 C  CG  . GLN A 1 526 ? -10.697 2.470   18.015  1.00 74.17  ? 526 GLN A CG  1 
ATOM   4142 C  CD  . GLN A 1 526 ? -12.096 3.022   18.251  1.00 98.36  ? 526 GLN A CD  1 
ATOM   4143 O  OE1 . GLN A 1 526 ? -12.357 4.213   18.035  1.00 104.18 ? 526 GLN A OE1 1 
ATOM   4144 N  NE2 . GLN A 1 526 ? -13.008 2.151   18.703  1.00 107.73 ? 526 GLN A NE2 1 
ATOM   4145 N  N   . PHE A 1 527 ? -6.562  4.009   18.938  1.00 51.50  ? 527 PHE A N   1 
ATOM   4146 C  CA  . PHE A 1 527 ? -5.667  4.581   19.936  1.00 51.23  ? 527 PHE A CA  1 
ATOM   4147 C  C   . PHE A 1 527 ? -4.613  5.484   19.306  1.00 51.04  ? 527 PHE A C   1 
ATOM   4148 O  O   . PHE A 1 527 ? -4.365  6.589   19.796  1.00 52.93  ? 527 PHE A O   1 
ATOM   4149 C  CB  . PHE A 1 527 ? -4.994  3.498   20.769  1.00 51.44  ? 527 PHE A CB  1 
ATOM   4150 C  CG  . PHE A 1 527 ? -3.998  4.053   21.705  1.00 53.34  ? 527 PHE A CG  1 
ATOM   4151 C  CD1 . PHE A 1 527 ? -4.407  4.827   22.776  1.00 55.91  ? 527 PHE A CD1 1 
ATOM   4152 C  CD2 . PHE A 1 527 ? -2.649  3.877   21.480  1.00 52.73  ? 527 PHE A CD2 1 
ATOM   4153 C  CE1 . PHE A 1 527 ? -3.487  5.381   23.628  1.00 57.85  ? 527 PHE A CE1 1 
ATOM   4154 C  CE2 . PHE A 1 527 ? -1.726  4.425   22.319  1.00 54.60  ? 527 PHE A CE2 1 
ATOM   4155 C  CZ  . PHE A 1 527 ? -2.137  5.179   23.399  1.00 57.18  ? 527 PHE A CZ  1 
ATOM   4156 N  N   . LEU A 1 528 ? -3.974  5.035   18.226  1.00 50.24  ? 528 LEU A N   1 
ATOM   4157 C  CA  . LEU A 1 528 ? -2.888  5.846   17.696  1.00 49.01  ? 528 LEU A CA  1 
ATOM   4158 C  C   . LEU A 1 528 ? -3.415  7.150   17.104  1.00 59.52  ? 528 LEU A C   1 
ATOM   4159 O  O   . LEU A 1 528 ? -2.816  8.204   17.359  1.00 57.70  ? 528 LEU A O   1 
ATOM   4160 C  CB  . LEU A 1 528 ? -2.063  5.078   16.663  1.00 57.96  ? 528 LEU A CB  1 
ATOM   4161 C  CG  . LEU A 1 528 ? -0.805  5.855   16.243  1.00 55.79  ? 528 LEU A CG  1 
ATOM   4162 C  CD1 . LEU A 1 528 ? 0.166   5.978   17.411  1.00 48.95  ? 528 LEU A CD1 1 
ATOM   4163 C  CD2 . LEU A 1 528 ? -0.121  5.191   15.076  1.00 45.07  ? 528 LEU A CD2 1 
ATOM   4164 N  N   . PRO A 1 529 ? -4.512  7.141   16.324  1.00 64.38  ? 529 PRO A N   1 
ATOM   4165 C  CA  . PRO A 1 529 ? -5.090  8.427   15.901  1.00 49.49  ? 529 PRO A CA  1 
ATOM   4166 C  C   . PRO A 1 529 ? -5.256  9.395   17.052  1.00 56.95  ? 529 PRO A C   1 
ATOM   4167 O  O   . PRO A 1 529 ? -4.918  10.576  16.905  1.00 63.63  ? 529 PRO A O   1 
ATOM   4168 C  CB  . PRO A 1 529 ? -6.439  8.033   15.291  1.00 48.33  ? 529 PRO A CB  1 
ATOM   4169 C  CG  . PRO A 1 529 ? -6.440  6.528   15.208  1.00 49.78  ? 529 PRO A CG  1 
ATOM   4170 C  CD  . PRO A 1 529 ? -5.082  6.029   15.548  1.00 55.83  ? 529 PRO A CD  1 
ATOM   4171 N  N   . LYS A 1 530 ? -5.715  8.924   18.218  1.00 54.52  ? 530 LYS A N   1 
ATOM   4172 C  CA  . LYS A 1 530 ? -5.941  9.849   19.319  1.00 60.06  ? 530 LYS A CA  1 
ATOM   4173 C  C   . LYS A 1 530 ? -4.648  10.266  19.986  1.00 57.65  ? 530 LYS A C   1 
ATOM   4174 O  O   . LYS A 1 530 ? -4.610  11.324  20.627  1.00 60.09  ? 530 LYS A O   1 
ATOM   4175 C  CB  . LYS A 1 530 ? -6.900  9.261   20.363  1.00 67.53  ? 530 LYS A CB  1 
ATOM   4176 C  CG  . LYS A 1 530 ? -7.593  10.341  21.202  1.00 80.97  ? 530 LYS A CG  1 
ATOM   4177 C  CD  . LYS A 1 530 ? -8.362  9.780   22.387  1.00 89.28  ? 530 LYS A CD  1 
ATOM   4178 C  CE  . LYS A 1 530 ? -9.463  8.906   21.912  1.00 90.88  ? 530 LYS A CE  1 
ATOM   4179 N  NZ  . LYS A 1 530 ? -9.140  7.495   21.994  1.00 82.46  1 530 LYS A NZ  1 
ATOM   4180 N  N   . LEU A 1 531 ? -3.585  9.480   19.828  1.00 56.36  ? 531 LEU A N   1 
ATOM   4181 C  CA  . LEU A 1 531 ? -2.301  9.889   20.380  1.00 57.77  ? 531 LEU A CA  1 
ATOM   4182 C  C   . LEU A 1 531 ? -1.721  11.050  19.583  1.00 63.13  ? 531 LEU A C   1 
ATOM   4183 O  O   . LEU A 1 531 ? -1.283  12.053  20.156  1.00 62.05  ? 531 LEU A O   1 
ATOM   4184 C  CB  . LEU A 1 531 ? -1.339  8.702   20.405  1.00 56.34  ? 531 LEU A CB  1 
ATOM   4185 C  CG  . LEU A 1 531 ? 0.041   8.970   21.004  1.00 57.75  ? 531 LEU A CG  1 
ATOM   4186 C  CD1 . LEU A 1 531 ? 0.597   7.702   21.587  1.00 65.49  ? 531 LEU A CD1 1 
ATOM   4187 C  CD2 . LEU A 1 531 ? 1.007   9.508   19.980  1.00 65.73  ? 531 LEU A CD2 1 
ATOM   4188 N  N   . LEU A 1 532 ? -1.726  10.938  18.251  1.00 65.77  ? 532 LEU A N   1 
ATOM   4189 C  CA  . LEU A 1 532 ? -1.052  11.938  17.427  1.00 64.26  ? 532 LEU A CA  1 
ATOM   4190 C  C   . LEU A 1 532 ? -1.851  13.232  17.317  1.00 67.62  ? 532 LEU A C   1 
ATOM   4191 O  O   . LEU A 1 532 ? -1.253  14.312  17.219  1.00 76.31  ? 532 LEU A O   1 
ATOM   4192 C  CB  . LEU A 1 532 ? -0.751  11.366  16.044  1.00 56.04  ? 532 LEU A CB  1 
ATOM   4193 C  CG  . LEU A 1 532 ? 0.029   10.043  16.019  1.00 54.72  ? 532 LEU A CG  1 
ATOM   4194 C  CD1 . LEU A 1 532 ? -0.286  9.275   14.740  1.00 52.40  ? 532 LEU A CD1 1 
ATOM   4195 C  CD2 . LEU A 1 532 ? 1.541   10.273  16.162  1.00 52.79  ? 532 LEU A CD2 1 
ATOM   4196 N  N   . ASN A 1 533 ? -3.187  13.155  17.346  1.00 60.02  ? 533 ASN A N   1 
ATOM   4197 C  CA  . ASN A 1 533 ? -3.986  14.376  17.424  1.00 64.02  ? 533 ASN A CA  1 
ATOM   4198 C  C   . ASN A 1 533 ? -3.752  15.104  18.741  1.00 73.01  ? 533 ASN A C   1 
ATOM   4199 O  O   . ASN A 1 533 ? -3.820  16.339  18.792  1.00 81.95  ? 533 ASN A O   1 
ATOM   4200 C  CB  . ASN A 1 533 ? -5.474  14.055  17.237  1.00 64.68  ? 533 ASN A CB  1 
ATOM   4201 C  CG  . ASN A 1 533 ? -6.354  15.301  17.321  1.00 85.02  ? 533 ASN A CG  1 
ATOM   4202 O  OD1 . ASN A 1 533 ? -6.146  16.259  16.565  1.00 96.78  ? 533 ASN A OD1 1 
ATOM   4203 N  ND2 . ASN A 1 533 ? -7.356  15.283  18.202  1.00 88.93  ? 533 ASN A ND2 1 
ATOM   4204 N  N   . ALA A 1 534 ? -3.460  14.356  19.808  1.00 81.77  ? 534 ALA A N   1 
ATOM   4205 C  CA  . ALA A 1 534 ? -3.125  14.969  21.089  1.00 88.55  ? 534 ALA A CA  1 
ATOM   4206 C  C   . ALA A 1 534 ? -1.808  15.734  21.018  1.00 97.23  ? 534 ALA A C   1 
ATOM   4207 O  O   . ALA A 1 534 ? -1.712  16.869  21.503  1.00 94.51  ? 534 ALA A O   1 
ATOM   4208 C  CB  . ALA A 1 534 ? -3.055  13.892  22.166  1.00 86.30  ? 534 ALA A CB  1 
ATOM   4209 N  N   . THR A 1 535 ? -0.779  15.122  20.437  1.00 113.66 ? 535 THR A N   1 
ATOM   4210 C  CA  . THR A 1 535 ? 0.530   15.759  20.286  1.00 131.78 ? 535 THR A CA  1 
ATOM   4211 C  C   . THR A 1 535 ? 1.015   15.683  18.838  1.00 134.94 ? 535 THR A C   1 
ATOM   4212 O  O   . THR A 1 535 ? 1.043   16.688  18.123  1.00 136.21 ? 535 THR A O   1 
ATOM   4213 C  CB  . THR A 1 535 ? 1.604   15.114  21.206  1.00 135.84 ? 535 THR A CB  1 
ATOM   4214 O  OG1 . THR A 1 535 ? 1.745   13.717  20.905  1.00 128.49 ? 535 THR A OG1 1 
ATOM   4215 C  CG2 . THR A 1 535 ? 1.220   15.286  22.662  1.00 140.36 ? 535 THR A CG2 1 
ATOM   4216 N  N   . SER B 1 4   ? 22.591  -10.984 84.882  1.00 92.53  ? 4   SER B N   1 
ATOM   4217 C  CA  . SER B 1 4   ? 21.625  -11.922 84.315  1.00 94.11  ? 4   SER B CA  1 
ATOM   4218 C  C   . SER B 1 4   ? 21.519  -11.748 82.800  1.00 88.54  ? 4   SER B C   1 
ATOM   4219 O  O   . SER B 1 4   ? 21.872  -10.698 82.252  1.00 92.45  ? 4   SER B O   1 
ATOM   4220 C  CB  . SER B 1 4   ? 20.241  -11.742 84.967  1.00 88.98  ? 4   SER B CB  1 
ATOM   4221 O  OG  . SER B 1 4   ? 19.322  -12.748 84.560  1.00 77.87  ? 4   SER B OG  1 
ATOM   4222 N  N   . GLU B 1 5   ? 21.029  -12.795 82.131  1.00 72.21  ? 5   GLU B N   1 
ATOM   4223 C  CA  . GLU B 1 5   ? 20.781  -12.719 80.694  1.00 64.50  ? 5   GLU B CA  1 
ATOM   4224 C  C   . GLU B 1 5   ? 19.795  -11.617 80.341  1.00 61.69  ? 5   GLU B C   1 
ATOM   4225 O  O   . GLU B 1 5   ? 19.864  -11.050 79.244  1.00 68.08  ? 5   GLU B O   1 
ATOM   4226 C  CB  . GLU B 1 5   ? 20.235  -14.051 80.189  1.00 67.43  ? 5   GLU B CB  1 
ATOM   4227 C  CG  . GLU B 1 5   ? 20.948  -14.634 78.994  1.00 70.77  ? 5   GLU B CG  1 
ATOM   4228 C  CD  . GLU B 1 5   ? 20.318  -15.938 78.530  1.00 78.63  ? 5   GLU B CD  1 
ATOM   4229 O  OE1 . GLU B 1 5   ? 19.231  -16.294 79.036  1.00 86.89  ? 5   GLU B OE1 1 
ATOM   4230 O  OE2 . GLU B 1 5   ? 20.910  -16.608 77.659  1.00 77.77  1 5   GLU B OE2 1 
ATOM   4231 N  N   . LEU B 1 6   ? 18.863  -11.316 81.243  1.00 53.18  ? 6   LEU B N   1 
ATOM   4232 C  CA  . LEU B 1 6   ? 17.741  -10.435 80.959  1.00 43.85  ? 6   LEU B CA  1 
ATOM   4233 C  C   . LEU B 1 6   ? 17.945  -9.015  81.456  1.00 54.23  ? 6   LEU B C   1 
ATOM   4234 O  O   . LEU B 1 6   ? 17.185  -8.126  81.057  1.00 51.13  ? 6   LEU B O   1 
ATOM   4235 C  CB  . LEU B 1 6   ? 16.448  -10.977 81.581  1.00 36.54  ? 6   LEU B CB  1 
ATOM   4236 C  CG  . LEU B 1 6   ? 16.061  -12.438 81.366  1.00 50.13  ? 6   LEU B CG  1 
ATOM   4237 C  CD1 . LEU B 1 6   ? 14.566  -12.603 81.601  1.00 50.73  ? 6   LEU B CD1 1 
ATOM   4238 C  CD2 . LEU B 1 6   ? 16.448  -12.921 79.969  1.00 59.57  ? 6   LEU B CD2 1 
ATOM   4239 N  N   . LEU B 1 7   ? 18.909  -8.774  82.339  1.00 65.40  ? 7   LEU B N   1 
ATOM   4240 C  CA  . LEU B 1 7   ? 19.249  -7.411  82.703  1.00 69.25  ? 7   LEU B CA  1 
ATOM   4241 C  C   . LEU B 1 7   ? 20.418  -6.971  81.832  1.00 72.97  ? 7   LEU B C   1 
ATOM   4242 O  O   . LEU B 1 7   ? 21.487  -7.595  81.845  1.00 92.74  ? 7   LEU B O   1 
ATOM   4243 C  CB  . LEU B 1 7   ? 19.574  -7.253  84.186  1.00 67.89  ? 7   LEU B CB  1 
ATOM   4244 C  CG  . LEU B 1 7   ? 19.679  -5.737  84.386  1.00 69.89  ? 7   LEU B CG  1 
ATOM   4245 C  CD1 . LEU B 1 7   ? 18.416  -5.185  85.000  1.00 67.19  ? 7   LEU B CD1 1 
ATOM   4246 C  CD2 . LEU B 1 7   ? 20.904  -5.340  85.196  1.00 77.99  ? 7   LEU B CD2 1 
ATOM   4247 N  N   . VAL B 1 8   ? 20.190  -5.907  81.070  1.00 51.53  ? 8   VAL B N   1 
ATOM   4248 C  CA  . VAL B 1 8   ? 21.124  -5.374  80.092  1.00 50.10  ? 8   VAL B CA  1 
ATOM   4249 C  C   . VAL B 1 8   ? 21.238  -3.881  80.350  1.00 48.06  ? 8   VAL B C   1 
ATOM   4250 O  O   . VAL B 1 8   ? 20.216  -3.199  80.478  1.00 34.08  ? 8   VAL B O   1 
ATOM   4251 C  CB  . VAL B 1 8   ? 20.637  -5.649  78.654  1.00 48.81  ? 8   VAL B CB  1 
ATOM   4252 C  CG1 . VAL B 1 8   ? 21.601  -5.057  77.629  1.00 39.71  ? 8   VAL B CG1 1 
ATOM   4253 C  CG2 . VAL B 1 8   ? 20.435  -7.157  78.436  1.00 44.02  ? 8   VAL B CG2 1 
ATOM   4254 N  N   . ASN B 1 9   ? 22.472  -3.371  80.436  1.00 57.55  ? 9   ASN B N   1 
ATOM   4255 C  CA  . ASN B 1 9   ? 22.717  -1.973  80.791  1.00 61.30  ? 9   ASN B CA  1 
ATOM   4256 C  C   . ASN B 1 9   ? 23.147  -1.224  79.531  1.00 58.82  ? 9   ASN B C   1 
ATOM   4257 O  O   . ASN B 1 9   ? 24.256  -1.431  79.021  1.00 64.07  ? 9   ASN B O   1 
ATOM   4258 C  CB  . ASN B 1 9   ? 23.750  -1.885  81.917  1.00 69.37  ? 9   ASN B CB  1 
ATOM   4259 C  CG  . ASN B 1 9   ? 24.312  -0.488  82.111  1.00 78.79  ? 9   ASN B CG  1 
ATOM   4260 O  OD1 . ASN B 1 9   ? 23.574  0.468   82.386  1.00 76.90  ? 9   ASN B OD1 1 
ATOM   4261 N  ND2 . ASN B 1 9   ? 25.638  -0.380  82.047  1.00 88.97  ? 9   ASN B ND2 1 
ATOM   4262 N  N   . THR B 1 10  ? 22.262  -0.360  79.029  1.00 48.43  ? 10  THR B N   1 
ATOM   4263 C  CA  . THR B 1 10  ? 22.455  0.339   77.771  1.00 54.16  ? 10  THR B CA  1 
ATOM   4264 C  C   . THR B 1 10  ? 23.024  1.736   78.003  1.00 65.20  ? 10  THR B C   1 
ATOM   4265 O  O   . THR B 1 10  ? 23.297  2.156   79.129  1.00 78.94  ? 10  THR B O   1 
ATOM   4266 C  CB  . THR B 1 10  ? 21.139  0.453   77.005  1.00 52.83  ? 10  THR B CB  1 
ATOM   4267 O  OG1 . THR B 1 10  ? 20.389  1.530   77.565  1.00 58.88  ? 10  THR B OG1 1 
ATOM   4268 C  CG2 . THR B 1 10  ? 20.335  -0.833  77.115  1.00 48.77  ? 10  THR B CG2 1 
ATOM   4269 N  N   . LYS B 1 11  ? 23.195  2.468   76.900  1.00 56.33  ? 11  LYS B N   1 
ATOM   4270 C  CA  . LYS B 1 11  ? 23.636  3.853   76.935  1.00 45.43  ? 11  LYS B CA  1 
ATOM   4271 C  C   . LYS B 1 11  ? 22.535  4.814   77.362  1.00 44.23  ? 11  LYS B C   1 
ATOM   4272 O  O   . LYS B 1 11  ? 22.811  6.005   77.544  1.00 50.82  ? 11  LYS B O   1 
ATOM   4273 C  CB  . LYS B 1 11  ? 24.188  4.250   75.564  1.00 44.81  ? 11  LYS B CB  1 
ATOM   4274 C  CG  . LYS B 1 11  ? 25.415  3.426   75.169  1.00 57.59  ? 11  LYS B CG  1 
ATOM   4275 C  CD  . LYS B 1 11  ? 26.325  4.159   74.188  1.00 61.04  ? 11  LYS B CD  1 
ATOM   4276 C  CE  . LYS B 1 11  ? 27.683  3.483   74.080  1.00 65.59  ? 11  LYS B CE  1 
ATOM   4277 N  NZ  . LYS B 1 11  ? 28.111  3.349   72.653  1.00 73.90  1 11  LYS B NZ  1 
ATOM   4278 N  N   . SER B 1 12  ? 21.305  4.332   77.535  1.00 38.72  ? 12  SER B N   1 
ATOM   4279 C  CA  . SER B 1 12  ? 20.202  5.162   77.991  1.00 51.46  ? 12  SER B CA  1 
ATOM   4280 C  C   . SER B 1 12  ? 19.652  4.715   79.333  1.00 63.63  ? 12  SER B C   1 
ATOM   4281 O  O   . SER B 1 12  ? 18.801  5.409   79.899  1.00 66.97  ? 12  SER B O   1 
ATOM   4282 C  CB  . SER B 1 12  ? 19.063  5.163   76.959  1.00 59.34  ? 12  SER B CB  1 
ATOM   4283 O  OG  . SER B 1 12  ? 19.447  5.792   75.749  1.00 68.91  ? 12  SER B OG  1 
ATOM   4284 N  N   . GLY B 1 13  ? 20.110  3.581   79.855  1.00 67.46  ? 13  GLY B N   1 
ATOM   4285 C  CA  . GLY B 1 13  ? 19.601  3.057   81.106  1.00 63.36  ? 13  GLY B CA  1 
ATOM   4286 C  C   . GLY B 1 13  ? 19.537  1.553   81.057  1.00 63.05  ? 13  GLY B C   1 
ATOM   4287 O  O   . GLY B 1 13  ? 19.833  0.963   80.017  1.00 77.98  ? 13  GLY B O   1 
ATOM   4288 N  N   . LYS B 1 14  ? 19.166  0.915   82.156  1.00 52.28  ? 14  LYS B N   1 
ATOM   4289 C  CA  . LYS B 1 14  ? 19.049  -0.533  82.168  1.00 47.33  ? 14  LYS B CA  1 
ATOM   4290 C  C   . LYS B 1 14  ? 17.640  -0.961  81.750  1.00 46.09  ? 14  LYS B C   1 
ATOM   4291 O  O   . LYS B 1 14  ? 16.648  -0.260  81.995  1.00 41.35  ? 14  LYS B O   1 
ATOM   4292 C  CB  . LYS B 1 14  ? 19.387  -1.100  83.553  1.00 43.63  ? 14  LYS B CB  1 
ATOM   4293 C  CG  . LYS B 1 14  ? 20.323  -0.258  84.384  1.00 47.37  ? 14  LYS B CG  1 
ATOM   4294 C  CD  . LYS B 1 14  ? 20.293  -0.705  85.843  1.00 62.72  ? 14  LYS B CD  1 
ATOM   4295 C  CE  . LYS B 1 14  ? 21.113  0.224   86.779  1.00 64.04  ? 14  LYS B CE  1 
ATOM   4296 N  NZ  . LYS B 1 14  ? 20.990  -0.095  88.247  1.00 45.21  1 14  LYS B NZ  1 
ATOM   4297 N  N   . VAL B 1 15  ? 17.563  -2.133  81.120  1.00 33.32  ? 15  VAL B N   1 
ATOM   4298 C  CA  . VAL B 1 15  ? 16.306  -2.729  80.690  1.00 46.46  ? 15  VAL B CA  1 
ATOM   4299 C  C   . VAL B 1 15  ? 16.194  -4.137  81.267  1.00 54.35  ? 15  VAL B C   1 
ATOM   4300 O  O   . VAL B 1 15  ? 17.145  -4.925  81.207  1.00 33.97  ? 15  VAL B O   1 
ATOM   4301 C  CB  . VAL B 1 15  ? 16.177  -2.751  79.144  1.00 43.68  ? 15  VAL B CB  1 
ATOM   4302 C  CG1 . VAL B 1 15  ? 16.104  -1.331  78.589  1.00 31.13  ? 15  VAL B CG1 1 
ATOM   4303 C  CG2 . VAL B 1 15  ? 17.336  -3.517  78.494  1.00 43.06  ? 15  VAL B CG2 1 
ATOM   4304 N  N   . MET B 1 16  ? 15.017  -4.455  81.815  1.00 57.64  ? 16  MET B N   1 
ATOM   4305 C  CA  . MET B 1 16  ? 14.664  -5.815  82.212  1.00 56.08  ? 16  MET B CA  1 
ATOM   4306 C  C   . MET B 1 16  ? 13.806  -6.433  81.114  1.00 53.03  ? 16  MET B C   1 
ATOM   4307 O  O   . MET B 1 16  ? 12.750  -5.894  80.775  1.00 52.91  ? 16  MET B O   1 
ATOM   4308 C  CB  . MET B 1 16  ? 13.919  -5.819  83.548  1.00 59.40  ? 16  MET B CB  1 
ATOM   4309 C  CG  . MET B 1 16  ? 13.466  -7.182  84.062  1.00 63.92  ? 16  MET B CG  1 
ATOM   4310 S  SD  . MET B 1 16  ? 14.828  -8.250  84.587  1.00 69.06  ? 16  MET B SD  1 
ATOM   4311 C  CE  . MET B 1 16  ? 15.363  -7.410  86.084  1.00 73.72  ? 16  MET B CE  1 
ATOM   4312 N  N   . GLY B 1 17  ? 14.272  -7.548  80.545  1.00 52.16  ? 17  GLY B N   1 
ATOM   4313 C  CA  . GLY B 1 17  ? 13.513  -8.301  79.570  1.00 43.51  ? 17  GLY B CA  1 
ATOM   4314 C  C   . GLY B 1 17  ? 12.858  -9.534  80.175  1.00 54.44  ? 17  GLY B C   1 
ATOM   4315 O  O   . GLY B 1 17  ? 12.799  -9.720  81.393  1.00 64.10  ? 17  GLY B O   1 
ATOM   4316 N  N   . THR B 1 18  ? 12.366  -10.398 79.294  1.00 50.51  ? 18  THR B N   1 
ATOM   4317 C  CA  . THR B 1 18  ? 11.630  -11.587 79.700  1.00 56.74  ? 18  THR B CA  1 
ATOM   4318 C  C   . THR B 1 18  ? 12.088  -12.793 78.898  1.00 56.71  ? 18  THR B C   1 
ATOM   4319 O  O   . THR B 1 18  ? 12.423  -12.679 77.717  1.00 63.71  ? 18  THR B O   1 
ATOM   4320 C  CB  . THR B 1 18  ? 10.128  -11.409 79.492  1.00 72.18  ? 18  THR B CB  1 
ATOM   4321 O  OG1 . THR B 1 18  ? 9.480   -12.684 79.588  1.00 77.46  ? 18  THR B OG1 1 
ATOM   4322 C  CG2 . THR B 1 18  ? 9.858   -10.806 78.119  1.00 74.05  ? 18  THR B CG2 1 
ATOM   4323 N  N   . ARG B 1 19  ? 12.088  -13.957 79.544  1.00 53.16  ? 19  ARG B N   1 
ATOM   4324 C  CA  . ARG B 1 19  ? 12.393  -15.217 78.871  1.00 50.97  ? 19  ARG B CA  1 
ATOM   4325 C  C   . ARG B 1 19  ? 11.087  -15.796 78.335  1.00 56.44  ? 19  ARG B C   1 
ATOM   4326 O  O   . ARG B 1 19  ? 10.205  -16.178 79.107  1.00 62.35  ? 19  ARG B O   1 
ATOM   4327 C  CB  . ARG B 1 19  ? 13.102  -16.189 79.814  1.00 41.89  ? 19  ARG B CB  1 
ATOM   4328 C  CG  . ARG B 1 19  ? 12.961  -17.666 79.438  1.00 58.51  ? 19  ARG B CG  1 
ATOM   4329 C  CD  . ARG B 1 19  ? 14.007  -18.538 80.141  1.00 74.90  ? 19  ARG B CD  1 
ATOM   4330 N  NE  . ARG B 1 19  ? 15.352  -18.274 79.626  1.00 91.28  ? 19  ARG B NE  1 
ATOM   4331 C  CZ  . ARG B 1 19  ? 16.040  -19.101 78.838  1.00 96.91  ? 19  ARG B CZ  1 
ATOM   4332 N  NH1 . ARG B 1 19  ? 17.251  -18.757 78.416  1.00 97.76  1 19  ARG B NH1 1 
ATOM   4333 N  NH2 . ARG B 1 19  ? 15.536  -20.279 78.486  1.00 94.54  ? 19  ARG B NH2 1 
ATOM   4334 N  N   . VAL B 1 20  ? 10.951  -15.845 77.015  1.00 57.61  ? 20  VAL B N   1 
ATOM   4335 C  CA  . VAL B 1 20  ? 9.718   -16.328 76.404  1.00 61.70  ? 20  VAL B CA  1 
ATOM   4336 C  C   . VAL B 1 20  ? 10.011  -17.660 75.725  1.00 62.74  ? 20  VAL B C   1 
ATOM   4337 O  O   . VAL B 1 20  ? 11.168  -17.941 75.381  1.00 60.23  ? 20  VAL B O   1 
ATOM   4338 C  CB  . VAL B 1 20  ? 9.145   -15.296 75.418  1.00 64.51  ? 20  VAL B CB  1 
ATOM   4339 C  CG1 . VAL B 1 20  ? 9.174   -13.906 76.037  1.00 73.75  ? 20  VAL B CG1 1 
ATOM   4340 C  CG2 . VAL B 1 20  ? 9.899   -15.303 74.117  1.00 53.74  ? 20  VAL B CG2 1 
ATOM   4341 N  N   . PRO B 1 21  ? 9.017   -18.513 75.525  1.00 60.06  ? 21  PRO B N   1 
ATOM   4342 C  CA  . PRO B 1 21  ? 9.264   -19.794 74.869  1.00 57.00  ? 21  PRO B CA  1 
ATOM   4343 C  C   . PRO B 1 21  ? 8.999   -19.704 73.370  1.00 62.45  ? 21  PRO B C   1 
ATOM   4344 O  O   . PRO B 1 21  ? 8.404   -18.746 72.862  1.00 53.97  ? 21  PRO B O   1 
ATOM   4345 C  CB  . PRO B 1 21  ? 8.258   -20.717 75.551  1.00 55.28  ? 21  PRO B CB  1 
ATOM   4346 C  CG  . PRO B 1 21  ? 7.079   -19.796 75.785  1.00 52.41  ? 21  PRO B CG  1 
ATOM   4347 C  CD  . PRO B 1 21  ? 7.625   -18.403 75.995  1.00 50.01  ? 21  PRO B CD  1 
ATOM   4348 N  N   . VAL B 1 22  ? 9.465   -20.738 72.673  1.00 63.61  ? 22  VAL B N   1 
ATOM   4349 C  CA  . VAL B 1 22  ? 9.393   -20.858 71.225  1.00 57.72  ? 22  VAL B CA  1 
ATOM   4350 C  C   . VAL B 1 22  ? 9.846   -22.263 70.851  1.00 56.02  ? 22  VAL B C   1 
ATOM   4351 O  O   . VAL B 1 22  ? 10.968  -22.671 71.174  1.00 48.80  ? 22  VAL B O   1 
ATOM   4352 C  CB  . VAL B 1 22  ? 10.249  -19.784 70.521  1.00 57.00  ? 22  VAL B CB  1 
ATOM   4353 C  CG1 . VAL B 1 22  ? 11.647  -19.721 71.113  1.00 50.67  ? 22  VAL B CG1 1 
ATOM   4354 C  CG2 . VAL B 1 22  ? 10.331  -20.063 69.034  1.00 56.05  ? 22  VAL B CG2 1 
ATOM   4355 N  N   . LEU B 1 23  ? 8.957   -23.023 70.214  1.00 62.48  ? 23  LEU B N   1 
ATOM   4356 C  CA  . LEU B 1 23  ? 9.314   -24.241 69.488  1.00 70.80  ? 23  LEU B CA  1 
ATOM   4357 C  C   . LEU B 1 23  ? 10.073  -25.227 70.381  1.00 73.01  ? 23  LEU B C   1 
ATOM   4358 O  O   . LEU B 1 23  ? 11.186  -25.669 70.072  1.00 70.72  ? 23  LEU B O   1 
ATOM   4359 C  CB  . LEU B 1 23  ? 10.130  -23.890 68.239  1.00 68.25  ? 23  LEU B CB  1 
ATOM   4360 C  CG  . LEU B 1 23  ? 9.467   -23.133 67.081  1.00 58.12  ? 23  LEU B CG  1 
ATOM   4361 C  CD1 . LEU B 1 23  ? 10.545  -22.632 66.126  1.00 49.96  ? 23  LEU B CD1 1 
ATOM   4362 C  CD2 . LEU B 1 23  ? 8.462   -24.013 66.346  1.00 55.08  ? 23  LEU B CD2 1 
ATOM   4363 N  N   . SER B 1 24  ? 9.451   -25.559 71.512  1.00 68.73  ? 24  SER B N   1 
ATOM   4364 C  CA  . SER B 1 24  ? 10.031  -26.495 72.480  1.00 74.70  ? 24  SER B CA  1 
ATOM   4365 C  C   . SER B 1 24  ? 11.385  -26.010 73.001  1.00 69.39  ? 24  SER B C   1 
ATOM   4366 O  O   . SER B 1 24  ? 12.267  -26.817 73.311  1.00 74.00  ? 24  SER B O   1 
ATOM   4367 C  CB  . SER B 1 24  ? 10.169  -27.905 71.887  1.00 83.63  ? 24  SER B CB  1 
ATOM   4368 O  OG  . SER B 1 24  ? 8.925   -28.386 71.398  1.00 92.83  ? 24  SER B OG  1 
ATOM   4369 N  N   . SER B 1 25  ? 11.565  -24.694 73.085  1.00 58.95  ? 25  SER B N   1 
ATOM   4370 C  CA  . SER B 1 25  ? 12.758  -24.083 73.661  1.00 60.44  ? 25  SER B CA  1 
ATOM   4371 C  C   . SER B 1 25  ? 12.388  -22.675 74.119  1.00 65.93  ? 25  SER B C   1 
ATOM   4372 O  O   . SER B 1 25  ? 11.206  -22.332 74.222  1.00 76.03  ? 25  SER B O   1 
ATOM   4373 C  CB  . SER B 1 25  ? 13.917  -24.080 72.660  1.00 60.60  ? 25  SER B CB  1 
ATOM   4374 O  OG  . SER B 1 25  ? 15.112  -23.657 73.290  1.00 59.44  ? 25  SER B OG  1 
ATOM   4375 N  N   . HIS B 1 26  ? 13.394  -21.854 74.408  1.00 61.18  ? 26  HIS B N   1 
ATOM   4376 C  CA  . HIS B 1 26  ? 13.130  -20.510 74.901  1.00 61.12  ? 26  HIS B CA  1 
ATOM   4377 C  C   . HIS B 1 26  ? 14.138  -19.532 74.331  1.00 52.51  ? 26  HIS B C   1 
ATOM   4378 O  O   . HIS B 1 26  ? 15.269  -19.897 73.999  1.00 54.76  ? 26  HIS B O   1 
ATOM   4379 C  CB  . HIS B 1 26  ? 13.176  -20.422 76.434  1.00 72.25  ? 26  HIS B CB  1 
ATOM   4380 C  CG  . HIS B 1 26  ? 12.284  -21.404 77.123  1.00 85.35  ? 26  HIS B CG  1 
ATOM   4381 N  ND1 . HIS B 1 26  ? 12.574  -22.750 77.192  1.00 90.12  ? 26  HIS B ND1 1 
ATOM   4382 C  CD2 . HIS B 1 26  ? 11.107  -21.238 77.772  1.00 87.10  ? 26  HIS B CD2 1 
ATOM   4383 C  CE1 . HIS B 1 26  ? 11.613  -23.371 77.853  1.00 89.82  ? 26  HIS B CE1 1 
ATOM   4384 N  NE2 . HIS B 1 26  ? 10.711  -22.476 78.215  1.00 88.70  ? 26  HIS B NE2 1 
ATOM   4385 N  N   . ILE B 1 27  ? 13.717  -18.271 74.270  1.00 49.00  ? 27  ILE B N   1 
ATOM   4386 C  CA  . ILE B 1 27  ? 14.506  -17.170 73.739  1.00 56.51  ? 27  ILE B CA  1 
ATOM   4387 C  C   . ILE B 1 27  ? 14.360  -15.998 74.712  1.00 51.18  ? 27  ILE B C   1 
ATOM   4388 O  O   . ILE B 1 27  ? 13.491  -15.989 75.588  1.00 40.34  ? 27  ILE B O   1 
ATOM   4389 C  CB  . ILE B 1 27  ? 14.043  -16.818 72.293  1.00 61.26  ? 27  ILE B CB  1 
ATOM   4390 C  CG1 . ILE B 1 27  ? 14.895  -15.750 71.614  1.00 57.20  ? 27  ILE B CG1 1 
ATOM   4391 C  CG2 . ILE B 1 27  ? 12.588  -16.416 72.255  1.00 65.49  ? 27  ILE B CG2 1 
ATOM   4392 C  CD1 . ILE B 1 27  ? 14.988  -15.949 70.106  1.00 57.32  ? 27  ILE B CD1 1 
ATOM   4393 N  N   . SER B 1 28  ? 15.251  -15.024 74.596  1.00 55.04  ? 28  SER B N   1 
ATOM   4394 C  CA  . SER B 1 28  ? 15.157  -13.820 75.412  1.00 53.62  ? 28  SER B CA  1 
ATOM   4395 C  C   . SER B 1 28  ? 14.520  -12.695 74.606  1.00 48.18  ? 28  SER B C   1 
ATOM   4396 O  O   . SER B 1 28  ? 14.852  -12.491 73.433  1.00 47.76  ? 28  SER B O   1 
ATOM   4397 C  CB  . SER B 1 28  ? 16.533  -13.397 75.928  1.00 51.52  ? 28  SER B CB  1 
ATOM   4398 O  OG  . SER B 1 28  ? 16.930  -14.247 76.987  1.00 59.23  ? 28  SER B OG  1 
ATOM   4399 N  N   . ALA B 1 29  ? 13.606  -11.965 75.238  1.00 40.39  ? 29  ALA B N   1 
ATOM   4400 C  CA  . ALA B 1 29  ? 12.876  -10.896 74.569  1.00 41.67  ? 29  ALA B CA  1 
ATOM   4401 C  C   . ALA B 1 29  ? 12.996  -9.606  75.369  1.00 36.04  ? 29  ALA B C   1 
ATOM   4402 O  O   . ALA B 1 29  ? 12.943  -9.622  76.598  1.00 39.55  ? 29  ALA B O   1 
ATOM   4403 C  CB  . ALA B 1 29  ? 11.393  -11.269 74.375  1.00 31.63  ? 29  ALA B CB  1 
ATOM   4404 N  N   . PHE B 1 30  ? 13.165  -8.492  74.665  1.00 38.59  ? 30  PHE B N   1 
ATOM   4405 C  CA  . PHE B 1 30  ? 13.161  -7.154  75.257  1.00 45.81  ? 30  PHE B CA  1 
ATOM   4406 C  C   . PHE B 1 30  ? 12.113  -6.346  74.488  1.00 50.59  ? 30  PHE B C   1 
ATOM   4407 O  O   . PHE B 1 30  ? 12.355  -5.924  73.351  1.00 52.23  ? 30  PHE B O   1 
ATOM   4408 C  CB  . PHE B 1 30  ? 14.556  -6.519  75.202  1.00 41.67  ? 30  PHE B CB  1 
ATOM   4409 C  CG  . PHE B 1 30  ? 15.617  -7.342  75.882  1.00 38.76  ? 30  PHE B CG  1 
ATOM   4410 C  CD1 . PHE B 1 30  ? 16.229  -8.395  75.216  1.00 42.28  ? 30  PHE B CD1 1 
ATOM   4411 C  CD2 . PHE B 1 30  ? 15.997  -7.076  77.183  1.00 43.03  ? 30  PHE B CD2 1 
ATOM   4412 C  CE1 . PHE B 1 30  ? 17.185  -9.165  75.833  1.00 43.19  ? 30  PHE B CE1 1 
ATOM   4413 C  CE2 . PHE B 1 30  ? 16.960  -7.847  77.811  1.00 41.65  ? 30  PHE B CE2 1 
ATOM   4414 C  CZ  . PHE B 1 30  ? 17.548  -8.894  77.135  1.00 46.29  ? 30  PHE B CZ  1 
ATOM   4415 N  N   . LEU B 1 31  ? 10.954  -6.141  75.116  1.00 43.08  ? 31  LEU B N   1 
ATOM   4416 C  CA  . LEU B 1 31  ? 9.761   -5.594  74.481  1.00 34.27  ? 31  LEU B CA  1 
ATOM   4417 C  C   . LEU B 1 31  ? 9.454   -4.190  74.986  1.00 33.27  ? 31  LEU B C   1 
ATOM   4418 O  O   . LEU B 1 31  ? 9.529   -3.922  76.185  1.00 42.62  ? 31  LEU B O   1 
ATOM   4419 C  CB  . LEU B 1 31  ? 8.556   -6.499  74.747  1.00 34.38  ? 31  LEU B CB  1 
ATOM   4420 C  CG  . LEU B 1 31  ? 8.692   -7.954  74.293  1.00 39.73  ? 31  LEU B CG  1 
ATOM   4421 C  CD1 . LEU B 1 31  ? 7.437   -8.730  74.633  1.00 39.62  ? 31  LEU B CD1 1 
ATOM   4422 C  CD2 . LEU B 1 31  ? 8.968   -8.008  72.790  1.00 34.64  ? 31  LEU B CD2 1 
ATOM   4423 N  N   . GLY B 1 32  ? 9.090   -3.302  74.067  1.00 32.59  ? 32  GLY B N   1 
ATOM   4424 C  CA  . GLY B 1 32  ? 8.700   -1.948  74.424  1.00 28.12  ? 32  GLY B CA  1 
ATOM   4425 C  C   . GLY B 1 32  ? 9.809   -1.012  74.881  1.00 38.92  ? 32  GLY B C   1 
ATOM   4426 O  O   . GLY B 1 32  ? 9.522   -0.048  75.593  1.00 44.07  ? 32  GLY B O   1 
ATOM   4427 N  N   . ILE B 1 33  ? 11.056  -1.243  74.484  1.00 34.73  ? 33  ILE B N   1 
ATOM   4428 C  CA  . ILE B 1 33  ? 12.129  -0.334  74.918  1.00 36.97  ? 33  ILE B CA  1 
ATOM   4429 C  C   . ILE B 1 33  ? 11.968  1.014   74.222  1.00 34.66  ? 33  ILE B C   1 
ATOM   4430 O  O   . ILE B 1 33  ? 11.894  1.060   72.985  1.00 40.66  ? 33  ILE B O   1 
ATOM   4431 C  CB  . ILE B 1 33  ? 13.501  -0.944  74.617  1.00 40.81  ? 33  ILE B CB  1 
ATOM   4432 C  CG1 . ILE B 1 33  ? 13.714  -2.202  75.450  1.00 39.80  ? 33  ILE B CG1 1 
ATOM   4433 C  CG2 . ILE B 1 33  ? 14.615  0.076   74.874  1.00 35.27  ? 33  ILE B CG2 1 
ATOM   4434 C  CD1 . ILE B 1 33  ? 14.808  -3.054  74.943  1.00 33.44  ? 33  ILE B CD1 1 
ATOM   4435 N  N   . PRO B 1 34  ? 11.931  2.130   74.951  1.00 38.35  ? 34  PRO B N   1 
ATOM   4436 C  CA  . PRO B 1 34  ? 11.758  3.435   74.292  1.00 39.95  ? 34  PRO B CA  1 
ATOM   4437 C  C   . PRO B 1 34  ? 13.061  3.938   73.693  1.00 36.54  ? 34  PRO B C   1 
ATOM   4438 O  O   . PRO B 1 34  ? 14.120  3.849   74.322  1.00 38.02  ? 34  PRO B O   1 
ATOM   4439 C  CB  . PRO B 1 34  ? 11.282  4.343   75.434  1.00 39.60  ? 34  PRO B CB  1 
ATOM   4440 C  CG  . PRO B 1 34  ? 11.928  3.746   76.670  1.00 39.22  ? 34  PRO B CG  1 
ATOM   4441 C  CD  . PRO B 1 34  ? 11.988  2.246   76.424  1.00 39.09  ? 34  PRO B CD  1 
ATOM   4442 N  N   . PHE B 1 35  ? 12.983  4.465   72.451  1.00 35.92  ? 35  PHE B N   1 
ATOM   4443 C  CA  . PHE B 1 35  ? 14.168  5.004   71.779  1.00 39.21  ? 35  PHE B CA  1 
ATOM   4444 C  C   . PHE B 1 35  ? 14.091  6.502   71.530  1.00 35.21  ? 35  PHE B C   1 
ATOM   4445 O  O   . PHE B 1 35  ? 15.053  7.076   70.994  1.00 39.67  ? 35  PHE B O   1 
ATOM   4446 C  CB  . PHE B 1 35  ? 14.471  4.258   70.450  1.00 43.44  ? 35  PHE B CB  1 
ATOM   4447 C  CG  . PHE B 1 35  ? 13.432  4.434   69.360  1.00 39.64  ? 35  PHE B CG  1 
ATOM   4448 C  CD1 . PHE B 1 35  ? 13.448  5.541   68.523  1.00 39.22  ? 35  PHE B CD1 1 
ATOM   4449 C  CD2 . PHE B 1 35  ? 12.446  3.478   69.163  1.00 42.56  ? 35  PHE B CD2 1 
ATOM   4450 C  CE1 . PHE B 1 35  ? 12.479  5.702   67.530  1.00 29.05  ? 35  PHE B CE1 1 
ATOM   4451 C  CE2 . PHE B 1 35  ? 11.469  3.635   68.177  1.00 29.86  ? 35  PHE B CE2 1 
ATOM   4452 C  CZ  . PHE B 1 35  ? 11.490  4.753   67.366  1.00 24.92  ? 35  PHE B CZ  1 
ATOM   4453 N  N   . ALA B 1 36  ? 13.010  7.160   71.931  1.00 30.66  ? 36  ALA B N   1 
ATOM   4454 C  CA  . ALA B 1 36  ? 12.918  8.597   71.718  1.00 36.65  ? 36  ALA B CA  1 
ATOM   4455 C  C   . ALA B 1 36  ? 11.918  9.193   72.703  1.00 47.81  ? 36  ALA B C   1 
ATOM   4456 O  O   . ALA B 1 36  ? 11.122  8.480   73.325  1.00 49.45  ? 36  ALA B O   1 
ATOM   4457 C  CB  . ALA B 1 36  ? 12.527  8.918   70.268  1.00 32.89  ? 36  ALA B CB  1 
ATOM   4458 N  N   . GLU B 1 37  ? 11.982  10.515  72.853  1.00 53.33  ? 37  GLU B N   1 
ATOM   4459 C  CA  . GLU B 1 37  ? 11.024  11.206  73.718  1.00 48.93  ? 37  GLU B CA  1 
ATOM   4460 C  C   . GLU B 1 37  ? 9.620   11.092  73.126  1.00 53.09  ? 37  GLU B C   1 
ATOM   4461 O  O   . GLU B 1 37  ? 9.466   11.122  71.901  1.00 59.52  ? 37  GLU B O   1 
ATOM   4462 C  CB  . GLU B 1 37  ? 11.408  12.676  73.895  1.00 37.06  ? 37  GLU B CB  1 
ATOM   4463 C  CG  . GLU B 1 37  ? 12.600  12.855  74.778  1.00 32.21  ? 37  GLU B CG  1 
ATOM   4464 C  CD  . GLU B 1 37  ? 12.285  12.468  76.213  1.00 45.09  ? 37  GLU B CD  1 
ATOM   4465 O  OE1 . GLU B 1 37  ? 12.802  11.434  76.676  1.00 51.96  ? 37  GLU B OE1 1 
ATOM   4466 O  OE2 . GLU B 1 37  ? 11.495  13.172  76.877  1.00 49.48  1 37  GLU B OE2 1 
ATOM   4467 N  N   . PRO B 1 38  ? 8.595   10.919  73.957  1.00 43.00  ? 38  PRO B N   1 
ATOM   4468 C  CA  . PRO B 1 38  ? 7.236   10.711  73.444  1.00 37.12  ? 38  PRO B CA  1 
ATOM   4469 C  C   . PRO B 1 38  ? 6.779   11.900  72.611  1.00 32.24  ? 38  PRO B C   1 
ATOM   4470 O  O   . PRO B 1 38  ? 6.658   13.015  73.133  1.00 39.63  ? 38  PRO B O   1 
ATOM   4471 C  CB  . PRO B 1 38  ? 6.394   10.561  74.725  1.00 36.00  ? 38  PRO B CB  1 
ATOM   4472 C  CG  . PRO B 1 38  ? 7.376   10.534  75.873  1.00 31.20  ? 38  PRO B CG  1 
ATOM   4473 C  CD  . PRO B 1 38  ? 8.749   10.487  75.351  1.00 32.46  ? 38  PRO B CD  1 
ATOM   4474 N  N   . PRO B 1 39  ? 6.496   11.707  71.319  1.00 27.37  ? 39  PRO B N   1 
ATOM   4475 C  CA  . PRO B 1 39  ? 6.216   12.859  70.453  1.00 33.08  ? 39  PRO B CA  1 
ATOM   4476 C  C   . PRO B 1 39  ? 4.831   13.426  70.729  1.00 44.43  ? 39  PRO B C   1 
ATOM   4477 O  O   . PRO B 1 39  ? 3.932   13.310  69.893  1.00 45.03  ? 39  PRO B O   1 
ATOM   4478 C  CB  . PRO B 1 39  ? 6.302   12.264  69.053  1.00 26.37  ? 39  PRO B CB  1 
ATOM   4479 C  CG  . PRO B 1 39  ? 6.758   10.850  69.207  1.00 36.39  ? 39  PRO B CG  1 
ATOM   4480 C  CD  . PRO B 1 39  ? 6.379   10.435  70.595  1.00 32.39  ? 39  PRO B CD  1 
ATOM   4481 N  N   . VAL B 1 40  ? 4.653   14.066  71.882  1.00 47.65  ? 40  VAL B N   1 
ATOM   4482 C  CA  . VAL B 1 40  ? 3.328   14.461  72.334  1.00 42.40  ? 40  VAL B CA  1 
ATOM   4483 C  C   . VAL B 1 40  ? 3.298   15.972  72.490  1.00 40.72  ? 40  VAL B C   1 
ATOM   4484 O  O   . VAL B 1 40  ? 4.296   16.644  72.225  1.00 41.11  ? 40  VAL B O   1 
ATOM   4485 C  CB  . VAL B 1 40  ? 2.971   13.748  73.653  1.00 41.04  ? 40  VAL B CB  1 
ATOM   4486 C  CG1 . VAL B 1 40  ? 2.862   12.254  73.427  1.00 45.92  ? 40  VAL B CG1 1 
ATOM   4487 C  CG2 . VAL B 1 40  ? 3.983   14.038  74.718  1.00 29.41  ? 40  VAL B CG2 1 
ATOM   4488 N  N   . GLY B 1 41  ? 2.150   16.518  72.899  1.00 36.69  ? 41  GLY B N   1 
ATOM   4489 C  CA  . GLY B 1 41  ? 2.021   17.942  73.165  1.00 40.66  ? 41  GLY B CA  1 
ATOM   4490 C  C   . GLY B 1 41  ? 2.463   18.851  72.037  1.00 49.86  ? 41  GLY B C   1 
ATOM   4491 O  O   . GLY B 1 41  ? 1.936   18.774  70.923  1.00 55.18  ? 41  GLY B O   1 
ATOM   4492 N  N   . ASN B 1 42  ? 3.431   19.723  72.320  1.00 62.25  ? 42  ASN B N   1 
ATOM   4493 C  CA  . ASN B 1 42  ? 4.007   20.586  71.294  1.00 59.35  ? 42  ASN B CA  1 
ATOM   4494 C  C   . ASN B 1 42  ? 5.067   19.884  70.462  1.00 44.15  ? 42  ASN B C   1 
ATOM   4495 O  O   . ASN B 1 42  ? 5.623   20.495  69.545  1.00 45.91  ? 42  ASN B O   1 
ATOM   4496 C  CB  . ASN B 1 42  ? 4.611   21.844  71.923  1.00 67.48  ? 42  ASN B CB  1 
ATOM   4497 C  CG  . ASN B 1 42  ? 3.584   22.669  72.670  1.00 84.11  ? 42  ASN B CG  1 
ATOM   4498 O  OD1 . ASN B 1 42  ? 3.419   22.525  73.883  1.00 91.34  ? 42  ASN B OD1 1 
ATOM   4499 N  ND2 . ASN B 1 42  ? 2.878   23.536  71.946  1.00 87.35  ? 42  ASN B ND2 1 
ATOM   4500 N  N   . MET B 1 43  ? 5.382   18.637  70.769  1.00 38.21  ? 43  MET B N   1 
ATOM   4501 C  CA  . MET B 1 43  ? 6.306   17.876  69.951  1.00 41.36  ? 43  MET B CA  1 
ATOM   4502 C  C   . MET B 1 43  ? 5.582   17.061  68.906  1.00 47.68  ? 43  MET B C   1 
ATOM   4503 O  O   . MET B 1 43  ? 6.209   16.223  68.255  1.00 53.74  ? 43  MET B O   1 
ATOM   4504 C  CB  . MET B 1 43  ? 7.159   16.944  70.812  1.00 47.08  ? 43  MET B CB  1 
ATOM   4505 C  CG  . MET B 1 43  ? 7.747   17.559  72.064  1.00 51.92  ? 43  MET B CG  1 
ATOM   4506 S  SD  . MET B 1 43  ? 9.219   16.616  72.458  1.00 64.64  ? 43  MET B SD  1 
ATOM   4507 C  CE  . MET B 1 43  ? 10.177  16.988  71.000  1.00 62.57  ? 43  MET B CE  1 
ATOM   4508 N  N   . ARG B 1 44  ? 4.269   17.241  68.776  1.00 51.64  ? 44  ARG B N   1 
ATOM   4509 C  CA  . ARG B 1 44  ? 3.544   16.619  67.679  1.00 50.73  ? 44  ARG B CA  1 
ATOM   4510 C  C   . ARG B 1 44  ? 3.948   17.298  66.379  1.00 47.27  ? 44  ARG B C   1 
ATOM   4511 O  O   . ARG B 1 44  ? 4.032   18.530  66.316  1.00 48.72  ? 44  ARG B O   1 
ATOM   4512 C  CB  . ARG B 1 44  ? 2.035   16.725  67.892  1.00 45.99  ? 44  ARG B CB  1 
ATOM   4513 C  CG  . ARG B 1 44  ? 1.200   16.056  66.796  1.00 41.28  ? 44  ARG B CG  1 
ATOM   4514 C  CD  . ARG B 1 44  ? -0.264  16.421  66.925  1.00 37.44  ? 44  ARG B CD  1 
ATOM   4515 N  NE  . ARG B 1 44  ? -1.004  15.509  67.805  1.00 38.90  ? 44  ARG B NE  1 
ATOM   4516 C  CZ  . ARG B 1 44  ? -2.246  15.733  68.230  1.00 42.60  ? 44  ARG B CZ  1 
ATOM   4517 N  NH1 . ARG B 1 44  ? -2.858  16.863  67.905  1.00 29.65  1 44  ARG B NH1 1 
ATOM   4518 N  NH2 . ARG B 1 44  ? -2.851  14.853  69.011  1.00 37.57  ? 44  ARG B NH2 1 
ATOM   4519 N  N   . PHE B 1 45  ? 4.219   16.489  65.354  1.00 41.34  ? 45  PHE B N   1 
ATOM   4520 C  CA  . PHE B 1 45  ? 4.655   16.862  64.013  1.00 44.78  ? 45  PHE B CA  1 
ATOM   4521 C  C   . PHE B 1 45  ? 6.132   17.209  63.952  1.00 38.00  ? 45  PHE B C   1 
ATOM   4522 O  O   . PHE B 1 45  ? 6.628   17.493  62.863  1.00 34.89  ? 45  PHE B O   1 
ATOM   4523 C  CB  . PHE B 1 45  ? 3.863   18.040  63.417  1.00 44.82  ? 45  PHE B CB  1 
ATOM   4524 C  CG  . PHE B 1 45  ? 2.397   17.816  63.408  1.00 53.07  ? 45  PHE B CG  1 
ATOM   4525 C  CD1 . PHE B 1 45  ? 1.873   16.628  62.909  1.00 58.00  ? 45  PHE B CD1 1 
ATOM   4526 C  CD2 . PHE B 1 45  ? 1.537   18.769  63.925  1.00 45.51  ? 45  PHE B CD2 1 
ATOM   4527 C  CE1 . PHE B 1 45  ? 0.511   16.403  62.908  1.00 50.85  ? 45  PHE B CE1 1 
ATOM   4528 C  CE2 . PHE B 1 45  ? 0.178   18.553  63.927  1.00 44.22  ? 45  PHE B CE2 1 
ATOM   4529 C  CZ  . PHE B 1 45  ? -0.340  17.370  63.412  1.00 41.48  ? 45  PHE B CZ  1 
ATOM   4530 N  N   . ARG B 1 46  ? 6.847   17.214  65.072  1.00 29.24  ? 46  ARG B N   1 
ATOM   4531 C  CA  . ARG B 1 46  ? 8.259   17.546  65.113  1.00 32.47  ? 46  ARG B CA  1 
ATOM   4532 C  C   . ARG B 1 46  ? 9.124   16.287  65.088  1.00 47.83  ? 46  ARG B C   1 
ATOM   4533 O  O   . ARG B 1 46  ? 8.654   15.154  65.266  1.00 50.50  ? 46  ARG B O   1 
ATOM   4534 C  CB  . ARG B 1 46  ? 8.607   18.381  66.353  1.00 38.42  ? 46  ARG B CB  1 
ATOM   4535 C  CG  . ARG B 1 46  ? 7.917   19.720  66.385  1.00 59.69  ? 46  ARG B CG  1 
ATOM   4536 C  CD  . ARG B 1 46  ? 8.813   20.776  66.982  1.00 70.40  ? 46  ARG B CD  1 
ATOM   4537 N  NE  . ARG B 1 46  ? 9.592   20.263  68.094  1.00 80.31  ? 46  ARG B NE  1 
ATOM   4538 C  CZ  . ARG B 1 46  ? 9.383   20.598  69.362  1.00 81.70  ? 46  ARG B CZ  1 
ATOM   4539 N  NH1 . ARG B 1 46  ? 8.400   21.437  69.678  1.00 74.08  1 46  ARG B NH1 1 
ATOM   4540 N  NH2 . ARG B 1 46  ? 10.158  20.091  70.313  1.00 79.86  ? 46  ARG B NH2 1 
ATOM   4541 N  N   . ARG B 1 47  ? 10.419  16.510  64.859  1.00 47.05  ? 47  ARG B N   1 
ATOM   4542 C  CA  . ARG B 1 47  ? 11.385  15.424  64.833  1.00 50.98  ? 47  ARG B CA  1 
ATOM   4543 C  C   . ARG B 1 47  ? 11.431  14.715  66.182  1.00 42.03  ? 47  ARG B C   1 
ATOM   4544 O  O   . ARG B 1 47  ? 11.249  15.358  67.217  1.00 41.16  ? 47  ARG B O   1 
ATOM   4545 C  CB  . ARG B 1 47  ? 12.769  15.967  64.515  1.00 59.77  ? 47  ARG B CB  1 
ATOM   4546 C  CG  . ARG B 1 47  ? 12.805  16.695  63.253  1.00 64.73  ? 47  ARG B CG  1 
ATOM   4547 C  CD  . ARG B 1 47  ? 13.724  17.847  63.400  1.00 72.63  ? 47  ARG B CD  1 
ATOM   4548 N  NE  . ARG B 1 47  ? 13.536  18.796  62.306  1.00 76.05  ? 47  ARG B NE  1 
ATOM   4549 C  CZ  . ARG B 1 47  ? 13.768  18.535  61.027  1.00 71.28  ? 47  ARG B CZ  1 
ATOM   4550 N  NH1 . ARG B 1 47  ? 13.552  19.479  60.137  1.00 66.93  1 47  ARG B NH1 1 
ATOM   4551 N  NH2 . ARG B 1 47  ? 14.209  17.343  60.652  1.00 78.52  ? 47  ARG B NH2 1 
ATOM   4552 N  N   . PRO B 1 48  ? 11.722  13.410  66.196  1.00 31.10  ? 48  PRO B N   1 
ATOM   4553 C  CA  . PRO B 1 48  ? 11.940  12.742  67.462  1.00 37.97  ? 48  PRO B CA  1 
ATOM   4554 C  C   . PRO B 1 48  ? 13.113  13.404  68.151  1.00 45.31  ? 48  PRO B C   1 
ATOM   4555 O  O   . PRO B 1 48  ? 14.022  13.930  67.507  1.00 38.59  ? 48  PRO B O   1 
ATOM   4556 C  CB  . PRO B 1 48  ? 12.276  11.310  67.055  1.00 33.38  ? 48  PRO B CB  1 
ATOM   4557 C  CG  . PRO B 1 48  ? 12.818  11.424  65.709  1.00 32.52  ? 48  PRO B CG  1 
ATOM   4558 C  CD  . PRO B 1 48  ? 12.002  12.513  65.074  1.00 36.51  ? 48  PRO B CD  1 
ATOM   4559 N  N   . GLU B 1 49  ? 13.061  13.410  69.485  1.00 49.33  ? 49  GLU B N   1 
ATOM   4560 C  CA  . GLU B 1 49  ? 14.250  13.638  70.264  1.00 54.33  ? 49  GLU B CA  1 
ATOM   4561 C  C   . GLU B 1 49  ? 14.617  12.354  70.982  1.00 52.51  ? 49  GLU B C   1 
ATOM   4562 O  O   . GLU B 1 49  ? 13.726  11.598  71.371  1.00 52.53  ? 49  GLU B O   1 
ATOM   4563 C  CB  . GLU B 1 49  ? 14.064  14.769  71.277  1.00 59.06  ? 49  GLU B CB  1 
ATOM   4564 C  CG  . GLU B 1 49  ? 13.358  15.963  70.704  1.00 71.57  ? 49  GLU B CG  1 
ATOM   4565 C  CD  . GLU B 1 49  ? 14.304  17.013  70.155  1.00 87.90  ? 49  GLU B CD  1 
ATOM   4566 O  OE1 . GLU B 1 49  ? 15.528  16.889  70.380  1.00 86.50  ? 49  GLU B OE1 1 
ATOM   4567 O  OE2 . GLU B 1 49  ? 13.820  17.951  69.485  1.00 99.14  1 49  GLU B OE2 1 
ATOM   4568 N  N   . PRO B 1 50  ? 15.904  12.072  71.160  1.00 46.46  ? 50  PRO B N   1 
ATOM   4569 C  CA  . PRO B 1 50  ? 16.298  10.805  71.792  1.00 42.94  ? 50  PRO B CA  1 
ATOM   4570 C  C   . PRO B 1 50  ? 15.763  10.700  73.210  1.00 52.83  ? 50  PRO B C   1 
ATOM   4571 O  O   . PRO B 1 50  ? 15.650  11.699  73.928  1.00 53.42  ? 50  PRO B O   1 
ATOM   4572 C  CB  . PRO B 1 50  ? 17.830  10.845  71.775  1.00 37.22  ? 50  PRO B CB  1 
ATOM   4573 C  CG  . PRO B 1 50  ? 18.218  12.089  70.996  1.00 37.54  ? 50  PRO B CG  1 
ATOM   4574 C  CD  . PRO B 1 50  ? 17.028  12.993  70.956  1.00 38.78  ? 50  PRO B CD  1 
ATOM   4575 N  N   . LYS B 1 51  ? 15.419  9.465   73.599  1.00 52.79  ? 51  LYS B N   1 
ATOM   4576 C  CA  . LYS B 1 51  ? 14.947  9.186   74.952  1.00 48.23  ? 51  LYS B CA  1 
ATOM   4577 C  C   . LYS B 1 51  ? 15.956  9.720   75.951  1.00 47.44  ? 51  LYS B C   1 
ATOM   4578 O  O   . LYS B 1 51  ? 17.133  9.342   75.903  1.00 49.46  ? 51  LYS B O   1 
ATOM   4579 C  CB  . LYS B 1 51  ? 14.750  7.674   75.161  1.00 51.82  ? 51  LYS B CB  1 
ATOM   4580 C  CG  . LYS B 1 51  ? 13.899  7.268   76.415  1.00 47.14  ? 51  LYS B CG  1 
ATOM   4581 C  CD  . LYS B 1 51  ? 12.845  8.320   76.678  1.00 42.89  ? 51  LYS B CD  1 
ATOM   4582 C  CE  . LYS B 1 51  ? 12.221  8.254   78.049  1.00 44.74  ? 51  LYS B CE  1 
ATOM   4583 N  NZ  . LYS B 1 51  ? 11.299  7.101   78.184  1.00 42.73  1 51  LYS B NZ  1 
ATOM   4584 N  N   . LYS B 1 52  ? 15.502  10.612  76.838  1.00 51.91  ? 52  LYS B N   1 
ATOM   4585 C  CA  . LYS B 1 52  ? 16.342  11.049  77.949  1.00 55.79  ? 52  LYS B CA  1 
ATOM   4586 C  C   . LYS B 1 52  ? 16.650  9.843   78.833  1.00 57.79  ? 52  LYS B C   1 
ATOM   4587 O  O   . LYS B 1 52  ? 15.749  9.026   79.087  1.00 60.05  ? 52  LYS B O   1 
ATOM   4588 C  CB  . LYS B 1 52  ? 15.651  12.148  78.759  1.00 55.38  ? 52  LYS B CB  1 
ATOM   4589 C  CG  . LYS B 1 52  ? 15.871  13.570  78.238  1.00 58.63  ? 52  LYS B CG  1 
ATOM   4590 C  CD  . LYS B 1 52  ? 14.570  14.388  78.244  1.00 71.38  ? 52  LYS B CD  1 
ATOM   4591 C  CE  . LYS B 1 52  ? 13.867  14.391  79.612  1.00 81.53  ? 52  LYS B CE  1 
ATOM   4592 N  NZ  . LYS B 1 52  ? 12.530  15.087  79.614  1.00 77.38  1 52  LYS B NZ  1 
ATOM   4593 N  N   . PRO B 1 53  ? 17.897  9.668   79.280  1.00 55.85  ? 53  PRO B N   1 
ATOM   4594 C  CA  . PRO B 1 53  ? 18.260  8.422   79.973  1.00 51.90  ? 53  PRO B CA  1 
ATOM   4595 C  C   . PRO B 1 53  ? 17.566  8.305   81.314  1.00 45.45  ? 53  PRO B C   1 
ATOM   4596 O  O   . PRO B 1 53  ? 17.400  9.289   82.037  1.00 50.38  ? 53  PRO B O   1 
ATOM   4597 C  CB  . PRO B 1 53  ? 19.783  8.528   80.137  1.00 51.95  ? 53  PRO B CB  1 
ATOM   4598 C  CG  . PRO B 1 53  ? 20.211  9.497   79.093  1.00 58.09  ? 53  PRO B CG  1 
ATOM   4599 C  CD  . PRO B 1 53  ? 19.080  10.495  78.993  1.00 59.95  ? 53  PRO B CD  1 
ATOM   4600 N  N   . TRP B 1 54  ? 17.156  7.087   81.642  1.00 43.59  ? 54  TRP B N   1 
ATOM   4601 C  CA  . TRP B 1 54  ? 16.366  6.855   82.840  1.00 55.59  ? 54  TRP B CA  1 
ATOM   4602 C  C   . TRP B 1 54  ? 17.197  6.216   83.949  1.00 62.57  ? 54  TRP B C   1 
ATOM   4603 O  O   . TRP B 1 54  ? 18.137  5.449   83.697  1.00 58.91  ? 54  TRP B O   1 
ATOM   4604 C  CB  . TRP B 1 54  ? 15.165  5.966   82.535  1.00 56.16  ? 54  TRP B CB  1 
ATOM   4605 C  CG  . TRP B 1 54  ? 15.540  4.635   81.978  1.00 52.66  ? 54  TRP B CG  1 
ATOM   4606 C  CD1 . TRP B 1 54  ? 15.799  3.490   82.681  1.00 58.28  ? 54  TRP B CD1 1 
ATOM   4607 C  CD2 . TRP B 1 54  ? 15.679  4.298   80.596  1.00 43.88  ? 54  TRP B CD2 1 
ATOM   4608 N  NE1 . TRP B 1 54  ? 16.098  2.458   81.816  1.00 51.49  ? 54  TRP B NE1 1 
ATOM   4609 C  CE2 . TRP B 1 54  ? 16.034  2.930   80.531  1.00 47.70  ? 54  TRP B CE2 1 
ATOM   4610 C  CE3 . TRP B 1 54  ? 15.546  5.020   79.408  1.00 40.76  ? 54  TRP B CE3 1 
ATOM   4611 C  CZ2 . TRP B 1 54  ? 16.257  2.271   79.321  1.00 44.03  ? 54  TRP B CZ2 1 
ATOM   4612 C  CZ3 . TRP B 1 54  ? 15.769  4.368   78.209  1.00 43.43  ? 54  TRP B CZ3 1 
ATOM   4613 C  CH2 . TRP B 1 54  ? 16.121  3.005   78.175  1.00 47.48  ? 54  TRP B CH2 1 
ATOM   4614 N  N   . SER B 1 55  ? 16.843  6.556   85.189  1.00 63.64  ? 55  SER B N   1 
ATOM   4615 C  CA  . SER B 1 55  ? 17.291  5.762   86.319  1.00 57.89  ? 55  SER B CA  1 
ATOM   4616 C  C   . SER B 1 55  ? 16.367  4.561   86.491  1.00 47.67  ? 55  SER B C   1 
ATOM   4617 O  O   . SER B 1 55  ? 15.346  4.422   85.810  1.00 54.14  ? 55  SER B O   1 
ATOM   4618 C  CB  . SER B 1 55  ? 17.356  6.604   87.587  1.00 56.90  ? 55  SER B CB  1 
ATOM   4619 O  OG  . SER B 1 55  ? 16.290  7.530   87.625  1.00 63.87  ? 55  SER B OG  1 
ATOM   4620 N  N   . GLY B 1 56  ? 16.760  3.657   87.376  1.00 37.25  ? 56  GLY B N   1 
ATOM   4621 C  CA  . GLY B 1 56  ? 16.004  2.437   87.564  1.00 37.27  ? 56  GLY B CA  1 
ATOM   4622 C  C   . GLY B 1 56  ? 16.031  1.524   86.356  1.00 44.74  ? 56  GLY B C   1 
ATOM   4623 O  O   . GLY B 1 56  ? 16.602  1.868   85.315  1.00 53.13  ? 56  GLY B O   1 
ATOM   4624 N  N   . VAL B 1 57  ? 15.409  0.356   86.493  1.00 41.49  ? 57  VAL B N   1 
ATOM   4625 C  CA  . VAL B 1 57  ? 15.408  -0.687  85.471  1.00 46.00  ? 57  VAL B CA  1 
ATOM   4626 C  C   . VAL B 1 57  ? 14.094  -0.633  84.690  1.00 50.18  ? 57  VAL B C   1 
ATOM   4627 O  O   . VAL B 1 57  ? 13.016  -0.861  85.257  1.00 40.63  ? 57  VAL B O   1 
ATOM   4628 C  CB  . VAL B 1 57  ? 15.612  -2.070  86.107  1.00 38.03  ? 57  VAL B CB  1 
ATOM   4629 C  CG1 . VAL B 1 57  ? 15.632  -3.140  85.052  1.00 44.17  ? 57  VAL B CG1 1 
ATOM   4630 C  CG2 . VAL B 1 57  ? 16.889  -2.086  86.852  1.00 42.17  ? 57  VAL B CG2 1 
ATOM   4631 N  N   . TRP B 1 58  ? 14.185  -0.364  83.383  1.00 46.77  ? 58  TRP B N   1 
ATOM   4632 C  CA  . TRP B 1 58  ? 12.994  -0.295  82.542  1.00 48.20  ? 58  TRP B CA  1 
ATOM   4633 C  C   . TRP B 1 58  ? 12.393  -1.690  82.356  1.00 49.61  ? 58  TRP B C   1 
ATOM   4634 O  O   . TRP B 1 58  ? 13.074  -2.617  81.896  1.00 41.58  ? 58  TRP B O   1 
ATOM   4635 C  CB  . TRP B 1 58  ? 13.328  0.329   81.186  1.00 45.88  ? 58  TRP B CB  1 
ATOM   4636 C  CG  . TRP B 1 58  ? 12.104  0.676   80.392  1.00 37.47  ? 58  TRP B CG  1 
ATOM   4637 C  CD1 . TRP B 1 58  ? 11.297  -0.190  79.714  1.00 40.35  ? 58  TRP B CD1 1 
ATOM   4638 C  CD2 . TRP B 1 58  ? 11.524  1.984   80.221  1.00 42.51  ? 58  TRP B CD2 1 
ATOM   4639 N  NE1 . TRP B 1 58  ? 10.253  0.494   79.130  1.00 45.83  ? 58  TRP B NE1 1 
ATOM   4640 C  CE2 . TRP B 1 58  ? 10.367  1.827   79.428  1.00 42.49  ? 58  TRP B CE2 1 
ATOM   4641 C  CE3 . TRP B 1 58  ? 11.869  3.268   80.665  1.00 42.71  ? 58  TRP B CE3 1 
ATOM   4642 C  CZ2 . TRP B 1 58  ? 9.555   2.905   79.066  1.00 35.69  ? 58  TRP B CZ2 1 
ATOM   4643 C  CZ3 . TRP B 1 58  ? 11.057  4.344   80.299  1.00 40.38  ? 58  TRP B CZ3 1 
ATOM   4644 C  CH2 . TRP B 1 58  ? 9.918   4.152   79.512  1.00 36.41  ? 58  TRP B CH2 1 
ATOM   4645 N  N   . ASN B 1 59  ? 11.116  -1.838  82.713  1.00 47.73  ? 59  ASN B N   1 
ATOM   4646 C  CA  . ASN B 1 59  ? 10.405  -3.101  82.530  1.00 55.16  ? 59  ASN B CA  1 
ATOM   4647 C  C   . ASN B 1 59  ? 10.131  -3.275  81.041  1.00 56.05  ? 59  ASN B C   1 
ATOM   4648 O  O   . ASN B 1 59  ? 9.229   -2.653  80.478  1.00 51.94  ? 59  ASN B O   1 
ATOM   4649 C  CB  . ASN B 1 59  ? 9.114   -3.114  83.342  1.00 62.65  ? 59  ASN B CB  1 
ATOM   4650 C  CG  . ASN B 1 59  ? 8.475   -4.501  83.429  1.00 73.23  ? 59  ASN B CG  1 
ATOM   4651 O  OD1 . ASN B 1 59  ? 9.093   -5.513  83.075  1.00 71.64  ? 59  ASN B OD1 1 
ATOM   4652 N  ND2 . ASN B 1 59  ? 7.227   -4.543  83.924  1.00 84.67  ? 59  ASN B ND2 1 
ATOM   4653 N  N   . ALA B 1 60  ? 10.925  -4.109  80.388  1.00 47.46  ? 60  ALA B N   1 
ATOM   4654 C  CA  . ALA B 1 60  ? 10.744  -4.322  78.966  1.00 44.74  ? 60  ALA B CA  1 
ATOM   4655 C  C   . ALA B 1 60  ? 10.147  -5.699  78.723  1.00 48.95  ? 60  ALA B C   1 
ATOM   4656 O  O   . ALA B 1 60  ? 10.645  -6.465  77.894  1.00 67.21  ? 60  ALA B O   1 
ATOM   4657 C  CB  . ALA B 1 60  ? 12.079  -4.168  78.231  1.00 50.00  ? 60  ALA B CB  1 
ATOM   4658 N  N   . SER B 1 61  ? 9.078   -6.026  79.436  1.00 43.92  ? 61  SER B N   1 
ATOM   4659 C  CA  . SER B 1 61  ? 8.514   -7.367  79.383  1.00 41.89  ? 61  SER B CA  1 
ATOM   4660 C  C   . SER B 1 61  ? 7.248   -7.466  78.552  1.00 40.98  ? 61  SER B C   1 
ATOM   4661 O  O   . SER B 1 61  ? 6.820   -8.585  78.247  1.00 44.18  ? 61  SER B O   1 
ATOM   4662 C  CB  . SER B 1 61  ? 8.214   -7.863  80.798  1.00 48.55  ? 61  SER B CB  1 
ATOM   4663 O  OG  . SER B 1 61  ? 7.476   -6.875  81.490  1.00 56.58  ? 61  SER B OG  1 
ATOM   4664 N  N   . THR B 1 62  ? 6.634   -6.345  78.189  1.00 40.41  ? 62  THR B N   1 
ATOM   4665 C  CA  . THR B 1 62  ? 5.363   -6.379  77.489  1.00 51.52  ? 62  THR B CA  1 
ATOM   4666 C  C   . THR B 1 62  ? 5.385   -5.388  76.338  1.00 50.19  ? 62  THR B C   1 
ATOM   4667 O  O   . THR B 1 62  ? 6.083   -4.374  76.376  1.00 63.53  ? 62  THR B O   1 
ATOM   4668 C  CB  . THR B 1 62  ? 4.169   -6.056  78.404  1.00 51.85  ? 62  THR B CB  1 
ATOM   4669 O  OG1 . THR B 1 62  ? 4.288   -4.715  78.892  1.00 54.04  ? 62  THR B OG1 1 
ATOM   4670 C  CG2 . THR B 1 62  ? 4.126   -7.014  79.579  1.00 50.78  ? 62  THR B CG2 1 
ATOM   4671 N  N   . TYR B 1 63  ? 4.559   -5.671  75.341  1.00 39.48  ? 63  TYR B N   1 
ATOM   4672 C  CA  . TYR B 1 63  ? 4.531   -4.909  74.096  1.00 39.51  ? 63  TYR B CA  1 
ATOM   4673 C  C   . TYR B 1 63  ? 4.137   -3.442  74.325  1.00 32.46  ? 63  TYR B C   1 
ATOM   4674 O  O   . TYR B 1 63  ? 3.294   -3.154  75.177  1.00 33.06  ? 63  TYR B O   1 
ATOM   4675 C  CB  . TYR B 1 63  ? 3.549   -5.572  73.127  1.00 41.75  ? 63  TYR B CB  1 
ATOM   4676 C  CG  . TYR B 1 63  ? 4.176   -6.537  72.147  1.00 47.76  ? 63  TYR B CG  1 
ATOM   4677 C  CD1 . TYR B 1 63  ? 5.434   -6.301  71.616  1.00 49.67  ? 63  TYR B CD1 1 
ATOM   4678 C  CD2 . TYR B 1 63  ? 3.501   -7.702  71.760  1.00 39.82  ? 63  TYR B CD2 1 
ATOM   4679 C  CE1 . TYR B 1 63  ? 5.984   -7.181  70.704  1.00 56.14  ? 63  TYR B CE1 1 
ATOM   4680 C  CE2 . TYR B 1 63  ? 4.057   -8.593  70.861  1.00 32.67  ? 63  TYR B CE2 1 
ATOM   4681 C  CZ  . TYR B 1 63  ? 5.287   -8.327  70.334  1.00 51.52  ? 63  TYR B CZ  1 
ATOM   4682 O  OH  . TYR B 1 63  ? 5.830   -9.213  69.429  1.00 66.67  ? 63  TYR B OH  1 
ATOM   4683 N  N   . PRO B 1 64  ? 4.673   -2.510  73.533  1.00 42.03  ? 64  PRO B N   1 
ATOM   4684 C  CA  . PRO B 1 64  ? 4.376   -1.089  73.710  1.00 35.92  ? 64  PRO B CA  1 
ATOM   4685 C  C   . PRO B 1 64  ? 2.977   -0.786  73.178  1.00 42.05  ? 64  PRO B C   1 
ATOM   4686 O  O   . PRO B 1 64  ? 2.270   -1.667  72.662  1.00 35.07  ? 64  PRO B O   1 
ATOM   4687 C  CB  . PRO B 1 64  ? 5.420   -0.397  72.880  1.00 29.95  ? 64  PRO B CB  1 
ATOM   4688 C  CG  . PRO B 1 64  ? 5.961   -1.393  71.936  1.00 43.87  ? 64  PRO B CG  1 
ATOM   4689 C  CD  . PRO B 1 64  ? 5.625   -2.765  72.462  1.00 46.99  ? 64  PRO B CD  1 
ATOM   4690 N  N   . ASN B 1 65  ? 2.607   0.495   73.273  1.00 49.00  ? 65  ASN B N   1 
ATOM   4691 C  CA  . ASN B 1 65  ? 1.455   1.024   72.556  1.00 45.02  ? 65  ASN B CA  1 
ATOM   4692 C  C   . ASN B 1 65  ? 1.718   1.014   71.059  1.00 48.26  ? 65  ASN B C   1 
ATOM   4693 O  O   . ASN B 1 65  ? 2.856   0.878   70.599  1.00 60.15  ? 65  ASN B O   1 
ATOM   4694 C  CB  . ASN B 1 65  ? 1.167   2.471   72.953  1.00 50.12  ? 65  ASN B CB  1 
ATOM   4695 C  CG  . ASN B 1 65  ? 0.693   2.626   74.386  1.00 54.98  ? 65  ASN B CG  1 
ATOM   4696 O  OD1 . ASN B 1 65  ? 1.141   3.531   75.091  1.00 54.93  ? 65  ASN B OD1 1 
ATOM   4697 N  ND2 . ASN B 1 65  ? -0.210  1.744   74.825  1.00 47.80  ? 65  ASN B ND2 1 
ATOM   4698 N  N   . ASN B 1 66  ? 0.658   1.210   70.287  1.00 38.57  ? 66  ASN B N   1 
ATOM   4699 C  CA  . ASN B 1 66  ? 0.786   1.428   68.853  1.00 31.56  ? 66  ASN B CA  1 
ATOM   4700 C  C   . ASN B 1 66  ? 0.479   2.881   68.533  1.00 35.16  ? 66  ASN B C   1 
ATOM   4701 O  O   . ASN B 1 66  ? -0.283  3.535   69.250  1.00 39.60  ? 66  ASN B O   1 
ATOM   4702 C  CB  . ASN B 1 66  ? -0.118  0.486   68.068  1.00 28.30  ? 66  ASN B CB  1 
ATOM   4703 C  CG  . ASN B 1 66  ? 0.151   -0.969  68.405  1.00 36.32  ? 66  ASN B CG  1 
ATOM   4704 O  OD1 . ASN B 1 66  ? -0.768  -1.745  68.680  1.00 40.44  ? 66  ASN B OD1 1 
ATOM   4705 N  ND2 . ASN B 1 66  ? 1.426   -1.344  68.403  1.00 45.71  ? 66  ASN B ND2 1 
ATOM   4706 N  N   . CYS B 1 67  ? 1.110   3.401   67.479  1.00 34.22  ? 67  CYS B N   1 
ATOM   4707 C  CA  . CYS B 1 67  ? 0.888   4.799   67.144  1.00 40.58  ? 67  CYS B CA  1 
ATOM   4708 C  C   . CYS B 1 67  ? -0.549  4.995   66.690  1.00 41.24  ? 67  CYS B C   1 
ATOM   4709 O  O   . CYS B 1 67  ? -1.216  4.052   66.248  1.00 38.03  ? 67  CYS B O   1 
ATOM   4710 C  CB  . CYS B 1 67  ? 1.860   5.259   66.065  1.00 47.61  ? 67  CYS B CB  1 
ATOM   4711 S  SG  . CYS B 1 67  ? 3.586   5.230   66.598  1.00 55.08  ? 67  CYS B SG  1 
ATOM   4712 N  N   . GLN B 1 68  ? -1.033  6.229   66.824  1.00 40.40  ? 68  GLN B N   1 
ATOM   4713 C  CA  . GLN B 1 68  ? -2.412  6.524   66.464  1.00 40.92  ? 68  GLN B CA  1 
ATOM   4714 C  C   . GLN B 1 68  ? -2.611  6.380   64.966  1.00 45.69  ? 68  GLN B C   1 
ATOM   4715 O  O   . GLN B 1 68  ? -1.831  6.911   64.168  1.00 43.24  ? 68  GLN B O   1 
ATOM   4716 C  CB  . GLN B 1 68  ? -2.795  7.920   66.922  1.00 44.10  ? 68  GLN B CB  1 
ATOM   4717 C  CG  . GLN B 1 68  ? -2.507  8.098   68.375  1.00 48.57  ? 68  GLN B CG  1 
ATOM   4718 C  CD  . GLN B 1 68  ? -3.761  7.882   69.165  1.00 49.48  ? 68  GLN B CD  1 
ATOM   4719 O  OE1 . GLN B 1 68  ? -4.734  7.351   68.620  1.00 49.98  ? 68  GLN B OE1 1 
ATOM   4720 N  NE2 . GLN B 1 68  ? -3.741  8.222   70.464  1.00 47.95  ? 68  GLN B NE2 1 
ATOM   4721 N  N   . GLN B 1 69  ? -3.667  5.667   64.584  1.00 43.48  ? 69  GLN B N   1 
ATOM   4722 C  CA  . GLN B 1 69  ? -3.841  5.359   63.182  1.00 38.84  ? 69  GLN B CA  1 
ATOM   4723 C  C   . GLN B 1 69  ? -5.286  4.994   62.912  1.00 42.02  ? 69  GLN B C   1 
ATOM   4724 O  O   . GLN B 1 69  ? -6.013  4.559   63.804  1.00 54.19  ? 69  GLN B O   1 
ATOM   4725 C  CB  . GLN B 1 69  ? -2.933  4.213   62.771  1.00 44.09  ? 69  GLN B CB  1 
ATOM   4726 C  CG  . GLN B 1 69  ? -3.326  2.884   63.338  1.00 34.58  ? 69  GLN B CG  1 
ATOM   4727 C  CD  . GLN B 1 69  ? -2.136  1.969   63.404  1.00 36.19  ? 69  GLN B CD  1 
ATOM   4728 O  OE1 . GLN B 1 69  ? -2.044  0.996   62.657  1.00 30.53  ? 69  GLN B OE1 1 
ATOM   4729 N  NE2 . GLN B 1 69  ? -1.203  2.281   64.300  1.00 33.51  ? 69  GLN B NE2 1 
ATOM   4730 N  N   . TYR B 1 70  ? -5.684  5.174   61.658  1.00 46.90  ? 70  TYR B N   1 
ATOM   4731 C  CA  . TYR B 1 70  ? -6.959  4.658   61.175  1.00 50.69  ? 70  TYR B CA  1 
ATOM   4732 C  C   . TYR B 1 70  ? -7.079  3.171   61.489  1.00 42.20  ? 70  TYR B C   1 
ATOM   4733 O  O   . TYR B 1 70  ? -6.090  2.434   61.507  1.00 43.74  ? 70  TYR B O   1 
ATOM   4734 C  CB  . TYR B 1 70  ? -7.068  4.905   59.660  1.00 51.69  ? 70  TYR B CB  1 
ATOM   4735 C  CG  . TYR B 1 70  ? -8.256  4.272   58.964  1.00 46.27  ? 70  TYR B CG  1 
ATOM   4736 C  CD1 . TYR B 1 70  ? -9.409  5.008   58.688  1.00 43.40  ? 70  TYR B CD1 1 
ATOM   4737 C  CD2 . TYR B 1 70  ? -8.210  2.943   58.550  1.00 45.84  ? 70  TYR B CD2 1 
ATOM   4738 C  CE1 . TYR B 1 70  ? -10.493 4.418   58.026  1.00 49.00  ? 70  TYR B CE1 1 
ATOM   4739 C  CE2 . TYR B 1 70  ? -9.278  2.350   57.906  1.00 50.62  ? 70  TYR B CE2 1 
ATOM   4740 C  CZ  . TYR B 1 70  ? -10.412 3.085   57.642  1.00 50.69  ? 70  TYR B CZ  1 
ATOM   4741 O  OH  . TYR B 1 70  ? -11.450 2.464   57.000  1.00 44.82  ? 70  TYR B OH  1 
ATOM   4742 N  N   . VAL B 1 71  ? -8.303  2.725   61.734  1.00 44.41  ? 71  VAL B N   1 
ATOM   4743 C  CA  . VAL B 1 71  ? -8.571  1.334   62.074  1.00 45.57  ? 71  VAL B CA  1 
ATOM   4744 C  C   . VAL B 1 71  ? -9.492  0.747   61.012  1.00 53.30  ? 71  VAL B C   1 
ATOM   4745 O  O   . VAL B 1 71  ? -10.612 1.239   60.803  1.00 58.69  ? 71  VAL B O   1 
ATOM   4746 C  CB  . VAL B 1 71  ? -9.160  1.191   63.491  1.00 40.53  ? 71  VAL B CB  1 
ATOM   4747 C  CG1 . VAL B 1 71  ? -9.221  -0.250  63.868  1.00 32.99  ? 71  VAL B CG1 1 
ATOM   4748 C  CG2 . VAL B 1 71  ? -8.277  1.900   64.521  1.00 29.88  ? 71  VAL B CG2 1 
ATOM   4749 N  N   . ASP B 1 72  ? -9.012  -0.298  60.337  1.00 56.20  ? 72  ASP B N   1 
ATOM   4750 C  CA  . ASP B 1 72  ? -9.800  -0.954  59.306  1.00 56.70  ? 72  ASP B CA  1 
ATOM   4751 C  C   . ASP B 1 72  ? -10.946 -1.719  59.947  1.00 59.10  ? 72  ASP B C   1 
ATOM   4752 O  O   . ASP B 1 72  ? -10.729 -2.558  60.825  1.00 51.57  ? 72  ASP B O   1 
ATOM   4753 C  CB  . ASP B 1 72  ? -8.928  -1.900  58.494  1.00 50.91  ? 72  ASP B CB  1 
ATOM   4754 C  CG  . ASP B 1 72  ? -9.738  -2.891  57.656  1.00 61.57  ? 72  ASP B CG  1 
ATOM   4755 O  OD1 . ASP B 1 72  ? -9.151  -3.956  57.296  1.00 76.95  ? 72  ASP B OD1 1 
ATOM   4756 O  OD2 . ASP B 1 72  ? -10.918 -2.609  57.327  1.00 64.89  1 72  ASP B OD2 1 
ATOM   4757 N  N   . GLU B 1 73  ? -12.170 -1.438  59.498  1.00 63.86  ? 73  GLU B N   1 
ATOM   4758 C  CA  . GLU B 1 73  ? -13.326 -2.117  60.059  1.00 59.02  ? 73  GLU B CA  1 
ATOM   4759 C  C   . GLU B 1 73  ? -14.347 -2.514  58.999  1.00 48.52  ? 73  GLU B C   1 
ATOM   4760 O  O   . GLU B 1 73  ? -15.540 -2.628  59.302  1.00 53.37  ? 73  GLU B O   1 
ATOM   4761 C  CB  . GLU B 1 73  ? -13.970 -1.257  61.124  1.00 70.77  ? 73  GLU B CB  1 
ATOM   4762 C  CG  . GLU B 1 73  ? -13.274 -1.388  62.447  1.00 84.85  ? 73  GLU B CG  1 
ATOM   4763 C  CD  . GLU B 1 73  ? -14.216 -1.153  63.576  1.00 102.63 ? 73  GLU B CD  1 
ATOM   4764 O  OE1 . GLU B 1 73  ? -14.580 0.023   63.788  1.00 102.30 ? 73  GLU B OE1 1 
ATOM   4765 O  OE2 . GLU B 1 73  ? -14.617 -2.147  64.222  1.00 116.61 1 73  GLU B OE2 1 
ATOM   4766 N  N   . GLN B 1 74  ? -13.900 -2.761  57.765  1.00 38.77  ? 74  GLN B N   1 
ATOM   4767 C  CA  . GLN B 1 74  ? -14.811 -3.283  56.749  1.00 38.41  ? 74  GLN B CA  1 
ATOM   4768 C  C   . GLN B 1 74  ? -15.357 -4.641  57.150  1.00 40.32  ? 74  GLN B C   1 
ATOM   4769 O  O   . GLN B 1 74  ? -16.525 -4.945  56.899  1.00 52.21  ? 74  GLN B O   1 
ATOM   4770 C  CB  . GLN B 1 74  ? -14.126 -3.394  55.383  1.00 39.45  ? 74  GLN B CB  1 
ATOM   4771 C  CG  . GLN B 1 74  ? -13.610 -2.108  54.902  1.00 46.96  ? 74  GLN B CG  1 
ATOM   4772 C  CD  . GLN B 1 74  ? -14.650 -1.335  54.165  1.00 49.95  ? 74  GLN B CD  1 
ATOM   4773 O  OE1 . GLN B 1 74  ? -15.855 -1.622  54.278  1.00 54.58  ? 74  GLN B OE1 1 
ATOM   4774 N  NE2 . GLN B 1 74  ? -14.207 -0.307  53.432  1.00 51.63  ? 74  GLN B NE2 1 
ATOM   4775 N  N   . PHE B 1 75  ? -14.532 -5.479  57.754  1.00 42.06  ? 75  PHE B N   1 
ATOM   4776 C  CA  . PHE B 1 75  ? -14.918 -6.848  58.071  1.00 45.94  ? 75  PHE B CA  1 
ATOM   4777 C  C   . PHE B 1 75  ? -14.622 -7.063  59.543  1.00 53.99  ? 75  PHE B C   1 
ATOM   4778 O  O   . PHE B 1 75  ? -13.546 -7.566  59.911  1.00 49.44  ? 75  PHE B O   1 
ATOM   4779 C  CB  . PHE B 1 75  ? -14.189 -7.854  57.180  1.00 42.35  ? 75  PHE B CB  1 
ATOM   4780 C  CG  . PHE B 1 75  ? -14.273 -7.539  55.725  1.00 45.43  ? 75  PHE B CG  1 
ATOM   4781 C  CD1 . PHE B 1 75  ? -13.192 -6.993  55.061  1.00 47.04  ? 75  PHE B CD1 1 
ATOM   4782 C  CD2 . PHE B 1 75  ? -15.440 -7.753  55.030  1.00 43.49  ? 75  PHE B CD2 1 
ATOM   4783 C  CE1 . PHE B 1 75  ? -13.273 -6.696  53.730  1.00 44.78  ? 75  PHE B CE1 1 
ATOM   4784 C  CE2 . PHE B 1 75  ? -15.527 -7.451  53.701  1.00 44.77  ? 75  PHE B CE2 1 
ATOM   4785 C  CZ  . PHE B 1 75  ? -14.442 -6.922  53.046  1.00 49.07  ? 75  PHE B CZ  1 
ATOM   4786 N  N   . PRO B 1 76  ? -15.540 -6.657  60.416  1.00 51.10  ? 76  PRO B N   1 
ATOM   4787 C  CA  . PRO B 1 76  ? -15.309 -6.849  61.850  1.00 52.86  ? 76  PRO B CA  1 
ATOM   4788 C  C   . PRO B 1 76  ? -15.371 -8.333  62.193  1.00 51.25  ? 76  PRO B C   1 
ATOM   4789 O  O   . PRO B 1 76  ? -16.163 -9.097  61.628  1.00 39.99  ? 76  PRO B O   1 
ATOM   4790 C  CB  . PRO B 1 76  ? -16.424 -6.035  62.519  1.00 52.49  ? 76  PRO B CB  1 
ATOM   4791 C  CG  . PRO B 1 76  ? -17.227 -5.414  61.421  1.00 48.87  ? 76  PRO B CG  1 
ATOM   4792 C  CD  . PRO B 1 76  ? -16.638 -5.732  60.105  1.00 38.54  ? 76  PRO B CD  1 
ATOM   4793 N  N   . GLY B 1 77  ? -14.474 -8.746  63.090  1.00 45.65  ? 77  GLY B N   1 
ATOM   4794 C  CA  . GLY B 1 77  ? -14.279 -10.146 63.419  1.00 51.70  ? 77  GLY B CA  1 
ATOM   4795 C  C   . GLY B 1 77  ? -13.403 -10.919 62.457  1.00 59.32  ? 77  GLY B C   1 
ATOM   4796 O  O   . GLY B 1 77  ? -12.814 -11.936 62.857  1.00 57.80  ? 77  GLY B O   1 
ATOM   4797 N  N   . PHE B 1 78  ? -13.289 -10.464 61.207  1.00 56.15  ? 78  PHE B N   1 
ATOM   4798 C  CA  . PHE B 1 78  ? -12.646 -11.241 60.159  1.00 44.43  ? 78  PHE B CA  1 
ATOM   4799 C  C   . PHE B 1 78  ? -11.138 -11.221 60.369  1.00 51.47  ? 78  PHE B C   1 
ATOM   4800 O  O   . PHE B 1 78  ? -10.501 -10.168 60.248  1.00 54.90  ? 78  PHE B O   1 
ATOM   4801 C  CB  . PHE B 1 78  ? -13.024 -10.671 58.794  1.00 44.87  ? 78  PHE B CB  1 
ATOM   4802 C  CG  . PHE B 1 78  ? -12.414 -11.408 57.622  1.00 50.02  ? 78  PHE B CG  1 
ATOM   4803 C  CD1 . PHE B 1 78  ? -12.742 -12.734 57.353  1.00 42.63  ? 78  PHE B CD1 1 
ATOM   4804 C  CD2 . PHE B 1 78  ? -11.473 -10.777 56.809  1.00 55.59  ? 78  PHE B CD2 1 
ATOM   4805 C  CE1 . PHE B 1 78  ? -12.168 -13.387 56.283  1.00 49.76  ? 78  PHE B CE1 1 
ATOM   4806 C  CE2 . PHE B 1 78  ? -10.888 -11.436 55.753  1.00 53.75  ? 78  PHE B CE2 1 
ATOM   4807 C  CZ  . PHE B 1 78  ? -11.228 -12.738 55.483  1.00 55.61  ? 78  PHE B CZ  1 
ATOM   4808 N  N   . SER B 1 79  ? -10.571 -12.395 60.672  1.00 56.62  ? 79  SER B N   1 
ATOM   4809 C  CA  . SER B 1 79  ? -9.154  -12.488 61.025  1.00 43.82  ? 79  SER B CA  1 
ATOM   4810 C  C   . SER B 1 79  ? -8.257  -11.950 59.923  1.00 40.91  ? 79  SER B C   1 
ATOM   4811 O  O   . SER B 1 79  ? -7.234  -11.318 60.212  1.00 37.54  ? 79  SER B O   1 
ATOM   4812 C  CB  . SER B 1 79  ? -8.789  -13.937 61.324  1.00 36.23  ? 79  SER B CB  1 
ATOM   4813 O  OG  . SER B 1 79  ? -8.903  -14.713 60.143  1.00 47.19  ? 79  SER B OG  1 
ATOM   4814 N  N   . GLY B 1 80  ? -8.628  -12.175 58.660  1.00 39.72  ? 80  GLY B N   1 
ATOM   4815 C  CA  . GLY B 1 80  ? -7.795  -11.725 57.558  1.00 43.39  ? 80  GLY B CA  1 
ATOM   4816 C  C   . GLY B 1 80  ? -7.515  -10.237 57.578  1.00 43.29  ? 80  GLY B C   1 
ATOM   4817 O  O   . GLY B 1 80  ? -6.448  -9.796  57.139  1.00 51.85  ? 80  GLY B O   1 
ATOM   4818 N  N   . SER B 1 81  ? -8.457  -9.441  58.068  1.00 32.83  ? 81  SER B N   1 
ATOM   4819 C  CA  . SER B 1 81  ? -8.241  -8.003  58.103  1.00 42.83  ? 81  SER B CA  1 
ATOM   4820 C  C   . SER B 1 81  ? -7.847  -7.502  59.483  1.00 54.66  ? 81  SER B C   1 
ATOM   4821 O  O   . SER B 1 81  ? -6.980  -6.623  59.588  1.00 55.14  ? 81  SER B O   1 
ATOM   4822 C  CB  . SER B 1 81  ? -9.489  -7.261  57.615  1.00 40.79  ? 81  SER B CB  1 
ATOM   4823 O  OG  . SER B 1 81  ? -10.621 -7.569  58.396  1.00 45.64  ? 81  SER B OG  1 
ATOM   4824 N  N   . GLU B 1 82  ? -8.437  -8.066  60.547  1.00 49.95  ? 82  GLU B N   1 
ATOM   4825 C  CA  . GLU B 1 82  ? -8.103  -7.629  61.896  1.00 52.00  ? 82  GLU B CA  1 
ATOM   4826 C  C   . GLU B 1 82  ? -6.692  -8.035  62.314  1.00 54.63  ? 82  GLU B C   1 
ATOM   4827 O  O   . GLU B 1 82  ? -6.123  -7.384  63.198  1.00 49.32  ? 82  GLU B O   1 
ATOM   4828 C  CB  . GLU B 1 82  ? -9.146  -8.152  62.882  1.00 55.41  ? 82  GLU B CB  1 
ATOM   4829 C  CG  . GLU B 1 82  ? -10.543 -7.926  62.349  1.00 74.26  ? 82  GLU B CG  1 
ATOM   4830 C  CD  . GLU B 1 82  ? -11.529 -7.421  63.370  1.00 76.48  ? 82  GLU B CD  1 
ATOM   4831 O  OE1 . GLU B 1 82  ? -11.771 -8.154  64.348  1.00 85.05  ? 82  GLU B OE1 1 
ATOM   4832 O  OE2 . GLU B 1 82  ? -12.074 -6.305  63.177  1.00 69.61  1 82  GLU B OE2 1 
ATOM   4833 N  N   . MET B 1 83  ? -6.096  -9.056  61.682  1.00 56.46  ? 83  MET B N   1 
ATOM   4834 C  CA  . MET B 1 83  ? -4.702  -9.382  61.977  1.00 42.12  ? 83  MET B CA  1 
ATOM   4835 C  C   . MET B 1 83  ? -3.767  -8.215  61.685  1.00 43.02  ? 83  MET B C   1 
ATOM   4836 O  O   . MET B 1 83  ? -2.633  -8.212  62.170  1.00 52.16  ? 83  MET B O   1 
ATOM   4837 C  CB  . MET B 1 83  ? -4.237  -10.612 61.190  1.00 47.26  ? 83  MET B CB  1 
ATOM   4838 C  CG  . MET B 1 83  ? -3.982  -10.338 59.696  1.00 58.78  ? 83  MET B CG  1 
ATOM   4839 S  SD  . MET B 1 83  ? -3.450  -11.763 58.707  1.00 63.73  ? 83  MET B SD  1 
ATOM   4840 C  CE  . MET B 1 83  ? -1.779  -11.971 59.299  1.00 54.02  ? 83  MET B CE  1 
ATOM   4841 N  N   . TRP B 1 84  ? -4.202  -7.223  60.911  1.00 40.56  ? 84  TRP B N   1 
ATOM   4842 C  CA  . TRP B 1 84  ? -3.362  -6.064  60.625  1.00 33.95  ? 84  TRP B CA  1 
ATOM   4843 C  C   . TRP B 1 84  ? -3.740  -4.849  61.456  1.00 33.63  ? 84  TRP B C   1 
ATOM   4844 O  O   . TRP B 1 84  ? -2.987  -3.869  61.456  1.00 29.53  ? 84  TRP B O   1 
ATOM   4845 C  CB  . TRP B 1 84  ? -3.427  -5.699  59.127  1.00 31.73  ? 84  TRP B CB  1 
ATOM   4846 C  CG  . TRP B 1 84  ? -3.116  -6.848  58.224  1.00 35.69  ? 84  TRP B CG  1 
ATOM   4847 C  CD1 . TRP B 1 84  ? -4.012  -7.652  57.574  1.00 41.86  ? 84  TRP B CD1 1 
ATOM   4848 C  CD2 . TRP B 1 84  ? -1.815  -7.332  57.874  1.00 45.58  ? 84  TRP B CD2 1 
ATOM   4849 N  NE1 . TRP B 1 84  ? -3.347  -8.609  56.844  1.00 50.27  ? 84  TRP B NE1 1 
ATOM   4850 C  CE2 . TRP B 1 84  ? -1.997  -8.432  57.011  1.00 54.87  ? 84  TRP B CE2 1 
ATOM   4851 C  CE3 . TRP B 1 84  ? -0.510  -6.936  58.199  1.00 38.30  ? 84  TRP B CE3 1 
ATOM   4852 C  CZ2 . TRP B 1 84  ? -0.924  -9.140  56.477  1.00 56.78  ? 84  TRP B CZ2 1 
ATOM   4853 C  CZ3 . TRP B 1 84  ? 0.550   -7.640  57.678  1.00 29.58  ? 84  TRP B CZ3 1 
ATOM   4854 C  CH2 . TRP B 1 84  ? 0.342   -8.727  56.827  1.00 47.33  ? 84  TRP B CH2 1 
ATOM   4855 N  N   . ASN B 1 85  ? -4.888  -4.889  62.145  1.00 44.20  ? 85  ASN B N   1 
ATOM   4856 C  CA  . ASN B 1 85  ? -5.305  -3.822  63.055  1.00 42.21  ? 85  ASN B CA  1 
ATOM   4857 C  C   . ASN B 1 85  ? -4.423  -3.773  64.305  1.00 34.82  ? 85  ASN B C   1 
ATOM   4858 O  O   . ASN B 1 85  ? -3.950  -4.809  64.777  1.00 34.58  ? 85  ASN B O   1 
ATOM   4859 C  CB  . ASN B 1 85  ? -6.747  -4.036  63.490  1.00 40.84  ? 85  ASN B CB  1 
ATOM   4860 C  CG  . ASN B 1 85  ? -7.744  -3.552  62.471  1.00 49.94  ? 85  ASN B CG  1 
ATOM   4861 O  OD1 . ASN B 1 85  ? -7.636  -2.441  61.953  1.00 56.11  ? 85  ASN B OD1 1 
ATOM   4862 N  ND2 . ASN B 1 85  ? -8.726  -4.390  62.170  1.00 53.16  ? 85  ASN B ND2 1 
ATOM   4863 N  N   . PRO B 1 86  ? -4.215  -2.586  64.876  1.00 35.31  ? 86  PRO B N   1 
ATOM   4864 C  CA  . PRO B 1 86  ? -3.488  -2.495  66.155  1.00 38.11  ? 86  PRO B CA  1 
ATOM   4865 C  C   . PRO B 1 86  ? -4.069  -3.426  67.216  1.00 35.47  ? 86  PRO B C   1 
ATOM   4866 O  O   . PRO B 1 86  ? -5.288  -3.541  67.366  1.00 36.21  ? 86  PRO B O   1 
ATOM   4867 C  CB  . PRO B 1 86  ? -3.638  -1.016  66.559  1.00 35.54  ? 86  PRO B CB  1 
ATOM   4868 C  CG  . PRO B 1 86  ? -4.337  -0.309  65.413  1.00 30.64  ? 86  PRO B CG  1 
ATOM   4869 C  CD  . PRO B 1 86  ? -4.461  -1.267  64.262  1.00 33.50  ? 86  PRO B CD  1 
ATOM   4870 N  N   . ASN B 1 87  ? -3.182  -4.116  67.943  1.00 41.67  ? 87  ASN B N   1 
ATOM   4871 C  CA  . ASN B 1 87  ? -3.582  -5.053  68.991  1.00 39.47  ? 87  ASN B CA  1 
ATOM   4872 C  C   . ASN B 1 87  ? -3.164  -4.593  70.385  1.00 42.16  ? 87  ASN B C   1 
ATOM   4873 O  O   . ASN B 1 87  ? -3.249  -5.372  71.339  1.00 43.86  ? 87  ASN B O   1 
ATOM   4874 C  CB  . ASN B 1 87  ? -3.036  -6.462  68.715  1.00 30.37  ? 87  ASN B CB  1 
ATOM   4875 C  CG  . ASN B 1 87  ? -1.516  -6.511  68.638  1.00 37.83  ? 87  ASN B CG  1 
ATOM   4876 O  OD1 . ASN B 1 87  ? -0.815  -5.520  68.891  1.00 35.95  ? 87  ASN B OD1 1 
ATOM   4877 N  ND2 . ASN B 1 87  ? -0.994  -7.682  68.296  1.00 41.18  ? 87  ASN B ND2 1 
ATOM   4878 N  N   . ARG B 1 88  ? -2.701  -3.358  70.521  1.00 29.77  ? 88  ARG B N   1 
ATOM   4879 C  CA  . ARG B 1 88  ? -2.426  -2.755  71.813  1.00 36.63  ? 88  ARG B CA  1 
ATOM   4880 C  C   . ARG B 1 88  ? -3.105  -1.398  71.823  1.00 40.92  ? 88  ARG B C   1 
ATOM   4881 O  O   . ARG B 1 88  ? -3.665  -0.968  70.819  1.00 50.98  ? 88  ARG B O   1 
ATOM   4882 C  CB  . ARG B 1 88  ? -0.911  -2.637  72.081  1.00 40.82  ? 88  ARG B CB  1 
ATOM   4883 C  CG  . ARG B 1 88  ? -0.160  -3.989  72.213  1.00 43.97  ? 88  ARG B CG  1 
ATOM   4884 C  CD  . ARG B 1 88  ? -0.825  -4.936  73.209  1.00 56.62  ? 88  ARG B CD  1 
ATOM   4885 N  NE  . ARG B 1 88  ? 0.088   -5.306  74.287  1.00 73.72  ? 88  ARG B NE  1 
ATOM   4886 C  CZ  . ARG B 1 88  ? -0.289  -5.594  75.533  1.00 84.67  ? 88  ARG B CZ  1 
ATOM   4887 N  NH1 . ARG B 1 88  ? 0.624   -5.911  76.444  1.00 82.30  1 88  ARG B NH1 1 
ATOM   4888 N  NH2 . ARG B 1 88  ? -1.574  -5.550  75.878  1.00 89.42  ? 88  ARG B NH2 1 
ATOM   4889 N  N   . GLU B 1 89  ? -3.098  -0.728  72.969  1.00 55.91  ? 89  GLU B N   1 
ATOM   4890 C  CA  . GLU B 1 89  ? -3.707  0.594   73.019  1.00 58.44  ? 89  GLU B CA  1 
ATOM   4891 C  C   . GLU B 1 89  ? -2.958  1.527   72.069  1.00 45.28  ? 89  GLU B C   1 
ATOM   4892 O  O   . GLU B 1 89  ? -1.738  1.421   71.911  1.00 43.25  ? 89  GLU B O   1 
ATOM   4893 C  CB  . GLU B 1 89  ? -3.697  1.138   74.457  1.00 60.25  ? 89  GLU B CB  1 
ATOM   4894 C  CG  . GLU B 1 89  ? -4.980  1.875   74.853  1.00 74.68  ? 89  GLU B CG  1 
ATOM   4895 C  CD  . GLU B 1 89  ? -4.808  2.819   76.047  1.00 90.86  ? 89  GLU B CD  1 
ATOM   4896 O  OE1 . GLU B 1 89  ? -4.164  3.885   75.883  1.00 92.25  ? 89  GLU B OE1 1 
ATOM   4897 O  OE2 . GLU B 1 89  ? -5.340  2.505   77.141  1.00 94.97  1 89  GLU B OE2 1 
ATOM   4898 N  N   . MET B 1 90  ? -3.700  2.410   71.394  1.00 38.05  ? 90  MET B N   1 
ATOM   4899 C  CA  . MET B 1 90  ? -3.096  3.449   70.562  1.00 37.82  ? 90  MET B CA  1 
ATOM   4900 C  C   . MET B 1 90  ? -2.798  4.684   71.398  1.00 39.47  ? 90  MET B C   1 
ATOM   4901 O  O   . MET B 1 90  ? -3.471  4.961   72.391  1.00 51.55  ? 90  MET B O   1 
ATOM   4902 C  CB  . MET B 1 90  ? -3.997  3.846   69.392  1.00 41.70  ? 90  MET B CB  1 
ATOM   4903 C  CG  . MET B 1 90  ? -4.027  2.869   68.243  1.00 45.02  ? 90  MET B CG  1 
ATOM   4904 S  SD  . MET B 1 90  ? -5.114  3.444   66.934  1.00 39.58  ? 90  MET B SD  1 
ATOM   4905 C  CE  . MET B 1 90  ? -6.713  2.958   67.539  1.00 29.57  ? 90  MET B CE  1 
ATOM   4906 N  N   . SER B 1 91  ? -1.788  5.437   70.970  1.00 48.79  ? 91  SER B N   1 
ATOM   4907 C  CA  . SER B 1 91  ? -1.231  6.530   71.763  1.00 43.08  ? 91  SER B CA  1 
ATOM   4908 C  C   . SER B 1 91  ? -0.152  7.234   70.959  1.00 34.09  ? 91  SER B C   1 
ATOM   4909 O  O   . SER B 1 91  ? 0.554   6.579   70.192  1.00 40.07  ? 91  SER B O   1 
ATOM   4910 C  CB  . SER B 1 91  ? -0.655  6.000   73.075  1.00 37.04  ? 91  SER B CB  1 
ATOM   4911 O  OG  . SER B 1 91  ? 0.082   7.003   73.724  1.00 43.82  ? 91  SER B OG  1 
ATOM   4912 N  N   . GLU B 1 92  ? -0.039  8.561   71.082  1.00 32.41  ? 92  GLU B N   1 
ATOM   4913 C  CA  . GLU B 1 92  ? 1.076   9.251   70.429  1.00 40.13  ? 92  GLU B CA  1 
ATOM   4914 C  C   . GLU B 1 92  ? 2.404   8.901   71.081  1.00 54.15  ? 92  GLU B C   1 
ATOM   4915 O  O   . GLU B 1 92  ? 3.450   8.922   70.421  1.00 63.49  ? 92  GLU B O   1 
ATOM   4916 C  CB  . GLU B 1 92  ? 0.892   10.767  70.448  1.00 31.87  ? 92  GLU B CB  1 
ATOM   4917 C  CG  . GLU B 1 92  ? -0.310  11.217  69.733  1.00 36.93  ? 92  GLU B CG  1 
ATOM   4918 C  CD  . GLU B 1 92  ? -0.384  12.714  69.573  1.00 51.36  ? 92  GLU B CD  1 
ATOM   4919 O  OE1 . GLU B 1 92  ? 0.594   13.321  69.081  1.00 58.28  ? 92  GLU B OE1 1 
ATOM   4920 O  OE2 . GLU B 1 92  ? -1.431  13.299  69.922  1.00 63.72  1 92  GLU B OE2 1 
ATOM   4921 N  N   . ASP B 1 93  ? 2.377   8.616   72.375  1.00 47.38  ? 93  ASP B N   1 
ATOM   4922 C  CA  . ASP B 1 93  ? 3.464   7.929   73.038  1.00 45.13  ? 93  ASP B CA  1 
ATOM   4923 C  C   . ASP B 1 93  ? 3.573   6.514   72.475  1.00 46.12  ? 93  ASP B C   1 
ATOM   4924 O  O   . ASP B 1 93  ? 2.949   5.582   72.993  1.00 56.13  ? 93  ASP B O   1 
ATOM   4925 C  CB  . ASP B 1 93  ? 3.208   7.932   74.543  1.00 40.14  ? 93  ASP B CB  1 
ATOM   4926 C  CG  . ASP B 1 93  ? 4.430   7.595   75.339  1.00 48.52  ? 93  ASP B CG  1 
ATOM   4927 O  OD1 . ASP B 1 93  ? 5.302   6.892   74.796  1.00 51.18  ? 93  ASP B OD1 1 
ATOM   4928 O  OD2 . ASP B 1 93  ? 4.529   8.051   76.500  1.00 57.60  1 93  ASP B OD2 1 
ATOM   4929 N  N   . CYS B 1 94  ? 4.355   6.340   71.413  1.00 40.92  ? 94  CYS B N   1 
ATOM   4930 C  CA  . CYS B 1 94  ? 4.436   5.046   70.746  1.00 46.98  ? 94  CYS B CA  1 
ATOM   4931 C  C   . CYS B 1 94  ? 5.819   4.692   70.207  1.00 50.88  ? 94  CYS B C   1 
ATOM   4932 O  O   . CYS B 1 94  ? 5.983   3.581   69.687  1.00 58.08  ? 94  CYS B O   1 
ATOM   4933 C  CB  . CYS B 1 94  ? 3.425   4.975   69.587  1.00 44.61  ? 94  CYS B CB  1 
ATOM   4934 S  SG  . CYS B 1 94  ? 3.556   6.289   68.343  1.00 45.10  ? 94  CYS B SG  1 
ATOM   4935 N  N   . LEU B 1 95  ? 6.817   5.569   70.328  1.00 36.52  ? 95  LEU B N   1 
ATOM   4936 C  CA  . LEU B 1 95  ? 8.133   5.323   69.733  1.00 41.40  ? 95  LEU B CA  1 
ATOM   4937 C  C   . LEU B 1 95  ? 8.948   4.364   70.606  1.00 40.38  ? 95  LEU B C   1 
ATOM   4938 O  O   . LEU B 1 95  ? 9.818   4.758   71.384  1.00 41.93  ? 95  LEU B O   1 
ATOM   4939 C  CB  . LEU B 1 95  ? 8.863   6.641   69.501  1.00 39.08  ? 95  LEU B CB  1 
ATOM   4940 C  CG  . LEU B 1 95  ? 8.130   7.547   68.514  1.00 31.95  ? 95  LEU B CG  1 
ATOM   4941 C  CD1 . LEU B 1 95  ? 9.034   8.655   68.031  1.00 36.16  ? 95  LEU B CD1 1 
ATOM   4942 C  CD2 . LEU B 1 95  ? 7.645   6.711   67.350  1.00 29.76  ? 95  LEU B CD2 1 
ATOM   4943 N  N   . TYR B 1 96  ? 8.679   3.071   70.441  1.00 39.67  ? 96  TYR B N   1 
ATOM   4944 C  CA  . TYR B 1 96  ? 9.381   2.011   71.153  1.00 44.13  ? 96  TYR B CA  1 
ATOM   4945 C  C   . TYR B 1 96  ? 9.835   0.958   70.154  1.00 55.48  ? 96  TYR B C   1 
ATOM   4946 O  O   . TYR B 1 96  ? 9.418   0.955   68.991  1.00 53.95  ? 96  TYR B O   1 
ATOM   4947 C  CB  . TYR B 1 96  ? 8.499   1.363   72.225  1.00 42.70  ? 96  TYR B CB  1 
ATOM   4948 C  CG  . TYR B 1 96  ? 7.868   2.356   73.177  1.00 48.73  ? 96  TYR B CG  1 
ATOM   4949 C  CD1 . TYR B 1 96  ? 8.389   2.548   74.462  1.00 40.78  ? 96  TYR B CD1 1 
ATOM   4950 C  CD2 . TYR B 1 96  ? 6.759   3.104   72.799  1.00 39.91  ? 96  TYR B CD2 1 
ATOM   4951 C  CE1 . TYR B 1 96  ? 7.825   3.454   75.335  1.00 38.76  ? 96  TYR B CE1 1 
ATOM   4952 C  CE2 . TYR B 1 96  ? 6.194   4.020   73.668  1.00 47.29  ? 96  TYR B CE2 1 
ATOM   4953 C  CZ  . TYR B 1 96  ? 6.731   4.186   74.937  1.00 49.62  ? 96  TYR B CZ  1 
ATOM   4954 O  OH  . TYR B 1 96  ? 6.176   5.083   75.816  1.00 61.24  ? 96  TYR B OH  1 
ATOM   4955 N  N   . LEU B 1 97  ? 10.681  0.042   70.627  1.00 52.89  ? 97  LEU B N   1 
ATOM   4956 C  CA  . LEU B 1 97  ? 11.251  -0.985  69.765  1.00 47.68  ? 97  LEU B CA  1 
ATOM   4957 C  C   . LEU B 1 97  ? 11.467  -2.264  70.567  1.00 45.24  ? 97  LEU B C   1 
ATOM   4958 O  O   . LEU B 1 97  ? 11.673  -2.222  71.783  1.00 45.54  ? 97  LEU B O   1 
ATOM   4959 C  CB  . LEU B 1 97  ? 12.559  -0.496  69.129  1.00 47.28  ? 97  LEU B CB  1 
ATOM   4960 C  CG  . LEU B 1 97  ? 13.774  -0.197  70.015  1.00 45.43  ? 97  LEU B CG  1 
ATOM   4961 C  CD1 . LEU B 1 97  ? 14.611  -1.453  70.273  1.00 40.08  ? 97  LEU B CD1 1 
ATOM   4962 C  CD2 . LEU B 1 97  ? 14.627  0.872   69.376  1.00 43.27  ? 97  LEU B CD2 1 
ATOM   4963 N  N   . ASN B 1 98  ? 11.437  -3.404  69.871  1.00 42.17  ? 98  ASN B N   1 
ATOM   4964 C  CA  . ASN B 1 98  ? 11.506  -4.721  70.493  1.00 42.90  ? 98  ASN B CA  1 
ATOM   4965 C  C   . ASN B 1 98  ? 12.692  -5.507  69.965  1.00 45.41  ? 98  ASN B C   1 
ATOM   4966 O  O   . ASN B 1 98  ? 13.071  -5.375  68.801  1.00 55.56  ? 98  ASN B O   1 
ATOM   4967 C  CB  . ASN B 1 98  ? 10.238  -5.511  70.229  1.00 40.62  ? 98  ASN B CB  1 
ATOM   4968 C  CG  . ASN B 1 98  ? 9.028   -4.642  70.251  1.00 41.22  ? 98  ASN B CG  1 
ATOM   4969 O  OD1 . ASN B 1 98  ? 8.740   -3.988  71.257  1.00 38.44  ? 98  ASN B OD1 1 
ATOM   4970 N  ND2 . ASN B 1 98  ? 8.327   -4.582  69.124  1.00 47.71  ? 98  ASN B ND2 1 
ATOM   4971 N  N   . ILE B 1 99  ? 13.273  -6.338  70.827  1.00 46.07  ? 99  ILE B N   1 
ATOM   4972 C  CA  . ILE B 1 99  ? 14.472  -7.104  70.500  1.00 52.19  ? 99  ILE B CA  1 
ATOM   4973 C  C   . ILE B 1 99  ? 14.254  -8.543  70.950  1.00 52.18  ? 99  ILE B C   1 
ATOM   4974 O  O   . ILE B 1 99  ? 13.874  -8.781  72.101  1.00 60.86  ? 99  ILE B O   1 
ATOM   4975 C  CB  . ILE B 1 99  ? 15.731  -6.515  71.175  1.00 48.62  ? 99  ILE B CB  1 
ATOM   4976 C  CG1 . ILE B 1 99  ? 15.896  -5.017  70.864  1.00 38.04  ? 99  ILE B CG1 1 
ATOM   4977 C  CG2 . ILE B 1 99  ? 16.965  -7.278  70.749  1.00 50.86  ? 99  ILE B CG2 1 
ATOM   4978 C  CD1 . ILE B 1 99  ? 17.097  -4.353  71.567  1.00 32.10  ? 99  ILE B CD1 1 
ATOM   4979 N  N   . TRP B 1 100 ? 14.471  -9.496  70.048  1.00 46.40  ? 100 TRP B N   1 
ATOM   4980 C  CA  . TRP B 1 100 ? 14.575  -10.903 70.417  1.00 48.24  ? 100 TRP B CA  1 
ATOM   4981 C  C   . TRP B 1 100 ? 16.037  -11.288 70.338  1.00 55.56  ? 100 TRP B C   1 
ATOM   4982 O  O   . TRP B 1 100 ? 16.714  -10.960 69.359  1.00 62.51  ? 100 TRP B O   1 
ATOM   4983 C  CB  . TRP B 1 100 ? 13.737  -11.825 69.525  1.00 49.35  ? 100 TRP B CB  1 
ATOM   4984 C  CG  . TRP B 1 100 ? 12.279  -11.704 69.788  1.00 50.42  ? 100 TRP B CG  1 
ATOM   4985 C  CD1 . TRP B 1 100 ? 11.523  -12.474 70.626  1.00 52.81  ? 100 TRP B CD1 1 
ATOM   4986 C  CD2 . TRP B 1 100 ? 11.396  -10.730 69.233  1.00 45.66  ? 100 TRP B CD2 1 
ATOM   4987 N  NE1 . TRP B 1 100 ? 10.215  -12.039 70.621  1.00 46.97  ? 100 TRP B NE1 1 
ATOM   4988 C  CE2 . TRP B 1 100 ? 10.115  -10.968 69.773  1.00 45.21  ? 100 TRP B CE2 1 
ATOM   4989 C  CE3 . TRP B 1 100 ? 11.565  -9.674  68.335  1.00 44.11  ? 100 TRP B CE3 1 
ATOM   4990 C  CZ2 . TRP B 1 100 ? 9.013   -10.191 69.441  1.00 44.20  ? 100 TRP B CZ2 1 
ATOM   4991 C  CZ3 . TRP B 1 100 ? 10.467  -8.904  68.008  1.00 47.17  ? 100 TRP B CZ3 1 
ATOM   4992 C  CH2 . TRP B 1 100 ? 9.208   -9.167  68.560  1.00 46.41  ? 100 TRP B CH2 1 
ATOM   4993 N  N   . VAL B 1 101 ? 16.528  -11.945 71.383  1.00 53.96  ? 101 VAL B N   1 
ATOM   4994 C  CA  . VAL B 1 101 ? 17.936  -12.321 71.474  1.00 41.77  ? 101 VAL B CA  1 
ATOM   4995 C  C   . VAL B 1 101 ? 18.017  -13.815 71.744  1.00 38.23  ? 101 VAL B C   1 
ATOM   4996 O  O   . VAL B 1 101 ? 17.355  -14.287 72.678  1.00 37.91  ? 101 VAL B O   1 
ATOM   4997 C  CB  . VAL B 1 101 ? 18.648  -11.520 72.569  1.00 37.61  ? 101 VAL B CB  1 
ATOM   4998 C  CG1 . VAL B 1 101 ? 20.128  -11.831 72.527  1.00 32.92  ? 101 VAL B CG1 1 
ATOM   4999 C  CG2 . VAL B 1 101 ? 18.366  -10.044 72.434  1.00 43.33  ? 101 VAL B CG2 1 
