data_6GBL
# 
_entry.id   6GBL 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.299 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6GBL         
WWPDB D_1200009706 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB . 6GBJ unspecified 
PDB . 6GBK unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6GBL 
_pdbx_database_status.recvd_initial_deposition_date   2018-04-15 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Khersonsky, O.'  1  ? 
'Lipsh, R.'       2  ? 
'Avizemer, Z.'    3  ? 
'Goldsmith, M.'   4  ? 
'Ashani, Y.'      5  ? 
'Leader, H.'      6  ? 
'Dym, O.'         7  ? 
'Rogotner, S.'    8  ? 
'Trudeau, D.'     9  ? 
'Tawfik, D.S.'    10 ? 
'Fleishman, S.J.' 11 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Mol. Cell' 
_citation.journal_id_ASTM           MOCEFL 
_citation.journal_id_CSD            2168 
_citation.journal_id_ISSN           1097-4164 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            72 
_citation.language                  ? 
_citation.page_first                178 
_citation.page_last                 186.e5 
_citation.title                     'Automated Design of Efficient and Functionally Diverse Enzyme Repertoires.' 
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.molcel.2018.08.033 
_citation.pdbx_database_id_PubMed   30270109 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Khersonsky, O.'    1  ? 
primary 'Lipsh, R.'         2  ? 
primary 'Avizemer, Z.'      3  ? 
primary 'Ashani, Y.'        4  ? 
primary 'Goldsmith, M.'     5  ? 
primary 'Leader, H.'        6  ? 
primary 'Dym, O.'           7  ? 
primary 'Rogotner, S.'      8  ? 
primary 'Trudeau, D.L.'     9  ? 
primary 'Prilusky, J.'      10 ? 
primary 'Amengual-Rigo, P.' 11 ? 
primary 'Guallar, V.'       12 ? 
primary 'Tawfik, D.S.'      13 ? 
primary 'Fleishman, S.J.'   14 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   107.21 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6GBL 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     155.797 
_cell.length_a_esd                 ? 
_cell.length_b                     53.560 
_cell.length_b_esd                 ? 
_cell.length_c                     89.339 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6GBL 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Parathion hydrolase' 36633.316 2   3.1.8.1 ? ? ? 
2 non-polymer syn 'FORMIC ACID'         46.025    2   ?       ? ? ? 
3 non-polymer syn 'ZINC ION'            65.409    4   ?       ? ? ? 
4 non-polymer syn 1,2-ETHANEDIOL        62.068    2   ?       ? ? ? 
5 non-polymer syn 'CACODYLATE ION'      136.989   2   ?       ? ? ? 
6 water       nat water                 18.015    213 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        Phosphotriesterase,PTE 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;ITNSGDRINTVRGPITISEAGFTLMHEHICGSSAGFLRAWPEFFGSRDALAEKAVRGLRRARAAGVRTIVDVSTFDLGRD
VELLAEVSEAADVHIVAATGLWFDPPLSMRLRSVEELTQFFLREIQYGIEDTGIRAGIIKVATTGKATPFQERVLRAAAR
ASLATGVPVTTHTDASQRDGEQQADIFESEGLDPSRVCIGHSDDTDDLDYLTALAARGYLIGLDGIPWSAIGLEDNASAA
ALLGLRSWQTRALLIKALIDQGYADQILVSNDWTFGFSSYVTNIMDVMDRVNPDGMAFIPLRVIPFLREKGVPDETLETI
MVDNPARFLSPTLRAS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;ITNSGDRINTVRGPITISEAGFTLMHEHICGSSAGFLRAWPEFFGSRDALAEKAVRGLRRARAAGVRTIVDVSTFDLGRD
VELLAEVSEAADVHIVAATGLWFDPPLSMRLRSVEELTQFFLREIQYGIEDTGIRAGIIKVATTGKATPFQERVLRAAAR
ASLATGVPVTTHTDASQRDGEQQADIFESEGLDPSRVCIGHSDDTDDLDYLTALAARGYLIGLDGIPWSAIGLEDNASAA
ALLGLRSWQTRALLIKALIDQGYADQILVSNDWTFGFSSYVTNIMDVMDRVNPDGMAFIPLRVIPFLREKGVPDETLETI
MVDNPARFLSPTLRAS
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ILE n 
1 2   THR n 
1 3   ASN n 
1 4   SER n 
1 5   GLY n 
1 6   ASP n 
1 7   ARG n 
1 8   ILE n 
1 9   ASN n 
1 10  THR n 
1 11  VAL n 
1 12  ARG n 
1 13  GLY n 
1 14  PRO n 
1 15  ILE n 
1 16  THR n 
1 17  ILE n 
1 18  SER n 
1 19  GLU n 
1 20  ALA n 
1 21  GLY n 
1 22  PHE n 
1 23  THR n 
1 24  LEU n 
1 25  MET n 
1 26  HIS n 
1 27  GLU n 
1 28  HIS n 
1 29  ILE n 
1 30  CYS n 
1 31  GLY n 
1 32  SER n 
1 33  SER n 
1 34  ALA n 
1 35  GLY n 
1 36  PHE n 
1 37  LEU n 
1 38  ARG n 
1 39  ALA n 
1 40  TRP n 
1 41  PRO n 
1 42  GLU n 
1 43  PHE n 
1 44  PHE n 
1 45  GLY n 
1 46  SER n 
1 47  ARG n 
1 48  ASP n 
1 49  ALA n 
1 50  LEU n 
1 51  ALA n 
1 52  GLU n 
1 53  LYS n 
1 54  ALA n 
1 55  VAL n 
1 56  ARG n 
1 57  GLY n 
1 58  LEU n 
1 59  ARG n 
1 60  ARG n 
1 61  ALA n 
1 62  ARG n 
1 63  ALA n 
1 64  ALA n 
1 65  GLY n 
1 66  VAL n 
1 67  ARG n 
1 68  THR n 
1 69  ILE n 
1 70  VAL n 
1 71  ASP n 
1 72  VAL n 
1 73  SER n 
1 74  THR n 
1 75  PHE n 
1 76  ASP n 
1 77  LEU n 
1 78  GLY n 
1 79  ARG n 
1 80  ASP n 
1 81  VAL n 
1 82  GLU n 
1 83  LEU n 
1 84  LEU n 
1 85  ALA n 
1 86  GLU n 
1 87  VAL n 
1 88  SER n 
1 89  GLU n 
1 90  ALA n 
1 91  ALA n 
1 92  ASP n 
1 93  VAL n 
1 94  HIS n 
1 95  ILE n 
1 96  VAL n 
1 97  ALA n 
1 98  ALA n 
1 99  THR n 
1 100 GLY n 
1 101 LEU n 
1 102 TRP n 
1 103 PHE n 
1 104 ASP n 
1 105 PRO n 
1 106 PRO n 
1 107 LEU n 
1 108 SER n 
1 109 MET n 
1 110 ARG n 
1 111 LEU n 
1 112 ARG n 
1 113 SER n 
1 114 VAL n 
1 115 GLU n 
1 116 GLU n 
1 117 LEU n 
1 118 THR n 
1 119 GLN n 
1 120 PHE n 
1 121 PHE n 
1 122 LEU n 
1 123 ARG n 
1 124 GLU n 
1 125 ILE n 
1 126 GLN n 
1 127 TYR n 
1 128 GLY n 
1 129 ILE n 
1 130 GLU n 
1 131 ASP n 
1 132 THR n 
1 133 GLY n 
1 134 ILE n 
1 135 ARG n 
1 136 ALA n 
1 137 GLY n 
1 138 ILE n 
1 139 ILE n 
1 140 LYS n 
1 141 VAL n 
1 142 ALA n 
1 143 THR n 
1 144 THR n 
1 145 GLY n 
1 146 LYS n 
1 147 ALA n 
1 148 THR n 
1 149 PRO n 
1 150 PHE n 
1 151 GLN n 
1 152 GLU n 
1 153 ARG n 
1 154 VAL n 
1 155 LEU n 
1 156 ARG n 
1 157 ALA n 
1 158 ALA n 
1 159 ALA n 
1 160 ARG n 
1 161 ALA n 
1 162 SER n 
1 163 LEU n 
1 164 ALA n 
1 165 THR n 
1 166 GLY n 
1 167 VAL n 
1 168 PRO n 
1 169 VAL n 
1 170 THR n 
1 171 THR n 
1 172 HIS n 
1 173 THR n 
1 174 ASP n 
1 175 ALA n 
1 176 SER n 
1 177 GLN n 
1 178 ARG n 
1 179 ASP n 
1 180 GLY n 
1 181 GLU n 
1 182 GLN n 
1 183 GLN n 
1 184 ALA n 
1 185 ASP n 
1 186 ILE n 
1 187 PHE n 
1 188 GLU n 
1 189 SER n 
1 190 GLU n 
1 191 GLY n 
1 192 LEU n 
1 193 ASP n 
1 194 PRO n 
1 195 SER n 
1 196 ARG n 
1 197 VAL n 
1 198 CYS n 
1 199 ILE n 
1 200 GLY n 
1 201 HIS n 
1 202 SER n 
1 203 ASP n 
1 204 ASP n 
1 205 THR n 
1 206 ASP n 
1 207 ASP n 
1 208 LEU n 
1 209 ASP n 
1 210 TYR n 
1 211 LEU n 
1 212 THR n 
1 213 ALA n 
1 214 LEU n 
1 215 ALA n 
1 216 ALA n 
1 217 ARG n 
1 218 GLY n 
1 219 TYR n 
1 220 LEU n 
1 221 ILE n 
1 222 GLY n 
1 223 LEU n 
1 224 ASP n 
1 225 GLY n 
1 226 ILE n 
1 227 PRO n 
1 228 TRP n 
1 229 SER n 
1 230 ALA n 
1 231 ILE n 
1 232 GLY n 
1 233 LEU n 
1 234 GLU n 
1 235 ASP n 
1 236 ASN n 
1 237 ALA n 
1 238 SER n 
1 239 ALA n 
1 240 ALA n 
1 241 ALA n 
1 242 LEU n 
1 243 LEU n 
1 244 GLY n 
1 245 LEU n 
1 246 ARG n 
1 247 SER n 
1 248 TRP n 
1 249 GLN n 
1 250 THR n 
1 251 ARG n 
1 252 ALA n 
1 253 LEU n 
1 254 LEU n 
1 255 ILE n 
1 256 LYS n 
1 257 ALA n 
1 258 LEU n 
1 259 ILE n 
1 260 ASP n 
1 261 GLN n 
1 262 GLY n 
1 263 TYR n 
1 264 ALA n 
1 265 ASP n 
1 266 GLN n 
1 267 ILE n 
1 268 LEU n 
1 269 VAL n 
1 270 SER n 
1 271 ASN n 
1 272 ASP n 
1 273 TRP n 
1 274 THR n 
1 275 PHE n 
1 276 GLY n 
1 277 PHE n 
1 278 SER n 
1 279 SER n 
1 280 TYR n 
1 281 VAL n 
1 282 THR n 
1 283 ASN n 
1 284 ILE n 
1 285 MET n 
1 286 ASP n 
1 287 VAL n 
1 288 MET n 
1 289 ASP n 
1 290 ARG n 
1 291 VAL n 
1 292 ASN n 
1 293 PRO n 
1 294 ASP n 
1 295 GLY n 
1 296 MET n 
1 297 ALA n 
1 298 PHE n 
1 299 ILE n 
1 300 PRO n 
1 301 LEU n 
1 302 ARG n 
1 303 VAL n 
1 304 ILE n 
1 305 PRO n 
1 306 PHE n 
1 307 LEU n 
1 308 ARG n 
1 309 GLU n 
1 310 LYS n 
1 311 GLY n 
1 312 VAL n 
1 313 PRO n 
1 314 ASP n 
1 315 GLU n 
1 316 THR n 
1 317 LEU n 
1 318 GLU n 
1 319 THR n 
1 320 ILE n 
1 321 MET n 
1 322 VAL n 
1 323 ASP n 
1 324 ASN n 
1 325 PRO n 
1 326 ALA n 
1 327 ARG n 
1 328 PHE n 
1 329 LEU n 
1 330 SER n 
1 331 PRO n 
1 332 THR n 
1 333 LEU n 
1 334 ARG n 
1 335 ALA n 
1 336 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   336 
_entity_src_gen.gene_src_common_name               'Pseudomonas diminuta' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 opd 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Brevundimonas diminuta' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     293 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    OPD_BREDI 
_struct_ref.pdbx_db_accession          P0A434 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;GDRINTVRGPITISEAGFTLTHEHICGSSAGFLRAWPEFFGSRKALAEKAVRGLRRARAAGVRTIVDVSTFDIGRDVSLL
AEVSRAADVHIVAATGLWFDPPLSMRLRSVEELTQFFLREIQYGIEDTGIRAGIIKVATTGKATPFQELVLKAAARASLA
TGVPVTTHTAASQRDGEQQAAIFESEGLSPSRVCIGHSDDTDDLSYLTALAARGYLIGLDHIPHSAIGLEDNASASALLG
IRSWQTRALLIKALIDQGYMKQILVSNDWLFGFSSYVTNIMDVMDRVNPDGMAFIPLRVIPFLREKGVPQETLAGITVTN
PARFLSPTLRAS
;
_struct_ref.pdbx_align_begin           34 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6GBL A 5 ? 336 ? P0A434 34 ? 365 ? 34 365 
2 1 6GBL B 5 ? 336 ? P0A434 34 ? 365 ? 34 365 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6GBL ILE A 1   ? UNP P0A434 ?   ?   'expression tag'      30  1  
1 6GBL THR A 2   ? UNP P0A434 ?   ?   'expression tag'      31  2  
1 6GBL ASN A 3   ? UNP P0A434 ?   ?   'expression tag'      32  3  
1 6GBL SER A 4   ? UNP P0A434 ?   ?   'expression tag'      33  4  
1 6GBL MET A 25  ? UNP P0A434 THR 54  'engineered mutation' 54  5  
1 6GBL ASP A 48  ? UNP P0A434 LYS 77  'engineered mutation' 77  6  
1 6GBL LEU A 77  ? UNP P0A434 ILE 106 'engineered mutation' 106 7  
1 6GBL GLU A 82  ? UNP P0A434 SER 111 'engineered mutation' 111 8  
1 6GBL GLU A 89  ? UNP P0A434 ARG 118 'engineered mutation' 118 9  
1 6GBL ARG A 153 ? UNP P0A434 LEU 182 'engineered mutation' 182 10 
1 6GBL ARG A 156 ? UNP P0A434 LYS 185 'engineered mutation' 185 11 
1 6GBL ASP A 174 ? UNP P0A434 ALA 203 'engineered mutation' 203 12 
1 6GBL ASP A 185 ? UNP P0A434 ALA 214 'engineered mutation' 214 13 
1 6GBL ASP A 193 ? UNP P0A434 SER 222 'engineered mutation' 222 14 
1 6GBL ASP A 209 ? UNP P0A434 SER 238 'engineered mutation' 238 15 
1 6GBL GLY A 225 ? UNP P0A434 HIS 254 'engineered mutation' 254 16 
1 6GBL TRP A 228 ? UNP P0A434 HIS 257 'engineered mutation' 257 17 
1 6GBL ALA A 240 ? UNP P0A434 SER 269 'engineered mutation' 269 18 
1 6GBL LEU A 245 ? UNP P0A434 ILE 274 'engineered mutation' 274 19 
1 6GBL ALA A 264 ? UNP P0A434 MET 293 'engineered mutation' 293 20 
1 6GBL ASP A 265 ? UNP P0A434 LYS 294 'engineered mutation' 294 21 
1 6GBL THR A 274 ? UNP P0A434 LEU 303 'engineered mutation' 303 22 
1 6GBL ASP A 314 ? UNP P0A434 GLN 343 'engineered mutation' 343 23 
1 6GBL GLU A 318 ? UNP P0A434 ALA 347 'engineered mutation' 347 24 
1 6GBL THR A 319 ? UNP P0A434 GLY 348 'engineered mutation' 348 25 
1 6GBL MET A 321 ? UNP P0A434 THR 350 'engineered mutation' 350 26 
1 6GBL ASP A 323 ? UNP P0A434 THR 352 'engineered mutation' 352 27 
2 6GBL ILE B 1   ? UNP P0A434 ?   ?   'expression tag'      30  28 
2 6GBL THR B 2   ? UNP P0A434 ?   ?   'expression tag'      31  29 
2 6GBL ASN B 3   ? UNP P0A434 ?   ?   'expression tag'      32  30 
2 6GBL SER B 4   ? UNP P0A434 ?   ?   'expression tag'      33  31 
2 6GBL MET B 25  ? UNP P0A434 THR 54  'engineered mutation' 54  32 
2 6GBL ASP B 48  ? UNP P0A434 LYS 77  'engineered mutation' 77  33 
2 6GBL LEU B 77  ? UNP P0A434 ILE 106 'engineered mutation' 106 34 
2 6GBL GLU B 82  ? UNP P0A434 SER 111 'engineered mutation' 111 35 
2 6GBL GLU B 89  ? UNP P0A434 ARG 118 'engineered mutation' 118 36 
2 6GBL ARG B 153 ? UNP P0A434 LEU 182 'engineered mutation' 182 37 
2 6GBL ARG B 156 ? UNP P0A434 LYS 185 'engineered mutation' 185 38 
2 6GBL ASP B 174 ? UNP P0A434 ALA 203 'engineered mutation' 203 39 
2 6GBL ASP B 185 ? UNP P0A434 ALA 214 'engineered mutation' 214 40 
2 6GBL ASP B 193 ? UNP P0A434 SER 222 'engineered mutation' 222 41 
2 6GBL ASP B 209 ? UNP P0A434 SER 238 'engineered mutation' 238 42 
2 6GBL GLY B 225 ? UNP P0A434 HIS 254 'engineered mutation' 254 43 
2 6GBL TRP B 228 ? UNP P0A434 HIS 257 'engineered mutation' 257 44 
2 6GBL ALA B 240 ? UNP P0A434 SER 269 'engineered mutation' 269 45 
2 6GBL LEU B 245 ? UNP P0A434 ILE 274 'engineered mutation' 274 46 
2 6GBL ALA B 264 ? UNP P0A434 MET 293 'engineered mutation' 293 47 
2 6GBL ASP B 265 ? UNP P0A434 LYS 294 'engineered mutation' 294 48 
2 6GBL THR B 274 ? UNP P0A434 LEU 303 'engineered mutation' 303 49 
2 6GBL ASP B 314 ? UNP P0A434 GLN 343 'engineered mutation' 343 50 
2 6GBL GLU B 318 ? UNP P0A434 ALA 347 'engineered mutation' 347 51 
2 6GBL THR B 319 ? UNP P0A434 GLY 348 'engineered mutation' 348 52 
2 6GBL MET B 321 ? UNP P0A434 THR 350 'engineered mutation' 350 53 
2 6GBL ASP B 323 ? UNP P0A434 THR 352 'engineered mutation' 352 54 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE          ?                 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE         ?                 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE       ?                 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'  ?                 'C4 H7 N O4'     133.103 
CAC non-polymer         . 'CACODYLATE ION' dimethylarsinate  'C2 H6 As O2 -1' 136.989 
CYS 'L-peptide linking' y CYSTEINE         ?                 'C3 H7 N O2 S'   121.158 
EDO non-polymer         . 1,2-ETHANEDIOL   'ETHYLENE GLYCOL' 'C2 H6 O2'       62.068  
FMT non-polymer         . 'FORMIC ACID'    ?                 'C H2 O2'        46.025  
GLN 'L-peptide linking' y GLUTAMINE        ?                 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'  ?                 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE          ?                 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE        ?                 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER            ?                 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE       ?                 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE          ?                 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE           ?                 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE       ?                 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE    ?                 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE          ?                 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE           ?                 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE        ?                 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN       ?                 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE         ?                 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE           ?                 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'       ?                 'Zn 2'           65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6GBL 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.43 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         49.38 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.4 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
;0.2M Magnesium acetate 4H2O
0.1M Na cacodylate pH=6.4
16% PEG 8000
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     'IMAGE PLATE' 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'RIGAKU RAXIS IV++' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2017-11-19 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5419 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.target                      ? 
_diffrn_source.type                        'RIGAKU RU300' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.5419 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_synchrotron_site       ? 
# 
_reflns.B_iso_Wilson_estimate            18.63 
_reflns.entry_id                         6GBL 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.95 
_reflns.d_resolution_low                 41.61 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       45387 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             87.83 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  7.4 
_reflns.pdbx_Rmerge_I_obs                0.04564 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            10.91 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  1.95 
_reflns_shell.d_res_low                   2.02 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         3.05 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           3967 
_reflns_shell.percent_possible_all        77.54 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.2236 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             7.3 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            -1.09 
_refine.aniso_B[1][2]                            -0.00 
_refine.aniso_B[1][3]                            -0.46 
_refine.aniso_B[2][2]                            2.66 
_refine.aniso_B[2][3]                            -0.00 
_refine.aniso_B[3][3]                            -1.09 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               18.693 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               0.950 
_refine.correlation_coeff_Fo_to_Fc_free          0.929 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6GBL 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.95 
_refine.ls_d_res_low                             41.61 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     43111 
_refine.ls_number_reflns_R_free                  2272 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    87.83 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.17959 
_refine.ls_R_factor_R_free                       0.21957 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.17743 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      1HYZ 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       0.181 
_refine.pdbx_overall_ESU_R_Free                  0.160 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             3.980 
_refine.overall_SU_ML                            0.110 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         1 
_refine_hist.pdbx_number_atoms_protein        5033 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         28 
_refine_hist.number_atoms_solvent             213 
_refine_hist.number_atoms_total               5274 
_refine_hist.d_res_high                       1.95 
_refine_hist.d_res_low                        41.61 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.011  0.015  5200  ? r_bond_refined_d             ? ? 
'X-RAY DIFFRACTION' ? 0.001  0.017  4651  ? r_bond_other_d               ? ? 
'X-RAY DIFFRACTION' ? 1.482  1.745  7064  ? r_angle_refined_deg          ? ? 
'X-RAY DIFFRACTION' ? 0.507  1.705  10867 ? r_angle_other_deg            ? ? 
'X-RAY DIFFRACTION' ? 6.630  5.000  663   ? r_dihedral_angle_1_deg       ? ? 
'X-RAY DIFFRACTION' ? 26.518 16.250 192   ? r_dihedral_angle_2_deg       ? ? 
'X-RAY DIFFRACTION' ? 13.997 15.000 701   ? r_dihedral_angle_3_deg       ? ? 
'X-RAY DIFFRACTION' ? 18.193 15.000 51    ? r_dihedral_angle_4_deg       ? ? 
'X-RAY DIFFRACTION' ? 0.064  0.200  702   ? r_chiral_restr               ? ? 
'X-RAY DIFFRACTION' ? 0.007  0.021  5972  ? r_gen_planes_refined         ? ? 
'X-RAY DIFFRACTION' ? 0.001  0.020  956   ? r_gen_planes_other           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_nbd_refined                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_nbd_other                  ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_nbtor_refined              ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_nbtor_other                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_xyhbond_nbd_refined        ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_xyhbond_nbd_other          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_metal_ion_refined          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_metal_ion_other            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_vdw_refined       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_vdw_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_hbond_refined     ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_hbond_other       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_metal_ion_refined ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_metal_ion_other   ? ? 
'X-RAY DIFFRACTION' ? 1.237  1.820  2643  ? r_mcbond_it                  ? ? 
'X-RAY DIFFRACTION' ? 1.236  1.820  2644  ? r_mcbond_other               ? ? 
'X-RAY DIFFRACTION' ? 1.862  2.722  3309  ? r_mcangle_it                 ? ? 
'X-RAY DIFFRACTION' ? 1.862  2.723  3310  ? r_mcangle_other              ? ? 
'X-RAY DIFFRACTION' ? 1.826  2.039  2554  ? r_scbond_it                  ? ? 
'X-RAY DIFFRACTION' ? 1.826  2.040  2555  ? r_scbond_other               ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_scangle_it                 ? ? 
'X-RAY DIFFRACTION' ? 2.906  2.986  3753  ? r_scangle_other              ? ? 
'X-RAY DIFFRACTION' ? 3.805  22.759 5738  ? r_long_range_B_refined       ? ? 
'X-RAY DIFFRACTION' ? 3.800  22.728 5706  ? r_long_range_B_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_rigid_bond_restr           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_sphericity_free            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_sphericity_bonded          ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       1.950 
_refine_ls_shell.d_res_low                        2.001 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             162 
_refine_ls_shell.number_reflns_R_work             2767 
_refine_ls_shell.percent_reflns_obs               76.92 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.321 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.R_factor_R_work                  0.252 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
_struct.entry_id                     6GBL 
_struct.title                        
'Repertoires of functionally diverse enzymes through computational design at epistatic active-site positions' 
_struct.pdbx_descriptor              'Parathion hydrolase (E.C.3.1.8.1)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6GBL 
_struct_keywords.text            'Phosphotriesterase, HYDROLASE' 
_struct_keywords.pdbx_keywords   HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 3 ? 
F N N 4 ? 
G N N 5 ? 
H N N 2 ? 
I N N 3 ? 
J N N 3 ? 
K N N 5 ? 
L N N 4 ? 
M N N 6 ? 
N N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ILE A 17  ? GLY A 21  ? ILE A 46  GLY A 50  1 ? 5  
HELX_P HELX_P2  AA2 GLY A 35  ? TRP A 40  ? GLY A 64  TRP A 69  1 ? 6  
HELX_P HELX_P3  AA3 PRO A 41  ? GLY A 45  ? PRO A 70  GLY A 74  5 ? 5  
HELX_P HELX_P4  AA4 SER A 46  ? ALA A 64  ? SER A 75  ALA A 93  1 ? 19 
HELX_P HELX_P5  AA5 THR A 74  ? GLY A 78  ? THR A 103 GLY A 107 5 ? 5  
HELX_P HELX_P6  AA6 ASP A 80  ? ASP A 92  ? ASP A 109 ASP A 121 1 ? 13 
HELX_P HELX_P7  AA7 PRO A 106 ? LEU A 111 ? PRO A 135 LEU A 140 1 ? 6  
HELX_P HELX_P8  AA8 SER A 113 ? TYR A 127 ? SER A 142 TYR A 156 1 ? 15 
HELX_P HELX_P9  AA9 THR A 148 ? GLY A 166 ? THR A 177 GLY A 195 1 ? 19 
HELX_P HELX_P10 AB1 ASP A 174 ? GLN A 177 ? ASP A 203 GLN A 206 5 ? 4  
HELX_P HELX_P11 AB2 ARG A 178 ? GLU A 190 ? ARG A 207 GLU A 219 1 ? 13 
HELX_P HELX_P12 AB3 ASP A 193 ? SER A 195 ? ASP A 222 SER A 224 5 ? 3  
HELX_P HELX_P13 AB4 HIS A 201 ? THR A 205 ? HIS A 230 THR A 234 5 ? 5  
HELX_P HELX_P14 AB5 ASP A 207 ? ARG A 217 ? ASP A 236 ARG A 246 1 ? 11 
HELX_P HELX_P15 AB6 ASN A 236 ? GLY A 244 ? ASN A 265 GLY A 273 1 ? 9  
HELX_P HELX_P16 AB7 SER A 247 ? GLN A 261 ? SER A 276 GLN A 290 1 ? 15 
HELX_P HELX_P17 AB8 TYR A 263 ? ASP A 265 ? TYR A 292 ASP A 294 5 ? 3  
HELX_P HELX_P18 AB9 ASN A 283 ? ASN A 292 ? ASN A 312 ASN A 321 1 ? 10 
HELX_P HELX_P19 AC1 ASP A 294 ? MET A 296 ? ASP A 323 MET A 325 5 ? 3  
HELX_P HELX_P20 AC2 ALA A 297 ? LYS A 310 ? ALA A 326 LYS A 339 1 ? 14 
HELX_P HELX_P21 AC3 PRO A 313 ? VAL A 322 ? PRO A 342 VAL A 351 1 ? 10 
HELX_P HELX_P22 AC4 VAL A 322 ? SER A 330 ? VAL A 351 SER A 359 1 ? 9  
HELX_P HELX_P23 AC5 ILE B 17  ? GLY B 21  ? ILE B 46  GLY B 50  1 ? 5  
HELX_P HELX_P24 AC6 GLY B 35  ? TRP B 40  ? GLY B 64  TRP B 69  1 ? 6  
HELX_P HELX_P25 AC7 PRO B 41  ? GLY B 45  ? PRO B 70  GLY B 74  5 ? 5  
HELX_P HELX_P26 AC8 SER B 46  ? ALA B 64  ? SER B 75  ALA B 93  1 ? 19 
HELX_P HELX_P27 AC9 THR B 74  ? GLY B 78  ? THR B 103 GLY B 107 5 ? 5  
HELX_P HELX_P28 AD1 ASP B 80  ? ASP B 92  ? ASP B 109 ASP B 121 1 ? 13 
HELX_P HELX_P29 AD2 PRO B 106 ? LEU B 111 ? PRO B 135 LEU B 140 1 ? 6  
HELX_P HELX_P30 AD3 SER B 113 ? TYR B 127 ? SER B 142 TYR B 156 1 ? 15 
HELX_P HELX_P31 AD4 THR B 148 ? GLY B 166 ? THR B 177 GLY B 195 1 ? 19 
HELX_P HELX_P32 AD5 ASP B 174 ? ARG B 178 ? ASP B 203 ARG B 207 5 ? 5  
HELX_P HELX_P33 AD6 ASP B 179 ? GLY B 191 ? ASP B 208 GLY B 220 1 ? 13 
HELX_P HELX_P34 AD7 ASP B 193 ? SER B 195 ? ASP B 222 SER B 224 5 ? 3  
HELX_P HELX_P35 AD8 HIS B 201 ? THR B 205 ? HIS B 230 THR B 234 5 ? 5  
HELX_P HELX_P36 AD9 ASP B 207 ? ARG B 217 ? ASP B 236 ARG B 246 1 ? 11 
HELX_P HELX_P37 AE1 ASN B 236 ? GLY B 244 ? ASN B 265 GLY B 273 1 ? 9  
HELX_P HELX_P38 AE2 SER B 247 ? GLN B 261 ? SER B 276 GLN B 290 1 ? 15 
HELX_P HELX_P39 AE3 TYR B 263 ? ASP B 265 ? TYR B 292 ASP B 294 5 ? 3  
HELX_P HELX_P40 AE4 ASN B 283 ? ASN B 292 ? ASN B 312 ASN B 321 1 ? 10 
HELX_P HELX_P41 AE5 ASP B 294 ? MET B 296 ? ASP B 323 MET B 325 5 ? 3  
HELX_P HELX_P42 AE6 ALA B 297 ? LYS B 310 ? ALA B 326 LYS B 339 1 ? 14 
HELX_P HELX_P43 AE7 PRO B 313 ? VAL B 322 ? PRO B 342 VAL B 351 1 ? 10 
HELX_P HELX_P44 AE8 VAL B 322 ? SER B 330 ? VAL B 351 SER B 359 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ?    ? A HIS 26  NE2 ? ? ? 1_555 D ZN  . ZN ? ? A HIS 55  A ZN  402 1_555 ? ? ? ? ? ? ? 2.080 ? 
metalc2  metalc ?    ? A HIS 28  NE2 ? ? ? 1_555 D ZN  . ZN ? ? A HIS 57  A ZN  402 1_555 ? ? ? ? ? ? ? 2.049 ? 
covale1  covale none ? A LYS 140 NZ  ? ? ? 1_555 C FMT . C  ? ? A LYS 169 A FMT 401 1_555 ? ? ? ? ? ? ? 1.281 ? 
metalc3  metalc ?    ? A HIS 172 ND1 ? ? ? 1_555 E ZN  . ZN ? ? A HIS 201 A ZN  403 1_555 ? ? ? ? ? ? ? 2.102 ? 
metalc4  metalc ?    ? A HIS 201 NE2 ? ? ? 1_555 E ZN  . ZN ? ? A HIS 230 A ZN  403 1_555 ? ? ? ? ? ? ? 1.936 ? 
metalc5  metalc ?    ? A ASP 272 OD1 ? ? ? 1_555 D ZN  . ZN ? ? A ASP 301 A ZN  402 1_555 ? ? ? ? ? ? ? 2.376 ? 
metalc6  metalc ?    ? B HIS 26  NE2 ? ? ? 1_555 I ZN  . ZN ? ? B HIS 55  B ZN  402 1_555 ? ? ? ? ? ? ? 2.045 ? 
metalc7  metalc ?    ? B HIS 28  NE2 ? ? ? 1_555 I ZN  . ZN ? ? B HIS 57  B ZN  402 1_555 ? ? ? ? ? ? ? 2.009 ? 
covale2  covale none ? B LYS 140 NZ  ? ? ? 1_555 H FMT . C  ? ? B LYS 169 B FMT 401 1_555 ? ? ? ? ? ? ? 1.287 ? 
metalc8  metalc ?    ? B HIS 172 ND1 ? ? ? 1_555 J ZN  . ZN ? ? B HIS 201 B ZN  403 1_555 ? ? ? ? ? ? ? 2.017 ? 
metalc9  metalc ?    ? B HIS 201 NE2 ? ? ? 1_555 J ZN  . ZN ? ? B HIS 230 B ZN  403 1_555 ? ? ? ? ? ? ? 2.115 ? 
metalc10 metalc ?    ? B ASP 272 OD1 ? ? ? 1_555 I ZN  . ZN ? ? B ASP 301 B ZN  402 1_555 ? ? ? ? ? ? ? 2.499 ? 
metalc11 metalc ?    ? C FMT .   O1  ? ? ? 1_555 E ZN  . ZN ? ? A FMT 401 A ZN  403 1_555 ? ? ? ? ? ? ? 1.969 ? 
metalc12 metalc ?    ? C FMT .   O2  ? ? ? 1_555 D ZN  . ZN ? ? A FMT 401 A ZN  402 1_555 ? ? ? ? ? ? ? 1.999 ? 
metalc13 metalc ?    ? D ZN  .   ZN  ? ? ? 1_555 G CAC . O2 ? ? A ZN  402 A CAC 405 1_555 ? ? ? ? ? ? ? 1.930 ? 
metalc14 metalc ?    ? E ZN  .   ZN  ? ? ? 1_555 G CAC . O1 ? ? A ZN  403 A CAC 405 1_555 ? ? ? ? ? ? ? 1.998 ? 
metalc15 metalc ?    ? H FMT .   O1  ? ? ? 1_555 J ZN  . ZN ? ? B FMT 401 B ZN  403 1_555 ? ? ? ? ? ? ? 1.998 ? 
metalc16 metalc ?    ? H FMT .   O2  ? ? ? 1_555 I ZN  . ZN ? ? B FMT 401 B ZN  402 1_555 ? ? ? ? ? ? ? 2.015 ? 
metalc17 metalc ?    ? I ZN  .   ZN  ? ? ? 1_555 K CAC . O2 ? ? B ZN  402 B CAC 404 1_555 ? ? ? ? ? ? ? 1.935 ? 
metalc18 metalc ?    ? J ZN  .   ZN  ? ? ? 1_555 K CAC . O1 ? ? B ZN  403 B CAC 404 1_555 ? ? ? ? ? ? ? 1.994 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 3 ? 
AA3 ? 6 ? 
AA4 ? 2 ? 
AA5 ? 3 ? 
AA6 ? 2 ? 
AA7 ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA2 1 2 ? parallel      
AA2 2 3 ? parallel      
AA3 1 2 ? parallel      
AA3 2 3 ? parallel      
AA3 3 4 ? parallel      
AA3 4 5 ? parallel      
AA3 5 6 ? parallel      
AA4 1 2 ? anti-parallel 
AA5 1 2 ? parallel      
AA5 2 3 ? parallel      
AA6 1 2 ? parallel      
AA7 1 2 ? parallel      
AA7 2 3 ? parallel      
AA7 3 4 ? parallel      
AA7 4 5 ? parallel      
AA7 5 6 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ARG A 7   ? THR A 10  ? ARG A 36  THR A 39  
AA1 2 GLY A 13  ? THR A 16  ? GLY A 42  THR A 45  
AA2 1 THR A 23  ? GLU A 27  ? THR A 52  GLU A 56  
AA2 2 THR A 68  ? ASP A 71  ? THR A 97  ASP A 100 
AA2 3 HIS A 94  ? VAL A 96  ? HIS A 123 VAL A 125 
AA3 1 ALA A 98  ? GLY A 100 ? ALA A 127 GLY A 129 
AA3 2 ILE A 138 ? ALA A 142 ? ILE A 167 ALA A 171 
AA3 3 VAL A 169 ? HIS A 172 ? VAL A 198 HIS A 201 
AA3 4 VAL A 197 ? ILE A 199 ? VAL A 226 ILE A 228 
AA3 5 LEU A 220 ? LEU A 223 ? LEU A 249 LEU A 252 
AA3 6 ILE A 267 ? VAL A 269 ? ILE A 296 VAL A 298 
AA4 1 ARG B 7   ? THR B 10  ? ARG B 36  THR B 39  
AA4 2 GLY B 13  ? THR B 16  ? GLY B 42  THR B 45  
AA5 1 THR B 23  ? GLU B 27  ? THR B 52  GLU B 56  
AA5 2 THR B 68  ? ASP B 71  ? THR B 97  ASP B 100 
AA5 3 HIS B 94  ? VAL B 96  ? HIS B 123 VAL B 125 
AA6 1 CYS B 30  ? GLY B 31  ? CYS B 59  GLY B 60  
AA6 2 GLY B 276 ? PHE B 277 ? GLY B 305 PHE B 306 
AA7 1 ALA B 98  ? GLY B 100 ? ALA B 127 GLY B 129 
AA7 2 ILE B 138 ? ALA B 142 ? ILE B 167 ALA B 171 
AA7 3 VAL B 169 ? HIS B 172 ? VAL B 198 HIS B 201 
AA7 4 VAL B 197 ? ILE B 199 ? VAL B 226 ILE B 228 
AA7 5 LEU B 220 ? LEU B 223 ? LEU B 249 LEU B 252 
AA7 6 ILE B 267 ? VAL B 269 ? ILE B 296 VAL B 298 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ILE A 8   ? N ILE A 37  O ILE A 15  ? O ILE A 44  
AA2 1 2 N LEU A 24  ? N LEU A 53  O VAL A 70  ? O VAL A 99  
AA2 2 3 N ILE A 69  ? N ILE A 98  O VAL A 96  ? O VAL A 125 
AA3 1 2 N THR A 99  ? N THR A 128 O LYS A 140 ? O LYS A 169 
AA3 2 3 N ILE A 139 ? N ILE A 168 O THR A 170 ? O THR A 199 
AA3 3 4 N VAL A 169 ? N VAL A 198 O CYS A 198 ? O CYS A 227 
AA3 4 5 N VAL A 197 ? N VAL A 226 O LEU A 220 ? O LEU A 249 
AA3 5 6 N LEU A 223 ? N LEU A 252 O LEU A 268 ? O LEU A 297 
AA4 1 2 N ILE B 8   ? N ILE B 37  O ILE B 15  ? O ILE B 44  
AA5 1 2 N LEU B 24  ? N LEU B 53  O VAL B 70  ? O VAL B 99  
AA5 2 3 N ASP B 71  ? N ASP B 100 O VAL B 96  ? O VAL B 125 
AA6 1 2 N GLY B 31  ? N GLY B 60  O GLY B 276 ? O GLY B 305 
AA7 1 2 N THR B 99  ? N THR B 128 O ILE B 138 ? O ILE B 167 
AA7 2 3 N ILE B 139 ? N ILE B 168 O THR B 170 ? O THR B 199 
AA7 3 4 N VAL B 169 ? N VAL B 198 O CYS B 198 ? O CYS B 227 
AA7 4 5 N ILE B 199 ? N ILE B 228 O GLY B 222 ? O GLY B 251 
AA7 5 6 N ILE B 221 ? N ILE B 250 O LEU B 268 ? O LEU B 297 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A FMT 401 ? 8  'binding site for residue FMT A 401'                  
AC2 Software A ZN  402 ? 5  'binding site for residue ZN A 402'                   
AC3 Software A ZN  403 ? 4  'binding site for residue ZN A 403'                   
AC4 Software A EDO 404 ? 6  'binding site for residue EDO A 404'                  
AC5 Software A CAC 405 ? 11 'binding site for residue CAC A 405'                  
AC6 Software B ZN  402 ? 5  'binding site for residue ZN B 402'                   
AC7 Software B ZN  403 ? 4  'binding site for residue ZN B 403'                   
AC8 Software B CAC 404 ? 11 'binding site for residue CAC B 404'                  
AC9 Software B EDO 405 ? 6  'binding site for residue EDO B 405'                  
AD1 Software B FMT 401 ? 15 'binding site for Di-peptide FMT B 401 and LYS B 169' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 8  HIS A 26  ? HIS A 55  . ? 1_555 ? 
2  AC1 8  HIS A 28  ? HIS A 57  . ? 1_555 ? 
3  AC1 8  LYS A 140 ? LYS A 169 . ? 1_555 ? 
4  AC1 8  HIS A 172 ? HIS A 201 . ? 1_555 ? 
5  AC1 8  HIS A 201 ? HIS A 230 . ? 1_555 ? 
6  AC1 8  ZN  D .   ? ZN  A 402 . ? 1_555 ? 
7  AC1 8  ZN  E .   ? ZN  A 403 . ? 1_555 ? 
8  AC1 8  CAC G .   ? CAC A 405 . ? 1_555 ? 
9  AC2 5  HIS A 26  ? HIS A 55  . ? 1_555 ? 
10 AC2 5  HIS A 28  ? HIS A 57  . ? 1_555 ? 
11 AC2 5  ASP A 272 ? ASP A 301 . ? 1_555 ? 
12 AC2 5  FMT C .   ? FMT A 401 . ? 1_555 ? 
13 AC2 5  CAC G .   ? CAC A 405 . ? 1_555 ? 
14 AC3 4  HIS A 172 ? HIS A 201 . ? 1_555 ? 
15 AC3 4  HIS A 201 ? HIS A 230 . ? 1_555 ? 
16 AC3 4  FMT C .   ? FMT A 401 . ? 1_555 ? 
17 AC3 4  CAC G .   ? CAC A 405 . ? 1_555 ? 
18 AC4 6  HIS A 28  ? HIS A 57  . ? 1_555 ? 
19 AC4 6  TRP A 228 ? TRP A 257 . ? 1_555 ? 
20 AC4 6  ASP A 272 ? ASP A 301 . ? 1_555 ? 
21 AC4 6  THR A 274 ? THR A 303 . ? 1_555 ? 
22 AC4 6  PHE A 277 ? PHE A 306 . ? 1_555 ? 
23 AC4 6  CAC G .   ? CAC A 405 . ? 1_555 ? 
24 AC5 11 HIS A 26  ? HIS A 55  . ? 1_555 ? 
25 AC5 11 HIS A 28  ? HIS A 57  . ? 1_555 ? 
26 AC5 11 TRP A 102 ? TRP A 131 . ? 1_555 ? 
27 AC5 11 HIS A 172 ? HIS A 201 . ? 1_555 ? 
28 AC5 11 HIS A 201 ? HIS A 230 . ? 1_555 ? 
29 AC5 11 TRP A 228 ? TRP A 257 . ? 1_555 ? 
30 AC5 11 ASP A 272 ? ASP A 301 . ? 1_555 ? 
31 AC5 11 FMT C .   ? FMT A 401 . ? 1_555 ? 
32 AC5 11 ZN  D .   ? ZN  A 402 . ? 1_555 ? 
33 AC5 11 ZN  E .   ? ZN  A 403 . ? 1_555 ? 
34 AC5 11 EDO F .   ? EDO A 404 . ? 1_555 ? 
35 AC6 5  HIS B 26  ? HIS B 55  . ? 1_555 ? 
36 AC6 5  HIS B 28  ? HIS B 57  . ? 1_555 ? 
37 AC6 5  ASP B 272 ? ASP B 301 . ? 1_555 ? 
38 AC6 5  FMT H .   ? FMT B 401 . ? 1_555 ? 
39 AC6 5  CAC K .   ? CAC B 404 . ? 1_555 ? 
40 AC7 4  HIS B 172 ? HIS B 201 . ? 1_555 ? 
41 AC7 4  HIS B 201 ? HIS B 230 . ? 1_555 ? 
42 AC7 4  FMT H .   ? FMT B 401 . ? 1_555 ? 
43 AC7 4  CAC K .   ? CAC B 404 . ? 1_555 ? 
44 AC8 11 HIS B 26  ? HIS B 55  . ? 1_555 ? 
45 AC8 11 HIS B 28  ? HIS B 57  . ? 1_555 ? 
46 AC8 11 TRP B 102 ? TRP B 131 . ? 1_555 ? 
47 AC8 11 HIS B 172 ? HIS B 201 . ? 1_555 ? 
48 AC8 11 HIS B 201 ? HIS B 230 . ? 1_555 ? 
49 AC8 11 TRP B 228 ? TRP B 257 . ? 1_555 ? 
50 AC8 11 ASP B 272 ? ASP B 301 . ? 1_555 ? 
51 AC8 11 FMT H .   ? FMT B 401 . ? 1_555 ? 
52 AC8 11 ZN  I .   ? ZN  B 402 . ? 1_555 ? 
53 AC8 11 ZN  J .   ? ZN  B 403 . ? 1_555 ? 
54 AC8 11 EDO L .   ? EDO B 405 . ? 1_555 ? 
55 AC9 6  HIS B 28  ? HIS B 57  . ? 1_555 ? 
56 AC9 6  TRP B 228 ? TRP B 257 . ? 1_555 ? 
57 AC9 6  ASP B 272 ? ASP B 301 . ? 1_555 ? 
58 AC9 6  TRP B 273 ? TRP B 302 . ? 1_555 ? 
59 AC9 6  THR B 274 ? THR B 303 . ? 1_555 ? 
60 AC9 6  CAC K .   ? CAC B 404 . ? 1_555 ? 
61 AD1 15 HIS B 26  ? HIS B 55  . ? 1_555 ? 
62 AD1 15 HIS B 28  ? HIS B 57  . ? 1_555 ? 
63 AD1 15 VAL B 72  ? VAL B 101 . ? 1_555 ? 
64 AD1 15 THR B 74  ? THR B 103 . ? 1_555 ? 
65 AD1 15 THR B 99  ? THR B 128 . ? 1_555 ? 
66 AD1 15 GLY B 100 ? GLY B 129 . ? 1_555 ? 
67 AD1 15 LEU B 101 ? LEU B 130 . ? 1_555 ? 
68 AD1 15 ILE B 139 ? ILE B 168 . ? 1_555 ? 
69 AD1 15 VAL B 141 ? VAL B 170 . ? 1_555 ? 
70 AD1 15 THR B 170 ? THR B 199 . ? 1_555 ? 
71 AD1 15 HIS B 172 ? HIS B 201 . ? 1_555 ? 
72 AD1 15 HIS B 201 ? HIS B 230 . ? 1_555 ? 
73 AD1 15 ZN  I .   ? ZN  B 402 . ? 1_555 ? 
74 AD1 15 ZN  J .   ? ZN  B 403 . ? 1_555 ? 
75 AD1 15 CAC K .   ? CAC B 404 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6GBL 
_atom_sites.fract_transf_matrix[1][1]   0.006419 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001988 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.018671 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011718 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
AS 
C  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ASP A 1 6   ? -46.980 26.327 34.858  1.00 36.57 ? 35  ASP A N   1 
ATOM   2    C  CA  . ASP A 1 6   ? -46.108 25.403 34.086  1.00 35.22 ? 35  ASP A CA  1 
ATOM   3    C  C   . ASP A 1 6   ? -45.382 26.208 33.007  1.00 32.93 ? 35  ASP A C   1 
ATOM   4    O  O   . ASP A 1 6   ? -45.958 27.066 32.347  1.00 32.40 ? 35  ASP A O   1 
ATOM   5    C  CB  . ASP A 1 6   ? -46.893 24.263 33.443  1.00 39.03 ? 35  ASP A CB  1 
ATOM   6    C  CG  . ASP A 1 6   ? -46.430 22.884 33.884  1.00 42.75 ? 35  ASP A CG  1 
ATOM   7    O  OD1 . ASP A 1 6   ? -45.397 22.411 33.372  1.00 46.82 ? 35  ASP A OD1 1 
ATOM   8    O  OD2 . ASP A 1 6   ? -47.114 22.293 34.734  1.00 44.04 ? 35  ASP A OD2 1 
ATOM   9    N  N   . ARG A 1 7   ? -44.116 25.892 32.828  1.00 29.97 ? 36  ARG A N   1 
ATOM   10   C  CA  . ARG A 1 7   ? -43.245 26.725 32.021  1.00 26.22 ? 36  ARG A CA  1 
ATOM   11   C  C   . ARG A 1 7   ? -42.331 25.852 31.156  1.00 22.38 ? 36  ARG A C   1 
ATOM   12   O  O   . ARG A 1 7   ? -42.003 24.714 31.504  1.00 21.65 ? 36  ARG A O   1 
ATOM   13   C  CB  . ARG A 1 7   ? -42.405 27.614 32.941  1.00 28.64 ? 36  ARG A CB  1 
ATOM   14   C  CG  . ARG A 1 7   ? -43.213 28.585 33.794  1.00 29.13 ? 36  ARG A CG  1 
ATOM   15   C  CD  . ARG A 1 7   ? -43.894 29.635 32.943  1.00 31.94 ? 36  ARG A CD  1 
ATOM   16   N  NE  . ARG A 1 7   ? -44.585 30.648 33.728  1.00 34.34 ? 36  ARG A NE  1 
ATOM   17   C  CZ  . ARG A 1 7   ? -45.857 30.580 34.106  1.00 33.96 ? 36  ARG A CZ  1 
ATOM   18   N  NH1 . ARG A 1 7   ? -46.509 29.428 34.087  1.00 35.55 ? 36  ARG A NH1 1 
ATOM   19   N  NH2 . ARG A 1 7   ? -46.486 31.683 34.462  1.00 37.81 ? 36  ARG A NH2 1 
ATOM   20   N  N   . ILE A 1 8   ? -41.927 26.428 30.036  1.00 20.00 ? 37  ILE A N   1 
ATOM   21   C  CA  . ILE A 1 8   ? -40.877 25.881 29.169  1.00 19.95 ? 37  ILE A CA  1 
ATOM   22   C  C   . ILE A 1 8   ? -39.705 26.862 29.139  1.00 19.88 ? 37  ILE A C   1 
ATOM   23   O  O   . ILE A 1 8   ? -39.915 28.058 28.917  1.00 20.91 ? 37  ILE A O   1 
ATOM   24   C  CB  . ILE A 1 8   ? -41.415 25.669 27.748  1.00 19.03 ? 37  ILE A CB  1 
ATOM   25   C  CG1 . ILE A 1 8   ? -42.580 24.679 27.727  1.00 19.33 ? 37  ILE A CG1 1 
ATOM   26   C  CG2 . ILE A 1 8   ? -40.295 25.266 26.804  1.00 20.17 ? 37  ILE A CG2 1 
ATOM   27   C  CD1 . ILE A 1 8   ? -43.372 24.726 26.431  1.00 19.26 ? 37  ILE A CD1 1 
ATOM   28   N  N   . ASN A 1 9   ? -38.496 26.349 29.304  1.00 19.20 ? 38  ASN A N   1 
ATOM   29   C  CA  . ASN A 1 9   ? -37.282 27.164 29.228  1.00 18.96 ? 38  ASN A CA  1 
ATOM   30   C  C   . ASN A 1 9   ? -36.928 27.454 27.767  1.00 18.62 ? 38  ASN A C   1 
ATOM   31   O  O   . ASN A 1 9   ? -36.792 26.545 26.967  1.00 18.46 ? 38  ASN A O   1 
ATOM   32   C  CB  . ASN A 1 9   ? -36.137 26.473 29.959  1.00 19.52 ? 38  ASN A CB  1 
ATOM   33   C  CG  . ASN A 1 9   ? -36.266 26.615 31.459  1.00 20.28 ? 38  ASN A CG  1 
ATOM   34   O  OD1 . ASN A 1 9   ? -36.696 27.659 31.945  1.00 25.52 ? 38  ASN A OD1 1 
ATOM   35   N  ND2 . ASN A 1 9   ? -35.825 25.609 32.187  1.00 21.48 ? 38  ASN A ND2 1 
ATOM   36   N  N   . THR A 1 10  ? -36.728 28.729 27.455  1.00 18.17 ? 39  THR A N   1 
ATOM   37   C  CA  . THR A 1 10  ? -36.241 29.126 26.145  1.00 17.96 ? 39  THR A CA  1 
ATOM   38   C  C   . THR A 1 10  ? -34.930 29.897 26.302  1.00 16.65 ? 39  THR A C   1 
ATOM   39   O  O   . THR A 1 10  ? -34.537 30.267 27.408  1.00 16.51 ? 39  THR A O   1 
ATOM   40   C  CB  . THR A 1 10  ? -37.277 29.981 25.405  1.00 18.24 ? 39  THR A CB  1 
ATOM   41   O  OG1 . THR A 1 10  ? -37.284 31.285 26.000  1.00 19.55 ? 39  THR A OG1 1 
ATOM   42   C  CG2 . THR A 1 10  ? -38.660 29.363 25.438  1.00 19.59 ? 39  THR A CG2 1 
ATOM   43   N  N   . VAL A 1 11  ? -34.279 30.186 25.195  1.00 16.35 ? 40  VAL A N   1 
ATOM   44   C  CA  . VAL A 1 11  ? -33.022 30.933 25.272  1.00 16.62 ? 40  VAL A CA  1 
ATOM   45   C  C   . VAL A 1 11  ? -33.268 32.397 25.702  1.00 18.41 ? 40  VAL A C   1 
ATOM   46   O  O   . VAL A 1 11  ? -32.303 33.123 25.943  1.00 18.34 ? 40  VAL A O   1 
ATOM   47   C  CB  . VAL A 1 11  ? -32.237 30.843 23.949  1.00 17.15 ? 40  VAL A CB  1 
ATOM   48   C  CG1 . VAL A 1 11  ? -31.828 29.406 23.639  1.00 17.17 ? 40  VAL A CG1 1 
ATOM   49   C  CG2 . VAL A 1 11  ? -33.000 31.477 22.801  1.00 17.56 ? 40  VAL A CG2 1 
ATOM   50   N  N   . ARG A 1 12  ? -34.526 32.835 25.843  1.00 19.29 ? 41  ARG A N   1 
ATOM   51   C  CA  . ARG A 1 12  ? -34.846 34.169 26.406  1.00 19.78 ? 41  ARG A CA  1 
ATOM   52   C  C   . ARG A 1 12  ? -35.576 34.042 27.751  1.00 20.16 ? 41  ARG A C   1 
ATOM   53   O  O   . ARG A 1 12  ? -36.143 35.029 28.226  1.00 17.95 ? 41  ARG A O   1 
ATOM   54   C  CB  . ARG A 1 12  ? -35.699 34.961 25.412  1.00 20.63 ? 41  ARG A CB  1 
ATOM   55   C  CG  . ARG A 1 12  ? -34.989 35.233 24.094  1.00 23.98 ? 41  ARG A CG  1 
ATOM   56   C  CD  . ARG A 1 12  ? -35.942 35.875 23.098  1.00 26.09 ? 41  ARG A CD  1 
ATOM   57   N  NE  . ARG A 1 12  ? -36.179 37.245 23.521  1.00 29.28 ? 41  ARG A NE  1 
ATOM   58   C  CZ  . ARG A 1 12  ? -37.126 38.039 23.036  1.00 31.04 ? 41  ARG A CZ  1 
ATOM   59   N  NH1 . ARG A 1 12  ? -38.032 37.567 22.196  1.00 27.36 ? 41  ARG A NH1 1 
ATOM   60   N  NH2 . ARG A 1 12  ? -37.127 39.316 23.376  1.00 32.90 ? 41  ARG A NH2 1 
ATOM   61   N  N   . GLY A 1 13  ? -35.538 32.855 28.367  1.00 19.97 ? 42  GLY A N   1 
ATOM   62   C  CA  . GLY A 1 13  ? -36.190 32.614 29.673  1.00 19.16 ? 42  GLY A CA  1 
ATOM   63   C  C   . GLY A 1 13  ? -37.446 31.750 29.570  1.00 18.67 ? 42  GLY A C   1 
ATOM   64   O  O   . GLY A 1 13  ? -37.755 31.199 28.507  1.00 18.34 ? 42  GLY A O   1 
ATOM   65   N  N   . PRO A 1 14  ? -38.174 31.607 30.701  1.00 18.61 ? 43  PRO A N   1 
ATOM   66   C  CA  . PRO A 1 14  ? -39.386 30.795 30.797  1.00 18.91 ? 43  PRO A CA  1 
ATOM   67   C  C   . PRO A 1 14  ? -40.522 31.412 29.974  1.00 18.93 ? 43  PRO A C   1 
ATOM   68   O  O   . PRO A 1 14  ? -40.642 32.642 29.927  1.00 17.70 ? 43  PRO A O   1 
ATOM   69   C  CB  . PRO A 1 14  ? -39.794 30.750 32.283  1.00 19.96 ? 43  PRO A CB  1 
ATOM   70   C  CG  . PRO A 1 14  ? -38.731 31.520 33.037  1.00 19.50 ? 43  PRO A CG  1 
ATOM   71   C  CD  . PRO A 1 14  ? -37.805 32.156 32.022  1.00 18.99 ? 43  PRO A CD  1 
ATOM   72   N  N   . ILE A 1 15  ? -41.286 30.560 29.304  1.00 20.42 ? 44  ILE A N   1 
ATOM   73   C  CA  . ILE A 1 15  ? -42.527 30.955 28.627  1.00 21.28 ? 44  ILE A CA  1 
ATOM   74   C  C   . ILE A 1 15  ? -43.634 30.013 29.111  1.00 23.03 ? 44  ILE A C   1 
ATOM   75   O  O   . ILE A 1 15  ? -43.343 28.880 29.536  1.00 22.91 ? 44  ILE A O   1 
ATOM   76   C  CB  . ILE A 1 15  ? -42.403 30.884 27.092  1.00 21.38 ? 44  ILE A CB  1 
ATOM   77   C  CG1 . ILE A 1 15  ? -42.168 29.446 26.604  1.00 21.97 ? 44  ILE A CG1 1 
ATOM   78   C  CG2 . ILE A 1 15  ? -41.340 31.852 26.575  1.00 22.30 ? 44  ILE A CG2 1 
ATOM   79   C  CD1 . ILE A 1 15  ? -42.316 29.270 25.104  1.00 21.98 ? 44  ILE A CD1 1 
ATOM   80   N  N   . THR A 1 16  ? -44.891 30.455 28.947  1.00 23.77 ? 45  THR A N   1 
ATOM   81   C  CA  . THR A 1 16  ? -46.054 29.625 29.249  1.00 23.77 ? 45  THR A CA  1 
ATOM   82   C  C   . THR A 1 16  ? -46.273 28.676 28.079  1.00 24.40 ? 45  THR A C   1 
ATOM   83   O  O   . THR A 1 16  ? -45.815 28.957 26.953  1.00 23.46 ? 45  THR A O   1 
ATOM   84   C  CB  . THR A 1 16  ? -47.329 30.451 29.464  1.00 22.56 ? 45  THR A CB  1 
ATOM   85   O  OG1 . THR A 1 16  ? -47.501 31.252 28.297  1.00 22.18 ? 45  THR A OG1 1 
ATOM   86   C  CG2 . THR A 1 16  ? -47.280 31.304 30.706  1.00 22.39 ? 45  THR A CG2 1 
ATOM   87   N  N   . ILE A 1 17  ? -47.049 27.628 28.359  1.00 25.57 ? 46  ILE A N   1 
ATOM   88   C  CA  . ILE A 1 17  ? -47.363 26.571 27.397  1.00 26.77 ? 46  ILE A CA  1 
ATOM   89   C  C   . ILE A 1 17  ? -48.020 27.193 26.162  1.00 25.88 ? 46  ILE A C   1 
ATOM   90   O  O   . ILE A 1 17  ? -47.698 26.861 25.002  1.00 25.67 ? 46  ILE A O   1 
ATOM   91   C  CB  . ILE A 1 17  ? -48.264 25.487 28.029  1.00 29.08 ? 46  ILE A CB  1 
ATOM   92   C  CG1 . ILE A 1 17  ? -47.818 25.095 29.448  1.00 33.20 ? 46  ILE A CG1 1 
ATOM   93   C  CG2 . ILE A 1 17  ? -48.372 24.274 27.113  1.00 29.20 ? 46  ILE A CG2 1 
ATOM   94   C  CD1 . ILE A 1 17  ? -46.306 25.041 29.674  1.00 35.36 ? 46  ILE A CD1 1 
ATOM   95   N  N   . SER A 1 18  ? -48.948 28.099 26.427  1.00 23.32 ? 47  SER A N   1 
ATOM   96   C  CA  . SER A 1 18  ? -49.733 28.677 25.396  1.00 22.98 ? 47  SER A CA  1 
ATOM   97   C  C   . SER A 1 18  ? -48.880 29.625 24.521  1.00 22.79 ? 47  SER A C   1 
ATOM   98   O  O   . SER A 1 18  ? -49.228 29.880 23.357  1.00 21.64 ? 47  SER A O   1 
ATOM   99   C  CB  . SER A 1 18  ? -50.959 29.359 25.996  1.00 25.02 ? 47  SER A CB  1 
ATOM   100  O  OG  . SER A 1 18  ? -50.627 30.626 26.530  1.00 24.53 ? 47  SER A OG  1 
ATOM   101  N  N   . GLU A 1 19  ? -47.750 30.139 24.999  1.00 22.87 ? 48  GLU A N   1 
ATOM   102  C  CA  . GLU A 1 19  ? -46.902 31.034 24.130  1.00 23.34 ? 48  GLU A CA  1 
ATOM   103  C  C   . GLU A 1 19  ? -46.122 30.244 23.055  1.00 20.75 ? 48  GLU A C   1 
ATOM   104  O  O   . GLU A 1 19  ? -45.649 30.820 22.082  1.00 20.68 ? 48  GLU A O   1 
ATOM   105  C  CB  . GLU A 1 19  ? -45.935 31.853 24.980  1.00 24.81 ? 48  GLU A CB  1 
ATOM   106  C  CG  . GLU A 1 19  ? -46.610 32.956 25.773  1.00 29.59 ? 48  GLU A CG  1 
ATOM   107  C  CD  . GLU A 1 19  ? -45.650 33.637 26.734  1.00 32.76 ? 48  GLU A CD  1 
ATOM   108  O  OE1 . GLU A 1 19  ? -45.313 33.034 27.774  1.00 34.35 ? 48  GLU A OE1 1 
ATOM   109  O  OE2 . GLU A 1 19  ? -45.210 34.755 26.417  1.00 36.07 ? 48  GLU A OE2 1 
ATOM   110  N  N   . ALA A 1 20  ? -45.974 28.943 23.221  1.00 19.44 ? 49  ALA A N   1 
ATOM   111  C  CA  . ALA A 1 20  ? -45.185 28.136 22.284  1.00 19.89 ? 49  ALA A CA  1 
ATOM   112  C  C   . ALA A 1 20  ? -45.872 28.099 20.912  1.00 18.94 ? 49  ALA A C   1 
ATOM   113  O  O   . ALA A 1 20  ? -45.211 28.225 19.878  1.00 17.27 ? 49  ALA A O   1 
ATOM   114  C  CB  . ALA A 1 20  ? -45.007 26.753 22.821  1.00 19.81 ? 49  ALA A CB  1 
ATOM   115  N  N   . GLY A 1 21  ? -47.191 27.922 20.907  1.00 17.63 ? 50  GLY A N   1 
ATOM   116  C  CA  . GLY A 1 21  ? -47.937 27.959 19.635  1.00 16.99 ? 50  GLY A CA  1 
ATOM   117  C  C   . GLY A 1 21  ? -47.387 26.917 18.669  1.00 16.76 ? 50  GLY A C   1 
ATOM   118  O  O   . GLY A 1 21  ? -46.917 25.838 19.101  1.00 16.48 ? 50  GLY A O   1 
ATOM   119  N  N   . PHE A 1 22  ? -47.418 27.255 17.384  1.00 15.63 ? 51  PHE A N   1 
ATOM   120  C  CA  . PHE A 1 22  ? -46.954 26.401 16.289  1.00 16.46 ? 51  PHE A CA  1 
ATOM   121  C  C   . PHE A 1 22  ? -45.439 26.168 16.456  1.00 15.43 ? 51  PHE A C   1 
ATOM   122  O  O   . PHE A 1 22  ? -44.641 27.115 16.334  1.00 13.85 ? 51  PHE A O   1 
ATOM   123  C  CB  . PHE A 1 22  ? -47.356 27.015 14.941  1.00 16.60 ? 51  PHE A CB  1 
ATOM   124  C  CG  . PHE A 1 22  ? -47.194 26.115 13.731  1.00 17.16 ? 51  PHE A CG  1 
ATOM   125  C  CD1 . PHE A 1 22  ? -45.932 25.750 13.262  1.00 15.97 ? 51  PHE A CD1 1 
ATOM   126  C  CD2 . PHE A 1 22  ? -48.296 25.709 12.996  1.00 17.15 ? 51  PHE A CD2 1 
ATOM   127  C  CE1 . PHE A 1 22  ? -45.786 24.972 12.121  1.00 16.06 ? 51  PHE A CE1 1 
ATOM   128  C  CE2 . PHE A 1 22  ? -48.144 24.892 11.881  1.00 17.84 ? 51  PHE A CE2 1 
ATOM   129  C  CZ  . PHE A 1 22  ? -46.886 24.549 11.429  1.00 16.07 ? 51  PHE A CZ  1 
ATOM   130  N  N   . THR A 1 23  ? -45.085 24.908 16.781  1.00 14.09 ? 52  THR A N   1 
ATOM   131  C  CA  . THR A 1 23  ? -43.739 24.542 17.224  1.00 14.35 ? 52  THR A CA  1 
ATOM   132  C  C   . THR A 1 23  ? -43.097 23.499 16.289  1.00 13.77 ? 52  THR A C   1 
ATOM   133  O  O   . THR A 1 23  ? -43.695 22.502 15.964  1.00 14.37 ? 52  THR A O   1 
ATOM   134  C  CB  . THR A 1 23  ? -43.779 24.035 18.668  1.00 14.10 ? 52  THR A CB  1 
ATOM   135  O  OG1 . THR A 1 23  ? -44.213 25.102 19.502  1.00 13.93 ? 52  THR A OG1 1 
ATOM   136  C  CG2 . THR A 1 23  ? -42.446 23.509 19.157  1.00 14.11 ? 52  THR A CG2 1 
ATOM   137  N  N   . LEU A 1 24  ? -41.873 23.777 15.851  1.00 13.14 ? 53  LEU A N   1 
ATOM   138  C  CA  . LEU A 1 24  ? -41.039 22.800 15.131  1.00 13.56 ? 53  LEU A CA  1 
ATOM   139  C  C   . LEU A 1 24  ? -40.091 22.148 16.135  1.00 13.23 ? 53  LEU A C   1 
ATOM   140  O  O   . LEU A 1 24  ? -39.247 22.807 16.715  1.00 14.18 ? 53  LEU A O   1 
ATOM   141  C  CB  . LEU A 1 24  ? -40.248 23.501 14.027  1.00 13.41 ? 53  LEU A CB  1 
ATOM   142  C  CG  . LEU A 1 24  ? -41.068 24.115 12.901  1.00 13.16 ? 53  LEU A CG  1 
ATOM   143  C  CD1 . LEU A 1 24  ? -40.182 24.975 12.017  1.00 13.62 ? 53  LEU A CD1 1 
ATOM   144  C  CD2 . LEU A 1 24  ? -41.756 23.039 12.087  1.00 14.30 ? 53  LEU A CD2 1 
ATOM   145  N  N   . MET A 1 25  ? -40.253 20.854 16.322  1.00 13.78 ? 54  MET A N   1 
ATOM   146  C  CA  . MET A 1 25  ? -39.665 20.123 17.472  1.00 13.42 ? 54  MET A CA  1 
ATOM   147  C  C   . MET A 1 25  ? -38.220 19.650 17.228  1.00 13.63 ? 54  MET A C   1 
ATOM   148  O  O   . MET A 1 25  ? -37.544 19.292 18.195  1.00 14.47 ? 54  MET A O   1 
ATOM   149  C  CB  . MET A 1 25  ? -40.516 18.898 17.803  1.00 13.41 ? 54  MET A CB  1 
ATOM   150  C  CG  . MET A 1 25  ? -41.750 19.213 18.635  1.00 14.03 ? 54  MET A CG  1 
ATOM   151  S  SD  . MET A 1 25  ? -41.412 19.910 20.280  1.00 14.88 ? 54  MET A SD  1 
ATOM   152  C  CE  . MET A 1 25  ? -40.142 18.768 20.846  1.00 14.16 ? 54  MET A CE  1 
ATOM   153  N  N   . HIS A 1 26  ? -37.767 19.583 15.983  1.00 12.50 ? 55  HIS A N   1 
ATOM   154  C  CA  . HIS A 1 26  ? -36.413 19.106 15.649  1.00 11.69 ? 55  HIS A CA  1 
ATOM   155  C  C   . HIS A 1 26  ? -35.831 20.006 14.545  1.00 11.26 ? 55  HIS A C   1 
ATOM   156  O  O   . HIS A 1 26  ? -36.079 19.776 13.349  1.00 10.88 ? 55  HIS A O   1 
ATOM   157  C  CB  . HIS A 1 26  ? -36.430 17.620 15.265  1.00 10.90 ? 55  HIS A CB  1 
ATOM   158  C  CG  . HIS A 1 26  ? -35.058 17.090 15.046  1.00 11.73 ? 55  HIS A CG  1 
ATOM   159  N  ND1 . HIS A 1 26  ? -34.567 15.977 15.727  1.00 11.58 ? 55  HIS A ND1 1 
ATOM   160  C  CD2 . HIS A 1 26  ? -34.026 17.584 14.318  1.00 11.58 ? 55  HIS A CD2 1 
ATOM   161  C  CE1 . HIS A 1 26  ? -33.310 15.786 15.360  1.00 12.45 ? 55  HIS A CE1 1 
ATOM   162  N  NE2 . HIS A 1 26  ? -32.953 16.766 14.507  1.00 11.56 ? 55  HIS A NE2 1 
ATOM   163  N  N   . GLU A 1 27  ? -35.106 21.037 14.971  1.00 11.28 ? 56  GLU A N   1 
ATOM   164  C  CA  . GLU A 1 27  ? -34.435 22.014 14.092  1.00 11.69 ? 56  GLU A CA  1 
ATOM   165  C  C   . GLU A 1 27  ? -33.042 22.367 14.627  1.00 11.85 ? 56  GLU A C   1 
ATOM   166  O  O   . GLU A 1 27  ? -32.679 22.018 15.767  1.00 11.91 ? 56  GLU A O   1 
ATOM   167  C  CB  . GLU A 1 27  ? -35.248 23.308 14.017  1.00 12.02 ? 56  GLU A CB  1 