ATOM   5000 N  N   . PRO B 1 102 ? 18.774  -14.586 70.964  1.00 36.36  ? 102 PRO B N   1 
ATOM   5001 C  CA  . PRO B 1 102 ? 18.884  -16.015 71.241  1.00 34.39  ? 102 PRO B CA  1 
ATOM   5002 C  C   . PRO B 1 102 ? 19.419  -16.267 72.644  1.00 43.39  ? 102 PRO B C   1 
ATOM   5003 O  O   . PRO B 1 102 ? 19.958  -15.376 73.315  1.00 39.55  ? 102 PRO B O   1 
ATOM   5004 C  CB  . PRO B 1 102 ? 19.841  -16.514 70.166  1.00 34.64  ? 102 PRO B CB  1 
ATOM   5005 C  CG  . PRO B 1 102 ? 19.700  -15.554 69.065  1.00 45.89  ? 102 PRO B CG  1 
ATOM   5006 C  CD  . PRO B 1 102 ? 19.414  -14.214 69.699  1.00 46.20  ? 102 PRO B CD  1 
ATOM   5007 N  N   . SER B 1 103 ? 19.229  -17.503 73.098  1.00 45.73  ? 103 SER B N   1 
ATOM   5008 C  CA  . SER B 1 103 ? 19.604  -17.899 74.435  1.00 53.40  ? 103 SER B CA  1 
ATOM   5009 C  C   . SER B 1 103 ? 20.250  -19.279 74.326  1.00 53.71  ? 103 SER B C   1 
ATOM   5010 O  O   . SER B 1 103 ? 19.618  -20.220 73.848  1.00 57.65  ? 103 SER B O   1 
ATOM   5011 C  CB  . SER B 1 103 ? 18.386  -17.908 75.385  1.00 64.94  ? 103 SER B CB  1 
ATOM   5012 O  OG  . SER B 1 103 ? 18.756  -18.057 76.751  1.00 69.47  ? 103 SER B OG  1 
ATOM   5013 N  N   . PRO B 1 104 ? 21.544  -19.393 74.715  1.00 52.77  ? 104 PRO B N   1 
ATOM   5014 C  CA  . PRO B 1 104 ? 22.417  -18.359 75.307  1.00 47.90  ? 104 PRO B CA  1 
ATOM   5015 C  C   . PRO B 1 104 ? 22.687  -17.182 74.375  1.00 47.64  ? 104 PRO B C   1 
ATOM   5016 O  O   . PRO B 1 104 ? 22.655  -17.337 73.149  1.00 58.89  ? 104 PRO B O   1 
ATOM   5017 C  CB  . PRO B 1 104 ? 23.716  -19.107 75.616  1.00 40.62  ? 104 PRO B CB  1 
ATOM   5018 C  CG  . PRO B 1 104 ? 23.459  -20.539 75.307  1.00 41.45  ? 104 PRO B CG  1 
ATOM   5019 C  CD  . PRO B 1 104 ? 22.309  -20.595 74.360  1.00 44.64  ? 104 PRO B CD  1 
ATOM   5020 N  N   . ARG B 1 105 ? 22.939  -16.033 74.954  1.00 39.77  ? 105 ARG B N   1 
ATOM   5021 C  CA  . ARG B 1 105 ? 23.059  -14.813 74.165  1.00 46.30  ? 105 ARG B CA  1 
ATOM   5022 C  C   . ARG B 1 105 ? 24.313  -14.858 73.284  1.00 62.53  ? 105 ARG B C   1 
ATOM   5023 O  O   . ARG B 1 105 ? 25.388  -15.245 73.757  1.00 68.08  ? 105 ARG B O   1 
ATOM   5024 C  CB  . ARG B 1 105 ? 23.082  -13.588 75.099  1.00 38.96  ? 105 ARG B CB  1 
ATOM   5025 C  CG  . ARG B 1 105 ? 23.751  -12.356 74.507  1.00 40.95  ? 105 ARG B CG  1 
ATOM   5026 C  CD  . ARG B 1 105 ? 24.139  -11.351 75.551  1.00 43.21  ? 105 ARG B CD  1 
ATOM   5027 N  NE  . ARG B 1 105 ? 23.063  -11.086 76.506  1.00 50.09  ? 105 ARG B NE  1 
ATOM   5028 C  CZ  . ARG B 1 105 ? 23.116  -10.172 77.472  1.00 61.50  ? 105 ARG B CZ  1 
ATOM   5029 N  NH1 . ARG B 1 105 ? 24.202  -9.429  77.604  1.00 65.69  1 105 ARG B NH1 1 
ATOM   5030 N  NH2 . ARG B 1 105 ? 22.085  -10.014 78.287  1.00 63.46  ? 105 ARG B NH2 1 
ATOM   5031 N  N   . PRO B 1 106 ? 24.214  -14.502 72.001  1.00 63.62  ? 106 PRO B N   1 
ATOM   5032 C  CA  . PRO B 1 106 ? 25.399  -14.515 71.127  1.00 64.09  ? 106 PRO B CA  1 
ATOM   5033 C  C   . PRO B 1 106 ? 26.472  -13.517 71.542  1.00 67.13  ? 106 PRO B C   1 
ATOM   5034 O  O   . PRO B 1 106 ? 26.325  -12.796 72.538  1.00 63.47  ? 106 PRO B O   1 
ATOM   5035 C  CB  . PRO B 1 106 ? 24.819  -14.152 69.751  1.00 64.95  ? 106 PRO B CB  1 
ATOM   5036 C  CG  . PRO B 1 106 ? 23.366  -14.509 69.843  1.00 63.44  ? 106 PRO B CG  1 
ATOM   5037 C  CD  . PRO B 1 106 ? 22.981  -14.204 71.259  1.00 62.13  ? 106 PRO B CD  1 
ATOM   5038 N  N   . LYS B 1 107 ? 27.558  -13.454 70.767  1.00 72.93  ? 107 LYS B N   1 
ATOM   5039 C  CA  . LYS B 1 107 ? 28.642  -12.514 71.047  1.00 65.42  ? 107 LYS B CA  1 
ATOM   5040 C  C   . LYS B 1 107 ? 28.599  -11.304 70.116  1.00 58.89  ? 107 LYS B C   1 
ATOM   5041 O  O   . LYS B 1 107 ? 28.477  -10.163 70.576  1.00 56.75  ? 107 LYS B O   1 
ATOM   5042 C  CB  . LYS B 1 107 ? 30.001  -13.233 70.971  1.00 53.51  ? 107 LYS B CB  1 
ATOM   5043 C  CG  . LYS B 1 107 ? 30.868  -12.982 72.210  1.00 52.23  ? 107 LYS B CG  1 
ATOM   5044 C  CD  . LYS B 1 107 ? 32.247  -13.632 72.132  1.00 59.77  ? 107 LYS B CD  1 
ATOM   5045 C  CE  . LYS B 1 107 ? 32.215  -15.131 72.427  1.00 63.11  ? 107 LYS B CE  1 
ATOM   5046 N  NZ  . LYS B 1 107 ? 33.592  -15.745 72.372  1.00 65.01  1 107 LYS B NZ  1 
ATOM   5047 N  N   . SER B 1 108 ? 28.672  -11.535 68.803  1.00 48.86  ? 108 SER B N   1 
ATOM   5048 C  CA  . SER B 1 108 ? 28.722  -10.464 67.811  1.00 51.16  ? 108 SER B CA  1 
ATOM   5049 C  C   . SER B 1 108 ? 27.991  -11.031 66.595  1.00 59.97  ? 108 SER B C   1 
ATOM   5050 O  O   . SER B 1 108 ? 28.600  -11.546 65.654  1.00 74.25  ? 108 SER B O   1 
ATOM   5051 C  CB  . SER B 1 108 ? 30.162  -10.056 67.480  1.00 55.25  ? 108 SER B CB  1 
ATOM   5052 O  OG  . SER B 1 108 ? 30.274  -8.733  66.968  1.00 54.34  ? 108 SER B OG  1 
ATOM   5053 N  N   . THR B 1 109 ? 26.662  -10.968 66.637  1.00 49.16  ? 109 THR B N   1 
ATOM   5054 C  CA  . THR B 1 109 ? 25.842  -11.687 65.677  1.00 42.27  ? 109 THR B CA  1 
ATOM   5055 C  C   . THR B 1 109 ? 25.039  -10.726 64.810  1.00 42.93  ? 109 THR B C   1 
ATOM   5056 O  O   . THR B 1 109 ? 24.862  -9.546  65.133  1.00 42.92  ? 109 THR B O   1 
ATOM   5057 C  CB  . THR B 1 109 ? 24.892  -12.665 66.371  1.00 37.49  ? 109 THR B CB  1 
ATOM   5058 O  OG1 . THR B 1 109 ? 24.287  -13.511 65.386  1.00 48.12  ? 109 THR B OG1 1 
ATOM   5059 C  CG2 . THR B 1 109 ? 23.798  -11.915 67.033  1.00 39.19  ? 109 THR B CG2 1 
ATOM   5060 N  N   . THR B 1 110 ? 24.555  -11.267 63.692  1.00 34.43  ? 110 THR B N   1 
ATOM   5061 C  CA  . THR B 1 110 ? 23.833  -10.475 62.711  1.00 33.56  ? 110 THR B CA  1 
ATOM   5062 C  C   . THR B 1 110 ? 22.552  -9.902  63.290  1.00 38.68  ? 110 THR B C   1 
ATOM   5063 O  O   . THR B 1 110 ? 21.821  -10.580 64.018  1.00 36.58  ? 110 THR B O   1 
ATOM   5064 C  CB  . THR B 1 110 ? 23.501  -11.338 61.511  1.00 37.04  ? 110 THR B CB  1 
ATOM   5065 O  OG1 . THR B 1 110 ? 24.696  -11.989 61.088  1.00 41.84  ? 110 THR B OG1 1 
ATOM   5066 C  CG2 . THR B 1 110 ? 22.972  -10.481 60.398  1.00 38.76  ? 110 THR B CG2 1 
ATOM   5067 N  N   . VAL B 1 111 ? 22.265  -8.655  62.933  1.00 45.05  ? 111 VAL B N   1 
ATOM   5068 C  CA  . VAL B 1 111 ? 21.092  -7.941  63.416  1.00 41.64  ? 111 VAL B CA  1 
ATOM   5069 C  C   . VAL B 1 111 ? 20.195  -7.638  62.229  1.00 36.32  ? 111 VAL B C   1 
ATOM   5070 O  O   . VAL B 1 111 ? 20.659  -7.078  61.232  1.00 38.02  ? 111 VAL B O   1 
ATOM   5071 C  CB  . VAL B 1 111 ? 21.487  -6.641  64.136  1.00 38.87  ? 111 VAL B CB  1 
ATOM   5072 C  CG1 . VAL B 1 111 ? 20.261  -5.900  64.609  1.00 28.20  ? 111 VAL B CG1 1 
ATOM   5073 C  CG2 . VAL B 1 111 ? 22.412  -6.962  65.277  1.00 44.28  ? 111 VAL B CG2 1 
ATOM   5074 N  N   . MET B 1 112 ? 18.916  -7.991  62.348  1.00 35.61  ? 112 MET B N   1 
ATOM   5075 C  CA  . MET B 1 112 ? 17.879  -7.661  61.374  1.00 34.89  ? 112 MET B CA  1 
ATOM   5076 C  C   . MET B 1 112 ? 16.825  -6.764  62.020  1.00 39.00  ? 112 MET B C   1 
ATOM   5077 O  O   . MET B 1 112 ? 16.273  -7.105  63.074  1.00 33.71  ? 112 MET B O   1 
ATOM   5078 C  CB  . MET B 1 112 ? 17.246  -8.938  60.806  1.00 27.81  ? 112 MET B CB  1 
ATOM   5079 C  CG  . MET B 1 112 ? 18.224  -9.830  60.047  1.00 39.61  ? 112 MET B CG  1 
ATOM   5080 S  SD  . MET B 1 112 ? 17.575  -11.487 59.654  1.00 42.89  ? 112 MET B SD  1 
ATOM   5081 C  CE  . MET B 1 112 ? 16.383  -11.186 58.364  1.00 28.21  ? 112 MET B CE  1 
ATOM   5082 N  N   . VAL B 1 113 ? 16.542  -5.623  61.387  1.00 37.92  ? 113 VAL B N   1 
ATOM   5083 C  CA  . VAL B 1 113 ? 15.596  -4.630  61.903  1.00 36.52  ? 113 VAL B CA  1 
ATOM   5084 C  C   . VAL B 1 113 ? 14.388  -4.525  60.970  1.00 38.08  ? 113 VAL B C   1 
ATOM   5085 O  O   . VAL B 1 113 ? 14.520  -4.071  59.828  1.00 38.69  ? 113 VAL B O   1 
ATOM   5086 C  CB  . VAL B 1 113 ? 16.253  -3.253  62.066  1.00 39.05  ? 113 VAL B CB  1 
ATOM   5087 C  CG1 . VAL B 1 113 ? 15.233  -2.251  62.572  1.00 39.89  ? 113 VAL B CG1 1 
ATOM   5088 C  CG2 . VAL B 1 113 ? 17.429  -3.330  63.001  1.00 38.89  ? 113 VAL B CG2 1 
ATOM   5089 N  N   . TRP B 1 114 ? 13.209  -4.890  61.480  1.00 30.77  ? 114 TRP B N   1 
ATOM   5090 C  CA  . TRP B 1 114 ? 11.963  -4.891  60.717  1.00 26.64  ? 114 TRP B CA  1 
ATOM   5091 C  C   . TRP B 1 114 ? 11.264  -3.533  60.765  1.00 28.16  ? 114 TRP B C   1 
ATOM   5092 O  O   . TRP B 1 114 ? 11.171  -2.900  61.821  1.00 27.38  ? 114 TRP B O   1 
ATOM   5093 C  CB  . TRP B 1 114 ? 11.013  -5.970  61.245  1.00 25.91  ? 114 TRP B CB  1 
ATOM   5094 C  CG  . TRP B 1 114 ? 9.733   -6.018  60.516  1.00 43.65  ? 114 TRP B CG  1 
ATOM   5095 C  CD1 . TRP B 1 114 ? 8.494   -5.615  60.958  1.00 46.90  ? 114 TRP B CD1 1 
ATOM   5096 C  CD2 . TRP B 1 114 ? 9.553   -6.461  59.176  1.00 56.45  ? 114 TRP B CD2 1 
ATOM   5097 N  NE1 . TRP B 1 114 ? 7.551   -5.804  59.975  1.00 48.78  ? 114 TRP B NE1 1 
ATOM   5098 C  CE2 . TRP B 1 114 ? 8.177   -6.322  58.869  1.00 58.35  ? 114 TRP B CE2 1 
ATOM   5099 C  CE3 . TRP B 1 114 ? 10.419  -6.978  58.205  1.00 51.72  ? 114 TRP B CE3 1 
ATOM   5100 C  CZ2 . TRP B 1 114 ? 7.656   -6.685  57.631  1.00 55.50  ? 114 TRP B CZ2 1 
ATOM   5101 C  CZ3 . TRP B 1 114 ? 9.903   -7.333  56.990  1.00 53.55  ? 114 TRP B CZ3 1 
ATOM   5102 C  CH2 . TRP B 1 114 ? 8.531   -7.181  56.706  1.00 50.52  ? 114 TRP B CH2 1 
ATOM   5103 N  N   . ILE B 1 115 ? 10.773  -3.085  59.609  1.00 31.34  ? 115 ILE B N   1 
ATOM   5104 C  CA  . ILE B 1 115 ? 9.942   -1.885  59.505  1.00 26.25  ? 115 ILE B CA  1 
ATOM   5105 C  C   . ILE B 1 115 ? 8.608   -2.269  58.885  1.00 29.86  ? 115 ILE B C   1 
ATOM   5106 O  O   . ILE B 1 115 ? 8.566   -2.736  57.742  1.00 42.24  ? 115 ILE B O   1 
ATOM   5107 C  CB  . ILE B 1 115 ? 10.617  -0.785  58.681  1.00 23.90  ? 115 ILE B CB  1 
ATOM   5108 C  CG1 . ILE B 1 115 ? 12.013  -0.501  59.233  1.00 24.05  ? 115 ILE B CG1 1 
ATOM   5109 C  CG2 . ILE B 1 115 ? 9.728   0.442   58.664  1.00 23.68  ? 115 ILE B CG2 1 
ATOM   5110 C  CD1 . ILE B 1 115 ? 13.112  -0.826  58.263  1.00 34.45  ? 115 ILE B CD1 1 
ATOM   5111 N  N   . TYR B 1 116 ? 7.521   -2.054  59.618  1.00 28.00  ? 116 TYR B N   1 
ATOM   5112 C  CA  . TYR B 1 116 ? 6.216   -2.489  59.132  1.00 37.13  ? 116 TYR B CA  1 
ATOM   5113 C  C   . TYR B 1 116 ? 5.689   -1.558  58.039  1.00 33.41  ? 116 TYR B C   1 
ATOM   5114 O  O   . TYR B 1 116 ? 5.997   -0.360  58.008  1.00 32.73  ? 116 TYR B O   1 
ATOM   5115 C  CB  . TYR B 1 116 ? 5.195   -2.569  60.278  1.00 38.18  ? 116 TYR B CB  1 
ATOM   5116 C  CG  . TYR B 1 116 ? 5.007   -1.299  61.090  1.00 34.02  ? 116 TYR B CG  1 
ATOM   5117 C  CD1 . TYR B 1 116 ? 4.438   -0.165  60.530  1.00 24.12  ? 116 TYR B CD1 1 
ATOM   5118 C  CD2 . TYR B 1 116 ? 5.385   -1.245  62.428  1.00 29.08  ? 116 TYR B CD2 1 
ATOM   5119 C  CE1 . TYR B 1 116 ? 4.263   0.992   61.263  1.00 24.06  ? 116 TYR B CE1 1 
ATOM   5120 C  CE2 . TYR B 1 116 ? 5.209   -0.092  63.177  1.00 28.13  ? 116 TYR B CE2 1 
ATOM   5121 C  CZ  . TYR B 1 116 ? 4.646   1.029   62.587  1.00 32.68  ? 116 TYR B CZ  1 
ATOM   5122 O  OH  . TYR B 1 116 ? 4.457   2.191   63.317  1.00 34.45  ? 116 TYR B OH  1 
ATOM   5123 N  N   . GLY B 1 117 ? 4.905   -2.129  57.122  1.00 24.28  ? 117 GLY B N   1 
ATOM   5124 C  CA  . GLY B 1 117 ? 4.123   -1.355  56.183  1.00 39.88  ? 117 GLY B CA  1 
ATOM   5125 C  C   . GLY B 1 117 ? 2.775   -0.960  56.769  1.00 37.48  ? 117 GLY B C   1 
ATOM   5126 O  O   . GLY B 1 117 ? 2.521   -1.081  57.966  1.00 39.94  ? 117 GLY B O   1 
ATOM   5127 N  N   . GLY B 1 118 ? 1.890   -0.498  55.897  1.00 32.83  ? 118 GLY B N   1 
ATOM   5128 C  CA  . GLY B 1 118 ? 0.637   0.068   56.349  1.00 36.28  ? 118 GLY B CA  1 
ATOM   5129 C  C   . GLY B 1 118 ? 0.326   1.383   55.667  1.00 39.00  ? 118 GLY B C   1 
ATOM   5130 O  O   . GLY B 1 118 ? -0.475  2.183   56.167  1.00 38.69  ? 118 GLY B O   1 
ATOM   5131 N  N   . GLY B 1 119 ? 0.980   1.613   54.526  1.00 35.91  ? 119 GLY B N   1 
ATOM   5132 C  CA  . GLY B 1 119 ? 0.698   2.750   53.673  1.00 27.77  ? 119 GLY B CA  1 
ATOM   5133 C  C   . GLY B 1 119 ? 1.158   4.080   54.210  1.00 38.57  ? 119 GLY B C   1 
ATOM   5134 O  O   . GLY B 1 119 ? 0.708   5.118   53.712  1.00 35.06  ? 119 GLY B O   1 
ATOM   5135 N  N   . PHE B 1 120 ? 2.043   4.077   55.217  1.00 43.49  ? 120 PHE B N   1 
ATOM   5136 C  CA  . PHE B 1 120 ? 2.447   5.244   56.000  1.00 32.20  ? 120 PHE B CA  1 
ATOM   5137 C  C   . PHE B 1 120 ? 1.284   5.853   56.791  1.00 32.22  ? 120 PHE B C   1 
ATOM   5138 O  O   . PHE B 1 120 ? 1.440   6.912   57.417  1.00 28.58  ? 120 PHE B O   1 
ATOM   5139 C  CB  . PHE B 1 120 ? 3.108   6.316   55.119  1.00 29.49  ? 120 PHE B CB  1 
ATOM   5140 C  CG  . PHE B 1 120 ? 4.428   5.899   54.519  1.00 28.29  ? 120 PHE B CG  1 
ATOM   5141 C  CD1 . PHE B 1 120 ? 5.540   5.630   55.327  1.00 31.54  ? 120 PHE B CD1 1 
ATOM   5142 C  CD2 . PHE B 1 120 ? 4.572   5.807   53.150  1.00 25.15  ? 120 PHE B CD2 1 
ATOM   5143 C  CE1 . PHE B 1 120 ? 6.773   5.265   54.770  1.00 23.70  ? 120 PHE B CE1 1 
ATOM   5144 C  CE2 . PHE B 1 120 ? 5.793   5.443   52.589  1.00 38.85  ? 120 PHE B CE2 1 
ATOM   5145 C  CZ  . PHE B 1 120 ? 6.891   5.166   53.403  1.00 33.42  ? 120 PHE B CZ  1 
ATOM   5146 N  N   . TYR B 1 121 ? 0.115   5.219   56.768  1.00 32.12  ? 121 TYR B N   1 
ATOM   5147 C  CA  . TYR B 1 121 ? -1.030  5.652   57.552  1.00 27.69  ? 121 TYR B CA  1 
ATOM   5148 C  C   . TYR B 1 121 ? -1.354  4.676   58.677  1.00 32.21  ? 121 TYR B C   1 
ATOM   5149 O  O   . TYR B 1 121 ? -2.160  5.013   59.555  1.00 36.59  ? 121 TYR B O   1 
ATOM   5150 C  CB  . TYR B 1 121 ? -2.272  5.847   56.640  1.00 29.17  ? 121 TYR B CB  1 
ATOM   5151 C  CG  . TYR B 1 121 ? -2.937  4.542   56.177  1.00 32.91  ? 121 TYR B CG  1 
ATOM   5152 C  CD1 . TYR B 1 121 ? -3.945  3.937   56.930  1.00 30.76  ? 121 TYR B CD1 1 
ATOM   5153 C  CD2 . TYR B 1 121 ? -2.557  3.922   54.987  1.00 30.17  ? 121 TYR B CD2 1 
ATOM   5154 C  CE1 . TYR B 1 121 ? -4.536  2.743   56.525  1.00 33.27  ? 121 TYR B CE1 1 
ATOM   5155 C  CE2 . TYR B 1 121 ? -3.144  2.732   54.574  1.00 26.89  ? 121 TYR B CE2 1 
ATOM   5156 C  CZ  . TYR B 1 121 ? -4.134  2.150   55.346  1.00 36.58  ? 121 TYR B CZ  1 
ATOM   5157 O  OH  . TYR B 1 121 ? -4.722  0.967   54.953  1.00 41.64  ? 121 TYR B OH  1 
ATOM   5158 N  N   . SER B 1 122 ? -0.753  3.483   58.683  1.00 28.24  ? 122 SER B N   1 
ATOM   5159 C  CA  . SER B 1 122 ? -1.022  2.498   59.725  1.00 30.34  ? 122 SER B CA  1 
ATOM   5160 C  C   . SER B 1 122 ? 0.169   1.550   59.860  1.00 30.16  ? 122 SER B C   1 
ATOM   5161 O  O   . SER B 1 122 ? 1.143   1.641   59.118  1.00 37.21  ? 122 SER B O   1 
ATOM   5162 C  CB  . SER B 1 122 ? -2.292  1.710   59.424  1.00 31.60  ? 122 SER B CB  1 
ATOM   5163 O  OG  . SER B 1 122 ? -2.059  0.828   58.338  1.00 39.28  ? 122 SER B OG  1 
ATOM   5164 N  N   . GLY B 1 123 ? 0.056   0.615   60.803  1.00 36.06  ? 123 GLY B N   1 
ATOM   5165 C  CA  . GLY B 1 123 ? 1.087   -0.363  61.119  1.00 39.16  ? 123 GLY B CA  1 
ATOM   5166 C  C   . GLY B 1 123 ? 1.414   -0.441  62.613  1.00 45.05  ? 123 GLY B C   1 
ATOM   5167 O  O   . GLY B 1 123 ? 1.300   0.533   63.359  1.00 35.13  ? 123 GLY B O   1 
ATOM   5168 N  N   . SER B 1 124 ? 1.840   -1.630  63.048  1.00 37.55  ? 124 SER B N   1 
ATOM   5169 C  CA  . SER B 1 124 ? 2.277   -1.809  64.423  1.00 41.81  ? 124 SER B CA  1 
ATOM   5170 C  C   . SER B 1 124 ? 3.479   -2.744  64.467  1.00 50.49  ? 124 SER B C   1 
ATOM   5171 O  O   . SER B 1 124 ? 3.597   -3.661  63.649  1.00 53.91  ? 124 SER B O   1 
ATOM   5172 C  CB  . SER B 1 124 ? 1.156   -2.369  65.297  1.00 49.84  ? 124 SER B CB  1 
ATOM   5173 O  OG  . SER B 1 124 ? 0.017   -1.525  65.280  1.00 54.88  ? 124 SER B OG  1 
ATOM   5174 N  N   . SER B 1 125 ? 4.382   -2.497  65.428  1.00 42.24  ? 125 SER B N   1 
ATOM   5175 C  CA  . SER B 1 125 ? 5.492   -3.408  65.682  1.00 40.97  ? 125 SER B CA  1 
ATOM   5176 C  C   . SER B 1 125 ? 5.066   -4.687  66.388  1.00 46.62  ? 125 SER B C   1 
ATOM   5177 O  O   . SER B 1 125 ? 5.882   -5.603  66.495  1.00 50.19  ? 125 SER B O   1 
ATOM   5178 C  CB  . SER B 1 125 ? 6.573   -2.729  66.529  1.00 45.05  ? 125 SER B CB  1 
ATOM   5179 O  OG  . SER B 1 125 ? 6.130   -2.526  67.867  1.00 52.63  ? 125 SER B OG  1 
ATOM   5180 N  N   . THR B 1 126 ? 3.812   -4.781  66.843  1.00 51.69  ? 126 THR B N   1 
ATOM   5181 C  CA  . THR B 1 126 ? 3.393   -5.771  67.830  1.00 52.04  ? 126 THR B CA  1 
ATOM   5182 C  C   . THR B 1 126 ? 2.379   -6.774  67.277  1.00 48.12  ? 126 THR B C   1 
ATOM   5183 O  O   . THR B 1 126 ? 1.620   -7.383  68.033  1.00 48.36  ? 126 THR B O   1 
ATOM   5184 C  CB  . THR B 1 126 ? 2.831   -5.060  69.067  1.00 46.71  ? 126 THR B CB  1 
ATOM   5185 O  OG1 . THR B 1 126 ? 1.609   -4.385  68.740  1.00 41.72  ? 126 THR B OG1 1 
ATOM   5186 C  CG2 . THR B 1 126 ? 3.808   -4.020  69.573  1.00 51.88  ? 126 THR B CG2 1 
ATOM   5187 N  N   . LEU B 1 127 ? 2.359   -6.985  65.970  1.00 39.33  ? 127 LEU B N   1 
ATOM   5188 C  CA  . LEU B 1 127 ? 1.387   -7.897  65.378  1.00 36.85  ? 127 LEU B CA  1 
ATOM   5189 C  C   . LEU B 1 127 ? 1.892   -9.331  65.322  1.00 32.94  ? 127 LEU B C   1 
ATOM   5190 O  O   . LEU B 1 127 ? 3.032   -9.589  64.946  1.00 42.51  ? 127 LEU B O   1 
ATOM   5191 C  CB  . LEU B 1 127 ? 0.989   -7.422  63.978  1.00 39.97  ? 127 LEU B CB  1 
ATOM   5192 C  CG  . LEU B 1 127 ? 0.629   -5.933  63.859  1.00 41.06  ? 127 LEU B CG  1 
ATOM   5193 C  CD1 . LEU B 1 127 ? 0.025   -5.633  62.495  1.00 35.84  ? 127 LEU B CD1 1 
ATOM   5194 C  CD2 . LEU B 1 127 ? -0.370  -5.562  64.959  1.00 54.00  ? 127 LEU B CD2 1 
ATOM   5195 N  N   . ASP B 1 128 ? 1.011   -10.263 65.660  1.00 33.15  ? 128 ASP B N   1 
ATOM   5196 C  CA  . ASP B 1 128 ? 1.297   -11.693 65.652  1.00 30.69  ? 128 ASP B CA  1 
ATOM   5197 C  C   . ASP B 1 128 ? 2.194   -12.147 64.513  1.00 35.09  ? 128 ASP B C   1 
ATOM   5198 O  O   . ASP B 1 128 ? 2.960   -13.104 64.661  1.00 46.54  ? 128 ASP B O   1 
ATOM   5199 C  CB  . ASP B 1 128 ? -0.001  -12.496 65.580  1.00 31.20  ? 128 ASP B CB  1 
ATOM   5200 C  CG  . ASP B 1 128 ? -0.707  -12.546 66.891  1.00 51.12  ? 128 ASP B CG  1 
ATOM   5201 O  OD1 . ASP B 1 128 ? -1.941  -12.705 66.895  1.00 66.64  ? 128 ASP B OD1 1 
ATOM   5202 O  OD2 . ASP B 1 128 ? -0.027  -12.378 67.924  1.00 66.75  1 128 ASP B OD2 1 
ATOM   5203 N  N   . VAL B 1 129 ? 2.093   -11.489 63.361  1.00 33.58  ? 129 VAL B N   1 
ATOM   5204 C  CA  . VAL B 1 129 ? 2.794   -11.978 62.181  1.00 41.24  ? 129 VAL B CA  1 
ATOM   5205 C  C   . VAL B 1 129 ? 4.212   -11.423 62.136  1.00 46.09  ? 129 VAL B C   1 
ATOM   5206 O  O   . VAL B 1 129 ? 5.068   -11.968 61.423  1.00 54.13  ? 129 VAL B O   1 
ATOM   5207 C  CB  . VAL B 1 129 ? 1.906   -11.680 60.944  1.00 28.91  ? 129 VAL B CB  1 
ATOM   5208 C  CG1 . VAL B 1 129 ? 2.129   -10.290 60.389  1.00 28.02  ? 129 VAL B CG1 1 
ATOM   5209 C  CG2 . VAL B 1 129 ? 2.068   -12.743 59.878  1.00 29.35  ? 129 VAL B CG2 1 
ATOM   5210 N  N   . TYR B 1 130 ? 4.499   -10.386 62.923  1.00 46.77  ? 130 TYR B N   1 
ATOM   5211 C  CA  . TYR B 1 130 ? 5.843   -9.858  63.125  1.00 39.65  ? 130 TYR B CA  1 
ATOM   5212 C  C   . TYR B 1 130 ? 6.473   -10.312 64.444  1.00 42.90  ? 130 TYR B C   1 
ATOM   5213 O  O   . TYR B 1 130 ? 7.296   -9.587  65.011  1.00 58.17  ? 130 TYR B O   1 
ATOM   5214 C  CB  . TYR B 1 130 ? 5.847   -8.328  63.081  1.00 33.83  ? 130 TYR B CB  1 
ATOM   5215 C  CG  . TYR B 1 130 ? 5.063   -7.630  61.989  1.00 35.33  ? 130 TYR B CG  1 
ATOM   5216 C  CD1 . TYR B 1 130 ? 4.527   -6.359  62.213  1.00 30.55  ? 130 TYR B CD1 1 
ATOM   5217 C  CD2 . TYR B 1 130 ? 4.902   -8.203  60.719  1.00 36.83  ? 130 TYR B CD2 1 
ATOM   5218 C  CE1 . TYR B 1 130 ? 3.842   -5.678  61.220  1.00 26.53  ? 130 TYR B CE1 1 
ATOM   5219 C  CE2 . TYR B 1 130 ? 4.207   -7.533  59.713  1.00 26.16  ? 130 TYR B CE2 1 
ATOM   5220 C  CZ  . TYR B 1 130 ? 3.678   -6.268  59.974  1.00 29.48  ? 130 TYR B CZ  1 
ATOM   5221 O  OH  . TYR B 1 130 ? 2.979   -5.573  59.002  1.00 35.01  ? 130 TYR B OH  1 
ATOM   5222 N  N   . ASN B 1 131 ? 6.108   -11.482 64.957  1.00 34.19  ? 131 ASN B N   1 
ATOM   5223 C  CA  . ASN B 1 131 ? 6.776   -12.001 66.143  1.00 39.77  ? 131 ASN B CA  1 
ATOM   5224 C  C   . ASN B 1 131 ? 8.187   -12.455 65.766  1.00 45.95  ? 131 ASN B C   1 
ATOM   5225 O  O   . ASN B 1 131 ? 8.361   -13.463 65.072  1.00 55.23  ? 131 ASN B O   1 
ATOM   5226 C  CB  . ASN B 1 131 ? 5.973   -13.154 66.730  1.00 43.95  ? 131 ASN B CB  1 
ATOM   5227 C  CG  . ASN B 1 131 ? 6.416   -13.514 68.127  1.00 49.88  ? 131 ASN B CG  1 
ATOM   5228 O  OD1 . ASN B 1 131 ? 7.516   -13.157 68.567  1.00 57.81  ? 131 ASN B OD1 1 
ATOM   5229 N  ND2 . ASN B 1 131 ? 5.559   -14.224 68.839  1.00 49.25  ? 131 ASN B ND2 1 
ATOM   5230 N  N   . GLY B 1 132 ? 9.202   -11.733 66.227  1.00 34.47  ? 132 GLY B N   1 
ATOM   5231 C  CA  . GLY B 1 132 ? 10.529  -12.167 65.859  1.00 42.35  ? 132 GLY B CA  1 
ATOM   5232 C  C   . GLY B 1 132 ? 11.022  -13.415 66.562  1.00 52.24  ? 132 GLY B C   1 
ATOM   5233 O  O   . GLY B 1 132 ? 12.162  -13.826 66.319  1.00 54.14  ? 132 GLY B O   1 
ATOM   5234 N  N   . LYS B 1 133 ? 10.210  -14.041 67.419  1.00 51.98  ? 133 LYS B N   1 
ATOM   5235 C  CA  . LYS B 1 133 ? 10.756  -15.102 68.260  1.00 56.12  ? 133 LYS B CA  1 
ATOM   5236 C  C   . LYS B 1 133 ? 11.218  -16.298 67.428  1.00 50.14  ? 133 LYS B C   1 
ATOM   5237 O  O   . LYS B 1 133 ? 12.254  -16.893 67.731  1.00 46.52  ? 133 LYS B O   1 
ATOM   5238 C  CB  . LYS B 1 133 ? 9.749   -15.519 69.344  1.00 49.12  ? 133 LYS B CB  1 
ATOM   5239 C  CG  . LYS B 1 133 ? 8.479   -16.224 68.903  1.00 32.42  ? 133 LYS B CG  1 
ATOM   5240 C  CD  . LYS B 1 133 ? 7.989   -17.068 70.066  1.00 44.04  ? 133 LYS B CD  1 
ATOM   5241 C  CE  . LYS B 1 133 ? 6.488   -16.968 70.269  1.00 50.03  ? 133 LYS B CE  1 
ATOM   5242 N  NZ  . LYS B 1 133 ? 5.942   -17.999 71.193  1.00 38.07  1 133 LYS B NZ  1 
ATOM   5243 N  N   . TYR B 1 134 ? 10.496  -16.641 66.354  1.00 42.96  ? 134 TYR B N   1 
ATOM   5244 C  CA  . TYR B 1 134 ? 10.870  -17.813 65.561  1.00 44.63  ? 134 TYR B CA  1 
ATOM   5245 C  C   . TYR B 1 134 ? 12.099  -17.538 64.702  1.00 47.01  ? 134 TYR B C   1 
ATOM   5246 O  O   . TYR B 1 134 ? 12.953  -18.418 64.522  1.00 44.63  ? 134 TYR B O   1 
ATOM   5247 C  CB  . TYR B 1 134 ? 9.688   -18.251 64.690  1.00 45.24  ? 134 TYR B CB  1 
ATOM   5248 C  CG  . TYR B 1 134 ? 8.419   -18.341 65.485  1.00 54.05  ? 134 TYR B CG  1 
ATOM   5249 C  CD1 . TYR B 1 134 ? 7.393   -17.401 65.331  1.00 49.56  ? 134 TYR B CD1 1 
ATOM   5250 C  CD2 . TYR B 1 134 ? 8.258   -19.344 66.430  1.00 64.51  ? 134 TYR B CD2 1 
ATOM   5251 C  CE1 . TYR B 1 134 ? 6.234   -17.481 66.095  1.00 45.46  ? 134 TYR B CE1 1 
ATOM   5252 C  CE2 . TYR B 1 134 ? 7.114   -19.430 67.196  1.00 64.42  ? 134 TYR B CE2 1 
ATOM   5253 C  CZ  . TYR B 1 134 ? 6.110   -18.500 67.033  1.00 53.85  ? 134 TYR B CZ  1 
ATOM   5254 O  OH  . TYR B 1 134 ? 4.989   -18.622 67.821  1.00 60.88  ? 134 TYR B OH  1 
ATOM   5255 N  N   . LEU B 1 135 ? 12.200  -16.323 64.159  1.00 44.51  ? 135 LEU B N   1 
ATOM   5256 C  CA  . LEU B 1 135 ? 13.307  -15.984 63.272  1.00 37.91  ? 135 LEU B CA  1 
ATOM   5257 C  C   . LEU B 1 135 ? 14.602  -15.854 64.046  1.00 48.69  ? 135 LEU B C   1 
ATOM   5258 O  O   . LEU B 1 135 ? 15.592  -16.528 63.734  1.00 53.25  ? 135 LEU B O   1 
ATOM   5259 C  CB  . LEU B 1 135 ? 12.989  -14.695 62.526  1.00 35.81  ? 135 LEU B CB  1 
ATOM   5260 C  CG  . LEU B 1 135 ? 13.939  -14.197 61.455  1.00 38.91  ? 135 LEU B CG  1 
ATOM   5261 C  CD1 . LEU B 1 135 ? 14.209  -15.248 60.391  1.00 37.21  ? 135 LEU B CD1 1 
ATOM   5262 C  CD2 . LEU B 1 135 ? 13.306  -12.979 60.843  1.00 38.50  ? 135 LEU B CD2 1 
ATOM   5263 N  N   . ALA B 1 136 ? 14.607  -14.994 65.069  1.00 50.02  ? 136 ALA B N   1 
ATOM   5264 C  CA  . ALA B 1 136 ? 15.779  -14.863 65.923  1.00 41.85  ? 136 ALA B CA  1 
ATOM   5265 C  C   . ALA B 1 136 ? 16.241  -16.220 66.408  1.00 48.33  ? 136 ALA B C   1 
ATOM   5266 O  O   . ALA B 1 136 ? 17.448  -16.473 66.513  1.00 55.30  ? 136 ALA B O   1 
ATOM   5267 C  CB  . ALA B 1 136 ? 15.475  -13.947 67.101  1.00 31.39  ? 136 ALA B CB  1 
ATOM   5268 N  N   . TYR B 1 137 ? 15.291  -17.128 66.644  1.00 47.02  ? 137 TYR B N   1 
ATOM   5269 C  CA  . TYR B 1 137 ? 15.595  -18.431 67.228  1.00 48.13  ? 137 TYR B CA  1 
ATOM   5270 C  C   . TYR B 1 137 ? 16.198  -19.391 66.204  1.00 54.07  ? 137 TYR B C   1 
ATOM   5271 O  O   . TYR B 1 137 ? 17.222  -20.025 66.472  1.00 60.39  ? 137 TYR B O   1 
ATOM   5272 C  CB  . TYR B 1 137 ? 14.333  -19.039 67.831  1.00 39.22  ? 137 TYR B CB  1 
ATOM   5273 C  CG  . TYR B 1 137 ? 14.474  -20.464 68.285  1.00 40.46  ? 137 TYR B CG  1 
ATOM   5274 C  CD1 . TYR B 1 137 ? 15.367  -20.832 69.293  1.00 41.80  ? 137 TYR B CD1 1 
ATOM   5275 C  CD2 . TYR B 1 137 ? 13.771  -21.465 67.628  1.00 42.07  ? 137 TYR B CD2 1 
ATOM   5276 C  CE1 . TYR B 1 137 ? 15.487  -22.159 69.683  1.00 39.55  ? 137 TYR B CE1 1 
ATOM   5277 C  CE2 . TYR B 1 137 ? 13.895  -22.780 67.984  1.00 38.68  ? 137 TYR B CE2 1 
ATOM   5278 C  CZ  . TYR B 1 137 ? 14.751  -23.125 69.014  1.00 41.35  ? 137 TYR B CZ  1 
ATOM   5279 O  OH  . TYR B 1 137 ? 14.867  -24.442 69.379  1.00 45.75  ? 137 TYR B OH  1 
ATOM   5280 N  N   . THR B 1 138 ? 15.580  -19.537 65.029  1.00 43.97  ? 138 THR B N   1 
ATOM   5281 C  CA  . THR B 1 138 ? 16.027  -20.616 64.150  1.00 52.49  ? 138 THR B CA  1 
ATOM   5282 C  C   . THR B 1 138 ? 17.182  -20.207 63.230  1.00 50.35  ? 138 THR B C   1 
ATOM   5283 O  O   . THR B 1 138 ? 17.826  -21.082 62.643  1.00 52.20  ? 138 THR B O   1 
ATOM   5284 C  CB  . THR B 1 138 ? 14.846  -21.190 63.337  1.00 61.33  ? 138 THR B CB  1 
ATOM   5285 O  OG1 . THR B 1 138 ? 14.584  -20.378 62.199  1.00 79.26  ? 138 THR B OG1 1 
ATOM   5286 C  CG2 . THR B 1 138 ? 13.585  -21.335 64.160  1.00 59.09  ? 138 THR B CG2 1 
ATOM   5287 N  N   . GLU B 1 139 ? 17.474  -18.912 63.095  1.00 45.80  ? 139 GLU B N   1 
ATOM   5288 C  CA  . GLU B 1 139 ? 18.641  -18.460 62.349  1.00 41.33  ? 139 GLU B CA  1 
ATOM   5289 C  C   . GLU B 1 139 ? 19.737  -17.886 63.236  1.00 47.67  ? 139 GLU B C   1 
ATOM   5290 O  O   . GLU B 1 139 ? 20.804  -17.522 62.722  1.00 49.30  ? 139 GLU B O   1 
ATOM   5291 C  CB  . GLU B 1 139 ? 18.232  -17.419 61.312  1.00 41.17  ? 139 GLU B CB  1 
ATOM   5292 C  CG  . GLU B 1 139 ? 17.353  -17.990 60.224  1.00 46.06  ? 139 GLU B CG  1 
ATOM   5293 C  CD  . GLU B 1 139 ? 18.000  -19.176 59.559  1.00 50.15  ? 139 GLU B CD  1 
ATOM   5294 O  OE1 . GLU B 1 139 ? 19.079  -19.012 58.962  1.00 49.65  ? 139 GLU B OE1 1 
ATOM   5295 O  OE2 . GLU B 1 139 ? 17.438  -20.281 59.642  1.00 52.67  1 139 GLU B OE2 1 
ATOM   5296 N  N   . GLU B 1 140 ? 19.496  -17.782 64.545  1.00 43.73  ? 140 GLU B N   1 
ATOM   5297 C  CA  . GLU B 1 140 ? 20.451  -17.219 65.500  1.00 46.55  ? 140 GLU B CA  1 
ATOM   5298 C  C   . GLU B 1 140 ? 20.876  -15.798 65.133  1.00 49.47  ? 140 GLU B C   1 
ATOM   5299 O  O   . GLU B 1 140 ? 22.037  -15.413 65.309  1.00 49.03  ? 140 GLU B O   1 
ATOM   5300 C  CB  . GLU B 1 140 ? 21.667  -18.126 65.672  1.00 46.42  ? 140 GLU B CB  1 
ATOM   5301 C  CG  . GLU B 1 140 ? 21.606  -18.951 66.952  1.00 61.36  ? 140 GLU B CG  1 
ATOM   5302 C  CD  . GLU B 1 140 ? 22.498  -20.175 66.899  1.00 79.28  ? 140 GLU B CD  1 
ATOM   5303 O  OE1 . GLU B 1 140 ? 22.155  -21.115 66.145  1.00 78.95  ? 140 GLU B OE1 1 
ATOM   5304 O  OE2 . GLU B 1 140 ? 23.529  -20.206 67.614  1.00 89.06  1 140 GLU B OE2 1 
ATOM   5305 N  N   . VAL B 1 141 ? 19.919  -15.006 64.647  1.00 39.36  ? 141 VAL B N   1 
ATOM   5306 C  CA  . VAL B 1 141 ? 20.091  -13.573 64.499  1.00 36.69  ? 141 VAL B CA  1 
ATOM   5307 C  C   . VAL B 1 141 ? 19.378  -12.885 65.658  1.00 42.84  ? 141 VAL B C   1 
ATOM   5308 O  O   . VAL B 1 141 ? 18.560  -13.474 66.373  1.00 38.85  ? 141 VAL B O   1 
ATOM   5309 C  CB  . VAL B 1 141 ? 19.571  -13.047 63.138  1.00 41.94  ? 141 VAL B CB  1 
ATOM   5310 C  CG1 . VAL B 1 141 ? 20.356  -13.657 61.975  1.00 46.44  ? 141 VAL B CG1 1 
ATOM   5311 C  CG2 . VAL B 1 141 ? 18.073  -13.335 62.996  1.00 38.50  ? 141 VAL B CG2 1 
ATOM   5312 N  N   . VAL B 1 142 ? 19.717  -11.621 65.857  1.00 42.75  ? 142 VAL B N   1 
ATOM   5313 C  CA  . VAL B 1 142 ? 19.113  -10.778 66.876  1.00 41.45  ? 142 VAL B CA  1 
ATOM   5314 C  C   . VAL B 1 142 ? 18.091  -9.920  66.148  1.00 49.14  ? 142 VAL B C   1 
ATOM   5315 O  O   . VAL B 1 142 ? 18.461  -9.060  65.339  1.00 59.34  ? 142 VAL B O   1 
ATOM   5316 C  CB  . VAL B 1 142 ? 20.178  -9.931  67.598  1.00 42.87  ? 142 VAL B CB  1 
ATOM   5317 C  CG1 . VAL B 1 142 ? 19.571  -8.669  68.235  1.00 42.39  ? 142 VAL B CG1 1 
ATOM   5318 C  CG2 . VAL B 1 142 ? 20.928  -10.768 68.641  1.00 32.79  ? 142 VAL B CG2 1 
ATOM   5319 N  N   . LEU B 1 143 ? 16.805  -10.166 66.397  1.00 50.89  ? 143 LEU B N   1 
ATOM   5320 C  CA  . LEU B 1 143 ? 15.731  -9.524  65.643  1.00 45.18  ? 143 LEU B CA  1 
ATOM   5321 C  C   . LEU B 1 143 ? 15.219  -8.296  66.386  1.00 40.00  ? 143 LEU B C   1 
ATOM   5322 O  O   . LEU B 1 143 ? 14.931  -8.362  67.583  1.00 46.77  ? 143 LEU B O   1 
ATOM   5323 C  CB  . LEU B 1 143 ? 14.578  -10.499 65.386  1.00 44.72  ? 143 LEU B CB  1 
ATOM   5324 C  CG  . LEU B 1 143 ? 13.576  -10.246 64.231  1.00 44.93  ? 143 LEU B CG  1 
ATOM   5325 C  CD1 . LEU B 1 143 ? 12.711  -8.996  64.437  1.00 44.29  ? 143 LEU B CD1 1 
ATOM   5326 C  CD2 . LEU B 1 143 ? 14.238  -10.182 62.887  1.00 42.28  ? 143 LEU B CD2 1 
ATOM   5327 N  N   . VAL B 1 144 ? 15.098  -7.186  65.662  1.00 42.32  ? 144 VAL B N   1 
ATOM   5328 C  CA  . VAL B 1 144 ? 14.510  -5.942  66.148  1.00 42.38  ? 144 VAL B CA  1 
ATOM   5329 C  C   . VAL B 1 144 ? 13.362  -5.554  65.226  1.00 45.03  ? 144 VAL B C   1 
ATOM   5330 O  O   . VAL B 1 144 ? 13.511  -5.587  64.001  1.00 52.92  ? 144 VAL B O   1 
ATOM   5331 C  CB  . VAL B 1 144 ? 15.546  -4.803  66.200  1.00 40.30  ? 144 VAL B CB  1 
ATOM   5332 C  CG1 . VAL B 1 144 ? 14.918  -3.529  66.717  1.00 26.20  ? 144 VAL B CG1 1 
ATOM   5333 C  CG2 . VAL B 1 144 ? 16.749  -5.201  67.056  1.00 44.41  ? 144 VAL B CG2 1 
ATOM   5334 N  N   . SER B 1 145 ? 12.222  -5.202  65.811  1.00 39.33  ? 145 SER B N   1 
ATOM   5335 C  CA  . SER B 1 145 ? 11.184  -4.443  65.130  1.00 32.62  ? 145 SER B CA  1 
ATOM   5336 C  C   . SER B 1 145 ? 11.100  -3.064  65.771  1.00 27.92  ? 145 SER B C   1 
ATOM   5337 O  O   . SER B 1 145 ? 11.213  -2.939  66.993  1.00 34.96  ? 145 SER B O   1 
ATOM   5338 C  CB  . SER B 1 145 ? 9.823   -5.156  65.198  1.00 48.45  ? 145 SER B CB  1 
ATOM   5339 O  OG  . SER B 1 145 ? 9.597   -5.801  66.447  1.00 49.19  ? 145 SER B OG  1 
ATOM   5340 N  N   . LEU B 1 146 ? 10.925  -2.025  64.953  1.00 29.33  ? 146 LEU B N   1 
ATOM   5341 C  CA  . LEU B 1 146 ? 10.815  -0.659  65.451  1.00 24.69  ? 146 LEU B CA  1 
ATOM   5342 C  C   . LEU B 1 146 ? 9.391   -0.135  65.276  1.00 40.66  ? 146 LEU B C   1 
ATOM   5343 O  O   . LEU B 1 146 ? 8.450   -0.892  65.017  1.00 46.10  ? 146 LEU B O   1 
ATOM   5344 C  CB  . LEU B 1 146 ? 11.828  0.245   64.753  1.00 31.58  ? 146 LEU B CB  1 
ATOM   5345 C  CG  . LEU B 1 146 ? 12.038  0.141   63.242  1.00 24.32  ? 146 LEU B CG  1 
ATOM   5346 C  CD1 . LEU B 1 146 ? 10.814  0.504   62.478  1.00 24.03  ? 146 LEU B CD1 1 
ATOM   5347 C  CD2 . LEU B 1 146 ? 13.172  1.062   62.855  1.00 26.23  ? 146 LEU B CD2 1 
ATOM   5348 N  N   . SER B 1 147 ? 9.240   1.182   65.411  1.00 36.14  ? 147 SER B N   1 
ATOM   5349 C  CA  . SER B 1 147 ? 7.951   1.840   65.239  1.00 30.57  ? 147 SER B CA  1 
ATOM   5350 C  C   . SER B 1 147 ? 8.198   3.254   64.743  1.00 34.34  ? 147 SER B C   1 
ATOM   5351 O  O   . SER B 1 147 ? 9.280   3.815   64.929  1.00 41.03  ? 147 SER B O   1 
ATOM   5352 C  CB  . SER B 1 147 ? 7.162   1.884   66.542  1.00 36.92  ? 147 SER B CB  1 
ATOM   5353 O  OG  . SER B 1 147 ? 7.718   2.852   67.417  1.00 43.46  ? 147 SER B OG  1 
ATOM   5354 N  N   . TYR B 1 148 ? 7.182   3.823   64.100  1.00 25.37  ? 148 TYR B N   1 
ATOM   5355 C  CA  . TYR B 1 148 ? 7.240   5.202   63.625  1.00 31.15  ? 148 TYR B CA  1 
ATOM   5356 C  C   . TYR B 1 148 ? 5.817   5.748   63.539  1.00 39.23  ? 148 TYR B C   1 
ATOM   5357 O  O   . TYR B 1 148 ? 4.850   4.995   63.338  1.00 34.27  ? 148 TYR B O   1 
ATOM   5358 C  CB  . TYR B 1 148 ? 7.966   5.312   62.265  1.00 27.59  ? 148 TYR B CB  1 
ATOM   5359 C  CG  . TYR B 1 148 ? 7.405   4.415   61.183  1.00 27.71  ? 148 TYR B CG  1 
ATOM   5360 C  CD1 . TYR B 1 148 ? 7.650   3.052   61.198  1.00 27.71  ? 148 TYR B CD1 1 
ATOM   5361 C  CD2 . TYR B 1 148 ? 6.621   4.932   60.148  1.00 23.66  ? 148 TYR B CD2 1 
ATOM   5362 C  CE1 . TYR B 1 148 ? 7.128   2.221   60.225  1.00 26.80  ? 148 TYR B CE1 1 
ATOM   5363 C  CE2 . TYR B 1 148 ? 6.112   4.113   59.174  1.00 27.88  ? 148 TYR B CE2 1 
ATOM   5364 C  CZ  . TYR B 1 148 ? 6.367   2.753   59.222  1.00 29.84  ? 148 TYR B CZ  1 
ATOM   5365 O  OH  . TYR B 1 148 ? 5.874   1.910   58.253  1.00 43.37  ? 148 TYR B OH  1 
ATOM   5366 N  N   . ARG B 1 149 ? 5.684   7.057   63.717  1.00 37.50  ? 149 ARG B N   1 
ATOM   5367 C  CA  . ARG B 1 149 ? 4.346   7.609   63.638  1.00 31.98  ? 149 ARG B CA  1 
ATOM   5368 C  C   . ARG B 1 149 ? 3.877   7.654   62.206  1.00 37.95  ? 149 ARG B C   1 
ATOM   5369 O  O   . ARG B 1 149 ? 4.601   8.079   61.309  1.00 43.62  ? 149 ARG B O   1 
ATOM   5370 C  CB  . ARG B 1 149 ? 4.243   8.993   64.260  1.00 30.43  ? 149 ARG B CB  1 
ATOM   5371 C  CG  . ARG B 1 149 ? 4.863   9.099   65.594  1.00 34.74  ? 149 ARG B CG  1 
ATOM   5372 C  CD  . ARG B 1 149 ? 5.171   10.527  65.904  1.00 38.23  ? 149 ARG B CD  1 
ATOM   5373 N  NE  . ARG B 1 149 ? 6.548   10.818  65.529  1.00 39.48  ? 149 ARG B NE  1 
ATOM   5374 C  CZ  . ARG B 1 149 ? 7.122   12.006  65.625  1.00 41.04  ? 149 ARG B CZ  1 
ATOM   5375 N  NH1 . ARG B 1 149 ? 6.431   13.025  66.094  1.00 25.78  1 149 ARG B NH1 1 
ATOM   5376 N  NH2 . ARG B 1 149 ? 8.382   12.158  65.253  1.00 45.73  ? 149 ARG B NH2 1 
ATOM   5377 N  N   . VAL B 1 150 ? 2.628   7.246   62.018  1.00 46.32  ? 150 VAL B N   1 
ATOM   5378 C  CA  . VAL B 1 150 ? 2.020   7.088   60.711  1.00 24.38  ? 150 VAL B CA  1 
ATOM   5379 C  C   . VAL B 1 150 ? 1.068   8.253   60.502  1.00 28.67  ? 150 VAL B C   1 
ATOM   5380 O  O   . VAL B 1 150 ? 0.911   9.100   61.393  1.00 31.12  ? 150 VAL B O   1 
ATOM   5381 C  CB  . VAL B 1 150 ? 1.317   5.730   60.633  1.00 33.35  ? 150 VAL B CB  1 
ATOM   5382 C  CG1 . VAL B 1 150 ? 2.377   4.621   60.649  1.00 29.32  ? 150 VAL B CG1 1 
ATOM   5383 C  CG2 . VAL B 1 150 ? 0.376   5.587   61.822  1.00 24.85  ? 150 VAL B CG2 1 
ATOM   5384 N  N   . GLY B 1 151 ? 0.455   8.314   59.320  1.00 29.48  ? 151 GLY B N   1 
ATOM   5385 C  CA  . GLY B 1 151 ? -0.471  9.363   58.947  1.00 25.24  ? 151 GLY B CA  1 
ATOM   5386 C  C   . GLY B 1 151 ? 0.082   10.752  59.196  1.00 32.46  ? 151 GLY B C   1 
ATOM   5387 O  O   . GLY B 1 151 ? 1.295   10.994  59.184  1.00 34.99  ? 151 GLY B O   1 
ATOM   5388 N  N   . ALA B 1 152 ? -0.841  11.690  59.424  1.00 33.95  ? 152 ALA B N   1 
ATOM   5389 C  CA  . ALA B 1 152 ? -0.471  13.075  59.689  1.00 41.67  ? 152 ALA B CA  1 
ATOM   5390 C  C   . ALA B 1 152 ? 0.601   13.180  60.772  1.00 49.79  ? 152 ALA B C   1 
ATOM   5391 O  O   . ALA B 1 152 ? 1.571   13.932  60.621  1.00 50.28  ? 152 ALA B O   1 
ATOM   5392 C  CB  . ALA B 1 152 ? -1.717  13.873  60.092  1.00 39.03  ? 152 ALA B CB  1 
ATOM   5393 N  N   . PHE B 1 153 ? 0.441   12.433  61.871  1.00 48.65  ? 153 PHE B N   1 
ATOM   5394 C  CA  . PHE B 1 153 ? 1.389   12.530  62.979  1.00 46.98  ? 153 PHE B CA  1 
ATOM   5395 C  C   . PHE B 1 153 ? 2.815   12.292  62.516  1.00 48.85  ? 153 PHE B C   1 
ATOM   5396 O  O   . PHE B 1 153 ? 3.754   12.861  63.086  1.00 43.05  ? 153 PHE B O   1 
ATOM   5397 C  CB  . PHE B 1 153 ? 1.029   11.533  64.080  1.00 38.76  ? 153 PHE B CB  1 
ATOM   5398 C  CG  . PHE B 1 153 ? -0.413  11.568  64.459  1.00 44.73  ? 153 PHE B CG  1 
ATOM   5399 C  CD1 . PHE B 1 153 ? -0.884  12.529  65.336  1.00 40.69  ? 153 PHE B CD1 1 
ATOM   5400 C  CD2 . PHE B 1 153 ? -1.312  10.653  63.916  1.00 43.05  ? 153 PHE B CD2 1 
ATOM   5401 C  CE1 . PHE B 1 153 ? -2.234  12.576  65.680  1.00 42.43  ? 153 PHE B CE1 1 
ATOM   5402 C  CE2 . PHE B 1 153 ? -2.647  10.690  64.266  1.00 43.80  ? 153 PHE B CE2 1 
ATOM   5403 C  CZ  . PHE B 1 153 ? -3.112  11.660  65.149  1.00 39.61  ? 153 PHE B CZ  1 
ATOM   5404 N  N   . GLY B 1 154 ? 2.992   11.482  61.474  1.00 44.04  ? 154 GLY B N   1 
ATOM   5405 C  CA  . GLY B 1 154 ? 4.312   11.134  61.008  1.00 30.47  ? 154 GLY B CA  1 
ATOM   5406 C  C   . GLY B 1 154 ? 4.750   11.915  59.794  1.00 35.20  ? 154 GLY B C   1 
ATOM   5407 O  O   . GLY B 1 154 ? 5.958   12.114  59.590  1.00 35.68  ? 154 GLY B O   1 
ATOM   5408 N  N   . PHE B 1 155 ? 3.786   12.367  58.971  1.00 34.01  ? 155 PHE B N   1 
ATOM   5409 C  CA  . PHE B 1 155 ? 4.159   12.887  57.661  1.00 33.92  ? 155 PHE B CA  1 
ATOM   5410 C  C   . PHE B 1 155 ? 3.432   14.155  57.254  1.00 32.56  ? 155 PHE B C   1 
ATOM   5411 O  O   . PHE B 1 155 ? 3.616   14.608  56.114  1.00 37.27  ? 155 PHE B O   1 
ATOM   5412 C  CB  . PHE B 1 155 ? 3.989   11.799  56.595  1.00 24.83  ? 155 PHE B CB  1 
ATOM   5413 C  CG  . PHE B 1 155 ? 4.759   10.552  56.917  1.00 36.81  ? 155 PHE B CG  1 
ATOM   5414 C  CD1 . PHE B 1 155 ? 4.109   9.435   57.426  1.00 42.87  ? 155 PHE B CD1 1 
ATOM   5415 C  CD2 . PHE B 1 155 ? 6.144   10.511  56.759  1.00 36.47  ? 155 PHE B CD2 1 
ATOM   5416 C  CE1 . PHE B 1 155 ? 4.818   8.295   57.747  1.00 46.41  ? 155 PHE B CE1 1 
ATOM   5417 C  CE2 . PHE B 1 155 ? 6.861   9.371   57.068  1.00 37.64  ? 155 PHE B CE2 1 
ATOM   5418 C  CZ  . PHE B 1 155 ? 6.198   8.260   57.570  1.00 43.93  ? 155 PHE B CZ  1 
ATOM   5419 N  N   . LEU B 1 156 ? 2.634   14.751  58.133  1.00 29.86  ? 156 LEU B N   1 
ATOM   5420 C  CA  . LEU B 1 156 ? 2.147   16.097  57.872  1.00 37.73  ? 156 LEU B CA  1 
ATOM   5421 C  C   . LEU B 1 156 ? 3.349   16.992  57.597  1.00 42.41  ? 156 LEU B C   1 
ATOM   5422 O  O   . LEU B 1 156 ? 4.278   17.064  58.406  1.00 36.83  ? 156 LEU B O   1 
ATOM   5423 C  CB  . LEU B 1 156 ? 1.335   16.609  59.062  1.00 39.29  ? 156 LEU B CB  1 
ATOM   5424 C  CG  . LEU B 1 156 ? 0.771   18.017  58.883  1.00 38.68  ? 156 LEU B CG  1 
ATOM   5425 C  CD1 . LEU B 1 156 ? -0.621  17.937  58.297  1.00 40.00  ? 156 LEU B CD1 1 
ATOM   5426 C  CD2 . LEU B 1 156 ? 0.768   18.768  60.205  1.00 35.31  ? 156 LEU B CD2 1 
ATOM   5427 N  N   . ALA B 1 157 ? 3.376   17.628  56.430  1.00 51.47  ? 157 ALA B N   1 
ATOM   5428 C  CA  . ALA B 1 157 ? 4.591   18.296  55.966  1.00 47.93  ? 157 ALA B CA  1 
ATOM   5429 C  C   . ALA B 1 157 ? 4.270   19.708  55.491  1.00 50.86  ? 157 ALA B C   1 
ATOM   5430 O  O   . ALA B 1 157 ? 3.643   19.887  54.443  1.00 57.42  ? 157 ALA B O   1 
ATOM   5431 C  CB  . ALA B 1 157 ? 5.261   17.492  54.858  1.00 46.64  ? 157 ALA B CB  1 
ATOM   5432 N  N   . LEU B 1 158 ? 4.712   20.707  56.252  1.00 49.08  ? 158 LEU B N   1 
ATOM   5433 C  CA  . LEU B 1 158 ? 4.669   22.114  55.845  1.00 48.98  ? 158 LEU B CA  1 
ATOM   5434 C  C   . LEU B 1 158 ? 6.108   22.594  55.650  1.00 48.14  ? 158 LEU B C   1 
ATOM   5435 O  O   . LEU B 1 158 ? 6.685   23.236  56.525  1.00 38.20  ? 158 LEU B O   1 
ATOM   5436 C  CB  . LEU B 1 158 ? 3.965   22.940  56.864  1.00 43.05  ? 158 LEU B CB  1 
ATOM   5437 C  CG  . LEU B 1 158 ? 2.465   22.748  57.035  1.00 46.97  ? 158 LEU B CG  1 
ATOM   5438 C  CD1 . LEU B 1 158 ? 2.042   23.293  58.390  1.00 43.04  ? 158 LEU B CD1 1 
ATOM   5439 C  CD2 . LEU B 1 158 ? 1.719   23.483  55.933  1.00 50.86  ? 158 LEU B CD2 1 
ATOM   5440 N  N   . HIS B 1 159 ? 6.675   22.296  54.474  1.00 48.11  ? 159 HIS B N   1 
ATOM   5441 C  CA  . HIS B 1 159 ? 8.096   22.513  54.229  1.00 47.69  ? 159 HIS B CA  1 
ATOM   5442 C  C   . HIS B 1 159 ? 8.474   23.982  54.388  1.00 44.05  ? 159 HIS B C   1 
ATOM   5443 O  O   . HIS B 1 159 ? 7.804   24.873  53.853  1.00 38.70  ? 159 HIS B O   1 
ATOM   5444 C  CB  . HIS B 1 159 ? 8.468   22.031  52.836  1.00 56.47  ? 159 HIS B CB  1 
ATOM   5445 C  CG  . HIS B 1 159 ? 9.905   22.261  52.488  1.00 61.85  ? 159 HIS B CG  1 
ATOM   5446 N  ND1 . HIS B 1 159 ? 10.921  21.463  52.967  1.00 62.07  ? 159 HIS B ND1 1 
ATOM   5447 C  CD2 . HIS B 1 159 ? 10.495  23.204  51.719  1.00 59.49  ? 159 HIS B CD2 1 
ATOM   5448 C  CE1 . HIS B 1 159 ? 12.076  21.901  52.501  1.00 56.93  ? 159 HIS B CE1 1 
ATOM   5449 N  NE2 . HIS B 1 159 ? 11.846  22.956  51.741  1.00 55.81  ? 159 HIS B NE2 1 
ATOM   5450 N  N   . GLY B 1 160 ? 9.562   24.228  55.126  1.00 37.35  ? 160 GLY B N   1 
ATOM   5451 C  CA  . GLY B 1 160 ? 9.946   25.581  55.484  1.00 32.40  ? 160 GLY B CA  1 
ATOM   5452 C  C   . GLY B 1 160 ? 9.775   25.861  56.960  1.00 47.53  ? 160 GLY B C   1 
ATOM   5453 O  O   . GLY B 1 160 ? 10.588  26.544  57.586  1.00 49.40  ? 160 GLY B O   1 
ATOM   5454 N  N   . SER B 1 161 ? 8.680   25.363  57.512  1.00 52.21  ? 161 SER B N   1 
ATOM   5455 C  CA  . SER B 1 161 ? 8.503   25.319  58.948  1.00 45.57  ? 161 SER B CA  1 
ATOM   5456 C  C   . SER B 1 161 ? 9.507   24.340  59.544  1.00 53.64  ? 161 SER B C   1 
ATOM   5457 O  O   . SER B 1 161 ? 9.955   23.393  58.885  1.00 56.30  ? 161 SER B O   1 
ATOM   5458 C  CB  . SER B 1 161 ? 7.062   24.905  59.279  1.00 41.43  ? 161 SER B CB  1 
ATOM   5459 O  OG  . SER B 1 161 ? 6.950   24.166  60.488  1.00 41.02  ? 161 SER B OG  1 
ATOM   5460 N  N   . GLN B 1 162 ? 9.888   24.591  60.791  1.00 51.22  ? 162 GLN B N   1 
ATOM   5461 C  CA  . GLN B 1 162 ? 10.615  23.591  61.553  1.00 51.14  ? 162 GLN B CA  1 
ATOM   5462 C  C   . GLN B 1 162 ? 9.707   22.866  62.528  1.00 56.70  ? 162 GLN B C   1 
ATOM   5463 O  O   . GLN B 1 162 ? 10.115  21.846  63.096  1.00 53.99  ? 162 GLN B O   1 
ATOM   5464 C  CB  . GLN B 1 162 ? 11.801  24.228  62.306  1.00 58.87  ? 162 GLN B CB  1 
ATOM   5465 C  CG  . GLN B 1 162 ? 12.925  24.771  61.392  1.00 73.20  ? 162 GLN B CG  1 
ATOM   5466 C  CD  . GLN B 1 162 ? 13.547  23.715  60.460  1.00 76.88  ? 162 GLN B CD  1 
ATOM   5467 O  OE1 . GLN B 1 162 ? 13.979  24.039  59.347  1.00 73.38  ? 162 GLN B OE1 1 
ATOM   5468 N  NE2 . GLN B 1 162 ? 13.607  22.452  60.923  1.00 75.16  ? 162 GLN B NE2 1 
ATOM   5469 N  N   . GLU B 1 163 ? 8.473   23.354  62.704  1.00 62.91  ? 163 GLU B N   1 
ATOM   5470 C  CA  . GLU B 1 163 ? 7.533   22.714  63.618  1.00 61.41  ? 163 GLU B CA  1 
ATOM   5471 C  C   . GLU B 1 163 ? 6.804   21.542  62.967  1.00 58.95  ? 163 GLU B C   1 
ATOM   5472 O  O   . GLU B 1 163 ? 6.411   20.597  63.668  1.00 54.83  ? 163 GLU B O   1 
ATOM   5473 C  CB  . GLU B 1 163 ? 6.532   23.743  64.153  1.00 57.66  ? 163 GLU B CB  1 
ATOM   5474 C  CG  . GLU B 1 163 ? 7.127   24.792  65.114  1.00 58.07  ? 163 GLU B CG  1 
ATOM   5475 C  CD  . GLU B 1 163 ? 7.701   24.184  66.393  1.00 56.69  ? 163 GLU B CD  1 
ATOM   5476 O  OE1 . GLU B 1 163 ? 8.681   24.745  66.939  1.00 58.66  ? 163 GLU B OE1 1 
ATOM   5477 O  OE2 . GLU B 1 163 ? 7.175   23.141  66.842  1.00 49.76  1 163 GLU B OE2 1 
ATOM   5478 N  N   . ALA B 1 164 ? 6.630   21.570  61.644  1.00 57.17  ? 164 ALA B N   1 
ATOM   5479 C  CA  . ALA B 1 164 ? 6.028   20.458  60.905  1.00 52.45  ? 164 ALA B CA  1 
ATOM   5480 C  C   . ALA B 1 164 ? 6.794   20.264  59.609  1.00 47.93  ? 164 ALA B C   1 
ATOM   5481 O  O   . ALA B 1 164 ? 6.286   20.546  58.518  1.00 52.76  ? 164 ALA B O   1 
ATOM   5482 C  CB  . ALA B 1 164 ? 4.542   20.715  60.642  1.00 54.96  ? 164 ALA B CB  1 
ATOM   5483 N  N   . PRO B 1 165 ? 8.030   19.761  59.693  1.00 50.03  ? 165 PRO B N   1 
ATOM   5484 C  CA  . PRO B 1 165 ? 8.880   19.693  58.486  1.00 53.07  ? 165 PRO B CA  1 
ATOM   5485 C  C   . PRO B 1 165 ? 8.497   18.605  57.492  1.00 45.26  ? 165 PRO B C   1 
ATOM   5486 O  O   . PRO B 1 165 ? 8.801   18.746  56.302  1.00 37.79  ? 165 PRO B O   1 
ATOM   5487 C  CB  . PRO B 1 165 ? 10.271  19.431  59.067  1.00 47.59  ? 165 PRO B CB  1 
ATOM   5488 C  CG  . PRO B 1 165 ? 9.997   18.729  60.354  1.00 48.63  ? 165 PRO B CG  1 
ATOM   5489 C  CD  . PRO B 1 165 ? 8.774   19.383  60.906  1.00 46.85  ? 165 PRO B CD  1 
ATOM   5490 N  N   . GLY B 1 166 ? 7.846   17.540  57.934  1.00 43.71  ? 166 GLY B N   1 
ATOM   5491 C  CA  . GLY B 1 166 ? 7.671   16.346  57.127  1.00 37.87  ? 166 GLY B CA  1 
ATOM   5492 C  C   . GLY B 1 166 ? 8.763   15.330  57.392  1.00 38.90  ? 166 GLY B C   1 
ATOM   5493 O  O   . GLY B 1 166 ? 9.859   15.653  57.842  1.00 38.51  ? 166 GLY B O   1 
ATOM   5494 N  N   . ASN B 1 167 ? 8.440   14.066  57.139  1.00 37.25  ? 167 ASN B N   1 
ATOM   5495 C  CA  . ASN B 1 167 ? 9.391   12.964  57.193  1.00 43.92  ? 167 ASN B CA  1 
ATOM   5496 C  C   . ASN B 1 167 ? 9.783   12.605  58.609  1.00 40.27  ? 167 ASN B C   1 
ATOM   5497 O  O   . ASN B 1 167 ? 10.629  11.711  58.798  1.00 35.72  ? 167 ASN B O   1 
ATOM   5498 C  CB  . ASN B 1 167 ? 10.674  13.263  56.410  1.00 44.15  ? 167 ASN B CB  1 
ATOM   5499 C  CG  . ASN B 1 167 ? 10.434  13.378  54.932  1.00 37.16  ? 167 ASN B CG  1 
ATOM   5500 O  OD1 . ASN B 1 167 ? 9.394   12.953  54.415  1.00 36.26  ? 167 ASN B OD1 1 
ATOM   5501 N  ND2 . ASN B 1 167 ? 11.366  14.021  54.247  1.00 37.10  ? 167 ASN B ND2 1 
ATOM   5502 N  N   . VAL B 1 168 ? 9.199   13.256  59.615  1.00 35.95  ? 168 VAL B N   1 
ATOM   5503 C  CA  . VAL B 1 168 ? 9.527   12.921  60.992  1.00 37.38  ? 168 VAL B CA  1 
ATOM   5504 C  C   . VAL B 1 168 ? 9.217   11.452  61.275  1.00 36.33  ? 168 VAL B C   1 
ATOM   5505 O  O   . VAL B 1 168 ? 9.886   10.816  62.105  1.00 32.22  ? 168 VAL B O   1 
ATOM   5506 C  CB  . VAL B 1 168 ? 8.798   13.894  61.937  1.00 38.41  ? 168 VAL B CB  1 
ATOM   5507 C  CG1 . VAL B 1 168 ? 8.984   15.310  61.419  1.00 38.78  ? 168 VAL B CG1 1 
ATOM   5508 C  CG2 . VAL B 1 168 ? 7.312   13.563  62.077  1.00 25.30  ? 168 VAL B CG2 1 
ATOM   5509 N  N   . GLY B 1 169 ? 8.243   10.874  60.560  1.00 30.59  ? 169 GLY B N   1 
ATOM   5510 C  CA  . GLY B 1 169 ? 8.043   9.436   60.642  1.00 24.10  ? 169 GLY B CA  1 
ATOM   5511 C  C   . GLY B 1 169 ? 9.260   8.660   60.173  1.00 37.60  ? 169 GLY B C   1 
ATOM   5512 O  O   . GLY B 1 169 ? 9.630   7.635   60.765  1.00 24.58  ? 169 GLY B O   1 
ATOM   5513 N  N   . LEU B 1 170 ? 9.892   9.128   59.090  1.00 31.66  ? 170 LEU B N   1 
ATOM   5514 C  CA  . LEU B 1 170 ? 11.118  8.492   58.643  1.00 31.24  ? 170 LEU B CA  1 
ATOM   5515 C  C   . LEU B 1 170 ? 12.228  8.719   59.646  1.00 31.06  ? 170 LEU B C   1 
ATOM   5516 O  O   . LEU B 1 170 ? 12.988  7.796   59.949  1.00 26.57  ? 170 LEU B O   1 
ATOM   5517 C  CB  . LEU B 1 170 ? 11.533  9.019   57.280  1.00 34.08  ? 170 LEU B CB  1 
ATOM   5518 C  CG  . LEU B 1 170 ? 10.749  8.504   56.097  1.00 24.22  ? 170 LEU B CG  1 
ATOM   5519 C  CD1 . LEU B 1 170 ? 11.253  9.214   54.892  1.00 24.57  ? 170 LEU B CD1 1 
ATOM   5520 C  CD2 . LEU B 1 170 ? 10.891  6.987   55.973  1.00 24.01  ? 170 LEU B CD2 1 
ATOM   5521 N  N   . LEU B 1 171 ? 12.313  9.939   60.193  1.00 34.24  ? 171 LEU B N   1 
ATOM   5522 C  CA  . LEU B 1 171 ? 13.365  10.261  61.158  1.00 37.47  ? 171 LEU B CA  1 
ATOM   5523 C  C   . LEU B 1 171 ? 13.236  9.457   62.441  1.00 32.03  ? 171 LEU B C   1 
ATOM   5524 O  O   . LEU B 1 171 ? 14.251  9.183   63.097  1.00 40.64  ? 171 LEU B O   1 
ATOM   5525 C  CB  . LEU B 1 171 ? 13.367  11.743  61.506  1.00 29.17  ? 171 LEU B CB  1 
ATOM   5526 C  CG  . LEU B 1 171 ? 13.790  12.638  60.346  1.00 31.91  ? 171 LEU B CG  1 
ATOM   5527 C  CD1 . LEU B 1 171 ? 13.269  14.060  60.598  1.00 26.21  ? 171 LEU B CD1 1 
ATOM   5528 C  CD2 . LEU B 1 171 ? 15.313  12.567  60.065  1.00 26.28  ? 171 LEU B CD2 1 
ATOM   5529 N  N   . ASP B 1 172 ? 11.999  9.123   62.846  1.00 25.59  ? 172 ASP B N   1 
ATOM   5530 C  CA  . ASP B 1 172 ? 11.796  8.144   63.917  1.00 28.63  ? 172 ASP B CA  1 
ATOM   5531 C  C   . ASP B 1 172 ? 12.550  6.852   63.642  1.00 32.49  ? 172 ASP B C   1 
ATOM   5532 O  O   . ASP B 1 172 ? 13.255  6.328   64.513  1.00 44.00  ? 172 ASP B O   1 
ATOM   5533 C  CB  . ASP B 1 172 ? 10.315  7.801   64.115  1.00 24.36  ? 172 ASP B CB  1 
ATOM   5534 C  CG  . ASP B 1 172 ? 9.452   9.004   64.391  1.00 41.87  ? 172 ASP B CG  1 
ATOM   5535 O  OD1 . ASP B 1 172 ? 9.991   10.040  64.851  1.00 44.99  ? 172 ASP B OD1 1 
ATOM   5536 O  OD2 . ASP B 1 172 ? 8.217   8.895   64.165  1.00 39.87  1 172 ASP B OD2 1 
ATOM   5537 N  N   . GLN B 1 173 ? 12.353  6.276   62.459  1.00 32.69  ? 173 GLN B N   1 
ATOM   5538 C  CA  . GLN B 1 173 ? 13.016  5.011   62.181  1.00 34.56  ? 173 GLN B CA  1 
ATOM   5539 C  C   . GLN B 1 173 ? 14.531  5.189   62.139  1.00 38.20  ? 173 GLN B C   1 
ATOM   5540 O  O   . GLN B 1 173 ? 15.283  4.256   62.456  1.00 42.10  ? 173 GLN B O   1 
ATOM   5541 C  CB  . GLN B 1 173 ? 12.516  4.392   60.867  1.00 35.87  ? 173 GLN B CB  1 
ATOM   5542 C  CG  . GLN B 1 173 ? 11.010  4.420   60.536  1.00 35.12  ? 173 GLN B CG  1 
ATOM   5543 C  CD  . GLN B 1 173 ? 10.756  4.304   59.012  1.00 38.36  ? 173 GLN B CD  1 
ATOM   5544 O  OE1 . GLN B 1 173 ? 11.634  4.625   58.209  1.00 42.24  ? 173 GLN B OE1 1 
ATOM   5545 N  NE2 . GLN B 1 173 ? 9.591   3.788   58.626  1.00 25.21  ? 173 GLN B NE2 1 
ATOM   5546 N  N   . ARG B 1 174 ? 15.004  6.379   61.765  1.00 32.78  ? 174 ARG B N   1 
ATOM   5547 C  CA  . ARG B 1 174 ? 16.444  6.572   61.737  1.00 41.14  ? 174 ARG B CA  1 
ATOM   5548 C  C   . ARG B 1 174 ? 16.999  6.659   63.150  1.00 44.31  ? 174 ARG B C   1 
ATOM   5549 O  O   . ARG B 1 174 ? 18.094  6.158   63.434  1.00 53.04  ? 174 ARG B O   1 
ATOM   5550 C  CB  . ARG B 1 174 ? 16.803  7.823   60.940  1.00 43.00  ? 174 ARG B CB  1 
ATOM   5551 C  CG  . ARG B 1 174 ? 18.305  7.988   60.832  1.00 26.26  ? 174 ARG B CG  1 
ATOM   5552 C  CD  . ARG B 1 174 ? 18.811  9.416   60.929  1.00 26.81  ? 174 ARG B CD  1 
ATOM   5553 N  NE  . ARG B 1 174 ? 18.096  10.351  60.061  1.00 36.17  ? 174 ARG B NE  1 
ATOM   5554 C  CZ  . ARG B 1 174 ? 18.386  10.516  58.776  1.00 41.50  ? 174 ARG B CZ  1 
ATOM   5555 N  NH1 . ARG B 1 174 ? 19.268  9.715   58.239  1.00 44.42  1 174 ARG B NH1 1 
ATOM   5556 N  NH2 . ARG B 1 174 ? 17.749  11.393  58.018  1.00 41.92  ? 174 ARG B NH2 1 
ATOM   5557 N  N   . MET B 1 175 ? 16.251  7.278   64.052  1.00 44.71  ? 175 MET B N   1 
ATOM   5558 C  CA  . MET B 1 175 ? 16.746  7.392   65.409  1.00 50.92  ? 175 MET B CA  1 
ATOM   5559 C  C   . MET B 1 175 ? 16.620  6.072   66.154  1.00 45.77  ? 175 MET B C   1 
ATOM   5560 O  O   . MET B 1 175 ? 17.433  5.774   67.034  1.00 44.84  ? 175 MET B O   1 
ATOM   5561 C  CB  . MET B 1 175 ? 16.014  8.509   66.135  1.00 51.55  ? 175 MET B CB  1 
ATOM   5562 C  CG  . MET B 1 175 ? 16.269  8.508   67.602  1.00 42.94  ? 175 MET B CG  1 
ATOM   5563 S  SD  . MET B 1 175 ? 15.453  9.922   68.304  1.00 40.33  ? 175 MET B SD  1 
ATOM   5564 C  CE  . MET B 1 175 ? 16.165  11.239  67.295  1.00 29.90  ? 175 MET B CE  1 
ATOM   5565 N  N   . ALA B 1 176 ? 15.639  5.252   65.792  1.00 40.89  ? 176 ALA B N   1 
ATOM   5566 C  CA  . ALA B 1 176 ? 15.635  3.880   66.279  1.00 42.75  ? 176 ALA B CA  1 
ATOM   5567 C  C   . ALA B 1 176 ? 16.843  3.113   65.755  1.00 42.83  ? 176 ALA B C   1 
ATOM   5568 O  O   . ALA B 1 176 ? 17.423  2.295   66.476  1.00 48.65  ? 176 ALA B O   1 
ATOM   5569 C  CB  . ALA B 1 176 ? 14.336  3.174   65.881  1.00 38.12  ? 176 ALA B CB  1 
ATOM   5570 N  N   . LEU B 1 177 ? 17.234  3.351   64.495  1.00 38.14  ? 177 LEU B N   1 
ATOM   5571 C  CA  . LEU B 1 177 ? 18.417  2.672   63.974  1.00 40.57  ? 177 LEU B CA  1 
ATOM   5572 C  C   . LEU B 1 177 ? 19.680  3.233   64.600  1.00 40.38  ? 177 LEU B C   1 
ATOM   5573 O  O   . LEU B 1 177 ? 20.657  2.504   64.811  1.00 46.03  ? 177 LEU B O   1 
ATOM   5574 C  CB  . LEU B 1 177 ? 18.506  2.791   62.455  1.00 41.96  ? 177 LEU B CB  1 
ATOM   5575 C  CG  . LEU B 1 177 ? 17.506  2.046   61.575  1.00 36.25  ? 177 LEU B CG  1 
ATOM   5576 C  CD1 . LEU B 1 177 ? 17.588  2.607   60.169  1.00 27.74  ? 177 LEU B CD1 1 
ATOM   5577 C  CD2 . LEU B 1 177 ? 17.786  0.551   61.595  1.00 40.98  ? 177 LEU B CD2 1 
ATOM   5578 N  N   . GLN B 1 178 ? 19.688  4.537   64.864  1.00 36.14  ? 178 GLN B N   1 
ATOM   5579 C  CA  . GLN B 1 178 ? 20.758  5.114   65.660  1.00 44.62  ? 178 GLN B CA  1 
ATOM   5580 C  C   . GLN B 1 178 ? 20.823  4.441   67.026  1.00 44.64  ? 178 GLN B C   1 
ATOM   5581 O  O   . GLN B 1 178 ? 21.912  4.215   67.568  1.00 45.94  ? 178 GLN B O   1 
ATOM   5582 C  CB  . GLN B 1 178 ? 20.543  6.622   65.789  1.00 43.01  ? 178 GLN B CB  1 
ATOM   5583 C  CG  . GLN B 1 178 ? 21.682  7.375   66.457  1.00 43.75  ? 178 GLN B CG  1 
ATOM   5584 C  CD  . GLN B 1 178 ? 23.015  7.209   65.728  1.00 46.84  ? 178 GLN B CD  1 
ATOM   5585 O  OE1 . GLN B 1 178 ? 23.918  6.527   66.216  1.00 38.44  ? 178 GLN B OE1 1 
ATOM   5586 N  NE2 . GLN B 1 178 ? 23.149  7.852   64.574  1.00 50.13  ? 178 GLN B NE2 1 
ATOM   5587 N  N   . TRP B 1 179 ? 19.664  4.084   67.583  1.00 44.69  ? 179 TRP B N   1 
ATOM   5588 C  CA  . TRP B 1 179 ? 19.654  3.420   68.883  1.00 47.34  ? 179 TRP B CA  1 
ATOM   5589 C  C   . TRP B 1 179 ? 20.270  2.031   68.786  1.00 41.39  ? 179 TRP B C   1 
ATOM   5590 O  O   . TRP B 1 179 ? 21.060  1.628   69.650  1.00 41.49  ? 179 TRP B O   1 
ATOM   5591 C  CB  . TRP B 1 179 ? 18.224  3.348   69.435  1.00 39.51  ? 179 TRP B CB  1 
ATOM   5592 C  CG  . TRP B 1 179 ? 18.194  2.934   70.874  1.00 36.75  ? 179 TRP B CG  1 
ATOM   5593 C  CD1 . TRP B 1 179 ? 18.179  3.758   71.968  1.00 39.84  ? 179 TRP B CD1 1 
ATOM   5594 C  CD2 . TRP B 1 179 ? 18.208  1.593   71.381  1.00 32.12  ? 179 TRP B CD2 1 
ATOM   5595 N  NE1 . TRP B 1 179 ? 18.180  3.012   73.119  1.00 39.34  ? 179 TRP B NE1 1 
ATOM   5596 C  CE2 . TRP B 1 179 ? 18.202  1.682   72.789  1.00 28.48  ? 179 TRP B CE2 1 
ATOM   5597 C  CE3 . TRP B 1 179 ? 18.226  0.326   70.780  1.00 27.81  ? 179 TRP B CE3 1 
ATOM   5598 C  CZ2 . TRP B 1 179 ? 18.208  0.558   73.607  1.00 28.92  ? 179 TRP B CZ2 1 
ATOM   5599 C  CZ3 . TRP B 1 179 ? 18.227  -0.796  71.597  1.00 30.26  ? 179 TRP B CZ3 1 
ATOM   5600 C  CH2 . TRP B 1 179 ? 18.210  -0.669  72.999  1.00 29.88  ? 179 TRP B CH2 1 
ATOM   5601 N  N   . VAL B 1 180 ? 19.915  1.290   67.735  1.00 30.52  ? 180 VAL B N   1 
ATOM   5602 C  CA  . VAL B 1 180 ? 20.477  -0.036  67.518  1.00 30.15  ? 180 VAL B CA  1 
ATOM   5603 C  C   . VAL B 1 180 ? 21.982  0.056   67.283  1.00 36.10  ? 180 VAL B C   1 
ATOM   5604 O  O   . VAL B 1 180 ? 22.750  -0.768  67.797  1.00 36.23  ? 180 VAL B O   1 
ATOM   5605 C  CB  . VAL B 1 180 ? 19.731  -0.732  66.355  1.00 29.90  ? 180 VAL B CB  1 
ATOM   5606 C  CG1 . VAL B 1 180 ? 20.274  -2.152  66.063  1.00 27.64  ? 180 VAL B CG1 1 
ATOM   5607 C  CG2 . VAL B 1 180 ? 18.232  -0.788  66.629  1.00 30.33  ? 180 VAL B CG2 1 
ATOM   5608 N  N   . HIS B 1 181 ? 22.423  1.068   66.526  1.00 28.52  ? 181 HIS B N   1 
ATOM   5609 C  CA  . HIS B 1 181 ? 23.848  1.311   66.313  1.00 31.90  ? 181 HIS B CA  1 
ATOM   5610 C  C   . HIS B 1 181 ? 24.606  1.419   67.633  1.00 33.98  ? 181 HIS B C   1 
ATOM   5611 O  O   . HIS B 1 181 ? 25.726  0.908   67.763  1.00 37.03  ? 181 HIS B O   1 
ATOM   5612 C  CB  . HIS B 1 181 ? 24.036  2.598   65.502  1.00 32.97  ? 181 HIS B CB  1 
ATOM   5613 C  CG  . HIS B 1 181 ? 25.462  2.951   65.225  1.00 44.65  ? 181 HIS B CG  1 
ATOM   5614 N  ND1 . HIS B 1 181 ? 26.317  2.148   64.516  1.00 46.70  ? 181 HIS B ND1 1 
ATOM   5615 C  CD2 . HIS B 1 181 ? 26.194  4.026   65.589  1.00 53.19  ? 181 HIS B CD2 1 
ATOM   5616 C  CE1 . HIS B 1 181 ? 27.507  2.716   64.432  1.00 53.55  ? 181 HIS B CE1 1 
ATOM   5617 N  NE2 . HIS B 1 181 ? 27.462  3.860   65.083  1.00 59.80  ? 181 HIS B NE2 1 
ATOM   5618 N  N   . ASP B 1 182 ? 24.019  2.095   68.621  1.00 32.60  ? 182 ASP B N   1 
ATOM   5619 C  CA  . ASP B 1 182 ? 24.731  2.434   69.841  1.00 30.77  ? 182 ASP B CA  1 
ATOM   5620 C  C   . ASP B 1 182 ? 24.562  1.425   70.963  1.00 35.81  ? 182 ASP B C   1 
ATOM   5621 O  O   . ASP B 1 182 ? 25.321  1.485   71.934  1.00 43.79  ? 182 ASP B O   1 
ATOM   5622 C  CB  . ASP B 1 182 ? 24.274  3.790   70.363  1.00 30.68  ? 182 ASP B CB  1 
ATOM   5623 C  CG  . ASP B 1 182 ? 24.532  4.896   69.394  1.00 42.97  ? 182 ASP B CG  1 
ATOM   5624 O  OD1 . ASP B 1 182 ? 25.283  4.677   68.422  1.00 43.64  ? 182 ASP B OD1 1 
ATOM   5625 O  OD2 . ASP B 1 182 ? 24.004  6.001   69.622  1.00 46.44  1 182 ASP B OD2 1 
ATOM   5626 N  N   . ASN B 1 183 ? 23.575  0.530   70.881  1.00 37.90  ? 183 ASN B N   1 
ATOM   5627 C  CA  . ASN B 1 183 ? 23.300  -0.401  71.973  1.00 39.22  ? 183 ASN B CA  1 
ATOM   5628 C  C   . ASN B 1 183 ? 23.158  -1.857  71.575  1.00 40.91  ? 183 ASN B C   1 
ATOM   5629 O  O   . ASN B 1 183 ? 23.264  -2.711  72.460  1.00 46.11  ? 183 ASN B O   1 
ATOM   5630 C  CB  . ASN B 1 183 ? 22.036  -0.008  72.763  1.00 37.55  ? 183 ASN B CB  1 
ATOM   5631 C  CG  . ASN B 1 183 ? 21.971  1.473   73.062  1.00 46.16  ? 183 ASN B CG  1 
ATOM   5632 O  OD1 . ASN B 1 183 ? 21.528  2.281   72.241  1.00 48.52  ? 183 ASN B OD1 1 
ATOM   5633 N  ND2 . ASN B 1 183 ? 22.523  1.851   74.214  1.00 40.71  ? 183 ASN B ND2 1 
ATOM   5634 N  N   . ILE B 1 184 ? 22.924  -2.186  70.303  1.00 40.18  ? 184 ILE B N   1 
ATOM   5635 C  CA  . ILE B 1 184 ? 22.679  -3.585  69.991  1.00 39.13  ? 184 ILE B CA  1 
ATOM   5636 C  C   . ILE B 1 184 ? 23.848  -4.452  70.434  1.00 41.80  ? 184 ILE B C   1 
ATOM   5637 O  O   . ILE B 1 184 ? 23.658  -5.647  70.693  1.00 41.19  ? 184 ILE B O   1 
ATOM   5638 C  CB  . ILE B 1 184 ? 22.363  -3.772  68.487  1.00 41.55  ? 184 ILE B CB  1 
ATOM   5639 C  CG1 . ILE B 1 184 ? 21.516  -5.038  68.256  1.00 40.28  ? 184 ILE B CG1 1 
ATOM   5640 C  CG2 . ILE B 1 184 ? 23.656  -3.860  67.658  1.00 37.31  ? 184 ILE B CG2 1 
ATOM   5641 C  CD1 . ILE B 1 184 ? 20.146  -5.058  68.959  1.00 28.96  ? 184 ILE B CD1 1 
ATOM   5642 N  N   . GLN B 1 185 ? 25.052  -3.865  70.576  1.00 45.79  ? 185 GLN B N   1 
ATOM   5643 C  CA  . GLN B 1 185 ? 26.216  -4.628  71.038  1.00 43.28  ? 185 GLN B CA  1 
ATOM   5644 C  C   . GLN B 1 185 ? 26.008  -5.153  72.456  1.00 47.75  ? 185 GLN B C   1 
ATOM   5645 O  O   . GLN B 1 185 ? 26.476  -6.248  72.783  1.00 46.52  ? 185 GLN B O   1 
ATOM   5646 C  CB  . GLN B 1 185 ? 27.502  -3.781  70.947  1.00 36.20  ? 185 GLN B CB  1 
ATOM   5647 C  CG  . GLN B 1 185 ? 27.646  -2.656  71.989  1.00 38.32  ? 185 GLN B CG  1 
ATOM   5648 C  CD  . GLN B 1 185 ? 28.499  -1.471  71.502  1.00 45.98  ? 185 GLN B CD  1 
ATOM   5649 O  OE1 . GLN B 1 185 ? 28.141  -0.773  70.543  1.00 35.27  ? 185 GLN B OE1 1 
ATOM   5650 N  NE2 . GLN B 1 185 ? 29.622  -1.231  72.182  1.00 52.46  ? 185 GLN B NE2 1 
ATOM   5651 N  N   . PHE B 1 186 ? 25.263  -4.416  73.290  1.00 54.15  ? 186 PHE B N   1 
ATOM   5652 C  CA  . PHE B 1 186 ? 24.927  -4.835  74.650  1.00 43.37  ? 186 PHE B CA  1 
ATOM   5653 C  C   . PHE B 1 186 ? 23.977  -6.025  74.693  1.00 47.26  ? 186 PHE B C   1 
ATOM   5654 O  O   . PHE B 1 186 ? 23.759  -6.587  75.771  1.00 41.89  ? 186 PHE B O   1 
ATOM   5655 C  CB  . PHE B 1 186 ? 24.333  -3.652  75.404  1.00 33.35  ? 186 PHE B CB  1 
ATOM   5656 C  CG  . PHE B 1 186 ? 25.236  -2.457  75.433  1.00 33.70  ? 186 PHE B CG  1 
ATOM   5657 C  CD1 . PHE B 1 186 ? 26.579  -2.593  75.785  1.00 34.79  ? 186 PHE B CD1 1 
ATOM   5658 C  CD2 . PHE B 1 186 ? 24.764  -1.201  75.081  1.00 33.04  ? 186 PHE B CD2 1 
ATOM   5659 C  CE1 . PHE B 1 186 ? 27.432  -1.493  75.806  1.00 35.24  ? 186 PHE B CE1 1 
ATOM   5660 C  CE2 . PHE B 1 186 ? 25.619  -0.086  75.097  1.00 46.58  ? 186 PHE B CE2 1 
ATOM   5661 C  CZ  . PHE B 1 186 ? 26.952  -0.234  75.456  1.00 40.46  ? 186 PHE B CZ  1 
ATOM   5662 N  N   . PHE B 1 187 ? 23.424  -6.433  73.550  1.00 55.73  ? 187 PHE B N   1 
ATOM   5663 C  CA  . PHE B 1 187 ? 22.558  -7.602  73.457  1.00 51.24  ? 187 PHE B CA  1 
ATOM   5664 C  C   . PHE B 1 187 ? 23.169  -8.695  72.591  1.00 51.00  ? 187 PHE B C   1 
ATOM   5665 O  O   . PHE B 1 187 ? 22.449  -9.605  72.162  1.00 58.12  ? 187 PHE B O   1 
ATOM   5666 C  CB  . PHE B 1 187 ? 21.187  -7.217  72.895  1.00 35.50  ? 187 PHE B CB  1 
ATOM   5667 C  CG  . PHE B 1 187 ? 20.535  -6.073  73.615  1.00 37.81  ? 187 PHE B CG  1 
ATOM   5668 C  CD1 . PHE B 1 187 ? 21.017  -4.781  73.473  1.00 30.97  ? 187 PHE B CD1 1 
ATOM   5669 C  CD2 . PHE B 1 187 ? 19.415  -6.282  74.406  1.00 43.80  ? 187 PHE B CD2 1 
ATOM   5670 C  CE1 . PHE B 1 187 ? 20.422  -3.720  74.129  1.00 32.32  ? 187 PHE B CE1 1 
ATOM   5671 C  CE2 . PHE B 1 187 ? 18.803  -5.228  75.054  1.00 39.94  ? 187 PHE B CE2 1 
ATOM   5672 C  CZ  . PHE B 1 187 ? 19.305  -3.942  74.916  1.00 40.38  ? 187 PHE B CZ  1 
ATOM   5673 N  N   . GLY B 1 188 ? 24.469  -8.619  72.305  1.00 35.71  ? 188 GLY B N   1 
ATOM   5674 C  CA  . GLY B 1 188 ? 25.104  -9.564  71.415  1.00 44.43  ? 188 GLY B CA  1 
ATOM   5675 C  C   . GLY B 1 188 ? 24.956  -9.287  69.932  1.00 44.68  ? 188 GLY B C   1 
ATOM   5676 O  O   . GLY B 1 188 ? 25.197  -10.194 69.129  1.00 43.47  ? 188 GLY B O   1 
ATOM   5677 N  N   . GLY B 1 189 ? 24.586  -8.072  69.539  1.00 42.53  ? 189 GLY B N   1 
ATOM   5678 C  CA  . GLY B 1 189 ? 24.324  -7.755  68.146  1.00 46.07  ? 189 GLY B CA  1 
ATOM   5679 C  C   . GLY B 1 189 ? 25.470  -6.960  67.534  1.00 49.07  ? 189 GLY B C   1 
ATOM   5680 O  O   . GLY B 1 189 ? 26.000  -6.048  68.161  1.00 52.26  ? 189 GLY B O   1 
ATOM   5681 N  N   . ASP B 1 190 ? 25.846  -7.332  66.302  1.00 46.75  ? 190 ASP B N   1 
ATOM   5682 C  CA  . ASP B 1 190 ? 26.935  -6.628  65.642  1.00 37.27  ? 190 ASP B CA  1 
ATOM   5683 C  C   . ASP B 1 190 ? 26.393  -5.349  65.007  1.00 39.96  ? 190 ASP B C   1 
ATOM   5684 O  O   . ASP B 1 190 ? 25.676  -5.417  64.006  1.00 41.69  ? 190 ASP B O   1 
ATOM   5685 C  CB  . ASP B 1 190 ? 27.613  -7.506  64.583  1.00 43.08  ? 190 ASP B CB  1 
ATOM   5686 C  CG  . ASP B 1 190 ? 28.897  -6.887  64.045  1.00 64.35  ? 190 ASP B CG  1 
ATOM   5687 O  OD1 . ASP B 1 190 ? 29.168  -5.692  64.299  1.00 72.00  ? 190 ASP B OD1 1 
ATOM   5688 O  OD2 . ASP B 1 190 ? 29.676  -7.633  63.418  1.00 75.86  1 190 ASP B OD2 1 
ATOM   5689 N  N   . PRO B 1 191 ? 26.725  -4.166  65.531  1.00 36.63  ? 191 PRO B N   1 
ATOM   5690 C  CA  . PRO B 1 191 ? 26.325  -2.929  64.850  1.00 37.22  ? 191 PRO B CA  1 
ATOM   5691 C  C   . PRO B 1 191 ? 26.998  -2.728  63.496  1.00 40.91  ? 191 PRO B C   1 
ATOM   5692 O  O   . PRO B 1 191 ? 26.683  -1.746  62.807  1.00 36.91  ? 191 PRO B O   1 
ATOM   5693 C  CB  . PRO B 1 191 ? 26.740  -1.822  65.833  1.00 39.64  ? 191 PRO B CB  1 
ATOM   5694 C  CG  . PRO B 1 191 ? 27.392  -2.502  66.991  1.00 35.57  ? 191 PRO B CG  1 
ATOM   5695 C  CD  . PRO B 1 191 ? 27.672  -3.916  66.621  1.00 34.67  ? 191 PRO B CD  1 
ATOM   5696 N  N   . LYS B 1 192 ? 27.929  -3.599  63.105  1.00 44.98  ? 192 LYS B N   1 
ATOM   5697 C  CA  . LYS B 1 192 ? 28.565  -3.547  61.797  1.00 49.08  ? 192 LYS B CA  1 
ATOM   5698 C  C   . LYS B 1 192 ? 27.886  -4.450  60.786  1.00 45.69  ? 192 LYS B C   1 
ATOM   5699 O  O   . LYS B 1 192 ? 28.225  -4.383  59.603  1.00 45.13  ? 192 LYS B O   1 
ATOM   5700 C  CB  . LYS B 1 192 ? 30.033  -3.963  61.900  1.00 56.43  ? 192 LYS B CB  1 
ATOM   5701 C  CG  . LYS B 1 192 ? 30.799  -3.302  63.012  1.00 58.87  ? 192 LYS B CG  1 
ATOM   5702 C  CD  . LYS B 1 192 ? 32.243  -3.153  62.631  1.00 64.32  ? 192 LYS B CD  1 
ATOM   5703 C  CE  . LYS B 1 192 ? 32.380  -2.075  61.599  1.00 70.06  ? 192 LYS B CE  1 
ATOM   5704 N  NZ  . LYS B 1 192 ? 33.790  -1.677  61.445  1.00 72.81  1 192 LYS B NZ  1 
ATOM   5705 N  N   . THR B 1 193 ? 26.955  -5.297  61.229  1.00 44.76  ? 193 THR B N   1 
ATOM   5706 C  CA  . THR B 1 193 ? 26.249  -6.238  60.367  1.00 37.11  ? 193 THR B CA  1 
ATOM   5707 C  C   . THR B 1 193 ? 24.743  -6.174  60.713  1.00 35.61  ? 193 THR B C   1 
ATOM   5708 O  O   . THR B 1 193 ? 24.118  -7.134  61.172  1.00 30.20  ? 193 THR B O   1 
ATOM   5709 C  CB  . THR B 1 193 ? 26.946  -7.611  60.516  1.00 39.68  ? 193 THR B CB  1 
ATOM   5710 O  OG1 . THR B 1 193 ? 28.187  -7.575  59.799  1.00 44.90  ? 193 THR B OG1 1 
ATOM   5711 C  CG2 . THR B 1 193 ? 26.138  -8.766  59.940  1.00 32.01  ? 193 THR B CG2 1 
ATOM   5712 N  N   . VAL B 1 194 ? 24.163  -4.983  60.499  1.00 39.62  ? 194 VAL B N   1 
ATOM   5713 C  CA  . VAL B 1 194 ? 22.720  -4.747  60.625  1.00 39.98  ? 194 VAL B CA  1 
ATOM   5714 C  C   . VAL B 1 194 ? 22.072  -4.752  59.245  1.00 41.67  ? 194 VAL B C   1 
ATOM   5715 O  O   . VAL B 1 194 ? 22.426  -3.951  58.372  1.00 46.69  ? 194 VAL B O   1 
ATOM   5716 C  CB  . VAL B 1 194 ? 22.410  -3.420  61.336  1.00 44.37  ? 194 VAL B CB  1 
ATOM   5717 C  CG1 . VAL B 1 194 ? 20.902  -3.238  61.475  1.00 27.48  ? 194 VAL B CG1 1 
ATOM   5718 C  CG2 . VAL B 1 194 ? 23.069  -3.368  62.703  1.00 55.16  ? 194 VAL B CG2 1 
ATOM   5719 N  N   . THR B 1 195 ? 21.094  -5.626  59.071  1.00 41.77  ? 195 THR B N   1 
ATOM   5720 C  CA  . THR B 1 195 ? 20.221  -5.650  57.907  1.00 35.45  ? 195 THR B CA  1 
ATOM   5721 C  C   . THR B 1 195 ? 18.873  -5.020  58.261  1.00 33.12  ? 195 THR B C   1 
ATOM   5722 O  O   . THR B 1 195 ? 18.213  -5.454  59.212  1.00 34.34  ? 195 THR B O   1 
ATOM   5723 C  CB  . THR B 1 195 ? 20.035  -7.091  57.447  1.00 38.31  ? 195 THR B CB  1 
ATOM   5724 O  OG1 . THR B 1 195 ? 21.321  -7.640  57.155  1.00 58.15  ? 195 THR B OG1 1 
ATOM   5725 C  CG2 . THR B 1 195 ? 19.169  -7.154  56.236  1.00 38.64  ? 195 THR B CG2 1 
ATOM   5726 N  N   . ILE B 1 196 ? 18.474  -3.997  57.522  1.00 29.94  ? 196 ILE B N   1 
ATOM   5727 C  CA  . ILE B 1 196 ? 17.115  -3.482  57.649  1.00 34.66  ? 196 ILE B CA  1 
ATOM   5728 C  C   . ILE B 1 196 ? 16.245  -4.180  56.619  1.00 43.13  ? 196 ILE B C   1 
ATOM   5729 O  O   . ILE B 1 196 ? 16.730  -4.680  55.599  1.00 59.18  ? 196 ILE B O   1 
ATOM   5730 C  CB  . ILE B 1 196 ? 17.050  -1.943  57.510  1.00 32.35  ? 196 ILE B CB  1 
ATOM   5731 C  CG1 . ILE B 1 196 ? 17.525  -1.462  56.134  1.00 38.79  ? 196 ILE B CG1 1 
ATOM   5732 C  CG2 . ILE B 1 196 ? 17.867  -1.295  58.610  1.00 34.10  ? 196 ILE B CG2 1 
ATOM   5733 C  CD1 . ILE B 1 196 ? 17.371  0.049   55.913  1.00 25.54  ? 196 ILE B CD1 1 
ATOM   5734 N  N   . PHE B 1 197 ? 14.952  -4.257  56.914  1.00 31.56  ? 197 PHE B N   1 
ATOM   5735 C  CA  . PHE B 1 197 ? 13.999  -4.856  55.994  1.00 33.81  ? 197 PHE B CA  1 
ATOM   5736 C  C   . PHE B 1 197 ? 12.585  -4.493  56.415  1.00 43.80  ? 197 PHE B C   1 
ATOM   5737 O  O   . PHE B 1 197 ? 12.316  -4.142  57.572  1.00 37.72  ? 197 PHE B O   1 
ATOM   5738 C  CB  . PHE B 1 197 ? 14.161  -6.375  55.889  1.00 36.26  ? 197 PHE B CB  1 
ATOM   5739 C  CG  . PHE B 1 197 ? 13.909  -7.138  57.162  1.00 34.31  ? 197 PHE B CG  1 
ATOM   5740 C  CD1 . PHE B 1 197 ? 13.316  -8.381  57.108  1.00 31.95  ? 197 PHE B CD1 1 
ATOM   5741 C  CD2 . PHE B 1 197 ? 14.301  -6.658  58.393  1.00 39.34  ? 197 PHE B CD2 1 
ATOM   5742 C  CE1 . PHE B 1 197 ? 13.100  -9.122  58.253  1.00 32.64  ? 197 PHE B CE1 1 
ATOM   5743 C  CE2 . PHE B 1 197 ? 14.076  -7.397  59.548  1.00 38.78  ? 197 PHE B CE2 1 
ATOM   5744 C  CZ  . PHE B 1 197 ? 13.475  -8.631  59.468  1.00 33.10  ? 197 PHE B CZ  1 
ATOM   5745 N  N   . GLY B 1 198 ? 11.687  -4.574  55.446  1.00 41.85  ? 198 GLY B N   1 
ATOM   5746 C  CA  . GLY B 1 198 ? 10.319  -4.183  55.683  1.00 43.25  ? 198 GLY B CA  1 
ATOM   5747 C  C   . GLY B 1 198 ? 9.473   -4.439  54.460  1.00 37.37  ? 198 GLY B C   1 
ATOM   5748 O  O   . GLY B 1 198 ? 9.978   -4.599  53.340  1.00 30.93  ? 198 GLY B O   1 
ATOM   5749 N  N   . GLU B 1 199 ? 8.168   -4.442  54.689  1.00 29.05  ? 199 GLU B N   1 
ATOM   5750 C  CA  . GLU B 1 199 ? 7.224   -4.812  53.653  1.00 30.97  ? 199 GLU B CA  1 
ATOM   5751 C  C   . GLU B 1 199 ? 6.355   -3.616  53.306  1.00 31.85  ? 199 GLU B C   1 
ATOM   5752 O  O   . GLU B 1 199 ? 5.974   -2.848  54.194  1.00 25.69  ? 199 GLU B O   1 
ATOM   5753 C  CB  . GLU B 1 199 ? 6.392   -5.995  54.110  1.00 30.36  ? 199 GLU B CB  1 
ATOM   5754 C  CG  . GLU B 1 199 ? 5.424   -6.486  53.082  1.00 43.95  ? 199 GLU B CG  1 
ATOM   5755 C  CD  . GLU B 1 199 ? 4.057   -5.810  53.189  1.00 52.95  ? 199 GLU B CD  1 
ATOM   5756 O  OE1 . GLU B 1 199 ? 3.312   -5.892  52.199  1.00 59.40  ? 199 GLU B OE1 1 
ATOM   5757 O  OE2 . GLU B 1 199 ? 3.727   -5.193  54.237  1.00 47.38  1 199 GLU B OE2 1 
ATOM   5758 N  N   . SER B 1 200 ? 6.068   -3.454  52.001  1.00 41.31  ? 200 SER B N   1 
ATOM   5759 C  CA  . SER B 1 200 ? 5.141   -2.436  51.495  1.00 45.06  ? 200 SER B CA  1 
ATOM   5760 C  C   . SER B 1 200 ? 5.684   -1.024  51.695  1.00 45.05  ? 200 SER B C   1 
ATOM   5761 O  O   . SER B 1 200 ? 6.736   -0.671  51.151  1.00 52.93  ? 200 SER B O   1 
ATOM   5762 C  CB  . SER B 1 200 ? 3.783   -2.584  52.188  1.00 51.43  ? 200 SER B CB  1 
ATOM   5763 O  OG  . SER B 1 200 ? 2.735   -2.029  51.438  1.00 50.29  ? 200 SER B OG  1 
ATOM   5764 N  N   . ALA B 1 201 ? 4.971   -0.207  52.475  1.00 38.13  ? 201 ALA B N   1 
ATOM   5765 C  CA  . ALA B 1 201 ? 5.551   1.044   52.953  1.00 39.65  ? 201 ALA B CA  1 
ATOM   5766 C  C   . ALA B 1 201 ? 6.801   0.794   53.803  1.00 37.68  ? 201 ALA B C   1 
ATOM   5767 O  O   . ALA B 1 201 ? 7.658   1.685   53.924  1.00 31.73  ? 201 ALA B O   1 
ATOM   5768 C  CB  . ALA B 1 201 ? 4.503   1.838   53.743  1.00 34.31  ? 201 ALA B CB  1 
ATOM   5769 N  N   . GLY B 1 202 ? 6.923   -0.400  54.396  1.00 26.85  ? 202 GLY B N   1 
ATOM   5770 C  CA  . GLY B 1 202 ? 8.154   -0.746  55.088  1.00 31.71  ? 202 GLY B CA  1 
ATOM   5771 C  C   . GLY B 1 202 ? 9.299   -0.953  54.119  1.00 43.98  ? 202 GLY B C   1 
ATOM   5772 O  O   . GLY B 1 202 ? 10.422  -0.494  54.361  1.00 42.79  ? 202 GLY B O   1 
ATOM   5773 N  N   . GLY B 1 203 ? 9.022   -1.626  52.994  1.00 40.81  ? 203 GLY B N   1 
ATOM   5774 C  CA  . GLY B 1 203 ? 10.009  -1.722  51.928  1.00 38.03  ? 203 GLY B CA  1 
ATOM   5775 C  C   . GLY B 1 203 ? 10.396  -0.374  51.335  1.00 36.01  ? 203 GLY B C   1 
ATOM   5776 O  O   . GLY B 1 203 ? 11.569  -0.128  51.038  1.00 37.33  ? 203 GLY B O   1 
ATOM   5777 N  N   . ALA B 1 204 ? 9.423   0.515   51.130  1.00 33.53  ? 204 ALA B N   1 
ATOM   5778 C  CA  . ALA B 1 204 ? 9.784   1.817   50.576  1.00 36.89  ? 204 ALA B CA  1 
ATOM   5779 C  C   . ALA B 1 204 ? 10.673  2.612   51.535  1.00 41.88  ? 204 ALA B C   1 
ATOM   5780 O  O   . ALA B 1 204 ? 11.508  3.410   51.088  1.00 41.69  ? 204 ALA B O   1 
ATOM   5781 C  CB  . ALA B 1 204 ? 8.525   2.603   50.217  1.00 29.22  ? 204 ALA B CB  1 
ATOM   5782 N  N   . SER B 1 205 ? 10.517  2.404   52.849  1.00 32.74  ? 205 SER B N   1 
ATOM   5783 C  CA  . SER B 1 205 ? 11.339  3.120   53.816  1.00 27.78  ? 205 SER B CA  1 
ATOM   5784 C  C   . SER B 1 205 ? 12.772  2.593   53.801  1.00 38.85  ? 205 SER B C   1 
ATOM   5785 O  O   . SER B 1 205 ? 13.737  3.371   53.859  1.00 34.25  ? 205 SER B O   1 
ATOM   5786 C  CB  . SER B 1 205 ? 10.731  2.980   55.215  1.00 23.79  ? 205 SER B CB  1 
ATOM   5787 O  OG  . SER B 1 205 ? 9.428   3.485   55.291  1.00 25.36  ? 205 SER B OG  1 
ATOM   5788 N  N   . VAL B 1 206 ? 12.916  1.265   53.763  1.00 38.92  ? 206 VAL B N   1 
ATOM   5789 C  CA  . VAL B 1 206 ? 14.210  0.626   53.551  1.00 29.13  ? 206 VAL B CA  1 
ATOM   5790 C  C   . VAL B 1 206 ? 14.926  1.274   52.367  1.00 40.38  ? 206 VAL B C   1 
ATOM   5791 O  O   . VAL B 1 206 ? 16.096  1.677   52.460  1.00 46.05  ? 206 VAL B O   1 
ATOM   5792 C  CB  . VAL B 1 206 ? 14.013  -0.885  53.332  1.00 24.89  ? 206 VAL B CB  1 
ATOM   5793 C  CG1 . VAL B 1 206 ? 15.169  -1.484  52.571  1.00 25.41  ? 206 VAL B CG1 1 
ATOM   5794 C  CG2 . VAL B 1 206 ? 13.835  -1.597  54.629  1.00 24.76  ? 206 VAL B CG2 1 
ATOM   5795 N  N   . GLY B 1 207 ? 14.221  1.386   51.229  1.00 37.08  ? 207 GLY B N   1 
ATOM   5796 C  CA  . GLY B 1 207 ? 14.785  2.058   50.073  1.00 35.98  ? 207 GLY B CA  1 
ATOM   5797 C  C   . GLY B 1 207 ? 15.071  3.524   50.317  1.00 39.59  ? 207 GLY B C   1 
ATOM   5798 O  O   . GLY B 1 207 ? 16.028  4.069   49.766  1.00 46.52  ? 207 GLY B O   1 
ATOM   5799 N  N   . MET B 1 208 ? 14.262  4.187   51.141  1.00 25.25  ? 208 MET B N   1 
ATOM   5800 C  CA  . MET B 1 208 ? 14.528  5.595   51.392  1.00 30.93  ? 208 MET B CA  1 
ATOM   5801 C  C   . MET B 1 208 ? 15.741  5.776   52.282  1.00 39.16  ? 208 MET B C   1 
ATOM   5802 O  O   . MET B 1 208 ? 16.432  6.795   52.179  1.00 49.70  ? 208 MET B O   1 
ATOM   5803 C  CB  . MET B 1 208 ? 13.303  6.260   51.999  1.00 33.37  ? 208 MET B CB  1 
ATOM   5804 C  CG  . MET B 1 208 ? 12.164  6.350   51.014  1.00 31.21  ? 208 MET B CG  1 
ATOM   5805 S  SD  . MET B 1 208 ? 10.639  6.875   51.788  1.00 38.79  ? 208 MET B SD  1 
ATOM   5806 C  CE  . MET B 1 208 ? 9.566   7.018   50.332  1.00 43.72  ? 208 MET B CE  1 
ATOM   5807 N  N   . HIS B 1 209 ? 16.030  4.802   53.148  1.00 44.59  ? 209 HIS B N   1 
ATOM   5808 C  CA  . HIS B 1 209 ? 17.269  4.887   53.916  1.00 48.76  ? 209 HIS B CA  1 
ATOM   5809 C  C   . HIS B 1 209 ? 18.474  4.531   53.074  1.00 50.56  ? 209 HIS B C   1 
ATOM   5810 O  O   . HIS B 1 209 ? 19.584  4.964   53.395  1.00 56.09  ? 209 HIS B O   1 
ATOM   5811 C  CB  . HIS B 1 209 ? 17.235  3.982   55.143  1.00 43.85  ? 209 HIS B CB  1 
ATOM   5812 C  CG  . HIS B 1 209 ? 16.251  4.425   56.170  1.00 41.35  ? 209 HIS B CG  1 
ATOM   5813 N  ND1 . HIS B 1 209 ? 16.317  5.668   56.766  1.00 34.46  ? 209 HIS B ND1 1 
ATOM   5814 C  CD2 . HIS B 1 209 ? 15.156  3.813   56.680  1.00 24.65  ? 209 HIS B CD2 1 
ATOM   5815 C  CE1 . HIS B 1 209 ? 15.310  5.796   57.610  1.00 38.72  ? 209 HIS B CE1 1 
ATOM   5816 N  NE2 . HIS B 1 209 ? 14.594  4.683   57.581  1.00 37.75  ? 209 HIS B NE2 1 
ATOM   5817 N  N   . ILE B 1 210 ? 18.291  3.731   52.019  1.00 43.77  ? 210 ILE B N   1 
ATOM   5818 C  CA  . ILE B 1 210 ? 19.398  3.550   51.096  1.00 39.58  ? 210 ILE B CA  1 
ATOM   5819 C  C   . ILE B 1 210 ? 19.722  4.876   50.445  1.00 43.25  ? 210 ILE B C   1 
ATOM   5820 O  O   . ILE B 1 210 ? 20.892  5.181   50.177  1.00 44.70  ? 210 ILE B O   1 
ATOM   5821 C  CB  . ILE B 1 210 ? 19.082  2.455   50.061  1.00 42.20  ? 210 ILE B CB  1 
ATOM   5822 C  CG1 . ILE B 1 210 ? 19.237  1.082   50.693  1.00 41.75  ? 210 ILE B CG1 1 
ATOM   5823 C  CG2 . ILE B 1 210 ? 19.994  2.557   48.838  1.00 37.70  ? 210 ILE B CG2 1 
ATOM   5824 C  CD1 . ILE B 1 210 ? 18.920  -0.009  49.746  1.00 45.70  ? 210 ILE B CD1 1 
ATOM   5825 N  N   . LEU B 1 211 ? 18.711  5.711   50.228  1.00 27.36  ? 211 LEU B N   1 
ATOM   5826 C  CA  . LEU B 1 211 ? 18.981  6.971   49.555  1.00 45.38  ? 211 LEU B CA  1 
ATOM   5827 C  C   . LEU B 1 211 ? 19.410  8.078   50.507  1.00 46.13  ? 211 LEU B C   1 
ATOM   5828 O  O   . LEU B 1 211 ? 20.218  8.929   50.124  1.00 50.32  ? 211 LEU B O   1 
ATOM   5829 C  CB  . LEU B 1 211 ? 17.759  7.436   48.754  1.00 39.33  ? 211 LEU B CB  1 
ATOM   5830 C  CG  . LEU B 1 211 ? 17.128  6.567   47.647  1.00 38.79  ? 211 LEU B CG  1 
ATOM   5831 C  CD1 . LEU B 1 211 ? 16.185  7.451   46.879  1.00 37.64  ? 211 LEU B CD1 1 
ATOM   5832 C  CD2 . LEU B 1 211 ? 18.121  5.885   46.695  1.00 33.81  ? 211 LEU B CD2 1 
ATOM   5833 N  N   . SER B 1 212 ? 18.914  8.088   51.730  1.00 48.00  ? 212 SER B N   1 
ATOM   5834 C  CA  . SER B 1 212 ? 19.124  9.252   52.588  1.00 47.95  ? 212 SER B CA  1 
ATOM   5835 C  C   . SER B 1 212 ? 20.561  9.297   53.101  1.00 49.77  ? 212 SER B C   1 
ATOM   5836 O  O   . SER B 1 212 ? 21.041  8.316   53.682  1.00 47.85  ? 212 SER B O   1 
ATOM   5837 C  CB  . SER B 1 212 ? 18.142  9.237   53.759  1.00 47.52  ? 212 SER B CB  1 
ATOM   5838 O  OG  . SER B 1 212 ? 18.155  10.484  54.432  1.00 50.26  ? 212 SER B OG  1 
ATOM   5839 N  N   . PRO B 1 213 ? 21.277  10.404  52.895  1.00 52.28  ? 213 PRO B N   1 
ATOM   5840 C  CA  . PRO B 1 213 ? 22.657  10.494  53.415  1.00 39.01  ? 213 PRO B CA  1 
ATOM   5841 C  C   . PRO B 1 213 ? 22.762  10.288  54.925  1.00 39.11  ? 213 PRO B C   1 
ATOM   5842 O  O   . PRO B 1 213 ? 23.592  9.479   55.377  1.00 39.97  ? 213 PRO B O   1 
ATOM   5843 C  CB  . PRO B 1 213 ? 23.097  11.894  52.985  1.00 31.45  ? 213 PRO B CB  1 
ATOM   5844 C  CG  . PRO B 1 213 ? 22.120  12.361  51.977  1.00 41.13  ? 213 PRO B CG  1 
ATOM   5845 C  CD  . PRO B 1 213 ? 20.973  11.415  51.877  1.00 46.98  ? 213 PRO B CD  1 
ATOM   5846 N  N   . GLY B 1 214 ? 21.946  10.984  55.730  1.00 30.97  ? 214 GLY B N   1 
ATOM   5847 C  CA  . GLY B 1 214 ? 21.972  10.774  57.171  1.00 29.01  ? 214 GLY B CA  1 
ATOM   5848 C  C   . GLY B 1 214 ? 21.591  9.380   57.647  1.00 36.62  ? 214 GLY B C   1 
ATOM   5849 O  O   . GLY B 1 214 ? 21.626  9.126   58.856  1.00 32.28  ? 214 GLY B O   1 
ATOM   5850 N  N   . SER B 1 215 ? 21.147  8.489   56.752  1.00 38.05  ? 215 SER B N   1 
ATOM   5851 C  CA  . SER B 1 215 ? 20.726  7.148   57.141  1.00 30.99  ? 215 SER B CA  1 
ATOM   5852 C  C   . SER B 1 215 ? 21.685  6.055   56.701  1.00 41.45  ? 215 SER B C   1 
ATOM   5853 O  O   . SER B 1 215 ? 21.711  4.989   57.331  1.00 38.87  ? 215 SER B O   1 
ATOM   5854 C  CB  . SER B 1 215 ? 19.334  6.823   56.564  1.00 37.10  ? 215 SER B CB  1 
ATOM   5855 O  OG  . SER B 1 215 ? 18.278  7.549   57.187  1.00 40.68  ? 215 SER B OG  1 
ATOM   5856 N  N   . ARG B 1 216 ? 22.488  6.305   55.658  1.00 53.11  ? 216 ARG B N   1 
ATOM   5857 C  CA  . ARG B 1 216 ? 23.275  5.248   55.024  1.00 58.61  ? 216 ARG B CA  1 
ATOM   5858 C  C   . ARG B 1 216 ? 24.237  4.557   55.989  1.00 49.72  ? 216 ARG B C   1 
ATOM   5859 O  O   . ARG B 1 216 ? 24.532  3.366   55.823  1.00 51.79  ? 216 ARG B O   1 
ATOM   5860 C  CB  . ARG B 1 216 ? 24.056  5.817   53.840  1.00 65.45  ? 216 ARG B CB  1 
ATOM   5861 C  CG  . ARG B 1 216 ? 23.195  6.257   52.667  1.00 62.08  ? 216 ARG B CG  1 
ATOM   5862 C  CD  . ARG B 1 216 ? 24.074  6.879   51.592  1.00 59.73  ? 216 ARG B CD  1 
ATOM   5863 N  NE  . ARG B 1 216 ? 23.321  7.693   50.642  1.00 50.72  ? 216 ARG B NE  1 
ATOM   5864 C  CZ  . ARG B 1 216 ? 23.860  8.675   49.931  1.00 50.68  ? 216 ARG B CZ  1 
ATOM   5865 N  NH1 . ARG B 1 216 ? 23.119  9.371   49.083  1.00 48.85  1 216 ARG B NH1 1 
ATOM   5866 N  NH2 . ARG B 1 216 ? 25.146  8.969   50.083  1.00 57.93  ? 216 ARG B NH2 1 
ATOM   5867 N  N   . ASP B 1 217 ? 24.733  5.257   57.000  1.00 34.97  ? 217 ASP B N   1 
ATOM   5868 C  CA  . ASP B 1 217 ? 25.722  4.606   57.840  1.00 42.67  ? 217 ASP B CA  1 
ATOM   5869 C  C   . ASP B 1 217 ? 25.131  3.775   58.980  1.00 41.64  ? 217 ASP B C   1 
ATOM   5870 O  O   . ASP B 1 217 ? 25.896  3.110   59.682  1.00 44.53  ? 217 ASP B O   1 
ATOM   5871 C  CB  . ASP B 1 217 ? 26.715  5.641   58.373  1.00 52.00  ? 217 ASP B CB  1 
ATOM   5872 C  CG  . ASP B 1 217 ? 27.632  6.182   57.271  1.00 61.47  ? 217 ASP B CG  1 
ATOM   5873 O  OD1 . ASP B 1 217 ? 28.182  5.361   56.497  1.00 60.80  ? 217 ASP B OD1 1 
ATOM   5874 O  OD2 . ASP B 1 217 ? 27.789  7.419   57.162  1.00 65.77  1 217 ASP B OD2 1 
ATOM   5875 N  N   . LEU B 1 218 ? 23.807  3.735   59.166  1.00 46.69  ? 218 LEU B N   1 
ATOM   5876 C  CA  . LEU B 1 218 ? 23.257  3.031   60.324  1.00 43.89  ? 218 LEU B CA  1 
ATOM   5877 C  C   . LEU B 1 218 ? 22.775  1.622   60.027  1.00 38.63  ? 218 LEU B C   1 
ATOM   5878 O  O   . LEU B 1 218 ? 22.144  1.002   60.894  1.00 40.94  ? 218 LEU B O   1 
ATOM   5879 C  CB  . LEU B 1 218 ? 22.122  3.831   60.967  1.00 37.26  ? 218 LEU B CB  1 
ATOM   5880 C  CG  . LEU B 1 218 ? 22.719  5.168   61.398  1.00 40.53  ? 218 LEU B CG  1 
ATOM   5881 C  CD1 . LEU B 1 218 ? 21.688  6.309   61.454  1.00 32.40  ? 218 LEU B CD1 1 
ATOM   5882 C  CD2 . LEU B 1 218 ? 23.588  5.021   62.665  1.00 50.72  ? 218 LEU B CD2 1 
ATOM   5883 N  N   . PHE B 1 219 ? 23.063  1.097   58.846  1.00 38.48  ? 219 PHE B N   1 
ATOM   5884 C  CA  . PHE B 1 219 ? 22.832  -0.308  58.549  1.00 37.67  ? 219 PHE B CA  1 
ATOM   5885 C  C   . PHE B 1 219 ? 23.822  -0.721  57.473  1.00 41.06  ? 219 PHE B C   1 
ATOM   5886 O  O   . PHE B 1 219 ? 24.534  0.116   56.903  1.00 37.36  ? 219 PHE B O   1 
ATOM   5887 C  CB  . PHE B 1 219 ? 21.422  -0.563  58.060  1.00 37.01  ? 219 PHE B CB  1 
ATOM   5888 C  CG  . PHE B 1 219 ? 21.123  0.141   56.786  1.00 41.84  ? 219 PHE B CG  1 
ATOM   5889 C  CD1 . PHE B 1 219 ? 20.875  1.507   56.785  1.00 39.94  ? 219 PHE B CD1 1 
ATOM   5890 C  CD2 . PHE B 1 219 ? 21.138  -0.539  55.586  1.00 43.71  ? 219 PHE B CD2 1 
ATOM   5891 C  CE1 . PHE B 1 219 ? 20.612  2.176   55.624  1.00 29.22  ? 219 PHE B CE1 1 
ATOM   5892 C  CE2 . PHE B 1 219 ? 20.879  0.127   54.418  1.00 40.03  ? 219 PHE B CE2 1 
ATOM   5893 C  CZ  . PHE B 1 219 ? 20.611  1.489   54.441  1.00 34.56  ? 219 PHE B CZ  1 
ATOM   5894 N  N   . ARG B 1 220 ? 23.846  -2.021  57.175  1.00 30.54  ? 220 ARG B N   1 
ATOM   5895 C  CA  . ARG B 1 220 ? 24.833  -2.551  56.253  1.00 36.25  ? 220 ARG B CA  1 
ATOM   5896 C  C   . ARG B 1 220 ? 24.211  -3.075  54.964  1.00 41.26  ? 220 ARG B C   1 
ATOM   5897 O  O   . ARG B 1 220 ? 24.551  -2.588  53.888  1.00 36.79  ? 220 ARG B O   1 
ATOM   5898 C  CB  . ARG B 1 220 ? 25.685  -3.634  56.920  1.00 30.44  ? 220 ARG B CB  1 
ATOM   5899 C  CG  . ARG B 1 220 ? 26.781  -4.041  55.947  1.00 49.51  ? 220 ARG B CG  1 
ATOM   5900 C  CD  . ARG B 1 220 ? 27.861  -4.831  56.575  1.00 55.92  ? 220 ARG B CD  1 
ATOM   5901 N  NE  . ARG B 1 220 ? 28.833  -5.248  55.567  1.00 64.79  ? 220 ARG B NE  1 
ATOM   5902 C  CZ  . ARG B 1 220 ? 29.854  -6.053  55.807  1.00 63.83  ? 220 ARG B CZ  1 
ATOM   5903 N  NH1 . ARG B 1 220 ? 30.014  -6.523  57.028  1.00 55.64  1 220 ARG B NH1 1 
ATOM   5904 N  NH2 . ARG B 1 220 ? 30.679  -6.382  54.824  1.00 70.94  ? 220 ARG B NH2 1 
ATOM   5905 N  N   . ARG B 1 221 ? 23.340  -4.071  55.021  1.00 46.81  ? 221 ARG B N   1 
ATOM   5906 C  CA  . ARG B 1 221 ? 22.568  -4.450  53.849  1.00 45.62  ? 221 ARG B CA  1 
ATOM   5907 C  C   . ARG B 1 221 ? 21.099  -4.130  54.082  1.00 45.81  ? 221 ARG B C   1 
ATOM   5908 O  O   . ARG B 1 221 ? 20.687  -3.711  55.174  1.00 35.33  ? 221 ARG B O   1 
ATOM   5909 C  CB  . ARG B 1 221 ? 22.742  -5.929  53.526  1.00 37.39  ? 221 ARG B CB  1 
ATOM   5910 C  CG  . ARG B 1 221 ? 24.106  -6.397  53.743  1.00 30.39  ? 221 ARG B CG  1 
ATOM   5911 C  CD  . ARG B 1 221 ? 24.112  -7.779  54.316  1.00 39.91  ? 221 ARG B CD  1 
ATOM   5912 N  NE  . ARG B 1 221 ? 25.436  -8.089  54.887  1.00 46.63  ? 221 ARG B NE  1 
ATOM   5913 C  CZ  . ARG B 1 221 ? 26.559  -8.168  54.185  1.00 41.37  ? 221 ARG B CZ  1 
ATOM   5914 N  NH1 . ARG B 1 221 ? 26.511  -7.950  52.891  1.00 40.66  1 221 ARG B NH1 1 
ATOM   5915 N  NH2 . ARG B 1 221 ? 27.702  -8.449  54.781  1.00 47.89  ? 221 ARG B NH2 1 
ATOM   5916 N  N   . ALA B 1 222 ? 20.314  -4.359  53.027  1.00 40.13  ? 222 ALA B N   1 
ATOM   5917 C  CA  . ALA B 1 222 ? 18.928  -3.932  52.950  1.00 33.34  ? 222 ALA B CA  1 
ATOM   5918 C  C   . ALA B 1 222 ? 18.095  -5.035  52.324  1.00 32.87  ? 222 ALA B C   1 
ATOM   5919 O  O   . ALA B 1 222 ? 18.606  -5.846  51.550  1.00 44.46  ? 222 ALA B O   1 
ATOM   5920 C  CB  . ALA B 1 222 ? 18.794  -2.655  52.126  1.00 27.00  ? 222 ALA B CB  1 
ATOM   5921 N  N   . ILE B 1 223 ? 16.806  -5.055  52.677  1.00 34.55  ? 223 ILE B N   1 
ATOM   5922 C  CA  . ILE B 1 223 ? 15.803  -5.962  52.115  1.00 32.75  ? 223 ILE B CA  1 
ATOM   5923 C  C   . ILE B 1 223 ? 14.489  -5.217  51.916  1.00 33.63  ? 223 ILE B C   1 
ATOM   5924 O  O   . ILE B 1 223 ? 14.002  -4.554  52.835  1.00 44.55  ? 223 ILE B O   1 
ATOM   5925 C  CB  . ILE B 1 223 ? 15.569  -7.190  53.005  1.00 28.06  ? 223 ILE B CB  1 
ATOM   5926 C  CG1 . ILE B 1 223 ? 16.898  -7.803  53.439  1.00 32.73  ? 223 ILE B CG1 1 
ATOM   5927 C  CG2 . ILE B 1 223 ? 14.640  -8.192  52.338  1.00 32.20  ? 223 ILE B CG2 1 
ATOM   5928 C  CD1 . ILE B 1 223 ? 16.706  -9.167  53.969  1.00 27.69  ? 223 ILE B CD1 1 
ATOM   5929 N  N   . LEU B 1 224 ? 13.910  -5.335  50.725  1.00 28.51  ? 224 LEU B N   1 
ATOM   5930 C  CA  . LEU B 1 224 ? 12.712  -4.590  50.344  1.00 34.48  ? 224 LEU B CA  1 
ATOM   5931 C  C   . LEU B 1 224 ? 11.662  -5.554  49.799  1.00 38.44  ? 224 LEU B C   1 
ATOM   5932 O  O   . LEU B 1 224 ? 11.889  -6.199  48.777  1.00 38.16  ? 224 LEU B O   1 
ATOM   5933 C  CB  . LEU B 1 224 ? 13.036  -3.522  49.285  1.00 29.68  ? 224 LEU B CB  1 
ATOM   5934 C  CG  . LEU B 1 224 ? 14.211  -2.552  49.477  1.00 32.85  ? 224 LEU B CG  1 
ATOM   5935 C  CD1 . LEU B 1 224 ? 15.572  -3.135  49.077  1.00 32.90  ? 224 LEU B CD1 1 
ATOM   5936 C  CD2 . LEU B 1 224 ? 13.967  -1.224  48.770  1.00 39.48  ? 224 LEU B CD2 1 
ATOM   5937 N  N   . GLN B 1 225 ? 10.515  -5.654  50.459  1.00 37.27  ? 225 GLN B N   1 
ATOM   5938 C  CA  . GLN B 1 225 ? 9.491   -6.603  50.048  1.00 39.15  ? 225 GLN B CA  1 
ATOM   5939 C  C   . GLN B 1 225 ? 8.302   -5.796  49.536  1.00 43.81  ? 225 GLN B C   1 
ATOM   5940 O  O   . GLN B 1 225 ? 7.753   -4.972  50.278  1.00 55.10  ? 225 GLN B O   1 
ATOM   5941 C  CB  . GLN B 1 225 ? 9.027   -7.439  51.226  1.00 40.77  ? 225 GLN B CB  1 
ATOM   5942 C  CG  . GLN B 1 225 ? 10.012  -7.617  52.328  1.00 39.07  ? 225 GLN B CG  1 
ATOM   5943 C  CD  . GLN B 1 225 ? 9.862   -8.915  53.070  1.00 38.95  ? 225 GLN B CD  1 
ATOM   5944 O  OE1 . GLN B 1 225 ? 8.913   -9.664  52.856  1.00 63.78  ? 225 GLN B OE1 1 
ATOM   5945 N  NE2 . GLN B 1 225 ? 10.631  -9.043  54.122  1.00 31.15  ? 225 GLN B NE2 1 
ATOM   5946 N  N   . SER B 1 226 ? 7.906   -6.023  48.283  1.00 35.54  ? 226 SER B N   1 
ATOM   5947 C  CA  . SER B 1 226 ? 6.689   -5.416  47.731  1.00 40.15  ? 226 SER B CA  1 
ATOM   5948 C  C   . SER B 1 226 ? 6.652   -3.912  47.977  1.00 43.28  ? 226 SER B C   1 
ATOM   5949 O  O   . SER B 1 226 ? 5.583   -3.329  48.201  1.00 43.88  ? 226 SER B O   1 
ATOM   5950 C  CB  . SER B 1 226 ? 5.438   -6.076  48.308  1.00 31.92  ? 226 SER B CB  1 
ATOM   5951 O  OG  . SER B 1 226 ? 5.411   -7.464  47.979  1.00 40.13  ? 226 SER B OG  1 
ATOM   5952 N  N   . GLY B 1 227 ? 7.828   -3.282  47.943  1.00 34.77  ? 227 GLY B N   1 
ATOM   5953 C  CA  . GLY B 1 227 ? 7.941   -1.851  48.138  1.00 32.39  ? 227 GLY B CA  1 
ATOM   5954 C  C   . GLY B 1 227 ? 9.291   -1.299  47.722  1.00 37.01  ? 227 GLY B C   1 
ATOM   5955 O  O   . GLY B 1 227 ? 10.317  -1.986  47.767  1.00 35.38  ? 227 GLY B O   1 
ATOM   5956 N  N   . SER B 1 228 ? 9.301   -0.039  47.312  1.00 32.95  ? 228 SER B N   1 
ATOM   5957 C  CA  . SER B 1 228 ? 10.533  0.588   46.871  1.00 30.57  ? 228 SER B CA  1 
ATOM   5958 C  C   . SER B 1 228 ? 10.316  2.085   46.925  1.00 32.31  ? 228 SER B C   1 
ATOM   5959 O  O   . SER B 1 228 ? 9.184   2.548   46.734  1.00 28.29  ? 228 SER B O   1 
ATOM   5960 C  CB  . SER B 1 228 ? 10.916  0.134   45.448  1.00 44.13  ? 228 SER B CB  1 
ATOM   5961 O  OG  . SER B 1 228 ? 9.912   0.475   44.501  1.00 49.20  ? 228 SER B OG  1 
ATOM   5962 N  N   . PRO B 1 229 ? 11.368  2.867   47.171  1.00 34.70  ? 229 PRO B N   1 
ATOM   5963 C  CA  . PRO B 1 229 ? 11.156  4.298   47.430  1.00 32.90  ? 229 PRO B CA  1 
ATOM   5964 C  C   . PRO B 1 229 ? 10.401  4.994   46.315  1.00 33.56  ? 229 PRO B C   1 
ATOM   5965 O  O   . PRO B 1 229 ? 9.558   5.852   46.587  1.00 25.81  ? 229 PRO B O   1 
ATOM   5966 C  CB  . PRO B 1 229 ? 12.580  4.850   47.570  1.00 31.19  ? 229 PRO B CB  1 
ATOM   5967 C  CG  . PRO B 1 229 ? 13.437  3.864   46.866  1.00 34.38  ? 229 PRO B CG  1 
ATOM   5968 C  CD  . PRO B 1 229 ? 12.792  2.530   47.002  1.00 26.03  ? 229 PRO B CD  1 
ATOM   5969 N  N   . ASN B 1 230 ? 10.649  4.632   45.061  1.00 31.25  ? 230 ASN B N   1 
ATOM   5970 C  CA  . ASN B 1 230 ? 10.141  5.443   43.963  1.00 32.94  ? 230 ASN B CA  1 
ATOM   5971 C  C   . ASN B 1 230 ? 8.656   5.219   43.656  1.00 36.85  ? 230 ASN B C   1 
ATOM   5972 O  O   . ASN B 1 230 ? 8.087   6.027   42.919  1.00 45.82  ? 230 ASN B O   1 
ATOM   5973 C  CB  . ASN B 1 230 ? 11.006  5.195   42.729  1.00 27.60  ? 230 ASN B CB  1 
ATOM   5974 C  CG  . ASN B 1 230 ? 11.328  3.723   42.538  1.00 39.37  ? 230 ASN B CG  1 
ATOM   5975 O  OD1 . ASN B 1 230 ? 11.701  3.039   43.493  1.00 43.68  ? 230 ASN B OD1 1 
ATOM   5976 N  ND2 . ASN B 1 230 ? 11.207  3.234   41.309  1.00 33.75  ? 230 ASN B ND2 1 
ATOM   5977 N  N   . CYS B 1 231 ? 8.007   4.182   44.220  1.00 26.49  ? 231 CYS B N   1 
ATOM   5978 C  CA  . CYS B 1 231 ? 6.576   3.893   44.050  1.00 30.77  ? 231 CYS B CA  1 
ATOM   5979 C  C   . CYS B 1 231 ? 5.698   5.148   44.015  1.00 39.17  ? 231 CYS B C   1 
ATOM   5980 O  O   . CYS B 1 231 ? 6.025   6.151   44.664  1.00 34.97  ? 231 CYS B O   1 
ATOM   5981 C  CB  . CYS B 1 231 ? 6.076   2.957   45.168  1.00 33.02  ? 231 CYS B CB  1 
ATOM   5982 S  SG  . CYS B 1 231 ? 6.709   1.231   45.122  1.00 45.43  ? 231 CYS B SG  1 
ATOM   5983 N  N   . PRO B 1 232 ? 4.561   5.122   43.300  1.00 44.30  ? 232 PRO B N   1 
ATOM   5984 C  CA  . PRO B 1 232 ? 3.784   6.356   43.120  1.00 32.84  ? 232 PRO B CA  1 
ATOM   5985 C  C   . PRO B 1 232 ? 3.089   6.816   44.387  1.00 33.77  ? 232 PRO B C   1 
ATOM   5986 O  O   . PRO B 1 232 ? 2.775   8.008   44.512  1.00 42.95  ? 232 PRO B O   1 
ATOM   5987 C  CB  . PRO B 1 232 ? 2.753   5.973   42.054  1.00 31.49  ? 232 PRO B CB  1 
ATOM   5988 C  CG  . PRO B 1 232 ? 3.116   4.566   41.603  1.00 29.33  ? 232 PRO B CG  1 
ATOM   5989 C  CD  . PRO B 1 232 ? 3.870   3.961   42.718  1.00 41.46  ? 232 PRO B CD  1 
ATOM   5990 N  N   . TRP B 1 233 ? 2.828   5.911   45.322  1.00 30.60  ? 233 TRP B N   1 
ATOM   5991 C  CA  . TRP B 1 233 ? 2.071   6.219   46.529  1.00 40.87  ? 233 TRP B CA  1 
ATOM   5992 C  C   . TRP B 1 233 ? 2.957   6.559   47.713  1.00 36.86  ? 233 TRP B C   1 
ATOM   5993 O  O   . TRP B 1 233 ? 2.442   6.723   48.828  1.00 37.09  ? 233 TRP B O   1 
ATOM   5994 C  CB  . TRP B 1 233 ? 1.190   5.027   46.899  1.00 47.01  ? 233 TRP B CB  1 
ATOM   5995 C  CG  . TRP B 1 233 ? 1.946   3.766   46.766  1.00 43.88  ? 233 TRP B CG  1 
ATOM   5996 C  CD1 . TRP B 1 233 ? 1.970   2.944   45.685  1.00 56.18  ? 233 TRP B CD1 1 
ATOM   5997 C  CD2 . TRP B 1 233 ? 2.851   3.207   47.718  1.00 44.85  ? 233 TRP B CD2 1 
ATOM   5998 N  NE1 . TRP B 1 233 ? 2.809   1.881   45.915  1.00 59.28  ? 233 TRP B NE1 1 
ATOM   5999 C  CE2 . TRP B 1 233 ? 3.360   2.017   47.161  1.00 45.44  ? 233 TRP B CE2 1 
ATOM   6000 C  CE3 . TRP B 1 233 ? 3.265   3.584   48.998  1.00 42.23  ? 233 TRP B CE3 1 
ATOM   6001 C  CZ2 . TRP B 1 233 ? 4.270   1.205   47.833  1.00 30.89  ? 233 TRP B CZ2 1 
ATOM   6002 C  CZ3 . TRP B 1 233 ? 4.173   2.776   49.666  1.00 39.97  ? 233 TRP B CZ3 1 
ATOM   6003 C  CH2 . TRP B 1 233 ? 4.669   1.605   49.077  1.00 36.23  ? 233 TRP B CH2 1 
ATOM   6004 N  N   . ALA B 1 234 ? 4.275   6.644   47.504  1.00 30.28  ? 234 ALA B N   1 
ATOM   6005 C  CA  . ALA B 1 234 ? 5.227   6.696   48.601  1.00 28.82  ? 234 ALA B CA  1 
ATOM   6006 C  C   . ALA B 1 234 ? 5.838   8.071   48.826  1.00 36.31  ? 234 ALA B C   1 
ATOM   6007 O  O   . ALA B 1 234 ? 6.476   8.279   49.865  1.00 40.62  ? 234 ALA B O   1 
ATOM   6008 C  CB  . ALA B 1 234 ? 6.343   5.668   48.375  1.00 28.95  ? 234 ALA B CB  1 
ATOM   6009 N  N   . SER B 1 235 ? 5.670   9.013   47.901  1.00 40.27  ? 235 SER B N   1 
ATOM   6010 C  CA  . SER B 1 235 ? 6.236   10.338  48.105  1.00 43.74  ? 235 SER B CA  1 
ATOM   6011 C  C   . SER B 1 235 ? 5.316   11.383  47.504  1.00 34.74  ? 235 SER B C   1 
ATOM   6012 O  O   . SER B 1 235 ? 4.503   11.089  46.627  1.00 47.86  ? 235 SER B O   1 
ATOM   6013 C  CB  . SER B 1 235 ? 7.656   10.452  47.521  1.00 50.01  ? 235 SER B CB  1 
ATOM   6014 O  OG  . SER B 1 235 ? 7.686   10.186  46.129  1.00 55.96  ? 235 SER B OG  1 
ATOM   6015 N  N   . VAL B 1 236 ? 5.438   12.607  48.017  1.00 26.59  ? 236 VAL B N   1 
ATOM   6016 C  CA  . VAL B 1 236 ? 4.756   13.782  47.485  1.00 27.20  ? 236 VAL B CA  1 
ATOM   6017 C  C   . VAL B 1 236 ? 5.747   14.936  47.489  1.00 39.55  ? 236 VAL B C   1 
ATOM   6018 O  O   . VAL B 1 236 ? 6.758   14.915  48.194  1.00 47.97  ? 236 VAL B O   1 
ATOM   6019 C  CB  . VAL B 1 236 ? 3.493   14.190  48.287  1.00 33.34  ? 236 VAL B CB  1 
ATOM   6020 C  CG1 . VAL B 1 236 ? 2.371   13.168  48.116  1.00 27.02  ? 236 VAL B CG1 1 
ATOM   6021 C  CG2 . VAL B 1 236 ? 3.839   14.409  49.773  1.00 26.79  ? 236 VAL B CG2 1 
ATOM   6022 N  N   . SER B 1 237 ? 5.443   15.955  46.693  1.00 33.38  ? 237 SER B N   1 
ATOM   6023 C  CA  . SER B 1 237 ? 6.305   17.121  46.619  1.00 36.30  ? 237 SER B CA  1 
ATOM   6024 C  C   . SER B 1 237 ? 6.055   18.055  47.802  1.00 50.40  ? 237 SER B C   1 
ATOM   6025 O  O   . SER B 1 237 ? 5.065   17.938  48.534  1.00 44.30  ? 237 SER B O   1 
ATOM   6026 C  CB  . SER B 1 237 ? 6.067   17.869  45.321  1.00 31.02  ? 237 SER B CB  1 
ATOM   6027 O  OG  . SER B 1 237 ? 4.763   18.440  45.339  1.00 36.92  ? 237 SER B OG  1 
ATOM   6028 N  N   . VAL B 1 238 ? 6.977   18.998  47.985  1.00 55.11  ? 238 VAL B N   1 
ATOM   6029 C  CA  . VAL B 1 238 ? 6.778   20.036  48.990  1.00 48.34  ? 238 VAL B CA  1 
ATOM   6030 C  C   . VAL B 1 238 ? 5.437   20.737  48.780  1.00 38.66  ? 238 VAL B C   1 
ATOM   6031 O  O   . VAL B 1 238 ? 4.657   20.919  49.723  1.00 39.74  ? 238 VAL B O   1 
ATOM   6032 C  CB  . VAL B 1 238 ? 7.965   21.016  48.962  1.00 41.48  ? 238 VAL B CB  1 
ATOM   6033 C  CG1 . VAL B 1 238 ? 7.600   22.327  49.611  1.00 46.25  ? 238 VAL B CG1 1 
ATOM   6034 C  CG2 . VAL B 1 238 ? 9.160   20.386  49.649  1.00 34.29  ? 238 VAL B CG2 1 
ATOM   6035 N  N   . ALA B 1 239 ? 5.133   21.118  47.546  1.00 31.98  ? 239 ALA B N   1 
ATOM   6036 C  CA  . ALA B 1 239 ? 3.889   21.837  47.307  1.00 40.73  ? 239 ALA B CA  1 
ATOM   6037 C  C   . ALA B 1 239 ? 2.663   20.982  47.639  1.00 46.40  ? 239 ALA B C   1 
ATOM   6038 O  O   . ALA B 1 239 ? 1.680   21.487  48.203  1.00 49.01  ? 239 ALA B O   1 
ATOM   6039 C  CB  . ALA B 1 239 ? 3.832   22.315  45.864  1.00 32.20  ? 239 ALA B CB  1 
ATOM   6040 N  N   . GLU B 1 240 ? 2.700   19.684  47.309  1.00 37.71  ? 240 GLU B N   1 
ATOM   6041 C  CA  . GLU B 1 240 ? 1.501   18.859  47.478  1.00 42.41  ? 240 GLU B CA  1 
ATOM   6042 C  C   . GLU B 1 240 ? 1.274   18.468  48.936  1.00 46.18  ? 240 GLU B C   1 
ATOM   6043 O  O   . GLU B 1 240 ? 0.132   18.478  49.416  1.00 48.38  ? 240 GLU B O   1 
ATOM   6044 C  CB  . GLU B 1 240 ? 1.570   17.605  46.604  1.00 36.06  ? 240 GLU B CB  1 
ATOM   6045 C  CG  . GLU B 1 240 ? 0.649   16.484  47.124  1.00 39.28  ? 240 GLU B CG  1 
ATOM   6046 C  CD  . GLU B 1 240 ? -0.805  16.682  46.648  1.00 44.53  ? 240 GLU B CD  1 
ATOM   6047 O  OE1 . GLU B 1 240 ? -1.093  17.762  46.059  1.00 45.06  ? 240 GLU B OE1 1 
ATOM   6048 O  OE2 . GLU B 1 240 ? -1.697  15.809  46.885  1.00 39.42  1 240 GLU B OE2 1 
ATOM   6049 N  N   . GLY B 1 241 ? 2.342   18.114  49.652  1.00 46.94  ? 241 GLY B N   1 
ATOM   6050 C  CA  . GLY B 1 241 ? 2.210   17.893  51.078  1.00 44.71  ? 241 GLY B CA  1 
ATOM   6051 C  C   . GLY B 1 241 ? 1.698   19.117  51.817  1.00 46.61  ? 241 GLY B C   1 
ATOM   6052 O  O   . GLY B 1 241 ? 1.070   18.993  52.872  1.00 51.79  ? 241 GLY B O   1 
ATOM   6053 N  N   . ARG B 1 242 ? 1.962   20.312  51.284  1.00 38.47  ? 242 ARG B N   1 
ATOM   6054 C  CA  . ARG B 1 242 ? 1.484   21.531  51.924  1.00 36.55  ? 242 ARG B CA  1 
ATOM   6055 C  C   . ARG B 1 242 ? -0.011  21.684  51.729  1.00 49.81  ? 242 ARG B C   1 
ATOM   6056 O  O   . ARG B 1 242 ? -0.746  22.005  52.671  1.00 62.99  ? 242 ARG B O   1 
ATOM   6057 C  CB  . ARG B 1 242 ? 2.228   22.745  51.362  1.00 39.42  ? 242 ARG B CB  1 
ATOM   6058 C  CG  . ARG B 1 242 ? 1.550   24.094  51.614  1.00 44.69  ? 242 ARG B CG  1 
ATOM   6059 C  CD  . ARG B 1 242 ? 2.507   25.261  51.367  1.00 57.80  ? 242 ARG B CD  1 
ATOM   6060 N  NE  . ARG B 1 242 ? 3.772   25.029  52.089  1.00 61.64  ? 242 ARG B NE  1 
ATOM   6061 C  CZ  . ARG B 1 242 ? 4.057   25.496  53.308  1.00 56.95  ? 242 ARG B CZ  1 
ATOM   6062 N  NH1 . ARG B 1 242 ? 5.213   25.198  53.876  1.00 52.89  1 242 ARG B NH1 1 
ATOM   6063 N  NH2 . ARG B 1 242 ? 3.183   26.258  53.946  1.00 57.67  ? 242 ARG B NH2 1 
ATOM   6064 N  N   . ARG B 1 243 ? -0.486  21.453  50.506  1.00 48.22  ? 243 ARG B N   1 
ATOM   6065 C  CA  . ARG B 1 243 ? -1.887  21.715  50.253  1.00 53.20  ? 243 ARG B CA  1 
ATOM   6066 C  C   . ARG B 1 243 ? -2.744  20.706  50.990  1.00 50.59  ? 243 ARG B C   1 
ATOM   6067 O  O   . ARG B 1 243 ? -3.886  21.017  51.367  1.00 65.24  ? 243 ARG B O   1 
ATOM   6068 C  CB  . ARG B 1 243 ? -2.172  21.718  48.743  1.00 64.64  ? 243 ARG B CB  1 
ATOM   6069 C  CG  . ARG B 1 243 ? -3.665  21.586  48.407  1.00 64.53  ? 243 ARG B CG  1 
ATOM   6070 C  CD  . ARG B 1 243 ? -4.001  21.103  47.031  1.00 58.73  ? 243 ARG B CD  1 
ATOM   6071 N  NE  . ARG B 1 243 ? -3.601  19.723  46.776  1.00 49.05  ? 243 ARG B NE  1 
ATOM   6072 C  CZ  . ARG B 1 243 ? -4.231  18.649  47.233  1.00 46.50  ? 243 ARG B CZ  1 
ATOM   6073 N  NH1 . ARG B 1 243 ? -5.290  18.763  48.022  1.00 47.07  1 243 ARG B NH1 1 
ATOM   6074 N  NH2 . ARG B 1 243 ? -3.778  17.458  46.900  1.00 51.97  ? 243 ARG B NH2 1 
ATOM   6075 N  N   . ARG B 1 244 ? -2.195  19.517  51.262  1.00 34.20  ? 244 ARG B N   1 
ATOM   6076 C  CA  . ARG B 1 244 ? -2.947  18.609  52.118  1.00 42.72  ? 244 ARG B CA  1 
ATOM   6077 C  C   . ARG B 1 244 ? -2.971  19.094  53.556  1.00 50.71  ? 244 ARG B C   1 
ATOM   6078 O  O   . ARG B 1 244 ? -4.051  19.203  54.161  1.00 55.56  ? 244 ARG B O   1 
ATOM   6079 C  CB  . ARG B 1 244 ? -2.418  17.181  52.029  1.00 37.64  ? 244 ARG B CB  1 
ATOM   6080 C  CG  . ARG B 1 244 ? -1.975  16.760  50.642  1.00 34.16  ? 244 ARG B CG  1 
ATOM   6081 C  CD  . ARG B 1 244 ? -1.686  15.277  50.614  1.00 29.44  ? 244 ARG B CD  1 
ATOM   6082 N  NE  . ARG B 1 244 ? -1.826  14.712  49.262  1.00 38.44  ? 244 ARG B NE  1 
ATOM   6083 C  CZ  . ARG B 1 244 ? -1.449  13.483  48.903  1.00 39.03  ? 244 ARG B CZ  1 
ATOM   6084 N  NH1 . ARG B 1 244 ? -0.926  12.679  49.805  1.00 37.52  1 244 ARG B NH1 1 
ATOM   6085 N  NH2 . ARG B 1 244 ? -1.615  13.063  47.657  1.00 29.99  ? 244 ARG B NH2 1 
ATOM   6086 N  N   . ALA B 1 245 ? -1.789  19.382  54.110  1.00 45.89  ? 245 ALA B N   1 
ATOM   6087 C  CA  . ALA B 1 245 ? -1.698  19.948  55.449  1.00 29.38  ? 245 ALA B CA  1 
ATOM   6088 C  C   . ALA B 1 245 ? -2.679  21.096  55.623  1.00 41.77  ? 245 ALA B C   1 
ATOM   6089 O  O   . ALA B 1 245 ? -3.499  21.092  56.552  1.00 48.95  ? 245 ALA B O   1 
ATOM   6090 C  CB  . ALA B 1 245 ? -0.280  20.419  55.708  1.00 29.21  ? 245 ALA B CB  1 
ATOM   6091 N  N   . VAL B 1 246 ? -2.639  22.071  54.710  1.00 37.32  ? 246 VAL B N   1 
ATOM   6092 C  CA  . VAL B 1 246 ? -3.614  23.158  54.753  1.00 39.07  ? 246 VAL B CA  1 
ATOM   6093 C  C   . VAL B 1 246 ? -5.028  22.593  54.705  1.00 42.11  ? 246 VAL B C   1 
ATOM   6094 O  O   . VAL B 1 246 ? -5.878  22.918  55.544  1.00 49.59  ? 246 VAL B O   1 
ATOM   6095 C  CB  . VAL B 1 246 ? -3.378  24.156  53.603  1.00 42.10  ? 246 VAL B CB  1 
ATOM   6096 C  CG1 . VAL B 1 246 ? -4.511  25.182  53.570  1.00 33.82  ? 246 VAL B CG1 1 
ATOM   6097 C  CG2 . VAL B 1 246 ? -2.023  24.837  53.724  1.00 32.70  ? 246 VAL B CG2 1 
ATOM   6098 N  N   . GLU B 1 247 ? -5.298  21.724  53.727  1.00 31.91  ? 247 GLU B N   1 
ATOM   6099 C  CA  . GLU B 1 247 ? -6.657  21.219  53.568  1.00 41.82  ? 247 GLU B CA  1 
ATOM   6100 C  C   . GLU B 1 247 ? -7.097  20.408  54.776  1.00 48.89  ? 247 GLU B C   1 
ATOM   6101 O  O   . GLU B 1 247 ? -8.274  20.442  55.141  1.00 57.48  ? 247 GLU B O   1 
ATOM   6102 C  CB  . GLU B 1 247 ? -6.776  20.385  52.294  1.00 44.89  ? 247 GLU B CB  1 
ATOM   6103 C  CG  . GLU B 1 247 ? -8.122  19.687  52.123  1.00 56.49  ? 247 GLU B CG  1 
ATOM   6104 C  CD  . GLU B 1 247 ? -9.269  20.656  51.821  1.00 68.77  ? 247 GLU B CD  1 
ATOM   6105 O  OE1 . GLU B 1 247 ? -9.032  21.885  51.758  1.00 69.63  ? 247 GLU B OE1 1 
ATOM   6106 O  OE2 . GLU B 1 247 ? -10.413 20.179  51.640  1.00 70.47  1 247 GLU B OE2 1 
ATOM   6107 N  N   . LEU B 1 248 ? -6.174  19.680  55.412  1.00 51.99  ? 248 LEU B N   1 
ATOM   6108 C  CA  . LEU B 1 248 ? -6.507  18.996  56.659  1.00 45.94  ? 248 LEU B CA  1 
ATOM   6109 C  C   . LEU B 1 248 ? -6.966  19.990  57.709  1.00 40.59  ? 248 LEU B C   1 
ATOM   6110 O  O   . LEU B 1 248 ? -7.857  19.692  58.509  1.00 41.06  ? 248 LEU B O   1 
ATOM   6111 C  CB  . LEU B 1 248 ? -5.307  18.209  57.178  1.00 43.29  ? 248 LEU B CB  1 
ATOM   6112 C  CG  . LEU B 1 248 ? -5.587  17.443  58.473  1.00 41.24  ? 248 LEU B CG  1 
ATOM   6113 C  CD1 . LEU B 1 248 ? -6.125  16.043  58.199  1.00 38.75  ? 248 LEU B CD1 1 
ATOM   6114 C  CD2 . LEU B 1 248 ? -4.338  17.377  59.319  1.00 38.15  ? 248 LEU B CD2 1 
ATOM   6115 N  N   . GLY B 1 249 ? -6.367  21.181  57.717  1.00 44.72  ? 249 GLY B N   1 
ATOM   6116 C  CA  . GLY B 1 249 ? -6.824  22.222  58.619  1.00 50.52  ? 249 GLY B CA  1 
ATOM   6117 C  C   . GLY B 1 249 ? -8.160  22.803  58.198  1.00 55.18  ? 249 GLY B C   1 
ATOM   6118 O  O   . GLY B 1 249 ? -9.009  23.093  59.042  1.00 55.17  ? 249 GLY B O   1 
ATOM   6119 N  N   . ARG B 1 250 ? -8.360  23.001  56.891  1.00 55.83  ? 250 ARG B N   1 
ATOM   6120 C  CA  . ARG B 1 250 ? -9.659  23.465  56.413  1.00 55.10  ? 250 ARG B CA  1 
ATOM   6121 C  C   . ARG B 1 250 ? -10.760 22.512  56.853  1.00 57.69  ? 250 ARG B C   1 
ATOM   6122 O  O   . ARG B 1 250 ? -11.815 22.945  57.332  1.00 60.64  ? 250 ARG B O   1 
ATOM   6123 C  CB  . ARG B 1 250 ? -9.631  23.617  54.889  1.00 59.51  ? 250 ARG B CB  1 
ATOM   6124 C  CG  . ARG B 1 250 ? -10.960 23.993  54.226  1.00 64.75  ? 250 ARG B CG  1 
ATOM   6125 C  CD  . ARG B 1 250 ? -10.782 24.363  52.739  1.00 71.11  ? 250 ARG B CD  1 
ATOM   6126 N  NE  . ARG B 1 250 ? -10.005 25.597  52.548  1.00 78.94  ? 250 ARG B NE  1 
ATOM   6127 C  CZ  . ARG B 1 250 ? -8.724  25.656  52.167  1.00 70.63  ? 250 ARG B CZ  1 
ATOM   6128 N  NH1 . ARG B 1 250 ? -8.125  26.840  52.031  1.00 58.37  1 250 ARG B NH1 1 
ATOM   6129 N  NH2 . ARG B 1 250 ? -8.039  24.540  51.918  1.00 65.55  ? 250 ARG B NH2 1 
ATOM   6130 N  N   . ASN B 1 251 ? -10.509 21.205  56.741  1.00 60.92  ? 251 ASN B N   1 
ATOM   6131 C  CA  . ASN B 1 251 ? -11.445 20.198  57.224  1.00 61.91  ? 251 ASN B CA  1 
ATOM   6132 C  C   . ASN B 1 251 ? -11.661 20.280  58.725  1.00 62.83  ? 251 ASN B C   1 
ATOM   6133 O  O   . ASN B 1 251 ? -12.648 19.734  59.226  1.00 59.88  ? 251 ASN B O   1 
ATOM   6134 C  CB  . ASN B 1 251 ? -10.945 18.799  56.866  1.00 61.13  ? 251 ASN B CB  1 
ATOM   6135 C  CG  . ASN B 1 251 ? -11.240 18.423  55.425  1.00 61.02  ? 251 ASN B CG  1 
ATOM   6136 O  OD1 . ASN B 1 251 ? -12.191 17.695  55.144  1.00 61.80  ? 251 ASN B OD1 1 
ATOM   6137 N  ND2 . ASN B 1 251 ? -10.421 18.915  54.505  1.00 57.28  ? 251 ASN B ND2 1 
ATOM   6138 N  N   . LEU B 1 252 ? -10.760 20.928  59.457  1.00 63.49  ? 252 LEU B N   1 
ATOM   6139 C  CA  . LEU B 1 252 ? -10.876 21.051  60.904  1.00 59.85  ? 252 LEU B CA  1 
ATOM   6140 C  C   . LEU B 1 252 ? -11.183 22.480  61.341  1.00 59.01  ? 252 LEU B C   1 
ATOM   6141 O  O   . LEU B 1 252 ? -11.034 22.803  62.525  1.00 46.21  ? 252 LEU B O   1 
ATOM   6142 C  CB  . LEU B 1 252 ? -9.594  20.540  61.563  1.00 59.30  ? 252 LEU B CB  1 
ATOM   6143 C  CG  . LEU B 1 252 ? -9.393  19.024  61.405  1.00 58.18  ? 252 LEU B CG  1 
ATOM   6144 C  CD1 . LEU B 1 252 ? -7.997  18.576  61.834  1.00 55.70  ? 252 LEU B CD1 1 
ATOM   6145 C  CD2 . LEU B 1 252 ? -10.446 18.265  62.202  1.00 58.13  ? 252 LEU B CD2 1 
ATOM   6146 N  N   . ASN B 1 253 ? -11.618 23.332  60.410  1.00 68.59  ? 253 ASN B N   1 
ATOM   6147 C  CA  . ASN B 1 253 ? -11.909 24.744  60.672  1.00 73.63  ? 253 ASN B CA  1 
ATOM   6148 C  C   . ASN B 1 253 ? -10.768 25.418  61.429  1.00 62.13  ? 253 ASN B C   1 
ATOM   6149 O  O   . ASN B 1 253 ? -10.955 26.041  62.474  1.00 57.27  ? 253 ASN B O   1 
ATOM   6150 C  CB  . ASN B 1 253 ? -13.240 24.904  61.410  1.00 78.75  ? 253 ASN B CB  1 
ATOM   6151 C  CG  . ASN B 1 253 ? -14.424 24.732  60.490  1.00 90.16  ? 253 ASN B CG  1 
ATOM   6152 O  OD1 . ASN B 1 253 ? -15.363 24.005  60.804  1.00 98.97  ? 253 ASN B OD1 1 
ATOM   6153 N  ND2 . ASN B 1 253 ? -14.380 25.392  59.333  1.00 94.50  ? 253 ASN B ND2 1 
ATOM   6154 N  N   . CYS B 1 254 ? -9.572  25.305  60.874  1.00 61.78  ? 254 CYS B N   1 
ATOM   6155 C  CA  . CYS B 1 254 ? -8.375  25.863  61.479  1.00 55.28  ? 254 CYS B CA  1 
ATOM   6156 C  C   . CYS B 1 254 ? -8.055  27.231  60.900  1.00 55.10  ? 254 CYS B C   1 
ATOM   6157 O  O   . CYS B 1 254 ? -8.550  27.618  59.839  1.00 63.45  ? 254 CYS B O   1 
ATOM   6158 C  CB  . CYS B 1 254 ? -7.190  24.926  61.273  1.00 52.42  ? 254 CYS B CB  1 
ATOM   6159 S  SG  . CYS B 1 254 ? -7.180  23.649  62.503  1.00 71.39  ? 254 CYS B SG  1 
ATOM   6160 N  N   . ASN B 1 255 ? -7.215  27.968  61.615  1.00 54.52  ? 255 ASN B N   1 
ATOM   6161 C  CA  . ASN B 1 255 ? -6.642  29.170  61.037  1.00 54.00  ? 255 ASN B CA  1 
ATOM   6162 C  C   . ASN B 1 255 ? -5.542  28.754  60.074  1.00 59.28  ? 255 ASN B C   1 
ATOM   6163 O  O   . ASN B 1 255 ? -4.653  27.980  60.432  1.00 63.59  ? 255 ASN B O   1 
ATOM   6164 C  CB  . ASN B 1 255 ? -6.104  30.116  62.107  1.00 38.13  ? 255 ASN B CB  1 
ATOM   6165 C  CG  . ASN B 1 255 ? -5.845  31.510  61.556  1.00 50.69  ? 255 ASN B CG  1 
ATOM   6166 O  OD1 . ASN B 1 255 ? -5.406  31.667  60.410  1.00 52.31  ? 255 ASN B OD1 1 
ATOM   6167 N  ND2 . ASN B 1 255 ? -6.156  32.533  62.349  1.00 57.87  ? 255 ASN B ND2 1 
ATOM   6168 N  N   . LEU B 1 256 ? -5.629  29.237  58.838  1.00 59.00  ? 256 LEU B N   1 
ATOM   6169 C  CA  . LEU B 1 256 ? -4.696  28.863  57.785  1.00 57.44  ? 256 LEU B CA  1 
ATOM   6170 C  C   . LEU B 1 256 ? -3.886  30.043  57.272  1.00 62.07  ? 256 LEU B C   1 
ATOM   6171 O  O   . LEU B 1 256 ? -3.191  29.906  56.255  1.00 61.51  ? 256 LEU B O   1 
ATOM   6172 C  CB  . LEU B 1 256 ? -5.448  28.205  56.627  1.00 54.28  ? 256 LEU B CB  1 
ATOM   6173 C  CG  . LEU B 1 256 ? -6.558  27.253  57.075  1.00 51.93  ? 256 LEU B CG  1 
ATOM   6174 C  CD1 . LEU B 1 256 ? -7.502  26.942  55.920  1.00 42.28  ? 256 LEU B CD1 1 
ATOM   6175 C  CD2 . LEU B 1 256 ? -5.936  25.981  57.627  1.00 62.19  ? 256 LEU B CD2 1 
ATOM   6176 N  N   . ASN B 1 257 ? -3.951  31.196  57.947  1.00 64.36  ? 257 ASN B N   1 
ATOM   6177 C  CA  . ASN B 1 257 ? -3.176  32.357  57.523  1.00 69.13  ? 257 ASN B CA  1 
ATOM   6178 C  C   . ASN B 1 257 ? -1.674  32.147  57.649  1.00 67.12  ? 257 ASN B C   1 
ATOM   6179 O  O   . ASN B 1 257 ? -0.903  32.921  57.070  1.00 69.00  ? 257 ASN B O   1 
ATOM   6180 C  CB  . ASN B 1 257 ? -3.580  33.588  58.329  1.00 67.37  ? 257 ASN B CB  1 
ATOM   6181 C  CG  . ASN B 1 257 ? -4.745  34.309  57.717  1.00 68.42  ? 257 ASN B CG  1 
ATOM   6182 O  OD1 . ASN B 1 257 ? -4.892  34.347  56.490  1.00 71.62  ? 257 ASN B OD1 1 
ATOM   6183 N  ND2 . ASN B 1 257 ? -5.574  34.906  58.560  1.00 63.97  ? 257 ASN B ND2 1 
ATOM   6184 N  N   . SER B 1 258 ? -1.253  31.112  58.365  1.00 57.93  ? 258 SER B N   1 
ATOM   6185 C  CA  . SER B 1 258 ? 0.142   30.908  58.687  1.00 52.64  ? 258 SER B CA  1 
ATOM   6186 C  C   . SER B 1 258 ? 0.320   29.488  59.201  1.00 55.03  ? 258 SER B C   1 
ATOM   6187 O  O   . SER B 1 258 ? -0.591  28.909  59.795  1.00 56.03  ? 258 SER B O   1 
ATOM   6188 C  CB  . SER B 1 258 ? 0.605   31.925  59.731  1.00 57.38  ? 258 SER B CB  1 
ATOM   6189 O  OG  . SER B 1 258 ? 1.691   31.412  60.489  1.00 75.02  ? 258 SER B OG  1 
ATOM   6190 N  N   . ASP B 1 259 ? 1.504   28.933  58.956  1.00 60.09  ? 259 ASP B N   1 
ATOM   6191 C  CA  . ASP B 1 259 ? 1.834   27.615  59.488  1.00 61.19  ? 259 ASP B CA  1 
ATOM   6192 C  C   . ASP B 1 259 ? 1.718   27.594  61.005  1.00 62.76  ? 259 ASP B C   1 
ATOM   6193 O  O   . ASP B 1 259 ? 1.061   26.718  61.578  1.00 59.43  ? 259 ASP B O   1 
ATOM   6194 C  CB  . ASP B 1 259 ? 3.247   27.232  59.061  1.00 57.18  ? 259 ASP B CB  1 
ATOM   6195 C  CG  . ASP B 1 259 ? 3.549   27.665  57.662  1.00 61.42  ? 259 ASP B CG  1 
ATOM   6196 O  OD1 . ASP B 1 259 ? 3.725   26.791  56.794  1.00 62.41  ? 259 ASP B OD1 1 
ATOM   6197 O  OD2 . ASP B 1 259 ? 3.555   28.892  57.426  1.00 71.43  1 259 ASP B OD2 1 
ATOM   6198 N  N   . GLU B 1 260 ? 2.358   28.564  61.669  1.00 67.34  ? 260 GLU B N   1 
ATOM   6199 C  CA  . GLU B 1 260 ? 2.351   28.619  63.127  1.00 65.15  ? 260 GLU B CA  1 
ATOM   6200 C  C   . GLU B 1 260 ? 0.932   28.543  63.672  1.00 57.65  ? 260 GLU B C   1 
ATOM   6201 O  O   . GLU B 1 260 ? 0.637   27.730  64.554  1.00 55.56  ? 260 GLU B O   1 
ATOM   6202 C  CB  . GLU B 1 260 ? 3.055   29.896  63.596  1.00 73.09  ? 260 GLU B CB  1 
ATOM   6203 C  CG  . GLU B 1 260 ? 4.008   29.712  64.795  1.00 76.93  ? 260 GLU B CG  1 
ATOM   6204 C  CD  . GLU B 1 260 ? 5.011   28.570  64.611  1.00 76.48  ? 260 GLU B CD  1 
ATOM   6205 O  OE1 . GLU B 1 260 ? 5.238   27.811  65.576  1.00 73.55  ? 260 GLU B OE1 1 
ATOM   6206 O  OE2 . GLU B 1 260 ? 5.584   28.419  63.506  1.00 83.89  1 260 GLU B OE2 1 
ATOM   6207 N  N   . GLU B 1 261 ? 0.028   29.353  63.127  1.00 57.86  ? 261 GLU B N   1 
ATOM   6208 C  CA  . GLU B 1 261 ? -1.370  29.274  63.532  1.00 55.59  ? 261 GLU B CA  1 
ATOM   6209 C  C   . GLU B 1 261 ? -1.988  27.939  63.129  1.00 49.41  ? 261 GLU B C   1 
ATOM   6210 O  O   . GLU B 1 261 ? -2.739  27.338  63.908  1.00 45.29  ? 261 GLU B O   1 
ATOM   6211 C  CB  . GLU B 1 261 ? -2.140  30.446  62.923  1.00 59.88  ? 261 GLU B CB  1 
ATOM   6212 C  CG  . GLU B 1 261 ? -1.318  31.727  62.881  1.00 68.71  ? 261 GLU B CG  1 
ATOM   6213 C  CD  . GLU B 1 261 ? -2.059  32.901  62.281  1.00 80.96  ? 261 GLU B CD  1 
ATOM   6214 O  OE1 . GLU B 1 261 ? -3.305  32.956  62.423  1.00 90.70  ? 261 GLU B OE1 1 
ATOM   6215 O  OE2 . GLU B 1 261 ? -1.410  33.775  61.645  1.00 84.96  1 261 GLU B OE2 1 
ATOM   6216 N  N   . LEU B 1 262 ? -1.667  27.445  61.930  1.00 47.08  ? 262 LEU B N   1 
ATOM   6217 C  CA  . LEU B 1 262 ? -2.284  26.205  61.469  1.00 43.40  ? 262 LEU B CA  1 
ATOM   6218 C  C   . LEU B 1 262 ? -1.794  25.011  62.274  1.00 45.32  ? 262 LEU B C   1 
ATOM   6219 O  O   . LEU B 1 262 ? -2.564  24.079  62.538  1.00 42.27  ? 262 LEU B O   1 
ATOM   6220 C  CB  . LEU B 1 262 ? -2.010  25.993  59.985  1.00 33.15  ? 262 LEU B CB  1 
ATOM   6221 C  CG  . LEU B 1 262 ? -2.080  24.563  59.454  1.00 32.15  ? 262 LEU B CG  1 
ATOM   6222 C  CD1 . LEU B 1 262 ? -3.499  24.064  59.441  1.00 32.31  ? 262 LEU B CD1 1 
ATOM   6223 C  CD2 . LEU B 1 262 ? -1.504  24.494  58.060  1.00 43.62  ? 262 LEU B CD2 1 
ATOM   6224 N  N   . ILE B 1 263 ? -0.518  25.023  62.684  1.00 50.89  ? 263 ILE B N   1 
ATOM   6225 C  CA  . ILE B 1 263 ? 0.014   23.934  63.500  1.00 46.87  ? 263 ILE B CA  1 
ATOM   6226 C  C   . ILE B 1 263 ? -0.437  24.063  64.945  1.00 51.72  ? 263 ILE B C   1 
ATOM   6227 O  O   . ILE B 1 263 ? -0.709  23.056  65.607  1.00 64.26  ? 263 ILE B O   1 
ATOM   6228 C  CB  . ILE B 1 263 ? 1.544   23.866  63.405  1.00 44.57  ? 263 ILE B CB  1 
ATOM   6229 C  CG1 . ILE B 1 263 ? 2.006   23.875  61.951  1.00 46.98  ? 263 ILE B CG1 1 
ATOM   6230 C  CG2 . ILE B 1 263 ? 2.049   22.619  64.112  1.00 48.10  ? 263 ILE B CG2 1 
ATOM   6231 C  CD1 . ILE B 1 263 ? 3.521   24.051  61.779  1.00 43.39  ? 263 ILE B CD1 1 
ATOM   6232 N  N   . HIS B 1 264 ? -0.512  25.290  65.465  1.00 46.37  ? 264 HIS B N   1 
ATOM   6233 C  CA  . HIS B 1 264 ? -1.112  25.480  66.782  1.00 51.85  ? 264 HIS B CA  1 
ATOM   6234 C  C   . HIS B 1 264 ? -2.523  24.899  66.807  1.00 54.59  ? 264 HIS B C   1 
ATOM   6235 O  O   . HIS B 1 264 ? -2.876  24.124  67.711  1.00 45.51  ? 264 HIS B O   1 
ATOM   6236 C  CB  . HIS B 1 264 ? -1.122  26.967  67.156  1.00 53.43  ? 264 HIS B CB  1 
ATOM   6237 C  CG  . HIS B 1 264 ? -1.647  27.246  68.533  1.00 59.83  ? 264 HIS B CG  1 
ATOM   6238 N  ND1 . HIS B 1 264 ? -0.856  27.183  69.661  1.00 64.54  ? 264 HIS B ND1 1 
ATOM   6239 C  CD2 . HIS B 1 264 ? -2.885  27.587  68.963  1.00 60.08  ? 264 HIS B CD2 1 
ATOM   6240 C  CE1 . HIS B 1 264 ? -1.583  27.473  70.724  1.00 64.16  ? 264 HIS B CE1 1 
ATOM   6241 N  NE2 . HIS B 1 264 ? -2.818  27.721  70.328  1.00 61.43  ? 264 HIS B NE2 1 
ATOM   6242 N  N   . CYS B 1 265 ? -3.326  25.228  65.784  1.00 54.21  ? 265 CYS B N   1 
ATOM   6243 C  CA  . CYS B 1 265 ? -4.686  24.706  65.699  1.00 56.81  ? 265 CYS B CA  1 
ATOM   6244 C  C   . CYS B 1 265 ? -4.681  23.192  65.602  1.00 54.28  ? 265 CYS B C   1 
ATOM   6245 O  O   . CYS B 1 265 ? -5.493  22.518  66.243  1.00 57.13  ? 265 CYS B O   1 
ATOM   6246 C  CB  . CYS B 1 265 ? -5.414  25.303  64.494  1.00 68.08  ? 265 CYS B CB  1 
ATOM   6247 S  SG  . CYS B 1 265 ? -7.126  24.694  64.272  1.00 82.37  ? 265 CYS B SG  1 
ATOM   6248 N  N   . LEU B 1 266 ? -3.769  22.639  64.803  1.00 56.04  ? 266 LEU B N   1 
ATOM   6249 C  CA  . LEU B 1 266 ? -3.754  21.196  64.597  1.00 56.27  ? 266 LEU B CA  1 
ATOM   6250 C  C   . LEU B 1 266 ? -3.256  20.447  65.825  1.00 54.45  ? 266 LEU B C   1 
ATOM   6251 O  O   . LEU B 1 266 ? -3.605  19.277  66.008  1.00 57.04  ? 266 LEU B O   1 
ATOM   6252 C  CB  . LEU B 1 266 ? -2.898  20.852  63.381  1.00 51.98  ? 266 LEU B CB  1 
ATOM   6253 C  CG  . LEU B 1 266 ? -3.682  21.018  62.095  1.00 48.52  ? 266 LEU B CG  1 
ATOM   6254 C  CD1 . LEU B 1 266 ? -2.849  20.660  60.873  1.00 51.42  ? 266 LEU B CD1 1 
ATOM   6255 C  CD2 . LEU B 1 266 ? -4.890  20.124  62.200  1.00 47.84  ? 266 LEU B CD2 1 
ATOM   6256 N  N   . ARG B 1 267 ? -2.452  21.098  66.675  1.00 50.00  ? 267 ARG B N   1 
ATOM   6257 C  CA  . ARG B 1 267 ? -1.898  20.441  67.851  1.00 39.51  ? 267 ARG B CA  1 
ATOM   6258 C  C   . ARG B 1 267 ? -2.860  20.397  69.021  1.00 46.33  ? 267 ARG B C   1 
ATOM   6259 O  O   . ARG B 1 267 ? -2.629  19.618  69.956  1.00 50.41  ? 267 ARG B O   1 
ATOM   6260 C  CB  . ARG B 1 267 ? -0.591  21.114  68.270  1.00 41.31  ? 267 ARG B CB  1 
ATOM   6261 C  CG  . ARG B 1 267 ? 0.540   20.772  67.306  1.00 53.42  ? 267 ARG B CG  1 
ATOM   6262 C  CD  . ARG B 1 267 ? 1.877   20.611  67.979  1.00 51.97  ? 267 ARG B CD  1 
ATOM   6263 N  NE  . ARG B 1 267 ? 2.641   21.850  67.991  1.00 54.65  ? 267 ARG B NE  1 
ATOM   6264 C  CZ  . ARG B 1 267 ? 3.818   22.012  67.397  1.00 47.01  ? 267 ARG B CZ  1 
ATOM   6265 N  NH1 . ARG B 1 267 ? 4.379   21.012  66.737  1.00 29.55  1 267 ARG B NH1 1 
ATOM   6266 N  NH2 . ARG B 1 267 ? 4.438   23.178  67.483  1.00 50.30  ? 267 ARG B NH2 1 
ATOM   6267 N  N   . GLU B 1 268 ? -3.940  21.188  68.988  1.00 54.56  ? 268 GLU B N   1 
ATOM   6268 C  CA  . GLU B 1 268 ? -4.938  21.123  70.052  1.00 54.26  ? 268 GLU B CA  1 
ATOM   6269 C  C   . GLU B 1 268 ? -5.937  19.993  69.830  1.00 53.80  ? 268 GLU B C   1 
ATOM   6270 O  O   . GLU B 1 268 ? -6.380  19.369  70.799  1.00 64.50  ? 268 GLU B O   1 
ATOM   6271 C  CB  . GLU B 1 268 ? -5.667  22.461  70.178  1.00 60.52  ? 268 GLU B CB  1 
ATOM   6272 C  CG  . GLU B 1 268 ? -4.769  23.664  70.537  1.00 79.50  ? 268 GLU B CG  1 
ATOM   6273 C  CD  . GLU B 1 268 ? -4.001  23.507  71.855  1.00 91.29  ? 268 GLU B CD  1 
ATOM   6274 O  OE1 . GLU B 1 268 ? -2.767  23.737  71.853  1.00 88.11  ? 268 GLU B OE1 1 
ATOM   6275 O  OE2 . GLU B 1 268 ? -4.626  23.161  72.887  1.00 98.78  1 268 GLU B OE2 1 
ATOM   6276 N  N   . LYS B 1 269 ? -6.268  19.694  68.575  1.00 52.34  ? 269 LYS B N   1 
ATOM   6277 C  CA  . LYS B 1 269 ? -7.258  18.674  68.255  1.00 52.70  ? 269 LYS B CA  1 
ATOM   6278 C  C   . LYS B 1 269 ? -6.805  17.309  68.759  1.00 46.12  ? 269 LYS B C   1 
ATOM   6279 O  O   . LYS B 1 269 ? -5.624  17.064  68.998  1.00 49.99  ? 269 LYS B O   1 
ATOM   6280 C  CB  . LYS B 1 269 ? -7.509  18.622  66.743  1.00 58.57  ? 269 LYS B CB  1 
ATOM   6281 C  CG  . LYS B 1 269 ? -7.741  19.991  66.077  1.00 58.99  ? 269 LYS B CG  1 
ATOM   6282 C  CD  . LYS B 1 269 ? -9.195  20.433  66.085  1.00 55.91  ? 269 LYS B CD  1 
ATOM   6283 C  CE  . LYS B 1 269 ? -9.310  21.881  65.604  1.00 62.07  ? 269 LYS B CE  1 
ATOM   6284 N  NZ  . LYS B 1 269 ? -10.705 22.442  65.605  1.00 64.70  1 269 LYS B NZ  1 
ATOM   6285 N  N   . LYS B 1 270 ? -7.765  16.422  68.940  1.00 49.60  ? 270 LYS B N   1 
ATOM   6286 C  CA  . LYS B 1 270 ? -7.460  15.093  69.443  1.00 51.39  ? 270 LYS B CA  1 
ATOM   6287 C  C   . LYS B 1 270 ? -7.062  14.177  68.297  1.00 42.01  ? 270 LYS B C   1 
ATOM   6288 O  O   . LYS B 1 270 ? -7.442  14.408  67.148  1.00 56.06  ? 270 LYS B O   1 
ATOM   6289 C  CB  . LYS B 1 270 ? -8.663  14.531  70.215  1.00 63.18  ? 270 LYS B CB  1 
ATOM   6290 C  CG  . LYS B 1 270 ? -8.959  15.190  71.608  1.00 68.97  ? 270 LYS B CG  1 
ATOM   6291 C  CD  . LYS B 1 270 ? -7.869  14.886  72.672  1.00 83.72  ? 270 LYS B CD  1 
ATOM   6292 C  CE  . LYS B 1 270 ? -6.629  15.863  72.647  1.00 85.86  ? 270 LYS B CE  1 
ATOM   6293 N  NZ  . LYS B 1 270 ? -5.313  15.326  73.128  1.00 76.18  1 270 LYS B NZ  1 
ATOM   6294 N  N   . PRO B 1 271 ? -6.272  13.136  68.570  1.00 40.40  ? 271 PRO B N   1 
ATOM   6295 C  CA  . PRO B 1 271 ? -5.801  12.265  67.471  1.00 48.04  ? 271 PRO B CA  1 
ATOM   6296 C  C   . PRO B 1 271 ? -6.879  11.774  66.516  1.00 39.11  ? 271 PRO B C   1 
ATOM   6297 O  O   . PRO B 1 271 ? -6.751  11.965  65.299  1.00 42.17  ? 271 PRO B O   1 
ATOM   6298 C  CB  . PRO B 1 271 ? -5.128  11.113  68.229  1.00 47.66  ? 271 PRO B CB  1 
ATOM   6299 C  CG  . PRO B 1 271 ? -4.545  11.791  69.424  1.00 37.64  ? 271 PRO B CG  1 
ATOM   6300 C  CD  . PRO B 1 271 ? -5.585  12.827  69.831  1.00 45.72  ? 271 PRO B CD  1 
ATOM   6301 N  N   . GLN B 1 272 ? -7.942  11.155  67.024  1.00 36.62  ? 272 GLN B N   1 
ATOM   6302 C  CA  . GLN B 1 272 ? -8.990  10.677  66.128  1.00 45.30  ? 272 GLN B CA  1 
ATOM   6303 C  C   . GLN B 1 272 ? -9.583  11.800  65.277  1.00 43.20  ? 272 GLN B C   1 
ATOM   6304 O  O   . GLN B 1 272 ? -10.004 11.553  64.141  1.00 48.79  ? 272 GLN B O   1 
ATOM   6305 C  CB  . GLN B 1 272 ? -10.088 9.979   66.924  1.00 52.13  ? 272 GLN B CB  1 
ATOM   6306 C  CG  . GLN B 1 272 ? -10.650 8.761   66.221  1.00 62.05  ? 272 GLN B CG  1 
ATOM   6307 C  CD  . GLN B 1 272 ? -9.579  7.752   65.876  1.00 67.14  ? 272 GLN B CD  1 
ATOM   6308 O  OE1 . GLN B 1 272 ? -9.581  7.186   64.782  1.00 61.74  ? 272 GLN B OE1 1 
ATOM   6309 N  NE2 . GLN B 1 272 ? -8.651  7.518   66.811  1.00 73.66  ? 272 GLN B NE2 1 
ATOM   6310 N  N   . GLU B 1 273 ? -9.606  13.035  65.784  1.00 36.96  ? 273 GLU B N   1 
ATOM   6311 C  CA  . GLU B 1 273 ? -10.171 14.125  64.994  1.00 51.18  ? 273 GLU B CA  1 
ATOM   6312 C  C   . GLU B 1 273 ? -9.379  14.349  63.712  1.00 60.68  ? 273 GLU B C   1 
ATOM   6313 O  O   . GLU B 1 273 ? -9.957  14.658  62.662  1.00 65.83  ? 273 GLU B O   1 
ATOM   6314 C  CB  . GLU B 1 273 ? -10.234 15.415  65.808  1.00 50.95  ? 273 GLU B CB  1 
ATOM   6315 C  CG  . GLU B 1 273 ? -11.285 15.436  66.889  1.00 57.08  ? 273 GLU B CG  1 
ATOM   6316 C  CD  . GLU B 1 273 ? -11.360 16.791  67.577  1.00 70.85  ? 273 GLU B CD  1 
ATOM   6317 O  OE1 . GLU B 1 273 ? -11.204 16.830  68.817  1.00 76.37  ? 273 GLU B OE1 1 
ATOM   6318 O  OE2 . GLU B 1 273 ? -11.590 17.809  66.882  1.00 67.13  1 273 GLU B OE2 1 
ATOM   6319 N  N   . LEU B 1 274 ? -8.056  14.212  63.773  1.00 59.06  ? 274 LEU B N   1 
ATOM   6320 C  CA  . LEU B 1 274 ? -7.289  14.214  62.535  1.00 53.94  ? 274 LEU B CA  1 
ATOM   6321 C  C   . LEU B 1 274 ? -7.593  12.967  61.719  1.00 53.86  ? 274 LEU B C   1 
ATOM   6322 O  O   . LEU B 1 274 ? -8.048  13.057  60.572  1.00 59.37  ? 274 LEU B O   1 
ATOM   6323 C  CB  . LEU B 1 274 ? -5.798  14.327  62.836  1.00 45.77  ? 274 LEU B CB  1 
ATOM   6324 C  CG  . LEU B 1 274 ? -5.518  15.651  63.544  1.00 51.49  ? 274 LEU B CG  1 
ATOM   6325 C  CD1 . LEU B 1 274 ? -4.788  15.405  64.843  1.00 54.71  ? 274 LEU B CD1 1 
ATOM   6326 C  CD2 . LEU B 1 274 ? -4.740  16.601  62.662  1.00 53.77  ? 274 LEU B CD2 1 
ATOM   6327 N  N   . ILE B 1 275 ? -7.396  11.792  62.320  1.00 46.71  ? 275 ILE B N   1 
ATOM   6328 C  CA  . ILE B 1 275 ? -7.669  10.525  61.646  1.00 43.60  ? 275 ILE B CA  1 
ATOM   6329 C  C   . ILE B 1 275 ? -9.040  10.513  60.983  1.00 42.88  ? 275 ILE B C   1 
ATOM   6330 O  O   . ILE B 1 275 ? -9.239  9.865   59.948  1.00 44.65  ? 275 ILE B O   1 
ATOM   6331 C  CB  . ILE B 1 275 ? -7.514  9.378   62.658  1.00 40.84  ? 275 ILE B CB  1 
ATOM   6332 C  CG1 . ILE B 1 275 ? -6.111  9.458   63.274  1.00 49.24  ? 275 ILE B CG1 1 
ATOM   6333 C  CG2 . ILE B 1 275 ? -7.733  8.029   61.987  1.00 28.80  ? 275 ILE B CG2 1 
ATOM   6334 C  CD1 . ILE B 1 275 ? -5.782  8.359   64.273  1.00 56.86  ? 275 ILE B CD1 1 
ATOM   6335 N  N   . ASP B 1 276 ? -10.001 11.240  61.546  1.00 49.91  ? 276 ASP B N   1 
ATOM   6336 C  CA  . ASP B 1 276 ? -11.342 11.220  60.974  1.00 60.50  ? 276 ASP B CA  1 
ATOM   6337 C  C   . ASP B 1 276 ? -11.414 11.945  59.631  1.00 54.51  ? 276 ASP B C   1 
ATOM   6338 O  O   . ASP B 1 276 ? -12.287 11.626  58.818  1.00 57.79  ? 276 ASP B O   1 
ATOM   6339 C  CB  . ASP B 1 276 ? -12.346 11.812  61.970  1.00 71.39  ? 276 ASP B CB  1 
ATOM   6340 C  CG  . ASP B 1 276 ? -12.737 10.823  63.080  1.00 81.08  ? 276 ASP B CG  1 
ATOM   6341 O  OD1 . ASP B 1 276 ? -12.084 9.756   63.191  1.00 83.46  ? 276 ASP B OD1 1 
ATOM   6342 O  OD2 . ASP B 1 276 ? -13.677 11.129  63.859  1.00 79.24  1 276 ASP B OD2 1 
ATOM   6343 N  N   . VAL B 1 277 ? -10.510 12.886  59.359  1.00 44.53  ? 277 VAL B N   1 
ATOM   6344 C  CA  . VAL B 1 277 ? -10.554 13.640  58.112  1.00 41.09  ? 277 VAL B CA  1 
ATOM   6345 C  C   . VAL B 1 277 ? -9.367  13.366  57.225  1.00 49.59  ? 277 VAL B C   1 
ATOM   6346 O  O   . VAL B 1 277 ? -9.287  13.953  56.134  1.00 58.25  ? 277 VAL B O   1 
ATOM   6347 C  CB  . VAL B 1 277 ? -10.665 15.154  58.359  1.00 37.53  ? 277 VAL B CB  1 
ATOM   6348 C  CG1 . VAL B 1 277 ? -12.001 15.489  58.971  1.00 38.28  ? 277 VAL B CG1 1 
ATOM   6349 C  CG2 . VAL B 1 277 ? -9.539  15.620  59.244  1.00 44.37  ? 277 VAL B CG2 1 
ATOM   6350 N  N   . GLU B 1 278 ? -8.441  12.494  57.641  1.00 41.95  ? 278 GLU B N   1 
ATOM   6351 C  CA  . GLU B 1 278 ? -7.180  12.384  56.917  1.00 37.96  ? 278 GLU B CA  1 
ATOM   6352 C  C   . GLU B 1 278 ? -7.393  11.986  55.456  1.00 42.53  ? 278 GLU B C   1 
ATOM   6353 O  O   . GLU B 1 278 ? -6.607  12.388  54.594  1.00 47.65  ? 278 GLU B O   1 
ATOM   6354 C  CB  . GLU B 1 278 ? -6.245  11.408  57.632  1.00 37.26  ? 278 GLU B CB  1 
ATOM   6355 C  CG  . GLU B 1 278 ? -6.188  10.026  57.041  1.00 50.55  ? 278 GLU B CG  1 
ATOM   6356 C  CD  . GLU B 1 278 ? -5.071  9.199   57.637  1.00 59.63  ? 278 GLU B CD  1 
ATOM   6357 O  OE1 . GLU B 1 278 ? -5.240  8.687   58.766  1.00 60.03  ? 278 GLU B OE1 1 
ATOM   6358 O  OE2 . GLU B 1 278 ? -4.017  9.050   56.976  1.00 65.26  1 278 GLU B OE2 1 
ATOM   6359 N  N   . TRP B 1 279 ? -8.468  11.252  55.141  1.00 29.40  ? 279 TRP B N   1 
ATOM   6360 C  CA  . TRP B 1 279 ? -8.685  10.877  53.747  1.00 36.51  ? 279 TRP B CA  1 
ATOM   6361 C  C   . TRP B 1 279 ? -9.255  12.008  52.911  1.00 36.29  ? 279 TRP B C   1 
ATOM   6362 O  O   . TRP B 1 279 ? -9.091  11.993  51.684  1.00 42.69  ? 279 TRP B O   1 
ATOM   6363 C  CB  . TRP B 1 279 ? -9.586  9.639   53.636  1.00 35.13  ? 279 TRP B CB  1 
ATOM   6364 C  CG  . TRP B 1 279 ? -9.062  8.477   54.430  1.00 47.46  ? 279 TRP B CG  1 
ATOM   6365 C  CD1 . TRP B 1 279 ? -9.435  8.109   55.679  1.00 51.86  ? 279 TRP B CD1 1 
ATOM   6366 C  CD2 . TRP B 1 279 ? -8.015  7.576   54.048  1.00 55.64  ? 279 TRP B CD2 1 
ATOM   6367 N  NE1 . TRP B 1 279 ? -8.723  7.015   56.092  1.00 46.05  ? 279 TRP B NE1 1 
ATOM   6368 C  CE2 . TRP B 1 279 ? -7.842  6.669   55.110  1.00 51.24  ? 279 TRP B CE2 1 
ATOM   6369 C  CE3 . TRP B 1 279 ? -7.212  7.443   52.905  1.00 62.81  ? 279 TRP B CE3 1 
ATOM   6370 C  CZ2 . TRP B 1 279 ? -6.909  5.645   55.069  1.00 65.04  ? 279 TRP B CZ2 1 
ATOM   6371 C  CZ3 . TRP B 1 279 ? -6.286  6.422   52.864  1.00 63.50  ? 279 TRP B CZ3 1 
ATOM   6372 C  CH2 . TRP B 1 279 ? -6.140  5.538   53.941  1.00 64.82  ? 279 TRP B CH2 1 
ATOM   6373 N  N   . ASN B 1 280 ? -9.862  13.010  53.543  1.00 33.39  ? 280 ASN B N   1 
ATOM   6374 C  CA  . ASN B 1 280 ? -10.528 14.059  52.783  1.00 47.95  ? 280 ASN B CA  1 
ATOM   6375 C  C   . ASN B 1 280 ? -9.554  14.968  52.059  1.00 48.41  ? 280 ASN B C   1 
ATOM   6376 O  O   . ASN B 1 280 ? -9.980  15.773  51.227  1.00 59.18  ? 280 ASN B O   1 
ATOM   6377 C  CB  . ASN B 1 280 ? -11.424 14.876  53.717  1.00 59.70  ? 280 ASN B CB  1 
ATOM   6378 C  CG  . ASN B 1 280 ? -12.437 14.007  54.464  1.00 63.15  ? 280 ASN B CG  1 
ATOM   6379 O  OD1 . ASN B 1 280 ? -12.640 12.833  54.134  1.00 61.81  ? 280 ASN B OD1 1 
ATOM   6380 N  ND2 . ASN B 1 280 ? -13.067 14.581  55.485  1.00 62.00  ? 280 ASN B ND2 1 
ATOM   6381 N  N   . VAL B 1 281 ? -8.261  14.867  52.362  1.00 48.50  ? 281 VAL B N   1 
ATOM   6382 C  CA  . VAL B 1 281 ? -7.267  15.715  51.730  1.00 44.55  ? 281 VAL B CA  1 
ATOM   6383 C  C   . VAL B 1 281 ? -6.705  15.089  50.467  1.00 52.83  ? 281 VAL B C   1 
ATOM   6384 O  O   . VAL B 1 281 ? -5.847  15.703  49.811  1.00 46.52  ? 281 VAL B O   1 
ATOM   6385 C  CB  . VAL B 1 281 ? -6.132  16.006  52.723  1.00 38.71  ? 281 VAL B CB  1 
ATOM   6386 C  CG1 . VAL B 1 281 ? -6.721  16.392  54.058  1.00 47.36  ? 281 VAL B CG1 1 
ATOM   6387 C  CG2 . VAL B 1 281 ? -5.247  14.787  52.868  1.00 29.55  ? 281 VAL B CG2 1 
ATOM   6388 N  N   . LEU B 1 282 ? -7.156  13.884  50.101  1.00 51.18  ? 282 LEU B N   1 
ATOM   6389 C  CA  . LEU B 1 282 ? -6.655  13.263  48.882  1.00 48.12  ? 282 LEU B CA  1 
ATOM   6390 C  C   . LEU B 1 282 ? -7.155  14.027  47.653  1.00 49.44  ? 282 LEU B C   1 
ATOM   6391 O  O   . LEU B 1 282 ? -8.317  14.443  47.604  1.00 42.96  ? 282 LEU B O   1 
ATOM   6392 C  CB  . LEU B 1 282 ? -7.064  11.791  48.807  1.00 43.62  ? 282 LEU B CB  1 
ATOM   6393 C  CG  . LEU B 1 282 ? -6.114  10.793  49.491  1.00 39.06  ? 282 LEU B CG  1 
ATOM   6394 C  CD1 . LEU B 1 282 ? -6.610  9.347   49.438  1.00 31.60  ? 282 LEU B CD1 1 
ATOM   6395 C  CD2 . LEU B 1 282 ? -4.699  10.880  48.906  1.00 33.81  ? 282 LEU B CD2 1 
ATOM   6396 N  N   . PRO B 1 283 ? -6.286  14.256  46.664  1.00 58.61  ? 283 PRO B N   1 
ATOM   6397 C  CA  . PRO B 1 283 ? -6.703  14.990  45.455  1.00 48.82  ? 283 PRO B CA  1 
ATOM   6398 C  C   . PRO B 1 283 ? -7.707  14.256  44.596  1.00 51.38  ? 283 PRO B C   1 
ATOM   6399 O  O   . PRO B 1 283 ? -8.419  14.910  43.828  1.00 43.19  ? 283 PRO B O   1 
ATOM   6400 C  CB  . PRO B 1 283 ? -5.390  15.192  44.679  1.00 38.41  ? 283 PRO B CB  1 
ATOM   6401 C  CG  . PRO B 1 283 ? -4.306  14.694  45.549  1.00 49.78  ? 283 PRO B CG  1 
ATOM   6402 C  CD  . PRO B 1 283 ? -4.872  13.852  46.634  1.00 59.37  ? 283 PRO B CD  1 
ATOM   6403 N  N   . PHE B 1 284 ? -7.764  12.928  44.661  1.00 57.76  ? 284 PHE B N   1 
ATOM   6404 C  CA  . PHE B 1 284 ? -8.605  12.163  43.757  1.00 52.17  ? 284 PHE B CA  1 
ATOM   6405 C  C   . PHE B 1 284 ? -9.299  11.044  44.503  1.00 59.46  ? 284 PHE B C   1 
ATOM   6406 O  O   . PHE B 1 284 ? -8.825  10.556  45.535  1.00 56.21  ? 284 PHE B O   1 
ATOM   6407 C  CB  . PHE B 1 284 ? -7.826  11.501  42.617  1.00 52.84  ? 284 PHE B CB  1 
ATOM   6408 C  CG  . PHE B 1 284 ? -6.787  12.365  41.993  1.00 53.06  ? 284 PHE B CG  1 
ATOM   6409 C  CD1 . PHE B 1 284 ? -7.146  13.462  41.218  1.00 58.12  ? 284 PHE B CD1 1 
ATOM   6410 C  CD2 . PHE B 1 284 ? -5.447  12.069  42.155  1.00 43.20  ? 284 PHE B CD2 1 
ATOM   6411 C  CE1 . PHE B 1 284 ? -6.180  14.251  40.621  1.00 55.37  ? 284 PHE B CE1 1 
ATOM   6412 C  CE2 . PHE B 1 284 ? -4.481  12.844  41.562  1.00 48.07  ? 284 PHE B CE2 1 
ATOM   6413 C  CZ  . PHE B 1 284 ? -4.843  13.941  40.792  1.00 51.80  ? 284 PHE B CZ  1 
ATOM   6414 N  N   . ASP B 1 285 ? -10.428 10.628  43.937  1.00 71.35  ? 285 ASP B N   1 
ATOM   6415 C  CA  . ASP B 1 285 ? -10.933 9.295   44.206  1.00 76.13  ? 285 ASP B CA  1 
ATOM   6416 C  C   . ASP B 1 285 ? -9.819  8.339   43.817  1.00 72.63  ? 285 ASP B C   1 
ATOM   6417 O  O   . ASP B 1 285 ? -9.436  8.252   42.645  1.00 73.89  ? 285 ASP B O   1 
ATOM   6418 C  CB  . ASP B 1 285 ? -12.217 9.014   43.427  1.00 75.43  ? 285 ASP B CB  1 
ATOM   6419 C  CG  . ASP B 1 285 ? -13.242 10.129  43.564  1.00 85.06  ? 285 ASP B CG  1 
ATOM   6420 O  OD1 . ASP B 1 285 ? -13.107 11.161  42.875  1.00 86.75  ? 285 ASP B OD1 1 
ATOM   6421 O  OD2 . ASP B 1 285 ? -14.191 9.974   44.361  1.00 92.89  1 285 ASP B OD2 1 
ATOM   6422 N  N   . SER B 1 286 ? -9.252  7.662   44.796  1.00 60.02  ? 286 SER B N   1 
ATOM   6423 C  CA  . SER B 1 286 ? -8.118  6.809   44.537  1.00 45.93  ? 286 SER B CA  1 
ATOM   6424 C  C   . SER B 1 286 ? -8.339  5.469   45.199  1.00 41.44  ? 286 SER B C   1 
ATOM   6425 O  O   . SER B 1 286 ? -8.986  5.367   46.246  1.00 56.17  ? 286 SER B O   1 
ATOM   6426 C  CB  . SER B 1 286 ? -6.821  7.413   45.073  1.00 56.10  ? 286 SER B CB  1 
ATOM   6427 O  OG  . SER B 1 286 ? -6.633  8.734   44.611  1.00 68.57  ? 286 SER B OG  1 
ATOM   6428 N  N   . ILE B 1 287 ? -7.775  4.449   44.591  1.00 31.89  ? 287 ILE B N   1 
ATOM   6429 C  CA  . ILE B 1 287 ? -7.327  3.296   45.346  1.00 42.90  ? 287 ILE B CA  1 
ATOM   6430 C  C   . ILE B 1 287 ? -5.806  3.324   45.352  1.00 46.35  ? 287 ILE B C   1 
ATOM   6431 O  O   . ILE B 1 287 ? -5.174  3.868   44.439  1.00 39.60  ? 287 ILE B O   1 
ATOM   6432 C  CB  . ILE B 1 287 ? -7.860  1.983   44.766  1.00 36.72  ? 287 ILE B CB  1 
ATOM   6433 C  CG1 . ILE B 1 287 ? -7.395  1.849   43.331  1.00 35.89  ? 287 ILE B CG1 1 
ATOM   6434 C  CG2 . ILE B 1 287 ? -9.351  1.977   44.840  1.00 31.70  ? 287 ILE B CG2 1 
ATOM   6435 C  CD1 . ILE B 1 287 ? -7.257  0.415   42.916  1.00 31.32  ? 287 ILE B CD1 1 
ATOM   6436 N  N   . PHE B 1 288 ? -5.218  2.776   46.416  1.00 41.45  ? 288 PHE B N   1 
ATOM   6437 C  CA  . PHE B 1 288 ? -3.762  2.685   46.562  1.00 40.58  ? 288 PHE B CA  1 
ATOM   6438 C  C   . PHE B 1 288 ? -3.108  4.054   46.681  1.00 38.80  ? 288 PHE B C   1 
ATOM   6439 O  O   . PHE B 1 288 ? -1.988  4.250   46.205  1.00 39.21  ? 288 PHE B O   1 
ATOM   6440 C  CB  . PHE B 1 288 ? -3.126  1.904   45.406  1.00 39.06  ? 288 PHE B CB  1 
ATOM   6441 C  CG  . PHE B 1 288 ? -2.005  0.981   45.817  1.00 35.13  ? 288 PHE B CG  1 
ATOM   6442 C  CD1 . PHE B 1 288 ? -2.054  -0.368  45.479  1.00 37.45  ? 288 PHE B CD1 1 
ATOM   6443 C  CD2 . PHE B 1 288 ? -0.889  1.454   46.493  1.00 36.01  ? 288 PHE B CD2 1 
ATOM   6444 C  CE1 . PHE B 1 288 ? -1.024  -1.240  45.820  1.00 34.40  ? 288 PHE B CE1 1 
ATOM   6445 C  CE2 . PHE B 1 288 ? 0.144   0.588   46.850  1.00 35.18  ? 288 PHE B CE2 1 
ATOM   6446 C  CZ  . PHE B 1 288 ? 0.070   -0.769  46.506  1.00 39.20  ? 288 PHE B CZ  1 
ATOM   6447 N  N   . ARG B 1 289 ? -3.792  5.015   47.304  1.00 39.52  ? 289 ARG B N   1 
ATOM   6448 C  CA  . ARG B 1 289 ? -3.190  6.304   47.612  1.00 39.24  ? 289 ARG B CA  1 
ATOM   6449 C  C   . ARG B 1 289 ? -3.550  6.705   49.032  1.00 44.25  ? 289 ARG B C   1 
ATOM   6450 O  O   . ARG B 1 289 ? -4.650  6.428   49.523  1.00 34.60  ? 289 ARG B O   1 
ATOM   6451 C  CB  . ARG B 1 289 ? -3.614  7.413   46.636  1.00 38.51  ? 289 ARG B CB  1 
ATOM   6452 C  CG  . ARG B 1 289 ? -3.290  7.126   45.171  1.00 49.84  ? 289 ARG B CG  1 
ATOM   6453 C  CD  . ARG B 1 289 ? -2.101  7.946   44.680  1.00 53.41  ? 289 ARG B CD  1 
ATOM   6454 N  NE  . ARG B 1 289 ? -1.634  7.525   43.355  1.00 53.54  ? 289 ARG B NE  1 
ATOM   6455 C  CZ  . ARG B 1 289 ? -1.063  6.349   43.092  1.00 50.05  ? 289 ARG B CZ  1 
ATOM   6456 N  NH1 . ARG B 1 289 ? -0.884  5.460   44.058  1.00 49.26  1 289 ARG B NH1 1 
ATOM   6457 N  NH2 . ARG B 1 289 ? -0.662  6.060   41.862  1.00 42.64  ? 289 ARG B NH2 1 
ATOM   6458 N  N   . PHE B 1 290 ? -2.596  7.363   49.685  1.00 50.94  ? 290 PHE B N   1 
ATOM   6459 C  CA  . PHE B 1 290 ? -2.704  7.703   51.091  1.00 43.65  ? 290 PHE B CA  1 
ATOM   6460 C  C   . PHE B 1 290 ? -2.249  9.136   51.282  1.00 40.24  ? 290 PHE B C   1 
ATOM   6461 O  O   . PHE B 1 290 ? -1.426  9.651   50.520  1.00 43.47  ? 290 PHE B O   1 
ATOM   6462 C  CB  . PHE B 1 290 ? -1.893  6.718   51.912  1.00 48.50  ? 290 PHE B CB  1 
ATOM   6463 C  CG  . PHE B 1 290 ? -1.973  5.332   51.373  1.00 49.39  ? 290 PHE B CG  1 
ATOM   6464 C  CD1 . PHE B 1 290 ? -3.130  4.575   51.550  1.00 49.06  ? 290 PHE B CD1 1 
ATOM   6465 C  CD2 . PHE B 1 290 ? -0.928  4.804   50.630  1.00 40.97  ? 290 PHE B CD2 1 
ATOM   6466 C  CE1 . PHE B 1 290 ? -3.241  3.296   51.020  1.00 43.51  ? 290 PHE B CE1 1 
ATOM   6467 C  CE2 . PHE B 1 290 ? -1.030  3.540   50.098  1.00 39.05  ? 290 PHE B CE2 1 
ATOM   6468 C  CZ  . PHE B 1 290 ? -2.194  2.771   50.296  1.00 39.21  ? 290 PHE B CZ  1 
ATOM   6469 N  N   . SER B 1 291 ? -2.797  9.771   52.318  1.00 37.46  ? 291 SER B N   1 
ATOM   6470 C  CA  . SER B 1 291 ? -2.741  11.226  52.424  1.00 46.12  ? 291 SER B CA  1 
ATOM   6471 C  C   . SER B 1 291 ? -1.356  11.734  52.841  1.00 48.46  ? 291 SER B C   1 
ATOM   6472 O  O   . SER B 1 291 ? -0.784  12.613  52.182  1.00 47.32  ? 291 SER B O   1 
ATOM   6473 C  CB  . SER B 1 291 ? -3.814  11.692  53.399  1.00 49.31  ? 291 SER B CB  1 
ATOM   6474 O  OG  . SER B 1 291 ? -5.079  11.214  52.976  1.00 54.64  ? 291 SER B OG  1 
ATOM   6475 N  N   . PHE B 1 292 ? -0.803  11.216  53.936  1.00 41.84  ? 292 PHE B N   1 
ATOM   6476 C  CA  . PHE B 1 292 ? 0.439   11.750  54.489  1.00 32.71  ? 292 PHE B CA  1 
ATOM   6477 C  C   . PHE B 1 292 ? 1.530   10.704  54.354  1.00 34.99  ? 292 PHE B C   1 
ATOM   6478 O  O   . PHE B 1 292 ? 1.461   9.637   54.973  1.00 33.39  ? 292 PHE B O   1 
ATOM   6479 C  CB  . PHE B 1 292 ? 0.219   12.201  55.921  1.00 29.36  ? 292 PHE B CB  1 
ATOM   6480 C  CG  . PHE B 1 292 ? -0.884  13.196  56.030  1.00 38.43  ? 292 PHE B CG  1 
ATOM   6481 C  CD1 . PHE B 1 292 ? -0.656  14.538  55.746  1.00 42.28  ? 292 PHE B CD1 1 
ATOM   6482 C  CD2 . PHE B 1 292 ? -2.182  12.782  56.314  1.00 36.68  ? 292 PHE B CD2 1 
ATOM   6483 C  CE1 . PHE B 1 292 ? -1.703  15.464  55.796  1.00 41.39  ? 292 PHE B CE1 1 
ATOM   6484 C  CE2 . PHE B 1 292 ? -3.224  13.697  56.377  1.00 33.57  ? 292 PHE B CE2 1 
ATOM   6485 C  CZ  . PHE B 1 292 ? -2.988  15.038  56.116  1.00 34.48  ? 292 PHE B CZ  1 
ATOM   6486 N  N   . VAL B 1 293 ? 2.507   11.018  53.507  1.00 34.14  ? 293 VAL B N   1 
ATOM   6487 C  CA  . VAL B 1 293 ? 3.576   10.133  53.058  1.00 29.64  ? 293 VAL B CA  1 
ATOM   6488 C  C   . VAL B 1 293 ? 4.857   10.952  53.100  1.00 31.30  ? 293 VAL B C   1 
ATOM   6489 O  O   . VAL B 1 293 ? 4.786   12.175  53.263  1.00 32.32  ? 293 VAL B O   1 
ATOM   6490 C  CB  . VAL B 1 293 ? 3.315   9.606   51.640  1.00 30.69  ? 293 VAL B CB  1 
ATOM   6491 C  CG1 . VAL B 1 293 ? 2.146   8.605   51.615  1.00 25.05  ? 293 VAL B CG1 1 
ATOM   6492 C  CG2 . VAL B 1 293 ? 3.061   10.776  50.734  1.00 25.52  ? 293 VAL B CG2 1 
ATOM   6493 N  N   . PRO B 1 294 ? 6.034   10.333  52.978  1.00 28.97  ? 294 PRO B N   1 
ATOM   6494 C  CA  . PRO B 1 294 ? 7.286   11.105  52.911  1.00 29.79  ? 294 PRO B CA  1 
ATOM   6495 C  C   . PRO B 1 294 ? 7.235   12.200  51.850  1.00 43.30  ? 294 PRO B C   1 
ATOM   6496 O  O   . PRO B 1 294 ? 6.473   12.116  50.885  1.00 65.32  ? 294 PRO B O   1 
ATOM   6497 C  CB  . PRO B 1 294 ? 8.323   10.043  52.546  1.00 30.18  ? 294 PRO B CB  1 
ATOM   6498 C  CG  . PRO B 1 294 ? 7.795   8.786   53.140  1.00 35.41  ? 294 PRO B CG  1 
ATOM   6499 C  CD  . PRO B 1 294 ? 6.282   8.884   53.130  1.00 28.95  ? 294 PRO B CD  1 
ATOM   6500 N  N   . VAL B 1 295 ? 8.048   13.244  52.039  1.00 30.69  ? 295 VAL B N   1 
ATOM   6501 C  CA  . VAL B 1 295 ? 8.078   14.388  51.133  1.00 34.76  ? 295 VAL B CA  1 
ATOM   6502 C  C   . VAL B 1 295 ? 9.482   14.531  50.553  1.00 40.34  ? 295 VAL B C   1 
ATOM   6503 O  O   . VAL B 1 295 ? 10.482  14.159  51.177  1.00 42.68  ? 295 VAL B O   1 
ATOM   6504 C  CB  . VAL B 1 295 ? 7.622   15.696  51.834  1.00 33.76  ? 295 VAL B CB  1 
ATOM   6505 C  CG1 . VAL B 1 295 ? 8.548   16.041  52.998  1.00 34.86  ? 295 VAL B CG1 1 
ATOM   6506 C  CG2 . VAL B 1 295 ? 7.533   16.868  50.838  1.00 27.53  ? 295 VAL B CG2 1 
ATOM   6507 N  N   . ILE B 1 296 ? 9.547   15.037  49.323  1.00 39.09  ? 296 ILE B N   1 
ATOM   6508 C  CA  . ILE B 1 296 ? 10.818  15.297  48.647  1.00 37.28  ? 296 ILE B CA  1 
ATOM   6509 C  C   . ILE B 1 296 ? 11.182  16.724  49.044  1.00 43.94  ? 296 ILE B C   1 
ATOM   6510 O  O   . ILE B 1 296 ? 10.837  17.698  48.373  1.00 50.82  ? 296 ILE B O   1 
ATOM   6511 C  CB  . ILE B 1 296 ? 10.720  15.083  47.132  1.00 35.27  ? 296 ILE B CB  1 
ATOM   6512 C  CG1 . ILE B 1 296 ? 10.370  13.622  46.818  1.00 32.65  ? 296 ILE B CG1 1 
ATOM   6513 C  CG2 . ILE B 1 296 ? 12.009  15.453  46.410  1.00 42.91  ? 296 ILE B CG2 1 
ATOM   6514 C  CD1 . ILE B 1 296 ? 10.992  12.584  47.754  1.00 27.16  ? 296 ILE B CD1 1 
ATOM   6515 N  N   . ASP B 1 297 ? 11.867  16.842  50.183  1.00 48.41  ? 297 ASP B N   1 
ATOM   6516 C  CA  . ASP B 1 297 ? 12.071  18.119  50.858  1.00 52.43  ? 297 ASP B CA  1 
ATOM   6517 C  C   . ASP B 1 297 ? 13.384  18.789  50.484  1.00 56.99  ? 297 ASP B C   1 
ATOM   6518 O  O   . ASP B 1 297 ? 13.460  20.023  50.456  1.00 60.61  ? 297 ASP B O   1 
ATOM   6519 C  CB  . ASP B 1 297 ? 12.021  17.923  52.382  1.00 46.36  ? 297 ASP B CB  1 
ATOM   6520 C  CG  . ASP B 1 297 ? 12.958  16.813  52.866  1.00 51.66  ? 297 ASP B CG  1 
ATOM   6521 O  OD1 . ASP B 1 297 ? 13.364  15.972  52.035  1.00 60.97  ? 297 ASP B OD1 1 
ATOM   6522 O  OD2 . ASP B 1 297 ? 13.293  16.783  54.073  1.00 45.67  1 297 ASP B OD2 1 
ATOM   6523 N  N   . GLY B 1 298 ? 14.422  18.015  50.195  1.00 50.62  ? 298 GLY B N   1 
ATOM   6524 C  CA  . GLY B 1 298 ? 15.732  18.589  50.008  1.00 43.64  ? 298 GLY B CA  1 
ATOM   6525 C  C   . GLY B 1 298 ? 16.646  18.472  51.202  1.00 42.37  ? 298 GLY B C   1 
ATOM   6526 O  O   . GLY B 1 298 ? 17.746  19.027  51.169  1.00 53.05  ? 298 GLY B O   1 
ATOM   6527 N  N   . GLU B 1 299 ? 16.221  17.785  52.263  1.00 44.14  ? 299 GLU B N   1 
ATOM   6528 C  CA  . GLU B 1 299 ? 17.099  17.469  53.387  1.00 46.03  ? 299 GLU B CA  1 
ATOM   6529 C  C   . GLU B 1 299 ? 17.213  15.960  53.533  1.00 39.55  ? 299 GLU B C   1 
ATOM   6530 O  O   . GLU B 1 299 ? 18.272  15.398  53.242  1.00 37.77  ? 299 GLU B O   1 
ATOM   6531 C  CB  . GLU B 1 299 ? 16.594  18.124  54.676  1.00 60.47  ? 299 GLU B CB  1 
ATOM   6532 C  CG  . GLU B 1 299 ? 17.673  18.848  55.490  1.00 83.40  ? 299 GLU B CG  1 
ATOM   6533 C  CD  . GLU B 1 299 ? 18.377  19.960  54.695  1.00 105.06 ? 299 GLU B CD  1 
ATOM   6534 O  OE1 . GLU B 1 299 ? 19.498  20.363  55.089  1.00 112.74 ? 299 GLU B OE1 1 
ATOM   6535 O  OE2 . GLU B 1 299 ? 17.812  20.434  53.679  1.00 106.75 1 299 GLU B OE2 1 
ATOM   6536 N  N   . PHE B 1 300 ? 16.148  15.280  53.963  1.00 43.90  ? 300 PHE B N   1 
ATOM   6537 C  CA  . PHE B 1 300 ? 16.162  13.822  54.035  1.00 41.28  ? 300 PHE B CA  1 
ATOM   6538 C  C   . PHE B 1 300 ? 16.461  13.227  52.674  1.00 46.40  ? 300 PHE B C   1 
ATOM   6539 O  O   . PHE B 1 300 ? 17.160  12.211  52.567  1.00 53.65  ? 300 PHE B O   1 
ATOM   6540 C  CB  . PHE B 1 300 ? 14.816  13.310  54.550  1.00 32.59  ? 300 PHE B CB  1 
ATOM   6541 C  CG  . PHE B 1 300 ? 14.829  11.866  54.955  1.00 28.16  ? 300 PHE B CG  1 
ATOM   6542 C  CD1 . PHE B 1 300 ? 14.676  10.861  54.014  1.00 25.98  ? 300 PHE B CD1 1 
ATOM   6543 C  CD2 . PHE B 1 300 ? 14.973  11.514  56.291  1.00 28.37  ? 300 PHE B CD2 1 
ATOM   6544 C  CE1 . PHE B 1 300 ? 14.689  9.526   54.407  1.00 39.44  ? 300 PHE B CE1 1 
ATOM   6545 C  CE2 . PHE B 1 300 ? 14.988  10.176  56.696  1.00 25.57  ? 300 PHE B CE2 1 
ATOM   6546 C  CZ  . PHE B 1 300 ? 14.845  9.184   55.768  1.00 28.04  ? 300 PHE B CZ  1 
ATOM   6547 N  N   . PHE B 1 301 ? 15.927  13.846  51.630  1.00 45.17  ? 301 PHE B N   1 
ATOM   6548 C  CA  . PHE B 1 301 ? 16.196  13.487  50.244  1.00 42.13  ? 301 PHE B CA  1 
ATOM   6549 C  C   . PHE B 1 301 ? 16.834  14.706  49.606  1.00 46.40  ? 301 PHE B C   1 
ATOM   6550 O  O   . PHE B 1 301 ? 16.149  15.728  49.409  1.00 45.91  ? 301 PHE B O   1 
ATOM   6551 C  CB  . PHE B 1 301 ? 14.917  13.097  49.506  1.00 40.57  ? 301 PHE B CB  1 
ATOM   6552 C  CG  . PHE B 1 301 ? 14.221  11.884  50.084  1.00 38.74  ? 301 PHE B CG  1 
ATOM   6553 C  CD1 . PHE B 1 301 ? 13.013  12.019  50.765  1.00 49.19  ? 301 PHE B CD1 1 
ATOM   6554 C  CD2 . PHE B 1 301 ? 14.756  10.610  49.932  1.00 31.26  ? 301 PHE B CD2 1 
ATOM   6555 C  CE1 . PHE B 1 301 ? 12.358  10.911  51.296  1.00 47.12  ? 301 PHE B CE1 1 
ATOM   6556 C  CE2 . PHE B 1 301 ? 14.108  9.493   50.457  1.00 42.16  ? 301 PHE B CE2 1 
ATOM   6557 C  CZ  . PHE B 1 301 ? 12.908  9.648   51.146  1.00 47.08  ? 301 PHE B CZ  1 
ATOM   6558 N  N   . PRO B 1 302 ? 18.143  14.683  49.341  1.00 49.56  ? 302 PRO B N   1 
ATOM   6559 C  CA  . PRO B 1 302 ? 18.782  15.852  48.701  1.00 45.08  ? 302 PRO B CA  1 
ATOM   6560 C  C   . PRO B 1 302 ? 18.115  16.289  47.403  1.00 52.20  ? 302 PRO B C   1 
ATOM   6561 O  O   . PRO B 1 302 ? 17.901  17.489  47.202  1.00 54.36  ? 302 PRO B O   1 
ATOM   6562 C  CB  . PRO B 1 302 ? 20.229  15.373  48.462  1.00 35.27  ? 302 PRO B CB  1 
ATOM   6563 C  CG  . PRO B 1 302 ? 20.365  14.049  49.209  1.00 38.13  ? 302 PRO B CG  1 
ATOM   6564 C  CD  . PRO B 1 302 ? 19.135  13.825  50.020  1.00 43.91  ? 302 PRO B CD  1 
ATOM   6565 N  N   . THR B 1 303 ? 17.779  15.354  46.514  1.00 47.51  ? 303 THR B N   1 
ATOM   6566 C  CA  . THR B 1 303 ? 17.157  15.686  45.235  1.00 38.38  ? 303 THR B CA  1 
ATOM   6567 C  C   . THR B 1 303 ? 16.065  14.672  44.952  1.00 46.02  ? 303 THR B C   1 
ATOM   6568 O  O   . THR B 1 303 ? 15.675  13.890  45.824  1.00 53.59  ? 303 THR B O   1 
ATOM   6569 C  CB  . THR B 1 303 ? 18.164  15.691  44.082  1.00 42.00  ? 303 THR B CB  1 
ATOM   6570 O  OG1 . THR B 1 303 ? 18.833  14.426  44.042  1.00 46.43  ? 303 THR B OG1 1 
ATOM   6571 C  CG2 . THR B 1 303 ? 19.182  16.832  44.221  1.00 33.69  ? 303 THR B CG2 1 
ATOM   6572 N  N   . SER B 1 304 ? 15.579  14.688  43.716  1.00 45.05  ? 304 SER B N   1 
ATOM   6573 C  CA  . SER B 1 304 ? 14.543  13.751  43.312  1.00 43.49  ? 304 SER B CA  1 
ATOM   6574 C  C   . SER B 1 304 ? 15.035  12.322  43.481  1.00 45.95  ? 304 SER B C   1 
ATOM   6575 O  O   . SER B 1 304 ? 16.216  12.020  43.273  1.00 47.74  ? 304 SER B O   1 
ATOM   6576 C  CB  . SER B 1 304 ? 14.160  13.973  41.854  1.00 41.03  ? 304 SER B CB  1 
ATOM   6577 O  OG  . SER B 1 304 ? 15.303  13.825  41.025  1.00 33.96  ? 304 SER B OG  1 
ATOM   6578 N  N   . LEU B 1 305 ? 14.114  11.439  43.872  1.00 29.22  ? 305 LEU B N   1 
ATOM   6579 C  CA  . LEU B 1 305 ? 14.420  10.013  43.901  1.00 28.87  ? 305 LEU B CA  1 
ATOM   6580 C  C   . LEU B 1 305 ? 15.040  9.557   42.583  1.00 49.72  ? 305 LEU B C   1 
ATOM   6581 O  O   . LEU B 1 305 ? 15.947  8.717   42.568  1.00 55.96  ? 305 LEU B O   1 
ATOM   6582 C  CB  . LEU B 1 305 ? 13.149  9.223   44.191  1.00 29.59  ? 305 LEU B CB  1 
ATOM   6583 C  CG  . LEU B 1 305 ? 12.348  9.499   45.474  1.00 46.53  ? 305 LEU B CG  1 
ATOM   6584 C  CD1 . LEU B 1 305 ? 11.589  8.262   45.940  1.00 55.09  ? 305 LEU B CD1 1 
ATOM   6585 C  CD2 . LEU B 1 305 ? 13.288  9.969   46.579  1.00 64.52  ? 305 LEU B CD2 1 
ATOM   6586 N  N   . GLU B 1 306 ? 14.572  10.110  41.465  1.00 44.12  ? 306 GLU B N   1 
ATOM   6587 C  CA  . GLU B 1 306 ? 15.073  9.669   40.169  1.00 51.27  ? 306 GLU B CA  1 
ATOM   6588 C  C   . GLU B 1 306 ? 16.517  10.101  39.970  1.00 57.46  ? 306 GLU B C   1 
ATOM   6589 O  O   . GLU B 1 306 ? 17.385  9.276   39.659  1.00 68.54  ? 306 GLU B O   1 
ATOM   6590 C  CB  . GLU B 1 306 ? 14.180  10.211  39.045  1.00 51.63  ? 306 GLU B CB  1 
ATOM   6591 C  CG  . GLU B 1 306 ? 14.604  9.835   37.641  1.00 47.53  ? 306 GLU B CG  1 
ATOM   6592 C  CD  . GLU B 1 306 ? 14.438  8.345   37.321  1.00 63.33  ? 306 GLU B CD  1 
ATOM   6593 O  OE1 . GLU B 1 306 ? 14.094  7.552   38.223  1.00 59.60  ? 306 GLU B OE1 1 
ATOM   6594 O  OE2 . GLU B 1 306 ? 14.662  7.960   36.149  1.00 71.28  1 306 GLU B OE2 1 
ATOM   6595 N  N   . SER B 1 307 ? 16.799  11.389  40.164  1.00 49.38  ? 307 SER B N   1 
ATOM   6596 C  CA  . SER B 1 307 ? 18.147  11.878  39.910  1.00 51.66  ? 307 SER B CA  1 
ATOM   6597 C  C   . SER B 1 307 ? 19.154  11.236  40.856  1.00 52.67  ? 307 SER B C   1 
ATOM   6598 O  O   . SER B 1 307 ? 20.277  10.926  40.451  1.00 62.29  ? 307 SER B O   1 
ATOM   6599 C  CB  . SER B 1 307 ? 18.179  13.400  40.014  1.00 53.91  ? 307 SER B CB  1 
ATOM   6600 O  OG  . SER B 1 307 ? 18.467  13.813  41.332  1.00 60.97  ? 307 SER B OG  1 
ATOM   6601 N  N   . MET B 1 308 ? 18.770  11.011  42.112  1.00 53.99  ? 308 MET B N   1 
ATOM   6602 C  CA  . MET B 1 308 ? 19.635  10.255  43.010  1.00 54.46  ? 308 MET B CA  1 
ATOM   6603 C  C   . MET B 1 308 ? 19.923  8.868   42.445  1.00 52.40  ? 308 MET B C   1 
ATOM   6604 O  O   . MET B 1 308 ? 21.072  8.412   42.452  1.00 54.94  ? 308 MET B O   1 
ATOM   6605 C  CB  . MET B 1 308 ? 19.005  10.162  44.402  1.00 54.61  ? 308 MET B CB  1 
ATOM   6606 C  CG  . MET B 1 308 ? 18.752  11.521  45.040  1.00 55.56  ? 308 MET B CG  1 
ATOM   6607 S  SD  . MET B 1 308 ? 18.152  11.472  46.737  1.00 52.89  ? 308 MET B SD  1 
ATOM   6608 C  CE  . MET B 1 308 ? 19.546  10.680  47.535  1.00 58.61  ? 308 MET B CE  1 
ATOM   6609 N  N   . LEU B 1 309 ? 18.892  8.187   41.924  1.00 39.81  ? 309 LEU B N   1 
ATOM   6610 C  CA  . LEU B 1 309 ? 19.101  6.846   41.385  1.00 41.53  ? 309 LEU B CA  1 
ATOM   6611 C  C   . LEU B 1 309 ? 20.027  6.876   40.165  1.00 56.75  ? 309 LEU B C   1 
ATOM   6612 O  O   . LEU B 1 309 ? 20.840  5.962   39.960  1.00 60.23  ? 309 LEU B O   1 
ATOM   6613 C  CB  . LEU B 1 309 ? 17.758  6.196   41.041  1.00 37.22  ? 309 LEU B CB  1 
ATOM   6614 C  CG  . LEU B 1 309 ? 16.958  5.627   42.229  1.00 42.79  ? 309 LEU B CG  1 
ATOM   6615 C  CD1 . LEU B 1 309 ? 15.579  5.045   41.852  1.00 29.31  ? 309 LEU B CD1 1 
ATOM   6616 C  CD2 . LEU B 1 309 ? 17.793  4.566   42.906  1.00 41.50  ? 309 LEU B CD2 1 
ATOM   6617 N  N   . ASN B 1 310 ? 19.950  7.939   39.364  1.00 51.93  ? 310 ASN B N   1 
ATOM   6618 C  CA  . ASN B 1 310 ? 20.756  8.014   38.147  1.00 55.33  ? 310 ASN B CA  1 
ATOM   6619 C  C   . ASN B 1 310 ? 22.182  8.476   38.426  1.00 53.85  ? 310 ASN B C   1 
ATOM   6620 O  O   . ASN B 1 310 ? 23.142  7.932   37.859  1.00 59.02  ? 310 ASN B O   1 
ATOM   6621 C  CB  . ASN B 1 310 ? 20.080  8.936   37.137  1.00 62.87  ? 310 ASN B CB  1 
ATOM   6622 C  CG  . ASN B 1 310 ? 19.059  8.214   36.278  1.00 59.96  ? 310 ASN B CG  1 
ATOM   6623 O  OD1 . ASN B 1 310 ? 19.311  7.108   35.779  1.00 72.45  ? 310 ASN B OD1 1 
ATOM   6624 N  ND2 . ASN B 1 310 ? 17.901  8.818   36.121  1.00 46.32  ? 310 ASN B ND2 1 
ATOM   6625 N  N   . SER B 1 311 ? 22.348  9.486   39.284  1.00 52.24  ? 311 SER B N   1 
ATOM   6626 C  CA  . SER B 1 311 ? 23.700  9.903   39.617  1.00 53.10  ? 311 SER B CA  1 
ATOM   6627 C  C   . SER B 1 311 ? 24.427  8.878   40.485  1.00 52.44  ? 311 SER B C   1 
ATOM   6628 O  O   . SER B 1 311 ? 25.644  9.000   40.661  1.00 55.87  ? 311 SER B O   1 
ATOM   6629 C  CB  . SER B 1 311 ? 23.678  11.274  40.292  1.00 55.93  ? 311 SER B CB  1 
ATOM   6630 O  OG  . SER B 1 311 ? 22.941  11.272  41.508  1.00 56.81  ? 311 SER B OG  1 
ATOM   6631 N  N   . GLY B 1 312 ? 23.734  7.853   40.985  1.00 41.18  ? 312 GLY B N   1 
ATOM   6632 C  CA  . GLY B 1 312 ? 24.367  6.893   41.871  1.00 36.23  ? 312 GLY B CA  1 
ATOM   6633 C  C   . GLY B 1 312 ? 24.469  7.365   43.302  1.00 47.99  ? 312 GLY B C   1 
ATOM   6634 O  O   . GLY B 1 312 ? 25.299  6.846   44.058  1.00 51.31  ? 312 GLY B O   1 
ATOM   6635 N  N   . ASN B 1 313 ? 23.637  8.337   43.693  1.00 43.83  ? 313 ASN B N   1 
ATOM   6636 C  CA  . ASN B 1 313 ? 23.686  8.983   45.005  1.00 40.63  ? 313 ASN B CA  1 
ATOM   6637 C  C   . ASN B 1 313 ? 22.897  8.163   46.032  1.00 51.62  ? 313 ASN B C   1 
ATOM   6638 O  O   . ASN B 1 313 ? 21.826  8.546   46.513  1.00 57.42  ? 313 ASN B O   1 
ATOM   6639 C  CB  . ASN B 1 313 ? 23.152  10.405  44.892  1.00 45.61  ? 313 ASN B CB  1 
ATOM   6640 C  CG  . ASN B 1 313 ? 23.434  11.240  46.120  1.00 63.10  ? 313 ASN B CG  1 
ATOM   6641 O  OD1 . ASN B 1 313 ? 24.345  10.943  46.903  1.00 67.82  ? 313 ASN B OD1 1 
ATOM   6642 N  ND2 . ASN B 1 313 ? 22.644  12.299  46.302  1.00 66.25  ? 313 ASN B ND2 1 
ATOM   6643 N  N   . PHE B 1 314 ? 23.456  7.006   46.370  1.00 45.74  ? 314 PHE B N   1 
ATOM   6644 C  CA  . PHE B 1 314 ? 22.853  6.159   47.387  1.00 43.46  ? 314 PHE B CA  1 
ATOM   6645 C  C   . PHE B 1 314 ? 23.900  5.203   47.941  1.00 43.15  ? 314 PHE B C   1 
ATOM   6646 O  O   . PHE B 1 314 ? 25.027  5.123   47.453  1.00 51.20  ? 314 PHE B O   1 
ATOM   6647 C  CB  . PHE B 1 314 ? 21.641  5.396   46.840  1.00 42.63  ? 314 PHE B CB  1 
ATOM   6648 C  CG  . PHE B 1 314 ? 21.862  4.762   45.496  1.00 44.58  ? 314 PHE B CG  1 
ATOM   6649 C  CD1 . PHE B 1 314 ? 22.540  3.556   45.376  1.00 44.38  ? 314 PHE B CD1 1 
ATOM   6650 C  CD2 . PHE B 1 314 ? 21.364  5.366   44.349  1.00 43.61  ? 314 PHE B CD2 1 
ATOM   6651 C  CE1 . PHE B 1 314 ? 22.733  2.971   44.129  1.00 44.11  ? 314 PHE B CE1 1 
ATOM   6652 C  CE2 . PHE B 1 314 ? 21.549  4.790   43.095  1.00 41.64  ? 314 PHE B CE2 1 
ATOM   6653 C  CZ  . PHE B 1 314 ? 22.226  3.584   42.987  1.00 45.07  ? 314 PHE B CZ  1 
ATOM   6654 N  N   . LYS B 1 315 ? 23.502  4.484   48.982  1.00 43.45  ? 315 LYS B N   1 
ATOM   6655 C  CA  . LYS B 1 315 ? 24.350  3.473   49.596  1.00 37.85  ? 315 LYS B CA  1 
ATOM   6656 C  C   . LYS B 1 315 ? 24.568  2.298   48.653  1.00 35.30  ? 315 LYS B C   1 
ATOM   6657 O  O   . LYS B 1 315 ? 23.612  1.754   48.092  1.00 32.11  ? 315 LYS B O   1 
ATOM   6658 C  CB  . LYS B 1 315 ? 23.708  2.990   50.893  1.00 38.68  ? 315 LYS B CB  1 
ATOM   6659 C  CG  . LYS B 1 315 ? 24.391  1.804   51.506  1.00 43.45  ? 315 LYS B CG  1 
ATOM   6660 C  CD  . LYS B 1 315 ? 23.721  1.427   52.821  1.00 43.41  ? 315 LYS B CD  1 
ATOM   6661 C  CE  . LYS B 1 315 ? 24.652  0.597   53.704  1.00 33.12  ? 315 LYS B CE  1 
ATOM   6662 N  NZ  . LYS B 1 315 ? 25.912  1.359   54.006  1.00 33.35  1 315 LYS B NZ  1 
ATOM   6663 N  N   . LYS B 1 316 ? 25.828  1.903   48.478  1.00 37.80  ? 316 LYS B N   1 
ATOM   6664 C  CA  . LYS B 1 316 ? 26.173  0.728   47.687  1.00 40.87  ? 316 LYS B CA  1 
ATOM   6665 C  C   . LYS B 1 316 ? 26.322  -0.464  48.626  1.00 44.40  ? 316 LYS B C   1 
ATOM   6666 O  O   . LYS B 1 316 ? 27.225  -0.484  49.468  1.00 57.16  ? 316 LYS B O   1 
ATOM   6667 C  CB  . LYS B 1 316 ? 27.466  0.958   46.903  1.00 43.97  ? 316 LYS B CB  1 
ATOM   6668 C  CG  . LYS B 1 316 ? 27.659  2.357   46.325  1.00 39.31  ? 316 LYS B CG  1 
ATOM   6669 C  CD  . LYS B 1 316 ? 26.599  2.720   45.341  1.00 38.57  ? 316 LYS B CD  1 
ATOM   6670 C  CE  . LYS B 1 316 ? 26.899  4.035   44.649  1.00 34.60  ? 316 LYS B CE  1 
ATOM   6671 N  NZ  . LYS B 1 316 ? 27.984  4.794   45.294  1.00 41.44  1 316 LYS B NZ  1 
ATOM   6672 N  N   . THR B 1 317 ? 25.439  -1.454  48.499  1.00 38.07  ? 317 THR B N   1 
ATOM   6673 C  CA  . THR B 1 317 ? 25.684  -2.715  49.196  1.00 44.24  ? 317 THR B CA  1 
ATOM   6674 C  C   . THR B 1 317 ? 25.071  -3.850  48.413  1.00 50.16  ? 317 THR B C   1 
ATOM   6675 O  O   . THR B 1 317 ? 25.032  -3.806  47.179  1.00 50.67  ? 317 THR B O   1 
ATOM   6676 C  CB  . THR B 1 317 ? 25.094  -2.753  50.605  1.00 36.69  ? 317 THR B CB  1 
ATOM   6677 O  OG1 . THR B 1 317 ? 25.158  -1.463  51.192  1.00 46.45  ? 317 THR B OG1 1 
ATOM   6678 C  CG2 . THR B 1 317 ? 25.926  -3.680  51.445  1.00 31.51  ? 317 THR B CG2 1 
ATOM   6679 N  N   . GLN B 1 318 ? 24.579  -4.850  49.141  1.00 43.90  ? 318 GLN B N   1 
ATOM   6680 C  CA  . GLN B 1 318 ? 23.705  -5.885  48.619  1.00 41.99  ? 318 GLN B CA  1 
ATOM   6681 C  C   . GLN B 1 318 ? 22.298  -5.582  49.082  1.00 38.05  ? 318 GLN B C   1 
ATOM   6682 O  O   . GLN B 1 318 ? 22.079  -5.305  50.262  1.00 44.37  ? 318 GLN B O   1 
ATOM   6683 C  CB  . GLN B 1 318 ? 24.112  -7.282  49.098  1.00 40.13  ? 318 GLN B CB  1 
ATOM   6684 C  CG  . GLN B 1 318 ? 25.564  -7.642  48.865  1.00 41.13  ? 318 GLN B CG  1 
ATOM   6685 C  CD  . GLN B 1 318 ? 26.463  -6.958  49.870  1.00 53.43  ? 318 GLN B CD  1 
ATOM   6686 O  OE1 . GLN B 1 318 ? 26.041  -6.696  51.000  1.00 57.34  ? 318 GLN B OE1 1 
ATOM   6687 N  NE2 . GLN B 1 318 ? 27.702  -6.642  49.464  1.00 49.19  ? 318 GLN B NE2 1 
ATOM   6688 N  N   . ILE B 1 319 ? 21.353  -5.618  48.155  1.00 50.37  ? 319 ILE B N   1 
ATOM   6689 C  CA  . ILE B 1 319 ? 19.932  -5.643  48.477  1.00 41.16  ? 319 ILE B CA  1 
ATOM   6690 C  C   . ILE B 1 319 ? 19.383  -6.988  48.034  1.00 37.15  ? 319 ILE B C   1 
ATOM   6691 O  O   . ILE B 1 319 ? 19.771  -7.519  46.987  1.00 31.05  ? 319 ILE B O   1 
ATOM   6692 C  CB  . ILE B 1 319 ? 19.137  -4.508  47.805  1.00 28.96  ? 319 ILE B CB  1 
ATOM   6693 C  CG1 . ILE B 1 319 ? 19.259  -4.634  46.281  1.00 29.30  ? 319 ILE B CG1 1 
ATOM   6694 C  CG2 . ILE B 1 319 ? 19.577  -3.135  48.325  1.00 28.45  ? 319 ILE B CG2 1 
ATOM   6695 C  CD1 . ILE B 1 319 ? 18.783  -3.427  45.506  1.00 43.84  ? 319 ILE B CD1 1 
ATOM   6696 N  N   . LEU B 1 320 ? 18.510  -7.553  48.848  1.00 39.92  ? 320 LEU B N   1 
ATOM   6697 C  CA  . LEU B 1 320 ? 17.615  -8.619  48.430  1.00 38.19  ? 320 LEU B CA  1 
ATOM   6698 C  C   . LEU B 1 320 ? 16.206  -8.041  48.439  1.00 38.88  ? 320 LEU B C   1 
ATOM   6699 O  O   . LEU B 1 320 ? 15.818  -7.344  49.385  1.00 38.86  ? 320 LEU B O   1 
ATOM   6700 C  CB  . LEU B 1 320 ? 17.739  -9.825  49.358  1.00 33.67  ? 320 LEU B CB  1 
ATOM   6701 C  CG  . LEU B 1 320 ? 16.899  -11.082 49.145  1.00 34.80  ? 320 LEU B CG  1 
ATOM   6702 C  CD1 . LEU B 1 320 ? 17.628  -12.270 49.753  1.00 38.98  ? 320 LEU B CD1 1 
ATOM   6703 C  CD2 . LEU B 1 320 ? 15.554  -10.927 49.796  1.00 29.50  ? 320 LEU B CD2 1 
ATOM   6704 N  N   . LEU B 1 321 ? 15.452  -8.299  47.380  1.00 36.57  ? 321 LEU B N   1 
ATOM   6705 C  CA  . LEU B 1 321 ? 14.172  -7.624  47.239  1.00 35.75  ? 321 LEU B CA  1 
ATOM   6706 C  C   . LEU B 1 321 ? 13.294  -8.423  46.301  1.00 38.63  ? 321 LEU B C   1 
ATOM   6707 O  O   . LEU B 1 321 ? 13.767  -9.300  45.579  1.00 29.67  ? 321 LEU B O   1 
ATOM   6708 C  CB  . LEU B 1 321 ? 14.334  -6.188  46.728  1.00 36.82  ? 321 LEU B CB  1 
ATOM   6709 C  CG  . LEU B 1 321 ? 14.596  -5.904  45.251  1.00 32.49  ? 321 LEU B CG  1 
ATOM   6710 C  CD1 . LEU B 1 321 ? 14.561  -4.397  45.001  1.00 27.99  ? 321 LEU B CD1 1 
ATOM   6711 C  CD2 . LEU B 1 321 ? 15.926  -6.487  44.792  1.00 29.02  ? 321 LEU B CD2 1 
ATOM   6712 N  N   . GLY B 1 322 ? 12.003  -8.120  46.338  1.00 52.42  ? 322 GLY B N   1 
ATOM   6713 C  CA  . GLY B 1 322 ? 11.065  -8.842  45.504  1.00 55.83  ? 322 GLY B CA  1 
ATOM   6714 C  C   . GLY B 1 322 ? 9.638   -8.443  45.794  1.00 52.14  ? 322 GLY B C   1 
ATOM   6715 O  O   . GLY B 1 322 ? 9.367   -7.539  46.586  1.00 50.24  ? 322 GLY B O   1 