ATOM   168  C  CG  . GLU A 1 27  ? -36.647 23.115 13.469  1.00 12.88 ? 56  GLU A CG  1 
ATOM   169  C  CD  . GLU A 1 27  ? -36.800 22.620 12.039  1.00 12.79 ? 56  GLU A CD  1 
ATOM   170  O  OE1 . GLU A 1 27  ? -35.832 22.776 11.217  1.00 12.66 ? 56  GLU A OE1 1 
ATOM   171  O  OE2 . GLU A 1 27  ? -37.909 22.115 11.739  1.00 11.57 ? 56  GLU A OE2 1 
ATOM   172  N  N   . HIS A 1 28  ? -32.270 23.093 13.807  1.00 12.07 ? 57  HIS A N   1 
ATOM   173  C  CA  . HIS A 1 28  ? -30.967 23.615 14.193  1.00 11.84 ? 57  HIS A CA  1 
ATOM   174  C  C   . HIS A 1 28  ? -30.812 25.063 13.701  1.00 11.87 ? 57  HIS A C   1 
ATOM   175  O  O   . HIS A 1 28  ? -31.297 25.429 12.630  1.00 10.66 ? 57  HIS A O   1 
ATOM   176  C  CB  . HIS A 1 28  ? -29.825 22.749 13.633  1.00 12.00 ? 57  HIS A CB  1 
ATOM   177  C  CG  . HIS A 1 28  ? -29.942 21.319 14.007  1.00 11.92 ? 57  HIS A CG  1 
ATOM   178  N  ND1 . HIS A 1 28  ? -29.398 20.829 15.164  1.00 12.24 ? 57  HIS A ND1 1 
ATOM   179  C  CD2 . HIS A 1 28  ? -30.558 20.280 13.409  1.00 11.85 ? 57  HIS A CD2 1 
ATOM   180  C  CE1 . HIS A 1 28  ? -29.674 19.551 15.259  1.00 12.39 ? 57  HIS A CE1 1 
ATOM   181  N  NE2 . HIS A 1 28  ? -30.368 19.185 14.196  1.00 11.67 ? 57  HIS A NE2 1 
ATOM   182  N  N   . ILE A 1 29  ? -30.106 25.889 14.462  1.00 11.89 ? 58  ILE A N   1 
ATOM   183  C  CA  . ILE A 1 29  ? -29.642 27.158 13.883  1.00 12.78 ? 58  ILE A CA  1 
ATOM   184  C  C   . ILE A 1 29  ? -28.355 26.861 13.101  1.00 13.56 ? 58  ILE A C   1 
ATOM   185  O  O   . ILE A 1 29  ? -28.191 27.272 11.941  1.00 12.42 ? 58  ILE A O   1 
ATOM   186  C  CB  . ILE A 1 29  ? -29.465 28.242 14.967  1.00 12.45 ? 58  ILE A CB  1 
ATOM   187  C  CG1 . ILE A 1 29  ? -30.795 28.567 15.646  1.00 12.38 ? 58  ILE A CG1 1 
ATOM   188  C  CG2 . ILE A 1 29  ? -28.815 29.500 14.399  1.00 12.62 ? 58  ILE A CG2 1 
ATOM   189  C  CD1 . ILE A 1 29  ? -31.876 29.026 14.679  1.00 12.84 ? 58  ILE A CD1 1 
ATOM   190  N  N   . CYS A 1 30  ? -27.475 26.077 13.717  1.00 14.14 ? 59  CYS A N   1 
ATOM   191  C  CA  . CYS A 1 30  ? -26.212 25.776 13.088  1.00 15.80 ? 59  CYS A CA  1 
ATOM   192  C  C   . CYS A 1 30  ? -25.707 24.423 13.585  1.00 16.22 ? 59  CYS A C   1 
ATOM   193  O  O   . CYS A 1 30  ? -25.509 24.258 14.779  1.00 17.61 ? 59  CYS A O   1 
ATOM   194  C  CB  . CYS A 1 30  ? -25.195 26.862 13.387  1.00 15.46 ? 59  CYS A CB  1 
ATOM   195  S  SG  . CYS A 1 30  ? -23.624 26.610 12.531  1.00 19.43 ? 59  CYS A SG  1 
ATOM   196  N  N   . GLY A 1 31  ? -25.546 23.471 12.665  1.00 15.90 ? 60  GLY A N   1 
ATOM   197  C  CA  . GLY A 1 31  ? -24.961 22.183 12.979  1.00 14.55 ? 60  GLY A CA  1 
ATOM   198  C  C   . GLY A 1 31  ? -23.451 22.227 12.872  1.00 14.27 ? 60  GLY A C   1 
ATOM   199  O  O   . GLY A 1 31  ? -22.908 22.356 11.790  1.00 14.09 ? 60  GLY A O   1 
ATOM   200  N  N   . SER A 1 32  ? -22.762 22.063 14.003  1.00 13.52 ? 61  SER A N   1 
ATOM   201  C  CA  . SER A 1 32  ? -21.360 22.302 14.034  1.00 13.51 ? 61  SER A CA  1 
ATOM   202  C  C   . SER A 1 32  ? -20.675 21.334 15.026  1.00 13.17 ? 61  SER A C   1 
ATOM   203  O  O   . SER A 1 32  ? -21.139 20.207 15.245  1.00 12.39 ? 61  SER A O   1 
ATOM   204  C  CB  . SER A 1 32  ? -21.138 23.778 14.338  1.00 14.45 ? 61  SER A CB  1 
ATOM   205  O  OG  . SER A 1 32  ? -19.787 24.156 14.136  1.00 15.31 ? 61  SER A OG  1 
ATOM   206  N  N   . SER A 1 33  ? -19.600 21.791 15.659  1.00 13.04 ? 62  SER A N   1 
ATOM   207  C  CA  . SER A 1 33  ? -18.848 21.006 16.625  1.00 13.23 ? 62  SER A CA  1 
ATOM   208  C  C   . SER A 1 33  ? -18.495 21.950 17.779  1.00 14.41 ? 62  SER A C   1 
ATOM   209  O  O   . SER A 1 33  ? -18.372 23.175 17.549  1.00 12.40 ? 62  SER A O   1 
ATOM   210  C  CB  . SER A 1 33  ? -17.597 20.444 16.010  1.00 13.21 ? 62  SER A CB  1 
ATOM   211  O  OG  . SER A 1 33  ? -17.867 19.565 14.929  1.00 12.62 ? 62  SER A OG  1 
ATOM   212  N  N   . ALA A 1 34  ? -18.340 21.420 19.000  1.00 13.92 ? 63  ALA A N   1 
ATOM   213  C  CA  . ALA A 1 34  ? -18.066 22.309 20.152  1.00 13.15 ? 63  ALA A CA  1 
ATOM   214  C  C   . ALA A 1 34  ? -16.898 23.243 19.828  1.00 13.61 ? 63  ALA A C   1 
ATOM   215  O  O   . ALA A 1 34  ? -15.874 22.776 19.298  1.00 14.33 ? 63  ALA A O   1 
ATOM   216  C  CB  . ALA A 1 34  ? -17.753 21.483 21.370  1.00 13.72 ? 63  ALA A CB  1 
ATOM   217  N  N   . GLY A 1 35  ? -17.061 24.536 20.147  1.00 12.52 ? 64  GLY A N   1 
ATOM   218  C  CA  . GLY A 1 35  ? -15.990 25.565 20.026  1.00 12.60 ? 64  GLY A CA  1 
ATOM   219  C  C   . GLY A 1 35  ? -15.764 26.026 18.593  1.00 12.45 ? 64  GLY A C   1 
ATOM   220  O  O   . GLY A 1 35  ? -15.084 27.031 18.379  1.00 11.00 ? 64  GLY A O   1 
ATOM   221  N  N   . PHE A 1 36  ? -16.407 25.383 17.599  1.00 12.20 ? 65  PHE A N   1 
ATOM   222  C  CA  . PHE A 1 36  ? -15.992 25.557 16.195  1.00 12.78 ? 65  PHE A CA  1 
ATOM   223  C  C   . PHE A 1 36  ? -16.384 26.948 15.664  1.00 13.43 ? 65  PHE A C   1 
ATOM   224  O  O   . PHE A 1 36  ? -15.564 27.633 15.012  1.00 12.10 ? 65  PHE A O   1 
ATOM   225  C  CB  . PHE A 1 36  ? -16.548 24.429 15.321  1.00 12.58 ? 65  PHE A CB  1 
ATOM   226  C  CG  . PHE A 1 36  ? -16.067 24.438 13.892  1.00 12.15 ? 65  PHE A CG  1 
ATOM   227  C  CD1 . PHE A 1 36  ? -16.750 25.146 12.907  1.00 12.03 ? 65  PHE A CD1 1 
ATOM   228  C  CD2 . PHE A 1 36  ? -14.920 23.753 13.530  1.00 11.84 ? 65  PHE A CD2 1 
ATOM   229  C  CE1 . PHE A 1 36  ? -16.299 25.161 11.599  1.00 11.76 ? 65  PHE A CE1 1 
ATOM   230  C  CE2 . PHE A 1 36  ? -14.453 23.789 12.225  1.00 12.23 ? 65  PHE A CE2 1 
ATOM   231  C  CZ  . PHE A 1 36  ? -15.139 24.492 11.262  1.00 12.07 ? 65  PHE A CZ  1 
ATOM   232  N  N   . LEU A 1 37  ? -17.621 27.363 15.930  1.00 13.96 ? 66  LEU A N   1 
ATOM   233  C  CA  . LEU A 1 37  ? -18.105 28.667 15.493  1.00 14.55 ? 66  LEU A CA  1 
ATOM   234  C  C   . LEU A 1 37  ? -17.240 29.777 16.112  1.00 14.74 ? 66  LEU A C   1 
ATOM   235  O  O   . LEU A 1 37  ? -16.927 30.753 15.451  1.00 15.57 ? 66  LEU A O   1 
ATOM   236  C  CB  . LEU A 1 37  ? -19.583 28.804 15.891  1.00 15.41 ? 66  LEU A CB  1 
ATOM   237  C  CG  . LEU A 1 37  ? -20.253 30.143 15.555  1.00 15.35 ? 66  LEU A CG  1 
ATOM   238  C  CD1 . LEU A 1 37  ? -20.125 30.480 14.078  1.00 14.82 ? 66  LEU A CD1 1 
ATOM   239  C  CD2 . LEU A 1 37  ? -21.720 30.105 15.955  1.00 16.87 ? 66  LEU A CD2 1 
ATOM   240  N  N   . ARG A 1 38  ? -16.827 29.654 17.359  1.00 16.11 ? 67  ARG A N   1 
ATOM   241  C  CA  . ARG A 1 38  ? -16.020 30.710 17.965  1.00 17.33 ? 67  ARG A CA  1 
ATOM   242  C  C   . ARG A 1 38  ? -14.586 30.709 17.379  1.00 16.56 ? 67  ARG A C   1 
ATOM   243  O  O   . ARG A 1 38  ? -13.950 31.777 17.256  1.00 18.01 ? 67  ARG A O   1 
ATOM   244  C  CB  . ARG A 1 38  ? -15.990 30.530 19.480  1.00 21.54 ? 67  ARG A CB  1 
ATOM   245  C  CG  . ARG A 1 38  ? -17.287 30.884 20.195  1.00 26.43 ? 67  ARG A CG  1 
ATOM   246  C  CD  . ARG A 1 38  ? -17.186 30.660 21.703  1.00 32.00 ? 67  ARG A CD  1 
ATOM   247  N  NE  . ARG A 1 38  ? -16.329 31.652 22.367  1.00 40.25 ? 67  ARG A NE  1 
ATOM   248  C  CZ  . ARG A 1 38  ? -14.994 31.597 22.478  1.00 43.99 ? 67  ARG A CZ  1 
ATOM   249  N  NH1 . ARG A 1 38  ? -14.337 30.473 22.235  1.00 46.77 ? 67  ARG A NH1 1 
ATOM   250  N  NH2 . ARG A 1 38  ? -14.318 32.683 22.817  1.00 42.60 ? 67  ARG A NH2 1 
ATOM   251  N  N   . ALA A 1 39  ? -14.057 29.543 17.032  1.00 14.68 ? 68  ALA A N   1 
ATOM   252  C  CA  . ALA A 1 39  ? -12.647 29.406 16.592  1.00 15.28 ? 68  ALA A CA  1 
ATOM   253  C  C   . ALA A 1 39  ? -12.494 29.708 15.096  1.00 14.81 ? 68  ALA A C   1 
ATOM   254  O  O   . ALA A 1 39  ? -11.395 30.142 14.639  1.00 14.82 ? 68  ALA A O   1 
ATOM   255  C  CB  . ALA A 1 39  ? -12.152 28.015 16.912  1.00 14.28 ? 68  ALA A CB  1 
ATOM   256  N  N   . TRP A 1 40  ? -13.554 29.493 14.323  1.00 14.84 ? 69  TRP A N   1 
ATOM   257  C  CA  . TRP A 1 40  ? -13.427 29.569 12.871  1.00 15.81 ? 69  TRP A CA  1 
ATOM   258  C  C   . TRP A 1 40  ? -14.721 30.076 12.234  1.00 15.04 ? 69  TRP A C   1 
ATOM   259  O  O   . TRP A 1 40  ? -15.286 29.403 11.374  1.00 14.55 ? 69  TRP A O   1 
ATOM   260  C  CB  . TRP A 1 40  ? -13.025 28.205 12.299  1.00 16.31 ? 69  TRP A CB  1 
ATOM   261  C  CG  . TRP A 1 40  ? -12.522 28.216 10.884  1.00 17.34 ? 69  TRP A CG  1 
ATOM   262  C  CD1 . TRP A 1 40  ? -12.419 29.256 10.000  1.00 19.13 ? 69  TRP A CD1 1 
ATOM   263  C  CD2 . TRP A 1 40  ? -12.105 27.050 10.156  1.00 17.88 ? 69  TRP A CD2 1 
ATOM   264  N  NE1 . TRP A 1 40  ? -11.918 28.818 8.798   1.00 19.41 ? 69  TRP A NE1 1 
ATOM   265  C  CE2 . TRP A 1 40  ? -11.735 27.468 8.860   1.00 17.67 ? 69  TRP A CE2 1 
ATOM   266  C  CE3 . TRP A 1 40  ? -11.962 25.713 10.514  1.00 16.69 ? 69  TRP A CE3 1 
ATOM   267  C  CZ2 . TRP A 1 40  ? -11.282 26.578 7.896   1.00 18.45 ? 69  TRP A CZ2 1 
ATOM   268  C  CZ3 . TRP A 1 40  ? -11.498 24.833 9.564   1.00 18.26 ? 69  TRP A CZ3 1 
ATOM   269  C  CH2 . TRP A 1 40  ? -11.174 25.262 8.274   1.00 17.88 ? 69  TRP A CH2 1 
ATOM   270  N  N   . PRO A 1 41  ? -15.138 31.283 12.617  1.00 14.86 ? 70  PRO A N   1 
ATOM   271  C  CA  . PRO A 1 41  ? -16.395 31.819 12.105  1.00 15.22 ? 70  PRO A CA  1 
ATOM   272  C  C   . PRO A 1 41  ? -16.398 32.006 10.581  1.00 15.08 ? 70  PRO A C   1 
ATOM   273  O  O   . PRO A 1 41  ? -17.471 31.998 9.960   1.00 14.05 ? 70  PRO A O   1 
ATOM   274  C  CB  . PRO A 1 41  ? -16.602 33.161 12.840  1.00 15.58 ? 70  PRO A CB  1 
ATOM   275  C  CG  . PRO A 1 41  ? -15.247 33.490 13.440  1.00 16.51 ? 70  PRO A CG  1 
ATOM   276  C  CD  . PRO A 1 41  ? -14.591 32.139 13.676  1.00 15.47 ? 70  PRO A CD  1 
ATOM   277  N  N   . GLU A 1 42  ? -15.215 32.173 10.000  1.00 16.57 ? 71  GLU A N   1 
ATOM   278  C  CA  . GLU A 1 42  ? -15.017 32.408 8.547   1.00 16.55 ? 71  GLU A CA  1 
ATOM   279  C  C   . GLU A 1 42  ? -15.469 31.196 7.730   1.00 16.54 ? 71  GLU A C   1 
ATOM   280  O  O   . GLU A 1 42  ? -15.716 31.340 6.543   1.00 15.49 ? 71  GLU A O   1 
ATOM   281  C  CB  . GLU A 1 42  ? -13.539 32.686 8.229   1.00 18.85 ? 71  GLU A CB  1 
ATOM   282  C  CG  . GLU A 1 42  ? -13.022 33.962 8.884   1.00 20.08 ? 71  GLU A CG  1 
ATOM   283  C  CD  . GLU A 1 42  ? -12.758 33.869 10.379  1.00 19.90 ? 71  GLU A CD  1 
ATOM   284  O  OE1 . GLU A 1 42  ? -12.470 32.750 10.844  1.00 18.44 ? 71  GLU A OE1 1 
ATOM   285  O  OE2 . GLU A 1 42  ? -12.807 34.928 11.074  1.00 20.02 ? 71  GLU A OE2 1 
ATOM   286  N  N   . PHE A 1 43  ? -15.551 30.011 8.348   1.00 14.82 ? 72  PHE A N   1 
ATOM   287  C  CA  . PHE A 1 43  ? -16.081 28.862 7.653   1.00 14.20 ? 72  PHE A CA  1 
ATOM   288  C  C   . PHE A 1 43  ? -17.517 29.153 7.176   1.00 14.28 ? 72  PHE A C   1 
ATOM   289  O  O   . PHE A 1 43  ? -17.933 28.672 6.136   1.00 13.09 ? 72  PHE A O   1 
ATOM   290  C  CB  . PHE A 1 43  ? -16.034 27.616 8.541   1.00 14.71 ? 72  PHE A CB  1 
ATOM   291  C  CG  . PHE A 1 43  ? -16.559 26.369 7.875   1.00 14.63 ? 72  PHE A CG  1 
ATOM   292  C  CD1 . PHE A 1 43  ? -15.706 25.558 7.138   1.00 14.73 ? 72  PHE A CD1 1 
ATOM   293  C  CD2 . PHE A 1 43  ? -17.896 26.022 7.957   1.00 14.30 ? 72  PHE A CD2 1 
ATOM   294  C  CE1 . PHE A 1 43  ? -16.175 24.416 6.508   1.00 14.22 ? 72  PHE A CE1 1 
ATOM   295  C  CE2 . PHE A 1 43  ? -18.361 24.870 7.338   1.00 14.39 ? 72  PHE A CE2 1 
ATOM   296  C  CZ  . PHE A 1 43  ? -17.495 24.063 6.630   1.00 14.03 ? 72  PHE A CZ  1 
ATOM   297  N  N   . PHE A 1 44  ? -18.267 29.928 7.949   1.00 13.45 ? 73  PHE A N   1 
ATOM   298  C  CA  . PHE A 1 44  ? -19.625 30.285 7.651   1.00 14.04 ? 73  PHE A CA  1 
ATOM   299  C  C   . PHE A 1 44  ? -19.686 31.689 6.995   1.00 15.45 ? 73  PHE A C   1 
ATOM   300  O  O   . PHE A 1 44  ? -20.738 32.383 7.069   1.00 14.64 ? 73  PHE A O   1 
ATOM   301  C  CB  . PHE A 1 44  ? -20.445 30.257 8.947   1.00 13.59 ? 73  PHE A CB  1 
ATOM   302  C  CG  . PHE A 1 44  ? -20.337 28.986 9.754   1.00 14.15 ? 73  PHE A CG  1 
ATOM   303  C  CD1 . PHE A 1 44  ? -21.079 27.865 9.408   1.00 13.68 ? 73  PHE A CD1 1 
ATOM   304  C  CD2 . PHE A 1 44  ? -19.486 28.898 10.853  1.00 14.08 ? 73  PHE A CD2 1 
ATOM   305  C  CE1 . PHE A 1 44  ? -20.969 26.690 10.132  1.00 13.52 ? 73  PHE A CE1 1 
ATOM   306  C  CE2 . PHE A 1 44  ? -19.372 27.719 11.576  1.00 13.82 ? 73  PHE A CE2 1 
ATOM   307  C  CZ  . PHE A 1 44  ? -20.119 26.615 11.224  1.00 13.68 ? 73  PHE A CZ  1 
ATOM   308  N  N   . GLY A 1 45  ? -18.601 32.140 6.350   1.00 15.60 ? 74  GLY A N   1 
ATOM   309  C  CA  . GLY A 1 45  ? -18.519 33.566 5.913   1.00 15.36 ? 74  GLY A CA  1 
ATOM   310  C  C   . GLY A 1 45  ? -18.015 34.424 7.050   1.00 15.55 ? 74  GLY A C   1 
ATOM   311  O  O   . GLY A 1 45  ? -16.849 34.819 7.080   1.00 16.29 ? 74  GLY A O   1 
ATOM   312  N  N   . SER A 1 46  ? -18.895 34.664 8.004   1.00 15.30 ? 75  SER A N   1 
ATOM   313  C  CA  . SER A 1 46  ? -18.600 35.278 9.288   1.00 15.65 ? 75  SER A CA  1 
ATOM   314  C  C   . SER A 1 46  ? -19.766 34.988 10.256  1.00 16.65 ? 75  SER A C   1 
ATOM   315  O  O   . SER A 1 46  ? -20.832 34.510 9.835   1.00 15.40 ? 75  SER A O   1 
ATOM   316  C  CB  . SER A 1 46  ? -18.419 36.779 9.147   1.00 15.75 ? 75  SER A CB  1 
ATOM   317  O  OG  . SER A 1 46  ? -19.680 37.380 8.818   1.00 14.02 ? 75  SER A OG  1 
ATOM   318  N  N   . ARG A 1 47  ? -19.568 35.304 11.539  1.00 17.28 ? 76  ARG A N   1 
ATOM   319  C  CA  . ARG A 1 47  ? -20.625 35.176 12.519  1.00 18.30 ? 76  ARG A CA  1 
ATOM   320  C  C   . ARG A 1 47  ? -21.793 36.083 12.118  1.00 17.62 ? 76  ARG A C   1 
ATOM   321  O  O   . ARG A 1 47  ? -22.941 35.647 12.194  1.00 16.71 ? 76  ARG A O   1 
ATOM   322  C  CB  . ARG A 1 47  ? -20.144 35.509 13.937  1.00 18.20 ? 76  ARG A CB  1 
ATOM   323  C  CG  . ARG A 1 47  ? -21.146 35.149 15.022  1.00 19.08 ? 76  ARG A CG  1 
ATOM   324  C  CD  . ARG A 1 47  ? -20.752 35.566 16.437  1.00 20.82 ? 76  ARG A CD  1 
ATOM   325  N  NE  . ARG A 1 47  ? -21.710 35.117 17.456  1.00 21.17 ? 76  ARG A NE  1 
ATOM   326  C  CZ  . ARG A 1 47  ? -21.673 33.943 18.105  1.00 22.63 ? 76  ARG A CZ  1 
ATOM   327  N  NH1 . ARG A 1 47  ? -20.659 33.106 17.926  1.00 24.01 ? 76  ARG A NH1 1 
ATOM   328  N  NH2 . ARG A 1 47  ? -22.651 33.614 18.938  1.00 22.34 ? 76  ARG A NH2 1 
ATOM   329  N  N   . ASP A 1 48  ? -21.501 37.299 11.661  1.00 17.03 ? 77  ASP A N   1 
ATOM   330  C  CA  . ASP A 1 48  ? -22.571 38.224 11.248  1.00 17.99 ? 77  ASP A CA  1 
ATOM   331  C  C   . ASP A 1 48  ? -23.388 37.616 10.091  1.00 16.73 ? 77  ASP A C   1 
ATOM   332  O  O   . ASP A 1 48  ? -24.619 37.741 10.056  1.00 15.82 ? 77  ASP A O   1 
ATOM   333  C  CB  . ASP A 1 48  ? -22.038 39.582 10.787  1.00 19.78 ? 77  ASP A CB  1 
ATOM   334  C  CG  . ASP A 1 48  ? -21.520 40.484 11.893  1.00 23.40 ? 77  ASP A CG  1 
ATOM   335  O  OD1 . ASP A 1 48  ? -21.791 40.204 13.074  1.00 24.50 ? 77  ASP A OD1 1 
ATOM   336  O  OD2 . ASP A 1 48  ? -20.835 41.469 11.552  1.00 27.96 ? 77  ASP A OD2 1 
ATOM   337  N  N   . ALA A 1 49  ? -22.713 37.003 9.133   1.00 14.82 ? 78  ALA A N   1 
ATOM   338  C  CA  . ALA A 1 49  ? -23.417 36.499 7.960   1.00 14.79 ? 78  ALA A CA  1 
ATOM   339  C  C   . ALA A 1 49  ? -24.279 35.281 8.340   1.00 14.44 ? 78  ALA A C   1 
ATOM   340  O  O   . ALA A 1 49  ? -25.347 35.109 7.760   1.00 13.44 ? 78  ALA A O   1 
ATOM   341  C  CB  . ALA A 1 49  ? -22.448 36.178 6.850   1.00 15.81 ? 78  ALA A CB  1 
ATOM   342  N  N   . LEU A 1 50  ? -23.825 34.441 9.280   1.00 13.24 ? 79  LEU A N   1 
ATOM   343  C  CA  . LEU A 1 50  ? -24.620 33.292 9.756   1.00 12.89 ? 79  LEU A CA  1 
ATOM   344  C  C   . LEU A 1 50  ? -25.869 33.796 10.479  1.00 12.51 ? 79  LEU A C   1 
ATOM   345  O  O   . LEU A 1 50  ? -26.963 33.286 10.278  1.00 12.23 ? 79  LEU A O   1 
ATOM   346  C  CB  . LEU A 1 50  ? -23.772 32.450 10.719  1.00 13.16 ? 79  LEU A CB  1 
ATOM   347  C  CG  . LEU A 1 50  ? -24.468 31.217 11.294  1.00 13.15 ? 79  LEU A CG  1 
ATOM   348  C  CD1 . LEU A 1 50  ? -24.784 30.234 10.195  1.00 13.72 ? 79  LEU A CD1 1 
ATOM   349  C  CD2 . LEU A 1 50  ? -23.620 30.548 12.348  1.00 12.99 ? 79  LEU A CD2 1 
ATOM   350  N  N   . ALA A 1 51  ? -25.686 34.749 11.384  1.00 12.74 ? 80  ALA A N   1 
ATOM   351  C  CA  . ALA A 1 51  ? -26.824 35.369 12.122  1.00 13.27 ? 80  ALA A CA  1 
ATOM   352  C  C   . ALA A 1 51  ? -27.837 36.010 11.154  1.00 14.01 ? 80  ALA A C   1 
ATOM   353  O  O   . ALA A 1 51  ? -29.036 35.886 11.369  1.00 13.45 ? 80  ALA A O   1 
ATOM   354  C  CB  . ALA A 1 51  ? -26.320 36.380 13.123  1.00 13.47 ? 80  ALA A CB  1 
ATOM   355  N  N   . GLU A 1 52  ? -27.359 36.685 10.106  1.00 15.03 ? 81  GLU A N   1 
ATOM   356  C  CA  . GLU A 1 52  ? -28.236 37.360 9.127   1.00 15.15 ? 81  GLU A CA  1 
ATOM   357  C  C   . GLU A 1 52  ? -29.115 36.319 8.422   1.00 14.16 ? 81  GLU A C   1 
ATOM   358  O  O   . GLU A 1 52  ? -30.298 36.489 8.244   1.00 12.57 ? 81  GLU A O   1 
ATOM   359  C  CB  . GLU A 1 52  ? -27.402 38.141 8.097   1.00 16.50 ? 81  GLU A CB  1 
ATOM   360  C  CG  . GLU A 1 52  ? -28.239 38.881 7.054   1.00 18.35 ? 81  GLU A CG  1 
ATOM   361  C  CD  . GLU A 1 52  ? -27.460 39.650 5.986   1.00 20.06 ? 81  GLU A CD  1 
ATOM   362  O  OE1 . GLU A 1 52  ? -26.328 40.070 6.244   1.00 21.10 ? 81  GLU A OE1 1 
ATOM   363  O  OE2 . GLU A 1 52  ? -27.994 39.818 4.884   1.00 21.72 ? 81  GLU A OE2 1 
ATOM   364  N  N   . LYS A 1 53  ? -28.495 35.221 8.020   1.00 15.22 ? 82  LYS A N   1 
ATOM   365  C  CA  . LYS A 1 53  ? -29.179 34.151 7.312   1.00 15.11 ? 82  LYS A CA  1 
ATOM   366  C  C   . LYS A 1 53  ? -30.187 33.458 8.225   1.00 14.28 ? 82  LYS A C   1 
ATOM   367  O  O   . LYS A 1 53  ? -31.273 33.093 7.763   1.00 15.12 ? 82  LYS A O   1 
ATOM   368  C  CB  . LYS A 1 53  ? -28.143 33.148 6.807   1.00 15.77 ? 82  LYS A CB  1 
ATOM   369  C  CG  . LYS A 1 53  ? -28.651 31.991 5.958   1.00 16.88 ? 82  LYS A CG  1 
ATOM   370  C  CD  . LYS A 1 53  ? -27.496 31.079 5.578   1.00 18.14 ? 82  LYS A CD  1 
ATOM   371  C  CE  . LYS A 1 53  ? -27.903 29.750 4.973   1.00 18.88 ? 82  LYS A CE  1 
ATOM   372  N  NZ  . LYS A 1 53  ? -28.687 29.956 3.740   1.00 20.23 ? 82  LYS A NZ  1 
ATOM   373  N  N   . ALA A 1 54  ? -29.795 33.183 9.474   1.00 13.39 ? 83  ALA A N   1 
ATOM   374  C  CA  . ALA A 1 54  ? -30.695 32.534 10.446  1.00 12.96 ? 83  ALA A CA  1 
ATOM   375  C  C   . ALA A 1 54  ? -31.889 33.448 10.766  1.00 12.76 ? 83  ALA A C   1 
ATOM   376  O  O   . ALA A 1 54  ? -33.042 32.997 10.803  1.00 12.63 ? 83  ALA A O   1 
ATOM   377  C  CB  . ALA A 1 54  ? -29.918 32.139 11.693  1.00 12.57 ? 83  ALA A CB  1 
ATOM   378  N  N   . VAL A 1 55  ? -31.635 34.749 10.954  1.00 13.30 ? 84  VAL A N   1 
ATOM   379  C  CA  . VAL A 1 55  ? -32.739 35.670 11.277  1.00 13.09 ? 84  VAL A CA  1 
ATOM   380  C  C   . VAL A 1 55  ? -33.713 35.739 10.086  1.00 13.32 ? 84  VAL A C   1 
ATOM   381  O  O   . VAL A 1 55  ? -34.927 35.689 10.261  1.00 11.17 ? 84  VAL A O   1 
ATOM   382  C  CB  . VAL A 1 55  ? -32.208 37.051 11.680  1.00 13.41 ? 84  VAL A CB  1 
ATOM   383  C  CG1 . VAL A 1 55  ? -33.299 38.105 11.589  1.00 13.62 ? 84  VAL A CG1 1 
ATOM   384  C  CG2 . VAL A 1 55  ? -31.585 37.016 13.076  1.00 13.25 ? 84  VAL A CG2 1 
ATOM   385  N  N   . ARG A 1 56  ? -33.174 35.802 8.866   1.00 14.23 ? 85  ARG A N   1 
ATOM   386  C  CA  . ARG A 1 56  ? -34.013 35.798 7.668   1.00 14.83 ? 85  ARG A CA  1 
ATOM   387  C  C   . ARG A 1 56  ? -34.835 34.499 7.601   1.00 14.48 ? 85  ARG A C   1 
ATOM   388  O  O   . ARG A 1 56  ? -36.028 34.530 7.333   1.00 14.22 ? 85  ARG A O   1 
ATOM   389  C  CB  . ARG A 1 56  ? -33.169 35.975 6.399   1.00 16.48 ? 85  ARG A CB  1 
ATOM   390  C  CG  . ARG A 1 56  ? -33.976 36.023 5.104   1.00 17.65 ? 85  ARG A CG  1 
ATOM   391  C  CD  . ARG A 1 56  ? -33.091 36.260 3.906   1.00 19.06 ? 85  ARG A CD  1 
ATOM   392  N  NE  . ARG A 1 56  ? -32.377 37.528 4.085   1.00 20.95 ? 85  ARG A NE  1 
ATOM   393  C  CZ  . ARG A 1 56  ? -31.064 37.676 4.026   1.00 21.03 ? 85  ARG A CZ  1 
ATOM   394  N  NH1 . ARG A 1 56  ? -30.303 36.625 3.770   1.00 20.03 ? 85  ARG A NH1 1 
ATOM   395  N  NH2 . ARG A 1 56  ? -30.531 38.873 4.206   1.00 18.34 ? 85  ARG A NH2 1 
ATOM   396  N  N   . GLY A 1 57  ? -34.196 33.365 7.794   1.00 14.61 ? 86  GLY A N   1 
ATOM   397  C  CA  . GLY A 1 57  ? -34.884 32.088 7.703   1.00 14.40 ? 86  GLY A CA  1 
ATOM   398  C  C   . GLY A 1 57  ? -35.950 31.939 8.771   1.00 14.68 ? 86  GLY A C   1 
ATOM   399  O  O   . GLY A 1 57  ? -37.039 31.427 8.496   1.00 14.67 ? 86  GLY A O   1 
ATOM   400  N  N   . LEU A 1 58  ? -35.666 32.462 9.969   1.00 14.29 ? 87  LEU A N   1 
ATOM   401  C  CA  . LEU A 1 58  ? -36.616 32.402 11.077  1.00 14.80 ? 87  LEU A CA  1 
ATOM   402  C  C   . LEU A 1 58  ? -37.796 33.344 10.833  1.00 14.57 ? 87  LEU A C   1 
ATOM   403  O  O   . LEU A 1 58  ? -38.888 32.998 11.217  1.00 12.93 ? 87  LEU A O   1 
ATOM   404  C  CB  . LEU A 1 58  ? -35.933 32.735 12.407  1.00 14.91 ? 87  LEU A CB  1 
ATOM   405  C  CG  . LEU A 1 58  ? -34.950 31.684 12.917  1.00 16.44 ? 87  LEU A CG  1 
ATOM   406  C  CD1 . LEU A 1 58  ? -34.124 32.253 14.076  1.00 16.87 ? 87  LEU A CD1 1 
ATOM   407  C  CD2 . LEU A 1 58  ? -35.659 30.403 13.324  1.00 15.18 ? 87  LEU A CD2 1 
ATOM   408  N  N   . ARG A 1 59  ? -37.564 34.521 10.257  1.00 16.22 ? 88  ARG A N   1 
ATOM   409  C  CA  . ARG A 1 59  ? -38.661 35.471 9.965   1.00 16.55 ? 88  ARG A CA  1 
ATOM   410  C  C   . ARG A 1 59  ? -39.520 34.866 8.851   1.00 16.35 ? 88  ARG A C   1 
ATOM   411  O  O   . ARG A 1 59  ? -40.734 35.009 8.876   1.00 15.38 ? 88  ARG A O   1 
ATOM   412  C  CB  . ARG A 1 59  ? -38.156 36.860 9.556   1.00 18.80 ? 88  ARG A CB  1 
ATOM   413  C  CG  . ARG A 1 59  ? -37.781 37.780 10.716  1.00 21.16 ? 88  ARG A CG  1 
ATOM   414  C  CD  . ARG A 1 59  ? -36.953 38.985 10.280  1.00 23.39 ? 88  ARG A CD  1 
ATOM   415  N  NE  . ARG A 1 59  ? -36.437 39.750 11.430  1.00 26.95 ? 88  ARG A NE  1 
ATOM   416  C  CZ  . ARG A 1 59  ? -35.524 40.731 11.367  1.00 26.29 ? 88  ARG A CZ  1 
ATOM   417  N  NH1 . ARG A 1 59  ? -34.896 40.985 10.231  1.00 23.64 ? 88  ARG A NH1 1 
ATOM   418  N  NH2 . ARG A 1 59  ? -35.244 41.456 12.441  1.00 28.37 ? 88  ARG A NH2 1 
ATOM   419  N  N   . ARG A 1 60  ? -38.891 34.175 7.903   1.00 16.32 ? 89  ARG A N   1 
ATOM   420  C  CA  . ARG A 1 60  ? -39.636 33.478 6.819   1.00 17.26 ? 89  ARG A CA  1 
ATOM   421  C  C   . ARG A 1 60  ? -40.553 32.424 7.427   1.00 16.78 ? 89  ARG A C   1 
ATOM   422  O  O   . ARG A 1 60  ? -41.734 32.373 7.099   1.00 16.34 ? 89  ARG A O   1 
ATOM   423  C  CB  . ARG A 1 60  ? -38.688 32.794 5.835   1.00 19.28 ? 89  ARG A CB  1 
ATOM   424  C  CG  . ARG A 1 60  ? -39.359 32.198 4.606   1.00 21.18 ? 89  ARG A CG  1 
ATOM   425  C  CD  . ARG A 1 60  ? -38.317 31.866 3.548   1.00 23.65 ? 89  ARG A CD  1 
ATOM   426  N  NE  . ARG A 1 60  ? -38.861 31.309 2.307   1.00 26.63 ? 89  ARG A NE  1 
ATOM   427  C  CZ  . ARG A 1 60  ? -38.144 31.124 1.201   1.00 25.43 ? 89  ARG A CZ  1 
ATOM   428  N  NH1 . ARG A 1 60  ? -36.934 31.651 1.106   1.00 26.08 ? 89  ARG A NH1 1 
ATOM   429  N  NH2 . ARG A 1 60  ? -38.637 30.412 0.209   1.00 24.73 ? 89  ARG A NH2 1 
ATOM   430  N  N   . ALA A 1 61  ? -39.995 31.607 8.327   1.00 16.16 ? 90  ALA A N   1 
ATOM   431  C  CA  . ALA A 1 61  ? -40.773 30.602 9.100   1.00 15.89 ? 90  ALA A CA  1 
ATOM   432  C  C   . ALA A 1 61  ? -41.901 31.266 9.897   1.00 14.99 ? 90  ALA A C   1 
ATOM   433  O  O   . ALA A 1 61  ? -43.024 30.770 9.920   1.00 15.50 ? 90  ALA A O   1 
ATOM   434  C  CB  . ALA A 1 61  ? -39.861 29.841 10.032  1.00 15.55 ? 90  ALA A CB  1 
ATOM   435  N  N   . ARG A 1 62  ? -41.606 32.371 10.583  1.00 15.96 ? 91  ARG A N   1 
ATOM   436  C  CA  . ARG A 1 62  ? -42.610 33.024 11.444  1.00 16.29 ? 91  ARG A CA  1 
ATOM   437  C  C   . ARG A 1 62  ? -43.768 33.544 10.583  1.00 15.79 ? 91  ARG A C   1 
ATOM   438  O  O   . ARG A 1 62  ? -44.928 33.412 10.979  1.00 15.16 ? 91  ARG A O   1 
ATOM   439  C  CB  . ARG A 1 62  ? -41.987 34.164 12.245  1.00 17.80 ? 91  ARG A CB  1 
ATOM   440  C  CG  . ARG A 1 62  ? -42.861 34.670 13.378  1.00 19.59 ? 91  ARG A CG  1 
ATOM   441  C  CD  . ARG A 1 62  ? -42.417 36.035 13.862  1.00 21.53 ? 91  ARG A CD  1 
ATOM   442  N  NE  . ARG A 1 62  ? -43.132 36.394 15.083  1.00 24.04 ? 91  ARG A NE  1 
ATOM   443  C  CZ  . ARG A 1 62  ? -44.430 36.718 15.138  1.00 26.80 ? 91  ARG A CZ  1 
ATOM   444  N  NH1 . ARG A 1 62  ? -45.123 36.904 14.026  1.00 24.93 ? 91  ARG A NH1 1 
ATOM   445  N  NH2 . ARG A 1 62  ? -45.027 36.873 16.304  1.00 27.67 ? 91  ARG A NH2 1 
ATOM   446  N  N   . ALA A 1 63  ? -43.454 34.111 9.409   1.00 16.23 ? 92  ALA A N   1 
ATOM   447  C  CA  . ALA A 1 63  ? -44.498 34.634 8.471   1.00 17.96 ? 92  ALA A CA  1 
ATOM   448  C  C   . ALA A 1 63  ? -45.427 33.498 7.993   1.00 17.80 ? 92  ALA A C   1 
ATOM   449  O  O   . ALA A 1 63  ? -46.551 33.761 7.600   1.00 17.00 ? 92  ALA A O   1 
ATOM   450  C  CB  . ALA A 1 63  ? -43.827 35.336 7.307   1.00 18.05 ? 92  ALA A CB  1 
ATOM   451  N  N   . ALA A 1 64  ? -44.963 32.244 8.030   1.00 17.13 ? 93  ALA A N   1 
ATOM   452  C  CA  . ALA A 1 64  ? -45.758 31.070 7.621   1.00 17.26 ? 93  ALA A CA  1 
ATOM   453  C  C   . ALA A 1 64  ? -46.508 30.468 8.812   1.00 15.86 ? 93  ALA A C   1 
ATOM   454  O  O   . ALA A 1 64  ? -47.186 29.474 8.653   1.00 15.30 ? 93  ALA A O   1 
ATOM   455  C  CB  . ALA A 1 64  ? -44.837 30.038 7.012   1.00 18.32 ? 93  ALA A CB  1 
ATOM   456  N  N   . GLY A 1 65  ? -46.341 31.035 10.002  1.00 14.34 ? 94  GLY A N   1 
ATOM   457  C  CA  . GLY A 1 65  ? -47.123 30.631 11.165  1.00 14.48 ? 94  GLY A CA  1 
ATOM   458  C  C   . GLY A 1 65  ? -46.265 30.088 12.298  1.00 14.50 ? 94  GLY A C   1 
ATOM   459  O  O   . GLY A 1 65  ? -46.802 29.860 13.394  1.00 13.26 ? 94  GLY A O   1 
ATOM   460  N  N   . VAL A 1 66  ? -44.954 29.838 12.073  1.00 15.97 ? 95  VAL A N   1 
ATOM   461  C  CA  . VAL A 1 66  ? -44.117 29.179 13.130  1.00 15.51 ? 95  VAL A CA  1 
ATOM   462  C  C   . VAL A 1 66  ? -43.901 30.194 14.253  1.00 15.98 ? 95  VAL A C   1 
ATOM   463  O  O   . VAL A 1 66  ? -43.652 31.369 13.968  1.00 17.05 ? 95  VAL A O   1 
ATOM   464  C  CB  . VAL A 1 66  ? -42.761 28.687 12.593  1.00 15.90 ? 95  VAL A CB  1 
ATOM   465  C  CG1 . VAL A 1 66  ? -41.847 28.223 13.731  1.00 15.51 ? 95  VAL A CG1 1 
ATOM   466  C  CG2 . VAL A 1 66  ? -42.922 27.604 11.534  1.00 15.39 ? 95  VAL A CG2 1 
ATOM   467  N  N   . ARG A 1 67  ? -44.009 29.747 15.500  1.00 16.75 ? 96  ARG A N   1 
ATOM   468  C  CA  . ARG A 1 67  ? -43.819 30.621 16.682  1.00 17.63 ? 96  ARG A CA  1 
ATOM   469  C  C   . ARG A 1 67  ? -42.654 30.147 17.564  1.00 16.67 ? 96  ARG A C   1 
ATOM   470  O  O   . ARG A 1 67  ? -42.007 30.972 18.245  1.00 15.91 ? 96  ARG A O   1 
ATOM   471  C  CB  . ARG A 1 67  ? -45.109 30.666 17.506  1.00 18.39 ? 96  ARG A CB  1 
ATOM   472  C  CG  . ARG A 1 67  ? -46.247 31.398 16.814  1.00 21.62 ? 96  ARG A CG  1 
ATOM   473  C  CD  . ARG A 1 67  ? -45.843 32.830 16.490  1.00 22.32 ? 96  ARG A CD  1 
ATOM   474  N  NE  . ARG A 1 67  ? -46.903 33.522 15.791  1.00 23.60 ? 96  ARG A NE  1 
ATOM   475  C  CZ  . ARG A 1 67  ? -46.950 33.714 14.474  1.00 23.91 ? 96  ARG A CZ  1 
ATOM   476  N  NH1 . ARG A 1 67  ? -46.022 33.198 13.671  1.00 21.30 ? 96  ARG A NH1 1 
ATOM   477  N  NH2 . ARG A 1 67  ? -47.952 34.422 13.983  1.00 22.33 ? 96  ARG A NH2 1 
ATOM   478  N  N   . THR A 1 68  ? -42.385 28.844 17.552  1.00 15.65 ? 97  THR A N   1 
ATOM   479  C  CA  . THR A 1 68  ? -41.311 28.253 18.364  1.00 15.33 ? 97  THR A CA  1 
ATOM   480  C  C   . THR A 1 68  ? -40.575 27.189 17.547  1.00 14.12 ? 97  THR A C   1 
ATOM   481  O  O   . THR A 1 68  ? -41.204 26.486 16.761  1.00 12.56 ? 97  THR A O   1 
ATOM   482  C  CB  . THR A 1 68  ? -41.881 27.570 19.612  1.00 15.95 ? 97  THR A CB  1 
ATOM   483  O  OG1 . THR A 1 68  ? -42.540 28.512 20.461  1.00 17.27 ? 97  THR A OG1 1 
ATOM   484  C  CG2 . THR A 1 68  ? -40.808 26.858 20.401  1.00 16.56 ? 97  THR A CG2 1 
ATOM   485  N  N   . ILE A 1 69  ? -39.255 27.124 17.705  1.00 13.48 ? 98  ILE A N   1 
ATOM   486  C  CA  . ILE A 1 69  ? -38.449 25.968 17.283  1.00 13.00 ? 98  ILE A CA  1 
ATOM   487  C  C   . ILE A 1 69  ? -37.658 25.485 18.498  1.00 12.91 ? 98  ILE A C   1 
ATOM   488  O  O   . ILE A 1 69  ? -37.315 26.221 19.450  1.00 12.49 ? 98  ILE A O   1 
ATOM   489  C  CB  . ILE A 1 69  ? -37.528 26.267 16.081  1.00 13.05 ? 98  ILE A CB  1 
ATOM   490  C  CG1 . ILE A 1 69  ? -36.278 27.077 16.452  1.00 13.87 ? 98  ILE A CG1 1 
ATOM   491  C  CG2 . ILE A 1 69  ? -38.321 26.965 15.001  1.00 13.59 ? 98  ILE A CG2 1 
ATOM   492  C  CD1 . ILE A 1 69  ? -35.155 26.983 15.459  1.00 13.51 ? 98  ILE A CD1 1 
ATOM   493  N  N   . VAL A 1 70  ? -37.399 24.202 18.437  1.00 13.20 ? 99  VAL A N   1 
ATOM   494  C  CA  . VAL A 1 70  ? -36.577 23.543 19.379  1.00 12.45 ? 99  VAL A CA  1 
ATOM   495  C  C   . VAL A 1 70  ? -35.266 23.157 18.682  1.00 12.61 ? 99  VAL A C   1 
ATOM   496  O  O   . VAL A 1 70  ? -35.253 22.311 17.772  1.00 12.83 ? 99  VAL A O   1 
ATOM   497  C  CB  . VAL A 1 70  ? -37.299 22.296 19.901  1.00 13.00 ? 99  VAL A CB  1 
ATOM   498  C  CG1 . VAL A 1 70  ? -36.379 21.539 20.855  1.00 13.26 ? 99  VAL A CG1 1 
ATOM   499  C  CG2 . VAL A 1 70  ? -38.653 22.640 20.518  1.00 13.16 ? 99  VAL A CG2 1 
ATOM   500  N  N   . ASP A 1 71  ? -34.196 23.834 19.053  1.00 11.79 ? 100 ASP A N   1 
ATOM   501  C  CA  . ASP A 1 71  ? -32.882 23.571 18.515  1.00 12.27 ? 100 ASP A CA  1 
ATOM   502  C  C   . ASP A 1 71  ? -32.274 22.373 19.246  1.00 12.35 ? 100 ASP A C   1 
ATOM   503  O  O   . ASP A 1 71  ? -31.942 22.468 20.426  1.00 13.20 ? 100 ASP A O   1 
ATOM   504  C  CB  . ASP A 1 71  ? -32.002 24.801 18.668  1.00 12.68 ? 100 ASP A CB  1 
ATOM   505  C  CG  . ASP A 1 71  ? -30.693 24.681 17.920  1.00 12.81 ? 100 ASP A CG  1 
ATOM   506  O  OD1 . ASP A 1 71  ? -30.156 23.538 17.871  1.00 13.20 ? 100 ASP A OD1 1 
ATOM   507  O  OD2 . ASP A 1 71  ? -30.219 25.728 17.411  1.00 13.18 ? 100 ASP A OD2 1 
ATOM   508  N  N   . VAL A 1 72  ? -32.166 21.250 18.560  1.00 11.63 ? 101 VAL A N   1 
ATOM   509  C  CA  . VAL A 1 72  ? -31.712 20.009 19.216  1.00 12.07 ? 101 VAL A CA  1 
ATOM   510  C  C   . VAL A 1 72  ? -30.202 19.831 18.973  1.00 11.75 ? 101 VAL A C   1 
ATOM   511  O  O   . VAL A 1 72  ? -29.699 18.679 18.884  1.00 11.33 ? 101 VAL A O   1 
ATOM   512  C  CB  . VAL A 1 72  ? -32.542 18.783 18.757  1.00 12.24 ? 101 VAL A CB  1 
ATOM   513  C  CG1 . VAL A 1 72  ? -33.995 18.866 19.241  1.00 12.56 ? 101 VAL A CG1 1 
ATOM   514  C  CG2 . VAL A 1 72  ? -32.500 18.578 17.251  1.00 11.63 ? 101 VAL A CG2 1 
ATOM   515  N  N   . SER A 1 73  ? -29.504 20.967 18.777  1.00 11.64 ? 102 SER A N   1 
ATOM   516  C  CA  . SER A 1 73  ? -28.055 21.019 18.751  1.00 12.09 ? 102 SER A CA  1 
ATOM   517  C  C   . SER A 1 73  ? -27.502 20.889 20.179  1.00 12.66 ? 102 SER A C   1 
ATOM   518  O  O   . SER A 1 73  ? -27.735 21.760 21.032  1.00 13.45 ? 102 SER A O   1 
ATOM   519  C  CB  . SER A 1 73  ? -27.581 22.291 18.165  1.00 12.34 ? 102 SER A CB  1 
ATOM   520  O  OG  . SER A 1 73  ? -28.112 22.480 16.879  1.00 13.03 ? 102 SER A OG  1 
ATOM   521  N  N   . THR A 1 74  ? -26.769 19.817 20.414  1.00 12.45 ? 103 THR A N   1 
ATOM   522  C  CA  . THR A 1 74  ? -26.099 19.544 21.681  1.00 12.35 ? 103 THR A CA  1 
ATOM   523  C  C   . THR A 1 74  ? -24.754 20.265 21.728  1.00 13.21 ? 103 THR A C   1 
ATOM   524  O  O   . THR A 1 74  ? -24.319 20.854 20.750  1.00 12.62 ? 103 THR A O   1 
ATOM   525  C  CB  . THR A 1 74  ? -25.807 18.048 21.801  1.00 12.31 ? 103 THR A CB  1 
ATOM   526  O  OG1 . THR A 1 74  ? -25.246 17.706 20.522  1.00 11.95 ? 103 THR A OG1 1 
ATOM   527  C  CG2 . THR A 1 74  ? -27.034 17.230 22.140  1.00 12.38 ? 103 THR A CG2 1 
ATOM   528  N  N   . PHE A 1 75  ? -24.094 20.134 22.884  1.00 13.91 ? 104 PHE A N   1 
ATOM   529  C  CA  . PHE A 1 75  ? -22.691 20.457 23.073  1.00 14.38 ? 104 PHE A CA  1 
ATOM   530  C  C   . PHE A 1 75  ? -21.826 20.031 21.873  1.00 13.24 ? 104 PHE A C   1 
ATOM   531  O  O   . PHE A 1 75  ? -21.140 20.847 21.311  1.00 12.60 ? 104 PHE A O   1 
ATOM   532  C  CB  . PHE A 1 75  ? -22.173 19.755 24.332  1.00 15.19 ? 104 PHE A CB  1 
ATOM   533  C  CG  . PHE A 1 75  ? -20.680 19.877 24.470  1.00 15.82 ? 104 PHE A CG  1 
ATOM   534  C  CD1 . PHE A 1 75  ? -20.124 21.046 24.940  1.00 16.02 ? 104 PHE A CD1 1 
ATOM   535  C  CD2 . PHE A 1 75  ? -19.850 18.840 24.107  1.00 16.61 ? 104 PHE A CD2 1 
ATOM   536  C  CE1 . PHE A 1 75  ? -18.747 21.175 25.046  1.00 17.48 ? 104 PHE A CE1 1 
ATOM   537  C  CE2 . PHE A 1 75  ? -18.473 18.968 24.212  1.00 17.55 ? 104 PHE A CE2 1 
ATOM   538  C  CZ  . PHE A 1 75  ? -17.925 20.137 24.695  1.00 16.87 ? 104 PHE A CZ  1 
ATOM   539  N  N   . ASP A 1 76  ? -21.875 18.753 21.492  1.00 13.80 ? 105 ASP A N   1 
ATOM   540  C  CA  . ASP A 1 76  ? -20.958 18.228 20.501  1.00 13.80 ? 105 ASP A CA  1 
ATOM   541  C  C   . ASP A 1 76  ? -21.445 18.570 19.088  1.00 13.50 ? 105 ASP A C   1 
ATOM   542  O  O   . ASP A 1 76  ? -20.746 18.294 18.106  1.00 13.70 ? 105 ASP A O   1 
ATOM   543  C  CB  . ASP A 1 76  ? -20.740 16.721 20.664  1.00 14.24 ? 105 ASP A CB  1 
ATOM   544  C  CG  . ASP A 1 76  ? -22.013 15.905 20.537  1.00 15.07 ? 105 ASP A CG  1 
ATOM   545  O  OD1 . ASP A 1 76  ? -23.014 16.274 21.218  1.00 14.76 ? 105 ASP A OD1 1 
ATOM   546  O  OD2 . ASP A 1 76  ? -22.011 14.944 19.712  1.00 14.92 ? 105 ASP A OD2 1 
ATOM   547  N  N   . LEU A 1 77  ? -22.612 19.177 18.968  1.00 13.96 ? 106 LEU A N   1 
ATOM   548  C  CA  . LEU A 1 77  ? -23.063 19.759 17.705  1.00 13.74 ? 106 LEU A CA  1 
ATOM   549  C  C   . LEU A 1 77  ? -22.732 21.259 17.704  1.00 13.20 ? 106 LEU A C   1 
ATOM   550  O  O   . LEU A 1 77  ? -23.183 21.958 16.837  1.00 13.43 ? 106 LEU A O   1 
ATOM   551  C  CB  . LEU A 1 77  ? -24.560 19.512 17.504  1.00 13.97 ? 106 LEU A CB  1 
ATOM   552  C  CG  . LEU A 1 77  ? -24.944 18.286 16.676  1.00 14.54 ? 106 LEU A CG  1 
ATOM   553  C  CD1 . LEU A 1 77  ? -26.439 18.030 16.802  1.00 14.12 ? 106 LEU A CD1 1 
ATOM   554  C  CD2 . LEU A 1 77  ? -24.566 18.452 15.203  1.00 14.57 ? 106 LEU A CD2 1 
ATOM   555  N  N   . GLY A 1 78  ? -21.931 21.742 18.649  1.00 12.77 ? 107 GLY A N   1 
ATOM   556  C  CA  . GLY A 1 78  ? -21.444 23.121 18.605  1.00 12.00 ? 107 GLY A CA  1 
ATOM   557  C  C   . GLY A 1 78  ? -22.544 24.128 18.861  1.00 13.21 ? 107 GLY A C   1 
ATOM   558  O  O   . GLY A 1 78  ? -22.475 25.242 18.362  1.00 12.29 ? 107 GLY A O   1 
ATOM   559  N  N   . ARG A 1 79  ? -23.573 23.734 19.616  1.00 13.01 ? 108 ARG A N   1 
ATOM   560  C  CA  . ARG A 1 79  ? -24.604 24.667 20.092  1.00 13.92 ? 108 ARG A CA  1 
ATOM   561  C  C   . ARG A 1 79  ? -23.949 25.944 20.658  1.00 14.34 ? 108 ARG A C   1 
ATOM   562  O  O   . ARG A 1 79  ? -23.067 25.877 21.526  1.00 14.79 ? 108 ARG A O   1 
ATOM   563  C  CB  . ARG A 1 79  ? -25.434 23.928 21.144  1.00 14.24 ? 108 ARG A CB  1 
ATOM   564  C  CG  . ARG A 1 79  ? -26.316 24.796 22.037  1.00 14.93 ? 108 ARG A CG  1 
ATOM   565  C  CD  . ARG A 1 79  ? -26.585 24.098 23.369  1.00 14.62 ? 108 ARG A CD  1 
ATOM   566  N  NE  . ARG A 1 79  ? -25.374 24.111 24.175  1.00 15.25 ? 108 ARG A NE  1 
ATOM   567  C  CZ  . ARG A 1 79  ? -25.131 23.345 25.235  1.00 14.51 ? 108 ARG A CZ  1 
ATOM   568  N  NH1 . ARG A 1 79  ? -26.063 22.513 25.678  1.00 13.23 ? 108 ARG A NH1 1 
ATOM   569  N  NH2 . ARG A 1 79  ? -23.960 23.460 25.856  1.00 13.20 ? 108 ARG A NH2 1 
ATOM   570  N  N   . ASP A 1 80  ? -24.367 27.094 20.167  1.00 14.30 ? 109 ASP A N   1 
ATOM   571  C  CA  . ASP A 1 80  ? -23.883 28.378 20.671  1.00 15.25 ? 109 ASP A CA  1 
ATOM   572  C  C   . ASP A 1 80  ? -25.121 29.134 21.156  1.00 15.58 ? 109 ASP A C   1 
ATOM   573  O  O   . ASP A 1 80  ? -25.846 29.710 20.332  1.00 14.10 ? 109 ASP A O   1 
ATOM   574  C  CB  . ASP A 1 80  ? -23.082 29.120 19.584  1.00 16.02 ? 109 ASP A CB  1 
ATOM   575  C  CG  . ASP A 1 80  ? -22.443 30.442 19.993  1.00 15.62 ? 109 ASP A CG  1 
ATOM   576  O  OD1 . ASP A 1 80  ? -23.086 31.162 20.753  1.00 17.62 ? 109 ASP A OD1 1 
ATOM   577  O  OD2 . ASP A 1 80  ? -21.311 30.751 19.524  1.00 14.96 ? 109 ASP A OD2 1 
ATOM   578  N  N   . VAL A 1 81  ? -25.393 29.107 22.462  1.00 16.09 ? 110 VAL A N   1 
ATOM   579  C  CA  . VAL A 1 81  ? -26.680 29.641 22.960  1.00 17.14 ? 110 VAL A CA  1 
ATOM   580  C  C   . VAL A 1 81  ? -26.738 31.165 22.808  1.00 18.57 ? 110 VAL A C   1 
ATOM   581  O  O   . VAL A 1 81  ? -27.854 31.727 22.816  1.00 17.96 ? 110 VAL A O   1 
ATOM   582  C  CB  . VAL A 1 81  ? -27.023 29.260 24.412  1.00 19.00 ? 110 VAL A CB  1 
ATOM   583  C  CG1 . VAL A 1 81  ? -27.628 27.877 24.497  1.00 20.41 ? 110 VAL A CG1 1 
ATOM   584  C  CG2 . VAL A 1 81  ? -25.862 29.414 25.372  1.00 18.59 ? 110 VAL A CG2 1 
ATOM   585  N  N   . GLU A 1 82  ? -25.590 31.838 22.715  1.00 18.01 ? 111 GLU A N   1 
ATOM   586  C  CA  . GLU A 1 82  ? -25.614 33.277 22.508  1.00 20.81 ? 111 GLU A CA  1 
ATOM   587  C  C   . GLU A 1 82  ? -26.116 33.582 21.088  1.00 17.88 ? 111 GLU A C   1 
ATOM   588  O  O   . GLU A 1 82  ? -26.873 34.518 20.882  1.00 16.25 ? 111 GLU A O   1 
ATOM   589  C  CB  . GLU A 1 82  ? -24.231 33.859 22.799  1.00 25.07 ? 111 GLU A CB  1 
ATOM   590  C  CG  . GLU A 1 82  ? -23.906 33.820 24.289  1.00 31.02 ? 111 GLU A CG  1 
ATOM   591  C  CD  . GLU A 1 82  ? -22.438 33.885 24.658  1.00 36.07 ? 111 GLU A CD  1 
ATOM   592  O  OE1 . GLU A 1 82  ? -21.629 33.250 23.962  1.00 41.65 ? 111 GLU A OE1 1 
ATOM   593  O  OE2 . GLU A 1 82  ? -22.118 34.554 25.663  1.00 43.63 ? 111 GLU A OE2 1 
ATOM   594  N  N   . LEU A 1 83  ? -25.691 32.783 20.120  1.00 15.55 ? 112 LEU A N   1 
ATOM   595  C  CA  . LEU A 1 83  ? -26.224 32.942 18.767  1.00 15.47 ? 112 LEU A CA  1 
ATOM   596  C  C   . LEU A 1 83  ? -27.729 32.664 18.792  1.00 15.50 ? 112 LEU A C   1 
ATOM   597  O  O   . LEU A 1 83  ? -28.523 33.416 18.170  1.00 14.78 ? 112 LEU A O   1 
ATOM   598  C  CB  . LEU A 1 83  ? -25.488 32.020 17.781  1.00 15.20 ? 112 LEU A CB  1 
ATOM   599  C  CG  . LEU A 1 83  ? -26.008 32.075 16.341  1.00 14.84 ? 112 LEU A CG  1 
ATOM   600  C  CD1 . LEU A 1 83  ? -25.687 33.400 15.682  1.00 15.29 ? 112 LEU A CD1 1 
ATOM   601  C  CD2 . LEU A 1 83  ? -25.471 30.922 15.526  1.00 14.68 ? 112 LEU A CD2 1 
ATOM   602  N  N   . LEU A 1 84  ? -28.129 31.596 19.483  1.00 15.04 ? 113 LEU A N   1 
ATOM   603  C  CA  . LEU A 1 84  ? -29.555 31.240 19.583  1.00 16.24 ? 113 LEU A CA  1 
ATOM   604  C  C   . LEU A 1 84  ? -30.353 32.393 20.220  1.00 16.07 ? 113 LEU A C   1 
ATOM   605  O  O   . LEU A 1 84  ? -31.371 32.801 19.685  1.00 15.67 ? 113 LEU A O   1 
ATOM   606  C  CB  . LEU A 1 84  ? -29.706 29.955 20.399  1.00 16.30 ? 113 LEU A CB  1 
ATOM   607  C  CG  . LEU A 1 84  ? -29.768 28.675 19.579  1.00 17.14 ? 113 LEU A CG  1 
ATOM   608  C  CD1 . LEU A 1 84  ? -28.574 28.549 18.646  1.00 18.29 ? 113 LEU A CD1 1 
ATOM   609  C  CD2 . LEU A 1 84  ? -29.859 27.481 20.508  1.00 18.51 ? 113 LEU A CD2 1 
ATOM   610  N  N   . ALA A 1 85  ? -29.892 32.934 21.350  1.00 16.32 ? 114 ALA A N   1 
ATOM   611  C  CA  . ALA A 1 85  ? -30.566 34.136 21.973  1.00 16.99 ? 114 ALA A CA  1 
ATOM   612  C  C   . ALA A 1 85  ? -30.693 35.322 20.999  1.00 15.87 ? 114 ALA A C   1 
ATOM   613  O  O   . ALA A 1 85  ? -31.749 35.949 20.915  1.00 15.65 ? 114 ALA A O   1 
ATOM   614  C  CB  . ALA A 1 85  ? -29.826 34.567 23.225  1.00 16.71 ? 114 ALA A CB  1 
ATOM   615  N  N   . GLU A 1 86  ? -29.605 35.637 20.300  1.00 17.27 ? 115 GLU A N   1 
ATOM   616  C  CA  . GLU A 1 86  ? -29.531 36.762 19.349  1.00 16.45 ? 115 GLU A CA  1 
ATOM   617  C  C   . GLU A 1 86  ? -30.595 36.610 18.253  1.00 16.28 ? 115 GLU A C   1 
ATOM   618  O  O   . GLU A 1 86  ? -31.394 37.524 18.030  1.00 14.90 ? 115 GLU A O   1 
ATOM   619  C  CB  . GLU A 1 86  ? -28.145 36.823 18.715  1.00 17.01 ? 115 GLU A CB  1 
ATOM   620  C  CG  . GLU A 1 86  ? -28.000 37.922 17.681  1.00 18.22 ? 115 GLU A CG  1 
ATOM   621  C  CD  . GLU A 1 86  ? -26.651 37.986 16.984  1.00 18.81 ? 115 GLU A CD  1 
ATOM   622  O  OE1 . GLU A 1 86  ? -25.671 37.419 17.507  1.00 20.73 ? 115 GLU A OE1 1 
ATOM   623  O  OE2 . GLU A 1 86  ? -26.577 38.574 15.908  1.00 19.52 ? 115 GLU A OE2 1 
ATOM   624  N  N   . VAL A 1 87  ? -30.642 35.443 17.598  1.00 15.49 ? 116 VAL A N   1 
ATOM   625  C  CA  . VAL A 1 87  ? -31.538 35.269 16.447  1.00 15.51 ? 116 VAL A CA  1 
ATOM   626  C  C   . VAL A 1 87  ? -32.981 35.051 16.909  1.00 15.56 ? 116 VAL A C   1 
ATOM   627  O  O   . VAL A 1 87  ? -33.886 35.507 16.212  1.00 14.39 ? 116 VAL A O   1 
ATOM   628  C  CB  . VAL A 1 87  ? -31.067 34.154 15.499  1.00 15.84 ? 116 VAL A CB  1 
ATOM   629  C  CG1 . VAL A 1 87  ? -29.677 34.483 14.957  1.00 15.68 ? 116 VAL A CG1 1 
ATOM   630  C  CG2 . VAL A 1 87  ? -31.108 32.779 16.139  1.00 15.24 ? 116 VAL A CG2 1 
ATOM   631  N  N   . SER A 1 88  ? -33.178 34.400 18.070  1.00 15.83 ? 117 SER A N   1 
ATOM   632  C  CA  . SER A 1 88  ? -34.514 34.242 18.625  1.00 16.43 ? 117 SER A CA  1 
ATOM   633  C  C   . SER A 1 88  ? -35.158 35.625 18.767  1.00 16.99 ? 117 SER A C   1 
ATOM   634  O  O   . SER A 1 88  ? -36.278 35.843 18.305  1.00 16.87 ? 117 SER A O   1 
ATOM   635  C  CB  . SER A 1 88  ? -34.509 33.499 19.946  1.00 15.54 ? 117 SER A CB  1 
ATOM   636  O  OG  . SER A 1 88  ? -35.754 33.660 20.640  1.00 15.88 ? 117 SER A OG  1 
ATOM   637  N  N   . GLU A 1 89  ? -34.389 36.542 19.358  1.00 18.33 ? 118 GLU A N   1 
ATOM   638  C  CA  . GLU A 1 89  ? -34.874 37.862 19.701  1.00 20.85 ? 118 GLU A CA  1 
ATOM   639  C  C   . GLU A 1 89  ? -35.095 38.692 18.434  1.00 20.12 ? 118 GLU A C   1 
ATOM   640  O  O   . GLU A 1 89  ? -36.122 39.314 18.295  1.00 20.33 ? 118 GLU A O   1 
ATOM   641  C  CB  . GLU A 1 89  ? -33.905 38.608 20.621  1.00 22.99 ? 118 GLU A CB  1 
ATOM   642  C  CG  . GLU A 1 89  ? -34.519 39.900 21.136  1.00 27.35 ? 118 GLU A CG  1 
ATOM   643  C  CD  . GLU A 1 89  ? -33.654 40.691 22.100  1.00 30.51 ? 118 GLU A CD  1 
ATOM   644  O  OE1 . GLU A 1 89  ? -32.760 40.095 22.726  1.00 33.90 ? 118 GLU A OE1 1 
ATOM   645  O  OE2 . GLU A 1 89  ? -33.873 41.909 22.203  1.00 37.11 ? 118 GLU A OE2 1 
ATOM   646  N  N   . ALA A 1 90  ? -34.142 38.706 17.511  1.00 20.08 ? 119 ALA A N   1 
ATOM   647  C  CA  . ALA A 1 90  ? -34.284 39.537 16.291  1.00 18.81 ? 119 ALA A CA  1 
ATOM   648  C  C   . ALA A 1 90  ? -35.447 39.033 15.410  1.00 18.29 ? 119 ALA A C   1 
ATOM   649  O  O   . ALA A 1 90  ? -36.145 39.842 14.782  1.00 16.98 ? 119 ALA A O   1 
ATOM   650  C  CB  . ALA A 1 90  ? -32.971 39.546 15.543  1.00 19.66 ? 119 ALA A CB  1 
ATOM   651  N  N   . ALA A 1 91  ? -35.692 37.711 15.358  1.00 17.87 ? 120 ALA A N   1 
ATOM   652  C  CA  . ALA A 1 91  ? -36.772 37.140 14.483  1.00 17.25 ? 120 ALA A CA  1 
ATOM   653  C  C   . ALA A 1 91  ? -38.102 37.026 15.236  1.00 16.55 ? 120 ALA A C   1 
ATOM   654  O  O   . ALA A 1 91  ? -39.134 36.847 14.623  1.00 15.46 ? 120 ALA A O   1 
ATOM   655  C  CB  . ALA A 1 91  ? -36.323 35.815 13.919  1.00 17.39 ? 120 ALA A CB  1 
ATOM   656  N  N   . ASP A 1 92  ? -38.083 37.163 16.564  1.00 17.40 ? 121 ASP A N   1 
ATOM   657  C  CA  . ASP A 1 92  ? -39.271 37.044 17.406  1.00 18.24 ? 121 ASP A CA  1 
ATOM   658  C  C   . ASP A 1 92  ? -39.894 35.652 17.241  1.00 17.74 ? 121 ASP A C   1 
ATOM   659  O  O   . ASP A 1 92  ? -41.108 35.491 17.020  1.00 19.11 ? 121 ASP A O   1 
ATOM   660  C  CB  . ASP A 1 92  ? -40.271 38.167 17.131  1.00 20.91 ? 121 ASP A CB  1 
ATOM   661  C  CG  . ASP A 1 92  ? -41.507 38.018 17.989  1.00 22.59 ? 121 ASP A CG  1 
ATOM   662  O  OD1 . ASP A 1 92  ? -41.349 37.576 19.148  1.00 24.16 ? 121 ASP A OD1 1 
ATOM   663  O  OD2 . ASP A 1 92  ? -42.618 38.300 17.481  1.00 27.99 ? 121 ASP A OD2 1 
ATOM   664  N  N   . VAL A 1 93  ? -39.028 34.643 17.332  1.00 17.51 ? 122 VAL A N   1 
ATOM   665  C  CA  . VAL A 1 93  ? -39.397 33.229 17.347  1.00 15.34 ? 122 VAL A CA  1 
ATOM   666  C  C   . VAL A 1 93  ? -38.710 32.631 18.570  1.00 15.20 ? 122 VAL A C   1 
ATOM   667  O  O   . VAL A 1 93  ? -37.486 32.752 18.690  1.00 16.64 ? 122 VAL A O   1 
ATOM   668  C  CB  . VAL A 1 93  ? -38.958 32.521 16.049  1.00 15.15 ? 122 VAL A CB  1 
ATOM   669  C  CG1 . VAL A 1 93  ? -39.096 30.997 16.121  1.00 14.98 ? 122 VAL A CG1 1 
ATOM   670  C  CG2 . VAL A 1 93  ? -39.704 33.064 14.832  1.00 15.33 ? 122 VAL A CG2 1 
ATOM   671  N  N   . HIS A 1 94  ? -39.484 32.042 19.470  1.00 14.20 ? 123 HIS A N   1 
ATOM   672  C  CA  . HIS A 1 94  ? -38.921 31.340 20.617  1.00 14.43 ? 123 HIS A CA  1 
ATOM   673  C  C   . HIS A 1 94  ? -38.009 30.204 20.140  1.00 13.51 ? 123 HIS A C   1 
ATOM   674  O  O   . HIS A 1 94  ? -38.363 29.496 19.158  1.00 12.84 ? 123 HIS A O   1 
ATOM   675  C  CB  . HIS A 1 94  ? -40.031 30.721 21.470  1.00 16.18 ? 123 HIS A CB  1 
ATOM   676  C  CG  . HIS A 1 94  ? -41.077 31.693 21.918  1.00 17.65 ? 123 HIS A CG  1 
ATOM   677  N  ND1 . HIS A 1 94  ? -40.785 32.775 22.728  1.00 19.04 ? 123 HIS A ND1 1 
ATOM   678  C  CD2 . HIS A 1 94  ? -42.403 31.755 21.669  1.00 19.36 ? 123 HIS A CD2 1 
ATOM   679  C  CE1 . HIS A 1 94  ? -41.897 33.455 22.972  1.00 18.92 ? 123 HIS A CE1 1 
ATOM   680  N  NE2 . HIS A 1 94  ? -42.900 32.859 22.320  1.00 19.40 ? 123 HIS A NE2 1 
ATOM   681  N  N   . ILE A 1 95  ? -36.919 29.981 20.876  1.00 13.30 ? 124 ILE A N   1 
ATOM   682  C  CA  . ILE A 1 95  ? -36.022 28.829 20.664  1.00 12.85 ? 124 ILE A CA  1 
ATOM   683  C  C   . ILE A 1 95  ? -35.802 28.087 21.983  1.00 13.20 ? 124 ILE A C   1 
ATOM   684  O  O   . ILE A 1 95  ? -35.369 28.658 22.990  1.00 13.30 ? 124 ILE A O   1 
ATOM   685  C  CB  . ILE A 1 95  ? -34.685 29.254 20.018  1.00 13.12 ? 124 ILE A CB  1 
ATOM   686  C  CG1 . ILE A 1 95  ? -34.927 29.967 18.683  1.00 12.92 ? 124 ILE A CG1 1 
ATOM   687  C  CG2 . ILE A 1 95  ? -33.760 28.039 19.883  1.00 13.01 ? 124 ILE A CG2 1 
ATOM   688  C  CD1 . ILE A 1 95  ? -33.693 30.415 17.945  1.00 13.86 ? 124 ILE A CD1 1 
ATOM   689  N  N   . VAL A 1 96  ? -36.097 26.801 21.959  1.00 13.31 ? 125 VAL A N   1 
ATOM   690  C  CA  . VAL A 1 96  ? -35.797 25.928 23.088  1.00 13.94 ? 125 VAL A CA  1 
ATOM   691  C  C   . VAL A 1 96  ? -34.419 25.327 22.828  1.00 14.55 ? 125 VAL A C   1 
ATOM   692  O  O   . VAL A 1 96  ? -34.196 24.811 21.730  1.00 14.53 ? 125 VAL A O   1 
ATOM   693  C  CB  . VAL A 1 96  ? -36.876 24.833 23.249  1.00 13.81 ? 125 VAL A CB  1 
ATOM   694  C  CG1 . VAL A 1 96  ? -36.561 23.864 24.389  1.00 13.59 ? 125 VAL A CG1 1 
ATOM   695  C  CG2 . VAL A 1 96  ? -38.240 25.457 23.438  1.00 13.77 ? 125 VAL A CG2 1 
ATOM   696  N  N   . ALA A 1 97  ? -33.524 25.411 23.812  1.00 14.91 ? 126 ALA A N   1 
ATOM   697  C  CA  . ALA A 1 97  ? -32.189 24.862 23.696  1.00 15.20 ? 126 ALA A CA  1 
ATOM   698  C  C   . ALA A 1 97  ? -32.179 23.449 24.268  1.00 14.64 ? 126 ALA A C   1 
ATOM   699  O  O   . ALA A 1 97  ? -33.054 23.078 25.088  1.00 15.15 ? 126 ALA A O   1 
ATOM   700  C  CB  . ALA A 1 97  ? -31.197 25.738 24.407  1.00 15.51 ? 126 ALA A CB  1 
ATOM   701  N  N   . ALA A 1 98  ? -31.184 22.689 23.823  1.00 13.66 ? 127 ALA A N   1 
ATOM   702  C  CA  . ALA A 1 98  ? -31.051 21.262 24.188  1.00 13.88 ? 127 ALA A CA  1 
ATOM   703  C  C   . ALA A 1 98  ? -29.792 21.041 25.028  1.00 14.22 ? 127 ALA A C   1 
ATOM   704  O  O   . ALA A 1 98  ? -28.792 21.735 24.837  1.00 15.58 ? 127 ALA A O   1 
ATOM   705  C  CB  . ALA A 1 98  ? -30.979 20.410 22.947  1.00 13.33 ? 127 ALA A CB  1 
ATOM   706  N  N   . THR A 1 99  ? -29.847 20.042 25.900  1.00 13.73 ? 128 THR A N   1 
ATOM   707  C  CA  . THR A 1 99  ? -28.654 19.409 26.452  1.00 12.47 ? 128 THR A CA  1 
ATOM   708  C  C   . THR A 1 99  ? -28.582 18.000 25.864  1.00 11.80 ? 128 THR A C   1 
ATOM   709  O  O   . THR A 1 99  ? -29.310 17.678 24.905  1.00 11.58 ? 128 THR A O   1 
ATOM   710  C  CB  . THR A 1 99  ? -28.669 19.392 27.987  1.00 13.24 ? 128 THR A CB  1 
ATOM   711  O  OG1 . THR A 1 99  ? -27.406 18.977 28.515  1.00 12.64 ? 128 THR A OG1 1 
ATOM   712  C  CG2 . THR A 1 99  ? -29.694 18.445 28.576  1.00 13.64 ? 128 THR A CG2 1 
ATOM   713  N  N   . GLY A 1 100 ? -27.726 17.165 26.423  1.00 11.43 ? 129 GLY A N   1 
ATOM   714  C  CA  . GLY A 1 100 ? -27.500 15.849 25.876  1.00 11.81 ? 129 GLY A CA  1 
ATOM   715  C  C   . GLY A 1 100 ? -26.241 15.750 25.025  1.00 11.78 ? 129 GLY A C   1 
ATOM   716  O  O   . GLY A 1 100 ? -25.409 16.638 25.067  1.00 12.14 ? 129 GLY A O   1 
ATOM   717  N  N   . LEU A 1 101 ? -26.111 14.632 24.292  1.00 11.29 ? 130 LEU A N   1 
ATOM   718  C  CA  . LEU A 1 101 ? -24.973 14.376 23.355  1.00 12.08 ? 130 LEU A CA  1 
ATOM   719  C  C   . LEU A 1 101 ? -25.473 13.690 22.079  1.00 12.12 ? 130 LEU A C   1 
ATOM   720  O  O   . LEU A 1 101 ? -26.297 12.779 22.111  1.00 11.40 ? 130 LEU A O   1 
ATOM   721  C  CB  . LEU A 1 101 ? -23.885 13.523 24.020  1.00 11.99 ? 130 LEU A CB  1 
ATOM   722  C  CG  . LEU A 1 101 ? -23.093 14.223 25.136  1.00 11.66 ? 130 LEU A CG  1 
ATOM   723  C  CD1 . LEU A 1 101 ? -22.097 13.283 25.748  1.00 12.24 ? 130 LEU A CD1 1 
ATOM   724  C  CD2 . LEU A 1 101 ? -22.389 15.491 24.659  1.00 12.07 ? 130 LEU A CD2 1 
ATOM   725  N  N   . TRP A 1 102 ? -24.924 14.171 20.963  1.00 12.79 ? 131 TRP A N   1 
ATOM   726  C  CA  . TRP A 1 102 ? -25.177 13.675 19.634  1.00 12.72 ? 131 TRP A CA  1 
ATOM   727  C  C   . TRP A 1 102 ? -24.120 12.590 19.393  1.00 14.54 ? 131 TRP A C   1 
ATOM   728  O  O   . TRP A 1 102 ? -23.613 12.077 20.408  1.00 13.92 ? 131 TRP A O   1 
ATOM   729  C  CB  . TRP A 1 102 ? -25.128 14.882 18.691  1.00 12.85 ? 131 TRP A CB  1 
ATOM   730  C  CG  . TRP A 1 102 ? -25.368 14.651 17.228  1.00 12.91 ? 131 TRP A CG  1 
ATOM   731  C  CD1 . TRP A 1 102 ? -26.537 14.276 16.634  1.00 12.66 ? 131 TRP A CD1 1 
ATOM   732  C  CD2 . TRP A 1 102 ? -24.444 14.916 16.156  1.00 12.12 ? 131 TRP A CD2 1 
ATOM   733  N  NE1 . TRP A 1 102 ? -26.392 14.257 15.276  1.00 12.50 ? 131 TRP A NE1 1 
ATOM   734  C  CE2 . TRP A 1 102 ? -25.125 14.664 14.952  1.00 12.37 ? 131 TRP A CE2 1 
ATOM   735  C  CE3 . TRP A 1 102 ? -23.108 15.319 16.097  1.00 11.95 ? 131 TRP A CE3 1 
ATOM   736  C  CZ2 . TRP A 1 102 ? -24.518 14.798 13.704  1.00 12.26 ? 131 TRP A CZ2 1 