ATOM   6716 N  N   . VAL B 1 323 ? 8.722   -9.138  45.118  1.00 28.57  ? 323 VAL B N   1 
ATOM   6717 C  CA  . VAL B 1 323 ? 7.298   -8.840  45.171  1.00 31.33  ? 323 VAL B CA  1 
ATOM   6718 C  C   . VAL B 1 323 ? 6.515   -10.146 45.181  1.00 32.66  ? 323 VAL B C   1 
ATOM   6719 O  O   . VAL B 1 323 ? 7.047   -11.220 44.888  1.00 31.11  ? 323 VAL B O   1 
ATOM   6720 C  CB  . VAL B 1 323 ? 6.853   -7.968  43.984  1.00 35.12  ? 323 VAL B CB  1 
ATOM   6721 C  CG1 . VAL B 1 323 ? 7.599   -6.630  43.989  1.00 34.66  ? 323 VAL B CG1 1 
ATOM   6722 C  CG2 . VAL B 1 323 ? 7.093   -8.732  42.691  1.00 29.42  ? 323 VAL B CG2 1 
ATOM   6723 N  N   . ASN B 1 324 ? 5.232   -10.047 45.537  1.00 32.19  ? 324 ASN B N   1 
ATOM   6724 C  CA  . ASN B 1 324 ? 4.304   -11.154 45.372  1.00 29.74  ? 324 ASN B CA  1 
ATOM   6725 C  C   . ASN B 1 324 ? 3.492   -10.987 44.084  1.00 42.98  ? 324 ASN B C   1 
ATOM   6726 O  O   . ASN B 1 324 ? 3.464   -9.923  43.455  1.00 30.03  ? 324 ASN B O   1 
ATOM   6727 C  CB  . ASN B 1 324 ? 3.362   -11.281 46.573  1.00 38.75  ? 324 ASN B CB  1 
ATOM   6728 C  CG  . ASN B 1 324 ? 4.094   -11.285 47.914  1.00 49.97  ? 324 ASN B CG  1 
ATOM   6729 O  OD1 . ASN B 1 324 ? 5.190   -11.830 48.038  1.00 56.48  ? 324 ASN B OD1 1 
ATOM   6730 N  ND2 . ASN B 1 324 ? 3.458   -10.729 48.935  1.00 47.31  ? 324 ASN B ND2 1 
ATOM   6731 N  N   . LYS B 1 325 ? 2.799   -12.068 43.719  1.00 44.27  ? 325 LYS B N   1 
ATOM   6732 C  CA  . LYS B 1 325 ? 2.038   -12.120 42.476  1.00 39.82  ? 325 LYS B CA  1 
ATOM   6733 C  C   . LYS B 1 325 ? 0.929   -11.078 42.468  1.00 47.57  ? 325 LYS B C   1 
ATOM   6734 O  O   . LYS B 1 325 ? 0.934   -10.153 41.651  1.00 59.86  ? 325 LYS B O   1 
ATOM   6735 C  CB  . LYS B 1 325 ? 1.485   -13.536 42.294  1.00 32.90  ? 325 LYS B CB  1 
ATOM   6736 C  CG  . LYS B 1 325 ? 0.911   -13.922 40.957  1.00 37.51  ? 325 LYS B CG  1 
ATOM   6737 C  CD  . LYS B 1 325 ? 0.500   -15.400 41.034  1.00 42.59  ? 325 LYS B CD  1 
ATOM   6738 C  CE  . LYS B 1 325 ? -0.706  -15.767 40.185  1.00 51.32  ? 325 LYS B CE  1 
ATOM   6739 N  NZ  . LYS B 1 325 ? -1.467  -14.601 39.606  1.00 58.97  1 325 LYS B NZ  1 
ATOM   6740 N  N   . ASP B 1 326 ? -0.015  -11.186 43.389  1.00 53.41  ? 326 ASP B N   1 
ATOM   6741 C  CA  . ASP B 1 326 ? -1.228  -10.375 43.314  1.00 58.39  ? 326 ASP B CA  1 
ATOM   6742 C  C   . ASP B 1 326 ? -1.154  -9.218  44.314  1.00 54.91  ? 326 ASP B C   1 
ATOM   6743 O  O   . ASP B 1 326 ? -1.926  -9.105  45.263  1.00 62.84  ? 326 ASP B O   1 
ATOM   6744 C  CB  . ASP B 1 326 ? -2.453  -11.263 43.513  1.00 68.12  ? 326 ASP B CB  1 
ATOM   6745 C  CG  . ASP B 1 326 ? -2.476  -12.450 42.536  1.00 81.39  ? 326 ASP B CG  1 
ATOM   6746 O  OD1 . ASP B 1 326 ? -2.274  -13.607 42.966  1.00 77.29  ? 326 ASP B OD1 1 
ATOM   6747 O  OD2 . ASP B 1 326 ? -2.676  -12.225 41.321  1.00 94.14  1 326 ASP B OD2 1 
ATOM   6748 N  N   . GLU B 1 327 ? -0.196  -8.327  44.054  1.00 46.30  ? 327 GLU B N   1 
ATOM   6749 C  CA  . GLU B 1 327 ? 0.001   -7.138  44.875  1.00 41.73  ? 327 GLU B CA  1 
ATOM   6750 C  C   . GLU B 1 327 ? -1.201  -6.204  44.889  1.00 48.56  ? 327 GLU B C   1 
ATOM   6751 O  O   . GLU B 1 327 ? -1.253  -5.320  45.750  1.00 58.81  ? 327 GLU B O   1 
ATOM   6752 C  CB  . GLU B 1 327 ? 1.217   -6.348  44.381  1.00 47.41  ? 327 GLU B CB  1 
ATOM   6753 C  CG  . GLU B 1 327 ? 2.538   -7.104  44.450  1.00 55.80  ? 327 GLU B CG  1 
ATOM   6754 C  CD  . GLU B 1 327 ? 3.131   -7.105  45.843  1.00 54.09  ? 327 GLU B CD  1 
ATOM   6755 O  OE1 . GLU B 1 327 ? 2.718   -6.240  46.645  1.00 63.04  ? 327 GLU B OE1 1 
ATOM   6756 O  OE2 . GLU B 1 327 ? 3.990   -7.974  46.136  1.00 42.67  1 327 GLU B OE2 1 
ATOM   6757 N  N   . GLY B 1 328 ? -2.160  -6.366  43.976  1.00 47.49  ? 328 GLY B N   1 
ATOM   6758 C  CA  . GLY B 1 328 ? -3.200  -5.368  43.801  1.00 35.09  ? 328 GLY B CA  1 
ATOM   6759 C  C   . GLY B 1 328 ? -4.550  -5.734  44.376  1.00 37.95  ? 328 GLY B C   1 
ATOM   6760 O  O   . GLY B 1 328 ? -5.389  -4.857  44.601  1.00 39.87  ? 328 GLY B O   1 
ATOM   6761 N  N   . SER B 1 329 ? -4.753  -7.025  44.654  1.00 44.37  ? 329 SER B N   1 
ATOM   6762 C  CA  . SER B 1 329 ? -6.085  -7.542  44.961  1.00 42.25  ? 329 SER B CA  1 
ATOM   6763 C  C   . SER B 1 329 ? -6.629  -7.023  46.294  1.00 47.79  ? 329 SER B C   1 
ATOM   6764 O  O   . SER B 1 329 ? -7.849  -6.975  46.488  1.00 56.81  ? 329 SER B O   1 
ATOM   6765 C  CB  . SER B 1 329 ? -6.051  -9.071  44.952  1.00 36.13  ? 329 SER B CB  1 
ATOM   6766 O  OG  . SER B 1 329 ? -5.398  -9.571  46.106  1.00 43.10  ? 329 SER B OG  1 
ATOM   6767 N  N   . PHE B 1 330 ? -5.764  -6.637  47.224  1.00 51.78  ? 330 PHE B N   1 
ATOM   6768 C  CA  . PHE B 1 330 ? -6.269  -6.088  48.477  1.00 51.63  ? 330 PHE B CA  1 
ATOM   6769 C  C   . PHE B 1 330 ? -7.013  -4.784  48.225  1.00 44.26  ? 330 PHE B C   1 
ATOM   6770 O  O   . PHE B 1 330 ? -8.128  -4.579  48.729  1.00 39.47  ? 330 PHE B O   1 
ATOM   6771 C  CB  . PHE B 1 330 ? -5.116  -5.874  49.464  1.00 61.25  ? 330 PHE B CB  1 
ATOM   6772 C  CG  . PHE B 1 330 ? -5.431  -6.311  50.869  1.00 70.90  ? 330 PHE B CG  1 
ATOM   6773 C  CD1 . PHE B 1 330 ? -4.462  -6.912  51.656  1.00 72.87  ? 330 PHE B CD1 1 
ATOM   6774 C  CD2 . PHE B 1 330 ? -6.697  -6.121  51.402  1.00 78.02  ? 330 PHE B CD2 1 
ATOM   6775 C  CE1 . PHE B 1 330 ? -4.748  -7.333  52.936  1.00 78.20  ? 330 PHE B CE1 1 
ATOM   6776 C  CE2 . PHE B 1 330 ? -6.991  -6.531  52.686  1.00 81.15  ? 330 PHE B CE2 1 
ATOM   6777 C  CZ  . PHE B 1 330 ? -6.014  -7.138  53.455  1.00 82.72  ? 330 PHE B CZ  1 
ATOM   6778 N  N   . PHE B 1 331 ? -6.427  -3.904  47.407  1.00 36.54  ? 331 PHE B N   1 
ATOM   6779 C  CA  . PHE B 1 331 ? -6.924  -2.539  47.312  1.00 38.19  ? 331 PHE B CA  1 
ATOM   6780 C  C   . PHE B 1 331 ? -8.168  -2.429  46.439  1.00 43.21  ? 331 PHE B C   1 
ATOM   6781 O  O   . PHE B 1 331 ? -8.988  -1.526  46.652  1.00 35.53  ? 331 PHE B O   1 
ATOM   6782 C  CB  . PHE B 1 331 ? -5.808  -1.618  46.822  1.00 33.58  ? 331 PHE B CB  1 
ATOM   6783 C  CG  . PHE B 1 331 ? -4.549  -1.740  47.620  1.00 42.86  ? 331 PHE B CG  1 
ATOM   6784 C  CD1 . PHE B 1 331 ? -4.236  -0.773  48.574  1.00 51.92  ? 331 PHE B CD1 1 
ATOM   6785 C  CD2 . PHE B 1 331 ? -3.649  -2.780  47.394  1.00 38.19  ? 331 PHE B CD2 1 
ATOM   6786 C  CE1 . PHE B 1 331 ? -3.072  -0.857  49.330  1.00 44.94  ? 331 PHE B CE1 1 
ATOM   6787 C  CE2 . PHE B 1 331 ? -2.485  -2.878  48.144  1.00 40.07  ? 331 PHE B CE2 1 
ATOM   6788 C  CZ  . PHE B 1 331 ? -2.191  -1.906  49.118  1.00 37.83  ? 331 PHE B CZ  1 
ATOM   6789 N  N   . LEU B 1 332 ? -8.335  -3.335  45.473  1.00 31.86  ? 332 LEU B N   1 
ATOM   6790 C  CA  . LEU B 1 332 ? -9.582  -3.391  44.721  1.00 32.98  ? 332 LEU B CA  1 
ATOM   6791 C  C   . LEU B 1 332 ? -10.727 -3.891  45.576  1.00 37.02  ? 332 LEU B C   1 
ATOM   6792 O  O   . LEU B 1 332 ? -11.864 -3.432  45.429  1.00 46.77  ? 332 LEU B O   1 
ATOM   6793 C  CB  . LEU B 1 332 ? -9.418  -4.268  43.483  1.00 38.66  ? 332 LEU B CB  1 
ATOM   6794 C  CG  . LEU B 1 332 ? -8.198  -3.853  42.685  1.00 43.81  ? 332 LEU B CG  1 
ATOM   6795 C  CD1 . LEU B 1 332 ? -7.708  -4.969  41.769  1.00 47.05  ? 332 LEU B CD1 1 
ATOM   6796 C  CD2 . LEU B 1 332 ? -8.661  -2.642  41.893  1.00 48.95  ? 332 LEU B CD2 1 
ATOM   6797 N  N   . LEU B 1 333 ? -10.446 -4.843  46.459  1.00 43.29  ? 333 LEU B N   1 
ATOM   6798 C  CA  . LEU B 1 333 ? -11.455 -5.315  47.399  1.00 42.57  ? 333 LEU B CA  1 
ATOM   6799 C  C   . LEU B 1 333 ? -12.064 -4.168  48.198  1.00 38.07  ? 333 LEU B C   1 
ATOM   6800 O  O   . LEU B 1 333 ? -13.292 -4.023  48.251  1.00 46.89  ? 333 LEU B O   1 
ATOM   6801 C  CB  . LEU B 1 333 ? -10.830 -6.364  48.307  1.00 33.94  ? 333 LEU B CB  1 
ATOM   6802 C  CG  . LEU B 1 333 ? -11.719 -6.853  49.425  1.00 36.05  ? 333 LEU B CG  1 
ATOM   6803 C  CD1 . LEU B 1 333 ? -12.635 -7.875  48.839  1.00 39.79  ? 333 LEU B CD1 1 
ATOM   6804 C  CD2 . LEU B 1 333 ? -10.870 -7.525  50.424  1.00 39.03  ? 333 LEU B CD2 1 
ATOM   6805 N  N   . TYR B 1 334 ? -11.218 -3.295  48.757  1.00 33.04  ? 334 TYR B N   1 
ATOM   6806 C  CA  . TYR B 1 334 ? -11.692 -2.193  49.589  1.00 35.61  ? 334 TYR B CA  1 
ATOM   6807 C  C   . TYR B 1 334 ? -12.071 -0.934  48.819  1.00 39.11  ? 334 TYR B C   1 
ATOM   6808 O  O   . TYR B 1 334 ? -12.789 -0.089  49.367  1.00 60.75  ? 334 TYR B O   1 
ATOM   6809 C  CB  . TYR B 1 334 ? -10.633 -1.795  50.632  1.00 31.94  ? 334 TYR B CB  1 
ATOM   6810 C  CG  . TYR B 1 334 ? -10.477 -2.749  51.792  1.00 35.82  ? 334 TYR B CG  1 
ATOM   6811 C  CD1 . TYR B 1 334 ? -10.177 -4.091  51.574  1.00 46.28  ? 334 TYR B CD1 1 
ATOM   6812 C  CD2 . TYR B 1 334 ? -10.592 -2.309  53.103  1.00 31.59  ? 334 TYR B CD2 1 
ATOM   6813 C  CE1 . TYR B 1 334 ? -10.021 -4.965  52.617  1.00 39.50  ? 334 TYR B CE1 1 
ATOM   6814 C  CE2 . TYR B 1 334 ? -10.425 -3.185  54.161  1.00 31.65  ? 334 TYR B CE2 1 
ATOM   6815 C  CZ  . TYR B 1 334 ? -10.147 -4.512  53.901  1.00 31.89  ? 334 TYR B CZ  1 
ATOM   6816 O  OH  . TYR B 1 334 ? -9.979  -5.417  54.910  1.00 43.10  ? 334 TYR B OH  1 
ATOM   6817 N  N   . GLY B 1 335 ? -11.600 -0.749  47.597  1.00 38.09  ? 335 GLY B N   1 
ATOM   6818 C  CA  . GLY B 1 335 ? -11.824 0.551   46.993  1.00 43.82  ? 335 GLY B CA  1 
ATOM   6819 C  C   . GLY B 1 335 ? -12.356 0.590   45.571  1.00 50.30  ? 335 GLY B C   1 
ATOM   6820 O  O   . GLY B 1 335 ? -12.481 1.679   45.001  1.00 53.80  ? 335 GLY B O   1 
ATOM   6821 N  N   . ALA B 1 336 ? -12.680 -0.562  44.987  1.00 44.35  ? 336 ALA B N   1 
ATOM   6822 C  CA  . ALA B 1 336 ? -13.024 -0.610  43.575  1.00 47.61  ? 336 ALA B CA  1 
ATOM   6823 C  C   . ALA B 1 336 ? -14.377 -1.272  43.364  1.00 57.48  ? 336 ALA B C   1 
ATOM   6824 O  O   . ALA B 1 336 ? -14.758 -2.183  44.112  1.00 65.64  ? 336 ALA B O   1 
ATOM   6825 C  CB  . ALA B 1 336 ? -11.955 -1.364  42.773  1.00 39.48  ? 336 ALA B CB  1 
ATOM   6826 N  N   . PRO B 1 337 ? -15.111 -0.851  42.334  1.00 53.74  ? 337 PRO B N   1 
ATOM   6827 C  CA  . PRO B 1 337 ? -16.466 -1.370  42.120  1.00 53.21  ? 337 PRO B CA  1 
ATOM   6828 C  C   . PRO B 1 337 ? -16.460 -2.779  41.558  1.00 58.70  ? 337 PRO B C   1 
ATOM   6829 O  O   . PRO B 1 337 ? -15.608 -3.152  40.744  1.00 71.85  ? 337 PRO B O   1 
ATOM   6830 C  CB  . PRO B 1 337 ? -17.067 -0.392  41.104  1.00 58.94  ? 337 PRO B CB  1 
ATOM   6831 C  CG  . PRO B 1 337 ? -16.052 0.703   40.932  1.00 60.42  ? 337 PRO B CG  1 
ATOM   6832 C  CD  . PRO B 1 337 ? -14.739 0.139   41.316  1.00 56.12  ? 337 PRO B CD  1 
ATOM   6833 N  N   . GLY B 1 338 ? -17.452 -3.555  41.991  1.00 40.88  ? 338 GLY B N   1 
ATOM   6834 C  CA  . GLY B 1 338 ? -17.616 -4.922  41.563  1.00 41.71  ? 338 GLY B CA  1 
ATOM   6835 C  C   . GLY B 1 338 ? -16.879 -5.955  42.388  1.00 46.71  ? 338 GLY B C   1 
ATOM   6836 O  O   . GLY B 1 338 ? -17.144 -7.151  42.225  1.00 42.96  ? 338 GLY B O   1 
ATOM   6837 N  N   . PHE B 1 339 ? -15.964 -5.540  43.260  1.00 49.40  ? 339 PHE B N   1 
ATOM   6838 C  CA  . PHE B 1 339 ? -15.173 -6.473  44.051  1.00 54.85  ? 339 PHE B CA  1 
ATOM   6839 C  C   . PHE B 1 339 ? -15.859 -6.759  45.375  1.00 61.27  ? 339 PHE B C   1 
ATOM   6840 O  O   . PHE B 1 339 ? -16.417 -5.858  46.012  1.00 60.69  ? 339 PHE B O   1 
ATOM   6841 C  CB  . PHE B 1 339 ? -13.768 -5.923  44.292  1.00 53.88  ? 339 PHE B CB  1 
ATOM   6842 C  CG  . PHE B 1 339 ? -12.902 -5.973  43.079  1.00 53.97  ? 339 PHE B CG  1 
ATOM   6843 C  CD1 . PHE B 1 339 ? -12.051 -7.042  42.868  1.00 50.25  ? 339 PHE B CD1 1 
ATOM   6844 C  CD2 . PHE B 1 339 ? -12.972 -4.973  42.124  1.00 53.58  ? 339 PHE B CD2 1 
ATOM   6845 C  CE1 . PHE B 1 339 ? -11.266 -7.105  41.744  1.00 51.47  ? 339 PHE B CE1 1 
ATOM   6846 C  CE2 . PHE B 1 339 ? -12.194 -5.031  40.999  1.00 53.32  ? 339 PHE B CE2 1 
ATOM   6847 C  CZ  . PHE B 1 339 ? -11.335 -6.101  40.808  1.00 53.07  ? 339 PHE B CZ  1 
ATOM   6848 N  N   . SER B 1 340 ? -15.794 -8.023  45.788  1.00 61.78  ? 340 SER B N   1 
ATOM   6849 C  CA  . SER B 1 340 ? -16.532 -8.520  46.937  1.00 60.54  ? 340 SER B CA  1 
ATOM   6850 C  C   . SER B 1 340 ? -15.706 -9.590  47.634  1.00 58.61  ? 340 SER B C   1 
ATOM   6851 O  O   . SER B 1 340 ? -15.045 -10.402 46.978  1.00 46.40  ? 340 SER B O   1 
ATOM   6852 C  CB  . SER B 1 340 ? -17.900 -9.076  46.505  1.00 64.96  ? 340 SER B CB  1 
ATOM   6853 O  OG  . SER B 1 340 ? -18.607 -9.697  47.569  1.00 63.11  ? 340 SER B OG  1 
ATOM   6854 N  N   . LYS B 1 341 ? -15.744 -9.571  48.973  1.00 68.77  ? 341 LYS B N   1 
ATOM   6855 C  CA  . LYS B 1 341 ? -14.969 -10.522 49.764  1.00 65.64  ? 341 LYS B CA  1 
ATOM   6856 C  C   . LYS B 1 341 ? -15.553 -11.923 49.681  1.00 58.58  ? 341 LYS B C   1 
ATOM   6857 O  O   . LYS B 1 341 ? -14.832 -12.912 49.850  1.00 60.68  ? 341 LYS B O   1 
ATOM   6858 C  CB  . LYS B 1 341 ? -14.911 -10.068 51.222  1.00 64.26  ? 341 LYS B CB  1 
ATOM   6859 C  CG  . LYS B 1 341 ? -13.864 -10.806 52.052  1.00 65.26  ? 341 LYS B CG  1 
ATOM   6860 C  CD  . LYS B 1 341 ? -14.071 -10.613 53.555  1.00 55.66  ? 341 LYS B CD  1 
ATOM   6861 C  CE  . LYS B 1 341 ? -15.069 -11.605 54.089  1.00 56.39  ? 341 LYS B CE  1 
ATOM   6862 N  NZ  . LYS B 1 341 ? -14.430 -12.939 54.247  1.00 59.38  1 341 LYS B NZ  1 
ATOM   6863 N  N   . ASP B 1 342 ? -16.846 -12.028 49.431  1.00 52.58  ? 342 ASP B N   1 
ATOM   6864 C  CA  . ASP B 1 342 ? -17.493 -13.329 49.430  1.00 70.58  ? 342 ASP B CA  1 
ATOM   6865 C  C   . ASP B 1 342 ? -18.130 -13.554 48.069  1.00 77.19  ? 342 ASP B C   1 
ATOM   6866 O  O   . ASP B 1 342 ? -19.342 -13.774 47.954  1.00 64.97  ? 342 ASP B O   1 
ATOM   6867 C  CB  . ASP B 1 342 ? -18.527 -13.420 50.553  1.00 74.88  ? 342 ASP B CB  1 
ATOM   6868 C  CG  . ASP B 1 342 ? -18.048 -12.771 51.829  1.00 75.11  ? 342 ASP B CG  1 
ATOM   6869 O  OD1 . ASP B 1 342 ? -17.200 -13.372 52.526  1.00 76.74  ? 342 ASP B OD1 1 
ATOM   6870 O  OD2 . ASP B 1 342 ? -18.524 -11.656 52.127  1.00 72.30  1 342 ASP B OD2 1 
ATOM   6871 N  N   . SER B 1 343 ? -17.295 -13.496 47.038  1.00 78.20  ? 343 SER B N   1 
ATOM   6872 C  CA  . SER B 1 343 ? -17.729 -13.576 45.655  1.00 64.89  ? 343 SER B CA  1 
ATOM   6873 C  C   . SER B 1 343 ? -16.488 -13.604 44.782  1.00 63.37  ? 343 SER B C   1 
ATOM   6874 O  O   . SER B 1 343 ? -15.432 -13.083 45.171  1.00 49.42  ? 343 SER B O   1 
ATOM   6875 C  CB  . SER B 1 343 ? -18.629 -12.396 45.285  1.00 48.67  ? 343 SER B CB  1 
ATOM   6876 O  OG  . SER B 1 343 ? -18.703 -12.259 43.893  1.00 46.21  ? 343 SER B OG  1 
ATOM   6877 N  N   . GLU B 1 344 ? -16.621 -14.233 43.609  1.00 56.75  ? 344 GLU B N   1 
ATOM   6878 C  CA  . GLU B 1 344 ? -15.488 -14.320 42.699  1.00 52.15  ? 344 GLU B CA  1 
ATOM   6879 C  C   . GLU B 1 344 ? -15.207 -13.020 41.967  1.00 50.88  ? 344 GLU B C   1 
ATOM   6880 O  O   . GLU B 1 344 ? -14.160 -12.919 41.313  1.00 48.30  ? 344 GLU B O   1 
ATOM   6881 C  CB  . GLU B 1 344 ? -15.696 -15.432 41.688  1.00 48.09  ? 344 GLU B CB  1 
ATOM   6882 C  CG  . GLU B 1 344 ? -16.251 -16.676 42.264  1.00 61.03  ? 344 GLU B CG  1 
ATOM   6883 C  CD  . GLU B 1 344 ? -16.573 -17.671 41.184  1.00 85.02  ? 344 GLU B CD  1 
ATOM   6884 O  OE1 . GLU B 1 344 ? -16.288 -17.375 39.997  1.00 86.20  ? 344 GLU B OE1 1 
ATOM   6885 O  OE2 . GLU B 1 344 ? -17.157 -18.735 41.502  1.00 100.62 1 344 GLU B OE2 1 
ATOM   6886 N  N   . SER B 1 345 ? -16.092 -12.033 42.074  1.00 43.49  ? 345 SER B N   1 
ATOM   6887 C  CA  . SER B 1 345 ? -15.786 -10.668 41.664  1.00 55.84  ? 345 SER B CA  1 
ATOM   6888 C  C   . SER B 1 345 ? -15.456 -10.588 40.171  1.00 55.72  ? 345 SER B C   1 
ATOM   6889 O  O   . SER B 1 345 ? -14.428 -10.040 39.774  1.00 54.12  ? 345 SER B O   1 
ATOM   6890 C  CB  . SER B 1 345 ? -14.639 -10.097 42.511  1.00 53.06  ? 345 SER B CB  1 
ATOM   6891 O  OG  . SER B 1 345 ? -14.871 -10.292 43.908  1.00 51.13  ? 345 SER B OG  1 
ATOM   6892 N  N   . LYS B 1 346 ? -16.336 -11.150 39.334  1.00 56.53  ? 346 LYS B N   1 
ATOM   6893 C  CA  . LYS B 1 346 ? -16.231 -10.927 37.893  1.00 57.49  ? 346 LYS B CA  1 
ATOM   6894 C  C   . LYS B 1 346 ? -16.580 -9.479  37.584  1.00 60.51  ? 346 LYS B C   1 
ATOM   6895 O  O   . LYS B 1 346 ? -17.637 -8.979  37.984  1.00 57.87  ? 346 LYS B O   1 
ATOM   6896 C  CB  . LYS B 1 346 ? -17.122 -11.868 37.080  1.00 46.76  ? 346 LYS B CB  1 
ATOM   6897 C  CG  . LYS B 1 346 ? -17.332 -13.258 37.631  1.00 66.94  ? 346 LYS B CG  1 
ATOM   6898 C  CD  . LYS B 1 346 ? -17.067 -14.298 36.543  1.00 74.16  ? 346 LYS B CD  1 
ATOM   6899 C  CE  . LYS B 1 346 ? -17.770 -15.622 36.851  1.00 78.57  ? 346 LYS B CE  1 
ATOM   6900 N  NZ  . LYS B 1 346 ? -17.348 -16.174 38.182  1.00 89.06  1 346 LYS B NZ  1 
ATOM   6901 N  N   . ILE B 1 347 ? -15.682 -8.806  36.881  1.00 65.64  ? 347 ILE B N   1 
ATOM   6902 C  CA  . ILE B 1 347 ? -15.755 -7.370  36.683  1.00 62.39  ? 347 ILE B CA  1 
ATOM   6903 C  C   . ILE B 1 347 ? -16.297 -7.119  35.287  1.00 57.01  ? 347 ILE B C   1 
ATOM   6904 O  O   . ILE B 1 347 ? -15.723 -7.575  34.289  1.00 64.27  ? 347 ILE B O   1 
ATOM   6905 C  CB  . ILE B 1 347 ? -14.381 -6.712  36.898  1.00 63.30  ? 347 ILE B CB  1 
ATOM   6906 C  CG1 . ILE B 1 347 ? -13.891 -7.000  38.316  1.00 61.09  ? 347 ILE B CG1 1 
ATOM   6907 C  CG2 . ILE B 1 347 ? -14.437 -5.207  36.674  1.00 66.55  ? 347 ILE B CG2 1 
ATOM   6908 C  CD1 . ILE B 1 347 ? -14.878 -6.596  39.400  1.00 59.97  ? 347 ILE B CD1 1 
ATOM   6909 N  N   . SER B 1 348 ? -17.421 -6.417  35.221  1.00 45.34  ? 348 SER B N   1 
ATOM   6910 C  CA  . SER B 1 348 ? -17.935 -5.946  33.949  1.00 57.08  ? 348 SER B CA  1 
ATOM   6911 C  C   . SER B 1 348 ? -17.015 -4.872  33.367  1.00 51.89  ? 348 SER B C   1 
ATOM   6912 O  O   . SER B 1 348 ? -16.274 -4.200  34.085  1.00 54.41  ? 348 SER B O   1 
ATOM   6913 C  CB  . SER B 1 348 ? -19.335 -5.358  34.115  1.00 47.61  ? 348 SER B CB  1 
ATOM   6914 O  OG  . SER B 1 348 ? -19.243 -4.077  34.719  1.00 46.67  ? 348 SER B OG  1 
ATOM   6915 N  N   . ARG B 1 349 ? -17.113 -4.688  32.045  1.00 53.42  ? 349 ARG B N   1 
ATOM   6916 C  CA  . ARG B 1 349 ? -16.365 -3.640  31.354  1.00 52.59  ? 349 ARG B CA  1 
ATOM   6917 C  C   . ARG B 1 349 ? -16.543 -2.278  32.022  1.00 57.40  ? 349 ARG B C   1 
ATOM   6918 O  O   . ARG B 1 349 ? -15.564 -1.556  32.254  1.00 49.16  ? 349 ARG B O   1 
ATOM   6919 C  CB  . ARG B 1 349 ? -16.781 -3.574  29.880  1.00 47.38  ? 349 ARG B CB  1 
ATOM   6920 C  CG  . ARG B 1 349 ? -15.727 -2.920  29.030  1.00 46.87  ? 349 ARG B CG  1 
ATOM   6921 C  CD  . ARG B 1 349 ? -14.696 -3.959  28.606  1.00 51.29  ? 349 ARG B CD  1 
ATOM   6922 N  NE  . ARG B 1 349 ? -13.425 -3.351  28.169  1.00 58.97  ? 349 ARG B NE  1 
ATOM   6923 C  CZ  . ARG B 1 349 ? -12.210 -3.676  28.617  1.00 63.46  ? 349 ARG B CZ  1 
ATOM   6924 N  NH1 . ARG B 1 349 ? -11.150 -3.052  28.131  1.00 67.17  1 349 ARG B NH1 1 
ATOM   6925 N  NH2 . ARG B 1 349 ? -12.065 -4.648  29.505  1.00 59.84  ? 349 ARG B NH2 1 
ATOM   6926 N  N   . GLU B 1 350 ? -17.789 -1.913  32.350  1.00 68.12  ? 350 GLU B N   1 
ATOM   6927 C  CA  . GLU B 1 350 ? -18.040 -0.622  32.986  1.00 71.41  ? 350 GLU B CA  1 
ATOM   6928 C  C   . GLU B 1 350 ? -17.249 -0.492  34.285  1.00 63.11  ? 350 GLU B C   1 
ATOM   6929 O  O   . GLU B 1 350 ? -16.522 0.490   34.491  1.00 47.68  ? 350 GLU B O   1 
ATOM   6930 C  CB  . GLU B 1 350 ? -19.539 -0.452  33.230  1.00 79.76  ? 350 GLU B CB  1 
ATOM   6931 C  CG  . GLU B 1 350 ? -19.937 0.868   33.857  1.00 85.96  ? 350 GLU B CG  1 
ATOM   6932 C  CD  . GLU B 1 350 ? -21.443 0.996   34.044  1.00 99.96  ? 350 GLU B CD  1 
ATOM   6933 O  OE1 . GLU B 1 350 ? -22.167 -0.025  33.954  1.00 104.88 ? 350 GLU B OE1 1 
ATOM   6934 O  OE2 . GLU B 1 350 ? -21.903 2.131   34.288  1.00 106.19 1 350 GLU B OE2 1 
ATOM   6935 N  N   . ASP B 1 351 ? -17.353 -1.501  35.158  1.00 65.35  ? 351 ASP B N   1 
ATOM   6936 C  CA  . ASP B 1 351 ? -16.567 -1.509  36.388  1.00 64.68  ? 351 ASP B CA  1 
ATOM   6937 C  C   . ASP B 1 351 ? -15.063 -1.550  36.102  1.00 57.35  ? 351 ASP B C   1 
ATOM   6938 O  O   . ASP B 1 351 ? -14.268 -0.972  36.856  1.00 61.98  ? 351 ASP B O   1 
ATOM   6939 C  CB  . ASP B 1 351 ? -16.991 -2.694  37.266  1.00 62.41  ? 351 ASP B CB  1 
ATOM   6940 C  CG  . ASP B 1 351 ? -18.277 -2.429  38.054  1.00 60.50  ? 351 ASP B CG  1 
ATOM   6941 O  OD1 . ASP B 1 351 ? -18.704 -1.253  38.154  1.00 54.92  ? 351 ASP B OD1 1 
ATOM   6942 O  OD2 . ASP B 1 351 ? -18.831 -3.412  38.604  1.00 43.82  1 351 ASP B OD2 1 
ATOM   6943 N  N   . PHE B 1 352 ? -14.658 -2.222  35.023  1.00 58.43  ? 352 PHE B N   1 
ATOM   6944 C  CA  . PHE B 1 352 ? -13.252 -2.223  34.609  1.00 48.67  ? 352 PHE B CA  1 
ATOM   6945 C  C   . PHE B 1 352 ? -12.777 -0.814  34.266  1.00 44.25  ? 352 PHE B C   1 
ATOM   6946 O  O   . PHE B 1 352 ? -11.776 -0.338  34.799  1.00 38.80  ? 352 PHE B O   1 
ATOM   6947 C  CB  . PHE B 1 352 ? -13.063 -3.163  33.409  1.00 41.38  ? 352 PHE B CB  1 
ATOM   6948 C  CG  . PHE B 1 352 ? -11.658 -3.230  32.907  1.00 48.87  ? 352 PHE B CG  1 
ATOM   6949 C  CD1 . PHE B 1 352 ? -11.238 -2.417  31.861  1.00 52.26  ? 352 PHE B CD1 1 
ATOM   6950 C  CD2 . PHE B 1 352 ? -10.745 -4.110  33.479  1.00 50.22  ? 352 PHE B CD2 1 
ATOM   6951 C  CE1 . PHE B 1 352 ? -9.918  -2.472  31.406  1.00 52.05  ? 352 PHE B CE1 1 
ATOM   6952 C  CE2 . PHE B 1 352 ? -9.430  -4.178  33.020  1.00 45.74  ? 352 PHE B CE2 1 
ATOM   6953 C  CZ  . PHE B 1 352 ? -9.014  -3.357  31.983  1.00 39.48  ? 352 PHE B CZ  1 
ATOM   6954 N  N   . MET B 1 353 ? -13.477 -0.134  33.363  1.00 56.65  ? 353 MET B N   1 
ATOM   6955 C  CA  . MET B 1 353 ? -13.110 1.243   33.061  1.00 52.14  ? 353 MET B CA  1 
ATOM   6956 C  C   . MET B 1 353 ? -12.989 2.070   34.336  1.00 45.62  ? 353 MET B C   1 
ATOM   6957 O  O   . MET B 1 353 ? -11.970 2.731   34.556  1.00 47.40  ? 353 MET B O   1 
ATOM   6958 C  CB  . MET B 1 353 ? -14.117 1.848   32.080  1.00 55.01  ? 353 MET B CB  1 
ATOM   6959 C  CG  . MET B 1 353 ? -14.046 1.217   30.673  1.00 69.08  ? 353 MET B CG  1 
ATOM   6960 S  SD  . MET B 1 353 ? -15.189 1.968   29.474  1.00 86.03  ? 353 MET B SD  1 
ATOM   6961 C  CE  . MET B 1 353 ? -16.571 0.805   29.445  1.00 74.20  ? 353 MET B CE  1 
ATOM   6962 N  N   . SER B 1 354 ? -14.001 2.000   35.215  1.00 49.23  ? 354 SER B N   1 
ATOM   6963 C  CA  . SER B 1 354 ? -13.966 2.746   36.478  1.00 51.82  ? 354 SER B CA  1 
ATOM   6964 C  C   . SER B 1 354 ? -12.735 2.406   37.305  1.00 54.10  ? 354 SER B C   1 
ATOM   6965 O  O   . SER B 1 354 ? -12.099 3.300   37.875  1.00 62.40  ? 354 SER B O   1 
ATOM   6966 C  CB  . SER B 1 354 ? -15.224 2.479   37.307  1.00 50.75  ? 354 SER B CB  1 
ATOM   6967 O  OG  . SER B 1 354 ? -16.279 3.363   36.965  1.00 49.93  ? 354 SER B OG  1 
ATOM   6968 N  N   . GLY B 1 355 ? -12.394 1.119   37.397  1.00 49.67  ? 355 GLY B N   1 
ATOM   6969 C  CA  . GLY B 1 355 ? -11.175 0.727   38.090  1.00 44.41  ? 355 GLY B CA  1 
ATOM   6970 C  C   . GLY B 1 355 ? -9.913  1.350   37.512  1.00 44.27  ? 355 GLY B C   1 
ATOM   6971 O  O   . GLY B 1 355 ? -9.003  1.723   38.254  1.00 54.88  ? 355 GLY B O   1 
ATOM   6972 N  N   . VAL B 1 356 ? -9.829  1.465   36.184  1.00 36.28  ? 356 VAL B N   1 
ATOM   6973 C  CA  . VAL B 1 356 ? -8.630  2.042   35.579  1.00 35.83  ? 356 VAL B CA  1 
ATOM   6974 C  C   . VAL B 1 356 ? -8.466  3.491   36.011  1.00 38.15  ? 356 VAL B C   1 
ATOM   6975 O  O   . VAL B 1 356 ? -7.354  3.937   36.313  1.00 42.98  ? 356 VAL B O   1 
ATOM   6976 C  CB  . VAL B 1 356 ? -8.670  1.900   34.043  1.00 44.15  ? 356 VAL B CB  1 
ATOM   6977 C  CG1 . VAL B 1 356 ? -7.503  2.639   33.376  1.00 36.62  ? 356 VAL B CG1 1 
ATOM   6978 C  CG2 . VAL B 1 356 ? -8.651  0.440   33.651  1.00 44.04  ? 356 VAL B CG2 1 
ATOM   6979 N  N   . LYS B 1 357 ? -9.572  4.245   36.076  1.00 40.35  ? 357 LYS B N   1 
ATOM   6980 C  CA  . LYS B 1 357 ? -9.486  5.635   36.526  1.00 47.30  ? 357 LYS B CA  1 
ATOM   6981 C  C   . LYS B 1 357 ? -9.091  5.720   37.998  1.00 45.25  ? 357 LYS B C   1 
ATOM   6982 O  O   . LYS B 1 357 ? -8.331  6.614   38.392  1.00 55.39  ? 357 LYS B O   1 
ATOM   6983 C  CB  . LYS B 1 357 ? -10.813 6.368   36.283  1.00 50.97  ? 357 LYS B CB  1 
ATOM   6984 C  CG  . LYS B 1 357 ? -10.716 7.892   36.511  1.00 49.45  ? 357 LYS B CG  1 
ATOM   6985 C  CD  . LYS B 1 357 ? -11.243 8.718   35.339  1.00 53.11  ? 357 LYS B CD  1 
ATOM   6986 C  CE  . LYS B 1 357 ? -10.816 10.201  35.409  1.00 63.59  ? 357 LYS B CE  1 
ATOM   6987 N  NZ  . LYS B 1 357 ? -9.394  10.479  34.954  1.00 67.45  1 357 LYS B NZ  1 
ATOM   6988 N  N   . LEU B 1 358 ? -9.590  4.794   38.825  1.00 40.16  ? 358 LEU B N   1 
ATOM   6989 C  CA  . LEU B 1 358 ? -9.232  4.790   40.245  1.00 50.90  ? 358 LEU B CA  1 
ATOM   6990 C  C   . LEU B 1 358 ? -7.789  4.356   40.472  1.00 52.58  ? 358 LEU B C   1 
ATOM   6991 O  O   . LEU B 1 358 ? -7.186  4.716   41.492  1.00 49.82  ? 358 LEU B O   1 
ATOM   6992 C  CB  . LEU B 1 358 ? -10.168 3.864   41.012  1.00 41.65  ? 358 LEU B CB  1 
ATOM   6993 C  CG  . LEU B 1 358 ? -11.557 4.412   41.303  1.00 37.35  ? 358 LEU B CG  1 
ATOM   6994 C  CD1 . LEU B 1 358 ? -12.338 3.352   42.043  1.00 37.88  ? 358 LEU B CD1 1 
ATOM   6995 C  CD2 . LEU B 1 358 ? -11.461 5.700   42.107  1.00 34.11  ? 358 LEU B CD2 1 
ATOM   6996 N  N   . SER B 1 359 ? -7.246  3.557   39.550  1.00 45.70  ? 359 SER B N   1 
ATOM   6997 C  CA  . SER B 1 359 ? -5.891  3.049   39.666  1.00 39.18  ? 359 SER B CA  1 
ATOM   6998 C  C   . SER B 1 359 ? -4.892  4.050   39.127  1.00 52.67  ? 359 SER B C   1 
ATOM   6999 O  O   . SER B 1 359 ? -3.783  4.176   39.658  1.00 57.53  ? 359 SER B O   1 
ATOM   7000 C  CB  . SER B 1 359 ? -5.758  1.731   38.915  1.00 36.51  ? 359 SER B CB  1 
ATOM   7001 O  OG  . SER B 1 359 ? -6.485  0.718   39.564  1.00 33.54  ? 359 SER B OG  1 
ATOM   7002 N  N   . VAL B 1 360 ? -5.271  4.789   38.092  1.00 52.40  ? 360 VAL B N   1 
ATOM   7003 C  CA  . VAL B 1 360 ? -4.379  5.807   37.552  1.00 51.24  ? 360 VAL B CA  1 
ATOM   7004 C  C   . VAL B 1 360 ? -5.109  7.138   37.751  1.00 48.60  ? 360 VAL B C   1 
ATOM   7005 O  O   . VAL B 1 360 ? -5.523  7.761   36.761  1.00 46.66  ? 360 VAL B O   1 
ATOM   7006 C  CB  . VAL B 1 360 ? -4.002  5.491   36.081  1.00 43.27  ? 360 VAL B CB  1 
ATOM   7007 C  CG1 . VAL B 1 360 ? -3.266  6.642   35.461  1.00 38.87  ? 360 VAL B CG1 1 
ATOM   7008 C  CG2 . VAL B 1 360 ? -3.179  4.201   35.984  1.00 32.78  ? 360 VAL B CG2 1 
ATOM   7009 N  N   . PRO B 1 361 ? -5.314  7.585   39.000  1.00 39.74  ? 361 PRO B N   1 
ATOM   7010 C  CA  . PRO B 1 361 ? -5.946  8.878   39.245  1.00 34.83  ? 361 PRO B CA  1 
ATOM   7011 C  C   . PRO B 1 361 ? -5.389  10.019  38.414  1.00 47.50  ? 361 PRO B C   1 
ATOM   7012 O  O   . PRO B 1 361 ? -6.150  10.897  37.988  1.00 62.74  ? 361 PRO B O   1 
ATOM   7013 C  CB  . PRO B 1 361 ? -5.651  9.106   40.723  1.00 44.77  ? 361 PRO B CB  1 
ATOM   7014 C  CG  . PRO B 1 361 ? -4.623  8.069   41.094  1.00 47.37  ? 361 PRO B CG  1 
ATOM   7015 C  CD  . PRO B 1 361 ? -4.950  6.930   40.249  1.00 38.61  ? 361 PRO B CD  1 
ATOM   7016 N  N   . HIS B 1 362 ? -4.085  10.047  38.186  1.00 58.65  ? 362 HIS B N   1 
ATOM   7017 C  CA  . HIS B 1 362 ? -3.376  11.220  37.691  1.00 66.79  ? 362 HIS B CA  1 
ATOM   7018 C  C   . HIS B 1 362 ? -3.346  11.369  36.162  1.00 70.89  ? 362 HIS B C   1 
ATOM   7019 O  O   . HIS B 1 362 ? -2.760  12.342  35.671  1.00 72.31  ? 362 HIS B O   1 
ATOM   7020 C  CB  . HIS B 1 362 ? -1.938  11.181  38.206  1.00 70.34  ? 362 HIS B CB  1 
ATOM   7021 C  CG  . HIS B 1 362 ? -1.224  9.907   37.875  1.00 78.34  ? 362 HIS B CG  1 
ATOM   7022 N  ND1 . HIS B 1 362 ? -1.502  8.714   38.509  1.00 79.35  ? 362 HIS B ND1 1 
ATOM   7023 C  CD2 . HIS B 1 362 ? -0.264  9.634   36.959  1.00 79.45  ? 362 HIS B CD2 1 
ATOM   7024 C  CE1 . HIS B 1 362 ? -0.735  7.763   38.004  1.00 81.31  ? 362 HIS B CE1 1 
ATOM   7025 N  NE2 . HIS B 1 362 ? 0.024   8.294   37.062  1.00 79.01  ? 362 HIS B NE2 1 
ATOM   7026 N  N   . ALA B 1 363 ? -3.945  10.465  35.385  1.00 62.68  ? 363 ALA B N   1 
ATOM   7027 C  CA  . ALA B 1 363 ? -3.772  10.521  33.939  1.00 54.74  ? 363 ALA B CA  1 
ATOM   7028 C  C   . ALA B 1 363 ? -4.961  11.159  33.244  1.00 58.66  ? 363 ALA B C   1 
ATOM   7029 O  O   . ALA B 1 363 ? -6.106  11.046  33.690  1.00 52.99  ? 363 ALA B O   1 
ATOM   7030 C  CB  . ALA B 1 363 ? -3.549  9.135   33.334  1.00 45.79  ? 363 ALA B CB  1 
ATOM   7031 N  N   . ASN B 1 364 ? -4.658  11.832  32.133  1.00 65.56  ? 364 ASN B N   1 
ATOM   7032 C  CA  . ASN B 1 364 ? -5.646  12.235  31.148  1.00 58.25  ? 364 ASN B CA  1 
ATOM   7033 C  C   . ASN B 1 364 ? -6.176  10.997  30.430  1.00 52.12  ? 364 ASN B C   1 
ATOM   7034 O  O   . ASN B 1 364 ? -5.745  9.862   30.675  1.00 47.16  ? 364 ASN B O   1 
ATOM   7035 C  CB  . ASN B 1 364 ? -5.032  13.224  30.161  1.00 58.96  ? 364 ASN B CB  1 
ATOM   7036 C  CG  . ASN B 1 364 ? -3.653  12.786  29.672  1.00 62.09  ? 364 ASN B CG  1 
ATOM   7037 O  OD1 . ASN B 1 364 ? -3.537  11.976  28.755  1.00 62.68  ? 364 ASN B OD1 1 
ATOM   7038 N  ND2 . ASN B 1 364 ? -2.604  13.333  30.278  1.00 72.10  ? 364 ASN B ND2 1 
ATOM   7039 N  N   . ASP B 1 365 ? -7.118  11.216  29.516  1.00 56.43  ? 365 ASP B N   1 
ATOM   7040 C  CA  . ASP B 1 365 ? -7.813  10.079  28.929  1.00 61.59  ? 365 ASP B CA  1 
ATOM   7041 C  C   . ASP B 1 365 ? -6.994  9.379   27.865  1.00 56.59  ? 365 ASP B C   1 
ATOM   7042 O  O   . ASP B 1 365 ? -7.162  8.172   27.664  1.00 58.59  ? 365 ASP B O   1 
ATOM   7043 C  CB  . ASP B 1 365 ? -9.168  10.522  28.389  1.00 61.67  ? 365 ASP B CB  1 
ATOM   7044 C  CG  . ASP B 1 365 ? -10.102 10.941  29.499  1.00 79.01  ? 365 ASP B CG  1 
ATOM   7045 O  OD1 . ASP B 1 365 ? -9.598  11.306  30.586  1.00 87.47  ? 365 ASP B OD1 1 
ATOM   7046 O  OD2 . ASP B 1 365 ? -11.332 10.873  29.306  1.00 88.15  1 365 ASP B OD2 1 
ATOM   7047 N  N   . LEU B 1 366 ? -6.094  10.096  27.200  1.00 53.74  ? 366 LEU B N   1 
ATOM   7048 C  CA  . LEU B 1 366 ? -5.081  9.408   26.416  1.00 48.22  ? 366 LEU B CA  1 
ATOM   7049 C  C   . LEU B 1 366 ? -4.322  8.421   27.288  1.00 52.76  ? 366 LEU B C   1 
ATOM   7050 O  O   . LEU B 1 366 ? -4.014  7.304   26.855  1.00 55.39  ? 366 LEU B O   1 
ATOM   7051 C  CB  . LEU B 1 366 ? -4.119  10.414  25.795  1.00 52.54  ? 366 LEU B CB  1 
ATOM   7052 C  CG  . LEU B 1 366 ? -3.330  9.742   24.685  1.00 57.21  ? 366 LEU B CG  1 
ATOM   7053 C  CD1 . LEU B 1 366 ? -4.284  9.478   23.533  1.00 47.26  ? 366 LEU B CD1 1 
ATOM   7054 C  CD2 . LEU B 1 366 ? -2.152  10.590  24.264  1.00 69.46  ? 366 LEU B CD2 1 
ATOM   7055 N  N   . GLY B 1 367 ? -4.031  8.818   28.532  1.00 55.65  ? 367 GLY B N   1 
ATOM   7056 C  CA  . GLY B 1 367 ? -3.414  7.902   29.478  1.00 45.42  ? 367 GLY B CA  1 
ATOM   7057 C  C   . GLY B 1 367 ? -4.248  6.659   29.724  1.00 51.77  ? 367 GLY B C   1 
ATOM   7058 O  O   . GLY B 1 367 ? -3.741  5.536   29.655  1.00 51.89  ? 367 GLY B O   1 
ATOM   7059 N  N   . LEU B 1 368 ? -5.546  6.833   30.016  1.00 51.28  ? 368 LEU B N   1 
ATOM   7060 C  CA  . LEU B 1 368 ? -6.314  5.657   30.415  1.00 53.02  ? 368 LEU B CA  1 
ATOM   7061 C  C   . LEU B 1 368 ? -6.692  4.790   29.235  1.00 39.39  ? 368 LEU B C   1 
ATOM   7062 O  O   . LEU B 1 368 ? -6.878  3.577   29.403  1.00 39.32  ? 368 LEU B O   1 
ATOM   7063 C  CB  . LEU B 1 368 ? -7.580  6.028   31.189  1.00 50.87  ? 368 LEU B CB  1 
ATOM   7064 C  CG  . LEU B 1 368 ? -7.412  7.017   32.336  1.00 51.94  ? 368 LEU B CG  1 
ATOM   7065 C  CD1 . LEU B 1 368 ? -8.255  8.256   32.088  1.00 46.48  ? 368 LEU B CD1 1 
ATOM   7066 C  CD2 . LEU B 1 368 ? -7.712  6.371   33.655  1.00 56.18  ? 368 LEU B CD2 1 
ATOM   7067 N  N   . ASP B 1 369 ? -6.829  5.384   28.050  1.00 50.35  ? 369 ASP B N   1 
ATOM   7068 C  CA  . ASP B 1 369 ? -6.978  4.559   26.856  1.00 55.86  ? 369 ASP B CA  1 
ATOM   7069 C  C   . ASP B 1 369 ? -5.757  3.672   26.674  1.00 53.59  ? 369 ASP B C   1 
ATOM   7070 O  O   . ASP B 1 369 ? -5.880  2.475   26.376  1.00 44.48  ? 369 ASP B O   1 
ATOM   7071 C  CB  . ASP B 1 369 ? -7.210  5.433   25.626  1.00 63.78  ? 369 ASP B CB  1 
ATOM   7072 C  CG  . ASP B 1 369 ? -8.527  6.190   25.692  1.00 76.68  ? 369 ASP B CG  1 
ATOM   7073 O  OD1 . ASP B 1 369 ? -9.440  5.708   26.402  1.00 71.50  ? 369 ASP B OD1 1 
ATOM   7074 O  OD2 . ASP B 1 369 ? -8.668  7.234   25.006  1.00 87.28  1 369 ASP B OD2 1 
ATOM   7075 N  N   . ALA B 1 370 ? -4.569  4.243   26.897  1.00 52.27  ? 370 ALA B N   1 
ATOM   7076 C  CA  . ALA B 1 370 ? -3.334  3.475   26.853  1.00 42.06  ? 370 ALA B CA  1 
ATOM   7077 C  C   . ALA B 1 370 ? -3.380  2.299   27.822  1.00 43.26  ? 370 ALA B C   1 
ATOM   7078 O  O   . ALA B 1 370 ? -3.155  1.150   27.424  1.00 47.58  ? 370 ALA B O   1 
ATOM   7079 C  CB  . ALA B 1 370 ? -2.147  4.393   27.151  1.00 39.35  ? 370 ALA B CB  1 
ATOM   7080 N  N   . VAL B 1 371 ? -3.696  2.564   29.098  1.00 43.55  ? 371 VAL B N   1 
ATOM   7081 C  CA  . VAL B 1 371 ? -3.740  1.491   30.099  1.00 44.94  ? 371 VAL B CA  1 
ATOM   7082 C  C   . VAL B 1 371 ? -4.774  0.443   29.711  1.00 51.02  ? 371 VAL B C   1 
ATOM   7083 O  O   . VAL B 1 371 ? -4.507  -0.768  29.757  1.00 43.24  ? 371 VAL B O   1 
ATOM   7084 C  CB  . VAL B 1 371 ? -4.032  2.049   31.505  1.00 36.35  ? 371 VAL B CB  1 
ATOM   7085 C  CG1 . VAL B 1 371 ? -4.023  0.916   32.517  1.00 35.66  ? 371 VAL B CG1 1 
ATOM   7086 C  CG2 . VAL B 1 371 ? -3.047  3.140   31.893  1.00 35.62  ? 371 VAL B CG2 1 
ATOM   7087 N  N   . THR B 1 372 ? -5.979  0.900   29.339  1.00 53.67  ? 372 THR B N   1 
ATOM   7088 C  CA  . THR B 1 372 ? -7.038  -0.007  28.903  1.00 51.52  ? 372 THR B CA  1 
ATOM   7089 C  C   . THR B 1 372 ? -6.592  -0.866  27.730  1.00 49.52  ? 372 THR B C   1 
ATOM   7090 O  O   . THR B 1 372 ? -6.722  -2.095  27.768  1.00 41.23  ? 372 THR B O   1 
ATOM   7091 C  CB  . THR B 1 372 ? -8.284  0.779   28.509  1.00 46.45  ? 372 THR B CB  1 
ATOM   7092 O  OG1 . THR B 1 372 ? -8.576  1.746   29.519  1.00 49.96  ? 372 THR B OG1 1 
ATOM   7093 C  CG2 . THR B 1 372 ? -9.463  -0.157  28.331  1.00 42.02  ? 372 THR B CG2 1 
ATOM   7094 N  N   . LEU B 1 373 ? -6.075  -0.228  26.671  1.00 48.69  ? 373 LEU B N   1 
ATOM   7095 C  CA  . LEU B 1 373 ? -5.716  -0.964  25.463  1.00 61.44  ? 373 LEU B CA  1 
ATOM   7096 C  C   . LEU B 1 373 ? -4.721  -2.061  25.779  1.00 58.40  ? 373 LEU B C   1 
ATOM   7097 O  O   . LEU B 1 373 ? -4.732  -3.129  25.152  1.00 66.69  ? 373 LEU B O   1 
ATOM   7098 C  CB  . LEU B 1 373 ? -5.141  -0.006  24.412  1.00 62.32  ? 373 LEU B CB  1 
ATOM   7099 C  CG  . LEU B 1 373 ? -4.159  -0.537  23.362  1.00 52.95  ? 373 LEU B CG  1 
ATOM   7100 C  CD1 . LEU B 1 373 ? -4.881  -1.427  22.375  1.00 48.08  ? 373 LEU B CD1 1 
ATOM   7101 C  CD2 . LEU B 1 373 ? -3.472  0.610   22.651  1.00 62.40  ? 373 LEU B CD2 1 
ATOM   7102 N  N   . GLN B 1 374 ? -3.899  -1.839  26.786  1.00 43.61  ? 374 GLN B N   1 
ATOM   7103 C  CA  . GLN B 1 374 ? -2.751  -2.683  26.983  1.00 44.42  ? 374 GLN B CA  1 
ATOM   7104 C  C   . GLN B 1 374 ? -3.010  -3.794  27.992  1.00 39.70  ? 374 GLN B C   1 
ATOM   7105 O  O   . GLN B 1 374 ? -2.242  -4.754  28.038  1.00 39.62  ? 374 GLN B O   1 
ATOM   7106 C  CB  . GLN B 1 374 ? -1.563  -1.792  27.363  1.00 47.31  ? 374 GLN B CB  1 
ATOM   7107 C  CG  . GLN B 1 374 ? -0.356  -2.500  27.798  1.00 56.77  ? 374 GLN B CG  1 
ATOM   7108 C  CD  . GLN B 1 374 ? 0.738   -2.408  26.783  1.00 67.02  ? 374 GLN B CD  1 
ATOM   7109 O  OE1 . GLN B 1 374 ? 0.546   -1.842  25.703  1.00 76.21  ? 374 GLN B OE1 1 
ATOM   7110 N  NE2 . GLN B 1 374 ? 1.890   -2.994  27.099  1.00 65.30  ? 374 GLN B NE2 1 
ATOM   7111 N  N   . TYR B 1 375 ? -4.112  -3.740  28.743  1.00 39.50  ? 375 TYR B N   1 
ATOM   7112 C  CA  . TYR B 1 375 ? -4.488  -4.822  29.656  1.00 39.74  ? 375 TYR B CA  1 
ATOM   7113 C  C   . TYR B 1 375 ? -5.763  -5.562  29.223  1.00 47.37  ? 375 TYR B C   1 
ATOM   7114 O  O   . TYR B 1 375 ? -6.311  -6.349  29.996  1.00 51.50  ? 375 TYR B O   1 
ATOM   7115 C  CB  . TYR B 1 375 ? -4.622  -4.280  31.087  1.00 37.96  ? 375 TYR B CB  1 
ATOM   7116 C  CG  . TYR B 1 375 ? -3.279  -4.093  31.763  1.00 42.67  ? 375 TYR B CG  1 
ATOM   7117 C  CD1 . TYR B 1 375 ? -2.705  -5.131  32.496  1.00 36.32  ? 375 TYR B CD1 1 
ATOM   7118 C  CD2 . TYR B 1 375 ? -2.561  -2.903  31.640  1.00 42.68  ? 375 TYR B CD2 1 
ATOM   7119 C  CE1 . TYR B 1 375 ? -1.473  -4.994  33.101  1.00 35.38  ? 375 TYR B CE1 1 
ATOM   7120 C  CE2 . TYR B 1 375 ? -1.321  -2.756  32.244  1.00 41.53  ? 375 TYR B CE2 1 
ATOM   7121 C  CZ  . TYR B 1 375 ? -0.788  -3.807  32.980  1.00 44.54  ? 375 TYR B CZ  1 
ATOM   7122 O  OH  . TYR B 1 375 ? 0.443   -3.684  33.591  1.00 42.82  ? 375 TYR B OH  1 
ATOM   7123 N  N   . THR B 1 376 ? -6.208  -5.363  27.985  1.00 54.80  ? 376 THR B N   1 
ATOM   7124 C  CA  . THR B 1 376 ? -7.450  -5.909  27.455  1.00 53.00  ? 376 THR B CA  1 
ATOM   7125 C  C   . THR B 1 376 ? -7.192  -6.964  26.396  1.00 62.57  ? 376 THR B C   1 
ATOM   7126 O  O   . THR B 1 376 ? -6.293  -6.813  25.567  1.00 76.62  ? 376 THR B O   1 
ATOM   7127 C  CB  . THR B 1 376 ? -8.281  -4.792  26.833  1.00 52.69  ? 376 THR B CB  1 
ATOM   7128 O  OG1 . THR B 1 376 ? -8.297  -3.678  27.724  1.00 59.23  ? 376 THR B OG1 1 
ATOM   7129 C  CG2 . THR B 1 376 ? -9.690  -5.257  26.511  1.00 44.95  ? 376 THR B CG2 1 
ATOM   7130 N  N   . ASP B 1 377 ? -7.993  -8.017  26.415  1.00 57.47  ? 377 ASP B N   1 
ATOM   7131 C  CA  . ASP B 1 377 ? -8.103  -8.928  25.284  1.00 60.90  ? 377 ASP B CA  1 
ATOM   7132 C  C   . ASP B 1 377 ? -9.371  -8.539  24.537  1.00 65.29  ? 377 ASP B C   1 
ATOM   7133 O  O   . ASP B 1 377 ? -10.481 -8.691  25.060  1.00 60.91  ? 377 ASP B O   1 
ATOM   7134 C  CB  . ASP B 1 377 ? -8.137  -10.389 25.726  1.00 62.70  ? 377 ASP B CB  1 
ATOM   7135 C  CG  . ASP B 1 377 ? -8.386  -11.342 24.570  1.00 70.62  ? 377 ASP B CG  1 
ATOM   7136 O  OD1 . ASP B 1 377 ? -8.181  -10.941 23.409  1.00 79.30  ? 377 ASP B OD1 1 
ATOM   7137 O  OD2 . ASP B 1 377 ? -8.780  -12.500 24.822  1.00 71.68  1 377 ASP B OD2 1 
ATOM   7138 N  N   . TRP B 1 378 ? -9.203  -8.015  23.327  1.00 57.28  ? 378 TRP B N   1 
ATOM   7139 C  CA  . TRP B 1 378 ? -10.344 -7.515  22.585  1.00 49.95  ? 378 TRP B CA  1 
ATOM   7140 C  C   . TRP B 1 378 ? -11.090 -8.611  21.838  1.00 59.37  ? 378 TRP B C   1 
ATOM   7141 O  O   . TRP B 1 378 ? -12.199 -8.363  21.350  1.00 62.52  ? 378 TRP B O   1 
ATOM   7142 C  CB  . TRP B 1 378 ? -9.881  -6.408  21.645  1.00 52.83  ? 378 TRP B CB  1 
ATOM   7143 C  CG  . TRP B 1 378 ? -9.650  -5.139  22.384  1.00 53.26  ? 378 TRP B CG  1 
ATOM   7144 C  CD1 . TRP B 1 378 ? -8.449  -4.554  22.674  1.00 59.79  ? 378 TRP B CD1 1 
ATOM   7145 C  CD2 . TRP B 1 378 ? -10.653 -4.303  22.962  1.00 58.08  ? 378 TRP B CD2 1 
ATOM   7146 N  NE1 . TRP B 1 378 ? -8.644  -3.395  23.390  1.00 63.95  ? 378 TRP B NE1 1 
ATOM   7147 C  CE2 . TRP B 1 378 ? -9.989  -3.217  23.581  1.00 62.96  ? 378 TRP B CE2 1 
ATOM   7148 C  CE3 . TRP B 1 378 ? -12.053 -4.360  23.012  1.00 64.80  ? 378 TRP B CE3 1 
ATOM   7149 C  CZ2 . TRP B 1 378 ? -10.676 -2.199  24.242  1.00 71.09  ? 378 TRP B CZ2 1 
ATOM   7150 C  CZ3 . TRP B 1 378 ? -12.734 -3.349  23.673  1.00 73.15  ? 378 TRP B CZ3 1 
ATOM   7151 C  CH2 . TRP B 1 378 ? -12.044 -2.283  24.282  1.00 75.49  ? 378 TRP B CH2 1 
ATOM   7152 N  N   . MET B 1 379 ? -10.530 -9.817  21.763  1.00 59.26  ? 379 MET B N   1 
ATOM   7153 C  CA  . MET B 1 379 ? -11.295 -10.965 21.298  1.00 65.59  ? 379 MET B CA  1 
ATOM   7154 C  C   . MET B 1 379 ? -12.373 -11.373 22.289  1.00 62.40  ? 379 MET B C   1 
ATOM   7155 O  O   . MET B 1 379 ? -13.210 -12.219 21.958  1.00 61.48  ? 379 MET B O   1 
ATOM   7156 C  CB  . MET B 1 379 ? -10.365 -12.148 21.066  1.00 65.49  ? 379 MET B CB  1 
ATOM   7157 C  CG  . MET B 1 379 ? -9.189  -11.861 20.188  1.00 69.68  ? 379 MET B CG  1 
ATOM   7158 S  SD  . MET B 1 379 ? -8.573  -13.364 19.436  1.00 81.97  ? 379 MET B SD  1 
ATOM   7159 C  CE  . MET B 1 379 ? -6.936  -13.416 20.145  1.00 66.44  ? 379 MET B CE  1 
ATOM   7160 N  N   . ASP B 1 380 ? -12.370 -10.782 23.484  1.00 68.78  ? 380 ASP B N   1 
ATOM   7161 C  CA  . ASP B 1 380 ? -13.092 -11.294 24.641  1.00 70.45  ? 380 ASP B CA  1 
ATOM   7162 C  C   . ASP B 1 380 ? -13.067 -10.249 25.748  1.00 69.61  ? 380 ASP B C   1 
ATOM   7163 O  O   . ASP B 1 380 ? -12.542 -10.510 26.832  1.00 77.89  ? 380 ASP B O   1 
ATOM   7164 C  CB  . ASP B 1 380 ? -12.450 -12.606 25.108  1.00 69.49  ? 380 ASP B CB  1 
ATOM   7165 C  CG  . ASP B 1 380 ? -13.279 -13.341 26.141  1.00 68.80  ? 380 ASP B CG  1 
ATOM   7166 O  OD1 . ASP B 1 380 ? -14.495 -13.060 26.252  1.00 81.62  ? 380 ASP B OD1 1 
ATOM   7167 O  OD2 . ASP B 1 380 ? -12.713 -14.226 26.821  1.00 55.40  1 380 ASP B OD2 1 
ATOM   7168 N  N   . ASP B 1 381 ? -13.632 -9.065  25.488  1.00 65.87  ? 381 ASP B N   1 
ATOM   7169 C  CA  . ASP B 1 381 ? -13.521 -7.918  26.387  1.00 59.07  ? 381 ASP B CA  1 
ATOM   7170 C  C   . ASP B 1 381 ? -14.566 -7.901  27.508  1.00 63.07  ? 381 ASP B C   1 
ATOM   7171 O  O   . ASP B 1 381 ? -14.457 -7.086  28.431  1.00 53.74  ? 381 ASP B O   1 
ATOM   7172 C  CB  . ASP B 1 381 ? -13.605 -6.615  25.573  1.00 55.51  ? 381 ASP B CB  1 
ATOM   7173 C  CG  . ASP B 1 381 ? -14.891 -6.515  24.741  1.00 67.91  ? 381 ASP B CG  1 
ATOM   7174 O  OD1 . ASP B 1 381 ? -15.069 -7.331  23.804  1.00 68.04  ? 381 ASP B OD1 1 
ATOM   7175 O  OD2 . ASP B 1 381 ? -15.720 -5.610  25.015  1.00 71.84  1 381 ASP B OD2 1 
ATOM   7176 N  N   . ASN B 1 382 ? -15.573 -8.764  27.466  1.00 72.70  ? 382 ASN B N   1 
ATOM   7177 C  CA  . ASN B 1 382 ? -16.576 -8.814  28.521  1.00 74.96  ? 382 ASN B CA  1 
ATOM   7178 C  C   . ASN B 1 382 ? -16.561 -10.169 29.221  1.00 72.55  ? 382 ASN B C   1 
ATOM   7179 O  O   . ASN B 1 382 ? -17.607 -10.790 29.459  1.00 70.13  ? 382 ASN B O   1 
ATOM   7180 C  CB  . ASN B 1 382 ? -17.962 -8.478  27.971  1.00 75.78  ? 382 ASN B CB  1 
ATOM   7181 C  CG  . ASN B 1 382 ? -18.154 -6.986  27.764  1.00 72.95  ? 382 ASN B CG  1 
ATOM   7182 O  OD1 . ASN B 1 382 ? -17.901 -6.194  28.670  1.00 78.38  ? 382 ASN B OD1 1 
ATOM   7183 N  ND2 . ASN B 1 382 ? -18.626 -6.597  26.583  1.00 62.77  ? 382 ASN B ND2 1 
ATOM   7184 N  N   . ASN B 1 383 ? -15.357 -10.640 29.552  1.00 51.73  ? 383 ASN B N   1 
ATOM   7185 C  CA  . ASN B 1 383 ? -15.164 -11.850 30.342  1.00 53.92  ? 383 ASN B CA  1 
ATOM   7186 C  C   . ASN B 1 383 ? -14.722 -11.409 31.732  1.00 60.39  ? 383 ASN B C   1 
ATOM   7187 O  O   . ASN B 1 383 ? -13.581 -10.969 31.920  1.00 53.66  ? 383 ASN B O   1 
ATOM   7188 C  CB  . ASN B 1 383 ? -14.169 -12.792 29.654  1.00 54.55  ? 383 ASN B CB  1 
ATOM   7189 C  CG  . ASN B 1 383 ? -13.563 -13.876 30.586  1.00 62.54  ? 383 ASN B CG  1 
ATOM   7190 O  OD1 . ASN B 1 383 ? -13.663 -13.839 31.821  1.00 57.84  ? 383 ASN B OD1 1 
ATOM   7191 N  ND2 . ASN B 1 383 ? -13.014 -14.914 29.951  1.00 62.68  ? 383 ASN B ND2 1 
ATOM   7192 N  N   . GLY B 1 384 ? -15.639 -11.532 32.699  1.00 65.18  ? 384 GLY B N   1 
ATOM   7193 C  CA  . GLY B 1 384 ? -15.383 -11.021 34.039  1.00 69.27  ? 384 GLY B CA  1 
ATOM   7194 C  C   . GLY B 1 384 ? -14.035 -11.430 34.608  1.00 58.09  ? 384 GLY B C   1 
ATOM   7195 O  O   . GLY B 1 384 ? -13.313 -10.607 35.180  1.00 45.21  ? 384 GLY B O   1 
ATOM   7196 N  N   . ILE B 1 385 ? -13.673 -12.707 34.454  1.00 47.62  ? 385 ILE B N   1 
ATOM   7197 C  CA  . ILE B 1 385 ? -12.424 -13.188 35.031  1.00 44.35  ? 385 ILE B CA  1 
ATOM   7198 C  C   . ILE B 1 385 ? -11.243 -12.453 34.413  1.00 46.18  ? 385 ILE B C   1 
ATOM   7199 O  O   . ILE B 1 385 ? -10.368 -11.945 35.122  1.00 46.13  ? 385 ILE B O   1 
ATOM   7200 C  CB  . ILE B 1 385 ? -12.301 -14.710 34.864  1.00 50.02  ? 385 ILE B CB  1 
ATOM   7201 C  CG1 . ILE B 1 385 ? -13.270 -15.409 35.818  1.00 49.13  ? 385 ILE B CG1 1 
ATOM   7202 C  CG2 . ILE B 1 385 ? -10.858 -15.157 35.097  1.00 44.33  ? 385 ILE B CG2 1 
ATOM   7203 C  CD1 . ILE B 1 385 ? -13.254 -16.923 35.749  1.00 50.22  ? 385 ILE B CD1 1 
ATOM   7204 N  N   . LYS B 1 386 ? -11.217 -12.352 33.081  1.00 52.71  ? 386 LYS B N   1 
ATOM   7205 C  CA  . LYS B 1 386 ? -10.116 -11.644 32.430  1.00 51.39  ? 386 LYS B CA  1 
ATOM   7206 C  C   . LYS B 1 386 ? -10.078 -10.180 32.823  1.00 45.46  ? 386 LYS B C   1 
ATOM   7207 O  O   . LYS B 1 386 ? -8.990  -9.589  32.891  1.00 41.15  ? 386 LYS B O   1 
ATOM   7208 C  CB  . LYS B 1 386 ? -10.200 -11.775 30.906  1.00 48.87  ? 386 LYS B CB  1 
ATOM   7209 C  CG  . LYS B 1 386 ? -9.421  -12.947 30.327  1.00 45.13  ? 386 LYS B CG  1 
ATOM   7210 C  CD  . LYS B 1 386 ? -10.264 -13.704 29.334  1.00 57.22  ? 386 LYS B CD  1 
ATOM   7211 C  CE  . LYS B 1 386 ? -9.505  -14.116 28.071  1.00 58.30  ? 386 LYS B CE  1 
ATOM   7212 N  NZ  . LYS B 1 386 ? -10.446 -14.680 27.052  1.00 62.68  1 386 LYS B NZ  1 
ATOM   7213 N  N   . ASN B 1 387 ? -11.246 -9.578  33.076  1.00 42.86  ? 387 ASN B N   1 
ATOM   7214 C  CA  . ASN B 1 387 ? -11.265 -8.182  33.493  1.00 45.94  ? 387 ASN B CA  1 
ATOM   7215 C  C   . ASN B 1 387 ? -10.886 -8.023  34.949  1.00 42.26  ? 387 ASN B C   1 
ATOM   7216 O  O   . ASN B 1 387 ? -10.195 -7.064  35.303  1.00 48.42  ? 387 ASN B O   1 
ATOM   7217 C  CB  . ASN B 1 387 ? -12.630 -7.540  33.278  1.00 51.62  ? 387 ASN B CB  1 
ATOM   7218 C  CG  . ASN B 1 387 ? -13.053 -7.558  31.866  1.00 52.13  ? 387 ASN B CG  1 
ATOM   7219 O  OD1 . ASN B 1 387 ? -12.686 -6.675  31.101  1.00 57.04  ? 387 ASN B OD1 1 
ATOM   7220 N  ND2 . ASN B 1 387 ? -13.872 -8.529  31.507  1.00 54.01  ? 387 ASN B ND2 1 
ATOM   7221 N  N   . ARG B 1 388 ? -11.369 -8.911  35.815  1.00 45.35  ? 388 ARG B N   1 
ATOM   7222 C  CA  . ARG B 1 388 ? -11.019 -8.788  37.224  1.00 46.86  ? 388 ARG B CA  1 
ATOM   7223 C  C   . ARG B 1 388 ? -9.530  -8.994  37.394  1.00 43.36  ? 388 ARG B C   1 
ATOM   7224 O  O   . ARG B 1 388 ? -8.840  -8.184  38.024  1.00 46.17  ? 388 ARG B O   1 
ATOM   7225 C  CB  . ARG B 1 388 ? -11.829 -9.785  38.058  1.00 49.20  ? 388 ARG B CB  1 
ATOM   7226 C  CG  . ARG B 1 388 ? -11.424 -9.878  39.528  1.00 46.64  ? 388 ARG B CG  1 
ATOM   7227 C  CD  . ARG B 1 388 ? -11.626 -11.274 40.062  1.00 39.83  ? 388 ARG B CD  1 
ATOM   7228 N  NE  . ARG B 1 388 ? -10.611 -12.181 39.562  1.00 39.79  ? 388 ARG B NE  1 
ATOM   7229 C  CZ  . ARG B 1 388 ? -10.765 -13.491 39.397  1.00 42.40  ? 388 ARG B CZ  1 
ATOM   7230 N  NH1 . ARG B 1 388 ? -9.763  -14.211 38.926  1.00 40.73  1 388 ARG B NH1 1 
ATOM   7231 N  NH2 . ARG B 1 388 ? -11.919 -14.069 39.671  1.00 42.69  ? 388 ARG B NH2 1 
ATOM   7232 N  N   . ASP B 1 389 ? -9.014  -10.039 36.751  1.00 41.01  ? 389 ASP B N   1 
ATOM   7233 C  CA  . ASP B 1 389 ? -7.590  -10.329 36.746  1.00 40.12  ? 389 ASP B CA  1 
ATOM   7234 C  C   . ASP B 1 389 ? -6.757  -9.224  36.101  1.00 42.41  ? 389 ASP B C   1 
ATOM   7235 O  O   . ASP B 1 389 ? -5.638  -8.950  36.544  1.00 46.12  ? 389 ASP B O   1 
ATOM   7236 C  CB  . ASP B 1 389 ? -7.403  -11.657 36.042  1.00 39.14  ? 389 ASP B CB  1 
ATOM   7237 C  CG  . ASP B 1 389 ? -7.552  -12.807 36.979  1.00 49.20  ? 389 ASP B CG  1 
ATOM   7238 O  OD1 . ASP B 1 389 ? -7.480  -13.957 36.492  1.00 53.53  ? 389 ASP B OD1 1 
ATOM   7239 O  OD2 . ASP B 1 389 ? -7.604  -12.562 38.212  1.00 40.57  1 389 ASP B OD2 1 
ATOM   7240 N  N   . GLY B 1 390 ? -7.259  -8.600  35.039  1.00 41.07  ? 390 GLY B N   1 
ATOM   7241 C  CA  . GLY B 1 390 ? -6.488  -7.543  34.409  1.00 44.56  ? 390 GLY B CA  1 
ATOM   7242 C  C   . GLY B 1 390 ? -6.350  -6.331  35.306  1.00 43.16  ? 390 GLY B C   1 
ATOM   7243 O  O   . GLY B 1 390 ? -5.258  -5.772  35.452  1.00 42.00  ? 390 GLY B O   1 
ATOM   7244 N  N   . LEU B 1 391 ? -7.466  -5.901  35.906  1.00 48.15  ? 391 LEU B N   1 
ATOM   7245 C  CA  . LEU B 1 391 ? -7.428  -4.817  36.884  1.00 49.32  ? 391 LEU B CA  1 
ATOM   7246 C  C   . LEU B 1 391 ? -6.449  -5.119  38.021  1.00 47.59  ? 391 LEU B C   1 
ATOM   7247 O  O   . LEU B 1 391 ? -5.701  -4.238  38.460  1.00 34.16  ? 391 LEU B O   1 
ATOM   7248 C  CB  . LEU B 1 391 ? -8.830  -4.572  37.445  1.00 43.94  ? 391 LEU B CB  1 
ATOM   7249 C  CG  . LEU B 1 391 ? -9.422  -3.197  37.184  1.00 47.26  ? 391 LEU B CG  1 
ATOM   7250 C  CD1 . LEU B 1 391 ? -10.627 -3.046  37.989  1.00 44.00  ? 391 LEU B CD1 1 
ATOM   7251 C  CD2 . LEU B 1 391 ? -8.450  -2.121  37.486  1.00 51.50  ? 391 LEU B CD2 1 
ATOM   7252 N  N   . ASP B 1 392 ? -6.445  -6.361  38.514  1.00 46.93  ? 392 ASP B N   1 
ATOM   7253 C  CA  . ASP B 1 392 ? -5.545  -6.725  39.604  1.00 45.33  ? 392 ASP B CA  1 
ATOM   7254 C  C   . ASP B 1 392 ? -4.096  -6.528  39.172  1.00 40.84  ? 392 ASP B C   1 
ATOM   7255 O  O   . ASP B 1 392 ? -3.297  -5.934  39.911  1.00 32.22  ? 392 ASP B O   1 
ATOM   7256 C  CB  . ASP B 1 392 ? -5.856  -8.171  40.038  1.00 39.68  ? 392 ASP B CB  1 
ATOM   7257 C  CG  . ASP B 1 392 ? -4.873  -8.753  41.059  1.00 69.39  ? 392 ASP B CG  1 
ATOM   7258 O  OD1 . ASP B 1 392 ? -3.760  -8.220  41.309  1.00 84.78  ? 392 ASP B OD1 1 
ATOM   7259 O  OD2 . ASP B 1 392 ? -5.264  -9.760  41.687  1.00 76.61  1 392 ASP B OD2 1 
ATOM   7260 N  N   . ASP B 1 393 ? -3.765  -6.960  37.944  1.00 39.42  ? 393 ASP B N   1 
ATOM   7261 C  CA  . ASP B 1 393 ? -2.427  -6.754  37.393  1.00 36.11  ? 393 ASP B CA  1 
ATOM   7262 C  C   . ASP B 1 393 ? -2.120  -5.276  37.179  1.00 33.02  ? 393 ASP B C   1 
ATOM   7263 O  O   . ASP B 1 393 ? -1.000  -4.840  37.449  1.00 32.37  ? 393 ASP B O   1 
ATOM   7264 C  CB  . ASP B 1 393 ? -2.255  -7.526  36.087  1.00 37.41  ? 393 ASP B CB  1 
ATOM   7265 C  CG  . ASP B 1 393 ? -2.085  -9.033  36.302  1.00 43.97  ? 393 ASP B CG  1 
ATOM   7266 O  OD1 . ASP B 1 393 ? -1.752  -9.450  37.432  1.00 48.01  ? 393 ASP B OD1 1 
ATOM   7267 O  OD2 . ASP B 1 393 ? -2.259  -9.803  35.330  1.00 50.23  1 393 ASP B OD2 1 
ATOM   7268 N  N   . ILE B 1 394 ? -3.095  -4.479  36.722  1.00 39.67  ? 394 ILE B N   1 
ATOM   7269 C  CA  . ILE B 1 394 ? -2.874  -3.032  36.612  1.00 41.79  ? 394 ILE B CA  1 
ATOM   7270 C  C   . ILE B 1 394 ? -2.399  -2.454  37.942  1.00 47.95  ? 394 ILE B C   1 
ATOM   7271 O  O   . ILE B 1 394 ? -1.341  -1.812  38.022  1.00 50.36  ? 394 ILE B O   1 
ATOM   7272 C  CB  . ILE B 1 394 ? -4.145  -2.315  36.133  1.00 39.33  ? 394 ILE B CB  1 
ATOM   7273 C  CG1 . ILE B 1 394 ? -4.365  -2.588  34.648  1.00 50.23  ? 394 ILE B CG1 1 
ATOM   7274 C  CG2 . ILE B 1 394 ? -4.054  -0.822  36.416  1.00 33.23  ? 394 ILE B CG2 1 
ATOM   7275 C  CD1 . ILE B 1 394 ? -5.599  -1.942  34.086  1.00 35.69  ? 394 ILE B CD1 1 
ATOM   7276 N  N   . VAL B 1 395 ? -3.184  -2.674  39.006  1.00 37.65  ? 395 VAL B N   1 
ATOM   7277 C  CA  . VAL B 1 395 ? -2.860  -2.108  40.311  1.00 30.77  ? 395 VAL B CA  1 
ATOM   7278 C  C   . VAL B 1 395 ? -1.514  -2.625  40.794  1.00 30.12  ? 395 VAL B C   1 
ATOM   7279 O  O   . VAL B 1 395 ? -0.669  -1.849  41.254  1.00 33.91  ? 395 VAL B O   1 
ATOM   7280 C  CB  . VAL B 1 395 ? -3.978  -2.415  41.324  1.00 40.50  ? 395 VAL B CB  1 
ATOM   7281 C  CG1 . VAL B 1 395 ? -3.632  -1.838  42.724  1.00 31.56  ? 395 VAL B CG1 1 
ATOM   7282 C  CG2 . VAL B 1 395 ? -5.348  -1.909  40.809  1.00 33.45  ? 395 VAL B CG2 1 
ATOM   7283 N  N   . GLY B 1 396 ? -1.289  -3.941  40.682  1.00 30.42  ? 396 GLY B N   1 
ATOM   7284 C  CA  . GLY B 1 396 ? -0.044  -4.520  41.168  1.00 29.93  ? 396 GLY B CA  1 
ATOM   7285 C  C   . GLY B 1 396 ? 1.175   -4.021  40.410  1.00 44.77  ? 396 GLY B C   1 
ATOM   7286 O  O   . GLY B 1 396 ? 2.233   -3.769  41.001  1.00 40.15  ? 396 GLY B O   1 
ATOM   7287 N  N   . ASP B 1 397 ? 1.038   -3.856  39.091  1.00 39.62  ? 397 ASP B N   1 
ATOM   7288 C  CA  . ASP B 1 397 ? 2.147   -3.433  38.246  1.00 30.63  ? 397 ASP B CA  1 
ATOM   7289 C  C   . ASP B 1 397 ? 2.435   -1.954  38.393  1.00 34.89  ? 397 ASP B C   1 
ATOM   7290 O  O   . ASP B 1 397 ? 3.595   -1.545  38.529  1.00 35.21  ? 397 ASP B O   1 
ATOM   7291 C  CB  . ASP B 1 397 ? 1.838   -3.719  36.783  1.00 31.99  ? 397 ASP B CB  1 
ATOM   7292 C  CG  . ASP B 1 397 ? 1.838   -5.189  36.460  1.00 37.45  ? 397 ASP B CG  1 
ATOM   7293 O  OD1 . ASP B 1 397 ? 1.405   -5.520  35.333  1.00 40.06  ? 397 ASP B OD1 1 
ATOM   7294 O  OD2 . ASP B 1 397 ? 2.268   -6.006  37.320  1.00 33.02  1 397 ASP B OD2 1 
ATOM   7295 N  N   . HIS B 1 398 ? 1.398   -1.131  38.287  1.00 33.29  ? 398 HIS B N   1 
ATOM   7296 C  CA  . HIS B 1 398 ? 1.607   0.308   38.388  1.00 40.32  ? 398 HIS B CA  1 
ATOM   7297 C  C   . HIS B 1 398 ? 2.177   0.691   39.749  1.00 40.52  ? 398 HIS B C   1 
ATOM   7298 O  O   . HIS B 1 398 ? 3.076   1.540   39.839  1.00 48.84  ? 398 HIS B O   1 
ATOM   7299 C  CB  . HIS B 1 398 ? 0.297   1.045   38.115  1.00 30.45  ? 398 HIS B CB  1 
ATOM   7300 C  CG  . HIS B 1 398 ? 0.325   2.487   38.504  1.00 30.13  ? 398 HIS B CG  1 
ATOM   7301 N  ND1 . HIS B 1 398 ? 1.133   3.410   37.881  1.00 30.29  ? 398 HIS B ND1 1 
ATOM   7302 C  CD2 . HIS B 1 398 ? -0.355  3.167   39.456  1.00 29.76  ? 398 HIS B CD2 1 
ATOM   7303 C  CE1 . HIS B 1 398 ? 0.951   4.598   38.430  1.00 33.86  ? 398 HIS B CE1 1 
ATOM   7304 N  NE2 . HIS B 1 398 ? 0.047   4.480   39.385  1.00 34.35  ? 398 HIS B NE2 1 
ATOM   7305 N  N   . ASN B 1 399 ? 1.703   0.045   40.814  1.00 31.84  ? 399 ASN B N   1 
ATOM   7306 C  CA  . ASN B 1 399 ? 2.011   0.520   42.156  1.00 38.08  ? 399 ASN B CA  1 
ATOM   7307 C  C   . ASN B 1 399 ? 3.179   -0.183  42.811  1.00 35.93  ? 399 ASN B C   1 
ATOM   7308 O  O   . ASN B 1 399 ? 3.780   0.392   43.722  1.00 36.52  ? 399 ASN B O   1 
ATOM   7309 C  CB  . ASN B 1 399 ? 0.794   0.371   43.075  1.00 37.38  ? 399 ASN B CB  1 
ATOM   7310 C  CG  . ASN B 1 399 ? -0.251  1.416   42.816  1.00 37.79  ? 399 ASN B CG  1 
ATOM   7311 O  OD1 . ASN B 1 399 ? -0.048  2.600   43.100  1.00 27.90  ? 399 ASN B OD1 1 
ATOM   7312 N  ND2 . ASN B 1 399 ? -1.375  0.994   42.254  1.00 47.12  ? 399 ASN B ND2 1 
ATOM   7313 N  N   . VAL B 1 400 ? 3.506   -1.407  42.407  1.00 27.83  ? 400 VAL B N   1 
ATOM   7314 C  CA  . VAL B 1 400 ? 4.487   -2.162  43.172  1.00 27.49  ? 400 VAL B CA  1 
ATOM   7315 C  C   . VAL B 1 400 ? 5.500   -2.828  42.263  1.00 34.05  ? 400 VAL B C   1 
ATOM   7316 O  O   . VAL B 1 400 ? 6.705   -2.608  42.406  1.00 44.19  ? 400 VAL B O   1 
ATOM   7317 C  CB  . VAL B 1 400 ? 3.813   -3.217  44.069  1.00 42.69  ? 400 VAL B CB  1 
ATOM   7318 C  CG1 . VAL B 1 400 ? 4.874   -4.062  44.767  1.00 43.29  ? 400 VAL B CG1 1 
ATOM   7319 C  CG2 . VAL B 1 400 ? 2.891   -2.556  45.098  1.00 36.66  ? 400 VAL B CG2 1 
ATOM   7320 N  N   . ILE B 1 401 ? 5.024   -3.670  41.347  1.00 36.20  ? 401 ILE B N   1 
ATOM   7321 C  CA  . ILE B 1 401 ? 5.925   -4.457  40.507  1.00 37.54  ? 401 ILE B CA  1 
ATOM   7322 C  C   . ILE B 1 401 ? 6.842   -3.544  39.707  1.00 38.43  ? 401 ILE B C   1 
ATOM   7323 O  O   . ILE B 1 401 ? 8.072   -3.697  39.700  1.00 36.40  ? 401 ILE B O   1 
ATOM   7324 C  CB  . ILE B 1 401 ? 5.125   -5.352  39.552  1.00 44.60  ? 401 ILE B CB  1 
ATOM   7325 C  CG1 . ILE B 1 401 ? 4.071   -6.196  40.289  1.00 43.38  ? 401 ILE B CG1 1 
ATOM   7326 C  CG2 . ILE B 1 401 ? 6.108   -6.217  38.774  1.00 43.33  ? 401 ILE B CG2 1 
ATOM   7327 C  CD1 . ILE B 1 401 ? 4.527   -7.528  40.729  1.00 36.10  ? 401 ILE B CD1 1 
ATOM   7328 N  N   . CYS B 1 402 ? 6.255   -2.611  38.986  1.00 34.40  ? 402 CYS B N   1 
ATOM   7329 C  CA  . CYS B 1 402 ? 7.077   -1.931  38.000  1.00 33.10  ? 402 CYS B CA  1 
ATOM   7330 C  C   . CYS B 1 402 ? 7.892   -0.826  38.667  1.00 36.80  ? 402 CYS B C   1 
ATOM   7331 O  O   . CYS B 1 402 ? 9.075   -0.663  38.330  1.00 34.40  ? 402 CYS B O   1 
ATOM   7332 C  CB  . CYS B 1 402 ? 6.210   -1.398  36.859  1.00 30.63  ? 402 CYS B CB  1 
ATOM   7333 S  SG  . CYS B 1 402 ? 5.656   -2.706  35.719  1.00 35.77  ? 402 CYS B SG  1 
ATOM   7334 N  N   . PRO B 1 403 ? 7.333   -0.063  39.618  1.00 44.05  ? 403 PRO B N   1 
ATOM   7335 C  CA  . PRO B 1 403 ? 8.192   0.863   40.377  1.00 41.28  ? 403 PRO B CA  1 
ATOM   7336 C  C   . PRO B 1 403 ? 9.382   0.184   41.024  1.00 34.29  ? 403 PRO B C   1 
ATOM   7337 O  O   . PRO B 1 403 ? 10.453  0.796   41.119  1.00 36.77  ? 403 PRO B O   1 
ATOM   7338 C  CB  . PRO B 1 403 ? 7.236   1.466   41.417  1.00 36.70  ? 403 PRO B CB  1 
ATOM   7339 C  CG  . PRO B 1 403 ? 5.925   0.774   41.245  1.00 34.93  ? 403 PRO B CG  1 
ATOM   7340 C  CD  . PRO B 1 403 ? 5.904   0.195   39.875  1.00 40.30  ? 403 PRO B CD  1 
ATOM   7341 N  N   . LEU B 1 404 ? 9.244   -1.073  41.448  1.00 35.03  ? 404 LEU B N   1 
ATOM   7342 C  CA  . LEU B 1 404 ? 10.373  -1.772  42.054  1.00 38.20  ? 404 LEU B CA  1 
ATOM   7343 C  C   . LEU B 1 404 ? 11.359  -2.252  41.001  1.00 46.95  ? 404 LEU B C   1 
ATOM   7344 O  O   . LEU B 1 404 ? 12.573  -2.078  41.163  1.00 55.25  ? 404 LEU B O   1 
ATOM   7345 C  CB  . LEU B 1 404 ? 9.880   -2.934  42.933  1.00 37.76  ? 404 LEU B CB  1 
ATOM   7346 C  CG  . LEU B 1 404 ? 10.958  -3.885  43.510  1.00 39.43  ? 404 LEU B CG  1 
ATOM   7347 C  CD1 . LEU B 1 404 ? 10.664  -4.369  44.942  1.00 27.22  ? 404 LEU B CD1 1 
ATOM   7348 C  CD2 . LEU B 1 404 ? 11.169  -5.111  42.610  1.00 31.87  ? 404 LEU B CD2 1 
ATOM   7349 N  N   . MET B 1 405 ? 10.866  -2.826  39.900  1.00 52.05  ? 405 MET B N   1 
ATOM   7350 C  CA  . MET B 1 405 ? 11.793  -3.221  38.844  1.00 41.51  ? 405 MET B CA  1 
ATOM   7351 C  C   . MET B 1 405 ? 12.512  -2.031  38.221  1.00 34.91  ? 405 MET B C   1 
ATOM   7352 O  O   . MET B 1 405 ? 13.619  -2.189  37.712  1.00 32.70  ? 405 MET B O   1 
ATOM   7353 C  CB  . MET B 1 405 ? 11.100  -4.042  37.767  1.00 38.26  ? 405 MET B CB  1 
ATOM   7354 C  CG  . MET B 1 405 ? 10.503  -5.326  38.277  1.00 39.90  ? 405 MET B CG  1 
ATOM   7355 S  SD  . MET B 1 405 ? 11.822  -6.509  38.680  1.00 39.27  ? 405 MET B SD  1 
ATOM   7356 C  CE  . MET B 1 405 ? 12.866  -6.477  37.217  1.00 33.82  ? 405 MET B CE  1 
ATOM   7357 N  N   . HIS B 1 406 ? 11.930  -0.841  38.252  1.00 41.72  ? 406 HIS B N   1 
ATOM   7358 C  CA  . HIS B 1 406 ? 12.732  0.332   37.947  1.00 37.40  ? 406 HIS B CA  1 
ATOM   7359 C  C   . HIS B 1 406 ? 13.856  0.474   38.962  1.00 43.76  ? 406 HIS B C   1 
ATOM   7360 O  O   . HIS B 1 406 ? 15.018  0.675   38.597  1.00 53.21  ? 406 HIS B O   1 
ATOM   7361 C  CB  . HIS B 1 406 ? 11.845  1.567   37.934  1.00 40.83  ? 406 HIS B CB  1 
ATOM   7362 C  CG  . HIS B 1 406 ? 12.523  2.806   37.449  1.00 38.12  ? 406 HIS B CG  1 
ATOM   7363 N  ND1 . HIS B 1 406 ? 12.801  3.030   36.119  1.00 47.10  ? 406 HIS B ND1 1 
ATOM   7364 C  CD2 . HIS B 1 406 ? 12.947  3.905   38.113  1.00 38.03  ? 406 HIS B CD2 1 
ATOM   7365 C  CE1 . HIS B 1 406 ? 13.373  4.213   35.986  1.00 55.78  ? 406 HIS B CE1 1 
ATOM   7366 N  NE2 . HIS B 1 406 ? 13.474  4.765   37.182  1.00 47.96  ? 406 HIS B NE2 1 
ATOM   7367 N  N   . PHE B 1 407 ? 13.533  0.329   40.247  1.00 46.71  ? 407 PHE B N   1 
ATOM   7368 C  CA  . PHE B 1 407 ? 14.536  0.558   41.284  1.00 37.27  ? 407 PHE B CA  1 
ATOM   7369 C  C   . PHE B 1 407 ? 15.645  -0.475  41.200  1.00 39.09  ? 407 PHE B C   1 
ATOM   7370 O  O   . PHE B 1 407 ? 16.835  -0.129  41.224  1.00 47.02  ? 407 PHE B O   1 
ATOM   7371 C  CB  . PHE B 1 407 ? 13.866  0.560   42.665  1.00 33.10  ? 407 PHE B CB  1 
ATOM   7372 C  CG  . PHE B 1 407 ? 14.823  0.564   43.843  1.00 27.91  ? 407 PHE B CG  1 
ATOM   7373 C  CD1 . PHE B 1 407 ? 15.276  1.768   44.361  1.00 27.80  ? 407 PHE B CD1 1 
ATOM   7374 C  CD2 . PHE B 1 407 ? 15.170  -0.622  44.503  1.00 28.67  ? 407 PHE B CD2 1 
ATOM   7375 C  CE1 . PHE B 1 407 ? 16.114  1.799   45.446  1.00 36.76  ? 407 PHE B CE1 1 
ATOM   7376 C  CE2 . PHE B 1 407 ? 16.009  -0.602  45.607  1.00 27.63  ? 407 PHE B CE2 1 
ATOM   7377 C  CZ  . PHE B 1 407 ? 16.483  0.609   46.080  1.00 40.27  ? 407 PHE B CZ  1 
ATOM   7378 N  N   . VAL B 1 408 ? 15.278  -1.752  41.062  1.00 34.76  ? 408 VAL B N   1 
ATOM   7379 C  CA  . VAL B 1 408 ? 16.304  -2.786  40.985  1.00 37.82  ? 408 VAL B CA  1 
ATOM   7380 C  C   . VAL B 1 408 ? 17.218  -2.528  39.801  1.00 40.55  ? 408 VAL B C   1 
ATOM   7381 O  O   . VAL B 1 408 ? 18.437  -2.703  39.894  1.00 43.46  ? 408 VAL B O   1 
ATOM   7382 C  CB  . VAL B 1 408 ? 15.673  -4.188  40.921  1.00 40.74  ? 408 VAL B CB  1 
ATOM   7383 C  CG1 . VAL B 1 408 ? 14.929  -4.376  39.664  1.00 40.49  ? 408 VAL B CG1 1 
ATOM   7384 C  CG2 . VAL B 1 408 ? 16.745  -5.236  40.992  1.00 49.82  ? 408 VAL B CG2 1 
ATOM   7385 N  N   . ASN B 1 409 ? 16.658  -2.063  38.685  1.00 38.01  ? 409 ASN B N   1 
ATOM   7386 C  CA  . ASN B 1 409 ? 17.485  -1.804  37.517  1.00 42.40  ? 409 ASN B CA  1 
ATOM   7387 C  C   . ASN B 1 409 ? 18.475  -0.673  37.794  1.00 49.62  ? 409 ASN B C   1 
ATOM   7388 O  O   . ASN B 1 409 ? 19.686  -0.832  37.582  1.00 57.53  ? 409 ASN B O   1 
ATOM   7389 C  CB  . ASN B 1 409 ? 16.605  -1.517  36.292  1.00 36.02  ? 409 ASN B CB  1 
ATOM   7390 C  CG  . ASN B 1 409 ? 16.203  -2.803  35.521  1.00 52.94  ? 409 ASN B CG  1 
ATOM   7391 O  OD1 . ASN B 1 409 ? 17.055  -3.616  35.159  1.00 62.07  ? 409 ASN B OD1 1 
ATOM   7392 N  ND2 . ASN B 1 409 ? 14.902  -2.971  35.262  1.00 54.31  ? 409 ASN B ND2 1 
ATOM   7393 N  N   . LYS B 1 410 ? 17.990  0.463   38.311  1.00 38.03  ? 410 LYS B N   1 
ATOM   7394 C  CA  . LYS B 1 410 ? 18.885  1.597   38.525  1.00 41.27  ? 410 LYS B CA  1 
ATOM   7395 C  C   . LYS B 1 410 ? 19.957  1.257   39.548  1.00 45.83  ? 410 LYS B C   1 
ATOM   7396 O  O   . LYS B 1 410 ? 21.147  1.532   39.332  1.00 46.30  ? 410 LYS B O   1 
ATOM   7397 C  CB  . LYS B 1 410 ? 18.103  2.823   38.978  1.00 45.90  ? 410 LYS B CB  1 
ATOM   7398 C  CG  . LYS B 1 410 ? 16.796  3.007   38.248  1.00 58.48  ? 410 LYS B CG  1 
ATOM   7399 C  CD  . LYS B 1 410 ? 17.007  3.312   36.793  1.00 63.75  ? 410 LYS B CD  1 
ATOM   7400 C  CE  . LYS B 1 410 ? 17.383  4.768   36.617  1.00 63.39  ? 410 LYS B CE  1 
ATOM   7401 N  NZ  . LYS B 1 410 ? 17.765  5.081   35.206  1.00 65.22  1 410 LYS B NZ  1 
ATOM   7402 N  N   . TYR B 1 411 ? 19.557  0.630   40.656  1.00 45.10  ? 411 TYR B N   1 
ATOM   7403 C  CA  . TYR B 1 411 ? 20.495  0.393   41.750  1.00 40.46  ? 411 TYR B CA  1 
ATOM   7404 C  C   . TYR B 1 411 ? 21.585  -0.591  41.329  1.00 36.74  ? 411 TYR B C   1 
ATOM   7405 O  O   . TYR B 1 411 ? 22.772  -0.362  41.575  1.00 38.20  ? 411 TYR B O   1 
ATOM   7406 C  CB  . TYR B 1 411 ? 19.733  -0.103  42.993  1.00 39.67  ? 411 TYR B CB  1 
ATOM   7407 C  CG  . TYR B 1 411 ? 20.618  -0.431  44.170  1.00 35.54  ? 411 TYR B CG  1 
ATOM   7408 C  CD1 . TYR B 1 411 ? 21.239  -1.661  44.280  1.00 39.72  ? 411 TYR B CD1 1 
ATOM   7409 C  CD2 . TYR B 1 411 ? 20.864  0.515   45.159  1.00 47.07  ? 411 TYR B CD2 1 
ATOM   7410 C  CE1 . TYR B 1 411 ? 22.067  -1.953  45.345  1.00 45.97  ? 411 TYR B CE1 1 
ATOM   7411 C  CE2 . TYR B 1 411 ? 21.702  0.237   46.237  1.00 34.61  ? 411 TYR B CE2 1 
ATOM   7412 C  CZ  . TYR B 1 411 ? 22.296  -1.002  46.316  1.00 39.27  ? 411 TYR B CZ  1 
ATOM   7413 O  OH  . TYR B 1 411 ? 23.133  -1.310  47.363  1.00 47.90  ? 411 TYR B OH  1 
ATOM   7414 N  N   . THR B 1 412 ? 21.204  -1.677  40.667  1.00 32.53  ? 412 THR B N   1 
ATOM   7415 C  CA  . THR B 1 412 ? 22.160  -2.715  40.295  1.00 36.17  ? 412 THR B CA  1 
ATOM   7416 C  C   . THR B 1 412 ? 23.351  -2.184  39.503  1.00 41.18  ? 412 THR B C   1 
ATOM   7417 O  O   . THR B 1 412 ? 24.441  -2.770  39.568  1.00 43.80  ? 412 THR B O   1 
ATOM   7418 C  CB  . THR B 1 412 ? 21.408  -3.801  39.543  1.00 36.81  ? 412 THR B CB  1 
ATOM   7419 O  OG1 . THR B 1 412 ? 20.253  -4.136  40.307  1.00 44.71  ? 412 THR B OG1 1 
ATOM   7420 C  CG2 . THR B 1 412 ? 22.247  -5.033  39.333  1.00 34.41  ? 412 THR B CG2 1 
ATOM   7421 N  N   . LYS B 1 413 ? 23.174  -1.083  38.770  1.00 43.50  ? 413 LYS B N   1 
ATOM   7422 C  CA  . LYS B 1 413 ? 24.301  -0.449  38.091  1.00 36.05  ? 413 LYS B CA  1 
ATOM   7423 C  C   . LYS B 1 413 ? 25.430  -0.128  39.061  1.00 49.75  ? 413 LYS B C   1 
ATOM   7424 O  O   . LYS B 1 413 ? 26.609  -0.283  38.724  1.00 59.39  ? 413 LYS B O   1 
ATOM   7425 C  CB  . LYS B 1 413 ? 23.856  0.839   37.401  1.00 37.78  ? 413 LYS B CB  1 
ATOM   7426 C  CG  . LYS B 1 413 ? 23.018  0.702   36.119  1.00 45.13  ? 413 LYS B CG  1 
ATOM   7427 C  CD  . LYS B 1 413 ? 23.067  2.039   35.362  1.00 47.57  ? 413 LYS B CD  1 
ATOM   7428 C  CE  . LYS B 1 413 ? 24.476  2.678   35.568  1.00 49.30  ? 413 LYS B CE  1 
ATOM   7429 N  NZ  . LYS B 1 413 ? 24.804  3.936   34.820  1.00 41.79  1 413 LYS B NZ  1 
ATOM   7430 N  N   . PHE B 1 414 ? 25.087  0.330   40.271  1.00 46.64  ? 414 PHE B N   1 
ATOM   7431 C  CA  . PHE B 1 414 ? 26.061  0.793   41.255  1.00 45.12  ? 414 PHE B CA  1 
ATOM   7432 C  C   . PHE B 1 414 ? 26.211  -0.122  42.462  1.00 49.16  ? 414 PHE B C   1 
ATOM   7433 O  O   . PHE B 1 414 ? 27.282  -0.142  43.071  1.00 52.10  ? 414 PHE B O   1 
ATOM   7434 C  CB  . PHE B 1 414 ? 25.688  2.192   41.763  1.00 41.60  ? 414 PHE B CB  1 
ATOM   7435 C  CG  . PHE B 1 414 ? 25.621  3.234   40.692  1.00 48.24  ? 414 PHE B CG  1 
ATOM   7436 C  CD1 . PHE B 1 414 ? 26.779  3.855   40.232  1.00 44.31  ? 414 PHE B CD1 1 
ATOM   7437 C  CD2 . PHE B 1 414 ? 24.398  3.600   40.139  1.00 46.20  ? 414 PHE B CD2 1 
ATOM   7438 C  CE1 . PHE B 1 414 ? 26.717  4.829   39.231  1.00 38.34  ? 414 PHE B CE1 1 
ATOM   7439 C  CE2 . PHE B 1 414 ? 24.327  4.570   39.127  1.00 42.70  ? 414 PHE B CE2 1 
ATOM   7440 C  CZ  . PHE B 1 414 ? 25.485  5.188   38.686  1.00 43.92  ? 414 PHE B CZ  1 
ATOM   7441 N  N   . GLY B 1 415 ? 25.172  -0.863  42.828  1.00 47.33  ? 415 GLY B N   1 
ATOM   7442 C  CA  . GLY B 1 415 ? 25.224  -1.701  44.009  1.00 41.38  ? 415 GLY B CA  1 
ATOM   7443 C  C   . GLY B 1 415 ? 26.274  -2.786  43.896  1.00 44.65  ? 415 GLY B C   1 
ATOM   7444 O  O   . GLY B 1 415 ? 26.854  -3.039  42.844  1.00 60.45  ? 415 GLY B O   1 
ATOM   7445 N  N   . ASN B 1 416 ? 26.536  -3.431  45.033  1.00 42.57  ? 416 ASN B N   1 
ATOM   7446 C  CA  . ASN B 1 416 ? 27.488  -4.531  45.117  1.00 48.00  ? 416 ASN B CA  1 
ATOM   7447 C  C   . ASN B 1 416 ? 26.789  -5.893  45.107  1.00 50.70  ? 416 ASN B C   1 
ATOM   7448 O  O   . ASN B 1 416 ? 27.333  -6.884  45.609  1.00 60.30  ? 416 ASN B O   1 
ATOM   7449 C  CB  . ASN B 1 416 ? 28.377  -4.368  46.356  1.00 48.81  ? 416 ASN B CB  1 
ATOM   7450 C  CG  . ASN B 1 416 ? 29.533  -5.362  46.386  1.00 58.44  ? 416 ASN B CG  1 
ATOM   7451 O  OD1 . ASN B 1 416 ? 29.598  -6.204  47.281  1.00 66.42  ? 416 ASN B OD1 1 
ATOM   7452 N  ND2 . ASN B 1 416 ? 30.438  -5.277  45.392  1.00 59.31  ? 416 ASN B ND2 1 
ATOM   7453 N  N   . GLY B 1 417 ? 25.587  -5.964  44.534  1.00 46.82  ? 417 GLY B N   1 
ATOM   7454 C  CA  . GLY B 1 417 ? 24.916  -7.238  44.355  1.00 42.06  ? 417 GLY B CA  1 
ATOM   7455 C  C   . GLY B 1 417 ? 23.435  -7.195  44.667  1.00 38.63  ? 417 GLY B C   1 
ATOM   7456 O  O   . GLY B 1 417 ? 23.032  -6.635  45.692  1.00 33.58  ? 417 GLY B O   1 
ATOM   7457 N  N   . THR B 1 418 ? 22.617  -7.793  43.796  1.00 41.69  ? 418 THR B N   1 
ATOM   7458 C  CA  . THR B 1 418 ? 21.163  -7.764  43.913  1.00 32.05  ? 418 THR B CA  1 
ATOM   7459 C  C   . THR B 1 418 ? 20.607  -9.173  43.767  1.00 38.01  ? 418 THR B C   1 
ATOM   7460 O  O   . THR B 1 418 ? 21.031  -9.917  42.876  1.00 44.66  ? 418 THR B O   1 
ATOM   7461 C  CB  . THR B 1 418 ? 20.539  -6.852  42.856  1.00 43.51  ? 418 THR B CB  1 
ATOM   7462 O  OG1 . THR B 1 418 ? 21.150  -5.561  42.905  1.00 39.86  ? 418 THR B OG1 1 
ATOM   7463 C  CG2 . THR B 1 418 ? 19.071  -6.707  43.116  1.00 56.16  ? 418 THR B CG2 1 
ATOM   7464 N  N   . TYR B 1 419 ? 19.666  -9.539  44.646  1.00 34.61  ? 419 TYR B N   1 
ATOM   7465 C  CA  . TYR B 1 419 ? 18.932  -10.803 44.563  1.00 35.92  ? 419 TYR B CA  1 
ATOM   7466 C  C   . TYR B 1 419 ? 17.431  -10.529 44.521  1.00 39.07  ? 419 TYR B C   1 
ATOM   7467 O  O   . TYR B 1 419 ? 16.878  -9.945  45.458  1.00 47.83  ? 419 TYR B O   1 
ATOM   7468 C  CB  . TYR B 1 419 ? 19.279  -11.728 45.733  1.00 31.88  ? 419 TYR B CB  1 
ATOM   7469 C  CG  . TYR B 1 419 ? 20.729  -12.125 45.782  1.00 41.96  ? 419 TYR B CG  1 
ATOM   7470 C  CD1 . TYR B 1 419 ? 21.152  -13.344 45.239  1.00 48.43  ? 419 TYR B CD1 1 
ATOM   7471 C  CD2 . TYR B 1 419 ? 21.672  -11.325 46.410  1.00 40.88  ? 419 TYR B CD2 1 
ATOM   7472 C  CE1 . TYR B 1 419 ? 22.501  -13.724 45.263  1.00 47.08  ? 419 TYR B CE1 1 
ATOM   7473 C  CE2 . TYR B 1 419 ? 23.007  -11.705 46.464  1.00 45.92  ? 419 TYR B CE2 1 
ATOM   7474 C  CZ  . TYR B 1 419 ? 23.419  -12.884 45.880  1.00 52.32  ? 419 TYR B CZ  1 
ATOM   7475 O  OH  . TYR B 1 419 ? 24.730  -13.248 45.979  1.00 65.00  ? 419 TYR B OH  1 
ATOM   7476 N  N   . LEU B 1 420 ? 16.771  -10.934 43.436  1.00 37.41  ? 420 LEU B N   1 
ATOM   7477 C  CA  . LEU B 1 420 ? 15.378  -10.569 43.212  1.00 43.24  ? 420 LEU B CA  1 
ATOM   7478 C  C   . LEU B 1 420 ? 14.481  -11.801 43.145  1.00 39.75  ? 420 LEU B C   1 
ATOM   7479 O  O   . LEU B 1 420 ? 14.809  -12.781 42.469  1.00 41.92  ? 420 LEU B O   1 
ATOM   7480 C  CB  . LEU B 1 420 ? 15.247  -9.698  41.958  1.00 41.03  ? 420 LEU B CB  1 
ATOM   7481 C  CG  . LEU B 1 420 ? 13.778  -9.298  41.837  1.00 38.50  ? 420 LEU B CG  1 
ATOM   7482 C  CD1 . LEU B 1 420 ? 13.510  -7.842  42.212  1.00 29.92  ? 420 LEU B CD1 1 
ATOM   7483 C  CD2 . LEU B 1 420 ? 13.473  -9.503  40.392  1.00 44.55  ? 420 LEU B CD2 1 
ATOM   7484 N  N   . TYR B 1 421 ? 13.370  -11.761 43.891  1.00 30.74  ? 421 TYR B N   1 
ATOM   7485 C  CA  . TYR B 1 421 ? 12.480  -12.903 44.044  1.00 38.85  ? 421 TYR B CA  1 
ATOM   7486 C  C   . TYR B 1 421 ? 11.059  -12.536 43.628  1.00 40.95  ? 421 TYR B C   1 
ATOM   7487 O  O   . TYR B 1 421 ? 10.610  -11.394 43.806  1.00 38.70  ? 421 TYR B O   1 
ATOM   7488 C  CB  . TYR B 1 421 ? 12.443  -13.429 45.499  1.00 31.08  ? 421 TYR B CB  1 
ATOM   7489 C  CG  . TYR B 1 421 ? 11.757  -12.491 46.479  1.00 35.96  ? 421 TYR B CG  1 
ATOM   7490 C  CD1 . TYR B 1 421 ? 10.371  -12.518 46.670  1.00 31.20  ? 421 TYR B CD1 1 
ATOM   7491 C  CD2 . TYR B 1 421 ? 12.495  -11.575 47.214  1.00 37.04  ? 421 TYR B CD2 1 
ATOM   7492 C  CE1 . TYR B 1 421 ? 9.749   -11.637 47.563  1.00 32.68  ? 421 TYR B CE1 1 
ATOM   7493 C  CE2 . TYR B 1 421 ? 11.886  -10.715 48.111  1.00 33.56  ? 421 TYR B CE2 1 
ATOM   7494 C  CZ  . TYR B 1 421 ? 10.518  -10.739 48.275  1.00 36.01  ? 421 TYR B CZ  1 
ATOM   7495 O  OH  . TYR B 1 421 ? 9.938   -9.860  49.169  1.00 45.27  ? 421 TYR B OH  1 
ATOM   7496 N  N   . PHE B 1 422 ? 10.349  -13.531 43.097  1.00 34.71  ? 422 PHE B N   1 
ATOM   7497 C  CA  . PHE B 1 422 ? 8.921   -13.441 42.813  1.00 46.12  ? 422 PHE B CA  1 
ATOM   7498 C  C   . PHE B 1 422 ? 8.223   -14.471 43.696  1.00 48.29  ? 422 PHE B C   1 
ATOM   7499 O  O   . PHE B 1 422 ? 8.360   -15.679 43.469  1.00 51.02  ? 422 PHE B O   1 
ATOM   7500 C  CB  . PHE B 1 422 ? 8.644   -13.681 41.324  1.00 48.71  ? 422 PHE B CB  1 
ATOM   7501 C  CG  . PHE B 1 422 ? 7.207   -13.490 40.932  1.00 48.18  ? 422 PHE B CG  1 
ATOM   7502 C  CD1 . PHE B 1 422 ? 6.711   -12.220 40.667  1.00 53.70  ? 422 PHE B CD1 1 
ATOM   7503 C  CD2 . PHE B 1 422 ? 6.346   -14.578 40.824  1.00 45.58  ? 422 PHE B CD2 1 
ATOM   7504 C  CE1 . PHE B 1 422 ? 5.369   -12.038 40.304  1.00 50.88  ? 422 PHE B CE1 1 
ATOM   7505 C  CE2 . PHE B 1 422 ? 5.008   -14.401 40.460  1.00 42.00  ? 422 PHE B CE2 1 
ATOM   7506 C  CZ  . PHE B 1 422 ? 4.524   -13.131 40.203  1.00 41.63  ? 422 PHE B CZ  1 
ATOM   7507 N  N   . PHE B 1 423 ? 7.493   -13.999 44.709  1.00 39.04  ? 423 PHE B N   1 
ATOM   7508 C  CA  . PHE B 1 423 ? 6.850   -14.876 45.683  1.00 34.78  ? 423 PHE B CA  1 
ATOM   7509 C  C   . PHE B 1 423 ? 5.435   -15.196 45.213  1.00 42.98  ? 423 PHE B C   1 
ATOM   7510 O  O   . PHE B 1 423 ? 4.599   -14.292 45.088  1.00 36.81  ? 423 PHE B O   1 
ATOM   7511 C  CB  . PHE B 1 423 ? 6.826   -14.240 47.072  1.00 30.56  ? 423 PHE B CB  1 
ATOM   7512 C  CG  . PHE B 1 423 ? 6.150   -15.087 48.097  1.00 30.87  ? 423 PHE B CG  1 
ATOM   7513 C  CD1 . PHE B 1 423 ? 6.841   -16.109 48.727  1.00 41.01  ? 423 PHE B CD1 1 
ATOM   7514 C  CD2 . PHE B 1 423 ? 4.810   -14.886 48.417  1.00 30.86  ? 423 PHE B CD2 1 
ATOM   7515 C  CE1 . PHE B 1 423 ? 6.209   -16.916 49.665  1.00 42.54  ? 423 PHE B CE1 1 
ATOM   7516 C  CE2 . PHE B 1 423 ? 4.169   -15.687 49.346  1.00 32.09  ? 423 PHE B CE2 1 
ATOM   7517 C  CZ  . PHE B 1 423 ? 4.864   -16.701 49.976  1.00 40.37  ? 423 PHE B CZ  1 
ATOM   7518 N  N   . ASN B 1 424 ? 5.165   -16.480 44.976  1.00 43.24  ? 424 ASN B N   1 
ATOM   7519 C  CA  . ASN B 1 424 ? 3.910   -16.917 44.373  1.00 42.49  ? 424 ASN B CA  1 
ATOM   7520 C  C   . ASN B 1 424 ? 3.376   -18.186 45.041  1.00 49.81  ? 424 ASN B C   1 
ATOM   7521 O  O   . ASN B 1 424 ? 3.049   -19.178 44.385  1.00 52.16  ? 424 ASN B O   1 
ATOM   7522 C  CB  . ASN B 1 424 ? 4.075   -17.120 42.867  1.00 48.41  ? 424 ASN B CB  1 
ATOM   7523 C  CG  . ASN B 1 424 ? 5.060   -18.223 42.514  1.00 50.25  ? 424 ASN B CG  1 
ATOM   7524 O  OD1 . ASN B 1 424 ? 5.443   -19.038 43.346  1.00 49.86  ? 424 ASN B OD1 1 
ATOM   7525 N  ND2 . ASN B 1 424 ? 5.448   -18.266 41.251  1.00 56.41  ? 424 ASN B ND2 1 
ATOM   7526 N  N   . HIS B 1 425 ? 3.260   -18.165 46.364  1.00 55.68  ? 425 HIS B N   1 
ATOM   7527 C  CA  . HIS B 1 425 ? 2.577   -19.235 47.082  1.00 58.01  ? 425 HIS B CA  1 
ATOM   7528 C  C   . HIS B 1 425 ? 1.358   -18.648 47.776  1.00 66.07  ? 425 HIS B C   1 
ATOM   7529 O  O   . HIS B 1 425 ? 1.496   -17.811 48.673  1.00 73.83  ? 425 HIS B O   1 
ATOM   7530 C  CB  . HIS B 1 425 ? 3.490   -19.912 48.096  1.00 46.98  ? 425 HIS B CB  1 
ATOM   7531 C  CG  . HIS B 1 425 ? 2.860   -21.097 48.750  1.00 46.29  ? 425 HIS B CG  1 
ATOM   7532 N  ND1 . HIS B 1 425 ? 2.614   -22.273 48.074  1.00 49.86  ? 425 HIS B ND1 1 
ATOM   7533 C  CD2 . HIS B 1 425 ? 2.385   -21.277 50.003  1.00 47.15  ? 425 HIS B CD2 1 
ATOM   7534 C  CE1 . HIS B 1 425 ? 2.038   -23.136 48.892  1.00 51.84  ? 425 HIS B CE1 1 
ATOM   7535 N  NE2 . HIS B 1 425 ? 1.882   -22.555 50.067  1.00 48.59  ? 425 HIS B NE2 1 
ATOM   7536 N  N   . ARG B 1 426 ? 0.169   -19.063 47.355  1.00 65.74  ? 426 ARG B N   1 
ATOM   7537 C  CA  . ARG B 1 426 ? -1.010  -18.827 48.176  1.00 68.58  ? 426 ARG B CA  1 
ATOM   7538 C  C   . ARG B 1 426 ? -0.974  -19.828 49.317  1.00 67.15  ? 426 ARG B C   1 
ATOM   7539 O  O   . ARG B 1 426 ? -1.070  -21.038 49.081  1.00 63.92  ? 426 ARG B O   1 
ATOM   7540 C  CB  . ARG B 1 426 ? -2.293  -18.969 47.363  1.00 75.42  ? 426 ARG B CB  1 
ATOM   7541 C  CG  . ARG B 1 426 ? -3.513  -19.271 48.223  1.00 79.51  ? 426 ARG B CG  1 
ATOM   7542 C  CD  . ARG B 1 426 ? -4.785  -19.193 47.417  1.00 81.50  ? 426 ARG B CD  1 
ATOM   7543 N  NE  . ARG B 1 426 ? -5.295  -17.830 47.385  1.00 78.80  ? 426 ARG B NE  1 
ATOM   7544 C  CZ  . ARG B 1 426 ? -6.328  -17.408 48.104  1.00 73.20  ? 426 ARG B CZ  1 
ATOM   7545 N  NH1 . ARG B 1 426 ? -6.718  -16.141 48.009  1.00 62.30  1 426 ARG B NH1 1 
ATOM   7546 N  NH2 . ARG B 1 426 ? -6.975  -18.258 48.901  1.00 72.90  ? 426 ARG B NH2 1 
ATOM   7547 N  N   . ALA B 1 427 ? -0.779  -19.333 50.544  1.00 71.61  ? 427 ALA B N   1 
ATOM   7548 C  CA  . ALA B 1 427 ? -0.767  -20.204 51.711  1.00 68.18  ? 427 ALA B CA  1 
ATOM   7549 C  C   . ALA B 1 427 ? -2.043  -21.037 51.743  1.00 70.55  ? 427 ALA B C   1 
ATOM   7550 O  O   . ALA B 1 427 ? -3.116  -20.579 51.337  1.00 62.27  ? 427 ALA B O   1 
ATOM   7551 C  CB  . ALA B 1 427 ? -0.625  -19.378 52.988  1.00 67.29  ? 427 ALA B CB  1 
ATOM   7552 N  N   . SER B 1 428 ? -1.914  -22.286 52.188  1.00 77.55  ? 428 SER B N   1 
ATOM   7553 C  CA  . SER B 1 428 ? -3.021  -23.230 52.081  1.00 77.35  ? 428 SER B CA  1 
ATOM   7554 C  C   . SER B 1 428 ? -4.170  -22.902 53.020  1.00 70.35  ? 428 SER B C   1 
ATOM   7555 O  O   . SER B 1 428 ? -5.239  -23.508 52.897  1.00 69.52  ? 428 SER B O   1 
ATOM   7556 C  CB  . SER B 1 428 ? -2.526  -24.648 52.363  1.00 83.90  ? 428 SER B CB  1 
ATOM   7557 O  OG  . SER B 1 428 ? -2.028  -24.738 53.689  1.00 85.60  ? 428 SER B OG  1 
ATOM   7558 N  N   . ASN B 1 429 ? -3.973  -21.965 53.946  1.00 72.37  ? 429 ASN B N   1 
ATOM   7559 C  CA  . ASN B 1 429 ? -4.940  -21.667 54.996  1.00 76.74  ? 429 ASN B CA  1 
ATOM   7560 C  C   . ASN B 1 429 ? -5.452  -20.230 54.931  1.00 77.85  ? 429 ASN B C   1 
ATOM   7561 O  O   . ASN B 1 429 ? -6.018  -19.737 55.916  1.00 74.67  ? 429 ASN B O   1 
ATOM   7562 C  CB  . ASN B 1 429 ? -4.318  -21.943 56.365  1.00 73.77  ? 429 ASN B CB  1 
ATOM   7563 C  CG  . ASN B 1 429 ? -2.977  -21.236 56.550  1.00 76.70  ? 429 ASN B CG  1 
ATOM   7564 O  OD1 . ASN B 1 429 ? -2.434  -20.636 55.612  1.00 78.25  ? 429 ASN B OD1 1 
ATOM   7565 N  ND2 . ASN B 1 429 ? -2.437  -21.305 57.765  1.00 70.44  ? 429 ASN B ND2 1 
ATOM   7566 N  N   . LEU B 1 430 ? -5.262  -19.549 53.795  1.00 73.40  ? 430 LEU B N   1 
ATOM   7567 C  CA  . LEU B 1 430 ? -5.679  -18.157 53.663  1.00 60.39  ? 430 LEU B CA  1 
ATOM   7568 C  C   . LEU B 1 430 ? -7.192  -18.025 53.807  1.00 62.02  ? 430 LEU B C   1 
ATOM   7569 O  O   . LEU B 1 430 ? -7.963  -18.889 53.370  1.00 58.51  ? 430 LEU B O   1 
ATOM   7570 C  CB  . LEU B 1 430 ? -5.209  -17.580 52.320  1.00 54.00  ? 430 LEU B CB  1 
ATOM   7571 C  CG  . LEU B 1 430 ? -4.065  -16.551 52.340  1.00 54.05  ? 430 LEU B CG  1 
ATOM   7572 C  CD1 . LEU B 1 430 ? -3.535  -16.238 50.988  1.00 55.11  ? 430 LEU B CD1 1 
ATOM   7573 C  CD2 . LEU B 1 430 ? -4.514  -15.291 52.960  1.00 49.67  ? 430 LEU B CD2 1 
ATOM   7574 N  N   . VAL B 1 431 ? -7.610  -16.935 54.455  1.00 60.97  ? 431 VAL B N   1 
ATOM   7575 C  CA  . VAL B 1 431 ? -9.021  -16.690 54.736  1.00 59.48  ? 431 VAL B CA  1 
ATOM   7576 C  C   . VAL B 1 431 ? -9.673  -15.794 53.707  1.00 60.26  ? 431 VAL B C   1 
ATOM   7577 O  O   . VAL B 1 431 ? -10.895 -15.580 53.776  1.00 56.61  ? 431 VAL B O   1 
ATOM   7578 C  CB  . VAL B 1 431 ? -9.200  -16.069 56.131  1.00 61.28  ? 431 VAL B CB  1 
ATOM   7579 C  CG1 . VAL B 1 431 ? -9.197  -17.162 57.183  1.00 61.59  ? 431 VAL B CG1 1 
ATOM   7580 C  CG2 . VAL B 1 431 ? -8.085  -15.066 56.378  1.00 67.88  ? 431 VAL B CG2 1 
ATOM   7581 N  N   . TRP B 1 432 ? -8.916  -15.262 52.780  1.00 59.91  ? 432 TRP B N   1 
ATOM   7582 C  CA  . TRP B 1 432 ? -9.371  -14.430 51.687  1.00 49.59  ? 432 TRP B CA  1 
ATOM   7583 C  C   . TRP B 1 432 ? -9.700  -15.289 50.470  1.00 48.28  ? 432 TRP B C   1 
ATOM   7584 O  O   . TRP B 1 432 ? -9.084  -16.338 50.256  1.00 45.74  ? 432 TRP B O   1 
ATOM   7585 C  CB  . TRP B 1 432 ? -8.305  -13.418 51.331  1.00 45.80  ? 432 TRP B CB  1 
ATOM   7586 C  CG  . TRP B 1 432 ? -7.970  -12.490 52.443  1.00 48.79  ? 432 TRP B CG  1 
ATOM   7587 C  CD1 . TRP B 1 432 ? -6.893  -12.563 53.288  1.00 45.70  ? 432 TRP B CD1 1 
ATOM   7588 C  CD2 . TRP B 1 432 ? -8.704  -11.326 52.830  1.00 52.77  ? 432 TRP B CD2 1 
ATOM   7589 N  NE1 . TRP B 1 432 ? -6.918  -11.514 54.175  1.00 46.14  ? 432 TRP B NE1 1 
ATOM   7590 C  CE2 . TRP B 1 432 ? -8.016  -10.737 53.910  1.00 51.38  ? 432 TRP B CE2 1 
ATOM   7591 C  CE3 . TRP B 1 432 ? -9.875  -10.721 52.365  1.00 48.84  ? 432 TRP B CE3 1 
ATOM   7592 C  CZ2 . TRP B 1 432 ? -8.459  -9.571  54.523  1.00 53.26  ? 432 TRP B CZ2 1 
ATOM   7593 C  CZ3 . TRP B 1 432 ? -10.318 -9.573  52.985  1.00 43.74  ? 432 TRP B CZ3 1 
ATOM   7594 C  CH2 . TRP B 1 432 ? -9.611  -9.005  54.048  1.00 51.31  ? 432 TRP B CH2 1 
ATOM   7595 N  N   . PRO B 1 433 ? -10.670 -14.870 49.663  1.00 46.40  ? 433 PRO B N   1 
ATOM   7596 C  CA  . PRO B 1 433 ? -11.097 -15.701 48.536  1.00 45.19  ? 433 PRO B CA  1 
ATOM   7597 C  C   . PRO B 1 433 ? -9.992  -15.881 47.500  1.00 47.56  ? 433 PRO B C   1 
ATOM   7598 O  O   . PRO B 1 433 ? -9.032  -15.113 47.415  1.00 44.33  ? 433 PRO B O   1 
ATOM   7599 C  CB  . PRO B 1 433 ? -12.277 -14.925 47.954  1.00 43.06  ? 433 PRO B CB  1 
ATOM   7600 C  CG  . PRO B 1 433 ? -12.002 -13.504 48.348  1.00 43.90  ? 433 PRO B CG  1 
ATOM   7601 C  CD  . PRO B 1 433 ? -11.357 -13.565 49.685  1.00 42.01  ? 433 PRO B CD  1 
ATOM   7602 N  N   . GLU B 1 434 ? -10.174 -16.922 46.683  1.00 56.51  ? 434 GLU B N   1 
ATOM   7603 C  CA  . GLU B 1 434 ? -9.141  -17.366 45.749  1.00 57.98  ? 434 GLU B CA  1 
ATOM   7604 C  C   . GLU B 1 434 ? -8.814  -16.295 44.716  1.00 49.71  ? 434 GLU B C   1 
ATOM   7605 O  O   . GLU B 1 434 ? -7.639  -16.116 44.353  1.00 42.71  ? 434 GLU B O   1 
ATOM   7606 C  CB  . GLU B 1 434 ? -9.568  -18.672 45.056  1.00 64.52  ? 434 GLU B CB  1 
ATOM   7607 C  CG  . GLU B 1 434 ? -9.791  -19.895 45.983  1.00 84.30  ? 434 GLU B CG  1 
ATOM   7608 C  CD  . GLU B 1 434 ? -10.905 -19.744 47.028  1.00 108.08 ? 434 GLU B CD  1 
ATOM   7609 O  OE1 . GLU B 1 434 ? -11.620 -18.707 47.058  1.00 112.92 ? 434 GLU B OE1 1 
ATOM   7610 O  OE2 . GLU B 1 434 ? -11.052 -20.673 47.866  1.00 118.12 1 434 GLU B OE2 1 
ATOM   7611 N  N   . TRP B 1 435 ? -9.833  -15.560 44.242  1.00 48.46  ? 435 TRP B N   1 
ATOM   7612 C  CA  . TRP B 1 435 ? -9.594  -14.540 43.224  1.00 46.93  ? 435 TRP B CA  1 
ATOM   7613 C  C   . TRP B 1 435 ? -8.496  -13.580 43.653  1.00 43.33  ? 435 TRP B C   1 
ATOM   7614 O  O   . TRP B 1 435 ? -7.764  -13.051 42.807  1.00 50.24  ? 435 TRP B O   1 
ATOM   7615 C  CB  . TRP B 1 435 ? -10.890 -13.784 42.906  1.00 48.21  ? 435 TRP B CB  1 
ATOM   7616 C  CG  . TRP B 1 435 ? -11.315 -12.707 43.893  1.00 50.89  ? 435 TRP B CG  1 
ATOM   7617 C  CD1 . TRP B 1 435 ? -12.321 -12.786 44.822  1.00 53.84  ? 435 TRP B CD1 1 
ATOM   7618 C  CD2 . TRP B 1 435 ? -10.761 -11.387 44.019  1.00 47.38  ? 435 TRP B CD2 1 
ATOM   7619 N  NE1 . TRP B 1 435 ? -12.412 -11.603 45.527  1.00 43.95  ? 435 TRP B NE1 1 
ATOM   7620 C  CE2 . TRP B 1 435 ? -11.468 -10.730 45.049  1.00 43.95  ? 435 TRP B CE2 1 
ATOM   7621 C  CE3 . TRP B 1 435 ? -9.728  -10.704 43.368  1.00 53.94  ? 435 TRP B CE3 1 
ATOM   7622 C  CZ2 . TRP B 1 435 ? -11.174 -9.426  45.438  1.00 48.20  ? 435 TRP B CZ2 1 
ATOM   7623 C  CZ3 . TRP B 1 435 ? -9.436  -9.411  43.758  1.00 58.14  ? 435 TRP B CZ3 1 
ATOM   7624 C  CH2 . TRP B 1 435 ? -10.157 -8.785  44.786  1.00 57.22  ? 435 TRP B CH2 1 
ATOM   7625 N  N   . MET B 1 436 ? -8.352  -13.361 44.959  1.00 41.52  ? 436 MET B N   1 
ATOM   7626 C  CA  . MET B 1 436 ? -7.330  -12.456 45.458  1.00 49.12  ? 436 MET B CA  1 
ATOM   7627 C  C   . MET B 1 436 ? -5.914  -13.021 45.308  1.00 43.55  ? 436 MET B C   1 
ATOM   7628 O  O   . MET B 1 436 ? -4.947  -12.254 45.403  1.00 41.83  ? 436 MET B O   1 
ATOM   7629 C  CB  . MET B 1 436 ? -7.612  -12.115 46.928  1.00 56.02  ? 436 MET B CB  1 
ATOM   7630 C  CG  . MET B 1 436 ? -8.978  -11.490 47.200  1.00 53.39  ? 436 MET B CG  1 
ATOM   7631 S  SD  . MET B 1 436 ? -9.125  -10.746 48.844  1.00 58.58  ? 436 MET B SD  1 
ATOM   7632 C  CE  . MET B 1 436 ? -7.866  -9.479  48.749  1.00 58.57  ? 436 MET B CE  1 
ATOM   7633 N  N   . GLY B 1 437 ? -5.767  -14.332 45.087  1.00 38.23  ? 437 GLY B N   1 
ATOM   7634 C  CA  . GLY B 1 437 ? -4.437  -14.891 44.845  1.00 39.89  ? 437 GLY B CA  1 
ATOM   7635 C  C   . GLY B 1 437 ? -3.509  -14.765 46.041  1.00 46.95  ? 437 GLY B C   1 
ATOM   7636 O  O   . GLY B 1 437 ? -3.905  -14.996 47.191  1.00 53.09  ? 437 GLY B O   1 
ATOM   7637 N  N   . VAL B 1 438 ? -2.251  -14.405 45.783  1.00 45.56  ? 438 VAL B N   1 
ATOM   7638 C  CA  . VAL B 1 438 ? -1.250  -14.300 46.843  1.00 47.34  ? 438 VAL B CA  1 
ATOM   7639 C  C   . VAL B 1 438 ? -1.215  -12.831 47.262  1.00 47.96  ? 438 VAL B C   1 
ATOM   7640 O  O   . VAL B 1 438 ? -0.527  -11.983 46.675  1.00 42.07  ? 438 VAL B O   1 
ATOM   7641 C  CB  . VAL B 1 438 ? 0.114   -14.872 46.421  1.00 47.55  ? 438 VAL B CB  1 
ATOM   7642 C  CG1 . VAL B 1 438 ? -0.082  -16.205 45.707  1.00 61.22  ? 438 VAL B CG1 1 
ATOM   7643 C  CG2 . VAL B 1 438 ? 0.895   -13.996 45.499  1.00 55.03  ? 438 VAL B CG2 1 
ATOM   7644 N  N   . ILE B 1 439 ? -2.007  -12.512 48.284  1.00 48.60  ? 439 ILE B N   1 
ATOM   7645 C  CA  . ILE B 1 439 ? -2.201  -11.118 48.642  1.00 49.30  ? 439 ILE B CA  1 
ATOM   7646 C  C   . ILE B 1 439 ? -0.903  -10.531 49.165  1.00 50.85  ? 439 ILE B C   1 
ATOM   7647 O  O   . ILE B 1 439 ? -0.103  -11.214 49.815  1.00 52.73  ? 439 ILE B O   1 
ATOM   7648 C  CB  . ILE B 1 439 ? -3.350  -10.978 49.653  1.00 59.43  ? 439 ILE B CB  1 
ATOM   7649 C  CG1 . ILE B 1 439 ? -4.662  -11.480 49.027  1.00 57.26  ? 439 ILE B CG1 1 
ATOM   7650 C  CG2 . ILE B 1 439 ? -3.499  -9.546  50.063  1.00 64.95  ? 439 ILE B CG2 1 
ATOM   7651 C  CD1 . ILE B 1 439 ? -5.170  -12.773 49.591  1.00 55.51  ? 439 ILE B CD1 1 
ATOM   7652 N  N   . HIS B 1 440 ? -0.661  -9.272  48.822  1.00 54.08  ? 440 HIS B N   1 
ATOM   7653 C  CA  . HIS B 1 440 ? 0.461   -8.560  49.407  1.00 50.36  ? 440 HIS B CA  1 
ATOM   7654 C  C   . HIS B 1 440 ? 0.331   -8.606  50.925  1.00 55.12  ? 440 HIS B C   1 
ATOM   7655 O  O   . HIS B 1 440 ? -0.775  -8.542  51.474  1.00 59.61  ? 440 HIS B O   1 
ATOM   7656 C  CB  . HIS B 1 440 ? 0.504   -7.116  48.887  1.00 46.13  ? 440 HIS B CB  1 
ATOM   7657 C  CG  . HIS B 1 440 ? 0.343   -6.078  49.954  1.00 56.19  ? 440 HIS B CG  1 
ATOM   7658 N  ND1 . HIS B 1 440 ? -0.784  -5.983  50.744  1.00 62.23  ? 440 HIS B ND1 1 
ATOM   7659 C  CD2 . HIS B 1 440 ? 1.162   -5.075  50.348  1.00 61.89  ? 440 HIS B CD2 1 
ATOM   7660 C  CE1 . HIS B 1 440 ? -0.639  -4.986  51.598  1.00 64.94  ? 440 HIS B CE1 1 
ATOM   7661 N  NE2 . HIS B 1 440 ? 0.532   -4.416  51.377  1.00 63.25  ? 440 HIS B NE2 1 
ATOM   7662 N  N   . GLY B 1 441 ? 1.470   -8.751  51.603  1.00 53.37  ? 441 GLY B N   1 
ATOM   7663 C  CA  . GLY B 1 441 ? 1.531   -8.987  53.025  1.00 42.80  ? 441 GLY B CA  1 
ATOM   7664 C  C   . GLY B 1 441 ? 1.697   -10.452 53.395  1.00 41.59  ? 441 GLY B C   1 
ATOM   7665 O  O   . GLY B 1 441 ? 2.256   -10.759 54.454  1.00 36.53  ? 441 GLY B O   1 
ATOM   7666 N  N   . TYR B 1 442 ? 1.237   -11.368 52.548  1.00 42.92  ? 442 TYR B N   1 
ATOM   7667 C  CA  . TYR B 1 442 ? 1.171   -12.762 52.954  1.00 45.80  ? 442 TYR B CA  1 
ATOM   7668 C  C   . TYR B 1 442 ? 2.426   -13.521 52.578  1.00 47.22  ? 442 TYR B C   1 
ATOM   7669 O  O   . TYR B 1 442 ? 2.447   -14.753 52.642  1.00 54.67  ? 442 TYR B O   1 
ATOM   7670 C  CB  . TYR B 1 442 ? -0.125  -13.401 52.428  1.00 40.14  ? 442 TYR B CB  1 
ATOM   7671 C  CG  . TYR B 1 442 ? -1.281  -12.864 53.274  1.00 44.01  ? 442 TYR B CG  1 
ATOM   7672 C  CD1 . TYR B 1 442 ? -1.717  -11.538 53.141  1.00 50.09  ? 442 TYR B CD1 1 
ATOM   7673 C  CD2 . TYR B 1 442 ? -1.854  -13.632 54.275  1.00 39.98  ? 442 TYR B CD2 1 
ATOM   7674 C  CE1 . TYR B 1 442 ? -2.720  -11.018 53.950  1.00 51.77  ? 442 TYR B CE1 1 
ATOM   7675 C  CE2 . TYR B 1 442 ? -2.861  -13.121 55.087  1.00 44.88  ? 442 TYR B CE2 1 
ATOM   7676 C  CZ  . TYR B 1 442 ? -3.293  -11.818 54.919  1.00 49.50  ? 442 TYR B CZ  1 
ATOM   7677 O  OH  . TYR B 1 442 ? -4.296  -11.319 55.727  1.00 45.94  ? 442 TYR B OH  1 
ATOM   7678 N  N   . GLU B 1 443 ? 3.488   -12.796 52.226  1.00 41.42  ? 443 GLU B N   1 
ATOM   7679 C  CA  . GLU B 1 443 ? 4.822   -13.360 52.329  1.00 36.98  ? 443 GLU B CA  1 
ATOM   7680 C  C   . GLU B 1 443 ? 5.247   -13.376 53.788  1.00 38.99  ? 443 GLU B C   1 
ATOM   7681 O  O   . GLU B 1 443 ? 5.948   -14.295 54.221  1.00 35.60  ? 443 GLU B O   1 
ATOM   7682 C  CB  . GLU B 1 443 ? 5.820   -12.550 51.479  1.00 31.58  ? 443 GLU B CB  1 
ATOM   7683 C  CG  . GLU B 1 443 ? 6.102   -11.116 52.003  1.00 39.65  ? 443 GLU B CG  1 
ATOM   7684 C  CD  . GLU B 1 443 ? 5.213   -10.039 51.397  1.00 55.18  ? 443 GLU B CD  1 
ATOM   7685 O  OE1 . GLU B 1 443 ? 4.058   -10.342 51.001  1.00 59.11  ? 443 GLU B OE1 1 
ATOM   7686 O  OE2 . GLU B 1 443 ? 5.657   -8.864  51.347  1.00 63.04  1 443 GLU B OE2 1 
ATOM   7687 N  N   . ILE B 1 444 ? 4.746   -12.413 54.571  1.00 28.48  ? 444 ILE B N   1 
ATOM   7688 C  CA  . ILE B 1 444 ? 5.399   -12.044 55.821  1.00 32.70  ? 444 ILE B CA  1 
ATOM   7689 C  C   . ILE B 1 444 ? 5.440   -13.213 56.807  1.00 37.35  ? 444 ILE B C   1 
ATOM   7690 O  O   . ILE B 1 444 ? 6.457   -13.426 57.481  1.00 43.76  ? 444 ILE B O   1 
ATOM   7691 C  CB  . ILE B 1 444 ? 4.741   -10.787 56.427  1.00 35.23  ? 444 ILE B CB  1 
ATOM   7692 C  CG1 . ILE B 1 444 ? 5.025   -9.573  55.537  1.00 30.94  ? 444 ILE B CG1 1 
ATOM   7693 C  CG2 . ILE B 1 444 ? 5.292   -10.505 57.811  1.00 35.78  ? 444 ILE B CG2 1 
ATOM   7694 C  CD1 . ILE B 1 444 ? 4.121   -8.373  55.729  1.00 26.45  ? 444 ILE B CD1 1 
ATOM   7695 N  N   . GLU B 1 445 ? 4.367   -14.001 56.901  1.00 32.39  ? 445 GLU B N   1 
ATOM   7696 C  CA  . GLU B 1 445 ? 4.399   -15.095 57.867  1.00 46.73  ? 445 GLU B CA  1 
ATOM   7697 C  C   . GLU B 1 445 ? 5.443   -16.156 57.526  1.00 41.68  ? 445 GLU B C   1 
ATOM   7698 O  O   . GLU B 1 445 ? 5.896   -16.876 58.425  1.00 41.45  ? 445 GLU B O   1 
ATOM   7699 C  CB  . GLU B 1 445 ? 3.028   -15.754 57.998  1.00 54.49  ? 445 GLU B CB  1 
ATOM   7700 C  CG  . GLU B 1 445 ? 2.444   -16.221 56.695  1.00 59.98  ? 445 GLU B CG  1 
ATOM   7701 C  CD  . GLU B 1 445 ? 1.137   -15.542 56.416  1.00 60.81  ? 445 GLU B CD  1 
ATOM   7702 O  OE1 . GLU B 1 445 ? 1.110   -14.286 56.459  1.00 61.18  ? 445 GLU B OE1 1 
ATOM   7703 O  OE2 . GLU B 1 445 ? 0.144   -16.267 56.178  1.00 60.37  1 445 GLU B OE2 1 
ATOM   7704 N  N   . PHE B 1 446 ? 5.833   -16.284 56.264  1.00 42.87  ? 446 PHE B N   1 
ATOM   7705 C  CA  . PHE B 1 446 ? 6.931   -17.198 55.973  1.00 55.36  ? 446 PHE B CA  1 
ATOM   7706 C  C   . PHE B 1 446 ? 8.282   -16.610 56.398  1.00 47.99  ? 446 PHE B C   1 
ATOM   7707 O  O   . PHE B 1 446 ? 9.113   -17.320 56.979  1.00 46.65  ? 446 PHE B O   1 
ATOM   7708 C  CB  . PHE B 1 446 ? 6.914   -17.565 54.489  1.00 59.94  ? 446 PHE B CB  1 
ATOM   7709 C  CG  . PHE B 1 446 ? 5.694   -18.359 54.073  1.00 56.67  ? 446 PHE B CG  1 
ATOM   7710 C  CD1 . PHE B 1 446 ? 4.550   -17.717 53.626  1.00 57.00  ? 446 PHE B CD1 1 
ATOM   7711 C  CD2 . PHE B 1 446 ? 5.696   -19.745 54.116  1.00 49.98  ? 446 PHE B CD2 1 
ATOM   7712 C  CE1 . PHE B 1 446 ? 3.432   -18.446 53.234  1.00 58.79  ? 446 PHE B CE1 1 
ATOM   7713 C  CE2 . PHE B 1 446 ? 4.579   -20.476 53.725  1.00 49.25  ? 446 PHE B CE2 1 
ATOM   7714 C  CZ  . PHE B 1 446 ? 3.447   -19.827 53.286  1.00 51.21  ? 446 PHE B CZ  1 
ATOM   7715 N  N   . VAL B 1 447 ? 8.506   -15.316 56.139  1.00 41.37  ? 447 VAL B N   1 
ATOM   7716 C  CA  . VAL B 1 447 ? 9.742   -14.658 56.565  1.00 47.47  ? 447 VAL B CA  1 
ATOM   7717 C  C   . VAL B 1 447 ? 9.928   -14.768 58.076  1.00 42.19  ? 447 VAL B C   1 
ATOM   7718 O  O   . VAL B 1 447 ? 11.049  -14.968 58.566  1.00 39.11  ? 447 VAL B O   1 
ATOM   7719 C  CB  . VAL B 1 447 ? 9.748   -13.185 56.114  1.00 44.46  ? 447 VAL B CB  1 
ATOM   7720 C  CG1 . VAL B 1 447 ? 10.860  -12.398 56.837  1.00 28.82  ? 447 VAL B CG1 1 
ATOM   7721 C  CG2 . VAL B 1 447 ? 9.873   -13.086 54.606  1.00 28.35  ? 447 VAL B CG2 1 
ATOM   7722 N  N   . PHE B 1 448 ? 8.842   -14.632 58.834  1.00 33.53  ? 448 PHE B N   1 
ATOM   7723 C  CA  . PHE B 1 448 ? 8.877   -14.713 60.290  1.00 33.32  ? 448 PHE B CA  1 
ATOM   7724 C  C   . PHE B 1 448 ? 8.662   -16.134 60.814  1.00 34.34  ? 448 PHE B C   1 
ATOM   7725 O  O   . PHE B 1 448 ? 8.605   -16.340 62.027  1.00 30.70  ? 448 PHE B O   1 
ATOM   7726 C  CB  . PHE B 1 448 ? 7.845   -13.743 60.891  1.00 31.84  ? 448 PHE B CB  1 
ATOM   7727 C  CG  . PHE B 1 448 ? 8.299   -12.304 60.869  1.00 45.30  ? 448 PHE B CG  1 
ATOM   7728 C  CD1 . PHE B 1 448 ? 8.096   -11.514 59.755  1.00 45.65  ? 448 PHE B CD1 1 
ATOM   7729 C  CD2 . PHE B 1 448 ? 8.976   -11.752 61.957  1.00 53.53  ? 448 PHE B CD2 1 
ATOM   7730 C  CE1 . PHE B 1 448 ? 8.538   -10.183 59.725  1.00 50.61  ? 448 PHE B CE1 1 
ATOM   7731 C  CE2 . PHE B 1 448 ? 9.414   -10.428 61.936  1.00 51.50  ? 448 PHE B CE2 1 
ATOM   7732 C  CZ  . PHE B 1 448 ? 9.197   -9.644  60.810  1.00 50.94  ? 448 PHE B CZ  1 
ATOM   7733 N  N   . GLY B 1 449 ? 8.575   -17.121 59.933  1.00 38.39  ? 449 GLY B N   1 
ATOM   7734 C  CA  . GLY B 1 449 ? 8.602   -18.502 60.367  1.00 42.64  ? 449 GLY B CA  1 
ATOM   7735 C  C   . GLY B 1 449 ? 7.419   -18.995 61.156  1.00 47.39  ? 449 GLY B C   1 
ATOM   7736 O  O   . GLY B 1 449 ? 7.568   -19.959 61.914  1.00 48.17  ? 449 GLY B O   1 
ATOM   7737 N  N   . LEU B 1 450 ? 6.246   -18.379 61.001  1.00 48.05  ? 450 LEU B N   1 
ATOM   7738 C  CA  . LEU B 1 450 ? 5.049   -18.958 61.604  1.00 53.31  ? 450 LEU B CA  1 
ATOM   7739 C  C   . LEU B 1 450 ? 4.657   -20.328 61.054  1.00 49.10  ? 450 LEU B C   1 
ATOM   7740 O  O   . LEU B 1 450 ? 3.982   -21.068 61.791  1.00 53.33  ? 450 LEU B O   1 
ATOM   7741 C  CB  . LEU B 1 450 ? 3.864   -17.990 61.480  1.00 60.53  ? 450 LEU B CB  1 
ATOM   7742 C  CG  . LEU B 1 450 ? 4.098   -16.488 61.645  1.00 69.85  ? 450 LEU B CG  1 
ATOM   7743 C  CD1 . LEU B 1 450 ? 2.763   -15.792 61.559  1.00 72.86  ? 450 LEU B CD1 1 
ATOM   7744 C  CD2 . LEU B 1 450 ? 4.783   -16.132 62.958  1.00 77.16  ? 450 LEU B CD2 1 
ATOM   7745 N  N   . PRO B 1 451 ? 4.986   -20.713 59.809  1.00 46.46  ? 451 PRO B N   1 
ATOM   7746 C  CA  . PRO B 1 451 ? 4.667   -22.083 59.392  1.00 47.33  ? 451 PRO B CA  1 
ATOM   7747 C  C   . PRO B 1 451 ? 5.359   -23.186 60.182  1.00 56.95  ? 451 PRO B C   1 
ATOM   7748 O  O   . PRO B 1 451 ? 5.042   -24.360 59.961  1.00 66.87  ? 451 PRO B O   1 
ATOM   7749 C  CB  . PRO B 1 451 ? 5.075   -22.091 57.924  1.00 45.11  ? 451 PRO B CB  1 
ATOM   7750 C  CG  . PRO B 1 451 ? 4.781   -20.687 57.472  1.00 45.20  ? 451 PRO B CG  1 
ATOM   7751 C  CD  . PRO B 1 451 ? 5.153   -19.804 58.652  1.00 33.46  ? 451 PRO B CD  1 
ATOM   7752 N  N   . LEU B 1 452 ? 6.256   -22.845 61.118  1.00 57.02  ? 452 LEU B N   1 
ATOM   7753 C  CA  . LEU B 1 452 ? 6.923   -23.839 61.963  1.00 63.65  ? 452 LEU B CA  1 
ATOM   7754 C  C   . LEU B 1 452 ? 6.111   -24.202 63.194  1.00 65.01  ? 452 LEU B C   1 
ATOM   7755 O  O   . LEU B 1 452 ? 6.492   -25.131 63.922  1.00 68.86  ? 452 LEU B O   1 
ATOM   7756 C  CB  . LEU B 1 452 ? 8.304   -23.335 62.416  1.00 62.63  ? 452 LEU B CB  1 
ATOM   7757 C  CG  . LEU B 1 452 ? 9.218   -22.648 61.408  1.00 59.03  ? 452 LEU B CG  1 
ATOM   7758 C  CD1 . LEU B 1 452 ? 10.634  -22.644 61.923  1.00 56.18  ? 452 LEU B CD1 1 
ATOM   7759 C  CD2 . LEU B 1 452 ? 9.149   -23.274 60.026  1.00 61.15  ? 452 LEU B CD2 1 
ATOM   7760 N  N   . VAL B 1 453 ? 5.021   -23.478 63.427  1.00 58.50  ? 453 VAL B N   1 
ATOM   7761 C  CA  . VAL B 1 453 ? 4.132   -23.646 64.567  1.00 56.17  ? 453 VAL B CA  1 
ATOM   7762 C  C   . VAL B 1 453 ? 2.998   -24.575 64.165  1.00 58.49  ? 453 VAL B C   1 
ATOM   7763 O  O   . VAL B 1 453 ? 2.289   -24.303 63.183  1.00 67.46  ? 453 VAL B O   1 
ATOM   7764 C  CB  . VAL B 1 453 ? 3.573   -22.289 65.018  1.00 53.87  ? 453 VAL B CB  1 
ATOM   7765 C  CG1 . VAL B 1 453 ? 2.939   -22.422 66.380  1.00 67.53  ? 453 VAL B CG1 1 
ATOM   7766 C  CG2 . VAL B 1 453 ? 4.662   -21.231 65.022  1.00 46.44  ? 453 VAL B CG2 1 
ATOM   7767 N  N   . LYS B 1 454 ? 2.800   -25.651 64.937  1.00 52.16  ? 454 LYS B N   1 
ATOM   7768 C  CA  . LYS B 1 454 ? 1.927   -26.691 64.421  1.00 61.86  ? 454 LYS B CA  1 
ATOM   7769 C  C   . LYS B 1 454 ? 0.451   -26.331 64.541  1.00 66.25  ? 454 LYS B C   1 
ATOM   7770 O  O   . LYS B 1 454 ? -0.337  -26.663 63.646  1.00 62.39  ? 454 LYS B O   1 
ATOM   7771 C  CB  . LYS B 1 454 ? 2.245   -28.023 65.087  1.00 65.43  ? 454 LYS B CB  1 
ATOM   7772 C  CG  . LYS B 1 454 ? 3.479   -28.698 64.453  1.00 79.81  ? 454 LYS B CG  1 
ATOM   7773 C  CD  . LYS B 1 454 ? 3.403   -28.564 62.918  1.00 86.73  ? 454 LYS B CD  1 
ATOM   7774 C  CE  . LYS B 1 454 ? 4.778   -28.640 62.235  1.00 87.74  ? 454 LYS B CE  1 
ATOM   7775 N  NZ  . LYS B 1 454 ? 5.238   -27.338 61.614  1.00 89.05  1 454 LYS B NZ  1 
ATOM   7776 N  N   . GLU B 1 455 ? 0.051   -25.629 65.597  1.00 76.10  ? 455 GLU B N   1 
ATOM   7777 C  CA  . GLU B 1 455 ? -1.371  -25.339 65.725  1.00 84.24  ? 455 GLU B CA  1 
ATOM   7778 C  C   . GLU B 1 455 ? -1.818  -24.175 64.836  1.00 79.74  ? 455 GLU B C   1 
ATOM   7779 O  O   . GLU B 1 455 ? -3.009  -23.830 64.833  1.00 89.26  ? 455 GLU B O   1 
ATOM   7780 C  CB  . GLU B 1 455 ? -1.722  -25.116 67.213  1.00 98.49  ? 455 GLU B CB  1 
ATOM   7781 C  CG  . GLU B 1 455 ? -3.168  -24.669 67.533  1.00 112.84 ? 455 GLU B CG  1 
ATOM   7782 C  CD  . GLU B 1 455 ? -4.246  -25.692 67.146  1.00 123.71 ? 455 GLU B CD  1 
ATOM   7783 O  OE1 . GLU B 1 455 ? -5.427  -25.287 66.990  1.00 126.36 ? 455 GLU B OE1 1 
ATOM   7784 O  OE2 . GLU B 1 455 ? -3.935  -26.901 66.976  1.00 128.15 1 455 GLU B OE2 1 
ATOM   7785 N  N   . LEU B 1 456 ? -0.925  -23.587 64.040  1.00 64.97  ? 456 LEU B N   1 
ATOM   7786 C  CA  . LEU B 1 456 ? -1.384  -22.678 62.994  1.00 55.65  ? 456 LEU B CA  1 
ATOM   7787 C  C   . LEU B 1 456 ? -1.637  -23.382 61.668  1.00 61.38  ? 456 LEU B C   1 
ATOM   7788 O  O   . LEU B 1 456 ? -1.985  -22.719 60.685  1.00 64.81  ? 456 LEU B O   1 
ATOM   7789 C  CB  . LEU B 1 456 ? -0.399  -21.527 62.776  1.00 40.05  ? 456 LEU B CB  1 
ATOM   7790 C  CG  . LEU B 1 456 ? 0.176   -20.897 64.029  1.00 39.47  ? 456 LEU B CG  1 
ATOM   7791 C  CD1 . LEU B 1 456 ? 1.009   -19.695 63.638  1.00 35.41  ? 456 LEU B CD1 1 
ATOM   7792 C  CD2 . LEU B 1 456 ? -0.977  -20.495 64.951  1.00 37.33  ? 456 LEU B CD2 1 
ATOM   7793 N  N   . ASN B 1 457 ? -1.439  -24.696 61.616  1.00 60.26  ? 457 ASN B N   1 
ATOM   7794 C  CA  . ASN B 1 457 ? -2.026  -25.545 60.590  1.00 65.14  ? 457 ASN B CA  1 
ATOM   7795 C  C   . ASN B 1 457 ? -1.547  -25.158 59.190  1.00 66.30  ? 457 ASN B C   1 
ATOM   7796 O  O   . ASN B 1 457 ? -2.327  -24.746 58.329  1.00 69.25  ? 457 ASN B O   1 
ATOM   7797 C  CB  . ASN B 1 457 ? -3.554  -25.504 60.689  1.00 71.51  ? 457 ASN B CB  1 
ATOM   7798 C  CG  . ASN B 1 457 ? -4.084  -26.287 61.884  1.00 84.76  ? 457 ASN B CG  1 
ATOM   7799 O  OD1 . ASN B 1 457 ? -3.419  -27.188 62.388  1.00 99.31  ? 457 ASN B OD1 1 
ATOM   7800 N  ND2 . ASN B 1 457 ? -5.283  -25.953 62.337  1.00 82.09  ? 457 ASN B ND2 1 
ATOM   7801 N  N   . TYR B 1 458 ? -0.243  -25.296 58.973  1.00 59.11  ? 458 TYR B N   1 
ATOM   7802 C  CA  . TYR B 1 458 ? 0.315   -25.109 57.644  1.00 50.02  ? 458 TYR B CA  1 
ATOM   7803 C  C   . TYR B 1 458 ? 0.674   -26.448 57.020  1.00 51.99  ? 458 TYR B C   1 
ATOM   7804 O  O   . TYR B 1 458 ? 0.996   -27.417 57.714  1.00 46.67  ? 458 TYR B O   1 
ATOM   7805 C  CB  . TYR B 1 458 ? 1.561   -24.232 57.667  1.00 38.52  ? 458 TYR B CB  1 
ATOM   7806 C  CG  . TYR B 1 458 ? 1.325   -22.754 57.897  1.00 43.17  ? 458 TYR B CG  1 
ATOM   7807 C  CD1 . TYR B 1 458 ? 1.259   -22.243 59.189  1.00 39.87  ? 458 TYR B CD1 1 
ATOM   7808 C  CD2 . TYR B 1 458 ? 1.210   -21.865 56.826  1.00 36.35  ? 458 TYR B CD2 1 
ATOM   7809 C  CE1 . TYR B 1 458 ? 1.082   -20.896 59.415  1.00 41.65  ? 458 TYR B CE1 1 
ATOM   7810 C  CE2 . TYR B 1 458 ? 1.031   -20.507 57.042  1.00 43.98  ? 458 TYR B CE2 1 
ATOM   7811 C  CZ  . TYR B 1 458 ? 0.966   -20.033 58.345  1.00 52.47  ? 458 TYR B CZ  1 
ATOM   7812 O  OH  . TYR B 1 458 ? 0.779   -18.692 58.589  1.00 61.05  ? 458 TYR B OH  1 
ATOM   7813 N  N   . THR B 1 459 ? 0.600   -26.484 55.689  1.00 58.44  ? 459 THR B N   1 
ATOM   7814 C  CA  . THR B 1 459 ? 1.175   -27.575 54.917  1.00 60.44  ? 459 THR B CA  1 
ATOM   7815 C  C   . THR B 1 459 ? 2.607   -27.812 55.366  1.00 51.47  ? 459 THR B C   1 
ATOM   7816 O  O   . THR B 1 459 ? 3.353   -26.864 55.611  1.00 49.60  ? 459 THR B O   1 
ATOM   7817 C  CB  . THR B 1 459 ? 1.126   -27.226 53.420  1.00 79.78  ? 459 THR B CB  1 
ATOM   7818 O  OG1 . THR B 1 459 ? -0.155  -27.513 52.894  1.00 93.60  ? 459 THR B OG1 1 
ATOM   7819 C  CG2 . THR B 1 459 ? 2.156   -27.959 52.628  1.00 82.31  ? 459 THR B CG2 1 
ATOM   7820 N  N   . ALA B 1 460 ? 2.976   -29.084 55.522  1.00 55.08  ? 460 ALA B N   1 
ATOM   7821 C  CA  . ALA B 1 460 ? 4.357   -29.397 55.877  1.00 55.67  ? 460 ALA B CA  1 
ATOM   7822 C  C   . ALA B 1 460 ? 5.336   -28.700 54.938  1.00 65.94  ? 460 ALA B C   1 
ATOM   7823 O  O   . ALA B 1 460 ? 6.327   -28.111 55.387  1.00 76.97  ? 460 ALA B O   1 
ATOM   7824 C  CB  . ALA B 1 460 ? 4.576   -30.906 55.858  1.00 44.82  ? 460 ALA B CB  1 
ATOM   7825 N  N   . GLU B 1 461 ? 5.052   -28.722 53.631  1.00 63.50  ? 461 GLU B N   1 
ATOM   7826 C  CA  . GLU B 1 461 ? 5.887   -28.043 52.643  1.00 62.40  ? 461 GLU B CA  1 
ATOM   7827 C  C   . GLU B 1 461 ? 5.822   -26.523 52.755  1.00 58.40  ? 461 GLU B C   1 
ATOM   7828 O  O   . GLU B 1 461 ? 6.627   -25.837 52.114  1.00 52.66  ? 461 GLU B O   1 
ATOM   7829 C  CB  . GLU B 1 461 ? 5.502   -28.487 51.222  1.00 64.45  ? 461 GLU B CB  1 
ATOM   7830 C  CG  . GLU B 1 461 ? 5.823   -29.959 50.896  1.00 72.30  ? 461 GLU B CG  1 
ATOM   7831 C  CD  . GLU B 1 461 ? 4.783   -30.949 51.429  1.00 85.15  ? 461 GLU B CD  1 
ATOM   7832 O  OE1 . GLU B 1 461 ? 3.600   -30.564 51.535  1.00 84.40  ? 461 GLU B OE1 1 
ATOM   7833 O  OE2 . GLU B 1 461 ? 5.146   -32.110 51.743  1.00 90.97  1 461 GLU B OE2 1 
ATOM   7834 N  N   . GLU B 1 462 ? 4.886   -25.987 53.546  1.00 60.44  ? 462 GLU B N   1 
ATOM   7835 C  CA  . GLU B 1 462 ? 4.897   -24.571 53.900  1.00 54.82  ? 462 GLU B CA  1 
ATOM   7836 C  C   . GLU B 1 462 ? 5.867   -24.286 55.037  1.00 53.19  ? 462 GLU B C   1 
ATOM   7837 O  O   . GLU B 1 462 ? 6.379   -23.164 55.152  1.00 48.64  ? 462 GLU B O   1 
ATOM   7838 C  CB  . GLU B 1 462 ? 3.488   -24.115 54.280  1.00 54.99  ? 462 GLU B CB  1 
ATOM   7839 C  CG  . GLU B 1 462 ? 2.718   -23.498 53.129  1.00 64.18  ? 462 GLU B CG  1 
ATOM   7840 C  CD  . GLU B 1 462 ? 1.217   -23.708 53.237  1.00 68.16  ? 462 GLU B CD  1 
ATOM   7841 O  OE1 . GLU B 1 462 ? 0.770   -24.283 54.256  1.00 72.58  ? 462 GLU B OE1 1 
ATOM   7842 O  OE2 . GLU B 1 462 ? 0.488   -23.288 52.306  1.00 60.49  1 462 GLU B OE2 1 
ATOM   7843 N  N   . GLU B 1 463 ? 6.124   -25.277 55.892  1.00 54.90  ? 463 GLU B N   1 
ATOM   7844 C  CA  . GLU B 1 463 ? 7.183   -25.125 56.879  1.00 53.51  ? 463 GLU B CA  1 
ATOM   7845 C  C   . GLU B 1 463 ? 8.540   -25.104 56.196  1.00 52.60  ? 463 GLU B C   1 
ATOM   7846 O  O   . GLU B 1 463 ? 9.367   -24.218 56.446  1.00 54.61  ? 463 GLU B O   1 
ATOM   7847 C  CB  . GLU B 1 463 ? 7.115   -26.254 57.904  1.00 56.58  ? 463 GLU B CB  1 
ATOM   7848 C  CG  . GLU B 1 463 ? 8.366   -26.384 58.757  1.00 64.67  ? 463 GLU B CG  1 
ATOM   7849 C  CD  . GLU B 1 463 ? 8.244   -27.458 59.824  1.00 73.27  ? 463 GLU B CD  1 
ATOM   7850 O  OE1 . GLU B 1 463 ? 7.099   -27.891 60.109  1.00 68.78  ? 463 GLU B OE1 1 
ATOM   7851 O  OE2 . GLU B 1 463 ? 9.294   -27.861 60.380  1.00 76.32  1 463 GLU B OE2 1 
ATOM   7852 N  N   . ALA B 1 464 ? 8.779   -26.072 55.317  1.00 50.56  ? 464 ALA B N   1 
ATOM   7853 C  CA  . ALA B 1 464 ? 10.021  -26.089 54.563  1.00 52.39  ? 464 ALA B CA  1 
ATOM   7854 C  C   . ALA B 1 464 ? 10.237  -24.765 53.839  1.00 55.36  ? 464 ALA B C   1 
ATOM   7855 O  O   . ALA B 1 464 ? 11.302  -24.150 53.953  1.00 56.04  ? 464 ALA B O   1 
ATOM   7856 C  CB  . ALA B 1 464 ? 10.012  -27.259 53.585  1.00 54.04  ? 464 ALA B CB  1 
ATOM   7857 N  N   . LEU B 1 465 ? 9.223   -24.294 53.111  1.00 50.61  ? 465 LEU B N   1 
ATOM   7858 C  CA  . LEU B 1 465 ? 9.374   -23.040 52.384  1.00 48.31  ? 465 LEU B CA  1 
ATOM   7859 C  C   . LEU B 1 465 ? 9.670   -21.885 53.335  1.00 53.33  ? 465 LEU B C   1 
ATOM   7860 O  O   . LEU B 1 465 ? 10.489  -21.008 53.027  1.00 51.04  ? 465 LEU B O   1 
ATOM   7861 C  CB  . LEU B 1 465 ? 8.119   -22.761 51.560  1.00 49.12  ? 465 LEU B CB  1 
ATOM   7862 C  CG  . LEU B 1 465 ? 7.983   -21.335 51.012  1.00 48.99  ? 465 LEU B CG  1 
ATOM   7863 C  CD1 . LEU B 1 465 ? 8.900   -21.153 49.811  1.00 44.86  ? 465 LEU B CD1 1 
ATOM   7864 C  CD2 . LEU B 1 465 ? 6.544   -21.033 50.634  1.00 47.53  ? 465 LEU B CD2 1 
ATOM   7865 N  N   . SER B 1 466 ? 9.036   -21.880 54.512  1.00 56.52  ? 466 SER B N   1 
ATOM   7866 C  CA  . SER B 1 466 ? 9.329   -20.827 55.476  1.00 53.39  ? 466 SER B CA  1 
ATOM   7867 C  C   . SER B 1 466 ? 10.741  -20.958 56.030  1.00 50.85  ? 466 SER B C   1 
ATOM   7868 O  O   . SER B 1 466 ? 11.360  -19.950 56.386  1.00 46.50  ? 466 SER B O   1 
ATOM   7869 C  CB  . SER B 1 466 ? 8.313   -20.840 56.613  1.00 45.98  ? 466 SER B CB  1 
ATOM   7870 O  OG  . SER B 1 466 ? 8.617   -19.821 57.558  1.00 39.87  ? 466 SER B OG  1 
ATOM   7871 N  N   . ARG B 1 467 ? 11.269  -22.179 56.104  1.00 51.93  ? 467 ARG B N   1 
ATOM   7872 C  CA  . ARG B 1 467 ? 12.639  -22.347 56.579  1.00 54.28  ? 467 ARG B CA  1 
ATOM   7873 C  C   . ARG B 1 467 ? 13.671  -21.989 55.508  1.00 47.79  ? 467 ARG B C   1 
ATOM   7874 O  O   . ARG B 1 467 ? 14.700  -21.380 55.825  1.00 45.10  ? 467 ARG B O   1 
ATOM   7875 C  CB  . ARG B 1 467 ? 12.870  -23.776 57.070  1.00 54.17  ? 467 ARG B CB  1 
ATOM   7876 C  CG  . ARG B 1 467 ? 12.052  -24.182 58.278  1.00 49.05  ? 467 ARG B CG  1 
ATOM   7877 C  CD  . ARG B 1 467 ? 12.452  -25.590 58.690  1.00 51.77  ? 467 ARG B CD  1 
ATOM   7878 N  NE  . ARG B 1 467 ? 11.820  -26.060 59.923  1.00 52.61  ? 467 ARG B NE  1 
ATOM   7879 C  CZ  . ARG B 1 467 ? 12.193  -25.682 61.139  1.00 46.92  ? 467 ARG B CZ  1 
ATOM   7880 N  NH1 . ARG B 1 467 ? 13.171  -24.797 61.289  1.00 47.15  1 467 ARG B NH1 1 
ATOM   7881 N  NH2 . ARG B 1 467 ? 11.574  -26.169 62.204  1.00 46.88  ? 467 ARG B NH2 1 
ATOM   7882 N  N   . ARG B 1 468 ? 13.440  -22.365 54.242  1.00 42.03  ? 468 ARG B N   1 
ATOM   7883 C  CA  A ARG B 1 468 ? 14.398  -21.955 53.225  0.55 41.81  ? 468 ARG B CA  1 
ATOM   7884 C  CA  B ARG B 1 468 ? 14.340  -21.954 53.165  0.45 41.67  ? 468 ARG B CA  1 
ATOM   7885 C  C   . ARG B 1 468 ? 14.437  -20.438 53.086  1.00 45.35  ? 468 ARG B C   1 
ATOM   7886 O  O   . ARG B 1 468 ? 15.515  -19.877 52.854  1.00 54.24  ? 468 ARG B O   1 
ATOM   7887 C  CB  A ARG B 1 468 ? 14.112  -22.637 51.882  0.55 39.36  ? 468 ARG B CB  1 
ATOM   7888 C  CB  B ARG B 1 468 ? 13.853  -22.506 51.826  0.45 39.59  ? 468 ARG B CB  1 
ATOM   7889 C  CG  A ARG B 1 468 ? 12.851  -22.216 51.159  0.55 42.96  ? 468 ARG B CG  1 
ATOM   7890 C  CG  B ARG B 1 468 ? 14.592  -23.725 51.313  0.45 38.83  ? 468 ARG B CG  1 
ATOM   7891 C  CD  A ARG B 1 468 ? 12.613  -23.096 49.920  0.55 41.82  ? 468 ARG B CD  1 
ATOM   7892 C  CD  B ARG B 1 468 ? 14.178  -24.043 49.879  0.45 40.15  ? 468 ARG B CD  1 
ATOM   7893 N  NE  A ARG B 1 468 ? 13.457  -22.718 48.787  0.55 36.51  ? 468 ARG B NE  1 
ATOM   7894 N  NE  B ARG B 1 468 ? 12.726  -24.082 49.713  0.45 41.33  ? 468 ARG B NE  1 
ATOM   7895 C  CZ  A ARG B 1 468 ? 12.990  -22.317 47.609  0.55 40.29  ? 468 ARG B CZ  1 
ATOM   7896 C  CZ  B ARG B 1 468 ? 11.966  -25.128 50.020  0.45 38.29  ? 468 ARG B CZ  1 
ATOM   7897 N  NH1 A ARG B 1 468 ? 11.687  -22.251 47.394  0.55 36.29  1 468 ARG B NH1 1 
ATOM   7898 N  NH1 B ARG B 1 468 ? 12.521  -26.227 50.515  0.45 39.32  1 468 ARG B NH1 1 
ATOM   7899 N  NH2 A ARG B 1 468 ? 13.832  -21.992 46.640  0.55 46.17  ? 468 ARG B NH2 1 
ATOM   7900 N  NH2 B ARG B 1 468 ? 10.653  -25.074 49.835  0.45 38.23  ? 468 ARG B NH2 1 
ATOM   7901 N  N   . ILE B 1 469 ? 13.305  -19.758 53.275  1.00 40.69  ? 469 ILE B N   1 
ATOM   7902 C  CA  . ILE B 1 469 ? 13.277  -18.301 53.159  1.00 40.85  ? 469 ILE B CA  1 
ATOM   7903 C  C   . ILE B 1 469 ? 14.035  -17.650 54.310  1.00 47.29  ? 469 ILE B C   1 
ATOM   7904 O  O   . ILE B 1 469 ? 14.957  -16.862 54.085  1.00 47.79  ? 469 ILE B O   1 
ATOM   7905 C  CB  . ILE B 1 469 ? 11.831  -17.791 53.080  1.00 37.95  ? 469 ILE B CB  1 
ATOM   7906 C  CG1 . ILE B 1 469 ? 11.298  -17.987 51.666  1.00 41.23  ? 469 ILE B CG1 1 
ATOM   7907 C  CG2 . ILE B 1 469 ? 11.764  -16.329 53.443  1.00 36.89  ? 469 ILE B CG2 1 
ATOM   7908 C  CD1 . ILE B 1 469 ? 9.823   -17.833 51.570  1.00 32.35  ? 469 ILE B CD1 1 
ATOM   7909 N  N   . MET B 1 470 ? 13.656  -17.957 55.557  1.00 50.70  ? 470 MET B N   1 
ATOM   7910 C  CA  . MET B 1 470 ? 14.384  -17.408 56.701  1.00 43.63  ? 470 MET B CA  1 
ATOM   7911 C  C   . MET B 1 470 ? 15.871  -17.611 56.523  1.00 48.27  ? 470 MET B C   1 
ATOM   7912 O  O   . MET B 1 470 ? 16.672  -16.685 56.709  1.00 38.24  ? 470 MET B O   1 
ATOM   7913 C  CB  . MET B 1 470 ? 13.948  -18.074 58.000  1.00 44.48  ? 470 MET B CB  1 
ATOM   7914 C  CG  . MET B 1 470 ? 12.508  -17.859 58.369  1.00 46.04  ? 470 MET B CG  1 
ATOM   7915 S  SD  . MET B 1 470 ? 12.163  -18.843 59.829  1.00 40.42  ? 470 MET B SD  1 
ATOM   7916 C  CE  . MET B 1 470 ? 11.729  -17.525 60.907  1.00 43.11  ? 470 MET B CE  1 
ATOM   7917 N  N   . HIS B 1 471 ? 16.255  -18.827 56.134  1.00 50.49  ? 471 HIS B N   1 
ATOM   7918 C  CA  . HIS B 1 471 ? 17.654  -19.085 55.856  1.00 47.93  ? 471 HIS B CA  1 
ATOM   7919 C  C   . HIS B 1 471 ? 18.181  -18.133 54.785  1.00 53.77  ? 471 HIS B C   1 
ATOM   7920 O  O   . HIS B 1 471 ? 19.119  -17.375 55.049  1.00 60.38  ? 471 HIS B O   1 
ATOM   7921 C  CB  . HIS B 1 471 ? 17.859  -20.538 55.465  1.00 51.12  ? 471 HIS B CB  1 
ATOM   7922 C  CG  . HIS B 1 471 ? 19.277  -20.974 55.603  1.00 54.27  ? 471 HIS B CG  1 
ATOM   7923 N  ND1 . HIS B 1 471 ? 20.048  -20.623 56.688  1.00 49.33  ? 471 HIS B ND1 1 
ATOM   7924 C  CD2 . HIS B 1 471 ? 20.072  -21.709 54.792  1.00 58.99  ? 471 HIS B CD2 1 
ATOM   7925 C  CE1 . HIS B 1 471 ? 21.256  -21.132 56.546  1.00 53.60  ? 471 HIS B CE1 1 
ATOM   7926 N  NE2 . HIS B 1 471 ? 21.297  -21.795 55.404  1.00 60.20  ? 471 HIS B NE2 1 
ATOM   7927 N  N   . TYR B 1 472 ? 17.554  -18.115 53.585  1.00 49.95  ? 472 TYR B N   1 
ATOM   7928 C  CA  . TYR B 1 472 ? 17.964  -17.179 52.523  1.00 51.27  ? 472 TYR B CA  1 
ATOM   7929 C  C   . TYR B 1 472 ? 18.097  -15.760 53.041  1.00 50.84  ? 472 TYR B C   1 
ATOM   7930 O  O   . TYR B 1 472 ? 18.918  -14.974 52.551  1.00 52.43  ? 472 TYR B O   1 
ATOM   7931 C  CB  . TYR B 1 472 ? 16.955  -17.110 51.368  1.00 52.69  ? 472 TYR B CB  1 
ATOM   7932 C  CG  . TYR B 1 472 ? 16.840  -18.288 50.444  1.00 48.37  ? 472 TYR B CG  1 
ATOM   7933 C  CD1 . TYR B 1 472 ? 17.848  -19.216 50.318  1.00 47.85  ? 472 TYR B CD1 1 
ATOM   7934 C  CD2 . TYR B 1 472 ? 15.702  -18.452 49.680  1.00 53.71  ? 472 TYR B CD2 1 
ATOM   7935 C  CE1 . TYR B 1 472 ? 17.709  -20.290 49.457  1.00 51.56  ? 472 TYR B CE1 1 
ATOM   7936 C  CE2 . TYR B 1 472 ? 15.556  -19.516 48.824  1.00 58.44  ? 472 TYR B CE2 1 
ATOM   7937 C  CZ  . TYR B 1 472 ? 16.556  -20.435 48.710  1.00 54.84  ? 472 TYR B CZ  1 
ATOM   7938 O  OH  . TYR B 1 472 ? 16.382  -21.496 47.839  1.00 60.08  ? 472 TYR B OH  1 
ATOM   7939 N  N   . TRP B 1 473 ? 17.283  -15.410 54.014  1.00 45.86  ? 473 TRP B N   1 
ATOM   7940 C  CA  . TRP B 1 473 ? 17.215  -14.038 54.460  1.00 50.14  ? 473 TRP B CA  1 
ATOM   7941 C  C   . TRP B 1 473 ? 18.213  -13.759 55.567  1.00 53.81  ? 473 TRP B C   1 
ATOM   7942 O  O   . TRP B 1 473 ? 18.920  -12.748 55.517  1.00 95.76  ? 473 TRP B O   1 
ATOM   7943 C  CB  . TRP B 1 473 ? 15.789  -13.728 54.895  1.00 54.34  ? 473 TRP B CB  1 
ATOM   7944 C  CG  . TRP B 1 473 ? 14.923  -13.732 53.718  1.00 64.64  ? 473 TRP B CG  1 
ATOM   7945 C  CD1 . TRP B 1 473 ? 14.951  -14.602 52.649  1.00 73.77  ? 473 TRP B CD1 1 
ATOM   7946 C  CD2 . TRP B 1 473 ? 13.987  -12.740 53.390  1.00 54.73  ? 473 TRP B CD2 1 
ATOM   7947 N  NE1 . TRP B 1 473 ? 14.022  -14.242 51.707  1.00 61.93  ? 473 TRP B NE1 1 
ATOM   7948 C  CE2 . TRP B 1 473 ? 13.423  -13.088 52.130  1.00 49.76  ? 473 TRP B CE2 1 
ATOM   7949 C  CE3 . TRP B 1 473 ? 13.548  -11.595 54.042  1.00 41.39  ? 473 TRP B CE3 1 
ATOM   7950 C  CZ2 . TRP B 1 473 ? 12.449  -12.331 51.523  1.00 44.66  ? 473 TRP B CZ2 1 
ATOM   7951 C  CZ3 . TRP B 1 473 ? 12.595  -10.850 53.444  1.00 51.92  ? 473 TRP B CZ3 1 
ATOM   7952 C  CH2 . TRP B 1 473 ? 12.038  -11.218 52.193  1.00 57.47  ? 473 TRP B CH2 1 
ATOM   7953 N  N   . ALA B 1 474 ? 18.297  -14.629 56.567  1.00 41.37  ? 474 ALA B N   1 
ATOM   7954 C  CA  . ALA B 1 474 ? 19.343  -14.422 57.553  1.00 47.75  ? 474 ALA B CA  1 
ATOM   7955 C  C   . ALA B 1 474 ? 20.720  -14.661 56.939  1.00 46.28  ? 474 ALA B C   1 
ATOM   7956 O  O   . ALA B 1 474 ? 21.668  -13.917 57.238  1.00 38.99  ? 474 ALA B O   1 
ATOM   7957 C  CB  . ALA B 1 474 ? 19.110  -15.300 58.785  1.00 45.07  ? 474 ALA B CB  1 
ATOM   7958 N  N   . THR B 1 475 ? 20.850  -15.663 56.049  1.00 44.78  ? 475 THR B N   1 
ATOM   7959 C  CA  . THR B 1 475 ? 22.142  -15.870 55.391  1.00 46.17  ? 475 THR B CA  1 
ATOM   7960 C  C   . THR B 1 475 ? 22.519  -14.652 54.563  1.00 43.20  ? 475 THR B C   1 
ATOM   7961 O  O   . THR B 1 475 ? 23.681  -14.225 54.564  1.00 35.32  ? 475 THR B O   1 
ATOM   7962 C  CB  . THR B 1 475 ? 22.143  -17.141 54.536  1.00 34.04  ? 475 THR B CB  1 
ATOM   7963 O  OG1 . THR B 1 475 ? 21.765  -18.261 55.327  1.00 52.01  ? 475 THR B OG1 1 
ATOM   7964 C  CG2 . THR B 1 475 ? 23.504  -17.390 53.977  1.00 35.00  ? 475 THR B CG2 1 
ATOM   7965 N  N   . PHE B 1 476 ? 21.542  -14.047 53.885  1.00 41.51  ? 476 PHE B N   1 
ATOM   7966 C  CA  . PHE B 1 476 ? 21.818  -12.782 53.213  1.00 42.54  ? 476 PHE B CA  1 
ATOM   7967 C  C   . PHE B 1 476 ? 22.246  -11.713 54.215  1.00 46.81  ? 476 PHE B C   1 
ATOM   7968 O  O   . PHE B 1 476 ? 23.237  -11.006 54.002  1.00 46.61  ? 476 PHE B O   1 
ATOM   7969 C  CB  . PHE B 1 476 ? 20.595  -12.316 52.413  1.00 37.63  ? 476 PHE B CB  1 
ATOM   7970 C  CG  . PHE B 1 476 ? 20.726  -10.925 51.888  1.00 38.97  ? 476 PHE B CG  1 
ATOM   7971 C  CD1 . PHE B 1 476 ? 21.498  -10.669 50.748  1.00 37.08  ? 476 PHE B CD1 1 
ATOM   7972 C  CD2 . PHE B 1 476 ? 20.134  -9.861  52.566  1.00 29.53  ? 476 PHE B CD2 1 
ATOM   7973 C  CE1 . PHE B 1 476 ? 21.645  -9.367  50.277  1.00 37.30  ? 476 PHE B CE1 1 
ATOM   7974 C  CE2 . PHE B 1 476 ? 20.275  -8.562  52.113  1.00 31.15  ? 476 PHE B CE2 1 
ATOM   7975 C  CZ  . PHE B 1 476 ? 21.023  -8.306  50.964  1.00 38.65  ? 476 PHE B CZ  1 
ATOM   7976 N  N   . ALA B 1 477 ? 21.514  -11.595 55.326  1.00 53.21  ? 477 ALA B N   1 
ATOM   7977 C  CA  . ALA B 1 477 ? 21.831  -10.591 56.341  1.00 43.49  ? 477 ALA B CA  1 
ATOM   7978 C  C   . ALA B 1 477 ? 23.233  -10.776 56.904  1.00 41.68  ? 477 ALA B C   1 
ATOM   7979 O  O   . ALA B 1 477 ? 23.938  -9.794  57.154  1.00 48.83  ? 477 ALA B O   1 
ATOM   7980 C  CB  . ALA B 1 477 ? 20.805  -10.649 57.468  1.00 38.70  ? 477 ALA B CB  1 
ATOM   7981 N  N   . LYS B 1 478 ? 23.654  -12.025 57.120  1.00 39.15  ? 478 LYS B N   1 
ATOM   7982 C  CA  . LYS B 1 478 ? 24.989  -12.271 57.660  1.00 43.50  ? 478 LYS B CA  1 
ATOM   7983 C  C   . LYS B 1 478 ? 26.070  -11.958 56.628  1.00 48.34  ? 478 LYS B C   1 
ATOM   7984 O  O   . LYS B 1 478 ? 26.950  -11.121 56.861  1.00 51.07  ? 478 LYS B O   1 
ATOM   7985 C  CB  . LYS B 1 478 ? 25.096  -13.725 58.124  1.00 47.48  ? 478 LYS B CB  1 
ATOM   7986 C  CG  . LYS B 1 478 ? 24.018  -14.107 59.129  1.00 63.00  ? 478 LYS B CG  1 
ATOM   7987 C  CD  . LYS B 1 478 ? 24.172  -15.513 59.672  1.00 66.93  ? 478 LYS B CD  1 
ATOM   7988 C  CE  . LYS B 1 478 ? 23.425  -15.677 60.991  1.00 63.81  ? 478 LYS B CE  1 
ATOM   7989 N  NZ  . LYS B 1 478 ? 23.425  -17.106 61.425  1.00 60.12  1 478 LYS B NZ  1 
ATOM   7990 N  N   . THR B 1 479 ? 25.993  -12.598 55.466  1.00 45.16  ? 479 THR B N   1 
ATOM   7991 C  CA  . THR B 1 479 ? 27.081  -12.640 54.508  1.00 47.13  ? 479 THR B CA  1 
ATOM   7992 C  C   . THR B 1 479 ? 26.885  -11.738 53.301  1.00 47.98  ? 479 THR B C   1 
ATOM   7993 O  O   . THR B 1 479 ? 27.827  -11.578 52.516  1.00 46.41  ? 479 THR B O   1 
ATOM   7994 C  CB  . THR B 1 479 ? 27.273  -14.079 54.017  1.00 53.47  ? 479 THR B CB  1 
ATOM   7995 O  OG1 . THR B 1 479 ? 26.258  -14.385 53.052  1.00 54.71  ? 479 THR B OG1 1 
ATOM   7996 C  CG2 . THR B 1 479 ? 27.150  -15.051 55.196  1.00 52.71  ? 479 THR B CG2 1 
ATOM   7997 N  N   . GLY B 1 480 ? 25.700  -11.160 53.120  1.00 46.56  ? 480 GLY B N   1 
ATOM   7998 C  CA  . GLY B 1 480 ? 25.412  -10.461 51.882  1.00 40.20  ? 480 GLY B CA  1 
ATOM   7999 C  C   . GLY B 1 480 ? 25.108  -11.352 50.696  1.00 41.93  ? 480 GLY B C   1 
ATOM   8000 O  O   . GLY B 1 480 ? 25.146  -10.877 49.557  1.00 35.88  ? 480 GLY B O   1 
ATOM   8001 N  N   . ASN B 1 481 ? 24.794  -12.629 50.919  1.00 46.75  ? 481 ASN B N   1 
ATOM   8002 C  CA  . ASN B 1 481 ? 24.445  -13.556 49.841  1.00 45.57  ? 481 ASN B CA  1 
ATOM   8003 C  C   . ASN B 1 481 ? 23.462  -14.607 50.350  1.00 59.78  ? 481 ASN B C   1 
ATOM   8004 O  O   . ASN B 1 481 ? 23.827  -15.350 51.267  1.00 73.34  ? 481 ASN B O   1 
ATOM   8005 C  CB  . ASN B 1 481 ? 25.717  -14.209 49.285  1.00 47.68  ? 481 ASN B CB  1 
ATOM   8006 C  CG  . ASN B 1 481 ? 25.416  -15.384 48.349  1.00 50.52  ? 481 ASN B CG  1 
ATOM   8007 O  OD1 . ASN B 1 481 ? 24.263  -15.655 47.982  1.00 50.59  ? 481 ASN B OD1 1 
ATOM   8008 N  ND2 . ASN B 1 481 ? 26.463  -16.039 47.904  1.00 52.23  ? 481 ASN B ND2 1 
ATOM   8009 N  N   . PRO B 1 482 ? 22.260  -14.754 49.775  1.00 57.00  ? 482 PRO B N   1 
ATOM   8010 C  CA  . PRO B 1 482 ? 21.287  -15.664 50.369  1.00 46.90  ? 482 PRO B CA  1 
ATOM   8011 C  C   . PRO B 1 482 ? 21.761  -17.103 50.388  1.00 42.49  ? 482 PRO B C   1 
ATOM   8012 O  O   . PRO B 1 482 ? 21.226  -17.899 51.177  1.00 44.55  ? 482 PRO B O   1 
ATOM   8013 C  CB  . PRO B 1 482 ? 20.035  -15.495 49.507  1.00 42.15  ? 482 PRO B CB  1 
ATOM   8014 C  CG  . PRO B 1 482 ? 20.403  -14.710 48.343  1.00 45.34  ? 482 PRO B CG  1 
ATOM   8015 C  CD  . PRO B 1 482 ? 21.724  -14.022 48.646  1.00 54.81  ? 482 PRO B CD  1 
ATOM   8016 N  N   . ASN B 1 483 ? 22.712  -17.467 49.541  1.00 35.50  ? 483 ASN B N   1 
ATOM   8017 C  CA  . ASN B 1 483 ? 23.179  -18.835 49.455  1.00 37.90  ? 483 ASN B CA  1 
ATOM   8018 C  C   . ASN B 1 483 ? 24.259  -19.127 50.488  1.00 48.26  ? 483 ASN B C   1 
ATOM   8019 O  O   . ASN B 1 483 ? 24.998  -18.238 50.918  1.00 61.88  ? 483 ASN B O   1 
ATOM   8020 C  CB  . ASN B 1 483 ? 23.713  -19.152 48.046  1.00 43.06  ? 483 ASN B CB  1 
ATOM   8021 C  CG  . ASN B 1 483 ? 22.842  -18.585 46.918  1.00 44.97  ? 483 ASN B CG  1 
ATOM   8022 O  OD1 . ASN B 1 483 ? 23.123  -17.522 46.367  1.00 45.07  ? 483 ASN B OD1 1 
ATOM   8023 N  ND2 . ASN B 1 483 ? 21.759  -19.292 46.597  1.00 42.33  ? 483 ASN B ND2 1 
ATOM   8024 N  N   . GLU B 1 484 ? 24.333  -20.392 50.898  1.00 47.97  ? 484 GLU B N   1 
ATOM   8025 C  CA  . GLU B 1 484 ? 25.541  -20.900 51.521  1.00 63.81  ? 484 GLU B CA  1 
ATOM   8026 C  C   . GLU B 1 484 ? 26.427  -21.505 50.440  1.00 89.53  ? 484 GLU B C   1 
ATOM   8027 O  O   . GLU B 1 484 ? 25.969  -22.400 49.713  1.00 96.58  ? 484 GLU B O   1 
ATOM   8028 C  CB  . GLU B 1 484 ? 25.209  -21.940 52.576  1.00 64.54  ? 484 GLU B CB  1 
ATOM   8029 C  CG  . GLU B 1 484 ? 24.600  -21.329 53.824  1.00 75.04  ? 484 GLU B CG  1 
ATOM   8030 C  CD  . GLU B 1 484 ? 24.271  -22.344 54.909  1.00 81.38  ? 484 GLU B CD  1 
ATOM   8031 O  OE1 . GLU B 1 484 ? 23.998  -23.518 54.564  1.00 82.58  ? 484 GLU B OE1 1 
ATOM   8032 O  OE2 . GLU B 1 484 ? 24.285  -21.955 56.108  1.00 78.56  1 484 GLU B OE2 1 
ATOM   8033 N  N   . PRO B 1 485 ? 27.666  -21.037 50.262  1.00 107.44 ? 485 PRO B N   1 
ATOM   8034 C  CA  . PRO B 1 485 ? 28.633  -21.833 49.496  1.00 114.88 ? 485 PRO B CA  1 
ATOM   8035 C  C   . PRO B 1 485 ? 28.800  -23.182 50.170  1.00 118.87 ? 485 PRO B C   1 
ATOM   8036 O  O   . PRO B 1 485 ? 28.275  -23.412 51.262  1.00 117.61 ? 485 PRO B O   1 
ATOM   8037 C  CB  . PRO B 1 485 ? 29.917  -20.996 49.536  1.00 112.92 ? 485 PRO B CB  1 
ATOM   8038 C  CG  . PRO B 1 485 ? 29.447  -19.595 49.804  1.00 111.96 ? 485 PRO B CG  1 
ATOM   8039 C  CD  . PRO B 1 485 ? 28.225  -19.736 50.680  1.00 110.84 ? 485 PRO B CD  1 
ATOM   8040 N  N   . HIS B 1 486 ? 29.517  -24.087 49.499  1.00 121.95 ? 486 HIS B N   1 
ATOM   8041 C  CA  . HIS B 1 486 ? 29.695  -25.462 49.970  1.00 128.35 ? 486 HIS B CA  1 
ATOM   8042 C  C   . HIS B 1 486 ? 28.430  -26.273 49.700  1.00 127.78 ? 486 HIS B C   1 
ATOM   8043 O  O   . HIS B 1 486 ? 28.509  -27.368 49.129  1.00 136.82 ? 486 HIS B O   1 
ATOM   8044 C  CB  . HIS B 1 486 ? 30.097  -25.480 51.461  1.00 133.46 ? 486 HIS B CB  1 
ATOM   8045 C  CG  . HIS B 1 486 ? 30.072  -26.829 52.116  1.00 140.23 ? 486 HIS B CG  1 
ATOM   8046 N  ND1 . HIS B 1 486 ? 28.958  -27.634 52.160  1.00 142.11 ? 486 HIS B ND1 1 
ATOM   8047 C  CD2 . HIS B 1 486 ? 31.019  -27.484 52.824  1.00 142.60 ? 486 HIS B CD2 1 
ATOM   8048 C  CE1 . HIS B 1 486 ? 29.228  -28.743 52.827  1.00 142.67 ? 486 HIS B CE1 1 
ATOM   8049 N  NE2 . HIS B 1 486 ? 30.476  -28.676 53.245  1.00 142.94 ? 486 HIS B NE2 1 
ATOM   8050 N  N   . SER B 1 487 ? 27.265  -25.751 50.094  1.00 115.39 ? 487 SER B N   1 
ATOM   8051 C  CA  . SER B 1 487 ? 26.008  -26.482 49.962  1.00 100.11 ? 487 SER B CA  1 
ATOM   8052 C  C   . SER B 1 487 ? 25.741  -26.875 48.511  1.00 97.94  ? 487 SER B C   1 
ATOM   8053 O  O   . SER B 1 487 ? 26.280  -26.288 47.568  1.00 100.36 ? 487 SER B O   1 
ATOM   8054 C  CB  . SER B 1 487 ? 24.837  -25.648 50.477  1.00 84.58  ? 487 SER B CB  1 
ATOM   8055 O  OG  . SER B 1 487 ? 23.609  -26.187 50.015  1.00 70.39  ? 487 SER B OG  1 
ATOM   8056 N  N   . GLN B 1 488 ? 24.888  -27.887 48.340  1.00 97.13  ? 488 GLN B N   1 
ATOM   8057 C  CA  . GLN B 1 488 ? 24.497  -28.357 47.016  1.00 94.79  ? 488 GLN B CA  1 
ATOM   8058 C  C   . GLN B 1 488 ? 23.033  -28.099 46.690  1.00 90.51  ? 488 GLN B C   1 
ATOM   8059 O  O   . GLN B 1 488 ? 22.576  -28.519 45.624  1.00 92.92  ? 488 GLN B O   1 
ATOM   8060 C  CB  . GLN B 1 488 ? 24.794  -29.853 46.858  1.00 91.73  ? 488 GLN B CB  1 
ATOM   8061 C  CG  . GLN B 1 488 ? 26.193  -30.244 47.251  1.00 92.09  ? 488 GLN B CG  1 
ATOM   8062 C  CD  . GLN B 1 488 ? 26.242  -30.782 48.657  1.00 99.43  ? 488 GLN B CD  1 
ATOM   8063 O  OE1 . GLN B 1 488 ? 25.589  -31.776 48.970  1.00 98.27  ? 488 GLN B OE1 1 
ATOM   8064 N  NE2 . GLN B 1 488 ? 27.004  -30.122 49.521  1.00 104.58 ? 488 GLN B NE2 1 
ATOM   8065 N  N   . GLU B 1 489 ? 22.281  -27.444 47.575  1.00 91.69  ? 489 GLU B N   1 
ATOM   8066 C  CA  . GLU B 1 489 ? 20.980  -26.915 47.186  1.00 94.17  ? 489 GLU B CA  1 
ATOM   8067 C  C   . GLU B 1 489 ? 21.155  -25.958 46.007  1.00 98.38  ? 489 GLU B C   1 
ATOM   8068 O  O   . GLU B 1 489 ? 22.171  -25.270 45.886  1.00 103.50 ? 489 GLU B O   1 
ATOM   8069 C  CB  . GLU B 1 489 ? 20.314  -26.204 48.371  1.00 90.74  ? 489 GLU B CB  1 
ATOM   8070 C  CG  . GLU B 1 489 ? 18.907  -25.685 48.095  1.00 98.38  ? 489 GLU B CG  1 
ATOM   8071 C  CD  . GLU B 1 489 ? 18.699  -24.241 48.547  1.00 102.19 ? 489 GLU B CD  1 
ATOM   8072 O  OE1 . GLU B 1 489 ? 19.578  -23.699 49.249  1.00 103.94 ? 489 GLU B OE1 1 
ATOM   8073 O  OE2 . GLU B 1 489 ? 17.654  -23.653 48.200  1.00 98.21  1 489 GLU B OE2 1 
ATOM   8074 N  N   . SER B 1 490 ? 20.169  -25.937 45.112  1.00 91.61  ? 490 SER B N   1 
ATOM   8075 C  CA  . SER B 1 490 ? 20.288  -25.139 43.897  1.00 83.89  ? 490 SER B CA  1 
ATOM   8076 C  C   . SER B 1 490 ? 20.398  -23.653 44.235  1.00 65.75  ? 490 SER B C   1 
ATOM   8077 O  O   . SER B 1 490 ? 19.752  -23.157 45.164  1.00 64.24  ? 490 SER B O   1 
ATOM   8078 C  CB  . SER B 1 490 ? 19.091  -25.405 42.976  1.00 90.81  ? 490 SER B CB  1 
ATOM   8079 O  OG  . SER B 1 490 ? 19.173  -26.699 42.383  1.00 94.76  ? 490 SER B OG  1 
ATOM   8080 N  N   . LYS B 1 491 ? 21.218  -22.940 43.469  1.00 52.60  ? 491 LYS B N   1 
ATOM   8081 C  CA  . LYS B 1 491 ? 21.697  -21.612 43.847  1.00 48.32  ? 491 LYS B CA  1 
ATOM   8082 C  C   . LYS B 1 491 ? 20.858  -20.497 43.231  1.00 46.79  ? 491 LYS B C   1 
ATOM   8083 O  O   . LYS B 1 491 ? 20.570  -20.517 42.027  1.00 50.66  ? 491 LYS B O   1 
ATOM   8084 C  CB  . LYS B 1 491 ? 23.164  -21.433 43.444  1.00 43.15  ? 491 LYS B CB  1 
ATOM   8085 C  CG  . LYS B 1 491 ? 24.129  -21.652 44.575  1.00 46.33  ? 491 LYS B CG  1 
ATOM   8086 C  CD  . LYS B 1 491 ? 24.197  -23.104 44.970  1.00 64.04  ? 491 LYS B CD  1 
ATOM   8087 C  CE  . LYS B 1 491 ? 25.065  -23.296 46.210  1.00 82.89  ? 491 LYS B CE  1 
ATOM   8088 N  NZ  . LYS B 1 491 ? 25.254  -24.744 46.514  1.00 92.71  1 491 LYS B NZ  1 
ATOM   8089 N  N   . TRP B 1 492 ? 20.501  -19.495 44.068  1.00 44.58  ? 492 TRP B N   1 
ATOM   8090 C  CA  . TRP B 1 492 ? 19.746  -18.294 43.690  1.00 46.06  ? 492 TRP B CA  1 
ATOM   8091 C  C   . TRP B 1 492 ? 20.680  -17.293 43.009  1.00 48.59  ? 492 TRP B C   1 
ATOM   8092 O  O   . TRP B 1 492 ? 21.492  -16.656 43.695  1.00 54.20  ? 492 TRP B O   1 
ATOM   8093 C  CB  . TRP B 1 492 ? 19.061  -17.678 44.932  1.00 45.01  ? 492 TRP B CB  1 
ATOM   8094 C  CG  . TRP B 1 492 ? 18.347  -16.313 44.749  1.00 48.34  ? 492 TRP B CG  1 
ATOM   8095 C  CD1 . TRP B 1 492 ? 18.374  -15.486 43.651  1.00 49.23  ? 492 TRP B CD1 1 
ATOM   8096 C  CD2 . TRP B 1 492 ? 17.478  -15.667 45.699  1.00 48.61  ? 492 TRP B CD2 1 
ATOM   8097 N  NE1 . TRP B 1 492 ? 17.592  -14.372 43.864  1.00 43.53  ? 492 TRP B NE1 1 
ATOM   8098 C  CE2 . TRP B 1 492 ? 17.035  -14.460 45.111  1.00 45.20  ? 492 TRP B CE2 1 
ATOM   8099 C  CE3 . TRP B 1 492 ? 17.029  -15.996 46.992  1.00 49.15  ? 492 TRP B CE3 1 
ATOM   8100 C  CZ2 . TRP B 1 492 ? 16.186  -13.589 45.766  1.00 52.44  ? 492 TRP B CZ2 1 
ATOM   8101 C  CZ3 . TRP B 1 492 ? 16.179  -15.129 47.638  1.00 46.50  ? 492 TRP B CZ3 1 
ATOM   8102 C  CH2 . TRP B 1 492 ? 15.769  -13.940 47.024  1.00 49.77  ? 492 TRP B CH2 1 
ATOM   8103 N  N   . PRO B 1 493 ? 20.572  -17.089 41.694  1.00 42.19  ? 493 PRO B N   1 
ATOM   8104 C  CA  . PRO B 1 493 ? 21.566  -16.275 40.996  1.00 40.17  ? 493 PRO B CA  1 
ATOM   8105 C  C   . PRO B 1 493 ? 21.393  -14.794 41.279  1.00 38.02  ? 493 PRO B C   1 
ATOM   8106 O  O   . PRO B 1 493 ? 20.324  -14.330 41.683  1.00 40.41  ? 493 PRO B O   1 
ATOM   8107 C  CB  . PRO B 1 493 ? 21.313  -16.582 39.515  1.00 41.45  ? 493 PRO B CB  1 
ATOM   8108 C  CG  . PRO B 1 493 ? 20.067  -17.408 39.460  1.00 53.25  ? 493 PRO B CG  1 
ATOM   8109 C  CD  . PRO B 1 493 ? 19.424  -17.373 40.827  1.00 45.90  ? 493 PRO B CD  1 
ATOM   8110 N  N   . LEU B 1 494 ? 22.504  -14.069 41.096  1.00 36.76  ? 494 LEU B N   1 
ATOM   8111 C  CA  . LEU B 1 494 ? 22.503  -12.609 41.045  1.00 46.22  ? 494 LEU B CA  1 
ATOM   8112 C  C   . LEU B 1 494 ? 21.723  -12.014 39.886  1.00 45.20  ? 494 LEU B C   1 
ATOM   8113 O  O   . LEU B 1 494 ? 21.893  -12.387 38.720  1.00 56.56  ? 494 LEU B O   1 
ATOM   8114 C  CB  . LEU B 1 494 ? 23.927  -12.074 40.998  1.00 49.29  ? 494 LEU B CB  1 
ATOM   8115 C  CG  . LEU B 1 494 ? 24.730  -12.220 42.265  1.00 52.99  ? 494 LEU B CG  1 
ATOM   8116 C  CD1 . LEU B 1 494 ? 26.214  -12.279 41.977  1.00 55.49  ? 494 LEU B CD1 1 
ATOM   8117 C  CD2 . LEU B 1 494 ? 24.358  -10.932 43.147  1.00 55.42  ? 494 LEU B CD2 1 
ATOM   8118 N  N   . PHE B 1 495 ? 20.896  -11.045 40.223  1.00 44.03  ? 495 PHE B N   1 
ATOM   8119 C  CA  . PHE B 1 495 ? 20.372  -10.144 39.217  1.00 52.76  ? 495 PHE B CA  1 
ATOM   8120 C  C   . PHE B 1 495 ? 21.526  -9.279  38.725  1.00 58.45  ? 495 PHE B C   1 
ATOM   8121 O  O   . PHE B 1 495 ? 22.148  -8.562  39.516  1.00 65.60  ? 495 PHE B O   1 
ATOM   8122 C  CB  . PHE B 1 495 ? 19.249  -9.293  39.807  1.00 49.24  ? 495 PHE B CB  1 
ATOM   8123 C  CG  . PHE B 1 495 ? 18.591  -8.360  38.824  1.00 47.14  ? 495 PHE B CG  1 
ATOM   8124 C  CD1 . PHE B 1 495 ? 19.182  -7.147  38.489  1.00 48.26  ? 495 PHE B CD1 1 
ATOM   8125 C  CD2 . PHE B 1 495 ? 17.368  -8.679  38.264  1.00 44.44  ? 495 PHE B CD2 1 
ATOM   8126 C  CE1 . PHE B 1 495 ? 18.572  -6.274  37.614  1.00 48.05  ? 495 PHE B CE1 1 
ATOM   8127 C  CE2 . PHE B 1 495 ? 16.758  -7.815  37.393  1.00 53.00  ? 495 PHE B CE2 1 
ATOM   8128 C  CZ  . PHE B 1 495 ? 17.364  -6.608  37.066  1.00 57.14  ? 495 PHE B CZ  1 
ATOM   8129 N  N   . THR B 1 496 ? 21.841  -9.373  37.437  1.00 57.29  ? 496 THR B N   1 
ATOM   8130 C  CA  . THR B 1 496 ? 22.859  -8.529  36.824  1.00 55.51  ? 496 THR B CA  1 
ATOM   8131 C  C   . THR B 1 496 ? 22.187  -7.501  35.926  1.00 56.15  ? 496 THR B C   1 
ATOM   8132 O  O   . THR B 1 496 ? 21.067  -7.722  35.457  1.00 60.54  ? 496 THR B O   1 
ATOM   8133 C  CB  . THR B 1 496 ? 23.833  -9.349  35.992  1.00 49.75  ? 496 THR B CB  1 
ATOM   8134 O  OG1 . THR B 1 496 ? 23.113  -9.911  34.896  1.00 54.32  ? 496 THR B OG1 1 
ATOM   8135 C  CG2 . THR B 1 496 ? 24.427  -10.474 36.828  1.00 38.95  ? 496 THR B CG2 1 
ATOM   8136 N  N   . THR B 1 497 ? 22.895  -6.384  35.678  1.00 55.73  ? 497 THR B N   1 
ATOM   8137 C  CA  . THR B 1 497 ? 22.299  -5.235  34.985  1.00 58.83  ? 497 THR B CA  1 
ATOM   8138 C  C   . THR B 1 497 ? 21.530  -5.668  33.746  1.00 73.05  ? 497 THR B C   1 
ATOM   8139 O  O   . THR B 1 497 ? 20.433  -5.158  33.474  1.00 85.60  ? 497 THR B O   1 
ATOM   8140 C  CB  . THR B 1 497 ? 23.365  -4.204  34.601  1.00 61.11  ? 497 THR B CB  1 
ATOM   8141 O  OG1 . THR B 1 497 ? 23.518  -3.239  35.648  1.00 69.10  ? 497 THR B OG1 1 
ATOM   8142 C  CG2 . THR B 1 497 ? 22.976  -3.483  33.308  1.00 38.81  ? 497 THR B CG2 1 
ATOM   8143 N  N   . LYS B 1 498 ? 22.074  -6.617  32.990  1.00 64.46  ? 498 LYS B N   1 
ATOM   8144 C  CA  . LYS B 1 498 ? 21.187  -7.401  32.164  1.00 67.25  ? 498 LYS B CA  1 
ATOM   8145 C  C   . LYS B 1 498 ? 21.711  -8.778  31.765  1.00 56.55  ? 498 LYS B C   1 
ATOM   8146 O  O   . LYS B 1 498 ? 22.435  -8.935  30.786  1.00 55.84  ? 498 LYS B O   1 
ATOM   8147 C  CB  . LYS B 1 498 ? 20.776  -6.622  30.910  1.00 93.34  ? 498 LYS B CB  1 
ATOM   8148 C  CG  . LYS B 1 498 ? 19.318  -6.941  30.538  1.00 107.70 ? 498 LYS B CG  1 
ATOM   8149 C  CD  . LYS B 1 498 ? 19.196  -8.271  29.793  1.00 111.36 ? 498 LYS B CD  1 
ATOM   8150 C  CE  . LYS B 1 498 ? 17.861  -8.965  30.039  1.00 105.50 ? 498 LYS B CE  1 
ATOM   8151 N  NZ  . LYS B 1 498 ? 17.833  -10.351 29.463  1.00 102.28 1 498 LYS B NZ  1 
ATOM   8152 N  N   . GLU B 1 499 ? 21.350  -9.751  32.601  1.00 58.33  ? 499 GLU B N   1 
ATOM   8153 C  CA  . GLU B 1 499 ? 20.692  -10.988 32.161  1.00 56.08  ? 499 GLU B CA  1 
ATOM   8154 C  C   . GLU B 1 499 ? 19.539  -11.174 33.168  1.00 51.38  ? 499 GLU B C   1 
ATOM   8155 O  O   . GLU B 1 499 ? 18.769  -12.139 33.101  1.00 47.10  ? 499 GLU B O   1 
ATOM   8156 C  CB  . GLU B 1 499 ? 21.621  -12.215 32.072  1.00 57.44  ? 499 GLU B CB  1 
ATOM   8157 C  CG  . GLU B 1 499 ? 22.426  -12.563 33.309  1.00 84.98  ? 499 GLU B CG  1 
ATOM   8158 C  CD  . GLU B 1 499 ? 23.903  -12.211 33.177  1.00 101.98 ? 499 GLU B CD  1 
ATOM   8159 O  OE1 . GLU B 1 499 ? 24.220  -11.061 32.793  1.00 105.24 ? 499 GLU B OE1 1 
ATOM   8160 O  OE2 . GLU B 1 499 ? 24.745  -13.090 33.467  1.00 106.56 1 499 GLU B OE2 1 
ATOM   8161 N  N   . GLN B 1 500 ? 19.462  -10.222 34.107  1.00 49.59  ? 500 GLN B N   1 
ATOM   8162 C  CA  . GLN B 1 500 ? 18.262  -9.942  34.897  1.00 44.52  ? 500 GLN B CA  1 
ATOM   8163 C  C   . GLN B 1 500 ? 17.613  -11.205 35.471  1.00 45.96  ? 500 GLN B C   1 
ATOM   8164 O  O   . GLN B 1 500 ? 16.389  -11.316 35.555  1.00 50.59  ? 500 GLN B O   1 
ATOM   8165 C  CB  . GLN B 1 500 ? 17.263  -9.159  34.058  1.00 47.75  ? 500 GLN B CB  1 
ATOM   8166 C  CG  . GLN B 1 500 ? 17.759  -7.801  33.635  1.00 58.85  ? 500 GLN B CG  1 
ATOM   8167 C  CD  . GLN B 1 500 ? 16.629  -6.906  33.166  1.00 76.08  ? 500 GLN B CD  1 
ATOM   8168 O  OE1 . GLN B 1 500 ? 15.467  -7.122  33.520  1.00 76.90  ? 500 GLN B OE1 1 
ATOM   8169 N  NE2 . GLN B 1 500 ? 16.961  -5.892  32.374  1.00 82.98  ? 500 GLN B NE2 1 
ATOM   8170 N  N   . LYS B 1 501 ? 18.443  -12.165 35.874  1.00 51.44  ? 501 LYS B N   1 
ATOM   8171 C  CA  . LYS B 1 501 ? 17.954  -13.378 36.520  1.00 52.37  ? 501 LYS B CA  1 
ATOM   8172 C  C   . LYS B 1 501 ? 17.227  -13.043 37.823  1.00 45.83  ? 501 LYS B C   1 
ATOM   8173 O  O   . LYS B 1 501 ? 17.599  -12.102 38.537  1.00 37.18  ? 501 LYS B O   1 
ATOM   8174 C  CB  . LYS B 1 501 ? 19.130  -14.325 36.803  1.00 58.37  ? 501 LYS B CB  1 
ATOM   8175 C  CG  . LYS B 1 501 ? 19.568  -15.241 35.647  1.00 55.83  ? 501 LYS B CG  1 
ATOM   8176 C  CD  . LYS B 1 501 ? 21.094  -15.413 35.627  1.00 53.49  ? 501 LYS B CD  1 
ATOM   8177 C  CE  . LYS B 1 501 ? 21.578  -16.397 34.543  1.00 53.53  ? 501 LYS B CE  1 
ATOM   8178 N  NZ  . LYS B 1 501 ? 21.310  -17.847 34.842  1.00 50.99  1 501 LYS B NZ  1 
ATOM   8179 N  N   . PHE B 1 502 ? 16.174  -13.815 38.119  1.00 35.47  ? 502 PHE B N   1 
ATOM   8180 C  CA  . PHE B 1 502 ? 15.480  -13.779 39.404  1.00 34.49  ? 502 PHE B CA  1 
ATOM   8181 C  C   . PHE B 1 502 ? 14.893  -15.166 39.646  1.00 44.10  ? 502 PHE B C   1 
ATOM   8182 O  O   . PHE B 1 502 ? 14.925  -16.025 38.757  1.00 40.11  ? 502 PHE B O   1 
ATOM   8183 C  CB  . PHE B 1 502 ? 14.402  -12.687 39.439  1.00 43.83  ? 502 PHE B CB  1 
ATOM   8184 C  CG  . PHE B 1 502 ? 13.160  -13.027 38.662  1.00 48.80  ? 502 PHE B CG  1 
ATOM   8185 C  CD1 . PHE B 1 502 ? 12.100  -13.675 39.277  1.00 40.73  ? 502 PHE B CD1 1 
ATOM   8186 C  CD2 . PHE B 1 502 ? 13.049  -12.692 37.315  1.00 51.89  ? 502 PHE B CD2 1 
ATOM   8187 C  CE1 . PHE B 1 502 ? 10.952  -13.993 38.560  1.00 46.14  ? 502 PHE B CE1 1 
ATOM   8188 C  CE2 . PHE B 1 502 ? 11.907  -13.011 36.595  1.00 50.80  ? 502 PHE B CE2 1 
ATOM   8189 C  CZ  . PHE B 1 502 ? 10.852  -13.653 37.218  1.00 44.90  ? 502 PHE B CZ  1 
ATOM   8190 N  N   . ILE B 1 503 ? 14.352  -15.398 40.857  1.00 42.34  ? 503 ILE B N   1 
ATOM   8191 C  CA  . ILE B 1 503 ? 13.830  -16.723 41.198  1.00 46.12  ? 503 ILE B CA  1 
ATOM   8192 C  C   . ILE B 1 503 ? 12.380  -16.676 41.670  1.00 47.56  ? 503 ILE B C   1 
ATOM   8193 O  O   . ILE B 1 503 ? 11.871  -15.650 42.131  1.00 46.74  ? 503 ILE B O   1 
ATOM   8194 C  CB  . ILE B 1 503 ? 14.665  -17.456 42.275  1.00 41.52  ? 503 ILE B CB  1 
ATOM   8195 C  CG1 . ILE B 1 503 ? 14.593  -16.720 43.611  1.00 34.50  ? 503 ILE B CG1 1 
ATOM   8196 C  CG2 . ILE B 1 503 ? 16.082  -17.641 41.823  1.00 50.23  ? 503 ILE B CG2 1 
ATOM   8197 C  CD1 . ILE B 1 503 ? 14.794  -17.628 44.782  1.00 39.79  ? 503 ILE B CD1 1 
ATOM   8198 N  N   . ASP B 1 504 ? 11.731  -17.842 41.563  1.00 54.59  ? 504 ASP B N   1 
ATOM   8199 C  CA  . ASP B 1 504 ? 10.463  -18.194 42.193  1.00 56.31  ? 504 ASP B CA  1 
ATOM   8200 C  C   . ASP B 1 504 ? 10.660  -18.490 43.674  1.00 50.14  ? 504 ASP B C   1 
ATOM   8201 O  O   . ASP B 1 504 ? 11.713  -18.967 44.102  1.00 60.59  ? 504 ASP B O   1 
ATOM   8202 C  CB  . ASP B 1 504 ? 9.855   -19.451 41.561  1.00 63.41  ? 504 ASP B CB  1 
ATOM   8203 C  CG  . ASP B 1 504 ? 9.089   -19.173 40.297  1.00 69.15  ? 504 ASP B CG  1 
ATOM   8204 O  OD1 . ASP B 1 504 ? 8.888   -17.987 39.957  1.00 67.12  ? 504 ASP B OD1 1 
ATOM   8205 O  OD2 . ASP B 1 504 ? 8.666   -20.164 39.659  1.00 75.60  1 504 ASP B OD2 1 
ATOM   8206 N  N   . LEU B 1 505 ? 9.606   -18.258 44.448  1.00 43.82  ? 505 LEU B N   1 
ATOM   8207 C  CA  . LEU B 1 505 ? 9.587   -18.622 45.864  1.00 49.71  ? 505 LEU B CA  1 
ATOM   8208 C  C   . LEU B 1 505 ? 8.263   -19.327 46.151  1.00 53.34  ? 505 LEU B C   1 
ATOM   8209 O  O   . LEU B 1 505 ? 7.225   -18.669 46.300  1.00 49.38  ? 505 LEU B O   1 
ATOM   8210 C  CB  . LEU B 1 505 ? 9.765   -17.399 46.752  1.00 44.19  ? 505 LEU B CB  1 
ATOM   8211 C  CG  . LEU B 1 505 ? 11.211  -16.956 46.921  1.00 32.33  ? 505 LEU B CG  1 
ATOM   8212 C  CD1 . LEU B 1 505 ? 11.306  -15.729 47.785  1.00 31.27  ? 505 LEU B CD1 1 
ATOM   8213 C  CD2 . LEU B 1 505 ? 12.009  -18.098 47.503  1.00 35.80  ? 505 LEU B CD2 1 
ATOM   8214 N  N   . ASN B 1 506 ? 8.308   -20.655 46.245  1.00 44.68  ? 506 ASN B N   1 
ATOM   8215 C  CA  . ASN B 1 506 ? 7.114   -21.456 46.486  1.00 45.54  ? 506 ASN B CA  1 
ATOM   8216 C  C   . ASN B 1 506 ? 7.539   -22.844 46.944  1.00 49.81  ? 506 ASN B C   1 
ATOM   8217 O  O   . ASN B 1 506 ? 8.704   -23.080 47.279  1.00 50.35  ? 506 ASN B O   1 
ATOM   8218 C  CB  . ASN B 1 506 ? 6.241   -21.529 45.236  1.00 47.02  ? 506 ASN B CB  1 
ATOM   8219 C  CG  . ASN B 1 506 ? 7.040   -21.886 44.015  1.00 63.44  ? 506 ASN B CG  1 
ATOM   8220 O  OD1 . ASN B 1 506 ? 7.896   -22.779 44.055  1.00 74.61  ? 506 ASN B OD1 1 
ATOM   8221 N  ND2 . ASN B 1 506 ? 6.815   -21.155 42.929  1.00 63.76  ? 506 ASN B ND2 1 
ATOM   8222 N  N   . THR B 1 507 ? 6.582   -23.771 46.941  1.00 52.07  ? 507 THR B N   1 
ATOM   8223 C  CA  . THR B 1 507 ? 6.822   -25.102 47.471  1.00 57.06  ? 507 THR B CA  1 
ATOM   8224 C  C   . THR B 1 507 ? 7.472   -26.024 46.461  1.00 61.14  ? 507 THR B C   1 
ATOM   8225 O  O   . THR B 1 507 ? 8.063   -27.031 46.860  1.00 62.59  ? 507 THR B O   1 
ATOM   8226 C  CB  . THR B 1 507 ? 5.512   -25.720 47.943  1.00 62.09  ? 507 THR B CB  1 
ATOM   8227 O  OG1 . THR B 1 507 ? 4.589   -25.770 46.843  1.00 65.59  ? 507 THR B OG1 1 
ATOM   8228 C  CG2 . THR B 1 507 ? 4.932   -24.890 49.084  1.00 57.03  ? 507 THR B CG2 1 
ATOM   8229 N  N   . GLU B 1 508 ? 7.365   -25.721 45.179  1.00 66.29  ? 508 GLU B N   1 
ATOM   8230 C  CA  . GLU B 1 508 ? 8.076   -26.574 44.245  1.00 78.75  ? 508 GLU B CA  1 
ATOM   8231 C  C   . GLU B 1 508 ? 9.501   -26.069 44.048  1.00 79.27  ? 508 GLU B C   1 
ATOM   8232 O  O   . GLU B 1 508 ? 9.822   -24.925 44.396  1.00 80.63  ? 508 GLU B O   1 
ATOM   8233 C  CB  . GLU B 1 508 ? 7.324   -26.653 42.914  1.00 88.20  ? 508 GLU B CB  1 
ATOM   8234 C  CG  . GLU B 1 508 ? 6.677   -25.381 42.416  1.00 92.81  ? 508 GLU B CG  1 
ATOM   8235 C  CD  . GLU B 1 508 ? 5.772   -25.643 41.224  1.00 95.06  ? 508 GLU B CD  1 
ATOM   8236 O  OE1 . GLU B 1 508 ? 4.614   -26.047 41.446  1.00 101.16 ? 508 GLU B OE1 1 
ATOM   8237 O  OE2 . GLU B 1 508 ? 6.220   -25.474 40.069  1.00 91.44  1 508 GLU B OE2 1 
ATOM   8238 N  N   . PRO B 1 509 ? 10.402  -26.932 43.531  1.00 74.97  ? 509 PRO B N   1 
ATOM   8239 C  CA  . PRO B 1 509 ? 11.825  -26.568 43.419  1.00 73.63  ? 509 PRO B CA  1 
ATOM   8240 C  C   . PRO B 1 509 ? 12.105  -25.260 42.696  1.00 76.58  ? 509 PRO B C   1 
ATOM   8241 O  O   . PRO B 1 509 ? 11.275  -24.778 41.921  1.00 88.68  ? 509 PRO B O   1 
ATOM   8242 C  CB  . PRO B 1 509 ? 12.410  -27.758 42.654  1.00 73.07  ? 509 PRO B CB  1 
ATOM   8243 C  CG  . PRO B 1 509 ? 11.581  -28.909 43.127  1.00 74.67  ? 509 PRO B CG  1 
ATOM   8244 C  CD  . PRO B 1 509 ? 10.188  -28.369 43.271  1.00 73.61  ? 509 PRO B CD  1 
ATOM   8245 N  N   . MET B 1 510 ? 13.286  -24.691 42.931  1.00 73.41  ? 510 MET B N   1 
ATOM   8246 C  CA  . MET B 1 510 ? 13.585  -23.329 42.504  1.00 74.45  ? 510 MET B CA  1 
ATOM   8247 C  C   . MET B 1 510 ? 13.814  -23.257 40.997  1.00 79.01  ? 510 MET B C   1 
ATOM   8248 O  O   . MET B 1 510 ? 14.624  -24.009 40.445  1.00 80.54  ? 510 MET B O   1 
ATOM   8249 C  CB  . MET B 1 510 ? 14.814  -22.806 43.242  1.00 72.04  ? 510 MET B CB  1 
ATOM   8250 C  CG  . MET B 1 510 ? 15.198  -21.391 42.878  1.00 74.52  ? 510 MET B CG  1 
ATOM   8251 S  SD  . MET B 1 510 ? 16.877  -21.018 43.419  1.00 79.81  ? 510 MET B SD  1 
ATOM   8252 C  CE  . MET B 1 510 ? 17.796  -22.103 42.333  1.00 83.41  ? 510 MET B CE  1 
ATOM   8253 N  N   . LYS B 1 511 ? 13.094  -22.348 40.339  1.00 76.36  ? 511 LYS B N   1 
ATOM   8254 C  CA  . LYS B 1 511 ? 13.268  -22.044 38.925  1.00 76.12  ? 511 LYS B CA  1 
ATOM   8255 C  C   . LYS B 1 511 ? 13.929  -20.677 38.791  1.00 74.04  ? 511 LYS B C   1 
ATOM   8256 O  O   . LYS B 1 511 ? 13.705  -19.781 39.611  1.00 76.57  ? 511 LYS B O   1 
ATOM   8257 C  CB  . LYS B 1 511 ? 11.927  -22.033 38.171  1.00 81.15  ? 511 LYS B CB  1 
ATOM   8258 C  CG  . LYS B 1 511 ? 10.992  -23.194 38.486  1.00 84.59  ? 511 LYS B CG  1 
ATOM   8259 C  CD  . LYS B 1 511 ? 11.289  -24.428 37.655  1.00 84.22  ? 511 LYS B CD  1 
ATOM   8260 C  CE  . LYS B 1 511 ? 11.110  -25.700 38.486  1.00 87.03  ? 511 LYS B CE  1 
ATOM   8261 N  NZ  . LYS B 1 511 ? 9.881   -25.695 39.347  1.00 88.65  1 511 LYS B NZ  1 
ATOM   8262 N  N   . VAL B 1 512 ? 14.746  -20.518 37.752  1.00 68.86  ? 512 VAL B N   1 
ATOM   8263 C  CA  . VAL B 1 512 ? 15.444  -19.262 37.484  1.00 60.29  ? 512 VAL B CA  1 
ATOM   8264 C  C   . VAL B 1 512 ? 14.858  -18.656 36.222  1.00 48.65  ? 512 VAL B C   1 
ATOM   8265 O  O   . VAL B 1 512 ? 15.020  -19.198 35.124  1.00 50.73  ? 512 VAL B O   1 
ATOM   8266 C  CB  . VAL B 1 512 ? 16.961  -19.453 37.357  1.00 57.78  ? 512 VAL B CB  1 
ATOM   8267 C  CG1 . VAL B 1 512 ? 17.643  -18.125 37.026  1.00 42.86  ? 512 VAL B CG1 1 
ATOM   8268 C  CG2 . VAL B 1 512 ? 17.515  -20.003 38.663  1.00 63.82  ? 512 VAL B CG2 1 
ATOM   8269 N  N   . HIS B 1 513 ? 14.190  -17.526 36.384  1.00 43.14  ? 513 HIS B N   1 
ATOM   8270 C  CA  . HIS B 1 513 ? 13.585  -16.779 35.301  1.00 47.16  ? 513 HIS B CA  1 
ATOM   8271 C  C   . HIS B 1 513 ? 14.405  -15.531 35.004  1.00 51.30  ? 513 HIS B C   1 
ATOM   8272 O  O   . HIS B 1 513 ? 15.358  -15.194 35.706  1.00 52.34  ? 513 HIS B O   1 
ATOM   8273 C  CB  . HIS B 1 513 ? 12.145  -16.406 35.655  1.00 53.50  ? 513 HIS B CB  1 
ATOM   8274 C  CG  . HIS B 1 513 ? 11.261  -17.587 35.908  1.00 60.11  ? 513 HIS B CG  1 
ATOM   8275 N  ND1 . HIS B 1 513 ? 10.774  -18.382 34.890  1.00 60.38  ? 513 HIS B ND1 1 
ATOM   8276 C  CD2 . HIS B 1 513 ? 10.773  -18.107 37.060  1.00 55.12  ? 513 HIS B CD2 1 
ATOM   8277 C  CE1 . HIS B 1 513 ? 10.026  -19.341 35.405  1.00 56.43  ? 513 HIS B CE1 1 
ATOM   8278 N  NE2 . HIS B 1 513 ? 10.007  -19.195 36.719  1.00 54.51  ? 513 HIS B NE2 1 
ATOM   8279 N  N   . GLN B 1 514 ? 14.023  -14.847 33.937  1.00 51.74  ? 514 GLN B N   1 
ATOM   8280 C  CA  . GLN B 1 514 ? 14.682  -13.626 33.523  1.00 47.05  ? 514 GLN B CA  1 
ATOM   8281 C  C   . GLN B 1 514 ? 13.636  -12.577 33.212  1.00 46.30  ? 514 GLN B C   1 
ATOM   8282 O  O   . GLN B 1 514 ? 12.533  -12.897 32.766  1.00 37.68  ? 514 GLN B O   1 
ATOM   8283 C  CB  . GLN B 1 514 ? 15.556  -13.838 32.291  1.00 50.05  ? 514 GLN B CB  1 
ATOM   8284 C  CG  . GLN B 1 514 ? 16.791  -14.653 32.557  1.00 62.09  ? 514 GLN B CG  1 
ATOM   8285 C  CD  . GLN B 1 514 ? 17.837  -14.454 31.496  1.00 65.95  ? 514 GLN B CD  1 
ATOM   8286 O  OE1 . GLN B 1 514 ? 18.415  -15.413 30.984  1.00 72.35  ? 514 GLN B OE1 1 
ATOM   8287 N  NE2 . GLN B 1 514 ? 18.068  -13.193 31.134  1.00 62.46  ? 514 GLN B NE2 1 
ATOM   8288 N  N   . ARG B 1 515 ? 14.008  -11.321 33.457  1.00 48.70  ? 515 ARG B N   1 
ATOM   8289 C  CA  . ARG B 1 515 ? 13.256  -10.157 33.005  1.00 47.63  ? 515 ARG B CA  1 
ATOM   8290 C  C   . ARG B 1 515 ? 11.806  -10.223 33.466  1.00 50.40  ? 515 ARG B C   1 
ATOM   8291 O  O   . ARG B 1 515 ? 10.946  -10.730 32.743  1.00 67.25  ? 515 ARG B O   1 
ATOM   8292 C  CB  . ARG B 1 515 ? 13.335  -10.041 31.479  1.00 38.98  ? 515 ARG B CB  1 
ATOM   8293 C  CG  . ARG B 1 515 ? 14.561  -10.589 30.816  1.00 53.69  ? 515 ARG B CG  1 
ATOM   8294 C  CD  . ARG B 1 515 ? 14.568  -10.383 29.304  1.00 59.10  ? 515 ARG B CD  1 
ATOM   8295 N  NE  . ARG B 1 515 ? 14.842  -8.976  28.994  1.00 69.88  ? 515 ARG B NE  1 
ATOM   8296 C  CZ  . ARG B 1 515 ? 15.443  -8.542  27.894  1.00 76.46  ? 515 ARG B CZ  1 
ATOM   8297 N  NH1 . ARG B 1 515 ? 15.878  -9.418  27.007  1.00 81.87  1 515 ARG B NH1 1 
ATOM   8298 N  NH2 . ARG B 1 515 ? 15.636  -7.245  27.720  1.00 77.69  ? 515 ARG B NH2 1 
ATOM   8299 N  N   . LEU B 1 516 ? 11.514  -9.714  34.657  1.00 46.39  ? 516 LEU B N   1 
ATOM   8300 C  CA  . LEU B 1 516 ? 10.235  -9.978  35.309  1.00 42.82  ? 516 LEU B CA  1 
ATOM   8301 C  C   . LEU B 1 516 ? 9.210   -8.933  34.880  1.00 41.14  ? 516 LEU B C   1 
ATOM   8302 O  O   . LEU B 1 516 ? 9.362   -7.739  35.166  1.00 33.39  ? 516 LEU B O   1 
ATOM   8303 C  CB  . LEU B 1 516 ? 10.415  -10.005 36.821  1.00 37.93  ? 516 LEU B CB  1 
ATOM   8304 C  CG  . LEU B 1 516 ? 9.262   -9.673  37.767  1.00 43.05  ? 516 LEU B CG  1 
ATOM   8305 C  CD1 . LEU B 1 516 ? 8.182   -10.758 37.708  1.00 52.89  ? 516 LEU B CD1 1 
ATOM   8306 C  CD2 . LEU B 1 516 ? 9.834   -9.558  39.168  1.00 37.15  ? 516 LEU B CD2 1 
ATOM   8307 N  N   . ARG B 1 517 ? 8.165   -9.391  34.198  1.00 39.84  ? 517 ARG B N   1 
ATOM   8308 C  CA  . ARG B 1 517 ? 7.114   -8.523  33.691  1.00 45.72  ? 517 ARG B CA  1 
ATOM   8309 C  C   . ARG B 1 517 ? 7.683   -7.350  32.884  1.00 38.80  ? 517 ARG B C   1 
ATOM   8310 O  O   . ARG B 1 517 ? 7.324   -6.194  33.104  1.00 39.61  ? 517 ARG B O   1 
ATOM   8311 C  CB  . ARG B 1 517 ? 6.227   -8.025  34.842  1.00 50.98  ? 517 ARG B CB  1 
ATOM   8312 C  CG  . ARG B 1 517 ? 5.429   -9.137  35.502  1.00 51.40  ? 517 ARG B CG  1 
ATOM   8313 C  CD  . ARG B 1 517 ? 4.148   -8.632  36.162  1.00 40.98  ? 517 ARG B CD  1 
ATOM   8314 N  NE  . ARG B 1 517 ? 3.029   -9.302  35.491  1.00 38.82  ? 517 ARG B NE  1 
ATOM   8315 C  CZ  . ARG B 1 517 ? 2.055   -8.664  34.865  1.00 41.65  ? 517 ARG B CZ  1 
ATOM   8316 N  NH1 . ARG B 1 517 ? 2.066   -7.349  34.855  1.00 50.71  1 517 ARG B NH1 1 
ATOM   8317 N  NH2 . ARG B 1 517 ? 1.091   -9.335  34.266  1.00 35.34  ? 517 ARG B NH2 1 
ATOM   8318 N  N   . VAL B 1 518 ? 8.581   -7.647  31.935  1.00 35.63  ? 518 VAL B N   1 
ATOM   8319 C  CA  . VAL B 1 518 ? 9.220   -6.573  31.162  1.00 40.99  ? 518 VAL B CA  1 
ATOM   8320 C  C   . VAL B 1 518 ? 8.172   -5.745  30.456  1.00 45.54  ? 518 VAL B C   1 
ATOM   8321 O  O   . VAL B 1 518 ? 8.161   -4.511  30.549  1.00 44.52  ? 518 VAL B O   1 
ATOM   8322 C  CB  . VAL B 1 518 ? 10.196  -7.125  30.108  1.00 45.26  ? 518 VAL B CB  1 
ATOM   8323 C  CG1 . VAL B 1 518 ? 11.151  -6.033  29.672  1.00 37.32  ? 518 VAL B CG1 1 
ATOM   8324 C  CG2 . VAL B 1 518 ? 10.877  -8.321  30.568  1.00 51.25  ? 518 VAL B CG2 1 
ATOM   8325 N  N   . GLN B 1 519 ? 7.304   -6.431  29.701  1.00 37.02  ? 519 GLN B N   1 
ATOM   8326 C  CA  . GLN B 1 519 ? 6.369   -5.798  28.783  1.00 37.63  ? 519 GLN B CA  1 
ATOM   8327 C  C   . GLN B 1 519 ? 5.538   -4.723  29.463  1.00 43.94  ? 519 GLN B C   1 
ATOM   8328 O  O   . GLN B 1 519 ? 5.482   -3.580  28.988  1.00 44.36  ? 519 GLN B O   1 
ATOM   8329 C  CB  . GLN B 1 519 ? 5.480   -6.878  28.163  1.00 44.01  ? 519 GLN B CB  1 
ATOM   8330 C  CG  . GLN B 1 519 ? 4.817   -6.503  26.891  1.00 41.47  ? 519 GLN B CG  1 
ATOM   8331 C  CD  . GLN B 1 519 ? 5.774   -6.662  25.757  1.00 47.48  ? 519 GLN B CD  1 
ATOM   8332 O  OE1 . GLN B 1 519 ? 6.593   -7.580  25.760  1.00 53.32  ? 519 GLN B OE1 1 
ATOM   8333 N  NE2 . GLN B 1 519 ? 5.685   -5.771  24.769  1.00 60.36  ? 519 GLN B NE2 1 
ATOM   8334 N  N   . MET B 1 520 ? 4.897   -5.061  30.594  1.00 35.98  ? 520 MET B N   1 
ATOM   8335 C  CA  . MET B 1 520 ? 4.147   -4.029  31.289  1.00 35.23  ? 520 MET B CA  1 
ATOM   8336 C  C   . MET B 1 520 ? 5.064   -3.025  31.958  1.00 34.42  ? 520 MET B C   1 
ATOM   8337 O  O   . MET B 1 520 ? 4.718   -1.843  32.063  1.00 48.71  ? 520 MET B O   1 
ATOM   8338 C  CB  . MET B 1 520 ? 3.179   -4.638  32.298  1.00 40.54  ? 520 MET B CB  1 
ATOM   8339 C  CG  . MET B 1 520 ? 2.489   -5.955  31.912  1.00 50.86  ? 520 MET B CG  1 
ATOM   8340 S  SD  . MET B 1 520 ? 1.742   -6.117  30.262  1.00 71.84  ? 520 MET B SD  1 
ATOM   8341 C  CE  . MET B 1 520 ? 1.016   -4.536  29.971  1.00 64.16  ? 520 MET B CE  1 
ATOM   8342 N  N   . CYS B 1 521 ? 6.248   -3.443  32.370  1.00 36.54  ? 521 CYS B N   1 
ATOM   8343 C  CA  . CYS B 1 521 ? 7.106   -2.471  33.027  1.00 41.47  ? 521 CYS B CA  1 
ATOM   8344 C  C   . CYS B 1 521 ? 7.801   -1.548  32.017  1.00 41.50  ? 521 CYS B C   1 
ATOM   8345 O  O   . CYS B 1 521 ? 8.081   -0.390  32.350  1.00 46.70  ? 521 CYS B O   1 
ATOM   8346 C  CB  . CYS B 1 521 ? 8.093   -3.195  33.958  1.00 43.98  ? 521 CYS B CB  1 
ATOM   8347 S  SG  . CYS B 1 521 ? 7.327   -3.958  35.408  1.00 53.37  ? 521 CYS B SG  1 
ATOM   8348 N  N   . VAL B 1 522 ? 8.039   -1.996  30.775  1.00 35.20  ? 522 VAL B N   1 
ATOM   8349 C  CA  . VAL B 1 522 ? 8.342   -1.037  29.716  1.00 39.15  ? 522 VAL B CA  1 
ATOM   8350 C  C   . VAL B 1 522 ? 7.189   -0.059  29.550  1.00 48.50  ? 522 VAL B C   1 
ATOM   8351 O  O   . VAL B 1 522 ? 7.401   1.145   29.355  1.00 51.26  ? 522 VAL B O   1 
ATOM   8352 C  CB  . VAL B 1 522 ? 8.670   -1.765  28.399  1.00 37.28  ? 522 VAL B CB  1 
ATOM   8353 C  CG1 . VAL B 1 522 ? 9.140   -0.762  27.343  1.00 38.20  ? 522 VAL B CG1 1 
ATOM   8354 C  CG2 . VAL B 1 522 ? 9.777   -2.754  28.638  1.00 42.74  ? 522 VAL B CG2 1 
ATOM   8355 N  N   . PHE B 1 523 ? 5.950   -0.557  29.636  1.00 35.94  ? 523 PHE B N   1 
ATOM   8356 C  CA  . PHE B 1 523 ? 4.794   0.323   29.535  1.00 35.99  ? 523 PHE B CA  1 
ATOM   8357 C  C   . PHE B 1 523 ? 4.750   1.297   30.705  1.00 39.24  ? 523 PHE B C   1 
ATOM   8358 O  O   . PHE B 1 523 ? 4.663   2.515   30.501  1.00 44.75  ? 523 PHE B O   1 
ATOM   8359 C  CB  . PHE B 1 523 ? 3.508   -0.504  29.466  1.00 42.11  ? 523 PHE B CB  1 
ATOM   8360 C  CG  . PHE B 1 523 ? 2.252   0.316   29.557  1.00 42.74  ? 523 PHE B CG  1 
ATOM   8361 C  CD1 . PHE B 1 523 ? 1.470   0.288   30.690  1.00 43.86  ? 523 PHE B CD1 1 
ATOM   8362 C  CD2 . PHE B 1 523 ? 1.837   1.110   28.496  1.00 52.86  ? 523 PHE B CD2 1 
ATOM   8363 C  CE1 . PHE B 1 523 ? 0.305   1.056   30.780  1.00 48.95  ? 523 PHE B CE1 1 
ATOM   8364 C  CE2 . PHE B 1 523 ? 0.660   1.876   28.577  1.00 52.51  ? 523 PHE B CE2 1 
ATOM   8365 C  CZ  . PHE B 1 523 ? -0.103  1.848   29.723  1.00 44.02  ? 523 PHE B CZ  1 
ATOM   8366 N  N   . TRP B 1 524 ? 4.830   0.777   31.946  1.00 33.98  ? 524 TRP B N   1 
ATOM   8367 C  CA  . TRP B 1 524 ? 4.639   1.621   33.125  1.00 48.32  ? 524 TRP B CA  1 
ATOM   8368 C  C   . TRP B 1 524 ? 5.844   2.511   33.399  1.00 46.85  ? 524 TRP B C   1 
ATOM   8369 O  O   . TRP B 1 524 ? 5.674   3.690   33.741  1.00 41.61  ? 524 TRP B O   1 
ATOM   8370 C  CB  . TRP B 1 524 ? 4.324   0.783   34.379  1.00 52.97  ? 524 TRP B CB  1 
ATOM   8371 C  CG  . TRP B 1 524 ? 2.958   0.120   34.370  1.00 36.04  ? 524 TRP B CG  1 
ATOM   8372 C  CD1 . TRP B 1 524 ? 2.713   -1.215  34.269  1.00 37.03  ? 524 TRP B CD1 1 
ATOM   8373 C  CD2 . TRP B 1 524 ? 1.670   0.757   34.423  1.00 32.53  ? 524 TRP B CD2 1 
ATOM   8374 N  NE1 . TRP B 1 524 ? 1.365   -1.456  34.247  1.00 43.96  ? 524 TRP B NE1 1 
ATOM   8375 C  CE2 . TRP B 1 524 ? 0.697   -0.263  34.342  1.00 37.10  ? 524 TRP B CE2 1 
ATOM   8376 C  CE3 . TRP B 1 524 ? 1.242   2.083   34.531  1.00 34.08  ? 524 TRP B CE3 1 
ATOM   8377 C  CZ2 . TRP B 1 524 ? -0.673  -0.001  34.378  1.00 33.21  ? 524 TRP B CZ2 1 
ATOM   8378 C  CZ3 . TRP B 1 524 ? -0.130  2.340   34.564  1.00 32.95  ? 524 TRP B CZ3 1 
ATOM   8379 C  CH2 . TRP B 1 524 ? -1.062  1.301   34.494  1.00 33.13  ? 524 TRP B CH2 1 
ATOM   8380 N  N   . ASN B 1 525 ? 7.062   1.973   33.289  1.00 49.35  ? 525 ASN B N   1 
ATOM   8381 C  CA  . ASN B 1 525 ? 8.241   2.761   33.636  1.00 42.87  ? 525 ASN B CA  1 
ATOM   8382 C  C   . ASN B 1 525 ? 8.736   3.651   32.503  1.00 45.18  ? 525 ASN B C   1 
ATOM   8383 O  O   . ASN B 1 525 ? 9.458   4.617   32.775  1.00 54.09  ? 525 ASN B O   1 
ATOM   8384 C  CB  . ASN B 1 525 ? 9.389   1.858   34.081  1.00 37.85  ? 525 ASN B CB  1 
ATOM   8385 C  CG  . ASN B 1 525 ? 9.018   0.971   35.254  1.00 54.15  ? 525 ASN B CG  1 
ATOM   8386 O  OD1 . ASN B 1 525 ? 8.091   1.280   36.021  1.00 59.82  ? 525 ASN B OD1 1 
ATOM   8387 N  ND2 . ASN B 1 525 ? 9.738   -0.151  35.398  1.00 31.66  ? 525 ASN B ND2 1 
ATOM   8388 N  N   . GLN B 1 526 ? 8.356   3.377   31.248  1.00 35.08  ? 526 GLN B N   1 
ATOM   8389 C  CA  . GLN B 1 526 ? 9.016   4.117   30.173  1.00 46.16  ? 526 GLN B CA  1 
ATOM   8390 C  C   . GLN B 1 526 ? 8.066   4.788   29.195  1.00 45.51  ? 526 GLN B C   1 
ATOM   8391 O  O   . GLN B 1 526 ? 8.325   5.924   28.783  1.00 49.00  ? 526 GLN B O   1 
ATOM   8392 C  CB  . GLN B 1 526 ? 9.959   3.180   29.408  1.00 47.06  ? 526 GLN B CB  1 
ATOM   8393 C  CG  . GLN B 1 526 ? 10.746  3.849   28.322  1.00 61.21  ? 526 GLN B CG  1 
ATOM   8394 C  CD  . GLN B 1 526 ? 12.147  3.297   28.251  1.00 77.01  ? 526 GLN B CD  1 
ATOM   8395 O  OE1 . GLN B 1 526 ? 12.601  2.652   29.207  1.00 76.20  ? 526 GLN B OE1 1 
ATOM   8396 N  NE2 . GLN B 1 526 ? 12.839  3.516   27.113  1.00 70.12  ? 526 GLN B NE2 1 
ATOM   8397 N  N   . PHE B 1 527 ? 6.987   4.118   28.792  1.00 46.67  ? 527 PHE B N   1 
ATOM   8398 C  CA  . PHE B 1 527 ? 6.121   4.707   27.776  1.00 48.54  ? 527 PHE B CA  1 
ATOM   8399 C  C   . PHE B 1 527 ? 5.113   5.679   28.383  1.00 53.36  ? 527 PHE B C   1 
ATOM   8400 O  O   . PHE B 1 527 ? 5.072   6.853   28.002  1.00 61.95  ? 527 PHE B O   1 
ATOM   8401 C  CB  . PHE B 1 527 ? 5.403   3.620   26.969  1.00 38.27  ? 527 PHE B CB  1 
ATOM   8402 C  CG  . PHE B 1 527 ? 4.346   4.165   26.037  1.00 42.93  ? 527 PHE B CG  1 
ATOM   8403 C  CD1 . PHE B 1 527 ? 4.703   4.826   24.872  1.00 42.55  ? 527 PHE B CD1 1 
ATOM   8404 C  CD2 . PHE B 1 527 ? 2.996   4.015   26.323  1.00 39.04  ? 527 PHE B CD2 1 
ATOM   8405 C  CE1 . PHE B 1 527 ? 3.741   5.322   24.019  1.00 44.92  ? 527 PHE B CE1 1 
ATOM   8406 C  CE2 . PHE B 1 527 ? 2.029   4.502   25.464  1.00 40.02  ? 527 PHE B CE2 1 
ATOM   8407 C  CZ  . PHE B 1 527 ? 2.399   5.162   24.314  1.00 41.18  ? 527 PHE B CZ  1 
ATOM   8408 N  N   . LEU B 1 528 ? 4.288   5.209   29.316  1.00 44.60  ? 528 LEU B N   1 
ATOM   8409 C  CA  . LEU B 1 528 ? 3.228   6.079   29.811  1.00 50.84  ? 528 LEU B CA  1 
ATOM   8410 C  C   . LEU B 1 528 ? 3.759   7.362   30.430  1.00 54.86  ? 528 LEU B C   1 
ATOM   8411 O  O   . LEU B 1 528 ? 3.184   8.432   30.144  1.00 61.38  ? 528 LEU B O   1 
ATOM   8412 C  CB  . LEU B 1 528 ? 2.319   5.319   30.780  1.00 45.46  ? 528 LEU B CB  1 
ATOM   8413 C  CG  . LEU B 1 528 ? 1.344   6.221   31.540  1.00 43.27  ? 528 LEU B CG  1 
ATOM   8414 C  CD1 . LEU B 1 528 ? 0.195   6.557   30.576  1.00 45.26  ? 528 LEU B CD1 1 
ATOM   8415 C  CD2 . LEU B 1 528 ? 0.804   5.550   32.764  1.00 33.94  ? 528 LEU B CD2 1 
ATOM   8416 N  N   . PRO B 1 529 ? 4.824   7.340   31.250  1.00 45.41  ? 529 PRO B N   1 
ATOM   8417 C  CA  . PRO B 1 529 ? 5.378   8.610   31.721  1.00 34.77  ? 529 PRO B CA  1 
ATOM   8418 C  C   . PRO B 1 529 ? 5.666   9.565   30.578  1.00 47.36  ? 529 PRO B C   1 
ATOM   8419 O  O   . PRO B 1 529 ? 5.366   10.759  30.690  1.00 55.04  ? 529 PRO B O   1 
ATOM   8420 C  CB  . PRO B 1 529 ? 6.637   8.177   32.446  1.00 36.18  ? 529 PRO B CB  1 
ATOM   8421 C  CG  . PRO B 1 529 ? 6.622   6.671   32.507  1.00 41.33  ? 529 PRO B CG  1 
ATOM   8422 C  CD  . PRO B 1 529 ? 5.280   6.203   32.065  1.00 42.94  ? 529 PRO B CD  1 
ATOM   8423 N  N   . LYS B 1 530 ? 6.219   9.067   29.465  1.00 39.85  ? 530 LYS B N   1 
ATOM   8424 C  CA  . LYS B 1 530 ? 6.430   9.907   28.289  1.00 39.85  ? 530 LYS B CA  1 
ATOM   8425 C  C   . LYS B 1 530 ? 5.117   10.450  27.744  1.00 55.24  ? 530 LYS B C   1 
ATOM   8426 O  O   . LYS B 1 530 ? 5.032   11.629  27.382  1.00 63.92  ? 530 LYS B O   1 
ATOM   8427 C  CB  . LYS B 1 530 ? 7.151   9.106   27.207  1.00 41.56  ? 530 LYS B CB  1 
ATOM   8428 C  CG  . LYS B 1 530 ? 8.507   9.629   26.834  1.00 45.46  ? 530 LYS B CG  1 
ATOM   8429 C  CD  . LYS B 1 530 ? 9.045   8.835   25.675  1.00 50.59  ? 530 LYS B CD  1 
ATOM   8430 C  CE  . LYS B 1 530 ? 8.646   9.463   24.370  1.00 57.80  ? 530 LYS B CE  1 
ATOM   8431 N  NZ  . LYS B 1 530 ? 9.565   8.988   23.305  1.00 74.01  1 530 LYS B NZ  1 
ATOM   8432 N  N   . LEU B 1 531 ? 4.088   9.597   27.653  1.00 50.94  ? 531 LEU B N   1 