ATOM   737  C  CZ3 . TRP A 1 102 ? -22.514 15.469 14.867  1.00 11.95 ? 131 TRP A CZ3 1 
ATOM   738  C  CH2 . TRP A 1 102 ? -23.213 15.232 13.688  1.00 11.54 ? 131 TRP A CH2 1 
ATOM   739  N  N   . PHE A 1 103 ? -23.724 12.258 18.160  1.00 14.49 ? 132 PHE A N   1 
ATOM   740  C  CA  . PHE A 1 103 ? -22.837 11.119 17.980  1.00 15.77 ? 132 PHE A CA  1 
ATOM   741  C  C   . PHE A 1 103 ? -21.402 11.555 17.636  1.00 15.48 ? 132 PHE A C   1 
ATOM   742  O  O   . PHE A 1 103 ? -20.652 10.763 17.016  1.00 14.86 ? 132 PHE A O   1 
ATOM   743  C  CB  . PHE A 1 103 ? -23.442 10.128 16.976  1.00 16.54 ? 132 PHE A CB  1 
ATOM   744  C  CG  . PHE A 1 103 ? -23.680 10.652 15.584  1.00 17.17 ? 132 PHE A CG  1 
ATOM   745  C  CD1 . PHE A 1 103 ? -22.649 10.700 14.651  1.00 18.42 ? 132 PHE A CD1 1 
ATOM   746  C  CD2 . PHE A 1 103 ? -24.947 11.040 15.183  1.00 19.24 ? 132 PHE A CD2 1 
ATOM   747  C  CE1 . PHE A 1 103 ? -22.882 11.149 13.358  1.00 19.21 ? 132 PHE A CE1 1 
ATOM   748  C  CE2 . PHE A 1 103 ? -25.176 11.477 13.887  1.00 19.19 ? 132 PHE A CE2 1 
ATOM   749  C  CZ  . PHE A 1 103 ? -24.145 11.529 12.977  1.00 20.34 ? 132 PHE A CZ  1 
ATOM   750  N  N   . ASP A 1 104 ? -20.975 12.733 18.090  1.00 14.43 ? 133 ASP A N   1 
ATOM   751  C  CA  . ASP A 1 104 ? -19.560 13.167 17.885  1.00 14.47 ? 133 ASP A CA  1 
ATOM   752  C  C   . ASP A 1 104 ? -18.991 13.720 19.196  1.00 14.30 ? 133 ASP A C   1 
ATOM   753  O  O   . ASP A 1 104 ? -18.371 14.772 19.204  1.00 13.69 ? 133 ASP A O   1 
ATOM   754  C  CB  . ASP A 1 104 ? -19.423 14.217 16.784  1.00 14.44 ? 133 ASP A CB  1 
ATOM   755  C  CG  . ASP A 1 104 ? -17.986 14.468 16.344  1.00 14.84 ? 133 ASP A CG  1 
ATOM   756  O  OD1 . ASP A 1 104 ? -17.183 13.533 16.382  1.00 13.73 ? 133 ASP A OD1 1 
ATOM   757  O  OD2 . ASP A 1 104 ? -17.687 15.606 15.959  1.00 15.22 ? 133 ASP A OD2 1 
ATOM   758  N  N   . PRO A 1 105 ? -19.205 12.998 20.312  1.00 14.97 ? 134 PRO A N   1 
ATOM   759  C  CA  . PRO A 1 105 ? -18.642 13.430 21.595  1.00 15.36 ? 134 PRO A CA  1 
ATOM   760  C  C   . PRO A 1 105 ? -17.103 13.419 21.591  1.00 15.26 ? 134 PRO A C   1 
ATOM   761  O  O   . PRO A 1 105 ? -16.502 12.438 21.192  1.00 15.30 ? 134 PRO A O   1 
ATOM   762  C  CB  . PRO A 1 105 ? -19.135 12.384 22.601  1.00 15.38 ? 134 PRO A CB  1 
ATOM   763  C  CG  . PRO A 1 105 ? -19.245 11.136 21.769  1.00 14.82 ? 134 PRO A CG  1 
ATOM   764  C  CD  . PRO A 1 105 ? -19.748 11.643 20.441  1.00 14.18 ? 134 PRO A CD  1 
ATOM   765  N  N   . PRO A 1 106 ? -16.472 14.479 22.080  1.00 14.48 ? 135 PRO A N   1 
ATOM   766  C  CA  . PRO A 1 106 ? -15.027 14.450 22.164  1.00 14.21 ? 135 PRO A CA  1 
ATOM   767  C  C   . PRO A 1 106 ? -14.601 13.535 23.328  1.00 13.87 ? 135 PRO A C   1 
ATOM   768  O  O   . PRO A 1 106 ? -15.477 13.024 24.068  1.00 13.76 ? 135 PRO A O   1 
ATOM   769  C  CB  . PRO A 1 106 ? -14.706 15.917 22.432  1.00 14.84 ? 135 PRO A CB  1 
ATOM   770  C  CG  . PRO A 1 106 ? -15.843 16.338 23.325  1.00 14.28 ? 135 PRO A CG  1 
ATOM   771  C  CD  . PRO A 1 106 ? -17.031 15.723 22.622  1.00 15.29 ? 135 PRO A CD  1 
ATOM   772  N  N   . LEU A 1 107 ? -13.314 13.337 23.499  1.00 13.45 ? 136 LEU A N   1 
ATOM   773  C  CA  . LEU A 1 107 ? -12.787 12.457 24.567  1.00 14.43 ? 136 LEU A CA  1 
ATOM   774  C  C   . LEU A 1 107 ? -13.279 12.866 25.958  1.00 13.75 ? 136 LEU A C   1 
ATOM   775  O  O   . LEU A 1 107 ? -13.556 11.978 26.775  1.00 15.82 ? 136 LEU A O   1 
ATOM   776  C  CB  . LEU A 1 107 ? -11.251 12.444 24.564  1.00 15.23 ? 136 LEU A CB  1 
ATOM   777  C  CG  . LEU A 1 107 ? -10.579 11.430 23.645  1.00 16.89 ? 136 LEU A CG  1 
ATOM   778  C  CD1 . LEU A 1 107 ? -9.065  11.603 23.712  1.00 18.15 ? 136 LEU A CD1 1 
ATOM   779  C  CD2 . LEU A 1 107 ? -10.970 9.994  23.967  1.00 17.79 ? 136 LEU A CD2 1 
ATOM   780  N  N   . SER A 1 108 ? -13.330 14.158 26.270  1.00 13.13 ? 137 SER A N   1 
ATOM   781  C  CA  . SER A 1 108 ? -13.703 14.595 27.609  1.00 12.93 ? 137 SER A CA  1 
ATOM   782  C  C   . SER A 1 108 ? -15.155 14.206 27.968  1.00 13.56 ? 137 SER A C   1 
ATOM   783  O  O   . SER A 1 108 ? -15.517 14.213 29.142  1.00 12.75 ? 137 SER A O   1 
ATOM   784  C  CB  . SER A 1 108 ? -13.487 16.075 27.758  1.00 13.83 ? 137 SER A CB  1 
ATOM   785  O  OG  . SER A 1 108 ? -12.094 16.382 27.842  1.00 14.90 ? 137 SER A OG  1 
ATOM   786  N  N   . MET A 1 109 ? -15.990 13.929 26.972  1.00 13.41 ? 138 MET A N   1 
ATOM   787  C  CA  . MET A 1 109 ? -17.345 13.443 27.160  1.00 14.57 ? 138 MET A CA  1 
ATOM   788  C  C   . MET A 1 109 ? -17.378 11.910 27.092  1.00 16.44 ? 138 MET A C   1 
ATOM   789  O  O   . MET A 1 109 ? -17.996 11.302 27.936  1.00 18.03 ? 138 MET A O   1 
ATOM   790  C  CB  . MET A 1 109 ? -18.283 13.997 26.077  1.00 14.46 ? 138 MET A CB  1 
ATOM   791  C  CG  . MET A 1 109 ? -18.668 15.446 26.291  1.00 14.94 ? 138 MET A CG  1 
ATOM   792  S  SD  . MET A 1 109 ? -19.472 15.773 27.902  1.00 15.59 ? 138 MET A SD  1 
ATOM   793  C  CE  . MET A 1 109 ? -19.734 17.537 27.765  1.00 15.86 ? 138 MET A CE  1 
ATOM   794  N  N   . ARG A 1 110 ? -16.718 11.348 26.075  1.00 16.34 ? 139 ARG A N   1 
ATOM   795  C  CA  . ARG A 1 110 ? -16.665 9.914  25.707  1.00 18.95 ? 139 ARG A CA  1 
ATOM   796  C  C   . ARG A 1 110 ? -16.228 9.061  26.909  1.00 18.67 ? 139 ARG A C   1 
ATOM   797  O  O   . ARG A 1 110 ? -16.593 7.915  27.027  1.00 16.78 ? 139 ARG A O   1 
ATOM   798  C  CB  . ARG A 1 110 ? -15.647 9.757  24.564  1.00 20.55 ? 139 ARG A CB  1 
ATOM   799  C  CG  . ARG A 1 110 ? -15.990 8.753  23.476  1.00 23.73 ? 139 ARG A CG  1 
ATOM   800  C  CD  . ARG A 1 110 ? -15.505 9.136  22.074  1.00 22.17 ? 139 ARG A CD  1 
ATOM   801  N  NE  . ARG A 1 110 ? -14.067 9.064  21.868  1.00 23.61 ? 139 ARG A NE  1 
ATOM   802  C  CZ  . ARG A 1 110 ? -13.306 10.013 21.305  1.00 22.84 ? 139 ARG A CZ  1 
ATOM   803  N  NH1 . ARG A 1 110 ? -13.779 11.225 21.035  1.00 17.26 ? 139 ARG A NH1 1 
ATOM   804  N  NH2 . ARG A 1 110 ? -12.058 9.719  21.005  1.00 22.21 ? 139 ARG A NH2 1 
ATOM   805  N  N   . LEU A 1 111 ? -15.365 9.601  27.761  1.00 19.56 ? 140 LEU A N   1 
ATOM   806  C  CA  . LEU A 1 111 ? -14.780 8.785  28.833  1.00 19.08 ? 140 LEU A CA  1 
ATOM   807  C  C   . LEU A 1 111 ? -15.569 8.915  30.138  1.00 19.41 ? 140 LEU A C   1 
ATOM   808  O  O   . LEU A 1 111 ? -15.192 8.278  31.124  1.00 18.99 ? 140 LEU A O   1 
ATOM   809  C  CB  . LEU A 1 111 ? -13.325 9.207  29.037  1.00 19.94 ? 140 LEU A CB  1 
ATOM   810  C  CG  . LEU A 1 111 ? -12.428 9.010  27.817  1.00 20.29 ? 140 LEU A CG  1 
ATOM   811  C  CD1 . LEU A 1 111 ? -11.068 9.631  28.073  1.00 21.53 ? 140 LEU A CD1 1 
ATOM   812  C  CD2 . LEU A 1 111 ? -12.320 7.532  27.467  1.00 20.53 ? 140 LEU A CD2 1 
ATOM   813  N  N   . ARG A 1 112 ? -16.631 9.713  30.165  1.00 16.69 ? 141 ARG A N   1 
ATOM   814  C  CA  . ARG A 1 112 ? -17.376 9.912  31.406  1.00 17.34 ? 141 ARG A CA  1 
ATOM   815  C  C   . ARG A 1 112 ? -18.345 8.744  31.644  1.00 18.28 ? 141 ARG A C   1 
ATOM   816  O  O   . ARG A 1 112 ? -18.820 8.078  30.711  1.00 16.30 ? 141 ARG A O   1 
ATOM   817  C  CB  . ARG A 1 112 ? -18.151 11.234 31.389  1.00 15.50 ? 141 ARG A CB  1 
ATOM   818  C  CG  . ARG A 1 112 ? -17.316 12.444 31.003  1.00 15.10 ? 141 ARG A CG  1 
ATOM   819  C  CD  . ARG A 1 112 ? -16.509 13.015 32.164  1.00 14.99 ? 141 ARG A CD  1 
ATOM   820  N  NE  . ARG A 1 112 ? -15.411 12.149 32.565  1.00 14.47 ? 141 ARG A NE  1 
ATOM   821  C  CZ  . ARG A 1 112 ? -14.175 12.228 32.104  1.00 15.12 ? 141 ARG A CZ  1 
ATOM   822  N  NH1 . ARG A 1 112 ? -13.924 13.077 31.128  1.00 15.02 ? 141 ARG A NH1 1 
ATOM   823  N  NH2 . ARG A 1 112 ? -13.210 11.472 32.623  1.00 14.64 ? 141 ARG A NH2 1 
ATOM   824  N  N   . SER A 1 113 ? -18.601 8.544  32.939  1.00 19.74 ? 142 SER A N   1 
ATOM   825  C  CA  . SER A 1 113 ? -19.535 7.525  33.480  1.00 20.43 ? 142 SER A CA  1 
ATOM   826  C  C   . SER A 1 113 ? -20.983 8.018  33.343  1.00 19.09 ? 142 SER A C   1 
ATOM   827  O  O   . SER A 1 113 ? -21.225 9.207  33.181  1.00 16.57 ? 142 SER A O   1 
ATOM   828  C  CB  . SER A 1 113 ? -19.210 7.308  34.937  1.00 20.97 ? 142 SER A CB  1 
ATOM   829  O  OG  . SER A 1 113 ? -19.506 8.504  35.669  1.00 21.56 ? 142 SER A OG  1 
ATOM   830  N  N   . VAL A 1 114 ? -21.946 7.107  33.493  1.00 19.69 ? 143 VAL A N   1 
ATOM   831  C  CA  . VAL A 1 114 ? -23.355 7.472  33.528  1.00 19.97 ? 143 VAL A CA  1 
ATOM   832  C  C   . VAL A 1 114 ? -23.592 8.606  34.537  1.00 19.58 ? 143 VAL A C   1 
ATOM   833  O  O   . VAL A 1 114 ? -24.326 9.544  34.230  1.00 18.00 ? 143 VAL A O   1 
ATOM   834  C  CB  . VAL A 1 114 ? -24.251 6.276  33.892  1.00 21.68 ? 143 VAL A CB  1 
ATOM   835  C  CG1 . VAL A 1 114 ? -25.720 6.595  33.678  1.00 21.54 ? 143 VAL A CG1 1 
ATOM   836  C  CG2 . VAL A 1 114 ? -23.857 5.021  33.157  1.00 23.49 ? 143 VAL A CG2 1 
ATOM   837  N  N   . GLU A 1 115 ? -22.990 8.496  35.734  1.00 18.65 ? 144 GLU A N   1 
ATOM   838  C  CA  . GLU A 1 115 ? -23.200 9.469  36.850  1.00 18.72 ? 144 GLU A CA  1 
ATOM   839  C  C   . GLU A 1 115 ? -22.698 10.861 36.438  1.00 16.78 ? 144 GLU A C   1 
ATOM   840  O  O   . GLU A 1 115 ? -23.379 11.905 36.649  1.00 15.60 ? 144 GLU A O   1 
ATOM   841  C  CB  . GLU A 1 115 ? -22.470 9.030  38.125  1.00 20.87 ? 144 GLU A CB  1 
ATOM   842  C  CG  . GLU A 1 115 ? -23.164 7.885  38.841  1.00 22.95 ? 144 GLU A CG  1 
ATOM   843  C  CD  . GLU A 1 115 ? -23.106 6.523  38.149  1.00 26.11 ? 144 GLU A CD  1 
ATOM   844  O  OE1 . GLU A 1 115 ? -22.105 6.214  37.415  1.00 26.33 ? 144 GLU A OE1 1 
ATOM   845  O  OE2 . GLU A 1 115 ? -24.089 5.762  38.325  1.00 32.05 ? 144 GLU A OE2 1 
ATOM   846  N  N   . GLU A 1 116 ? -21.555 10.887 35.783  1.00 13.54 ? 145 GLU A N   1 
ATOM   847  C  CA  . GLU A 1 116 ? -20.958 12.133 35.406  1.00 13.65 ? 145 GLU A CA  1 
ATOM   848  C  C   . GLU A 1 116 ? -21.826 12.818 34.348  1.00 13.17 ? 145 GLU A C   1 
ATOM   849  O  O   . GLU A 1 116 ? -22.159 13.994 34.476  1.00 12.33 ? 145 GLU A O   1 
ATOM   850  C  CB  . GLU A 1 116 ? -19.533 11.879 34.917  1.00 13.83 ? 145 GLU A CB  1 
ATOM   851  C  CG  . GLU A 1 116 ? -18.560 11.661 36.066  1.00 15.58 ? 145 GLU A CG  1 
ATOM   852  C  CD  . GLU A 1 116 ? -17.185 11.188 35.594  1.00 16.86 ? 145 GLU A CD  1 
ATOM   853  O  OE1 . GLU A 1 116 ? -17.100 10.639 34.463  1.00 16.27 ? 145 GLU A OE1 1 
ATOM   854  O  OE2 . GLU A 1 116 ? -16.193 11.464 36.294  1.00 16.47 ? 145 GLU A OE2 1 
ATOM   855  N  N   . LEU A 1 117 ? -22.199 12.065 33.324  1.00 13.83 ? 146 LEU A N   1 
ATOM   856  C  CA  . LEU A 1 117 ? -23.070 12.579 32.265  1.00 13.99 ? 146 LEU A CA  1 
ATOM   857  C  C   . LEU A 1 117 ? -24.397 13.086 32.847  1.00 14.61 ? 146 LEU A C   1 
ATOM   858  O  O   . LEU A 1 117 ? -24.912 14.076 32.404  1.00 15.51 ? 146 LEU A O   1 
ATOM   859  C  CB  . LEU A 1 117 ? -23.299 11.459 31.248  1.00 14.49 ? 146 LEU A CB  1 
ATOM   860  C  CG  . LEU A 1 117 ? -22.097 11.120 30.378  1.00 14.72 ? 146 LEU A CG  1 
ATOM   861  C  CD1 . LEU A 1 117 ? -22.400 9.923  29.507  1.00 15.38 ? 146 LEU A CD1 1 
ATOM   862  C  CD2 . LEU A 1 117 ? -21.699 12.321 29.522  1.00 14.77 ? 146 LEU A CD2 1 
ATOM   863  N  N   . THR A 1 118 ? -24.962 12.386 33.827  1.00 15.75 ? 147 THR A N   1 
ATOM   864  C  CA  . THR A 1 118 ? -26.216 12.829 34.427  1.00 16.08 ? 147 THR A CA  1 
ATOM   865  C  C   . THR A 1 118 ? -26.031 14.229 35.017  1.00 16.55 ? 147 THR A C   1 
ATOM   866  O  O   . THR A 1 118 ? -26.836 15.143 34.767  1.00 16.49 ? 147 THR A O   1 
ATOM   867  C  CB  . THR A 1 118 ? -26.711 11.846 35.496  1.00 16.86 ? 147 THR A CB  1 
ATOM   868  O  OG1 . THR A 1 118 ? -26.705 10.487 35.038  1.00 16.86 ? 147 THR A OG1 1 
ATOM   869  C  CG2 . THR A 1 118 ? -28.095 12.215 35.966  1.00 16.89 ? 147 THR A CG2 1 
ATOM   870  N  N   . GLN A 1 119 ? -24.955 14.395 35.771  1.00 16.31 ? 148 GLN A N   1 
ATOM   871  C  CA  . GLN A 1 119 ? -24.641 15.662 36.433  1.00 18.37 ? 148 GLN A CA  1 
ATOM   872  C  C   . GLN A 1 119 ? -24.425 16.754 35.377  1.00 16.33 ? 148 GLN A C   1 
ATOM   873  O  O   . GLN A 1 119 ? -24.832 17.888 35.580  1.00 16.83 ? 148 GLN A O   1 
ATOM   874  C  CB  . GLN A 1 119 ? -23.473 15.450 37.404  1.00 21.51 ? 148 GLN A CB  1 
ATOM   875  C  CG  . GLN A 1 119 ? -23.834 14.467 38.529  1.00 25.83 ? 148 GLN A CG  1 
ATOM   876  C  CD  . GLN A 1 119 ? -22.708 14.169 39.493  1.00 30.42 ? 148 GLN A CD  1 
ATOM   877  O  OE1 . GLN A 1 119 ? -21.985 15.071 39.896  1.00 35.22 ? 148 GLN A OE1 1 
ATOM   878  N  NE2 . GLN A 1 119 ? -22.543 12.901 39.867  1.00 34.17 ? 148 GLN A NE2 1 
ATOM   879  N  N   . PHE A 1 120 ? -23.825 16.418 34.242  1.00 16.19 ? 149 PHE A N   1 
ATOM   880  C  CA  . PHE A 1 120 ? -23.648 17.388 33.168  1.00 16.20 ? 149 PHE A CA  1 
ATOM   881  C  C   . PHE A 1 120 ? -25.012 17.813 32.615  1.00 15.86 ? 149 PHE A C   1 
ATOM   882  O  O   . PHE A 1 120 ? -25.272 19.026 32.462  1.00 14.87 ? 149 PHE A O   1 
ATOM   883  C  CB  . PHE A 1 120 ? -22.758 16.871 32.029  1.00 16.64 ? 149 PHE A CB  1 
ATOM   884  C  CG  . PHE A 1 120 ? -22.650 17.831 30.866  1.00 16.84 ? 149 PHE A CG  1 
ATOM   885  C  CD1 . PHE A 1 120 ? -22.115 19.096 31.038  1.00 16.08 ? 149 PHE A CD1 1 
ATOM   886  C  CD2 . PHE A 1 120 ? -23.132 17.497 29.605  1.00 16.26 ? 149 PHE A CD2 1 
ATOM   887  C  CE1 . PHE A 1 120 ? -22.060 19.993 29.979  1.00 16.01 ? 149 PHE A CE1 1 
ATOM   888  C  CE2 . PHE A 1 120 ? -23.055 18.389 28.545  1.00 15.53 ? 149 PHE A CE2 1 
ATOM   889  C  CZ  . PHE A 1 120 ? -22.529 19.642 28.735  1.00 16.38 ? 149 PHE A CZ  1 
ATOM   890  N  N   . PHE A 1 121 ? -25.879 16.844 32.326  1.00 15.65 ? 150 PHE A N   1 
ATOM   891  C  CA  . PHE A 1 121 ? -27.176 17.193 31.686  1.00 15.26 ? 150 PHE A CA  1 
ATOM   892  C  C   . PHE A 1 121 ? -28.017 18.048 32.651  1.00 14.77 ? 150 PHE A C   1 
ATOM   893  O  O   . PHE A 1 121 ? -28.621 19.067 32.248  1.00 13.82 ? 150 PHE A O   1 
ATOM   894  C  CB  . PHE A 1 121 ? -27.902 15.928 31.214  1.00 14.45 ? 150 PHE A CB  1 
ATOM   895  C  CG  . PHE A 1 121 ? -27.180 15.092 30.186  1.00 14.24 ? 150 PHE A CG  1 
ATOM   896  C  CD1 . PHE A 1 121 ? -26.162 15.612 29.402  1.00 14.29 ? 150 PHE A CD1 1 
ATOM   897  C  CD2 . PHE A 1 121 ? -27.552 13.774 29.976  1.00 13.46 ? 150 PHE A CD2 1 
ATOM   898  C  CE1 . PHE A 1 121 ? -25.522 14.822 28.462  1.00 13.75 ? 150 PHE A CE1 1 
ATOM   899  C  CE2 . PHE A 1 121 ? -26.924 12.988 29.027  1.00 13.49 ? 150 PHE A CE2 1 
ATOM   900  C  CZ  . PHE A 1 121 ? -25.895 13.510 28.281  1.00 13.86 ? 150 PHE A CZ  1 
ATOM   901  N  N   . LEU A 1 122 ? -27.958 17.700 33.938  1.00 14.76 ? 151 LEU A N   1 
ATOM   902  C  CA  . LEU A 1 122 ? -28.704 18.395 34.981  1.00 15.01 ? 151 LEU A CA  1 
ATOM   903  C  C   . LEU A 1 122 ? -28.201 19.830 35.135  1.00 15.84 ? 151 LEU A C   1 
ATOM   904  O  O   . LEU A 1 122 ? -28.982 20.729 35.523  1.00 14.93 ? 151 LEU A O   1 
ATOM   905  C  CB  . LEU A 1 122 ? -28.532 17.652 36.310  1.00 15.07 ? 151 LEU A CB  1 
ATOM   906  C  CG  . LEU A 1 122 ? -29.297 16.330 36.456  1.00 15.67 ? 151 LEU A CG  1 
ATOM   907  C  CD1 . LEU A 1 122 ? -28.843 15.603 37.711  1.00 15.45 ? 151 LEU A CD1 1 
ATOM   908  C  CD2 . LEU A 1 122 ? -30.802 16.559 36.497  1.00 15.61 ? 151 LEU A CD2 1 
ATOM   909  N  N   . ARG A 1 123 ? -26.902 20.033 34.889  1.00 15.11 ? 152 ARG A N   1 
ATOM   910  C  CA  . ARG A 1 123 ? -26.321 21.348 35.022  1.00 14.48 ? 152 ARG A CA  1 
ATOM   911  C  C   . ARG A 1 123 ? -26.991 22.256 33.980  1.00 14.47 ? 152 ARG A C   1 
ATOM   912  O  O   . ARG A 1 123 ? -27.433 23.339 34.279  1.00 13.56 ? 152 ARG A O   1 
ATOM   913  C  CB  . ARG A 1 123 ? -24.791 21.272 34.877  1.00 14.79 ? 152 ARG A CB  1 
ATOM   914  C  CG  . ARG A 1 123 ? -24.103 22.631 34.906  1.00 15.09 ? 152 ARG A CG  1 
ATOM   915  C  CD  . ARG A 1 123 ? -22.803 22.754 34.141  1.00 14.97 ? 152 ARG A CD  1 
ATOM   916  N  NE  . ARG A 1 123 ? -21.998 23.914 34.547  1.00 15.12 ? 152 ARG A NE  1 
ATOM   917  C  CZ  . ARG A 1 123 ? -22.072 25.161 34.047  1.00 13.65 ? 152 ARG A CZ  1 
ATOM   918  N  NH1 . ARG A 1 123 ? -22.964 25.484 33.127  1.00 14.39 ? 152 ARG A NH1 1 
ATOM   919  N  NH2 . ARG A 1 123 ? -21.244 26.093 34.492  1.00 12.73 ? 152 ARG A NH2 1 
ATOM   920  N  N   . GLU A 1 124 ? -27.109 21.756 32.763  1.00 13.92 ? 153 GLU A N   1 
ATOM   921  C  CA  . GLU A 1 124 ? -27.584 22.557 31.663  1.00 14.82 ? 153 GLU A CA  1 
ATOM   922  C  C   . GLU A 1 124 ? -29.103 22.773 31.777  1.00 14.87 ? 153 GLU A C   1 
ATOM   923  O  O   . GLU A 1 124 ? -29.617 23.753 31.230  1.00 17.50 ? 153 GLU A O   1 
ATOM   924  C  CB  . GLU A 1 124 ? -27.156 21.941 30.330  1.00 15.08 ? 153 GLU A CB  1 
ATOM   925  C  CG  . GLU A 1 124 ? -25.638 21.881 30.157  1.00 15.36 ? 153 GLU A CG  1 
ATOM   926  C  CD  . GLU A 1 124 ? -25.113 21.703 28.744  1.00 14.92 ? 153 GLU A CD  1 
ATOM   927  O  OE1 . GLU A 1 124 ? -25.650 20.834 28.008  1.00 15.20 ? 153 GLU A OE1 1 
ATOM   928  O  OE2 . GLU A 1 124 ? -24.175 22.436 28.377  1.00 14.64 ? 153 GLU A OE2 1 
ATOM   929  N  N   . ILE A 1 125 ? -29.831 21.883 32.450  1.00 15.22 ? 154 ILE A N   1 
ATOM   930  C  CA  . ILE A 1 125 ? -31.296 22.071 32.677  1.00 15.31 ? 154 ILE A CA  1 
ATOM   931  C  C   . ILE A 1 125 ? -31.556 22.957 33.899  1.00 15.87 ? 154 ILE A C   1 
ATOM   932  O  O   . ILE A 1 125 ? -32.420 23.828 33.815  1.00 16.11 ? 154 ILE A O   1 
ATOM   933  C  CB  . ILE A 1 125 ? -32.050 20.725 32.818  1.00 15.53 ? 154 ILE A CB  1 
ATOM   934  C  CG1 . ILE A 1 125 ? -31.962 19.858 31.559  1.00 14.15 ? 154 ILE A CG1 1 
ATOM   935  C  CG2 . ILE A 1 125 ? -33.510 20.973 33.215  1.00 15.90 ? 154 ILE A CG2 1 
ATOM   936  C  CD1 . ILE A 1 125 ? -32.033 18.392 31.843  1.00 14.81 ? 154 ILE A CD1 1 
ATOM   937  N  N   . GLN A 1 126 ? -30.870 22.685 35.027  1.00 17.21 ? 155 GLN A N   1 
ATOM   938  C  CA  . GLN A 1 126 ? -31.219 23.246 36.357  1.00 17.63 ? 155 GLN A CA  1 
ATOM   939  C  C   . GLN A 1 126 ? -30.558 24.619 36.546  1.00 16.65 ? 155 GLN A C   1 
ATOM   940  O  O   . GLN A 1 126 ? -31.072 25.463 37.287  1.00 14.81 ? 155 GLN A O   1 
ATOM   941  C  CB  . GLN A 1 126 ? -30.722 22.324 37.482  1.00 19.81 ? 155 GLN A CB  1 
ATOM   942  C  CG  . GLN A 1 126 ? -31.429 20.963 37.604  1.00 19.71 ? 155 GLN A CG  1 
ATOM   943  C  CD  . GLN A 1 126 ? -31.031 20.270 38.891  1.00 20.87 ? 155 GLN A CD  1 
ATOM   944  O  OE1 . GLN A 1 126 ? -29.859 20.053 39.161  1.00 22.32 ? 155 GLN A OE1 1 
ATOM   945  N  NE2 . GLN A 1 126 ? -31.991 19.984 39.754  1.00 21.40 ? 155 GLN A NE2 1 
ATOM   946  N  N   . TYR A 1 127 ? -29.392 24.816 35.932  1.00 16.96 ? 156 TYR A N   1 
ATOM   947  C  CA  . TYR A 1 127 ? -28.552 26.020 36.207  1.00 17.79 ? 156 TYR A CA  1 
ATOM   948  C  C   . TYR A 1 127 ? -28.411 26.868 34.937  1.00 16.95 ? 156 TYR A C   1 
ATOM   949  O  O   . TYR A 1 127 ? -28.817 28.009 34.895  1.00 17.13 ? 156 TYR A O   1 
ATOM   950  C  CB  . TYR A 1 127 ? -27.163 25.649 36.743  1.00 18.28 ? 156 TYR A CB  1 
ATOM   951  C  CG  . TYR A 1 127 ? -26.232 26.835 36.857  1.00 19.80 ? 156 TYR A CG  1 
ATOM   952  C  CD1 . TYR A 1 127 ? -26.556 27.935 37.635  1.00 20.74 ? 156 TYR A CD1 1 
ATOM   953  C  CD2 . TYR A 1 127 ? -25.056 26.890 36.133  1.00 19.11 ? 156 TYR A CD2 1 
ATOM   954  C  CE1 . TYR A 1 127 ? -25.703 29.025 37.740  1.00 21.53 ? 156 TYR A CE1 1 
ATOM   955  C  CE2 . TYR A 1 127 ? -24.199 27.973 36.217  1.00 21.42 ? 156 TYR A CE2 1 
ATOM   956  C  CZ  . TYR A 1 127 ? -24.524 29.046 37.021  1.00 21.28 ? 156 TYR A CZ  1 
ATOM   957  O  OH  . TYR A 1 127 ? -23.674 30.099 37.099  1.00 21.83 ? 156 TYR A OH  1 
ATOM   958  N  N   . GLY A 1 128 ? -27.849 26.279 33.908  1.00 16.28 ? 157 GLY A N   1 
ATOM   959  C  CA  . GLY A 1 128 ? -27.686 26.959 32.662  1.00 17.68 ? 157 GLY A CA  1 
ATOM   960  C  C   . GLY A 1 128 ? -26.541 26.365 31.861  1.00 17.65 ? 157 GLY A C   1 
ATOM   961  O  O   . GLY A 1 128 ? -25.792 25.520 32.352  1.00 16.83 ? 157 GLY A O   1 
ATOM   962  N  N   . ILE A 1 129 ? -26.466 26.821 30.620  1.00 17.33 ? 158 ILE A N   1 
ATOM   963  C  CA  . ILE A 1 129 ? -25.478 26.417 29.676  1.00 17.29 ? 158 ILE A CA  1 
ATOM   964  C  C   . ILE A 1 129 ? -24.311 27.404 29.792  1.00 15.70 ? 158 ILE A C   1 
ATOM   965  O  O   . ILE A 1 129 ? -24.517 28.596 29.774  1.00 15.28 ? 158 ILE A O   1 
ATOM   966  C  CB  . ILE A 1 129 ? -26.081 26.365 28.257  1.00 17.48 ? 158 ILE A CB  1 
ATOM   967  C  CG1 . ILE A 1 129 ? -27.106 25.232 28.132  1.00 19.21 ? 158 ILE A CG1 1 
ATOM   968  C  CG2 . ILE A 1 129 ? -25.005 26.242 27.192  1.00 17.88 ? 158 ILE A CG2 1 
ATOM   969  C  CD1 . ILE A 1 129 ? -28.034 25.365 26.945  1.00 19.40 ? 158 ILE A CD1 1 
ATOM   970  N  N   . GLU A 1 130 ? -23.114 26.862 29.939  1.00 17.10 ? 159 GLU A N   1 
ATOM   971  C  CA  . GLU A 1 130 ? -21.865 27.652 30.120  1.00 20.36 ? 159 GLU A CA  1 
ATOM   972  C  C   . GLU A 1 130 ? -22.082 28.677 31.247  1.00 20.67 ? 159 GLU A C   1 
ATOM   973  O  O   . GLU A 1 130 ? -22.559 28.329 32.335  1.00 19.42 ? 159 GLU A O   1 
ATOM   974  C  CB  . GLU A 1 130 ? -21.418 28.244 28.775  1.00 21.19 ? 159 GLU A CB  1 
ATOM   975  C  CG  . GLU A 1 130 ? -21.144 27.186 27.711  1.00 24.33 ? 159 GLU A CG  1 
ATOM   976  C  CD  . GLU A 1 130 ? -21.404 27.564 26.254  1.00 26.94 ? 159 GLU A CD  1 
ATOM   977  O  OE1 . GLU A 1 130 ? -22.318 28.356 25.965  1.00 29.45 ? 159 GLU A OE1 1 
ATOM   978  O  OE2 . GLU A 1 130 ? -20.689 27.056 25.402  1.00 31.57 ? 159 GLU A OE2 1 
ATOM   979  N  N   . ASP A 1 131 ? -21.754 29.929 30.996  1.00 20.60 ? 160 ASP A N   1 
ATOM   980  C  CA  . ASP A 1 131 ? -21.960 30.970 32.007  1.00 22.92 ? 160 ASP A CA  1 
ATOM   981  C  C   . ASP A 1 131 ? -23.144 31.870 31.587  1.00 21.31 ? 160 ASP A C   1 
ATOM   982  O  O   . ASP A 1 131 ? -23.131 33.063 31.868  1.00 21.54 ? 160 ASP A O   1 
ATOM   983  C  CB  . ASP A 1 131 ? -20.687 31.806 32.167  1.00 24.84 ? 160 ASP A CB  1 
ATOM   984  C  CG  . ASP A 1 131 ? -20.194 32.421 30.866  1.00 30.63 ? 160 ASP A CG  1 
ATOM   985  O  OD1 . ASP A 1 131 ? -20.697 31.988 29.769  1.00 34.39 ? 160 ASP A OD1 1 
ATOM   986  O  OD2 . ASP A 1 131 ? -19.300 33.334 30.938  1.00 37.03 ? 160 ASP A OD2 1 
ATOM   987  N  N   . THR A 1 132 ? -24.163 31.336 30.923  1.00 17.74 ? 161 THR A N   1 
ATOM   988  C  CA  . THR A 1 132 ? -25.150 32.202 30.309  1.00 17.00 ? 161 THR A CA  1 
ATOM   989  C  C   . THR A 1 132 ? -26.422 32.263 31.146  1.00 17.61 ? 161 THR A C   1 
ATOM   990  O  O   . THR A 1 132 ? -27.233 33.128 30.888  1.00 17.29 ? 161 THR A O   1 
ATOM   991  C  CB  . THR A 1 132 ? -25.558 31.753 28.901  1.00 16.77 ? 161 THR A CB  1 
ATOM   992  O  OG1 . THR A 1 132 ? -26.244 30.503 29.005  1.00 16.23 ? 161 THR A OG1 1 
ATOM   993  C  CG2 . THR A 1 132 ? -24.377 31.635 27.950  1.00 16.11 ? 161 THR A CG2 1 
ATOM   994  N  N   . GLY A 1 133 ? -26.648 31.322 32.056  1.00 17.43 ? 162 GLY A N   1 
ATOM   995  C  CA  . GLY A 1 133 ? -27.971 31.221 32.713  1.00 18.48 ? 162 GLY A CA  1 
ATOM   996  C  C   . GLY A 1 133 ? -29.068 30.729 31.759  1.00 19.31 ? 162 GLY A C   1 
ATOM   997  O  O   . GLY A 1 133 ? -30.219 30.663 32.141  1.00 17.30 ? 162 GLY A O   1 
ATOM   998  N  N   . ILE A 1 134 ? -28.743 30.398 30.499  1.00 18.89 ? 163 ILE A N   1 
ATOM   999  C  CA  . ILE A 1 134 ? -29.779 29.871 29.586  1.00 18.81 ? 163 ILE A CA  1 
ATOM   1000 C  C   . ILE A 1 134 ? -29.971 28.369 29.872  1.00 16.80 ? 163 ILE A C   1 
ATOM   1001 O  O   . ILE A 1 134 ? -29.058 27.592 29.735  1.00 16.03 ? 163 ILE A O   1 
ATOM   1002 C  CB  . ILE A 1 134 ? -29.417 30.172 28.115  1.00 19.47 ? 163 ILE A CB  1 
ATOM   1003 C  CG1 . ILE A 1 134 ? -29.473 31.678 27.834  1.00 20.43 ? 163 ILE A CG1 1 
ATOM   1004 C  CG2 . ILE A 1 134 ? -30.298 29.383 27.154  1.00 19.35 ? 163 ILE A CG2 1 
ATOM   1005 C  CD1 . ILE A 1 134 ? -29.077 32.097 26.444  1.00 20.15 ? 163 ILE A CD1 1 
ATOM   1006 N  N   . ARG A 1 135 ? -31.166 27.965 30.235  1.00 15.54 ? 164 ARG A N   1 
ATOM   1007 C  CA  . ARG A 1 135 ? -31.438 26.547 30.622  1.00 15.87 ? 164 ARG A CA  1 
ATOM   1008 C  C   . ARG A 1 135 ? -32.043 25.768 29.449  1.00 15.91 ? 164 ARG A C   1 
ATOM   1009 O  O   . ARG A 1 135 ? -32.853 26.315 28.682  1.00 16.25 ? 164 ARG A O   1 
ATOM   1010 C  CB  . ARG A 1 135 ? -32.358 26.501 31.845  1.00 16.51 ? 164 ARG A CB  1 
ATOM   1011 C  CG  . ARG A 1 135 ? -31.739 27.190 33.061  1.00 16.57 ? 164 ARG A CG  1 
ATOM   1012 C  CD  . ARG A 1 135 ? -32.703 27.373 34.214  1.00 16.60 ? 164 ARG A CD  1 
ATOM   1013 N  NE  . ARG A 1 135 ? -31.970 27.979 35.311  1.00 17.17 ? 164 ARG A NE  1 
ATOM   1014 C  CZ  . ARG A 1 135 ? -32.438 28.185 36.539  1.00 17.50 ? 164 ARG A CZ  1 
ATOM   1015 N  NH1 . ARG A 1 135 ? -33.665 27.824 36.849  1.00 15.33 ? 164 ARG A NH1 1 
ATOM   1016 N  NH2 . ARG A 1 135 ? -31.667 28.766 37.439  1.00 18.14 ? 164 ARG A NH2 1 
ATOM   1017 N  N   . ALA A 1 136 ? -31.602 24.513 29.306  1.00 14.90 ? 165 ALA A N   1 
ATOM   1018 C  CA  . ALA A 1 136 ? -32.104 23.599 28.277  1.00 15.90 ? 165 ALA A CA  1 
ATOM   1019 C  C   . ALA A 1 136 ? -33.545 23.168 28.593  1.00 17.49 ? 165 ALA A C   1 
ATOM   1020 O  O   . ALA A 1 136 ? -33.860 22.896 29.766  1.00 16.76 ? 165 ALA A O   1 
ATOM   1021 C  CB  . ALA A 1 136 ? -31.188 22.400 28.171  1.00 15.46 ? 165 ALA A CB  1 
ATOM   1022 N  N   . GLY A 1 137 ? -34.400 23.096 27.562  1.00 16.21 ? 166 GLY A N   1 
ATOM   1023 C  CA  . GLY A 1 137 ? -35.767 22.598 27.729  1.00 16.51 ? 166 GLY A CA  1 
ATOM   1024 C  C   . GLY A 1 137 ? -35.998 21.201 27.148  1.00 15.99 ? 166 GLY A C   1 
ATOM   1025 O  O   . GLY A 1 137 ? -37.141 20.723 27.155  1.00 16.53 ? 166 GLY A O   1 
ATOM   1026 N  N   . ILE A 1 138 ? -34.940 20.539 26.674  1.00 14.41 ? 167 ILE A N   1 
ATOM   1027 C  CA  . ILE A 1 138 ? -35.042 19.225 26.118  1.00 14.12 ? 167 ILE A CA  1 
ATOM   1028 C  C   . ILE A 1 138 ? -33.663 18.551 26.190  1.00 13.62 ? 167 ILE A C   1 
ATOM   1029 O  O   . ILE A 1 138 ? -32.629 19.249 26.244  1.00 13.04 ? 167 ILE A O   1 
ATOM   1030 C  CB  . ILE A 1 138 ? -35.564 19.306 24.670  1.00 13.59 ? 167 ILE A CB  1 
ATOM   1031 C  CG1 . ILE A 1 138 ? -36.022 17.943 24.141  1.00 13.92 ? 167 ILE A CG1 1 
ATOM   1032 C  CG2 . ILE A 1 138 ? -34.530 19.933 23.751  1.00 14.41 ? 167 ILE A CG2 1 
ATOM   1033 C  CD1 . ILE A 1 138 ? -36.864 18.072 22.866  1.00 14.65 ? 167 ILE A CD1 1 
ATOM   1034 N  N   . ILE A 1 139 ? -33.675 17.219 26.196  1.00 13.38 ? 168 ILE A N   1 
ATOM   1035 C  CA  . ILE A 1 139 ? -32.432 16.384 26.213  1.00 14.18 ? 168 ILE A CA  1 
ATOM   1036 C  C   . ILE A 1 139 ? -32.355 15.597 24.902  1.00 14.10 ? 168 ILE A C   1 
ATOM   1037 O  O   . ILE A 1 139 ? -33.246 14.805 24.635  1.00 15.03 ? 168 ILE A O   1 
ATOM   1038 C  CB  . ILE A 1 139 ? -32.395 15.416 27.416  1.00 15.27 ? 168 ILE A CB  1 
ATOM   1039 C  CG1 . ILE A 1 139 ? -32.672 16.133 28.739  1.00 15.03 ? 168 ILE A CG1 1 
ATOM   1040 C  CG2 . ILE A 1 139 ? -31.062 14.658 27.481  1.00 15.56 ? 168 ILE A CG2 1 
ATOM   1041 C  CD1 . ILE A 1 139 ? -33.223 15.211 29.798  1.00 15.42 ? 168 ILE A CD1 1 
ATOM   1042 N  N   . LYS A 1 140 ? -31.261 15.772 24.158  1.00 13.58 ? 169 LYS A N   1 
ATOM   1043 C  CA  . LYS A 1 140 ? -31.031 15.130 22.860  1.00 13.20 ? 169 LYS A CA  1 
ATOM   1044 C  C   . LYS A 1 140 ? -29.979 14.024 23.026  1.00 13.10 ? 169 LYS A C   1 
ATOM   1045 O  O   . LYS A 1 140 ? -28.975 14.260 23.644  1.00 13.04 ? 169 LYS A O   1 
ATOM   1046 C  CB  . LYS A 1 140 ? -30.588 16.205 21.853  1.00 12.53 ? 169 LYS A CB  1 
ATOM   1047 C  CG  . LYS A 1 140 ? -30.035 15.695 20.534  1.00 12.20 ? 169 LYS A CG  1 
ATOM   1048 C  CD  . LYS A 1 140 ? -31.111 15.162 19.606  1.00 12.82 ? 169 LYS A CD  1 
ATOM   1049 C  CE  . LYS A 1 140 ? -30.559 14.550 18.351  1.00 12.59 ? 169 LYS A CE  1 
ATOM   1050 N  NZ  . LYS A 1 140 ? -30.256 15.609 17.369  1.00 13.15 ? 169 LYS A NZ  1 
ATOM   1051 N  N   . VAL A 1 141 ? -30.240 12.846 22.458  1.00 13.26 ? 170 VAL A N   1 
ATOM   1052 C  CA  . VAL A 1 141 ? -29.330 11.701 22.457  1.00 14.10 ? 170 VAL A CA  1 
ATOM   1053 C  C   . VAL A 1 141 ? -29.352 11.045 21.066  1.00 14.11 ? 170 VAL A C   1 
ATOM   1054 O  O   . VAL A 1 141 ? -30.120 11.444 20.201  1.00 13.73 ? 170 VAL A O   1 
ATOM   1055 C  CB  . VAL A 1 141 ? -29.701 10.695 23.569  1.00 15.02 ? 170 VAL A CB  1 
ATOM   1056 C  CG1 . VAL A 1 141 ? -29.853 11.401 24.913  1.00 14.98 ? 170 VAL A CG1 1 
ATOM   1057 C  CG2 . VAL A 1 141 ? -30.964 9.912  23.244  1.00 15.00 ? 170 VAL A CG2 1 
ATOM   1058 N  N   . ALA A 1 142 ? -28.479 10.057 20.857  1.00 14.56 ? 171 ALA A N   1 
ATOM   1059 C  CA  . ALA A 1 142 ? -28.218 9.485  19.515  1.00 15.06 ? 171 ALA A CA  1 
ATOM   1060 C  C   . ALA A 1 142 ? -27.686 8.059  19.655  1.00 15.44 ? 171 ALA A C   1 
ATOM   1061 O  O   . ALA A 1 142 ? -26.877 7.762  20.556  1.00 14.97 ? 171 ALA A O   1 
ATOM   1062 C  CB  . ALA A 1 142 ? -27.216 10.344 18.751  1.00 14.96 ? 171 ALA A CB  1 
ATOM   1063 N  N   . THR A 1 143 ? -28.182 7.209  18.765  1.00 15.44 ? 172 THR A N   1 
ATOM   1064 C  CA  . THR A 1 143 ? -27.539 5.982  18.397  1.00 15.69 ? 172 THR A CA  1 
ATOM   1065 C  C   . THR A 1 143 ? -27.392 5.973  16.875  1.00 16.43 ? 172 THR A C   1 
ATOM   1066 O  O   . THR A 1 143 ? -28.183 6.629  16.158  1.00 14.88 ? 172 THR A O   1 
ATOM   1067 C  CB  . THR A 1 143 ? -28.314 4.763  18.897  1.00 14.85 ? 172 THR A CB  1 
ATOM   1068 O  OG1 . THR A 1 143 ? -29.622 4.785  18.330  1.00 14.71 ? 172 THR A OG1 1 
ATOM   1069 C  CG2 . THR A 1 143 ? -28.395 4.704  20.405  1.00 14.48 ? 172 THR A CG2 1 
ATOM   1070 N  N   . THR A 1 144 ? -26.390 5.247  16.377  1.00 16.53 ? 173 THR A N   1 
ATOM   1071 C  CA  . THR A 1 144 ? -26.253 5.069  14.913  1.00 17.56 ? 173 THR A CA  1 
ATOM   1072 C  C   . THR A 1 144 ? -26.087 3.582  14.601  1.00 17.73 ? 173 THR A C   1 
ATOM   1073 O  O   . THR A 1 144 ? -25.024 3.159  14.220  1.00 18.65 ? 173 THR A O   1 
ATOM   1074 C  CB  . THR A 1 144 ? -25.082 5.890  14.353  1.00 18.03 ? 173 THR A CB  1 
ATOM   1075 O  OG1 . THR A 1 144 ? -23.830 5.384  14.819  1.00 17.28 ? 173 THR A OG1 1 
ATOM   1076 C  CG2 . THR A 1 144 ? -25.178 7.349  14.731  1.00 18.67 ? 173 THR A CG2 1 
ATOM   1077 N  N   . GLY A 1 145 ? -27.154 2.813  14.738  1.00 17.81 ? 174 GLY A N   1 
ATOM   1078 C  CA  . GLY A 1 145 ? -27.044 1.385  14.865  1.00 17.90 ? 174 GLY A CA  1 
ATOM   1079 C  C   . GLY A 1 145 ? -27.182 0.965  16.323  1.00 19.59 ? 174 GLY A C   1 
ATOM   1080 O  O   . GLY A 1 145 ? -27.568 1.750  17.232  1.00 19.54 ? 174 GLY A O   1 
ATOM   1081 N  N   . LYS A 1 146 ? -26.891 -0.298 16.545  1.00 21.34 ? 175 LYS A N   1 
ATOM   1082 C  CA  . LYS A 1 146 ? -26.772 -0.867 17.859  1.00 22.44 ? 175 LYS A CA  1 
ATOM   1083 C  C   . LYS A 1 146 ? -25.959 0.104  18.734  1.00 20.68 ? 175 LYS A C   1 
ATOM   1084 O  O   . LYS A 1 146 ? -24.962 0.657  18.294  1.00 18.97 ? 175 LYS A O   1 
ATOM   1085 C  CB  . LYS A 1 146 ? -26.144 -2.254 17.693  1.00 26.11 ? 175 LYS A CB  1 
ATOM   1086 C  CG  . LYS A 1 146 ? -25.925 -3.034 18.982  1.00 30.92 ? 175 LYS A CG  1 
ATOM   1087 C  CD  . LYS A 1 146 ? -25.224 -4.361 18.770  1.00 33.64 ? 175 LYS A CD  1 
ATOM   1088 C  CE  . LYS A 1 146 ? -25.480 -5.334 19.900  1.00 36.80 ? 175 LYS A CE  1 
ATOM   1089 N  NZ  . LYS A 1 146 ? -24.983 -4.819 21.199  1.00 36.95 ? 175 LYS A NZ  1 
ATOM   1090 N  N   . ALA A 1 147 ? -26.442 0.369  19.946  1.00 19.12 ? 176 ALA A N   1 
ATOM   1091 C  CA  . ALA A 1 147 ? -25.847 1.403  20.793  1.00 20.31 ? 176 ALA A CA  1 
ATOM   1092 C  C   . ALA A 1 147 ? -24.408 0.999  21.133  1.00 19.99 ? 176 ALA A C   1 
ATOM   1093 O  O   . ALA A 1 147 ? -24.182 -0.128 21.492  1.00 19.43 ? 176 ALA A O   1 
ATOM   1094 C  CB  . ALA A 1 147 ? -26.681 1.621  22.047  1.00 18.25 ? 176 ALA A CB  1 
ATOM   1095 N  N   . THR A 1 148 ? -23.460 1.918  21.013  1.00 19.55 ? 177 THR A N   1 
ATOM   1096 C  CA  . THR A 1 148 ? -22.127 1.705  21.627  1.00 19.53 ? 177 THR A CA  1 
ATOM   1097 C  C   . THR A 1 148 ? -22.280 1.728  23.149  1.00 18.49 ? 177 THR A C   1 
ATOM   1098 O  O   . THR A 1 148 ? -23.286 2.210  23.661  1.00 17.29 ? 177 THR A O   1 
ATOM   1099 C  CB  . THR A 1 148 ? -21.094 2.751  21.182  1.00 19.73 ? 177 THR A CB  1 
ATOM   1100 O  OG1 . THR A 1 148 ? -21.484 4.046  21.664  1.00 18.55 ? 177 THR A OG1 1 
ATOM   1101 C  CG2 . THR A 1 148 ? -20.870 2.759  19.682  1.00 19.66 ? 177 THR A CG2 1 
ATOM   1102 N  N   . PRO A 1 149 ? -21.285 1.202  23.864  1.00 18.85 ? 178 PRO A N   1 
ATOM   1103 C  CA  . PRO A 1 149 ? -21.305 1.337  25.311  1.00 18.53 ? 178 PRO A CA  1 
ATOM   1104 C  C   . PRO A 1 149 ? -21.506 2.796  25.762  1.00 17.63 ? 178 PRO A C   1 
ATOM   1105 O  O   . PRO A 1 149 ? -22.356 3.065  26.608  1.00 16.02 ? 178 PRO A O   1 
ATOM   1106 C  CB  . PRO A 1 149 ? -19.956 0.744  25.729  1.00 20.03 ? 178 PRO A CB  1 
ATOM   1107 C  CG  . PRO A 1 149 ? -19.743 -0.393 24.723  1.00 19.88 ? 178 PRO A CG  1 
ATOM   1108 C  CD  . PRO A 1 149 ? -20.330 0.154  23.436  1.00 20.35 ? 178 PRO A CD  1 
ATOM   1109 N  N   . PHE A 1 150 ? -20.778 3.734  25.174  1.00 16.62 ? 179 PHE A N   1 
ATOM   1110 C  CA  . PHE A 1 150 ? -20.934 5.118  25.565  1.00 16.80 ? 179 PHE A CA  1 
ATOM   1111 C  C   . PHE A 1 150 ? -22.346 5.664  25.248  1.00 17.35 ? 179 PHE A C   1 
ATOM   1112 O  O   . PHE A 1 150 ? -22.917 6.381  26.061  1.00 16.66 ? 179 PHE A O   1 
ATOM   1113 C  CB  . PHE A 1 150 ? -19.871 5.991  24.908  1.00 16.67 ? 179 PHE A CB  1 
ATOM   1114 C  CG  . PHE A 1 150 ? -20.018 7.409  25.374  1.00 16.56 ? 179 PHE A CG  1 
ATOM   1115 C  CD1 . PHE A 1 150 ? -19.723 7.733  26.684  1.00 16.66 ? 179 PHE A CD1 1 
ATOM   1116 C  CD2 . PHE A 1 150 ? -20.516 8.377  24.536  1.00 15.68 ? 179 PHE A CD2 1 
ATOM   1117 C  CE1 . PHE A 1 150 ? -19.890 9.024  27.142  1.00 17.24 ? 179 PHE A CE1 1 
ATOM   1118 C  CE2 . PHE A 1 150 ? -20.697 9.669  24.994  1.00 15.99 ? 179 PHE A CE2 1 
ATOM   1119 C  CZ  . PHE A 1 150 ? -20.396 9.987  26.296  1.00 17.38 ? 179 PHE A CZ  1 
ATOM   1120 N  N   . GLN A 1 151 ? -22.930 5.347  24.097  1.00 16.78 ? 180 GLN A N   1 
ATOM   1121 C  CA  . GLN A 1 151 ? -24.260 5.835  23.784  1.00 17.25 ? 180 GLN A CA  1 
ATOM   1122 C  C   . GLN A 1 151 ? -25.275 5.244  24.770  1.00 17.42 ? 180 GLN A C   1 
ATOM   1123 O  O   . GLN A 1 151 ? -26.237 5.902  25.147  1.00 14.93 ? 180 GLN A O   1 
ATOM   1124 C  CB  . GLN A 1 151 ? -24.620 5.480  22.349  1.00 18.39 ? 180 GLN A CB  1 
ATOM   1125 C  CG  . GLN A 1 151 ? -23.709 6.166  21.355  1.00 19.17 ? 180 GLN A CG  1 
ATOM   1126 C  CD  . GLN A 1 151 ? -23.874 5.593  19.974  1.00 18.79 ? 180 GLN A CD  1 
ATOM   1127 O  OE1 . GLN A 1 151 ? -24.451 4.520  19.770  1.00 18.49 ? 180 GLN A OE1 1 
ATOM   1128 N  NE2 . GLN A 1 151 ? -23.413 6.359  19.006  1.00 19.31 ? 180 GLN A NE2 1 
ATOM   1129 N  N   . GLU A 1 152 ? -25.043 4.019  25.228  1.00 18.86 ? 181 GLU A N   1 
ATOM   1130 C  CA  . GLU A 1 152 ? -25.948 3.432  26.223  1.00 21.31 ? 181 GLU A CA  1 
ATOM   1131 C  C   . GLU A 1 152 ? -25.908 4.289  27.501  1.00 20.06 ? 181 GLU A C   1 
ATOM   1132 O  O   . GLU A 1 152 ? -26.945 4.661  28.056  1.00 21.39 ? 181 GLU A O   1 
ATOM   1133 C  CB  . GLU A 1 152 ? -25.587 1.961  26.436  1.00 24.96 ? 181 GLU A CB  1 
ATOM   1134 C  CG  . GLU A 1 152 ? -26.458 1.271  27.468  1.00 29.93 ? 181 GLU A CG  1 
ATOM   1135 C  CD  . GLU A 1 152 ? -26.409 -0.251 27.466  1.00 32.36 ? 181 GLU A CD  1 
ATOM   1136 O  OE1 . GLU A 1 152 ? -25.812 -0.838 26.548  1.00 32.98 ? 181 GLU A OE1 1 
ATOM   1137 O  OE2 . GLU A 1 152 ? -27.009 -0.842 28.368  1.00 34.92 ? 181 GLU A OE2 1 
ATOM   1138 N  N   . ARG A 1 153 ? -24.716 4.670  27.918  1.00 18.88 ? 182 ARG A N   1 
ATOM   1139 C  CA  . ARG A 1 153 ? -24.532 5.499  29.110  1.00 19.06 ? 182 ARG A CA  1 
ATOM   1140 C  C   . ARG A 1 153 ? -25.218 6.861  28.910  1.00 17.60 ? 182 ARG A C   1 
ATOM   1141 O  O   . ARG A 1 153 ? -25.853 7.366  29.839  1.00 17.43 ? 182 ARG A O   1 
ATOM   1142 C  CB  . ARG A 1 153 ? -23.030 5.632  29.400  1.00 20.49 ? 182 ARG A CB  1 
ATOM   1143 C  CG  . ARG A 1 153 ? -22.392 4.311  29.824  1.00 22.45 ? 182 ARG A CG  1 
ATOM   1144 C  CD  . ARG A 1 153 ? -21.028 4.412  30.489  1.00 25.60 ? 182 ARG A CD  1 
ATOM   1145 N  NE  . ARG A 1 153 ? -20.072 5.254  29.786  1.00 27.61 ? 182 ARG A NE  1 
ATOM   1146 C  CZ  . ARG A 1 153 ? -19.007 4.831  29.100  1.00 29.48 ? 182 ARG A CZ  1 
ATOM   1147 N  NH1 . ARG A 1 153 ? -18.954 3.595  28.632  1.00 26.02 ? 182 ARG A NH1 1 
ATOM   1148 N  NH2 . ARG A 1 153 ? -18.000 5.676  28.896  1.00 29.91 ? 182 ARG A NH2 1 
ATOM   1149 N  N   . VAL A 1 154 ? -25.159 7.419  27.700  1.00 15.54 ? 183 VAL A N   1 
ATOM   1150 C  CA  . VAL A 1 154 ? -25.837 8.688  27.413  1.00 15.70 ? 183 VAL A CA  1 
ATOM   1151 C  C   . VAL A 1 154 ? -27.355 8.494  27.569  1.00 14.59 ? 183 VAL A C   1 
ATOM   1152 O  O   . VAL A 1 154 ? -28.010 9.325  28.184  1.00 14.19 ? 183 VAL A O   1 
ATOM   1153 C  CB  . VAL A 1 154 ? -25.479 9.238  26.019  1.00 15.75 ? 183 VAL A CB  1 
ATOM   1154 C  CG1 . VAL A 1 154 ? -26.342 10.437 25.633  1.00 16.62 ? 183 VAL A CG1 1 
ATOM   1155 C  CG2 . VAL A 1 154 ? -24.005 9.609  25.926  1.00 16.20 ? 183 VAL A CG2 1 
ATOM   1156 N  N   . LEU A 1 155 ? -27.912 7.440  26.993  1.00 15.00 ? 184 LEU A N   1 
ATOM   1157 C  CA  . LEU A 1 155 ? -29.369 7.229  27.085  1.00 16.60 ? 184 LEU A CA  1 
ATOM   1158 C  C   . LEU A 1 155 ? -29.785 7.100  28.565  1.00 15.09 ? 184 LEU A C   1 
ATOM   1159 O  O   . LEU A 1 155 ? -30.790 7.684  28.978  1.00 15.15 ? 184 LEU A O   1 
ATOM   1160 C  CB  . LEU A 1 155 ? -29.782 6.016  26.229  1.00 18.39 ? 184 LEU A CB  1 
ATOM   1161 C  CG  . LEU A 1 155 ? -30.257 6.324  24.800  1.00 20.06 ? 184 LEU A CG  1 
ATOM   1162 C  CD1 . LEU A 1 155 ? -29.187 7.004  23.981  1.00 21.31 ? 184 LEU A CD1 1 
ATOM   1163 C  CD2 . LEU A 1 155 ? -30.689 5.055  24.100  1.00 22.69 ? 184 LEU A CD2 1 
ATOM   1164 N  N   . ARG A 1 156 ? -29.024 6.355  29.385  1.00 15.04 ? 185 ARG A N   1 
ATOM   1165 C  CA  . ARG A 1 156 ? -29.385 6.160  30.769  1.00 14.41 ? 185 ARG A CA  1 
ATOM   1166 C  C   . ARG A 1 156 ? -29.263 7.494  31.511  1.00 14.17 ? 185 ARG A C   1 
ATOM   1167 O  O   . ARG A 1 156 ? -30.129 7.854  32.304  1.00 12.55 ? 185 ARG A O   1 
ATOM   1168 C  CB  . ARG A 1 156 ? -28.501 5.082  31.407  1.00 14.89 ? 185 ARG A CB  1 
ATOM   1169 C  CG  . ARG A 1 156 ? -28.729 3.695  30.815  1.00 15.26 ? 185 ARG A CG  1 
ATOM   1170 C  CD  . ARG A 1 156 ? -27.880 2.603  31.454  1.00 15.89 ? 185 ARG A CD  1 
ATOM   1171 N  NE  . ARG A 1 156 ? -28.072 1.288  30.825  1.00 15.92 ? 185 ARG A NE  1 
ATOM   1172 C  CZ  . ARG A 1 156 ? -29.177 0.545  30.921  1.00 16.80 ? 185 ARG A CZ  1 
ATOM   1173 N  NH1 . ARG A 1 156 ? -30.189 0.928  31.692  1.00 16.98 ? 185 ARG A NH1 1 
ATOM   1174 N  NH2 . ARG A 1 156 ? -29.277 -0.550 30.204  1.00 15.95 ? 185 ARG A NH2 1 
ATOM   1175 N  N   . ALA A 1 157 ? -28.190 8.240  31.236  1.00 13.67 ? 186 ALA A N   1 
ATOM   1176 C  CA  . ALA A 1 157 ? -28.024 9.525  31.890  1.00 14.15 ? 186 ALA A CA  1 
ATOM   1177 C  C   . ALA A 1 157 ? -29.162 10.474 31.461  1.00 14.75 ? 186 ALA A C   1 
ATOM   1178 O  O   . ALA A 1 157 ? -29.658 11.246 32.267  1.00 15.75 ? 186 ALA A O   1 
ATOM   1179 C  CB  . ALA A 1 157 ? -26.663 10.099 31.562  1.00 13.73 ? 186 ALA A CB  1 
ATOM   1180 N  N   . ALA A 1 158 ? -29.567 10.428 30.183  1.00 15.25 ? 187 ALA A N   1 
ATOM   1181 C  CA  . ALA A 1 158 ? -30.712 11.222 29.707  1.00 14.81 ? 187 ALA A CA  1 
ATOM   1182 C  C   . ALA A 1 158 ? -31.990 10.848 30.480  1.00 14.50 ? 187 ALA A C   1 
ATOM   1183 O  O   . ALA A 1 158 ? -32.705 11.736 30.946  1.00 14.30 ? 187 ALA A O   1 
ATOM   1184 C  CB  . ALA A 1 158 ? -30.911 11.005 28.233  1.00 14.35 ? 187 ALA A CB  1 
ATOM   1185 N  N   . ALA A 1 159 ? -32.293 9.542  30.596  1.00 15.34 ? 188 ALA A N   1 
ATOM   1186 C  CA  . ALA A 1 159 ? -33.465 9.093  31.335  1.00 15.27 ? 188 ALA A CA  1 
ATOM   1187 C  C   . ALA A 1 159 ? -33.419 9.649  32.766  1.00 16.57 ? 188 ALA A C   1 
ATOM   1188 O  O   . ALA A 1 159 ? -34.421 10.108 33.273  1.00 17.65 ? 188 ALA A O   1 
ATOM   1189 C  CB  . ALA A 1 159 ? -33.511 7.575  31.346  1.00 16.04 ? 188 ALA A CB  1 
ATOM   1190 N  N   . ARG A 1 160 ? -32.251 9.620  33.410  1.00 16.94 ? 189 ARG A N   1 
ATOM   1191 C  CA  . ARG A 1 160 ? -32.178 10.018 34.825  1.00 17.80 ? 189 ARG A CA  1 
ATOM   1192 C  C   . ARG A 1 160 ? -32.387 11.526 34.948  1.00 17.34 ? 189 ARG A C   1 
ATOM   1193 O  O   . ARG A 1 160 ? -33.124 11.979 35.827  1.00 18.16 ? 189 ARG A O   1 
ATOM   1194 C  CB  . ARG A 1 160 ? -30.858 9.564  35.460  1.00 18.73 ? 189 ARG A CB  1 
ATOM   1195 C  CG  . ARG A 1 160 ? -30.720 8.050  35.593  1.00 19.51 ? 189 ARG A CG  1 
ATOM   1196 C  CD  . ARG A 1 160 ? -29.391 7.593  36.171  1.00 20.34 ? 189 ARG A CD  1 
ATOM   1197 N  NE  . ARG A 1 160 ? -29.213 6.164  35.933  1.00 23.35 ? 189 ARG A NE  1 
ATOM   1198 C  CZ  . ARG A 1 160 ? -28.165 5.432  36.334  1.00 23.70 ? 189 ARG A CZ  1 
ATOM   1199 N  NH1 . ARG A 1 160 ? -27.179 5.993  37.009  1.00 25.35 ? 189 ARG A NH1 1 
ATOM   1200 N  NH2 . ARG A 1 160 ? -28.109 4.149  36.034  1.00 22.78 ? 189 ARG A NH2 1 
ATOM   1201 N  N   . ALA A 1 161 ? -31.775 12.291 34.049  1.00 16.46 ? 190 ALA A N   1 
ATOM   1202 C  CA  . ALA A 1 161 ? -32.018 13.739 34.000  1.00 16.02 ? 190 ALA A CA  1 
ATOM   1203 C  C   . ALA A 1 161 ? -33.506 14.046 33.773  1.00 15.02 ? 190 ALA A C   1 
ATOM   1204 O  O   . ALA A 1 161 ? -34.040 14.953 34.398  1.00 13.79 ? 190 ALA A O   1 
ATOM   1205 C  CB  . ALA A 1 161 ? -31.144 14.394 32.944  1.00 16.13 ? 190 ALA A CB  1 
ATOM   1206 N  N   . SER A 1 162 ? -34.148 13.357 32.831  1.00 15.51 ? 191 SER A N   1 
ATOM   1207 C  CA  . SER A 1 162 ? -35.582 13.547 32.569  1.00 15.55 ? 191 SER A CA  1 
ATOM   1208 C  C   . SER A 1 162 ? -36.414 13.226 33.826  1.00 17.02 ? 191 SER A C   1 
ATOM   1209 O  O   . SER A 1 162 ? -37.320 13.978 34.192  1.00 18.07 ? 191 SER A O   1 
ATOM   1210 C  CB  . SER A 1 162 ? -36.078 12.707 31.392  1.00 16.15 ? 191 SER A CB  1 
ATOM   1211 O  OG  . SER A 1 162 ? -37.465 12.944 31.141  1.00 15.97 ? 191 SER A OG  1 
ATOM   1212 N  N   . LEU A 1 163 ? -36.135 12.102 34.462  1.00 17.45 ? 192 LEU A N   1 
ATOM   1213 C  CA  . LEU A 1 163 ? -36.885 11.696 35.622  1.00 19.26 ? 192 LEU A CA  1 
ATOM   1214 C  C   . LEU A 1 163 ? -36.770 12.770 36.715  1.00 20.57 ? 192 LEU A C   1 
ATOM   1215 O  O   . LEU A 1 163 ? -37.737 13.047 37.417  1.00 19.12 ? 192 LEU A O   1 
ATOM   1216 C  CB  . LEU A 1 163 ? -36.344 10.342 36.092  1.00 19.91 ? 192 LEU A CB  1 
ATOM   1217 C  CG  . LEU A 1 163 ? -36.912 9.119  35.379  1.00 20.73 ? 192 LEU A CG  1 
ATOM   1218 C  CD1 . LEU A 1 163 ? -36.209 7.872  35.850  1.00 21.07 ? 192 LEU A CD1 1 
ATOM   1219 C  CD2 . LEU A 1 163 ? -38.420 8.987  35.566  1.00 21.18 ? 192 LEU A CD2 1 
ATOM   1220 N  N   . ALA A 1 164 ? -35.607 13.425 36.827  1.00 20.23 ? 193 ALA A N   1 
ATOM   1221 C  CA  . ALA A 1 164 ? -35.395 14.366 37.920  1.00 20.76 ? 193 ALA A CA  1 
ATOM   1222 C  C   . ALA A 1 164 ? -35.976 15.751 37.592  1.00 21.51 ? 193 ALA A C   1 
ATOM   1223 O  O   . ALA A 1 164 ? -36.175 16.540 38.483  1.00 20.01 ? 193 ALA A O   1 
ATOM   1224 C  CB  . ALA A 1 164 ? -33.916 14.433 38.253  1.00 21.02 ? 193 ALA A CB  1 
ATOM   1225 N  N   . THR A 1 165 ? -36.247 16.061 36.336  1.00 20.91 ? 194 THR A N   1 
ATOM   1226 C  CA  . THR A 1 165 ? -36.577 17.421 35.973  1.00 19.70 ? 194 THR A CA  1 
ATOM   1227 C  C   . THR A 1 165 ? -37.907 17.504 35.217  1.00 18.72 ? 194 THR A C   1 
ATOM   1228 O  O   . THR A 1 165 ? -38.458 18.578 35.098  1.00 17.42 ? 194 THR A O   1 
ATOM   1229 C  CB  . THR A 1 165 ? -35.487 18.012 35.080  1.00 19.76 ? 194 THR A CB  1 
ATOM   1230 O  OG1 . THR A 1 165 ? -35.412 17.175 33.922  1.00 20.07 ? 194 THR A OG1 1 
ATOM   1231 C  CG2 . THR A 1 165 ? -34.157 18.098 35.792  1.00 18.90 ? 194 THR A CG2 1 
ATOM   1232 N  N   . GLY A 1 166 ? -38.387 16.400 34.673  1.00 17.57 ? 195 GLY A N   1 
ATOM   1233 C  CA  . GLY A 1 166 ? -39.628 16.392 33.883  1.00 18.02 ? 195 GLY A CA  1 
ATOM   1234 C  C   . GLY A 1 166 ? -39.428 16.819 32.440  1.00 17.46 ? 195 GLY A C   1 
ATOM   1235 O  O   . GLY A 1 166 ? -40.350 16.746 31.646  1.00 17.33 ? 195 GLY A O   1 
ATOM   1236 N  N   . VAL A 1 167 ? -38.198 17.202 32.079  1.00 19.15 ? 196 VAL A N   1 
ATOM   1237 C  CA  . VAL A 1 167 ? -37.831 17.650 30.737  1.00 17.28 ? 196 VAL A CA  1 
ATOM   1238 C  C   . VAL A 1 167 ? -37.806 16.421 29.811  1.00 15.29 ? 196 VAL A C   1 
ATOM   1239 O  O   . VAL A 1 167 ? -37.288 15.372 30.189  1.00 15.59 ? 196 VAL A O   1 
ATOM   1240 C  CB  . VAL A 1 167 ? -36.476 18.385 30.833  1.00 20.18 ? 196 VAL A CB  1 
ATOM   1241 C  CG1 . VAL A 1 167 ? -35.704 18.407 29.532  1.00 21.81 ? 196 VAL A CG1 1 
ATOM   1242 C  CG2 . VAL A 1 167 ? -36.651 19.799 31.374  1.00 20.27 ? 196 VAL A CG2 1 
ATOM   1243 N  N   . PRO A 1 168 ? -38.347 16.530 28.585  1.00 13.74 ? 197 PRO A N   1 
ATOM   1244 C  CA  . PRO A 1 168 ? -38.408 15.375 27.669  1.00 13.62 ? 197 PRO A CA  1 
ATOM   1245 C  C   . PRO A 1 168 ? -37.086 15.015 26.959  1.00 12.75 ? 197 PRO A C   1 
ATOM   1246 O  O   . PRO A 1 168 ? -36.148 15.783 26.901  1.00 11.78 ? 197 PRO A O   1 
ATOM   1247 C  CB  . PRO A 1 168 ? -39.463 15.802 26.631  1.00 13.86 ? 197 PRO A CB  1 
ATOM   1248 C  CG  . PRO A 1 168 ? -39.277 17.307 26.540  1.00 14.62 ? 197 PRO A CG  1 
ATOM   1249 C  CD  . PRO A 1 168 ? -38.953 17.713 27.956  1.00 14.70 ? 197 PRO A CD  1 
ATOM   1250 N  N   . VAL A 1 169 ? -37.024 13.809 26.433  1.00 12.99 ? 198 VAL A N   1 
ATOM   1251 C  CA  . VAL A 1 169 ? -35.857 13.313 25.696  1.00 13.68 ? 198 VAL A CA  1 
ATOM   1252 C  C   . VAL A 1 169 ? -36.234 13.175 24.209  1.00 14.12 ? 198 VAL A C   1 
ATOM   1253 O  O   . VAL A 1 169 ? -37.316 12.682 23.912  1.00 14.00 ? 198 VAL A O   1 
ATOM   1254 C  CB  . VAL A 1 169 ? -35.406 11.956 26.268  1.00 13.62 ? 198 VAL A CB  1 
ATOM   1255 C  CG1 . VAL A 1 169 ? -34.215 11.371 25.509  1.00 14.17 ? 198 VAL A CG1 1 
ATOM   1256 C  CG2 . VAL A 1 169 ? -35.127 12.035 27.769  1.00 13.75 ? 198 VAL A CG2 1 
ATOM   1257 N  N   . THR A 1 170 ? -35.347 13.564 23.298  1.00 12.76 ? 199 THR A N   1 
ATOM   1258 C  CA  . THR A 1 170 ? -35.567 13.388 21.856  1.00 13.43 ? 199 THR A CA  1 
ATOM   1259 C  C   . THR A 1 170 ? -34.321 12.708 21.292  1.00 13.66 ? 199 THR A C   1 
ATOM   1260 O  O   . THR A 1 170 ? -33.228 12.953 21.806  1.00 13.31 ? 199 THR A O   1 
ATOM   1261 C  CB  . THR A 1 170 ? -35.871 14.733 21.183  1.00 13.81 ? 199 THR A CB  1 
ATOM   1262 O  OG1 . THR A 1 170 ? -36.412 14.528 19.876  1.00 14.64 ? 199 THR A OG1 1 
ATOM   1263 C  CG2 . THR A 1 170 ? -34.649 15.625 21.099  1.00 14.42 ? 199 THR A CG2 1 
ATOM   1264 N  N   . THR A 1 171 ? -34.477 11.826 20.304  1.00 13.14 ? 200 THR A N   1 
ATOM   1265 C  CA  . THR A 1 171 ? -33.380 10.940 19.896  1.00 12.82 ? 200 THR A CA  1 
ATOM   1266 C  C   . THR A 1 171 ? -33.071 11.079 18.403  1.00 12.53 ? 200 THR A C   1 
ATOM   1267 O  O   . THR A 1 171 ? -33.961 11.345 17.572  1.00 13.33 ? 200 THR A O   1 
ATOM   1268 C  CB  . THR A 1 171 ? -33.658 9.460  20.195  1.00 12.52 ? 200 THR A CB  1 
ATOM   1269 O  OG1 . THR A 1 171 ? -34.512 8.922  19.198  1.00 12.01 ? 200 THR A OG1 1 
ATOM   1270 C  CG2 . THR A 1 171 ? -34.327 9.216  21.527  1.00 13.84 ? 200 THR A CG2 1 
ATOM   1271 N  N   . HIS A 1 172 ? -31.785 10.911 18.102  1.00 11.45 ? 201 HIS A N   1 
ATOM   1272 C  CA  . HIS A 1 172 ? -31.309 10.568 16.780  1.00 11.55 ? 201 HIS A CA  1 
ATOM   1273 C  C   . HIS A 1 172 ? -31.323 9.035  16.661  1.00 12.08 ? 201 HIS A C   1 
ATOM   1274 O  O   . HIS A 1 172 ? -30.863 8.326  17.592  1.00 11.12 ? 201 HIS A O   1 
ATOM   1275 C  CB  . HIS A 1 172 ? -29.900 11.178 16.560  1.00 11.60 ? 201 HIS A CB  1 
ATOM   1276 C  CG  . HIS A 1 172 ? -29.226 10.728 15.312  1.00 11.84 ? 201 HIS A CG  1 
ATOM   1277 N  ND1 . HIS A 1 172 ? -29.051 11.553 14.227  1.00 11.11 ? 201 HIS A ND1 1 
ATOM   1278 C  CD2 . HIS A 1 172 ? -28.751 9.513  14.950  1.00 12.14 ? 201 HIS A CD2 1 
ATOM   1279 C  CE1 . HIS A 1 172 ? -28.446 10.879 13.272  1.00 11.74 ? 201 HIS A CE1 1 
ATOM   1280 N  NE2 . HIS A 1 172 ? -28.270 9.626  13.673  1.00 12.17 ? 201 HIS A NE2 1 
ATOM   1281 N  N   . THR A 1 173 ? -31.885 8.514  15.556  1.00 13.21 ? 202 THR A N   1 
ATOM   1282 C  CA  . THR A 1 173 ? -31.779 7.081  15.186  1.00 13.23 ? 202 THR A CA  1 
ATOM   1283 C  C   . THR A 1 173 ? -31.177 6.885  13.794  1.00 14.76 ? 202 THR A C   1 
ATOM   1284 O  O   . THR A 1 173 ? -31.272 7.738  12.927  1.00 14.13 ? 202 THR A O   1 
ATOM   1285 C  CB  . THR A 1 173 ? -33.138 6.381  15.174  1.00 12.65 ? 202 THR A CB  1 
ATOM   1286 O  OG1 . THR A 1 173 ? -34.050 6.910  14.204  1.00 12.35 ? 202 THR A OG1 1 
ATOM   1287 C  CG2 . THR A 1 173 ? -33.798 6.446  16.522  1.00 13.06 ? 202 THR A CG2 1 
ATOM   1288 N  N   . ASP A 1 174 ? -30.563 5.715  13.612  1.00 16.22 ? 203 ASP A N   1 
ATOM   1289 C  CA  . ASP A 1 174 ? -30.536 5.065  12.326  1.00 17.07 ? 203 ASP A CA  1 
ATOM   1290 C  C   . ASP A 1 174 ? -31.839 4.252  12.199  1.00 17.54 ? 203 ASP A C   1 
ATOM   1291 O  O   . ASP A 1 174 ? -31.955 3.126  12.667  1.00 17.97 ? 203 ASP A O   1 
ATOM   1292 C  CB  . ASP A 1 174 ? -29.283 4.201  12.130  1.00 17.86 ? 203 ASP A CB  1 
ATOM   1293 C  CG  . ASP A 1 174 ? -29.110 3.709  10.707  1.00 18.23 ? 203 ASP A CG  1 
ATOM   1294 O  OD1 . ASP A 1 174 ? -30.126 3.647  9.958   1.00 17.58 ? 203 ASP A OD1 1 
ATOM   1295 O  OD2 . ASP A 1 174 ? -27.974 3.422  10.354  1.00 17.45 ? 203 ASP A OD2 1 
ATOM   1296 N  N   . ALA A 1 175 ? -32.812 4.853  11.531  1.00 18.69 ? 204 ALA A N   1 
ATOM   1297 C  CA  . ALA A 1 175 ? -34.140 4.274  11.411  1.00 17.97 ? 204 ALA A CA  1 
ATOM   1298 C  C   . ALA A 1 175 ? -34.061 2.961  10.623  1.00 19.29 ? 204 ALA A C   1 
ATOM   1299 O  O   . ALA A 1 175 ? -34.813 2.023  10.927  1.00 17.61 ? 204 ALA A O   1 
ATOM   1300 C  CB  . ALA A 1 175 ? -35.074 5.252  10.775  1.00 17.29 ? 204 ALA A CB  1 
ATOM   1301 N  N   . SER A 1 176 ? -33.135 2.871  9.669   1.00 19.91 ? 205 SER A N   1 
ATOM   1302 C  CA  . SER A 1 176 ? -33.034 1.692  8.826   1.00 20.70 ? 205 SER A CA  1 
ATOM   1303 C  C   . SER A 1 176 ? -32.603 0.491  9.673   1.00 20.18 ? 205 SER A C   1 
ATOM   1304 O  O   . SER A 1 176 ? -32.805 -0.617 9.262   1.00 20.03 ? 205 SER A O   1 
ATOM   1305 C  CB  . SER A 1 176 ? -32.117 1.909  7.657   1.00 21.04 ? 205 SER A CB  1 
ATOM   1306 O  OG  . SER A 1 176 ? -30.760 1.913  8.081   1.00 24.46 ? 205 SER A OG  1 