ATOM   8433 C  CA  . LEU B 1 531 ? 2.814   10.029  27.091  1.00 51.36  ? 531 LEU B CA  1 
ATOM   8434 C  C   . LEU B 1 531 ? 2.222   11.167  27.907  1.00 59.53  ? 531 LEU B C   1 
ATOM   8435 O  O   . LEU B 1 531 ? 1.660   12.118  27.346  1.00 69.21  ? 531 LEU B O   1 
ATOM   8436 C  CB  . LEU B 1 531 ? 1.843   8.842   27.016  1.00 51.03  ? 531 LEU B CB  1 
ATOM   8437 C  CG  . LEU B 1 531 ? 0.423   9.008   26.435  1.00 51.39  ? 531 LEU B CG  1 
ATOM   8438 C  CD1 . LEU B 1 531 ? -0.055  7.730   25.787  1.00 57.93  ? 531 LEU B CD1 1 
ATOM   8439 C  CD2 . LEU B 1 531 ? -0.582  9.418   27.491  1.00 51.20  ? 531 LEU B CD2 1 
ATOM   8440 N  N   . LEU B 1 532 ? 2.356   11.097  29.234  1.00 60.28  ? 532 LEU B N   1 
ATOM   8441 C  CA  . LEU B 1 532 ? 1.754   12.102  30.104  1.00 63.24  ? 532 LEU B CA  1 
ATOM   8442 C  C   . LEU B 1 532 ? 2.554   13.406  30.155  1.00 64.01  ? 532 LEU B C   1 
ATOM   8443 O  O   . LEU B 1 532 ? 1.958   14.478  30.317  1.00 63.61  ? 532 LEU B O   1 
ATOM   8444 C  CB  . LEU B 1 532 ? 1.561   11.522  31.505  1.00 55.07  ? 532 LEU B CB  1 
ATOM   8445 C  CG  . LEU B 1 532 ? 0.627   10.302  31.524  1.00 49.89  ? 532 LEU B CG  1 
ATOM   8446 C  CD1 . LEU B 1 532 ? 0.806   9.492   32.776  1.00 34.56  ? 532 LEU B CD1 1 
ATOM   8447 C  CD2 . LEU B 1 532 ? -0.827  10.729  31.406  1.00 45.95  ? 532 LEU B CD2 1 
ATOM   8448 N  N   . ASN B 1 533 ? 3.884   13.353  29.998  1.00 59.69  ? 533 ASN B N   1 
ATOM   8449 C  CA  . ASN B 1 533 ? 4.649   14.595  29.899  1.00 66.31  ? 533 ASN B CA  1 
ATOM   8450 C  C   . ASN B 1 533 ? 4.312   15.368  28.626  1.00 67.33  ? 533 ASN B C   1 
ATOM   8451 O  O   . ASN B 1 533 ? 4.424   16.599  28.603  1.00 65.18  ? 533 ASN B O   1 
ATOM   8452 C  CB  . ASN B 1 533 ? 6.154   14.317  29.963  1.00 73.75  ? 533 ASN B CB  1 
ATOM   8453 C  CG  . ASN B 1 533 ? 6.934   15.471  30.593  1.00 89.34  ? 533 ASN B CG  1 
ATOM   8454 O  OD1 . ASN B 1 533 ? 6.386   16.246  31.387  1.00 97.33  ? 533 ASN B OD1 1 
ATOM   8455 N  ND2 . ASN B 1 533 ? 8.215   15.592  30.240  1.00 91.51  ? 533 ASN B ND2 1 
ATOM   8456 N  N   . ALA B 1 534 ? 3.898   14.675  27.566  1.00 69.15  ? 534 ALA B N   1 
ATOM   8457 C  CA  . ALA B 1 534 ? 3.488   15.328  26.331  1.00 68.19  ? 534 ALA B CA  1 
ATOM   8458 C  C   . ALA B 1 534 ? 2.015   15.739  26.320  1.00 68.66  ? 534 ALA B C   1 
ATOM   8459 O  O   . ALA B 1 534 ? 1.617   16.517  25.446  1.00 78.91  ? 534 ALA B O   1 
ATOM   8460 C  CB  . ALA B 1 534 ? 3.780   14.413  25.137  1.00 59.17  ? 534 ALA B CB  1 
ATOM   8461 N  N   . THR B 1 535 ? 1.212   15.285  27.280  1.00 62.28  ? 535 THR B N   1 
ATOM   8462 C  CA  . THR B 1 535 ? -0.241  15.478  27.220  1.00 71.78  ? 535 THR B CA  1 
ATOM   8463 C  C   . THR B 1 535 ? -0.940  16.049  28.480  1.00 70.20  ? 535 THR B C   1 
ATOM   8464 O  O   . THR B 1 535 ? -0.319  16.380  29.498  1.00 67.32  ? 535 THR B O   1 
ATOM   8465 C  CB  . THR B 1 535 ? -0.914  14.139  26.875  1.00 76.29  ? 535 THR B CB  1 
ATOM   8466 O  OG1 . THR B 1 535 ? -0.308  13.602  25.691  1.00 68.43  ? 535 THR B OG1 1 
ATOM   8467 C  CG2 . THR B 1 535 ? -2.419  14.326  26.659  1.00 82.62  ? 535 THR B CG2 1 
HETATM 8468 C  C1  . NAG C 2 .   ? -6.555  -8.202  -36.590 1.00 75.26  ? 601 NAG A C1  1 
HETATM 8469 C  C2  . NAG C 2 .   ? -6.589  -8.966  -37.920 1.00 83.36  ? 601 NAG A C2  1 
HETATM 8470 C  C3  . NAG C 2 .   ? -5.984  -10.369 -37.742 1.00 86.24  ? 601 NAG A C3  1 
HETATM 8471 C  C4  . NAG C 2 .   ? -4.572  -10.274 -37.170 1.00 87.92  ? 601 NAG A C4  1 
HETATM 8472 C  C5  . NAG C 2 .   ? -4.599  -9.509  -35.845 1.00 79.23  ? 601 NAG A C5  1 
HETATM 8473 C  C6  . NAG C 2 .   ? -3.228  -9.315  -35.221 1.00 76.24  ? 601 NAG A C6  1 
HETATM 8474 C  C7  . NAG C 2 .   ? -8.370  -8.324  -39.503 1.00 77.69  ? 601 NAG A C7  1 
HETATM 8475 C  C8  . NAG C 2 .   ? -9.798  -8.536  -39.914 1.00 67.50  ? 601 NAG A C8  1 
HETATM 8476 N  N2  . NAG C 2 .   ? -7.945  -9.043  -38.452 1.00 78.14  ? 601 NAG A N2  1 
HETATM 8477 O  O3  . NAG C 2 .   ? -5.960  -11.069 -38.982 1.00 81.90  ? 601 NAG A O3  1 
HETATM 8478 O  O4  . NAG C 2 .   ? -4.018  -11.574 -36.985 1.00 89.88  ? 601 NAG A O4  1 
HETATM 8479 O  O5  . NAG C 2 .   ? -5.168  -8.202  -36.048 1.00 80.17  ? 601 NAG A O5  1 
HETATM 8480 O  O6  . NAG C 2 .   ? -2.304  -8.639  -36.067 1.00 77.70  ? 601 NAG A O6  1 
HETATM 8481 O  O7  . NAG C 2 .   ? -7.635  -7.542  -40.100 1.00 82.29  ? 601 NAG A O7  1 
HETATM 8482 C  C1  . NAG D 2 .   ? -31.706 -6.281  2.624   1.00 49.19  ? 602 NAG A C1  1 
HETATM 8483 C  C2  . NAG D 2 .   ? -31.925 -6.913  4.018   1.00 55.34  ? 602 NAG A C2  1 
HETATM 8484 C  C3  . NAG D 2 .   ? -33.310 -7.581  4.116   1.00 74.87  ? 602 NAG A C3  1 
HETATM 8485 C  C4  . NAG D 2 .   ? -34.414 -6.640  3.654   1.00 76.86  ? 602 NAG A C4  1 
HETATM 8486 C  C5  . NAG D 2 .   ? -34.098 -6.189  2.235   1.00 63.39  ? 602 NAG A C5  1 
HETATM 8487 C  C6  . NAG D 2 .   ? -35.154 -5.287  1.628   1.00 60.45  ? 602 NAG A C6  1 
HETATM 8488 C  C7  . NAG D 2 .   ? -29.730 -7.584  4.930   1.00 53.04  ? 602 NAG A C7  1 
HETATM 8489 C  C8  . NAG D 2 .   ? -28.786 -8.731  5.151   1.00 42.13  ? 602 NAG A C8  1 
HETATM 8490 N  N2  . NAG D 2 .   ? -30.880 -7.884  4.312   1.00 50.02  ? 602 NAG A N2  1 
HETATM 8491 O  O3  . NAG D 2 .   ? -33.565 -7.995  5.455   1.00 82.39  ? 602 NAG A O3  1 
HETATM 8492 O  O4  . NAG D 2 .   ? -35.692 -7.269  3.735   1.00 79.74  ? 602 NAG A O4  1 
HETATM 8493 O  O5  . NAG D 2 .   ? -32.859 -5.466  2.261   1.00 50.32  ? 602 NAG A O5  1 
HETATM 8494 O  O6  . NAG D 2 .   ? -34.790 -3.914  1.634   1.00 59.89  ? 602 NAG A O6  1 
HETATM 8495 O  O7  . NAG D 2 .   ? -29.459 -6.440  5.289   1.00 53.62  ? 602 NAG A O7  1 
HETATM 8496 P  P01 . ELT E 3 .   ? -1.518  -1.857  -4.262  1.00 49.18  ? 603 ELT A P01 1 
HETATM 8497 O  O02 . ELT E 3 .   ? -1.887  -1.183  -5.536  1.00 44.23  ? 603 ELT A O02 1 
HETATM 8498 N  N03 . ELT E 3 .   ? -1.338  -0.860  -2.996  1.00 60.25  ? 603 ELT A N03 1 
HETATM 8499 C  C04 . ELT E 3 .   ? -0.573  0.322   -3.140  1.00 58.44  ? 603 ELT A C04 1 
HETATM 8500 C  C05 . ELT E 3 .   ? -1.162  -1.531  -1.672  1.00 65.91  ? 603 ELT A C05 1 
HETATM 8501 O  O06 . ELT E 3 .   ? -0.241  -2.836  -4.447  1.00 30.74  ? 603 ELT A O06 1 
HETATM 8502 C  C07 . ELT E 3 .   ? 0.666   -2.550  -5.526  1.00 61.52  ? 603 ELT A C07 1 
HETATM 8503 C  C08 . ELT E 3 .   ? 2.173   -2.614  -5.178  1.00 73.09  ? 603 ELT A C08 1 
HETATM 8504 C  C02 . DQ5 F 4 .   ? 12.132  3.334   -7.941  1.00 97.88  ? 604 DQ5 A C02 1 
HETATM 8505 C  C03 . DQ5 F 4 .   ? 13.414  4.090   -8.338  1.00 101.26 ? 604 DQ5 A C03 1 
HETATM 8506 C  C04 . DQ5 F 4 .   ? 14.659  3.173   -8.125  1.00 100.99 ? 604 DQ5 A C04 1 
HETATM 8507 C  C05 . DQ5 F 4 .   ? 14.450  2.066   -7.058  1.00 90.44  ? 604 DQ5 A C05 1 
HETATM 8508 C  C06 . DQ5 F 4 .   ? 14.181  2.666   -5.667  1.00 92.63  ? 604 DQ5 A C06 1 
HETATM 8509 C  C07 . DQ5 F 4 .   ? 14.774  3.858   -5.288  1.00 88.42  ? 604 DQ5 A C07 1 
HETATM 8510 C  C08 . DQ5 F 4 .   ? 14.510  4.383   -4.045  1.00 84.90  ? 604 DQ5 A C08 1 
HETATM 8511 C  C09 . DQ5 F 4 .   ? 13.672  3.730   -3.187  1.00 92.15  ? 604 DQ5 A C09 1 
HETATM 8512 C  C11 . DQ5 F 4 .   ? 13.074  2.534   -3.572  1.00 89.49  ? 604 DQ5 A C11 1 
HETATM 8513 C  C12 . DQ5 F 4 .   ? 12.146  1.811   -2.598  1.00 92.74  ? 604 DQ5 A C12 1 
HETATM 8514 C  C16 . DQ5 F 4 .   ? 10.348  3.896   -6.172  1.00 87.37  ? 604 DQ5 A C16 1 
HETATM 8515 C  C17 . DQ5 F 4 .   ? 10.387  4.855   -5.091  1.00 85.44  ? 604 DQ5 A C17 1 
HETATM 8516 C  C18 . DQ5 F 4 .   ? 11.247  6.094   -5.195  1.00 86.18  ? 604 DQ5 A C18 1 
HETATM 8517 C  C19 . DQ5 F 4 .   ? 11.159  7.046   -3.997  1.00 85.45  ? 604 DQ5 A C19 1 
HETATM 8518 C  C20 . DQ5 F 4 .   ? 10.780  6.415   -2.671  1.00 86.31  ? 604 DQ5 A C20 1 
HETATM 8519 C  C21 . DQ5 F 4 .   ? 9.576   5.507   -2.760  1.00 80.90  ? 604 DQ5 A C21 1 
HETATM 8520 C  C22 . DQ5 F 4 .   ? 9.629   4.597   -3.965  1.00 85.57  ? 604 DQ5 A C22 1 
HETATM 8521 C  C24 . DQ5 F 4 .   ? 8.780   2.524   -4.887  1.00 84.29  ? 604 DQ5 A C24 1 
HETATM 8522 C  C25 . DQ5 F 4 .   ? 7.969   1.398   -4.713  1.00 83.70  ? 604 DQ5 A C25 1 
HETATM 8523 C  C26 . DQ5 F 4 .   ? 7.891   0.445   -5.713  1.00 90.63  ? 604 DQ5 A C26 1 
HETATM 8524 C  C27 . DQ5 F 4 .   ? 8.616   0.625   -6.881  1.00 92.49  ? 604 DQ5 A C27 1 
HETATM 8525 C  C28 . DQ5 F 4 .   ? 9.421   1.756   -7.047  1.00 92.01  ? 604 DQ5 A C28 1 
HETATM 8526 C  C29 . DQ5 F 4 .   ? 9.519   2.718   -6.046  1.00 86.74  ? 604 DQ5 A C29 1 
HETATM 8527 N  N01 . DQ5 F 4 .   ? 11.153  4.223   -7.349  1.00 90.03  ? 604 DQ5 A N01 1 
HETATM 8528 N  N13 . DQ5 F 4 .   ? 10.889  1.549   -2.894  1.00 100.64 ? 604 DQ5 A N13 1 
HETATM 8529 N  N15 . DQ5 F 4 .   ? 13.330  2.014   -4.807  1.00 94.72  ? 604 DQ5 A N15 1 
HETATM 8530 N  N23 . DQ5 F 4 .   ? 8.839   3.458   -3.859  1.00 87.46  ? 604 DQ5 A N23 1 
HETATM 8531 O  O10 . DQ5 F 4 .   ? 13.409  4.262   -1.895  1.00 99.47  ? 604 DQ5 A O10 1 
HETATM 8532 O  O14 . DQ5 F 4 .   ? 10.051  1.022   -1.942  1.00 103.07 ? 604 DQ5 A O14 1 
HETATM 8533 CL CL  . CL  G 5 .   ? -16.000 -3.561  17.721  1.00 77.47  ? 605 CL  A CL  1 
HETATM 8534 CL CL  . CL  H 5 .   ? -5.516  -23.017 -21.771 1.00 65.84  ? 606 CL  A CL  1 
HETATM 8535 O  O1  . PG4 I 6 .   ? -1.920  -5.085  -6.211  1.00 63.72  ? 607 PG4 A O1  1 
HETATM 8536 C  C1  . PG4 I 6 .   ? -1.305  -4.829  -7.445  1.00 56.74  ? 607 PG4 A C1  1 
HETATM 8537 C  C2  . PG4 I 6 .   ? -0.502  -6.117  -7.645  1.00 56.69  ? 607 PG4 A C2  1 
HETATM 8538 O  O2  . PG4 I 6 .   ? 0.667   -5.693  -8.265  1.00 55.15  ? 607 PG4 A O2  1 
HETATM 8539 C  C3  . PG4 I 6 .   ? 1.647   -5.377  -7.354  1.00 49.59  ? 607 PG4 A C3  1 
HETATM 8540 C  C4  . PG4 I 6 .   ? 2.312   -6.730  -7.134  1.00 57.22  ? 607 PG4 A C4  1 
HETATM 8541 O  O3  . PG4 I 6 .   ? 3.532   -6.437  -6.504  1.00 60.10  ? 607 PG4 A O3  1 
HETATM 8542 C  C5  . PG4 I 6 .   ? 4.475   -5.823  -7.355  1.00 57.67  ? 607 PG4 A C5  1 
HETATM 8543 C  C6  . PG4 I 6 .   ? 4.838   -4.513  -6.619  1.00 62.01  ? 607 PG4 A C6  1 
HETATM 8544 O  O4  . PG4 I 6 .   ? 6.225   -4.411  -6.765  1.00 64.65  ? 607 PG4 A O4  1 
HETATM 8545 C  C7  . PG4 I 6 .   ? 6.724   -3.211  -6.192  1.00 61.71  ? 607 PG4 A C7  1 
HETATM 8546 C  C8  . PG4 I 6 .   ? 6.887   -3.468  -4.676  1.00 57.30  ? 607 PG4 A C8  1 
HETATM 8547 O  O5  . PG4 I 6 .   ? 6.274   -2.328  -4.123  1.00 56.76  ? 607 PG4 A O5  1 
HETATM 8548 CL CL  . CL  J 5 .   ? -27.698 5.920   -4.211  1.00 67.80  ? 608 CL  A CL  1 
HETATM 8549 CL CL  . CL  K 5 .   ? -3.037  -23.515 4.046   1.00 81.24  ? 609 CL  A CL  1 
HETATM 8550 CL CL  . CL  L 5 .   ? -0.250  23.440  -25.224 1.00 86.84  ? 610 CL  A CL  1 
HETATM 8551 C  C1  . NAG M 2 .   ? 6.383   -5.709  84.113  1.00 91.48  ? 601 NAG B C1  1 
HETATM 8552 C  C2  . NAG M 2 .   ? 6.560   -6.413  85.459  1.00 95.90  ? 601 NAG B C2  1 
HETATM 8553 C  C3  . NAG M 2 .   ? 5.657   -7.644  85.529  1.00 97.50  ? 601 NAG B C3  1 
HETATM 8554 C  C4  . NAG M 2 .   ? 4.207   -7.255  85.269  1.00 100.33 ? 601 NAG B C4  1 
HETATM 8555 C  C5  . NAG M 2 .   ? 4.089   -6.528  83.929  1.00 95.50  ? 601 NAG B C5  1 
HETATM 8556 C  C6  . NAG M 2 .   ? 2.695   -6.005  83.656  1.00 87.83  ? 601 NAG B C6  1 
HETATM 8557 C  C7  . NAG M 2 .   ? 8.702   -6.294  86.667  1.00 96.17  ? 601 NAG B C7  1 
HETATM 8558 C  C8  . NAG M 2 .   ? 10.116  -6.793  86.726  1.00 100.45 ? 601 NAG B C8  1 
HETATM 8559 N  N2  . NAG M 2 .   ? 7.950   -6.785  85.674  1.00 101.06 ? 601 NAG B N2  1 
HETATM 8560 O  O3  . NAG M 2 .   ? 5.780   -8.273  86.801  1.00 99.29  ? 601 NAG B O3  1 
HETATM 8561 O  O4  . NAG M 2 .   ? 3.381   -8.416  85.272  1.00 102.81 ? 601 NAG B O4  1 
HETATM 8562 O  O5  . NAG M 2 .   ? 4.973   -5.395  83.904  1.00 95.39  ? 601 NAG B O5  1 
HETATM 8563 O  O6  . NAG M 2 .   ? 2.684   -4.606  83.404  1.00 80.56  ? 601 NAG B O6  1 
HETATM 8564 O  O7  . NAG M 2 .   ? 8.262   -5.482  87.478  1.00 82.33  ? 601 NAG B O7  1 
HETATM 8565 C  C1  . NAG N 2 .   ? 31.594  -6.134  45.236  1.00 65.23  ? 602 NAG B C1  1 
HETATM 8566 C  C2  . NAG N 2 .   ? 31.733  -6.695  43.811  1.00 66.29  ? 602 NAG B C2  1 
HETATM 8567 C  C3  . NAG N 2 .   ? 33.015  -7.526  43.684  1.00 79.20  ? 602 NAG B C3  1 
HETATM 8568 C  C4  . NAG N 2 .   ? 34.227  -6.716  44.128  1.00 82.36  ? 602 NAG B C4  1 
HETATM 8569 C  C5  . NAG N 2 .   ? 34.005  -6.199  45.549  1.00 75.50  ? 602 NAG B C5  1 
HETATM 8570 C  C6  . NAG N 2 .   ? 35.119  -5.298  46.033  1.00 69.63  ? 602 NAG B C6  1 
HETATM 8571 C  C7  . NAG N 2 .   ? 29.486  -6.963  42.828  1.00 57.29  ? 602 NAG B C7  1 
HETATM 8572 C  C8  . NAG N 2 .   ? 28.399  -7.934  42.482  1.00 43.01  ? 602 NAG B C8  1 
HETATM 8573 N  N2  . NAG N 2 .   ? 30.571  -7.483  43.425  1.00 55.76  ? 602 NAG B N2  1 
HETATM 8574 O  O3  . NAG N 2 .   ? 33.184  -7.951  42.336  1.00 81.50  ? 602 NAG B O3  1 
HETATM 8575 O  O4  . NAG N 2 .   ? 35.426  -7.486  44.042  1.00 81.09  ? 602 NAG B O4  1 
HETATM 8576 O  O5  . NAG N 2 .   ? 32.796  -5.423  45.598  1.00 73.99  ? 602 NAG B O5  1 
HETATM 8577 O  O6  . NAG N 2 .   ? 34.956  -3.959  45.583  1.00 61.26  ? 602 NAG B O6  1 
HETATM 8578 O  O7  . NAG N 2 .   ? 29.386  -5.758  42.578  1.00 59.98  ? 602 NAG B O7  1 
HETATM 8579 P  P01 . ELT O 3 .   ? 1.694   -1.025  52.050  1.00 41.59  ? 603 ELT B P01 1 
HETATM 8580 O  O02 . ELT O 3 .   ? 2.095   -0.370  53.319  1.00 42.98  ? 603 ELT B O02 1 
HETATM 8581 N  N03 . ELT O 3 .   ? 1.613   -0.053  50.760  1.00 57.59  ? 603 ELT B N03 1 
HETATM 8582 C  C04 . ELT O 3 .   ? 0.564   0.864   50.657  1.00 59.32  ? 603 ELT B C04 1 
HETATM 8583 C  C05 . ELT O 3 .   ? 1.872   -0.744  49.478  1.00 67.30  ? 603 ELT B C05 1 
HETATM 8584 O  O06 . ELT O 3 .   ? 0.383   -1.922  52.244  1.00 33.29  ? 603 ELT B O06 1 
HETATM 8585 C  C07 . ELT O 3 .   ? -0.381  -1.795  53.438  1.00 54.23  ? 603 ELT B C07 1 
HETATM 8586 C  C08 . ELT O 3 .   ? -1.713  -1.038  53.250  1.00 60.13  ? 603 ELT B C08 1 
HETATM 8587 C  C1  . NAG P 2 .   ? -5.845  -26.664 63.454  1.00 87.08  ? 604 NAG B C1  1 
HETATM 8588 C  C2  . NAG P 2 .   ? -6.988  -25.879 64.094  1.00 89.03  ? 604 NAG B C2  1 
HETATM 8589 C  C3  . NAG P 2 .   ? -7.564  -26.659 65.272  1.00 94.47  ? 604 NAG B C3  1 
HETATM 8590 C  C4  . NAG P 2 .   ? -7.982  -28.058 64.840  1.00 98.58  ? 604 NAG B C4  1 
HETATM 8591 C  C5  . NAG P 2 .   ? -6.829  -28.779 64.140  1.00 97.07  ? 604 NAG B C5  1 
HETATM 8592 C  C6  . NAG P 2 .   ? -7.257  -30.091 63.517  1.00 101.16 ? 604 NAG B C6  1 
HETATM 8593 C  C7  . NAG P 2 .   ? -6.645  -23.463 63.782  1.00 76.14  ? 604 NAG B C7  1 
HETATM 8594 C  C8  . NAG P 2 .   ? -6.097  -22.204 64.382  1.00 68.35  ? 604 NAG B C8  1 
HETATM 8595 N  N2  . NAG P 2 .   ? -6.527  -24.568 64.526  1.00 84.86  ? 604 NAG B N2  1 
HETATM 8596 O  O3  . NAG P 2 .   ? -8.679  -25.959 65.812  1.00 96.98  ? 604 NAG B O3  1 
HETATM 8597 O  O4  . NAG P 2 .   ? -8.397  -28.804 65.980  1.00 100.85 ? 604 NAG B O4  1 
HETATM 8598 O  O5  . NAG P 2 .   ? -6.309  -27.972 63.070  1.00 92.58  ? 604 NAG B O5  1 
HETATM 8599 O  O6  . NAG P 2 .   ? -6.339  -31.139 63.798  1.00 101.58 ? 604 NAG B O6  1 
HETATM 8600 O  O7  . NAG P 2 .   ? -7.170  -23.479 62.675  1.00 78.16  ? 604 NAG B O7  1 
HETATM 8601 CL CL  . CL  Q 5 .   ? 5.336   -21.293 70.511  1.00 64.68  ? 605 CL  B CL  1 
HETATM 8602 NA NA  . NA  R 7 .   ? 3.555   31.159  56.821  1.00 63.33  ? 606 NA  B NA  1 
HETATM 8603 CL CL  . CL  S 5 .   ? -0.294  28.620  54.721  1.00 83.11  ? 607 CL  B CL  1 
HETATM 8604 CL CL  . CL  T 5 .   ? 25.859  -5.910  36.825  1.00 48.58  ? 608 CL  B CL  1 
HETATM 8605 O  O1  . P6G U 8 .   ? -10.626 5.946   52.272  1.00 71.12  ? 609 P6G B O1  1 
HETATM 8606 C  C2  . P6G U 8 .   ? -10.581 4.900   53.216  1.00 71.35  ? 609 P6G B C2  1 
HETATM 8607 C  C3  . P6G U 8 .   ? -10.087 3.701   52.382  1.00 77.27  ? 609 P6G B C3  1 
HETATM 8608 O  O4  . P6G U 8 .   ? -9.613  2.738   53.305  1.00 83.60  ? 609 P6G B O4  1 
HETATM 8609 C  C5  . P6G U 8 .   ? -8.202  2.650   53.317  1.00 83.98  ? 609 P6G B C5  1 
HETATM 8610 C  C6  . P6G U 8 .   ? -7.880  1.361   52.510  1.00 86.89  ? 609 P6G B C6  1 
HETATM 8611 O  O7  . P6G U 8 .   ? -6.452  1.252   52.541  1.00 90.78  ? 609 P6G B O7  1 
HETATM 8612 C  C8  . P6G U 8 .   ? -5.906  0.576   51.422  1.00 90.76  ? 609 P6G B C8  1 
HETATM 8613 C  C9  . P6G U 8 .   ? -5.299  -0.715  52.010  1.00 89.65  ? 609 P6G B C9  1 
HETATM 8614 O  O10 . P6G U 8 .   ? -6.429  -1.533  52.240  1.00 91.23  ? 609 P6G B O10 1 
HETATM 8615 C  C11 . P6G U 8 .   ? -6.106  -2.792  52.776  1.00 92.78  ? 609 P6G B C11 1 
HETATM 8616 C  C12 . P6G U 8 .   ? -6.499  -2.686  54.267  1.00 89.06  ? 609 P6G B C12 1 
HETATM 8617 O  O13 . P6G U 8 .   ? -5.607  -3.565  54.923  1.00 84.84  ? 609 P6G B O13 1 
HETATM 8618 C  C14 . P6G U 8 .   ? -4.270  -3.176  54.784  1.00 80.05  ? 609 P6G B C14 1 
HETATM 8619 C  C15 . P6G U 8 .   ? -3.467  -4.487  54.821  1.00 73.22  ? 609 P6G B C15 1 
HETATM 8620 O  O16 . P6G U 8 .   ? -2.224  -4.054  55.348  1.00 74.10  ? 609 P6G B O16 1 
HETATM 8621 C  C17 . P6G U 8 .   ? -1.120  -4.875  55.012  1.00 68.01  ? 609 P6G B C17 1 
HETATM 8622 C  C18 . P6G U 8 .   ? 0.060   -4.279  55.838  1.00 61.50  ? 609 P6G B C18 1 
HETATM 8623 O  O19 . P6G U 8 .   ? 1.108   -4.122  54.910  1.00 58.76  ? 609 P6G B O19 1 
HETATM 8624 O  O   . HOH V 9 .   ? 17.855  -5.932  1.007   1.00 75.48  ? 701 HOH A O   1 
HETATM 8625 O  O   . HOH V 9 .   ? -28.794 -10.785 -23.090 1.00 56.41  ? 702 HOH A O   1 
HETATM 8626 O  O   . HOH V 9 .   ? 18.798  -8.780  7.933   1.00 67.75  ? 703 HOH A O   1 
HETATM 8627 O  O   . HOH V 9 .   ? 21.534  -3.119  11.270  1.00 52.51  ? 704 HOH A O   1 
HETATM 8628 O  O   . HOH V 9 .   ? -2.381  18.851  22.435  1.00 55.54  ? 705 HOH A O   1 
HETATM 8629 O  O   . HOH V 9 .   ? -4.626  -5.364  -9.088  1.00 40.42  ? 706 HOH A O   1 
HETATM 8630 O  O   . HOH V 9 .   ? -26.435 -17.511 -3.753  1.00 45.03  ? 707 HOH A O   1 
HETATM 8631 O  O   . HOH V 9 .   ? 10.163  11.060  15.419  1.00 51.16  ? 708 HOH A O   1 
HETATM 8632 O  O   . HOH V 9 .   ? -4.666  -6.002  11.675  1.00 97.92  ? 709 HOH A O   1 
HETATM 8633 O  O   . HOH V 9 .   ? -7.530  -8.500  -18.022 1.00 64.86  ? 710 HOH A O   1 
HETATM 8634 O  O   . HOH V 9 .   ? -3.672  -8.549  -2.375  1.00 22.11  ? 711 HOH A O   1 
HETATM 8635 O  O   . HOH V 9 .   ? 4.228   5.593   -12.661 1.00 53.47  ? 712 HOH A O   1 
HETATM 8636 O  O   . HOH V 9 .   ? -2.312  -4.454  -11.649 1.00 51.76  ? 713 HOH A O   1 
HETATM 8637 O  O   . HOH V 9 .   ? -11.237 -26.352 -1.240  1.00 43.89  ? 714 HOH A O   1 
HETATM 8638 O  O   . HOH V 9 .   ? 7.094   -5.687  -10.739 1.00 58.15  ? 715 HOH A O   1 
HETATM 8639 O  O   . HOH V 9 .   ? 3.527   2.815   5.959   1.00 43.93  ? 716 HOH A O   1 
HETATM 8640 O  O   . HOH V 9 .   ? 13.394  5.543   -16.059 1.00 34.96  ? 717 HOH A O   1 
HETATM 8641 O  O   . HOH V 9 .   ? -20.968 -11.350 12.035  1.00 39.20  ? 718 HOH A O   1 
HETATM 8642 O  O   . HOH V 9 .   ? 6.892   -21.206 -2.218  1.00 39.19  ? 719 HOH A O   1 
HETATM 8643 O  O   . HOH V 9 .   ? -6.532  -10.235 -1.069  1.00 56.13  ? 720 HOH A O   1 
HETATM 8644 O  O   . HOH V 9 .   ? -11.903 8.636   -31.949 1.00 49.77  ? 721 HOH A O   1 
HETATM 8645 O  O   . HOH V 9 .   ? -9.874  -15.887 -15.738 1.00 23.43  ? 722 HOH A O   1 
HETATM 8646 O  O   . HOH V 9 .   ? -7.088  -2.119  -20.866 1.00 57.49  ? 723 HOH A O   1 
HETATM 8647 O  O   . HOH V 9 .   ? -7.921  7.137   1.691   1.00 48.51  ? 724 HOH A O   1 
HETATM 8648 O  O   . HOH V 9 .   ? -2.984  1.139   -10.342 1.00 36.73  ? 725 HOH A O   1 
HETATM 8649 O  O   . HOH V 9 .   ? -5.055  -0.353  -21.793 1.00 42.54  ? 726 HOH A O   1 
HETATM 8650 O  O   . HOH V 9 .   ? -21.922 -0.845  -15.284 1.00 41.01  ? 727 HOH A O   1 
HETATM 8651 O  O   . HOH V 9 .   ? 11.803  9.381   -9.730  1.00 56.28  ? 728 HOH A O   1 
HETATM 8652 O  O   . HOH V 9 .   ? -8.413  -3.334  -15.033 1.00 33.21  ? 729 HOH A O   1 
HETATM 8653 O  O   . HOH V 9 .   ? -23.880 -17.682 -14.259 1.00 51.47  ? 730 HOH A O   1 
HETATM 8654 O  O   . HOH V 9 .   ? -19.567 -22.533 -29.333 1.00 52.81  ? 731 HOH A O   1 
HETATM 8655 O  O   . HOH V 9 .   ? -2.844  -3.748  23.419  1.00 44.74  ? 732 HOH A O   1 
HETATM 8656 O  O   . HOH V 9 .   ? -7.592  -28.718 -21.719 1.00 48.36  ? 733 HOH A O   1 
HETATM 8657 O  O   . HOH V 9 .   ? 11.933  -6.444  -11.508 1.00 40.77  ? 734 HOH A O   1 
HETATM 8658 O  O   . HOH V 9 .   ? -9.955  11.574  -23.124 1.00 46.36  ? 735 HOH A O   1 
HETATM 8659 O  O   . HOH V 9 .   ? 18.596  -3.526  3.299   1.00 21.79  ? 736 HOH A O   1 
HETATM 8660 O  O   . HOH V 9 .   ? -11.385 11.937  4.036   1.00 53.01  ? 737 HOH A O   1 
HETATM 8661 O  O   . HOH V 9 .   ? -25.191 -0.806  -15.485 1.00 39.88  ? 738 HOH A O   1 
HETATM 8662 O  O   . HOH V 9 .   ? -1.886  -26.394 -12.329 1.00 38.30  ? 739 HOH A O   1 
HETATM 8663 O  O   . HOH V 9 .   ? 9.308   -14.818 24.310  1.00 46.59  ? 740 HOH A O   1 
HETATM 8664 O  O   . HOH V 9 .   ? -18.660 -21.314 -22.776 1.00 62.41  ? 741 HOH A O   1 
HETATM 8665 O  O   . HOH V 9 .   ? -18.387 11.652  -14.192 1.00 54.61  ? 742 HOH A O   1 
HETATM 8666 O  O   . HOH V 9 .   ? 2.753   -18.701 -7.905  1.00 30.22  ? 743 HOH A O   1 
HETATM 8667 O  O   . HOH V 9 .   ? -6.017  12.463  -8.165  1.00 51.17  ? 744 HOH A O   1 
HETATM 8668 O  O   . HOH V 9 .   ? 14.038  -13.545 28.241  1.00 56.82  ? 745 HOH A O   1 
HETATM 8669 O  O   . HOH V 9 .   ? 13.404  -15.251 -4.589  1.00 45.17  ? 746 HOH A O   1 
HETATM 8670 O  O   . HOH V 9 .   ? 17.423  -14.363 15.486  1.00 47.05  ? 747 HOH A O   1 
HETATM 8671 O  O   . HOH V 9 .   ? 13.991  -0.445  -11.258 1.00 60.28  ? 748 HOH A O   1 
HETATM 8672 O  O   . HOH V 9 .   ? -4.570  -29.446 -11.660 1.00 58.65  ? 749 HOH A O   1 
HETATM 8673 O  O   . HOH V 9 .   ? 1.970   -2.950  -9.840  1.00 47.42  ? 750 HOH A O   1 
HETATM 8674 O  O   . HOH V 9 .   ? 3.046   -8.589  0.357   1.00 33.11  ? 751 HOH A O   1 
HETATM 8675 O  O   . HOH V 9 .   ? -13.946 -8.697  12.562  1.00 43.20  ? 752 HOH A O   1 
HETATM 8676 O  O   . HOH V 9 .   ? 10.094  3.282   -15.817 1.00 39.82  ? 753 HOH A O   1 
HETATM 8677 O  O   . HOH V 9 .   ? 16.544  -11.162 22.527  1.00 50.39  ? 754 HOH A O   1 
HETATM 8678 O  O   . HOH V 9 .   ? 11.957  -0.984  -7.389  1.00 61.33  ? 755 HOH A O   1 
HETATM 8679 O  O   . HOH V 9 .   ? -2.703  11.029  -20.247 1.00 41.38  ? 756 HOH A O   1 
HETATM 8680 O  O   . HOH V 9 .   ? -25.449 -2.866  -12.090 1.00 54.18  ? 757 HOH A O   1 
HETATM 8681 O  O   . HOH V 9 .   ? -18.536 -6.627  17.227  1.00 95.28  ? 758 HOH A O   1 
HETATM 8682 O  O   . HOH V 9 .   ? -20.659 3.955   -23.559 1.00 54.59  ? 759 HOH A O   1 
HETATM 8683 O  O   . HOH V 9 .   ? -8.045  5.777   -25.474 1.00 69.18  ? 760 HOH A O   1 
HETATM 8684 O  O   . HOH V 9 .   ? -2.546  0.023   -18.506 1.00 36.04  ? 761 HOH A O   1 
HETATM 8685 O  O   . HOH V 9 .   ? 12.571  -17.275 3.534   1.00 42.41  ? 762 HOH A O   1 
HETATM 8686 O  O   . HOH V 9 .   ? -9.277  14.060  -22.198 1.00 99.63  ? 763 HOH A O   1 
HETATM 8687 O  O   . HOH V 9 .   ? -24.867 1.727   -34.871 1.00 43.54  ? 764 HOH A O   1 
HETATM 8688 O  O   . HOH V 9 .   ? 18.385  -0.697  3.462   1.00 29.52  ? 765 HOH A O   1 
HETATM 8689 O  O   . HOH V 9 .   ? 16.700  -12.789 25.303  1.00 45.33  ? 766 HOH A O   1 
HETATM 8690 O  O   . HOH V 9 .   ? -23.674 -4.379  4.866   1.00 33.89  ? 767 HOH A O   1 
HETATM 8691 O  O   . HOH V 9 .   ? -9.445  13.352  16.986  1.00 58.25  ? 768 HOH A O   1 
HETATM 8692 O  O   . HOH V 9 .   ? 19.118  -7.456  17.193  1.00 42.11  ? 769 HOH A O   1 
HETATM 8693 O  O   . HOH V 9 .   ? 15.578  22.200  -10.228 1.00 37.33  ? 770 HOH A O   1 
HETATM 8694 O  O   . HOH V 9 .   ? -28.926 -1.996  8.304   1.00 26.12  ? 771 HOH A O   1 
HETATM 8695 O  O   . HOH V 9 .   ? 11.362  5.914   -13.416 1.00 51.94  ? 772 HOH A O   1 
HETATM 8696 O  O   . HOH V 9 .   ? 0.204   18.860  23.148  1.00 50.04  ? 773 HOH A O   1 
HETATM 8697 O  O   . HOH V 9 .   ? 0.518   27.370  -7.658  1.00 38.82  ? 774 HOH A O   1 
HETATM 8698 O  O   . HOH V 9 .   ? 19.545  1.729   10.592  1.00 44.46  ? 775 HOH A O   1 
HETATM 8699 O  O   . HOH V 9 .   ? -21.406 -22.198 -0.713  1.00 66.88  ? 776 HOH A O   1 
HETATM 8700 O  O   . HOH V 9 .   ? -8.640  -1.700  -35.059 1.00 54.57  ? 777 HOH A O   1 
HETATM 8701 O  O   . HOH V 9 .   ? 0.687   1.137   23.137  1.00 41.07  ? 778 HOH A O   1 
HETATM 8702 O  O   . HOH V 9 .   ? -33.990 -14.755 -29.273 1.00 48.90  ? 779 HOH A O   1 
HETATM 8703 O  O   . HOH V 9 .   ? 13.520  3.043   -17.711 1.00 48.39  ? 780 HOH A O   1 
HETATM 8704 O  O   . HOH V 9 .   ? 19.281  -13.013 7.007   1.00 46.09  ? 781 HOH A O   1 
HETATM 8705 O  O   . HOH V 9 .   ? 3.931   -8.639  21.605  1.00 43.93  ? 782 HOH A O   1 
HETATM 8706 O  O   . HOH V 9 .   ? -28.537 -12.069 -13.662 1.00 49.31  ? 783 HOH A O   1 
HETATM 8707 O  O   . HOH V 9 .   ? 6.768   19.013  2.797   1.00 33.61  ? 784 HOH A O   1 
HETATM 8708 O  O   . HOH V 9 .   ? 2.200   -17.107 -10.975 1.00 54.15  ? 785 HOH A O   1 
HETATM 8709 O  O   . HOH V 9 .   ? -31.402 -3.967  -26.916 1.00 58.37  ? 786 HOH A O   1 
HETATM 8710 O  O   . HOH V 9 .   ? -24.620 -7.349  -32.347 1.00 44.87  ? 787 HOH A O   1 
HETATM 8711 O  O   . HOH V 9 .   ? 5.941   -15.911 -10.672 1.00 58.41  ? 788 HOH A O   1 
HETATM 8712 O  O   . HOH V 9 .   ? -27.230 -10.048 -26.975 1.00 41.31  ? 789 HOH A O   1 
HETATM 8713 O  O   . HOH V 9 .   ? -11.537 -2.296  13.981  1.00 31.49  ? 790 HOH A O   1 
HETATM 8714 O  O   . HOH V 9 .   ? -7.020  -14.997 -23.837 1.00 40.23  ? 791 HOH A O   1 
HETATM 8715 O  O   . HOH V 9 .   ? -3.521  -8.664  16.127  1.00 52.78  ? 792 HOH A O   1 
HETATM 8716 O  O   . HOH V 9 .   ? -6.984  20.686  1.874   1.00 43.50  ? 793 HOH A O   1 
HETATM 8717 O  O   . HOH V 9 .   ? 5.213   -16.881 -8.767  1.00 46.42  ? 794 HOH A O   1 
HETATM 8718 O  O   . HOH V 9 .   ? -0.685  27.399  -26.008 1.00 34.78  ? 795 HOH A O   1 
HETATM 8719 O  O   . HOH V 9 .   ? 15.248  19.658  -6.342  1.00 61.44  ? 796 HOH A O   1 
HETATM 8720 O  O   . HOH V 9 .   ? -2.755  29.268  -24.321 1.00 93.49  ? 797 HOH A O   1 
HETATM 8721 O  O   . HOH V 9 .   ? 22.289  -6.357  11.061  1.00 37.02  ? 798 HOH A O   1 
HETATM 8722 O  O   . HOH V 9 .   ? -25.938 -5.998  10.756  1.00 25.56  ? 799 HOH A O   1 
HETATM 8723 O  O   . HOH V 9 .   ? 15.507  -15.428 25.262  1.00 32.06  ? 800 HOH A O   1 
HETATM 8724 O  O   . HOH V 9 .   ? 9.248   -17.446 23.474  1.00 58.81  ? 801 HOH A O   1 
HETATM 8725 O  O   . HOH V 9 .   ? 4.088   -19.600 -11.584 1.00 40.10  ? 802 HOH A O   1 
HETATM 8726 O  O   . HOH V 9 .   ? -30.630 -6.509  -25.576 1.00 49.16  ? 803 HOH A O   1 
HETATM 8727 O  O   . HOH V 9 .   ? -3.867  21.097  -31.237 1.00 56.42  ? 804 HOH A O   1 
HETATM 8728 O  O   . HOH V 9 .   ? -12.026 -28.303 1.081   1.00 41.82  ? 805 HOH A O   1 
HETATM 8729 O  O   . HOH V 9 .   ? 7.396   -19.973 -11.545 1.00 59.85  ? 806 HOH A O   1 
HETATM 8730 O  O   . HOH V 9 .   ? 0.829   -1.281  1.619   1.00 27.68  ? 807 HOH A O   1 
HETATM 8731 O  O   . HOH W 9 .   ? 17.812  -11.104 55.633  1.00 100.82 ? 701 HOH B O   1 
HETATM 8732 O  O   . HOH W 9 .   ? 6.405   -7.504  66.140  1.00 47.45  ? 702 HOH B O   1 
HETATM 8733 O  O   . HOH W 9 .   ? 16.714  -9.306  25.035  1.00 41.25  ? 703 HOH B O   1 
HETATM 8734 O  O   . HOH W 9 .   ? 3.448   13.852  53.670  1.00 40.23  ? 704 HOH B O   1 
HETATM 8735 O  O   . HOH W 9 .   ? 8.481   7.677   46.019  1.00 32.36  ? 705 HOH B O   1 
HETATM 8736 O  O   . HOH W 9 .   ? 24.138  -9.718  29.619  1.00 51.34  ? 706 HOH B O   1 
HETATM 8737 O  O   . HOH W 9 .   ? 12.313  -15.014 50.502  1.00 57.03  ? 707 HOH B O   1 
HETATM 8738 O  O   . HOH W 9 .   ? 22.113  -9.913  86.796  1.00 48.40  ? 708 HOH B O   1 
HETATM 8739 O  O   . HOH W 9 .   ? -6.968  -10.531 21.505  1.00 51.46  ? 709 HOH B O   1 
HETATM 8740 O  O   . HOH W 9 .   ? 20.074  -19.694 34.241  1.00 66.40  ? 710 HOH B O   1 
HETATM 8741 O  O   . HOH W 9 .   ? -3.829  17.029  72.634  1.00 67.38  ? 711 HOH B O   1 
HETATM 8742 O  O   . HOH W 9 .   ? 2.196   -3.532  59.762  1.00 55.19  ? 712 HOH B O   1 
HETATM 8743 O  O   . HOH W 9 .   ? 13.796  1.675   34.487  1.00 33.77  ? 713 HOH B O   1 
HETATM 8744 O  O   . HOH W 9 .   ? 21.927  -17.988 59.779  1.00 38.05  ? 714 HOH B O   1 
HETATM 8745 O  O   . HOH W 9 .   ? -1.481  -7.433  41.525  1.00 79.08  ? 715 HOH B O   1 
HETATM 8746 O  O   . HOH W 9 .   ? 0.015   7.698   54.825  1.00 28.62  ? 716 HOH B O   1 
HETATM 8747 O  O   . HOH W 9 .   ? -18.630 -7.919  39.963  1.00 36.35  ? 717 HOH B O   1 
HETATM 8748 O  O   . HOH W 9 .   ? 9.955   -14.853 63.794  1.00 23.30  ? 718 HOH B O   1 
HETATM 8749 O  O   . HOH W 9 .   ? 9.484   6.657   73.744  1.00 34.35  ? 719 HOH B O   1 
HETATM 8750 O  O   . HOH W 9 .   ? 4.641   -4.573  56.743  1.00 33.08  ? 720 HOH B O   1 
HETATM 8751 O  O   . HOH W 9 .   ? -1.785  9.297   55.861  1.00 38.72  ? 721 HOH B O   1 
HETATM 8752 O  O   . HOH W 9 .   ? 3.740   -7.540  50.322  1.00 45.35  ? 722 HOH B O   1 
HETATM 8753 O  O   . HOH W 9 .   ? 21.434  3.922   38.512  1.00 30.62  ? 723 HOH B O   1 
HETATM 8754 O  O   . HOH W 9 .   ? 1.315   16.904  54.319  1.00 55.88  ? 724 HOH B O   1 
HETATM 8755 O  O   . HOH W 9 .   ? 12.175  2.152   57.836  1.00 68.92  ? 725 HOH B O   1 
HETATM 8756 O  O   . HOH W 9 .   ? 25.966  -1.581  69.459  1.00 44.33  ? 726 HOH B O   1 
HETATM 8757 O  O   . HOH W 9 .   ? 25.177  -2.655  60.146  1.00 32.39  ? 727 HOH B O   1 
HETATM 8758 O  O   . HOH W 9 .   ? -11.628 -5.426  59.383  1.00 43.40  ? 728 HOH B O   1 
HETATM 8759 O  O   . HOH W 9 .   ? 32.031  -7.397  62.403  1.00 53.55  ? 729 HOH B O   1 
HETATM 8760 O  O   . HOH W 9 .   ? -4.095  6.803   60.121  1.00 33.82  ? 730 HOH B O   1 
HETATM 8761 O  O   . HOH W 9 .   ? 16.884  -12.654 28.749  1.00 105.04 ? 731 HOH B O   1 
HETATM 8762 O  O   . HOH W 9 .   ? -2.004  8.250   61.941  1.00 40.36  ? 732 HOH B O   1 
HETATM 8763 O  O   . HOH W 9 .   ? 21.146  8.890   63.242  1.00 46.24  ? 733 HOH B O   1 
HETATM 8764 O  O   . HOH W 9 .   ? 6.563   17.102  60.190  1.00 34.86  ? 734 HOH B O   1 
HETATM 8765 O  O   . HOH W 9 .   ? -0.341  -21.378 46.178  1.00 41.71  ? 735 HOH B O   1 
HETATM 8766 O  O   . HOH W 9 .   ? 3.398   -23.083 45.677  1.00 46.15  ? 736 HOH B O   1 
HETATM 8767 O  O   . HOH W 9 .   ? -0.230  8.273   48.596  1.00 35.93  ? 737 HOH B O   1 
HETATM 8768 O  O   . HOH W 9 .   ? 3.625   13.749  65.586  1.00 21.86  ? 738 HOH B O   1 
HETATM 8769 O  O   . HOH W 9 .   ? 6.679   7.382   72.569  1.00 28.04  ? 739 HOH B O   1 
HETATM 8770 O  O   . HOH W 9 .   ? -4.046  8.181   54.059  1.00 64.17  ? 740 HOH B O   1 
HETATM 8771 O  O   . HOH W 9 .   ? 11.256  7.517   80.822  1.00 58.92  ? 741 HOH B O   1 
HETATM 8772 O  O   . HOH W 9 .   ? -1.330  9.882   42.113  1.00 51.70  ? 742 HOH B O   1 
HETATM 8773 O  O   . HOH W 9 .   ? 17.321  -18.678 71.619  1.00 65.48  ? 743 HOH B O   1 
HETATM 8774 O  O   . HOH W 9 .   ? 18.184  -12.688 41.542  1.00 42.31  ? 744 HOH B O   1 
HETATM 8775 O  O   . HOH W 9 .   ? 6.340   13.886  55.409  1.00 38.42  ? 745 HOH B O   1 
HETATM 8776 O  O   . HOH W 9 .   ? 29.204  -1.575  44.394  1.00 38.06  ? 746 HOH B O   1 
HETATM 8777 O  O   . HOH W 9 .   ? 14.958  -21.449 58.553  1.00 32.83  ? 747 HOH B O   1 
HETATM 8778 O  O   . HOH W 9 .   ? -6.634  5.653   47.648  1.00 35.42  ? 748 HOH B O   1 
HETATM 8779 O  O   . HOH W 9 .   ? 7.206   -9.543  49.010  1.00 35.33  ? 749 HOH B O   1 
HETATM 8780 O  O   . HOH W 9 .   ? 28.694  -14.071 67.715  1.00 39.88  ? 750 HOH B O   1 
HETATM 8781 O  O   . HOH W 9 .   ? 2.950   2.213   57.077  1.00 35.16  ? 751 HOH B O   1 
HETATM 8782 O  O   . HOH W 9 .   ? 33.952  -2.837  47.941  1.00 54.01  ? 752 HOH B O   1 
HETATM 8783 O  O   . HOH W 9 .   ? 8.464   -2.162  62.521  1.00 26.59  ? 753 HOH B O   1 
HETATM 8784 O  O   . HOH W 9 .   ? 28.458  0.432   62.710  1.00 62.13  ? 754 HOH B O   1 
HETATM 8785 O  O   . HOH W 9 .   ? 9.921   14.320  69.505  1.00 41.65  ? 755 HOH B O   1 
HETATM 8786 O  O   . HOH W 9 .   ? -11.084 10.880  56.200  1.00 50.54  ? 756 HOH B O   1 
HETATM 8787 O  O   . HOH W 9 .   ? -0.414  10.583  46.940  1.00 31.53  ? 757 HOH B O   1 
HETATM 8788 O  O   . HOH W 9 .   ? 1.228   24.277  47.840  1.00 42.35  ? 758 HOH B O   1 
HETATM 8789 O  O   . HOH W 9 .   ? 10.616  10.866  78.419  1.00 43.67  ? 759 HOH B O   1 
HETATM 8790 O  O   . HOH W 9 .   ? 14.083  -9.104  35.859  1.00 51.90  ? 760 HOH B O   1 
HETATM 8791 O  O   . HOH W 9 .   ? -10.911 13.169  48.145  1.00 32.45  ? 761 HOH B O   1 
HETATM 8792 O  O   . HOH W 9 .   ? 21.857  13.667  42.826  1.00 51.90  ? 762 HOH B O   1 
HETATM 8793 O  O   . HOH W 9 .   ? 4.789   -4.874  36.293  1.00 172.31 ? 763 HOH B O   1 
HETATM 8794 O  O   . HOH W 9 .   ? 21.212  -15.741 82.422  1.00 34.17  ? 764 HOH B O   1 
HETATM 8795 O  O   . HOH W 9 .   ? -18.354 -3.893  44.808  1.00 28.73  ? 765 HOH B O   1 
HETATM 8796 O  O   . HOH W 9 .   ? 9.588   18.960  45.972  1.00 35.05  ? 766 HOH B O   1 
HETATM 8797 O  O   . HOH W 9 .   ? -5.194  23.663  50.866  1.00 58.78  ? 767 HOH B O   1 
HETATM 8798 O  O   . HOH W 9 .   ? 24.382  7.963   58.571  1.00 32.67  ? 768 HOH B O   1 
HETATM 8799 O  O   . HOH W 9 .   ? -7.178  -24.175 55.104  1.00 48.01  ? 769 HOH B O   1 
HETATM 8800 O  O   . HOH W 9 .   ? -10.153 4.634   63.282  1.00 26.96  ? 770 HOH B O   1 
HETATM 8801 O  O   . HOH W 9 .   ? 3.539   0.100   66.799  1.00 53.13  ? 771 HOH B O   1 
HETATM 8802 O  O   . HOH W 9 .   ? -6.483  2.723   49.160  1.00 42.95  ? 772 HOH B O   1 
HETATM 8803 O  O   . HOH W 9 .   ? 5.439   0.532   69.055  1.00 54.43  ? 773 HOH B O   1 
HETATM 8804 O  O   . HOH W 9 .   ? 15.976  -3.385  30.970  1.00 63.78  ? 774 HOH B O   1 
HETATM 8805 O  O   . HOH W 9 .   ? 28.696  -11.229 62.625  1.00 35.23  ? 775 HOH B O   1 
HETATM 8806 O  O   . HOH W 9 .   ? 27.576  3.879   53.415  1.00 30.73  ? 776 HOH B O   1 
HETATM 8807 O  O   . HOH W 9 .   ? 11.631  10.962  41.148  1.00 30.24  ? 777 HOH B O   1 
HETATM 8808 O  O   . HOH W 9 .   ? 7.172   -12.297 34.525  1.00 36.10  ? 778 HOH B O   1 
HETATM 8809 O  O   . HOH W 9 .   ? 7.697   -13.122 72.056  1.00 31.85  ? 779 HOH B O   1 
HETATM 8810 O  O   . HOH W 9 .   ? 9.184   0.617   82.770  1.00 33.29  ? 780 HOH B O   1 
HETATM 8811 O  O   . HOH W 9 .   ? 17.938  -21.793 52.377  1.00 48.53  ? 781 HOH B O   1 
HETATM 8812 O  O   . HOH W 9 .   ? -2.057  -2.302  58.371  1.00 47.42  ? 782 HOH B O   1 
HETATM 8813 O  O   . HOH W 9 .   ? 10.063  5.381   39.304  1.00 37.92  ? 783 HOH B O   1 
HETATM 8814 O  O   . HOH W 9 .   ? -12.074 4.900   46.695  1.00 64.80  ? 784 HOH B O   1 
HETATM 8815 O  O   . HOH W 9 .   ? -8.802  5.457   49.414  1.00 37.76  ? 785 HOH B O   1 
HETATM 8816 O  O   . HOH W 9 .   ? 11.345  12.938  43.452  1.00 32.77  ? 786 HOH B O   1 
HETATM 8817 O  O   . HOH W 9 .   ? 18.702  -10.658 26.186  1.00 65.74  ? 787 HOH B O   1 
HETATM 8818 O  O   . HOH W 9 .   ? -12.801 9.778   53.079  1.00 65.91  ? 788 HOH B O   1 
HETATM 8819 O  O   . HOH W 9 .   ? 1.046   8.322   64.628  1.00 46.92  ? 789 HOH B O   1 
HETATM 8820 O  O   . HOH W 9 .   ? 5.292   -14.486 72.081  1.00 34.66  ? 790 HOH B O   1 
HETATM 8821 O  O   . HOH W 9 .   ? 27.357  7.429   47.293  1.00 37.21  ? 791 HOH B O   1 
HETATM 8822 O  O   . HOH W 9 .   ? -4.733  -14.008 39.109  1.00 48.07  ? 792 HOH B O   1 
HETATM 8823 O  O   . HOH W 9 .   ? 12.747  -0.636  33.966  1.00 28.73  ? 793 HOH B O   1 
HETATM 8824 O  O   . HOH W 9 .   ? 17.655  14.647  57.061  1.00 47.41  ? 794 HOH B O   1 
HETATM 8825 O  O   . HOH W 9 .   ? 26.943  1.469   33.887  1.00 48.38  ? 795 HOH B O   1 
HETATM 8826 O  O   . HOH W 9 .   ? 2.773   -12.519 36.565  1.00 44.90  ? 796 HOH B O   1 
HETATM 8827 O  O   . HOH W 9 .   ? 11.342  -2.529  33.491  1.00 37.79  ? 797 HOH B O   1 
HETATM 8828 O  O   . HOH W 9 .   ? -6.290  -4.438  72.678  1.00 43.76  ? 798 HOH B O   1 
HETATM 8829 O  O   . HOH W 9 .   ? -11.496 7.922   47.444  1.00 62.22  ? 799 HOH B O   1 
HETATM 8830 O  O   . HOH W 9 .   ? 1.379   8.711   67.212  1.00 34.06  ? 800 HOH B O   1 
HETATM 8831 O  O   . HOH W 9 .   ? -16.253 -13.876 22.479  1.00 44.22  ? 801 HOH B O   1 
HETATM 8832 O  O   . HOH W 9 .   ? -17.277 -14.627 32.829  1.00 46.68  ? 802 HOH B O   1 
HETATM 8833 O  O   . HOH W 9 .   ? 22.969  -18.561 31.822  1.00 53.13  ? 803 HOH B O   1 
HETATM 8834 O  O   . HOH W 9 .   ? -5.170  -2.354  58.204  1.00 61.02  ? 804 HOH B O   1 
HETATM 8835 O  O   . HOH W 9 .   ? 10.030  5.275   36.204  1.00 36.54  ? 805 HOH B O   1 
HETATM 8836 O  O   . HOH W 9 .   ? -4.252  -16.619 38.762  1.00 43.35  ? 806 HOH B O   1 
HETATM 8837 O  O   . HOH W 9 .   ? 17.583  -15.688 27.548  1.00 40.18  ? 807 HOH B O   1 
HETATM 8838 O  O   . HOH W 9 .   ? 1.235   19.283  27.632  1.00 35.68  ? 808 HOH B O   1 
HETATM 8839 O  O   . HOH W 9 .   ? 5.196   10.832  43.140  1.00 33.27  ? 809 HOH B O   1 
HETATM 8840 O  O   . HOH W 9 .   ? 5.053   -11.112 76.413  1.00 42.50  ? 810 HOH B O   1 
HETATM 8841 O  O   . HOH W 9 .   ? -11.391 29.878  60.122  1.00 42.67  ? 811 HOH B O   1 
HETATM 8842 O  O   . HOH W 9 .   ? 17.590  0.904   34.704  1.00 48.03  ? 812 HOH B O   1 
HETATM 8843 O  O   . HOH W 9 .   ? 28.885  -16.441 51.494  1.00 60.34  ? 813 HOH B O   1 
HETATM 8844 O  O   . HOH W 9 .   ? 15.986  18.756  65.058  1.00 58.07  ? 814 HOH B O   1 
HETATM 8845 O  O   . HOH W 9 .   ? -17.285 -14.517 29.760  1.00 55.62  ? 815 HOH B O   1 
HETATM 8846 O  O   . HOH W 9 .   ? 27.417  6.444   51.699  1.00 54.31  ? 816 HOH B O   1 
HETATM 8847 O  O   . HOH W 9 .   ? 11.965  3.012   84.847  1.00 49.64  ? 817 HOH B O   1 
HETATM 8848 O  O   . HOH W 9 .   ? 14.292  -3.838  28.792  1.00 49.77  ? 818 HOH B O   1 
HETATM 8849 O  O   . HOH W 9 .   ? -11.445 3.689   49.299  1.00 34.81  ? 819 HOH B O   1 
HETATM 8850 O  O   . HOH W 9 .   ? 23.640  6.628   81.250  1.00 36.01  ? 820 HOH B O   1 
HETATM 8851 O  O   . HOH W 9 .   ? 13.934  19.777  46.514  1.00 55.63  ? 821 HOH B O   1 
HETATM 8852 O  O   . HOH W 9 .   ? 11.719  5.064   84.296  1.00 33.37  ? 822 HOH B O   1 
HETATM 8853 O  O   . HOH W 9 .   ? -20.409 -9.000  31.684  1.00 33.79  ? 823 HOH B O   1 
HETATM 8854 O  O   . HOH W 9 .   ? -20.118 -9.749  34.669  1.00 48.59  ? 824 HOH B O   1 
HETATM 8855 O  O   . HOH W 9 .   ? 31.010  -2.388  49.057  1.00 42.08  ? 825 HOH B O   1 
HETATM 8856 O  O   . HOH W 9 .   ? 12.795  19.205  44.531  1.00 46.91  ? 826 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . SER A 4   ? 0.8080 1.3491 0.6145 0.0588  -0.1543 -0.0670 4   SER A N   
2    C CA  . SER A 4   ? 0.8675 1.3821 0.6702 0.0571  -0.1444 -0.0766 4   SER A CA  
3    C C   . SER A 4   ? 0.8973 1.3848 0.7247 0.0479  -0.1315 -0.0631 4   SER A C   
4    O O   . SER A 4   ? 0.8574 1.3482 0.6975 0.0472  -0.1256 -0.0417 4   SER A O   
5    C CB  . SER A 4   ? 0.8209 1.3457 0.5932 0.0711  -0.1349 -0.0713 4   SER A CB  
6    O OG  . SER A 4   ? 0.8071 1.3064 0.5795 0.0697  -0.1236 -0.0767 4   SER A OG  
7    N N   . GLU A 5   ? 0.8576 1.3184 0.6914 0.0417  -0.1276 -0.0763 5   GLU A N   
8    C CA  . GLU A 5   ? 0.9117 1.3476 0.7679 0.0330  -0.1164 -0.0654 5   GLU A CA  
9    C C   . GLU A 5   ? 0.9372 1.3727 0.7878 0.0398  -0.1010 -0.0424 5   GLU A C   
10   O O   . GLU A 5   ? 0.9711 1.4005 0.8396 0.0357  -0.0948 -0.0260 5   GLU A O   
11   C CB  . GLU A 5   ? 0.9039 1.3123 0.7649 0.0269  -0.1151 -0.0828 5   GLU A CB  
12   C CG  . GLU A 5   ? 0.8852 1.2745 0.7765 0.0123  -0.1162 -0.0833 5   GLU A CG  
13   C CD  . GLU A 5   ? 0.8519 1.2115 0.7490 0.0068  -0.1130 -0.0955 5   GLU A CD  
14   O OE1 . GLU A 5   ? 0.8787 1.2205 0.7901 0.0016  -0.1023 -0.0844 5   GLU A OE1 
15   O OE2 . GLU A 5   ? 0.7926 1.1466 0.6803 0.0081  -0.1217 -0.1166 5   GLU A OE2 
16   N N   . LEU A 6   ? 0.8335 1.2766 0.6599 0.0505  -0.0951 -0.0412 6   LEU A N   
17   C CA  . LEU A 6   ? 0.6353 1.0786 0.4566 0.0564  -0.0809 -0.0198 6   LEU A CA  
18   C C   . LEU A 6   ? 0.6420 1.1112 0.4544 0.0642  -0.0814 -0.0004 6   LEU A C   
19   O O   . LEU A 6   ? 0.5691 1.0417 0.3758 0.0697  -0.0706 0.0179  6   LEU A O   
20   C CB  . LEU A 6   ? 0.7088 1.1486 0.5111 0.0636  -0.0731 -0.0270 6   LEU A CB  
21   C CG  . LEU A 6   ? 0.7862 1.2024 0.5941 0.0578  -0.0758 -0.0497 6   LEU A CG  
22   C CD1 . LEU A 6   ? 0.5731 0.9910 0.3588 0.0677  -0.0718 -0.0625 6   LEU A CD1 
23   C CD2 . LEU A 6   ? 0.8321 1.2217 0.6640 0.0481  -0.0677 -0.0415 6   LEU A CD2 
24   N N   . LEU A 7   ? 0.8132 1.3013 0.6252 0.0649  -0.0939 -0.0032 7   LEU A N   
25   C CA  . LEU A 7   ? 0.8654 1.3772 0.6722 0.0720  -0.0957 0.0169  7   LEU A CA  
26   C C   . LEU A 7   ? 0.8848 1.3900 0.7193 0.0648  -0.0985 0.0265  7   LEU A C   
27   O O   . LEU A 7   ? 0.9814 1.4934 0.8260 0.0601  -0.1104 0.0156  7   LEU A O   
28   C CB  . LEU A 7   ? 0.9257 1.4642 0.7120 0.0796  -0.1075 0.0068  7   LEU A CB  
29   C CG  . LEU A 7   ? 1.0392 1.5949 0.8219 0.0875  -0.1062 0.0267  7   LEU A CG  
30   C CD1 . LEU A 7   ? 1.0659 1.6288 0.8680 0.0839  -0.1157 0.0348  7   LEU A CD1 
31   C CD2 . LEU A 7   ? 0.9978 1.5499 0.7781 0.0924  -0.0907 0.0514  7   LEU A CD2 
32   N N   . VAL A 8   ? 0.8000 1.2921 0.6478 0.0639  -0.0878 0.0458  8   VAL A N   
33   C CA  . VAL A 8   ? 0.7099 1.1954 0.5834 0.0593  -0.0888 0.0555  8   VAL A CA  
34   C C   . VAL A 8   ? 0.6450 1.1382 0.5190 0.0670  -0.0844 0.0813  8   VAL A C   
35   O O   . VAL A 8   ? 0.7515 1.2392 0.6171 0.0706  -0.0745 0.0935  8   VAL A O   
36   C CB  . VAL A 8   ? 0.6408 1.0978 0.5336 0.0501  -0.0807 0.0511  8   VAL A CB  
37   C CG1 . VAL A 8   ? 0.6163 1.0708 0.5341 0.0466  -0.0824 0.0586  8   VAL A CG1 
38   C CG2 . VAL A 8   ? 0.5381 0.9841 0.4298 0.0425  -0.0839 0.0276  8   VAL A CG2 
39   N N   . ASN A 9   ? 0.5788 1.0846 0.4645 0.0693  -0.0919 0.0901  9   ASN A N   
40   C CA  . ASN A 9   ? 0.6620 1.1757 0.5494 0.0775  -0.0901 0.1149  9   ASN A CA  
41   C C   . ASN A 9   ? 0.6154 1.1100 0.5297 0.0746  -0.0858 0.1237  9   ASN A C   
42   O O   . ASN A 9   ? 0.6409 1.1371 0.5725 0.0714  -0.0917 0.1166  9   ASN A O   
43   C CB  . ASN A 9   ? 0.6917 1.2351 0.5712 0.0849  -0.1026 0.1196  9   ASN A CB  
44   C CG  . ASN A 9   ? 0.8463 1.3898 0.7352 0.0919  -0.1001 0.1443  9   ASN A CG  
45   O OD1 . ASN A 9   ? 0.9618 1.4914 0.8550 0.0934  -0.0910 0.1611  9   ASN A OD1 
46   N ND2 . ASN A 9   ? 0.9122 1.4709 0.8046 0.0962  -0.1090 0.1464  9   ASN A ND2 
47   N N   . THR A 10  ? 0.5482 1.0261 0.4664 0.0759  -0.0758 0.1385  10  THR A N   
48   C CA  . THR A 10  ? 0.4077 0.8657 0.3493 0.0745  -0.0713 0.1462  10  THR A CA  
49   C C   . THR A 10  ? 0.4166 0.8814 0.3662 0.0831  -0.0748 0.1680  10  THR A C   
50   O O   . THR A 10  ? 0.4853 0.9697 0.4215 0.0898  -0.0792 0.1798  10  THR A O   
51   C CB  . THR A 10  ? 0.5098 0.9440 0.4527 0.0702  -0.0596 0.1477  10  THR A CB  
52   O OG1 . THR A 10  ? 0.5673 1.0024 0.5041 0.0753  -0.0551 0.1682  10  THR A OG1 
53   C CG2 . THR A 10  ? 0.3960 0.8273 0.3244 0.0644  -0.0563 0.1296  10  THR A CG2 
54   N N   . LYS A 11  ? 0.5763 1.0247 0.5480 0.0838  -0.0729 0.1736  11  LYS A N   
55   C CA  . LYS A 11  ? 0.6034 1.0550 0.5865 0.0927  -0.0773 0.1928  11  LYS A CA  
56   C C   . LYS A 11  ? 0.6828 1.1275 0.6610 0.0963  -0.0724 0.2149  11  LYS A C   
57   O O   . LYS A 11  ? 0.7075 1.1522 0.6956 0.1037  -0.0760 0.2335  11  LYS A O   
58   C CB  . LYS A 11  ? 0.5395 0.9747 0.5479 0.0935  -0.0769 0.1900  11  LYS A CB  
59   C CG  . LYS A 11  ? 0.5585 0.9979 0.5757 0.0884  -0.0788 0.1698  11  LYS A CG  
60   C CD  . LYS A 11  ? 0.6239 1.0779 0.6577 0.0952  -0.0869 0.1714  11  LYS A CD  
61   C CE  . LYS A 11  ? 0.6243 1.0836 0.6689 0.0887  -0.0873 0.1525  11  LYS A CE  
62   N NZ  . LYS A 11  ? 0.6998 1.1724 0.7649 0.0958  -0.0933 0.1543  11  LYS A NZ  
63   N N   . SER A 12  ? 0.8027 1.2411 0.7680 0.0913  -0.0642 0.2141  12  SER A N   
64   C CA  . SER A 12  ? 0.8122 1.2482 0.7727 0.0934  -0.0587 0.2358  12  SER A CA  
65   C C   . SER A 12  ? 0.7356 1.1966 0.6690 0.0956  -0.0578 0.2396  12  SER A C   
66   O O   . SER A 12  ? 0.8189 1.2787 0.7485 0.0958  -0.0507 0.2549  12  SER A O   
67   C CB  . SER A 12  ? 0.8606 1.2702 0.8311 0.0865  -0.0491 0.2344  12  SER A CB  
68   O OG  . SER A 12  ? 0.7836 1.1702 0.7774 0.0856  -0.0499 0.2303  12  SER A OG  
69   N N   . GLY A 13  ? 0.5646 1.0438 0.4830 0.0959  -0.0634 0.2220  13  GLY A N   
70   C CA  . GLY A 13  ? 0.5152 1.0105 0.4100 0.0966  -0.0605 0.2151  13  GLY A CA  
71   C C   . GLY A 13  ? 0.5693 1.0676 0.4517 0.0919  -0.0617 0.1900  13  GLY A C   
72   O O   . GLY A 13  ? 0.4442 0.9253 0.3397 0.0855  -0.0614 0.1764  13  GLY A O   
73   N N   . LYS A 14  ? 0.6004 1.1133 0.4617 0.0939  -0.0608 0.1801  14  LYS A N   
74   C CA  . LYS A 14  ? 0.6019 1.1168 0.4507 0.0903  -0.0632 0.1548  14  LYS A CA  
75   C C   . LYS A 14  ? 0.7083 1.2125 0.5498 0.0876  -0.0522 0.1518  14  LYS A C   
76   O O   . LYS A 14  ? 0.7087 1.2120 0.5486 0.0898  -0.0424 0.1673  14  LYS A O   
77   C CB  . LYS A 14  ? 0.5460 1.0811 0.3763 0.0945  -0.0700 0.1407  14  LYS A CB  
78   C CG  . LYS A 14  ? 0.6222 1.1724 0.4551 0.0998  -0.0778 0.1498  14  LYS A CG  
79   C CD  . LYS A 14  ? 0.6266 1.1971 0.4373 0.1058  -0.0807 0.1411  14  LYS A CD  
80   C CE  . LYS A 14  ? 0.7624 1.3488 0.5741 0.1117  -0.0879 0.1522  14  LYS A CE  
81   N NZ  . LYS A 14  ? 0.8829 1.4764 0.6996 0.1093  -0.1021 0.1346  14  LYS A NZ  
82   N N   . VAL A 15  ? 0.7170 1.2083 0.5599 0.0814  -0.0526 0.1299  15  VAL A N   
83   C CA  . VAL A 15  ? 0.6195 1.0977 0.4573 0.0786  -0.0429 0.1218  15  VAL A CA  
84   C C   . VAL A 15  ? 0.6653 1.1499 0.4866 0.0789  -0.0482 0.0958  15  VAL A C   
85   O O   . VAL A 15  ? 0.6670 1.1561 0.4897 0.0769  -0.0593 0.0816  15  VAL A O   
86   C CB  . VAL A 15  ? 0.6162 1.0639 0.4776 0.0701  -0.0368 0.1202  15  VAL A CB  
87   C CG1 . VAL A 15  ? 0.4193 0.8591 0.3008 0.0697  -0.0366 0.1399  15  VAL A CG1 
88   C CG2 . VAL A 15  ? 0.4180 0.8524 0.2875 0.0631  -0.0421 0.0973  15  VAL A CG2 
89   N N   . MET A 16  ? 0.7809 1.2667 0.5873 0.0819  -0.0409 0.0896  16  MET A N   
90   C CA  . MET A 16  ? 0.8393 1.3252 0.6316 0.0825  -0.0451 0.0632  16  MET A CA  
91   C C   . MET A 16  ? 0.8932 1.3565 0.6913 0.0786  -0.0357 0.0550  16  MET A C   
92   O O   . MET A 16  ? 0.8983 1.3624 0.6943 0.0814  -0.0245 0.0682  16  MET A O   
93   C CB  . MET A 16  ? 0.7391 1.2494 0.5069 0.0928  -0.0462 0.0587  16  MET A CB  
94   C CG  . MET A 16  ? 0.8139 1.3245 0.5684 0.0940  -0.0548 0.0287  16  MET A CG  
95   S SD  . MET A 16  ? 1.1876 1.7215 0.9258 0.1024  -0.0644 0.0191  16  MET A SD  
96   C CE  . MET A 16  ? 1.2228 1.7537 0.9704 0.0942  -0.0832 0.0005  16  MET A CE  
97   N N   . GLY A 17  ? 0.7918 1.2361 0.5980 0.0719  -0.0405 0.0341  17  GLY A N   
98   C CA  . GLY A 17  ? 0.5932 1.0139 0.4071 0.0677  -0.0333 0.0254  17  GLY A CA  
99   C C   . GLY A 17  ? 0.6273 1.0504 0.4226 0.0737  -0.0333 0.0057  17  GLY A C   
100  O O   . GLY A 17  ? 0.6812 1.1279 0.4544 0.0836  -0.0338 0.0040  17  GLY A O   
101  N N   . THR A 18  ? 0.6308 1.0300 0.4350 0.0685  -0.0329 -0.0094 18  THR A N   
102  C CA  . THR A 18  ? 0.6546 1.0503 0.4449 0.0745  -0.0319 -0.0281 18  THR A CA  
103  C C   . THR A 18  ? 0.4778 0.8465 0.2817 0.0661  -0.0384 -0.0469 18  THR A C   
104  O O   . THR A 18  ? 0.4575 0.8077 0.2822 0.0563  -0.0368 -0.0400 18  THR A O   
105  C CB  . THR A 18  ? 0.7104 1.1055 0.4984 0.0796  -0.0177 -0.0177 18  THR A CB  
106  O OG1 . THR A 18  ? 0.7377 1.1225 0.5184 0.0843  -0.0168 -0.0375 18  THR A OG1 
107  C CG2 . THR A 18  ? 0.5415 0.9183 0.3524 0.0710  -0.0103 -0.0008 18  THR A CG2 
108  N N   . ARG A 19  ? 0.5005 0.8672 0.2926 0.0702  -0.0460 -0.0703 19  ARG A N   
109  C CA  . ARG A 19  ? 0.6275 0.9663 0.4326 0.0628  -0.0517 -0.0880 19  ARG A CA  
110  C C   . ARG A 19  ? 0.7524 1.0729 0.5613 0.0651  -0.0408 -0.0869 19  ARG A C   
111  O O   . ARG A 19  ? 0.7594 1.0889 0.5520 0.0764  -0.0352 -0.0917 19  ARG A O   
112  C CB  . ARG A 19  ? 0.7097 1.0508 0.5021 0.0669  -0.0649 -0.1145 19  ARG A CB  
113  C CG  . ARG A 19  ? 0.7707 1.0825 0.5712 0.0639  -0.0688 -0.1345 19  ARG A CG  
114  C CD  . ARG A 19  ? 0.9235 1.2312 0.7241 0.0605  -0.0862 -0.1585 19  ARG A CD  
115  N NE  . ARG A 19  ? 0.9866 1.2850 0.8117 0.0448  -0.0935 -0.1532 19  ARG A NE  
116  C CZ  . ARG A 19  ? 0.9498 1.2341 0.7879 0.0358  -0.1073 -0.1705 19  ARG A CZ  
117  N NH1 . ARG A 19  ? 0.9350 1.2098 0.7635 0.0413  -0.1167 -0.1961 19  ARG A NH1 
118  N NH2 . ARG A 19  ? 0.8765 1.1564 0.7385 0.0215  -0.1119 -0.1624 19  ARG A NH2 
119  N N   . VAL A 20  ? 0.7416 1.0390 0.5715 0.0552  -0.0378 -0.0805 20  VAL A N   
120  C CA  . VAL A 20  ? 0.6434 0.9231 0.4795 0.0562  -0.0282 -0.0775 20  VAL A CA  
121  C C   . VAL A 20  ? 0.6695 0.9219 0.5152 0.0514  -0.0347 -0.0949 20  VAL A C   
122  O O   . VAL A 20  ? 0.7253 0.9665 0.5856 0.0405  -0.0426 -0.0976 20  VAL A O   
123  C CB  . VAL A 20  ? 0.7097 0.9846 0.5620 0.0494  -0.0198 -0.0556 20  VAL A CB  
124  C CG1 . VAL A 20  ? 0.7519 1.0069 0.6124 0.0493  -0.0122 -0.0546 20  VAL A CG1 
125  C CG2 . VAL A 20  ? 0.6953 0.9935 0.5398 0.0548  -0.0128 -0.0378 20  VAL A CG2 
126  N N   . PRO A 21  ? 0.6712 0.9130 0.5106 0.0592  -0.0319 -0.1062 21  PRO A N   
127  C CA  . PRO A 21  ? 0.7169 0.9292 0.5682 0.0545  -0.0374 -0.1197 21  PRO A CA  
128  C C   . PRO A 21  ? 0.6645 0.8589 0.5369 0.0436  -0.0323 -0.1043 21  PRO A C   
129  O O   . PRO A 21  ? 0.6471 0.8484 0.5221 0.0440  -0.0222 -0.0866 21  PRO A O   
130  C CB  . PRO A 21  ? 0.7634 0.9720 0.6026 0.0679  -0.0326 -0.1307 21  PRO A CB  
131  C CG  . PRO A 21  ? 0.7405 0.9777 0.5650 0.0776  -0.0220 -0.1183 21  PRO A CG  
132  C CD  . PRO A 21  ? 0.6965 0.9554 0.5159 0.0739  -0.0258 -0.1104 21  PRO A CD  
133  N N   . VAL A 22  ? 0.6254 0.7969 0.5133 0.0340  -0.0398 -0.1112 22  VAL A N   
134  C CA  . VAL A 22  ? 0.6766 0.8301 0.5832 0.0251  -0.0350 -0.0984 22  VAL A CA  
135  C C   . VAL A 22  ? 0.8362 0.9623 0.7560 0.0185  -0.0432 -0.1099 22  VAL A C   
136  O O   . VAL A 22  ? 0.9068 1.0294 0.8361 0.0092  -0.0532 -0.1164 22  VAL A O   
137  C CB  . VAL A 22  ? 0.4403 0.6050 0.3578 0.0155  -0.0331 -0.0815 22  VAL A CB  
138  C CG1 . VAL A 22  ? 0.4491 0.6231 0.3700 0.0087  -0.0441 -0.0885 22  VAL A CG1 
139  C CG2 . VAL A 22  ? 0.4260 0.5732 0.3615 0.0070  -0.0286 -0.0698 22  VAL A CG2 
140  N N   . LEU A 23  ? 0.8814 0.9881 0.8034 0.0230  -0.0391 -0.1113 23  LEU A N   
141  C CA  . LEU A 23  ? 0.8460 0.9232 0.7831 0.0169  -0.0454 -0.1178 23  LEU A CA  
142  C C   . LEU A 23  ? 0.9442 1.0132 0.8842 0.0127  -0.0599 -0.1376 23  LEU A C   
143  O O   . LEU A 23  ? 0.9955 1.0576 0.9526 -0.0009 -0.0671 -0.1356 23  LEU A O   
144  C CB  . LEU A 23  ? 0.7249 0.7940 0.6814 0.0040  -0.0420 -0.0995 23  LEU A CB  
145  C CG  . LEU A 23  ? 0.7090 0.7874 0.6647 0.0061  -0.0294 -0.0801 23  LEU A CG  
146  C CD1 . LEU A 23  ? 0.5312 0.6022 0.5050 -0.0060 -0.0275 -0.0649 23  LEU A CD1 
147  C CD2 . LEU A 23  ? 0.7853 0.8550 0.7334 0.0178  -0.0230 -0.0813 23  LEU A CD2 
148  N N   . SER A 24  ? 0.9151 0.9873 0.8383 0.0250  -0.0643 -0.1569 24  SER A N   
149  C CA  . SER A 24  ? 0.9517 1.0156 0.8743 0.0242  -0.0793 -0.1803 24  SER A CA  
150  C C   . SER A 24  ? 0.8782 0.9623 0.8019 0.0155  -0.0873 -0.1813 24  SER A C   
151  O O   . SER A 24  ? 0.8843 0.9620 0.8114 0.0118  -0.1016 -0.1999 24  SER A O   
152  C CB  . SER A 24  ? 0.9898 1.0178 0.9336 0.0155  -0.0879 -0.1870 24  SER A CB  
153  O OG  . SER A 24  ? 0.9231 0.9317 0.8698 0.0219  -0.0802 -0.1813 24  SER A OG  
154  N N   . SER A 25  ? 0.7732 0.8807 0.6953 0.0122  -0.0794 -0.1624 25  SER A N   
155  C CA  . SER A 25  ? 0.6349 0.7654 0.5560 0.0067  -0.0861 -0.1622 25  SER A CA  
156  C C   . SER A 25  ? 0.6633 0.8231 0.5656 0.0164  -0.0761 -0.1503 25  SER A C   
157  O O   . SER A 25  ? 0.6777 0.8415 0.5651 0.0285  -0.0669 -0.1487 25  SER A O   
158  C CB  . SER A 25  ? 0.6658 0.7928 0.6122 -0.0105 -0.0884 -0.1488 25  SER A CB  
159  O OG  . SER A 25  ? 0.5685 0.7207 0.5144 -0.0145 -0.0938 -0.1466 25  SER A OG  
160  N N   . HIS A 26  ? 0.6949 0.8762 0.5990 0.0112  -0.0782 -0.1412 26  HIS A N   
161  C CA  . HIS A 26  ? 0.6749 0.8835 0.5633 0.0194  -0.0703 -0.1287 26  HIS A CA  
162  C C   . HIS A 26  ? 0.6250 0.8446 0.5278 0.0100  -0.0679 -0.1096 26  HIS A C   
163  O O   . HIS A 26  ? 0.6533 0.8672 0.5748 -0.0019 -0.0748 -0.1099 26  HIS A O   
164  C CB  . HIS A 26  ? 0.6694 0.9002 0.5361 0.0290  -0.0781 -0.1428 26  HIS A CB  
165  C CG  . HIS A 26  ? 0.8059 1.0277 0.6579 0.0394  -0.0825 -0.1655 26  HIS A CG  
166  N ND1 . HIS A 26  ? 0.8722 1.1059 0.7029 0.0546  -0.0739 -0.1668 26  HIS A ND1 
167  C CD2 . HIS A 26  ? 0.7703 0.9727 0.6269 0.0373  -0.0948 -0.1883 26  HIS A CD2 
168  C CE1 . HIS A 26  ? 0.7506 0.9734 0.5720 0.0627  -0.0803 -0.1902 26  HIS A CE1 
169  N NE2 . HIS A 26  ? 0.7711 0.9730 0.6081 0.0524  -0.0935 -0.2040 26  HIS A NE2 
170  N N   . ILE A 27  ? 0.4982 0.7337 0.3937 0.0154  -0.0579 -0.0927 27  ILE A N   
171  C CA  . ILE A 27  ? 0.5844 0.8349 0.4892 0.0103  -0.0566 -0.0765 27  ILE A CA  
172  C C   . ILE A 27  ? 0.5827 0.8581 0.4697 0.0203  -0.0533 -0.0683 27  ILE A C   
173  O O   . ILE A 27  ? 0.5838 0.8658 0.4522 0.0306  -0.0503 -0.0733 27  ILE A O   
174  C CB  . ILE A 27  ? 0.7044 0.9434 0.6262 0.0040  -0.0472 -0.0598 27  ILE A CB  
175  C CG1 . ILE A 27  ? 0.8790 1.1060 0.7955 0.0099  -0.0361 -0.0544 27  ILE A CG1 
176  C CG2 . ILE A 27  ? 0.8112 1.0335 0.7534 -0.0079 -0.0518 -0.0635 27  ILE A CG2 
177  C CD1 . ILE A 27  ? 0.9484 1.1910 0.8496 0.0202  -0.0287 -0.0459 27  ILE A CD1 
178  N N   . SER A 28  ? 0.5791 0.8694 0.4727 0.0177  -0.0538 -0.0550 28  SER A N   
179  C CA  . SER A 28  ? 0.5179 0.8312 0.3981 0.0261  -0.0511 -0.0433 28  SER A CA  
180  C C   . SER A 28  ? 0.5048 0.8147 0.3910 0.0273  -0.0389 -0.0236 28  SER A C   
181  O O   . SER A 28  ? 0.5110 0.8093 0.4148 0.0205  -0.0359 -0.0161 28  SER A O   
182  C CB  . SER A 28  ? 0.4293 0.7617 0.3138 0.0236  -0.0605 -0.0406 28  SER A CB  
183  O OG  . SER A 28  ? 0.5726 0.9037 0.4604 0.0183  -0.0731 -0.0590 28  SER A OG  
184  N N   . ALA A 29  ? 0.4618 0.7830 0.3337 0.0362  -0.0323 -0.0154 29  ALA A N   
185  C CA  . ALA A 29  ? 0.4210 0.7407 0.2986 0.0375  -0.0220 0.0033  29  ALA A CA  
186  C C   . ALA A 29  ? 0.4227 0.7646 0.2932 0.0430  -0.0218 0.0185  29  ALA A C   
187  O O   . ALA A 29  ? 0.5205 0.8812 0.3732 0.0501  -0.0244 0.0156  29  ALA A O   
188  C CB  . ALA A 29  ? 0.3933 0.7055 0.2640 0.0422  -0.0131 0.0019  29  ALA A CB  
189  N N   . PHE A 30  ? 0.4219 0.7620 0.3062 0.0405  -0.0191 0.0347  30  PHE A N   
190  C CA  . PHE A 30  ? 0.4753 0.8320 0.3566 0.0455  -0.0176 0.0530  30  PHE A CA  
191  C C   . PHE A 30  ? 0.5901 0.9368 0.4808 0.0451  -0.0078 0.0678  30  PHE A C   
192  O O   . PHE A 30  ? 0.6621 0.9951 0.5700 0.0406  -0.0067 0.0732  30  PHE A O   
193  C CB  . PHE A 30  ? 0.5374 0.9008 0.4288 0.0435  -0.0253 0.0582  30  PHE A CB  
194  C CG  . PHE A 30  ? 0.6251 0.9992 0.5100 0.0427  -0.0359 0.0433  30  PHE A CG  
195  C CD1 . PHE A 30  ? 0.6090 0.9705 0.5045 0.0351  -0.0405 0.0284  30  PHE A CD1 
196  C CD2 . PHE A 30  ? 0.5515 0.9490 0.4196 0.0495  -0.0417 0.0442  30  PHE A CD2 
197  C CE1 . PHE A 30  ? 0.4927 0.8636 0.3848 0.0331  -0.0515 0.0140  30  PHE A CE1 
198  C CE2 . PHE A 30  ? 0.5370 0.9447 0.3994 0.0487  -0.0529 0.0285  30  PHE A CE2 
199  C CZ  . PHE A 30  ? 0.5299 0.9234 0.4054 0.0399  -0.0582 0.0130  30  PHE A CZ  
200  N N   . LEU A 31  ? 0.5604 0.9158 0.4404 0.0502  -0.0011 0.0738  31  LEU A N   
201  C CA  . LEU A 31  ? 0.3679 0.7146 0.2572 0.0492  0.0079  0.0852  31  LEU A CA  
202  C C   . LEU A 31  ? 0.4431 0.8026 0.3350 0.0519  0.0111  0.1079  31  LEU A C   
203  O O   . LEU A 31  ? 0.6132 0.9945 0.4911 0.0578  0.0106  0.1147  31  LEU A O   
204  C CB  . LEU A 31  ? 0.3722 0.7194 0.2514 0.0524  0.0141  0.0762  31  LEU A CB  
205  C CG  . LEU A 31  ? 0.4748 0.8074 0.3518 0.0500  0.0102  0.0542  31  LEU A CG  
206  C CD1 . LEU A 31  ? 0.3789 0.7108 0.2470 0.0546  0.0159  0.0453  31  LEU A CD1 
207  C CD2 . LEU A 31  ? 0.4606 0.7705 0.3564 0.0420  0.0089  0.0525  31  LEU A CD2 
208  N N   . GLY A 32  ? 0.4080 0.7539 0.3183 0.0479  0.0141  0.1195  32  GLY A N   
209  C CA  . GLY A 32  ? 0.3766 0.7295 0.2947 0.0489  0.0170  0.1421  32  GLY A CA  
210  C C   . GLY A 32  ? 0.5166 0.8783 0.4361 0.0513  0.0105  0.1538  32  GLY A C   
211  O O   . GLY A 32  ? 0.6395 1.0178 0.5543 0.0551  0.0121  0.1714  32  GLY A O   
212  N N   . ILE A 33  ? 0.5154 0.8679 0.4421 0.0496  0.0034  0.1455  33  ILE A N   
213  C CA  . ILE A 33  ? 0.4318 0.7922 0.3625 0.0526  -0.0033 0.1563  33  ILE A CA  
214  C C   . ILE A 33  ? 0.4324 0.7792 0.3836 0.0513  -0.0023 0.1732  33  ILE A C   
215  O O   . ILE A 33  ? 0.4538 0.7804 0.4194 0.0472  -0.0009 0.1674  33  ILE A O   
216  C CB  . ILE A 33  ? 0.4001 0.7578 0.3330 0.0514  -0.0110 0.1411  33  ILE A CB  
217  C CG1 . ILE A 33  ? 0.3676 0.7323 0.2843 0.0506  -0.0125 0.1215  33  ILE A CG1 
218  C CG2 . ILE A 33  ? 0.4049 0.7759 0.3395 0.0560  -0.0185 0.1513  33  ILE A CG2 
219  C CD1 . ILE A 33  ? 0.4121 0.7822 0.3293 0.0496  -0.0218 0.1092  33  ILE A CD1 
220  N N   . PRO A 34  ? 0.4680 0.8247 0.4214 0.0550  -0.0035 0.1940  34  PRO A N   
221  C CA  . PRO A 34  ? 0.5023 0.8430 0.4775 0.0536  -0.0037 0.2096  34  PRO A CA  
222  C C   . PRO A 34  ? 0.3864 0.7176 0.3742 0.0559  -0.0117 0.2064  34  PRO A C   
223  O O   . PRO A 34  ? 0.5488 0.8944 0.5299 0.0607  -0.0176 0.2079  34  PRO A O   
224  C CB  . PRO A 34  ? 0.5943 0.9513 0.5659 0.0568  -0.0019 0.2345  34  PRO A CB  
225  C CG  . PRO A 34  ? 0.5850 0.9674 0.5343 0.0628  -0.0055 0.2311  34  PRO A CG  
226  C CD  . PRO A 34  ? 0.5253 0.9080 0.4614 0.0610  -0.0052 0.2045  34  PRO A CD  
227  N N   . PHE A 35  ? 0.3923 0.7010 0.3983 0.0532  -0.0120 0.2014  35  PHE A N   
228  C CA  . PHE A 35  ? 0.5474 0.8470 0.5671 0.0567  -0.0187 0.1977  35  PHE A CA  
229  C C   . PHE A 35  ? 0.5728 0.8570 0.6129 0.0588  -0.0214 0.2136  35  PHE A C   
230  O O   . PHE A 35  ? 0.5548 0.8277 0.6088 0.0626  -0.0265 0.2094  35  PHE A O   
231  C CB  . PHE A 35  ? 0.4467 0.7342 0.4703 0.0536  -0.0178 0.1765  35  PHE A CB  
232  C CG  . PHE A 35  ? 0.3821 0.6513 0.4136 0.0488  -0.0128 0.1727  35  PHE A CG  
233  C CD1 . PHE A 35  ? 0.4047 0.6554 0.4552 0.0496  -0.0147 0.1783  35  PHE A CD1 
234  C CD2 . PHE A 35  ? 0.3991 0.6692 0.4196 0.0439  -0.0069 0.1626  35  PHE A CD2 
235  C CE1 . PHE A 35  ? 0.3326 0.5676 0.3905 0.0450  -0.0113 0.1737  35  PHE A CE1 
236  C CE2 . PHE A 35  ? 0.3216 0.5767 0.3496 0.0399  -0.0030 0.1591  35  PHE A CE2 
237  C CZ  . PHE A 35  ? 0.3234 0.5618 0.3698 0.0402  -0.0053 0.1645  35  PHE A CZ  
238  N N   . ALA A 36  ? 0.5477 0.8310 0.5909 0.0567  -0.0183 0.2315  36  ALA A N   
239  C CA  . ALA A 36  ? 0.5060 0.7728 0.5709 0.0576  -0.0217 0.2479  36  ALA A CA  
240  C C   . ALA A 36  ? 0.4547 0.7304 0.5188 0.0547  -0.0174 0.2712  36  ALA A C   
241  O O   . ALA A 36  ? 0.5053 0.7932 0.5567 0.0505  -0.0101 0.2702  36  ALA A O   
242  C CB  . ALA A 36  ? 0.5584 0.7992 0.6409 0.0541  -0.0220 0.2364  36  ALA A CB  
243  N N   . GLU A 37  ? 0.5001 0.7702 0.5789 0.0574  -0.0219 0.2927  37  GLU A N   
244  C CA  . GLU A 37  ? 0.5513 0.8295 0.6334 0.0540  -0.0177 0.3185  37  GLU A CA  
245  C C   . GLU A 37  ? 0.6717 0.9375 0.7659 0.0448  -0.0121 0.3174  37  GLU A C   
246  O O   . GLU A 37  ? 0.7035 0.9457 0.8128 0.0421  -0.0151 0.3030  37  GLU A O   
247  C CB  . GLU A 37  ? 0.4752 0.7451 0.5752 0.0579  -0.0244 0.3428  37  GLU A CB  
248  C CG  . GLU A 37  ? 0.5504 0.8346 0.6382 0.0675  -0.0301 0.3423  37  GLU A CG  
249  C CD  . GLU A 37  ? 0.7242 1.0408 0.7900 0.0701  -0.0264 0.3593  37  GLU A CD  
250  O OE1 . GLU A 37  ? 0.8104 1.1350 0.8766 0.0651  -0.0195 0.3768  37  GLU A OE1 
251  O OE2 . GLU A 37  ? 0.9540 1.2904 1.0003 0.0764  -0.0291 0.3502  37  GLU A OE2 
252  N N   . PRO A 38  ? 0.6938 0.9777 0.7807 0.0405  -0.0040 0.3310  38  PRO A N   
253  C CA  . PRO A 38  ? 0.6383 0.9144 0.7380 0.0316  0.0015  0.3310  38  PRO A CA  
254  C C   . PRO A 38  ? 0.6164 0.8634 0.7483 0.0269  -0.0049 0.3393  38  PRO A C   
255  O O   . PRO A 38  ? 0.7303 0.9727 0.8769 0.0275  -0.0090 0.3625  38  PRO A O   
256  C CB  . PRO A 38  ? 0.5806 0.8850 0.6708 0.0299  0.0103  0.3531  38  PRO A CB  
257  C CG  . PRO A 38  ? 0.5563 0.8851 0.6217 0.0387  0.0100  0.3579  38  PRO A CG  
258  C CD  . PRO A 38  ? 0.5202 0.8369 0.5821 0.0448  0.0010  0.3408  38  PRO A CD  
259  N N   . PRO A 39  ? 0.5086 0.7351 0.6522 0.0226  -0.0068 0.3207  39  PRO A N   
260  C CA  . PRO A 39  ? 0.5886 0.7858 0.7635 0.0180  -0.0142 0.3245  39  PRO A CA  
261  C C   . PRO A 39  ? 0.6194 0.8183 0.8134 0.0076  -0.0103 0.3441  39  PRO A C   
262  O O   . PRO A 39  ? 0.5661 0.7593 0.7687 0.0007  -0.0084 0.3341  39  PRO A O   
263  C CB  . PRO A 39  ? 0.4164 0.5968 0.5905 0.0187  -0.0171 0.2939  39  PRO A CB  
264  C CG  . PRO A 39  ? 0.4035 0.6050 0.5496 0.0199  -0.0089 0.2784  39  PRO A CG  
265  C CD  . PRO A 39  ? 0.4401 0.6703 0.5684 0.0216  -0.0022 0.2953  39  PRO A CD  
266  N N   . VAL A 40  ? 0.6843 0.8927 0.8865 0.0062  -0.0093 0.3742  40  VAL A N   
267  C CA  . VAL A 40  ? 0.6551 0.8751 0.8723 -0.0036 -0.0030 0.3980  40  VAL A CA  
268  C C   . VAL A 40  ? 0.4993 0.7036 0.7460 -0.0074 -0.0097 0.4263  40  VAL A C   
269  O O   . VAL A 40  ? 0.5785 0.7782 0.8234 -0.0001 -0.0151 0.4362  40  VAL A O   
270  C CB  . VAL A 40  ? 0.5993 0.8589 0.7903 -0.0013 0.0091  0.4101  40  VAL A CB  
271  C CG1 . VAL A 40  ? 0.6288 0.9012 0.7987 -0.0006 0.0161  0.3848  40  VAL A CG1 
272  C CG2 . VAL A 40  ? 0.5446 0.8176 0.7138 0.0094  0.0076  0.4166  40  VAL A CG2 
273  N N   . GLY A 41  ? 0.5078 0.7045 0.7832 -0.0191 -0.0096 0.4401  41  GLY A N   
274  C CA  . GLY A 41  ? 0.6356 0.8188 0.9414 -0.0245 -0.0154 0.4633  41  GLY A CA  
275  C C   . GLY A 41  ? 0.6550 0.7962 0.9847 -0.0225 -0.0304 0.4589  41  GLY A C   
276  O O   . GLY A 41  ? 0.7776 0.8950 1.1216 -0.0260 -0.0370 0.4373  41  GLY A O   
277  N N   . ASN A 42  ? 0.5847 0.7191 0.9167 -0.0156 -0.0358 0.4683  42  ASN A N   
278  C CA  . ASN A 42  ? 0.7506 0.8468 1.1013 -0.0097 -0.0502 0.4605  42  ASN A CA  
279  C C   . ASN A 42  ? 0.8371 0.9238 1.1699 -0.0006 -0.0535 0.4249  42  ASN A C   
280  O O   . ASN A 42  ? 0.8568 0.9120 1.2064 0.0028  -0.0646 0.4073  42  ASN A O   
281  C CB  . ASN A 42  ? 0.8593 0.9575 1.2064 -0.0012 -0.0532 0.4731  42  ASN A CB  
282  C CG  . ASN A 42  ? 1.0613 1.1789 1.4172 -0.0086 -0.0469 0.4989  42  ASN A CG  
283  O OD1 . ASN A 42  ? 1.0893 1.2365 1.4361 -0.0152 -0.0357 0.5062  42  ASN A OD1 
284  N ND2 . ASN A 42  ? 1.1825 1.2849 1.5559 -0.0063 -0.0541 0.5128  42  ASN A ND2 
285  N N   . MET A 43  ? 0.8563 0.9712 1.1552 0.0034  -0.0439 0.4106  43  MET A N   
286  C CA  . MET A 43  ? 0.7961 0.9087 1.0742 0.0124  -0.0452 0.3772  43  MET A CA  
287  C C   . MET A 43  ? 0.7213 0.8334 0.9946 0.0066  -0.0415 0.3524  43  MET A C   
288  O O   . MET A 43  ? 0.6743 0.7903 0.9270 0.0128  -0.0401 0.3267  43  MET A O   
289  C CB  . MET A 43  ? 0.8205 0.9630 1.0651 0.0210  -0.0386 0.3772  43  MET A CB  
290  C CG  . MET A 43  ? 0.9712 1.1164 1.2164 0.0293  -0.0433 0.3980  43  MET A CG  
291  S SD  . MET A 43  ? 1.1187 1.2866 1.3298 0.0425  -0.0421 0.3820  43  MET A SD  
292  C CE  . MET A 43  ? 1.1190 1.3289 1.3000 0.0391  -0.0291 0.3934  43  MET A CE  
293  N N   . ARG A 44  ? 0.7349 0.8437 1.0271 -0.0051 -0.0400 0.3603  44  ARG A N   
294  C CA  . ARG A 44  ? 0.7463 0.8512 1.0376 -0.0096 -0.0389 0.3362  44  ARG A CA  
295  C C   . ARG A 44  ? 0.7651 0.8359 1.0734 -0.0063 -0.0515 0.3144  44  ARG A C   
296  O O   . ARG A 44  ? 0.7286 0.7758 1.0606 -0.0053 -0.0614 0.3236  44  ARG A O   
297  C CB  . ARG A 44  ? 0.7124 0.8270 1.0201 -0.0229 -0.0338 0.3513  44  ARG A CB  
298  C CG  . ARG A 44  ? 0.7405 0.8532 1.0477 -0.0274 -0.0330 0.3276  44  ARG A CG  
299  C CD  . ARG A 44  ? 0.7829 0.9004 1.1155 -0.0411 -0.0313 0.3423  44  ARG A CD  
300  N NE  . ARG A 44  ? 0.8676 1.0198 1.1903 -0.0453 -0.0179 0.3630  44  ARG A NE  
301  C CZ  . ARG A 44  ? 0.7301 0.8938 1.0747 -0.0569 -0.0142 0.3801  44  ARG A CZ  
302  N NH1 . ARG A 44  ? 0.6297 0.7711 1.0084 -0.0666 -0.0240 0.3793  44  ARG A NH1 
303  N NH2 . ARG A 44  ? 0.6386 0.8369 0.9721 -0.0587 -0.0011 0.3980  44  ARG A NH2 
304  N N   . PHE A 45  ? 0.7211 0.7900 1.0163 -0.0035 -0.0512 0.2854  45  PHE A N   
305  C CA  . PHE A 45  ? 0.7271 0.7704 1.0294 0.0027  -0.0613 0.2595  45  PHE A CA  
306  C C   . PHE A 45  ? 0.7102 0.7458 1.0050 0.0159  -0.0660 0.2529  45  PHE A C   
307  O O   . PHE A 45  ? 0.7691 0.7850 1.0698 0.0230  -0.0742 0.2320  45  PHE A O   
308  C CB  . PHE A 45  ? 0.8545 0.8687 1.1920 -0.0038 -0.0732 0.2604  45  PHE A CB  
309  C CG  . PHE A 45  ? 0.9529 0.9731 1.3078 -0.0185 -0.0707 0.2742  45  PHE A CG  
310  C CD1 . PHE A 45  ? 0.9572 0.9781 1.3129 -0.0236 -0.0710 0.2558  45  PHE A CD1 
311  C CD2 . PHE A 45  ? 0.9703 0.9948 1.3441 -0.0270 -0.0691 0.3064  45  PHE A CD2 
312  C CE1 . PHE A 45  ? 0.8620 0.8900 1.2361 -0.0369 -0.0692 0.2683  45  PHE A CE1 
313  C CE2 . PHE A 45  ? 0.9925 1.0245 1.3853 -0.0408 -0.0666 0.3199  45  PHE A CE2 
314  C CZ  . PHE A 45  ? 0.9378 0.9718 1.3313 -0.0457 -0.0668 0.3003  45  PHE A CZ  
315  N N   . ARG A 46  ? 0.7497 0.8019 1.0318 0.0203  -0.0614 0.2695  46  ARG A N   
316  C CA  . ARG A 46  ? 0.6979 0.7434 0.9793 0.0321  -0.0670 0.2700  46  ARG A CA  
317  C C   . ARG A 46  ? 0.6760 0.7376 0.9298 0.0414  -0.0625 0.2493  46  ARG A C   
318  O O   . ARG A 46  ? 0.6332 0.7147 0.8657 0.0381  -0.0537 0.2410  46  ARG A O   
319  C CB  . ARG A 46  ? 0.7661 0.8230 1.0499 0.0314  -0.0651 0.3019  46  ARG A CB  
320  C CG  . ARG A 46  ? 0.9497 0.9940 1.2429 0.0422  -0.0735 0.3092  46  ARG A CG  
321  C CD  . ARG A 46  ? 1.0854 1.1178 1.4040 0.0370  -0.0781 0.3408  46  ARG A CD  
322  N NE  . ARG A 46  ? 1.1974 1.2054 1.5344 0.0473  -0.0898 0.3429  46  ARG A NE  
323  C CZ  . ARG A 46  ? 1.2705 1.2869 1.6033 0.0560  -0.0913 0.3602  46  ARG A CZ  
324  N NH1 . ARG A 46  ? 1.3044 1.2969 1.6556 0.0665  -0.1025 0.3605  46  ARG A NH1 
325  N NH2 . ARG A 46  ? 1.2716 1.3207 1.5815 0.0551  -0.0822 0.3765  46  ARG A NH2 
326  N N   . ARG A 47  ? 0.7043 0.7568 0.9604 0.0531  -0.0689 0.2408  47  ARG A N   
327  C CA  . ARG A 47  ? 0.6698 0.7411 0.9026 0.0613  -0.0646 0.2259  47  ARG A CA  
328  C C   . ARG A 47  ? 0.6987 0.7984 0.9118 0.0592  -0.0569 0.2422  47  ARG A C   
329  O O   . ARG A 47  ? 0.7704 0.8734 0.9901 0.0578  -0.0579 0.2669  47  ARG A O   
330  C CB  . ARG A 47  ? 0.6167 0.6771 0.8577 0.0750  -0.0726 0.2180  47  ARG A CB  
331  C CG  . ARG A 47  ? 0.6956 0.7319 0.9505 0.0798  -0.0796 0.1961  47  ARG A CG  
332  C CD  . ARG A 47  ? 0.7610 0.7909 1.0221 0.0951  -0.0863 0.1872  47  ARG A CD  
333  N NE  . ARG A 47  ? 0.8105 0.8086 1.0988 0.0999  -0.0979 0.1866  47  ARG A NE  
334  C CZ  . ARG A 47  ? 0.8874 0.8672 1.1840 0.1054  -0.1037 0.1632  47  ARG A CZ  
335  N NH1 . ARG A 47  ? 0.8813 0.8303 1.2036 0.1101  -0.1156 0.1622  47  ARG A NH1 
336  N NH2 . ARG A 47  ? 0.9072 0.8994 1.1862 0.1065  -0.0980 0.1407  47  ARG A NH2 
337  N N   . PRO A 48  ? 0.5997 0.7205 0.7890 0.0590  -0.0496 0.2296  48  PRO A N   
338  C CA  . PRO A 48  ? 0.5847 0.7324 0.7546 0.0577  -0.0435 0.2425  48  PRO A CA  
339  C C   . PRO A 48  ? 0.6709 0.8260 0.8402 0.0674  -0.0486 0.2515  48  PRO A C   
340  O O   . PRO A 48  ? 0.6843 0.8296 0.8620 0.0761  -0.0546 0.2409  48  PRO A O   
341  C CB  . PRO A 48  ? 0.3924 0.5552 0.5404 0.0560  -0.0368 0.2222  48  PRO A CB  
342  C CG  . PRO A 48  ? 0.4476 0.5934 0.6029 0.0580  -0.0393 0.2002  48  PRO A CG  
343  C CD  . PRO A 48  ? 0.4028 0.5242 0.5823 0.0628  -0.0483 0.2033  48  PRO A CD  
344  N N   . GLU A 49  ? 0.6275 0.8020 0.7867 0.0666  -0.0461 0.2715  49  GLU A N   
345  C CA  . GLU A 49  ? 0.6173 0.8061 0.7710 0.0755  -0.0502 0.2808  49  GLU A CA  
346  C C   . GLU A 49  ? 0.6033 0.8225 0.7295 0.0747  -0.0446 0.2760  49  GLU A C   
347  O O   . GLU A 49  ? 0.6389 0.8686 0.7521 0.0674  -0.0373 0.2768  49  GLU A O   
348  C CB  . GLU A 49  ? 0.7379 0.9236 0.9041 0.0767  -0.0540 0.3110  49  GLU A CB  
349  C CG  . GLU A 49  ? 0.9042 1.0587 1.0990 0.0733  -0.0587 0.3190  49  GLU A CG  
350  C CD  . GLU A 49  ? 1.0128 1.1461 1.2281 0.0838  -0.0694 0.3188  49  GLU A CD  
351  O OE1 . GLU A 49  ? 1.0502 1.1543 1.2895 0.0823  -0.0749 0.3178  49  GLU A OE1 
352  O OE2 . GLU A 49  ? 1.0982 1.2440 1.3065 0.0938  -0.0728 0.3188  49  GLU A OE2 
353  N N   . PRO A 50  ? 0.6579 0.8916 0.7758 0.0823  -0.0483 0.2700  50  PRO A N   
354  C CA  . PRO A 50  ? 0.6477 0.9077 0.7413 0.0810  -0.0445 0.2602  50  PRO A CA  
355  C C   . PRO A 50  ? 0.6967 0.9788 0.7741 0.0798  -0.0419 0.2789  50  PRO A C   
356  O O   . PRO A 50  ? 0.8074 1.0910 0.8914 0.0831  -0.0447 0.3023  50  PRO A O   
357  C CB  . PRO A 50  ? 0.5217 0.7905 0.6167 0.0896  -0.0510 0.2509  50  PRO A CB  
358  C CG  . PRO A 50  ? 0.4517 0.6975 0.5711 0.0962  -0.0570 0.2529  50  PRO A CG  
359  C CD  . PRO A 50  ? 0.4626 0.6904 0.5945 0.0929  -0.0569 0.2720  50  PRO A CD  
360  N N   . LYS A 51  ? 0.6663 0.9663 0.7223 0.0758  -0.0365 0.2681  51  LYS A N   
361  C CA  . LYS A 51  ? 0.6504 0.9739 0.6874 0.0753  -0.0327 0.2818  51  LYS A CA  
362  C C   . LYS A 51  ? 0.7559 1.0987 0.7866 0.0837  -0.0394 0.2963  51  LYS A C   
363  O O   . LYS A 51  ? 0.8293 1.1849 0.8520 0.0880  -0.0447 0.2836  51  LYS A O   
364  C CB  . LYS A 51  ? 0.5894 0.9271 0.6045 0.0714  -0.0275 0.2625  51  LYS A CB  
365  C CG  . LYS A 51  ? 0.6763 1.0392 0.6699 0.0721  -0.0230 0.2730  51  LYS A CG  
366  C CD  . LYS A 51  ? 0.6977 1.0570 0.6999 0.0690  -0.0171 0.2964  51  LYS A CD  
367  C CE  . LYS A 51  ? 0.6667 1.0505 0.6475 0.0686  -0.0092 0.3019  51  LYS A CE  
368  N NZ  . LYS A 51  ? 0.6718 1.0568 0.6635 0.0657  -0.0034 0.3280  51  LYS A NZ  
369  N N   . LYS A 52  ? 0.7802 1.1261 0.8159 0.0860  -0.0397 0.3238  52  LYS A N   
370  C CA  . LYS A 52  ? 0.7500 1.1151 0.7787 0.0941  -0.0455 0.3386  52  LYS A CA  
371  C C   . LYS A 52  ? 0.7333 1.1275 0.7334 0.0947  -0.0433 0.3262  52  LYS A C   
372  O O   . LYS A 52  ? 0.6728 1.0763 0.6583 0.0900  -0.0353 0.3224  52  LYS A O   
373  C CB  . LYS A 52  ? 0.6681 1.0273 0.7077 0.0927  -0.0425 0.3638  52  LYS A CB  
374  C CG  . LYS A 52  ? 0.7252 1.0530 0.7939 0.0893  -0.0436 0.3760  52  LYS A CG  
375  C CD  . LYS A 52  ? 0.8908 1.2077 0.9771 0.0924  -0.0479 0.3974  52  LYS A CD  
376  C CE  . LYS A 52  ? 0.8805 1.1680 0.9946 0.0859  -0.0473 0.4104  52  LYS A CE  
377  N NZ  . LYS A 52  ? 0.8612 1.1574 0.9762 0.0781  -0.0390 0.4299  52  LYS A NZ  
378  N N   . PRO A 53  ? 0.7001 1.1090 0.6930 0.1010  -0.0508 0.3191  53  PRO A N   
379  C CA  . PRO A 53  ? 0.6635 1.0975 0.6314 0.1015  -0.0511 0.3023  53  PRO A CA  
380  C C   . PRO A 53  ? 0.6152 1.0675 0.5652 0.1014  -0.0445 0.3104  53  PRO A C   
381  O O   . PRO A 53  ? 0.6405 1.0953 0.5953 0.1040  -0.0433 0.3305  53  PRO A O   
382  C CB  . PRO A 53  ? 0.6824 1.1262 0.6531 0.1082  -0.0618 0.2971  53  PRO A CB  
383  C CG  . PRO A 53  ? 0.6968 1.1258 0.6883 0.1128  -0.0647 0.3182  53  PRO A CG  
384  C CD  . PRO A 53  ? 0.6282 1.0309 0.6373 0.1082  -0.0599 0.3252  53  PRO A CD  
385  N N   . TRP A 54  ? 0.6077 1.0736 0.5375 0.0991  -0.0405 0.2937  54  TRP A N   
386  C CA  . TRP A 54  ? 0.6915 1.1755 0.6042 0.0998  -0.0331 0.2975  54  TRP A CA  
387  C C   . TRP A 54  ? 0.7449 1.2539 0.6359 0.1054  -0.0385 0.2841  54  TRP A C   
388  O O   . TRP A 54  ? 0.5251 1.0372 0.4102 0.1057  -0.0461 0.2642  54  TRP A O   
389  C CB  . TRP A 54  ? 0.5077 0.9875 0.4145 0.0941  -0.0238 0.2882  54  TRP A CB  
390  C CG  . TRP A 54  ? 0.5731 1.0545 0.4669 0.0926  -0.0268 0.2610  54  TRP A CG  
391  C CD1 . TRP A 54  ? 0.6457 1.1454 0.5175 0.0954  -0.0284 0.2426  54  TRP A CD1 
392  C CD2 . TRP A 54  ? 0.5426 1.0061 0.4455 0.0881  -0.0295 0.2491  54  TRP A CD2 
393  N NE1 . TRP A 54  ? 0.4822 0.9751 0.3498 0.0920  -0.0320 0.2202  54  TRP A NE1 
394  C CE2 . TRP A 54  ? 0.4620 0.9342 0.3482 0.0874  -0.0324 0.2244  54  TRP A CE2 
395  C CE3 . TRP A 54  ? 0.5505 0.9913 0.4749 0.0848  -0.0301 0.2562  54  TRP A CE3 
396  C CZ2 . TRP A 54  ? 0.4740 0.9295 0.3680 0.0817  -0.0340 0.2054  54  TRP A CZ2 
397  C CZ3 . TRP A 54  ? 0.4318 0.8542 0.3648 0.0791  -0.0304 0.2330  54  TRP A CZ3 
398  C CH2 . TRP A 54  ? 0.4266 0.8566 0.3448 0.0773  -0.0320 0.2092  54  TRP A CH2 
399  N N   . SER A 55  ? 0.7642 1.2920 0.6443 0.1097  -0.0350 0.2952  55  SER A N   
400  C CA  . SER A 55  ? 0.8280 1.3808 0.6850 0.1154  -0.0390 0.2815  55  SER A CA  
401  C C   . SER A 55  ? 0.8242 1.3848 0.6640 0.1141  -0.0327 0.2634  55  SER A C   
402  O O   . SER A 55  ? 0.8573 1.4092 0.7020 0.1100  -0.0231 0.2676  55  SER A O   
403  C CB  . SER A 55  ? 0.8496 1.4213 0.7015 0.1219  -0.0382 0.3012  55  SER A CB  
404  O OG  . SER A 55  ? 0.9010 1.4603 0.7729 0.1223  -0.0413 0.3225  55  SER A OG  
405  N N   . GLY A 56  ? 0.7446 1.3211 0.5650 0.1179  -0.0388 0.2424  56  GLY A N   
406  C CA  . GLY A 56  ? 0.6165 1.1986 0.4204 0.1179  -0.0347 0.2221  56  GLY A CA  
407  C C   . GLY A 56  ? 0.6106 1.1744 0.4182 0.1114  -0.0373 0.2013  56  GLY A C   
408  O O   . GLY A 56  ? 0.6978 1.2454 0.5212 0.1066  -0.0420 0.2022  56  GLY A O   
409  N N   . VAL A 57  ? 0.5570 1.1245 0.3495 0.1120  -0.0344 0.1820  57  VAL A N   
410  C CA  . VAL A 57  ? 0.5372 1.0891 0.3303 0.1063  -0.0360 0.1608  57  VAL A CA  
411  C C   . VAL A 57  ? 0.5224 1.0601 0.3234 0.1023  -0.0239 0.1684  57  VAL A C   
412  O O   . VAL A 57  ? 0.5529 1.0998 0.3477 0.1058  -0.0147 0.1748  57  VAL A O   
413  C CB  . VAL A 57  ? 0.5516 1.1142 0.3240 0.1099  -0.0415 0.1334  57  VAL A CB  
414  C CG1 . VAL A 57  ? 0.7071 1.2536 0.4823 0.1033  -0.0473 0.1112  57  VAL A CG1 
415  C CG2 . VAL A 57  ? 0.5738 1.1556 0.3366 0.1155  -0.0515 0.1302  57  VAL A CG2 
416  N N   . TRP A 58  ? 0.5237 1.0406 0.3391 0.0953  -0.0242 0.1675  58  TRP A N   
417  C CA  . TRP A 58  ? 0.5538 1.0558 0.3782 0.0908  -0.0138 0.1741  58  TRP A CA  
418  C C   . TRP A 58  ? 0.6425 1.1423 0.4538 0.0906  -0.0109 0.1512  58  TRP A C   
419  O O   . TRP A 58  ? 0.4987 0.9897 0.3074 0.0874  -0.0174 0.1322  58  TRP A O   
420  C CB  . TRP A 58  ? 0.4979 0.9792 0.3424 0.0843  -0.0159 0.1820  58  TRP A CB  
421  C CG  . TRP A 58  ? 0.5597 1.0262 0.4161 0.0798  -0.0059 0.1925  58  TRP A CG  
422  C CD1 . TRP A 58  ? 0.6016 1.0554 0.4583 0.0757  0.0000  0.1783  58  TRP A CD1 
423  C CD2 . TRP A 58  ? 0.6014 1.0609 0.4756 0.0779  -0.0008 0.2174  58  TRP A CD2 
424  N NE1 . TRP A 58  ? 0.6011 1.0426 0.4739 0.0716  0.0082  0.1930  58  TRP A NE1 
425  C CE2 . TRP A 58  ? 0.6132 1.0592 0.4957 0.0727  0.0075  0.2182  58  TRP A CE2 
426  C CE3 . TRP A 58  ? 0.5046 0.9670 0.3900 0.0798  -0.0029 0.2389  58  TRP A CE3 
427  C CZ2 . TRP A 58  ? 0.5386 0.9750 0.4403 0.0688  0.0129  0.2397  58  TRP A CZ2 
428  C CZ3 . TRP A 58  ? 0.4584 0.9093 0.3632 0.0761  0.0026  0.2602  58  TRP A CZ3 
429  C CH2 . TRP A 58  ? 0.4455 0.8838 0.3586 0.0703  0.0101  0.2603  58  TRP A CH2 
430  N N   . ASN A 59  ? 0.7351 1.2434 0.5394 0.0943  -0.0014 0.1531  59  ASN A N   
431  C CA  . ASN A 59  ? 0.7136 1.2168 0.5084 0.0948  0.0025  0.1331  59  ASN A CA  
432  C C   . ASN A 59  ? 0.7396 1.2195 0.5482 0.0867  0.0051  0.1327  59  ASN A C   
433  O O   . ASN A 59  ? 0.7930 1.2659 0.6150 0.0835  0.0138  0.1484  59  ASN A O   
434  C CB  . ASN A 59  ? 0.6910 1.2085 0.4797 0.1008  0.0130  0.1379  59  ASN A CB  
435  C CG  . ASN A 59  ? 0.7576 1.2731 0.5333 0.1044  0.0152  0.1135  59  ASN A CG  
436  O OD1 . ASN A 59  ? 0.7311 1.2313 0.5044 0.1010  0.0097  0.0950  59  ASN A OD1 
437  N ND2 . ASN A 59  ? 0.7629 1.2943 0.5309 0.1118  0.0229  0.1138  59  ASN A ND2 
438  N N   . ALA A 60  ? 0.6787 1.1441 0.4893 0.0823  -0.0027 0.1143  60  ALA A N   
439  C CA  . ALA A 60  ? 0.7142 1.1495 0.5466 0.0733  -0.0003 0.1092  60  ALA A CA  
440  C C   . ALA A 60  ? 0.7251 1.1494 0.5515 0.0727  0.0010  0.0860  60  ALA A C   
441  O O   . ALA A 60  ? 0.6504 1.0579 0.4837 0.0674  -0.0053 0.0693  60  ALA A O   
442  C CB  . ALA A 60  ? 0.7406 1.1620 0.5891 0.0673  -0.0090 0.1066  60  ALA A CB  
443  N N   . SER A 61  ? 0.7520 1.1868 0.5664 0.0785  0.0090  0.0856  61  SER A N   
444  C CA  . SER A 61  ? 0.7201 1.1479 0.5255 0.0810  0.0096  0.0630  61  SER A CA  
445  C C   . SER A 61  ? 0.6996 1.1163 0.5143 0.0798  0.0201  0.0662  61  SER A C   
446  O O   . SER A 61  ? 0.6514 1.0590 0.4616 0.0819  0.0211  0.0483  61  SER A O   
447  C CB  . SER A 61  ? 0.6012 1.0555 0.3793 0.0921  0.0076  0.0529  61  SER A CB  
448  O OG  . SER A 61  ? 0.6349 1.1102 0.4089 0.0981  0.0164  0.0717  61  SER A OG  
449  N N   . THR A 62  ? 0.5929 1.0089 0.4223 0.0762  0.0270  0.0880  62  THR A N   
450  C CA  . THR A 62  ? 0.6223 1.0294 0.4631 0.0743  0.0361  0.0923  62  THR A CA  
451  C C   . THR A 62  ? 0.6300 1.0181 0.4952 0.0650  0.0365  0.1061  62  THR A C   
452  O O   . THR A 62  ? 0.5697 0.9596 0.4417 0.0625  0.0330  0.1199  62  THR A O   
453  C CB  . THR A 62  ? 0.6944 1.1287 0.5260 0.0817  0.0461  0.1058  62  THR A CB  
454  O OG1 . THR A 62  ? 0.7592 1.2112 0.5910 0.0822  0.0465  0.1280  62  THR A OG1 
455  C CG2 . THR A 62  ? 0.6522 1.1036 0.4595 0.0926  0.0468  0.0879  62  THR A CG2 
456  N N   . TYR A 63  ? 0.6577 1.0281 0.5358 0.0611  0.0403  0.1018  63  TYR A N   
457  C CA  . TYR A 63  ? 0.6029 0.9544 0.5032 0.0531  0.0401  0.1111  63  TYR A CA  
458  C C   . TYR A 63  ? 0.6073 0.9694 0.5180 0.0517  0.0436  0.1356  63  TYR A C   
459  O O   . TYR A 63  ? 0.5627 0.9462 0.4672 0.0559  0.0500  0.1469  63  TYR A O   
460  C CB  . TYR A 63  ? 0.4829 0.8197 0.3925 0.0508  0.0443  0.1036  63  TYR A CB  