ATOM   1307 N  N   . GLN A 1 177 ? -32.010 0.719  10.841  1.00 21.27 ? 206 GLN A N   1 
ATOM   1308 C  CA  . GLN A 1 177 ? -31.615 -0.378 11.739  1.00 20.00 ? 206 GLN A CA  1 
ATOM   1309 C  C   . GLN A 1 177 ? -32.568 -0.435 12.939  1.00 20.08 ? 206 GLN A C   1 
ATOM   1310 O  O   . GLN A 1 177 ? -32.254 -1.075 13.933  1.00 20.56 ? 206 GLN A O   1 
ATOM   1311 C  CB  . GLN A 1 177 ? -30.159 -0.205 12.177  1.00 20.52 ? 206 GLN A CB  1 
ATOM   1312 C  CG  . GLN A 1 177 ? -29.174 -0.167 11.011  1.00 21.10 ? 206 GLN A CG  1 
ATOM   1313 C  CD  . GLN A 1 177 ? -27.727 -0.221 11.444  1.00 21.84 ? 206 GLN A CD  1 
ATOM   1314 O  OE1 . GLN A 1 177 ? -27.268 -1.203 12.010  1.00 20.91 ? 206 GLN A OE1 1 
ATOM   1315 N  NE2 . GLN A 1 177 ? -26.967 0.820  11.146  1.00 22.34 ? 206 GLN A NE2 1 
ATOM   1316 N  N   . ARG A 1 178 ? -33.690 0.269  12.866  1.00 20.11 ? 207 ARG A N   1 
ATOM   1317 C  CA  . ARG A 1 178 ? -34.732 0.244  13.907  1.00 22.60 ? 207 ARG A CA  1 
ATOM   1318 C  C   . ARG A 1 178 ? -34.166 0.569  15.307  1.00 20.45 ? 207 ARG A C   1 
ATOM   1319 O  O   . ARG A 1 178 ? -34.555 -0.039 16.308  1.00 19.21 ? 207 ARG A O   1 
ATOM   1320 C  CB  . ARG A 1 178 ? -35.430 -1.123 13.900  1.00 25.35 ? 207 ARG A CB  1 
ATOM   1321 C  CG  . ARG A 1 178 ? -36.352 -1.346 12.711  1.00 29.85 ? 207 ARG A CG  1 
ATOM   1322 C  CD  . ARG A 1 178 ? -37.253 -2.571 12.863  1.00 35.77 ? 207 ARG A CD  1 
ATOM   1323 N  NE  . ARG A 1 178 ? -36.614 -3.758 12.318  1.00 43.29 ? 207 ARG A NE  1 
ATOM   1324 C  CZ  . ARG A 1 178 ? -36.413 -3.969 11.013  1.00 48.56 ? 207 ARG A CZ  1 
ATOM   1325 N  NH1 . ARG A 1 178 ? -36.948 -3.147 10.124  1.00 50.56 ? 207 ARG A NH1 1 
ATOM   1326 N  NH2 . ARG A 1 178 ? -35.654 -4.975 10.605  1.00 49.70 ? 207 ARG A NH2 1 
ATOM   1327 N  N   . ASP A 1 179 ? -33.316 1.576  15.404  1.00 18.64 ? 208 ASP A N   1 
ATOM   1328 C  CA  . ASP A 1 179 ? -32.670 1.917  16.670  1.00 17.93 ? 208 ASP A CA  1 
ATOM   1329 C  C   . ASP A 1 179 ? -33.689 2.193  17.785  1.00 18.34 ? 208 ASP A C   1 
ATOM   1330 O  O   . ASP A 1 179 ? -33.402 1.958  18.981  1.00 16.59 ? 208 ASP A O   1 
ATOM   1331 C  CB  . ASP A 1 179 ? -31.793 3.164  16.534  1.00 18.93 ? 208 ASP A CB  1 
ATOM   1332 C  CG  . ASP A 1 179 ? -30.529 2.981  15.700  1.00 18.91 ? 208 ASP A CG  1 
ATOM   1333 O  OD1 . ASP A 1 179 ? -30.343 1.876  15.148  1.00 17.57 ? 208 ASP A OD1 1 
ATOM   1334 O  OD2 . ASP A 1 179 ? -29.733 3.965  15.604  1.00 18.85 ? 208 ASP A OD2 1 
ATOM   1335 N  N   . GLY A 1 180 ? -34.845 2.756  17.435  1.00 15.88 ? 209 GLY A N   1 
ATOM   1336 C  CA  . GLY A 1 180 ? -35.798 3.135  18.434  1.00 16.60 ? 209 GLY A CA  1 
ATOM   1337 C  C   . GLY A 1 180 ? -36.235 1.984  19.343  1.00 16.60 ? 209 GLY A C   1 
ATOM   1338 O  O   . GLY A 1 180 ? -36.656 2.235  20.476  1.00 15.99 ? 209 GLY A O   1 
ATOM   1339 N  N   . GLU A 1 181 ? -36.136 0.741  18.865  1.00 17.70 ? 210 GLU A N   1 
ATOM   1340 C  CA  . GLU A 1 181 ? -36.491 -0.442 19.657  1.00 17.70 ? 210 GLU A CA  1 
ATOM   1341 C  C   . GLU A 1 181 ? -35.513 -0.550 20.834  1.00 18.06 ? 210 GLU A C   1 
ATOM   1342 O  O   . GLU A 1 181 ? -35.946 -0.591 21.979  1.00 19.21 ? 210 GLU A O   1 
ATOM   1343 C  CB  . GLU A 1 181 ? -36.542 -1.687 18.757  1.00 18.76 ? 210 GLU A CB  1 
ATOM   1344 C  CG  . GLU A 1 181 ? -37.912 -1.894 18.110  1.00 19.33 ? 210 GLU A CG  1 
ATOM   1345 C  CD  . GLU A 1 181 ? -37.977 -2.868 16.934  1.00 19.94 ? 210 GLU A CD  1 
ATOM   1346 O  OE1 . GLU A 1 181 ? -37.124 -3.730 16.851  1.00 20.31 ? 210 GLU A OE1 1 
ATOM   1347 O  OE2 . GLU A 1 181 ? -38.905 -2.761 16.115  1.00 21.16 ? 210 GLU A OE2 1 
ATOM   1348 N  N   . GLN A 1 182 ? -34.204 -0.538 20.566  1.00 17.93 ? 211 GLN A N   1 
ATOM   1349 C  CA  . GLN A 1 182 ? -33.213 -0.579 21.624  1.00 16.76 ? 211 GLN A CA  1 
ATOM   1350 C  C   . GLN A 1 182 ? -33.266 0.684  22.494  1.00 16.63 ? 211 GLN A C   1 
ATOM   1351 O  O   . GLN A 1 182 ? -33.049 0.613  23.696  1.00 14.82 ? 211 GLN A O   1 
ATOM   1352 C  CB  . GLN A 1 182 ? -31.801 -0.713 21.063  1.00 18.50 ? 211 GLN A CB  1 
ATOM   1353 C  CG  . GLN A 1 182 ? -30.817 -1.162 22.133  1.00 19.97 ? 211 GLN A CG  1 
ATOM   1354 C  CD  . GLN A 1 182 ? -29.388 -1.189 21.662  1.00 20.99 ? 211 GLN A CD  1 
ATOM   1355 O  OE1 . GLN A 1 182 ? -29.031 -0.530 20.681  1.00 23.31 ? 211 GLN A OE1 1 
ATOM   1356 N  NE2 . GLN A 1 182 ? -28.561 -1.930 22.379  1.00 19.56 ? 211 GLN A NE2 1 
ATOM   1357 N  N   . GLN A 1 183 ? -33.524 1.846  21.905  1.00 14.91 ? 212 GLN A N   1 
ATOM   1358 C  CA  . GLN A 1 183 ? -33.581 3.083  22.690  1.00 14.66 ? 212 GLN A CA  1 
ATOM   1359 C  C   . GLN A 1 183 ? -34.682 2.940  23.754  1.00 15.22 ? 212 GLN A C   1 
ATOM   1360 O  O   . GLN A 1 183 ? -34.450 3.174  24.970  1.00 14.13 ? 212 GLN A O   1 
ATOM   1361 C  CB  . GLN A 1 183 ? -33.806 4.290  21.773  1.00 14.30 ? 212 GLN A CB  1 
ATOM   1362 C  CG  . GLN A 1 183 ? -32.634 4.597  20.843  1.00 14.14 ? 212 GLN A CG  1 
ATOM   1363 C  CD  . GLN A 1 183 ? -32.831 5.847  20.020  1.00 14.33 ? 212 GLN A CD  1 
ATOM   1364 O  OE1 . GLN A 1 183 ? -33.926 6.397  19.952  1.00 14.15 ? 212 GLN A OE1 1 
ATOM   1365 N  NE2 . GLN A 1 183 ? -31.751 6.305  19.394  1.00 15.39 ? 212 GLN A NE2 1 
ATOM   1366 N  N   . ALA A 1 184 ? -35.834 2.454  23.293  1.00 15.78 ? 213 ALA A N   1 
ATOM   1367 C  CA  . ALA A 1 184 ? -37.032 2.220  24.121  1.00 17.14 ? 213 ALA A CA  1 
ATOM   1368 C  C   . ALA A 1 184 ? -36.716 1.268  25.284  1.00 18.38 ? 213 ALA A C   1 
ATOM   1369 O  O   . ALA A 1 184 ? -37.030 1.587  26.429  1.00 18.23 ? 213 ALA A O   1 
ATOM   1370 C  CB  . ALA A 1 184 ? -38.161 1.667  23.282  1.00 17.02 ? 213 ALA A CB  1 
ATOM   1371 N  N   . ASP A 1 185 ? -36.119 0.119  24.995  1.00 19.26 ? 214 ASP A N   1 
ATOM   1372 C  CA  . ASP A 1 185 ? -35.743 -0.863 26.060  1.00 19.49 ? 214 ASP A CA  1 
ATOM   1373 C  C   . ASP A 1 185 ? -34.817 -0.196 27.093  1.00 19.22 ? 214 ASP A C   1 
ATOM   1374 O  O   . ASP A 1 185 ? -35.056 -0.314 28.276  1.00 19.96 ? 214 ASP A O   1 
ATOM   1375 C  CB  . ASP A 1 185 ? -35.070 -2.110 25.482  1.00 21.51 ? 214 ASP A CB  1 
ATOM   1376 C  CG  . ASP A 1 185 ? -35.913 -2.926 24.514  1.00 21.42 ? 214 ASP A CG  1 
ATOM   1377 O  OD1 . ASP A 1 185 ? -37.133 -2.840 24.566  1.00 22.46 ? 214 ASP A OD1 1 
ATOM   1378 O  OD2 . ASP A 1 185 ? -35.315 -3.633 23.699  1.00 24.92 ? 214 ASP A OD2 1 
ATOM   1379 N  N   . ILE A 1 186 ? -33.783 0.524  26.664  1.00 16.88 ? 215 ILE A N   1 
ATOM   1380 C  CA  . ILE A 1 186 ? -32.872 1.148  27.606  1.00 17.46 ? 215 ILE A CA  1 
ATOM   1381 C  C   . ILE A 1 186 ? -33.638 2.181  28.455  1.00 18.01 ? 215 ILE A C   1 
ATOM   1382 O  O   . ILE A 1 186 ? -33.478 2.209  29.682  1.00 18.33 ? 215 ILE A O   1 
ATOM   1383 C  CB  . ILE A 1 186 ? -31.662 1.775  26.881  1.00 17.67 ? 215 ILE A CB  1 
ATOM   1384 C  CG1 . ILE A 1 186 ? -30.724 0.705  26.311  1.00 19.00 ? 215 ILE A CG1 1 
ATOM   1385 C  CG2 . ILE A 1 186 ? -30.918 2.735  27.799  1.00 16.82 ? 215 ILE A CG2 1 
ATOM   1386 C  CD1 . ILE A 1 186 ? -29.763 1.200  25.253  1.00 18.26 ? 215 ILE A CD1 1 
ATOM   1387 N  N   . PHE A 1 187 ? -34.428 3.071  27.828  1.00 17.49 ? 216 PHE A N   1 
ATOM   1388 C  CA  . PHE A 1 187 ? -35.163 4.086  28.587  1.00 18.15 ? 216 PHE A CA  1 
ATOM   1389 C  C   . PHE A 1 187 ? -36.116 3.423  29.598  1.00 20.45 ? 216 PHE A C   1 
ATOM   1390 O  O   . PHE A 1 187 ? -36.184 3.855  30.763  1.00 21.42 ? 216 PHE A O   1 
ATOM   1391 C  CB  . PHE A 1 187 ? -35.965 4.983  27.645  1.00 17.83 ? 216 PHE A CB  1 
ATOM   1392 C  CG  . PHE A 1 187 ? -35.159 5.884  26.741  1.00 16.82 ? 216 PHE A CG  1 
ATOM   1393 C  CD1 . PHE A 1 187 ? -34.079 6.608  27.223  1.00 16.51 ? 216 PHE A CD1 1 
ATOM   1394 C  CD2 . PHE A 1 187 ? -35.521 6.050  25.410  1.00 16.52 ? 216 PHE A CD2 1 
ATOM   1395 C  CE1 . PHE A 1 187 ? -33.357 7.446  26.381  1.00 17.07 ? 216 PHE A CE1 1 
ATOM   1396 C  CE2 . PHE A 1 187 ? -34.796 6.887  24.573  1.00 17.15 ? 216 PHE A CE2 1 
ATOM   1397 C  CZ  . PHE A 1 187 ? -33.725 7.599  25.062  1.00 16.04 ? 216 PHE A CZ  1 
ATOM   1398 N  N   . GLU A 1 188 ? -36.872 2.413  29.154  1.00 19.15 ? 217 GLU A N   1 
ATOM   1399 C  CA  . GLU A 1 188 ? -37.831 1.707  30.043  1.00 20.11 ? 217 GLU A CA  1 
ATOM   1400 C  C   . GLU A 1 188 ? -37.088 1.017  31.195  1.00 20.29 ? 217 GLU A C   1 
ATOM   1401 O  O   . GLU A 1 188 ? -37.576 1.016  32.323  1.00 18.83 ? 217 GLU A O   1 
ATOM   1402 C  CB  . GLU A 1 188 ? -38.661 0.683  29.263  1.00 20.06 ? 217 GLU A CB  1 
ATOM   1403 C  CG  . GLU A 1 188 ? -39.740 1.325  28.430  1.00 22.46 ? 217 GLU A CG  1 
ATOM   1404 C  CD  . GLU A 1 188 ? -40.365 0.446  27.367  1.00 22.67 ? 217 GLU A CD  1 
ATOM   1405 O  OE1 . GLU A 1 188 ? -40.502 -0.769 27.603  1.00 24.84 ? 217 GLU A OE1 1 
ATOM   1406 O  OE2 . GLU A 1 188 ? -40.710 0.979  26.311  1.00 23.60 ? 217 GLU A OE2 1 
ATOM   1407 N  N   . SER A 1 189 ? -35.910 0.463  30.920  1.00 20.83 ? 218 SER A N   1 
ATOM   1408 C  CA  . SER A 1 189 ? -35.087 -0.155 31.974  1.00 22.31 ? 218 SER A CA  1 
ATOM   1409 C  C   . SER A 1 189 ? -34.694 0.886  33.029  1.00 22.43 ? 218 SER A C   1 
ATOM   1410 O  O   . SER A 1 189 ? -34.378 0.514  34.156  1.00 21.57 ? 218 SER A O   1 
ATOM   1411 C  CB  . SER A 1 189 ? -33.848 -0.824 31.439  1.00 22.73 ? 218 SER A CB  1 
ATOM   1412 O  OG  . SER A 1 189 ? -32.846 0.141  31.146  1.00 21.50 ? 218 SER A OG  1 
ATOM   1413 N  N   . GLU A 1 190 ? -34.690 2.165  32.666  1.00 21.68 ? 219 GLU A N   1 
ATOM   1414 C  CA  . GLU A 1 190 ? -34.427 3.238  33.637  1.00 20.75 ? 219 GLU A CA  1 
ATOM   1415 C  C   . GLU A 1 190 ? -35.715 3.788  34.260  1.00 19.88 ? 219 GLU A C   1 
ATOM   1416 O  O   . GLU A 1 190 ? -35.624 4.772  34.986  1.00 19.73 ? 219 GLU A O   1 
ATOM   1417 C  CB  . GLU A 1 190 ? -33.645 4.368  32.962  1.00 22.31 ? 219 GLU A CB  1 
ATOM   1418 C  CG  . GLU A 1 190 ? -32.229 3.932  32.577  1.00 21.56 ? 219 GLU A CG  1 
ATOM   1419 C  CD  . GLU A 1 190 ? -31.241 3.895  33.740  1.00 21.52 ? 219 GLU A CD  1 
ATOM   1420 O  OE1 . GLU A 1 190 ? -31.434 4.671  34.717  1.00 22.16 ? 219 GLU A OE1 1 
ATOM   1421 O  OE2 . GLU A 1 190 ? -30.276 3.121  33.659  1.00 20.88 ? 219 GLU A OE2 1 
ATOM   1422 N  N   . GLY A 1 191 ? -36.889 3.212  33.942  1.00 20.23 ? 220 GLY A N   1 
ATOM   1423 C  CA  . GLY A 1 191 ? -38.203 3.630  34.483  1.00 20.16 ? 220 GLY A CA  1 
ATOM   1424 C  C   . GLY A 1 191 ? -38.743 4.925  33.863  1.00 20.97 ? 220 GLY A C   1 
ATOM   1425 O  O   . GLY A 1 191 ? -39.619 5.550  34.442  1.00 19.12 ? 220 GLY A O   1 
ATOM   1426 N  N   . LEU A 1 192 ? -38.231 5.365  32.704  1.00 20.16 ? 221 LEU A N   1 
ATOM   1427 C  CA  . LEU A 1 192 ? -38.750 6.597  32.069  1.00 19.68 ? 221 LEU A CA  1 
ATOM   1428 C  C   . LEU A 1 192 ? -40.048 6.276  31.307  1.00 19.64 ? 221 LEU A C   1 
ATOM   1429 O  O   . LEU A 1 192 ? -40.122 5.258  30.618  1.00 18.07 ? 221 LEU A O   1 
ATOM   1430 C  CB  . LEU A 1 192 ? -37.678 7.145  31.132  1.00 18.30 ? 221 LEU A CB  1 
ATOM   1431 C  CG  . LEU A 1 192 ? -37.989 8.475  30.444  1.00 18.42 ? 221 LEU A CG  1 
ATOM   1432 C  CD1 . LEU A 1 192 ? -38.070 9.616  31.447  1.00 17.55 ? 221 LEU A CD1 1 
ATOM   1433 C  CD2 . LEU A 1 192 ? -36.925 8.770  29.389  1.00 18.88 ? 221 LEU A CD2 1 
ATOM   1434 N  N   . ASP A 1 193 ? -41.053 7.138  31.432  1.00 20.15 ? 222 ASP A N   1 
ATOM   1435 C  CA  . ASP A 1 193 ? -42.290 6.944  30.670  1.00 22.21 ? 222 ASP A CA  1 
ATOM   1436 C  C   . ASP A 1 193 ? -42.030 7.276  29.192  1.00 20.60 ? 222 ASP A C   1 
ATOM   1437 O  O   . ASP A 1 193 ? -41.396 8.283  28.865  1.00 17.90 ? 222 ASP A O   1 
ATOM   1438 C  CB  . ASP A 1 193 ? -43.490 7.761  31.172  1.00 23.87 ? 222 ASP A CB  1 
ATOM   1439 C  CG  . ASP A 1 193 ? -44.796 7.262  30.546  1.00 25.52 ? 222 ASP A CG  1 
ATOM   1440 O  OD1 . ASP A 1 193 ? -45.219 6.141  30.889  1.00 29.53 ? 222 ASP A OD1 1 
ATOM   1441 O  OD2 . ASP A 1 193 ? -45.343 7.954  29.675  1.00 24.25 ? 222 ASP A OD2 1 
ATOM   1442 N  N   . PRO A 1 194 ? -42.517 6.403  28.309  1.00 20.84 ? 223 PRO A N   1 
ATOM   1443 C  CA  . PRO A 1 194 ? -42.409 6.587  26.878  1.00 20.02 ? 223 PRO A CA  1 
ATOM   1444 C  C   . PRO A 1 194 ? -42.996 7.929  26.414  1.00 19.65 ? 223 PRO A C   1 
ATOM   1445 O  O   . PRO A 1 194 ? -42.547 8.457  25.413  1.00 20.86 ? 223 PRO A O   1 
ATOM   1446 C  CB  . PRO A 1 194 ? -43.192 5.413  26.284  1.00 19.91 ? 223 PRO A CB  1 
ATOM   1447 C  CG  . PRO A 1 194 ? -42.952 4.308  27.272  1.00 20.65 ? 223 PRO A CG  1 
ATOM   1448 C  CD  . PRO A 1 194 ? -42.962 5.021  28.607  1.00 21.85 ? 223 PRO A CD  1 
ATOM   1449 N  N   . SER A 1 195 ? -43.970 8.481  27.131  1.00 18.89 ? 224 SER A N   1 
ATOM   1450 C  CA  . SER A 1 195 ? -44.588 9.736  26.698  1.00 19.28 ? 224 SER A CA  1 
ATOM   1451 C  C   . SER A 1 195 ? -43.590 10.890 26.879  1.00 17.67 ? 224 SER A C   1 
ATOM   1452 O  O   . SER A 1 195 ? -43.844 12.024 26.411  1.00 15.70 ? 224 SER A O   1 
ATOM   1453 C  CB  . SER A 1 195 ? -45.893 10.005 27.412  1.00 18.86 ? 224 SER A CB  1 
ATOM   1454 O  OG  . SER A 1 195 ? -45.631 10.216 28.785  1.00 19.93 ? 224 SER A OG  1 
ATOM   1455 N  N   . ARG A 1 196 ? -42.449 10.616 27.518  1.00 17.24 ? 225 ARG A N   1 
ATOM   1456 C  CA  . ARG A 1 196 ? -41.415 11.650 27.690  1.00 17.45 ? 225 ARG A CA  1 
ATOM   1457 C  C   . ARG A 1 196 ? -40.339 11.529 26.605  1.00 16.69 ? 225 ARG A C   1 
ATOM   1458 O  O   . ARG A 1 196 ? -39.333 12.262 26.677  1.00 15.79 ? 225 ARG A O   1 
ATOM   1459 C  CB  . ARG A 1 196 ? -40.818 11.547 29.100  1.00 18.73 ? 225 ARG A CB  1 
ATOM   1460 C  CG  . ARG A 1 196 ? -41.869 11.614 30.204  1.00 20.78 ? 225 ARG A CG  1 
ATOM   1461 C  CD  . ARG A 1 196 ? -42.888 12.740 29.982  1.00 22.11 ? 225 ARG A CD  1 
ATOM   1462 N  NE  . ARG A 1 196 ? -42.224 14.023 29.898  1.00 20.92 ? 225 ARG A NE  1 
ATOM   1463 C  CZ  . ARG A 1 196 ? -42.648 15.093 29.230  1.00 21.46 ? 225 ARG A CZ  1 
ATOM   1464 N  NH1 . ARG A 1 196 ? -43.723 15.044 28.470  1.00 20.86 ? 225 ARG A NH1 1 
ATOM   1465 N  NH2 . ARG A 1 196 ? -41.950 16.214 29.294  1.00 18.58 ? 225 ARG A NH2 1 
ATOM   1466 N  N   . VAL A 1 197 ? -40.564 10.662 25.608  1.00 15.34 ? 226 VAL A N   1 
ATOM   1467 C  CA  . VAL A 1 197 ? -39.530 10.291 24.618  1.00 15.43 ? 226 VAL A CA  1 
ATOM   1468 C  C   . VAL A 1 197 ? -40.082 10.423 23.193  1.00 16.53 ? 226 VAL A C   1 
ATOM   1469 O  O   . VAL A 1 197 ? -41.184 9.931  22.876  1.00 16.92 ? 226 VAL A O   1 
ATOM   1470 C  CB  . VAL A 1 197 ? -39.034 8.854  24.816  1.00 15.53 ? 226 VAL A CB  1 
ATOM   1471 C  CG1 . VAL A 1 197 ? -38.066 8.462  23.711  1.00 15.78 ? 226 VAL A CG1 1 
ATOM   1472 C  CG2 . VAL A 1 197 ? -38.448 8.630  26.204  1.00 16.30 ? 226 VAL A CG2 1 
ATOM   1473 N  N   . CYS A 1 198 ? -39.313 11.114 22.352  1.00 16.46 ? 227 CYS A N   1 
ATOM   1474 C  CA  . CYS A 1 198 ? -39.537 11.142 20.920  1.00 16.21 ? 227 CYS A CA  1 
ATOM   1475 C  C   . CYS A 1 198 ? -38.399 10.365 20.255  1.00 16.26 ? 227 CYS A C   1 
ATOM   1476 O  O   . CYS A 1 198 ? -37.223 10.679 20.517  1.00 15.39 ? 227 CYS A O   1 
ATOM   1477 C  CB  . CYS A 1 198 ? -39.548 12.566 20.382  1.00 16.45 ? 227 CYS A CB  1 
ATOM   1478 S  SG  . CYS A 1 198 ? -39.802 12.655 18.592  1.00 17.50 ? 227 CYS A SG  1 
ATOM   1479 N  N   . ILE A 1 199 ? -38.772 9.388  19.422  1.00 14.62 ? 228 ILE A N   1 
ATOM   1480 C  CA  . ILE A 1 199 ? -37.832 8.626  18.579  1.00 14.78 ? 228 ILE A CA  1 
ATOM   1481 C  C   . ILE A 1 199 ? -37.718 9.342  17.230  1.00 13.68 ? 228 ILE A C   1 
ATOM   1482 O  O   . ILE A 1 199 ? -38.617 9.273  16.384  1.00 12.41 ? 228 ILE A O   1 
ATOM   1483 C  CB  . ILE A 1 199 ? -38.315 7.162  18.408  1.00 14.93 ? 228 ILE A CB  1 
ATOM   1484 C  CG1 . ILE A 1 199 ? -38.608 6.499  19.757  1.00 14.60 ? 228 ILE A CG1 1 
ATOM   1485 C  CG2 . ILE A 1 199 ? -37.327 6.356  17.578  1.00 14.34 ? 228 ILE A CG2 1 
ATOM   1486 C  CD1 . ILE A 1 199 ? -37.432 6.471  20.688  1.00 14.58 ? 228 ILE A CD1 1 
ATOM   1487 N  N   . GLY A 1 200 ? -36.601 10.023 17.031  1.00 14.28 ? 229 GLY A N   1 
ATOM   1488 C  CA  . GLY A 1 200 ? -36.427 10.904 15.902  1.00 14.84 ? 229 GLY A CA  1 
ATOM   1489 C  C   . GLY A 1 200 ? -35.863 10.218 14.667  1.00 14.83 ? 229 GLY A C   1 
ATOM   1490 O  O   . GLY A 1 200 ? -35.439 9.028  14.653  1.00 15.98 ? 229 GLY A O   1 
ATOM   1491 N  N   . HIS A 1 201 ? -35.873 11.021 13.613  1.00 13.41 ? 230 HIS A N   1 
ATOM   1492 C  CA  . HIS A 1 201 ? -35.553 10.628 12.241  1.00 13.69 ? 230 HIS A CA  1 
ATOM   1493 C  C   . HIS A 1 201 ? -36.362 9.398  11.803  1.00 14.05 ? 230 HIS A C   1 
ATOM   1494 O  O   . HIS A 1 201 ? -35.891 8.607  10.946  1.00 13.83 ? 230 HIS A O   1 
ATOM   1495 C  CB  . HIS A 1 201 ? -34.043 10.398 12.057  1.00 12.80 ? 230 HIS A CB  1 
ATOM   1496 C  CG  . HIS A 1 201 ? -33.173 11.549 12.450  1.00 12.64 ? 230 HIS A CG  1 
ATOM   1497 N  ND1 . HIS A 1 201 ? -33.506 12.862 12.174  1.00 12.08 ? 230 HIS A ND1 1 
ATOM   1498 C  CD2 . HIS A 1 201 ? -31.965 11.578 13.072  1.00 12.48 ? 230 HIS A CD2 1 
ATOM   1499 C  CE1 . HIS A 1 201 ? -32.559 13.663 12.640  1.00 12.31 ? 230 HIS A CE1 1 
ATOM   1500 N  NE2 . HIS A 1 201 ? -31.594 12.894 13.190  1.00 12.79 ? 230 HIS A NE2 1 
ATOM   1501 N  N   . SER A 1 202 ? -37.577 9.254  12.333  1.00 13.96 ? 231 SER A N   1 
ATOM   1502 C  CA  . SER A 1 202 ? -38.395 8.064  12.064  1.00 14.72 ? 231 SER A CA  1 
ATOM   1503 C  C   . SER A 1 202 ? -38.962 8.111  10.638  1.00 14.81 ? 231 SER A C   1 
ATOM   1504 O  O   . SER A 1 202 ? -39.439 7.086  10.136  1.00 17.16 ? 231 SER A O   1 
ATOM   1505 C  CB  . SER A 1 202 ? -39.475 7.911  13.098  1.00 14.62 ? 231 SER A CB  1 
ATOM   1506 O  OG  . SER A 1 202 ? -38.910 7.438  14.324  1.00 13.94 ? 231 SER A OG  1 
ATOM   1507 N  N   . ASP A 1 203 ? -38.906 9.272  9.990   1.00 14.40 ? 232 ASP A N   1 
ATOM   1508 C  CA  . ASP A 1 203 ? -39.326 9.418  8.589   1.00 13.87 ? 232 ASP A CA  1 
ATOM   1509 C  C   . ASP A 1 203 ? -38.217 8.966  7.626   1.00 13.99 ? 232 ASP A C   1 
ATOM   1510 O  O   . ASP A 1 203 ? -38.398 8.974  6.398   1.00 13.20 ? 232 ASP A O   1 
ATOM   1511 C  CB  . ASP A 1 203 ? -39.761 10.858 8.294   1.00 13.91 ? 232 ASP A CB  1 
ATOM   1512 C  CG  . ASP A 1 203 ? -38.692 11.921 8.533   1.00 14.27 ? 232 ASP A CG  1 
ATOM   1513 O  OD1 . ASP A 1 203 ? -38.035 11.875 9.598   1.00 13.24 ? 232 ASP A OD1 1 
ATOM   1514 O  OD2 . ASP A 1 203 ? -38.557 12.819 7.659   1.00 16.09 ? 232 ASP A OD2 1 
ATOM   1515 N  N   . ASP A 1 204 ? -37.083 8.521  8.151   1.00 13.92 ? 233 ASP A N   1 
ATOM   1516 C  CA  . ASP A 1 204 ? -36.009 8.045  7.254   1.00 15.18 ? 233 ASP A CA  1 
ATOM   1517 C  C   . ASP A 1 204 ? -36.295 6.603  6.800   1.00 16.36 ? 233 ASP A C   1 
ATOM   1518 O  O   . ASP A 1 204 ? -35.565 6.095  6.011   1.00 16.86 ? 233 ASP A O   1 
ATOM   1519 C  CB  . ASP A 1 204 ? -34.631 8.056  7.903   1.00 14.31 ? 233 ASP A CB  1 
ATOM   1520 C  CG  . ASP A 1 204 ? -33.967 9.402  7.993   1.00 13.30 ? 233 ASP A CG  1 
ATOM   1521 O  OD1 . ASP A 1 204 ? -34.561 10.382 7.535   1.00 14.17 ? 233 ASP A OD1 1 
ATOM   1522 O  OD2 . ASP A 1 204 ? -32.913 9.460  8.598   1.00 12.49 ? 233 ASP A OD2 1 
ATOM   1523 N  N   . THR A 1 205 ? -37.305 5.972  7.370   1.00 18.27 ? 234 THR A N   1 
ATOM   1524 C  CA  . THR A 1 205 ? -37.691 4.582  7.081   1.00 19.62 ? 234 THR A CA  1 
ATOM   1525 C  C   . THR A 1 205 ? -39.142 4.606  6.587   1.00 20.14 ? 234 THR A C   1 
ATOM   1526 O  O   . THR A 1 205 ? -39.914 5.431  7.054   1.00 15.98 ? 234 THR A O   1 
ATOM   1527 C  CB  . THR A 1 205 ? -37.607 3.685  8.328   1.00 20.02 ? 234 THR A CB  1 
ATOM   1528 O  OG1 . THR A 1 205 ? -38.077 2.366  8.044   1.00 22.22 ? 234 THR A OG1 1 
ATOM   1529 C  CG2 . THR A 1 205 ? -38.458 4.155  9.499   1.00 19.88 ? 234 THR A CG2 1 
ATOM   1530 N  N   . ASP A 1 206 ? -39.506 3.661  5.709   1.00 21.52 ? 235 ASP A N   1 
ATOM   1531 C  CA  . ASP A 1 206 ? -40.922 3.421  5.351   1.00 24.01 ? 235 ASP A CA  1 
ATOM   1532 C  C   . ASP A 1 206 ? -41.500 2.219  6.130   1.00 25.12 ? 235 ASP A C   1 
ATOM   1533 O  O   . ASP A 1 206 ? -42.536 1.676  5.755   1.00 31.66 ? 235 ASP A O   1 
ATOM   1534 C  CB  . ASP A 1 206 ? -41.074 3.296  3.826   1.00 23.72 ? 235 ASP A CB  1 
ATOM   1535 C  CG  . ASP A 1 206 ? -41.025 4.641  3.106   1.00 23.38 ? 235 ASP A CG  1 
ATOM   1536 O  OD1 . ASP A 1 206 ? -41.579 5.605  3.643   1.00 23.98 ? 235 ASP A OD1 1 
ATOM   1537 O  OD2 . ASP A 1 206 ? -40.457 4.713  2.008   1.00 24.75 ? 235 ASP A OD2 1 
ATOM   1538 N  N   . ASP A 1 207 ? -40.958 1.904  7.290   1.00 24.17 ? 236 ASP A N   1 
ATOM   1539 C  CA  . ASP A 1 207 ? -41.338 0.729  8.055   1.00 22.73 ? 236 ASP A CA  1 
ATOM   1540 C  C   . ASP A 1 207 ? -42.459 1.054  9.050   1.00 20.94 ? 236 ASP A C   1 
ATOM   1541 O  O   . ASP A 1 207 ? -42.217 1.271  10.245  1.00 18.01 ? 236 ASP A O   1 
ATOM   1542 C  CB  . ASP A 1 207 ? -40.116 0.221  8.818   1.00 24.89 ? 236 ASP A CB  1 
ATOM   1543 C  CG  . ASP A 1 207 ? -40.224 -1.192 9.356   1.00 25.96 ? 236 ASP A CG  1 
ATOM   1544 O  OD1 . ASP A 1 207 ? -41.350 -1.692 9.485   1.00 25.86 ? 236 ASP A OD1 1 
ATOM   1545 O  OD2 . ASP A 1 207 ? -39.158 -1.764 9.674   1.00 33.41 ? 236 ASP A OD2 1 
ATOM   1546 N  N   . LEU A 1 208 ? -43.688 0.998  8.595   1.00 19.87 ? 237 LEU A N   1 
ATOM   1547 C  CA  . LEU A 1 208 ? -44.826 1.313  9.448   1.00 22.76 ? 237 LEU A CA  1 
ATOM   1548 C  C   . LEU A 1 208 ? -44.990 0.321  10.618  1.00 22.27 ? 237 LEU A C   1 
ATOM   1549 O  O   . LEU A 1 208 ? -45.427 0.711  11.685  1.00 20.83 ? 237 LEU A O   1 
ATOM   1550 C  CB  . LEU A 1 208 ? -46.075 1.328  8.578   1.00 25.47 ? 237 LEU A CB  1 
ATOM   1551 C  CG  . LEU A 1 208 ? -46.356 2.653  7.888   1.00 28.74 ? 237 LEU A CG  1 
ATOM   1552 C  CD1 . LEU A 1 208 ? -47.562 2.517  6.960   1.00 32.04 ? 237 LEU A CD1 1 
ATOM   1553 C  CD2 . LEU A 1 208 ? -46.578 3.743  8.932   1.00 30.03 ? 237 LEU A CD2 1 
ATOM   1554 N  N   . ASP A 1 209 ? -44.642 -0.945 10.449  1.00 21.19 ? 238 ASP A N   1 
ATOM   1555 C  CA  . ASP A 1 209 ? -44.759 -1.905 11.544  1.00 21.44 ? 238 ASP A CA  1 
ATOM   1556 C  C   . ASP A 1 209 ? -43.901 -1.454 12.731  1.00 19.58 ? 238 ASP A C   1 
ATOM   1557 O  O   . ASP A 1 209 ? -44.327 -1.514 13.863  1.00 18.86 ? 238 ASP A O   1 
ATOM   1558 C  CB  . ASP A 1 209 ? -44.303 -3.301 11.119  1.00 22.79 ? 238 ASP A CB  1 
ATOM   1559 C  CG  . ASP A 1 209 ? -45.319 -4.041 10.264  1.00 25.71 ? 238 ASP A CG  1 
ATOM   1560 O  OD1 . ASP A 1 209 ? -46.468 -3.552 10.127  1.00 25.85 ? 238 ASP A OD1 1 
ATOM   1561 O  OD2 . ASP A 1 209 ? -44.938 -5.091 9.740   1.00 27.95 ? 238 ASP A OD2 1 
ATOM   1562 N  N   . TYR A 1 210 ? -42.665 -1.079 12.434  1.00 18.48 ? 239 TYR A N   1 
ATOM   1563 C  CA  . TYR A 1 210 ? -41.723 -0.485 13.381  1.00 17.87 ? 239 TYR A CA  1 
ATOM   1564 C  C   . TYR A 1 210 ? -42.313 0.776  14.040  1.00 17.10 ? 239 TYR A C   1 
ATOM   1565 O  O   . TYR A 1 210 ? -42.349 0.867  15.268  1.00 18.71 ? 239 TYR A O   1 
ATOM   1566 C  CB  . TYR A 1 210 ? -40.427 -0.199 12.614  1.00 18.16 ? 239 TYR A CB  1 
ATOM   1567 C  CG  . TYR A 1 210 ? -39.442 0.737  13.264  1.00 18.08 ? 239 TYR A CG  1 
ATOM   1568 C  CD1 . TYR A 1 210 ? -38.828 0.399  14.459  1.00 18.92 ? 239 TYR A CD1 1 
ATOM   1569 C  CD2 . TYR A 1 210 ? -39.067 1.933  12.657  1.00 18.37 ? 239 TYR A CD2 1 
ATOM   1570 C  CE1 . TYR A 1 210 ? -37.918 1.247  15.074  1.00 18.32 ? 239 TYR A CE1 1 
ATOM   1571 C  CE2 . TYR A 1 210 ? -38.134 2.775  13.248  1.00 17.90 ? 239 TYR A CE2 1 
ATOM   1572 C  CZ  . TYR A 1 210 ? -37.562 2.430  14.463  1.00 17.74 ? 239 TYR A CZ  1 
ATOM   1573 O  OH  . TYR A 1 210 ? -36.649 3.219  15.105  1.00 17.19 ? 239 TYR A OH  1 
ATOM   1574 N  N   . LEU A 1 211 ? -42.770 1.746  13.259  1.00 16.90 ? 240 LEU A N   1 
ATOM   1575 C  CA  . LEU A 1 211 ? -43.263 3.005  13.815  1.00 18.35 ? 240 LEU A CA  1 
ATOM   1576 C  C   . LEU A 1 211 ? -44.547 2.785  14.623  1.00 18.54 ? 240 LEU A C   1 
ATOM   1577 O  O   . LEU A 1 211 ? -44.656 3.336  15.691  1.00 18.65 ? 240 LEU A O   1 
ATOM   1578 C  CB  . LEU A 1 211 ? -43.525 3.997  12.682  1.00 20.01 ? 240 LEU A CB  1 
ATOM   1579 C  CG  . LEU A 1 211 ? -42.309 4.334  11.813  1.00 21.80 ? 240 LEU A CG  1 
ATOM   1580 C  CD1 . LEU A 1 211 ? -42.674 5.345  10.726  1.00 24.92 ? 240 LEU A CD1 1 
ATOM   1581 C  CD2 . LEU A 1 211 ? -41.170 4.845  12.667  1.00 21.04 ? 240 LEU A CD2 1 
ATOM   1582 N  N   . THR A 1 212 ? -45.508 2.010  14.115  1.00 16.68 ? 241 THR A N   1 
ATOM   1583 C  CA  . THR A 1 212 ? -46.782 1.806  14.866  1.00 18.79 ? 241 THR A CA  1 
ATOM   1584 C  C   . THR A 1 212 ? -46.525 1.066  16.190  1.00 18.36 ? 241 THR A C   1 
ATOM   1585 O  O   . THR A 1 212 ? -47.194 1.367  17.149  1.00 20.25 ? 241 THR A O   1 
ATOM   1586 C  CB  . THR A 1 212 ? -47.882 1.128  14.022  1.00 19.49 ? 241 THR A CB  1 
ATOM   1587 O  OG1 . THR A 1 212 ? -47.411 -0.153 13.612  1.00 19.39 ? 241 THR A OG1 1 
ATOM   1588 C  CG2 . THR A 1 212 ? -48.275 1.950  12.810  1.00 19.31 ? 241 THR A CG2 1 
ATOM   1589 N  N   . ALA A 1 213 ? -45.561 0.141  16.251  1.00 18.60 ? 242 ALA A N   1 
ATOM   1590 C  CA  . ALA A 1 213 ? -45.243 -0.629 17.467  1.00 19.49 ? 242 ALA A CA  1 
ATOM   1591 C  C   . ALA A 1 213 ? -44.694 0.301  18.562  1.00 19.55 ? 242 ALA A C   1 
ATOM   1592 O  O   . ALA A 1 213 ? -45.066 0.152  19.717  1.00 18.57 ? 242 ALA A O   1 
ATOM   1593 C  CB  . ALA A 1 213 ? -44.259 -1.749 17.145  1.00 20.59 ? 242 ALA A CB  1 
ATOM   1594 N  N   . LEU A 1 214 ? -43.855 1.285  18.203  1.00 18.48 ? 243 LEU A N   1 
ATOM   1595 C  CA  . LEU A 1 214 ? -43.366 2.257  19.187  1.00 18.39 ? 243 LEU A CA  1 
ATOM   1596 C  C   . LEU A 1 214 ? -44.508 3.170  19.623  1.00 17.15 ? 243 LEU A C   1 
ATOM   1597 O  O   . LEU A 1 214 ? -44.647 3.430  20.784  1.00 17.77 ? 243 LEU A O   1 
ATOM   1598 C  CB  . LEU A 1 214 ? -42.227 3.083  18.579  1.00 19.98 ? 243 LEU A CB  1 
ATOM   1599 C  CG  . LEU A 1 214 ? -40.986 2.281  18.180  1.00 21.18 ? 243 LEU A CG  1 
ATOM   1600 C  CD1 . LEU A 1 214 ? -40.050 3.123  17.319  1.00 21.23 ? 243 LEU A CD1 1 
ATOM   1601 C  CD2 . LEU A 1 214 ? -40.260 1.761  19.416  1.00 22.91 ? 243 LEU A CD2 1 
ATOM   1602 N  N   . ALA A 1 215 ? -45.315 3.638  18.684  1.00 17.04 ? 244 ALA A N   1 
ATOM   1603 C  CA  . ALA A 1 215 ? -46.454 4.500  19.013  1.00 18.89 ? 244 ALA A CA  1 
ATOM   1604 C  C   . ALA A 1 215 ? -47.407 3.767  19.976  1.00 19.87 ? 244 ALA A C   1 
ATOM   1605 O  O   . ALA A 1 215 ? -47.872 4.352  20.963  1.00 20.22 ? 244 ALA A O   1 
ATOM   1606 C  CB  . ALA A 1 215 ? -47.182 4.902  17.756  1.00 18.00 ? 244 ALA A CB  1 
ATOM   1607 N  N   . ALA A 1 216 ? -47.685 2.500  19.685  1.00 21.40 ? 245 ALA A N   1 
ATOM   1608 C  CA  . ALA A 1 216 ? -48.491 1.611  20.590  1.00 22.11 ? 245 ALA A CA  1 
ATOM   1609 C  C   . ALA A 1 216 ? -47.900 1.597  22.015  1.00 24.04 ? 245 ALA A C   1 
ATOM   1610 O  O   . ALA A 1 216 ? -48.637 1.472  22.980  1.00 25.20 ? 245 ALA A O   1 
ATOM   1611 C  CB  . ALA A 1 216 ? -48.566 0.217  20.006  1.00 21.14 ? 245 ALA A CB  1 
ATOM   1612 N  N   . ARG A 1 217 ? -46.584 1.735  22.174  1.00 23.67 ? 246 ARG A N   1 
ATOM   1613 C  CA  . ARG A 1 217 ? -45.999 1.689  23.501  1.00 22.14 ? 246 ARG A CA  1 
ATOM   1614 C  C   . ARG A 1 217 ? -45.989 3.094  24.119  1.00 21.28 ? 246 ARG A C   1 
ATOM   1615 O  O   . ARG A 1 217 ? -45.543 3.232  25.236  1.00 21.15 ? 246 ARG A O   1 
ATOM   1616 C  CB  . ARG A 1 217 ? -44.593 1.082  23.458  1.00 24.02 ? 246 ARG A CB  1 
ATOM   1617 C  CG  . ARG A 1 217 ? -44.523 -0.321 22.872  1.00 23.27 ? 246 ARG A CG  1 
ATOM   1618 C  CD  . ARG A 1 217 ? -43.118 -0.654 22.399  1.00 23.92 ? 246 ARG A CD  1 
ATOM   1619 N  NE  . ARG A 1 217 ? -42.128 -0.650 23.482  1.00 24.02 ? 246 ARG A NE  1 
ATOM   1620 C  CZ  . ARG A 1 217 ? -40.867 -1.099 23.409  1.00 23.65 ? 246 ARG A CZ  1 
ATOM   1621 N  NH1 . ARG A 1 217 ? -40.363 -1.558 22.274  1.00 23.47 ? 246 ARG A NH1 1 
ATOM   1622 N  NH2 . ARG A 1 217 ? -40.094 -1.046 24.485  1.00 22.61 ? 246 ARG A NH2 1 
ATOM   1623 N  N   . GLY A 1 218 ? -46.477 4.114  23.409  1.00 19.90 ? 247 GLY A N   1 
ATOM   1624 C  CA  . GLY A 1 218 ? -46.664 5.472  23.971  1.00 19.48 ? 247 GLY A CA  1 
ATOM   1625 C  C   . GLY A 1 218 ? -45.585 6.469  23.546  1.00 18.78 ? 247 GLY A C   1 
ATOM   1626 O  O   . GLY A 1 218 ? -45.564 7.654  24.023  1.00 18.34 ? 247 GLY A O   1 
ATOM   1627 N  N   . TYR A 1 219 ? -44.665 6.030  22.679  1.00 17.27 ? 248 TYR A N   1 
ATOM   1628 C  CA  . TYR A 1 219 ? -43.579 6.911  22.250  1.00 16.94 ? 248 TYR A CA  1 
ATOM   1629 C  C   . TYR A 1 219 ? -44.131 7.952  21.269  1.00 16.47 ? 248 TYR A C   1 
ATOM   1630 O  O   . TYR A 1 219 ? -45.117 7.685  20.535  1.00 16.04 ? 248 TYR A O   1 
ATOM   1631 C  CB  . TYR A 1 219 ? -42.434 6.095  21.644  1.00 17.50 ? 248 TYR A CB  1 
ATOM   1632 C  CG  . TYR A 1 219 ? -41.663 5.327  22.684  1.00 18.55 ? 248 TYR A CG  1 
ATOM   1633 C  CD1 . TYR A 1 219 ? -40.719 5.972  23.465  1.00 18.08 ? 248 TYR A CD1 1 
ATOM   1634 C  CD2 . TYR A 1 219 ? -41.905 3.989  22.927  1.00 18.48 ? 248 TYR A CD2 1 
ATOM   1635 C  CE1 . TYR A 1 219 ? -40.010 5.297  24.440  1.00 17.23 ? 248 TYR A CE1 1 
ATOM   1636 C  CE2 . TYR A 1 219 ? -41.199 3.298  23.898  1.00 18.40 ? 248 TYR A CE2 1 
ATOM   1637 C  CZ  . TYR A 1 219 ? -40.257 3.960  24.662  1.00 18.12 ? 248 TYR A CZ  1 
ATOM   1638 O  OH  . TYR A 1 219 ? -39.578 3.323  25.660  1.00 18.60 ? 248 TYR A OH  1 
ATOM   1639 N  N   . LEU A 1 220 ? -43.513 9.126  21.290  1.00 15.93 ? 249 LEU A N   1 
ATOM   1640 C  CA  . LEU A 1 220 ? -43.727 10.076 20.259  1.00 16.49 ? 249 LEU A CA  1 
ATOM   1641 C  C   . LEU A 1 220 ? -42.778 9.742  19.102  1.00 16.72 ? 249 LEU A C   1 
ATOM   1642 O  O   . LEU A 1 220 ? -41.677 9.241  19.304  1.00 18.04 ? 249 LEU A O   1 
ATOM   1643 C  CB  . LEU A 1 220 ? -43.562 11.480 20.837  1.00 17.72 ? 249 LEU A CB  1 
ATOM   1644 C  CG  . LEU A 1 220 ? -44.770 11.927 21.663  1.00 19.23 ? 249 LEU A CG  1 
ATOM   1645 C  CD1 . LEU A 1 220 ? -44.673 11.439 23.107  1.00 19.31 ? 249 LEU A CD1 1 
ATOM   1646 C  CD2 . LEU A 1 220 ? -44.921 13.425 21.610  1.00 22.11 ? 249 LEU A CD2 1 
ATOM   1647 N  N   . ILE A 1 221 ? -43.287 9.922  17.890  1.00 15.85 ? 250 ILE A N   1 
ATOM   1648 C  CA  . ILE A 1 221 ? -42.603 9.545  16.673  1.00 15.43 ? 250 ILE A CA  1 
ATOM   1649 C  C   . ILE A 1 221 ? -42.223 10.832 15.947  1.00 15.63 ? 250 ILE A C   1 
ATOM   1650 O  O   . ILE A 1 221 ? -43.091 11.621 15.573  1.00 14.00 ? 250 ILE A O   1 
ATOM   1651 C  CB  . ILE A 1 221 ? -43.490 8.666  15.763  1.00 15.94 ? 250 ILE A CB  1 
ATOM   1652 C  CG1 . ILE A 1 221 ? -44.120 7.480  16.514  1.00 15.10 ? 250 ILE A CG1 1 
ATOM   1653 C  CG2 . ILE A 1 221 ? -42.697 8.232  14.538  1.00 15.80 ? 250 ILE A CG2 1 
ATOM   1654 C  CD1 . ILE A 1 221 ? -43.140 6.551  17.149  1.00 15.15 ? 250 ILE A CD1 1 
ATOM   1655 N  N   . GLY A 1 222 ? -40.923 11.001 15.758  1.00 14.21 ? 251 GLY A N   1 
ATOM   1656 C  CA  . GLY A 1 222 ? -40.408 12.232 15.206  1.00 13.71 ? 251 GLY A CA  1 
ATOM   1657 C  C   . GLY A 1 222 ? -40.251 12.116 13.704  1.00 12.27 ? 251 GLY A C   1 
ATOM   1658 O  O   . GLY A 1 222 ? -39.278 11.525 13.244  1.00 11.84 ? 251 GLY A O   1 
ATOM   1659 N  N   . LEU A 1 223 ? -41.198 12.686 12.951  1.00 12.11 ? 252 LEU A N   1 
ATOM   1660 C  CA  . LEU A 1 223 ? -41.102 12.702 11.491  1.00 12.29 ? 252 LEU A CA  1 
ATOM   1661 C  C   . LEU A 1 223 ? -40.515 14.077 11.149  1.00 12.08 ? 252 LEU A C   1 
ATOM   1662 O  O   . LEU A 1 223 ? -41.246 15.052 10.946  1.00 11.19 ? 252 LEU A O   1 
ATOM   1663 C  CB  . LEU A 1 223 ? -42.479 12.429 10.859  1.00 12.69 ? 252 LEU A CB  1 
ATOM   1664 C  CG  . LEU A 1 223 ? -43.184 11.133 11.308  1.00 13.46 ? 252 LEU A CG  1 
ATOM   1665 C  CD1 . LEU A 1 223 ? -44.562 10.975 10.677  1.00 13.95 ? 252 LEU A CD1 1 
ATOM   1666 C  CD2 . LEU A 1 223 ? -42.371 9.896  11.003  1.00 14.34 ? 252 LEU A CD2 1 
ATOM   1667 N  N   . ASP A 1 224 ? -39.186 14.145 11.153  1.00 12.84 ? 253 ASP A N   1 
ATOM   1668 C  CA  . ASP A 1 224 ? -38.494 15.431 11.398  1.00 13.99 ? 253 ASP A CA  1 
ATOM   1669 C  C   . ASP A 1 224 ? -37.627 15.866 10.217  1.00 14.11 ? 253 ASP A C   1 
ATOM   1670 O  O   . ASP A 1 224 ? -36.933 16.899 10.337  1.00 14.97 ? 253 ASP A O   1 
ATOM   1671 C  CB  . ASP A 1 224 ? -37.662 15.342 12.682  1.00 14.74 ? 253 ASP A CB  1 
ATOM   1672 C  CG  . ASP A 1 224 ? -36.667 14.206 12.734  1.00 15.43 ? 253 ASP A CG  1 
ATOM   1673 O  OD1 . ASP A 1 224 ? -36.048 13.942 11.686  1.00 16.05 ? 253 ASP A OD1 1 
ATOM   1674 O  OD2 . ASP A 1 224 ? -36.492 13.631 13.832  1.00 15.51 ? 253 ASP A OD2 1 
ATOM   1675 N  N   . GLY A 1 225 ? -37.640 15.129 9.106   1.00 12.99 ? 254 GLY A N   1 
ATOM   1676 C  CA  . GLY A 1 225 ? -36.808 15.486 7.954   1.00 13.14 ? 254 GLY A CA  1 
ATOM   1677 C  C   . GLY A 1 225 ? -37.591 15.539 6.656   1.00 12.72 ? 254 GLY A C   1 
ATOM   1678 O  O   . GLY A 1 225 ? -37.091 15.113 5.613   1.00 11.58 ? 254 GLY A O   1 
ATOM   1679 N  N   . ILE A 1 226 ? -38.816 16.081 6.681   1.00 12.75 ? 255 ILE A N   1 
ATOM   1680 C  CA  . ILE A 1 226 ? -39.755 15.907 5.526   1.00 12.73 ? 255 ILE A CA  1 
ATOM   1681 C  C   . ILE A 1 226 ? -39.162 16.472 4.213   1.00 12.69 ? 255 ILE A C   1 
ATOM   1682 O  O   . ILE A 1 226 ? -39.288 15.838 3.151   1.00 12.37 ? 255 ILE A O   1 
ATOM   1683 C  CB  . ILE A 1 226 ? -41.144 16.505 5.840   1.00 12.87 ? 255 ILE A CB  1 
ATOM   1684 C  CG1 . ILE A 1 226 ? -41.664 16.062 7.213   1.00 13.08 ? 255 ILE A CG1 1 
ATOM   1685 C  CG2 . ILE A 1 226 ? -42.132 16.158 4.732   1.00 13.10 ? 255 ILE A CG2 1 
ATOM   1686 C  CD1 . ILE A 1 226 ? -41.801 14.546 7.362   1.00 13.77 ? 255 ILE A CD1 1 
ATOM   1687 N  N   . PRO A 1 227 ? -38.477 17.638 4.244   1.00 12.75 ? 256 PRO A N   1 
ATOM   1688 C  CA  . PRO A 1 227 ? -37.969 18.148 2.968   1.00 12.21 ? 256 PRO A CA  1 
ATOM   1689 C  C   . PRO A 1 227 ? -36.655 17.505 2.484   1.00 12.32 ? 256 PRO A C   1 
ATOM   1690 O  O   . PRO A 1 227 ? -36.087 17.919 1.433   1.00 12.01 ? 256 PRO A O   1 
ATOM   1691 C  CB  . PRO A 1 227 ? -37.765 19.645 3.234   1.00 12.69 ? 256 PRO A CB  1 
ATOM   1692 C  CG  . PRO A 1 227 ? -37.434 19.730 4.704   1.00 13.11 ? 256 PRO A CG  1 
ATOM   1693 C  CD  . PRO A 1 227 ? -38.179 18.570 5.345   1.00 12.79 ? 256 PRO A CD  1 
ATOM   1694 N  N   . TRP A 1 228 ? -36.127 16.552 3.252   1.00 11.92 ? 257 TRP A N   1 
ATOM   1695 C  CA  . TRP A 1 228 ? -34.831 15.938 2.947   1.00 13.60 ? 257 TRP A CA  1 
ATOM   1696 C  C   . TRP A 1 228 ? -34.953 14.942 1.796   1.00 13.99 ? 257 TRP A C   1 
ATOM   1697 O  O   . TRP A 1 228 ? -35.514 13.851 1.981   1.00 14.31 ? 257 TRP A O   1 
ATOM   1698 C  CB  . TRP A 1 228 ? -34.261 15.247 4.193   1.00 13.43 ? 257 TRP A CB  1 
ATOM   1699 C  CG  . TRP A 1 228 ? -33.687 16.202 5.192   1.00 14.05 ? 257 TRP A CG  1 
ATOM   1700 C  CD1 . TRP A 1 228 ? -34.235 17.374 5.622   1.00 15.17 ? 257 TRP A CD1 1 
ATOM   1701 C  CD2 . TRP A 1 228 ? -32.443 16.063 5.891   1.00 14.53 ? 257 TRP A CD2 1 
ATOM   1702 N  NE1 . TRP A 1 228 ? -33.407 17.979 6.533   1.00 15.70 ? 257 TRP A NE1 1 
ATOM   1703 C  CE2 . TRP A 1 228 ? -32.297 17.199 6.714   1.00 15.13 ? 257 TRP A CE2 1 
ATOM   1704 C  CE3 . TRP A 1 228 ? -31.446 15.083 5.903   1.00 14.77 ? 257 TRP A CE3 1 
ATOM   1705 C  CZ2 . TRP A 1 228 ? -31.192 17.372 7.555   1.00 14.90 ? 257 TRP A CZ2 1 
ATOM   1706 C  CZ3 . TRP A 1 228 ? -30.350 15.260 6.711   1.00 15.10 ? 257 TRP A CZ3 1 
ATOM   1707 C  CH2 . TRP A 1 228 ? -30.223 16.399 7.511   1.00 14.96 ? 257 TRP A CH2 1 
ATOM   1708 N  N   . SER A 1 229 ? -34.342 15.280 0.658   1.00 14.70 ? 258 SER A N   1 
ATOM   1709 C  CA  . SER A 1 229 ? -34.392 14.438 -0.547  1.00 14.77 ? 258 SER A CA  1 
ATOM   1710 C  C   . SER A 1 229 ? -33.285 14.855 -1.515  1.00 15.94 ? 258 SER A C   1 
ATOM   1711 O  O   . SER A 1 229 ? -33.155 16.072 -1.787  1.00 15.56 ? 258 SER A O   1 
ATOM   1712 C  CB  . SER A 1 229 ? -35.732 14.539 -1.237  1.00 15.00 ? 258 SER A CB  1 
ATOM   1713 O  OG  . SER A 1 229 ? -35.703 13.823 -2.469  1.00 15.58 ? 258 SER A OG  1 
ATOM   1714 N  N   . ALA A 1 230 ? -32.547 13.852 -2.030  1.00 15.07 ? 259 ALA A N   1 
ATOM   1715 C  CA  . ALA A 1 230 ? -31.535 14.024 -3.094  1.00 15.81 ? 259 ALA A CA  1 
ATOM   1716 C  C   . ALA A 1 230 ? -32.068 13.580 -4.471  1.00 17.24 ? 259 ALA A C   1 
ATOM   1717 O  O   . ALA A 1 230 ? -31.276 13.454 -5.448  1.00 15.83 ? 259 ALA A O   1 
ATOM   1718 C  CB  . ALA A 1 230 ? -30.280 13.255 -2.739  1.00 15.70 ? 259 ALA A CB  1 
ATOM   1719 N  N   . ILE A 1 231 ? -33.384 13.320 -4.579  1.00 18.61 ? 260 ILE A N   1 
ATOM   1720 C  CA  . ILE A 1 231 ? -33.969 12.996 -5.902  1.00 19.67 ? 260 ILE A CA  1 
ATOM   1721 C  C   . ILE A 1 231 ? -33.756 14.205 -6.810  1.00 21.26 ? 260 ILE A C   1 
ATOM   1722 O  O   . ILE A 1 231 ? -34.059 15.369 -6.441  1.00 19.58 ? 260 ILE A O   1 
ATOM   1723 C  CB  . ILE A 1 231 ? -35.465 12.633 -5.836  1.00 20.18 ? 260 ILE A CB  1 
ATOM   1724 C  CG1 . ILE A 1 231 ? -35.734 11.425 -4.938  1.00 19.97 ? 260 ILE A CG1 1 
ATOM   1725 C  CG2 . ILE A 1 231 ? -36.035 12.457 -7.249  1.00 20.43 ? 260 ILE A CG2 1 
ATOM   1726 C  CD1 . ILE A 1 231 ? -37.189 11.005 -4.929  1.00 21.43 ? 260 ILE A CD1 1 
ATOM   1727 N  N   . GLY A 1 232 ? -33.201 13.927 -7.973  1.00 21.79 ? 261 GLY A N   1 
ATOM   1728 C  CA  . GLY A 1 232 ? -32.873 14.986 -8.905  1.00 22.88 ? 261 GLY A CA  1 
ATOM   1729 C  C   . GLY A 1 232 ? -31.394 15.276 -8.901  1.00 25.60 ? 261 GLY A C   1 
ATOM   1730 O  O   . GLY A 1 232 ? -30.908 15.823 -9.867  1.00 28.25 ? 261 GLY A O   1 
ATOM   1731 N  N   . LEU A 1 233 ? -30.681 14.929 -7.825  1.00 26.79 ? 262 LEU A N   1 
ATOM   1732 C  CA  . LEU A 1 233 ? -29.224 15.155 -7.778  1.00 27.48 ? 262 LEU A CA  1 
ATOM   1733 C  C   . LEU A 1 233 ? -28.541 13.937 -7.137  1.00 24.53 ? 262 LEU A C   1 
ATOM   1734 O  O   . LEU A 1 233 ? -27.571 14.064 -6.386  1.00 23.71 ? 262 LEU A O   1 
ATOM   1735 C  CB  . LEU A 1 233 ? -28.846 16.519 -7.145  1.00 28.69 ? 262 LEU A CB  1 
ATOM   1736 C  CG  . LEU A 1 233 ? -29.403 17.037 -5.805  1.00 28.62 ? 262 LEU A CG  1 
ATOM   1737 C  CD1 . LEU A 1 233 ? -30.906 16.986 -5.697  1.00 28.74 ? 262 LEU A CD1 1 
ATOM   1738 C  CD2 . LEU A 1 233 ? -28.778 16.363 -4.608  1.00 31.96 ? 262 LEU A CD2 1 
ATOM   1739 N  N   . GLU A 1 234 ? -29.001 12.755 -7.554  1.00 23.29 ? 263 GLU A N   1 
ATOM   1740 C  CA  . GLU A 1 234 ? -28.471 11.442 -7.096  1.00 25.61 ? 263 GLU A CA  1 
ATOM   1741 C  C   . GLU A 1 234 ? -26.973 11.274 -7.381  1.00 24.21 ? 263 GLU A C   1 
ATOM   1742 O  O   . GLU A 1 234 ? -26.332 10.441 -6.757  1.00 22.17 ? 263 GLU A O   1 
ATOM   1743 C  CB  . GLU A 1 234 ? -28.994 10.232 -7.881  1.00 28.70 ? 263 GLU A CB  1 
ATOM   1744 C  CG  . GLU A 1 234 ? -30.477 10.115 -7.981  1.00 31.09 ? 263 GLU A CG  1 
ATOM   1745 C  CD  . GLU A 1 234 ? -31.074 10.932 -9.099  1.00 31.80 ? 263 GLU A CD  1 
ATOM   1746 O  OE1 . GLU A 1 234 ? -31.507 12.045 -8.803  1.00 33.12 ? 263 GLU A OE1 1 
ATOM   1747 O  OE2 . GLU A 1 234 ? -31.092 10.443 -10.246 1.00 34.27 ? 263 GLU A OE2 1 
ATOM   1748 N  N   . ASP A 1 235 ? -26.427 11.950 -8.376  1.00 23.55 ? 264 ASP A N   1 
ATOM   1749 C  CA  . ASP A 1 235 ? -25.041 11.648 -8.729  1.00 25.48 ? 264 ASP A CA  1 
ATOM   1750 C  C   . ASP A 1 235 ? -24.093 12.426 -7.779  1.00 22.13 ? 264 ASP A C   1 
ATOM   1751 O  O   . ASP A 1 235 ? -22.874 12.278 -7.858  1.00 20.43 ? 264 ASP A O   1 
ATOM   1752 C  CB  . ASP A 1 235 ? -24.888 11.714 -10.262 1.00 29.65 ? 264 ASP A CB  1 
ATOM   1753 C  CG  . ASP A 1 235 ? -24.935 13.082 -10.922 1.00 35.23 ? 264 ASP A CG  1 
ATOM   1754 O  OD1 . ASP A 1 235 ? -25.377 14.047 -10.259 1.00 41.17 ? 264 ASP A OD1 1 
ATOM   1755 O  OD2 . ASP A 1 235 ? -24.564 13.162 -12.131 1.00 33.32 ? 264 ASP A OD2 1 
ATOM   1756 N  N   . ASN A 1 236 ? -24.642 13.247 -6.875  1.00 19.63 ? 265 ASN A N   1 
ATOM   1757 C  CA  . ASN A 1 236 ? -23.912 13.854 -5.757  1.00 18.32 ? 265 ASN A CA  1 
ATOM   1758 C  C   . ASN A 1 236 ? -23.991 12.872 -4.587  1.00 18.63 ? 265 ASN A C   1 
ATOM   1759 O  O   . ASN A 1 236 ? -25.017 12.816 -3.882  1.00 18.39 ? 265 ASN A O   1 
ATOM   1760 C  CB  . ASN A 1 236 ? -24.435 15.249 -5.375  1.00 17.62 ? 265 ASN A CB  1 
ATOM   1761 C  CG  . ASN A 1 236 ? -23.742 15.895 -4.186  1.00 16.43 ? 265 ASN A CG  1 
ATOM   1762 O  OD1 . ASN A 1 236 ? -23.063 15.230 -3.409  1.00 14.95 ? 265 ASN A OD1 1 
ATOM   1763 N  ND2 . ASN A 1 236 ? -23.959 17.186 -3.981  1.00 15.71 ? 265 ASN A ND2 1 
ATOM   1764 N  N   . ALA A 1 237 ? -22.911 12.111 -4.429  1.00 17.13 ? 266 ALA A N   1 
ATOM   1765 C  CA  . ALA A 1 237 ? -22.860 10.960 -3.543  1.00 17.31 ? 266 ALA A CA  1 
ATOM   1766 C  C   . ALA A 1 237 ? -22.996 11.381 -2.074  1.00 17.59 ? 266 ALA A C   1 
ATOM   1767 O  O   . ALA A 1 237 ? -23.699 10.684 -1.298  1.00 17.34 ? 266 ALA A O   1 
ATOM   1768 C  CB  . ALA A 1 237 ? -21.601 10.158 -3.785  1.00 18.49 ? 266 ALA A CB  1 
ATOM   1769 N  N   A SER A 1 238 ? -22.354 12.487 -1.681  0.50 16.91 ? 267 SER A N   1 
ATOM   1770 N  N   B SER A 1 238 ? -22.367 12.501 -1.697  0.50 16.19 ? 267 SER A N   1 
ATOM   1771 C  CA  A SER A 1 238 ? -22.435 12.935 -0.300  0.50 17.29 ? 267 SER A CA  1 
ATOM   1772 C  CA  B SER A 1 238 ? -22.417 12.954 -0.319  0.50 16.11 ? 267 SER A CA  1 
ATOM   1773 C  C   A SER A 1 238 ? -23.853 13.449 0.008   0.50 16.65 ? 267 SER A C   1 
ATOM   1774 C  C   B SER A 1 238 ? -23.827 13.481 0.013   0.50 16.01 ? 267 SER A C   1 
ATOM   1775 O  O   A SER A 1 238 ? -24.392 13.189 1.099   0.50 15.95 ? 267 SER A O   1 
ATOM   1776 O  O   B SER A 1 238 ? -24.342 13.250 1.123   0.50 15.44 ? 267 SER A O   1 
ATOM   1777 C  CB  A SER A 1 238 ? -21.384 13.973 0.013   0.50 17.35 ? 267 SER A CB  1 
ATOM   1778 C  CB  B SER A 1 238 ? -21.328 13.969 -0.023  0.50 15.43 ? 267 SER A CB  1 
ATOM   1779 O  OG  A SER A 1 238 ? -20.242 13.380 0.616   0.50 18.87 ? 267 SER A OG  1 
ATOM   1780 O  OG  B SER A 1 238 ? -21.462 15.147 -0.808  0.50 15.12 ? 267 SER A OG  1 
ATOM   1781 N  N   . ALA A 1 239 ? -24.467 14.152 -0.938  1.00 16.15 ? 268 ALA A N   1 
ATOM   1782 C  CA  . ALA A 1 239 ? -25.807 14.682 -0.703  1.00 17.26 ? 268 ALA A CA  1 
ATOM   1783 C  C   . ALA A 1 239 ? -26.798 13.525 -0.646  1.00 17.10 ? 268 ALA A C   1 
ATOM   1784 O  O   . ALA A 1 239 ? -27.649 13.530 0.197   1.00 17.47 ? 268 ALA A O   1 
ATOM   1785 C  CB  . ALA A 1 239 ? -26.185 15.677 -1.764  1.00 17.74 ? 268 ALA A CB  1 
ATOM   1786 N  N   . ALA A 1 240 ? -26.623 12.513 -1.504  1.00 18.06 ? 269 ALA A N   1 
ATOM   1787 C  CA  . ALA A 1 240 ? -27.513 11.344 -1.533  1.00 17.90 ? 269 ALA A CA  1 
ATOM   1788 C  C   . ALA A 1 240 ? -27.447 10.563 -0.219  1.00 18.02 ? 269 ALA A C   1 
ATOM   1789 O  O   . ALA A 1 240 ? -28.484 10.194 0.324   1.00 17.42 ? 269 ALA A O   1 
ATOM   1790 C  CB  . ALA A 1 240 ? -27.184 10.452 -2.698  1.00 18.38 ? 269 ALA A CB  1 
ATOM   1791 N  N   . ALA A 1 241 ? -26.255 10.327 0.296   1.00 18.26 ? 270 ALA A N   1 
ATOM   1792 C  CA  . ALA A 1 241 ? -26.102 9.626  1.573   1.00 18.60 ? 270 ALA A CA  1 
ATOM   1793 C  C   . ALA A 1 241 ? -26.738 10.425 2.724   1.00 17.73 ? 270 ALA A C   1 
ATOM   1794 O  O   . ALA A 1 241 ? -27.325 9.827  3.616   1.00 17.71 ? 270 ALA A O   1 
ATOM   1795 C  CB  . ALA A 1 241 ? -24.651 9.374  1.850   1.00 19.07 ? 270 ALA A CB  1 
ATOM   1796 N  N   . LEU A 1 242 ? -26.640 11.742 2.716   1.00 16.68 ? 271 LEU A N   1 
ATOM   1797 C  CA  . LEU A 1 242 ? -27.277 12.602 3.762   1.00 16.31 ? 271 LEU A CA  1 
ATOM   1798 C  C   . LEU A 1 242 ? -28.802 12.617 3.623   1.00 15.59 ? 271 LEU A C   1 
ATOM   1799 O  O   . LEU A 1 242 ? -29.481 12.428 4.583   1.00 15.05 ? 271 LEU A O   1 
ATOM   1800 C  CB  . LEU A 1 242 ? -26.779 14.051 3.649   1.00 16.98 ? 271 LEU A CB  1 
ATOM   1801 C  CG  . LEU A 1 242 ? -27.283 14.991 4.761   1.00 18.26 ? 271 LEU A CG  1 
ATOM   1802 C  CD1 . LEU A 1 242 ? -26.739 14.550 6.112   1.00 17.85 ? 271 LEU A CD1 1 
ATOM   1803 C  CD2 . LEU A 1 242 ? -26.924 16.460 4.509   1.00 18.21 ? 271 LEU A CD2 1 
ATOM   1804 N  N   . LEU A 1 243 ? -29.306 12.975 2.437   1.00 15.14 ? 272 LEU A N   1 
ATOM   1805 C  CA  . LEU A 1 243 ? -30.694 13.374 2.250   1.00 16.46 ? 272 LEU A CA  1 
ATOM   1806 C  C   . LEU A 1 243 ? -31.600 12.192 1.844   1.00 14.97 ? 272 LEU A C   1 
ATOM   1807 O  O   . LEU A 1 243 ? -32.820 12.330 1.960   1.00 14.21 ? 272 LEU A O   1 
ATOM   1808 C  CB  . LEU A 1 243 ? -30.747 14.448 1.159   1.00 17.25 ? 272 LEU A CB  1 
ATOM   1809 C  CG  . LEU A 1 243 ? -30.035 15.771 1.462   1.00 18.17 ? 272 LEU A CG  1 
ATOM   1810 C  CD1 . LEU A 1 243 ? -30.057 16.674 0.238   1.00 17.18 ? 272 LEU A CD1 1 
ATOM   1811 C  CD2 . LEU A 1 243 ? -30.653 16.497 2.646   1.00 18.89 ? 272 LEU A CD2 1 
ATOM   1812 N  N   . GLY A 1 244 ? -31.030 11.129 1.259   1.00 13.45 ? 273 GLY A N   1 
ATOM   1813 C  CA  . GLY A 1 244 ? -31.731 9.899  0.870   1.00 13.59 ? 273 GLY A CA  1 
ATOM   1814 C  C   . GLY A 1 244 ? -32.329 9.996  -0.526  1.00 13.83 ? 273 GLY A C   1 
ATOM   1815 O  O   . GLY A 1 244 ? -32.295 11.054 -1.159  1.00 14.28 ? 273 GLY A O   1 
ATOM   1816 N  N   . LEU A 1 245 ? -32.964 8.918  -0.983  1.00 14.96 ? 274 LEU A N   1 
ATOM   1817 C  CA  . LEU A 1 245 ? -33.561 8.864  -2.351  1.00 15.21 ? 274 LEU A CA  1 
ATOM   1818 C  C   . LEU A 1 245 ? -35.083 8.672  -2.311  1.00 14.13 ? 274 LEU A C   1 
ATOM   1819 O  O   . LEU A 1 245 ? -35.667 8.101  -3.245  1.00 12.97 ? 274 LEU A O   1 
ATOM   1820 C  CB  . LEU A 1 245 ? -32.867 7.743  -3.128  1.00 17.09 ? 274 LEU A CB  1 
ATOM   1821 C  CG  . LEU A 1 245 ? -31.367 7.960  -3.323  1.00 18.00 ? 274 LEU A CG  1 
ATOM   1822 C  CD1 . LEU A 1 245 ? -30.709 6.746  -3.965  1.00 20.51 ? 274 LEU A CD1 1 
ATOM   1823 C  CD2 . LEU A 1 245 ? -31.095 9.222  -4.123  1.00 17.28 ? 274 LEU A CD2 1 
ATOM   1824 N  N   . ARG A 1 246 ? -35.717 9.251  -1.285  1.00 14.13 ? 275 ARG A N   1 
ATOM   1825 C  CA  . ARG A 1 246 ? -37.175 9.265  -1.087  1.00 14.23 ? 275 ARG A CA  1 
ATOM   1826 C  C   . ARG A 1 246 ? -37.656 10.710 -1.158  1.00 14.51 ? 275 ARG A C   1 
ATOM   1827 O  O   . ARG A 1 246 ? -36.996 11.600 -0.654  1.00 14.59 ? 275 ARG A O   1 
ATOM   1828 C  CB  . ARG A 1 246 ? -37.550 8.621  0.247   1.00 14.51 ? 275 ARG A CB  1 
ATOM   1829 C  CG  . ARG A 1 246 ? -37.364 7.102  0.258   1.00 15.52 ? 275 ARG A CG  1 
ATOM   1830 C  CD  . ARG A 1 246 ? -37.343 6.436  1.623   1.00 15.80 ? 275 ARG A CD  1 
ATOM   1831 N  NE  . ARG A 1 246 ? -38.517 6.721  2.439   1.00 15.70 ? 275 ARG A NE  1 
ATOM   1832 C  CZ  . ARG A 1 246 ? -38.542 7.509  3.512   1.00 16.30 ? 275 ARG A CZ  1 
ATOM   1833 N  NH1 . ARG A 1 246 ? -37.498 8.272  3.808   1.00 15.64 ? 275 ARG A NH1 1 
ATOM   1834 N  NH2 . ARG A 1 246 ? -39.647 7.587  4.242   1.00 16.72 ? 275 ARG A NH2 1 
ATOM   1835 N  N   . SER A 1 247 ? -38.771 10.923 -1.845  1.00 14.56 ? 276 SER A N   1 
ATOM   1836 C  CA  . SER A 1 247 ? -39.374 12.254 -2.042  1.00 15.46 ? 276 SER A CA  1 
ATOM   1837 C  C   . SER A 1 247 ? -39.880 12.825 -0.722  1.00 14.84 ? 276 SER A C   1 
ATOM   1838 O  O   . SER A 1 247 ? -40.202 12.079 0.199   1.00 16.78 ? 276 SER A O   1 
ATOM   1839 C  CB  . SER A 1 247 ? -40.520 12.206 -3.067  1.00 16.40 ? 276 SER A CB  1 
ATOM   1840 O  OG  . SER A 1 247 ? -41.644 11.469 -2.583  1.00 15.59 ? 276 SER A OG  1 
ATOM   1841 N  N   . TRP A 1 248 ? -39.981 14.145 -0.636  1.00 14.94 ? 277 TRP A N   1 
ATOM   1842 C  CA  . TRP A 1 248 ? -40.605 14.730 0.563   1.00 14.87 ? 277 TRP A CA  1 
ATOM   1843 C  C   . TRP A 1 248 ? -42.042 14.230 0.699   1.00 13.99 ? 277 TRP A C   1 
ATOM   1844 O  O   . TRP A 1 248 ? -42.489 14.027 1.792   1.00 14.58 ? 277 TRP A O   1 
ATOM   1845 C  CB  . TRP A 1 248 ? -40.536 16.258 0.585   1.00 15.45 ? 277 TRP A CB  1 
ATOM   1846 C  CG  . TRP A 1 248 ? -41.393 16.988 -0.395  1.00 14.85 ? 277 TRP A CG  1 
ATOM   1847 C  CD1 . TRP A 1 248 ? -40.985 17.504 -1.585  1.00 15.62 ? 277 TRP A CD1 1 
ATOM   1848 C  CD2 . TRP A 1 248 ? -42.756 17.409 -0.218  1.00 15.54 ? 277 TRP A CD2 1 
ATOM   1849 N  NE1 . TRP A 1 248 ? -42.018 18.180 -2.180  1.00 16.04 ? 277 TRP A NE1 1 
ATOM   1850 C  CE2 . TRP A 1 248 ? -43.124 18.118 -1.379  1.00 16.20 ? 277 TRP A CE2 1 
ATOM   1851 C  CE3 . TRP A 1 248 ? -43.726 17.204 0.768   1.00 16.05 ? 277 TRP A CE3 1 
ATOM   1852 C  CZ2 . TRP A 1 248 ? -44.398 18.655 -1.567  1.00 15.79 ? 277 TRP A CZ2 1 
ATOM   1853 C  CZ3 . TRP A 1 248 ? -44.984 17.740 0.592   1.00 17.03 ? 277 TRP A CZ3 1 
ATOM   1854 C  CH2 . TRP A 1 248 ? -45.315 18.453 -0.563  1.00 16.77 ? 277 TRP A CH2 1 
ATOM   1855 N  N   . GLN A 1 249 ? -42.764 14.039 -0.394  1.00 15.15 ? 278 GLN A N   1 
ATOM   1856 C  CA  . GLN A 1 249 ? -44.155 13.558 -0.289  1.00 15.25 ? 278 GLN A CA  1 
ATOM   1857 C  C   . GLN A 1 249 ? -44.191 12.154 0.322   1.00 14.52 ? 278 GLN A C   1 
ATOM   1858 O  O   . GLN A 1 249 ? -45.102 11.865 1.089   1.00 12.72 ? 278 GLN A O   1 
ATOM   1859 C  CB  . GLN A 1 249 ? -44.848 13.489 -1.647  1.00 17.20 ? 278 GLN A CB  1 
ATOM   1860 C  CG  . GLN A 1 249 ? -45.113 14.841 -2.257  1.00 18.93 ? 278 GLN A CG  1 
ATOM   1861 C  CD  . GLN A 1 249 ? -44.028 15.319 -3.196  1.00 20.86 ? 278 GLN A CD  1 
ATOM   1862 O  OE1 . GLN A 1 249 ? -42.850 14.944 -3.120  1.00 20.04 ? 278 GLN A OE1 1 
ATOM   1863 N  NE2 . GLN A 1 249 ? -44.432 16.219 -4.076  1.00 21.38 ? 278 GLN A NE2 1 
ATOM   1864 N  N   . THR A 1 250 ? -43.243 11.287 -0.037  1.00 13.43 ? 279 THR A N   1 
ATOM   1865 C  CA  . THR A 1 250 ? -43.168 9.938  0.568   1.00 13.45 ? 279 THR A CA  1 
ATOM   1866 C  C   . THR A 1 250 ? -42.995 10.066 2.086   1.00 12.93 ? 279 THR A C   1 
ATOM   1867 O  O   . THR A 1 250 ? -43.665 9.404  2.865   1.00 12.45 ? 279 THR A O   1 
ATOM   1868 C  CB  . THR A 1 250 ? -42.034 9.131  -0.062  1.00 13.68 ? 279 THR A CB  1 
ATOM   1869 O  OG1 . THR A 1 250 ? -42.371 8.959  -1.446  1.00 14.18 ? 279 THR A OG1 1 
ATOM   1870 C  CG2 . THR A 1 250 ? -41.794 7.817  0.645   1.00 14.15 ? 279 THR A CG2 1 
ATOM   1871 N  N   . ARG A 1 251 ? -42.143 10.982 2.520   1.00 12.56 ? 280 ARG A N   1 
ATOM   1872 C  CA  . ARG A 1 251 ? -41.949 11.180 3.954   1.00 13.03 ? 280 ARG A CA  1 
ATOM   1873 C  C   . ARG A 1 251 ? -43.255 11.711 4.577   1.00 12.59 ? 280 ARG A C   1 
ATOM   1874 O  O   . ARG A 1 251 ? -43.721 11.177 5.596   1.00 12.32 ? 280 ARG A O   1 
ATOM   1875 C  CB  . ARG A 1 251 ? -40.781 12.144 4.217   1.00 12.97 ? 280 ARG A CB  1 
ATOM   1876 C  CG  . ARG A 1 251 ? -39.395 11.606 3.885   1.00 13.60 ? 280 ARG A CG  1 
ATOM   1877 C  CD  . ARG A 1 251 ? -38.408 12.736 4.172   1.00 13.77 ? 280 ARG A CD  1 
ATOM   1878 N  NE  . ARG A 1 251 ? -37.032 12.486 3.818   1.00 13.47 ? 280 ARG A NE  1 
ATOM   1879 C  CZ  . ARG A 1 251 ? -36.124 12.006 4.659   1.00 14.44 ? 280 ARG A CZ  1 
ATOM   1880 N  NH1 . ARG A 1 251 ? -36.472 11.762 5.908   1.00 13.26 ? 280 ARG A NH1 1 
ATOM   1881 N  NH2 . ARG A 1 251 ? -34.877 11.779 4.253   1.00 13.80 ? 280 ARG A NH2 1 
ATOM   1882 N  N   . ALA A 1 252 ? -43.878 12.718 3.948   1.00 12.28 ? 281 ALA A N   1 
ATOM   1883 C  CA  . ALA A 1 252 ? -45.094 13.338 4.494   1.00 12.59 ? 281 ALA A CA  1 
ATOM   1884 C  C   . ALA A 1 252 ? -46.234 12.301 4.586   1.00 12.78 ? 281 ALA A C   1 
ATOM   1885 O  O   . ALA A 1 252 ? -47.073 12.369 5.476   1.00 13.05 ? 281 ALA A O   1 
ATOM   1886 C  CB  . ALA A 1 252 ? -45.486 14.542 3.655   1.00 12.34 ? 281 ALA A CB  1 
ATOM   1887 N  N   . LEU A 1 253 ? -46.283 11.338 3.688   1.00 13.89 ? 282 LEU A N   1 
ATOM   1888 C  CA  . LEU A 1 253 ? -47.368 10.362 3.728   1.00 14.92 ? 282 LEU A CA  1 
ATOM   1889 C  C   . LEU A 1 253 ? -47.241 9.437  4.942   1.00 15.15 ? 282 LEU A C   1 
ATOM   1890 O  O   . LEU A 1 253 ? -48.251 8.852  5.350   1.00 14.94 ? 282 LEU A O   1 
ATOM   1891 C  CB  . LEU A 1 253 ? -47.408 9.558  2.430   1.00 16.84 ? 282 LEU A CB  1 
ATOM   1892 C  CG  . LEU A 1 253 ? -47.988 10.285 1.222   1.00 17.27 ? 282 LEU A CG  1 
ATOM   1893 C  CD1 . LEU A 1 253 ? -47.721 9.467  -0.027  1.00 17.74 ? 282 LEU A CD1 1 
ATOM   1894 C  CD2 . LEU A 1 253 ? -49.487 10.539 1.388   1.00 18.95 ? 282 LEU A CD2 1 
ATOM   1895 N  N   . LEU A 1 254 ? -46.065 9.350  5.562   1.00 15.55 ? 283 LEU A N   1 
ATOM   1896 C  CA  . LEU A 1 254 ? -45.936 8.646  6.837   1.00 15.53 ? 283 LEU A CA  1 
ATOM   1897 C  C   . LEU A 1 254 ? -46.756 9.348  7.926   1.00 16.56 ? 283 LEU A C   1 
ATOM   1898 O  O   . LEU A 1 254 ? -47.221 8.689  8.879   1.00 16.65 ? 283 LEU A O   1 
ATOM   1899 C  CB  . LEU A 1 254 ? -44.470 8.589  7.255   1.00 16.94 ? 283 LEU A CB  1 
ATOM   1900 C  CG  . LEU A 1 254 ? -43.549 7.728  6.398   1.00 17.22 ? 283 LEU A CG  1 
ATOM   1901 C  CD1 . LEU A 1 254 ? -42.106 7.913  6.821   1.00 17.98 ? 283 LEU A CD1 1 
ATOM   1902 C  CD2 . LEU A 1 254 ? -43.941 6.263  6.502   1.00 17.99 ? 283 LEU A CD2 1 
ATOM   1903 N  N   . ILE A 1 255 ? -46.916 10.665 7.809   1.00 15.78 ? 284 ILE A N   1 
ATOM   1904 C  CA  . ILE A 1 255 ? -47.714 11.434 8.785   1.00 16.18 ? 284 ILE A CA  1 
ATOM   1905 C  C   . ILE A 1 255 ? -49.179 10.993 8.670   1.00 15.90 ? 284 ILE A C   1 
ATOM   1906 O  O   . ILE A 1 255 ? -49.835 10.670 9.672   1.00 15.47 ? 284 ILE A O   1 
ATOM   1907 C  CB  . ILE A 1 255 ? -47.563 12.958 8.561   1.00 15.59 ? 284 ILE A CB  1 
ATOM   1908 C  CG1 . ILE A 1 255 ? -46.093 13.406 8.524   1.00 15.91 ? 284 ILE A CG1 1 
ATOM   1909 C  CG2 . ILE A 1 255 ? -48.375 13.718 9.599   1.00 15.63 ? 284 ILE A CG2 1 
ATOM   1910 C  CD1 . ILE A 1 255 ? -45.868 14.850 8.060   1.00 15.96 ? 284 ILE A CD1 1 
ATOM   1911 N  N   . LYS A 1 256 ? -49.686 11.032 7.442   1.00 16.57 ? 285 LYS A N   1 
ATOM   1912 C  CA  . LYS A 1 256 ? -51.013 10.504 7.130   1.00 18.16 ? 285 LYS A CA  1 
ATOM   1913 C  C   . LYS A 1 256 ? -51.116 9.043  7.586   1.00 17.13 ? 285 LYS A C   1 
ATOM   1914 O  O   . LYS A 1 256 ? -52.132 8.662  8.200   1.00 17.02 ? 285 LYS A O   1 
ATOM   1915 C  CB  . LYS A 1 256 ? -51.330 10.661 5.637   1.00 19.45 ? 285 LYS A CB  1 
ATOM   1916 C  CG  . LYS A 1 256 ? -52.673 10.091 5.192   1.00 21.67 ? 285 LYS A CG  1 
ATOM   1917 C  CD  . LYS A 1 256 ? -52.994 10.361 3.740   1.00 21.92 ? 285 LYS A CD  1 
ATOM   1918 C  CE  . LYS A 1 256 ? -53.757 9.241  3.056   1.00 23.10 ? 285 LYS A CE  1 
ATOM   1919 N  NZ  . LYS A 1 256 ? -54.986 8.903  3.800   1.00 22.83 ? 285 LYS A NZ  1 
ATOM   1920 N  N   . ALA A 1 257 ? -50.099 8.223  7.345   1.00 17.33 ? 286 ALA A N   1 
ATOM   1921 C  CA  . ALA A 1 257 ? -50.212 6.775  7.710   1.00 17.43 ? 286 ALA A CA  1 
ATOM   1922 C  C   . ALA A 1 257 ? -50.399 6.613  9.221   1.00 17.58 ? 286 ALA A C   1 
ATOM   1923 O  O   . ALA A 1 257 ? -51.196 5.773  9.686   1.00 16.41 ? 286 ALA A O   1 
ATOM   1924 C  CB  . ALA A 1 257 ? -49.019 5.985  7.236   1.00 17.47 ? 286 ALA A CB  1 
ATOM   1925 N  N   . LEU A 1 258 ? -49.683 7.405  10.013  1.00 17.97 ? 287 LEU A N   1 
ATOM   1926 C  CA  . LEU A 1 258 ? -49.790 7.217  11.455  1.00 17.60 ? 287 LEU A CA  1 
ATOM   1927 C  C   . LEU A 1 258 ? -51.109 7.817  11.938  1.00 17.70 ? 287 LEU A C   1 
ATOM   1928 O  O   . LEU A 1 258 ? -51.732 7.268  12.849  1.00 18.44 ? 287 LEU A O   1 
ATOM   1929 C  CB  . LEU A 1 258 ? -48.576 7.835  12.151  1.00 17.43 ? 287 LEU A CB  1 
ATOM   1930 C  CG  . LEU A 1 258 ? -47.289 7.043  11.986  1.00 18.87 ? 287 LEU A CG  1 
ATOM   1931 C  CD1 . LEU A 1 258 ? -46.166 7.716  12.738  1.00 19.60 ? 287 LEU A CD1 1 
ATOM   1932 C  CD2 . LEU A 1 258 ? -47.467 5.601  12.465  1.00 19.70 ? 287 LEU A CD2 1 
ATOM   1933 N  N   . ILE A 1 259 ? -51.576 8.892  11.295  1.00 18.60 ? 288 ILE A N   1 
ATOM   1934 C  CA  . ILE A 1 259 ? -52.871 9.438  11.680  1.00 17.55 ? 288 ILE A CA  1 
ATOM   1935 C  C   . ILE A 1 259 ? -53.935 8.360  11.446  1.00 19.49 ? 288 ILE A C   1 
ATOM   1936 O  O   . ILE A 1 259 ? -54.791 8.110  12.321  1.00 19.24 ? 288 ILE A O   1 
ATOM   1937 C  CB  . ILE A 1 259 ? -53.209 10.745 10.930  1.00 17.73 ? 288 ILE A CB  1 
ATOM   1938 C  CG1 . ILE A 1 259 ? -52.330 11.921 11.382  1.00 16.34 ? 288 ILE A CG1 1 
ATOM   1939 C  CG2 . ILE A 1 259 ? -54.695 11.062 11.083  1.00 18.36 ? 288 ILE A CG2 1 
ATOM   1940 C  CD1 . ILE A 1 259 ? -52.282 13.104 10.420  1.00 16.37 ? 288 ILE A CD1 1 
ATOM   1941 N  N   . ASP A 1 260 ? -53.867 7.742  10.278  1.00 19.58 ? 289 ASP A N   1 
ATOM   1942 C  CA  . ASP A 1 260 ? -54.844 6.726  9.853   1.00 21.64 ? 289 ASP A CA  1 
ATOM   1943 C  C   . ASP A 1 260 ? -54.816 5.547  10.834  1.00 22.19 ? 289 ASP A C   1 
ATOM   1944 O  O   . ASP A 1 260 ? -55.844 4.913  11.012  1.00 22.11 ? 289 ASP A O   1 
ATOM   1945 C  CB  . ASP A 1 260 ? -54.630 6.298  8.392   1.00 19.39 ? 289 ASP A CB  1 
ATOM   1946 C  CG  . ASP A 1 260 ? -54.996 7.363  7.370   1.00 20.80 ? 289 ASP A CG  1 
ATOM   1947 O  OD1 . ASP A 1 260 ? -55.586 8.414  7.762   1.00 18.91 ? 289 ASP A OD1 1 
ATOM   1948 O  OD2 . ASP A 1 260 ? -54.673 7.154  6.174   1.00 21.64 ? 289 ASP A OD2 1 
ATOM   1949 N  N   . GLN A 1 261 ? -53.691 5.275  11.499  1.00 24.47 ? 290 GLN A N   1 
ATOM   1950 C  CA  . GLN A 1 261 ? -53.644 4.115  12.408  1.00 27.53 ? 290 GLN A CA  1 
ATOM   1951 C  C   . GLN A 1 261 ? -54.049 4.552  13.820  1.00 26.02 ? 290 GLN A C   1 
ATOM   1952 O  O   . GLN A 1 261 ? -54.034 3.749  14.745  1.00 26.00 ? 290 GLN A O   1 
ATOM   1953 C  CB  . GLN A 1 261 ? -52.279 3.417  12.376  1.00 33.44 ? 290 GLN A CB  1 
ATOM   1954 C  CG  . GLN A 1 261 ? -52.306 2.059  11.664  1.00 39.92 ? 290 GLN A CG  1 
ATOM   1955 C  CD  . GLN A 1 261 ? -51.496 2.035  10.387  1.00 47.94 ? 290 GLN A CD  1 
ATOM   1956 O  OE1 . GLN A 1 261 ? -51.484 2.984  9.600   1.00 56.05 ? 290 GLN A OE1 1 
ATOM   1957 N  NE2 . GLN A 1 261 ? -50.787 0.938  10.171  1.00 52.73 ? 290 GLN A NE2 1 
ATOM   1958 N  N   . GLY A 1 262 ? -54.398 5.823  13.976  1.00 22.89 ? 291 GLY A N   1 
ATOM   1959 C  CA  . GLY A 1 262 ? -54.978 6.340  15.218  1.00 22.66 ? 291 GLY A CA  1 
ATOM   1960 C  C   . GLY A 1 262 ? -53.938 6.959  16.139  1.00 21.59 ? 291 GLY A C   1 
ATOM   1961 O  O   . GLY A 1 262 ? -54.196 7.070  17.342  1.00 18.54 ? 291 GLY A O   1 
ATOM   1962 N  N   . TYR A 1 263 ? -52.790 7.401  15.592  1.00 19.85 ? 292 TYR A N   1 
ATOM   1963 C  CA  . TYR A 1 263 ? -51.668 7.828  16.428  1.00 20.48 ? 292 TYR A CA  1 
ATOM   1964 C  C   . TYR A 1 263 ? -51.357 9.320  16.226  1.00 20.65 ? 292 TYR A C   1 
ATOM   1965 O  O   . TYR A 1 263 ? -50.241 9.770  16.569  1.00 18.99 ? 292 TYR A O   1 
ATOM   1966 C  CB  . TYR A 1 263 ? -50.449 6.938  16.153  1.00 21.94 ? 292 TYR A CB  1 
ATOM   1967 C  CG  . TYR A 1 263 ? -50.601 5.509  16.615  1.00 22.99 ? 292 TYR A CG  1 
ATOM   1968 C  CD1 . TYR A 1 263 ? -50.814 5.205  17.951  1.00 24.83 ? 292 TYR A CD1 1 
ATOM   1969 C  CD2 . TYR A 1 263 ? -50.516 4.449  15.727  1.00 25.27 ? 292 TYR A CD2 1 
ATOM   1970 C  CE1 . TYR A 1 263 ? -50.964 3.897  18.393  1.00 26.64 ? 292 TYR A CE1 1 
ATOM   1971 C  CE2 . TYR A 1 263 ? -50.679 3.133  16.148  1.00 27.18 ? 292 TYR A CE2 1 
ATOM   1972 C  CZ  . TYR A 1 263 ? -50.896 2.851  17.490  1.00 27.89 ? 292 TYR A CZ  1 
ATOM   1973 O  OH  . TYR A 1 263 ? -51.022 1.559  17.917  1.00 28.88 ? 292 TYR A OH  1 
ATOM   1974 N  N   . ALA A 1 264 ? -52.352 10.095 15.779  1.00 21.13 ? 293 ALA A N   1 
ATOM   1975 C  CA  . ALA A 1 264 ? -52.226 11.560 15.612  1.00 21.62 ? 293 ALA A CA  1 
ATOM   1976 C  C   . ALA A 1 264 ? -51.599 12.201 16.863  1.00 23.29 ? 293 ALA A C   1 
ATOM   1977 O  O   . ALA A 1 264 ? -50.810 13.145 16.732  1.00 21.77 ? 293 ALA A O   1 
ATOM   1978 C  CB  . ALA A 1 264 ? -53.562 12.197 15.309  1.00 21.14 ? 293 ALA A CB  1 
ATOM   1979 N  N   . ASP A 1 265 ? -51.963 11.706 18.056  1.00 23.28 ? 294 ASP A N   1 
ATOM   1980 C  CA  . ASP A 1 265 ? -51.512 12.306 19.335  1.00 23.20 ? 294 ASP A CA  1 
ATOM   1981 C  C   . ASP A 1 265 ? -50.025 12.064 19.583  1.00 22.20 ? 294 ASP A C   1 
ATOM   1982 O  O   . ASP A 1 265 ? -49.464 12.655 20.481  1.00 23.18 ? 294 ASP A O   1 
ATOM   1983 C  CB  . ASP A 1 265 ? -52.221 11.699 20.542  1.00 25.29 ? 294 ASP A CB  1 
ATOM   1984 C  CG  . ASP A 1 265 ? -53.653 12.147 20.702  1.00 30.06 ? 294 ASP A CG  1 
ATOM   1985 O  OD1 . ASP A 1 265 ? -53.994 13.235 20.176  1.00 31.61 ? 294 ASP A OD1 1 
ATOM   1986 O  OD2 . ASP A 1 265 ? -54.419 11.385 21.339  1.00 36.31 ? 294 ASP A OD2 1 
ATOM   1987 N  N   . GLN A 1 266 ? -49.402 11.167 18.846  1.00 22.00 ? 295 GLN A N   1 
ATOM   1988 C  CA  . GLN A 1 266 ? -48.021 10.811 19.148  1.00 22.83 ? 295 GLN A CA  1 
ATOM   1989 C  C   . GLN A 1 266 ? -47.075 11.219 18.007  1.00 19.81 ? 295 GLN A C   1 
ATOM   1990 O  O   . GLN A 1 266 ? -45.923 10.785 17.952  1.00 18.94 ? 295 GLN A O   1 
ATOM   1991 C  CB  . GLN A 1 266 ? -48.025 9.327  19.481  1.00 25.88 ? 295 GLN A CB  1 
ATOM   1992 C  CG  . GLN A 1 266 ? -48.769 9.082  20.789  1.00 29.21 ? 295 GLN A CG  1 
ATOM   1993 C  CD  . GLN A 1 266 ? -48.881 7.614  21.017  1.00 33.40 ? 295 GLN A CD  1 
ATOM   1994 O  OE1 . GLN A 1 266 ? -49.975 7.072  21.098  1.00 37.92 ? 295 GLN A OE1 1 
ATOM   1995 N  NE2 . GLN A 1 266 ? -47.731 6.960  21.059  1.00 37.53 ? 295 GLN A NE2 1 
ATOM   1996 N  N   . ILE A 1 267 ? -47.531 12.089 17.118  1.00 17.35 ? 296 ILE A N   1 
ATOM   1997 C  CA  . ILE A 1 267 ? -46.692 12.509 15.992  1.00 16.88 ? 296 ILE A CA  1 
ATOM   1998 C  C   . ILE A 1 267 ? -46.099 13.902 16.231  1.00 14.99 ? 296 ILE A C   1 
ATOM   1999 O  O   . ILE A 1 267 ? -46.831 14.843 16.596  1.00 14.36 ? 296 ILE A O   1 
ATOM   2000 C  CB  . ILE A 1 267 ? -47.533 12.521 14.709  1.00 16.96 ? 296 ILE A CB  1 
ATOM   2001 C  CG1 . ILE A 1 267 ? -48.127 11.145 14.390  1.00 16.54 ? 296 ILE A CG1 1 
ATOM   2002 C  CG2 . ILE A 1 267 ? -46.712 13.091 13.575  1.00 17.78 ? 296 ILE A CG2 1 
ATOM   2003 C  CD1 . ILE A 1 267 ? -49.116 11.186 13.250  1.00 16.49 ? 296 ILE A CD1 1 
ATOM   2004 N  N   . LEU A 1 268 ? -44.805 14.033 15.936  1.00 14.17 ? 297 LEU A N   1 
ATOM   2005 C  CA  . LEU A 1 268 ? -44.124 15.315 15.954  1.00 14.12 ? 297 LEU A CA  1 
ATOM   2006 C  C   . LEU A 1 268 ? -43.472 15.538 14.587  1.00 14.55 ? 297 LEU A C   1 
ATOM   2007 O  O   . LEU A 1 268 ? -42.651 14.739 14.147  1.00 14.56 ? 297 LEU A O   1 
ATOM   2008 C  CB  . LEU A 1 268 ? -43.066 15.325 17.064  1.00 13.76 ? 297 LEU A CB  1 
ATOM   2009 C  CG  . LEU A 1 268 ? -43.589 15.269 18.494  1.00 13.11 ? 297 LEU A CG  1 
ATOM   2010 C  CD1 . LEU A 1 268 ? -42.416 15.249 19.462  1.00 13.03 ? 297 LEU A CD1 1 
ATOM   2011 C  CD2 . LEU A 1 268 ? -44.529 16.433 18.771  1.00 13.42 ? 297 LEU A CD2 1 
ATOM   2012 N  N   . VAL A 1 269 ? -43.797 16.647 13.956  1.00 14.38 ? 298 VAL A N   1 
ATOM   2013 C  CA  . VAL A 1 269 ? -43.336 16.905 12.581  1.00 14.95 ? 298 VAL A CA  1 
ATOM   2014 C  C   . VAL A 1 269 ? -42.375 18.093 12.541  1.00 14.13 ? 298 VAL A C   1 
ATOM   2015 O  O   . VAL A 1 269 ? -42.628 19.127 13.156  1.00 14.57 ? 298 VAL A O   1 
ATOM   2016 C  CB  . VAL A 1 269 ? -44.516 17.142 11.622  1.00 14.78 ? 298 VAL A CB  1 
ATOM   2017 C  CG1 . VAL A 1 269 ? -44.027 17.453 10.215  1.00 14.86 ? 298 VAL A CG1 1 
ATOM   2018 C  CG2 . VAL A 1 269 ? -45.448 15.935 11.621  1.00 14.48 ? 298 VAL A CG2 1 
ATOM   2019 N  N   . SER A 1 270 ? -41.311 17.935 11.748  1.00 13.42 ? 299 SER A N   1 
ATOM   2020 C  CA  . SER A 1 270 ? -40.343 18.981 11.665  1.00 13.21 ? 299 SER A CA  1 
ATOM   2021 C  C   . SER A 1 270 ? -39.590 18.936 10.331  1.00 12.27 ? 299 SER A C   1 
ATOM   2022 O  O   . SER A 1 270 ? -39.772 18.017 9.503   1.00 11.90 ? 299 SER A O   1 
ATOM   2023 C  CB  . SER A 1 270 ? -39.408 18.898 12.867  1.00 13.40 ? 299 SER A CB  1 
ATOM   2024 O  OG  . SER A 1 270 ? -39.149 20.199 13.385  1.00 16.12 ? 299 SER A OG  1 
ATOM   2025 N  N   . ASN A 1 271 ? -38.670 19.882 10.180  1.00 11.62 ? 300 ASN A N   1 
ATOM   2026 C  CA  . ASN A 1 271 ? -37.844 19.978 8.961   1.00 11.93 ? 300 ASN A CA  1 
ATOM   2027 C  C   . ASN A 1 271 ? -36.417 19.455 9.143   1.00 12.12 ? 300 ASN A C   1 
ATOM   2028 O  O   . ASN A 1 271 ? -35.800 19.080 8.155   1.00 12.27 ? 300 ASN A O   1 
ATOM   2029 C  CB  . ASN A 1 271 ? -37.699 21.422 8.465   1.00 11.79 ? 300 ASN A CB  1 
ATOM   2030 C  CG  . ASN A 1 271 ? -38.994 22.180 8.330   1.00 11.97 ? 300 ASN A CG  1 
ATOM   2031 O  OD1 . ASN A 1 271 ? -39.683 22.044 7.323   1.00 12.75 ? 300 ASN A OD1 1 
ATOM   2032 N  ND2 . ASN A 1 271 ? -39.271 23.035 9.305   1.00 11.97 ? 300 ASN A ND2 1 
ATOM   2033 N  N   . ASP A 1 272 ? -35.872 19.470 10.373  1.00 12.85 ? 301 ASP A N   1 
ATOM   2034 C  CA  . ASP A 1 272 ? -34.445 19.230 10.662  1.00 11.55 ? 301 ASP A CA  1 
ATOM   2035 C  C   . ASP A 1 272 ? -33.592 20.166 9.816   1.00 11.80 ? 301 ASP A C   1 
ATOM   2036 O  O   . ASP A 1 272 ? -32.591 19.732 9.239   1.00 9.87  ? 301 ASP A O   1 
ATOM   2037 C  CB  . ASP A 1 272 ? -33.985 17.791 10.389  1.00 11.32 ? 301 ASP A CB  1 
ATOM   2038 C  CG  . ASP A 1 272 ? -32.693 17.399 11.089  1.00 11.45 ? 301 ASP A CG  1 
ATOM   2039 O  OD1 . ASP A 1 272 ? -32.217 18.169 11.974  1.00 10.63 ? 301 ASP A OD1 1 
ATOM   2040 O  OD2 . ASP A 1 272 ? -32.136 16.334 10.745  1.00 10.58 ? 301 ASP A OD2 1 
ATOM   2041 N  N   . TRP A 1 273 ? -33.979 21.422 9.768   1.00 11.44 ? 302 TRP A N   1 
ATOM   2042 C  CA  . TRP A 1 273 ? -33.274 22.356 8.939   1.00 12.52 ? 302 TRP A CA  1 
ATOM   2043 C  C   . TRP A 1 273 ? -32.126 23.010 9.728   1.00 12.47 ? 302 TRP A C   1 
ATOM   2044 O  O   . TRP A 1 273 ? -31.913 22.751 10.913  1.00 12.57 ? 302 TRP A O   1 
ATOM   2045 C  CB  . TRP A 1 273 ? -34.243 23.380 8.321   1.00 12.56 ? 302 TRP A CB  1 
ATOM   2046 C  CG  . TRP A 1 273 ? -33.776 23.787 6.960   1.00 13.05 ? 302 TRP A CG  1 
ATOM   2047 C  CD1 . TRP A 1 273 ? -33.271 24.998 6.580   1.00 13.57 ? 302 TRP A CD1 1 
ATOM   2048 C  CD2 . TRP A 1 273 ? -33.616 22.912 5.832   1.00 13.74 ? 302 TRP A CD2 1 
ATOM   2049 N  NE1 . TRP A 1 273 ? -32.850 24.948 5.286   1.00 13.42 ? 302 TRP A NE1 1 
ATOM   2050 C  CE2 . TRP A 1 273 ? -33.060 23.690 4.793   1.00 13.50 ? 302 TRP A CE2 1 
ATOM   2051 C  CE3 . TRP A 1 273 ? -33.876 21.547 5.607   1.00 13.64 ? 302 TRP A CE3 1 
ATOM   2052 C  CZ2 . TRP A 1 273 ? -32.785 23.155 3.536   1.00 13.74 ? 302 TRP A CZ2 1 
ATOM   2053 C  CZ3 . TRP A 1 273 ? -33.587 21.014 4.371   1.00 13.28 ? 302 TRP A CZ3 1 
ATOM   2054 C  CH2 . TRP A 1 273 ? -33.042 21.807 3.351   1.00 13.89 ? 302 TRP A CH2 1 
ATOM   2055 N  N   . THR A 1 274 ? -31.328 23.818 9.037   1.00 12.96 ? 303 THR A N   1 
ATOM   2056 C  CA  . THR A 1 274 ? -30.200 24.508 9.675   1.00 12.48 ? 303 THR A CA  1 
ATOM   2057 C  C   . THR A 1 274 ? -29.833 25.738 8.844   1.00 12.70 ? 303 THR A C   1 
ATOM   2058 O  O   . THR A 1 274 ? -30.253 25.805 7.699   1.00 13.21 ? 303 THR A O   1 
ATOM   2059 C  CB  . THR A 1 274 ? -29.029 23.536 9.806   1.00 12.31 ? 303 THR A CB  1 
ATOM   2060 O  OG1 . THR A 1 274 ? -28.111 24.067 10.763  1.00 12.34 ? 303 THR A OG1 1 
ATOM   2061 C  CG2 . THR A 1 274 ? -28.366 23.308 8.470   1.00 12.75 ? 303 THR A CG2 1 
ATOM   2062 N  N   . PHE A 1 275 ? -29.028 26.662 9.381   1.00 12.25 ? 304 PHE A N   1 
ATOM   2063 C  CA  . PHE A 1 275 ? -28.545 27.801 8.602   1.00 12.74 ? 304 PHE A CA  1 
ATOM   2064 C  C   . PHE A 1 275 ? -27.036 27.730 8.358   1.00 12.75 ? 304 PHE A C   1 
ATOM   2065 O  O   . PHE A 1 275 ? -26.500 28.559 7.629   1.00 13.44 ? 304 PHE A O   1 
ATOM   2066 C  CB  . PHE A 1 275 ? -28.986 29.100 9.279   1.00 12.78 ? 304 PHE A CB  1 
ATOM   2067 C  CG  . PHE A 1 275 ? -30.482 29.173 9.340   1.00 12.14 ? 304 PHE A CG  1 
ATOM   2068 C  CD1 . PHE A 1 275 ? -31.231 29.226 8.165   1.00 12.73 ? 304 PHE A CD1 1 
ATOM   2069 C  CD2 . PHE A 1 275 ? -31.137 29.085 10.554  1.00 11.81 ? 304 PHE A CD2 1 
ATOM   2070 C  CE1 . PHE A 1 275 ? -32.613 29.241 8.211   1.00 12.62 ? 304 PHE A CE1 1 
ATOM   2071 C  CE2 . PHE A 1 275 ? -32.521 29.095 10.593  1.00 12.48 ? 304 PHE A CE2 1 
ATOM   2072 C  CZ  . PHE A 1 275 ? -33.253 29.158 9.421   1.00 12.45 ? 304 PHE A CZ  1 
ATOM   2073 N  N   . GLY A 1 276 ? -26.357 26.767 9.001   1.00 12.94 ? 305 GLY A N   1 
ATOM   2074 C  CA  . GLY A 1 276 ? -24.956 26.433 8.740   1.00 13.37 ? 305 GLY A CA  1 
ATOM   2075 C  C   . GLY A 1 276 ? -24.744 24.979 9.102   1.00 13.00 ? 305 GLY A C   1 
ATOM   2076 O  O   . GLY A 1 276 ? -25.542 24.448 9.901   1.00 12.86 ? 305 GLY A O   1 
ATOM   2077 N  N   . PHE A 1 277 ? -23.790 24.303 8.471   1.00 13.49 ? 306 PHE A N   1 
ATOM   2078 C  CA  . PHE A 1 277 ? -23.573 22.845 8.732   1.00 13.51 ? 306 PHE A CA  1 
ATOM   2079 C  C   . PHE A 1 277 ? -22.100 22.502 8.448   1.00 14.24 ? 306 PHE A C   1 
ATOM   2080 O  O   . PHE A 1 277 ? -21.729 22.089 7.362   1.00 13.90 ? 306 PHE A O   1 
ATOM   2081 C  CB  . PHE A 1 277 ? -24.596 22.008 7.954   1.00 14.50 ? 306 PHE A CB  1 
ATOM   2082 C  CG  . PHE A 1 277 ? -24.766 20.545 8.309   1.00 14.86 ? 306 PHE A CG  1 
ATOM   2083 C  CD1 . PHE A 1 277 ? -24.146 19.959 9.405   1.00 15.00 ? 306 PHE A CD1 1 
ATOM   2084 C  CD2 . PHE A 1 277 ? -25.616 19.746 7.560   1.00 16.43 ? 306 PHE A CD2 1 
ATOM   2085 C  CE1 . PHE A 1 277 ? -24.309 18.608 9.707   1.00 15.19 ? 306 PHE A CE1 1 
ATOM   2086 C  CE2 . PHE A 1 277 ? -25.771 18.397 7.853   1.00 16.17 ? 306 PHE A CE2 1 
ATOM   2087 C  CZ  . PHE A 1 277 ? -25.122 17.825 8.924   1.00 15.77 ? 306 PHE A CZ  1 
ATOM   2088 N  N   . SER A 1 278 ? -21.259 22.725 9.462   1.00 14.17 ? 307 SER A N   1 
ATOM   2089 C  CA  . SER A 1 278 ? -19.834 22.454 9.364   1.00 13.57 ? 307 SER A CA  1 
ATOM   2090 C  C   . SER A 1 278 ? -19.537 20.971 9.607   1.00 12.97 ? 307 SER A C   1 
ATOM   2091 O  O   . SER A 1 278 ? -18.499 20.470 9.195   1.00 11.76 ? 307 SER A O   1 
ATOM   2092 C  CB  . SER A 1 278 ? -19.069 23.336 10.317  1.00 13.93 ? 307 SER A CB  1 
ATOM   2093 O  OG  . SER A 1 278 ? -19.404 23.073 11.676  1.00 13.25 ? 307 SER A OG  1 
ATOM   2094 N  N   . SER A 1 279 ? -20.421 20.255 10.285  1.00 13.35 ? 308 SER A N   1 
ATOM   2095 C  CA  . SER A 1 279 ? -20.102 18.892 10.618  1.00 14.61 ? 308 SER A CA  1 
ATOM   2096 C  C   . SER A 1 279 ? -20.625 17.943 9.511   1.00 15.22 ? 308 SER A C   1 
ATOM   2097 O  O   . SER A 1 279 ? -20.952 16.819 9.759   1.00 15.51 ? 308 SER A O   1 
ATOM   2098 C  CB  . SER A 1 279 ? -20.517 18.554 12.039  1.00 15.51 ? 308 SER A CB  1 
ATOM   2099 O  OG  . SER A 1 279 ? -21.848 18.949 12.335  1.00 17.91 ? 308 SER A OG  1 
ATOM   2100 N  N   . TYR A 1 280 ? -20.577 18.389 8.251   1.00 14.54 ? 309 TYR A N   1 
ATOM   2101 C  CA  . TYR A 1 280 ? -20.713 17.529 7.073   1.00 14.98 ? 309 TYR A CA  1 
ATOM   2102 C  C   . TYR A 1 280 ? -19.804 18.124 5.980   1.00 14.71 ? 309 TYR A C   1 
ATOM   2103 O  O   . TYR A 1 280 ? -18.995 19.003 6.321   1.00 14.34 ? 309 TYR A O   1 
ATOM   2104 C  CB  . TYR A 1 280 ? -22.197 17.368 6.702   1.00 15.51 ? 309 TYR A CB  1 
ATOM   2105 C  CG  . TYR A 1 280 ? -22.464 16.166 5.830   1.00 16.21 ? 309 TYR A CG  1 
ATOM   2106 C  CD1 . TYR A 1 280 ? -22.173 14.880 6.283   1.00 16.46 ? 309 TYR A CD1 1 
ATOM   2107 C  CD2 . TYR A 1 280 ? -22.918 16.315 4.524   1.00 16.06 ? 309 TYR A CD2 1 
ATOM   2108 C  CE1 . TYR A 1 280 ? -22.341 13.769 5.464   1.00 16.79 ? 309 TYR A CE1 1 
ATOM   2109 C  CE2 . TYR A 1 280 ? -23.122 15.217 3.706   1.00 16.44 ? 309 TYR A CE2 1 
ATOM   2110 C  CZ  . TYR A 1 280 ? -22.844 13.942 4.183   1.00 17.08 ? 309 TYR A CZ  1 
ATOM   2111 O  OH  . TYR A 1 280 ? -23.036 12.869 3.370   1.00 18.14 ? 309 TYR A OH  1 
ATOM   2112 N  N   . VAL A 1 281 ? -19.938 17.722 4.712   1.00 14.03 ? 310 VAL A N   1 
ATOM   2113 C  CA  . VAL A 1 281 ? -19.009 18.105 3.656   1.00 14.33 ? 310 VAL A CA  1 
ATOM   2114 C  C   . VAL A 1 281 ? -19.170 19.607 3.392   1.00 14.79 ? 310 VAL A C   1 
ATOM   2115 O  O   . VAL A 1 281 ? -20.210 20.212 3.672   1.00 13.59 ? 310 VAL A O   1 
ATOM   2116 C  CB  . VAL A 1 281 ? -19.177 17.275 2.363   1.00 15.07 ? 310 VAL A CB  1 
ATOM   2117 C  CG1 . VAL A 1 281 ? -19.045 15.768 2.611   1.00 16.26 ? 310 VAL A CG1 1 
ATOM   2118 C  CG2 . VAL A 1 281 ? -20.468 17.586 1.628   1.00 15.08 ? 310 VAL A CG2 1 
ATOM   2119 N  N   . THR A 1 282 ? -18.120 20.193 2.854   1.00 13.46 ? 311 THR A N   1 
ATOM   2120 C  CA  . THR A 1 282 ? -18.092 21.624 2.567   1.00 14.69 ? 311 THR A CA  1 
ATOM   2121 C  C   . THR A 1 282 ? -19.191 21.935 1.555   1.00 16.25 ? 311 THR A C   1 
ATOM   2122 O  O   . THR A 1 282 ? -19.453 21.105 0.684   1.00 17.85 ? 311 THR A O   1 
ATOM   2123 C  CB  . THR A 1 282 ? -16.688 22.050 2.087   1.00 14.36 ? 311 THR A CB  1 
ATOM   2124 O  OG1 . THR A 1 282 ? -15.766 21.799 3.158   1.00 11.60 ? 311 THR A OG1 1 
ATOM   2125 C  CG2 . THR A 1 282 ? -16.614 23.513 1.701   1.00 13.85 ? 311 THR A CG2 1 
ATOM   2126 N  N   . ASN A 1 283 ? -19.899 23.038 1.745   1.00 18.81 ? 312 ASN A N   1 
ATOM   2127 C  CA  . ASN A 1 283 ? -20.916 23.551 0.766   1.00 21.76 ? 312 ASN A CA  1 
ATOM   2128 C  C   . ASN A 1 283 ? -22.208 22.703 0.768   1.00 20.66 ? 312 ASN A C   1 
ATOM   2129 O  O   . ASN A 1 283 ? -23.074 22.916 -0.124  1.00 20.29 ? 312 ASN A O   1 
ATOM   2130 C  CB  . ASN A 1 283 ? -20.367 23.625 -0.669  1.00 24.51 ? 312 ASN A CB  1 
ATOM   2131 C  CG  . ASN A 1 283 ? -19.206 24.587 -0.854  1.00 25.62 ? 312 ASN A CG  1 
ATOM   2132 O  OD1 . ASN A 1 283 ? -19.201 25.707 -0.342  1.00 26.46 ? 312 ASN A OD1 1 
ATOM   2133 N  ND2 . ASN A 1 283 ? -18.221 24.152 -1.618  1.00 27.44 ? 312 ASN A ND2 1 
ATOM   2134 N  N   . ILE A 1 284 ? -22.381 21.773 1.716   1.00 17.93 ? 313 ILE A N   1 
ATOM   2135 C  CA  . ILE A 1 284 ? -23.654 21.034 1.852   1.00 18.87 ? 313 ILE A CA  1 
ATOM   2136 C  C   . ILE A 1 284 ? -24.809 22.026 2.056   1.00 18.33 ? 313 ILE A C   1 
ATOM   2137 O  O   . ILE A 1 284 ? -25.896 21.767 1.544   1.00 17.17 ? 313 ILE A O   1 
ATOM   2138 C  CB  . ILE A 1 284 ? -23.658 20.009 3.001   1.00 18.50 ? 313 ILE A CB  1 
ATOM   2139 C  CG1 . ILE A 1 284 ? -24.870 19.075 2.946   1.00 18.66 ? 313 ILE A CG1 1 
ATOM   2140 C  CG2 . ILE A 1 284 ? -23.622 20.712 4.345   1.00 20.20 ? 313 ILE A CG2 1 
ATOM   2141 C  CD1 . ILE A 1 284 ? -24.881 18.154 1.775   1.00 18.78 ? 313 ILE A CD1 1 
ATOM   2142 N  N   . MET A 1 285 ? -24.594 23.127 2.797   1.00 17.95 ? 314 MET A N   1 
ATOM   2143 C  CA  . MET A 1 285 ? -25.712 24.102 3.014   1.00 18.15 ? 314 MET A CA  1 
ATOM   2144 C  C   . MET A 1 285 ? -26.285 24.562 1.683   1.00 16.61 ? 314 MET A C   1 
ATOM   2145 O  O   . MET A 1 285 ? -27.479 24.810 1.605   1.00 15.27 ? 314 MET A O   1 
ATOM   2146 C  CB  . MET A 1 285 ? -25.303 25.377 3.758   1.00 18.78 ? 314 MET A CB  1 
ATOM   2147 C  CG  . MET A 1 285 ? -25.625 25.287 5.203   1.00 20.43 ? 314 MET A CG  1 
ATOM   2148 S  SD  . MET A 1 285 ? -27.323 25.618 5.698   1.00 19.26 ? 314 MET A SD  1 
ATOM   2149 C  CE  . MET A 1 285 ? -28.313 24.319 4.962   1.00 20.52 ? 314 MET A CE  1 
ATOM   2150 N  N   . ASP A 1 286 ? -25.394 24.765 0.708   1.00 16.09 ? 315 ASP A N   1 
ATOM   2151 C  CA  . ASP A 1 286 ? -25.778 25.244 -0.614  1.00 16.32 ? 315 ASP A CA  1 
ATOM   2152 C  C   . ASP A 1 286 ? -26.632 24.202 -1.315  1.00 14.80 ? 315 ASP A C   1 
ATOM   2153 O  O   . ASP A 1 286 ? -27.680 24.534 -1.875  1.00 16.20 ? 315 ASP A O   1 
ATOM   2154 C  CB  . ASP A 1 286 ? -24.555 25.580 -1.472  1.00 18.27 ? 315 ASP A CB  1 
ATOM   2155 C  CG  . ASP A 1 286 ? -23.757 26.765 -0.951  1.00 20.94 ? 315 ASP A CG  1 
ATOM   2156 O  OD1 . ASP A 1 286 ? -24.303 27.533 -0.120  1.00 23.10 ? 315 ASP A OD1 1 
ATOM   2157 O  OD2 . ASP A 1 286 ? -22.601 26.901 -1.369  1.00 25.14 ? 315 ASP A OD2 1 
ATOM   2158 N  N   . VAL A 1 287 ? -26.222 22.945 -1.257  1.00 13.88 ? 316 VAL A N   1 
ATOM   2159 C  CA  . VAL A 1 287 ? -27.053 21.851 -1.802  1.00 13.77 ? 316 VAL A CA  1 
ATOM   2160 C  C   . VAL A 1 287 ? -28.422 21.829 -1.101  1.00 12.94 ? 316 VAL A C   1 
ATOM   2161 O  O   . VAL A 1 287 ? -29.478 21.807 -1.755  1.00 11.31 ? 316 VAL A O   1 
ATOM   2162 C  CB  . VAL A 1 287 ? -26.326 20.504 -1.669  1.00 14.47 ? 316 VAL A CB  1 
ATOM   2163 C  CG1 . VAL A 1 287 ? -27.195 19.346 -2.149  1.00 14.64 ? 316 VAL A CG1 1 
ATOM   2164 C  CG2 . VAL A 1 287 ? -24.984 20.522 -2.397  1.00 15.04 ? 316 VAL A CG2 1 
ATOM   2165 N  N   . MET A 1 288 ? -28.406 21.843 0.225   1.00 13.62 ? 317 MET A N   1 
ATOM   2166 C  CA  . MET A 1 288 ? -29.652 21.767 1.019   1.00 14.84 ? 317 MET A CA  1 
ATOM   2167 C  C   . MET A 1 288 ? -30.576 22.950 0.698   1.00 13.86 ? 317 MET A C   1 
ATOM   2168 O  O   . MET A 1 288 ? -31.773 22.743 0.521   1.00 12.28 ? 317 MET A O   1 
ATOM   2169 C  CB  . MET A 1 288 ? -29.373 21.725 2.522   1.00 15.59 ? 317 MET A CB  1 
ATOM   2170 C  CG  . MET A 1 288 ? -28.915 20.347 2.976   1.00 16.48 ? 317 MET A CG  1 
ATOM   2171 S  SD  . MET A 1 288 ? -28.346 20.444 4.679   1.00 17.81 ? 317 MET A SD  1 
ATOM   2172 C  CE  . MET A 1 288 ? -29.909 20.441 5.539   1.00 16.72 ? 317 MET A CE  1 
ATOM   2173 N  N   . ASP A 1 289 ? -30.028 24.156 0.589   1.00 13.95 ? 318 ASP A N   1 
ATOM   2174 C  CA  . ASP A 1 289 ? -30.853 25.371 0.338   1.00 14.15 ? 318 ASP A CA  1 
ATOM   2175 C  C   . ASP A 1 289 ? -31.500 25.345 -1.066  1.00 14.59 ? 318 ASP A C   1 
ATOM   2176 O  O   . ASP A 1 289 ? -32.605 25.845 -1.254  1.00 12.61 ? 318 ASP A O   1 
ATOM   2177 C  CB  . ASP A 1 289 ? -30.013 26.640 0.486   1.00 15.25 ? 318 ASP A CB  1 
ATOM   2178 C  CG  . ASP A 1 289 ? -29.689 26.942 1.933   1.00 14.83 ? 318 ASP A CG  1 
ATOM   2179 O  OD1 . ASP A 1 289 ? -30.440 26.474 2.820   1.00 15.46 ? 318 ASP A OD1 1 
ATOM   2180 O  OD2 . ASP A 1 289 ? -28.745 27.658 2.147   1.00 15.39 ? 318 ASP A OD2 1 
ATOM   2181 N  N   . ARG A 1 290 ? -30.797 24.783 -2.026  1.00 14.74 ? 319 ARG A N   1 
ATOM   2182 C  CA  . ARG A 1 290 ? -31.302 24.587 -3.374  1.00 17.83 ? 319 ARG A CA  1 
ATOM   2183 C  C   . ARG A 1 290 ? -32.443 23.550 -3.351  1.00 16.62 ? 319 ARG A C   1 
ATOM   2184 O  O   . ARG A 1 290 ? -33.413 23.670 -4.107  1.00 15.06 ? 319 ARG A O   1 
ATOM   2185 C  CB  . ARG A 1 290 ? -30.116 24.155 -4.247  1.00 21.49 ? 319 ARG A CB  1 
ATOM   2186 C  CG  . ARG A 1 290 ? -30.436 23.888 -5.707  1.00 27.22 ? 319 ARG A CG  1 
ATOM   2187 C  CD  . ARG A 1 290 ? -30.722 25.165 -6.471  1.00 30.98 ? 319 ARG A CD  1 
ATOM   2188 N  NE  . ARG A 1 290 ? -30.542 24.934 -7.904  1.00 37.13 ? 319 ARG A NE  1 
ATOM   2189 C  CZ  . ARG A 1 290 ? -29.513 25.366 -8.624  1.00 34.56 ? 319 ARG A CZ  1 
ATOM   2190 N  NH1 . ARG A 1 290 ? -28.519 25.992 -8.019  1.00 32.55 ? 319 ARG A NH1 1 
ATOM   2191 N  NH2 . ARG A 1 290 ? -29.512 25.202 -9.942  1.00 31.11 ? 319 ARG A NH2 1 
ATOM   2192 N  N   . VAL A 1 291 ? -32.334 22.534 -2.478  1.00 14.70 ? 320 VAL A N   1 
ATOM   2193 C  CA  . VAL A 1 291 ? -33.360 21.497 -2.393  1.00 14.73 ? 320 VAL A CA  1 
ATOM   2194 C  C   . VAL A 1 291 ? -34.610 22.090 -1.751  1.00 14.13 ? 320 VAL A C   1 
ATOM   2195 O  O   . VAL A 1 291 ? -35.721 21.866 -2.231  1.00 14.07 ? 320 VAL A O   1 
ATOM   2196 C  CB  . VAL A 1 291 ? -32.895 20.270 -1.593  1.00 14.33 ? 320 VAL A CB  1 
ATOM   2197 C  CG1 . VAL A 1 291 ? -34.061 19.391 -1.148  1.00 14.72 ? 320 VAL A CG1 1 
ATOM   2198 C  CG2 . VAL A 1 291 ? -31.880 19.473 -2.384  1.00 14.61 ? 320 VAL A CG2 1 
ATOM   2199 N  N   . ASN A 1 292 ? -34.409 22.769 -0.628  1.00 12.84 ? 321 ASN A N   1 
ATOM   2200 C  CA  . ASN A 1 292 ? -35.543 23.334 0.168   1.00 13.18 ? 321 ASN A CA  1 
ATOM   2201 C  C   . ASN A 1 292 ? -35.248 24.802 0.545   1.00 12.49 ? 321 ASN A C   1 
ATOM   2202 O  O   . ASN A 1 292 ? -34.813 25.113 1.670   1.00 12.09 ? 321 ASN A O   1 
ATOM   2203 C  CB  . ASN A 1 292 ? -35.872 22.456 1.378   1.00 12.85 ? 321 ASN A CB  1 
ATOM   2204 C  CG  . ASN A 1 292 ? -36.781 23.176 2.346   1.00 12.51 ? 321 ASN A CG  1 
ATOM   2205 O  OD1 . ASN A 1 292 ? -37.712 23.850 1.910   1.00 12.80 ? 321 ASN A OD1 1 
ATOM   2206 N  ND2 . ASN A 1 292 ? -36.495 23.053 3.630   1.00 11.07 ? 321 ASN A ND2 1 
ATOM   2207 N  N   . PRO A 1 293 ? -35.525 25.730 -0.393  1.00 13.14 ? 322 PRO A N   1 
ATOM   2208 C  CA  . PRO A 1 293 ? -35.378 27.177 -0.196  1.00 13.82 ? 322 PRO A CA  1 
ATOM   2209 C  C   . PRO A 1 293 ? -36.334 27.739 0.865   1.00 14.07 ? 322 PRO A C   1 
ATOM   2210 O  O   . PRO A 1 293 ? -36.025 28.767 1.454   1.00 13.06 ? 322 PRO A O   1 
ATOM   2211 C  CB  . PRO A 1 293 ? -35.675 27.856 -1.548  1.00 14.67 ? 322 PRO A CB  1 
ATOM   2212 C  CG  . PRO A 1 293 ? -35.925 26.708 -2.537  1.00 14.68 ? 322 PRO A CG  1 
ATOM   2213 C  CD  . PRO A 1 293 ? -35.997 25.424 -1.742  1.00 13.36 ? 322 PRO A CD  1 
ATOM   2214 N  N   . ASP A 1 294 ? -37.459 27.083 1.115   1.00 13.74 ? 323 ASP A N   1 
ATOM   2215 C  CA  . ASP A 1 294 ? -38.361 27.502 2.183   1.00 14.41 ? 323 ASP A CA  1 
ATOM   2216 C  C   . ASP A 1 294 ? -37.745 27.247 3.563   1.00 14.19 ? 323 ASP A C   1 
ATOM   2217 O  O   . ASP A 1 294 ? -38.284 27.702 4.548   1.00 13.85 ? 323 ASP A O   1 
ATOM   2218 C  CB  . ASP A 1 294 ? -39.687 26.750 2.106   1.00 15.26 ? 323 ASP A CB  1 
ATOM   2219 C  CG  . ASP A 1 294 ? -40.476 27.080 0.854   1.00 16.59 ? 323 ASP A CG  1 
ATOM   2220 O  OD1 . ASP A 1 294 ? -40.664 28.282 0.594   1.00 16.29 ? 323 ASP A OD1 1 
ATOM   2221 O  OD2 . ASP A 1 294 ? -40.830 26.129 0.149   1.00 15.08 ? 323 ASP A OD2 1 
ATOM   2222 N  N   . GLY A 1 295 ? -36.656 26.491 3.659   1.00 13.58 ? 324 GLY A N   1 
ATOM   2223 C  CA  . GLY A 1 295 ? -36.070 26.232 4.983   1.00 12.95 ? 324 GLY A CA  1 
ATOM   2224 C  C   . GLY A 1 295 ? -37.113 25.734 5.988   1.00 13.31 ? 324 GLY A C   1 
ATOM   2225 O  O   . GLY A 1 295 ? -37.839 24.768 5.743   1.00 12.79 ? 324 GLY A O   1 
ATOM   2226 N  N   . MET A 1 296 ? -37.234 26.421 7.120   1.00 13.49 ? 325 MET A N   1 
ATOM   2227 C  CA  . MET A 1 296 ? -38.104 25.969 8.228   1.00 14.36 ? 325 MET A CA  1 
ATOM   2228 C  C   . MET A 1 296 ? -39.573 26.294 7.933   1.00 13.73 ? 325 MET A C   1 
ATOM   2229 O  O   . MET A 1 296 ? -40.451 25.855 8.678   1.00 15.00 ? 325 MET A O   1 
ATOM   2230 C  CB  . MET A 1 296 ? -37.669 26.620 9.548   1.00 14.11 ? 325 MET A CB  1 
ATOM   2231 C  CG  . MET A 1 296 ? -36.306 26.171 9.962   1.00 14.25 ? 325 MET A CG  1 
ATOM   2232 S  SD  . MET A 1 296 ? -35.763 26.815 11.545  1.00 13.90 ? 325 MET A SD  1 
ATOM   2233 C  CE  . MET A 1 296 ? -34.135 26.079 11.620  1.00 14.41 ? 325 MET A CE  1 
ATOM   2234 N  N   . ALA A 1 297 ? -39.850 27.095 6.895   1.00 14.22 ? 326 ALA A N   1 
ATOM   2235 C  CA  . ALA A 1 297 ? -41.218 27.345 6.497   1.00 13.32 ? 326 ALA A CA  1 
ATOM   2236 C  C   . ALA A 1 297 ? -41.759 26.161 5.694   1.00 13.53 ? 326 ALA A C   1 
ATOM   2237 O  O   . ALA A 1 297 ? -42.933 26.164 5.371   1.00 11.98 ? 326 ALA A O   1 
ATOM   2238 C  CB  . ALA A 1 297 ? -41.336 28.620 5.691   1.00 13.85 ? 326 ALA A CB  1 
ATOM   2239 N  N   . PHE A 1 298 ? -40.926 25.175 5.352   1.00 13.29 ? 327 PHE A N   1 
ATOM   2240 C  CA  . PHE A 1 298 ? -41.377 24.047 4.519   1.00 14.03 ? 327 PHE A CA  1 
ATOM   2241 C  C   . PHE A 1 298 ? -42.589 23.316 5.125   1.00 14.15 ? 327 PHE A C   1 
ATOM   2242 O  O   . PHE A 1 298 ? -43.566 23.027 4.406   1.00 13.38 ? 327 PHE A O   1 
ATOM   2243 C  CB  . PHE A 1 298 ? -40.230 23.066 4.276   1.00 14.68 ? 327 PHE A CB  1 
ATOM   2244 C  CG  . PHE A 1 298 ? -40.591 21.978 3.309   1.00 14.66 ? 327 PHE A CG  1 
ATOM   2245 C  CD1 . PHE A 1 298 ? -40.595 22.231 1.950   1.00 14.60 ? 327 PHE A CD1 1 
ATOM   2246 C  CD2 . PHE A 1 298 ? -40.981 20.729 3.773   1.00 14.15 ? 327 PHE A CD2 1 
ATOM   2247 C  CE1 . PHE A 1 298 ? -40.937 21.230 1.060   1.00 15.57 ? 327 PHE A CE1 1 
ATOM   2248 C  CE2 . PHE A 1 298 ? -41.345 19.742 2.876   1.00 14.16 ? 327 PHE A CE2 1 
ATOM   2249 C  CZ  . PHE A 1 298 ? -41.326 19.996 1.529   1.00 14.20 ? 327 PHE A CZ  1 
ATOM   2250 N  N   . ILE A 1 299 ? -42.566 23.004 6.414   1.00 14.20 ? 328 ILE A N   1 
ATOM   2251 C  CA  . ILE A 1 299 ? -43.677 22.254 6.989   1.00 14.22 ? 328 ILE A CA  1 
ATOM   2252 C  C   . ILE A 1 299 ? -44.981 23.036 6.796   1.00 15.35 ? 328 ILE A C   1 
ATOM   2253 O  O   . ILE A 1 299 ? -45.925 22.506 6.156   1.00 15.37 ? 328 ILE A O   1 
ATOM   2254 C  CB  . ILE A 1 299 ? -43.479 21.901 8.475   1.00 14.09 ? 328 ILE A CB  1 
ATOM   2255 C  CG1 . ILE A 1 299 ? -42.301 20.955 8.725   1.00 14.00 ? 328 ILE A CG1 1 
ATOM   2256 C  CG2 . ILE A 1 299 ? -44.775 21.328 9.052   1.00 14.20 ? 328 ILE A CG2 1 
ATOM   2257 C  CD1 . ILE A 1 299 ? -42.360 19.637 7.990   1.00 13.53 ? 328 ILE A CD1 1 
ATOM   2258 N  N   . PRO A 1 300 ? -45.071 24.280 7.347   1.00 15.08 ? 329 PRO A N   1 
ATOM   2259 C  CA  . PRO A 1 300 ? -46.359 24.993 7.244   1.00 15.55 ? 329 PRO A CA  1 
ATOM   2260 C  C   . PRO A 1 300 ? -46.762 25.352 5.808   1.00 15.86 ? 329 PRO A C   1 
ATOM   2261 O  O   . PRO A 1 300 ? -47.949 25.332 5.526   1.00 16.38 ? 329 PRO A O   1 
ATOM   2262 C  CB  . PRO A 1 300 ? -46.187 26.277 8.077   1.00 15.17 ? 329 PRO A CB  1 
ATOM   2263 C  CG  . PRO A 1 300 ? -44.698 26.525 8.015   1.00 14.70 ? 329 PRO A CG  1 
ATOM   2264 C  CD  . PRO A 1 300 ? -44.127 25.123 8.098   1.00 14.68 ? 329 PRO A CD  1 
ATOM   2265 N  N   . LEU A 1 301 ? -45.839 25.695 4.905   1.00 15.40 ? 330 LEU A N   1 
ATOM   2266 C  CA  . LEU A 1 301 ? -46.259 26.111 3.566   1.00 16.03 ? 330 LEU A CA  1 
ATOM   2267 C  C   . LEU A 1 301 ? -46.392 24.924 2.608   1.00 16.34 ? 330 LEU A C   1 
ATOM   2268 O  O   . LEU A 1 301 ? -47.057 25.109 1.611   1.00 16.02 ? 330 LEU A O   1 
ATOM   2269 C  CB  . LEU A 1 301 ? -45.265 27.087 2.950   1.00 18.04 ? 330 LEU A CB  1 
ATOM   2270 C  CG  . LEU A 1 301 ? -45.055 28.406 3.694   1.00 18.29 ? 330 LEU A CG  1 
ATOM   2271 C  CD1 . LEU A 1 301 ? -43.929 29.195 3.030   1.00 19.57 ? 330 LEU A CD1 1 
ATOM   2272 C  CD2 . LEU A 1 301 ? -46.341 29.230 3.731   1.00 18.26 ? 330 LEU A CD2 1 
ATOM   2273 N  N   . ARG A 1 302 ? -45.706 23.789 2.783   1.00 16.25 ? 331 ARG A N   1 
ATOM   2274 C  CA  . ARG A 1 302 ? -45.775 22.748 1.746   1.00 17.59 ? 331 ARG A CA  1 
ATOM   2275 C  C   . ARG A 1 302 ? -46.425 21.483 2.316   1.00 16.97 ? 331 ARG A C   1 
ATOM   2276 O  O   . ARG A 1 302 ? -47.261 20.908 1.648   1.00 16.99 ? 331 ARG A O   1 
ATOM   2277 C  CB  . ARG A 1 302 ? -44.417 22.379 1.136   1.00 19.90 ? 331 ARG A CB  1 
ATOM   2278 C  CG  . ARG A 1 302 ? -43.593 23.529 0.550   1.00 21.48 ? 331 ARG A CG  1 
ATOM   2279 C  CD  . ARG A 1 302 ? -44.239 24.427 -0.486  1.00 23.31 ? 331 ARG A CD  1 
ATOM   2280 N  NE  . ARG A 1 302 ? -43.509 25.703 -0.577  1.00 25.45 ? 331 ARG A NE  1 
ATOM   2281 C  CZ  . ARG A 1 302 ? -44.035 26.892 -0.920  1.00 28.00 ? 331 ARG A CZ  1 
ATOM   2282 N  NH1 . ARG A 1 302 ? -45.276 26.987 -1.380  1.00 28.57 ? 331 ARG A NH1 1 
ATOM   2283 N  NH2 . ARG A 1 302 ? -43.315 27.995 -0.789  1.00 27.34 ? 331 ARG A NH2 1 
ATOM   2284 N  N   . VAL A 1 303 ? -46.055 21.069 3.527   1.00 14.81 ? 332 VAL A N   1 
ATOM   2285 C  CA  . VAL A 1 303 ? -46.511 19.807 4.070   1.00 16.04 ? 332 VAL A CA  1 
ATOM   2286 C  C   . VAL A 1 303 ? -47.954 19.953 4.571   1.00 15.93 ? 332 VAL A C   1 
ATOM   2287 O  O   . VAL A 1 303 ? -48.757 19.065 4.313   1.00 14.68 ? 332 VAL A O   1 
ATOM   2288 C  CB  . VAL A 1 303 ? -45.574 19.262 5.167   1.00 15.29 ? 332 VAL A CB  1 
ATOM   2289 C  CG1 . VAL A 1 303 ? -46.109 17.997 5.819   1.00 15.97 ? 332 VAL A CG1 1 
ATOM   2290 C  CG2 . VAL A 1 303 ? -44.175 19.013 4.616   1.00 15.28 ? 332 VAL A CG2 1 
ATOM   2291 N  N   . ILE A 1 304 ? -48.288 21.029 5.286   1.00 17.82 ? 333 ILE A N   1 
ATOM   2292 C  CA  . ILE A 1 304 ? -49.675 21.145 5.822   1.00 19.78 ? 333 ILE A CA  1 
ATOM   2293 C  C   . ILE A 1 304 ? -50.675 21.169 4.642   1.00 18.84 ? 333 ILE A C   1 
ATOM   2294 O  O   . ILE A 1 304 ? -51.658 20.435 4.652   1.00 17.70 ? 333 ILE A O   1 
ATOM   2295 C  CB  . ILE A 1 304 ? -49.837 22.365 6.759   1.00 20.55 ? 333 ILE A CB  1 
ATOM   2296 C  CG1 . ILE A 1 304 ? -49.026 22.269 8.054   1.00 21.65 ? 333 ILE A CG1 1 
ATOM   2297 C  CG2 . ILE A 1 304 ? -51.303 22.643 7.047   1.00 22.22 ? 333 ILE A CG2 1 
ATOM   2298 C  CD1 . ILE A 1 304 ? -48.946 20.898 8.659   1.00 24.09 ? 333 ILE A CD1 1 
ATOM   2299 N  N   . PRO A 1 305 ? -50.438 21.991 3.587   1.00 20.26 ? 334 PRO A N   1 
ATOM   2300 C  CA  . PRO A 1 305 ? -51.423 21.932 2.419   1.00 18.97 ? 334 PRO A CA  1 
ATOM   2301 C  C   . PRO A 1 305 ? -51.466 20.563 1.693   1.00 18.61 ? 334 PRO A C   1 
ATOM   2302 O  O   . PRO A 1 305 ? -52.567 20.062 1.301   1.00 18.85 ? 334 PRO A O   1 
ATOM   2303 C  CB  . PRO A 1 305 ? -50.988 23.072 1.493   1.00 19.11 ? 334 PRO A CB  1 
ATOM   2304 C  CG  . PRO A 1 305 ? -50.242 24.031 2.404   1.00 20.71 ? 334 PRO A CG  1 
ATOM   2305 C  CD  . PRO A 1 305 ? -49.554 23.159 3.435   1.00 19.87 ? 334 PRO A CD  1 
ATOM   2306 N  N   . PHE A 1 306 ? -50.319 19.907 1.557   1.00 16.86 ? 335 PHE A N   1 
ATOM   2307 C  CA  . PHE A 1 306 ? -50.266 18.538 1.026   1.00 17.98 ? 335 PHE A CA  1 
ATOM   2308 C  C   . PHE A 1 306 ? -51.186 17.600 1.815   1.00 18.50 ? 335 PHE A C   1 
ATOM   2309 O  O   . PHE A 1 306 ? -51.960 16.844 1.214   1.00 20.31 ? 335 PHE A O   1 
ATOM   2310 C  CB  . PHE A 1 306 ? -48.838 17.985 1.057   1.00 17.30 ? 335 PHE A CB  1 
ATOM   2311 C  CG  . PHE A 1 306 ? -48.695 16.563 0.562   1.00 16.63 ? 335 PHE A CG  1 
ATOM   2312 C  CD1 . PHE A 1 306 ? -48.761 16.272 -0.792  1.00 16.66 ? 335 PHE A CD1 1 
ATOM   2313 C  CD2 . PHE A 1 306 ? -48.464 15.524 1.449   1.00 16.48 ? 335 PHE A CD2 1 
ATOM   2314 C  CE1 . PHE A 1 306 ? -48.614 14.965 -1.240  1.00 16.62 ? 335 PHE A CE1 1 
ATOM   2315 C  CE2 . PHE A 1 306 ? -48.339 14.213 1.006   1.00 15.89 ? 335 PHE A CE2 1 
ATOM   2316 C  CZ  . PHE A 1 306 ? -48.402 13.942 -0.345  1.00 16.04 ? 335 PHE A CZ  1 
ATOM   2317 N  N   . LEU A 1 307 ? -51.098 17.614 3.142   1.00 19.09 ? 336 LEU A N   1 
ATOM   2318 C  CA  . LEU A 1 307 ? -51.865 16.672 3.955   1.00 19.31 ? 336 LEU A CA  1 
ATOM   2319 C  C   . LEU A 1 307 ? -53.354 17.051 3.924   1.00 20.72 ? 336 LEU A C   1 
ATOM   2320 O  O   . LEU A 1 307 ? -54.195 16.170 3.860   1.00 21.09 ? 336 LEU A O   1 
ATOM   2321 C  CB  . LEU A 1 307 ? -51.310 16.642 5.383   1.00 19.24 ? 336 LEU A CB  1 
ATOM   2322 C  CG  . LEU A 1 307 ? -49.927 15.999 5.542   1.00 18.46 ? 336 LEU A CG  1 
ATOM   2323 C  CD1 . LEU A 1 307 ? -49.433 16.107 6.982   1.00 17.92 ? 336 LEU A CD1 1 
ATOM   2324 C  CD2 . LEU A 1 307 ? -49.936 14.551 5.094   1.00 17.65 ? 336 LEU A CD2 1 
ATOM   2325 N  N   . ARG A 1 308 ? -53.671 18.333 3.900   1.00 22.55 ? 337 ARG A N   1 
ATOM   2326 C  CA  . ARG A 1 308 ? -55.066 18.783 3.697   1.00 25.31 ? 337 ARG A CA  1 
ATOM   2327 C  C   . ARG A 1 308 ? -55.653 18.213 2.400   1.00 23.82 ? 337 ARG A C   1 
ATOM   2328 O  O   . ARG A 1 308 ? -56.768 17.750 2.403   1.00 23.11 ? 337 ARG A O   1 
ATOM   2329 C  CB  . ARG A 1 308 ? -55.187 20.306 3.580   1.00 26.40 ? 337 ARG A CB  1 
ATOM   2330 C  CG  . ARG A 1 308 ? -55.523 21.004 4.885   1.00 33.33 ? 337 ARG A CG  1 
ATOM   2331 C  CD  . ARG A 1 308 ? -55.946 22.463 4.699   1.00 33.43 ? 337 ARG A CD  1 
ATOM   2332 N  NE  . ARG A 1 308 ? -55.091 23.353 5.473   1.00 33.57 ? 337 ARG A NE  1 
ATOM   2333 C  CZ  . ARG A 1 308 ? -54.200 24.189 4.943   1.00 38.21 ? 337 ARG A CZ  1 
ATOM   2334 N  NH1 . ARG A 1 308 ? -54.179 24.416 3.634   1.00 38.19 ? 337 ARG A NH1 1 
ATOM   2335 N  NH2 . ARG A 1 308 ? -53.339 24.805 5.732   1.00 39.90 ? 337 ARG A NH2 1 
ATOM   2336 N  N   . GLU A 1 309 ? -54.917 18.285 1.304   1.00 23.42 ? 338 GLU A N   1 
ATOM   2337 C  CA  . GLU A 1 309 ? -55.388 17.820 0.014   1.00 26.67 ? 338 GLU A CA  1 
ATOM   2338 C  C   . GLU A 1 309 ? -55.592 16.302 0.079   1.00 26.15 ? 338 GLU A C   1 
ATOM   2339 O  O   . GLU A 1 309 ? -56.459 15.775 -0.593  1.00 24.27 ? 338 GLU A O   1 
ATOM   2340 C  CB  . GLU A 1 309 ? -54.406 18.231 -1.088  1.00 32.70 ? 338 GLU A CB  1 
ATOM   2341 C  CG  . GLU A 1 309 ? -54.457 17.355 -2.332  1.00 41.47 ? 338 GLU A CG  1 
ATOM   2342 C  CD  . GLU A 1 309 ? -53.117 17.170 -3.038  1.00 53.01 ? 338 GLU A CD  1 
ATOM   2343 O  OE1 . GLU A 1 309 ? -52.176 16.584 -2.423  1.00 54.08 ? 338 GLU A OE1 1 
ATOM   2344 O  OE2 . GLU A 1 309 ? -53.008 17.616 -4.205  1.00 59.37 ? 338 GLU A OE2 1 
ATOM   2345 N  N   . LYS A 1 310 ? -54.812 15.605 0.897   1.00 23.36 ? 339 LYS A N   1 
ATOM   2346 C  CA  . LYS A 1 310 ? -55.006 14.169 1.090   1.00 22.48 ? 339 LYS A CA  1 
ATOM   2347 C  C   . LYS A 1 310 ? -56.085 13.883 2.150   1.00 21.39 ? 339 LYS A C   1 
ATOM   2348 O  O   . LYS A 1 310 ? -56.226 12.732 2.555   1.00 20.71 ? 339 LYS A O   1 
ATOM   2349 C  CB  . LYS A 1 310 ? -53.682 13.498 1.461   1.00 22.63 ? 339 LYS A CB  1 
ATOM   2350 C  CG  . LYS A 1 310 ? -52.598 13.578 0.388   1.00 24.06 ? 339 LYS A CG  1 
ATOM   2351 C  CD  . LYS A 1 310 ? -52.901 12.751 -0.836  1.00 25.98 ? 339 LYS A CD  1 
ATOM   2352 C  CE  . LYS A 1 310 ? -51.763 12.693 -1.833  1.00 26.80 ? 339 LYS A CE  1 
ATOM   2353 N  NZ  . LYS A 1 310 ? -52.034 13.538 -3.016  1.00 26.79 ? 339 LYS A NZ  1 
ATOM   2354 N  N   . GLY A 1 311 ? -56.844 14.878 2.609   1.00 20.74 ? 340 GLY A N   1 
ATOM   2355 C  CA  . GLY A 1 311 ? -58.018 14.593 3.423   1.00 20.92 ? 340 GLY A CA  1 
ATOM   2356 C  C   . GLY A 1 311 ? -57.732 14.615 4.912   1.00 21.34 ? 340 GLY A C   1 
ATOM   2357 O  O   . GLY A 1 311 ? -58.590 14.282 5.708   1.00 19.93 ? 340 GLY A O   1 
ATOM   2358 N  N   . VAL A 1 312 ? -56.547 15.050 5.334   1.00 22.00 ? 341 VAL A N   1 
ATOM   2359 C  CA  . VAL A 1 312 ? -56.327 15.209 6.763   1.00 20.04 ? 341 VAL A CA  1 
ATOM   2360 C  C   . VAL A 1 312 ? -57.027 16.500 7.207   1.00 21.27 ? 341 VAL A C   1 
ATOM   2361 O  O   . VAL A 1 312 ? -56.805 17.554 6.606   1.00 20.75 ? 341 VAL A O   1 
ATOM   2362 C  CB  . VAL A 1 312 ? -54.834 15.212 7.133   1.00 19.03 ? 341 VAL A CB  1 
ATOM   2363 C  CG1 . VAL A 1 312 ? -54.651 15.424 8.624   1.00 19.01 ? 341 VAL A CG1 1 
ATOM   2364 C  CG2 . VAL A 1 312 ? -54.164 13.928 6.698   1.00 19.27 ? 341 VAL A CG2 1 
ATOM   2365 N  N   . PRO A 1 313 ? -57.851 16.409 8.267   1.00 21.92 ? 342 PRO A N   1 
ATOM   2366 C  CA  . PRO A 1 313 ? -58.572 17.543 8.819   1.00 23.62 ? 342 PRO A CA  1 
ATOM   2367 C  C   . PRO A 1 313 ? -57.634 18.560 9.494   1.00 24.13 ? 342 PRO A C   1 
ATOM   2368 O  O   . PRO A 1 313 ? -56.647 18.183 10.154  1.00 22.10 ? 342 PRO A O   1 
ATOM   2369 C  CB  . PRO A 1 313 ? -59.546 16.999 9.878   1.00 23.59 ? 342 PRO A CB  1 
ATOM   2370 C  CG  . PRO A 1 313 ? -59.511 15.510 9.734   1.00 22.91 ? 342 PRO A CG  1 
ATOM   2371 C  CD  . PRO A 1 313 ? -58.195 15.209 9.045   1.00 23.18 ? 342 PRO A CD  1 
ATOM   2372 N  N   . ASP A 1 314 ? -57.991 19.827 9.351   1.00 24.19 ? 343 ASP A N   1 
ATOM   2373 C  CA  . ASP A 1 314 ? -57.268 20.954 9.925   1.00 28.53 ? 343 ASP A CA  1 
ATOM   2374 C  C   . ASP A 1 314 ? -57.091 20.794 11.443  1.00 28.19 ? 343 ASP A C   1 
ATOM   2375 O  O   . ASP A 1 314 ? -56.038 21.143 11.969  1.00 27.23 ? 343 ASP A O   1 
ATOM   2376 C  CB  . ASP A 1 314 ? -57.992 22.273 9.635   1.00 32.77 ? 343 ASP A CB  1 
ATOM   2377 C  CG  . ASP A 1 314 ? -57.874 22.722 8.190   1.00 39.76 ? 343 ASP A CG  1 
ATOM   2378 O  OD1 . ASP A 1 314 ? -56.920 22.287 7.518   1.00 39.34 ? 343 ASP A OD1 1 
ATOM   2379 O  OD2 . ASP A 1 314 ? -58.745 23.508 7.747   1.00 47.24 ? 343 ASP A OD2 1 
ATOM   2380 N  N   . GLU A 1 315 ? -58.103 20.301 12.142  1.00 25.60 ? 344 GLU A N   1 
ATOM   2381 C  CA  . GLU A 1 315 ? -58.028 20.081 13.591  1.00 26.79 ? 344 GLU A CA  1 
ATOM   2382 C  C   . GLU A 1 315 ? -56.917 19.070 13.921  1.00 24.46 ? 344 GLU A C   1 
ATOM   2383 O  O   . GLU A 1 315 ? -56.256 19.224 14.944  1.00 24.71 ? 344 GLU A O   1 
ATOM   2384 C  CB  . GLU A 1 315 ? -59.330 19.526 14.176  1.00 28.47 ? 344 GLU A CB  1 
ATOM   2385 C  CG  . GLU A 1 315 ? -60.518 20.465 14.046  1.00 34.90 ? 344 GLU A CG  1 
ATOM   2386 C  CD  . GLU A 1 315 ? -61.283 20.435 12.721  1.00 41.51 ? 344 GLU A CD  1 
ATOM   2387 O  OE1 . GLU A 1 315 ? -60.917 19.635 11.813  1.00 40.13 ? 344 GLU A OE1 1 
ATOM   2388 O  OE2 . GLU A 1 315 ? -62.246 21.239 12.584  1.00 48.41 ? 344 GLU A OE2 1 
ATOM   2389 N  N   . THR A 1 316 ? -56.728 18.041 13.101  1.00 19.89 ? 345 THR A N   1 
ATOM   2390 C  CA  . THR A 1 316 ? -55.665 17.086 13.345  1.00 20.06 ? 345 THR A CA  1 
ATOM   2391 C  C   . THR A 1 316 ? -54.301 17.753 13.087  1.00 18.53 ? 345 THR A C   1 
ATOM   2392 O  O   . THR A 1 316 ? -53.379 17.524 13.819  1.00 15.69 ? 345 THR A O   1 
ATOM   2393 C  CB  . THR A 1 316 ? -55.846 15.816 12.503  1.00 19.76 ? 345 THR A CB  1 
ATOM   2394 O  OG1 . THR A 1 316 ? -57.182 15.359 12.712  1.00 21.53 ? 345 THR A OG1 1 
ATOM   2395 C  CG2 . THR A 1 316 ? -54.885 14.705 12.880  1.00 18.96 ? 345 THR A CG2 1 
ATOM   2396 N  N   . LEU A 1 317 ? -54.191 18.609 12.088  1.00 19.67 ? 346 LEU A N   1 
ATOM   2397 C  CA  . LEU A 1 317 ? -52.901 19.286 11.835  1.00 22.33 ? 346 LEU A CA  1 
ATOM   2398 C  C   . LEU A 1 317 ? -52.605 20.255 12.988  1.00 22.44 ? 346 LEU A C   1 
ATOM   2399 O  O   . LEU A 1 317 ? -51.465 20.403 13.394  1.00 21.20 ? 346 LEU A O   1 
ATOM   2400 C  CB  . LEU A 1 317 ? -52.929 19.987 10.475  1.00 23.24 ? 346 LEU A CB  1 
ATOM   2401 C  CG  . LEU A 1 317 ? -53.219 19.058 9.295   1.00 25.04 ? 346 LEU A CG  1 
ATOM   2402 C  CD1 . LEU A 1 317 ? -53.621 19.853 8.060   1.00 25.81 ? 346 LEU A CD1 1 
ATOM   2403 C  CD2 . LEU A 1 317 ? -52.036 18.135 9.008   1.00 25.69 ? 346 LEU A CD2 1 
ATOM   2404 N  N   . GLU A 1 318 ? -53.643 20.822 13.577  1.00 23.25 ? 347 GLU A N   1 
ATOM   2405 C  CA  . GLU A 1 318 ? -53.513 21.720 14.731  1.00 25.96 ? 347 GLU A CA  1 
ATOM   2406 C  C   . GLU A 1 318 ? -53.047 20.939 15.971  1.00 22.43 ? 347 GLU A C   1 
ATOM   2407 O  O   . GLU A 1 318 ? -52.156 21.368 16.674  1.00 20.88 ? 347 GLU A O   1 
ATOM   2408 C  CB  . GLU A 1 318 ? -54.862 22.418 14.927  1.00 33.58 ? 347 GLU A CB  1 
ATOM   2409 C  CG  . GLU A 1 318 ? -54.901 23.423 16.060  1.00 40.60 ? 347 GLU A CG  1 
ATOM   2410 C  CD  . GLU A 1 318 ? -54.291 24.772 15.721  1.00 45.94 ? 347 GLU A CD  1 
ATOM   2411 O  OE1 . GLU A 1 318 ? -53.985 25.013 14.520  1.00 53.63 ? 347 GLU A OE1 1 
ATOM   2412 O  OE2 . GLU A 1 318 ? -54.111 25.571 16.663  1.00 44.43 ? 347 GLU A OE2 1 
ATOM   2413 N  N   . THR A 1 319 ? -53.640 19.787 16.250  1.00 21.48 ? 348 THR A N   1 
ATOM   2414 C  CA  . THR A 1 319 ? -53.163 18.899 17.300  1.00 21.51 ? 348 THR A CA  1 
ATOM   2415 C  C   . THR A 1 319 ? -51.645 18.658 17.141  1.00 19.24 ? 348 THR A C   1 
ATOM   2416 O  O   . THR A 1 319 ? -50.916 18.715 18.107  1.00 17.84 ? 348 THR A O   1 
ATOM   2417 C  CB  . THR A 1 319 ? -53.918 17.560 17.275  1.00 22.86 ? 348 THR A CB  1 
ATOM   2418 O  OG1 . THR A 1 319 ? -55.264 17.837 17.632  1.00 26.38 ? 348 THR A OG1 1 
ATOM   2419 C  CG2 . THR A 1 319 ? -53.370 16.497 18.203  1.00 23.44 ? 348 THR A CG2 1 
ATOM   2420 N  N   . ILE A 1 320 ? -51.200 18.329 15.937  1.00 16.82 ? 349 ILE A N   1 
ATOM   2421 C  CA  . ILE A 1 320 ? -49.854 17.773 15.721  1.00 16.98 ? 349 ILE A CA  1 
ATOM   2422 C  C   . ILE A 1 320 ? -48.829 18.902 15.834  1.00 16.46 ? 349 ILE A C   1 
ATOM   2423 O  O   . ILE A 1 320 ? -47.786 18.712 16.437  1.00 17.72 ? 349 ILE A O   1 
ATOM   2424 C  CB  . ILE A 1 320 ? -49.729 17.034 14.375  1.00 15.88 ? 349 ILE A CB  1 
ATOM   2425 C  CG1 . ILE A 1 320 ? -50.486 15.706 14.360  1.00 15.64 ? 349 ILE A CG1 1 
ATOM   2426 C  CG2 . ILE A 1 320 ? -48.279 16.812 13.994  1.00 15.93 ? 349 ILE A CG2 1 
ATOM   2427 C  CD1 . ILE A 1 320 ? -50.665 15.133 12.955  1.00 15.47 ? 349 ILE A CD1 1 
ATOM   2428 N  N   . MET A 1 321 ? -49.120 20.052 15.262  1.00 16.54 ? 350 MET A N   1 
ATOM   2429 C  CA  . MET A 1 321 ? -48.150 21.146 15.269  1.00 16.13 ? 350 MET A CA  1 
ATOM   2430 C  C   . MET A 1 321 ? -48.258 21.999 16.542  1.00 16.28 ? 350 MET A C   1 
ATOM   2431 O  O   . MET A 1 321 ? -47.307 22.735 16.848  1.00 15.29 ? 350 MET A O   1 
ATOM   2432 C  CB  . MET A 1 321 ? -48.337 22.057 14.055  1.00 16.12 ? 350 MET A CB  1 
ATOM   2433 C  CG  . MET A 1 321 ? -48.141 21.402 12.718  1.00 16.89 ? 350 MET A CG  1 
ATOM   2434 S  SD  . MET A 1 321 ? -46.729 20.253 12.609  1.00 18.46 ? 350 MET A SD  1 
ATOM   2435 C  CE  . MET A 1 321 ? -45.345 21.339 12.988  1.00 19.01 ? 350 MET A CE  1 
ATOM   2436 N  N   . VAL A 1 322 ? -49.382 21.982 17.281  1.00 17.39 ? 351 VAL A N   1 
ATOM   2437 C  CA  . VAL A 1 322 ? -49.511 22.886 18.469  1.00 17.46 ? 351 VAL A CA  1 
ATOM   2438 C  C   . VAL A 1 322 ? -49.609 22.057 19.761  1.00 18.02 ? 351 VAL A C   1 
ATOM   2439 O  O   . VAL A 1 322 ? -48.796 22.220 20.688  1.00 18.04 ? 351 VAL A O   1 
ATOM   2440 C  CB  . VAL A 1 322 ? -50.670 23.895 18.310  1.00 17.66 ? 351 VAL A CB  1 
ATOM   2441 C  CG1 . VAL A 1 322 ? -50.838 24.779 19.546  1.00 17.29 ? 351 VAL A CG1 1 
ATOM   2442 C  CG2 . VAL A 1 322 ? -50.491 24.759 17.072  1.00 17.53 ? 351 VAL A CG2 1 
ATOM   2443 N  N   . ASP A 1 323 ? -50.569 21.145 19.836  1.00 18.99 ? 352 ASP A N   1 
ATOM   2444 C  CA  . ASP A 1 323 ? -50.909 20.506 21.110  1.00 19.18 ? 352 ASP A CA  1 
ATOM   2445 C  C   . ASP A 1 323 ? -49.869 19.446 21.500  1.00 18.77 ? 352 ASP A C   1 
ATOM   2446 O  O   . ASP A 1 323 ? -49.496 19.350 22.693  1.00 16.02 ? 352 ASP A O   1 