461  C CG  . TYR A 63  ? 0.5292 0.8438 0.4405 0.0478  0.0392  0.0854  63  TYR A CG  
462  C CD1 . TYR A 63  ? 0.6602 0.9631 0.5772 0.0431  0.0323  0.0827  63  TYR A CD1 
463  C CD2 . TYR A 63  ? 0.4969 0.8037 0.4052 0.0499  0.0416  0.0721  63  TYR A CD2 
464  C CE1 . TYR A 63  ? 0.6640 0.9490 0.5839 0.0397  0.0285  0.0683  63  TYR A CE1 
465  C CE2 . TYR A 63  ? 0.5679 0.8546 0.4788 0.0466  0.0372  0.0579  63  TYR A CE2 
466  C CZ  . TYR A 63  ? 0.6395 0.9160 0.5563 0.0411  0.0310  0.0567  63  TYR A CZ  
467  O OH  . TYR A 63  ? 0.6621 0.9208 0.5825 0.0374  0.0275  0.0448  63  TYR A OH  
468  N N   . PRO A 64  ? 0.6757 1.0233 0.6035 0.0460  0.0396  0.1445  64  PRO A N   
469  C CA  . PRO A 64  ? 0.6447 0.9988 0.5853 0.0441  0.0416  0.1682  64  PRO A CA  
470  C C   . PRO A 64  ? 0.6100 0.9622 0.5659 0.0403  0.0483  0.1775  64  PRO A C   
471  O O   . PRO A 64  ? 0.5750 0.9247 0.5294 0.0407  0.0522  0.1661  64  PRO A O   
472  C CB  . PRO A 64  ? 0.7573 1.0927 0.7118 0.0402  0.0339  0.1698  64  PRO A CB  
473  C CG  . PRO A 64  ? 0.7910 1.1072 0.7471 0.0377  0.0311  0.1490  64  PRO A CG  
474  C CD  . PRO A 64  ? 0.7622 1.0878 0.6986 0.0417  0.0329  0.1334  64  PRO A CD  
475  N N   . ASN A 65  ? 0.6670 1.0199 0.6396 0.0365  0.0489  0.1984  65  ASN A N   
476  C CA  . ASN A 65  ? 0.7565 1.1047 0.7491 0.0310  0.0531  0.2070  65  ASN A CA  
477  C C   . ASN A 65  ? 0.7379 1.0578 0.7461 0.0257  0.0475  0.1952  65  ASN A C   
478  O O   . ASN A 65  ? 0.7571 1.0619 0.7630 0.0262  0.0410  0.1842  65  ASN A O   
479  C CB  . ASN A 65  ? 0.8142 1.1714 0.8222 0.0276  0.0547  0.2342  65  ASN A CB  
480  C CG  . ASN A 65  ? 0.7366 1.1256 0.7287 0.0332  0.0613  0.2484  65  ASN A CG  
481  O OD1 . ASN A 65  ? 0.5362 0.9446 0.5196 0.0364  0.0694  0.2469  65  ASN A OD1 
482  N ND2 . ASN A 65  ? 0.7932 1.1891 0.7810 0.0354  0.0580  0.2626  65  ASN A ND2 
483  N N   . ASN A 66  ? 0.6766 0.9917 0.7010 0.0211  0.0501  0.1976  66  ASN A N   
484  C CA  . ASN A 66  ? 0.5330 0.8239 0.5730 0.0165  0.0448  0.1880  66  ASN A CA  
485  C C   . ASN A 66  ? 0.5942 0.8759 0.6594 0.0102  0.0411  0.2041  66  ASN A C   
486  O O   . ASN A 66  ? 0.5972 0.8930 0.6719 0.0076  0.0449  0.2235  66  ASN A O   
487  C CB  . ASN A 66  ? 0.4713 0.7622 0.5114 0.0163  0.0487  0.1764  66  ASN A CB  
488  C CG  . ASN A 66  ? 0.5378 0.8325 0.5552 0.0224  0.0510  0.1590  66  ASN A CG  
489  O OD1 . ASN A 66  ? 0.4497 0.7531 0.4621 0.0251  0.0562  0.1532  66  ASN A OD1 
490  N ND2 . ASN A 66  ? 0.5832 0.8710 0.5884 0.0248  0.0465  0.1503  66  ASN A ND2 
491  N N   . CYS A 67  ? 0.6323 0.8910 0.7090 0.0082  0.0333  0.1965  67  CYS A N   
492  C CA  . CYS A 67  ? 0.6961 0.9423 0.7977 0.0028  0.0279  0.2094  67  CYS A CA  
493  C C   . CYS A 67  ? 0.7544 1.0019 0.8751 -0.0038 0.0296  0.2144  67  CYS A C   
494  O O   . CYS A 67  ? 0.8290 1.0780 0.9456 -0.0035 0.0321  0.2016  67  CYS A O   
495  C CB  . CYS A 67  ? 0.6611 0.8831 0.7688 0.0041  0.0189  0.1969  67  CYS A CB  
496  S SG  . CYS A 67  ? 0.6675 0.8891 0.7591 0.0112  0.0157  0.1933  67  CYS A SG  
497  N N   . GLN A 68  ? 0.7051 0.9522 0.8485 -0.0098 0.0278  0.2340  68  GLN A N   
498  C CA  . GLN A 68  ? 0.5267 0.7755 0.6928 -0.0176 0.0282  0.2399  68  GLN A CA  
499  C C   . GLN A 68  ? 0.5045 0.7326 0.6789 -0.0190 0.0208  0.2198  68  GLN A C   
500  O O   . GLN A 68  ? 0.4405 0.6465 0.6195 -0.0178 0.0122  0.2106  68  GLN A O   
501  C CB  . GLN A 68  ? 0.4461 0.6931 0.6394 -0.0253 0.0254  0.2642  68  GLN A CB  
502  C CG  . GLN A 68  ? 0.5841 0.8534 0.7714 -0.0242 0.0326  0.2882  68  GLN A CG  
503  C CD  . GLN A 68  ? 0.7317 1.0328 0.9121 -0.0243 0.0445  0.2962  68  GLN A CD  
504  O OE1 . GLN A 68  ? 0.8530 1.1596 1.0516 -0.0306 0.0462  0.2986  68  GLN A OE1 
505  N NE2 . GLN A 68  ? 0.7216 1.0454 0.8767 -0.0168 0.0524  0.3008  68  GLN A NE2 
506  N N   . GLN A 69  ? 0.5521 0.7892 0.7277 -0.0205 0.0243  0.2129  69  GLN A N   
507  C CA  . GLN A 69  ? 0.5504 0.7721 0.7277 -0.0200 0.0183  0.1926  69  GLN A CA  
508  C C   . GLN A 69  ? 0.5683 0.8031 0.7569 -0.0240 0.0213  0.1930  69  GLN A C   
509  O O   . GLN A 69  ? 0.7012 0.9593 0.8868 -0.0239 0.0304  0.2037  69  GLN A O   
510  C CB  . GLN A 69  ? 0.4684 0.6861 0.6179 -0.0115 0.0199  0.1740  69  GLN A CB  
511  C CG  . GLN A 69  ? 0.3439 0.5821 0.4725 -0.0068 0.0299  0.1730  69  GLN A CG  
512  C CD  . GLN A 69  ? 0.2921 0.5252 0.3957 0.0003  0.0307  0.1572  69  GLN A CD  
513  O OE1 . GLN A 69  ? 0.4014 0.6285 0.4979 0.0027  0.0300  0.1423  69  GLN A OE1 
514  N NE2 . GLN A 69  ? 0.3327 0.5688 0.4241 0.0033  0.0318  0.1612  69  GLN A NE2 
515  N N   . TYR A 70  ? 0.5167 0.7379 0.7185 -0.0267 0.0132  0.1811  70  TYR A N   
516  C CA  . TYR A 70  ? 0.4619 0.6948 0.6725 -0.0291 0.0146  0.1776  70  TYR A CA  
517  C C   . TYR A 70  ? 0.4893 0.7370 0.6745 -0.0210 0.0238  0.1695  70  TYR A C   
518  O O   . TYR A 70  ? 0.4340 0.6739 0.5957 -0.0140 0.0249  0.1579  70  TYR A O   
519  C CB  . TYR A 70  ? 0.4325 0.6468 0.6545 -0.0308 0.0030  0.1617  70  TYR A CB  
520  C CG  . TYR A 70  ? 0.4557 0.6802 0.6804 -0.0303 0.0031  0.1528  70  TYR A CG  
521  C CD1 . TYR A 70  ? 0.5093 0.7430 0.7620 -0.0386 -0.0004 0.1602  70  TYR A CD1 
522  C CD2 . TYR A 70  ? 0.4277 0.6529 0.6283 -0.0218 0.0062  0.1377  70  TYR A CD2 
523  C CE1 . TYR A 70  ? 0.5867 0.8314 0.8423 -0.0374 -0.0009 0.1522  70  TYR A CE1 
524  C CE2 . TYR A 70  ? 0.4561 0.6904 0.6589 -0.0204 0.0059  0.1304  70  TYR A CE2 
525  C CZ  . TYR A 70  ? 0.5788 0.8233 0.8085 -0.0277 0.0022  0.1372  70  TYR A CZ  
526  O OH  . TYR A 70  ? 0.5782 0.8335 0.8106 -0.0255 0.0014  0.1300  70  TYR A OH  
527  N N   . VAL A 71  ? 0.4671 0.7366 0.6585 -0.0220 0.0304  0.1761  71  VAL A N   
528  C CA  . VAL A 71  ? 0.4719 0.7563 0.6420 -0.0136 0.0392  0.1693  71  VAL A CA  
529  C C   . VAL A 71  ? 0.6365 0.9237 0.8143 -0.0129 0.0368  0.1593  71  VAL A C   
530  O O   . VAL A 71  ? 0.8087 1.1074 1.0108 -0.0191 0.0355  0.1675  71  VAL A O   
531  C CB  . VAL A 71  ? 0.5075 0.8190 0.6750 -0.0123 0.0504  0.1853  71  VAL A CB  
532  C CG1 . VAL A 71  ? 0.5269 0.8501 0.6695 -0.0018 0.0584  0.1750  71  VAL A CG1 
533  C CG2 . VAL A 71  ? 0.4710 0.7815 0.6352 -0.0141 0.0515  0.1989  71  VAL A CG2 
534  N N   . ASP A 72  ? 0.5928 0.8705 0.7513 -0.0056 0.0359  0.1425  72  ASP A N   
535  C CA  . ASP A 72  ? 0.5962 0.8740 0.7595 -0.0037 0.0322  0.1322  72  ASP A CA  
536  C C   . ASP A 72  ? 0.5095 0.8118 0.6743 0.0005  0.0407  0.1364  72  ASP A C   
537  O O   . ASP A 72  ? 0.5630 0.8719 0.7079 0.0085  0.0484  0.1332  72  ASP A O   
538  C CB  . ASP A 72  ? 0.6035 0.8632 0.7453 0.0029  0.0289  0.1154  72  ASP A CB  
539  C CG  . ASP A 72  ? 0.5526 0.8135 0.6956 0.0066  0.0258  0.1058  72  ASP A CG  
540  O OD1 . ASP A 72  ? 0.6748 0.9458 0.8390 0.0024  0.0223  0.1096  72  ASP A OD1 
541  O OD2 . ASP A 72  ? 0.3884 0.6409 0.5125 0.0134  0.0264  0.0952  72  ASP A OD2 
542  N N   . GLU A 73  ? 0.4552 0.7714 0.6446 -0.0045 0.0387  0.1426  73  GLU A N   
543  C CA  . GLU A 73  ? 0.4104 0.7519 0.6040 0.0003  0.0463  0.1459  73  GLU A CA  
544  C C   . GLU A 73  ? 0.3571 0.6999 0.5619 0.0016  0.0397  0.1370  73  GLU A C   
545  O O   . GLU A 73  ? 0.3459 0.7121 0.5651 0.0028  0.0435  0.1423  73  GLU A O   
546  C CB  . GLU A 73  ? 0.4093 0.7765 0.6235 -0.0058 0.0529  0.1657  73  GLU A CB  
547  C CG  . GLU A 73  ? 0.5280 0.8942 0.7352 -0.0087 0.0574  0.1775  73  GLU A CG  
548  C CD  . GLU A 73  ? 0.7408 1.1235 0.9768 -0.0195 0.0589  0.1993  73  GLU A CD  
549  O OE1 . GLU A 73  ? 0.8875 1.2642 1.1246 -0.0245 0.0588  0.2108  73  GLU A OE1 
550  O OE2 . GLU A 73  ? 0.8958 1.2984 1.1555 -0.0235 0.0597  0.2060  73  GLU A OE2 
551  N N   . GLN A 74  ? 0.3666 0.6870 0.5643 0.0022  0.0302  0.1237  74  GLN A N   
552  C CA  . GLN A 74  ? 0.3908 0.7127 0.5947 0.0052  0.0236  0.1146  74  GLN A CA  
553  C C   . GLN A 74  ? 0.3758 0.7116 0.5684 0.0162  0.0312  0.1114  74  GLN A C   
554  O O   . GLN A 74  ? 0.5467 0.8972 0.7530 0.0183  0.0292  0.1108  74  GLN A O   
555  C CB  . GLN A 74  ? 0.4675 0.7641 0.6580 0.0068  0.0141  0.1006  74  GLN A CB  
556  C CG  . GLN A 74  ? 0.5208 0.8185 0.7223 0.0071  0.0039  0.0925  74  GLN A CG  
557  C CD  . GLN A 74  ? 0.7270 1.0265 0.9574 -0.0040 -0.0059 0.0961  74  GLN A CD  
558  O OE1 . GLN A 74  ? 0.8885 1.2063 1.1426 -0.0106 -0.0035 0.1081  74  GLN A OE1 
559  N NE2 . GLN A 74  ? 0.7199 1.0006 0.9491 -0.0061 -0.0171 0.0858  74  GLN A NE2 
560  N N   . PHE A 75  ? 0.3315 0.6629 0.5004 0.0237  0.0393  0.1088  75  PHE A N   
561  C CA  . PHE A 75  ? 0.4091 0.7486 0.5651 0.0355  0.0458  0.1035  75  PHE A CA  
562  C C   . PHE A 75  ? 0.4111 0.7633 0.5570 0.0395  0.0571  0.1091  75  PHE A C   
563  O O   . PHE A 75  ? 0.2902 0.6294 0.4131 0.0448  0.0600  0.1024  75  PHE A O   
564  C CB  . PHE A 75  ? 0.4990 0.8152 0.6328 0.0422  0.0421  0.0904  75  PHE A CB  
565  C CG  . PHE A 75  ? 0.4886 0.7922 0.6275 0.0392  0.0312  0.0846  75  PHE A CG  
566  C CD1 . PHE A 75  ? 0.3749 0.6896 0.5272 0.0417  0.0264  0.0832  75  PHE A CD1 
567  C CD2 . PHE A 75  ? 0.5048 0.7875 0.6343 0.0349  0.0256  0.0800  75  PHE A CD2 
568  C CE1 . PHE A 75  ? 0.3511 0.6562 0.5060 0.0399  0.0159  0.0771  75  PHE A CE1 
569  C CE2 . PHE A 75  ? 0.4381 0.7116 0.5701 0.0337  0.0159  0.0736  75  PHE A CE2 
570  C CZ  . PHE A 75  ? 0.4128 0.6973 0.5568 0.0362  0.0108  0.0719  75  PHE A CZ  
571  N N   . PRO A 76  ? 0.5179 0.8973 0.6808 0.0372  0.0634  0.1214  76  PRO A N   
572  C CA  . PRO A 76  ? 0.5303 0.9261 0.6824 0.0422  0.0745  0.1272  76  PRO A CA  
573  C C   . PRO A 76  ? 0.4619 0.8535 0.5900 0.0563  0.0791  0.1143  76  PRO A C   
574  O O   . PRO A 76  ? 0.4691 0.8645 0.5991 0.0644  0.0788  0.1073  76  PRO A O   
575  C CB  . PRO A 76  ? 0.5267 0.9572 0.7039 0.0400  0.0805  0.1414  76  PRO A CB  
576  C CG  . PRO A 76  ? 0.4061 0.8338 0.6107 0.0287  0.0706  0.1456  76  PRO A CG  
577  C CD  . PRO A 76  ? 0.4696 0.8697 0.6622 0.0319  0.0609  0.1295  76  PRO A CD  
578  N N   . GLY A 77  ? 0.3939 0.7766 0.5000 0.0592  0.0825  0.1106  77  GLY A N   
579  C CA  . GLY A 77  ? 0.4502 0.8288 0.5348 0.0722  0.0864  0.0978  77  GLY A CA  
580  C C   . GLY A 77  ? 0.5534 0.9038 0.6271 0.0760  0.0793  0.0838  77  GLY A C   
581  O O   . GLY A 77  ? 0.5159 0.8611 0.5754 0.0869  0.0815  0.0731  77  GLY A O   
582  N N   . PHE A 78  ? 0.5605 0.8928 0.6405 0.0679  0.0709  0.0838  78  PHE A N   
583  C CA  . PHE A 78  ? 0.4161 0.7229 0.4850 0.0708  0.0647  0.0730  78  PHE A CA  
584  C C   . PHE A 78  ? 0.4153 0.7020 0.4662 0.0678  0.0633  0.0682  78  PHE A C   
585  O O   . PHE A 78  ? 0.4616 0.7441 0.5149 0.0589  0.0609  0.0734  78  PHE A O   
586  C CB  . PHE A 78  ? 0.3844 0.6844 0.4666 0.0648  0.0565  0.0746  78  PHE A CB  
587  C CG  . PHE A 78  ? 0.4735 0.7500 0.5440 0.0675  0.0506  0.0659  78  PHE A CG  
588  C CD1 . PHE A 78  ? 0.4126 0.6845 0.4759 0.0779  0.0515  0.0596  78  PHE A CD1 
589  C CD2 . PHE A 78  ? 0.5020 0.7616 0.5688 0.0602  0.0445  0.0649  78  PHE A CD2 
590  C CE1 . PHE A 78  ? 0.5390 0.7897 0.5924 0.0798  0.0464  0.0543  78  PHE A CE1 
591  C CE2 . PHE A 78  ? 0.4806 0.7216 0.5365 0.0628  0.0401  0.0588  78  PHE A CE2 
592  C CZ  . PHE A 78  ? 0.4849 0.7214 0.5342 0.0721  0.0411  0.0544  78  PHE A CZ  
593  N N   . SER A 79  ? 0.4421 0.7161 0.4768 0.0753  0.0641  0.0582  79  SER A N   
594  C CA  . SER A 79  ? 0.4269 0.6857 0.4458 0.0727  0.0631  0.0534  79  SER A CA  
595  C C   . SER A 79  ? 0.4132 0.6539 0.4322 0.0638  0.0567  0.0545  79  SER A C   
596  O O   . SER A 79  ? 0.4329 0.6690 0.4465 0.0582  0.0559  0.0559  79  SER A O   
597  C CB  . SER A 79  ? 0.4766 0.7232 0.4815 0.0818  0.0636  0.0417  79  SER A CB  
598  O OG  . SER A 79  ? 0.5115 0.7392 0.5166 0.0832  0.0586  0.0377  79  SER A OG  
599  N N   . GLY A 80  ? 0.3915 0.6240 0.4167 0.0633  0.0520  0.0539  80  GLY A N   
600  C CA  . GLY A 80  ? 0.4440 0.6613 0.4679 0.0569  0.0463  0.0537  80  GLY A CA  
601  C C   . GLY A 80  ? 0.5099 0.7324 0.5439 0.0487  0.0439  0.0602  80  GLY A C   
602  O O   . GLY A 80  ? 0.5722 0.7832 0.6033 0.0442  0.0398  0.0590  80  GLY A O   
603  N N   . SER A 81  ? 0.4596 0.6995 0.5068 0.0467  0.0461  0.0673  81  SER A N   
604  C CA  . SER A 81  ? 0.4455 0.6883 0.5041 0.0385  0.0434  0.0744  81  SER A CA  
605  C C   . SER A 81  ? 0.5548 0.8076 0.6115 0.0365  0.0486  0.0813  81  SER A C   
606  O O   . SER A 81  ? 0.5253 0.7744 0.5860 0.0304  0.0462  0.0864  81  SER A O   
607  C CB  . SER A 81  ? 0.4424 0.6972 0.5220 0.0353  0.0404  0.0797  81  SER A CB  
608  O OG  . SER A 81  ? 0.5633 0.8394 0.6512 0.0376  0.0469  0.0864  81  SER A OG  
609  N N   . GLU A 82  ? 0.5373 0.8033 0.5877 0.0425  0.0554  0.0816  82  GLU A N   
610  C CA  . GLU A 82  ? 0.5204 0.7982 0.5653 0.0423  0.0607  0.0877  82  GLU A CA  
611  C C   . GLU A 82  ? 0.6112 0.8753 0.6386 0.0424  0.0592  0.0817  82  GLU A C   
612  O O   . GLU A 82  ? 0.7211 0.9922 0.7449 0.0403  0.0610  0.0878  82  GLU A O   
613  C CB  . GLU A 82  ? 0.5945 0.8927 0.6361 0.0505  0.0684  0.0880  82  GLU A CB  
614  C CG  . GLU A 82  ? 0.7429 1.0581 0.8039 0.0505  0.0702  0.0945  82  GLU A CG  
615  C CD  . GLU A 82  ? 0.8252 1.1655 0.8995 0.0467  0.0758  0.1098  82  GLU A CD  
616  O OE1 . GLU A 82  ? 0.8542 1.1979 0.9495 0.0381  0.0725  0.1195  82  GLU A OE1 
617  O OE2 . GLU A 82  ? 0.8827 1.2400 0.9468 0.0527  0.0834  0.1121  82  GLU A OE2 
618  N N   . MET A 83  ? 0.5678 0.8137 0.5855 0.0444  0.0557  0.0710  83  MET A N   
619  C CA  . MET A 83  ? 0.3264 0.5606 0.3303 0.0434  0.0538  0.0656  83  MET A CA  
620  C C   . MET A 83  ? 0.3748 0.6039 0.3839 0.0362  0.0499  0.0714  83  MET A C   
621  O O   . MET A 83  ? 0.4847 0.7098 0.4848 0.0351  0.0487  0.0696  83  MET A O   
622  C CB  . MET A 83  ? 0.2750 0.4914 0.2708 0.0460  0.0509  0.0550  83  MET A CB  
623  C CG  . MET A 83  ? 0.4991 0.7039 0.5020 0.0430  0.0464  0.0548  83  MET A CG  
624  S SD  . MET A 83  ? 0.6908 0.8761 0.6839 0.0452  0.0438  0.0461  83  MET A SD  
625  C CE  . MET A 83  ? 0.6948 0.8785 0.6751 0.0486  0.0461  0.0391  83  MET A CE  
626  N N   . TRP A 84  ? 0.2615 0.4909 0.2857 0.0318  0.0471  0.0777  84  TRP A N   
627  C CA  . TRP A 84  ? 0.2585 0.4817 0.2895 0.0261  0.0427  0.0824  84  TRP A CA  
628  C C   . TRP A 84  ? 0.3549 0.5907 0.3977 0.0225  0.0442  0.0955  84  TRP A C   
629  O O   . TRP A 84  ? 0.4286 0.6592 0.4767 0.0186  0.0407  0.1005  84  TRP A O   
630  C CB  . TRP A 84  ? 0.4126 0.6243 0.4527 0.0240  0.0368  0.0786  84  TRP A CB  
631  C CG  . TRP A 84  ? 0.3969 0.5996 0.4277 0.0278  0.0361  0.0690  84  TRP A CG  
632  C CD1 . TRP A 84  ? 0.4926 0.6969 0.5260 0.0309  0.0361  0.0662  84  TRP A CD1 
633  C CD2 . TRP A 84  ? 0.5754 0.7670 0.5940 0.0288  0.0351  0.0624  84  TRP A CD2 
634  N NE1 . TRP A 84  ? 0.5113 0.7049 0.5341 0.0340  0.0352  0.0590  84  TRP A NE1 
635  C CE2 . TRP A 84  ? 0.5494 0.7353 0.5635 0.0323  0.0349  0.0569  84  TRP A CE2 
636  C CE3 . TRP A 84  ? 0.5124 0.6995 0.5246 0.0269  0.0344  0.0616  84  TRP A CE3 
637  C CZ2 . TRP A 84  ? 0.6125 0.7881 0.6168 0.0331  0.0344  0.0519  84  TRP A CZ2 
638  C CZ3 . TRP A 84  ? 0.5689 0.7471 0.5720 0.0277  0.0338  0.0555  84  TRP A CZ3 
639  C CH2 . TRP A 84  ? 0.6836 0.8560 0.6832 0.0304  0.0340  0.0513  84  TRP A CH2 
640  N N   . ASN A 85  ? 0.5227 0.7756 0.5704 0.0239  0.0495  0.1020  85  ASN A N   
641  C CA  . ASN A 85  ? 0.4519 0.7195 0.5111 0.0201  0.0521  0.1172  85  ASN A CA  
642  C C   . ASN A 85  ? 0.4952 0.7692 0.5404 0.0221  0.0550  0.1214  85  ASN A C   
643  O O   . ASN A 85  ? 0.5951 0.8678 0.6218 0.0274  0.0566  0.1117  85  ASN A O   
644  C CB  . ASN A 85  ? 0.4814 0.7696 0.5492 0.0219  0.0582  0.1233  85  ASN A CB  
645  C CG  . ASN A 85  ? 0.5688 0.8548 0.6560 0.0182  0.0542  0.1231  85  ASN A CG  
646  O OD1 . ASN A 85  ? 0.5781 0.8704 0.6653 0.0227  0.0564  0.1174  85  ASN A OD1 
647  N ND2 . ASN A 85  ? 0.5975 0.8745 0.7017 0.0105  0.0477  0.1286  85  ASN A ND2 
648  N N   . PRO A 86  ? 0.4642 0.7451 0.5185 0.0178  0.0551  0.1360  86  PRO A N   
649  C CA  . PRO A 86  ? 0.3907 0.6823 0.4316 0.0206  0.0580  0.1421  86  PRO A CA  
650  C C   . PRO A 86  ? 0.3699 0.6823 0.3959 0.0279  0.0659  0.1402  86  PRO A C   
651  O O   . PRO A 86  ? 0.4474 0.7765 0.4811 0.0289  0.0717  0.1464  86  PRO A O   
652  C CB  . PRO A 86  ? 0.3451 0.6427 0.4033 0.0145  0.0574  0.1617  86  PRO A CB  
653  C CG  . PRO A 86  ? 0.3477 0.6324 0.4292 0.0078  0.0520  0.1627  86  PRO A CG  
654  C CD  . PRO A 86  ? 0.4259 0.7072 0.5047 0.0105  0.0524  0.1485  86  PRO A CD  
655  N N   . ASN A 87  ? 0.4691 0.7812 0.4741 0.0333  0.0658  0.1306  87  ASN A N   
656  C CA  . ASN A 87  ? 0.4678 0.7979 0.4557 0.0418  0.0720  0.1252  87  ASN A CA  
657  C C   . ASN A 87  ? 0.5082 0.8592 0.4853 0.0448  0.0752  0.1360  87  ASN A C   
658  O O   . ASN A 87  ? 0.6184 0.9859 0.5784 0.0531  0.0797  0.1301  87  ASN A O   
659  C CB  . ASN A 87  ? 0.4017 0.7172 0.3734 0.0465  0.0686  0.1048  87  ASN A CB  
660  C CG  . ASN A 87  ? 0.4143 0.7150 0.3797 0.0433  0.0616  0.1003  87  ASN A CG  
661  O OD1 . ASN A 87  ? 0.3814 0.6819 0.3536 0.0386  0.0591  0.1115  87  ASN A OD1 
662  N ND2 . ASN A 87  ? 0.5030 0.7914 0.4570 0.0457  0.0582  0.0841  87  ASN A ND2 
663  N N   . ARG A 88  ? 0.3949 0.7450 0.3805 0.0391  0.0725  0.1507  88  ARG A N   
664  C CA  . ARG A 88  ? 0.4548 0.8265 0.4324 0.0415  0.0757  0.1652  88  ARG A CA  
665  C C   . ARG A 88  ? 0.4471 0.8262 0.4472 0.0345  0.0780  0.1888  88  ARG A C   
666  O O   . ARG A 88  ? 0.5006 0.8650 0.5219 0.0275  0.0752  0.1910  88  ARG A O   
667  C CB  . ARG A 88  ? 0.5943 0.9579 0.5592 0.0423  0.0688  0.1613  88  ARG A CB  
668  C CG  . ARG A 88  ? 0.6016 0.9581 0.5464 0.0479  0.0655  0.1383  88  ARG A CG  
669  C CD  . ARG A 88  ? 0.6445 1.0229 0.5717 0.0573  0.0720  0.1318  88  ARG A CD  
670  N NE  . ARG A 88  ? 0.7225 1.1055 0.6272 0.0636  0.0681  0.1182  88  ARG A NE  
671  C CZ  . ARG A 88  ? 0.7581 1.1628 0.6488 0.0683  0.0688  0.1260  88  ARG A CZ  
672  N NH1 . ARG A 88  ? 0.5370 0.9596 0.4350 0.0668  0.0737  0.1494  88  ARG A NH1 
673  N NH2 . ARG A 88  ? 0.8651 1.2739 0.7356 0.0741  0.0638  0.1113  88  ARG A NH2 
674  N N   . GLU A 89  ? 0.4725 0.8755 0.4686 0.0364  0.0829  0.2067  89  GLU A N   
675  C CA  . GLU A 89  ? 0.4578 0.8674 0.4772 0.0288  0.0847  0.2317  89  GLU A CA  
676  C C   . GLU A 89  ? 0.4902 0.8706 0.5263 0.0209  0.0747  0.2338  89  GLU A C   
677  O O   . GLU A 89  ? 0.5833 0.9485 0.6086 0.0229  0.0681  0.2236  89  GLU A O   
678  C CB  . GLU A 89  ? 0.3809 0.8164 0.3923 0.0328  0.0891  0.2496  89  GLU A CB  
679  C CG  . GLU A 89  ? 0.6211 1.0726 0.6539 0.0290  0.0939  0.2678  89  GLU A CG  
680  C CD  . GLU A 89  ? 0.8729 1.3406 0.9020 0.0347  0.1007  0.2573  89  GLU A CD  
681  O OE1 . GLU A 89  ? 0.9562 1.4363 0.9613 0.0456  0.1032  0.2435  89  GLU A OE1 
682  O OE2 . GLU A 89  ? 0.8478 1.3153 0.8986 0.0287  0.1030  0.2620  89  GLU A OE2 
683  N N   . MET A 90  ? 0.3886 0.7613 0.4523 0.0122  0.0733  0.2454  90  MET A N   
684  C CA  . MET A 90  ? 0.5136 0.8599 0.5957 0.0054  0.0637  0.2486  90  MET A CA  
685  C C   . MET A 90  ? 0.5420 0.8954 0.6312 0.0033  0.0631  0.2731  90  MET A C   
686  O O   . MET A 90  ? 0.5134 0.8901 0.6095 0.0014  0.0703  0.2941  90  MET A O   
687  C CB  . MET A 90  ? 0.5168 0.8498 0.6261 -0.0028 0.0604  0.2482  90  MET A CB  
688  C CG  . MET A 90  ? 0.5814 0.8963 0.6860 -0.0012 0.0563  0.2231  90  MET A CG  
689  S SD  . MET A 90  ? 0.7173 1.0168 0.8536 -0.0104 0.0501  0.2222  90  MET A SD  
690  C CE  . MET A 90  ? 0.6424 0.9698 0.8002 -0.0167 0.0579  0.2487  90  MET A CE  
691  N N   . SER A 91  ? 0.5905 0.9255 0.6781 0.0041  0.0550  0.2712  91  SER A N   
692  C CA  . SER A 91  ? 0.6100 0.9458 0.7082 0.0019  0.0524  0.2944  91  SER A CA  
693  C C   . SER A 91  ? 0.5335 0.8372 0.6462 -0.0005 0.0410  0.2879  91  SER A C   
694  O O   . SER A 91  ? 0.6280 0.9145 0.7348 0.0015  0.0364  0.2651  91  SER A O   
695  C CB  . SER A 91  ? 0.5550 0.9130 0.6278 0.0102  0.0558  0.3016  91  SER A CB  
696  O OG  . SER A 91  ? 0.5700 0.9204 0.6506 0.0098  0.0498  0.3180  91  SER A OG  
697  N N   . GLU A 92  ? 0.3833 0.6792 0.5163 -0.0047 0.0366  0.3086  92  GLU A N   
698  C CA  . GLU A 92  ? 0.5299 0.7982 0.6725 -0.0037 0.0258  0.3031  92  GLU A CA  
699  C C   . GLU A 92  ? 0.6640 0.9374 0.7833 0.0054  0.0239  0.2980  92  GLU A C   
700  O O   . GLU A 92  ? 0.6668 0.9215 0.7853 0.0089  0.0165  0.2828  92  GLU A O   
701  C CB  . GLU A 92  ? 0.4646 0.7208 0.6369 -0.0100 0.0205  0.3266  92  GLU A CB  
702  C CG  . GLU A 92  ? 0.5050 0.7583 0.7047 -0.0206 0.0214  0.3361  92  GLU A CG  
703  C CD  . GLU A 92  ? 0.6425 0.8710 0.8753 -0.0270 0.0116  0.3509  92  GLU A CD  
704  O OE1 . GLU A 92  ? 0.6419 0.8418 0.8822 -0.0248 0.0012  0.3347  92  GLU A OE1 
705  O OE2 . GLU A 92  ? 0.6501 0.8878 0.9018 -0.0338 0.0140  0.3791  92  GLU A OE2 
706  N N   . ASP A 93  ? 0.6566 0.9573 0.7573 0.0097  0.0303  0.3104  93  ASP A N   
707  C CA  . ASP A 93  ? 0.6285 0.9391 0.7041 0.0184  0.0287  0.3027  93  ASP A CA  
708  C C   . ASP A 93  ? 0.7009 1.0115 0.7572 0.0214  0.0302  0.2742  93  ASP A C   
709  O O   . ASP A 93  ? 0.6685 0.9999 0.7044 0.0248  0.0367  0.2687  93  ASP A O   
710  C CB  . ASP A 93  ? 0.5766 0.9185 0.6368 0.0225  0.0349  0.3230  93  ASP A CB  
711  C CG  . ASP A 93  ? 0.7454 1.0991 0.7805 0.0315  0.0315  0.3160  93  ASP A CG  
712  O OD1 . ASP A 93  ? 0.7262 1.1089 0.7406 0.0367  0.0370  0.3237  93  ASP A OD1 
713  O OD2 . ASP A 93  ? 0.7818 1.1181 0.8183 0.0338  0.0233  0.3030  93  ASP A OD2 
714  N N   . CYS A 94  ? 0.7252 1.0118 0.7882 0.0207  0.0239  0.2556  94  CYS A N   
715  C CA  . CYS A 94  ? 0.6371 0.9200 0.6873 0.0217  0.0253  0.2308  94  CYS A CA  
716  C C   . CYS A 94  ? 0.5374 0.8079 0.5817 0.0254  0.0188  0.2137  94  CYS A C   
717  O O   . CYS A 94  ? 0.5135 0.7784 0.5500 0.0255  0.0194  0.1943  94  CYS A O   
718  C CB  . CYS A 94  ? 0.5562 0.8257 0.6218 0.0159  0.0267  0.2241  94  CYS A CB  
719  S SG  . CYS A 94  ? 0.6429 0.8825 0.7366 0.0118  0.0175  0.2237  94  CYS A SG  
720  N N   . LEU A 95  ? 0.5260 0.7934 0.5745 0.0286  0.0127  0.2212  95  LEU A N   
721  C CA  . LEU A 95  ? 0.4925 0.7510 0.5383 0.0324  0.0067  0.2064  95  LEU A CA  
722  C C   . LEU A 95  ? 0.4693 0.7465 0.4927 0.0366  0.0071  0.1994  95  LEU A C   
723  O O   . LEU A 95  ? 0.5036 0.7931 0.5215 0.0409  0.0040  0.2095  95  LEU A O   
724  C CB  . LEU A 95  ? 0.5007 0.7470 0.5635 0.0350  -0.0005 0.2168  95  LEU A CB  
725  C CG  . LEU A 95  ? 0.5001 0.7250 0.5856 0.0304  -0.0023 0.2193  95  LEU A CG  
726  C CD1 . LEU A 95  ? 0.4622 0.6718 0.5651 0.0342  -0.0105 0.2255  95  LEU A CD1 
727  C CD2 . LEU A 95  ? 0.3388 0.5527 0.4234 0.0281  -0.0010 0.1974  95  LEU A CD2 
728  N N   . TYR A 96  ? 0.4443 0.7235 0.4553 0.0355  0.0102  0.1818  96  TYR A N   
729  C CA  . TYR A 96  ? 0.5436 0.8374 0.5350 0.0384  0.0094  0.1713  96  TYR A CA  
730  C C   . TYR A 96  ? 0.5840 0.8667 0.5740 0.0364  0.0083  0.1504  96  TYR A C   
731  O O   . TYR A 96  ? 0.6829 0.9500 0.6827 0.0333  0.0100  0.1443  96  TYR A O   
732  C CB  . TYR A 96  ? 0.4753 0.7879 0.4497 0.0397  0.0154  0.1737  96  TYR A CB  
733  C CG  . TYR A 96  ? 0.5522 0.8784 0.5283 0.0413  0.0181  0.1968  96  TYR A CG  
734  C CD1 . TYR A 96  ? 0.6034 0.9505 0.5659 0.0466  0.0162  0.2061  96  TYR A CD1 
735  C CD2 . TYR A 96  ? 0.6364 0.9558 0.6288 0.0372  0.0221  0.2101  96  TYR A CD2 
736  C CE1 . TYR A 96  ? 0.5896 0.9507 0.5538 0.0482  0.0192  0.2299  96  TYR A CE1 
737  C CE2 . TYR A 96  ? 0.6206 0.9528 0.6173 0.0376  0.0249  0.2338  96  TYR A CE2 
738  C CZ  . TYR A 96  ? 0.5688 0.9221 0.5507 0.0432  0.0239  0.2443  96  TYR A CZ  
739  O OH  . TYR A 96  ? 0.5139 0.8820 0.4995 0.0438  0.0272  0.2702  96  TYR A OH  
740  N N   . LEU A 97  ? 0.4180 0.7097 0.3965 0.0381  0.0049  0.1400  97  LEU A N   
741  C CA  . LEU A 97  ? 0.4088 0.6926 0.3859 0.0354  0.0041  0.1219  97  LEU A CA  
742  C C   . LEU A 97  ? 0.4076 0.7027 0.3669 0.0356  0.0044  0.1112  97  LEU A C   
743  O O   . LEU A 97  ? 0.4190 0.7307 0.3660 0.0392  0.0037  0.1164  97  LEU A O   
744  C CB  . LEU A 97  ? 0.3409 0.6220 0.3274 0.0361  -0.0017 0.1183  97  LEU A CB  
745  C CG  . LEU A 97  ? 0.3201 0.6179 0.3020 0.0399  -0.0077 0.1237  97  LEU A CG  
746  C CD1 . LEU A 97  ? 0.3210 0.6287 0.2929 0.0382  -0.0112 0.1095  97  LEU A CD1 
747  C CD2 . LEU A 97  ? 0.3195 0.6136 0.3168 0.0432  -0.0121 0.1309  97  LEU A CD2 
748  N N   . ASN A 98  ? 0.3131 0.5991 0.2711 0.0323  0.0049  0.0961  98  ASN A N   
749  C CA  . ASN A 98  ? 0.4365 0.7282 0.3801 0.0322  0.0042  0.0832  98  ASN A CA  
750  C C   . ASN A 98  ? 0.5567 0.8440 0.5042 0.0283  -0.0011 0.0707  98  ASN A C   
751  O O   . ASN A 98  ? 0.7459 1.0213 0.7056 0.0249  -0.0002 0.0689  98  ASN A O   
752  C CB  . ASN A 98  ? 0.4433 0.7267 0.3829 0.0317  0.0105  0.0778  98  ASN A CB  
753  C CG  . ASN A 98  ? 0.4564 0.7450 0.3965 0.0343  0.0164  0.0914  98  ASN A CG  
754  O OD1 . ASN A 98  ? 0.5154 0.8208 0.4461 0.0384  0.0172  0.0994  98  ASN A OD1 
755  N ND2 . ASN A 98  ? 0.3100 0.5858 0.2619 0.0319  0.0202  0.0948  98  ASN A ND2 
756  N N   . ILE A 99  ? 0.4369 0.7353 0.3746 0.0287  -0.0067 0.0623  99  ILE A N   
757  C CA  . ILE A 99  ? 0.4829 0.7799 0.4268 0.0238  -0.0127 0.0515  99  ILE A CA  
758  C C   . ILE A 99  ? 0.5365 0.8303 0.4707 0.0217  -0.0150 0.0358  99  ILE A C   
759  O O   . ILE A 99  ? 0.5363 0.8397 0.4551 0.0263  -0.0163 0.0317  99  ILE A O   
760  C CB  . ILE A 99  ? 0.4251 0.7388 0.3712 0.0253  -0.0202 0.0553  99  ILE A CB  
761  C CG1 . ILE A 99  ? 0.3280 0.6466 0.2793 0.0303  -0.0185 0.0723  99  ILE A CG1 
762  C CG2 . ILE A 99  ? 0.5151 0.8272 0.4754 0.0195  -0.0246 0.0488  99  ILE A CG2 
763  C CD1 . ILE A 99  ? 0.3321 0.6660 0.2885 0.0327  -0.0260 0.0773  99  ILE A CD1 
764  N N   . TRP A 100 ? 0.5030 0.7835 0.4463 0.0153  -0.0157 0.0271  100 TRP A N   
765  C CA  . TRP A 100 ? 0.5204 0.7949 0.4588 0.0121  -0.0200 0.0117  100 TRP A CA  
766  C C   . TRP A 100 ? 0.5892 0.8678 0.5391 0.0051  -0.0280 0.0059  100 TRP A C   
767  O O   . TRP A 100 ? 0.7135 0.9882 0.6787 0.0002  -0.0264 0.0109  100 TRP A O   
768  C CB  . TRP A 100 ? 0.4046 0.6591 0.3458 0.0098  -0.0145 0.0072  100 TRP A CB  
769  C CG  . TRP A 100 ? 0.4514 0.7037 0.3814 0.0164  -0.0081 0.0091  100 TRP A CG  
770  C CD1 . TRP A 100 ? 0.4719 0.7230 0.3888 0.0209  -0.0084 -0.0013 100 TRP A CD1 
771  C CD2 . TRP A 100 ? 0.4899 0.7420 0.4219 0.0197  -0.0005 0.0219  100 TRP A CD2 
772  N NE1 . TRP A 100 ? 0.5402 0.7927 0.4513 0.0268  -0.0005 0.0054  100 TRP A NE1 
773  C CE2 . TRP A 100 ? 0.5047 0.7574 0.4257 0.0253  0.0040  0.0200  100 TRP A CE2 
774  C CE3 . TRP A 100 ? 0.4824 0.7340 0.4255 0.0186  0.0023  0.0341  100 TRP A CE3 
775  C CZ2 . TRP A 100 ? 0.5251 0.7790 0.4476 0.0285  0.0112  0.0310  100 TRP A CZ2 
776  C CZ3 . TRP A 100 ? 0.4690 0.7193 0.4130 0.0218  0.0084  0.0437  100 TRP A CZ3 
777  C CH2 . TRP A 100 ? 0.4898 0.7415 0.4243 0.0260  0.0129  0.0428  100 TRP A CH2 
778  N N   . VAL A 101 ? 0.6084 0.8961 0.5512 0.0048  -0.0369 -0.0051 101 VAL A N   
779  C CA  . VAL A 101 ? 0.5344 0.8309 0.4887 -0.0017 -0.0461 -0.0102 101 VAL A CA  
780  C C   . VAL A 101 ? 0.4454 0.7320 0.3998 -0.0074 -0.0534 -0.0276 101 VAL A C   
781  O O   . VAL A 101 ? 0.5108 0.7991 0.4487 -0.0021 -0.0573 -0.0385 101 VAL A O   
782  C CB  . VAL A 101 ? 0.3709 0.6911 0.3187 0.0033  -0.0527 -0.0066 101 VAL A CB  
783  C CG1 . VAL A 101 ? 0.3719 0.7035 0.3357 -0.0037 -0.0620 -0.0097 101 VAL A CG1 
784  C CG2 . VAL A 101 ? 0.3590 0.6852 0.3053 0.0102  -0.0455 0.0109  101 VAL A CG2 
785  N N   . PRO A 102 ? 0.3951 0.6713 0.3674 -0.0174 -0.0554 -0.0304 102 PRO A N   
786  C CA  . PRO A 102 ? 0.4272 0.6905 0.4024 -0.0236 -0.0632 -0.0465 102 PRO A CA  
787  C C   . PRO A 102 ? 0.5550 0.8326 0.5217 -0.0222 -0.0760 -0.0603 102 PRO A C   
788  O O   . PRO A 102 ? 0.5894 0.8888 0.5564 -0.0207 -0.0808 -0.0560 102 PRO A O   
789  C CB  . PRO A 102 ? 0.4871 0.7445 0.4874 -0.0359 -0.0638 -0.0422 102 PRO A CB  
790  C CG  . PRO A 102 ? 0.3682 0.6388 0.3770 -0.0347 -0.0565 -0.0254 102 PRO A CG  
791  C CD  . PRO A 102 ? 0.4160 0.6897 0.4068 -0.0229 -0.0493 -0.0184 102 PRO A CD  
792  N N   . SER A 103 ? 0.6638 0.9292 0.6221 -0.0214 -0.0822 -0.0775 103 SER A N   
793  C CA  . SER A 103 ? 0.7346 1.0124 0.6850 -0.0203 -0.0960 -0.0938 103 SER A CA  
794  C C   . SER A 103 ? 0.7330 0.9969 0.7018 -0.0325 -0.1075 -0.1080 103 SER A C   
795  O O   . SER A 103 ? 0.8565 1.0954 0.8312 -0.0361 -0.1057 -0.1136 103 SER A O   
796  C CB  . SER A 103 ? 0.8131 1.0925 0.7361 -0.0073 -0.0961 -0.1054 103 SER A CB  
797  O OG  . SER A 103 ? 0.8723 1.1602 0.7882 -0.0066 -0.1110 -0.1251 103 SER A OG  
798  N N   . PRO A 104 ? 0.6541 0.9343 0.6344 -0.0394 -0.1197 -0.1129 104 PRO A N   
799  C CA  . PRO A 104 ? 0.5730 0.8837 0.5500 -0.0359 -0.1237 -0.1060 104 PRO A CA  
800  C C   . PRO A 104 ? 0.6083 0.9297 0.5945 -0.0354 -0.1123 -0.0829 104 PRO A C   
801  O O   . PRO A 104 ? 0.7354 1.0433 0.7366 -0.0413 -0.1031 -0.0724 104 PRO A O   
802  C CB  . PRO A 104 ? 0.4918 0.8110 0.4881 -0.0474 -0.1398 -0.1174 104 PRO A CB  
803  C CG  . PRO A 104 ? 0.5438 0.8360 0.5505 -0.0561 -0.1455 -0.1324 104 PRO A CG  
804  C CD  . PRO A 104 ? 0.6173 0.8846 0.6197 -0.0531 -0.1313 -0.1250 104 PRO A CD  
805  N N   . ARG A 105 ? 0.4774 0.8232 0.4539 -0.0276 -0.1136 -0.0755 105 ARG A N   
806  C CA  . ARG A 105 ? 0.4749 0.8312 0.4585 -0.0249 -0.1043 -0.0551 105 ARG A CA  
807  C C   . ARG A 105 ? 0.5143 0.8753 0.5274 -0.0362 -0.1059 -0.0491 105 ARG A C   
808  O O   . ARG A 105 ? 0.5597 0.9362 0.5850 -0.0424 -0.1181 -0.0560 105 ARG A O   
809  C CB  . ARG A 105 ? 0.4255 0.8073 0.3945 -0.0144 -0.1078 -0.0488 105 ARG A CB  
810  C CG  . ARG A 105 ? 0.4066 0.8027 0.3896 -0.0129 -0.1036 -0.0304 105 ARG A CG  
811  C CD  . ARG A 105 ? 0.4029 0.8091 0.3696 -0.0005 -0.0980 -0.0165 105 ARG A CD  
812  N NE  . ARG A 105 ? 0.6781 1.1018 0.6242 0.0066  -0.1074 -0.0238 105 ARG A NE  
813  C CZ  . ARG A 105 ? 0.6218 1.0627 0.5535 0.0172  -0.1071 -0.0123 105 ARG A CZ  
814  N NH1 . ARG A 105 ? 0.6040 1.0450 0.5419 0.0216  -0.0988 0.0067  105 ARG A NH1 
815  N NH2 . ARG A 105 ? 0.5881 1.0459 0.4997 0.0235  -0.1158 -0.0203 105 ARG A NH2 
816  N N   . PRO A 106 ? 0.4913 0.8422 0.5166 -0.0388 -0.0942 -0.0365 106 PRO A N   
817  C CA  . PRO A 106 ? 0.4229 0.7819 0.4757 -0.0484 -0.0941 -0.0296 106 PRO A CA  
818  C C   . PRO A 106 ? 0.5009 0.8881 0.5611 -0.0442 -0.0978 -0.0211 106 PRO A C   
819  O O   . PRO A 106 ? 0.5676 0.9653 0.6120 -0.0331 -0.0980 -0.0166 106 PRO A O   
820  C CB  . PRO A 106 ? 0.4754 0.8182 0.5318 -0.0478 -0.0794 -0.0180 106 PRO A CB  
821  C CG  . PRO A 106 ? 0.5116 0.8484 0.5445 -0.0352 -0.0723 -0.0136 106 PRO A CG  
822  C CD  . PRO A 106 ? 0.5342 0.8697 0.5478 -0.0317 -0.0806 -0.0271 106 PRO A CD  
823  N N   . LYS A 107 ? 0.5650 0.9652 0.6509 -0.0530 -0.1006 -0.0179 107 LYS A N   
824  C CA  . LYS A 107 ? 0.5925 1.0202 0.6905 -0.0491 -0.1031 -0.0090 107 LYS A CA  
825  C C   . LYS A 107 ? 0.6635 1.0900 0.7749 -0.0479 -0.0899 0.0049  107 LYS A C   
826  O O   . LYS A 107 ? 0.7458 1.1683 0.8755 -0.0579 -0.0860 0.0063  107 LYS A O   
827  C CB  . LYS A 107 ? 0.5938 1.0421 0.7123 -0.0592 -0.1169 -0.0165 107 LYS A CB  
828  C CG  . LYS A 107 ? 0.6355 1.1152 0.7631 -0.0531 -0.1224 -0.0095 107 LYS A CG  
829  C CD  . LYS A 107 ? 0.6146 1.1136 0.7399 -0.0545 -0.1402 -0.0213 107 LYS A CD  
830  C CE  . LYS A 107 ? 0.5515 1.0555 0.7015 -0.0713 -0.1511 -0.0324 107 LYS A CE  
831  N NZ  . LYS A 107 ? 0.4229 0.9350 0.5644 -0.0735 -0.1692 -0.0498 107 LYS A NZ  
832  N N   . SER A 108 ? 0.6402 1.0691 0.7421 -0.0354 -0.0831 0.0150  108 SER A N   
833  C CA  . SER A 108 ? 0.6156 1.0449 0.7284 -0.0316 -0.0717 0.0263  108 SER A CA  
834  C C   . SER A 108 ? 0.5759 0.9850 0.6921 -0.0386 -0.0619 0.0266  108 SER A C   
835  O O   . SER A 108 ? 0.7722 1.1885 0.9086 -0.0477 -0.0603 0.0283  108 SER A O   
836  C CB  . SER A 108 ? 0.6479 1.1062 0.7851 -0.0329 -0.0755 0.0310  108 SER A CB  
837  O OG  . SER A 108 ? 0.6774 1.1388 0.8286 -0.0313 -0.0648 0.0395  108 SER A OG  
838  N N   . THR A 109 ? 0.4231 0.8086 0.5207 -0.0345 -0.0554 0.0261  109 THR A N   
839  C CA  . THR A 109 ? 0.4794 0.8454 0.5782 -0.0399 -0.0468 0.0267  109 THR A CA  
840  C C   . THR A 109 ? 0.3867 0.7414 0.4755 -0.0301 -0.0360 0.0341  109 THR A C   
841  O O   . THR A 109 ? 0.2913 0.6489 0.3710 -0.0200 -0.0358 0.0378  109 THR A O   
842  C CB  . THR A 109 ? 0.5331 0.8788 0.6210 -0.0461 -0.0506 0.0163  109 THR A CB  
843  O OG1 . THR A 109 ? 0.6683 0.9982 0.7631 -0.0532 -0.0440 0.0179  109 THR A OG1 
844  C CG2 . THR A 109 ? 0.5364 0.8690 0.6001 -0.0366 -0.0486 0.0143  109 THR A CG2 
845  N N   . THR A 110 ? 0.2896 0.6316 0.3815 -0.0336 -0.0277 0.0366  110 THR A N   
846  C CA  . THR A 110 ? 0.3710 0.7028 0.4556 -0.0255 -0.0181 0.0424  110 THR A CA  
847  C C   . THR A 110 ? 0.3775 0.6931 0.4421 -0.0186 -0.0176 0.0405  110 THR A C   
848  O O   . THR A 110 ? 0.3951 0.6975 0.4492 -0.0219 -0.0198 0.0344  110 THR A O   
849  C CB  . THR A 110 ? 0.3940 0.7151 0.4832 -0.0314 -0.0108 0.0445  110 THR A CB  
850  O OG1 . THR A 110 ? 0.4881 0.8264 0.5974 -0.0391 -0.0108 0.0479  110 THR A OG1 
851  C CG2 . THR A 110 ? 0.3754 0.6893 0.4581 -0.0227 -0.0017 0.0495  110 THR A CG2 
852  N N   . VAL A 111 ? 0.3344 0.6511 0.3950 -0.0088 -0.0147 0.0459  111 VAL A N   
853  C CA  . VAL A 111 ? 0.4520 0.7544 0.4970 -0.0026 -0.0127 0.0469  111 VAL A CA  
854  C C   . VAL A 111 ? 0.4810 0.7705 0.5251 0.0009  -0.0046 0.0498  111 VAL A C   
855  O O   . VAL A 111 ? 0.3616 0.6574 0.4151 0.0043  -0.0013 0.0530  111 VAL A O   
856  C CB  . VAL A 111 ? 0.4979 0.8096 0.5396 0.0052  -0.0171 0.0516  111 VAL A CB  
857  C CG1 . VAL A 111 ? 0.5424 0.8671 0.5979 0.0106  -0.0170 0.0568  111 VAL A CG1 
858  C CG2 . VAL A 111 ? 0.5068 0.8047 0.5364 0.0109  -0.0136 0.0555  111 VAL A CG2 
859  N N   . MET A 112 ? 0.4560 0.7288 0.4886 0.0004  -0.0016 0.0479  112 MET A N   
860  C CA  . MET A 112 ? 0.2631 0.5231 0.2922 0.0046  0.0045  0.0502  112 MET A CA  
861  C C   . MET A 112 ? 0.3457 0.5992 0.3659 0.0100  0.0040  0.0530  112 MET A C   
862  O O   . MET A 112 ? 0.3038 0.5551 0.3145 0.0087  0.0021  0.0512  112 MET A O   
863  C CB  . MET A 112 ? 0.3039 0.5511 0.3294 -0.0004 0.0085  0.0470  112 MET A CB  
864  C CG  . MET A 112 ? 0.4891 0.7413 0.5245 -0.0067 0.0101  0.0469  112 MET A CG  
865  S SD  . MET A 112 ? 0.4997 0.7362 0.5319 -0.0143 0.0118  0.0439  112 MET A SD  
866  C CE  . MET A 112 ? 0.5975 0.8208 0.6215 -0.0082 0.0184  0.0464  112 MET A CE  
867  N N   . VAL A 113 ? 0.3330 0.5835 0.3568 0.0160  0.0057  0.0574  113 VAL A N   
868  C CA  . VAL A 113 ? 0.2926 0.5366 0.3119 0.0203  0.0055  0.0623  113 VAL A CA  
869  C C   . VAL A 113 ? 0.3312 0.5612 0.3487 0.0210  0.0099  0.0613  113 VAL A C   
870  O O   . VAL A 113 ? 0.3661 0.5931 0.3894 0.0235  0.0116  0.0598  113 VAL A O   
871  C CB  . VAL A 113 ? 0.3210 0.5706 0.3486 0.0266  0.0022  0.0683  113 VAL A CB  
872  C CG1 . VAL A 113 ? 0.3058 0.5469 0.3320 0.0299  0.0020  0.0753  113 VAL A CG1 
873  C CG2 . VAL A 113 ? 0.2676 0.5328 0.2967 0.0265  -0.0028 0.0698  113 VAL A CG2 
874  N N   . TRP A 114 ? 0.3790 0.6027 0.3885 0.0196  0.0114  0.0619  114 TRP A N   
875  C CA  . TRP A 114 ? 0.4050 0.6171 0.4131 0.0200  0.0149  0.0611  114 TRP A CA  
876  C C   . TRP A 114 ? 0.4007 0.6088 0.4142 0.0235  0.0139  0.0675  114 TRP A C   
877  O O   . TRP A 114 ? 0.3541 0.5669 0.3669 0.0244  0.0123  0.0742  114 TRP A O   
878  C CB  . TRP A 114 ? 0.4169 0.6256 0.4155 0.0172  0.0171  0.0581  114 TRP A CB  
879  C CG  . TRP A 114 ? 0.5872 0.7868 0.5852 0.0181  0.0201  0.0584  114 TRP A CG  
880  C CD1 . TRP A 114 ? 0.5546 0.7540 0.5507 0.0193  0.0215  0.0625  114 TRP A CD1 
881  C CD2 . TRP A 114 ? 0.6680 0.8599 0.6680 0.0183  0.0221  0.0551  114 TRP A CD2 
882  N NE1 . TRP A 114 ? 0.3172 0.5089 0.3154 0.0197  0.0236  0.0613  114 TRP A NE1 
883  C CE2 . TRP A 114 ? 0.5119 0.6985 0.5116 0.0194  0.0237  0.0565  114 TRP A CE2 
884  C CE3 . TRP A 114 ? 0.6485 0.8396 0.6507 0.0177  0.0228  0.0519  114 TRP A CE3 
885  C CZ2 . TRP A 114 ? 0.4607 0.6406 0.4615 0.0204  0.0249  0.0538  114 TRP A CZ2 
886  C CZ3 . TRP A 114 ? 0.5439 0.7286 0.5457 0.0190  0.0248  0.0501  114 TRP A CZ3 
887  C CH2 . TRP A 114 ? 0.3883 0.5671 0.3891 0.0205  0.0253  0.0506  114 TRP A CH2 
888  N N   . ILE A 115 ? 0.3082 0.5079 0.3272 0.0255  0.0146  0.0656  115 ILE A N   
889  C CA  . ILE A 115 ? 0.3218 0.5148 0.3489 0.0278  0.0125  0.0703  115 ILE A CA  
890  C C   . ILE A 115 ? 0.2771 0.4628 0.3028 0.0261  0.0148  0.0684  115 ILE A C   
891  O O   . ILE A 115 ? 0.3996 0.5810 0.4244 0.0270  0.0157  0.0618  115 ILE A O   
892  C CB  . ILE A 115 ? 0.2597 0.4494 0.2964 0.0328  0.0093  0.0677  115 ILE A CB  
893  C CG1 . ILE A 115 ? 0.3246 0.5243 0.3628 0.0351  0.0077  0.0681  115 ILE A CG1 
894  C CG2 . ILE A 115 ? 0.3052 0.4869 0.3528 0.0348  0.0053  0.0735  115 ILE A CG2 
895  C CD1 . ILE A 115 ? 0.2906 0.4881 0.3397 0.0419  0.0039  0.0670  115 ILE A CD1 
896  N N   . TYR A 116 ? 0.2582 0.4446 0.2840 0.0242  0.0158  0.0746  116 TYR A N   
897  C CA  . TYR A 116 ? 0.3976 0.5798 0.4234 0.0228  0.0179  0.0729  116 TYR A CA  
898  C C   . TYR A 116 ? 0.3319 0.5054 0.3691 0.0239  0.0143  0.0713  116 TYR A C   
899  O O   . TYR A 116 ? 0.3004 0.4699 0.3478 0.0253  0.0101  0.0743  116 TYR A O   
900  C CB  . TYR A 116 ? 0.2588 0.4474 0.2832 0.0209  0.0207  0.0804  116 TYR A CB  
901  C CG  . TYR A 116 ? 0.3430 0.5347 0.3767 0.0204  0.0188  0.0920  116 TYR A CG  
902  C CD1 . TYR A 116 ? 0.2668 0.4507 0.3157 0.0195  0.0152  0.0959  116 TYR A CD1 
903  C CD2 . TYR A 116 ? 0.2693 0.4719 0.2969 0.0207  0.0202  0.0995  116 TYR A CD2 
904  C CE1 . TYR A 116 ? 0.2740 0.4593 0.3336 0.0183  0.0132  0.1084  116 TYR A CE1 
905  C CE2 . TYR A 116 ? 0.3270 0.5333 0.3629 0.0203  0.0189  0.1125  116 TYR A CE2 
906  C CZ  . TYR A 116 ? 0.3341 0.5310 0.3869 0.0187  0.0155  0.1178  116 TYR A CZ  
907  O OH  . TYR A 116 ? 0.3550 0.5544 0.4180 0.0177  0.0138  0.1328  116 TYR A OH  
908  N N   . GLY A 117 ? 0.2547 0.4248 0.2905 0.0237  0.0152  0.0661  117 GLY A N   
909  C CA  . GLY A 117 ? 0.4645 0.6277 0.5107 0.0244  0.0110  0.0637  117 GLY A CA  
910  C C   . GLY A 117 ? 0.5101 0.6751 0.5648 0.0208  0.0112  0.0702  117 GLY A C   
911  O O   . GLY A 117 ? 0.4418 0.6139 0.4964 0.0184  0.0144  0.0790  117 GLY A O   
912  N N   . GLY A 118 ? 0.4707 0.6313 0.5327 0.0207  0.0076  0.0657  118 GLY A N   
913  C CA  . GLY A 118 ? 0.4208 0.5838 0.4957 0.0167  0.0065  0.0720  118 GLY A CA  
914  C C   . GLY A 118 ? 0.4197 0.5737 0.5128 0.0150  -0.0017 0.0718  118 GLY A C   
915  O O   . GLY A 118 ? 0.3925 0.5479 0.5013 0.0100  -0.0034 0.0809  118 GLY A O   
916  N N   . GLY A 119 ? 0.3977 0.5428 0.4896 0.0194  -0.0069 0.0616  119 GLY A N   
917  C CA  . GLY A 119 ? 0.3827 0.5174 0.4904 0.0194  -0.0162 0.0562  119 GLY A CA  
918  C C   . GLY A 119 ? 0.5138 0.6398 0.6380 0.0172  -0.0210 0.0637  119 GLY A C   
919  O O   . GLY A 119 ? 0.6296 0.7458 0.7716 0.0152  -0.0295 0.0613  119 GLY A O   
920  N N   . PHE A 120 ? 0.5055 0.6344 0.6253 0.0177  -0.0168 0.0726  120 PHE A N   
921  C CA  . PHE A 120 ? 0.5499 0.6718 0.6850 0.0159  -0.0207 0.0832  120 PHE A CA  
922  C C   . PHE A 120 ? 0.5430 0.6657 0.6969 0.0075  -0.0220 0.0967  120 PHE A C   
923  O O   . PHE A 120 ? 0.4943 0.6083 0.6658 0.0049  -0.0270 0.1062  120 PHE A O   
924  C CB  . PHE A 120 ? 0.5721 0.6783 0.7166 0.0213  -0.0299 0.0731  120 PHE A CB  
925  C CG  . PHE A 120 ? 0.6418 0.7499 0.7702 0.0301  -0.0283 0.0607  120 PHE A CG  
926  C CD1 . PHE A 120 ? 0.6896 0.8038 0.8096 0.0333  -0.0240 0.0660  120 PHE A CD1 
927  C CD2 . PHE A 120 ? 0.5858 0.6918 0.7080 0.0354  -0.0312 0.0445  120 PHE A CD2 
928  C CE1 . PHE A 120 ? 0.6310 0.7494 0.7389 0.0407  -0.0223 0.0558  120 PHE A CE1 
929  C CE2 . PHE A 120 ? 0.5679 0.6786 0.6763 0.0434  -0.0288 0.0350  120 PHE A CE2 
930  C CZ  . PHE A 120 ? 0.5293 0.6464 0.6316 0.0456  -0.0241 0.0410  120 PHE A CZ  
931  N N   . TYR A 121 ? 0.4190 0.5524 0.5713 0.0034  -0.0177 0.0985  121 TYR A N   
932  C CA  . TYR A 121 ? 0.3836 0.5246 0.5524 -0.0045 -0.0162 0.1139  121 TYR A CA  
933  C C   . TYR A 121 ? 0.4466 0.6069 0.6016 -0.0051 -0.0051 0.1239  121 TYR A C   
934  O O   . TYR A 121 ? 0.5165 0.6876 0.6829 -0.0106 -0.0017 0.1391  121 TYR A O   
935  C CB  . TYR A 121 ? 0.5753 0.7149 0.7589 -0.0089 -0.0216 0.1080  121 TYR A CB  
936  C CG  . TYR A 121 ? 0.4769 0.6287 0.6461 -0.0067 -0.0163 0.1000  121 TYR A CG  
937  C CD1 . TYR A 121 ? 0.3862 0.5555 0.5557 -0.0100 -0.0086 0.1102  121 TYR A CD1 
938  C CD2 . TYR A 121 ? 0.4021 0.5486 0.5579 -0.0006 -0.0191 0.0829  121 TYR A CD2 
939  C CE1 . TYR A 121 ? 0.4294 0.6084 0.5870 -0.0069 -0.0044 0.1030  121 TYR A CE1 
940  C CE2 . TYR A 121 ? 0.4907 0.6471 0.6343 0.0017  -0.0148 0.0774  121 TYR A CE2 
941  C CZ  . TYR A 121 ? 0.5108 0.6824 0.6558 -0.0013 -0.0078 0.0871  121 TYR A CZ  
942  O OH  . TYR A 121 ? 0.5602 0.7403 0.6940 0.0021  -0.0039 0.0814  121 TYR A OH  
943  N N   . SER A 122 ? 0.4406 0.6062 0.5722 0.0006  0.0004  0.1157  122 SER A N   
944  C CA  . SER A 122 ? 0.5496 0.7322 0.6669 0.0013  0.0098  0.1209  122 SER A CA  
945  C C   . SER A 122 ? 0.4730 0.6561 0.5684 0.0070  0.0130  0.1133  122 SER A C   
946  O O   . SER A 122 ? 0.4593 0.6317 0.5512 0.0101  0.0089  0.1048  122 SER A O   
947  C CB  . SER A 122 ? 0.5441 0.7343 0.6615 0.0006  0.0124  0.1160  122 SER A CB  
948  O OG  . SER A 122 ? 0.5716 0.7536 0.6790 0.0047  0.0099  0.1003  122 SER A OG  
949  N N   . GLY A 123 ? 0.4743 0.6706 0.5555 0.0085  0.0203  0.1158  123 GLY A N   
950  C CA  . GLY A 123 ? 0.5671 0.7644 0.6295 0.0127  0.0225  0.1087  123 GLY A CA  
951  C C   . GLY A 123 ? 0.6053 0.8151 0.6583 0.0138  0.0264  0.1174  123 GLY A C   
952  O O   . GLY A 123 ? 0.4260 0.6398 0.4871 0.0122  0.0255  0.1303  123 GLY A O   
953  N N   . SER A 124 ? 0.6753 0.8911 0.7110 0.0168  0.0301  0.1102  124 SER A N   
954  C CA  . SER A 124 ? 0.6745 0.9036 0.6983 0.0189  0.0331  0.1152  124 SER A CA  
955  C C   . SER A 124 ? 0.7543 0.9805 0.7636 0.0213  0.0318  0.1033  124 SER A C   
956  O O   . SER A 124 ? 0.7694 0.9870 0.7751 0.0215  0.0316  0.0921  124 SER A O   
957  C CB  . SER A 124 ? 0.6625 0.9069 0.6814 0.0204  0.0395  0.1193  124 SER A CB  
958  O OG  . SER A 124 ? 0.8010 1.0446 0.8346 0.0176  0.0406  0.1232  124 SER A OG  
959  N N   . SER A 125 ? 0.5981 0.8319 0.6002 0.0228  0.0304  0.1068  125 SER A N   
960  C CA  . SER A 125 ? 0.3977 0.6323 0.3872 0.0242  0.0286  0.0964  125 SER A CA  
961  C C   . SER A 125 ? 0.4363 0.6783 0.4116 0.0266  0.0321  0.0890  125 SER A C   
962  O O   . SER A 125 ? 0.3752 0.6141 0.3418 0.0269  0.0301  0.0779  125 SER A O   
963  C CB  . SER A 125 ? 0.3968 0.6393 0.3841 0.0255  0.0250  0.1027  125 SER A CB  
964  O OG  . SER A 125 ? 0.3363 0.5954 0.3153 0.0279  0.0275  0.1114  125 SER A OG  
965  N N   . THR A 126 ? 0.4675 0.7190 0.4416 0.0285  0.0370  0.0945  126 THR A N   
966  C CA  . THR A 126 ? 0.4588 0.7219 0.4182 0.0331  0.0404  0.0888  126 THR A CA  
967  C C   . THR A 126 ? 0.4446 0.7020 0.4037 0.0347  0.0439  0.0802  126 THR A C   
968  O O   . THR A 126 ? 0.4440 0.7124 0.3938 0.0399  0.0479  0.0769  126 THR A O   
969  C CB  . THR A 126 ? 0.5039 0.7875 0.4605 0.0358  0.0444  0.1023  126 THR A CB  
970  O OG1 . THR A 126 ? 0.3883 0.6736 0.3597 0.0334  0.0483  0.1137  126 THR A OG1 
971  C CG2 . THR A 126 ? 0.6454 0.9338 0.6024 0.0348  0.0402  0.1118  126 THR A CG2 
972  N N   . LEU A 127 ? 0.3949 0.6365 0.3633 0.0316  0.0422  0.0763  127 LEU A N   
973  C CA  . LEU A 127 ? 0.2862 0.5215 0.2543 0.0337  0.0446  0.0686  127 LEU A CA  
974  C C   . LEU A 127 ? 0.4922 0.7217 0.4478 0.0364  0.0430  0.0550  127 LEU A C   
975  O O   . LEU A 127 ? 0.8093 1.0375 0.7585 0.0351  0.0392  0.0508  127 LEU A O   
976  C CB  . LEU A 127 ? 0.2931 0.5143 0.2730 0.0302  0.0424  0.0683  127 LEU A CB  
977  C CG  . LEU A 127 ? 0.2916 0.5152 0.2863 0.0270  0.0419  0.0795  127 LEU A CG  
978  C CD1 . LEU A 127 ? 0.3560 0.5674 0.3600 0.0253  0.0394  0.0760  127 LEU A CD1 
979  C CD2 . LEU A 127 ? 0.2745 0.5142 0.2736 0.0283  0.0466  0.0890  127 LEU A CD2 
980  N N   . ASP A 128 ? 0.4977 0.7232 0.4511 0.0404  0.0454  0.0481  128 ASP A N   
981  C CA  . ASP A 128 ? 0.4623 0.6784 0.4061 0.0428  0.0430  0.0347  128 ASP A CA  
982  C C   . ASP A 128 ? 0.5181 0.7163 0.4665 0.0372  0.0386  0.0310  128 ASP A C   
983  O O   . ASP A 128 ? 0.6179 0.8096 0.5613 0.0355  0.0347  0.0231  128 ASP A O   
984  C CB  . ASP A 128 ? 0.5489 0.7649 0.4904 0.0498  0.0465  0.0287  128 ASP A CB  
985  C CG  . ASP A 128 ? 0.6855 0.9231 0.6234 0.0560  0.0523  0.0333  128 ASP A CG  
986  O OD1 . ASP A 128 ? 0.8244 1.0718 0.7724 0.0546  0.0559  0.0449  128 ASP A OD1 
987  O OD2 . ASP A 128 ? 0.6548 0.9004 0.5802 0.0625  0.0530  0.0250  128 ASP A OD2 
988  N N   . VAL A 129 ? 0.5273 0.7190 0.4857 0.0343  0.0390  0.0367  129 VAL A N   
989  C CA  . VAL A 129 ? 0.4990 0.6771 0.4613 0.0299  0.0360  0.0346  129 VAL A CA  
990  C C   . VAL A 129 ? 0.4652 0.6456 0.4291 0.0251  0.0328  0.0369  129 VAL A C   
991  O O   . VAL A 129 ? 0.6822 0.8546 0.6483 0.0214  0.0306  0.0345  129 VAL A O   
992  C CB  . VAL A 129 ? 0.4139 0.5870 0.3845 0.0296  0.0369  0.0392  129 VAL A CB  
993  C CG1 . VAL A 129 ? 0.2832 0.4502 0.2528 0.0340  0.0386  0.0355  129 VAL A CG1 
994  C CG2 . VAL A 129 ? 0.2709 0.4539 0.2486 0.0293  0.0380  0.0473  129 VAL A CG2 
995  N N   . TYR A 130 ? 0.3701 0.5622 0.3342 0.0252  0.0328  0.0427  130 TYR A N   
996  C CA  . TYR A 130 ? 0.4452 0.6408 0.4112 0.0220  0.0293  0.0449  130 TYR A CA  
997  C C   . TYR A 130 ? 0.5040 0.7069 0.4611 0.0223  0.0265  0.0399  130 TYR A C   
998  O O   . TYR A 130 ? 0.6040 0.8153 0.5616 0.0213  0.0239  0.0437  130 TYR A O   
999  C CB  . TYR A 130 ? 0.4247 0.6273 0.3977 0.0221  0.0295  0.0551  130 TYR A CB  
1000 C CG  . TYR A 130 ? 0.4664 0.6630 0.4494 0.0219  0.0306  0.0592  130 TYR A CG  
1001 C CD1 . TYR A 130 ? 0.5434 0.7298 0.5283 0.0214  0.0307  0.0545  130 TYR A CD1 
1002 C CD2 . TYR A 130 ? 0.4096 0.6109 0.4006 0.0221  0.0308  0.0682  130 TYR A CD2 
1003 C CE1 . TYR A 130 ? 0.5328 0.7152 0.5257 0.0218  0.0306  0.0568  130 TYR A CE1 
1004 C CE2 . TYR A 130 ? 0.3679 0.5633 0.3691 0.0215  0.0302  0.0703  130 TYR A CE2 
1005 C CZ  . TYR A 130 ? 0.4786 0.6651 0.4801 0.0218  0.0298  0.0637  130 TYR A CZ  
1006 O OH  . TYR A 130 ? 0.4489 0.6308 0.4595 0.0218  0.0281  0.0644  130 TYR A OH  
1007 N N   . ASN A 131 ? 0.4866 0.6864 0.4356 0.0244  0.0264  0.0308  131 ASN A N   
1008 C CA  . ASN A 131 ? 0.5243 0.7317 0.4636 0.0257  0.0227  0.0236  131 ASN A CA  
1009 C C   . ASN A 131 ? 0.5029 0.7031 0.4462 0.0197  0.0170  0.0174  131 ASN A C   
1010 O O   . ASN A 131 ? 0.6471 0.8337 0.5927 0.0174  0.0158  0.0106  131 ASN A O   
1011 C CB  . ASN A 131 ? 0.6113 0.8185 0.5408 0.0317  0.0243  0.0148  131 ASN A CB  
1012 C CG  . ASN A 131 ? 0.7266 0.9404 0.6445 0.0339  0.0193  0.0039  131 ASN A CG  
1013 O OD1 . ASN A 131 ? 0.9007 1.1206 0.8182 0.0305  0.0141  0.0037  131 ASN A OD1 
1014 N ND2 . ASN A 131 ? 0.6873 0.9006 0.5960 0.0405  0.0201  -0.0062 131 ASN A ND2 
1015 N N   . GLY A 132 ? 0.4587 0.6687 0.4039 0.0173  0.0133  0.0206  132 GLY A N   
1016 C CA  . GLY A 132 ? 0.4949 0.7022 0.4472 0.0110  0.0082  0.0169  132 GLY A CA  
1017 C C   . GLY A 132 ? 0.5787 0.7835 0.5266 0.0088  0.0019  0.0043  132 GLY A C   
1018 O O   . GLY A 132 ? 0.5949 0.7980 0.5515 0.0022  -0.0028 0.0016  132 GLY A O   
1019 N N   . LYS A 133 ? 0.5349 0.7399 0.4708 0.0142  0.0014  -0.0042 133 LYS A N   
1020 C CA  . LYS A 133 ? 0.6068 0.8094 0.5381 0.0129  -0.0063 -0.0186 133 LYS A CA  
1021 C C   . LYS A 133 ? 0.6460 0.8293 0.5888 0.0056  -0.0094 -0.0244 133 LYS A C   
1022 O O   . LYS A 133 ? 0.5977 0.7785 0.5443 0.0004  -0.0175 -0.0337 133 LYS A O   
1023 C CB  . LYS A 133 ? 0.5938 0.7999 0.5093 0.0221  -0.0057 -0.0279 133 LYS A CB  
1024 C CG  . LYS A 133 ? 0.4978 0.6850 0.4133 0.0244  -0.0045 -0.0372 133 LYS A CG  
1025 C CD  . LYS A 133 ? 0.5525 0.7472 0.4556 0.0353  0.0018  -0.0380 133 LYS A CD  
1026 C CE  . LYS A 133 ? 0.5259 0.7150 0.4184 0.0426  -0.0020 -0.0561 133 LYS A CE  
1027 N NZ  . LYS A 133 ? 0.4505 0.6579 0.3285 0.0544  0.0042  -0.0559 133 LYS A NZ  
1028 N N   . TYR A 134 ? 0.6154 0.7857 0.5649 0.0047  -0.0035 -0.0181 134 TYR A N   
1029 C CA  . TYR A 134 ? 0.5205 0.6726 0.4809 -0.0018 -0.0055 -0.0206 134 TYR A CA  
1030 C C   . TYR A 134 ? 0.4874 0.6428 0.4622 -0.0108 -0.0059 -0.0119 134 TYR A C   
1031 O O   . TYR A 134 ? 0.5563 0.7039 0.5418 -0.0188 -0.0107 -0.0150 134 TYR A O   
1032 C CB  . TYR A 134 ? 0.5004 0.6390 0.4606 0.0023  0.0008  -0.0170 134 TYR A CB  
1033 C CG  . TYR A 134 ? 0.5076 0.6457 0.4552 0.0123  0.0026  -0.0245 134 TYR A CG  
1034 C CD1 . TYR A 134 ? 0.4840 0.6315 0.4260 0.0190  0.0097  -0.0171 134 TYR A CD1 
1035 C CD2 . TYR A 134 ? 0.5249 0.6542 0.4671 0.0152  -0.0031 -0.0394 134 TYR A CD2 
1036 C CE1 . TYR A 134 ? 0.5453 0.6962 0.4771 0.0283  0.0122  -0.0228 134 TYR A CE1 
1037 C CE2 . TYR A 134 ? 0.5673 0.6989 0.4975 0.0259  -0.0008 -0.0469 134 TYR A CE2 
1038 C CZ  . TYR A 134 ? 0.5953 0.7391 0.5205 0.0325  0.0074  -0.0378 134 TYR A CZ  
1039 O OH  . TYR A 134 ? 0.6387 0.7886 0.5533 0.0433  0.0106  -0.0442 134 TYR A OH  
1040 N N   . LEU A 135 ? 0.4303 0.5974 0.4066 -0.0094 -0.0010 -0.0011 135 LEU A N   
1041 C CA  . LEU A 135 ? 0.4591 0.6314 0.4485 -0.0159 -0.0004 0.0068  135 LEU A CA  
1042 C C   . LEU A 135 ? 0.5480 0.7339 0.5427 -0.0207 -0.0072 0.0037  135 LEU A C   
1043 O O   . LEU A 135 ? 0.5728 0.7595 0.5808 -0.0289 -0.0101 0.0046  135 LEU A O   
1044 C CB  . LEU A 135 ? 0.4808 0.6599 0.4703 -0.0116 0.0062  0.0172  135 LEU A CB  
1045 C CG  . LEU A 135 ? 0.5490 0.7374 0.5500 -0.0151 0.0080  0.0251  135 LEU A CG  
1046 C CD1 . LEU A 135 ? 0.4445 0.6258 0.4559 -0.0223 0.0087  0.0271  135 LEU A CD1 
1047 C CD2 . LEU A 135 ? 0.5678 0.7583 0.5665 -0.0088 0.0136  0.0320  135 LEU A CD2 
1048 N N   . ALA A 136 ? 0.6013 0.7994 0.5864 -0.0156 -0.0101 0.0008  136 ALA A N   
1049 C CA  . ALA A 136 ? 0.3837 0.5958 0.3720 -0.0190 -0.0181 -0.0035 136 ALA A CA  
1050 C C   . ALA A 136 ? 0.3799 0.5831 0.3732 -0.0260 -0.0260 -0.0153 136 ALA A C   
1051 O O   . ALA A 136 ? 0.3549 0.5629 0.3629 -0.0346 -0.0309 -0.0154 136 ALA A O   
1052 C CB  . ALA A 136 ? 0.3383 0.5639 0.3122 -0.0111 -0.0199 -0.0047 136 ALA A CB  
1053 N N   . TYR A 137 ? 0.3665 0.5565 0.3495 -0.0224 -0.0275 -0.0256 137 TYR A N   
1054 C CA  . TYR A 137 ? 0.4581 0.6371 0.4458 -0.0282 -0.0367 -0.0391 137 TYR A CA  
1055 C C   . TYR A 137 ? 0.5746 0.7394 0.5816 -0.0388 -0.0365 -0.0345 137 TYR A C   
1056 O O   . TYR A 137 ? 0.5574 0.7254 0.5795 -0.0487 -0.0435 -0.0366 137 TYR A O   
1057 C CB  . TYR A 137 ? 0.4580 0.6247 0.4304 -0.0201 -0.0376 -0.0515 137 TYR A CB  
1058 C CG  . TYR A 137 ? 0.5711 0.7205 0.5496 -0.0252 -0.0472 -0.0667 137 TYR A CG  
1059 C CD1 . TYR A 137 ? 0.6321 0.7571 0.6171 -0.0268 -0.0455 -0.0679 137 TYR A CD1 
1060 C CD2 . TYR A 137 ? 0.6095 0.7665 0.5885 -0.0285 -0.0591 -0.0798 137 TYR A CD2 
1061 C CE1 . TYR A 137 ? 0.7099 0.8160 0.7027 -0.0317 -0.0553 -0.0817 137 TYR A CE1 
1062 C CE2 . TYR A 137 ? 0.7071 0.8464 0.6936 -0.0337 -0.0695 -0.0951 137 TYR A CE2 
1063 C CZ  . TYR A 137 ? 0.7336 0.8463 0.7276 -0.0355 -0.0676 -0.0960 137 TYR A CZ  
1064 O OH  . TYR A 137 ? 0.6298 0.7222 0.6330 -0.0407 -0.0788 -0.1113 137 TYR A OH  
1065 N N   . THR A 138 ? 0.6774 0.8281 0.6851 -0.0371 -0.0285 -0.0271 138 THR A N   
1066 C CA  . THR A 138 ? 0.6559 0.7918 0.6802 -0.0463 -0.0282 -0.0221 138 THR A CA  
1067 C C   . THR A 138 ? 0.5477 0.6982 0.5889 -0.0552 -0.0266 -0.0102 138 THR A C   
1068 O O   . THR A 138 ? 0.3852 0.5301 0.4439 -0.0659 -0.0301 -0.0080 138 THR A O   
1069 C CB  . THR A 138 ? 0.7034 0.8240 0.7230 -0.0410 -0.0199 -0.0154 138 THR A CB  
1070 O OG1 . THR A 138 ? 0.8959 1.0005 0.9052 -0.0345 -0.0228 -0.0276 138 THR A OG1 
1071 C CG2 . THR A 138 ? 0.5672 0.6771 0.6035 -0.0499 -0.0177 -0.0051 138 THR A CG2 
1072 N N   . GLU A 139 ? 0.3577 0.5275 0.3955 -0.0508 -0.0215 -0.0024 139 GLU A N   
1073 C CA  . GLU A 139 ? 0.5098 0.6959 0.5631 -0.0570 -0.0191 0.0083  139 GLU A CA  
1074 C C   . GLU A 139 ? 0.4894 0.6967 0.5473 -0.0587 -0.0257 0.0050  139 GLU A C   
1075 O O   . GLU A 139 ? 0.3978 0.6221 0.4692 -0.0625 -0.0239 0.0133  139 GLU A O   
1076 C CB  . GLU A 139 ? 0.5894 0.7812 0.6383 -0.0502 -0.0086 0.0199  139 GLU A CB  
1077 C CG  . GLU A 139 ? 0.6498 0.8240 0.6968 -0.0493 -0.0022 0.0253  139 GLU A CG  
1078 C CD  . GLU A 139 ? 0.6402 0.8094 0.7044 -0.0601 -0.0022 0.0320  139 GLU A CD  
1079 O OE1 . GLU A 139 ? 0.5327 0.7185 0.6117 -0.0670 -0.0028 0.0374  139 GLU A OE1 
1080 O OE2 . GLU A 139 ? 0.6759 0.8255 0.7401 -0.0616 -0.0015 0.0329  139 GLU A OE2 
1081 N N   . GLU A 140 ? 0.4720 0.6808 0.5189 -0.0552 -0.0333 -0.0067 140 GLU A N   
1082 C CA  . GLU A 140 ? 0.4350 0.6644 0.4851 -0.0564 -0.0412 -0.0106 140 GLU A CA  
1083 C C   . GLU A 140 ? 0.4051 0.6546 0.4567 -0.0510 -0.0357 0.0007  140 GLU A C   
1084 O O   . GLU A 140 ? 0.4051 0.6733 0.4706 -0.0551 -0.0391 0.0040  140 GLU A O   
1085 C CB  . GLU A 140 ? 0.5251 0.7576 0.5961 -0.0694 -0.0499 -0.0145 140 GLU A CB  
1086 C CG  . GLU A 140 ? 0.7714 0.9991 0.8378 -0.0716 -0.0627 -0.0316 140 GLU A CG  
1087 C CD  . GLU A 140 ? 0.9953 1.2259 1.0857 -0.0859 -0.0727 -0.0355 140 GLU A CD  
1088 O OE1 . GLU A 140 ? 0.9708 1.1966 1.0802 -0.0951 -0.0681 -0.0253 140 GLU A OE1 
1089 O OE2 . GLU A 140 ? 1.0858 1.3251 1.1766 -0.0880 -0.0851 -0.0481 140 GLU A OE2 
1090 N N   . VAL A 141 ? 0.3275 0.5733 0.3661 -0.0415 -0.0278 0.0062  141 VAL A N   
1091 C CA  . VAL A 141 ? 0.4739 0.7349 0.5122 -0.0347 -0.0237 0.0152  141 VAL A CA  
1092 C C   . VAL A 141 ? 0.4244 0.6885 0.4452 -0.0256 -0.0255 0.0130  141 VAL A C   
1093 O O   . VAL A 141 ? 0.4242 0.6777 0.4315 -0.0231 -0.0264 0.0062  141 VAL A O   
1094 C CB  . VAL A 141 ? 0.4885 0.7434 0.5286 -0.0314 -0.0134 0.0246  141 VAL A CB  
1095 C CG1 . VAL A 141 ? 0.5042 0.7575 0.5597 -0.0398 -0.0105 0.0286  141 VAL A CG1 
1096 C CG2 . VAL A 141 ? 0.5746 0.8119 0.5994 -0.0257 -0.0087 0.0234  141 VAL A CG2 
1097 N N   . VAL A 142 ? 0.3085 0.5881 0.3302 -0.0201 -0.0258 0.0197  142 VAL A N   
1098 C CA  . VAL A 142 ? 0.3096 0.5936 0.3169 -0.0112 -0.0260 0.0223  142 VAL A CA  
1099 C C   . VAL A 142 ? 0.4098 0.6832 0.4135 -0.0057 -0.0170 0.0302  142 VAL A C   
1100 O O   . VAL A 142 ? 0.4062 0.6812 0.4200 -0.0046 -0.0131 0.0368  142 VAL A O   
1101 C CB  . VAL A 142 ? 0.3711 0.6760 0.3827 -0.0079 -0.0317 0.0269  142 VAL A CB  
1102 C CG1 . VAL A 142 ? 0.3716 0.6792 0.3738 0.0016  -0.0289 0.0360  142 VAL A CG1 
1103 C CG2 . VAL A 142 ? 0.3666 0.6828 0.3747 -0.0110 -0.0421 0.0175  142 VAL A CG2 
1104 N N   . LEU A 143 ? 0.4664 0.7302 0.4566 -0.0018 -0.0140 0.0290  143 LEU A N   
1105 C CA  . LEU A 143 ? 0.3656 0.6188 0.3542 0.0022  -0.0064 0.0355  143 LEU A CA  
1106 C C   . LEU A 143 ? 0.3332 0.5925 0.3146 0.0092  -0.0055 0.0433  143 LEU A C   
1107 O O   . LEU A 143 ? 0.3361 0.6007 0.3055 0.0119  -0.0072 0.0416  143 LEU A O   
1108 C CB  . LEU A 143 ? 0.3309 0.5683 0.3134 0.0007  -0.0026 0.0300  143 LEU A CB  
1109 C CG  . LEU A 143 ? 0.4004 0.6295 0.3866 0.0035  0.0042  0.0371  143 LEU A CG  
1110 C CD1 . LEU A 143 ? 0.5199 0.7455 0.5174 -0.0006 0.0061  0.0377  143 LEU A CD1 
1111 C CD2 . LEU A 143 ? 0.3632 0.5815 0.3413 0.0060  0.0084  0.0358  143 LEU A CD2 
1112 N N   . VAL A 144 ? 0.3288 0.5876 0.3179 0.0124  -0.0028 0.0520  144 VAL A N   
1113 C CA  . VAL A 144 ? 0.3795 0.6406 0.3661 0.0181  -0.0017 0.0618  144 VAL A CA  
1114 C C   . VAL A 144 ? 0.4761 0.7234 0.4643 0.0189  0.0043  0.0644  144 VAL A C   
1115 O O   . VAL A 144 ? 0.6892 0.9279 0.6845 0.0173  0.0066  0.0616  144 VAL A O   
1116 C CB  . VAL A 144 ? 0.4011 0.6705 0.3978 0.0217  -0.0050 0.0695  144 VAL A CB  
1117 C CG1 . VAL A 144 ? 0.2870 0.5550 0.2839 0.0268  -0.0039 0.0814  144 VAL A CG1 
1118 C CG2 . VAL A 144 ? 0.3216 0.6074 0.3183 0.0212  -0.0118 0.0673  144 VAL A CG2 
1119 N N   . SER A 145 ? 0.4656 0.7127 0.4478 0.0214  0.0067  0.0700  145 SER A N   
1120 C CA  . SER A 145 ? 0.4535 0.6906 0.4410 0.0225  0.0108  0.0751  145 SER A CA  
1121 C C   . SER A 145 ? 0.3898 0.6319 0.3814 0.0257  0.0097  0.0879  145 SER A C   
1122 O O   . SER A 145 ? 0.2908 0.5444 0.2745 0.0274  0.0092  0.0935  145 SER A O   
1123 C CB  . SER A 145 ? 0.4931 0.7254 0.4730 0.0217  0.0152  0.0713  145 SER A CB  
1124 O OG  . SER A 145 ? 0.3609 0.6040 0.3298 0.0238  0.0158  0.0733  145 SER A OG  
1125 N N   . LEU A 146 ? 0.3441 0.5779 0.3483 0.0269  0.0090  0.0926  146 LEU A N   
1126 C CA  . LEU A 146 ? 0.2847 0.5198 0.2965 0.0295  0.0071  0.1056  146 LEU A CA  
1127 C C   . LEU A 146 ? 0.3833 0.6120 0.3997 0.0280  0.0105  0.1123  146 LEU A C   
1128 O O   . LEU A 146 ? 0.3898 0.6165 0.4011 0.0258  0.0146  0.1073  146 LEU A O   
1129 C CB  . LEU A 146 ? 0.3135 0.5427 0.3383 0.0326  0.0029  0.1060  146 LEU A CB  
1130 C CG  . LEU A 146 ? 0.3483 0.5657 0.3802 0.0327  0.0035  0.0963  146 LEU A CG  
1131 C CD1 . LEU A 146 ? 0.4609 0.6657 0.5009 0.0321  0.0042  0.0992  146 LEU A CD1 
1132 C CD2 . LEU A 146 ? 0.2769 0.4956 0.3178 0.0375  -0.0005 0.0943  146 LEU A CD2 
1133 N N   . SER A 147 ? 0.3833 0.6089 0.4110 0.0291  0.0083  0.1246  147 SER A N   
1134 C CA  . SER A 147 ? 0.4495 0.6684 0.4872 0.0266  0.0101  0.1321  147 SER A CA  
1135 C C   . SER A 147 ? 0.4887 0.6966 0.5440 0.0280  0.0047  0.1401  147 SER A C   
1136 O O   . SER A 147 ? 0.5890 0.7982 0.6464 0.0319  0.0005  0.1431  147 SER A O   
1137 C CB  . SER A 147 ? 0.4610 0.6937 0.4923 0.0253  0.0147  0.1438  147 SER A CB  
1138 O OG  . SER A 147 ? 0.4956 0.7395 0.5241 0.0280  0.0127  0.1561  147 SER A OG  
1139 N N   . TYR A 148 ? 0.3893 0.5859 0.4581 0.0252  0.0041  0.1426  148 TYR A N   
1140 C CA  . TYR A 148 ? 0.3570 0.5392 0.4448 0.0262  -0.0022 0.1480  148 TYR A CA  
1141 C C   . TYR A 148 ? 0.3129 0.4893 0.4144 0.0205  -0.0018 0.1559  148 TYR A C   
1142 O O   . TYR A 148 ? 0.4074 0.5890 0.5036 0.0170  0.0030  0.1519  148 TYR A O   
1143 C CB  . TYR A 148 ? 0.3419 0.5116 0.4335 0.0303  -0.0065 0.1321  148 TYR A CB  
1144 C CG  . TYR A 148 ? 0.4033 0.5689 0.4906 0.0283  -0.0040 0.1183  148 TYR A CG  
1145 C CD1 . TYR A 148 ? 0.2851 0.4594 0.3561 0.0284  0.0007  0.1086  148 TYR A CD1 
1146 C CD2 . TYR A 148 ? 0.2981 0.4510 0.3985 0.0261  -0.0072 0.1154  148 TYR A CD2 
1147 C CE1 . TYR A 148 ? 0.3310 0.5017 0.3981 0.0270  0.0028  0.0980  148 TYR A CE1 
1148 C CE2 . TYR A 148 ? 0.3788 0.5297 0.4746 0.0250  -0.0056 0.1036  148 TYR A CE2 
1149 C CZ  . TYR A 148 ? 0.4215 0.5814 0.5001 0.0257  -0.0002 0.0956  148 TYR A CZ  
1150 O OH  . TYR A 148 ? 0.3874 0.5453 0.4613 0.0251  0.0013  0.0854  148 TYR A OH  
1151 N N   . ARG A 149 ? 0.4568 0.6229 0.5773 0.0194  -0.0070 0.1678  149 ARG A N   
1152 C CA  . ARG A 149 ? 0.4425 0.6049 0.5793 0.0124  -0.0069 0.1774  149 ARG A CA  
1153 C C   . ARG A 149 ? 0.5375 0.6852 0.6832 0.0109  -0.0109 0.1617  149 ARG A C   
1154 O O   . ARG A 149 ? 0.6096 0.7440 0.7575 0.0158  -0.0166 0.1481  149 ARG A O   
1155 C CB  . ARG A 149 ? 0.4431 0.5976 0.6005 0.0104  -0.0119 0.1968  149 ARG A CB  
1156 C CG  . ARG A 149 ? 0.4873 0.6503 0.6375 0.0152  -0.0119 0.2092  149 ARG A CG  
1157 C CD  . ARG A 149 ? 0.5464 0.6964 0.7197 0.0140  -0.0185 0.2267  149 ARG A CD  
1158 N NE  . ARG A 149 ? 0.6215 0.7628 0.7944 0.0226  -0.0247 0.2227  149 ARG A NE  
1159 C CZ  . ARG A 149 ? 0.5912 0.7169 0.7832 0.0250  -0.0325 0.2336  149 ARG A CZ  
1160 N NH1 . ARG A 149 ? 0.5366 0.6523 0.7511 0.0181  -0.0353 0.2507  149 ARG A NH1 
1161 N NH2 . ARG A 149 ? 0.5137 0.6345 0.7035 0.0343  -0.0374 0.2274  149 ARG A NH2 
1162 N N   . VAL A 150 ? 0.5147 0.6670 0.6657 0.0048  -0.0080 0.1635  150 VAL A N   
1163 C CA  . VAL A 150 ? 0.4203 0.5617 0.5796 0.0030  -0.0122 0.1495  150 VAL A CA  
1164 C C   . VAL A 150 ? 0.3309 0.4646 0.5171 -0.0047 -0.0172 0.1606  150 VAL A C   
1165 O O   . VAL A 150 ? 0.4659 0.6051 0.6631 -0.0091 -0.0157 0.1805  150 VAL A O   
1166 C CB  . VAL A 150 ? 0.4829 0.6363 0.6261 0.0029  -0.0055 0.1396  150 VAL A CB  
1167 C CG1 . VAL A 150 ? 0.4569 0.6130 0.5776 0.0096  -0.0027 0.1269  150 VAL A CG1 
1168 C CG2 . VAL A 150 ? 0.3039 0.4765 0.4442 -0.0013 0.0028  0.1539  150 VAL A CG2 
1169 N N   . GLY A 151 ? 0.4753 0.5971 0.6725 -0.0063 -0.0238 0.1476  151 GLY A N   
1170 C CA  . GLY A 151 ? 0.5475 0.6599 0.7731 -0.0142 -0.0309 0.1546  151 GLY A CA  
1171 C C   . GLY A 151 ? 0.5453 0.6391 0.7900 -0.0142 -0.0394 0.1627  151 GLY A C   
1172 O O   . GLY A 151 ? 0.6111 0.6981 0.8469 -0.0065 -0.0409 0.1593  151 GLY A O   
1173 N N   . ALA A 152 ? 0.5113 0.5973 0.7848 -0.0233 -0.0453 0.1745  152 ALA A N   
1174 C CA  . ALA A 152 ? 0.5548 0.6213 0.8511 -0.0248 -0.0540 0.1856  152 ALA A CA  
1175 C C   . ALA A 152 ? 0.5653 0.6391 0.8509 -0.0203 -0.0482 0.2026  152 ALA A C   
1176 O O   . ALA A 152 ? 0.6084 0.6651 0.9025 -0.0156 -0.0552 0.2048  152 ALA A O   
1177 C CB  . ALA A 152 ? 0.5411 0.6041 0.8705 -0.0377 -0.0585 0.2021  152 ALA A CB  
1178 N N   . PHE A 153 ? 0.5083 0.6079 0.7750 -0.0208 -0.0361 0.2136  153 PHE A N   
1179 C CA  . PHE A 153 ? 0.6621 0.7715 0.9144 -0.0154 -0.0310 0.2268  153 PHE A CA  
1180 C C   . PHE A 153 ? 0.6356 0.7370 0.8705 -0.0041 -0.0339 0.2092  153 PHE A C   
1181 O O   . PHE A 153 ? 0.7035 0.8040 0.9357 0.0012  -0.0350 0.2184  153 PHE A O   
1182 C CB  . PHE A 153 ? 0.6311 0.7705 0.8631 -0.0166 -0.0181 0.2366  153 PHE A CB  
1183 C CG  . PHE A 153 ? 0.6376 0.7898 0.8852 -0.0266 -0.0137 0.2517  153 PHE A CG  
1184 C CD1 . PHE A 153 ? 0.6649 0.8223 0.9312 -0.0329 -0.0128 0.2793  153 PHE A CD1 
1185 C CD2 . PHE A 153 ? 0.6055 0.7657 0.8506 -0.0296 -0.0105 0.2396  153 PHE A CD2 
1186 C CE1 . PHE A 153 ? 0.6653 0.8375 0.9482 -0.0426 -0.0080 0.2947  153 PHE A CE1 
1187 C CE2 . PHE A 153 ? 0.6330 0.8076 0.8944 -0.0385 -0.0063 0.2537  153 PHE A CE2 
1188 C CZ  . PHE A 153 ? 0.6444 0.8258 0.9252 -0.0453 -0.0048 0.2813  153 PHE A CZ  
1189 N N   . GLY A 154 ? 0.6193 0.7164 0.8434 -0.0001 -0.0351 0.1852  154 GLY A N   
1190 C CA  . GLY A 154 ? 0.6516 0.7456 0.8593 0.0102  -0.0362 0.1693  154 GLY A CA  
1191 C C   . GLY A 154 ? 0.5839 0.6558 0.8024 0.0156  -0.0464 0.1509  154 GLY A C   
1192 O O   . GLY A 154 ? 0.4718 0.5402 0.6821 0.0251  -0.0484 0.1410  154 GLY A O   
1193 N N   . PHE A 155 ? 0.5670 0.6252 0.8038 0.0105  -0.0533 0.1450  155 PHE A N   
1194 C CA  . PHE A 155 ? 0.5597 0.5988 0.8029 0.0174  -0.0631 0.1238  155 PHE A CA  
1195 C C   . PHE A 155 ? 0.5730 0.5889 0.8468 0.0124  -0.0754 0.1245  155 PHE A C   
1196 O O   . PHE A 155 ? 0.5143 0.5160 0.7935 0.0166  -0.0842 0.1040  155 PHE A O   
1197 C CB  . PHE A 155 ? 0.3758 0.4238 0.6003 0.0200  -0.0597 0.1037  155 PHE A CB  
1198 C CG  . PHE A 155 ? 0.4620 0.5278 0.6595 0.0259  -0.0499 0.1003  155 PHE A CG  
1199 C CD1 . PHE A 155 ? 0.4497 0.5349 0.6324 0.0209  -0.0396 0.1094  155 PHE A CD1 
1200 C CD2 . PHE A 155 ? 0.4588 0.5225 0.6473 0.0367  -0.0514 0.0882  155 PHE A CD2 
1201 C CE1 . PHE A 155 ? 0.4548 0.5545 0.6148 0.0255  -0.0320 0.1056  155 PHE A CE1 
1202 C CE2 . PHE A 155 ? 0.4544 0.5351 0.6210 0.0408  -0.0429 0.0859  155 PHE A CE2 
1203 C CZ  . PHE A 155 ? 0.4707 0.5682 0.6236 0.0347  -0.0338 0.0944  155 PHE A CZ  
1204 N N   . LEU A 156 ? 0.5194 0.5314 0.8138 0.0038  -0.0768 0.1473  156 LEU A N   
1205 C CA  . LEU A 156 ? 0.5878 0.5742 0.9147 -0.0007 -0.0900 0.1493  156 LEU A CA  
1206 C C   . LEU A 156 ? 0.5594 0.5245 0.8914 0.0113  -0.0991 0.1395  156 LEU A C   
1207 O O   . LEU A 156 ? 0.6586 0.6290 0.9806 0.0183  -0.0949 0.1485  156 LEU A O   
1208 C CB  . LEU A 156 ? 0.5964 0.5855 0.9448 -0.0129 -0.0882 0.1796  156 LEU A CB  
1209 C CG  . LEU A 156 ? 0.5948 0.5591 0.9814 -0.0218 -0.1017 0.1841  156 LEU A CG  
1210 C CD1 . LEU A 156 ? 0.6065 0.5846 1.0107 -0.0373 -0.0968 0.2085  156 LEU A CD1 
1211 C CD2 . LEU A 156 ? 0.5161 0.4556 0.9211 -0.0168 -0.1110 0.1929  156 LEU A CD2 
1212 N N   . ALA A 157 ? 0.5162 0.4585 0.8628 0.0148  -0.1119 0.1195  157 ALA A N   
1213 C CA  . ALA A 157 ? 0.6528 0.5764 1.0015 0.0291  -0.1204 0.1045  157 ALA A CA  
1214 C C   . ALA A 157 ? 0.7801 0.6708 1.1637 0.0266  -0.1369 0.1027  157 ALA A C   
1215 O O   . ALA A 157 ? 0.8561 0.7360 1.2530 0.0211  -0.1456 0.0893  157 ALA A O   
1216 C CB  . ALA A 157 ? 0.5973 0.5277 0.9226 0.0410  -0.1196 0.0747  157 ALA A CB  
1217 N N   . LEU A 158 ? 0.7824 0.6569 1.1814 0.0309  -0.1419 0.1159  158 LEU A N   
1218 C CA  . LEU A 158 ? 0.7941 0.6332 1.2273 0.0309  -0.1587 0.1139  158 LEU A CA  
1219 C C   . LEU A 158 ? 0.7886 0.6148 1.2182 0.0493  -0.1635 0.1034  158 LEU A C   
1220 O O   . LEU A 158 ? 0.8850 0.7029 1.3264 0.0513  -0.1647 0.1241  158 LEU A O   
1221 C CB  . LEU A 158 ? 0.8033 0.6350 1.2645 0.0160  -0.1600 0.1471  158 LEU A CB  
1222 C CG  . LEU A 158 ? 0.7086 0.5532 1.1791 -0.0024 -0.1561 0.1591  158 LEU A CG  
1223 C CD1 . LEU A 158 ? 0.6813 0.5328 1.1669 -0.0138 -0.1502 0.1974  158 LEU A CD1 
1224 C CD2 . LEU A 158 ? 0.7216 0.5405 1.2216 -0.0092 -0.1724 0.1430  158 LEU A CD2 
1225 N N   . HIS A 159 ? 0.6842 0.5116 1.0968 0.0633  -0.1657 0.0724  159 HIS A N   
1226 C CA  . HIS A 159 ? 0.7308 0.5529 1.1363 0.0824  -0.1679 0.0608  159 HIS A CA  
1227 C C   . HIS A 159 ? 0.7367 0.5228 1.1755 0.0867  -0.1832 0.0657  159 HIS A C   
1228 O O   . HIS A 159 ? 0.6742 0.4331 1.1393 0.0805  -0.1969 0.0590  159 HIS A O   
1229 C CB  . HIS A 159 ? 0.8286 0.6566 1.2148 0.0961  -0.1692 0.0258  159 HIS A CB  
1230 C CG  . HIS A 159 ? 0.8975 0.7276 1.2735 0.1167  -0.1690 0.0128  159 HIS A CG  
1231 N ND1 . HIS A 159 ? 0.8655 0.7244 1.2177 0.1227  -0.1553 0.0202  159 HIS A ND1 
1232 C CD2 . HIS A 159 ? 0.9391 0.7474 1.3265 0.1332  -0.1810 -0.0082 159 HIS A CD2 
1233 C CE1 . HIS A 159 ? 0.9759 0.8322 1.3263 0.1415  -0.1584 0.0058  159 HIS A CE1 
1234 N NE2 . HIS A 159 ? 1.0082 0.8343 1.3789 0.1490  -0.1737 -0.0118 159 HIS A NE2 
1235 N N   . GLY A 160 ? 0.7883 0.5742 1.2268 0.0974  -0.1815 0.0774  160 GLY A N   
1236 C CA  . GLY A 160 ? 0.7800 0.5354 1.2495 0.0998  -0.1933 0.0923  160 GLY A CA  
1237 C C   . GLY A 160 ? 0.6757 0.4388 1.1533 0.0876  -0.1868 0.1323  160 GLY A C   
1238 O O   . GLY A 160 ? 0.7001 0.4443 1.1981 0.0919  -0.1938 0.1495  160 GLY A O   
1239 N N   . SER A 161 ? 0.6657 0.4569 1.1271 0.0735  -0.1737 0.1473  161 SER A N   
1240 C CA  . SER A 161 ? 0.8068 0.6116 1.2710 0.0626  -0.1657 0.1845  161 SER A CA  
1241 C C   . SER A 161 ? 0.8506 0.6910 1.2809 0.0694  -0.1511 0.1900  161 SER A C   
1242 O O   . SER A 161 ? 0.8189 0.6807 1.2222 0.0732  -0.1429 0.1700  161 SER A O   
1243 C CB  . SER A 161 ? 0.9216 0.7347 1.3935 0.0419  -0.1613 0.1987  161 SER A CB  
1244 O OG  . SER A 161 ? 0.9472 0.7899 1.4044 0.0342  -0.1474 0.2272  161 SER A OG  
1245 N N   . GLN A 162 ? 0.8962 0.7427 1.3289 0.0709  -0.1485 0.2175  162 GLN A N   
1246 C CA  . GLN A 162 ? 0.9222 0.8036 1.3250 0.0751  -0.1356 0.2261  162 GLN A CA  
1247 C C   . GLN A 162 ? 0.8829 0.7891 1.2760 0.0600  -0.1242 0.2521  162 GLN A C   
1248 O O   . GLN A 162 ? 0.8819 0.8188 1.2480 0.0618  -0.1133 0.2568  162 GLN A O   
1249 C CB  . GLN A 162 ? 0.9761 0.8541 1.3828 0.0894  -0.1398 0.2372  162 GLN A CB  
1250 C CG  . GLN A 162 ? 0.9417 0.7951 1.3602 0.1064  -0.1514 0.2122  162 GLN A CG  
1251 C CD  . GLN A 162 ? 0.9194 0.7929 1.3115 0.1174  -0.1453 0.1820  162 GLN A CD  
1252 O OE1 . GLN A 162 ? 0.9081 0.8135 1.2753 0.1191  -0.1345 0.1852  162 GLN A OE1 
1253 N NE2 . GLN A 162 ? 0.8502 0.7061 1.2479 0.1245  -0.1524 0.1525  162 GLN A NE2 
1254 N N   . GLU A 163 ? 0.9074 0.8022 1.3226 0.0453  -0.1267 0.2683  163 GLU A N   
1255 C CA  . GLU A 163 ? 0.8357 0.7567 1.2417 0.0312  -0.1150 0.2902  163 GLU A CA  
1256 C C   . GLU A 163 ? 0.7689 0.7076 1.1554 0.0252  -0.1068 0.2698  163 GLU A C   
1257 O O   . GLU A 163 ? 0.7518 0.7202 1.1177 0.0196  -0.0945 0.2795  163 GLU A O   
1258 C CB  . GLU A 163 ? 0.8547 0.7597 1.2943 0.0176  -0.1202 0.3178  163 GLU A CB  
1259 C CG  . GLU A 163 ? 0.9069 0.8015 1.3630 0.0215  -0.1251 0.3476  163 GLU A CG  
1260 C CD  . GLU A 163 ? 0.9415 0.8711 1.3773 0.0196  -0.1125 0.3768  163 GLU A CD  
1261 O OE1 . GLU A 163 ? 0.9570 0.9183 1.3645 0.0167  -0.1000 0.3716  163 GLU A OE1 
1262 O OE2 . GLU A 163 ? 0.9791 0.9045 1.4269 0.0219  -0.1155 0.4049  163 GLU A OE2 
1263 N N   . ALA A 164 ? 0.7451 0.6663 1.1375 0.0271  -0.1139 0.2415  164 ALA A N   
1264 C CA  . ALA A 164 ? 0.7175 0.6547 1.0894 0.0243  -0.1071 0.2197  164 ALA A CA  
1265 C C   . ALA A 164 ? 0.8287 0.7506 1.1969 0.0362  -0.1148 0.1864  164 ALA A C   
1266 O O   . ALA A 164 ? 0.8924 0.7921 1.2788 0.0342  -0.1251 0.1713  164 ALA A O   
1267 C CB  . ALA A 164 ? 0.5267 0.4637 0.9143 0.0083  -0.1069 0.2260  164 ALA A CB  
1268 N N   . PRO A 165 ? 0.7686 0.7033 1.1136 0.0491  -0.1102 0.1741  165 PRO A N   
1269 C CA  . PRO A 165 ? 0.7329 0.6566 1.0737 0.0622  -0.1164 0.1438  165 PRO A CA  
1270 C C   . PRO A 165 ? 0.5752 0.5133 0.8956 0.0608  -0.1107 0.1217  165 PRO A C   
1271 O O   . PRO A 165 ? 0.5436 0.4710 0.8637 0.0687  -0.1170 0.0964  165 PRO A O   
1272 C CB  . PRO A 165 ? 0.7972 0.7326 1.1242 0.0759  -0.1130 0.1452  165 PRO A CB  
1273 C CG  . PRO A 165 ? 0.7772 0.7411 1.0861 0.0685  -0.1007 0.1660  165 PRO A CG  
1274 C CD  . PRO A 165 ? 0.7881 0.7479 1.1123 0.0530  -0.1003 0.1886  165 PRO A CD  
1275 N N   . GLY A 166 ? 0.5449 0.5074 0.8476 0.0516  -0.0989 0.1310  166 GLY A N   
1276 C CA  . GLY A 166 ? 0.6524 0.6305 0.9338 0.0512  -0.0924 0.1126  166 GLY A CA  
1277 C C   . GLY A 166 ? 0.6738 0.6734 0.9285 0.0604  -0.0835 0.1052  166 GLY A C   
1278 O O   . GLY A 166 ? 0.8134 0.8152 1.0667 0.0688  -0.0837 0.1101  166 GLY A O   
1279 N N   . ASN A 167 ? 0.6345 0.6507 0.8690 0.0582  -0.0759 0.0940  167 ASN A N   
1280 C CA  . ASN A 167 ? 0.6272 0.6659 0.8370 0.0634  -0.0663 0.0893  167 ASN A CA  
1281 C C   . ASN A 167 ? 0.5316 0.5862 0.7342 0.0597  -0.0595 0.1100  167 ASN A C   
1282 O O   . ASN A 167 ? 0.5607 0.6330 0.7461 0.0639  -0.0532 0.1076  167 ASN A O   
1283 C CB  . ASN A 167 ? 0.6447 0.6819 0.8517 0.0779  -0.0695 0.0733  167 ASN A CB  
1284 C CG  . ASN A 167 ? 0.6742 0.7001 0.8834 0.0839  -0.0755 0.0505  167 ASN A CG  
1285 O OD1 . ASN A 167 ? 0.7196 0.7488 0.9216 0.0781  -0.0734 0.0428  167 ASN A OD1 
1286 N ND2 . ASN A 167 ? 0.5811 0.5944 0.8002 0.0965  -0.0833 0.0388  167 ASN A ND2 
1287 N N   . VAL A 168 ? 0.4445 0.4943 0.6601 0.0519  -0.0608 0.1305  168 VAL A N   
1288 C CA  . VAL A 168 ? 0.4390 0.5041 0.6474 0.0508  -0.0557 0.1501  168 VAL A CA  
1289 C C   . VAL A 168 ? 0.4568 0.5463 0.6411 0.0463  -0.0449 0.1495  168 VAL A C   
1290 O O   . VAL A 168 ? 0.5504 0.6562 0.7216 0.0491  -0.0407 0.1558  168 VAL A O   
1291 C CB  . VAL A 168 ? 0.4122 0.4692 0.6396 0.0436  -0.0588 0.1743  168 VAL A CB  
1292 C CG1 . VAL A 168 ? 0.4357 0.4637 0.6903 0.0470  -0.0710 0.1728  168 VAL A CG1 
1293 C CG2 . VAL A 168 ? 0.4339 0.4984 0.6613 0.0311  -0.0532 0.1820  168 VAL A CG2 
1294 N N   . GLY A 169 ? 0.3639 0.4559 0.5421 0.0405  -0.0411 0.1402  169 GLY A N   
1295 C CA  . GLY A 169 ? 0.3793 0.4916 0.5355 0.0372  -0.0316 0.1382  169 GLY A CA  
1296 C C   . GLY A 169 ? 0.4994 0.6200 0.6397 0.0440  -0.0290 0.1220  169 GLY A C   
1297 O O   . GLY A 169 ? 0.5172 0.6544 0.6403 0.0425  -0.0224 0.1219  169 GLY A O   
1298 N N   . LEU A 170 ? 0.6310 0.7408 0.7772 0.0514  -0.0343 0.1079  170 LEU A N   
1299 C CA  . LEU A 170 ? 0.5105 0.6309 0.6448 0.0587  -0.0318 0.0961  170 LEU A CA  
1300 C C   . LEU A 170 ? 0.4624 0.5924 0.5961 0.0631  -0.0323 0.1059  170 LEU A C   
1301 O O   . LEU A 170 ? 0.4640 0.6107 0.5848 0.0644  -0.0277 0.1028  170 LEU A O   
1302 C CB  . LEU A 170 ? 0.4198 0.5291 0.5606 0.0671  -0.0369 0.0790  170 LEU A CB  
1303 C CG  . LEU A 170 ? 0.4144 0.5218 0.5485 0.0640  -0.0350 0.0664  170 LEU A CG  
1304 C CD1 . LEU A 170 ? 0.4973 0.5936 0.6379 0.0730  -0.0414 0.0495  170 LEU A CD1 
1305 C CD2 . LEU A 170 ? 0.3518 0.4774 0.4663 0.0614  -0.0261 0.0629  170 LEU A CD2 
1306 N N   . LEU A 171 ? 0.3769 0.4969 0.5256 0.0649  -0.0382 0.1188  171 LEU A N   
1307 C CA  . LEU A 171 ? 0.4568 0.5867 0.6054 0.0695  -0.0395 0.1306  171 LEU A CA  
1308 C C   . LEU A 171 ? 0.5278 0.6770 0.6614 0.0630  -0.0334 0.1427  171 LEU A C   
1309 O O   . LEU A 171 ? 0.5783 0.7433 0.7038 0.0667  -0.0327 0.1447  171 LEU A O   
1310 C CB  . LEU A 171 ? 0.4039 0.5169 0.5727 0.0729  -0.0475 0.1433  171 LEU A CB  
1311 C CG  . LEU A 171 ? 0.3908 0.4837 0.5752 0.0814  -0.0551 0.1297  171 LEU A CG  
1312 C CD1 . LEU A 171 ? 0.4159 0.4866 0.6225 0.0800  -0.0631 0.1432  171 LEU A CD1 
1313 C CD2 . LEU A 171 ? 0.3894 0.4908 0.5725 0.0942  -0.0569 0.1208  171 LEU A CD2 
1314 N N   . ASP A 172 ? 0.3450 0.4948 0.4752 0.0542  -0.0295 0.1502  172 ASP A N   
1315 C CA  . ASP A 172 ? 0.5235 0.6931 0.6365 0.0496  -0.0232 0.1575  172 ASP A CA  
1316 C C   . ASP A 172 ? 0.4800 0.6627 0.5767 0.0504  -0.0192 0.1425  172 ASP A C   
1317 O O   . ASP A 172 ? 0.5245 0.7237 0.6102 0.0514  -0.0181 0.1452  172 ASP A O   
1318 C CB  . ASP A 172 ? 0.5401 0.7101 0.6517 0.0411  -0.0185 0.1646  172 ASP A CB  
1319 C CG  . ASP A 172 ? 0.7188 0.8762 0.8498 0.0381  -0.0222 0.1808  172 ASP A CG  
1320 O OD1 . ASP A 172 ? 0.7682 0.9065 0.9167 0.0404  -0.0288 0.1772  172 ASP A OD1 
1321 O OD2 . ASP A 172 ? 0.8153 0.9826 0.9453 0.0336  -0.0188 0.1978  172 ASP A OD2 
1322 N N   . GLN A 173 ? 0.3594 0.5354 0.4549 0.0498  -0.0175 0.1269  173 GLN A N   
1323 C CA  . GLN A 173 ? 0.3557 0.5431 0.4382 0.0499  -0.0136 0.1144  173 GLN A CA  
1324 C C   . GLN A 173 ? 0.4488 0.6454 0.5334 0.0566  -0.0167 0.1120  173 GLN A C   
1325 O O   . GLN A 173 ? 0.4436 0.6556 0.5184 0.0554  -0.0147 0.1093  173 GLN A O   
1326 C CB  . GLN A 173 ? 0.4315 0.6107 0.5134 0.0492  -0.0116 0.1001  173 GLN A CB  
1327 C CG  . GLN A 173 ? 0.4530 0.6237 0.5345 0.0434  -0.0093 0.0997  173 GLN A CG  
1328 C CD  . GLN A 173 ? 0.3991 0.5615 0.4815 0.0452  -0.0094 0.0855  173 GLN A CD  
1329 O OE1 . GLN A 173 ? 0.3653 0.5273 0.4500 0.0515  -0.0112 0.0768  173 GLN A OE1 
1330 N NE2 . GLN A 173 ? 0.2859 0.4440 0.3661 0.0404  -0.0072 0.0833  173 GLN A NE2 
1331 N N   . ARG A 174 ? 0.4197 0.6073 0.5184 0.0641  -0.0220 0.1123  174 ARG A N   
1332 C CA  . ARG A 174 ? 0.3399 0.5385 0.4420 0.0716  -0.0248 0.1102  174 ARG A CA  
1333 C C   . ARG A 174 ? 0.3757 0.5872 0.4749 0.0717  -0.0271 0.1240  174 ARG A C   
1334 O O   . ARG A 174 ? 0.4512 0.6798 0.5466 0.0739  -0.0277 0.1220  174 ARG A O   
1335 C CB  . ARG A 174 ? 0.3258 0.5113 0.4439 0.0814  -0.0303 0.1058  174 ARG A CB  
1336 C CG  . ARG A 174 ? 0.3342 0.5282 0.4610 0.0909  -0.0352 0.1105  174 ARG A CG  
1337 C CD  . ARG A 174 ? 0.3492 0.5257 0.4931 0.1011  -0.0417 0.1076  174 ARG A CD  
1338 N NE  . ARG A 174 ? 0.3466 0.5160 0.4911 0.1044  -0.0400 0.0900  174 ARG A NE  
1339 C CZ  . ARG A 174 ? 0.4438 0.5972 0.6009 0.1139  -0.0454 0.0815  174 ARG A CZ  
1340 N NH1 . ARG A 174 ? 0.4658 0.6048 0.6384 0.1201  -0.0532 0.0897  174 ARG A NH1 
1341 N NH2 . ARG A 174 ? 0.4195 0.5712 0.5733 0.1171  -0.0432 0.0649  174 ARG A NH2 
1342 N N   . MET A 175 ? 0.4026 0.6081 0.5034 0.0690  -0.0285 0.1385  175 MET A N   
1343 C CA  . MET A 175 ? 0.4664 0.6868 0.5618 0.0698  -0.0305 0.1523  175 MET A CA  
1344 C C   . MET A 175 ? 0.4544 0.6931 0.5312 0.0639  -0.0261 0.1481  175 MET A C   
1345 O O   . MET A 175 ? 0.3910 0.6472 0.4619 0.0661  -0.0286 0.1495  175 MET A O   
1346 C CB  . MET A 175 ? 0.4079 0.6201 0.5093 0.0683  -0.0321 0.1710  175 MET A CB  
1347 C CG  . MET A 175 ? 0.4727 0.6995 0.5715 0.0726  -0.0360 0.1864  175 MET A CG  
1348 S SD  . MET A 175 ? 0.5902 0.8057 0.7013 0.0725  -0.0388 0.2115  175 MET A SD  
1349 C CE  . MET A 175 ? 0.3888 0.5753 0.5254 0.0782  -0.0451 0.2053  175 MET A CE  
1350 N N   . ALA A 176 ? 0.4481 0.6828 0.5161 0.0568  -0.0204 0.1422  176 ALA A N   
1351 C CA  . ALA A 176 ? 0.4210 0.6695 0.4729 0.0520  -0.0169 0.1343  176 ALA A CA  
1352 C C   . ALA A 176 ? 0.4302 0.6865 0.4831 0.0533  -0.0179 0.1215  176 ALA A C   
1353 O O   . ALA A 176 ? 0.3750 0.6471 0.4198 0.0518  -0.0193 0.1186  176 ALA A O   
1354 C CB  . ALA A 176 ? 0.3039 0.5446 0.3489 0.0457  -0.0109 0.1290  176 ALA A CB  
1355 N N   . LEU A 177 ? 0.2986 0.5454 0.3619 0.0562  -0.0176 0.1138  177 LEU A N   
1356 C CA  . LEU A 177 ? 0.4036 0.6609 0.4699 0.0579  -0.0178 0.1038  177 LEU A CA  
1357 C C   . LEU A 177 ? 0.4006 0.6730 0.4730 0.0638  -0.0235 0.1093  177 LEU A C   
1358 O O   . LEU A 177 ? 0.4143 0.7037 0.4843 0.0618  -0.0246 0.1050  177 LEU A O   
1359 C CB  . LEU A 177 ? 0.2891 0.5358 0.3645 0.0619  -0.0160 0.0952  177 LEU A CB  
1360 C CG  . LEU A 177 ? 0.2811 0.5188 0.3502 0.0566  -0.0104 0.0864  177 LEU A CG  
1361 C CD1 . LEU A 177 ? 0.2801 0.5146 0.3568 0.0626  -0.0093 0.0773  177 LEU A CD1 
1362 C CD2 . LEU A 177 ? 0.2738 0.5218 0.3318 0.0488  -0.0068 0.0822  177 LEU A CD2 
1363 N N   . GLN A 178 ? 0.3228 0.5892 0.4043 0.0708  -0.0280 0.1193  178 GLN A N   
1364 C CA  . GLN A 178 ? 0.3462 0.6274 0.4330 0.0772  -0.0341 0.1264  178 GLN A CA  
1365 C C   . GLN A 178 ? 0.4141 0.7122 0.4873 0.0725  -0.0357 0.1316  178 GLN A C   
1366 O O   . GLN A 178 ? 0.5430 0.8604 0.6166 0.0739  -0.0397 0.1298  178 GLN A O   
1367 C CB  . GLN A 178 ? 0.3307 0.5997 0.4295 0.0853  -0.0389 0.1384  178 GLN A CB  
1368 C CG  . GLN A 178 ? 0.3403 0.6256 0.4433 0.0923  -0.0456 0.1479  178 GLN A CG  
1369 C CD  . GLN A 178 ? 0.3395 0.6314 0.4567 0.1013  -0.0482 0.1401  178 GLN A CD  