ATOM   2447 C  CB  . ASP A 1 323 ? -52.294 19.851 21.039  1.00 22.09 ? 352 ASP A CB  1 
ATOM   2448 C  CG  . ASP A 1 323 ? -53.383 20.874 20.794  1.00 23.48 ? 352 ASP A CG  1 
ATOM   2449 O  OD1 . ASP A 1 323 ? -53.127 22.080 21.025  1.00 25.06 ? 352 ASP A OD1 1 
ATOM   2450 O  OD2 . ASP A 1 323 ? -54.426 20.472 20.322  1.00 25.94 ? 352 ASP A OD2 1 
ATOM   2451 N  N   . ASN A 1 324 ? -49.429 18.643 20.524  1.00 15.97 ? 353 ASN A N   1 
ATOM   2452 C  CA  . ASN A 1 324 ? -48.464 17.581 20.822  1.00 16.06 ? 353 ASN A CA  1 
ATOM   2453 C  C   . ASN A 1 324 ? -47.164 18.202 21.372  1.00 15.15 ? 353 ASN A C   1 
ATOM   2454 O  O   . ASN A 1 324 ? -46.632 17.768 22.392  1.00 14.58 ? 353 ASN A O   1 
ATOM   2455 C  CB  . ASN A 1 324 ? -48.218 16.688 19.598  1.00 16.19 ? 353 ASN A CB  1 
ATOM   2456 C  CG  . ASN A 1 324 ? -49.398 15.827 19.206  1.00 16.35 ? 353 ASN A CG  1 
ATOM   2457 O  OD1 . ASN A 1 324 ? -50.439 15.832 19.872  1.00 15.33 ? 353 ASN A OD1 1 
ATOM   2458 N  ND2 . ASN A 1 324 ? -49.214 15.019 18.168  1.00 16.50 ? 353 ASN A ND2 1 
ATOM   2459 N  N   . PRO A 1 325 ? -46.621 19.230 20.696  1.00 15.97 ? 354 PRO A N   1 
ATOM   2460 C  CA  . PRO A 1 325 ? -45.410 19.874 21.241  1.00 16.26 ? 354 PRO A CA  1 
ATOM   2461 C  C   . PRO A 1 325 ? -45.638 20.478 22.635  1.00 16.76 ? 354 PRO A C   1 
ATOM   2462 O  O   . PRO A 1 325 ? -44.785 20.329 23.524  1.00 18.80 ? 354 PRO A O   1 
ATOM   2463 C  CB  . PRO A 1 325 ? -45.035 20.947 20.215  1.00 15.57 ? 354 PRO A CB  1 
ATOM   2464 C  CG  . PRO A 1 325 ? -45.538 20.372 18.925  1.00 15.82 ? 354 PRO A CG  1 
ATOM   2465 C  CD  . PRO A 1 325 ? -46.828 19.672 19.309  1.00 15.91 ? 354 PRO A CD  1 
ATOM   2466 N  N   . ALA A 1 326 ? -46.763 21.146 22.837  1.00 17.62 ? 355 ALA A N   1 
ATOM   2467 C  CA  . ALA A 1 326 ? -47.053 21.768 24.138  1.00 19.11 ? 355 ALA A CA  1 
ATOM   2468 C  C   . ALA A 1 326 ? -47.019 20.692 25.236  1.00 18.41 ? 355 ALA A C   1 
ATOM   2469 O  O   . ALA A 1 326 ? -46.404 20.865 26.277  1.00 18.84 ? 355 ALA A O   1 
ATOM   2470 C  CB  . ALA A 1 326 ? -48.402 22.454 24.091  1.00 20.12 ? 355 ALA A CB  1 
ATOM   2471 N  N   . ARG A 1 327 ? -47.700 19.591 24.989  1.00 19.40 ? 356 ARG A N   1 
ATOM   2472 C  CA  . ARG A 1 327 ? -47.762 18.483 25.966  1.00 20.99 ? 356 ARG A CA  1 
ATOM   2473 C  C   . ARG A 1 327 ? -46.368 17.841 26.146  1.00 19.90 ? 356 ARG A C   1 
ATOM   2474 O  O   . ARG A 1 327 ? -45.970 17.482 27.261  1.00 19.51 ? 356 ARG A O   1 
ATOM   2475 C  CB  . ARG A 1 327 ? -48.818 17.481 25.500  1.00 24.02 ? 356 ARG A CB  1 
ATOM   2476 C  CG  . ARG A 1 327 ? -49.260 16.473 26.555  1.00 28.39 ? 356 ARG A CG  1 
ATOM   2477 C  CD  . ARG A 1 327 ? -49.796 15.218 25.863  1.00 31.50 ? 356 ARG A CD  1 
ATOM   2478 N  NE  . ARG A 1 327 ? -50.788 15.544 24.834  1.00 35.77 ? 356 ARG A NE  1 
ATOM   2479 C  CZ  . ARG A 1 327 ? -50.697 15.272 23.522  1.00 35.14 ? 356 ARG A CZ  1 
ATOM   2480 N  NH1 . ARG A 1 327 ? -49.830 14.378 23.056  1.00 29.53 ? 356 ARG A NH1 1 
ATOM   2481 N  NH2 . ARG A 1 327 ? -51.510 15.899 22.690  1.00 36.70 ? 356 ARG A NH2 1 
ATOM   2482 N  N   . PHE A 1 328 ? -45.608 17.698 25.069  1.00 18.50 ? 357 PHE A N   1 
ATOM   2483 C  CA  . PHE A 1 328 ? -44.278 17.034 25.159  1.00 17.72 ? 357 PHE A CA  1 
ATOM   2484 C  C   . PHE A 1 328 ? -43.273 17.924 25.901  1.00 16.83 ? 357 PHE A C   1 
ATOM   2485 O  O   . PHE A 1 328 ? -42.554 17.449 26.771  1.00 17.57 ? 357 PHE A O   1 
ATOM   2486 C  CB  . PHE A 1 328 ? -43.791 16.705 23.752  1.00 16.74 ? 357 PHE A CB  1 
ATOM   2487 C  CG  . PHE A 1 328 ? -42.504 15.932 23.659  1.00 15.98 ? 357 PHE A CG  1 
ATOM   2488 C  CD1 . PHE A 1 328 ? -42.437 14.610 24.082  1.00 15.53 ? 357 PHE A CD1 1 
ATOM   2489 C  CD2 . PHE A 1 328 ? -41.381 16.510 23.091  1.00 15.60 ? 357 PHE A CD2 1 
ATOM   2490 C  CE1 . PHE A 1 328 ? -41.258 13.895 23.971  1.00 15.39 ? 357 PHE A CE1 1 
ATOM   2491 C  CE2 . PHE A 1 328 ? -40.212 15.785 22.963  1.00 15.80 ? 357 PHE A CE2 1 
ATOM   2492 C  CZ  . PHE A 1 328 ? -40.154 14.484 23.402  1.00 15.06 ? 357 PHE A CZ  1 
ATOM   2493 N  N   . LEU A 1 329 ? -43.272 19.223 25.603  1.00 16.42 ? 358 LEU A N   1 
ATOM   2494 C  CA  . LEU A 1 329 ? -42.277 20.145 26.154  1.00 15.88 ? 358 LEU A CA  1 
ATOM   2495 C  C   . LEU A 1 329 ? -42.584 20.529 27.604  1.00 15.68 ? 358 LEU A C   1 
ATOM   2496 O  O   . LEU A 1 329 ? -41.671 20.874 28.309  1.00 14.99 ? 358 LEU A O   1 
ATOM   2497 C  CB  . LEU A 1 329 ? -42.192 21.402 25.284  1.00 16.38 ? 358 LEU A CB  1 
ATOM   2498 C  CG  . LEU A 1 329 ? -41.344 21.271 24.014  1.00 15.74 ? 358 LEU A CG  1 
ATOM   2499 C  CD1 . LEU A 1 329 ? -41.503 22.502 23.137  1.00 16.12 ? 358 LEU A CD1 1 
ATOM   2500 C  CD2 . LEU A 1 329 ? -39.873 21.051 24.337  1.00 15.62 ? 358 LEU A CD2 1 
ATOM   2501 N  N   A SER A 1 330 ? -43.858 20.512 28.008  0.50 15.90 ? 359 SER A N   1 
ATOM   2502 N  N   B SER A 1 330 ? -43.857 20.512 28.014  0.50 16.46 ? 359 SER A N   1 
ATOM   2503 C  CA  A SER A 1 330 ? -44.246 20.778 29.384  0.50 16.09 ? 359 SER A CA  1 
ATOM   2504 C  CA  B SER A 1 330 ? -44.217 20.804 29.392  0.50 17.01 ? 359 SER A CA  1 
ATOM   2505 C  C   A SER A 1 330 ? -43.503 19.802 30.299  0.50 16.89 ? 359 SER A C   1 
ATOM   2506 C  C   B SER A 1 330 ? -43.493 19.810 30.297  0.50 17.43 ? 359 SER A C   1 
ATOM   2507 O  O   A SER A 1 330 ? -43.669 18.590 30.140  0.50 16.63 ? 359 SER A O   1 
ATOM   2508 O  O   B SER A 1 330 ? -43.664 18.600 30.127  0.50 17.14 ? 359 SER A O   1 
ATOM   2509 C  CB  A SER A 1 330 ? -45.750 20.662 29.565  0.50 16.35 ? 359 SER A CB  1 
ATOM   2510 C  CB  B SER A 1 330 ? -45.712 20.750 29.619  0.50 17.96 ? 359 SER A CB  1 
ATOM   2511 O  OG  A SER A 1 330 ? -46.445 21.597 28.743  0.50 15.79 ? 359 SER A OG  1 
ATOM   2512 O  OG  B SER A 1 330 ? -46.082 21.546 30.739  0.50 18.74 ? 359 SER A OG  1 
ATOM   2513 N  N   . PRO A 1 331 ? -42.645 20.319 31.205  1.00 17.23 ? 360 PRO A N   1 
ATOM   2514 C  CA  . PRO A 1 331 ? -41.980 19.475 32.179  1.00 18.85 ? 360 PRO A CA  1 
ATOM   2515 C  C   . PRO A 1 331 ? -43.026 18.664 32.957  1.00 19.88 ? 360 PRO A C   1 
ATOM   2516 O  O   . PRO A 1 331 ? -43.941 19.237 33.486  1.00 21.86 ? 360 PRO A O   1 
ATOM   2517 C  CB  . PRO A 1 331 ? -41.214 20.422 33.117  1.00 18.46 ? 360 PRO A CB  1 
ATOM   2518 C  CG  . PRO A 1 331 ? -40.944 21.616 32.248  1.00 18.39 ? 360 PRO A CG  1 
ATOM   2519 C  CD  . PRO A 1 331 ? -42.198 21.712 31.400  1.00 17.62 ? 360 PRO A CD  1 
ATOM   2520 N  N   . THR A 1 332 ? -42.895 17.352 32.986  1.00 22.07 ? 361 THR A N   1 
ATOM   2521 C  CA  . THR A 1 332 ? -43.900 16.486 33.626  1.00 25.29 ? 361 THR A CA  1 
ATOM   2522 C  C   . THR A 1 332 ? -43.185 15.276 34.224  1.00 28.20 ? 361 THR A C   1 
ATOM   2523 O  O   . THR A 1 332 ? -42.495 14.533 33.504  1.00 28.87 ? 361 THR A O   1 
ATOM   2524 C  CB  . THR A 1 332 ? -44.979 16.014 32.643  1.00 27.78 ? 361 THR A CB  1 
ATOM   2525 O  OG1 . THR A 1 332 ? -44.454 15.014 31.775  1.00 34.84 ? 361 THR A OG1 1 
ATOM   2526 C  CG2 . THR A 1 332 ? -45.535 17.107 31.768  1.00 25.53 ? 361 THR A CG2 1 
ATOM   2527 N  N   . LEU A 1 333 ? -43.344 15.091 35.524  1.00 32.29 ? 362 LEU A N   1 
ATOM   2528 C  CA  . LEU A 1 333 ? -42.522 14.131 36.303  1.00 36.94 ? 362 LEU A CA  1 
ATOM   2529 C  C   . LEU A 1 333 ? -43.096 12.702 36.247  1.00 36.36 ? 362 LEU A C   1 
ATOM   2530 O  O   . LEU A 1 333 ? -44.075 12.365 36.907  1.00 41.15 ? 362 LEU A O   1 
ATOM   2531 C  CB  . LEU A 1 333 ? -42.414 14.680 37.729  1.00 38.43 ? 362 LEU A CB  1 
ATOM   2532 C  CG  . LEU A 1 333 ? -41.684 16.028 37.819  1.00 39.67 ? 362 LEU A CG  1 
ATOM   2533 C  CD1 . LEU A 1 333 ? -42.399 17.013 38.740  1.00 41.00 ? 362 LEU A CD1 1 
ATOM   2534 C  CD2 . LEU A 1 333 ? -40.239 15.837 38.248  1.00 39.52 ? 362 LEU A CD2 1 
ATOM   2535 N  N   . ASP B 1 6   ? 12.236  40.750 15.468  1.00 55.83 ? 35  ASP B N   1 
ATOM   2536 C  CA  . ASP B 1 6   ? 12.380  39.270 15.556  1.00 56.45 ? 35  ASP B CA  1 
ATOM   2537 C  C   . ASP B 1 6   ? 11.793  38.783 16.893  1.00 51.00 ? 35  ASP B C   1 
ATOM   2538 O  O   . ASP B 1 6   ? 12.472  38.756 17.922  1.00 50.64 ? 35  ASP B O   1 
ATOM   2539 C  CB  . ASP B 1 6   ? 13.844  38.862 15.388  1.00 61.71 ? 35  ASP B CB  1 
ATOM   2540 C  CG  . ASP B 1 6   ? 14.048  37.359 15.347  1.00 68.70 ? 35  ASP B CG  1 
ATOM   2541 O  OD1 . ASP B 1 6   ? 13.033  36.624 15.423  1.00 72.91 ? 35  ASP B OD1 1 
ATOM   2542 O  OD2 . ASP B 1 6   ? 15.218  36.935 15.242  1.00 70.43 ? 35  ASP B OD2 1 
ATOM   2543 N  N   . ARG B 1 7   ? 10.534  38.366 16.860  1.00 44.66 ? 36  ARG B N   1 
ATOM   2544 C  CA  . ARG B 1 7   ? 9.718   38.231 18.073  1.00 38.47 ? 36  ARG B CA  1 
ATOM   2545 C  C   . ARG B 1 7   ? 9.089   36.830 18.143  1.00 30.59 ? 36  ARG B C   1 
ATOM   2546 O  O   . ARG B 1 7   ? 8.910   36.169 17.139  1.00 27.00 ? 36  ARG B O   1 
ATOM   2547 C  CB  . ARG B 1 7   ? 8.619   39.303 18.087  1.00 37.47 ? 36  ARG B CB  1 
ATOM   2548 C  CG  . ARG B 1 7   ? 9.107   40.737 18.263  1.00 39.17 ? 36  ARG B CG  1 
ATOM   2549 C  CD  . ARG B 1 7   ? 9.747   40.980 19.621  1.00 40.80 ? 36  ARG B CD  1 
ATOM   2550 N  NE  . ARG B 1 7   ? 10.087  42.377 19.852  1.00 41.47 ? 36  ARG B NE  1 
ATOM   2551 C  CZ  . ARG B 1 7   ? 11.121  43.016 19.305  1.00 44.52 ? 36  ARG B CZ  1 
ATOM   2552 N  NH1 . ARG B 1 7   ? 12.048  42.350 18.635  1.00 40.77 ? 36  ARG B NH1 1 
ATOM   2553 N  NH2 . ARG B 1 7   ? 11.199  44.334 19.401  1.00 44.84 ? 36  ARG B NH2 1 
ATOM   2554 N  N   . ILE B 1 8   ? 8.749   36.408 19.353  1.00 26.12 ? 37  ILE B N   1 
ATOM   2555 C  CA  . ILE B 1 8   ? 7.927   35.203 19.580  1.00 25.41 ? 37  ILE B CA  1 
ATOM   2556 C  C   . ILE B 1 8   ? 6.561   35.631 20.136  1.00 24.04 ? 37  ILE B C   1 
ATOM   2557 O  O   . ILE B 1 8   ? 6.524   36.387 21.092  1.00 25.73 ? 37  ILE B O   1 
ATOM   2558 C  CB  . ILE B 1 8   ? 8.657   34.242 20.536  1.00 25.48 ? 37  ILE B CB  1 
ATOM   2559 C  CG1 . ILE B 1 8   ? 9.888   33.629 19.861  1.00 26.81 ? 37  ILE B CG1 1 
ATOM   2560 C  CG2 . ILE B 1 8   ? 7.722   33.178 21.103  1.00 24.14 ? 37  ILE B CG2 1 
ATOM   2561 C  CD1 . ILE B 1 8   ? 10.892  32.986 20.844  1.00 27.96 ? 37  ILE B CD1 1 
ATOM   2562 N  N   . ASN B 1 9   ? 5.458   35.126 19.563  1.00 21.68 ? 38  ASN B N   1 
ATOM   2563 C  CA  . ASN B 1 9   ? 4.106   35.429 20.066  1.00 21.75 ? 38  ASN B CA  1 
ATOM   2564 C  C   . ASN B 1 9   ? 3.808   34.570 21.306  1.00 21.64 ? 38  ASN B C   1 
ATOM   2565 O  O   . ASN B 1 9   ? 4.089   33.370 21.319  1.00 20.11 ? 38  ASN B O   1 
ATOM   2566 C  CB  . ASN B 1 9   ? 3.061   35.290 18.956  1.00 22.93 ? 38  ASN B CB  1 
ATOM   2567 C  CG  . ASN B 1 9   ? 3.044   36.517 18.068  1.00 23.38 ? 38  ASN B CG  1 
ATOM   2568 O  OD1 . ASN B 1 9   ? 3.212   37.642 18.532  1.00 28.11 ? 38  ASN B OD1 1 
ATOM   2569 N  ND2 . ASN B 1 9   ? 2.854   36.323 16.792  1.00 24.00 ? 38  ASN B ND2 1 
ATOM   2570 N  N   . THR B 1 10  ? 3.306   35.232 22.349  1.00 18.88 ? 39  THR B N   1 
ATOM   2571 C  CA  . THR B 1 10  ? 2.858   34.641 23.601  1.00 17.36 ? 39  THR B CA  1 
ATOM   2572 C  C   . THR B 1 10  ? 1.428   35.108 23.839  1.00 17.69 ? 39  THR B C   1 
ATOM   2573 O  O   . THR B 1 10  ? 0.958   36.027 23.159  1.00 18.78 ? 39  THR B O   1 
ATOM   2574 C  CB  . THR B 1 10  ? 3.667   35.104 24.826  1.00 17.82 ? 39  THR B CB  1 
ATOM   2575 O  OG1 . THR B 1 10  ? 3.405   36.487 25.098  1.00 16.39 ? 39  THR B OG1 1 
ATOM   2576 C  CG2 . THR B 1 10  ? 5.147   34.901 24.647  1.00 17.98 ? 39  THR B CG2 1 
ATOM   2577 N  N   . VAL B 1 11  ? 0.775   34.522 24.830  1.00 16.48 ? 40  VAL B N   1 
ATOM   2578 C  CA  . VAL B 1 11  ? -0.606  34.859 25.115  1.00 16.58 ? 40  VAL B CA  1 
ATOM   2579 C  C   . VAL B 1 11  ? -0.748  36.293 25.658  1.00 18.26 ? 40  VAL B C   1 
ATOM   2580 O  O   . VAL B 1 11  ? -1.893  36.775 25.838  1.00 18.46 ? 40  VAL B O   1 
ATOM   2581 C  CB  . VAL B 1 11  ? -1.234  33.827 26.065  1.00 15.65 ? 40  VAL B CB  1 
ATOM   2582 C  CG1 . VAL B 1 11  ? -1.338  32.457 25.385  1.00 16.25 ? 40  VAL B CG1 1 
ATOM   2583 C  CG2 . VAL B 1 11  ? -0.495  33.720 27.398  1.00 15.00 ? 40  VAL B CG2 1 
ATOM   2584 N  N   . ARG B 1 12  ? 0.362   36.951 25.970  1.00 19.76 ? 41  ARG B N   1 
ATOM   2585 C  CA  . ARG B 1 12  ? 0.355   38.359 26.371  1.00 23.28 ? 41  ARG B CA  1 
ATOM   2586 C  C   . ARG B 1 12  ? 1.043   39.225 25.308  1.00 22.52 ? 41  ARG B C   1 
ATOM   2587 O  O   . ARG B 1 12  ? 1.412   40.333 25.598  1.00 22.93 ? 41  ARG B O   1 
ATOM   2588 C  CB  . ARG B 1 12  ? 1.063   38.549 27.718  1.00 24.17 ? 41  ARG B CB  1 
ATOM   2589 C  CG  . ARG B 1 12  ? 0.439   37.750 28.848  1.00 27.44 ? 41  ARG B CG  1 
ATOM   2590 C  CD  . ARG B 1 12  ? 1.243   37.886 30.114  1.00 30.79 ? 41  ARG B CD  1 
ATOM   2591 N  NE  . ARG B 1 12  ? 1.147   39.232 30.637  1.00 33.42 ? 41  ARG B NE  1 
ATOM   2592 C  CZ  . ARG B 1 12  ? 1.825   39.666 31.692  1.00 35.59 ? 41  ARG B CZ  1 
ATOM   2593 N  NH1 . ARG B 1 12  ? 2.789   38.917 32.208  1.00 29.47 ? 41  ARG B NH1 1 
ATOM   2594 N  NH2 . ARG B 1 12  ? 1.519   40.839 32.223  1.00 34.18 ? 41  ARG B NH2 1 
ATOM   2595 N  N   . GLY B 1 13  ? 1.204   38.742 24.095  1.00 21.82 ? 42  GLY B N   1 
ATOM   2596 C  CA  . GLY B 1 13  ? 1.847   39.551 23.089  1.00 22.40 ? 42  GLY B CA  1 
ATOM   2597 C  C   . GLY B 1 13  ? 3.266   39.101 22.786  1.00 23.30 ? 42  GLY B C   1 
ATOM   2598 O  O   . GLY B 1 13  ? 3.760   38.055 23.314  1.00 23.35 ? 42  GLY B O   1 
ATOM   2599 N  N   . PRO B 1 14  ? 3.940   39.887 21.913  1.00 24.01 ? 43  PRO B N   1 
ATOM   2600 C  CA  . PRO B 1 14  ? 5.256   39.594 21.407  1.00 23.90 ? 43  PRO B CA  1 
ATOM   2601 C  C   . PRO B 1 14  ? 6.271   39.770 22.542  1.00 23.77 ? 43  PRO B C   1 
ATOM   2602 O  O   . PRO B 1 14  ? 6.127   40.655 23.345  1.00 24.02 ? 43  PRO B O   1 
ATOM   2603 C  CB  . PRO B 1 14  ? 5.539   40.586 20.261  1.00 24.21 ? 43  PRO B CB  1 
ATOM   2604 C  CG  . PRO B 1 14  ? 4.195   41.186 19.930  1.00 24.23 ? 43  PRO B CG  1 
ATOM   2605 C  CD  . PRO B 1 14  ? 3.398   41.077 21.213  1.00 25.00 ? 43  PRO B CD  1 
ATOM   2606 N  N   . ILE B 1 15  ? 7.235   38.873 22.613  1.00 24.92 ? 44  ILE B N   1 
ATOM   2607 C  CA  . ILE B 1 15  ? 8.409   39.029 23.464  1.00 25.50 ? 44  ILE B CA  1 
ATOM   2608 C  C   . ILE B 1 15  ? 9.645   38.880 22.571  1.00 26.38 ? 44  ILE B C   1 
ATOM   2609 O  O   . ILE B 1 15  ? 9.581   38.226 21.538  1.00 27.89 ? 44  ILE B O   1 
ATOM   2610 C  CB  . ILE B 1 15  ? 8.408   37.994 24.609  1.00 25.84 ? 44  ILE B CB  1 
ATOM   2611 C  CG1 . ILE B 1 15  ? 8.536   36.550 24.096  1.00 26.69 ? 44  ILE B CG1 1 
ATOM   2612 C  CG2 . ILE B 1 15  ? 7.184   38.184 25.488  1.00 25.67 ? 44  ILE B CG2 1 
ATOM   2613 C  CD1 . ILE B 1 15  ? 8.996   35.534 25.139  1.00 24.97 ? 44  ILE B CD1 1 
ATOM   2614 N  N   . THR B 1 16  ? 10.763  39.452 22.989  1.00 26.35 ? 45  THR B N   1 
ATOM   2615 C  CA  . THR B 1 16  ? 12.031  39.287 22.269  1.00 27.20 ? 45  THR B CA  1 
ATOM   2616 C  C   . THR B 1 16  ? 12.556  37.875 22.555  1.00 27.97 ? 45  THR B C   1 
ATOM   2617 O  O   . THR B 1 16  ? 12.150  37.230 23.518  1.00 25.86 ? 45  THR B O   1 
ATOM   2618 C  CB  . THR B 1 16  ? 13.025  40.385 22.683  1.00 26.82 ? 45  THR B CB  1 
ATOM   2619 O  OG1 . THR B 1 16  ? 13.472  40.107 24.008  1.00 28.85 ? 45  THR B OG1 1 
ATOM   2620 C  CG2 . THR B 1 16  ? 12.430  41.777 22.682  1.00 25.94 ? 45  THR B CG2 1 
ATOM   2621 N  N   . ILE B 1 17  ? 13.517  37.409 21.784  1.00 31.41 ? 46  ILE B N   1 
ATOM   2622 C  CA  . ILE B 1 17  ? 13.981  36.018 21.950  1.00 35.48 ? 46  ILE B CA  1 
ATOM   2623 C  C   . ILE B 1 17  ? 14.620  35.827 23.334  1.00 32.53 ? 46  ILE B C   1 
ATOM   2624 O  O   . ILE B 1 17  ? 14.575  34.734 23.885  1.00 33.46 ? 46  ILE B O   1 
ATOM   2625 C  CB  . ILE B 1 17  ? 14.958  35.601 20.828  1.00 36.57 ? 46  ILE B CB  1 
ATOM   2626 C  CG1 . ILE B 1 17  ? 14.410  35.926 19.439  1.00 40.93 ? 46  ILE B CG1 1 
ATOM   2627 C  CG2 . ILE B 1 17  ? 15.300  34.124 20.940  1.00 39.87 ? 46  ILE B CG2 1 
ATOM   2628 C  CD1 . ILE B 1 17  ? 13.077  35.268 19.146  1.00 44.92 ? 46  ILE B CD1 1 
ATOM   2629 N  N   . SER B 1 18  ? 15.226  36.874 23.877  1.00 31.51 ? 47  SER B N   1 
ATOM   2630 C  CA  . SER B 1 18  ? 16.034  36.780 25.081  1.00 30.58 ? 47  SER B CA  1 
ATOM   2631 C  C   . SER B 1 18  ? 15.145  36.711 26.329  1.00 28.62 ? 47  SER B C   1 
ATOM   2632 O  O   . SER B 1 18  ? 15.553  36.185 27.352  1.00 30.17 ? 47  SER B O   1 
ATOM   2633 C  CB  . SER B 1 18  ? 16.973  37.957 25.152  1.00 33.41 ? 47  SER B CB  1 
ATOM   2634 O  OG  . SER B 1 18  ? 16.252  39.156 24.880  1.00 37.15 ? 47  SER B OG  1 
ATOM   2635 N  N   . GLU B 1 19  ? 13.944  37.251 26.248  1.00 27.34 ? 48  GLU B N   1 
ATOM   2636 C  CA  . GLU B 1 19  ? 12.991  37.187 27.347  1.00 26.51 ? 48  GLU B CA  1 
ATOM   2637 C  C   . GLU B 1 19  ? 12.478  35.746 27.516  1.00 23.46 ? 48  GLU B C   1 
ATOM   2638 O  O   . GLU B 1 19  ? 11.940  35.421 28.551  1.00 24.08 ? 48  GLU B O   1 
ATOM   2639 C  CB  . GLU B 1 19  ? 11.800  38.112 27.087  1.00 29.44 ? 48  GLU B CB  1 
ATOM   2640 C  CG  . GLU B 1 19  ? 12.132  39.584 27.027  1.00 32.19 ? 48  GLU B CG  1 
ATOM   2641 C  CD  . GLU B 1 19  ? 10.964  40.439 26.554  1.00 38.09 ? 48  GLU B CD  1 
ATOM   2642 O  OE1 . GLU B 1 19  ? 10.756  40.558 25.326  1.00 41.40 ? 48  GLU B OE1 1 
ATOM   2643 O  OE2 . GLU B 1 19  ? 10.246  40.968 27.414  1.00 43.69 ? 48  GLU B OE2 1 
ATOM   2644 N  N   . ALA B 1 20  ? 12.572  34.897 26.496  1.00 21.56 ? 49  ALA B N   1 
ATOM   2645 C  CA  . ALA B 1 20  ? 12.110  33.512 26.631  1.00 20.19 ? 49  ALA B CA  1 
ATOM   2646 C  C   . ALA B 1 20  ? 12.818  32.825 27.809  1.00 18.21 ? 49  ALA B C   1 
ATOM   2647 O  O   . ALA B 1 20  ? 12.169  32.211 28.636  1.00 18.24 ? 49  ALA B O   1 
ATOM   2648 C  CB  . ALA B 1 20  ? 12.324  32.749 25.344  1.00 19.53 ? 49  ALA B CB  1 
ATOM   2649 N  N   . GLY B 1 21  ? 14.138  32.965 27.909  1.00 17.69 ? 50  GLY B N   1 
ATOM   2650 C  CA  . GLY B 1 21  ? 14.901  32.282 28.931  1.00 16.48 ? 50  GLY B CA  1 
ATOM   2651 C  C   . GLY B 1 21  ? 14.619  30.782 28.935  1.00 16.85 ? 50  GLY B C   1 
ATOM   2652 O  O   . GLY B 1 21  ? 14.278  30.208 27.901  1.00 15.20 ? 50  GLY B O   1 
ATOM   2653 N  N   . PHE B 1 22  ? 14.735  30.187 30.123  1.00 15.72 ? 51  PHE B N   1 
ATOM   2654 C  CA  . PHE B 1 22  ? 14.586  28.763 30.344  1.00 16.63 ? 51  PHE B CA  1 
ATOM   2655 C  C   . PHE B 1 22  ? 13.143  28.395 29.981  1.00 16.63 ? 51  PHE B C   1 
ATOM   2656 O  O   . PHE B 1 22  ? 12.187  28.907 30.594  1.00 16.69 ? 51  PHE B O   1 
ATOM   2657 C  CB  . PHE B 1 22  ? 14.987  28.432 31.784  1.00 16.94 ? 51  PHE B CB  1 
ATOM   2658 C  CG  . PHE B 1 22  ? 15.004  26.985 32.184  1.00 17.07 ? 51  PHE B CG  1 
ATOM   2659 C  CD1 . PHE B 1 22  ? 13.856  26.214 32.137  1.00 18.11 ? 51  PHE B CD1 1 
ATOM   2660 C  CD2 . PHE B 1 22  ? 16.157  26.416 32.695  1.00 18.45 ? 51  PHE B CD2 1 
ATOM   2661 C  CE1 . PHE B 1 22  ? 13.866  24.899 32.568  1.00 17.61 ? 51  PHE B CE1 1 
ATOM   2662 C  CE2 . PHE B 1 22  ? 16.168  25.102 33.130  1.00 19.07 ? 51  PHE B CE2 1 
ATOM   2663 C  CZ  . PHE B 1 22  ? 15.022  24.337 33.047  1.00 19.64 ? 51  PHE B CZ  1 
ATOM   2664 N  N   . THR B 1 23  ? 13.015  27.563 28.939  1.00 16.95 ? 52  THR B N   1 
ATOM   2665 C  CA  . THR B 1 23  ? 11.737  27.292 28.264  1.00 15.51 ? 52  THR B CA  1 
ATOM   2666 C  C   . THR B 1 23  ? 11.415  25.802 28.374  1.00 15.31 ? 52  THR B C   1 
ATOM   2667 O  O   . THR B 1 23  ? 12.288  24.981 28.122  1.00 15.64 ? 52  THR B O   1 
ATOM   2668 C  CB  . THR B 1 23  ? 11.791  27.783 26.814  1.00 16.04 ? 52  THR B CB  1 
ATOM   2669 O  OG1 . THR B 1 23  ? 11.911  29.205 26.833  1.00 15.79 ? 52  THR B OG1 1 
ATOM   2670 C  CG2 . THR B 1 23  ? 10.551  27.424 26.026  1.00 16.85 ? 52  THR B CG2 1 
ATOM   2671 N  N   . LEU B 1 24  ? 10.185  25.470 28.774  1.00 14.77 ? 53  LEU B N   1 
ATOM   2672 C  CA  . LEU B 1 24  ? 9.662   24.102 28.661  1.00 15.53 ? 53  LEU B CA  1 
ATOM   2673 C  C   . LEU B 1 24  ? 8.808   23.975 27.386  1.00 15.30 ? 53  LEU B C   1 
ATOM   2674 O  O   . LEU B 1 24  ? 7.705   24.554 27.283  1.00 15.85 ? 53  LEU B O   1 
ATOM   2675 C  CB  . LEU B 1 24  ? 8.809   23.772 29.887  1.00 15.77 ? 53  LEU B CB  1 
ATOM   2676 C  CG  . LEU B 1 24  ? 9.554   23.741 31.218  1.00 17.49 ? 53  LEU B CG  1 
ATOM   2677 C  CD1 . LEU B 1 24  ? 8.554   23.770 32.375  1.00 17.00 ? 53  LEU B CD1 1 
ATOM   2678 C  CD2 . LEU B 1 24  ? 10.445  22.512 31.283  1.00 18.46 ? 53  LEU B CD2 1 
ATOM   2679 N  N   . MET B 1 25  ? 9.275   23.185 26.434  1.00 15.04 ? 54  MET B N   1 
ATOM   2680 C  CA  . MET B 1 25  ? 8.772   23.256 25.039  1.00 15.13 ? 54  MET B CA  1 
ATOM   2681 C  C   . MET B 1 25  ? 7.482   22.453 24.814  1.00 14.53 ? 54  MET B C   1 
ATOM   2682 O  O   . MET B 1 25  ? 6.891   22.575 23.699  1.00 14.16 ? 54  MET B O   1 
ATOM   2683 C  CB  . MET B 1 25  ? 9.838   22.764 24.047  1.00 15.08 ? 54  MET B CB  1 
ATOM   2684 C  CG  . MET B 1 25  ? 10.861  23.814 23.679  1.00 15.35 ? 54  MET B CG  1 
ATOM   2685 S  SD  . MET B 1 25  ? 10.235  25.274 22.892  1.00 17.43 ? 54  MET B SD  1 
ATOM   2686 C  CE  . MET B 1 25  ? 9.279   24.522 21.575  1.00 17.59 ? 54  MET B CE  1 
ATOM   2687 N  N   . HIS B 1 26  ? 7.078   21.601 25.766  1.00 14.12 ? 55  HIS B N   1 
ATOM   2688 C  CA  . HIS B 1 26  ? 5.880   20.757 25.631  1.00 13.33 ? 55  HIS B CA  1 
ATOM   2689 C  C   . HIS B 1 26  ? 5.181   20.581 26.984  1.00 13.00 ? 55  HIS B C   1 
ATOM   2690 O  O   . HIS B 1 26  ? 5.471   19.632 27.720  1.00 12.93 ? 55  HIS B O   1 
ATOM   2691 C  CB  . HIS B 1 26  ? 6.223   19.394 25.001  1.00 13.48 ? 55  HIS B CB  1 
ATOM   2692 C  CG  . HIS B 1 26  ? 5.015   18.552 24.715  1.00 13.25 ? 55  HIS B CG  1 
ATOM   2693 N  ND1 . HIS B 1 26  ? 4.796   17.943 23.503  1.00 13.11 ? 55  HIS B ND1 1 
ATOM   2694 C  CD2 . HIS B 1 26  ? 3.924   18.262 25.454  1.00 13.42 ? 55  HIS B CD2 1 
ATOM   2695 C  CE1 . HIS B 1 26  ? 3.654   17.264 23.546  1.00 13.21 ? 55  HIS B CE1 1 
ATOM   2696 N  NE2 . HIS B 1 26  ? 3.099   17.459 24.710  1.00 12.62 ? 55  HIS B NE2 1 
ATOM   2697 N  N   . GLU B 1 27  ? 4.219   21.466 27.260  1.00 13.42 ? 56  GLU B N   1 
ATOM   2698 C  CA  . GLU B 1 27  ? 3.384   21.443 28.467  1.00 13.92 ? 56  GLU B CA  1 
ATOM   2699 C  C   . GLU B 1 27  ? 1.917   21.713 28.090  1.00 14.34 ? 56  GLU B C   1 
ATOM   2700 O  O   . GLU B 1 27  ? 1.558   21.986 26.920  1.00 14.32 ? 56  GLU B O   1 
ATOM   2701 C  CB  . GLU B 1 27  ? 3.904   22.478 29.474  1.00 13.73 ? 56  GLU B CB  1 
ATOM   2702 C  CG  . GLU B 1 27  ? 5.393   22.323 29.773  1.00 14.89 ? 56  GLU B CG  1 
ATOM   2703 C  CD  . GLU B 1 27  ? 5.716   21.071 30.578  1.00 15.40 ? 56  GLU B CD  1 
ATOM   2704 O  OE1 . GLU B 1 27  ? 4.780   20.551 31.281  1.00 13.82 ? 56  GLU B OE1 1 
ATOM   2705 O  OE2 . GLU B 1 27  ? 6.880   20.643 30.549  1.00 15.98 ? 56  GLU B OE2 1 
ATOM   2706 N  N   . HIS B 1 28  ? 1.065   21.650 29.109  1.00 14.30 ? 57  HIS B N   1 
ATOM   2707 C  CA  . HIS B 1 28  ? -0.351  21.988 29.018  1.00 13.71 ? 57  HIS B CA  1 
ATOM   2708 C  C   . HIS B 1 28  ? -0.759  22.673 30.316  1.00 13.28 ? 57  HIS B C   1 
ATOM   2709 O  O   . HIS B 1 28  ? -0.313  22.265 31.364  1.00 13.33 ? 57  HIS B O   1 
ATOM   2710 C  CB  . HIS B 1 28  ? -1.213  20.736 28.782  1.00 13.94 ? 57  HIS B CB  1 
ATOM   2711 C  CG  . HIS B 1 28  ? -0.799  19.904 27.618  1.00 14.03 ? 57  HIS B CG  1 
ATOM   2712 N  ND1 . HIS B 1 28  ? -1.285  20.148 26.348  1.00 14.18 ? 57  HIS B ND1 1 
ATOM   2713 C  CD2 . HIS B 1 28  ? 0.003   18.809 27.535  1.00 14.06 ? 57  HIS B CD2 1 
ATOM   2714 C  CE1 . HIS B 1 28  ? -0.780  19.248 25.521  1.00 14.46 ? 57  HIS B CE1 1 
ATOM   2715 N  NE2 . HIS B 1 28  ? 0.038   18.416 26.226  1.00 13.41 ? 57  HIS B NE2 1 
ATOM   2716 N  N   . ILE B 1 29  ? -1.576  23.716 30.239  1.00 13.71 ? 58  ILE B N   1 
ATOM   2717 C  CA  . ILE B 1 29  ? -2.327  24.194 31.404  1.00 13.85 ? 58  ILE B CA  1 
ATOM   2718 C  C   . ILE B 1 29  ? -3.465  23.198 31.675  1.00 14.36 ? 58  ILE B C   1 
ATOM   2719 O  O   . ILE B 1 29  ? -3.629  22.729 32.806  1.00 14.11 ? 58  ILE B O   1 
ATOM   2720 C  CB  . ILE B 1 29  ? -2.809  25.643 31.204  1.00 14.00 ? 58  ILE B CB  1 
ATOM   2721 C  CG1 . ILE B 1 29  ? -1.621  26.578 31.031  1.00 14.76 ? 58  ILE B CG1 1 
ATOM   2722 C  CG2 . ILE B 1 29  ? -3.685  26.108 32.354  1.00 14.77 ? 58  ILE B CG2 1 
ATOM   2723 C  CD1 . ILE B 1 29  ? -0.725  26.662 32.274  1.00 15.24 ? 58  ILE B CD1 1 
ATOM   2724 N  N   . CYS B 1 30  ? -4.193  22.795 30.632  1.00 14.51 ? 59  CYS B N   1 
ATOM   2725 C  CA  . CYS B 1 30  ? -5.288  21.849 30.814  1.00 16.06 ? 59  CYS B CA  1 
ATOM   2726 C  C   . CYS B 1 30  ? -5.501  21.018 29.538  1.00 15.74 ? 59  CYS B C   1 
ATOM   2727 O  O   . CYS B 1 30  ? -5.702  21.541 28.441  1.00 16.31 ? 59  CYS B O   1 
ATOM   2728 C  CB  . CYS B 1 30  ? -6.558  22.596 31.199  1.00 16.50 ? 59  CYS B CB  1 
ATOM   2729 S  SG  . CYS B 1 30  ? -7.986  21.514 31.495  1.00 20.36 ? 59  CYS B SG  1 
ATOM   2730 N  N   . GLY B 1 31  ? -5.450  19.699 29.693  1.00 16.41 ? 60  GLY B N   1 
ATOM   2731 C  CA  . GLY B 1 31  ? -5.754  18.803 28.594  1.00 15.05 ? 60  GLY B CA  1 
ATOM   2732 C  C   . GLY B 1 31  ? -7.229  18.470 28.578  1.00 14.57 ? 60  GLY B C   1 
ATOM   2733 O  O   . GLY B 1 31  ? -7.696  17.700 29.393  1.00 14.11 ? 60  GLY B O   1 
ATOM   2734 N  N   . SER B 1 32  ? -7.956  19.025 27.619  1.00 14.23 ? 61  SER B N   1 
ATOM   2735 C  CA  . SER B 1 32  ? -9.386  18.939 27.623  1.00 13.74 ? 61  SER B CA  1 
ATOM   2736 C  C   . SER B 1 32  ? -9.896  18.703 26.192  1.00 12.68 ? 61  SER B C   1 
ATOM   2737 O  O   . SER B 1 32  ? -9.208  18.073 25.373  1.00 12.19 ? 61  SER B O   1 
ATOM   2738 C  CB  . SER B 1 32  ? -9.939  20.199 28.245  1.00 14.07 ? 61  SER B CB  1 
ATOM   2739 O  OG  . SER B 1 32  ? -11.294 20.001 28.665  1.00 15.00 ? 61  SER B OG  1 
ATOM   2740 N  N   . SER B 1 33  ? -11.098 19.196 25.931  1.00 12.54 ? 62  SER B N   1 
ATOM   2741 C  CA  . SER B 1 33  ? -11.767 19.144 24.631  1.00 12.58 ? 62  SER B CA  1 
ATOM   2742 C  C   . SER B 1 33  ? -12.350 20.526 24.308  1.00 12.82 ? 62  SER B C   1 
ATOM   2743 O  O   . SER B 1 33  ? -12.662 21.301 25.232  1.00 13.37 ? 62  SER B O   1 
ATOM   2744 C  CB  . SER B 1 33  ? -12.819 18.078 24.632  1.00 12.35 ? 62  SER B CB  1 
ATOM   2745 O  OG  . SER B 1 33  ? -12.242 16.830 25.000  1.00 11.89 ? 62  SER B OG  1 
ATOM   2746 N  N   . ALA B 1 34  ? -12.477 20.852 23.018  1.00 12.54 ? 63  ALA B N   1 
ATOM   2747 C  CA  . ALA B 1 34  ? -12.995 22.147 22.649  1.00 12.45 ? 63  ALA B CA  1 
ATOM   2748 C  C   . ALA B 1 34  ? -14.314 22.366 23.398  1.00 12.24 ? 63  ALA B C   1 
ATOM   2749 O  O   . ALA B 1 34  ? -15.146 21.475 23.468  1.00 12.31 ? 63  ALA B O   1 
ATOM   2750 C  CB  . ALA B 1 34  ? -13.191 22.240 21.149  1.00 12.29 ? 63  ALA B CB  1 
ATOM   2751 N  N   . GLY B 1 35  ? -14.427 23.526 24.035  1.00 12.71 ? 64  GLY B N   1 
ATOM   2752 C  CA  . GLY B 1 35  ? -15.682 24.008 24.625  1.00 13.56 ? 64  GLY B CA  1 
ATOM   2753 C  C   . GLY B 1 35  ? -15.957 23.410 26.000  1.00 13.43 ? 64  GLY B C   1 
ATOM   2754 O  O   . GLY B 1 35  ? -16.888 23.893 26.695  1.00 12.38 ? 64  GLY B O   1 
ATOM   2755 N  N   . PHE B 1 36  ? -15.150 22.401 26.417  1.00 13.24 ? 65  PHE B N   1 
ATOM   2756 C  CA  . PHE B 1 36  ? -15.442 21.557 27.599  1.00 13.71 ? 65  PHE B CA  1 
ATOM   2757 C  C   . PHE B 1 36  ? -15.259 22.375 28.878  1.00 13.98 ? 65  PHE B C   1 
ATOM   2758 O  O   . PHE B 1 36  ? -16.114 22.323 29.777  1.00 13.69 ? 65  PHE B O   1 
ATOM   2759 C  CB  . PHE B 1 36  ? -14.552 20.306 27.660  1.00 13.78 ? 65  PHE B CB  1 
ATOM   2760 C  CG  . PHE B 1 36  ? -14.914 19.358 28.777  1.00 14.20 ? 65  PHE B CG  1 
ATOM   2761 C  CD1 . PHE B 1 36  ? -15.932 18.424 28.607  1.00 15.00 ? 65  PHE B CD1 1 
ATOM   2762 C  CD2 . PHE B 1 36  ? -14.273 19.420 30.007  1.00 14.39 ? 65  PHE B CD2 1 
ATOM   2763 C  CE1 . PHE B 1 36  ? -16.285 17.555 29.632  1.00 14.76 ? 65  PHE B CE1 1 
ATOM   2764 C  CE2 . PHE B 1 36  ? -14.624 18.551 31.027  1.00 15.68 ? 65  PHE B CE2 1 
ATOM   2765 C  CZ  . PHE B 1 36  ? -15.618 17.608 30.841  1.00 14.91 ? 65  PHE B CZ  1 
ATOM   2766 N  N   . LEU B 1 37  ? -14.203 23.184 28.921  1.00 14.25 ? 66  LEU B N   1 
ATOM   2767 C  CA  . LEU B 1 37  ? -13.935 23.964 30.145  1.00 14.86 ? 66  LEU B CA  1 
ATOM   2768 C  C   . LEU B 1 37  ? -15.035 25.013 30.336  1.00 14.98 ? 66  LEU B C   1 
ATOM   2769 O  O   . LEU B 1 37  ? -15.448 25.272 31.474  1.00 13.48 ? 66  LEU B O   1 
ATOM   2770 C  CB  . LEU B 1 37  ? -12.549 24.609 30.080  1.00 14.81 ? 66  LEU B CB  1 
ATOM   2771 C  CG  . LEU B 1 37  ? -12.245 25.591 31.208  1.00 15.79 ? 66  LEU B CG  1 
ATOM   2772 C  CD1 . LEU B 1 37  ? -12.380 24.912 32.561  1.00 15.08 ? 66  LEU B CD1 1 
ATOM   2773 C  CD2 . LEU B 1 37  ? -10.858 26.230 31.042  1.00 16.49 ? 66  LEU B CD2 1 
ATOM   2774 N  N   . ARG B 1 38  ? -15.552 25.580 29.239  1.00 17.20 ? 67  ARG B N   1 
ATOM   2775 C  CA  . ARG B 1 38  ? -16.632 26.561 29.375  1.00 17.99 ? 67  ARG B CA  1 
ATOM   2776 C  C   . ARG B 1 38  ? -17.954 25.858 29.727  1.00 16.64 ? 67  ARG B C   1 
ATOM   2777 O  O   . ARG B 1 38  ? -18.801 26.430 30.401  1.00 14.79 ? 67  ARG B O   1 
ATOM   2778 C  CB  . ARG B 1 38  ? -16.750 27.389 28.098  1.00 22.81 ? 67  ARG B CB  1 
ATOM   2779 C  CG  . ARG B 1 38  ? -15.602 28.364 27.870  1.00 27.22 ? 67  ARG B CG  1 
ATOM   2780 C  CD  . ARG B 1 38  ? -15.470 28.780 26.411  1.00 33.23 ? 67  ARG B CD  1 
ATOM   2781 N  NE  . ARG B 1 38  ? -15.997 30.114 26.151  1.00 40.56 ? 67  ARG B NE  1 
ATOM   2782 C  CZ  . ARG B 1 38  ? -17.264 30.403 25.846  1.00 42.63 ? 67  ARG B CZ  1 
ATOM   2783 N  NH1 . ARG B 1 38  ? -18.167 29.442 25.753  1.00 45.21 ? 67  ARG B NH1 1 
ATOM   2784 N  NH2 . ARG B 1 38  ? -17.612 31.656 25.608  1.00 39.22 ? 67  ARG B NH2 1 
ATOM   2785 N  N   . ALA B 1 39  ? -18.168 24.632 29.255  1.00 15.22 ? 68  ALA B N   1 
ATOM   2786 C  CA  . ALA B 1 39  ? -19.499 24.001 29.409  1.00 14.21 ? 68  ALA B CA  1 
ATOM   2787 C  C   . ALA B 1 39  ? -19.603 23.243 30.727  1.00 15.26 ? 68  ALA B C   1 
ATOM   2788 O  O   . ALA B 1 39  ? -20.714 23.124 31.246  1.00 16.07 ? 68  ALA B O   1 
ATOM   2789 C  CB  . ALA B 1 39  ? -19.775 23.059 28.279  1.00 14.14 ? 68  ALA B CB  1 
ATOM   2790 N  N   . TRP B 1 40  ? -18.475 22.743 31.240  1.00 16.03 ? 69  TRP B N   1 
ATOM   2791 C  CA  . TRP B 1 40  ? -18.449 21.857 32.424  1.00 16.10 ? 69  TRP B CA  1 
ATOM   2792 C  C   . TRP B 1 40  ? -17.240 22.157 33.326  1.00 14.97 ? 69  TRP B C   1 
ATOM   2793 O  O   . TRP B 1 40  ? -16.468 21.247 33.668  1.00 14.13 ? 69  TRP B O   1 
ATOM   2794 C  CB  . TRP B 1 40  ? -18.455 20.402 31.967  1.00 17.26 ? 69  TRP B CB  1 
ATOM   2795 C  CG  . TRP B 1 40  ? -18.852 19.410 33.013  1.00 18.50 ? 69  TRP B CG  1 
ATOM   2796 C  CD1 . TRP B 1 40  ? -19.098 19.648 34.333  1.00 20.68 ? 69  TRP B CD1 1 
ATOM   2797 C  CD2 . TRP B 1 40  ? -19.009 17.987 32.828  1.00 19.30 ? 69  TRP B CD2 1 
ATOM   2798 N  NE1 . TRP B 1 40  ? -19.403 18.479 34.972  1.00 20.37 ? 69  TRP B NE1 1 
ATOM   2799 C  CE2 . TRP B 1 40  ? -19.351 17.443 34.081  1.00 19.17 ? 69  TRP B CE2 1 
ATOM   2800 C  CE3 . TRP B 1 40  ? -18.947 17.133 31.722  1.00 19.14 ? 69  TRP B CE3 1 
ATOM   2801 C  CZ2 . TRP B 1 40  ? -19.592 16.078 34.267  1.00 20.83 ? 69  TRP B CZ2 1 
ATOM   2802 C  CZ3 . TRP B 1 40  ? -19.200 15.785 31.895  1.00 19.78 ? 69  TRP B CZ3 1 
ATOM   2803 C  CH2 . TRP B 1 40  ? -19.503 15.264 33.155  1.00 19.68 ? 69  TRP B CH2 1 
ATOM   2804 N  N   . PRO B 1 41  ? -17.115 23.404 33.772  1.00 15.05 ? 70  PRO B N   1 
ATOM   2805 C  CA  . PRO B 1 41  ? -16.017 23.862 34.629  1.00 14.93 ? 70  PRO B CA  1 
ATOM   2806 C  C   . PRO B 1 41  ? -15.946 23.094 35.951  1.00 15.91 ? 70  PRO B C   1 
ATOM   2807 O  O   . PRO B 1 41  ? -14.849 22.894 36.511  1.00 17.33 ? 70  PRO B O   1 
ATOM   2808 C  CB  . PRO B 1 41  ? -16.281 25.346 34.937  1.00 15.36 ? 70  PRO B CB  1 
ATOM   2809 C  CG  . PRO B 1 41  ? -17.743 25.549 34.631  1.00 15.62 ? 70  PRO B CG  1 
ATOM   2810 C  CD  . PRO B 1 41  ? -18.036 24.543 33.534  1.00 15.52 ? 70  PRO B CD  1 
ATOM   2811 N  N   . GLU B 1 42  ? -17.108 22.689 36.455  1.00 16.49 ? 71  GLU B N   1 
ATOM   2812 C  CA  . GLU B 1 42  ? -17.184 21.995 37.734  1.00 16.83 ? 71  GLU B CA  1 
ATOM   2813 C  C   . GLU B 1 42  ? -16.464 20.641 37.646  1.00 16.70 ? 71  GLU B C   1 
ATOM   2814 O  O   . GLU B 1 42  ? -16.192 20.022 38.655  1.00 16.48 ? 71  GLU B O   1 
ATOM   2815 C  CB  . GLU B 1 42  ? -18.637 21.812 38.169  1.00 17.18 ? 71  GLU B CB  1 
ATOM   2816 C  CG  . GLU B 1 42  ? -19.366 23.134 38.333  1.00 17.70 ? 71  GLU B CG  1 
ATOM   2817 C  CD  . GLU B 1 42  ? -19.878 23.725 37.043  1.00 16.58 ? 71  GLU B CD  1 
ATOM   2818 O  OE1 . GLU B 1 42  ? -19.999 22.946 36.075  1.00 14.91 ? 71  GLU B OE1 1 
ATOM   2819 O  OE2 . GLU B 1 42  ? -20.132 24.972 36.996  1.00 17.16 ? 71  GLU B OE2 1 
ATOM   2820 N  N   . PHE B 1 43  ? -16.176 20.160 36.453  1.00 17.14 ? 72  PHE B N   1 
ATOM   2821 C  CA  . PHE B 1 43  ? -15.412 18.922 36.333  1.00 17.18 ? 72  PHE B CA  1 
ATOM   2822 C  C   . PHE B 1 43  ? -14.036 19.068 36.985  1.00 17.33 ? 72  PHE B C   1 
ATOM   2823 O  O   . PHE B 1 43  ? -13.516 18.071 37.471  1.00 16.88 ? 72  PHE B O   1 
ATOM   2824 C  CB  . PHE B 1 43  ? -15.253 18.502 34.877  1.00 16.47 ? 72  PHE B CB  1 
ATOM   2825 C  CG  . PHE B 1 43  ? -14.460 17.235 34.706  1.00 16.96 ? 72  PHE B CG  1 
ATOM   2826 C  CD1 . PHE B 1 43  ? -15.073 15.993 34.805  1.00 17.02 ? 72  PHE B CD1 1 
ATOM   2827 C  CD2 . PHE B 1 43  ? -13.107 17.287 34.424  1.00 17.20 ? 72  PHE B CD2 1 
ATOM   2828 C  CE1 . PHE B 1 43  ? -14.343 14.835 34.607  1.00 16.48 ? 72  PHE B CE1 1 
ATOM   2829 C  CE2 . PHE B 1 43  ? -12.368 16.122 34.262  1.00 17.01 ? 72  PHE B CE2 1 
ATOM   2830 C  CZ  . PHE B 1 43  ? -12.991 14.900 34.344  1.00 17.28 ? 72  PHE B CZ  1 
ATOM   2831 N  N   . PHE B 1 44  ? -13.502 20.301 36.977  1.00 17.52 ? 73  PHE B N   1 
ATOM   2832 C  CA  . PHE B 1 44  ? -12.188 20.652 37.582  1.00 17.82 ? 73  PHE B CA  1 
ATOM   2833 C  C   . PHE B 1 44  ? -12.392 21.377 38.921  1.00 17.61 ? 73  PHE B C   1 
ATOM   2834 O  O   . PHE B 1 44  ? -11.576 22.209 39.324  1.00 16.93 ? 73  PHE B O   1 
ATOM   2835 C  CB  . PHE B 1 44  ? -11.399 21.563 36.627  1.00 18.05 ? 73  PHE B CB  1 
ATOM   2836 C  CG  . PHE B 1 44  ? -11.353 21.110 35.189  1.00 17.70 ? 73  PHE B CG  1 
ATOM   2837 C  CD1 . PHE B 1 44  ? -10.355 20.253 34.747  1.00 17.58 ? 73  PHE B CD1 1 
ATOM   2838 C  CD2 . PHE B 1 44  ? -12.310 21.529 34.275  1.00 17.89 ? 73  PHE B CD2 1 
ATOM   2839 C  CE1 . PHE B 1 44  ? -10.320 19.822 33.431  1.00 17.02 ? 73  PHE B CE1 1 
ATOM   2840 C  CE2 . PHE B 1 44  ? -12.281 21.081 32.961  1.00 17.74 ? 73  PHE B CE2 1 
ATOM   2841 C  CZ  . PHE B 1 44  ? -11.272 20.247 32.536  1.00 17.46 ? 73  PHE B CZ  1 
ATOM   2842 N  N   . GLY B 1 45  ? -13.505 21.120 39.596  1.00 17.67 ? 74  GLY B N   1 
ATOM   2843 C  CA  . GLY B 1 45  ? -13.923 21.952 40.729  1.00 18.50 ? 74  GLY B CA  1 
ATOM   2844 C  C   . GLY B 1 45  ? -14.608 23.235 40.276  1.00 18.00 ? 74  GLY B C   1 
ATOM   2845 O  O   . GLY B 1 45  ? -15.786 23.482 40.531  1.00 18.37 ? 74  GLY B O   1 
ATOM   2846 N  N   . SER B 1 46  ? -13.855 24.083 39.627  1.00 17.64 ? 75  SER B N   1 
ATOM   2847 C  CA  . SER B 1 46  ? -14.402 25.261 39.019  1.00 18.42 ? 75  SER B CA  1 
ATOM   2848 C  C   . SER B 1 46  ? -13.335 25.837 38.090  1.00 18.22 ? 75  SER B C   1 
ATOM   2849 O  O   . SER B 1 46  ? -12.163 25.431 38.172  1.00 17.48 ? 75  SER B O   1 
ATOM   2850 C  CB  . SER B 1 46  ? -14.854 26.275 40.043  1.00 19.77 ? 75  SER B CB  1 
ATOM   2851 O  OG  . SER B 1 46  ? -13.740 26.776 40.778  1.00 19.32 ? 75  SER B OG  1 
ATOM   2852 N  N   . ARG B 1 47  ? -13.700 26.790 37.245  1.00 17.04 ? 76  ARG B N   1 
ATOM   2853 C  CA  . ARG B 1 47  ? -12.696 27.421 36.402  1.00 18.25 ? 76  ARG B CA  1 
ATOM   2854 C  C   . ARG B 1 47  ? -11.643 28.077 37.308  1.00 19.80 ? 76  ARG B C   1 
ATOM   2855 O  O   . ARG B 1 47  ? -10.438 27.997 37.034  1.00 18.57 ? 76  ARG B O   1 
ATOM   2856 C  CB  . ARG B 1 47  ? -13.334 28.459 35.475  1.00 18.62 ? 76  ARG B CB  1 
ATOM   2857 C  CG  . ARG B 1 47  ? -12.388 29.068 34.446  1.00 18.68 ? 76  ARG B CG  1 
ATOM   2858 C  CD  . ARG B 1 47  ? -13.016 30.267 33.740  1.00 18.31 ? 76  ARG B CD  1 
ATOM   2859 N  NE  . ARG B 1 47  ? -12.087 30.871 32.806  1.00 17.21 ? 76  ARG B NE  1 
ATOM   2860 C  CZ  . ARG B 1 47  ? -11.856 30.433 31.568  1.00 17.44 ? 76  ARG B CZ  1 
ATOM   2861 N  NH1 . ARG B 1 47  ? -12.558 29.403 31.086  1.00 15.64 ? 76  ARG B NH1 1 
ATOM   2862 N  NH2 . ARG B 1 47  ? -10.919 31.038 30.832  1.00 15.57 ? 76  ARG B NH2 1 
ATOM   2863 N  N   . ASP B 1 48  ? -12.095 28.740 38.365  1.00 19.03 ? 77  ASP B N   1 
ATOM   2864 C  CA  . ASP B 1 48  ? -11.169 29.516 39.184  1.00 20.98 ? 77  ASP B CA  1 
ATOM   2865 C  C   . ASP B 1 48  ? -10.282 28.555 39.977  1.00 19.54 ? 77  ASP B C   1 
ATOM   2866 O  O   . ASP B 1 48  ? -9.106  28.842 40.150  1.00 19.02 ? 77  ASP B O   1 
ATOM   2867 C  CB  . ASP B 1 48  ? -11.886 30.536 40.069  1.00 23.10 ? 77  ASP B CB  1 
ATOM   2868 C  CG  . ASP B 1 48  ? -12.310 31.817 39.348  1.00 26.82 ? 77  ASP B CG  1 
ATOM   2869 O  OD1 . ASP B 1 48  ? -11.808 32.084 38.225  1.00 25.62 ? 77  ASP B OD1 1 
ATOM   2870 O  OD2 . ASP B 1 48  ? -13.152 32.534 39.913  1.00 27.44 ? 77  ASP B OD2 1 
ATOM   2871 N  N   . ALA B 1 49  ? -10.812 27.416 40.407  1.00 18.00 ? 78  ALA B N   1 
ATOM   2872 C  CA  . ALA B 1 49  ? -9.962  26.412 41.095  1.00 18.44 ? 78  ALA B CA  1 
ATOM   2873 C  C   . ALA B 1 49  ? -8.828  25.908 40.184  1.00 17.34 ? 78  ALA B C   1 
ATOM   2874 O  O   . ALA B 1 49  ? -7.689  25.648 40.662  1.00 15.49 ? 78  ALA B O   1 
ATOM   2875 C  CB  . ALA B 1 49  ? -10.803 25.253 41.545  1.00 18.56 ? 78  ALA B CB  1 
ATOM   2876 N  N   . LEU B 1 50  ? -9.148  25.724 38.901  1.00 15.72 ? 79  LEU B N   1 
ATOM   2877 C  CA  . LEU B 1 50  ? -8.188  25.234 37.917  1.00 16.52 ? 79  LEU B CA  1 
ATOM   2878 C  C   . LEU B 1 50  ? -7.126  26.308 37.672  1.00 15.73 ? 79  LEU B C   1 
ATOM   2879 O  O   . LEU B 1 50  ? -5.930  25.992 37.693  1.00 16.78 ? 79  LEU B O   1 
ATOM   2880 C  CB  . LEU B 1 50  ? -8.904  24.865 36.618  1.00 17.20 ? 79  LEU B CB  1 
ATOM   2881 C  CG  . LEU B 1 50  ? -7.993  24.561 35.437  1.00 17.04 ? 79  LEU B CG  1 
ATOM   2882 C  CD1 . LEU B 1 50  ? -7.158  23.319 35.690  1.00 17.58 ? 79  LEU B CD1 1 
ATOM   2883 C  CD2 . LEU B 1 50  ? -8.818  24.421 34.176  1.00 17.29 ? 79  LEU B CD2 1 
ATOM   2884 N  N   . ALA B 1 51  ? -7.564  27.555 37.560  1.00 14.75 ? 80  ALA B N   1 
ATOM   2885 C  CA  . ALA B 1 51  ? -6.685  28.702 37.353  1.00 15.25 ? 80  ALA B CA  1 
ATOM   2886 C  C   . ALA B 1 51  ? -5.720  28.848 38.533  1.00 15.75 ? 80  ALA B C   1 
ATOM   2887 O  O   . ALA B 1 51  ? -4.539  29.039 38.318  1.00 14.31 ? 80  ALA B O   1 
ATOM   2888 C  CB  . ALA B 1 51  ? -7.474  29.977 37.167  1.00 14.92 ? 80  ALA B CB  1 
ATOM   2889 N  N   . GLU B 1 52  ? -6.239  28.783 39.750  1.00 18.59 ? 81  GLU B N   1 
ATOM   2890 C  CA  . GLU B 1 52  ? -5.397  28.961 40.972  1.00 20.75 ? 81  GLU B CA  1 
ATOM   2891 C  C   . GLU B 1 52  ? -4.369  27.811 41.038  1.00 19.44 ? 81  GLU B C   1 
ATOM   2892 O  O   . GLU B 1 52  ? -3.197  28.086 41.359  1.00 18.39 ? 81  GLU B O   1 
ATOM   2893 C  CB  . GLU B 1 52  ? -6.273  29.123 42.229  1.00 25.03 ? 81  GLU B CB  1 
ATOM   2894 C  CG  . GLU B 1 52  ? -5.560  28.926 43.588  1.00 29.52 ? 81  GLU B CG  1 
ATOM   2895 C  CD  . GLU B 1 52  ? -4.218  29.607 43.927  1.00 37.70 ? 81  GLU B CD  1 
ATOM   2896 O  OE1 . GLU B 1 52  ? -3.649  30.330 43.063  1.00 44.06 ? 81  GLU B OE1 1 
ATOM   2897 O  OE2 . GLU B 1 52  ? -3.711  29.403 45.080  1.00 37.03 ? 81  GLU B OE2 1 
ATOM   2898 N  N   . LYS B 1 53  ? -4.756  26.564 40.713  1.00 17.38 ? 82  LYS B N   1 
ATOM   2899 C  CA  . LYS B 1 53  ? -3.825  25.421 40.763  1.00 18.71 ? 82  LYS B CA  1 
ATOM   2900 C  C   . LYS B 1 53  ? -2.705  25.607 39.729  1.00 18.85 ? 82  LYS B C   1 
ATOM   2901 O  O   . LYS B 1 53  ? -1.561  25.284 40.026  1.00 17.57 ? 82  LYS B O   1 
ATOM   2902 C  CB  . LYS B 1 53  ? -4.547  24.091 40.525  1.00 19.56 ? 82  LYS B CB  1 
ATOM   2903 C  CG  . LYS B 1 53  ? -3.679  22.849 40.379  1.00 21.26 ? 82  LYS B CG  1 
ATOM   2904 C  CD  . LYS B 1 53  ? -4.533  21.607 40.184  1.00 23.97 ? 82  LYS B CD  1 
ATOM   2905 C  CE  . LYS B 1 53  ? -3.829  20.397 39.612  1.00 26.18 ? 82  LYS B CE  1 
ATOM   2906 N  NZ  . LYS B 1 53  ? -3.060  19.706 40.660  1.00 29.22 ? 82  LYS B NZ  1 
ATOM   2907 N  N   . ALA B 1 54  ? -3.049  26.083 38.528  1.00 17.83 ? 83  ALA B N   1 
ATOM   2908 C  CA  . ALA B 1 54  ? -2.076  26.423 37.502  1.00 18.17 ? 83  ALA B CA  1 
ATOM   2909 C  C   . ALA B 1 54  ? -1.108  27.482 38.018  1.00 17.38 ? 83  ALA B C   1 
ATOM   2910 O  O   . ALA B 1 54  ? 0.055   27.292 37.896  1.00 18.27 ? 83  ALA B O   1 
ATOM   2911 C  CB  . ALA B 1 54  ? -2.767  26.932 36.250  1.00 18.54 ? 83  ALA B CB  1 
ATOM   2912 N  N   . VAL B 1 55  ? -1.611  28.586 38.563  1.00 16.43 ? 84  VAL B N   1 
ATOM   2913 C  CA  . VAL B 1 55  ? -0.770  29.680 39.015  1.00 16.95 ? 84  VAL B CA  1 
ATOM   2914 C  C   . VAL B 1 55  ? 0.173   29.178 40.114  1.00 16.72 ? 84  VAL B C   1 
ATOM   2915 O  O   . VAL B 1 55  ? 1.362   29.495 40.139  1.00 14.32 ? 84  VAL B O   1 
ATOM   2916 C  CB  . VAL B 1 55  ? -1.614  30.870 39.509  1.00 17.37 ? 84  VAL B CB  1 
ATOM   2917 C  CG1 . VAL B 1 55  ? -0.786  31.868 40.310  1.00 17.77 ? 84  VAL B CG1 1 
ATOM   2918 C  CG2 . VAL B 1 55  ? -2.296  31.566 38.344  1.00 18.21 ? 84  VAL B CG2 1 
ATOM   2919 N  N   . ARG B 1 56  ? -0.357  28.392 41.023  1.00 18.19 ? 85  ARG B N   1 
ATOM   2920 C  CA  . ARG B 1 56  ? 0.493   27.795 42.073  1.00 20.39 ? 85  ARG B CA  1 
ATOM   2921 C  C   . ARG B 1 56  ? 1.662   27.003 41.457  1.00 19.51 ? 85  ARG B C   1 
ATOM   2922 O  O   . ARG B 1 56  ? 2.823   27.170 41.859  1.00 17.65 ? 85  ARG B O   1 
ATOM   2923 C  CB  . ARG B 1 56  ? -0.315  26.827 42.928  1.00 22.14 ? 85  ARG B CB  1 
ATOM   2924 C  CG  . ARG B 1 56  ? -1.201  27.496 43.953  1.00 27.03 ? 85  ARG B CG  1 
ATOM   2925 C  CD  . ARG B 1 56  ? -1.612  26.374 44.871  1.00 30.43 ? 85  ARG B CD  1 
ATOM   2926 N  NE  . ARG B 1 56  ? -2.800  26.659 45.645  1.00 37.47 ? 85  ARG B NE  1 
ATOM   2927 C  CZ  . ARG B 1 56  ? -3.371  25.756 46.444  1.00 40.71 ? 85  ARG B CZ  1 
ATOM   2928 N  NH1 . ARG B 1 56  ? -2.844  24.542 46.575  1.00 36.61 ? 85  ARG B NH1 1 
ATOM   2929 N  NH2 . ARG B 1 56  ? -4.451  26.085 47.118  1.00 40.40 ? 85  ARG B NH2 1 
ATOM   2930 N  N   . GLY B 1 57  ? 1.341   26.117 40.522  1.00 17.33 ? 86  GLY B N   1 
ATOM   2931 C  CA  . GLY B 1 57  ? 2.349   25.271 39.885  1.00 19.21 ? 86  GLY B CA  1 
ATOM   2932 C  C   . GLY B 1 57  ? 3.371   26.079 39.096  1.00 17.97 ? 86  GLY B C   1 
ATOM   2933 O  O   . GLY B 1 57  ? 4.581   25.883 39.192  1.00 18.62 ? 86  GLY B O   1 
ATOM   2934 N  N   . LEU B 1 58  ? 2.875   27.024 38.334  1.00 18.44 ? 87  LEU B N   1 
ATOM   2935 C  CA  . LEU B 1 58  ? 3.726   27.847 37.488  1.00 19.20 ? 87  LEU B CA  1 
ATOM   2936 C  C   . LEU B 1 58  ? 4.634   28.732 38.353  1.00 19.03 ? 87  LEU B C   1 
ATOM   2937 O  O   . LEU B 1 58  ? 5.798   28.918 38.025  1.00 18.99 ? 87  LEU B O   1 
ATOM   2938 C  CB  . LEU B 1 58  ? 2.844   28.690 36.565  1.00 19.89 ? 87  LEU B CB  1 
ATOM   2939 C  CG  . LEU B 1 58  ? 2.168   27.948 35.411  1.00 19.55 ? 87  LEU B CG  1 
ATOM   2940 C  CD1 . LEU B 1 58  ? 1.252   28.890 34.643  1.00 19.96 ? 87  LEU B CD1 1 
ATOM   2941 C  CD2 . LEU B 1 58  ? 3.196   27.328 34.484  1.00 20.48 ? 87  LEU B CD2 1 
ATOM   2942 N  N   . ARG B 1 59  ? 4.122   29.234 39.468  1.00 17.42 ? 88  ARG B N   1 
ATOM   2943 C  CA  . ARG B 1 59  ? 4.944   30.017 40.367  1.00 19.12 ? 88  ARG B CA  1 
ATOM   2944 C  C   . ARG B 1 59  ? 6.070   29.163 40.985  1.00 19.10 ? 88  ARG B C   1 
ATOM   2945 O  O   . ARG B 1 59  ? 7.181   29.689 41.113  1.00 17.71 ? 88  ARG B O   1 
ATOM   2946 C  CB  . ARG B 1 59  ? 4.092   30.709 41.434  1.00 19.16 ? 88  ARG B CB  1 
ATOM   2947 C  CG  . ARG B 1 59  ? 3.489   32.032 40.998  1.00 20.26 ? 88  ARG B CG  1 
ATOM   2948 C  CD  . ARG B 1 59  ? 2.760   32.728 42.144  1.00 22.58 ? 88  ARG B CD  1 
ATOM   2949 N  NE  . ARG B 1 59  ? 2.015   33.911 41.720  1.00 23.90 ? 88  ARG B NE  1 
ATOM   2950 C  CZ  . ARG B 1 59  ? 0.800   34.272 42.153  1.00 23.92 ? 88  ARG B CZ  1 
ATOM   2951 N  NH1 . ARG B 1 59  ? 0.222   33.642 43.156  1.00 22.52 ? 88  ARG B NH1 1 
ATOM   2952 N  NH2 . ARG B 1 59  ? 0.147   35.244 41.544  1.00 21.94 ? 88  ARG B NH2 1 
ATOM   2953 N  N   . ARG B 1 60  ? 5.806   27.905 41.375  1.00 20.15 ? 89  ARG B N   1 
ATOM   2954 C  CA  . ARG B 1 60  ? 6.866   26.982 41.866  1.00 20.95 ? 89  ARG B CA  1 
ATOM   2955 C  C   . ARG B 1 60  ? 7.858   26.737 40.727  1.00 20.92 ? 89  ARG B C   1 
ATOM   2956 O  O   . ARG B 1 60  ? 9.084   26.686 40.942  1.00 17.49 ? 89  ARG B O   1 
ATOM   2957 C  CB  . ARG B 1 60  ? 6.304   25.633 42.347  1.00 23.45 ? 89  ARG B CB  1 
ATOM   2958 C  CG  . ARG B 1 60  ? 5.667   25.667 43.738  1.00 24.65 ? 89  ARG B CG  1 
ATOM   2959 C  CD  . ARG B 1 60  ? 5.233   24.313 44.301  1.00 26.72 ? 89  ARG B CD  1 
ATOM   2960 N  NE  . ARG B 1 60  ? 4.261   23.597 43.465  1.00 28.11 ? 89  ARG B NE  1 
ATOM   2961 C  CZ  . ARG B 1 60  ? 2.949   23.469 43.712  1.00 31.69 ? 89  ARG B CZ  1 
ATOM   2962 N  NH1 . ARG B 1 60  ? 2.400   23.997 44.798  1.00 30.68 ? 89  ARG B NH1 1 
ATOM   2963 N  NH2 . ARG B 1 60  ? 2.180   22.812 42.857  1.00 29.39 ? 89  ARG B NH2 1 
ATOM   2964 N  N   . ALA B 1 61  ? 7.326   26.594 39.512  1.00 18.34 ? 90  ALA B N   1 
ATOM   2965 C  CA  . ALA B 1 61  ? 8.171   26.327 38.376  1.00 18.37 ? 90  ALA B CA  1 
ATOM   2966 C  C   . ALA B 1 61  ? 9.059   27.554 38.103  1.00 17.90 ? 90  ALA B C   1 
ATOM   2967 O  O   . ALA B 1 61  ? 10.233  27.377 37.776  1.00 16.05 ? 90  ALA B O   1 
ATOM   2968 C  CB  . ALA B 1 61  ? 7.342   25.916 37.177  1.00 18.92 ? 90  ALA B CB  1 
ATOM   2969 N  N   . ARG B 1 62  ? 8.511   28.764 38.250  1.00 17.49 ? 91  ARG B N   1 
ATOM   2970 C  CA  . ARG B 1 62  ? 9.259   29.975 38.047  1.00 20.47 ? 91  ARG B CA  1 
ATOM   2971 C  C   . ARG B 1 62  ? 10.359  30.073 39.110  1.00 21.71 ? 91  ARG B C   1 
ATOM   2972 O  O   . ARG B 1 62  ? 11.455  30.508 38.801  1.00 23.08 ? 91  ARG B O   1 
ATOM   2973 C  CB  . ARG B 1 62  ? 8.405   31.242 38.148  1.00 20.60 ? 91  ARG B CB  1 
ATOM   2974 C  CG  . ARG B 1 62  ? 9.125   32.499 37.669  1.00 22.32 ? 91  ARG B CG  1 
ATOM   2975 C  CD  . ARG B 1 62  ? 8.339   33.772 37.908  1.00 24.41 ? 91  ARG B CD  1 
ATOM   2976 N  NE  . ARG B 1 62  ? 8.891   34.884 37.136  1.00 27.64 ? 91  ARG B NE  1 
ATOM   2977 C  CZ  . ARG B 1 62  ? 10.053  35.457 37.409  1.00 28.90 ? 91  ARG B CZ  1 
ATOM   2978 N  NH1 . ARG B 1 62  ? 10.709  35.114 38.500  1.00 26.60 ? 91  ARG B NH1 1 
ATOM   2979 N  NH2 . ARG B 1 62  ? 10.581  36.324 36.576  1.00 32.34 ? 91  ARG B NH2 1 
ATOM   2980 N  N   . ALA B 1 63  ? 10.054  29.700 40.346  1.00 19.97 ? 92  ALA B N   1 
ATOM   2981 C  CA  . ALA B 1 63  ? 11.061  29.785 41.417  1.00 19.53 ? 92  ALA B CA  1 
ATOM   2982 C  C   . ALA B 1 63  ? 12.171  28.768 41.143  1.00 18.82 ? 92  ALA B C   1 
ATOM   2983 O  O   . ALA B 1 63  ? 13.312  28.962 41.561  1.00 20.24 ? 92  ALA B O   1 
ATOM   2984 C  CB  . ALA B 1 63  ? 10.428  29.572 42.769  1.00 19.68 ? 92  ALA B CB  1 
ATOM   2985 N  N   . ALA B 1 64  ? 11.880  27.675 40.449  1.00 17.59 ? 93  ALA B N   1 
ATOM   2986 C  CA  . ALA B 1 64  ? 12.950  26.727 40.141  1.00 18.14 ? 93  ALA B CA  1 
ATOM   2987 C  C   . ALA B 1 64  ? 13.718  27.167 38.876  1.00 17.85 ? 93  ALA B C   1 
ATOM   2988 O  O   . ALA B 1 64  ? 14.594  26.439 38.445  1.00 17.86 ? 93  ALA B O   1 
ATOM   2989 C  CB  . ALA B 1 64  ? 12.395  25.320 39.998  1.00 17.56 ? 93  ALA B CB  1 
ATOM   2990 N  N   . GLY B 1 65  ? 13.379  28.283 38.235  1.00 16.94 ? 94  GLY B N   1 
ATOM   2991 C  CA  . GLY B 1 65  ? 14.171  28.770 37.032  1.00 18.48 ? 94  GLY B CA  1 
ATOM   2992 C  C   . GLY B 1 65  ? 13.355  28.919 35.736  1.00 18.14 ? 94  GLY B C   1 
ATOM   2993 O  O   . GLY B 1 65  ? 13.800  29.618 34.805  1.00 17.30 ? 94  GLY B O   1 
ATOM   2994 N  N   . VAL B 1 66  ? 12.175  28.281 35.628  1.00 18.14 ? 95  VAL B N   1 
ATOM   2995 C  CA  . VAL B 1 66  ? 11.407  28.282 34.357  1.00 17.58 ? 95  VAL B CA  1 
ATOM   2996 C  C   . VAL B 1 66  ? 10.993  29.722 34.053  1.00 17.78 ? 95  VAL B C   1 
ATOM   2997 O  O   . VAL B 1 66  ? 10.528  30.404 34.951  1.00 22.40 ? 95  VAL B O   1 
ATOM   2998 C  CB  . VAL B 1 66  ? 10.161  27.369 34.404  1.00 18.01 ? 95  VAL B CB  1 
ATOM   2999 C  CG1 . VAL B 1 66  ? 9.368   27.454 33.095  1.00 18.88 ? 95  VAL B CG1 1 
ATOM   3000 C  CG2 . VAL B 1 66  ? 10.489  25.918 34.709  1.00 17.60 ? 95  VAL B CG2 1 
ATOM   3001 N  N   . ARG B 1 67  ? 11.130  30.207 32.820  1.00 18.81 ? 96  ARG B N   1 
ATOM   3002 C  CA  . ARG B 1 67  ? 10.620  31.565 32.468  1.00 19.33 ? 96  ARG B CA  1 
ATOM   3003 C  C   . ARG B 1 67  ? 9.520   31.509 31.392  1.00 18.41 ? 96  ARG B C   1 
ATOM   3004 O  O   . ARG B 1 67  ? 8.742   32.471 31.241  1.00 18.54 ? 96  ARG B O   1 
ATOM   3005 C  CB  . ARG B 1 67  ? 11.756  32.484 32.005  1.00 21.86 ? 96  ARG B CB  1 
ATOM   3006 C  CG  . ARG B 1 67  ? 12.799  32.740 33.081  1.00 22.85 ? 96  ARG B CG  1 
ATOM   3007 C  CD  . ARG B 1 67  ? 12.202  33.644 34.146  1.00 24.37 ? 96  ARG B CD  1 
ATOM   3008 N  NE  . ARG B 1 67  ? 13.110  33.827 35.275  1.00 25.03 ? 96  ARG B NE  1 
ATOM   3009 C  CZ  . ARG B 1 67  ? 13.195  33.039 36.336  1.00 25.20 ? 96  ARG B CZ  1 
ATOM   3010 N  NH1 . ARG B 1 67  ? 12.443  31.954 36.440  1.00 25.63 ? 96  ARG B NH1 1 
ATOM   3011 N  NH2 . ARG B 1 67  ? 14.062  33.336 37.291  1.00 25.57 ? 96  ARG B NH2 1 
ATOM   3012 N  N   . THR B 1 68  ? 9.420   30.389 30.680  1.00 17.94 ? 97  THR B N   1 
ATOM   3013 C  CA  . THR B 1 68  ? 8.462   30.235 29.568  1.00 18.09 ? 97  THR B CA  1 
ATOM   3014 C  C   . THR B 1 68  ? 8.007   28.771 29.494  1.00 18.81 ? 97  THR B C   1 
ATOM   3015 O  O   . THR B 1 68  ? 8.838   27.830 29.679  1.00 17.84 ? 97  THR B O   1 
ATOM   3016 C  CB  . THR B 1 68  ? 9.103   30.673 28.240  1.00 18.51 ? 97  THR B CB  1 
ATOM   3017 O  OG1 . THR B 1 68  ? 9.436   32.060 28.291  1.00 16.83 ? 97  THR B OG1 1 
ATOM   3018 C  CG2 . THR B 1 68  ? 8.231   30.415 27.028  1.00 17.87 ? 97  THR B CG2 1 
ATOM   3019 N  N   . ILE B 1 69  ? 6.705   28.570 29.226  1.00 17.66 ? 98  ILE B N   1 
ATOM   3020 C  CA  . ILE B 1 69  ? 6.226   27.268 28.786  1.00 17.03 ? 98  ILE B CA  1 
ATOM   3021 C  C   . ILE B 1 69  ? 5.558   27.445 27.411  1.00 15.12 ? 98  ILE B C   1 
ATOM   3022 O  O   . ILE B 1 69  ? 5.059   28.512 27.064  1.00 16.50 ? 98  ILE B O   1 
ATOM   3023 C  CB  . ILE B 1 69  ? 5.295   26.599 29.821  1.00 17.42 ? 98  ILE B CB  1 
ATOM   3024 C  CG1 . ILE B 1 69  ? 3.931   27.276 29.928  1.00 19.02 ? 98  ILE B CG1 1 
ATOM   3025 C  CG2 . ILE B 1 69  ? 5.968   26.521 31.179  1.00 17.98 ? 98  ILE B CG2 1 
ATOM   3026 C  CD1 . ILE B 1 69  ? 2.861   26.384 30.477  1.00 19.21 ? 98  ILE B CD1 1 
ATOM   3027 N  N   . VAL B 1 70  ? 5.630   26.399 26.611  1.00 14.01 ? 99  VAL B N   1 
ATOM   3028 C  CA  . VAL B 1 70  ? 4.892   26.321 25.400  1.00 12.94 ? 99  VAL B CA  1 
ATOM   3029 C  C   . VAL B 1 70  ? 3.715   25.375 25.647  1.00 13.04 ? 99  VAL B C   1 
ATOM   3030 O  O   . VAL B 1 70  ? 3.921   24.151 25.859  1.00 13.43 ? 99  VAL B O   1 
ATOM   3031 C  CB  . VAL B 1 70  ? 5.773   25.828 24.250  1.00 12.66 ? 99  VAL B CB  1 
ATOM   3032 C  CG1 . VAL B 1 70  ? 4.990   25.762 22.946  1.00 13.29 ? 99  VAL B CG1 1 
ATOM   3033 C  CG2 . VAL B 1 70  ? 6.987   26.722 24.096  1.00 12.88 ? 99  VAL B CG2 1 
ATOM   3034 N  N   . ASP B 1 71  ? 2.506   25.932 25.651  1.00 11.99 ? 100 ASP B N   1 
ATOM   3035 C  CA  . ASP B 1 71  ? 1.335   25.087 25.809  1.00 12.58 ? 100 ASP B CA  1 
ATOM   3036 C  C   . ASP B 1 71  ? 0.926   24.524 24.435  1.00 12.27 ? 100 ASP B C   1 
ATOM   3037 O  O   . ASP B 1 71  ? 0.492   25.252 23.511  1.00 13.18 ? 100 ASP B O   1 
ATOM   3038 C  CB  . ASP B 1 71  ? 0.231   25.857 26.515  1.00 12.99 ? 100 ASP B CB  1 
ATOM   3039 C  CG  . ASP B 1 71  ? -0.992  25.009 26.821  1.00 13.25 ? 100 ASP B CG  1 
ATOM   3040 O  OD1 . ASP B 1 71  ? -1.209  23.981 26.114  1.00 13.10 ? 100 ASP B OD1 1 
ATOM   3041 O  OD2 . ASP B 1 71  ? -1.699  25.379 27.773  1.00 13.06 ? 100 ASP B OD2 1 
ATOM   3042 N  N   . VAL B 1 72  ? 1.105   23.232 24.277  1.00 13.07 ? 101 VAL B N   1 
ATOM   3043 C  CA  . VAL B 1 72  ? 0.903   22.606 22.973  1.00 13.73 ? 101 VAL B CA  1 
ATOM   3044 C  C   . VAL B 1 72  ? -0.500  22.012 22.913  1.00 14.05 ? 101 VAL B C   1 
ATOM   3045 O  O   . VAL B 1 72  ? -0.763  21.095 22.133  1.00 15.38 ? 101 VAL B O   1 
ATOM   3046 C  CB  . VAL B 1 72  ? 2.001   21.589 22.617  1.00 13.55 ? 101 VAL B CB  1 
ATOM   3047 C  CG1 . VAL B 1 72  ? 3.348   22.295 22.471  1.00 13.61 ? 101 VAL B CG1 1 
ATOM   3048 C  CG2 . VAL B 1 72  ? 2.077   20.421 23.601  1.00 13.57 ? 101 VAL B CG2 1 
ATOM   3049 N  N   . SER B 1 73  ? -1.418  22.608 23.684  1.00 14.58 ? 102 SER B N   1 
ATOM   3050 C  CA  . SER B 1 73  ? -2.825  22.279 23.595  1.00 13.50 ? 102 SER B CA  1 
ATOM   3051 C  C   . SER B 1 73  ? -3.418  22.939 22.340  1.00 13.53 ? 102 SER B C   1 
ATOM   3052 O  O   . SER B 1 73  ? -3.403  24.151 22.235  1.00 12.43 ? 102 SER B O   1 
ATOM   3053 C  CB  . SER B 1 73  ? -3.563  22.737 24.861  1.00 14.16 ? 102 SER B CB  1 
ATOM   3054 O  OG  . SER B 1 73  ? -2.927  22.249 26.050  1.00 14.60 ? 102 SER B OG  1 
ATOM   3055 N  N   . THR B 1 74  ? -3.939  22.122 21.414  1.00 13.69 ? 103 THR B N   1 
ATOM   3056 C  CA  . THR B 1 74  ? -4.658  22.588 20.233  1.00 14.26 ? 103 THR B CA  1 
ATOM   3057 C  C   . THR B 1 74  ? -6.127  22.891 20.572  1.00 14.12 ? 103 THR B C   1 
ATOM   3058 O  O   . THR B 1 74  ? -6.627  22.571 21.664  1.00 13.77 ? 103 THR B O   1 
ATOM   3059 C  CB  . THR B 1 74  ? -4.639  21.509 19.143  1.00 14.12 ? 103 THR B CB  1 
ATOM   3060 O  OG1 . THR B 1 74  ? -5.184  20.338 19.750  1.00 15.70 ? 103 THR B OG1 1 
ATOM   3061 C  CG2 . THR B 1 74  ? -3.267  21.181 18.603  1.00 14.89 ? 103 THR B CG2 1 
ATOM   3062 N  N   . PHE B 1 75  ? -6.834  23.419 19.577  1.00 13.74 ? 104 PHE B N   1 
ATOM   3063 C  CA  . PHE B 1 75  ? -8.322  23.440 19.541  1.00 13.66 ? 104 PHE B CA  1 
ATOM   3064 C  C   . PHE B 1 75  ? -8.948  22.179 20.171  1.00 13.52 ? 104 PHE B C   1 
ATOM   3065 O  O   . PHE B 1 75  ? -9.779  22.280 21.104  1.00 14.14 ? 104 PHE B O   1 
ATOM   3066 C  CB  . PHE B 1 75  ? -8.803  23.591 18.092  1.00 13.65 ? 104 PHE B CB  1 
ATOM   3067 C  CG  . PHE B 1 75  ? -10.300 23.538 17.926  1.00 13.68 ? 104 PHE B CG  1 
ATOM   3068 C  CD1 . PHE B 1 75  ? -11.082 24.648 18.214  1.00 13.62 ? 104 PHE B CD1 1 
ATOM   3069 C  CD2 . PHE B 1 75  ? -10.930 22.373 17.518  1.00 13.64 ? 104 PHE B CD2 1 
ATOM   3070 C  CE1 . PHE B 1 75  ? -12.459 24.602 18.061  1.00 13.18 ? 104 PHE B CE1 1 
ATOM   3071 C  CE2 . PHE B 1 75  ? -12.310 22.324 17.384  1.00 13.56 ? 104 PHE B CE2 1 
ATOM   3072 C  CZ  . PHE B 1 75  ? -13.068 23.449 17.634  1.00 13.54 ? 104 PHE B CZ  1 
ATOM   3073 N  N   . ASP B 1 76  ? -8.598  20.992 19.665  1.00 12.67 ? 105 ASP B N   1 
ATOM   3074 C  CA  . ASP B 1 76  ? -9.288  19.761 20.062  1.00 12.94 ? 105 ASP B CA  1 
ATOM   3075 C  C   . ASP B 1 76  ? -8.775  19.246 21.414  1.00 13.17 ? 105 ASP B C   1 
ATOM   3076 O  O   . ASP B 1 76  ? -9.400  18.337 21.998  1.00 14.69 ? 105 ASP B O   1 
ATOM   3077 C  CB  . ASP B 1 76  ? -9.213  18.701 18.964  1.00 12.73 ? 105 ASP B CB  1 
ATOM   3078 C  CG  . ASP B 1 76  ? -7.801  18.271 18.592  1.00 12.94 ? 105 ASP B CG  1 
ATOM   3079 O  OD1 . ASP B 1 76  ? -6.956  19.177 18.293  1.00 13.23 ? 105 ASP B OD1 1 
ATOM   3080 O  OD2 . ASP B 1 76  ? -7.548  17.061 18.644  1.00 12.91 ? 105 ASP B OD2 1 
ATOM   3081 N  N   . LEU B 1 77  ? -7.695  19.822 21.927  1.00 12.76 ? 106 LEU B N   1 
ATOM   3082 C  CA  . LEU B 1 77  ? -7.285  19.631 23.332  1.00 13.23 ? 106 LEU B CA  1 
ATOM   3083 C  C   . LEU B 1 77  ? -7.950  20.672 24.236  1.00 13.17 ? 106 LEU B C   1 
ATOM   3084 O  O   . LEU B 1 77  ? -7.638  20.746 25.411  1.00 12.15 ? 106 LEU B O   1 
ATOM   3085 C  CB  . LEU B 1 77  ? -5.756  19.666 23.448  1.00 13.35 ? 106 LEU B CB  1 
ATOM   3086 C  CG  . LEU B 1 77  ? -5.107  18.294 23.353  1.00 14.14 ? 106 LEU B CG  1 
ATOM   3087 C  CD1 . LEU B 1 77  ? -3.609  18.408 23.177  1.00 14.96 ? 106 LEU B CD1 1 
ATOM   3088 C  CD2 . LEU B 1 77  ? -5.460  17.435 24.556  1.00 15.03 ? 106 LEU B CD2 1 
ATOM   3089 N  N   . GLY B 1 78  ? -8.868  21.475 23.695  1.00 14.12 ? 107 GLY B N   1 
ATOM   3090 C  CA  . GLY B 1 78  ? -9.661  22.376 24.542  1.00 14.18 ? 107 GLY B CA  1 
ATOM   3091 C  C   . GLY B 1 78  ? -8.874  23.575 25.027  1.00 14.14 ? 107 GLY B C   1 
ATOM   3092 O  O   . GLY B 1 78  ? -9.241  24.170 26.034  1.00 14.22 ? 107 GLY B O   1 
ATOM   3093 N  N   . ARG B 1 79  ? -7.806  23.924 24.315  1.00 13.90 ? 108 ARG B N   1 
ATOM   3094 C  CA  . ARG B 1 79  ? -7.074  25.160 24.542  1.00 13.98 ? 108 ARG B CA  1 
ATOM   3095 C  C   . ARG B 1 79  ? -8.051  26.298 24.814  1.00 14.00 ? 108 ARG B C   1 
ATOM   3096 O  O   . ARG B 1 79  ? -8.989  26.510 24.035  1.00 13.55 ? 108 ARG B O   1 
ATOM   3097 C  CB  . ARG B 1 79  ? -6.219  25.495 23.319  1.00 14.49 ? 108 ARG B CB  1 
ATOM   3098 C  CG  . ARG B 1 79  ? -5.563  26.873 23.318  1.00 14.83 ? 108 ARG B CG  1 
ATOM   3099 C  CD  . ARG B 1 79  ? -5.268  27.362 21.909  1.00 15.72 ? 108 ARG B CD  1 
ATOM   3100 N  NE  . ARG B 1 79  ? -6.487  27.456 21.125  1.00 15.72 ? 108 ARG B NE  1 
ATOM   3101 C  CZ  . ARG B 1 79  ? -6.556  27.415 19.803  1.00 16.32 ? 108 ARG B CZ  1 
ATOM   3102 N  NH1 . ARG B 1 79  ? -5.462  27.215 19.080  1.00 16.09 ? 108 ARG B NH1 1 
ATOM   3103 N  NH2 . ARG B 1 79  ? -7.730  27.588 19.221  1.00 15.75 ? 108 ARG B NH2 1 
ATOM   3104 N  N   . ASP B 1 80  ? -7.809  26.993 25.920  1.00 13.92 ? 109 ASP B N   1 
ATOM   3105 C  CA  . ASP B 1 80  ? -8.575  28.179 26.295  1.00 15.48 ? 109 ASP B CA  1 
ATOM   3106 C  C   . ASP B 1 80  ? -7.594  29.330 26.539  1.00 15.54 ? 109 ASP B C   1 
ATOM   3107 O  O   . ASP B 1 80  ? -6.958  29.455 27.605  1.00 16.13 ? 109 ASP B O   1 
ATOM   3108 C  CB  . ASP B 1 80  ? -9.509  27.858 27.465  1.00 16.19 ? 109 ASP B CB  1 
ATOM   3109 C  CG  . ASP B 1 80  ? -10.353 29.036 27.928  1.00 17.93 ? 109 ASP B CG  1 
ATOM   3110 O  OD1 . ASP B 1 80  ? -9.840  30.177 27.905  1.00 18.08 ? 109 ASP B OD1 1 
ATOM   3111 O  OD2 . ASP B 1 80  ? -11.513 28.799 28.332  1.00 20.68 ? 109 ASP B OD2 1 
ATOM   3112 N  N   . VAL B 1 81  ? -7.458  30.202 25.560  1.00 17.40 ? 110 VAL B N   1 
ATOM   3113 C  CA  . VAL B 1 81  ? -6.338  31.145 25.608  1.00 18.57 ? 110 VAL B CA  1 
ATOM   3114 C  C   . VAL B 1 81  ? -6.586  32.226 26.646  1.00 19.75 ? 110 VAL B C   1 
ATOM   3115 O  O   . VAL B 1 81  ? -5.615  32.756 27.161  1.00 20.82 ? 110 VAL B O   1 
ATOM   3116 C  CB  . VAL B 1 81  ? -5.969  31.757 24.244  1.00 18.86 ? 110 VAL B CB  1 
ATOM   3117 C  CG1 . VAL B 1 81  ? -5.378  30.701 23.335  1.00 19.01 ? 110 VAL B CG1 1 
ATOM   3118 C  CG2 . VAL B 1 81  ? -7.126  32.461 23.578  1.00 18.13 ? 110 VAL B CG2 1 
ATOM   3119 N  N   . GLU B 1 82  ? -7.832  32.510 26.997  1.00 20.29 ? 111 GLU B N   1 
ATOM   3120 C  CA  . GLU B 1 82  ? -8.073  33.475 28.067  1.00 22.81 ? 111 GLU B CA  1 
ATOM   3121 C  C   . GLU B 1 82  ? -7.589  32.898 29.413  1.00 20.31 ? 111 GLU B C   1 
ATOM   3122 O  O   . GLU B 1 82  ? -7.096  33.635 30.282  1.00 20.19 ? 111 GLU B O   1 
ATOM   3123 C  CB  . GLU B 1 82  ? -9.551  33.868 28.057  1.00 26.51 ? 111 GLU B CB  1 
ATOM   3124 C  CG  . GLU B 1 82  ? -9.913  34.622 26.788  1.00 28.94 ? 111 GLU B CG  1 
ATOM   3125 C  CD  . GLU B 1 82  ? -11.382 34.729 26.444  1.00 31.86 ? 111 GLU B CD  1 
ATOM   3126 O  OE1 . GLU B 1 82  ? -12.123 33.743 26.655  1.00 39.30 ? 111 GLU B OE1 1 
ATOM   3127 O  OE2 . GLU B 1 82  ? -11.772 35.797 25.936  1.00 33.84 ? 111 GLU B OE2 1 
ATOM   3128 N  N   . LEU B 1 83  ? -7.722  31.590 29.593  1.00 17.42 ? 112 LEU B N   1 
ATOM   3129 C  CA  . LEU B 1 83  ? -7.195  30.964 30.779  1.00 16.65 ? 112 LEU B CA  1 
ATOM   3130 C  C   . LEU B 1 83  ? -5.668  31.077 30.751  1.00 15.40 ? 112 LEU B C   1 
ATOM   3131 O  O   . LEU B 1 83  ? -5.034  31.424 31.776  1.00 14.78 ? 112 LEU B O   1 
ATOM   3132 C  CB  . LEU B 1 83  ? -7.627  29.497 30.835  1.00 16.42 ? 112 LEU B CB  1 
ATOM   3133 C  CG  . LEU B 1 83  ? -7.017  28.696 31.981  1.00 16.95 ? 112 LEU B CG  1 
ATOM   3134 C  CD1 . LEU B 1 83  ? -7.541  29.195 33.308  1.00 17.90 ? 112 LEU B CD1 1 
ATOM   3135 C  CD2 . LEU B 1 83  ? -7.307  27.212 31.833  1.00 16.44 ? 112 LEU B CD2 1 
ATOM   3136 N  N   . LEU B 1 84  ? -5.066  30.712 29.627  1.00 14.83 ? 113 LEU B N   1 
ATOM   3137 C  CA  . LEU B 1 84  ? -3.619  30.781 29.496  1.00 13.75 ? 113 LEU B CA  1 
ATOM   3138 C  C   . LEU B 1 84  ? -3.128  32.191 29.859  1.00 14.14 ? 113 LEU B C   1 
ATOM   3139 O  O   . LEU B 1 84  ? -2.209  32.339 30.659  1.00 13.13 ? 113 LEU B O   1 
ATOM   3140 C  CB  . LEU B 1 84  ? -3.200  30.439 28.074  1.00 13.82 ? 113 LEU B CB  1 
ATOM   3141 C  CG  . LEU B 1 84  ? -2.913  28.976 27.754  1.00 14.42 ? 113 LEU B CG  1 
ATOM   3142 C  CD1 . LEU B 1 84  ? -4.030  28.080 28.183  1.00 14.64 ? 113 LEU B CD1 1 
ATOM   3143 C  CD2 . LEU B 1 84  ? -2.630  28.801 26.278  1.00 14.56 ? 113 LEU B CD2 1 
ATOM   3144 N  N   . ALA B 1 85  ? -3.738  33.215 29.282  1.00 14.86 ? 114 ALA B N   1 
ATOM   3145 C  CA  . ALA B 1 85  ? -3.319  34.613 29.526  1.00 16.05 ? 114 ALA B CA  1 
ATOM   3146 C  C   . ALA B 1 85  ? -3.469  35.016 30.999  1.00 16.70 ? 114 ALA B C   1 
ATOM   3147 O  O   . ALA B 1 85  ? -2.584  35.711 31.524  1.00 17.90 ? 114 ALA B O   1 
ATOM   3148 C  CB  . ALA B 1 85  ? -4.111  35.557 28.653  1.00 15.40 ? 114 ALA B CB  1 
ATOM   3149 N  N   . GLU B 1 86  ? -4.571  34.620 31.644  1.00 16.64 ? 115 GLU B N   1 
ATOM   3150 C  CA  . GLU B 1 86  ? -4.803  34.904 33.084  1.00 17.47 ? 115 GLU B CA  1 
ATOM   3151 C  C   . GLU B 1 86  ? -3.707  34.235 33.938  1.00 17.67 ? 115 GLU B C   1 
ATOM   3152 O  O   . GLU B 1 86  ? -3.090  34.908 34.788  1.00 16.58 ? 115 GLU B O   1 
ATOM   3153 C  CB  . GLU B 1 86  ? -6.205  34.443 33.516  1.00 18.12 ? 115 GLU B CB  1 
ATOM   3154 C  CG  . GLU B 1 86  ? -6.531  34.668 35.000  1.00 20.02 ? 115 GLU B CG  1 
ATOM   3155 C  CD  . GLU B 1 86  ? -7.679  33.820 35.574  1.00 21.63 ? 115 GLU B CD  1 
ATOM   3156 O  OE1 . GLU B 1 86  ? -8.409  33.202 34.803  1.00 19.54 ? 115 GLU B OE1 1 
ATOM   3157 O  OE2 . GLU B 1 86  ? -7.830  33.754 36.793  1.00 22.12 ? 115 GLU B OE2 1 
ATOM   3158 N  N   . VAL B 1 87  ? -3.429  32.949 33.733  1.00 15.17 ? 116 VAL B N   1 
ATOM   3159 C  CA  . VAL B 1 87  ? -2.437  32.311 34.592  1.00 16.83 ? 116 VAL B CA  1 
ATOM   3160 C  C   . VAL B 1 87  ? -1.016  32.810 34.241  1.00 17.30 ? 116 VAL B C   1 
ATOM   3161 O  O   . VAL B 1 87  ? -0.167  32.915 35.124  1.00 17.06 ? 116 VAL B O   1 
ATOM   3162 C  CB  . VAL B 1 87  ? -2.525  30.779 34.544  1.00 17.28 ? 116 VAL B CB  1 
ATOM   3163 C  CG1 . VAL B 1 87  ? -3.927  30.296 34.830  1.00 16.74 ? 116 VAL B CG1 1 
ATOM   3164 C  CG2 . VAL B 1 87  ? -2.022  30.206 33.241  1.00 18.60 ? 116 VAL B CG2 1 
ATOM   3165 N  N   . SER B 1 88  ? -0.757  33.085 32.961  1.00 16.65 ? 117 SER B N   1 
ATOM   3166 C  CA  . SER B 1 88  ? 0.516   33.646 32.506  1.00 17.44 ? 117 SER B CA  1 
ATOM   3167 C  C   . SER B 1 88  ? 0.826   34.939 33.268  1.00 18.18 ? 117 SER B C   1 
ATOM   3168 O  O   . SER B 1 88  ? 1.922   35.085 33.835  1.00 17.62 ? 117 SER B O   1 
ATOM   3169 C  CB  . SER B 1 88  ? 0.488   33.927 31.024  1.00 16.81 ? 117 SER B CB  1 
ATOM   3170 O  OG  . SER B 1 88  ? 1.709   34.528 30.619  1.00 16.61 ? 117 SER B OG  1 
ATOM   3171 N  N   . GLU B 1 89  ? -0.131  35.870 33.305  1.00 19.24 ? 118 GLU B N   1 
ATOM   3172 C  CA  . GLU B 1 89  ? 0.111   37.136 34.011  1.00 21.86 ? 118 GLU B CA  1 
ATOM   3173 C  C   . GLU B 1 89  ? 0.279   36.870 35.508  1.00 22.17 ? 118 GLU B C   1 
ATOM   3174 O  O   . GLU B 1 89  ? 1.227   37.369 36.128  1.00 24.12 ? 118 GLU B O   1 
ATOM   3175 C  CB  . GLU B 1 89  ? -1.037  38.119 33.800  1.00 25.28 ? 118 GLU B CB  1 
ATOM   3176 C  CG  . GLU B 1 89  ? -0.874  39.421 34.555  1.00 29.40 ? 118 GLU B CG  1 
ATOM   3177 C  CD  . GLU B 1 89  ? -1.859  40.470 34.073  1.00 35.04 ? 118 GLU B CD  1 
ATOM   3178 O  OE1 . GLU B 1 89  ? -2.619  40.169 33.127  1.00 34.17 ? 118 GLU B OE1 1 
ATOM   3179 O  OE2 . GLU B 1 89  ? -1.874  41.580 34.635  1.00 39.27 ? 118 GLU B OE2 1 
ATOM   3180 N  N   . ALA B 1 90  ? -0.625  36.089 36.095  1.00 21.02 ? 119 ALA B N   1 
ATOM   3181 C  CA  . ALA B 1 90  ? -0.619  35.872 37.558  1.00 20.05 ? 119 ALA B CA  1 
ATOM   3182 C  C   . ALA B 1 90  ? 0.686   35.203 38.006  1.00 17.95 ? 119 ALA B C   1 
ATOM   3183 O  O   . ALA B 1 90  ? 1.191   35.561 39.054  1.00 17.86 ? 119 ALA B O   1 
ATOM   3184 C  CB  . ALA B 1 90  ? -1.836  35.082 37.996  1.00 20.07 ? 119 ALA B CB  1 
ATOM   3185 N  N   . ALA B 1 91  ? 1.228   34.252 37.237  1.00 16.69 ? 120 ALA B N   1 
ATOM   3186 C  CA  . ALA B 1 91  ? 2.430   33.499 37.656  1.00 16.22 ? 120 ALA B CA  1 
ATOM   3187 C  C   . ALA B 1 91  ? 3.733   34.173 37.169  1.00 17.34 ? 120 ALA B C   1 
ATOM   3188 O  O   . ALA B 1 91  ? 4.818   33.743 37.573  1.00 15.16 ? 120 ALA B O   1 
ATOM   3189 C  CB  . ALA B 1 91  ? 2.361   32.083 37.146  1.00 16.05 ? 120 ALA B CB  1 
ATOM   3190 N  N   . ASP B 1 92  ? 3.606   35.181 36.300  1.00 17.08 ? 121 ASP B N   1 
ATOM   3191 C  CA  . ASP B 1 92  ? 4.744   35.835 35.607  1.00 19.15 ? 121 ASP B CA  1 
ATOM   3192 C  C   . ASP B 1 92  ? 5.613   34.779 34.906  1.00 19.03 ? 121 ASP B C   1 
ATOM   3193 O  O   . ASP B 1 92  ? 6.861   34.742 35.015  1.00 18.26 ? 121 ASP B O   1 
ATOM   3194 C  CB  . ASP B 1 92  ? 5.500   36.735 36.589  1.00 20.62 ? 121 ASP B CB  1 
ATOM   3195 C  CG  . ASP B 1 92  ? 6.629   37.511 35.955  1.00 21.07 ? 121 ASP B CG  1 
ATOM   3196 O  OD1 . ASP B 1 92  ? 6.437   37.981 34.836  1.00 22.87 ? 121 ASP B OD1 1 
ATOM   3197 O  OD2 . ASP B 1 92  ? 7.701   37.586 36.571  1.00 25.35 ? 121 ASP B OD2 1 
ATOM   3198 N  N   . VAL B 1 93  ? 4.935   33.918 34.151  1.00 18.70 ? 122 VAL B N   1 
ATOM   3199 C  CA  . VAL B 1 93  ? 5.572   32.965 33.264  1.00 17.37 ? 122 VAL B CA  1 
ATOM   3200 C  C   . VAL B 1 93  ? 4.976   33.172 31.859  1.00 17.20 ? 122 VAL B C   1 
ATOM   3201 O  O   . VAL B 1 93  ? 3.741   33.141 31.702  1.00 17.95 ? 122 VAL B O   1 
ATOM   3202 C  CB  . VAL B 1 93  ? 5.366   31.529 33.784  1.00 17.57 ? 122 VAL B CB  1 
ATOM   3203 C  CG1 . VAL B 1 93  ? 5.838   30.473 32.806  1.00 18.30 ? 122 VAL B CG1 1 
ATOM   3204 C  CG2 . VAL B 1 93  ? 6.043   31.309 35.126  1.00 17.87 ? 122 VAL B CG2 1 
ATOM   3205 N  N   . HIS B 1 94  ? 5.832   33.395 30.857  1.00 16.01 ? 123 HIS B N   1 
ATOM   3206 C  CA  . HIS B 1 94  ? 5.413   33.550 29.499  1.00 16.00 ? 123 HIS B CA  1 
ATOM   3207 C  C   . HIS B 1 94  ? 4.767   32.240 29.022  1.00 16.27 ? 123 HIS B C   1 
ATOM   3208 O  O   . HIS B 1 94  ? 5.298   31.164 29.321  1.00 15.51 ? 123 HIS B O   1 
ATOM   3209 C  CB  . HIS B 1 94  ? 6.591   33.900 28.583  1.00 17.25 ? 123 HIS B CB  1 
ATOM   3210 C  CG  . HIS B 1 94  ? 7.371   35.113 28.975  1.00 17.80 ? 123 HIS B CG  1 
ATOM   3211 N  ND1 . HIS B 1 94  ? 6.799   36.368 29.072  1.00 18.90 ? 123 HIS B ND1 1 
ATOM   3212 C  CD2 . HIS B 1 94  ? 8.681   35.268 29.265  1.00 19.90 ? 123 HIS B CD2 1 
ATOM   3213 C  CE1 . HIS B 1 94  ? 7.730   37.245 29.412  1.00 19.65 ? 123 HIS B CE1 1 
ATOM   3214 N  NE2 . HIS B 1 94  ? 8.890   36.593 29.552  1.00 17.97 ? 123 HIS B NE2 1 
ATOM   3215 N  N   . ILE B 1 95  ? 3.654   32.332 28.282  1.00 15.77 ? 124 ILE B N   1 
ATOM   3216 C  CA  . ILE B 1 95  ? 3.085   31.139 27.682  1.00 15.42 ? 124 ILE B CA  1 
ATOM   3217 C  C   . ILE B 1 95  ? 2.887   31.354 26.178  1.00 15.51 ? 124 ILE B C   1 
ATOM   3218 O  O   . ILE B 1 95  ? 2.276   32.336 25.749  1.00 15.83 ? 124 ILE B O   1 
ATOM   3219 C  CB  . ILE B 1 95  ? 1.768   30.700 28.341  1.00 15.33 ? 124 ILE B CB  1 
ATOM   3220 C  CG1 . ILE B 1 95  ? 1.923   30.404 29.827  1.00 15.46 ? 124 ILE B CG1 1 
ATOM   3221 C  CG2 . ILE B 1 95  ? 1.223   29.492 27.600  1.00 15.11 ? 124 ILE B CG2 1 
ATOM   3222 C  CD1 . ILE B 1 95  ? 0.615   30.078 30.512  1.00 15.83 ? 124 ILE B CD1 1 
ATOM   3223 N  N   . VAL B 1 96  ? 3.376   30.374 25.421  1.00 15.65 ? 125 VAL B N   1 
ATOM   3224 C  CA  . VAL B 1 96  ? 3.205   30.321 23.975  1.00 14.84 ? 125 VAL B CA  1 
ATOM   3225 C  C   . VAL B 1 96  ? 2.046   29.380 23.660  1.00 14.10 ? 125 VAL B C   1 
ATOM   3226 O  O   . VAL B 1 96  ? 2.039   28.284 24.142  1.00 14.67 ? 125 VAL B O   1 
ATOM   3227 C  CB  . VAL B 1 96  ? 4.486   29.841 23.266  1.00 15.03 ? 125 VAL B CB  1 
ATOM   3228 C  CG1 . VAL B 1 96  ? 4.256   29.714 21.764  1.00 14.87 ? 125 VAL B CG1 1 
ATOM   3229 C  CG2 . VAL B 1 96  ? 5.655   30.755 23.555  1.00 15.68 ? 125 VAL B CG2 1 
ATOM   3230 N  N   . ALA B 1 97  ? 1.121   29.818 22.816  1.00 14.74 ? 126 ALA B N   1 
ATOM   3231 C  CA  . ALA B 1 97  ? -0.066  29.057 22.467  1.00 14.27 ? 126 ALA B CA  1 
ATOM   3232 C  C   . ALA B 1 97  ? 0.149   28.405 21.100  1.00 13.65 ? 126 ALA B C   1 
ATOM   3233 O  O   . ALA B 1 97  ? 0.984   28.836 20.281  1.00 14.46 ? 126 ALA B O   1 
ATOM   3234 C  CB  . ALA B 1 97  ? -1.313  29.925 22.468  1.00 14.16 ? 126 ALA B CB  1 
ATOM   3235 N  N   . ALA B 1 98  ? -0.590  27.320 20.912  1.00 13.59 ? 127 ALA B N   1 
ATOM   3236 C  CA  . ALA B 1 98  ? -0.445  26.471 19.790  1.00 13.50 ? 127 ALA B CA  1 
ATOM   3237 C  C   . ALA B 1 98  ? -1.689  26.538 18.903  1.00 13.53 ? 127 ALA B C   1 
ATOM   3238 O  O   . ALA B 1 98  ? -2.815  26.667 19.423  1.00 14.86 ? 127 ALA B O   1 
ATOM   3239 C  CB  . ALA B 1 98  ? -0.226  25.069 20.286  1.00 13.25 ? 127 ALA B CB  1 
ATOM   3240 N  N   . THR B 1 99  ? -1.476  26.426 17.587  1.00 13.40 ? 128 THR B N   1 
ATOM   3241 C  CA  . THR B 1 99  ? -2.540  26.007 16.638  1.00 13.23 ? 128 THR B CA  1 
ATOM   3242 C  C   . THR B 1 99  ? -2.296  24.549 16.235  1.00 13.63 ? 128 THR B C   1 
ATOM   3243 O  O   . THR B 1 99  ? -1.563  23.844 16.939  1.00 13.49 ? 128 THR B O   1 
ATOM   3244 C  CB  . THR B 1 99  ? -2.639  26.947 15.432  1.00 13.52 ? 128 THR B CB  1 
ATOM   3245 O  OG1 . THR B 1 99  ? -3.831  26.609 14.727  1.00 12.57 ? 128 THR B OG1 1 
ATOM   3246 C  CG2 . THR B 1 99  ? -1.425  26.893 14.527  1.00 14.76 ? 128 THR B CG2 1 
ATOM   3247 N  N   . GLY B 1 100 ? -2.963  24.076 15.164  1.00 13.49 ? 129 GLY B N   1 
ATOM   3248 C  CA  . GLY B 1 100 ? -2.897  22.681 14.742  1.00 13.09 ? 129 GLY B CA  1 
ATOM   3249 C  C   . GLY B 1 100 ? -4.035  21.861 15.332  1.00 13.12 ? 129 GLY B C   1 
ATOM   3250 O  O   . GLY B 1 100 ? -5.055  22.402 15.771  1.00 12.98 ? 129 GLY B O   1 
ATOM   3251 N  N   . LEU B 1 101 ? -3.862  20.543 15.291  1.00 13.09 ? 130 LEU B N   1 
ATOM   3252 C  CA  . LEU B 1 101 ? -4.878  19.571 15.762  1.00 12.70 ? 130 LEU B CA  1 
ATOM   3253 C  C   . LEU B 1 101 ? -4.149  18.367 16.337  1.00 12.94 ? 130 LEU B C   1 
ATOM   3254 O  O   . LEU B 1 101 ? -3.159  17.876 15.784  1.00 13.85 ? 130 LEU B O   1 
ATOM   3255 C  CB  . LEU B 1 101 ? -5.799  19.123 14.624  1.00 12.63 ? 130 LEU B CB  1 
ATOM   3256 C  CG  . LEU B 1 101 ? -6.754  20.183 14.083  1.00 12.42 ? 130 LEU B CG  1 
ATOM   3257 C  CD1 . LEU B 1 101 ? -7.422  19.715 12.807  1.00 12.34 ? 130 LEU B CD1 1 
ATOM   3258 C  CD2 . LEU B 1 101 ? -7.780  20.608 15.132  1.00 12.87 ? 130 LEU B CD2 1 
ATOM   3259 N  N   . TRP B 1 102 ? -4.671  17.922 17.459  1.00 13.81 ? 131 TRP B N   1 
ATOM   3260 C  CA  . TRP B 1 102 ? -4.240  16.704 18.144  1.00 14.11 ? 131 TRP B CA  1 
ATOM   3261 C  C   . TRP B 1 102 ? -5.057  15.533 17.573  1.00 13.91 ? 131 TRP B C   1 
ATOM   3262 O  O   . TRP B 1 102 ? -5.503  15.612 16.420  1.00 13.80 ? 131 TRP B O   1 
ATOM   3263 C  CB  . TRP B 1 102 ? -4.389  16.980 19.641  1.00 13.29 ? 131 TRP B CB  1 
ATOM   3264 C  CG  . TRP B 1 102 ? -3.974  15.941 20.627  1.00 13.35 ? 131 TRP B CG  1 
ATOM   3265 C  CD1 . TRP B 1 102 ? -2.710  15.542 20.965  1.00 13.54 ? 131 TRP B CD1 1 
ATOM   3266 C  CD2 . TRP B 1 102 ? -4.846  15.324 21.588  1.00 14.39 ? 131 TRP B CD2 1 
ATOM   3267 N  NE1 . TRP B 1 102 ? -2.745  14.660 22.010  1.00 12.56 ? 131 TRP B NE1 1 
ATOM   3268 C  CE2 . TRP B 1 102 ? -4.042  14.510 22.421  1.00 13.73 ? 131 TRP B CE2 1 
ATOM   3269 C  CE3 . TRP B 1 102 ? -6.224  15.346 21.795  1.00 14.42 ? 131 TRP B CE3 1 
ATOM   3270 C  CZ2 . TRP B 1 102 ? -4.582  13.727 23.435  1.00 14.07 ? 131 TRP B CZ2 1 
ATOM   3271 C  CZ3 . TRP B 1 102 ? -6.756  14.564 22.798  1.00 15.32 ? 131 TRP B CZ3 1 
ATOM   3272 C  CH2 . TRP B 1 102 ? -5.945  13.789 23.624  1.00 14.44 ? 131 TRP B CH2 1 
ATOM   3273 N  N   . PHE B 1 103 ? -5.246  14.450 18.300  1.00 15.03 ? 132 PHE B N   1 
ATOM   3274 C  CA  . PHE B 1 103 ? -5.881  13.261 17.703  1.00 16.11 ? 132 PHE B CA  1 
ATOM   3275 C  C   . PHE B 1 103 ? -7.336  13.100 18.176  1.00 15.41 ? 132 PHE B C   1 
ATOM   3276 O  O   . PHE B 1 103 ? -7.845  12.003 18.152  1.00 16.66 ? 132 PHE B O   1 
ATOM   3277 C  CB  . PHE B 1 103 ? -5.031  12.003 17.935  1.00 17.19 ? 132 PHE B CB  1 
ATOM   3278 C  CG  . PHE B 1 103 ? -4.770  11.598 19.362  1.00 18.11 ? 132 PHE B CG  1 
ATOM   3279 C  CD1 . PHE B 1 103 ? -5.711  10.882 20.092  1.00 19.70 ? 132 PHE B CD1 1 
ATOM   3280 C  CD2 . PHE B 1 103 ? -3.560  11.891 19.967  1.00 18.79 ? 132 PHE B CD2 1 
ATOM   3281 C  CE1 . PHE B 1 103 ? -5.450  10.489 21.400  1.00 21.51 ? 132 PHE B CE1 1 
ATOM   3282 C  CE2 . PHE B 1 103 ? -3.295  11.485 21.265  1.00 18.79 ? 132 PHE B CE2 1 
ATOM   3283 C  CZ  . PHE B 1 103 ? -4.233  10.782 21.979  1.00 20.94 ? 132 PHE B CZ  1 
ATOM   3284 N  N   . ASP B 1 104 ? -8.048  14.177 18.527  1.00 14.45 ? 133 ASP B N   1 
ATOM   3285 C  CA  . ASP B 1 104 ? -9.465  14.041 18.826  1.00 14.21 ? 133 ASP B CA  1 
ATOM   3286 C  C   . ASP B 1 104 ? -10.260 15.106 18.063  1.00 13.32 ? 133 ASP B C   1 
ATOM   3287 O  O   . ASP B 1 104 ? -11.033 15.823 18.637  1.00 13.63 ? 133 ASP B O   1 
ATOM   3288 C  CB  . ASP B 1 104 ? -9.695  14.109 20.330  1.00 14.68 ? 133 ASP B CB  1 
ATOM   3289 C  CG  . ASP B 1 104 ? -11.128 13.811 20.737  1.00 15.27 ? 133 ASP B CG  1 
ATOM   3290 O  OD1 . ASP B 1 104 ? -11.792 13.047 20.009  1.00 15.30 ? 133 ASP B OD1 1 
ATOM   3291 O  OD2 . ASP B 1 104 ? -11.575 14.395 21.770  1.00 15.83 ? 133 ASP B OD2 1 
ATOM   3292 N  N   . PRO B 1 105 ? -9.993  15.270 16.749  1.00 14.27 ? 134 PRO B N   1 
ATOM   3293 C  CA  . PRO B 1 105 ? -10.672 16.351 16.014  1.00 13.72 ? 134 PRO B CA  1 
ATOM   3294 C  C   . PRO B 1 105 ? -12.153 15.990 15.828  1.00 13.48 ? 134 PRO B C   1 
ATOM   3295 O  O   . PRO B 1 105 ? -12.452 14.811 15.600  1.00 12.55 ? 134 PRO B O   1 
ATOM   3296 C  CB  . PRO B 1 105 ? -9.940  16.417 14.667  1.00 13.55 ? 134 PRO B CB  1 
ATOM   3297 C  CG  . PRO B 1 105 ? -9.551  14.968 14.419  1.00 13.22 ? 134 PRO B CG  1 
ATOM   3298 C  CD  . PRO B 1 105 ? -9.178  14.467 15.798  1.00 13.28 ? 134 PRO B CD  1 
ATOM   3299 N  N   . PRO B 1 106 ? -13.063 16.986 15.961  1.00 13.03 ? 135 PRO B N   1 
ATOM   3300 C  CA  . PRO B 1 106 ? -14.457 16.746 15.775  1.00 13.91 ? 135 PRO B CA  1 
ATOM   3301 C  C   . PRO B 1 106 ? -14.769 16.728 14.271  1.00 13.85 ? 135 PRO B C   1 
ATOM   3302 O  O   . PRO B 1 106 ? -13.885 17.043 13.444  1.00 11.95 ? 135 PRO B O   1 
ATOM   3303 C  CB  . PRO B 1 106 ? -15.186 17.941 16.399  1.00 13.80 ? 135 PRO B CB  1 
ATOM   3304 C  CG  . PRO B 1 106 ? -14.205 19.082 16.097  1.00 13.78 ? 135 PRO B CG  1 
ATOM   3305 C  CD  . PRO B 1 106 ? -12.852 18.416 16.300  1.00 13.89 ? 135 PRO B CD  1 
ATOM   3306 N  N   . LEU B 1 107 ? -16.016 16.421 13.924  1.00 13.45 ? 136 LEU B N   1 
ATOM   3307 C  CA  . LEU B 1 107 ? -16.380 16.310 12.478  1.00 14.00 ? 136 LEU B CA  1 
ATOM   3308 C  C   . LEU B 1 107 ? -16.063 17.592 11.711  1.00 12.80 ? 136 LEU B C   1 
ATOM   3309 O  O   . LEU B 1 107 ? -15.582 17.522 10.576  1.00 12.01 ? 136 LEU B O   1 
ATOM   3310 C  CB  . LEU B 1 107 ? -17.850 15.943 12.316  1.00 15.71 ? 136 LEU B CB  1 
ATOM   3311 C  CG  . LEU B 1 107 ? -18.141 14.449 12.448  1.00 16.58 ? 136 LEU B CG  1 
ATOM   3312 C  CD1 . LEU B 1 107 ? -19.612 14.218 12.700  1.00 18.10 ? 136 LEU B CD1 1 
ATOM   3313 C  CD2 . LEU B 1 107 ? -17.710 13.694 11.203  1.00 18.10 ? 136 LEU B CD2 1 
ATOM   3314 N  N   . SER B 1 108 ? -16.324 18.741 12.305  1.00 12.24 ? 137 SER B N   1 
ATOM   3315 C  CA  . SER B 1 108 ? -16.153 20.009 11.559  1.00 12.00 ? 137 SER B CA  1 
ATOM   3316 C  C   . SER B 1 108 ? -14.680 20.230 11.148  1.00 12.89 ? 137 SER B C   1 
ATOM   3317 O  O   . SER B 1 108 ? -14.383 21.066 10.277  1.00 12.58 ? 137 SER B O   1 
ATOM   3318 C  CB  . SER B 1 108 ? -16.676 21.169 12.347  1.00 11.44 ? 137 SER B CB  1 
ATOM   3319 O  OG  . SER B 1 108 ? -18.062 21.024 12.643  1.00 10.47 ? 137 SER B OG  1 
ATOM   3320 N  N   . MET B 1 109 ? -13.753 19.520 11.776  1.00 13.22 ? 138 MET B N   1 
ATOM   3321 C  CA  . MET B 1 109 ? -12.343 19.572 11.418  1.00 14.15 ? 138 MET B CA  1 
ATOM   3322 C  C   . MET B 1 109 ? -11.990 18.378 10.537  1.00 15.03 ? 138 MET B C   1 
ATOM   3323 O  O   . MET B 1 109 ? -11.310 18.535 9.534   1.00 16.39 ? 138 MET B O   1 
ATOM   3324 C  CB  . MET B 1 109 ? -11.458 19.529 12.671  1.00 14.62 ? 138 MET B CB  1 
ATOM   3325 C  CG  . MET B 1 109 ? -11.440 20.838 13.478  1.00 14.34 ? 138 MET B CG  1 
ATOM   3326 S  SD  . MET B 1 109 ? -10.777 22.252 12.532  1.00 16.29 ? 138 MET B SD  1 
ATOM   3327 C  CE  . MET B 1 109 ? -10.813 23.510 13.802  1.00 15.71 ? 138 MET B CE  1 
ATOM   3328 N  N   . ARG B 1 110 ? -12.372 17.191 10.987  1.00 16.57 ? 139 ARG B N   1 
ATOM   3329 C  CA  . ARG B 1 110 ? -12.126 15.862 10.358  1.00 16.91 ? 139 ARG B CA  1 
ATOM   3330 C  C   . ARG B 1 110 ? -12.483 15.856 8.856   1.00 16.54 ? 139 ARG B C   1 
ATOM   3331 O  O   . ARG B 1 110 ? -11.956 15.081 8.027   1.00 15.48 ? 139 ARG B O   1 
ATOM   3332 C  CB  . ARG B 1 110 ? -13.050 14.864 11.073  1.00 19.44 ? 139 ARG B CB  1 
ATOM   3333 C  CG  . ARG B 1 110 ? -12.472 13.503 11.388  1.00 21.20 ? 139 ARG B CG  1 
ATOM   3334 C  CD  . ARG B 1 110 ? -12.986 12.917 12.696  1.00 21.37 ? 139 ARG B CD  1 
ATOM   3335 N  NE  . ARG B 1 110 ? -14.329 12.345 12.718  1.00 19.95 ? 139 ARG B NE  1 
ATOM   3336 C  CZ  . ARG B 1 110 ? -15.202 12.494 13.735  1.00 20.81 ? 139 ARG B CZ  1 
ATOM   3337 N  NH1 . ARG B 1 110 ? -14.922 13.294 14.762  1.00 17.43 ? 139 ARG B NH1 1 
ATOM   3338 N  NH2 . ARG B 1 110 ? -16.324 11.789 13.752  1.00 18.52 ? 139 ARG B NH2 1 
ATOM   3339 N  N   . LEU B 1 111 ? -13.478 16.632 8.498   1.00 15.53 ? 140 LEU B N   1 
ATOM   3340 C  CA  . LEU B 1 111 ? -13.984 16.581 7.126   1.00 15.51 ? 140 LEU B CA  1 
ATOM   3341 C  C   . LEU B 1 111 ? -13.317 17.634 6.237   1.00 14.76 ? 140 LEU B C   1 
ATOM   3342 O  O   . LEU B 1 111 ? -13.668 17.734 5.090   1.00 15.11 ? 140 LEU B O   1 
ATOM   3343 C  CB  . LEU B 1 111 ? -15.497 16.769 7.158   1.00 16.28 ? 140 LEU B CB  1 
ATOM   3344 C  CG  . LEU B 1 111 ? -16.269 15.654 7.856   1.00 16.66 ? 140 LEU B CG  1 
ATOM   3345 C  CD1 . LEU B 1 111 ? -17.742 15.998 7.870   1.00 16.79 ? 140 LEU B CD1 1 
ATOM   3346 C  CD2 . LEU B 1 111 ? -16.039 14.305 7.194   1.00 18.52 ? 140 LEU B CD2 1 
ATOM   3347 N  N   . ARG B 1 112 ? -12.367 18.410 6.766   1.00 14.51 ? 141 ARG B N   1 
ATOM   3348 C  CA  . ARG B 1 112 ? -11.771 19.526 6.036   1.00 14.34 ? 141 ARG B CA  1 
ATOM   3349 C  C   . ARG B 1 112 ? -10.622 19.070 5.129   1.00 14.54 ? 141 ARG B C   1 
ATOM   3350 O  O   . ARG B 1 112 ? -9.991  18.042 5.323   1.00 13.37 ? 141 ARG B O   1 
ATOM   3351 C  CB  . ARG B 1 112 ? -11.320 20.597 7.020   1.00 13.38 ? 141 ARG B CB  1 
ATOM   3352 C  CG  . ARG B 1 112 ? -12.466 21.171 7.841   1.00 13.79 ? 141 ARG B CG  1 
ATOM   3353 C  CD  . ARG B 1 112 ? -13.469 22.018 7.064   1.00 13.46 ? 141 ARG B CD  1 
ATOM   3354 N  NE  . ARG B 1 112 ? -14.401 21.282 6.211   1.00 12.55 ? 141 ARG B NE  1 
ATOM   3355 C  CZ  . ARG B 1 112 ? -15.607 20.847 6.587   1.00 12.88 ? 141 ARG B CZ  1 
ATOM   3356 N  NH1 . ARG B 1 112 ? -15.939 20.861 7.863   1.00 12.03 ? 141 ARG B NH1 1 
ATOM   3357 N  NH2 . ARG B 1 112 ? -16.481 20.410 5.682   1.00 12.66 ? 141 ARG B NH2 1 
ATOM   3358 N  N   . SER B 1 113 ? -10.450 19.853 4.071   1.00 15.00 ? 142 SER B N   1 
ATOM   3359 C  CA  . SER B 1 113 ? -9.373  19.663 3.083   1.00 15.21 ? 142 SER B CA  1 
ATOM   3360 C  C   . SER B 1 113 ? -8.047  20.269 3.578   1.00 14.67 ? 142 SER B C   1 
ATOM   3361 O  O   . SER B 1 113 ? -8.021  21.057 4.546   1.00 14.89 ? 142 SER B O   1 
ATOM   3362 C  CB  . SER B 1 113 ? -9.782  20.276 1.780   1.00 14.51 ? 142 SER B CB  1 
ATOM   3363 O  OG  . SER B 1 113 ? -9.772  21.693 1.881   1.00 15.40 ? 142 SER B OG  1 
ATOM   3364 N  N   . VAL B 1 114 ? -6.943  19.936 2.882   1.00 14.72 ? 143 VAL B N   1 
ATOM   3365 C  CA  . VAL B 1 114 ? -5.666  20.576 3.154   1.00 15.02 ? 143 VAL B CA  1 
ATOM   3366 C  C   . VAL B 1 114 ? -5.827  22.113 3.080   1.00 14.91 ? 143 VAL B C   1 
ATOM   3367 O  O   . VAL B 1 114 ? -5.377  22.819 3.965   1.00 15.11 ? 143 VAL B O   1 
ATOM   3368 C  CB  . VAL B 1 114 ? -4.520  20.070 2.242   1.00 15.12 ? 143 VAL B CB  1 
ATOM   3369 C  CG1 . VAL B 1 114 ? -3.191  20.668 2.676   1.00 15.19 ? 143 VAL B CG1 1 
ATOM   3370 C  CG2 . VAL B 1 114 ? -4.398  18.559 2.221   1.00 14.43 ? 143 VAL B CG2 1 
ATOM   3371 N  N   . GLU B 1 115 ? -6.417  22.636 2.012   1.00 14.61 ? 144 GLU B N   1 
ATOM   3372 C  CA  . GLU B 1 115 ? -6.587  24.056 1.850   1.00 15.13 ? 144 GLU B CA  1 
ATOM   3373 C  C   . GLU B 1 115 ? -7.336  24.630 3.062   1.00 14.05 ? 144 GLU B C   1 
ATOM   3374 O  O   . GLU B 1 115 ? -6.898  25.603 3.642   1.00 13.07 ? 144 GLU B O   1 
ATOM   3375 C  CB  . GLU B 1 115 ? -7.316  24.340 0.536   1.00 17.31 ? 144 GLU B CB  1 
ATOM   3376 C  CG  . GLU B 1 115 ? -8.012  25.704 0.487   1.00 20.42 ? 144 GLU B CG  1 
ATOM   3377 C  CD  . GLU B 1 115 ? -7.095  26.909 0.430   1.00 22.66 ? 144 GLU B CD  1 
ATOM   3378 O  OE1 . GLU B 1 115 ? -5.872  26.719 0.248   1.00 22.49 ? 144 GLU B OE1 1 
ATOM   3379 O  OE2 . GLU B 1 115 ? -7.617  28.041 0.565   1.00 28.04 ? 144 GLU B OE2 1 
ATOM   3380 N  N   . GLU B 1 116 ? -8.459  24.050 3.453   1.00 13.77 ? 145 GLU B N   1 
ATOM   3381 C  CA  . GLU B 1 116 ? -9.247  24.612 4.574   1.00 13.87 ? 145 GLU B CA  1 
ATOM   3382 C  C   . GLU B 1 116 ? -8.420  24.538 5.860   1.00 13.95 ? 145 GLU B C   1 
ATOM   3383 O  O   . GLU B 1 116 ? -8.294  25.509 6.608   1.00 14.69 ? 145 GLU B O   1 
ATOM   3384 C  CB  . GLU B 1 116 ? -10.562 23.844 4.729   1.00 13.46 ? 145 GLU B CB  1 
ATOM   3385 C  CG  . GLU B 1 116 ? -11.574 24.076 3.618   1.00 13.60 ? 145 GLU B CG  1 
ATOM   3386 C  CD  . GLU B 1 116 ? -12.765 23.121 3.677   1.00 13.49 ? 145 GLU B CD  1 
ATOM   3387 O  OE1 . GLU B 1 116 ? -12.547 21.928 3.954   1.00 12.18 ? 145 GLU B OE1 1 
ATOM   3388 O  OE2 . GLU B 1 116 ? -13.901 23.571 3.483   1.00 14.68 ? 145 GLU B OE2 1 
ATOM   3389 N  N   . LEU B 1 117 ? -7.801  23.390 6.108   1.00 14.76 ? 146 LEU B N   1 
ATOM   3390 C  CA  . LEU B 1 117 ? -6.987  23.250 7.323   1.00 14.76 ? 146 LEU B CA  1 
ATOM   3391 C  C   . LEU B 1 117 ? -5.897  24.326 7.343   1.00 15.64 ? 146 LEU B C   1 
ATOM   3392 O  O   . LEU B 1 117 ? -5.615  24.933 8.418   1.00 16.18 ? 146 LEU B O   1 
ATOM   3393 C  CB  . LEU B 1 117 ? -6.361  21.856 7.351   1.00 14.67 ? 146 LEU B CB  1 
ATOM   3394 C  CG  . LEU B 1 117 ? -7.338  20.741 7.700   1.00 15.40 ? 146 LEU B CG  1 
ATOM   3395 C  CD1 . LEU B 1 117 ? -6.661  19.373 7.611   1.00 15.33 ? 146 LEU B CD1 1 
ATOM   3396 C  CD2 . LEU B 1 117 ? -7.959  20.980 9.065   1.00 14.83 ? 146 LEU B CD2 1 
ATOM   3397 N  N   . THR B 1 118 ? -5.273  24.542 6.183   1.00 14.89 ? 147 THR B N   1 
ATOM   3398 C  CA  . THR B 1 118 ? -4.242  25.610 6.059   1.00 16.46 ? 147 THR B CA  1 
ATOM   3399 C  C   . THR B 1 118 ? -4.835  26.976 6.424   1.00 17.29 ? 147 THR B C   1 
ATOM   3400 O  O   . THR B 1 118 ? -4.214  27.677 7.200   1.00 17.48 ? 147 THR B O   1 
ATOM   3401 C  CB  . THR B 1 118 ? -3.571  25.642 4.680   1.00 15.55 ? 147 THR B CB  1 
ATOM   3402 O  OG1 . THR B 1 118 ? -2.995  24.362 4.396   1.00 15.30 ? 147 THR B OG1 1 
ATOM   3403 C  CG2 . THR B 1 118 ? -2.483  26.684 4.596   1.00 17.27 ? 147 THR B CG2 1 
ATOM   3404 N  N   . GLN B 1 119 ? -6.007  27.358 5.896   1.00 18.10 ? 148 GLN B N   1 
ATOM   3405 C  CA  . GLN B 1 119 ? -6.626  28.651 6.291   1.00 18.70 ? 148 GLN B CA  1 
ATOM   3406 C  C   . GLN B 1 119 ? -6.792  28.706 7.820   1.00 16.63 ? 148 GLN B C   1 
ATOM   3407 O  O   . GLN B 1 119 ? -6.565  29.768 8.472   1.00 15.04 ? 148 GLN B O   1 
ATOM   3408 C  CB  . GLN B 1 119 ? -8.000  28.875 5.657   1.00 21.89 ? 148 GLN B CB  1 
ATOM   3409 C  CG  . GLN B 1 119 ? -8.048  28.946 4.133   1.00 26.69 ? 148 GLN B CG  1 
ATOM   3410 C  CD  . GLN B 1 119 ? -9.448  28.624 3.611   1.00 34.67 ? 148 GLN B CD  1 
ATOM   3411 O  OE1 . GLN B 1 119 ? -10.446 28.594 4.352   1.00 38.79 ? 148 GLN B OE1 1 
ATOM   3412 N  NE2 . GLN B 1 119 ? -9.557  28.363 2.314   1.00 36.84 ? 148 GLN B NE2 1 
ATOM   3413 N  N   . PHE B 1 120 ? -7.178  27.595 8.434   1.00 14.58 ? 149 PHE B N   1 
ATOM   3414 C  CA  . PHE B 1 120 ? -7.462  27.641 9.884   1.00 15.42 ? 149 PHE B CA  1 
ATOM   3415 C  C   . PHE B 1 120 ? -6.159  27.863 10.675  1.00 15.18 ? 149 PHE B C   1 
ATOM   3416 O  O   . PHE B 1 120 ? -6.102  28.740 11.528  1.00 14.34 ? 149 PHE B O   1 
ATOM   3417 C  CB  . PHE B 1 120 ? -8.228  26.402 10.357  1.00 15.09 ? 149 PHE B CB  1 
ATOM   3418 C  CG  . PHE B 1 120 ? -8.401  26.299 11.858  1.00 15.24 ? 149 PHE B CG  1 
ATOM   3419 C  CD1 . PHE B 1 120 ? -9.154  27.232 12.554  1.00 14.53 ? 149 PHE B CD1 1 
ATOM   3420 C  CD2 . PHE B 1 120 ? -7.793  25.279 12.584  1.00 14.34 ? 149 PHE B CD2 1 
ATOM   3421 C  CE1 . PHE B 1 120 ? -9.283  27.155 13.933  1.00 14.73 ? 149 PHE B CE1 1 
ATOM   3422 C  CE2 . PHE B 1 120 ? -7.910  25.213 13.965  1.00 14.31 ? 149 PHE B CE2 1 
ATOM   3423 C  CZ  . PHE B 1 120 ? -8.660  26.151 14.636  1.00 14.63 ? 149 PHE B CZ  1 
ATOM   3424 N  N   . PHE B 1 121 ? -5.103  27.124 10.346  1.00 14.28 ? 150 PHE B N   1 
ATOM   3425 C  CA  . PHE B 1 121 ? -3.830  27.299 11.047  1.00 14.43 ? 150 PHE B CA  1 
ATOM   3426 C  C   . PHE B 1 121 ? -3.327  28.737 10.821  1.00 15.84 ? 150 PHE B C   1 
ATOM   3427 O  O   . PHE B 1 121 ? -2.917  29.408 11.774  1.00 15.93 ? 150 PHE B O   1 
ATOM   3428 C  CB  . PHE B 1 121 ? -2.830  26.207 10.650  1.00 13.64 ? 150 PHE B CB  1 
ATOM   3429 C  CG  . PHE B 1 121 ? -3.266  24.778 10.892  1.00 12.62 ? 150 PHE B CG  1 
ATOM   3430 C  CD1 . PHE B 1 121 ? -4.306  24.462 11.745  1.00 13.38 ? 150 PHE B CD1 1 
ATOM   3431 C  CD2 . PHE B 1 121 ? -2.611  23.739 10.269  1.00 12.50 ? 150 PHE B CD2 1 
ATOM   3432 C  CE1 . PHE B 1 121 ? -4.705  23.150 11.941  1.00 12.97 ? 150 PHE B CE1 1 
ATOM   3433 C  CE2 . PHE B 1 121 ? -3.013  22.429 10.456  1.00 13.56 ? 150 PHE B CE2 1 
ATOM   3434 C  CZ  . PHE B 1 121 ? -4.051  22.132 11.301  1.00 13.16 ? 150 PHE B CZ  1 
ATOM   3435 N  N   . LEU B 1 122 ? -3.357  29.212 9.579   1.00 16.09 ? 151 LEU B N   1 
ATOM   3436 C  CA  . LEU B 1 122 ? -2.874  30.584 9.254   1.00 17.22 ? 151 LEU B CA  1 
ATOM   3437 C  C   . LEU B 1 122 ? -3.649  31.599 10.081  1.00 16.23 ? 151 LEU B C   1 
ATOM   3438 O  O   . LEU B 1 122 ? -3.056  32.526 10.578  1.00 14.51 ? 151 LEU B O   1 
ATOM   3439 C  CB  . LEU B 1 122 ? -3.037  30.904 7.767   1.00 16.76 ? 151 LEU B CB  1 
ATOM   3440 C  CG  . LEU B 1 122 ? -2.050  30.201 6.844   1.00 17.85 ? 151 LEU B CG  1 
ATOM   3441 C  CD1 . LEU B 1 122 ? -2.362  30.521 5.389   1.00 17.78 ? 151 LEU B CD1 1 
ATOM   3442 C  CD2 . LEU B 1 122 ? -0.614  30.574 7.210   1.00 16.79 ? 151 LEU B CD2 1 
ATOM   3443 N  N   . ARG B 1 123 ? -4.947  31.375 10.249  1.00 16.25 ? 152 ARG B N   1 
ATOM   3444 C  CA  . ARG B 1 123 ? -5.770  32.327 10.986  1.00 16.82 ? 152 ARG B CA  1 
ATOM   3445 C  C   . ARG B 1 123 ? -5.274  32.442 12.442  1.00 16.73 ? 152 ARG B C   1 
ATOM   3446 O  O   . ARG B 1 123 ? -5.071  33.548 12.963  1.00 17.23 ? 152 ARG B O   1 
ATOM   3447 C  CB  . ARG B 1 123 ? -7.240  31.910 10.937  1.00 17.04 ? 152 ARG B CB  1 
ATOM   3448 C  CG  . ARG B 1 123 ? -8.141  32.778 11.792  1.00 17.84 ? 152 ARG B CG  1 
ATOM   3449 C  CD  . ARG B 1 123 ? -9.220  32.003 12.501  1.00 17.44 ? 152 ARG B CD  1 
ATOM   3450 N  NE  . ARG B 1 123 ? -10.371 32.871 12.608  1.00 17.45 ? 152 ARG B NE  1 
ATOM   3451 C  CZ  . ARG B 1 123 ? -10.706 33.595 13.658  1.00 15.82 ? 152 ARG B CZ  1 
ATOM   3452 N  NH1 . ARG B 1 123 ? -9.997  33.554 14.776  1.00 13.36 ? 152 ARG B NH1 1 
ATOM   3453 N  NH2 . ARG B 1 123 ? -11.778 34.362 13.565  1.00 16.48 ? 152 ARG B NH2 1 
ATOM   3454 N  N   . GLU B 1 124 ? -5.116  31.316 13.119  1.00 15.43 ? 153 GLU B N   1 
ATOM   3455 C  CA  . GLU B 1 124 ? -4.705  31.332 14.510  1.00 15.57 ? 153 GLU B CA  1 
ATOM   3456 C  C   . GLU B 1 124 ? -3.293  31.915 14.657  1.00 15.92 ? 153 GLU B C   1 
ATOM   3457 O  O   . GLU B 1 124 ? -2.990  32.441 15.707  1.00 16.41 ? 153 GLU B O   1 
ATOM   3458 C  CB  . GLU B 1 124 ? -4.816  29.928 15.083  1.00 15.53 ? 153 GLU B CB  1 
ATOM   3459 C  CG  . GLU B 1 124 ? -6.252  29.404 15.056  1.00 14.51 ? 153 GLU B CG  1 
ATOM   3460 C  CD  . GLU B 1 124 ? -6.569  28.373 16.116  1.00 14.67 ? 153 GLU B CD  1 
ATOM   3461 O  OE1 . GLU B 1 124 ? -5.775  27.411 16.226  1.00 16.03 ? 153 GLU B OE1 1 
ATOM   3462 O  OE2 . GLU B 1 124 ? -7.641  28.493 16.787  1.00 14.24 ? 153 GLU B OE2 1 
ATOM   3463 N  N   . ILE B 1 125 ? -2.457  31.877 13.620  1.00 16.06 ? 154 ILE B N   1 
ATOM   3464 C  CA  . ILE B 1 125 ? -1.102  32.429 13.713  1.00 16.98 ? 154 ILE B CA  1 
ATOM   3465 C  C   . ILE B 1 125 ? -1.069  33.922 13.369  1.00 18.19 ? 154 ILE B C   1 
ATOM   3466 O  O   . ILE B 1 125 ? -0.392  34.682 14.059  1.00 18.01 ? 154 ILE B O   1 
ATOM   3467 C  CB  . ILE B 1 125 ? -0.153  31.640 12.816  1.00 16.46 ? 154 ILE B CB  1 
ATOM   3468 C  CG1 . ILE B 1 125 ? 0.024   30.209 13.335  1.00 17.15 ? 154 ILE B CG1 1 
ATOM   3469 C  CG2 . ILE B 1 125 ? 1.172   32.372 12.672  1.00 17.23 ? 154 ILE B CG2 1 
ATOM   3470 C  CD1 . ILE B 1 125 ? 0.626   29.230 12.319  1.00 16.86 ? 154 ILE B CD1 1 
ATOM   3471 N  N   . GLN B 1 126 ? -1.754  34.292 12.285  1.00 19.35 ? 155 GLN B N   1 
ATOM   3472 C  CA  . GLN B 1 126 ? -1.593  35.577 11.593  1.00 20.70 ? 155 GLN B CA  1 
ATOM   3473 C  C   . GLN B 1 126 ? -2.633  36.569 12.113  1.00 19.72 ? 155 GLN B C   1 
ATOM   3474 O  O   . GLN B 1 126 ? -2.333  37.739 12.276  1.00 18.11 ? 155 GLN B O   1 
ATOM   3475 C  CB  . GLN B 1 126 ? -1.776  35.434 10.076  1.00 21.18 ? 155 GLN B CB  1 
ATOM   3476 C  CG  . GLN B 1 126 ? -0.623  34.713 9.396   1.00 22.58 ? 155 GLN B CG  1 
ATOM   3477 C  CD  . GLN B 1 126 ? -0.830  34.494 7.913   1.00 23.00 ? 155 GLN B CD  1 
ATOM   3478 O  OE1 . GLN B 1 126 ? -1.952  34.364 7.426   1.00 21.71 ? 155 GLN B OE1 1 
ATOM   3479 N  NE2 . GLN B 1 126 ? 0.271   34.473 7.178   1.00 21.82 ? 155 GLN B NE2 1 
ATOM   3480 N  N   . TYR B 1 127 ? -3.810  36.073 12.464  1.00 19.17 ? 156 TYR B N   1 
ATOM   3481 C  CA  . TYR B 1 127 ? -4.912  36.954 12.855  1.00 20.68 ? 156 TYR B CA  1 
ATOM   3482 C  C   . TYR B 1 127 ? -5.177  36.860 14.368  1.00 19.16 ? 156 TYR B C   1 
ATOM   3483 O  O   . TYR B 1 127 ? -5.290  37.852 15.068  1.00 17.92 ? 156 TYR B O   1 
ATOM   3484 C  CB  . TYR B 1 127 ? -6.151  36.598 12.030  1.00 21.00 ? 156 TYR B CB  1 
ATOM   3485 C  CG  . TYR B 1 127 ? -7.418  37.269 12.492  1.00 24.26 ? 156 TYR B CG  1 
ATOM   3486 C  CD1 . TYR B 1 127 ? -7.761  38.538 12.040  1.00 25.12 ? 156 TYR B CD1 1 
ATOM   3487 C  CD2 . TYR B 1 127 ? -8.277  36.637 13.386  1.00 23.17 ? 156 TYR B CD2 1 
ATOM   3488 C  CE1 . TYR B 1 127 ? -8.920  39.166 12.468  1.00 24.92 ? 156 TYR B CE1 1 
ATOM   3489 C  CE2 . TYR B 1 127 ? -9.432  37.258 13.833  1.00 23.22 ? 156 TYR B CE2 1 
ATOM   3490 C  CZ  . TYR B 1 127 ? -9.761  38.511 13.352  1.00 25.11 ? 156 TYR B CZ  1 
ATOM   3491 O  OH  . TYR B 1 127 ? -10.895 39.115 13.784  1.00 27.29 ? 156 TYR B OH  1 
ATOM   3492 N  N   . GLY B 1 128 ? -5.338  35.660 14.876  1.00 18.39 ? 157 GLY B N   1 
ATOM   3493 C  CA  . GLY B 1 128 ? -5.596  35.470 16.300  1.00 17.80 ? 157 GLY B CA  1 
ATOM   3494 C  C   . GLY B 1 128 ? -6.530  34.298 16.534  1.00 17.37 ? 157 GLY B C   1 
ATOM   3495 O  O   . GLY B 1 128 ? -7.200  33.809 15.599  1.00 16.29 ? 157 GLY B O   1 
ATOM   3496 N  N   . ILE B 1 129 ? -6.511  33.824 17.774  1.00 17.60 ? 158 ILE B N   1 
ATOM   3497 C  CA  . ILE B 1 129 ? -7.332  32.732 18.196  1.00 16.88 ? 158 ILE B CA  1 
ATOM   3498 C  C   . ILE B 1 129 ? -8.694  33.281 18.635  1.00 16.82 ? 158 ILE B C   1 
ATOM   3499 O  O   . ILE B 1 129 ? -8.787  34.146 19.489  1.00 15.55 ? 158 ILE B O   1 
ATOM   3500 C  CB  . ILE B 1 129 ? -6.644  31.929 19.319  1.00 16.37 ? 158 ILE B CB  1 
ATOM   3501 C  CG1 . ILE B 1 129 ? -5.453  31.130 18.785  1.00 16.37 ? 158 ILE B CG1 1 
ATOM   3502 C  CG2 . ILE B 1 129 ? -7.671  31.049 20.015  1.00 15.59 ? 158 ILE B CG2 1 
ATOM   3503 C  CD1 . ILE B 1 129 ? -4.358  30.859 19.831  1.00 17.26 ? 158 ILE B CD1 1 
ATOM   3504 N  N   . GLU B 1 130 ? -9.748  32.700 18.070  1.00 18.24 ? 159 GLU B N   1 
ATOM   3505 C  CA  . GLU B 1 130 ? -11.108 33.133 18.318  1.00 19.73 ? 159 GLU B CA  1 
ATOM   3506 C  C   . GLU B 1 130 ? -11.134 34.649 18.068  1.00 19.57 ? 159 GLU B C   1 
ATOM   3507 O  O   . GLU B 1 130 ? -10.609 35.088 17.052  1.00 17.65 ? 159 GLU B O   1 
ATOM   3508 C  CB  . GLU B 1 130 ? -11.555 32.695 19.717  1.00 21.48 ? 159 GLU B CB  1 
ATOM   3509 C  CG  . GLU B 1 130 ? -11.521 31.190 19.909  1.00 23.30 ? 159 GLU B CG  1 
ATOM   3510 C  CD  . GLU B 1 130 ? -11.232 30.658 21.308  1.00 28.15 ? 159 GLU B CD  1 
ATOM   3511 O  OE1 . GLU B 1 130 ? -10.764 31.419 22.185  1.00 30.50 ? 159 GLU B OE1 1 
ATOM   3512 O  OE2 . GLU B 1 130 ? -11.446 29.455 21.507  1.00 28.48 ? 159 GLU B OE2 1 
ATOM   3513 N  N   . ASP B 1 131 ? -11.677 35.405 19.022  1.00 20.61 ? 160 ASP B N   1 
ATOM   3514 C  CA  . ASP B 1 131 ? -11.823 36.839 18.957  1.00 22.24 ? 160 ASP B CA  1 
ATOM   3515 C  C   . ASP B 1 131 ? -10.884 37.505 19.972  1.00 21.11 ? 160 ASP B C   1 
ATOM   3516 O  O   . ASP B 1 131 ? -11.133 38.604 20.362  1.00 20.49 ? 160 ASP B O   1 
ATOM   3517 C  CB  . ASP B 1 131 ? -13.275 37.240 19.241  1.00 26.25 ? 160 ASP B CB  1 
ATOM   3518 C  CG  . ASP B 1 131 ? -13.767 36.791 20.612  1.00 30.13 ? 160 ASP B CG  1 
ATOM   3519 O  OD1 . ASP B 1 131 ? -13.091 35.940 21.251  1.00 32.62 ? 160 ASP B OD1 1 
ATOM   3520 O  OD2 . ASP B 1 131 ? -14.825 37.288 21.033  1.00 35.00 ? 160 ASP B OD2 1 
ATOM   3521 N  N   . THR B 1 132 ? -9.797  36.843 20.365  1.00 20.52 ? 161 THR B N   1 
ATOM   3522 C  CA  . THR B 1 132 ? -8.944  37.296 21.444  1.00 19.77 ? 161 THR B CA  1 
ATOM   3523 C  C   . THR B 1 132 ? -7.770  38.140 20.921  1.00 20.51 ? 161 THR B C   1 
ATOM   3524 O  O   . THR B 1 132 ? -7.117  38.804 21.708  1.00 19.64 ? 161 THR B O   1 
ATOM   3525 C  CB  . THR B 1 132 ? -8.374  36.109 22.238  1.00 19.59 ? 161 THR B CB  1 
ATOM   3526 O  OG1 . THR B 1 132 ? -7.470  35.386 21.408  1.00 19.47 ? 161 THR B OG1 1 
ATOM   3527 C  CG2 . THR B 1 132 ? -9.415  35.128 22.722  1.00 19.24 ? 161 THR B CG2 1 
ATOM   3528 N  N   . GLY B 1 133 ? -7.443  38.075 19.633  1.00 19.64 ? 162 GLY B N   1 
ATOM   3529 C  CA  . GLY B 1 133 ? -6.213  38.688 19.130  1.00 21.15 ? 162 GLY B CA  1 
ATOM   3530 C  C   . GLY B 1 133 ? -4.944  38.002 19.612  1.00 21.03 ? 162 GLY B C   1 
ATOM   3531 O  O   . GLY B 1 133 ? -3.857  38.450 19.317  1.00 22.73 ? 162 GLY B O   1 
ATOM   3532 N  N   . ILE B 1 134 ? -5.049  36.899 20.321  1.00 20.83 ? 163 ILE B N   1 
ATOM   3533 C  CA  . ILE B 1 134 ? -3.869  36.170 20.788  1.00 21.00 ? 163 ILE B CA  1 
ATOM   3534 C  C   . ILE B 1 134 ? -3.435  35.211 19.671  1.00 21.30 ? 163 ILE B C   1 
ATOM   3535 O  O   . ILE B 1 134 ? -4.252  34.379 19.214  1.00 20.23 ? 163 ILE B O   1 
ATOM   3536 C  CB  . ILE B 1 134 ? -4.187  35.404 22.092  1.00 21.61 ? 163 ILE B CB  1 
ATOM   3537 C  CG1 . ILE B 1 134 ? -4.362  36.370 23.267  1.00 22.08 ? 163 ILE B CG1 1 
ATOM   3538 C  CG2 . ILE B 1 134 ? -3.142  34.340 22.365  1.00 20.70 ? 163 ILE B CG2 1 
ATOM   3539 C  CD1 . ILE B 1 134 ? -5.072  35.798 24.464  1.00 23.17 ? 163 ILE B CD1 1 
ATOM   3540 N  N   . ARG B 1 135 ? -2.157  35.296 19.274  1.00 19.77 ? 164 ARG B N   1 
ATOM   3541 C  CA  . ARG B 1 135 ? -1.651  34.556 18.125  1.00 18.85 ? 164 ARG B CA  1 
ATOM   3542 C  C   . ARG B 1 135 ? -0.781  33.389 18.591  1.00 17.12 ? 164 ARG B C   1 
ATOM   3543 O  O   . ARG B 1 135 ? 0.014   33.526 19.516  1.00 15.89 ? 164 ARG B O   1 
ATOM   3544 C  CB  . ARG B 1 135 ? -0.875  35.489 17.196  1.00 19.10 ? 164 ARG B CB  1 
ATOM   3545 C  CG  . ARG B 1 135 ? -1.748  36.522 16.489  1.00 19.50 ? 164 ARG B CG  1 
ATOM   3546 C  CD  . ARG B 1 135 ? -0.928  37.637 15.841  1.00 20.52 ? 164 ARG B CD  1 
ATOM   3547 N  NE  . ARG B 1 135 ? -1.820  38.721 15.477  1.00 21.37 ? 164 ARG B NE  1 
ATOM   3548 N  N   . ALA B 1 136 ? -0.951  32.253 17.916  1.00 16.05 ? 165 ALA B N   1 
ATOM   3549 C  CA  . ALA B 1 136 ? -0.192  31.043 18.206  1.00 16.60 ? 165 ALA B CA  1 
ATOM   3550 C  C   . ALA B 1 136 ? 1.257   31.228 17.777  1.00 16.48 ? 165 ALA B C   1 
ATOM   3551 O  O   . ALA B 1 136 ? 1.501   31.915 16.798  1.00 16.49 ? 165 ALA B O   1 
ATOM   3552 C  CB  . ALA B 1 136 ? -0.802  29.874 17.478  1.00 16.54 ? 165 ALA B CB  1 
ATOM   3553 N  N   . GLY B 1 137 ? 2.181   30.598 18.503  1.00 15.19 ? 166 GLY B N   1 
ATOM   3554 C  CA  . GLY B 1 137 ? 3.585   30.661 18.173  1.00 15.16 ? 166 GLY B CA  1 
ATOM   3555 C  C   . GLY B 1 137 ? 4.161   29.294 17.857  1.00 14.64 ? 166 GLY B C   1 
ATOM   3556 O  O   . GLY B 1 137 ? 5.359   29.156 17.694  1.00 14.60 ? 166 GLY B O   1 
ATOM   3557 N  N   . ILE B 1 138 ? 3.309   28.282 17.751  1.00 13.15 ? 167 ILE B N   1 
ATOM   3558 C  CA  . ILE B 1 138 ? 3.730   26.954 17.353  1.00 13.05 ? 167 ILE B CA  1 
ATOM   3559 C  C   . ILE B 1 138 ? 2.537   26.217 16.710  1.00 13.29 ? 167 ILE B C   1 
ATOM   3560 O  O   . ILE B 1 138 ? 1.353   26.564 16.960  1.00 13.99 ? 167 ILE B O   1 
ATOM   3561 C  CB  . ILE B 1 138 ? 4.315   26.202 18.560  1.00 12.71 ? 167 ILE B CB  1 
ATOM   3562 C  CG1 . ILE B 1 138 ? 5.119   24.967 18.161  1.00 13.16 ? 167 ILE B CG1 1 
ATOM   3563 C  CG2 . ILE B 1 138 ? 3.240   25.843 19.574  1.00 12.89 ? 167 ILE B CG2 1 
ATOM   3564 C  CD1 . ILE B 1 138 ? 5.967   24.406 19.290  1.00 13.79 ? 167 ILE B CD1 1 
ATOM   3565 N  N   . ILE B 1 139 ? 2.831   25.155 15.966  1.00 13.70 ? 168 ILE B N   1 
ATOM   3566 C  CA  . ILE B 1 139 ? 1.813   24.341 15.317  1.00 14.63 ? 168 ILE B CA  1 
ATOM   3567 C  C   . ILE B 1 139 ? 1.956   22.908 15.823  1.00 14.72 ? 168 ILE B C   1 
ATOM   3568 O  O   . ILE B 1 139 ? 3.008   22.301 15.668  1.00 14.33 ? 168 ILE B O   1 
ATOM   3569 C  CB  . ILE B 1 139 ? 1.934   24.380 13.786  1.00 15.32 ? 168 ILE B CB  1 
ATOM   3570 C  CG1 . ILE B 1 139 ? 1.859   25.790 13.203  1.00 15.61 ? 168 ILE B CG1 1 
ATOM   3571 C  CG2 . ILE B 1 139 ? 0.873   23.487 13.180  1.00 16.24 ? 168 ILE B CG2 1 
ATOM   3572 C  CD1 . ILE B 1 139 ? 2.626   25.925 11.901  1.00 15.65 ? 168 ILE B CD1 1 
ATOM   3573 N  N   . LYS B 1 140 ? 0.894   22.369 16.413  1.00 13.19 ? 169 LYS B N   1 
ATOM   3574 C  CA  . LYS B 1 140 ? 0.925   21.025 16.965  1.00 13.95 ? 169 LYS B CA  1 
ATOM   3575 C  C   . LYS B 1 140 ? 0.175   20.067 16.016  1.00 13.45 ? 169 LYS B C   1 
ATOM   3576 O  O   . LYS B 1 140 ? -0.959  20.304 15.614  1.00 14.69 ? 169 LYS B O   1 
ATOM   3577 C  CB  . LYS B 1 140 ? 0.289   21.071 18.362  1.00 13.98 ? 169 LYS B CB  1 
ATOM   3578 C  CG  . LYS B 1 140 ? 0.078   19.760 19.090  1.00 13.80 ? 169 LYS B CG  1 
ATOM   3579 C  CD  . LYS B 1 140 ? 1.339   19.063 19.508  1.00 14.80 ? 169 LYS B CD  1 
ATOM   3580 C  CE  . LYS B 1 140 ? 1.076   17.715 20.142  1.00 15.88 ? 169 LYS B CE  1 
ATOM   3581 N  NZ  . LYS B 1 140 ? 0.584   17.844 21.543  1.00 15.64 ? 169 LYS B NZ  1 
ATOM   3582 N  N   . VAL B 1 141 ? 0.777   18.922 15.737  1.00 13.77 ? 170 VAL B N   1 
ATOM   3583 C  CA  . VAL B 1 141 ? 0.147   17.890 14.928  1.00 13.49 ? 170 VAL B CA  1 
ATOM   3584 C  C   . VAL B 1 141 ? 0.298   16.538 15.629  1.00 13.62 ? 170 VAL B C   1 
ATOM   3585 O  O   . VAL B 1 141 ? 1.019   16.430 16.613  1.00 16.29 ? 170 VAL B O   1 