1370 O OE1 . GLN A 178 ? 0.5367 0.8481 0.6526 0.0999  -0.0477 0.1321  178 GLN A OE1 
1371 N NE2 . GLN A 178 ? 0.3526 0.6283 0.4844 0.1104  -0.0509 0.1413  178 GLN A NE2 
1372 N N   . TRP A 179 ? 0.3215 0.6143 0.3828 0.0672  -0.0329 0.1371  179 TRP A N   
1373 C CA  . TRP A 179 ? 0.3628 0.6725 0.4090 0.0643  -0.0345 0.1406  179 TRP A CA  
1374 C C   . TRP A 179 ? 0.3363 0.6583 0.3760 0.0588  -0.0344 0.1261  179 TRP A C   
1375 O O   . TRP A 179 ? 0.3233 0.6640 0.3576 0.0591  -0.0396 0.1256  179 TRP A O   
1376 C CB  . TRP A 179 ? 0.4037 0.7066 0.4386 0.0602  -0.0300 0.1476  179 TRP A CB  
1377 C CG  . TRP A 179 ? 0.3868 0.7080 0.4043 0.0593  -0.0314 0.1514  179 TRP A CG  
1378 C CD1 . TRP A 179 ? 0.3531 0.6847 0.3651 0.0637  -0.0340 0.1675  179 TRP A CD1 
1379 C CD2 . TRP A 179 ? 0.3660 0.6975 0.3690 0.0544  -0.0307 0.1385  179 TRP A CD2 
1380 N NE1 . TRP A 179 ? 0.4382 0.7884 0.4314 0.0626  -0.0350 0.1645  179 TRP A NE1 
1381 C CE2 . TRP A 179 ? 0.3491 0.6983 0.3370 0.0570  -0.0334 0.1457  179 TRP A CE2 
1382 C CE3 . TRP A 179 ? 0.3615 0.6888 0.3633 0.0484  -0.0284 0.1217  179 TRP A CE3 
1383 C CZ2 . TRP A 179 ? 0.4373 0.7992 0.4086 0.0542  -0.0346 0.1344  179 TRP A CZ2 
1384 C CZ3 . TRP A 179 ? 0.4475 0.7853 0.4348 0.0448  -0.0297 0.1118  179 TRP A CZ3 
1385 C CH2 . TRP A 179 ? 0.5027 0.8572 0.4747 0.0480  -0.0331 0.1170  179 TRP A CH2 
1386 N N   . VAL A 180 ? 0.3491 0.6610 0.3900 0.0536  -0.0291 0.1145  180 VAL A N   
1387 C CA  . VAL A 180 ? 0.3335 0.6548 0.3718 0.0475  -0.0290 0.1020  180 VAL A CA  
1388 C C   . VAL A 180 ? 0.4173 0.7540 0.4687 0.0508  -0.0337 0.1000  180 VAL A C   
1389 O O   . VAL A 180 ? 0.3299 0.6831 0.3803 0.0472  -0.0380 0.0950  180 VAL A O   
1390 C CB  . VAL A 180 ? 0.4116 0.7179 0.4497 0.0421  -0.0221 0.0929  180 VAL A CB  
1391 C CG1 . VAL A 180 ? 0.2849 0.5992 0.3247 0.0356  -0.0219 0.0821  180 VAL A CG1 
1392 C CG2 . VAL A 180 ? 0.5164 0.8111 0.5415 0.0387  -0.0179 0.0941  180 VAL A CG2 
1393 N N   . HIS A 181 ? 0.4208 0.7532 0.4857 0.0581  -0.0336 0.1036  181 HIS A N   
1394 C CA  . HIS A 181 ? 0.4510 0.8000 0.5299 0.0629  -0.0374 0.1020  181 HIS A CA  
1395 C C   . HIS A 181 ? 0.5464 0.9138 0.6245 0.0665  -0.0457 0.1094  181 HIS A C   
1396 O O   . HIS A 181 ? 0.6209 1.0086 0.7075 0.0669  -0.0501 0.1062  181 HIS A O   
1397 C CB  . HIS A 181 ? 0.4187 0.7580 0.5111 0.0722  -0.0358 0.1035  181 HIS A CB  
1398 C CG  . HIS A 181 ? 0.3847 0.7422 0.4927 0.0800  -0.0396 0.1030  181 HIS A CG  
1399 N ND1 . HIS A 181 ? 0.4726 0.8382 0.5872 0.0889  -0.0466 0.1124  181 HIS A ND1 
1400 C CD2 . HIS A 181 ? 0.2931 0.6638 0.4120 0.0807  -0.0369 0.0953  181 HIS A CD2 
1401 C CE1 . HIS A 181 ? 0.3560 0.7390 0.4854 0.0953  -0.0485 0.1094  181 HIS A CE1 
1402 N NE2 . HIS A 181 ? 0.3693 0.7567 0.5017 0.0902  -0.0423 0.0991  181 HIS A NE2 
1403 N N   . ASP A 182 ? 0.5974 0.9601 0.6657 0.0691  -0.0479 0.1198  182 ASP A N   
1404 C CA  . ASP A 182 ? 0.5057 0.8866 0.5711 0.0738  -0.0560 0.1287  182 ASP A CA  
1405 C C   . ASP A 182 ? 0.5106 0.9050 0.5591 0.0670  -0.0590 0.1241  182 ASP A C   
1406 O O   . ASP A 182 ? 0.5293 0.9449 0.5764 0.0695  -0.0669 0.1259  182 ASP A O   
1407 C CB  . ASP A 182 ? 0.3541 0.7249 0.4187 0.0812  -0.0572 0.1452  182 ASP A CB  
1408 C CG  . ASP A 182 ? 0.4712 0.8328 0.5549 0.0906  -0.0585 0.1499  182 ASP A CG  
1409 O OD1 . ASP A 182 ? 0.5112 0.8800 0.6074 0.0930  -0.0588 0.1408  182 ASP A OD1 
1410 O OD2 . ASP A 182 ? 0.6012 0.9487 0.6883 0.0959  -0.0593 0.1628  182 ASP A OD2 
1411 N N   . ASN A 183 ? 0.4533 0.8367 0.4891 0.0594  -0.0535 0.1172  183 ASN A N   
1412 C CA  . ASN A 183 ? 0.4406 0.8342 0.4582 0.0554  -0.0563 0.1131  183 ASN A CA  
1413 C C   . ASN A 183 ? 0.5410 0.9318 0.5544 0.0456  -0.0545 0.0967  183 ASN A C   
1414 O O   . ASN A 183 ? 0.6409 1.0392 0.6395 0.0428  -0.0577 0.0905  183 ASN A O   
1415 C CB  . ASN A 183 ? 0.3457 0.7312 0.3485 0.0577  -0.0522 0.1235  183 ASN A CB  
1416 C CG  . ASN A 183 ? 0.4155 0.8057 0.4211 0.0667  -0.0553 0.1423  183 ASN A CG  
1417 O OD1 . ASN A 183 ? 0.4382 0.8477 0.4356 0.0710  -0.0619 0.1485  183 ASN A OD1 
1418 N ND2 . ASN A 183 ? 0.3708 0.7432 0.3885 0.0696  -0.0513 0.1513  183 ASN A ND2 
1419 N N   . ILE A 184 ? 0.4942 0.8748 0.5200 0.0409  -0.0498 0.0895  184 ILE A N   
1420 C CA  . ILE A 184 ? 0.3848 0.7596 0.4070 0.0315  -0.0477 0.0762  184 ILE A CA  
1421 C C   . ILE A 184 ? 0.3188 0.7117 0.3475 0.0262  -0.0558 0.0674  184 ILE A C   
1422 O O   . ILE A 184 ? 0.4129 0.8033 0.4361 0.0185  -0.0575 0.0563  184 ILE A O   
1423 C CB  . ILE A 184 ? 0.3117 0.6687 0.3424 0.0282  -0.0391 0.0733  184 ILE A CB  
1424 C CG1 . ILE A 184 ? 0.3013 0.6473 0.3243 0.0196  -0.0361 0.0627  184 ILE A CG1 
1425 C CG2 . ILE A 184 ? 0.2948 0.6610 0.3446 0.0272  -0.0394 0.0713  184 ILE A CG2 
1426 C CD1 . ILE A 184 ? 0.3047 0.6373 0.3115 0.0209  -0.0318 0.0638  184 ILE A CD1 
1427 N N   . GLN A 185 ? 0.4181 0.8293 0.4595 0.0302  -0.0616 0.0719  185 GLN A N   
1428 C CA  . GLN A 185 ? 0.4428 0.8743 0.4921 0.0247  -0.0707 0.0639  185 GLN A CA  
1429 C C   . GLN A 185 ? 0.5365 0.9738 0.5676 0.0224  -0.0782 0.0565  185 GLN A C   
1430 O O   . GLN A 185 ? 0.4679 0.9089 0.5011 0.0136  -0.0835 0.0440  185 GLN A O   
1431 C CB  . GLN A 185 ? 0.4040 0.8575 0.4681 0.0315  -0.0769 0.0712  185 GLN A CB  
1432 C CG  . GLN A 185 ? 0.5322 0.9796 0.6001 0.0430  -0.0725 0.0845  185 GLN A CG  
1433 C CD  . GLN A 185 ? 0.5038 0.9733 0.5798 0.0522  -0.0811 0.0930  185 GLN A CD  
1434 O OE1 . GLN A 185 ? 0.5947 1.0850 0.6692 0.0506  -0.0908 0.0897  185 GLN A OE1 
1435 N NE2 . GLN A 185 ? 0.3289 0.7935 0.4138 0.0624  -0.0785 0.1034  185 GLN A NE2 
1436 N N   . PHE A 186 ? 0.6158 1.0534 0.6288 0.0303  -0.0785 0.0640  186 PHE A N   
1437 C CA  . PHE A 186 ? 0.5800 1.0277 0.5731 0.0311  -0.0856 0.0576  186 PHE A CA  
1438 C C   . PHE A 186 ? 0.6365 1.0677 0.6176 0.0246  -0.0819 0.0446  186 PHE A C   
1439 O O   . PHE A 186 ? 0.6221 1.0609 0.5914 0.0226  -0.0895 0.0325  186 PHE A O   
1440 C CB  . PHE A 186 ? 0.4266 0.8802 0.4037 0.0417  -0.0849 0.0719  186 PHE A CB  
1441 C CG  . PHE A 186 ? 0.3742 0.8388 0.3631 0.0497  -0.0875 0.0872  186 PHE A CG  
1442 C CD1 . PHE A 186 ? 0.4603 0.9132 0.4499 0.0564  -0.0804 0.1032  186 PHE A CD1 
1443 C CD2 . PHE A 186 ? 0.4448 0.9312 0.4452 0.0507  -0.0976 0.0857  186 PHE A CD2 
1444 C CE1 . PHE A 186 ? 0.4151 0.8754 0.4165 0.0645  -0.0835 0.1172  186 PHE A CE1 
1445 C CE2 . PHE A 186 ? 0.4486 0.9449 0.4606 0.0595  -0.1002 0.0999  186 PHE A CE2 
1446 C CZ  . PHE A 186 ? 0.3764 0.8584 0.3887 0.0668  -0.0931 0.1156  186 PHE A CZ  
1447 N N   . PHE A 187 ? 0.5219 0.9309 0.5054 0.0223  -0.0712 0.0464  187 PHE A N   
1448 C CA  . PHE A 187 ? 0.5835 0.9759 0.5574 0.0171  -0.0675 0.0348  187 PHE A CA  
1449 C C   . PHE A 187 ? 0.5725 0.9576 0.5618 0.0063  -0.0692 0.0233  187 PHE A C   
1450 O O   . PHE A 187 ? 0.4764 0.8438 0.4620 0.0015  -0.0652 0.0151  187 PHE A O   
1451 C CB  . PHE A 187 ? 0.5207 0.8944 0.4892 0.0202  -0.0557 0.0430  187 PHE A CB  
1452 C CG  . PHE A 187 ? 0.4287 0.8093 0.3836 0.0293  -0.0536 0.0556  187 PHE A CG  
1453 C CD1 . PHE A 187 ? 0.4524 0.8360 0.4162 0.0347  -0.0519 0.0712  187 PHE A CD1 
1454 C CD2 . PHE A 187 ? 0.3783 0.7632 0.3124 0.0330  -0.0533 0.0524  187 PHE A CD2 
1455 C CE1 . PHE A 187 ? 0.4709 0.8604 0.4246 0.0422  -0.0502 0.0853  187 PHE A CE1 
1456 C CE2 . PHE A 187 ? 0.4632 0.8574 0.3858 0.0410  -0.0507 0.0667  187 PHE A CE2 
1457 C CZ  . PHE A 187 ? 0.4053 0.8011 0.3385 0.0450  -0.0492 0.0842  187 PHE A CZ  
1458 N N   . GLY A 188 ? 0.4790 0.8786 0.4861 0.0024  -0.0755 0.0231  188 GLY A N   
1459 C CA  . GLY A 188 ? 0.4813 0.8773 0.5070 -0.0087 -0.0767 0.0156  188 GLY A CA  
1460 C C   . GLY A 188 ? 0.4898 0.8730 0.5285 -0.0106 -0.0657 0.0230  188 GLY A C   
1461 O O   . GLY A 188 ? 0.4853 0.8614 0.5364 -0.0199 -0.0641 0.0183  188 GLY A O   
1462 N N   . GLY A 189 ? 0.4418 0.8215 0.4776 -0.0019 -0.0583 0.0345  189 GLY A N   
1463 C CA  . GLY A 189 ? 0.4998 0.8704 0.5473 -0.0019 -0.0490 0.0405  189 GLY A CA  
1464 C C   . GLY A 189 ? 0.6313 1.0205 0.6988 -0.0007 -0.0505 0.0456  189 GLY A C   
1465 O O   . GLY A 189 ? 0.8534 1.2621 0.9251 0.0025  -0.0584 0.0474  189 GLY A O   
1466 N N   . ASP A 190 ? 0.4300 0.8147 0.5096 -0.0025 -0.0427 0.0480  190 ASP A N   
1467 C CA  . ASP A 190 ? 0.2843 0.6872 0.3833 0.0002  -0.0417 0.0528  190 ASP A CA  
1468 C C   . ASP A 190 ? 0.3926 0.7878 0.4897 0.0116  -0.0350 0.0599  190 ASP A C   
1469 O O   . ASP A 190 ? 0.2803 0.6616 0.3761 0.0117  -0.0266 0.0600  190 ASP A O   
1470 C CB  . ASP A 190 ? 0.5696 0.9760 0.6837 -0.0097 -0.0376 0.0506  190 ASP A CB  
1471 C CG  . ASP A 190 ? 0.5045 0.9327 0.6391 -0.0063 -0.0346 0.0559  190 ASP A CG  
1472 O OD1 . ASP A 190 ? 0.4541 0.8903 0.6030 -0.0149 -0.0313 0.0560  190 ASP A OD1 
1473 O OD2 . ASP A 190 ? 0.3924 0.8308 0.5298 0.0049  -0.0356 0.0604  190 ASP A OD2 
1474 N N   . PRO A 191 ? 0.4149 0.8176 0.5119 0.0216  -0.0390 0.0657  191 PRO A N   
1475 C CA  . PRO A 191 ? 0.4568 0.8490 0.5539 0.0323  -0.0339 0.0715  191 PRO A CA  
1476 C C   . PRO A 191 ? 0.4653 0.8627 0.5769 0.0353  -0.0273 0.0707  191 PRO A C   
1477 O O   . PRO A 191 ? 0.3713 0.7546 0.4806 0.0418  -0.0218 0.0716  191 PRO A O   
1478 C CB  . PRO A 191 ? 0.3380 0.7413 0.4369 0.0417  -0.0412 0.0786  191 PRO A CB  
1479 C CG  . PRO A 191 ? 0.3577 0.7828 0.4602 0.0363  -0.0498 0.0759  191 PRO A CG  
1480 C CD  . PRO A 191 ? 0.3183 0.7371 0.4135 0.0238  -0.0491 0.0674  191 PRO A CD  
1481 N N   . LYS A 192 ? 0.4445 0.8634 0.5712 0.0309  -0.0280 0.0689  192 LYS A N   
1482 C CA  . LYS A 192 ? 0.4802 0.9092 0.6205 0.0343  -0.0209 0.0689  192 LYS A CA  
1483 C C   . LYS A 192 ? 0.4998 0.9148 0.6344 0.0281  -0.0121 0.0661  192 LYS A C   
1484 O O   . LYS A 192 ? 0.5065 0.9286 0.6486 0.0325  -0.0050 0.0663  192 LYS A O   
1485 C CB  . LYS A 192 ? 0.4779 0.9377 0.6381 0.0304  -0.0239 0.0695  192 LYS A CB  
1486 C CG  . LYS A 192 ? 0.5954 1.0745 0.7656 0.0403  -0.0315 0.0730  192 LYS A CG  
1487 C CD  . LYS A 192 ? 0.6688 1.1781 0.8619 0.0443  -0.0292 0.0744  192 LYS A CD  
1488 C CE  . LYS A 192 ? 0.7416 1.2474 0.9369 0.0553  -0.0193 0.0740  192 LYS A CE  
1489 N NZ  . LYS A 192 ? 0.6842 1.1740 0.8724 0.0707  -0.0208 0.0747  192 LYS A NZ  
1490 N N   . THR A 193 ? 0.3301 0.7269 0.4516 0.0189  -0.0122 0.0635  193 THR A N   
1491 C CA  . THR A 193 ? 0.3946 0.7766 0.5099 0.0138  -0.0044 0.0619  193 THR A CA  
1492 C C   . THR A 193 ? 0.4872 0.8426 0.5836 0.0140  -0.0043 0.0601  193 THR A C   
1493 O O   . THR A 193 ? 0.5189 0.8632 0.6074 0.0055  -0.0051 0.0572  193 THR A O   
1494 C CB  . THR A 193 ? 0.4030 0.7930 0.5271 0.0003  -0.0039 0.0612  193 THR A CB  
1495 O OG1 . THR A 193 ? 0.5998 0.9741 0.7134 -0.0083 -0.0084 0.0571  193 THR A OG1 
1496 C CG2 . THR A 193 ? 0.3811 0.7989 0.5240 -0.0027 -0.0088 0.0627  193 THR A CG2 
1497 N N   . VAL A 194 ? 0.4356 0.7809 0.5263 0.0241  -0.0036 0.0617  194 VAL A N   
1498 C CA  . VAL A 194 ? 0.4309 0.7535 0.5068 0.0248  -0.0024 0.0613  194 VAL A CA  
1499 C C   . VAL A 194 ? 0.5117 0.8235 0.5850 0.0258  0.0049  0.0592  194 VAL A C   
1500 O O   . VAL A 194 ? 0.5244 0.8442 0.6053 0.0317  0.0084  0.0588  194 VAL A O   
1501 C CB  . VAL A 194 ? 0.4146 0.7318 0.4881 0.0338  -0.0062 0.0655  194 VAL A CB  
1502 C CG1 . VAL A 194 ? 0.3299 0.6258 0.3913 0.0339  -0.0042 0.0663  194 VAL A CG1 
1503 C CG2 . VAL A 194 ? 0.3397 0.6696 0.4139 0.0338  -0.0138 0.0689  194 VAL A CG2 
1504 N N   . THR A 195 ? 0.4904 0.7856 0.5526 0.0210  0.0071  0.0576  195 THR A N   
1505 C CA  . THR A 195 ? 0.3189 0.6040 0.3771 0.0216  0.0132  0.0559  195 THR A CA  
1506 C C   . THR A 195 ? 0.3883 0.6546 0.4364 0.0244  0.0130  0.0556  195 THR A C   
1507 O O   . THR A 195 ? 0.4426 0.7001 0.4825 0.0194  0.0120  0.0553  195 THR A O   
1508 C CB  . THR A 195 ? 0.3329 0.6178 0.3905 0.0121  0.0162  0.0552  195 THR A CB  
1509 O OG1 . THR A 195 ? 0.6196 0.9239 0.6898 0.0081  0.0158  0.0568  195 THR A OG1 
1510 C CG2 . THR A 195 ? 0.2502 0.5275 0.3035 0.0136  0.0224  0.0550  195 THR A CG2 
1511 N N   . ILE A 196 ? 0.3651 0.6261 0.4148 0.0325  0.0134  0.0552  196 ILE A N   
1512 C CA  . ILE A 196 ? 0.3178 0.5620 0.3613 0.0343  0.0127  0.0556  196 ILE A CA  
1513 C C   . ILE A 196 ? 0.4160 0.6513 0.4530 0.0323  0.0172  0.0522  196 ILE A C   
1514 O O   . ILE A 196 ? 0.5312 0.7720 0.5697 0.0343  0.0206  0.0496  196 ILE A O   
1515 C CB  . ILE A 196 ? 0.2687 0.5086 0.3189 0.0431  0.0095  0.0562  196 ILE A CB  
1516 C CG1 . ILE A 196 ? 0.3148 0.5599 0.3704 0.0505  0.0114  0.0508  196 ILE A CG1 
1517 C CG2 . ILE A 196 ? 0.2595 0.5064 0.3152 0.0453  0.0047  0.0617  196 ILE A CG2 
1518 C CD1 . ILE A 196 ? 0.2870 0.5223 0.3489 0.0596  0.0074  0.0488  196 ILE A CD1 
1519 N N   . PHE A 197 ? 0.3958 0.6195 0.4255 0.0288  0.0173  0.0529  197 PHE A N   
1520 C CA  . PHE A 197 ? 0.4569 0.6722 0.4810 0.0276  0.0207  0.0503  197 PHE A CA  
1521 C C   . PHE A 197 ? 0.4649 0.6684 0.4849 0.0272  0.0196  0.0514  197 PHE A C   
1522 O O   . PHE A 197 ? 0.4248 0.6278 0.4432 0.0250  0.0180  0.0547  197 PHE A O   
1523 C CB  . PHE A 197 ? 0.4368 0.6543 0.4570 0.0212  0.0238  0.0500  197 PHE A CB  
1524 C CG  . PHE A 197 ? 0.3627 0.5758 0.3779 0.0155  0.0225  0.0504  197 PHE A CG  
1525 C CD1 . PHE A 197 ? 0.2583 0.4623 0.2674 0.0121  0.0246  0.0490  197 PHE A CD1 
1526 C CD2 . PHE A 197 ? 0.3890 0.6081 0.4052 0.0143  0.0188  0.0515  197 PHE A CD2 
1527 C CE1 . PHE A 197 ? 0.2676 0.4676 0.2719 0.0082  0.0231  0.0473  197 PHE A CE1 
1528 C CE2 . PHE A 197 ? 0.3929 0.6096 0.4028 0.0102  0.0172  0.0499  197 PHE A CE2 
1529 C CZ  . PHE A 197 ? 0.2826 0.4893 0.2866 0.0074  0.0195  0.0471  197 PHE A CZ  
1530 N N   . GLY A 198 ? 0.4836 0.6800 0.5022 0.0295  0.0206  0.0488  198 GLY A N   
1531 C CA  . GLY A 198 ? 0.5697 0.7568 0.5876 0.0293  0.0194  0.0500  198 GLY A CA  
1532 C C   . GLY A 198 ? 0.4976 0.6796 0.5129 0.0313  0.0204  0.0459  198 GLY A C   
1533 O O   . GLY A 198 ? 0.4866 0.6725 0.5003 0.0343  0.0217  0.0423  198 GLY A O   
1534 N N   . GLU A 199 ? 0.4981 0.6737 0.5132 0.0300  0.0198  0.0468  199 GLU A N   
1535 C CA  . GLU A 199 ? 0.3677 0.5395 0.3796 0.0315  0.0202  0.0434  199 GLU A CA  
1536 C C   . GLU A 199 ? 0.3399 0.5064 0.3597 0.0336  0.0155  0.0419  199 GLU A C   
1537 O O   . GLU A 199 ? 0.2876 0.4519 0.3147 0.0315  0.0136  0.0464  199 GLU A O   
1538 C CB  . GLU A 199 ? 0.2716 0.4416 0.2772 0.0281  0.0234  0.0454  199 GLU A CB  
1539 C CG  . GLU A 199 ? 0.4440 0.6111 0.4458 0.0300  0.0238  0.0431  199 GLU A CG  
1540 C CD  . GLU A 199 ? 0.5837 0.7479 0.5909 0.0305  0.0211  0.0432  199 GLU A CD  
1541 O OE1 . GLU A 199 ? 0.5621 0.7266 0.5754 0.0283  0.0202  0.0467  199 GLU A OE1 
1542 O OE2 . GLU A 199 ? 0.6575 0.8207 0.6636 0.0330  0.0197  0.0405  199 GLU A OE2 
1543 N N   . SER A 200 ? 0.4532 0.6183 0.4721 0.0376  0.0134  0.0358  200 SER A N   
1544 C CA  . SER A 200 ? 0.3360 0.4956 0.3635 0.0394  0.0073  0.0321  200 SER A CA  
1545 C C   . SER A 200 ? 0.4453 0.6007 0.4838 0.0409  0.0027  0.0319  200 SER A C   
1546 O O   . SER A 200 ? 0.5767 0.7340 0.6144 0.0460  0.0018  0.0271  200 SER A O   
1547 C CB  . SER A 200 ? 0.4010 0.5586 0.4325 0.0348  0.0073  0.0368  200 SER A CB  
1548 O OG  . SER A 200 ? 0.6207 0.7747 0.6602 0.0358  0.0013  0.0323  200 SER A OG  
1549 N N   . ALA A 201 ? 0.4282 0.5786 0.4777 0.0368  0.0000  0.0379  201 ALA A N   
1550 C CA  . ALA A 201 ? 0.3956 0.5410 0.4562 0.0379  -0.0042 0.0406  201 ALA A CA  
1551 C C   . ALA A 201 ? 0.4454 0.5973 0.5007 0.0387  -0.0003 0.0449  201 ALA A C   
1552 O O   . ALA A 201 ? 0.2740 0.4238 0.3361 0.0424  -0.0035 0.0450  201 ALA A O   
1553 C CB  . ALA A 201 ? 0.3892 0.5301 0.4632 0.0322  -0.0068 0.0498  201 ALA A CB  
1554 N N   . GLY A 202 ? 0.4148 0.5744 0.4592 0.0356  0.0058  0.0482  202 GLY A N   
1555 C CA  . GLY A 202 ? 0.3287 0.4960 0.3682 0.0362  0.0086  0.0499  202 GLY A CA  
1556 C C   . GLY A 202 ? 0.4969 0.6683 0.5336 0.0416  0.0090  0.0424  202 GLY A C   
1557 O O   . GLY A 202 ? 0.5859 0.7616 0.6266 0.0453  0.0078  0.0420  202 GLY A O   
1558 N N   . GLY A 203 ? 0.4590 0.6311 0.4889 0.0428  0.0109  0.0369  203 GLY A N   
1559 C CA  . GLY A 203 ? 0.4221 0.6008 0.4489 0.0489  0.0119  0.0303  203 GLY A CA  
1560 C C   . GLY A 203 ? 0.3881 0.5637 0.4233 0.0565  0.0065  0.0243  203 GLY A C   
1561 O O   . GLY A 203 ? 0.3821 0.5661 0.4184 0.0620  0.0074  0.0216  203 GLY A O   
1562 N N   . ALA A 204 ? 0.2970 0.4610 0.3399 0.0570  0.0004  0.0219  204 ALA A N   
1563 C CA  . ALA A 204 ? 0.3819 0.5398 0.4342 0.0646  -0.0062 0.0145  204 ALA A CA  
1564 C C   . ALA A 204 ? 0.4658 0.6235 0.5269 0.0658  -0.0075 0.0204  204 ALA A C   
1565 O O   . ALA A 204 ? 0.6151 0.7749 0.6803 0.0742  -0.0097 0.0145  204 ALA A O   
1566 C CB  . ALA A 204 ? 0.5248 0.6686 0.5864 0.0633  -0.0137 0.0112  204 ALA A CB  
1567 N N   . SER A 205 ? 0.4187 0.5755 0.4821 0.0584  -0.0060 0.0319  205 SER A N   
1568 C CA  . SER A 205 ? 0.4146 0.5734 0.4850 0.0598  -0.0074 0.0389  205 SER A CA  
1569 C C   . SER A 205 ? 0.4757 0.6494 0.5411 0.0639  -0.0035 0.0368  205 SER A C   
1570 O O   . SER A 205 ? 0.5116 0.6875 0.5844 0.0711  -0.0063 0.0350  205 SER A O   
1571 C CB  . SER A 205 ? 0.3485 0.5074 0.4191 0.0517  -0.0060 0.0517  205 SER A CB  
1572 O OG  . SER A 205 ? 0.3534 0.5024 0.4291 0.0470  -0.0082 0.0547  205 SER A OG  
1573 N N   . VAL A 206 ? 0.4421 0.6263 0.4966 0.0595  0.0028  0.0371  206 VAL A N   
1574 C CA  . VAL A 206 ? 0.3946 0.5948 0.4468 0.0618  0.0068  0.0360  206 VAL A CA  
1575 C C   . VAL A 206 ? 0.5076 0.7126 0.5625 0.0724  0.0061  0.0267  206 VAL A C   
1576 O O   . VAL A 206 ? 0.6939 0.9102 0.7542 0.0781  0.0064  0.0260  206 VAL A O   
1577 C CB  . VAL A 206 ? 0.3502 0.5575 0.3921 0.0545  0.0129  0.0378  206 VAL A CB  
1578 C CG1 . VAL A 206 ? 0.4315 0.6551 0.4725 0.0568  0.0173  0.0360  206 VAL A CG1 
1579 C CG2 . VAL A 206 ? 0.3439 0.5513 0.3838 0.0465  0.0132  0.0454  206 VAL A CG2 
1580 N N   . GLY A 207 ? 0.4172 0.6151 0.4687 0.0761  0.0047  0.0187  207 GLY A N   
1581 C CA  . GLY A 207 ? 0.3794 0.5822 0.4319 0.0877  0.0034  0.0078  207 GLY A CA  
1582 C C   . GLY A 207 ? 0.4579 0.6519 0.5233 0.0959  -0.0038 0.0041  207 GLY A C   
1583 O O   . GLY A 207 ? 0.4934 0.6963 0.5620 0.1067  -0.0040 -0.0029 207 GLY A O   
1584 N N   . MET A 208 ? 0.4330 0.6101 0.5067 0.0912  -0.0096 0.0096  208 MET A N   
1585 C CA  . MET A 208 ? 0.4927 0.6579 0.5806 0.0986  -0.0175 0.0073  208 MET A CA  
1586 C C   . MET A 208 ? 0.5017 0.6763 0.5959 0.1011  -0.0167 0.0151  208 MET A C   
1587 O O   . MET A 208 ? 0.6055 0.7766 0.7102 0.1113  -0.0218 0.0111  208 MET A O   
1588 C CB  . MET A 208 ? 0.4519 0.5963 0.5486 0.0920  -0.0240 0.0125  208 MET A CB  
1589 C CG  . MET A 208 ? 0.3803 0.5156 0.4740 0.0910  -0.0269 0.0029  208 MET A CG  
1590 S SD  . MET A 208 ? 0.4811 0.5951 0.5886 0.0819  -0.0344 0.0094  208 MET A SD  
1591 C CE  . MET A 208 ? 0.5732 0.6965 0.6741 0.0694  -0.0264 0.0274  208 MET A CE  
1592 N N   . HIS A 209 ? 0.3035 0.4902 0.3918 0.0927  -0.0113 0.0253  209 HIS A N   
1593 C CA  . HIS A 209 ? 0.3808 0.5802 0.4744 0.0950  -0.0110 0.0319  209 HIS A CA  
1594 C C   . HIS A 209 ? 0.5986 0.8184 0.6913 0.1028  -0.0065 0.0248  209 HIS A C   
1595 O O   . HIS A 209 ? 0.6378 0.8679 0.7391 0.1098  -0.0080 0.0262  209 HIS A O   
1596 C CB  . HIS A 209 ? 0.3465 0.5519 0.4342 0.0835  -0.0080 0.0436  209 HIS A CB  
1597 C CG  . HIS A 209 ? 0.3761 0.5666 0.4665 0.0778  -0.0120 0.0528  209 HIS A CG  
1598 N ND1 . HIS A 209 ? 0.3057 0.4854 0.4083 0.0826  -0.0186 0.0582  209 HIS A ND1 
1599 C CD2 . HIS A 209 ? 0.2887 0.4743 0.3721 0.0682  -0.0099 0.0586  209 HIS A CD2 
1600 C CE1 . HIS A 209 ? 0.4931 0.6631 0.5964 0.0754  -0.0201 0.0681  209 HIS A CE1 
1601 N NE2 . HIS A 209 ? 0.4047 0.5792 0.4961 0.0670  -0.0146 0.0680  209 HIS A NE2 
1602 N N   . ILE A 210 ? 0.5338 0.7613 0.6167 0.1021  -0.0008 0.0182  210 ILE A N   
1603 C CA  . ILE A 210 ? 0.4436 0.6912 0.5260 0.1112  0.0039  0.0111  210 ILE A CA  
1604 C C   . ILE A 210 ? 0.5162 0.7583 0.6061 0.1267  -0.0014 -0.0002 210 ILE A C   
1605 O O   . ILE A 210 ? 0.5785 0.8373 0.6744 0.1372  0.0001  -0.0039 210 ILE A O   
1606 C CB  . ILE A 210 ? 0.3783 0.6341 0.4477 0.1073  0.0109  0.0082  210 ILE A CB  
1607 C CG1 . ILE A 210 ? 0.4493 0.7169 0.5149 0.0949  0.0168  0.0185  210 ILE A CG1 
1608 C CG2 . ILE A 210 ? 0.3030 0.5763 0.3700 0.1193  0.0150  -0.0011 210 ILE A CG2 
1609 C CD1 . ILE A 210 ? 0.5626 0.8278 0.6163 0.0878  0.0214  0.0191  210 ILE A CD1 
1610 N N   . LEU A 211 ? 0.4721 0.6908 0.5634 0.1286  -0.0084 -0.0061 211 LEU A N   
1611 C CA  . LEU A 211 ? 0.4455 0.6548 0.5443 0.1433  -0.0151 -0.0194 211 LEU A CA  
1612 C C   . LEU A 211 ? 0.4746 0.6730 0.5897 0.1486  -0.0224 -0.0149 211 LEU A C   
1613 O O   . LEU A 211 ? 0.5276 0.7313 0.6506 0.1629  -0.0248 -0.0229 211 LEU A O   
1614 C CB  . LEU A 211 ? 0.4149 0.6032 0.5105 0.1421  -0.0208 -0.0281 211 LEU A CB  
1615 C CG  . LEU A 211 ? 0.3519 0.5495 0.4323 0.1439  -0.0164 -0.0381 211 LEU A CG  
1616 C CD1 . LEU A 211 ? 0.3612 0.5360 0.4428 0.1420  -0.0248 -0.0457 211 LEU A CD1 
1617 C CD2 . LEU A 211 ? 0.3635 0.5787 0.4408 0.1603  -0.0141 -0.0514 211 LEU A CD2 
1618 N N   . SER A 212 ? 0.5024 0.6868 0.6226 0.1381  -0.0259 -0.0019 212 SER A N   
1619 C CA  . SER A 212 ? 0.4930 0.6643 0.6290 0.1429  -0.0338 0.0044  212 SER A CA  
1620 C C   . SER A 212 ? 0.5271 0.7194 0.6676 0.1481  -0.0312 0.0107  212 SER A C   
1621 O O   . SER A 212 ? 0.6237 0.8329 0.7573 0.1388  -0.0253 0.0202  212 SER A O   
1622 C CB  . SER A 212 ? 0.4528 0.6074 0.5918 0.1298  -0.0371 0.0189  212 SER A CB  
1623 O OG  . SER A 212 ? 0.4839 0.6280 0.6375 0.1336  -0.0440 0.0286  212 SER A OG  
1624 N N   . PRO A 213 ? 0.5439 0.7356 0.6968 0.1630  -0.0362 0.0052  213 PRO A N   
1625 C CA  . PRO A 213 ? 0.5461 0.7594 0.7055 0.1684  -0.0346 0.0120  213 PRO A CA  
1626 C C   . PRO A 213 ? 0.5761 0.7889 0.7381 0.1584  -0.0367 0.0306  213 PRO A C   
1627 O O   . PRO A 213 ? 0.5441 0.7806 0.7043 0.1553  -0.0327 0.0374  213 PRO A O   
1628 C CB  . PRO A 213 ? 0.4106 0.6164 0.5845 0.1874  -0.0415 0.0022  213 PRO A CB  
1629 C CG  . PRO A 213 ? 0.4631 0.6462 0.6359 0.1921  -0.0460 -0.0127 213 PRO A CG  
1630 C CD  . PRO A 213 ? 0.4961 0.6656 0.6593 0.1752  -0.0449 -0.0071 213 PRO A CD  
1631 N N   . GLY A 214 ? 0.5982 0.7865 0.7646 0.1529  -0.0429 0.0393  214 GLY A N   
1632 C CA  . GLY A 214 ? 0.5946 0.7842 0.7613 0.1441  -0.0445 0.0576  214 GLY A CA  
1633 C C   . GLY A 214 ? 0.3451 0.5503 0.4966 0.1297  -0.0373 0.0638  214 GLY A C   
1634 O O   . GLY A 214 ? 0.3423 0.5532 0.4917 0.1235  -0.0383 0.0774  214 GLY A O   
1635 N N   . SER A 215 ? 0.3339 0.5459 0.4742 0.1248  -0.0305 0.0541  215 SER A N   
1636 C CA  . SER A 215 ? 0.3773 0.6002 0.5041 0.1113  -0.0243 0.0588  215 SER A CA  
1637 C C   . SER A 215 ? 0.4326 0.6802 0.5543 0.1106  -0.0177 0.0531  215 SER A C   
1638 O O   . SER A 215 ? 0.4956 0.7530 0.6084 0.0997  -0.0137 0.0572  215 SER A O   
1639 C CB  . SER A 215 ? 0.4879 0.6948 0.6060 0.1030  -0.0221 0.0557  215 SER A CB  
1640 O OG  . SER A 215 ? 0.3242 0.5093 0.4487 0.1015  -0.0278 0.0622  215 SER A OG  
1641 N N   . ARG A 216 ? 0.4802 0.7387 0.6084 0.1218  -0.0165 0.0439  216 ARG A N   
1642 C CA  . ARG A 216 ? 0.5912 0.8738 0.7154 0.1204  -0.0089 0.0392  216 ARG A CA  
1643 C C   . ARG A 216 ? 0.6063 0.9101 0.7328 0.1135  -0.0081 0.0478  216 ARG A C   
1644 O O   . ARG A 216 ? 0.6144 0.9312 0.7350 0.1038  -0.0025 0.0485  216 ARG A O   
1645 C CB  . ARG A 216 ? 0.5879 0.8815 0.7196 0.1357  -0.0076 0.0287  216 ARG A CB  
1646 C CG  . ARG A 216 ? 0.6156 0.8920 0.7425 0.1420  -0.0081 0.0170  216 ARG A CG  
1647 C CD  . ARG A 216 ? 0.6478 0.9322 0.7825 0.1601  -0.0089 0.0053  216 ARG A CD  
1648 N NE  . ARG A 216 ? 0.6928 0.9584 0.8228 0.1669  -0.0116 -0.0076 216 ARG A NE  
1649 C CZ  . ARG A 216 ? 0.7310 0.9992 0.8651 0.1838  -0.0133 -0.0216 216 ARG A CZ  
1650 N NH1 . ARG A 216 ? 0.7287 0.9789 0.8578 0.1891  -0.0171 -0.0346 216 ARG A NH1 
1651 N NH2 . ARG A 216 ? 0.7021 0.9920 0.8455 0.1959  -0.0115 -0.0234 216 ARG A NH2 
1652 N N   . ASP A 217 ? 0.5615 0.8687 0.6973 0.1182  -0.0143 0.0546  217 ASP A N   
1653 C CA  . ASP A 217 ? 0.5370 0.8676 0.6768 0.1136  -0.0150 0.0611  217 ASP A CA  
1654 C C   . ASP A 217 ? 0.4992 0.8252 0.6290 0.1004  -0.0169 0.0691  217 ASP A C   
1655 O O   . ASP A 217 ? 0.5097 0.8543 0.6417 0.0957  -0.0189 0.0734  217 ASP A O   
1656 C CB  . ASP A 217 ? 0.6499 0.9900 0.8042 0.1262  -0.0213 0.0646  217 ASP A CB  
1657 C CG  . ASP A 217 ? 0.7539 1.0992 0.9185 0.1418  -0.0197 0.0551  217 ASP A CG  
1658 O OD1 . ASP A 217 ? 0.7577 1.1304 0.9314 0.1468  -0.0169 0.0528  217 ASP A OD1 
1659 O OD2 . ASP A 217 ? 0.8763 1.1992 1.0405 0.1493  -0.0216 0.0493  217 ASP A OD2 
1660 N N   . LEU A 218 ? 0.3665 0.6701 0.4859 0.0946  -0.0166 0.0705  218 LEU A N   
1661 C CA  . LEU A 218 ? 0.3299 0.6298 0.4385 0.0836  -0.0178 0.0773  218 LEU A CA  
1662 C C   . LEU A 218 ? 0.3916 0.6916 0.4893 0.0723  -0.0118 0.0726  218 LEU A C   
1663 O O   . LEU A 218 ? 0.4604 0.7524 0.5475 0.0643  -0.0119 0.0757  218 LEU A O   
1664 C CB  . LEU A 218 ? 0.3029 0.5811 0.4087 0.0846  -0.0212 0.0842  218 LEU A CB  
1665 C CG  . LEU A 218 ? 0.3059 0.5792 0.4238 0.0955  -0.0278 0.0908  218 LEU A CG  
1666 C CD1 . LEU A 218 ? 0.3217 0.5704 0.4396 0.0950  -0.0299 0.0963  218 LEU A CD1 
1667 C CD2 . LEU A 218 ? 0.3094 0.5991 0.4283 0.0959  -0.0328 0.1005  218 LEU A CD2 
1668 N N   . PHE A 219 ? 0.2708 0.5799 0.3710 0.0722  -0.0066 0.0656  219 PHE A N   
1669 C CA  . PHE A 219 ? 0.3502 0.6603 0.4422 0.0616  -0.0012 0.0626  219 PHE A CA  
1670 C C   . PHE A 219 ? 0.3045 0.6320 0.4038 0.0636  0.0040  0.0583  219 PHE A C   
1671 O O   . PHE A 219 ? 0.3538 0.6897 0.4621 0.0744  0.0043  0.0558  219 PHE A O   
1672 C CB  . PHE A 219 ? 0.3397 0.6282 0.4208 0.0586  0.0017  0.0603  219 PHE A CB  
1673 C CG  . PHE A 219 ? 0.2651 0.5461 0.3482 0.0670  0.0040  0.0545  219 PHE A CG  
1674 C CD1 . PHE A 219 ? 0.2730 0.5423 0.3616 0.0761  -0.0005 0.0542  219 PHE A CD1 
1675 C CD2 . PHE A 219 ? 0.3500 0.6361 0.4298 0.0661  0.0102  0.0492  219 PHE A CD2 
1676 C CE1 . PHE A 219 ? 0.2783 0.5401 0.3689 0.0846  0.0002  0.0464  219 PHE A CE1 
1677 C CE2 . PHE A 219 ? 0.3513 0.6327 0.4312 0.0753  0.0118  0.0424  219 PHE A CE2 
1678 C CZ  . PHE A 219 ? 0.2753 0.5440 0.3604 0.0847  0.0063  0.0397  219 PHE A CZ  
1679 N N   . ARG A 220 ? 0.2557 0.5889 0.3518 0.0535  0.0082  0.0578  220 ARG A N   
1680 C CA  . ARG A 220 ? 0.3977 0.7525 0.5029 0.0527  0.0133  0.0572  220 ARG A CA  
1681 C C   . ARG A 220 ? 0.4358 0.7863 0.5348 0.0530  0.0209  0.0543  220 ARG A C   
1682 O O   . ARG A 220 ? 0.3252 0.6902 0.4297 0.0611  0.0255  0.0522  220 ARG A O   
1683 C CB  . ARG A 220 ? 0.4047 0.7723 0.5150 0.0404  0.0116  0.0604  220 ARG A CB  
1684 C CG  . ARG A 220 ? 0.4923 0.8781 0.6114 0.0350  0.0178  0.0618  220 ARG A CG  
1685 C CD  . ARG A 220 ? 0.8584 1.2718 0.9942 0.0405  0.0176  0.0635  220 ARG A CD  
1686 N NE  . ARG A 220 ? 1.0517 1.4835 1.1953 0.0381  0.0260  0.0659  220 ARG A NE  
1687 C CZ  . ARG A 220 ? 0.9666 1.4258 1.1274 0.0330  0.0273  0.0703  220 ARG A CZ  
1688 N NH1 . ARG A 220 ? 0.8750 1.3452 1.0465 0.0292  0.0195  0.0713  220 ARG A NH1 
1689 N NH2 . ARG A 220 ? 0.9173 1.3934 1.0844 0.0314  0.0363  0.0743  220 ARG A NH2 
1690 N N   . ARG A 221 ? 0.3670 0.6999 0.4543 0.0454  0.0224  0.0542  221 ARG A N   
1691 C CA  . ARG A 221 ? 0.3994 0.7254 0.4785 0.0467  0.0283  0.0519  221 ARG A CA  
1692 C C   . ARG A 221 ? 0.4475 0.7482 0.5144 0.0451  0.0260  0.0499  221 ARG A C   
1693 O O   . ARG A 221 ? 0.4417 0.7316 0.5069 0.0437  0.0207  0.0510  221 ARG A O   
1694 C CB  . ARG A 221 ? 0.3544 0.6903 0.4348 0.0370  0.0339  0.0561  221 ARG A CB  
1695 C CG  . ARG A 221 ? 0.2667 0.6219 0.3605 0.0304  0.0329  0.0603  221 ARG A CG  
1696 C CD  . ARG A 221 ? 0.4156 0.7742 0.5116 0.0187  0.0369  0.0653  221 ARG A CD  
1697 N NE  . ARG A 221 ? 0.5490 0.9182 0.6572 0.0087  0.0324  0.0680  221 ARG A NE  
1698 C CZ  . ARG A 221 ? 0.4287 0.8242 0.5536 0.0073  0.0335  0.0717  221 ARG A CZ  
1699 N NH1 . ARG A 221 ? 0.2855 0.7008 0.4160 0.0161  0.0402  0.0735  221 ARG A NH1 
1700 N NH2 . ARG A 221 ? 0.4102 0.8131 0.5460 -0.0028 0.0276  0.0728  221 ARG A NH2 
1701 N N   . ALA A 222 ? 0.4311 0.7248 0.4897 0.0451  0.0303  0.0482  222 ALA A N   
1702 C CA  . ALA A 222 ? 0.3857 0.6584 0.4347 0.0464  0.0284  0.0452  222 ALA A CA  
1703 C C   . ALA A 222 ? 0.2536 0.5204 0.2936 0.0413  0.0328  0.0461  222 ALA A C   
1704 O O   . ALA A 222 ? 0.3711 0.6495 0.4105 0.0424  0.0381  0.0472  222 ALA A O   
1705 C CB  . ALA A 222 ? 0.2908 0.5601 0.3409 0.0584  0.0264  0.0390  222 ALA A CB  
1706 N N   . ILE A 223 ? 0.3508 0.6007 0.3840 0.0364  0.0308  0.0465  223 ILE A N   
1707 C CA  . ILE A 223 ? 0.2886 0.5297 0.3131 0.0333  0.0336  0.0471  223 ILE A CA  
1708 C C   . ILE A 223 ? 0.3020 0.5287 0.3216 0.0378  0.0306  0.0430  223 ILE A C   
1709 O O   . ILE A 223 ? 0.4900 0.7078 0.5110 0.0366  0.0266  0.0432  223 ILE A O   
1710 C CB  . ILE A 223 ? 0.3389 0.5740 0.3617 0.0232  0.0338  0.0507  223 ILE A CB  
1711 C CG1 . ILE A 223 ? 0.4046 0.6534 0.4356 0.0173  0.0351  0.0544  223 ILE A CG1 
1712 C CG2 . ILE A 223 ? 0.4624 0.6876 0.4772 0.0213  0.0364  0.0518  223 ILE A CG2 
1713 C CD1 . ILE A 223 ? 0.4256 0.6667 0.4559 0.0073  0.0341  0.0563  223 ILE A CD1 
1714 N N   . LEU A 224 ? 0.3016 0.5277 0.3158 0.0429  0.0321  0.0397  224 LEU A N   
1715 C CA  . LEU A 224 ? 0.4355 0.6494 0.4469 0.0469  0.0283  0.0350  224 LEU A CA  
1716 C C   . LEU A 224 ? 0.4567 0.6650 0.4596 0.0442  0.0303  0.0364  224 LEU A C   
1717 O O   . LEU A 224 ? 0.3856 0.6013 0.3828 0.0470  0.0337  0.0365  224 LEU A O   
1718 C CB  . LEU A 224 ? 0.2659 0.4837 0.2786 0.0572  0.0260  0.0273  224 LEU A CB  
1719 C CG  . LEU A 224 ? 0.3572 0.5819 0.3787 0.0629  0.0241  0.0248  224 LEU A CG  
1720 C CD1 . LEU A 224 ? 0.2997 0.5441 0.3225 0.0641  0.0298  0.0275  224 LEU A CD1 
1721 C CD2 . LEU A 224 ? 0.3954 0.6147 0.4190 0.0731  0.0188  0.0149  224 LEU A CD2 
1722 N N   . GLN A 225 ? 0.4152 0.6119 0.4174 0.0397  0.0283  0.0379  225 GLN A N   
1723 C CA  . GLN A 225 ? 0.3925 0.5833 0.3880 0.0381  0.0295  0.0392  225 GLN A CA  
1724 C C   . GLN A 225 ? 0.5091 0.6938 0.5052 0.0424  0.0250  0.0342  225 GLN A C   
1725 O O   . GLN A 225 ? 0.6282 0.8064 0.6306 0.0411  0.0213  0.0337  225 GLN A O   
1726 C CB  . GLN A 225 ? 0.4167 0.6007 0.4118 0.0311  0.0305  0.0434  225 GLN A CB  
1727 C CG  . GLN A 225 ? 0.4836 0.6723 0.4823 0.0265  0.0315  0.0459  225 GLN A CG  
1728 C CD  . GLN A 225 ? 0.5053 0.6880 0.5020 0.0205  0.0321  0.0479  225 GLN A CD  
1729 O OE1 . GLN A 225 ? 0.4620 0.6368 0.4545 0.0201  0.0326  0.0480  225 GLN A OE1 
1730 N NE2 . GLN A 225 ? 0.6345 0.8216 0.6344 0.0164  0.0314  0.0486  225 GLN A NE2 
1731 N N   . SER A 226 ? 0.4212 0.6092 0.4112 0.0476  0.0248  0.0309  226 SER A N   
1732 C CA  . SER A 226 ? 0.3071 0.4898 0.2973 0.0510  0.0196  0.0256  226 SER A CA  
1733 C C   . SER A 226 ? 0.3380 0.5161 0.3380 0.0533  0.0134  0.0196  226 SER A C   
1734 O O   . SER A 226 ? 0.4926 0.6630 0.4994 0.0515  0.0086  0.0184  226 SER A O   
1735 C CB  . SER A 226 ? 0.2659 0.4415 0.2565 0.0462  0.0195  0.0297  226 SER A CB  
1736 O OG  . SER A 226 ? 0.4221 0.5998 0.4039 0.0464  0.0231  0.0335  226 SER A OG  
1737 N N   . GLY A 227 ? 0.3528 0.5356 0.3552 0.0574  0.0134  0.0165  227 GLY A N   
1738 C CA  . GLY A 227 ? 0.4223 0.5986 0.4356 0.0599  0.0073  0.0118  227 GLY A CA  
1739 C C   . GLY A 227 ? 0.4736 0.6574 0.4871 0.0680  0.0072  0.0057  227 GLY A C   
1740 O O   . GLY A 227 ? 0.5258 0.7217 0.5340 0.0691  0.0133  0.0086  227 GLY A O   
1741 N N   . SER A 228 ? 0.4509 0.6276 0.4723 0.0738  -0.0001 -0.0027 228 SER A N   
1742 C CA  . SER A 228 ? 0.4832 0.6673 0.5039 0.0844  -0.0010 -0.0118 228 SER A CA  
1743 C C   . SER A 228 ? 0.4092 0.5795 0.4440 0.0879  -0.0098 -0.0178 228 SER A C   
1744 O O   . SER A 228 ? 0.4392 0.5959 0.4817 0.0839  -0.0164 -0.0189 228 SER A O   
1745 C CB  . SER A 228 ? 0.6289 0.8217 0.6375 0.0922  -0.0011 -0.0212 228 SER A CB  
1746 O OG  . SER A 228 ? 0.7135 0.9205 0.7176 0.1027  0.0018  -0.0275 228 SER A OG  
1747 N N   . PRO A 229 ? 0.3903 0.5637 0.4308 0.0950  -0.0105 -0.0209 229 PRO A N   
1748 C CA  . PRO A 229 ? 0.3865 0.5438 0.4424 0.0982  -0.0197 -0.0252 229 PRO A CA  
1749 C C   . PRO A 229 ? 0.4774 0.6251 0.5357 0.1058  -0.0289 -0.0410 229 PRO A C   
1750 O O   . PRO A 229 ? 0.5421 0.6716 0.6150 0.1038  -0.0380 -0.0430 229 PRO A O   
1751 C CB  . PRO A 229 ? 0.3408 0.5064 0.4010 0.1057  -0.0175 -0.0249 229 PRO A CB  
1752 C CG  . PRO A 229 ? 0.3585 0.5467 0.4052 0.1093  -0.0083 -0.0256 229 PRO A CG  
1753 C CD  . PRO A 229 ? 0.3742 0.5663 0.4089 0.1007  -0.0033 -0.0203 229 PRO A CD  
1754 N N   . ASN A 230 ? 0.4866 0.6463 0.5313 0.1141  -0.0273 -0.0521 230 ASN A N   
1755 C CA  . ASN A 230 ? 0.5539 0.7060 0.5991 0.1223  -0.0371 -0.0694 230 ASN A CA  
1756 C C   . ASN A 230 ? 0.5560 0.7019 0.5991 0.1147  -0.0414 -0.0697 230 ASN A C   
1757 O O   . ASN A 230 ? 0.6428 0.7826 0.6871 0.1204  -0.0509 -0.0846 230 ASN A O   
1758 C CB  . ASN A 230 ? 0.5002 0.6707 0.5304 0.1371  -0.0341 -0.0825 230 ASN A CB  
1759 C CG  . ASN A 230 ? 0.6062 0.7989 0.6184 0.1349  -0.0224 -0.0738 230 ASN A CG  
1760 O OD1 . ASN A 230 ? 0.6454 0.8415 0.6577 0.1243  -0.0147 -0.0579 230 ASN A OD1 
1761 N ND2 . ASN A 230 ? 0.6466 0.8547 0.6433 0.1452  -0.0213 -0.0842 230 ASN A ND2 
1762 N N   . CYS A 231 ? 0.4804 0.6283 0.5214 0.1026  -0.0353 -0.0548 231 CYS A N   
1763 C CA  . CYS A 231 ? 0.5427 0.6858 0.5843 0.0957  -0.0394 -0.0542 231 CYS A CA  
1764 C C   . CYS A 231 ? 0.6997 0.8244 0.7596 0.0946  -0.0527 -0.0628 231 CYS A C   
1765 O O   . CYS A 231 ? 0.8050 0.9170 0.8804 0.0941  -0.0568 -0.0614 231 CYS A O   
1766 C CB  . CYS A 231 ? 0.5251 0.6691 0.5675 0.0832  -0.0321 -0.0367 231 CYS A CB  
1767 S SG  . CYS A 231 ? 0.6699 0.8322 0.6924 0.0821  -0.0187 -0.0272 231 CYS A SG  
1768 N N   . PRO A 232 ? 0.7291 0.8519 0.7895 0.0940  -0.0603 -0.0713 232 PRO A N   
1769 C CA  . PRO A 232 ? 0.6092 0.7141 0.6893 0.0930  -0.0746 -0.0814 232 PRO A CA  
1770 C C   . PRO A 232 ? 0.6007 0.6931 0.7022 0.0792  -0.0762 -0.0666 232 PRO A C   
1771 O O   . PRO A 232 ? 0.7241 0.7993 0.8464 0.0772  -0.0862 -0.0698 232 PRO A O   
1772 C CB  . PRO A 232 ? 0.7004 0.8114 0.7728 0.0962  -0.0817 -0.0943 232 PRO A CB  
1773 C CG  . PRO A 232 ? 0.7430 0.8707 0.7989 0.0922  -0.0705 -0.0820 232 PRO A CG  
1774 C CD  . PRO A 232 ? 0.7442 0.8804 0.7890 0.0938  -0.0572 -0.0713 232 PRO A CD  
1775 N N   . TRP A 233 ? 0.5566 0.6575 0.6540 0.0702  -0.0667 -0.0502 233 TRP A N   
1776 C CA  . TRP A 233 ? 0.5803 0.6738 0.6959 0.0579  -0.0664 -0.0347 233 TRP A CA  
1777 C C   . TRP A 233 ? 0.6419 0.7306 0.7631 0.0563  -0.0614 -0.0228 233 TRP A C   
1778 O O   . TRP A 233 ? 0.5791 0.6619 0.7160 0.0473  -0.0616 -0.0093 233 TRP A O   
1779 C CB  . TRP A 233 ? 0.4355 0.5414 0.5437 0.0506  -0.0585 -0.0235 233 TRP A CB  
1780 C CG  . TRP A 233 ? 0.5458 0.6651 0.6311 0.0547  -0.0469 -0.0201 233 TRP A CG  
1781 C CD1 . TRP A 233 ? 0.6849 0.8149 0.7522 0.0607  -0.0444 -0.0271 233 TRP A CD1 
1782 C CD2 . TRP A 233 ? 0.6467 0.7701 0.7258 0.0528  -0.0369 -0.0085 233 TRP A CD2 
1783 N NE1 . TRP A 233 ? 0.7459 0.8853 0.7982 0.0618  -0.0334 -0.0197 233 TRP A NE1 
1784 C CE2 . TRP A 233 ? 0.7706 0.9061 0.8298 0.0569  -0.0291 -0.0092 233 TRP A CE2 
1785 C CE3 . TRP A 233 ? 0.5995 0.7182 0.6882 0.0480  -0.0345 0.0029  233 TRP A CE3 
1786 C CZ2 . TRP A 233 ? 0.7636 0.9055 0.8140 0.0555  -0.0196 -0.0003 233 TRP A CZ2 
1787 C CZ3 . TRP A 233 ? 0.6156 0.7422 0.6934 0.0477  -0.0252 0.0110  233 TRP A CZ3 
1788 C CH2 . TRP A 233 ? 0.6566 0.7941 0.7163 0.0510  -0.0182 0.0088  233 TRP A CH2 
1789 N N   . ALA A 234 ? 0.6588 0.7518 0.7682 0.0651  -0.0569 -0.0268 234 ALA A N   
1790 C CA  . ALA A 234 ? 0.6587 0.7517 0.7702 0.0641  -0.0511 -0.0147 234 ALA A CA  
1791 C C   . ALA A 234 ? 0.6813 0.7583 0.8107 0.0677  -0.0595 -0.0167 234 ALA A C   
1792 O O   . ALA A 234 ? 0.6989 0.7735 0.8354 0.0644  -0.0568 -0.0031 234 ALA A O   
1793 C CB  . ALA A 234 ? 0.7208 0.8291 0.8128 0.0707  -0.0417 -0.0161 234 ALA A CB  
1794 N N   . SER A 235 ? 0.6393 0.7049 0.7763 0.0750  -0.0702 -0.0332 235 SER A N   
1795 C CA  . SER A 235 ? 0.5776 0.6247 0.7340 0.0786  -0.0794 -0.0352 235 SER A CA  
1796 C C   . SER A 235 ? 0.5794 0.6083 0.7539 0.0774  -0.0939 -0.0472 235 SER A C   
1797 O O   . SER A 235 ? 0.6510 0.6839 0.8198 0.0770  -0.0975 -0.0584 235 SER A O   
1798 C CB  . SER A 235 ? 0.5938 0.6444 0.7420 0.0933  -0.0783 -0.0458 235 SER A CB  
1799 O OG  . SER A 235 ? 0.6675 0.7287 0.7991 0.1036  -0.0783 -0.0643 235 SER A OG  
1800 N N   . VAL A 236 ? 0.4956 0.5040 0.6934 0.0762  -0.1028 -0.0436 236 VAL A N   
1801 C CA  . VAL A 236 ? 0.4534 0.4397 0.6728 0.0765  -0.1188 -0.0567 236 VAL A CA  
1802 C C   . VAL A 236 ? 0.6600 0.6301 0.8878 0.0895  -0.1263 -0.0673 236 VAL A C   
1803 O O   . VAL A 236 ? 0.6412 0.6163 0.8633 0.0954  -0.1192 -0.0593 236 VAL A O   
1804 C CB  . VAL A 236 ? 0.5295 0.5031 0.7757 0.0603  -0.1241 -0.0397 236 VAL A CB  
1805 C CG1 . VAL A 236 ? 0.5548 0.5458 0.7941 0.0488  -0.1169 -0.0302 236 VAL A CG1 
1806 C CG2 . VAL A 236 ? 0.4852 0.4522 0.7438 0.0562  -0.1202 -0.0176 236 VAL A CG2 
1807 N N   . SER A 237 ? 0.7456 0.6962 0.9878 0.0945  -0.1417 -0.0865 237 SER A N   
1808 C CA  . SER A 237 ? 0.7472 0.6772 1.0036 0.1059  -0.1510 -0.0956 237 SER A CA  
1809 C C   . SER A 237 ? 0.7954 0.7047 1.0807 0.0951  -0.1555 -0.0737 237 SER A C   
1810 O O   . SER A 237 ? 0.7361 0.6476 1.0313 0.0788  -0.1521 -0.0533 237 SER A O   
1811 C CB  . SER A 237 ? 0.7417 0.6557 1.0048 0.1156  -0.1673 -0.1249 237 SER A CB  
1812 O OG  . SER A 237 ? 0.8107 0.7037 1.1014 0.1023  -0.1805 -0.1229 237 SER A OG  
1813 N N   . VAL A 238 ? 0.8448 0.7346 1.1442 0.1052  -0.1631 -0.0777 238 VAL A N   
1814 C CA  . VAL A 238 ? 0.8219 0.6913 1.1488 0.0968  -0.1676 -0.0556 238 VAL A CA  
1815 C C   . VAL A 238 ? 0.7318 0.5783 1.0886 0.0829  -0.1812 -0.0535 238 VAL A C   
1816 O O   . VAL A 238 ? 0.7183 0.5613 1.0931 0.0674  -0.1795 -0.0276 238 VAL A O   
1817 C CB  . VAL A 238 ? 0.8625 0.7154 1.1981 0.1130  -0.1738 -0.0623 238 VAL A CB  
1818 C CG1 . VAL A 238 ? 0.8492 0.6805 1.2134 0.1047  -0.1791 -0.0383 238 VAL A CG1 
1819 C CG2 . VAL A 238 ? 0.8583 0.7373 1.1671 0.1249  -0.1597 -0.0614 238 VAL A CG2 
1820 N N   . ALA A 239 ? 0.7446 0.5765 1.1083 0.0886  -0.1955 -0.0806 239 ALA A N   
1821 C CA  . ALA A 239 ? 0.7152 0.5248 1.1098 0.0752  -0.2105 -0.0812 239 ALA A CA  
1822 C C   . ALA A 239 ? 0.7051 0.5343 1.0984 0.0568  -0.2029 -0.0650 239 ALA A C   
1823 O O   . ALA A 239 ? 0.7117 0.5304 1.1333 0.0402  -0.2074 -0.0460 239 ALA A O   
1824 C CB  . ALA A 239 ? 0.7089 0.5037 1.1056 0.0864  -0.2271 -0.1172 239 ALA A CB  
1825 N N   . GLU A 240 ? 0.7200 0.5784 1.0817 0.0597  -0.1910 -0.0711 240 GLU A N   
1826 C CA  . GLU A 240 ? 0.7273 0.6047 1.0866 0.0447  -0.1846 -0.0594 240 GLU A CA  
1827 C C   . GLU A 240 ? 0.8325 0.7211 1.1964 0.0319  -0.1713 -0.0253 240 GLU A C   
1828 O O   . GLU A 240 ? 0.9042 0.7937 1.2884 0.0159  -0.1723 -0.0088 240 GLU A O   
1829 C CB  . GLU A 240 ? 0.6808 0.5851 1.0046 0.0529  -0.1756 -0.0744 240 GLU A CB  
1830 C CG  . GLU A 240 ? 0.6896 0.6158 1.0072 0.0400  -0.1672 -0.0622 240 GLU A CG  
1831 C CD  . GLU A 240 ? 0.6988 0.6168 1.0394 0.0298  -0.1815 -0.0704 240 GLU A CD  
1832 O OE1 . GLU A 240 ? 0.6740 0.5680 1.0347 0.0327  -0.1987 -0.0872 240 GLU A OE1 
1833 O OE2 . GLU A 240 ? 0.6555 0.5914 0.9948 0.0194  -0.1761 -0.0610 240 GLU A OE2 
1834 N N   . GLY A 241 ? 0.7793 0.6785 1.1246 0.0391  -0.1588 -0.0146 241 GLY A N   
1835 C CA  . GLY A 241 ? 0.6717 0.5823 1.0193 0.0288  -0.1469 0.0162  241 GLY A CA  
1836 C C   . GLY A 241 ? 0.6554 0.5444 1.0384 0.0186  -0.1553 0.0357  241 GLY A C   
1837 O O   . GLY A 241 ? 0.7549 0.6541 1.1466 0.0059  -0.1478 0.0621  241 GLY A O   
1838 N N   . ARG A 242 ? 0.6227 0.4822 1.0270 0.0245  -0.1708 0.0234  242 ARG A N   
1839 C CA  . ARG A 242 ? 0.7223 0.5571 1.1653 0.0134  -0.1815 0.0405  242 ARG A CA  
1840 C C   . ARG A 242 ? 0.8372 0.6727 1.3023 -0.0038 -0.1874 0.0443  242 ARG A C   
1841 O O   . ARG A 242 ? 0.8355 0.6780 1.3177 -0.0189 -0.1823 0.0724  242 ARG A O   
1842 C CB  . ARG A 242 ? 0.6146 0.4151 1.0760 0.0247  -0.1985 0.0227  242 ARG A CB  
1843 C CG  . ARG A 242 ? 0.6647 0.4351 1.1684 0.0129  -0.2167 0.0232  242 ARG A CG  
1844 C CD  . ARG A 242 ? 0.8309 0.5652 1.3600 0.0203  -0.2305 0.0225  242 ARG A CD  
1845 N NE  . ARG A 242 ? 0.9220 0.6572 1.4580 0.0170  -0.2219 0.0565  242 ARG A NE  
1846 C CZ  . ARG A 242 ? 0.8771 0.6109 1.4000 0.0319  -0.2174 0.0591  242 ARG A CZ  
1847 N NH1 . ARG A 242 ? 0.8440 0.5800 1.3744 0.0276  -0.2107 0.0914  242 ARG A NH1 
1848 N NH2 . ARG A 242 ? 0.8909 0.6228 1.3939 0.0514  -0.2200 0.0298  242 ARG A NH2 
1849 N N   . ARG A 243 ? 0.8375 0.6681 1.3026 -0.0013 -0.1982 0.0165  243 ARG A N   
1850 C CA  . ARG A 243 ? 0.8339 0.6622 1.3259 -0.0176 -0.2070 0.0189  243 ARG A CA  
1851 C C   . ARG A 243 ? 0.7643 0.6248 1.2479 -0.0301 -0.1911 0.0417  243 ARG A C   
1852 O O   . ARG A 243 ? 0.8933 0.7551 1.4057 -0.0469 -0.1935 0.0605  243 ARG A O   
1853 C CB  . ARG A 243 ? 0.8854 0.7072 1.3742 -0.0115 -0.2211 -0.0164 243 ARG A CB  
1854 C CG  . ARG A 243 ? 0.9537 0.8017 1.4006 0.0007  -0.2112 -0.0352 243 ARG A CG  
1855 C CD  . ARG A 243 ? 0.9654 0.8126 1.4126 0.0026  -0.2249 -0.0643 243 ARG A CD  
1856 N NE  . ARG A 243 ? 0.9111 0.7734 1.3727 -0.0140 -0.2253 -0.0544 243 ARG A NE  
1857 C CZ  . ARG A 243 ? 0.8578 0.7513 1.2982 -0.0175 -0.2100 -0.0436 243 ARG A CZ  
1858 N NH1 . ARG A 243 ? 0.7476 0.6591 1.1520 -0.0068 -0.1935 -0.0410 243 ARG A NH1 
1859 N NH2 . ARG A 243 ? 0.8848 0.7914 1.3418 -0.0318 -0.2117 -0.0354 243 ARG A NH2 
1860 N N   . ARG A 244 ? 0.5766 0.4634 1.0226 -0.0221 -0.1746 0.0421  244 ARG A N   
1861 C CA  . ARG A 244 ? 0.6114 0.5280 1.0483 -0.0321 -0.1591 0.0635  244 ARG A CA  
1862 C C   . ARG A 244 ? 0.6078 0.5272 1.0581 -0.0406 -0.1508 0.0973  244 ARG A C   
1863 O O   . ARG A 244 ? 0.5059 0.4409 0.9700 -0.0542 -0.1448 0.1188  244 ARG A O   
1864 C CB  . ARG A 244 ? 0.5346 0.4759 0.9294 -0.0214 -0.1449 0.0543  244 ARG A CB  
1865 C CG  . ARG A 244 ? 0.5236 0.4647 0.9013 -0.0112 -0.1515 0.0230  244 ARG A CG  
1866 C CD  . ARG A 244 ? 0.5333 0.4987 0.8723 -0.0022 -0.1367 0.0186  244 ARG A CD  
1867 N NE  . ARG A 244 ? 0.6742 0.6444 0.9969 0.0059  -0.1419 -0.0076 244 ARG A NE  
1868 C CZ  . ARG A 244 ? 0.7708 0.7607 1.0615 0.0138  -0.1315 -0.0149 244 ARG A CZ  
1869 N NH1 . ARG A 244 ? 0.6699 0.6754 0.9420 0.0144  -0.1160 0.0003  244 ARG A NH1 
1870 N NH2 . ARG A 244 ? 0.9105 0.9043 1.1885 0.0212  -0.1375 -0.0373 244 ARG A NH2 
1871 N N   . ALA A 245 ? 0.6253 0.5320 1.0717 -0.0322 -0.1500 0.1033  245 ALA A N   
1872 C CA  . ALA A 245 ? 0.6973 0.6032 1.1614 -0.0405 -0.1454 0.1359  245 ALA A CA  
1873 C C   . ALA A 245 ? 0.7743 0.6604 1.2835 -0.0554 -0.1586 0.1477  245 ALA A C   
1874 O O   . ALA A 245 ? 0.5527 0.4523 1.0790 -0.0695 -0.1525 0.1751  245 ALA A O   
1875 C CB  . ALA A 245 ? 0.6012 0.4948 1.0558 -0.0278 -0.1448 0.1387  245 ALA A CB  
1876 N N   . VAL A 246 ? 0.8878 0.7428 1.4172 -0.0525 -0.1769 0.1267  246 VAL A N   
1877 C CA  . VAL A 246 ? 0.9477 0.7791 1.5235 -0.0668 -0.1916 0.1373  246 VAL A CA  
1878 C C   . VAL A 246 ? 1.0692 0.9207 1.6612 -0.0839 -0.1896 0.1465  246 VAL A C   
1879 O O   . VAL A 246 ? 1.0113 0.8617 1.6375 -0.1001 -0.1912 0.1730  246 VAL A O   
1880 C CB  . VAL A 246 ? 0.8355 0.6304 1.4278 -0.0593 -0.2130 0.1071  246 VAL A CB  
1881 C CG1 . VAL A 246 ? 0.6710 0.4397 1.3143 -0.0756 -0.2294 0.1183  246 VAL A CG1 
1882 C CG2 . VAL A 246 ? 0.8271 0.6034 1.4057 -0.0413 -0.2147 0.0989  246 VAL A CG2 
1883 N N   . GLU A 247 ? 1.1408 1.0129 1.7090 -0.0802 -0.1855 0.1264  247 GLU A N   
1884 C CA  . GLU A 247 ? 1.1828 1.0723 1.7685 -0.0948 -0.1866 0.1300  247 GLU A CA  
1885 C C   . GLU A 247 ? 1.0297 0.9548 1.6060 -0.1024 -0.1665 0.1596  247 GLU A C   
1886 O O   . GLU A 247 ? 1.1087 1.0454 1.7144 -0.1186 -0.1658 0.1807  247 GLU A O   
1887 C CB  . GLU A 247 ? 1.2657 1.1607 1.8312 -0.0866 -0.1924 0.0954  247 GLU A CB  
1888 C CG  . GLU A 247 ? 1.3954 1.3019 1.9842 -0.1002 -0.2001 0.0915  247 GLU A CG  
1889 C CD  . GLU A 247 ? 1.5239 1.4694 2.1009 -0.1065 -0.1832 0.1082  247 GLU A CD  
1890 O OE1 . GLU A 247 ? 1.6106 1.5748 2.1668 -0.1038 -0.1650 0.1283  247 GLU A OE1 
1891 O OE2 . GLU A 247 ? 1.4847 1.4433 2.0740 -0.1141 -0.1887 0.1005  247 GLU A OE2 
1892 N N   . LEU A 248 ? 0.8950 0.8386 1.4315 -0.0907 -0.1504 0.1615  248 LEU A N   
1893 C CA  . LEU A 248 ? 0.8381 0.8127 1.3649 -0.0959 -0.1319 0.1901  248 LEU A CA  
1894 C C   . LEU A 248 ? 0.8181 0.7872 1.3773 -0.1079 -0.1320 0.2237  248 LEU A C   
1895 O O   . LEU A 248 ? 0.8906 0.8853 1.4599 -0.1186 -0.1214 0.2494  248 LEU A O   
1896 C CB  . LEU A 248 ? 0.7593 0.7470 1.2426 -0.0812 -0.1179 0.1870  248 LEU A CB  
1897 C CG  . LEU A 248 ? 0.5643 0.5825 1.0333 -0.0838 -0.0992 0.2148  248 LEU A CG  
1898 C CD1 . LEU A 248 ? 0.5027 0.5472 0.9318 -0.0748 -0.0855 0.2039  248 LEU A CD1 
1899 C CD2 . LEU A 248 ? 0.5387 0.5494 1.0070 -0.0804 -0.0960 0.2352  248 LEU A CD2 
1900 N N   . GLY A 249 ? 0.7138 0.6507 1.2896 -0.1054 -0.1434 0.2246  249 GLY A N   
1901 C CA  . GLY A 249 ? 0.7050 0.6314 1.3182 -0.1182 -0.1469 0.2559  249 GLY A CA  
1902 C C   . GLY A 249 ? 0.7075 0.6339 1.3626 -0.1368 -0.1558 0.2631  249 GLY A C   
1903 O O   . GLY A 249 ? 0.6823 0.6302 1.3566 -0.1503 -0.1473 0.2940  249 GLY A O   
1904 N N   . ARG A 250 ? 0.7514 0.6566 1.4210 -0.1375 -0.1731 0.2342  250 ARG A N   
1905 C CA  . ARG A 250 ? 0.8616 0.7662 1.5735 -0.1557 -0.1839 0.2384  250 ARG A CA  
1906 C C   . ARG A 250 ? 0.8803 0.8275 1.5840 -0.1626 -0.1703 0.2458  250 ARG A C   
1907 O O   . ARG A 250 ? 0.8428 0.8040 1.5815 -0.1799 -0.1701 0.2679  250 ARG A O   
1908 C CB  . ARG A 250 ? 0.8904 0.7637 1.6159 -0.1529 -0.2065 0.2020  250 ARG A CB  
1909 C CG  . ARG A 250 ? 0.9636 0.8450 1.7197 -0.1679 -0.2169 0.1950  250 ARG A CG  
1910 C CD  . ARG A 250 ? 1.0374 0.8832 1.8124 -0.1661 -0.2421 0.1613  250 ARG A CD  
1911 N NE  . ARG A 250 ? 1.1009 0.9548 1.8402 -0.1516 -0.2443 0.1244  250 ARG A NE  
1912 C CZ  . ARG A 250 ? 1.0470 0.9232 1.7868 -0.1566 -0.2465 0.1121  250 ARG A CZ  
1913 N NH1 . ARG A 250 ? 0.9425 0.8249 1.6480 -0.1420 -0.2484 0.0799  250 ARG A NH1 
1914 N NH2 . ARG A 250 ? 1.0445 0.9385 1.8197 -0.1760 -0.2465 0.1331  250 ARG A NH2 
1915 N N   . ASN A 251 ? 0.9499 0.9189 1.6093 -0.1492 -0.1585 0.2291  251 ASN A N   
1916 C CA  . ASN A 251 ? 0.9720 0.9818 1.6206 -0.1533 -0.1441 0.2373  251 ASN A CA  
1917 C C   . ASN A 251 ? 0.9983 1.0367 1.6449 -0.1583 -0.1250 0.2743  251 ASN A C   
1918 O O   . ASN A 251 ? 1.0324 1.1064 1.6688 -0.1601 -0.1117 0.2819  251 ASN A O   
1919 C CB  . ASN A 251 ? 0.9119 0.9356 1.5140 -0.1373 -0.1367 0.2108  251 ASN A CB  
1920 C CG  . ASN A 251 ? 0.9634 0.9879 1.5707 -0.1383 -0.1484 0.1837  251 ASN A CG  
1921 O OD1 . ASN A 251 ? 0.9225 0.9305 1.5107 -0.1268 -0.1573 0.1540  251 ASN A OD1 
1922 N ND2 . ASN A 251 ? 1.0828 1.1285 1.7170 -0.1519 -0.1486 0.1945  251 ASN A ND2 
1923 N N   . LEU A 252 ? 0.9259 0.9517 1.5805 -0.1594 -0.1232 0.2970  252 LEU A N   
1924 C CA  . LEU A 252 ? 0.8044 0.8578 1.4670 -0.1674 -0.1078 0.3357  252 LEU A CA  
1925 C C   . LEU A 252 ? 0.7471 0.7794 1.4490 -0.1782 -0.1169 0.3601  252 LEU A C   
1926 O O   . LEU A 252 ? 0.6501 0.6991 1.3456 -0.1765 -0.1056 0.3873  252 LEU A O   
1927 C CB  . LEU A 252 ? 0.7979 0.8699 1.4149 -0.1528 -0.0903 0.3418  252 LEU A CB  
1928 C CG  . LEU A 252 ? 0.7689 0.8815 1.3584 -0.1488 -0.0740 0.3388  252 LEU A CG  
1929 C CD1 . LEU A 252 ? 0.7260 0.8602 1.2762 -0.1370 -0.0567 0.3496  252 LEU A CD1 
1930 C CD2 . LEU A 252 ? 0.7308 0.8715 1.3532 -0.1646 -0.0697 0.3599  252 LEU A CD2 
1931 N N   . ASN A 253 ? 0.8151 0.8138 1.5470 -0.1835 -0.1373 0.3440  253 ASN A N   
1932 C CA  . ASN A 253 ? 0.8988 0.8772 1.6631 -0.1894 -0.1484 0.3573  253 ASN A CA  
1933 C C   . ASN A 253 ? 0.9288 0.8965 1.6833 -0.1817 -0.1439 0.3767  253 ASN A C   
1934 O O   . ASN A 253 ? 0.9244 0.9139 1.6800 -0.1836 -0.1331 0.4063  253 ASN A O   
1935 C CB  . ASN A 253 ? 0.9514 0.9585 1.7382 -0.2012 -0.1435 0.3781  253 ASN A CB  
1936 C CG  . ASN A 253 ? 1.0532 1.0549 1.8641 -0.2101 -0.1572 0.3573  253 ASN A CG  
1937 O OD1 . ASN A 253 ? 1.0956 1.1291 1.9055 -0.2150 -0.1492 0.3592  253 ASN A OD1 
1938 N ND2 . ASN A 253 ? 1.0871 1.0489 1.9185 -0.2108 -0.1785 0.3353  253 ASN A ND2 
1939 N N   . CYS A 254 ? 0.9089 0.8428 1.6535 -0.1718 -0.1533 0.3576  254 CYS A N   
1940 C CA  . CYS A 254 ? 0.9091 0.8275 1.6432 -0.1620 -0.1520 0.3696  254 CYS A CA  
1941 C C   . CYS A 254 ? 0.8936 0.7683 1.6560 -0.1609 -0.1729 0.3577  254 CYS A C   
1942 O O   . CYS A 254 ? 0.9333 0.7869 1.7179 -0.1657 -0.1890 0.3349  254 CYS A O   
1943 C CB  . CYS A 254 ? 0.9092 0.8260 1.6044 -0.1482 -0.1443 0.3578  254 CYS A CB  
1944 S SG  . CYS A 254 ? 0.8496 0.8196 1.5049 -0.1444 -0.1175 0.3785  254 CYS A SG  
1945 N N   . ASN A 255 ? 0.8382 0.7007 1.5989 -0.1538 -0.1727 0.3724  255 ASN A N   
1946 C CA  . ASN A 255 ? 0.9163 0.7366 1.6987 -0.1494 -0.1916 0.3596  255 ASN A CA  
1947 C C   . ASN A 255 ? 1.0083 0.7988 1.7750 -0.1362 -0.2022 0.3223  255 ASN A C   
1948 O O   . ASN A 255 ? 1.0726 0.8706 1.8057 -0.1253 -0.1925 0.3167  255 ASN A O   
1949 C CB  . ASN A 255 ? 0.9863 0.8049 1.7662 -0.1434 -0.1869 0.3845  255 ASN A CB  
1950 C CG  . ASN A 255 ? 1.1168 0.9062 1.9338 -0.1476 -0.2030 0.3879  255 ASN A CG  
1951 O OD1 . ASN A 255 ? 1.1494 0.9056 1.9840 -0.1462 -0.2211 0.3607  255 ASN A OD1 
1952 N ND2 . ASN A 255 ? 1.1785 0.9815 2.0083 -0.1531 -0.1969 0.4211  255 ASN A ND2 
1953 N N   . LEU A 256 ? 0.9971 0.7543 1.7872 -0.1361 -0.2225 0.2961  256 LEU A N   
1954 C CA  . LEU A 256 ? 1.0272 0.7597 1.8027 -0.1234 -0.2334 0.2566  256 LEU A CA  
1955 C C   . LEU A 256 ? 1.1443 0.8368 1.9286 -0.1102 -0.2503 0.2360  256 LEU A C   
1956 O O   . LEU A 256 ? 1.1537 0.8282 1.9204 -0.0955 -0.2575 0.2034  256 LEU A O   
1957 C CB  . LEU A 256 ? 0.9901 0.7250 1.7767 -0.1323 -0.2425 0.2324  256 LEU A CB  
1958 C CG  . LEU A 256 ? 0.9071 0.6682 1.6607 -0.1291 -0.2313 0.2174  256 LEU A CG  
1959 C CD1 . LEU A 256 ? 0.8982 0.7019 1.6281 -0.1322 -0.2069 0.2482  256 LEU A CD1 
1960 C CD2 . LEU A 256 ? 0.7994 0.5659 1.5675 -0.1390 -0.2413 0.1957  256 LEU A CD2 
1961 N N   . ASN A 257 ? 1.2130 0.8925 2.0228 -0.1139 -0.2563 0.2537  257 ASN A N   
1962 C CA  . ASN A 257 ? 1.3575 0.9989 2.1787 -0.1019 -0.2734 0.2329  257 ASN A CA  
1963 C C   . ASN A 257 ? 1.3590 0.9908 2.1499 -0.0808 -0.2692 0.2235  257 ASN A C   
1964 O O   . ASN A 257 ? 1.4106 1.0126 2.2064 -0.0678 -0.2827 0.2017  257 ASN A O   
1965 C CB  . ASN A 257 ? 1.4860 1.1164 2.3416 -0.1108 -0.2798 0.2574  257 ASN A CB  
1966 C CG  . ASN A 257 ? 1.5670 1.2203 2.4469 -0.1313 -0.2751 0.2840  257 ASN A CG  
1967 O OD1 . ASN A 257 ? 1.5618 1.2404 2.4390 -0.1376 -0.2604 0.3183  257 ASN A OD1 
1968 N ND2 . ASN A 257 ? 1.6317 1.2783 2.5350 -0.1410 -0.2878 0.2678  257 ASN A ND2 
1969 N N   . SER A 258 ? 1.2836 0.9408 2.0436 -0.0761 -0.2512 0.2388  258 SER A N   
1970 C CA  . SER A 258 ? 1.2050 0.8560 1.9373 -0.0555 -0.2471 0.2316  258 SER A CA  
1971 C C   . SER A 258 ? 1.1020 0.7802 1.7984 -0.0498 -0.2309 0.2344  258 SER A C   
1972 O O   . SER A 258 ? 1.0212 0.7197 1.7035 -0.0549 -0.2261 0.2188  258 SER A O   
1973 C CB  . SER A 258 ? 1.1333 0.7843 1.8711 -0.0533 -0.2428 0.2612  258 SER A CB  
1974 O OG  . SER A 258 ? 0.9833 0.6698 1.7053 -0.0601 -0.2238 0.2955  258 SER A OG  
1975 N N   . ASP A 259 ? 1.0762 0.7666 1.7495 -0.0381 -0.2200 0.2495  259 ASP A N   
1976 C CA  . ASP A 259 ? 1.0825 0.8165 1.7121 -0.0336 -0.1994 0.2536  259 ASP A CA  
1977 C C   . ASP A 259 ? 1.1130 0.8689 1.7438 -0.0424 -0.1865 0.2974  259 ASP A C   
1978 O O   . ASP A 259 ? 1.1559 0.9432 1.7782 -0.0544 -0.1738 0.3123  259 ASP A O   
1979 C CB  . ASP A 259 ? 1.0759 0.8131 1.6717 -0.0110 -0.1967 0.2295  259 ASP A CB  
1980 C CG  . ASP A 259 ? 1.1126 0.8485 1.6909 -0.0021 -0.2012 0.1870  259 ASP A CG  
1981 O OD1 . ASP A 259 ? 1.1482 0.8859 1.7347 -0.0132 -0.2045 0.1759  259 ASP A OD1 
1982 O OD2 . ASP A 259 ? 1.0970 0.8322 1.6531 0.0165  -0.2011 0.1653  259 ASP A OD2 
1983 N N   . GLU A 260 ? 1.0853 0.8296 1.7240 -0.0361 -0.1890 0.3162  260 GLU A N   
1984 C CA  . GLU A 260 ? 1.0585 0.8317 1.6871 -0.0400 -0.1750 0.3518  260 GLU A CA  
1985 C C   . GLU A 260 ? 1.0951 0.8941 1.7357 -0.0602 -0.1661 0.3760  260 GLU A C   
1986 O O   . GLU A 260 ? 1.0737 0.9085 1.6941 -0.0629 -0.1501 0.3988  260 GLU A O   
1987 C CB  . GLU A 260 ? 1.1013 0.8571 1.7442 -0.0343 -0.1819 0.3634  260 GLU A CB  
1988 C CG  . GLU A 260 ? 1.1863 0.9705 1.8081 -0.0298 -0.1685 0.3927  260 GLU A CG  
1989 C CD  . GLU A 260 ? 1.2607 1.0568 1.9026 -0.0437 -0.1647 0.4263  260 GLU A CD  
1990 O OE1 . GLU A 260 ? 1.2087 1.0242 1.8368 -0.0392 -0.1563 0.4493  260 GLU A OE1 
1991 O OE2 . GLU A 260 ? 1.3521 1.1398 2.0244 -0.0586 -0.1705 0.4298  260 GLU A OE2 
1992 N N   . GLU A 261 ? 1.1211 0.9048 1.7940 -0.0734 -0.1763 0.3697  261 GLU A N   
1993 C CA  . GLU A 261 ? 1.2182 1.0286 1.9052 -0.0918 -0.1684 0.3910  261 GLU A CA  
1994 C C   . GLU A 261 ? 1.2027 1.0346 1.8735 -0.0968 -0.1599 0.3808  261 GLU A C   
1995 O O   . GLU A 261 ? 1.2628 1.1316 1.9248 -0.1053 -0.1451 0.4013  261 GLU A O   
1996 C CB  . GLU A 261 ? 1.3523 1.1400 2.0824 -0.1039 -0.1833 0.3901  261 GLU A CB  
1997 C CG  . GLU A 261 ? 1.4143 1.1656 2.1580 -0.1003 -0.2016 0.3530  261 GLU A CG  
1998 C CD  . GLU A 261 ? 1.4968 1.2145 2.2759 -0.1023 -0.2193 0.3490  261 GLU A CD  
1999 O OE1 . GLU A 261 ? 1.4859 1.2045 2.2757 -0.1036 -0.2174 0.3747  261 GLU A OE1 
2000 O OE2 . GLU A 261 ? 1.5663 1.2568 2.3616 -0.1020 -0.2355 0.3196  261 GLU A OE2 
2001 N N   . LEU A 262 ? 1.0911 0.9015 1.7576 -0.0910 -0.1691 0.3484  262 LEU A N   
2002 C CA  . LEU A 262 ? 0.8583 0.6962 1.5014 -0.0933 -0.1596 0.3322  262 LEU A CA  
2003 C C   . LEU A 262 ? 0.8725 0.7469 1.4696 -0.0829 -0.1406 0.3365  262 LEU A C   
2004 O O   . LEU A 262 ? 0.8766 0.7839 1.4551 -0.0875 -0.1278 0.3370  262 LEU A O   
2005 C CB  . LEU A 262 ? 0.7431 0.5612 1.3806 -0.0853 -0.1719 0.2881  262 LEU A CB  
2006 C CG  . LEU A 262 ? 0.7169 0.5620 1.3141 -0.0774 -0.1619 0.2609  262 LEU A CG  
2007 C CD1 . LEU A 262 ? 0.7513 0.6258 1.3519 -0.0921 -0.1533 0.2697  262 LEU A CD1 
2008 C CD2 . LEU A 262 ? 0.6483 0.4699 1.2411 -0.0667 -0.1758 0.2198  262 LEU A CD2 
2009 N N   . ILE A 263 ? 0.9691 0.8386 1.5484 -0.0688 -0.1390 0.3397  263 ILE A N   
2010 C CA  . ILE A 263 ? 1.0402 0.9449 1.5776 -0.0602 -0.1220 0.3441  263 ILE A CA  
2011 C C   . ILE A 263 ? 1.1275 1.0577 1.6684 -0.0688 -0.1103 0.3853  263 ILE A C   
2012 O O   . ILE A 263 ? 1.1005 1.0672 1.6133 -0.0685 -0.0949 0.3917  263 ILE A O   
2013 C CB  . ILE A 263 ? 0.9604 0.8561 1.4742 -0.0412 -0.1241 0.3288  263 ILE A CB  
2014 C CG1 . ILE A 263 ? 0.9498 0.8196 1.4638 -0.0318 -0.1364 0.2901  263 ILE A CG1 
2015 C CG2 . ILE A 263 ? 0.9365 0.8683 1.4068 -0.0338 -0.1083 0.3228  263 ILE A CG2 
2016 C CD1 . ILE A 263 ? 0.9892 0.8625 1.4721 -0.0129 -0.1339 0.2712  263 ILE A CD1 
2017 N N   . HIS A 264 ? 1.1708 1.0839 1.7449 -0.0759 -0.1173 0.4125  264 HIS A N   
2018 C CA  . HIS A 264 ? 1.1571 1.1045 1.7310 -0.0838 -0.1049 0.4429  264 HIS A CA  
2019 C C   . HIS A 264 ? 1.1781 1.1538 1.7554 -0.0969 -0.0956 0.4478  264 HIS A C   
2020 O O   . HIS A 264 ? 1.2039 1.2190 1.7588 -0.0970 -0.0798 0.4625  264 HIS A O   
2021 C CB  . HIS A 264 ? 1.1117 1.0419 1.7188 -0.0891 -0.1142 0.4587  264 HIS A CB  
2022 C CG  . HIS A 264 ? 1.1359 1.0980 1.7375 -0.0911 -0.1026 0.4902  264 HIS A CG  
2023 N ND1 . HIS A 264 ? 1.1761 1.1352 1.8092 -0.1003 -0.1069 0.5111  264 HIS A ND1 
2024 C CD2 . HIS A 264 ? 1.1430 1.1408 1.7112 -0.0843 -0.0876 0.5034  264 HIS A CD2 
2025 C CE1 . HIS A 264 ? 1.1966 1.1886 1.8157 -0.0988 -0.0946 0.5366  264 HIS A CE1 
2026 N NE2 . HIS A 264 ? 1.1725 1.1885 1.7518 -0.0889 -0.0830 0.5313  264 HIS A NE2 
2027 N N   . CYS A 265 ? 1.1370 1.0942 1.7416 -0.1070 -0.1058 0.4336  265 CYS A N   
2028 C CA  . CYS A 265 ? 1.0925 1.0757 1.7046 -0.1194 -0.0987 0.4367  265 CYS A CA  
2029 C C   . CYS A 265 ? 1.0839 1.0933 1.6613 -0.1152 -0.0852 0.4275  265 CYS A C   
2030 O O   . CYS A 265 ? 1.1558 1.1995 1.7289 -0.1218 -0.0736 0.4359  265 CYS A O   
2031 C CB  . CYS A 265 ? 1.1497 1.1049 1.7977 -0.1297 -0.1150 0.4190  265 CYS A CB  
2032 S SG  . CYS A 265 ? 1.2879 1.2734 1.9523 -0.1455 -0.1094 0.4217  265 CYS A SG  
2033 N N   . LEU A 266 ? 0.9900 0.9920 1.5344 -0.0996 -0.0860 0.3998  266 LEU A N   
2034 C CA  . LEU A 266 ? 0.8303 0.8604 1.3355 -0.0921 -0.0741 0.3800  266 LEU A CA  
2035 C C   . LEU A 266 ? 0.7835 0.8435 1.2535 -0.0830 -0.0591 0.3942  266 LEU A C   
2036 O O   . LEU A 266 ? 0.8140 0.9014 1.2548 -0.0791 -0.0476 0.3837  266 LEU A O   
2037 C CB  . LEU A 266 ? 0.7542 0.7638 1.2421 -0.0807 -0.0825 0.3399  266 LEU A CB  
2038 C CG  . LEU A 266 ? 0.6979 0.6806 1.2116 -0.0862 -0.0977 0.3171  266 LEU A CG  
2039 C CD1 . LEU A 266 ? 0.6402 0.6123 1.1278 -0.0724 -0.1021 0.2797  266 LEU A CD1 
2040 C CD2 . LEU A 266 ? 0.7408 0.7427 1.2693 -0.0997 -0.0942 0.3211  266 LEU A CD2 
2041 N N   . ARG A 267 ? 0.7152 0.7708 1.1870 -0.0792 -0.0595 0.4168  267 ARG A N   
2042 C CA  . ARG A 267 ? 0.7383 0.8253 1.1777 -0.0713 -0.0459 0.4318  267 ARG A CA  
2043 C C   . ARG A 267 ? 0.8475 0.9681 1.2929 -0.0800 -0.0342 0.4622  267 ARG A C   
2044 O O   . ARG A 267 ? 0.8156 0.9691 1.2307 -0.0729 -0.0219 0.4687  267 ARG A O   
2045 C CB  . ARG A 267 ? 0.7782 0.8508 1.2113 -0.0605 -0.0512 0.4399  267 ARG A CB  
2046 C CG  . ARG A 267 ? 0.7186 0.7597 1.1475 -0.0495 -0.0633 0.4099  267 ARG A CG  
2047 C CD  . ARG A 267 ? 0.8042 0.8261 1.2458 -0.0436 -0.0712 0.4277  267 ARG A CD  
2048 N NE  . ARG A 267 ? 0.9628 0.9831 1.3765 -0.0272 -0.0725 0.4086  267 ARG A NE  
2049 C CZ  . ARG A 267 ? 0.9668 0.9587 1.3847 -0.0181 -0.0837 0.3834  267 ARG A CZ  
2050 N NH1 . ARG A 267 ? 0.9654 0.9254 1.4133 -0.0231 -0.0959 0.3725  267 ARG A NH1 
2051 N NH2 . ARG A 267 ? 0.9576 0.9547 1.3502 -0.0038 -0.0830 0.3693  267 ARG A NH2 
2052 N N   . GLU A 268 ? 0.9483 1.0645 1.4289 -0.0923 -0.0388 0.4719  268 GLU A N   
2053 C CA  . GLU A 268 ? 0.9470 1.0990 1.4325 -0.0982 -0.0284 0.4913  268 GLU A CA  
2054 C C   . GLU A 268 ? 0.8787 1.0564 1.3561 -0.1025 -0.0191 0.4826  268 GLU A C   
2055 O O   . GLU A 268 ? 0.9641 1.1790 1.4306 -0.1016 -0.0069 0.4945  268 GLU A O   
2056 C CB  . GLU A 268 ? 1.0548 1.1917 1.5830 -0.1091 -0.0381 0.5071  268 GLU A CB  
2057 C CG  . GLU A 268 ? 1.2401 1.3764 1.7718 -0.1051 -0.0393 0.5283  268 GLU A CG  
2058 C CD  . GLU A 268 ? 1.3680 1.5496 1.8797 -0.1014 -0.0240 0.5482  268 GLU A CD  
2059 O OE1 . GLU A 268 ? 1.3670 1.5632 1.8457 -0.0897 -0.0173 0.5484  268 GLU A OE1 
2060 O OE2 . GLU A 268 ? 1.4276 1.6309 1.9565 -0.1096 -0.0193 0.5626  268 GLU A OE2 
2061 N N   . LYS A 269 ? 0.7776 0.9371 1.2598 -0.1060 -0.0245 0.4613  269 LYS A N   
2062 C CA  . LYS A 269 ? 0.7635 0.9464 1.2401 -0.1100 -0.0165 0.4513  269 LYS A CA  
2063 C C   . LYS A 269 ? 0.7544 0.9657 1.1869 -0.0986 -0.0023 0.4437  269 LYS A C   
2064 O O   . LYS A 269 ? 0.7742 0.9767 1.1794 -0.0872 -0.0030 0.4324  269 LYS A O   
2065 C CB  . LYS A 269 ? 0.7616 0.9167 1.2553 -0.1154 -0.0285 0.4257  269 LYS A CB  
2066 C CG  . LYS A 269 ? 0.8121 0.9341 1.3523 -0.1278 -0.0448 0.4317  269 LYS A CG  
2067 C CD  . LYS A 269 ? 0.8624 0.9882 1.4300 -0.1399 -0.0495 0.4234  269 LYS A CD  
2068 C CE  . LYS A 269 ? 0.8732 0.9887 1.4806 -0.1503 -0.0595 0.4383  269 LYS A CE  
2069 N NZ  . LYS A 269 ? 0.7868 0.9155 1.4180 -0.1615 -0.0616 0.4344  269 LYS A NZ  
2070 N N   . LYS A 270 ? 0.7619 1.0073 1.1854 -0.0990 0.0090  0.4438  270 LYS A N   
2071 C CA  . LYS A 270 ? 0.8089 1.0817 1.1921 -0.0880 0.0219  0.4337  270 LYS A CA  
2072 C C   . LYS A 270 ? 0.7833 1.0388 1.1491 -0.0822 0.0172  0.3993  270 LYS A C   
2073 O O   . LYS A 270 ? 0.7746 1.0041 1.1603 -0.0873 0.0056  0.3833  270 LYS A O   
2074 C CB  . LYS A 270 ? 0.8658 1.1759 1.2456 -0.0879 0.0329  0.4385  270 LYS A CB  
2075 C CG  . LYS A 270 ? 0.8889 1.2173 1.2829 -0.0903 0.0356  0.4635  270 LYS A CG  
2076 C CD  . LYS A 270 ? 0.9416 1.3066 1.3021 -0.0781 0.0486  0.4681  270 LYS A CD  
2077 C CE  . LYS A 270 ? 0.9771 1.3648 1.3151 -0.0720 0.0581  0.4504  270 LYS A CE  
2078 N NZ  . LYS A 270 ? 1.0110 1.4285 1.3123 -0.0582 0.0687  0.4487  270 LYS A NZ  
2079 N N   . PRO A 271 ? 0.7511 1.0198 1.0775 -0.0697 0.0246  0.3835  271 PRO A N   
2080 C CA  . PRO A 271 ? 0.7135 0.9637 1.0213 -0.0623 0.0189  0.3490  271 PRO A CA  
2081 C C   . PRO A 271 ? 0.6974 0.9460 1.0179 -0.0675 0.0164  0.3326  271 PRO A C   
2082 O O   . PRO A 271 ? 0.5694 0.7908 0.9008 -0.0689 0.0047  0.3139  271 PRO A O   
2083 C CB  . PRO A 271 ? 0.6482 0.9196 0.9156 -0.0503 0.0292  0.3409  271 PRO A CB  
2084 C CG  . PRO A 271 ? 0.6307 0.9213 0.8934 -0.0491 0.0357  0.3685  271 PRO A CG  
2085 C CD  . PRO A 271 ? 0.6953 0.9951 0.9927 -0.0615 0.0373  0.3959  271 PRO A CD  
2086 N N   . GLN A 272 ? 0.7682 1.0475 1.0874 -0.0693 0.0271  0.3393  272 GLN A N   
2087 C CA  . GLN A 272 ? 0.7598 1.0409 1.0900 -0.0730 0.0250  0.3240  272 GLN A CA  
2088 C C   . GLN A 272 ? 0.7270 0.9897 1.0983 -0.0860 0.0130  0.3288  272 GLN A C   
2089 O O   . GLN A 272 ? 0.7396 0.9943 1.1203 -0.0884 0.0063  0.3106  272 GLN A O   
2090 C CB  . GLN A 272 ? 0.3685 0.6883 0.6928 -0.0720 0.0390  0.3326  272 GLN A CB  
2091 C CG  . GLN A 272 ? 0.3538 0.6860 0.6388 -0.0585 0.0473  0.3139  272 GLN A CG  
2092 C CD  . GLN A 272 ? 0.6798 0.9966 0.9570 -0.0547 0.0412  0.2848  272 GLN A CD  
2093 O OE1 . GLN A 272 ? 0.7195 1.0172 1.0186 -0.0613 0.0305  0.2768  272 GLN A OE1 
2094 N NE2 . GLN A 272 ? 0.7443 1.0691 0.9902 -0.0438 0.0475  0.2688  272 GLN A NE2 
2095 N N   . GLU A 273 ? 0.6980 0.9528 1.0941 -0.0942 0.0092  0.3524  273 GLU A N   
2096 C CA  . GLU A 273 ? 0.7563 0.9907 1.1943 -0.1074 -0.0038 0.3568  273 GLU A CA  
2097 C C   . GLU A 273 ? 0.6639 0.8623 1.1008 -0.1038 -0.0190 0.3265  273 GLU A C   
2098 O O   . GLU A 273 ? 0.6965 0.8854 1.1554 -0.1105 -0.0286 0.3143  273 GLU A O   
2099 C CB  . GLU A 273 ? 0.8959 1.1231 1.3583 -0.1153 -0.0061 0.3871  273 GLU A CB  
2100 C CG  . GLU A 273 ? 0.9726 1.2364 1.4289 -0.1156 0.0094  0.4171  273 GLU A CG  
2101 C CD  . GLU A 273 ? 1.0491 1.3190 1.5371 -0.1247 0.0063  0.4371  273 GLU A CD  
2102 O OE1 . GLU A 273 ? 1.1021 1.3488 1.6259 -0.1360 -0.0069 0.4350  273 GLU A OE1 
2103 O OE2 . GLU A 273 ? 1.0094 1.3078 1.4872 -0.1204 0.0164  0.4545  273 GLU A OE2 
2104 N N   . LEU A 274 ? 0.6570 0.8375 1.0684 -0.0926 -0.0213 0.3136  274 LEU A N   
2105 C CA  . LEU A 274 ? 0.6714 0.8214 1.0792 -0.0875 -0.0344 0.2845  274 LEU A CA  
2106 C C   . LEU A 274 ? 0.6421 0.8017 1.0252 -0.0804 -0.0310 0.2592  274 LEU A C   
2107 O O   . LEU A 274 ? 0.6917 0.8363 1.0823 -0.0808 -0.0414 0.2383  274 LEU A O   
2108 C CB  . LEU A 274 ? 0.7038 0.8335 1.0952 -0.0778 -0.0378 0.2803  274 LEU A CB  
2109 C CG  . LEU A 274 ? 0.7644 0.8837 1.1796 -0.0836 -0.0414 0.3070  274 LEU A CG  
2110 C CD1 . LEU A 274 ? 0.7578 0.8984 1.1497 -0.0776 -0.0288 0.3264  274 LEU A CD1 
2111 C CD2 . LEU A 274 ? 0.7759 0.8576 1.2025 -0.0798 -0.0565 0.2943  274 LEU A CD2 
2112 N N   . ILE A 275 ? 0.5628 0.7476 0.9170 -0.0735 -0.0172 0.2609  275 ILE A N   
2113 C CA  . ILE A 275 ? 0.5134 0.7074 0.8452 -0.0668 -0.0136 0.2393  275 ILE A CA  
2114 C C   . ILE A 275 ? 0.6414 0.8455 0.9959 -0.0748 -0.0163 0.2374  275 ILE A C   
2115 O O   . ILE A 275 ? 0.7100 0.9085 1.0585 -0.0715 -0.0215 0.2158  275 ILE A O   
2116 C CB  . ILE A 275 ? 0.4384 0.6573 0.7388 -0.0586 0.0013  0.2436  275 ILE A CB  
2117 C CG1 . ILE A 275 ? 0.4234 0.6340 0.7047 -0.0518 0.0027  0.2471  275 ILE A CG1 
2118 C CG2 . ILE A 275 ? 0.3463 0.5698 0.6233 -0.0509 0.0040  0.2211  275 ILE A CG2 
2119 C CD1 . ILE A 275 ? 0.4019 0.6359 0.6534 -0.0441 0.0153  0.2503  275 ILE A CD1 
2120 N N   . ASP A 276 ? 0.6733 0.8946 1.0546 -0.0854 -0.0128 0.2609  276 ASP A N   
2121 C CA  . ASP A 276 ? 0.7293 0.9628 1.1360 -0.0940 -0.0159 0.2603  276 ASP A CA  
2122 C C   . ASP A 276 ? 0.7216 0.9268 1.1512 -0.0994 -0.0340 0.2439  276 ASP A C   
2123 O O   . ASP A 276 ? 0.8124 1.0215 1.2487 -0.1007 -0.0394 0.2292  276 ASP A O   
2124 C CB  . ASP A 276 ? 0.8444 1.1029 1.2793 -0.1053 -0.0087 0.2912  276 ASP A CB  
2125 C CG  . ASP A 276 ? 0.8748 1.1700 1.2875 -0.0989 0.0097  0.3036  276 ASP A CG  
2126 O OD1 . ASP A 276 ? 0.9217 1.2234 1.3021 -0.0870 0.0157  0.2860  276 ASP A OD1 
2127 O OD2 . ASP A 276 ? 0.7389 1.0568 1.1674 -0.1054 0.0181  0.3311  276 ASP A OD2 
2128 N N   . VAL A 277 ? 0.7062 0.8829 1.1467 -0.1014 -0.0440 0.2448  277 VAL A N   
2129 C CA  . VAL A 277 ? 0.6172 0.7652 1.0800 -0.1056 -0.0623 0.2282  277 VAL A CA  
2130 C C   . VAL A 277 ? 0.5990 0.7234 1.0343 -0.0925 -0.0687 0.2011  277 VAL A C   
2131 O O   . VAL A 277 ? 0.4900 0.5895 0.9383 -0.0929 -0.0840 0.1839  277 VAL A O   
2132 C CB  . VAL A 277 ? 0.6696 0.8001 1.1698 -0.1174 -0.0710 0.2478  277 VAL A CB  
2133 C CG1 . VAL A 277 ? 0.7416 0.8490 1.2740 -0.1254 -0.0903 0.2330  277 VAL A CG1 
2134 C CG2 . VAL A 277 ? 0.6459 0.8045 1.1656 -0.1282 -0.0596 0.2815  277 VAL A CG2 
2135 N N   . GLU A 278 ? 0.6414 0.7742 1.0394 -0.0808 -0.0574 0.1966  278 GLU A N   
2136 C CA  . GLU A 278 ? 0.6594 0.7748 1.0300 -0.0681 -0.0608 0.1742  278 GLU A CA  
2137 C C   . GLU A 278 ? 0.6049 0.7048 0.9782 -0.0653 -0.0740 0.1475  278 GLU A C   
2138 O O   . GLU A 278 ? 0.6596 0.7349 1.0353 -0.0608 -0.0849 0.1339  278 GLU A O   
2139 C CB  . GLU A 278 ? 0.7605 0.8952 1.0940 -0.0585 -0.0465 0.1713  278 GLU A CB  
2140 C CG  . GLU A 278 ? 0.8577 0.9792 1.1632 -0.0464 -0.0470 0.1541  278 GLU A CG  
2141 C CD  . GLU A 278 ? 0.9809 1.1180 1.2585 -0.0401 -0.0335 0.1617  278 GLU A CD  
2142 O OE1 . GLU A 278 ? 1.0046 1.1547 1.2599 -0.0348 -0.0264 0.1524  278 GLU A OE1 
2143 O OE2 . GLU A 278 ? 1.0622 1.1985 1.3409 -0.0404 -0.0305 0.1773  278 GLU A OE2 
2144 N N   . TRP A 279 ? 0.5643 0.6797 0.9366 -0.0668 -0.0735 0.1392  279 TRP A N   
2145 C CA  . TRP A 279 ? 0.5945 0.7009 0.9592 -0.0609 -0.0837 0.1127  279 TRP A CA  
2146 C C   . TRP A 279 ? 0.7095 0.7998 1.1075 -0.0689 -0.1014 0.1044  279 TRP A C   
2147 O O   . TRP A 279 ? 0.6673 0.7474 1.0588 -0.0628 -0.1121 0.0806  279 TRP A O   
2148 C CB  . TRP A 279 ? 0.5011 0.6308 0.8486 -0.0574 -0.0763 0.1067  279 TRP A CB  
2149 C CG  . TRP A 279 ? 0.4967 0.6437 0.8166 -0.0514 -0.0594 0.1163  279 TRP A CG  
2150 C CD1 . TRP A 279 ? 0.5660 0.7325 0.8901 -0.0563 -0.0475 0.1380  279 TRP A CD1 
2151 C CD2 . TRP A 279 ? 0.3758 0.5221 0.6605 -0.0395 -0.0529 0.1044  279 TRP A CD2 
2152 N NE1 . TRP A 279 ? 0.5002 0.6769 0.7931 -0.0475 -0.0351 0.1382  279 TRP A NE1 
2153 C CE2 . TRP A 279 ? 0.4585 0.6224 0.7282 -0.0380 -0.0383 0.1184  279 TRP A CE2 
2154 C CE3 . TRP A 279 ? 0.4052 0.5389 0.6701 -0.0298 -0.0579 0.0837  279 TRP A CE3 
2155 C CZ2 . TRP A 279 ? 0.5698 0.7366 0.8076 -0.0283 -0.0299 0.1117  279 TRP A CZ2 
2156 C CZ3 . TRP A 279 ? 0.4244 0.5630 0.6579 -0.0206 -0.0482 0.0793  279 TRP A CZ3 
2157 C CH2 . TRP A 279 ? 0.5257 0.6794 0.7471 -0.0205 -0.0350 0.0930  279 TRP A CH2 
2158 N N   . ASN A 280 ? 0.8104 0.8979 1.2434 -0.0819 -0.1054 0.1230  280 ASN A N   
2159 C CA  . ASN A 280 ? 0.8754 0.9481 1.3439 -0.0914 -0.1233 0.1154  280 ASN A CA  
2160 C C   . ASN A 280 ? 0.9306 0.9693 1.4023 -0.0855 -0.1385 0.0965  280 ASN A C   
2161 O O   . ASN A 280 ? 1.0454 1.0670 1.5493 -0.0936 -0.1551 0.0901  280 ASN A O   
2162 C CB  . ASN A 280 ? 0.9088 0.9883 1.4163 -0.1081 -0.1226 0.1434  280 ASN A CB  
2163 C CG  . ASN A 280 ? 0.9310 1.0460 1.4426 -0.1143 -0.1112 0.1579  280 ASN A CG  
2164 O OD1 . ASN A 280 ? 0.9259 1.0603 1.4066 -0.1051 -0.0997 0.1522  280 ASN A OD1 
2165 N ND2 . ASN A 280 ? 0.9836 1.1076 1.5349 -0.1300 -0.1143 0.1768  280 ASN A ND2 
2166 N N   . VAL A 281 ? 0.8283 0.8573 1.2695 -0.0717 -0.1342 0.0862  281 VAL A N   
2167 C CA  . VAL A 281 ? 0.7303 0.7289 1.1746 -0.0646 -0.1469 0.0703  281 VAL A CA  
2168 C C   . VAL A 281 ? 0.7669 0.7625 1.1815 -0.0494 -0.1509 0.0400  281 VAL A C   
2169 O O   . VAL A 281 ? 0.8300 0.8042 1.2403 -0.0398 -0.1592 0.0243  281 VAL A O   
2170 C CB  . VAL A 281 ? 0.6445 0.6336 1.0838 -0.0611 -0.1394 0.0870  281 VAL A CB  
2171 C CG1 . VAL A 281 ? 0.6304 0.6288 1.0938 -0.0750 -0.1326 0.1197  281 VAL A CG1 
2172 C CG2 . VAL A 281 ? 0.6056 0.6101 1.0034 -0.0485 -0.1242 0.0843  281 VAL A CG2 
2173 N N   . LEU A 282 ? 0.7496 0.7670 1.1438 -0.0463 -0.1451 0.0321  282 LEU A N   
2174 C CA  . LEU A 282 ? 0.8276 0.8463 1.1907 -0.0315 -0.1465 0.0068  282 LEU A CA  
2175 C C   . LEU A 282 ? 0.9258 0.9313 1.3026 -0.0301 -0.1661 -0.0179 282 LEU A C   
2176 O O   . LEU A 282 ? 0.8584 0.8683 1.2597 -0.0409 -0.1747 -0.0170 282 LEU A O   
2177 C CB  . LEU A 282 ? 0.7934 0.8394 1.1301 -0.0285 -0.1332 0.0094  282 LEU A CB  
2178 C CG  . LEU A 282 ? 0.7980 0.8560 1.1156 -0.0269 -0.1147 0.0286  282 LEU A CG  
2179 C CD1 . LEU A 282 ? 0.7705 0.8539 1.0838 -0.0323 -0.1034 0.0419  282 LEU A CD1 
2180 C CD2 . LEU A 282 ? 0.7654 0.8220 1.0492 -0.0126 -0.1085 0.0167  282 LEU A CD2 
2181 N N   . PRO A 283 ? 1.0509 1.0422 1.4124 -0.0165 -0.1736 -0.0410 283 PRO A N   
2182 C CA  . PRO A 283 ? 1.1260 1.1006 1.5034 -0.0146 -0.1943 -0.0657 283 PRO A CA  
2183 C C   . PRO A 283 ? 1.1769 1.1692 1.5480 -0.0146 -0.2002 -0.0796 283 PRO A C   
2184 O O   . PRO A 283 ? 1.2474 1.2363 1.6472 -0.0248 -0.2143 -0.0838 283 PRO A O   
2185 C CB  . PRO A 283 ? 1.1334 1.0947 1.4886 0.0031  -0.1967 -0.0857 283 PRO A CB  
2186 C CG  . PRO A 283 ? 1.0829 1.0637 1.4027 0.0113  -0.1767 -0.0763 283 PRO A CG  
2187 C CD  . PRO A 283 ? 1.0584 1.0509 1.3870 -0.0018 -0.1633 -0.0462 283 PRO A CD  
2188 N N   . PHE A 284 ? 1.2122 1.2237 1.5469 -0.0033 -0.1899 -0.0862 284 PHE A N   
2189 C CA  . PHE A 284 ? 1.2978 1.3283 1.6219 -0.0012 -0.1939 -0.0977 284 PHE A CA  
2190 C C   . PHE A 284 ? 1.4226 1.4764 1.7465 -0.0103 -0.1799 -0.0750 284 PHE A C   
2191 O O   . PHE A 284 ? 1.4171 1.4753 1.7353 -0.0131 -0.1642 -0.0543 284 PHE A O   
2192 C CB  . PHE A 284 ? 1.2493 1.2879 1.5342 0.0170  -0.1909 -0.1169 284 PHE A CB  
2193 C CG  . PHE A 284 ? 1.2964 1.3158 1.5732 0.0290  -0.1953 -0.1321 284 PHE A CG  
2194 C CD1 . PHE A 284 ? 1.3407 1.3651 1.5894 0.0398  -0.1807 -0.1282 284 PHE A CD1 
2195 C CD2 . PHE A 284 ? 1.3413 1.3380 1.6403 0.0297  -0.2145 -0.1504 284 PHE A CD2 
2196 C CE1 . PHE A 284 ? 1.3594 1.3691 1.6016 0.0517  -0.1841 -0.1418 284 PHE A CE1 
2197 C CE2 . PHE A 284 ? 1.3410 1.3205 1.6328 0.0424  -0.2184 -0.1651 284 PHE A CE2 
2198 C CZ  . PHE A 284 ? 1.3564 1.3436 1.6196 0.0537  -0.2027 -0.1604 284 PHE A CZ  
2199 N N   . ASP A 285 ? 1.5446 1.6138 1.8760 -0.0145 -0.1866 -0.0794 285 ASP A N   
2200 C CA  . ASP A 285 ? 1.6268 1.7201 1.9569 -0.0207 -0.1740 -0.0606 285 ASP A CA  
2201 C C   . ASP A 285 ? 1.5205 1.6245 1.8140 -0.0108 -0.1550 -0.0528 285 ASP A C   
2202 O O   . ASP A 285 ? 1.5341 1.6440 1.8271 -0.0156 -0.1405 -0.0321 285 ASP A O   
2203 C CB  . ASP A 285 ? 1.7704 1.8804 2.1056 -0.0215 -0.1845 -0.0715 285 ASP A CB  
2204 C CG  . ASP A 285 ? 1.8811 1.9813 2.2552 -0.0325 -0.2049 -0.0803 285 ASP A CG  
2205 O OD1 . ASP A 285 ? 1.9373 2.0133 2.3299 -0.0363 -0.2135 -0.0838 285 ASP A OD1 
2206 O OD2 . ASP A 285 ? 1.8832 1.9996 2.2707 -0.0373 -0.2132 -0.0836 285 ASP A OD2 
2207 N N   . SER A 286 ? 1.2578 1.3651 1.5207 0.0031  -0.1553 -0.0693 286 SER A N   
2208 C CA  . SER A 286 ? 1.0270 1.1362 1.2575 0.0133  -0.1406 -0.0660 286 SER A CA  
2209 C C   . SER A 286 ? 1.0262 1.1513 1.2454 0.0108  -0.1231 -0.0460 286 SER A C   
2210 O O   . SER A 286 ? 0.8709 1.0073 1.0628 0.0193  -0.1149 -0.0473 286 SER A O   
2211 C CB  . SER A 286 ? 0.8098 0.8990 1.0448 0.0143  -0.1398 -0.0650 286 SER A CB  
2212 O OG  . SER A 286 ? 0.6047 0.6986 0.8186 0.0180  -0.1230 -0.0523 286 SER A OG  
2213 N N   . ILE A 287 ? 1.2042 1.3297 1.4433 -0.0003 -0.1170 -0.0271 287 ILE A N   
2214 C CA  . ILE A 287 ? 1.2006 1.3416 1.4316 -0.0027 -0.1014 -0.0091 287 ILE A CA  
2215 C C   . ILE A 287 ? 1.1348 1.2733 1.3377 0.0050  -0.0883 -0.0054 287 ILE A C   
2216 O O   . ILE A 287 ? 1.1499 1.2942 1.3496 0.0019  -0.0760 0.0102  287 ILE A O   
2217 C CB  . ILE A 287 ? 1.2665 1.4265 1.4915 -0.0005 -0.1014 -0.0113 287 ILE A CB  
2218 C CG1 . ILE A 287 ? 1.2160 1.3803 1.4702 -0.0082 -0.1161 -0.0164 287 ILE A CG1 
2219 C CG2 . ILE A 287 ? 1.3304 1.5054 1.5500 -0.0024 -0.0864 0.0060  287 ILE A CG2 
2220 C CD1 . ILE A 287 ? 1.1442 1.3101 1.4322 -0.0223 -0.1159 -0.0001 287 ILE A CD1 
2221 N N   . PHE A 288 ? 1.0626 1.1937 1.2461 0.0152  -0.0911 -0.0201 288 PHE A N   
2222 C CA  . PHE A 288 ? 0.9108 1.0429 1.0674 0.0231  -0.0797 -0.0186 288 PHE A CA  
2223 C C   . PHE A 288 ? 0.8228 0.9408 0.9812 0.0241  -0.0783 -0.0171 288 PHE A C   
2224 O O   . PHE A 288 ? 0.7301 0.8485 0.8681 0.0316  -0.0714 -0.0193 288 PHE A O   
2225 C CB  . PHE A 288 ? 0.7676 0.9049 0.9009 0.0344  -0.0821 -0.0336 288 PHE A CB  
2226 C CG  . PHE A 288 ? 0.7375 0.8887 0.8675 0.0352  -0.0844 -0.0352 288 PHE A CG  
2227 C CD1 . PHE A 288 ? 0.7545 0.9098 0.8767 0.0425  -0.0945 -0.0512 288 PHE A CD1 
2228 C CD2 . PHE A 288 ? 0.7708 0.9324 0.9046 0.0298  -0.0765 -0.0212 288 PHE A CD2 
2229 C CE1 . PHE A 288 ? 0.7998 0.9689 0.9186 0.0440  -0.0971 -0.0519 288 PHE A CE1 
2230 C CE2 . PHE A 288 ? 0.8817 1.0564 1.0132 0.0316  -0.0788 -0.0224 288 PHE A CE2 
2231 C CZ  . PHE A 288 ? 0.8701 1.0484 0.9943 0.0384  -0.0892 -0.0372 288 PHE A CZ  
2232 N N   . ARG A 289 ? 0.7871 0.8936 0.9707 0.0167  -0.0851 -0.0128 289 ARG A N   
2233 C CA  . ARG A 289 ? 0.6979 0.7903 0.8863 0.0177  -0.0849 -0.0098 289 ARG A CA  
2234 C C   . ARG A 289 ? 0.6801 0.7755 0.8780 0.0090  -0.0757 0.0121  289 ARG A C   
2235 O O   . ARG A 289 ? 0.6823 0.7911 0.8827 0.0028  -0.0693 0.0236  289 ARG A O   
2236 C CB  . ARG A 289 ? 0.7406 0.8147 0.9509 0.0171  -0.1006 -0.0214 289 ARG A CB  
2237 C CG  . ARG A 289 ? 0.8311 0.9024 1.0314 0.0274  -0.1111 -0.0457 289 ARG A CG  
2238 C CD  . ARG A 289 ? 0.9418 1.0260 1.1086 0.0390  -0.1016 -0.0520 289 ARG A CD  
2239 N NE  . ARG A 289 ? 1.0880 1.1672 1.2433 0.0519  -0.1089 -0.0730 289 ARG A NE  
2240 C CZ  . ARG A 289 ? 1.0989 1.1904 1.2269 0.0630  -0.1028 -0.0808 289 ARG A CZ  
2241 N NH1 . ARG A 289 ? 1.0427 1.1496 1.1531 0.0621  -0.0901 -0.0694 289 ARG A NH1 
2242 N NH2 . ARG A 289 ? 1.1133 1.2020 1.2326 0.0751  -0.1097 -0.0999 289 ARG A NH2 
2243 N N   . PHE A 290 ? 0.6731 0.7574 0.8757 0.0096  -0.0751 0.0176  290 PHE A N   
2244 C CA  . PHE A 290 ? 0.4992 0.5866 0.7100 0.0025  -0.0674 0.0386  290 PHE A CA  
2245 C C   . PHE A 290 ? 0.5778 0.6469 0.8114 -0.0004 -0.0758 0.0432  290 PHE A C   
2246 O O   . PHE A 290 ? 0.5494 0.6039 0.7824 0.0071  -0.0832 0.0300  290 PHE A O   
2247 C CB  . PHE A 290 ? 0.5169 0.6137 0.7028 0.0079  -0.0548 0.0438  290 PHE A CB  
2248 C CG  . PHE A 290 ? 0.5160 0.6264 0.6797 0.0120  -0.0480 0.0374  290 PHE A CG  
2249 C CD1 . PHE A 290 ? 0.4871 0.5969 0.6323 0.0213  -0.0485 0.0227  290 PHE A CD1 
2250 C CD2 . PHE A 290 ? 0.5314 0.6558 0.6938 0.0071  -0.0411 0.0467  290 PHE A CD2 
2251 C CE1 . PHE A 290 ? 0.4161 0.5376 0.5424 0.0246  -0.0425 0.0190  290 PHE A CE1 
2252 C CE2 . PHE A 290 ? 0.4859 0.6206 0.6293 0.0113  -0.0356 0.0413  290 PHE A CE2 
2253 C CZ  . PHE A 290 ? 0.3759 0.5083 0.5016 0.0197  -0.0365 0.0282  290 PHE A CZ  
2254 N N   . SER A 291 ? 0.7068 0.7776 0.9611 -0.0109 -0.0744 0.0625  291 SER A N   
2255 C CA  . SER A 291 ? 0.7788 0.8311 1.0616 -0.0163 -0.0843 0.0691  291 SER A CA  
2256 C C   . SER A 291 ? 0.7509 0.7894 1.0277 -0.0081 -0.0852 0.0680  291 SER A C   
2257 O O   . SER A 291 ? 0.8100 0.8285 1.0973 -0.0034 -0.0968 0.0551  291 SER A O   
2258 C CB  . SER A 291 ? 0.8235 0.8852 1.1267 -0.0288 -0.0796 0.0944  291 SER A CB  
2259 O OG  . SER A 291 ? 0.7967 0.8737 1.1071 -0.0358 -0.0784 0.0957  291 SER A OG  
2260 N N   . PHE A 292 ? 0.6610 0.7105 0.9211 -0.0055 -0.0736 0.0804  292 PHE A N   
2261 C CA  . PHE A 292 ? 0.5931 0.6323 0.8512 0.0009  -0.0741 0.0840  292 PHE A CA  
2262 C C   . PHE A 292 ? 0.5849 0.6352 0.8126 0.0112  -0.0656 0.0753  292 PHE A C   
2263 O O   . PHE A 292 ? 0.5142 0.5827 0.7245 0.0099  -0.0544 0.0829  292 PHE A O   
2264 C CB  . PHE A 292 ? 0.6374 0.6791 0.9093 -0.0066 -0.0702 0.1103  292 PHE A CB  
2265 C CG  . PHE A 292 ? 0.7327 0.7610 1.0387 -0.0170 -0.0796 0.1204  292 PHE A CG  
2266 C CD1 . PHE A 292 ? 0.8469 0.8502 1.1747 -0.0156 -0.0916 0.1196  292 PHE A CD1 
2267 C CD2 . PHE A 292 ? 0.6012 0.6419 0.9197 -0.0281 -0.0773 0.1301  292 PHE A CD2 
2268 C CE1 . PHE A 292 ? 0.8054 0.7946 1.1674 -0.0265 -0.1013 0.1292  292 PHE A CE1 
2269 C CE2 . PHE A 292 ? 0.5045 0.5342 0.8572 -0.0390 -0.0863 0.1400  292 PHE A CE2 
2270 C CZ  . PHE A 292 ? 0.5541 0.5574 0.9291 -0.0389 -0.0985 0.1399  292 PHE A CZ  
2271 N N   . VAL A 293 ? 0.5334 0.5730 0.7561 0.0216  -0.0712 0.0588  293 VAL A N   
2272 C CA  . VAL A 293 ? 0.5365 0.5866 0.7335 0.0315  -0.0646 0.0480  293 VAL A CA  
2273 C C   . VAL A 293 ? 0.6034 0.6421 0.8040 0.0414  -0.0695 0.0429  293 VAL A C   
2274 O O   . VAL A 293 ? 0.6096 0.6295 0.8321 0.0413  -0.0793 0.0446  293 VAL A O   
2275 C CB  . VAL A 293 ? 0.5395 0.5946 0.7235 0.0357  -0.0658 0.0288  293 VAL A CB  
2276 C CG1 . VAL A 293 ? 0.6683 0.7369 0.8470 0.0274  -0.0598 0.0348  293 VAL A CG1 
2277 C CG2 . VAL A 293 ? 0.4966 0.5343 0.6961 0.0390  -0.0795 0.0128  293 VAL A CG2 
2278 N N   . PRO A 294 ? 0.4560 0.5057 0.6374