ATOM   3586 C  CB  . VAL B 1 141 ? 0.750   17.882 13.521  1.00 13.51 ? 170 VAL B CB  1 
ATOM   3587 C  CG1 . VAL B 1 141 ? 0.640   19.244 12.866  1.00 14.20 ? 170 VAL B CG1 1 
ATOM   3588 C  CG2 . VAL B 1 141 ? 2.197   17.404 13.532  1.00 13.75 ? 170 VAL B CG2 1 
ATOM   3589 N  N   . ALA B 1 142 ? -0.349  15.505 15.116  1.00 14.26 ? 171 ALA B N   1 
ATOM   3590 C  CA  . ALA B 1 142 ? -0.345  14.185 15.778  1.00 14.90 ? 171 ALA B CA  1 
ATOM   3591 C  C   . ALA B 1 142 ? -0.549  13.044 14.787  1.00 14.66 ? 171 ALA B C   1 
ATOM   3592 O  O   . ALA B 1 142 ? -1.311  13.147 13.846  1.00 15.06 ? 171 ALA B O   1 
ATOM   3593 C  CB  . ALA B 1 142 ? -1.433  14.132 16.803  1.00 14.48 ? 171 ALA B CB  1 
ATOM   3594 N  N   . THR B 1 143 ? 0.121   11.941 15.057  1.00 16.42 ? 172 THR B N   1 
ATOM   3595 C  CA  . THR B 1 143 ? -0.225  10.626 14.506  1.00 15.44 ? 172 THR B CA  1 
ATOM   3596 C  C   . THR B 1 143 ? -0.218  9.612  15.647  1.00 16.39 ? 172 THR B C   1 
ATOM   3597 O  O   . THR B 1 143 ? 0.430   9.852  16.665  1.00 16.77 ? 172 THR B O   1 
ATOM   3598 C  CB  . THR B 1 143 ? 0.765   10.162 13.434  1.00 15.86 ? 172 THR B CB  1 
ATOM   3599 O  OG1 . THR B 1 143 ? 2.073   10.005 13.993  1.00 14.66 ? 172 THR B OG1 1 
ATOM   3600 C  CG2 . THR B 1 143 ? 0.819   11.110 12.261  1.00 17.01 ? 172 THR B CG2 1 
ATOM   3601 N  N   . THR B 1 144 ? -0.888  8.479  15.474  1.00 16.46 ? 173 THR B N   1 
ATOM   3602 C  CA  . THR B 1 144 ? -0.943  7.453  16.524  1.00 18.38 ? 173 THR B CA  1 
ATOM   3603 C  C   . THR B 1 144 ? -0.828  6.098  15.838  1.00 17.78 ? 173 THR B C   1 
ATOM   3604 O  O   . THR B 1 144 ? -1.797  5.345  15.738  1.00 18.85 ? 173 THR B O   1 
ATOM   3605 C  CB  . THR B 1 144 ? -2.214  7.573  17.388  1.00 19.27 ? 173 THR B CB  1 
ATOM   3606 O  OG1 . THR B 1 144 ? -3.350  7.326  16.567  1.00 20.85 ? 173 THR B OG1 1 
ATOM   3607 C  CG2 . THR B 1 144 ? -2.366  8.943  18.001  1.00 19.39 ? 173 THR B CG2 1 
ATOM   3608 N  N   . GLY B 1 145 ? 0.368   5.863  15.340  1.00 18.24 ? 174 GLY B N   1 
ATOM   3609 C  CA  . GLY B 1 145 ? 0.628   4.823  14.380  1.00 18.67 ? 174 GLY B CA  1 
ATOM   3610 C  C   . GLY B 1 145 ? 0.659   5.407  12.976  1.00 20.64 ? 174 GLY B C   1 
ATOM   3611 O  O   . GLY B 1 145 ? 0.816   6.643  12.784  1.00 19.20 ? 174 GLY B O   1 
ATOM   3612 N  N   . LYS B 1 146 ? 0.483   4.533  11.989  1.00 20.10 ? 175 LYS B N   1 
ATOM   3613 C  CA  . LYS B 1 146 ? 0.405   4.991  10.618  1.00 23.61 ? 175 LYS B CA  1 
ATOM   3614 C  C   . LYS B 1 146 ? -0.653  6.088  10.548  1.00 20.33 ? 175 LYS B C   1 
ATOM   3615 O  O   . LYS B 1 146 ? -1.764  5.920  11.054  1.00 21.03 ? 175 LYS B O   1 
ATOM   3616 C  CB  . LYS B 1 146 ? 0.032   3.841  9.681   1.00 27.41 ? 175 LYS B CB  1 
ATOM   3617 C  CG  . LYS B 1 146 ? 0.127   4.151  8.194   1.00 29.96 ? 175 LYS B CG  1 
ATOM   3618 C  CD  . LYS B 1 146 ? 0.260   2.877  7.375   1.00 35.16 ? 175 LYS B CD  1 
ATOM   3619 C  CE  . LYS B 1 146 ? -0.760  2.755  6.267   1.00 40.06 ? 175 LYS B CE  1 
ATOM   3620 N  NZ  . LYS B 1 146 ? -0.673  3.895  5.321   1.00 44.33 ? 175 LYS B NZ  1 
ATOM   3621 N  N   . ALA B 1 147 ? -0.295  7.192  9.927   1.00 20.76 ? 176 ALA B N   1 
ATOM   3622 C  CA  . ALA B 1 147 ? -1.207  8.318  9.768   1.00 20.13 ? 176 ALA B CA  1 
ATOM   3623 C  C   . ALA B 1 147 ? -2.506  7.881  9.089   1.00 20.40 ? 176 ALA B C   1 
ATOM   3624 O  O   . ALA B 1 147 ? -2.515  7.163  8.090   1.00 19.92 ? 176 ALA B O   1 
ATOM   3625 C  CB  . ALA B 1 147 ? -0.557  9.427  8.972   1.00 21.23 ? 176 ALA B CB  1 
ATOM   3626 N  N   . THR B 1 148 ? -3.585  8.400  9.639   1.00 19.80 ? 177 THR B N   1 
ATOM   3627 C  CA  . THR B 1 148 ? -4.860  8.390  8.967   1.00 20.04 ? 177 THR B CA  1 
ATOM   3628 C  C   . THR B 1 148 ? -4.800  9.367  7.771   1.00 19.32 ? 177 THR B C   1 
ATOM   3629 O  O   . THR B 1 148 ? -3.955  10.271 7.698   1.00 17.46 ? 177 THR B O   1 
ATOM   3630 C  CB  . THR B 1 148 ? -5.974  8.706  9.981   1.00 18.99 ? 177 THR B CB  1 
ATOM   3631 O  OG1 . THR B 1 148 ? -5.876  10.091 10.328  1.00 19.54 ? 177 THR B OG1 1 
ATOM   3632 C  CG2 . THR B 1 148 ? -5.900  7.842  11.220  1.00 19.41 ? 177 THR B CG2 1 
ATOM   3633 N  N   . PRO B 1 149 ? -5.711  9.188  6.802   1.00 19.91 ? 178 PRO B N   1 
ATOM   3634 C  CA  . PRO B 1 149 ? -5.734  10.163 5.693   1.00 18.90 ? 178 PRO B CA  1 
ATOM   3635 C  C   . PRO B 1 149 ? -5.924  11.600 6.216   1.00 17.81 ? 178 PRO B C   1 
ATOM   3636 O  O   . PRO B 1 149 ? -5.279  12.523 5.735   1.00 17.36 ? 178 PRO B O   1 
ATOM   3637 C  CB  . PRO B 1 149 ? -6.866  9.684  4.751   1.00 19.22 ? 178 PRO B CB  1 
ATOM   3638 C  CG  . PRO B 1 149 ? -7.108  8.213  5.132   1.00 19.48 ? 178 PRO B CG  1 
ATOM   3639 C  CD  . PRO B 1 149 ? -6.625  8.048  6.562   1.00 19.38 ? 178 PRO B CD  1 
ATOM   3640 N  N   . PHE B 1 150 ? -6.760  11.786 7.227   1.00 17.00 ? 179 PHE B N   1 
ATOM   3641 C  CA  . PHE B 1 150 ? -6.969  13.099 7.769   1.00 15.28 ? 179 PHE B CA  1 
ATOM   3642 C  C   . PHE B 1 150 ? -5.687  13.636 8.416   1.00 15.64 ? 179 PHE B C   1 
ATOM   3643 O  O   . PHE B 1 150 ? -5.350  14.814 8.281   1.00 15.36 ? 179 PHE B O   1 
ATOM   3644 C  CB  . PHE B 1 150 ? -8.110  13.096 8.790   1.00 15.76 ? 179 PHE B CB  1 
ATOM   3645 C  CG  . PHE B 1 150 ? -8.287  14.464 9.391   1.00 15.52 ? 179 PHE B CG  1 
ATOM   3646 C  CD1 . PHE B 1 150 ? -8.680  15.528 8.593   1.00 15.58 ? 179 PHE B CD1 1 
ATOM   3647 C  CD2 . PHE B 1 150 ? -7.979  14.704 10.715  1.00 15.21 ? 179 PHE B CD2 1 
ATOM   3648 C  CE1 . PHE B 1 150 ? -8.782  16.806 9.113   1.00 15.94 ? 179 PHE B CE1 1 
ATOM   3649 C  CE2 . PHE B 1 150 ? -8.114  15.978 11.243  1.00 15.42 ? 179 PHE B CE2 1 
ATOM   3650 C  CZ  . PHE B 1 150 ? -8.504  17.029 10.441  1.00 15.49 ? 179 PHE B CZ  1 
ATOM   3651 N  N   . GLN B 1 151 ? -4.981  12.781 9.154   1.00 14.97 ? 180 GLN B N   1 
ATOM   3652 C  CA  . GLN B 1 151 ? -3.790  13.208 9.837   1.00 15.82 ? 180 GLN B CA  1 
ATOM   3653 C  C   . GLN B 1 151 ? -2.734  13.627 8.798   1.00 17.49 ? 180 GLN B C   1 
ATOM   3654 O  O   . GLN B 1 151 ? -1.980  14.601 9.005   1.00 17.98 ? 180 GLN B O   1 
ATOM   3655 C  CB  . GLN B 1 151 ? -3.310  12.105 10.778  1.00 14.48 ? 180 GLN B CB  1 
ATOM   3656 C  CG  . GLN B 1 151 ? -4.180  11.944 12.018  1.00 13.88 ? 180 GLN B CG  1 
ATOM   3657 C  CD  . GLN B 1 151 ? -3.833  10.672 12.746  1.00 14.07 ? 180 GLN B CD  1 
ATOM   3658 O  OE1 . GLN B 1 151 ? -3.040  9.883  12.278  1.00 13.10 ? 180 GLN B OE1 1 
ATOM   3659 N  NE2 . GLN B 1 151 ? -4.383  10.478 13.921  1.00 13.76 ? 180 GLN B NE2 1 
ATOM   3660 N  N   . GLU B 1 152 ? -2.648  12.917 7.681   1.00 17.36 ? 181 GLU B N   1 
ATOM   3661 C  CA  . GLU B 1 152 ? -1.733  13.344 6.611   1.00 17.09 ? 181 GLU B CA  1 
ATOM   3662 C  C   . GLU B 1 152 ? -2.103  14.749 6.138   1.00 15.85 ? 181 GLU B C   1 
ATOM   3663 O  O   . GLU B 1 152 ? -1.223  15.573 5.875   1.00 14.91 ? 181 GLU B O   1 
ATOM   3664 C  CB  . GLU B 1 152 ? -1.827  12.445 5.385   1.00 19.84 ? 181 GLU B CB  1 
ATOM   3665 C  CG  . GLU B 1 152 ? -0.897  11.257 5.414   1.00 24.33 ? 181 GLU B CG  1 
ATOM   3666 C  CD  . GLU B 1 152 ? -0.846  10.537 4.067   1.00 26.38 ? 181 GLU B CD  1 
ATOM   3667 O  OE1 . GLU B 1 152 ? -0.973  9.307  4.070   1.00 29.19 ? 181 GLU B OE1 1 
ATOM   3668 O  OE2 . GLU B 1 152 ? -0.663  11.222 3.026   1.00 27.48 ? 181 GLU B OE2 1 
ATOM   3669 N  N   . ARG B 1 153 ? -3.401  15.004 6.007   1.00 14.74 ? 182 ARG B N   1 
ATOM   3670 C  CA  . ARG B 1 153 ? -3.866  16.305 5.534   1.00 15.04 ? 182 ARG B CA  1 
ATOM   3671 C  C   . ARG B 1 153 ? -3.437  17.375 6.535   1.00 14.27 ? 182 ARG B C   1 
ATOM   3672 O  O   . ARG B 1 153 ? -3.011  18.448 6.126   1.00 12.93 ? 182 ARG B O   1 
ATOM   3673 C  CB  . ARG B 1 153 ? -5.387  16.353 5.333   1.00 15.70 ? 182 ARG B CB  1 
ATOM   3674 C  CG  . ARG B 1 153 ? -5.872  15.531 4.155   1.00 16.49 ? 182 ARG B CG  1 
ATOM   3675 C  CD  . ARG B 1 153 ? -7.170  16.022 3.544   1.00 15.19 ? 182 ARG B CD  1 
ATOM   3676 N  NE  . ARG B 1 153 ? -8.272  16.055 4.481   1.00 15.76 ? 182 ARG B NE  1 
ATOM   3677 C  CZ  . ARG B 1 153 ? -9.109  15.036 4.737   1.00 14.87 ? 182 ARG B CZ  1 
ATOM   3678 N  NH1 . ARG B 1 153 ? -8.805  13.804 4.377   1.00 14.88 ? 182 ARG B NH1 1 
ATOM   3679 N  NH2 . ARG B 1 153 ? -10.234 15.259 5.392   1.00 13.19 ? 182 ARG B NH2 1 
ATOM   3680 N  N   . VAL B 1 154 ? -3.537  17.059 7.833   1.00 14.21 ? 183 VAL B N   1 
ATOM   3681 C  CA  . VAL B 1 154 ? -3.083  17.995 8.888   1.00 13.67 ? 183 VAL B CA  1 
ATOM   3682 C  C   . VAL B 1 154 ? -1.564  18.226 8.786   1.00 13.80 ? 183 VAL B C   1 
ATOM   3683 O  O   . VAL B 1 154 ? -1.139  19.380 8.935   1.00 14.06 ? 183 VAL B O   1 
ATOM   3684 C  CB  . VAL B 1 154 ? -3.475  17.526 10.300  1.00 13.35 ? 183 VAL B CB  1 
ATOM   3685 C  CG1 . VAL B 1 154 ? -2.734  18.317 11.369  1.00 13.48 ? 183 VAL B CG1 1 
ATOM   3686 C  CG2 . VAL B 1 154 ? -4.979  17.614 10.530  1.00 13.17 ? 183 VAL B CG2 1 
ATOM   3687 N  N   . LEU B 1 155 ? -0.760  17.177 8.570   1.00 13.73 ? 184 LEU B N   1 
ATOM   3688 C  CA  . LEU B 1 155 ? 0.716   17.339 8.470   1.00 14.58 ? 184 LEU B CA  1 
ATOM   3689 C  C   . LEU B 1 155 ? 1.060   18.263 7.289   1.00 14.38 ? 184 LEU B C   1 
ATOM   3690 O  O   . LEU B 1 155 ? 1.985   19.108 7.388   1.00 14.81 ? 184 LEU B O   1 
ATOM   3691 C  CB  . LEU B 1 155 ? 1.413   15.984 8.294   1.00 15.27 ? 184 LEU B CB  1 
ATOM   3692 C  CG  . LEU B 1 155 ? 1.328   14.995 9.459   1.00 16.18 ? 184 LEU B CG  1 
ATOM   3693 C  CD1 . LEU B 1 155 ? 1.805   13.605 9.030   1.00 16.59 ? 184 LEU B CD1 1 
ATOM   3694 C  CD2 . LEU B 1 155 ? 2.099   15.501 10.672  1.00 17.33 ? 184 LEU B CD2 1 
ATOM   3695 N  N   . ARG B 1 156 ? 0.345   18.120 6.175   1.00 13.11 ? 185 ARG B N   1 
ATOM   3696 C  CA  . ARG B 1 156 ? 0.640   18.937 5.025   1.00 13.71 ? 185 ARG B CA  1 
ATOM   3697 C  C   . ARG B 1 156 ? 0.184   20.367 5.291   1.00 12.45 ? 185 ARG B C   1 
ATOM   3698 O  O   . ARG B 1 156 ? 0.914   21.295 5.018   1.00 11.78 ? 185 ARG B O   1 
ATOM   3699 C  CB  . ARG B 1 156 ? -0.035  18.426 3.750   1.00 14.17 ? 185 ARG B CB  1 
ATOM   3700 C  CG  . ARG B 1 156 ? 0.440   17.048 3.343   1.00 15.53 ? 185 ARG B CG  1 
ATOM   3701 C  CD  . ARG B 1 156 ? -0.356  16.506 2.177   1.00 16.22 ? 185 ARG B CD  1 
ATOM   3702 N  NE  . ARG B 1 156 ? 0.052   15.165 1.879   1.00 16.97 ? 185 ARG B NE  1 
ATOM   3703 C  CZ  . ARG B 1 156 ? 1.245   14.849 1.410   1.00 20.16 ? 185 ARG B CZ  1 
ATOM   3704 N  NH1 . ARG B 1 156 ? 2.113   15.804 1.098   1.00 21.93 ? 185 ARG B NH1 1 
ATOM   3705 N  NH2 . ARG B 1 156 ? 1.573   13.572 1.304   1.00 21.94 ? 185 ARG B NH2 1 
ATOM   3706 N  N   . ALA B 1 157 ? -1.000  20.545 5.862   1.00 12.51 ? 186 ALA B N   1 
ATOM   3707 C  CA  . ALA B 1 157 ? -1.448  21.906 6.209   1.00 12.48 ? 186 ALA B CA  1 
ATOM   3708 C  C   . ALA B 1 157 ? -0.496  22.552 7.228   1.00 12.73 ? 186 ALA B C   1 
ATOM   3709 O  O   . ALA B 1 157 ? -0.201  23.752 7.156   1.00 13.84 ? 186 ALA B O   1 
ATOM   3710 C  CB  . ALA B 1 157 ? -2.861  21.843 6.743   1.00 12.67 ? 186 ALA B CB  1 
ATOM   3711 N  N   . ALA B 1 158 ? 0.009   21.775 8.181   1.00 13.29 ? 187 ALA B N   1 
ATOM   3712 C  CA  . ALA B 1 158 ? 0.941   22.342 9.168   1.00 13.33 ? 187 ALA B CA  1 
ATOM   3713 C  C   . ALA B 1 158 ? 2.233   22.795 8.478   1.00 13.33 ? 187 ALA B C   1 
ATOM   3714 O  O   . ALA B 1 158 ? 2.737   23.843 8.791   1.00 12.61 ? 187 ALA B O   1 
ATOM   3715 C  CB  . ALA B 1 158 ? 1.255   21.319 10.217  1.00 13.53 ? 187 ALA B CB  1 
ATOM   3716 N  N   . ALA B 1 159 ? 2.766   21.968 7.595   1.00 13.96 ? 188 ALA B N   1 
ATOM   3717 C  CA  . ALA B 1 159 ? 3.986   22.321 6.858   1.00 15.43 ? 188 ALA B CA  1 
ATOM   3718 C  C   . ALA B 1 159 ? 3.781   23.616 6.062   1.00 16.36 ? 188 ALA B C   1 
ATOM   3719 O  O   . ALA B 1 159 ? 4.657   24.453 6.031   1.00 17.53 ? 188 ALA B O   1 
ATOM   3720 C  CB  . ALA B 1 159 ? 4.376   21.188 5.946   1.00 15.77 ? 188 ALA B CB  1 
ATOM   3721 N  N   . ARG B 1 160 ? 2.619   23.774 5.447   1.00 15.80 ? 189 ARG B N   1 
ATOM   3722 C  CA  . ARG B 1 160 ? 2.351   24.942 4.645   1.00 18.03 ? 189 ARG B CA  1 
ATOM   3723 C  C   . ARG B 1 160 ? 2.240   26.194 5.509   1.00 16.91 ? 189 ARG B C   1 
ATOM   3724 O  O   . ARG B 1 160 ? 2.809   27.230 5.170   1.00 16.85 ? 189 ARG B O   1 
ATOM   3725 C  CB  . ARG B 1 160 ? 1.062   24.743 3.863   1.00 19.01 ? 189 ARG B CB  1 
ATOM   3726 C  CG  . ARG B 1 160 ? 1.265   23.753 2.741   1.00 22.06 ? 189 ARG B CG  1 
ATOM   3727 C  CD  . ARG B 1 160 ? 0.013   23.485 1.923   1.00 24.89 ? 189 ARG B CD  1 
ATOM   3728 N  NE  . ARG B 1 160 ? 0.144   22.111 1.442   1.00 28.11 ? 189 ARG B NE  1 
ATOM   3729 C  CZ  . ARG B 1 160 ? -0.759  21.440 0.728   1.00 76.84 ? 189 ARG B CZ  1 
ATOM   3730 N  NH1 . ARG B 1 160 ? -0.502  20.185 0.354   1.00 31.57 ? 189 ARG B NH1 1 
ATOM   3731 N  NH2 . ARG B 1 160 ? -1.895  22.030 0.382   1.00 54.34 ? 189 ARG B NH2 1 
ATOM   3732 N  N   . ALA B 1 161 ? 1.509   26.095 6.612   1.00 16.39 ? 190 ALA B N   1 
ATOM   3733 C  CA  . ALA B 1 161 ? 1.399   27.219 7.542   1.00 16.46 ? 190 ALA B CA  1 
ATOM   3734 C  C   . ALA B 1 161 ? 2.784   27.610 8.081   1.00 16.64 ? 190 ALA B C   1 
ATOM   3735 O  O   . ALA B 1 161 ? 3.076   28.817 8.179   1.00 15.62 ? 190 ALA B O   1 
ATOM   3736 C  CB  . ALA B 1 161 ? 0.443   26.882 8.663   1.00 16.31 ? 190 ALA B CB  1 
ATOM   3737 N  N   . SER B 1 162 ? 3.614   26.608 8.429   1.00 16.27 ? 191 SER B N   1 
ATOM   3738 C  CA  . SER B 1 162 ? 4.963   26.873 8.948   1.00 16.99 ? 191 SER B CA  1 
ATOM   3739 C  C   . SER B 1 162 ? 5.852   27.520 7.878   1.00 16.01 ? 191 SER B C   1 
ATOM   3740 O  O   . SER B 1 162 ? 6.511   28.501 8.176   1.00 15.99 ? 191 SER B O   1 
ATOM   3741 C  CB  . SER B 1 162 ? 5.617   25.654 9.497   1.00 17.60 ? 191 SER B CB  1 
ATOM   3742 O  OG  . SER B 1 162 ? 6.985   25.931 9.806   1.00 20.05 ? 191 SER B OG  1 
ATOM   3743 N  N   . LEU B 1 163 ? 5.848   27.025 6.642   1.00 16.87 ? 192 LEU B N   1 
ATOM   3744 C  CA  . LEU B 1 163 ? 6.584   27.713 5.505   1.00 17.10 ? 192 LEU B CA  1 
ATOM   3745 C  C   . LEU B 1 163 ? 6.056   29.145 5.266   1.00 19.17 ? 192 LEU B C   1 
ATOM   3746 O  O   . LEU B 1 163 ? 6.832   30.050 4.895   1.00 19.04 ? 192 LEU B O   1 
ATOM   3747 C  CB  . LEU B 1 163 ? 6.459   26.890 4.222   1.00 15.77 ? 192 LEU B CB  1 
ATOM   3748 C  CG  . LEU B 1 163 ? 7.220   25.571 4.210   1.00 15.62 ? 192 LEU B CG  1 
ATOM   3749 C  CD1 . LEU B 1 163 ? 6.577   24.646 3.209   1.00 17.50 ? 192 LEU B CD1 1 
ATOM   3750 C  CD2 . LEU B 1 163 ? 8.709   25.763 3.892   1.00 15.10 ? 192 LEU B CD2 1 
ATOM   3751 N  N   . ALA B 1 164 ? 4.760   29.382 5.439   1.00 18.55 ? 193 ALA B N   1 
ATOM   3752 C  CA  . ALA B 1 164 ? 4.213   30.715 5.232   1.00 18.96 ? 193 ALA B CA  1 
ATOM   3753 C  C   . ALA B 1 164 ? 4.569   31.676 6.374   1.00 19.33 ? 193 ALA B C   1 
ATOM   3754 O  O   . ALA B 1 164 ? 4.594   32.870 6.161   1.00 18.70 ? 193 ALA B O   1 
ATOM   3755 C  CB  . ALA B 1 164 ? 2.716   30.642 5.059   1.00 19.40 ? 193 ALA B CB  1 
ATOM   3756 N  N   . THR B 1 165 ? 4.727   31.202 7.600   1.00 19.54 ? 194 THR B N   1 
ATOM   3757 C  CA  . THR B 1 165 ? 4.833   32.106 8.765   1.00 18.43 ? 194 THR B CA  1 
ATOM   3758 C  C   . THR B 1 165 ? 6.193   31.996 9.467   1.00 18.60 ? 194 THR B C   1 
ATOM   3759 O  O   . THR B 1 165 ? 6.556   32.843 10.268  1.00 16.87 ? 194 THR B O   1 
ATOM   3760 C  CB  . THR B 1 165 ? 3.749   31.779 9.801   1.00 20.22 ? 194 THR B CB  1 
ATOM   3761 O  OG1 . THR B 1 165 ? 3.896   30.435 10.296  1.00 18.55 ? 194 THR B OG1 1 
ATOM   3762 C  CG2 . THR B 1 165 ? 2.369   31.992 9.233   1.00 19.77 ? 194 THR B CG2 1 
ATOM   3763 N  N   . GLY B 1 166 ? 6.897   30.897 9.247   1.00 17.11 ? 195 GLY B N   1 
ATOM   3764 C  CA  . GLY B 1 166 ? 8.149   30.659 9.922   1.00 16.71 ? 195 GLY B CA  1 
ATOM   3765 C  C   . GLY B 1 166 ? 7.987   30.059 11.307  1.00 16.87 ? 195 GLY B C   1 
ATOM   3766 O  O   . GLY B 1 166 ? 8.981   29.681 11.918  1.00 16.89 ? 195 GLY B O   1 
ATOM   3767 N  N   . VAL B 1 167 ? 6.745   29.936 11.781  1.00 16.52 ? 196 VAL B N   1 
ATOM   3768 C  CA  . VAL B 1 167 ? 6.429   29.335 13.047  1.00 16.90 ? 196 VAL B CA  1 
ATOM   3769 C  C   . VAL B 1 167 ? 6.686   27.817 12.959  1.00 15.41 ? 196 VAL B C   1 
ATOM   3770 O  O   . VAL B 1 167 ? 6.380   27.163 11.964  1.00 14.71 ? 196 VAL B O   1 
ATOM   3771 C  CB  . VAL B 1 167 ? 4.966   29.694 13.393  1.00 18.95 ? 196 VAL B CB  1 
ATOM   3772 C  CG1 . VAL B 1 167 ? 4.333   28.731 14.357  1.00 20.30 ? 196 VAL B CG1 1 
ATOM   3773 C  CG2 . VAL B 1 167 ? 4.839   31.125 13.902  1.00 19.29 ? 196 VAL B CG2 1 
ATOM   3774 N  N   . PRO B 1 168 ? 7.280   27.238 14.006  1.00 15.15 ? 197 PRO B N   1 
ATOM   3775 C  CA  . PRO B 1 168 ? 7.668   25.826 13.968  1.00 15.40 ? 197 PRO B CA  1 
ATOM   3776 C  C   . PRO B 1 168 ? 6.526   24.832 14.227  1.00 14.07 ? 197 PRO B C   1 
ATOM   3777 O  O   . PRO B 1 168 ? 5.459   25.199 14.697  1.00 14.44 ? 197 PRO B O   1 
ATOM   3778 C  CB  . PRO B 1 168 ? 8.727   25.716 15.081  1.00 15.21 ? 197 PRO B CB  1 
ATOM   3779 C  CG  . PRO B 1 168 ? 8.240   26.724 16.083  1.00 15.36 ? 197 PRO B CG  1 
ATOM   3780 C  CD  . PRO B 1 168 ? 7.795   27.883 15.227  1.00 14.55 ? 197 PRO B CD  1 
ATOM   3781 N  N   . VAL B 1 169 ? 6.812   23.575 13.923  1.00 14.08 ? 198 VAL B N   1 
ATOM   3782 C  CA  . VAL B 1 169 ? 5.901   22.445 14.092  1.00 13.78 ? 198 VAL B CA  1 
ATOM   3783 C  C   . VAL B 1 169 ? 6.461   21.498 15.166  1.00 14.19 ? 198 VAL B C   1 
ATOM   3784 O  O   . VAL B 1 169 ? 7.636   21.155 15.106  1.00 13.62 ? 198 VAL B O   1 
ATOM   3785 C  CB  . VAL B 1 169 ? 5.706   21.716 12.753  1.00 13.63 ? 198 VAL B CB  1 
ATOM   3786 C  CG1 . VAL B 1 169 ? 4.777   20.511 12.863  1.00 13.53 ? 198 VAL B CG1 1 
ATOM   3787 C  CG2 . VAL B 1 169 ? 5.217   22.685 11.673  1.00 13.90 ? 198 VAL B CG2 1 
ATOM   3788 N  N   . THR B 1 170 ? 5.599   21.072 16.105  1.00 13.87 ? 199 THR B N   1 
ATOM   3789 C  CA  . THR B 1 170 ? 5.890   20.060 17.136  1.00 13.54 ? 199 THR B CA  1 
ATOM   3790 C  C   . THR B 1 170 ? 4.821   18.956 17.031  1.00 13.96 ? 199 THR B C   1 
ATOM   3791 O  O   . THR B 1 170 ? 3.635   19.238 16.767  1.00 11.99 ? 199 THR B O   1 
ATOM   3792 C  CB  . THR B 1 170 ? 6.027   20.731 18.517  1.00 13.20 ? 199 THR B CB  1 
ATOM   3793 O  OG1 . THR B 1 170 ? 6.598   19.813 19.449  1.00 13.23 ? 199 THR B OG1 1 
ATOM   3794 C  CG2 . THR B 1 170 ? 4.710   21.212 19.093  1.00 14.17 ? 199 THR B CG2 1 
ATOM   3795 N  N   . THR B 1 171 ? 5.226   17.703 17.255  1.00 14.34 ? 200 THR B N   1 
ATOM   3796 C  CA  . THR B 1 171 ? 4.350   16.553 16.933  1.00 14.31 ? 200 THR B CA  1 
ATOM   3797 C  C   . THR B 1 171 ? 4.159   15.624 18.129  1.00 14.26 ? 200 THR B C   1 
ATOM   3798 O  O   . THR B 1 171 ? 5.054   15.455 18.959  1.00 14.60 ? 200 THR B O   1 
ATOM   3799 C  CB  . THR B 1 171 ? 4.892   15.704 15.777  1.00 14.48 ? 200 THR B CB  1 
ATOM   3800 O  OG1 . THR B 1 171 ? 5.856   14.773 16.266  1.00 14.50 ? 200 THR B OG1 1 
ATOM   3801 C  CG2 . THR B 1 171 ? 5.495   16.528 14.666  1.00 14.25 ? 200 THR B CG2 1 
ATOM   3802 N  N   . HIS B 1 172 ? 2.981   15.012 18.157  1.00 14.31 ? 201 HIS B N   1 
ATOM   3803 C  CA  . HIS B 1 172 ? 2.698   13.846 18.947  1.00 14.92 ? 201 HIS B CA  1 
ATOM   3804 C  C   . HIS B 1 172 ? 3.040   12.608 18.114  1.00 15.61 ? 201 HIS B C   1 
ATOM   3805 O  O   . HIS B 1 172 ? 2.631   12.514 16.936  1.00 15.69 ? 201 HIS B O   1 
ATOM   3806 C  CB  . HIS B 1 172 ? 1.222   13.817 19.372  1.00 14.99 ? 201 HIS B CB  1 
ATOM   3807 C  CG  . HIS B 1 172 ? 0.810   12.569 20.085  1.00 14.83 ? 201 HIS B CG  1 
ATOM   3808 N  ND1 . HIS B 1 172 ? 0.528   12.542 21.434  1.00 14.82 ? 201 HIS B ND1 1 
ATOM   3809 C  CD2 . HIS B 1 172 ? 0.572   11.321 19.625  1.00 15.12 ? 201 HIS B CD2 1 
ATOM   3810 C  CE1 . HIS B 1 172 ? 0.170   11.323 21.780  1.00 15.70 ? 201 HIS B CE1 1 
ATOM   3811 N  NE2 . HIS B 1 172 ? 0.182   10.554 20.685  1.00 16.01 ? 201 HIS B NE2 1 
ATOM   3812 N  N   . THR B 1 173 ? 3.769   11.683 18.718  1.00 14.84 ? 202 THR B N   1 
ATOM   3813 C  CA  . THR B 1 173 ? 4.014   10.383 18.108  1.00 16.06 ? 202 THR B CA  1 
ATOM   3814 C  C   . THR B 1 173 ? 3.584   9.255  19.039  1.00 16.54 ? 202 THR B C   1 
ATOM   3815 O  O   . THR B 1 173 ? 3.605   9.364  20.246  1.00 15.81 ? 202 THR B O   1 
ATOM   3816 C  CB  . THR B 1 173 ? 5.503   10.149 17.808  1.00 16.76 ? 202 THR B CB  1 
ATOM   3817 O  OG1 . THR B 1 173 ? 6.254   10.180 19.032  1.00 14.75 ? 202 THR B OG1 1 
ATOM   3818 C  CG2 . THR B 1 173 ? 5.998   11.161 16.804  1.00 16.84 ? 202 THR B CG2 1 
ATOM   3819 N  N   . ASP B 1 174 ? 3.244   8.155  18.421  1.00 17.98 ? 203 ASP B N   1 
ATOM   3820 C  CA  . ASP B 1 174 ? 3.430   6.876  19.031  1.00 18.36 ? 203 ASP B CA  1 
ATOM   3821 C  C   . ASP B 1 174 ? 4.853   6.411  18.691  1.00 19.28 ? 203 ASP B C   1 
ATOM   3822 O  O   . ASP B 1 174 ? 5.099   5.866  17.607  1.00 19.13 ? 203 ASP B O   1 
ATOM   3823 C  CB  . ASP B 1 174 ? 2.385   5.899  18.515  1.00 19.18 ? 203 ASP B CB  1 
ATOM   3824 C  CG  . ASP B 1 174 ? 2.459   4.550  19.188  1.00 18.52 ? 203 ASP B CG  1 
ATOM   3825 O  OD1 . ASP B 1 174 ? 3.521   4.219  19.735  1.00 19.25 ? 203 ASP B OD1 1 
ATOM   3826 O  OD2 . ASP B 1 174 ? 1.458   3.875  19.161  1.00 17.10 ? 203 ASP B OD2 1 
ATOM   3827 N  N   . ALA B 1 175 ? 5.778   6.635  19.616  1.00 19.54 ? 204 ALA B N   1 
ATOM   3828 C  CA  . ALA B 1 175 ? 7.188   6.386  19.375  1.00 18.87 ? 204 ALA B CA  1 
ATOM   3829 C  C   . ALA B 1 175 ? 7.448   4.887  19.181  1.00 20.32 ? 204 ALA B C   1 
ATOM   3830 O  O   . ALA B 1 175 ? 8.315   4.527  18.391  1.00 21.07 ? 204 ALA B O   1 
ATOM   3831 C  CB  . ALA B 1 175 ? 8.009   6.932  20.508  1.00 19.89 ? 204 ALA B CB  1 
ATOM   3832 N  N   . SER B 1 176 ? 6.710   4.026  19.883  1.00 22.33 ? 205 SER B N   1 
ATOM   3833 C  CA  . SER B 1 176 ? 6.823   2.549  19.739  1.00 22.93 ? 205 SER B CA  1 
ATOM   3834 C  C   . SER B 1 176 ? 6.574   2.123  18.280  1.00 22.60 ? 205 SER B C   1 
ATOM   3835 O  O   . SER B 1 176 ? 7.094   1.099  17.839  1.00 22.67 ? 205 SER B O   1 
ATOM   3836 C  CB  . SER B 1 176 ? 5.879   1.828  20.681  1.00 22.25 ? 205 SER B CB  1 
ATOM   3837 O  OG  . SER B 1 176 ? 4.548   1.833  20.162  1.00 23.17 ? 205 SER B OG  1 
ATOM   3838 N  N   . GLN B 1 177 ? 5.793   2.893  17.528  1.00 21.40 ? 206 GLN B N   1 
ATOM   3839 C  CA  . GLN B 1 177 ? 5.581   2.617  16.101  1.00 22.07 ? 206 GLN B CA  1 
ATOM   3840 C  C   . GLN B 1 177 ? 6.458   3.503  15.209  1.00 20.36 ? 206 GLN B C   1 
ATOM   3841 O  O   . GLN B 1 177 ? 6.231   3.577  14.052  1.00 23.22 ? 206 GLN B O   1 
ATOM   3842 C  CB  . GLN B 1 177 ? 4.108   2.807  15.776  1.00 22.51 ? 206 GLN B CB  1 
ATOM   3843 C  CG  . GLN B 1 177 ? 3.233   1.884  16.613  1.00 23.39 ? 206 GLN B CG  1 
ATOM   3844 C  CD  . GLN B 1 177 ? 1.845   1.792  16.042  1.00 23.12 ? 206 GLN B CD  1 
ATOM   3845 O  OE1 . GLN B 1 177 ? 1.642   1.221  14.980  1.00 22.32 ? 206 GLN B OE1 1 
ATOM   3846 N  NE2 . GLN B 1 177 ? 0.875   2.356  16.746  1.00 25.57 ? 206 GLN B NE2 1 
ATOM   3847 N  N   . ARG B 1 178 ? 7.467   4.157  15.745  1.00 21.57 ? 207 ARG B N   1 
ATOM   3848 C  CA  . ARG B 1 178 ? 8.412   4.944  14.974  1.00 21.92 ? 207 ARG B CA  1 
ATOM   3849 C  C   . ARG B 1 178 ? 7.677   5.964  14.076  1.00 19.40 ? 207 ARG B C   1 
ATOM   3850 O  O   . ARG B 1 178 ? 8.081   6.199  12.954  1.00 17.63 ? 207 ARG B O   1 
ATOM   3851 C  CB  . ARG B 1 178 ? 9.352   3.997  14.213  1.00 26.17 ? 207 ARG B CB  1 
ATOM   3852 C  CG  . ARG B 1 178 ? 10.106  3.013  15.102  1.00 30.32 ? 207 ARG B CG  1 
ATOM   3853 C  CD  . ARG B 1 178 ? 11.419  2.514  14.514  1.00 36.89 ? 207 ARG B CD  1 
ATOM   3854 N  NE  . ARG B 1 178 ? 11.251  1.878  13.216  1.00 42.81 ? 207 ARG B NE  1 
ATOM   3855 C  CZ  . ARG B 1 178 ? 10.633  0.710  13.020  1.00 47.89 ? 207 ARG B CZ  1 
ATOM   3856 N  NH1 . ARG B 1 178 ? 10.076  0.062  14.029  1.00 49.41 ? 207 ARG B NH1 1 
ATOM   3857 N  NH2 . ARG B 1 178 ? 10.568  0.193  11.808  1.00 50.00 ? 207 ARG B NH2 1 
ATOM   3858 N  N   . ASP B 1 179 ? 6.643   6.628  14.595  1.00 17.64 ? 208 ASP B N   1 
ATOM   3859 C  CA  . ASP B 1 179 ? 5.805   7.508  13.790  1.00 17.55 ? 208 ASP B CA  1 
ATOM   3860 C  C   . ASP B 1 179 ? 6.629   8.664  13.211  1.00 16.85 ? 208 ASP B C   1 
ATOM   3861 O  O   . ASP B 1 179 ? 6.295   9.181  12.199  1.00 15.68 ? 208 ASP B O   1 
ATOM   3862 C  CB  . ASP B 1 179 ? 4.679   8.147  14.609  1.00 17.94 ? 208 ASP B CB  1 
ATOM   3863 C  CG  . ASP B 1 179 ? 3.499   7.253  14.914  1.00 19.23 ? 208 ASP B CG  1 
ATOM   3864 O  OD1 . ASP B 1 179 ? 3.552   6.068  14.569  1.00 20.87 ? 208 ASP B OD1 1 
ATOM   3865 O  OD2 . ASP B 1 179 ? 2.521   7.759  15.512  1.00 19.44 ? 208 ASP B OD2 1 
ATOM   3866 N  N   . GLY B 1 180 ? 7.693   9.065  13.873  1.00 16.59 ? 209 GLY B N   1 
ATOM   3867 C  CA  . GLY B 1 180 ? 8.536   10.154 13.406  1.00 17.70 ? 209 GLY B CA  1 
ATOM   3868 C  C   . GLY B 1 180 ? 9.019   9.977  11.974  1.00 18.21 ? 209 GLY B C   1 
ATOM   3869 O  O   . GLY B 1 180 ? 9.231   10.953 11.290  1.00 16.95 ? 209 GLY B O   1 
ATOM   3870 N  N   . GLU B 1 181 ? 9.201   8.740  11.523  1.00 20.50 ? 210 GLU B N   1 
ATOM   3871 C  CA  . GLU B 1 181 ? 9.751   8.466  10.173  1.00 22.11 ? 210 GLU B CA  1 
ATOM   3872 C  C   . GLU B 1 181 ? 8.743   8.897  9.096   1.00 22.64 ? 210 GLU B C   1 
ATOM   3873 O  O   . GLU B 1 181 ? 9.108   9.617  8.145   1.00 20.40 ? 210 GLU B O   1 
ATOM   3874 C  CB  . GLU B 1 181 ? 10.173  6.999  10.075  1.00 23.96 ? 210 GLU B CB  1 
ATOM   3875 C  CG  . GLU B 1 181 ? 11.342  6.692  10.990  1.00 26.29 ? 210 GLU B CG  1 
ATOM   3876 C  CD  . GLU B 1 181 ? 11.870  5.264  11.015  1.00 26.86 ? 210 GLU B CD  1 
ATOM   3877 O  OE1 . GLU B 1 181 ? 11.247  4.394  10.410  1.00 28.86 ? 210 GLU B OE1 1 
ATOM   3878 O  OE2 . GLU B 1 181 ? 12.893  5.040  11.664  1.00 27.67 ? 210 GLU B OE2 1 
ATOM   3879 N  N   . GLN B 1 182 ? 7.477   8.524  9.271   1.00 21.82 ? 211 GLN B N   1 
ATOM   3880 C  CA  . GLN B 1 182 ? 6.458   8.903  8.297   1.00 21.77 ? 211 GLN B CA  1 
ATOM   3881 C  C   . GLN B 1 182 ? 6.180   10.413 8.392   1.00 20.89 ? 211 GLN B C   1 
ATOM   3882 O  O   . GLN B 1 182 ? 5.965   11.072 7.372   1.00 19.79 ? 211 GLN B O   1 
ATOM   3883 C  CB  . GLN B 1 182 ? 5.182   8.098  8.498   1.00 23.65 ? 211 GLN B CB  1 
ATOM   3884 C  CG  . GLN B 1 182 ? 4.013   8.640  7.679   1.00 28.08 ? 211 GLN B CG  1 
ATOM   3885 C  CD  . GLN B 1 182 ? 2.760   7.831  7.901   1.00 30.07 ? 211 GLN B CD  1 
ATOM   3886 O  OE1 . GLN B 1 182 ? 2.470   7.370  9.023   1.00 28.20 ? 211 GLN B OE1 1 
ATOM   3887 N  NE2 . GLN B 1 182 ? 2.025   7.640  6.811   1.00 32.88 ? 211 GLN B NE2 1 
ATOM   3888 N  N   . GLN B 1 183 ? 6.187   10.977 9.592   1.00 19.27 ? 212 GLN B N   1 
ATOM   3889 C  CA  . GLN B 1 183 ? 5.998   12.410 9.728   1.00 18.74 ? 212 GLN B CA  1 
ATOM   3890 C  C   . GLN B 1 183 ? 7.100   13.134 8.945   1.00 19.13 ? 212 GLN B C   1 
ATOM   3891 O  O   . GLN B 1 183 ? 6.821   14.084 8.175   1.00 19.68 ? 212 GLN B O   1 
ATOM   3892 C  CB  . GLN B 1 183 ? 6.011   12.813 11.202  1.00 18.68 ? 212 GLN B CB  1 
ATOM   3893 C  CG  . GLN B 1 183 ? 4.905   12.158 12.005  1.00 19.19 ? 212 GLN B CG  1 
ATOM   3894 C  CD  . GLN B 1 183 ? 4.941   12.559 13.457  1.00 18.75 ? 212 GLN B CD  1 
ATOM   3895 O  OE1 . GLN B 1 183 ? 5.887   13.186 13.922  1.00 19.03 ? 212 GLN B OE1 1 
ATOM   3896 N  NE2 . GLN B 1 183 ? 3.866   12.250 14.163  1.00 17.38 ? 212 GLN B NE2 1 
ATOM   3897 N  N   . ALA B 1 184 ? 8.335   12.714 9.162   1.00 17.47 ? 213 ALA B N   1 
ATOM   3898 C  CA  . ALA B 1 184 ? 9.503   13.293 8.460   1.00 18.14 ? 213 ALA B CA  1 
ATOM   3899 C  C   . ALA B 1 184 ? 9.351   13.180 6.933   1.00 16.73 ? 213 ALA B C   1 
ATOM   3900 O  O   . ALA B 1 184 ? 9.646   14.115 6.214   1.00 16.03 ? 213 ALA B O   1 
ATOM   3901 C  CB  . ALA B 1 184 ? 10.778  12.625 8.924   1.00 19.67 ? 213 ALA B CB  1 
ATOM   3902 N  N   . ASP B 1 185 ? 8.915   12.035 6.435   1.00 17.53 ? 214 ASP B N   1 
ATOM   3903 C  CA  . ASP B 1 185 ? 8.848   11.857 4.992   1.00 17.79 ? 214 ASP B CA  1 
ATOM   3904 C  C   . ASP B 1 185 ? 7.832   12.832 4.415   1.00 17.64 ? 214 ASP B C   1 
ATOM   3905 O  O   . ASP B 1 185 ? 8.106   13.468 3.410   1.00 17.63 ? 214 ASP B O   1 
ATOM   3906 C  CB  . ASP B 1 185 ? 8.448   10.446 4.589   1.00 18.98 ? 214 ASP B CB  1 
ATOM   3907 C  CG  . ASP B 1 185 ? 9.448   9.383  4.996   1.00 18.96 ? 214 ASP B CG  1 
ATOM   3908 O  OD1 . ASP B 1 185 ? 10.561  9.736  5.410   1.00 19.55 ? 214 ASP B OD1 1 
ATOM   3909 O  OD2 . ASP B 1 185 ? 9.080   8.217  4.908   1.00 20.36 ? 214 ASP B OD2 1 
ATOM   3910 N  N   . ILE B 1 186 ? 6.707   13.005 5.095   1.00 17.54 ? 215 ILE B N   1 
ATOM   3911 C  CA  . ILE B 1 186 ? 5.699   13.919 4.596   1.00 17.50 ? 215 ILE B CA  1 
ATOM   3912 C  C   . ILE B 1 186 ? 6.189   15.364 4.716   1.00 16.44 ? 215 ILE B C   1 
ATOM   3913 O  O   . ILE B 1 186 ? 6.029   16.156 3.780   1.00 14.41 ? 215 ILE B O   1 
ATOM   3914 C  CB  . ILE B 1 186 ? 4.363   13.667 5.310   1.00 19.66 ? 215 ILE B CB  1 
ATOM   3915 C  CG1 . ILE B 1 186 ? 3.727   12.383 4.768   1.00 21.49 ? 215 ILE B CG1 1 
ATOM   3916 C  CG2 . ILE B 1 186 ? 3.435   14.846 5.168   1.00 18.78 ? 215 ILE B CG2 1 
ATOM   3917 C  CD1 . ILE B 1 186 ? 2.766   11.743 5.716   1.00 21.45 ? 215 ILE B CD1 1 
ATOM   3918 N  N   . PHE B 1 187 ? 6.773   15.744 5.855   1.00 14.50 ? 216 PHE B N   1 
ATOM   3919 C  CA  . PHE B 1 187 ? 7.308   17.122 5.936   1.00 15.39 ? 216 PHE B CA  1 
ATOM   3920 C  C   . PHE B 1 187 ? 8.352   17.360 4.827   1.00 14.74 ? 216 PHE B C   1 
ATOM   3921 O  O   . PHE B 1 187 ? 8.376   18.440 4.223   1.00 14.13 ? 216 PHE B O   1 
ATOM   3922 C  CB  . PHE B 1 187 ? 7.938   17.419 7.303   1.00 15.60 ? 216 PHE B CB  1 
ATOM   3923 C  CG  . PHE B 1 187 ? 6.969   17.438 8.457   1.00 16.28 ? 216 PHE B CG  1 
ATOM   3924 C  CD1 . PHE B 1 187 ? 5.752   18.099 8.352   1.00 16.52 ? 216 PHE B CD1 1 
ATOM   3925 C  CD2 . PHE B 1 187 ? 7.287   16.816 9.651   1.00 16.11 ? 216 PHE B CD2 1 
ATOM   3926 C  CE1 . PHE B 1 187 ? 4.883   18.149 9.429   1.00 17.15 ? 216 PHE B CE1 1 
ATOM   3927 C  CE2 . PHE B 1 187 ? 6.402   16.843 10.718  1.00 16.91 ? 216 PHE B CE2 1 
ATOM   3928 C  CZ  . PHE B 1 187 ? 5.212   17.520 10.611  1.00 16.24 ? 216 PHE B CZ  1 
ATOM   3929 N  N   . GLU B 1 188 ? 9.189   16.371 4.525   1.00 15.37 ? 217 GLU B N   1 
ATOM   3930 C  CA  . GLU B 1 188 ? 10.261  16.615 3.534   1.00 16.89 ? 217 GLU B CA  1 
ATOM   3931 C  C   . GLU B 1 188 ? 9.654   16.689 2.122   1.00 16.91 ? 217 GLU B C   1 
ATOM   3932 O  O   . GLU B 1 188 ? 10.091  17.506 1.338   1.00 17.15 ? 217 GLU B O   1 
ATOM   3933 C  CB  . GLU B 1 188 ? 11.397  15.607 3.694   1.00 18.14 ? 217 GLU B CB  1 
ATOM   3934 C  CG  . GLU B 1 188 ? 12.239  15.862 4.952   1.00 19.44 ? 217 GLU B CG  1 
ATOM   3935 C  CD  . GLU B 1 188 ? 13.028  14.633 5.396   1.00 21.70 ? 217 GLU B CD  1 
ATOM   3936 O  OE1 . GLU B 1 188 ? 13.350  13.816 4.525   1.00 25.32 ? 217 GLU B OE1 1 
ATOM   3937 O  OE2 . GLU B 1 188 ? 13.293  14.464 6.607   1.00 22.56 ? 217 GLU B OE2 1 
ATOM   3938 N  N   A SER B 1 189 ? 8.639   15.887 1.802   0.50 18.76 ? 218 SER B N   1 
ATOM   3939 N  N   B SER B 1 189 ? 8.644   15.868 1.833   0.50 17.59 ? 218 SER B N   1 
ATOM   3940 C  CA  A SER B 1 189 ? 7.999   15.983 0.472   0.50 18.38 ? 218 SER B CA  1 
ATOM   3941 C  CA  B SER B 1 189 ? 7.913   15.912 0.549   0.50 16.61 ? 218 SER B CA  1 
ATOM   3942 C  C   A SER B 1 189 ? 7.306   17.348 0.322   0.50 17.66 ? 218 SER B C   1 
ATOM   3943 C  C   B SER B 1 189 ? 7.297   17.307 0.340   0.50 16.72 ? 218 SER B C   1 
ATOM   3944 O  O   A SER B 1 189 ? 7.349   17.983 -0.751  0.50 16.49 ? 218 SER B O   1 
ATOM   3945 O  O   B SER B 1 189 ? 7.388   17.919 -0.744  0.50 15.90 ? 218 SER B O   1 
ATOM   3946 C  CB  A SER B 1 189 ? 7.043   14.849 0.236   0.50 19.68 ? 218 SER B CB  1 
ATOM   3947 C  CB  B SER B 1 189 ? 6.870   14.824 0.522   0.50 16.58 ? 218 SER B CB  1 
ATOM   3948 O  OG  A SER B 1 189 ? 5.781   15.130 0.813   0.50 21.69 ? 218 SER B OG  1 
ATOM   3949 O  OG  B SER B 1 189 ? 6.387   14.596 -0.793  0.50 15.74 ? 218 SER B OG  1 
ATOM   3950 N  N   . GLU B 1 190 ? 6.698   17.819 1.402   1.00 16.26 ? 219 GLU B N   1 
ATOM   3951 C  CA  . GLU B 1 190 ? 6.114   19.148 1.412   1.00 16.54 ? 219 GLU B CA  1 
ATOM   3952 C  C   . GLU B 1 190 ? 7.179   20.244 1.244   1.00 17.10 ? 219 GLU B C   1 
ATOM   3953 O  O   . GLU B 1 190 ? 6.893   21.274 0.590   1.00 17.26 ? 219 GLU B O   1 
ATOM   3954 C  CB  . GLU B 1 190 ? 5.292   19.356 2.694   1.00 17.46 ? 219 GLU B CB  1 
ATOM   3955 C  CG  . GLU B 1 190 ? 3.922   18.680 2.647   1.00 15.93 ? 219 GLU B CG  1 
ATOM   3956 C  CD  . GLU B 1 190 ? 2.998   19.249 1.573   1.00 16.82 ? 219 GLU B CD  1 
ATOM   3957 O  OE1 . GLU B 1 190 ? 3.051   20.461 1.345   1.00 16.01 ? 219 GLU B OE1 1 
ATOM   3958 O  OE2 . GLU B 1 190 ? 2.227   18.481 0.991   1.00 16.52 ? 219 GLU B OE2 1 
ATOM   3959 N  N   . GLY B 1 191 ? 8.372   20.058 1.806   1.00 16.34 ? 220 GLY B N   1 
ATOM   3960 C  CA  . GLY B 1 191 ? 9.444   21.047 1.686   1.00 17.63 ? 220 GLY B CA  1 
ATOM   3961 C  C   . GLY B 1 191 ? 9.776   21.743 3.001   1.00 18.52 ? 220 GLY B C   1 
ATOM   3962 O  O   . GLY B 1 191 ? 10.369  22.802 2.991   1.00 17.81 ? 220 GLY B O   1 
ATOM   3963 N  N   . LEU B 1 192 ? 9.367   21.205 4.129   1.00 19.03 ? 221 LEU B N   1 
ATOM   3964 C  CA  . LEU B 1 192 ? 9.666   21.856 5.413   1.00 20.06 ? 221 LEU B CA  1 
ATOM   3965 C  C   . LEU B 1 192 ? 11.052  21.407 5.888   1.00 19.16 ? 221 LEU B C   1 
ATOM   3966 O  O   . LEU B 1 192 ? 11.361  20.219 5.855   1.00 19.11 ? 221 LEU B O   1 
ATOM   3967 C  CB  . LEU B 1 192 ? 8.585   21.483 6.437   1.00 20.31 ? 221 LEU B CB  1 
ATOM   3968 C  CG  . LEU B 1 192 ? 8.636   22.214 7.783   1.00 21.43 ? 221 LEU B CG  1 
ATOM   3969 C  CD1 . LEU B 1 192 ? 8.455   23.706 7.620   1.00 21.52 ? 221 LEU B CD1 1 
ATOM   3970 C  CD2 . LEU B 1 192 ? 7.604   21.663 8.750   1.00 21.50 ? 221 LEU B CD2 1 
ATOM   3971 N  N   . ASP B 1 193 ? 11.870  22.364 6.315   1.00 20.54 ? 222 ASP B N   1 
ATOM   3972 C  CA  . ASP B 1 193 ? 13.206  22.061 6.868   1.00 21.35 ? 222 ASP B CA  1 
ATOM   3973 C  C   . ASP B 1 193 ? 13.055  21.391 8.246   1.00 20.39 ? 222 ASP B C   1 
ATOM   3974 O  O   . ASP B 1 193 ? 12.336  21.884 9.078   1.00 21.13 ? 222 ASP B O   1 
ATOM   3975 C  CB  . ASP B 1 193 ? 14.094  23.300 6.998   1.00 23.24 ? 222 ASP B CB  1 
ATOM   3976 C  CG  . ASP B 1 193 ? 15.540  22.901 7.240   1.00 25.29 ? 222 ASP B CG  1 
ATOM   3977 O  OD1 . ASP B 1 193 ? 16.199  22.522 6.257   1.00 26.84 ? 222 ASP B OD1 1 
ATOM   3978 O  OD2 . ASP B 1 193 ? 15.957  22.846 8.420   1.00 24.36 ? 222 ASP B OD2 1 
ATOM   3979 N  N   . PRO B 1 194 ? 13.745  20.272 8.489   1.00 20.14 ? 223 PRO B N   1 
ATOM   3980 C  CA  . PRO B 1 194 ? 13.698  19.498 9.735   1.00 20.37 ? 223 PRO B CA  1 
ATOM   3981 C  C   . PRO B 1 194 ? 14.035  20.302 10.995  1.00 19.92 ? 223 PRO B C   1 
ATOM   3982 O  O   . PRO B 1 194 ? 13.635  19.944 12.074  1.00 18.57 ? 223 PRO B O   1 
ATOM   3983 C  CB  . PRO B 1 194 ? 14.773  18.429 9.530   1.00 21.35 ? 223 PRO B CB  1 
ATOM   3984 C  CG  . PRO B 1 194 ? 14.641  18.136 8.086   1.00 21.49 ? 223 PRO B CG  1 
ATOM   3985 C  CD  . PRO B 1 194 ? 14.496  19.515 7.485   1.00 20.67 ? 223 PRO B CD  1 
ATOM   3986 N  N   . SER B 1 195 ? 14.757  21.396 10.809  1.00 20.75 ? 224 SER B N   1 
ATOM   3987 C  CA  . SER B 1 195 ? 15.135  22.270 11.889  1.00 20.90 ? 224 SER B CA  1 
ATOM   3988 C  C   . SER B 1 195 ? 13.897  23.038 12.387  1.00 20.54 ? 224 SER B C   1 
ATOM   3989 O  O   . SER B 1 195 ? 13.970  23.711 13.414  1.00 20.66 ? 224 SER B O   1 
ATOM   3990 C  CB  . SER B 1 195 ? 16.233  23.215 11.442  1.00 19.80 ? 224 SER B CB  1 
ATOM   3991 O  OG  . SER B 1 195 ? 15.683  24.225 10.603  1.00 20.32 ? 224 SER B OG  1 
ATOM   3992 N  N   . ARG B 1 196 ? 12.788  22.980 11.640  1.00 19.20 ? 225 ARG B N   1 
ATOM   3993 C  CA  . ARG B 1 196 ? 11.537  23.626 12.040  1.00 18.75 ? 225 ARG B CA  1 
ATOM   3994 C  C   . ARG B 1 196 ? 10.588  22.575 12.618  1.00 16.74 ? 225 ARG B C   1 
ATOM   3995 O  O   . ARG B 1 196 ? 9.427   22.875 12.872  1.00 16.75 ? 225 ARG B O   1 
ATOM   3996 C  CB  . ARG B 1 196 ? 10.895  24.338 10.848  1.00 20.25 ? 225 ARG B CB  1 
ATOM   3997 C  CG  . ARG B 1 196 ? 11.827  25.259 10.075  1.00 21.18 ? 225 ARG B CG  1 
ATOM   3998 C  CD  . ARG B 1 196 ? 12.592  26.207 10.969  1.00 22.36 ? 225 ARG B CD  1 
ATOM   3999 N  NE  . ARG B 1 196 ? 11.681  27.107 11.646  1.00 22.91 ? 225 ARG B NE  1 
ATOM   4000 C  CZ  . ARG B 1 196 ? 11.795  27.482 12.911  1.00 24.54 ? 225 ARG B CZ  1 
ATOM   4001 N  NH1 . ARG B 1 196 ? 12.687  26.882 13.676  1.00 24.04 ? 225 ARG B NH1 1 
ATOM   4002 N  NH2 . ARG B 1 196 ? 10.993  28.415 13.414  1.00 24.64 ? 225 ARG B NH2 1 
ATOM   4003 N  N   . VAL B 1 197 ? 11.071  21.362 12.863  1.00 14.55 ? 226 VAL B N   1 
ATOM   4004 C  CA  . VAL B 1 197 ? 10.187  20.315 13.326  1.00 14.59 ? 226 VAL B CA  1 
ATOM   4005 C  C   . VAL B 1 197 ? 10.764  19.658 14.572  1.00 14.81 ? 226 VAL B C   1 
ATOM   4006 O  O   . VAL B 1 197 ? 11.910  19.240 14.536  1.00 17.39 ? 226 VAL B O   1 
ATOM   4007 C  CB  . VAL B 1 197 ? 9.972   19.240 12.257  1.00 13.83 ? 226 VAL B CB  1 
ATOM   4008 C  CG1 . VAL B 1 197 ? 9.222   18.037 12.824  1.00 13.09 ? 226 VAL B CG1 1 
ATOM   4009 C  CG2 . VAL B 1 197 ? 9.281   19.821 11.031  1.00 14.44 ? 226 VAL B CG2 1 
ATOM   4010 N  N   . CYS B 1 198 ? 9.941   19.485 15.599  1.00 15.04 ? 227 CYS B N   1 
ATOM   4011 C  CA  . CYS B 1 198 ? 10.268  18.641 16.762  1.00 15.64 ? 227 CYS B CA  1 
ATOM   4012 C  C   . CYS B 1 198 ? 9.370   17.394 16.761  1.00 16.13 ? 227 CYS B C   1 
ATOM   4013 O  O   . CYS B 1 198 ? 8.123   17.511 16.767  1.00 15.14 ? 227 CYS B O   1 
ATOM   4014 C  CB  . CYS B 1 198 ? 10.057  19.411 18.063  1.00 16.42 ? 227 CYS B CB  1 
ATOM   4015 S  SG  . CYS B 1 198 ? 10.345  18.424 19.568  1.00 17.78 ? 227 CYS B SG  1 
ATOM   4016 N  N   . ILE B 1 199 ? 9.988   16.225 16.785  1.00 14.57 ? 228 ILE B N   1 
ATOM   4017 C  CA  . ILE B 1 199 ? 9.301   14.972 16.876  1.00 16.06 ? 228 ILE B CA  1 
ATOM   4018 C  C   . ILE B 1 199 ? 9.159   14.660 18.368  1.00 16.55 ? 228 ILE B C   1 
ATOM   4019 O  O   . ILE B 1 199 ? 10.144  14.322 19.009  1.00 17.33 ? 228 ILE B O   1 
ATOM   4020 C  CB  . ILE B 1 199 ? 10.091  13.862 16.154  1.00 16.72 ? 228 ILE B CB  1 
ATOM   4021 C  CG1 . ILE B 1 199 ? 10.456  14.237 14.720  1.00 17.23 ? 228 ILE B CG1 1 
ATOM   4022 C  CG2 . ILE B 1 199 ? 9.376   12.523 16.214  1.00 17.95 ? 228 ILE B CG2 1 
ATOM   4023 C  CD1 . ILE B 1 199 ? 9.286   14.352 13.785  1.00 16.55 ? 228 ILE B CD1 1 
ATOM   4024 N  N   . GLY B 1 200 ? 7.948   14.758 18.897  1.00 15.96 ? 229 GLY B N   1 
ATOM   4025 C  CA  . GLY B 1 200 ? 7.682   14.649 20.358  1.00 15.37 ? 229 GLY B CA  1 
ATOM   4026 C  C   . GLY B 1 200 ? 7.345   13.237 20.801  1.00 15.86 ? 229 GLY B C   1 
ATOM   4027 O  O   . GLY B 1 200 ? 7.187   12.315 19.998  1.00 16.51 ? 229 GLY B O   1 
ATOM   4028 N  N   . HIS B 1 201 ? 7.307   13.106 22.127  1.00 15.24 ? 230 HIS B N   1 
ATOM   4029 C  CA  . HIS B 1 201 ? 7.168   11.887 22.848  1.00 14.92 ? 230 HIS B CA  1 
ATOM   4030 C  C   . HIS B 1 201 ? 8.249   10.900 22.442  1.00 14.69 ? 230 HIS B C   1 
ATOM   4031 O  O   . HIS B 1 201 ? 8.066   9.714  22.564  1.00 14.83 ? 230 HIS B O   1 
ATOM   4032 C  CB  . HIS B 1 201 ? 5.780   11.288 22.697  1.00 15.36 ? 230 HIS B CB  1 
ATOM   4033 C  CG  . HIS B 1 201 ? 4.678   12.191 23.131  1.00 15.72 ? 230 HIS B CG  1 
ATOM   4034 N  ND1 . HIS B 1 201 ? 4.851   13.199 24.027  1.00 15.84 ? 230 HIS B ND1 1 
ATOM   4035 C  CD2 . HIS B 1 201 ? 3.382   12.218 22.782  1.00 15.66 ? 230 HIS B CD2 1 
ATOM   4036 C  CE1 . HIS B 1 201 ? 3.702   13.811 24.222  1.00 15.37 ? 230 HIS B CE1 1 
ATOM   4037 N  NE2 . HIS B 1 201 ? 2.797   13.236 23.460  1.00 16.83 ? 230 HIS B NE2 1 
ATOM   4038 N  N   . SER B 1 202 ? 9.401   11.408 22.063  1.00 15.68 ? 231 SER B N   1 
ATOM   4039 C  CA  . SER B 1 202 ? 10.464  10.510 21.621  1.00 17.51 ? 231 SER B CA  1 
ATOM   4040 C  C   . SER B 1 202 ? 11.083  9.757  22.810  1.00 18.89 ? 231 SER B C   1 
ATOM   4041 O  O   . SER B 1 202 ? 11.692  8.698  22.621  1.00 19.05 ? 231 SER B O   1 
ATOM   4042 C  CB  . SER B 1 202 ? 11.481  11.289 20.834  1.00 17.07 ? 231 SER B CB  1 
ATOM   4043 O  OG  . SER B 1 202 ? 10.944  11.616 19.564  1.00 15.97 ? 231 SER B OG  1 
ATOM   4044 N  N   . ASP B 1 203 ? 10.893  10.289 24.028  1.00 17.99 ? 232 ASP B N   1 
ATOM   4045 C  CA  . ASP B 1 203 ? 11.360  9.613  25.244  1.00 18.86 ? 232 ASP B CA  1 
ATOM   4046 C  C   . ASP B 1 203 ? 10.457  8.414  25.592  1.00 19.40 ? 232 ASP B C   1 
ATOM   4047 O  O   . ASP B 1 203 ? 10.777  7.739  26.556  1.00 17.45 ? 232 ASP B O   1 
ATOM   4048 C  CB  . ASP B 1 203 ? 11.452  10.580 26.426  1.00 18.18 ? 232 ASP B CB  1 
ATOM   4049 C  CG  . ASP B 1 203 ? 10.124  11.240 26.768  1.00 18.36 ? 232 ASP B CG  1 
ATOM   4050 O  OD1 . ASP B 1 203 ? 9.427   11.733 25.807  1.00 18.41 ? 232 ASP B OD1 1 
ATOM   4051 O  OD2 . ASP B 1 203 ? 9.776   11.252 27.971  1.00 17.55 ? 232 ASP B OD2 1 
ATOM   4052 N  N   . ASP B 1 204 ? 9.373   8.151  24.836  1.00 18.31 ? 233 ASP B N   1 
ATOM   4053 C  CA  . ASP B 1 204 ? 8.500   6.950  25.099  1.00 21.19 ? 233 ASP B CA  1 
ATOM   4054 C  C   . ASP B 1 204 ? 9.185   5.667  24.592  1.00 21.22 ? 233 ASP B C   1 
ATOM   4055 O  O   . ASP B 1 204 ? 8.668   4.604  24.805  1.00 21.11 ? 233 ASP B O   1 
ATOM   4056 C  CB  . ASP B 1 204 ? 7.100   7.067  24.472  1.00 19.29 ? 233 ASP B CB  1 
ATOM   4057 C  CG  . ASP B 1 204 ? 6.225   8.128  25.137  1.00 20.31 ? 233 ASP B CG  1 
ATOM   4058 O  OD1 . ASP B 1 204 ? 6.601   8.601  26.255  1.00 20.55 ? 233 ASP B OD1 1 
ATOM   4059 O  OD2 . ASP B 1 204 ? 5.218   8.518  24.529  1.00 18.13 ? 233 ASP B OD2 1 
ATOM   4060 N  N   . THR B 1 205 ? 10.307  5.775  23.888  1.00 23.65 ? 234 THR B N   1 
ATOM   4061 C  CA  . THR B 1 205 ? 10.988  4.594  23.318  1.00 23.86 ? 234 THR B CA  1 
ATOM   4062 C  C   . THR B 1 205 ? 12.444  4.578  23.790  1.00 23.08 ? 234 THR B C   1 
ATOM   4063 O  O   . THR B 1 205 ? 13.035  5.632  23.986  1.00 21.54 ? 234 THR B O   1 
ATOM   4064 C  CB  . THR B 1 205 ? 10.948  4.584  21.781  1.00 23.27 ? 234 THR B CB  1 
ATOM   4065 O  OG1 . THR B 1 205 ? 11.405  3.314  21.334  1.00 23.95 ? 234 THR B OG1 1 
ATOM   4066 C  CG2 . THR B 1 205 ? 11.832  5.628  21.128  1.00 23.80 ? 234 THR B CG2 1 
ATOM   4067 N  N   . ASP B 1 206 ? 12.995  3.367  23.945  1.00 25.50 ? 235 ASP B N   1 
ATOM   4068 C  CA  . ASP B 1 206 ? 14.448  3.157  24.191  1.00 27.13 ? 235 ASP B CA  1 
ATOM   4069 C  C   . ASP B 1 206 ? 15.219  2.862  22.882  1.00 27.90 ? 235 ASP B C   1 
ATOM   4070 O  O   . ASP B 1 206 ? 16.425  2.566  22.931  1.00 28.94 ? 235 ASP B O   1 
ATOM   4071 C  CB  . ASP B 1 206 ? 14.641  2.045  25.223  1.00 28.55 ? 235 ASP B CB  1 
ATOM   4072 C  CG  . ASP B 1 206 ? 14.175  2.421  26.620  1.00 27.74 ? 235 ASP B CG  1 
ATOM   4073 O  OD1 . ASP B 1 206 ? 14.510  3.524  27.068  1.00 28.00 ? 235 ASP B OD1 1 
ATOM   4074 O  OD2 . ASP B 1 206 ? 13.462  1.612  27.237  1.00 31.35 ? 235 ASP B OD2 1 
ATOM   4075 N  N   . ASP B 1 207 ? 14.576  2.961  21.712  1.00 27.32 ? 236 ASP B N   1 
ATOM   4076 C  CA  . ASP B 1 207 ? 15.232  2.695  20.416  1.00 26.40 ? 236 ASP B CA  1 
ATOM   4077 C  C   . ASP B 1 207 ? 16.107  3.899  19.986  1.00 24.33 ? 236 ASP B C   1 
ATOM   4078 O  O   . ASP B 1 207 ? 15.665  4.810  19.281  1.00 22.30 ? 236 ASP B O   1 
ATOM   4079 C  CB  . ASP B 1 207 ? 14.160  2.293  19.395  1.00 27.22 ? 236 ASP B CB  1 
ATOM   4080 C  CG  . ASP B 1 207 ? 14.704  1.906  18.028  1.00 26.51 ? 236 ASP B CG  1 
ATOM   4081 O  OD1 . ASP B 1 207 ? 15.882  2.146  17.774  1.00 27.88 ? 236 ASP B OD1 1 
ATOM   4082 O  OD2 . ASP B 1 207 ? 13.928  1.423  17.212  1.00 27.04 ? 236 ASP B OD2 1 
ATOM   4083 N  N   . LEU B 1 208 ? 17.368  3.905  20.402  1.00 24.10 ? 237 LEU B N   1 
ATOM   4084 C  CA  . LEU B 1 208 ? 18.316  4.961  20.040  1.00 26.28 ? 237 LEU B CA  1 
ATOM   4085 C  C   . LEU B 1 208 ? 18.553  5.024  18.537  1.00 23.70 ? 237 LEU B C   1 
ATOM   4086 O  O   . LEU B 1 208 ? 18.890  6.094  18.055  1.00 22.38 ? 237 LEU B O   1 
ATOM   4087 C  CB  . LEU B 1 208 ? 19.666  4.747  20.721  1.00 30.09 ? 237 LEU B CB  1 
ATOM   4088 C  CG  . LEU B 1 208 ? 19.886  5.581  21.967  1.00 33.92 ? 237 LEU B CG  1 
ATOM   4089 C  CD1 . LEU B 1 208 ? 21.188  5.157  22.640  1.00 36.49 ? 237 LEU B CD1 1 
ATOM   4090 C  CD2 . LEU B 1 208 ? 19.884  7.069  21.630  1.00 33.43 ? 237 LEU B CD2 1 
ATOM   4091 N  N   . ASP B 1 209 ? 18.441  3.896  17.842  1.00 25.32 ? 238 ASP B N   1 
ATOM   4092 C  CA  . ASP B 1 209 ? 18.640  3.856  16.381  1.00 26.72 ? 238 ASP B CA  1 
ATOM   4093 C  C   . ASP B 1 209 ? 17.619  4.773  15.703  1.00 24.66 ? 238 ASP B C   1 
ATOM   4094 O  O   . ASP B 1 209 ? 17.960  5.537  14.790  1.00 26.61 ? 238 ASP B O   1 
ATOM   4095 C  CB  . ASP B 1 209 ? 18.519  2.434  15.829  1.00 27.40 ? 238 ASP B CB  1 
ATOM   4096 C  CG  . ASP B 1 209 ? 19.707  1.575  16.211  1.00 27.99 ? 238 ASP B CG  1 
ATOM   4097 O  OD1 . ASP B 1 209 ? 20.757  2.150  16.476  1.00 29.30 ? 238 ASP B OD1 1 
ATOM   4098 O  OD2 . ASP B 1 209 ? 19.561  0.355  16.244  1.00 30.43 ? 238 ASP B OD2 1 
ATOM   4099 N  N   . TYR B 1 210 ? 16.391  4.689  16.183  1.00 22.80 ? 239 TYR B N   1 
ATOM   4100 C  CA  . TYR B 1 210 ? 15.302  5.491  15.671  1.00 22.05 ? 239 TYR B CA  1 
ATOM   4101 C  C   . TYR B 1 210 ? 15.602  6.975  15.886  1.00 21.10 ? 239 TYR B C   1 
ATOM   4102 O  O   . TYR B 1 210 ? 15.502  7.751  14.951  1.00 21.05 ? 239 TYR B O   1 
ATOM   4103 C  CB  . TYR B 1 210 ? 13.996  5.032  16.328  1.00 23.49 ? 239 TYR B CB  1 
ATOM   4104 C  CG  . TYR B 1 210 ? 12.814  5.974  16.258  1.00 22.89 ? 239 TYR B CG  1 
ATOM   4105 C  CD1 . TYR B 1 210 ? 12.194  6.302  15.057  1.00 23.10 ? 239 TYR B CD1 1 
ATOM   4106 C  CD2 . TYR B 1 210 ? 12.281  6.510  17.421  1.00 23.91 ? 239 TYR B CD2 1 
ATOM   4107 C  CE1 . TYR B 1 210 ? 11.084  7.137  15.024  1.00 24.10 ? 239 TYR B CE1 1 
ATOM   4108 C  CE2 . TYR B 1 210 ? 11.179  7.349  17.399  1.00 23.57 ? 239 TYR B CE2 1 
ATOM   4109 C  CZ  . TYR B 1 210 ? 10.567  7.660  16.197  1.00 23.45 ? 239 TYR B CZ  1 
ATOM   4110 O  OH  . TYR B 1 210 ? 9.468   8.482  16.214  1.00 23.36 ? 239 TYR B OH  1 
ATOM   4111 N  N   . LEU B 1 211 ? 15.972  7.349  17.111  1.00 21.17 ? 240 LEU B N   1 
ATOM   4112 C  CA  . LEU B 1 211 ? 16.129  8.751  17.491  1.00 21.88 ? 240 LEU B CA  1 
ATOM   4113 C  C   . LEU B 1 211 ? 17.350  9.361  16.789  1.00 21.38 ? 240 LEU B C   1 
ATOM   4114 O  O   . LEU B 1 211 ? 17.276  10.490 16.337  1.00 20.06 ? 240 LEU B O   1 
ATOM   4115 C  CB  . LEU B 1 211 ? 16.258  8.891  19.014  1.00 22.34 ? 240 LEU B CB  1 
ATOM   4116 C  CG  . LEU B 1 211 ? 15.096  8.364  19.859  1.00 23.13 ? 240 LEU B CG  1 
ATOM   4117 C  CD1 . LEU B 1 211 ? 15.321  8.662  21.332  1.00 23.51 ? 240 LEU B CD1 1 
ATOM   4118 C  CD2 . LEU B 1 211 ? 13.771  8.938  19.414  1.00 24.57 ? 240 LEU B CD2 1 
ATOM   4119 N  N   . THR B 1 212 ? 18.472  8.635  16.686  1.00 22.01 ? 241 THR B N   1 
ATOM   4120 C  CA  . THR B 1 212 ? 19.668  9.192  16.004  1.00 22.79 ? 241 THR B CA  1 
ATOM   4121 C  C   . THR B 1 212 ? 19.405  9.332  14.495  1.00 23.03 ? 241 THR B C   1 
ATOM   4122 O  O   . THR B 1 212 ? 19.886  10.270 13.893  1.00 22.96 ? 241 THR B O   1 
ATOM   4123 C  CB  . THR B 1 212 ? 20.940  8.371  16.280  1.00 22.95 ? 241 THR B CB  1 
ATOM   4124 O  OG1 . THR B 1 212 ? 20.646  6.996  16.055  1.00 22.87 ? 241 THR B OG1 1 
ATOM   4125 C  CG2 . THR B 1 212 ? 21.429  8.547  17.701  1.00 24.68 ? 241 THR B CG2 1 
ATOM   4126 N  N   . ALA B 1 213 ? 18.646  8.417  13.884  1.00 24.48 ? 242 ALA B N   1 
ATOM   4127 C  CA  . ALA B 1 213 ? 18.347  8.547  12.450  1.00 25.85 ? 242 ALA B CA  1 
ATOM   4128 C  C   . ALA B 1 213 ? 17.591  9.852  12.208  1.00 24.79 ? 242 ALA B C   1 
ATOM   4129 O  O   . ALA B 1 213 ? 17.931  10.595 11.295  1.00 25.89 ? 242 ALA B O   1 
ATOM   4130 C  CB  . ALA B 1 213 ? 17.564  7.371  11.918  1.00 26.09 ? 242 ALA B CB  1 
ATOM   4131 N  N   . LEU B 1 214 ? 16.589  10.119 13.046  1.00 22.46 ? 243 LEU B N   1 
ATOM   4132 C  CA  . LEU B 1 214 ? 15.847  11.347 12.954  1.00 21.57 ? 243 LEU B CA  1 
ATOM   4133 C  C   . LEU B 1 214 ? 16.789  12.541 13.189  1.00 20.08 ? 243 LEU B C   1 
ATOM   4134 O  O   . LEU B 1 214 ? 16.807  13.461 12.395  1.00 17.96 ? 243 LEU B O   1 
ATOM   4135 C  CB  . LEU B 1 214 ? 14.691  11.321 13.964  1.00 20.56 ? 243 LEU B CB  1 
ATOM   4136 C  CG  . LEU B 1 214 ? 13.529  10.383 13.629  1.00 20.77 ? 243 LEU B CG  1 
ATOM   4137 C  CD1 . LEU B 1 214 ? 12.509  10.411 14.759  1.00 21.27 ? 243 LEU B CD1 1 
ATOM   4138 C  CD2 . LEU B 1 214 ? 12.853  10.778 12.319  1.00 21.49 ? 243 LEU B CD2 1 
ATOM   4139 N  N   . ALA B 1 215 ? 17.599  12.512 14.235  1.00 20.09 ? 244 ALA B N   1 
ATOM   4140 C  CA  . ALA B 1 215 ? 18.458  13.666 14.542  1.00 21.04 ? 244 ALA B CA  1 
ATOM   4141 C  C   . ALA B 1 215 ? 19.501  13.864 13.428  1.00 22.13 ? 244 ALA B C   1 
ATOM   4142 O  O   . ALA B 1 215 ? 19.834  15.001 13.056  1.00 19.73 ? 244 ALA B O   1 
ATOM   4143 C  CB  . ALA B 1 215 ? 19.120  13.468 15.881  1.00 22.78 ? 244 ALA B CB  1 
ATOM   4144 N  N   . ALA B 1 216 ? 19.971  12.746 12.881  1.00 23.10 ? 245 ALA B N   1 
ATOM   4145 C  CA  . ALA B 1 216 ? 20.836  12.737 11.694  1.00 24.30 ? 245 ALA B CA  1 
ATOM   4146 C  C   . ALA B 1 216 ? 20.181  13.527 10.557  1.00 25.09 ? 245 ALA B C   1 
ATOM   4147 O  O   . ALA B 1 216 ? 20.844  14.272 9.855   1.00 24.01 ? 245 ALA B O   1 
ATOM   4148 C  CB  . ALA B 1 216 ? 21.139  11.313 11.273  1.00 24.41 ? 245 ALA B CB  1 
ATOM   4149 N  N   . ARG B 1 217 ? 18.875  13.412 10.390  1.00 23.43 ? 246 ARG B N   1 
ATOM   4150 C  CA  . ARG B 1 217 ? 18.242  14.117 9.280   1.00 22.53 ? 246 ARG B CA  1 
ATOM   4151 C  C   . ARG B 1 217 ? 17.982  15.590 9.662   1.00 19.81 ? 246 ARG B C   1 
ATOM   4152 O  O   . ARG B 1 217 ? 17.534  16.356 8.807   1.00 20.41 ? 246 ARG B O   1 
ATOM   4153 C  CB  . ARG B 1 217 ? 16.959  13.392 8.849   1.00 24.02 ? 246 ARG B CB  1 
ATOM   4154 C  CG  . ARG B 1 217 ? 17.179  12.035 8.192   1.00 25.46 ? 246 ARG B CG  1 
ATOM   4155 C  CD  . ARG B 1 217 ? 15.957  11.109 8.265   1.00 25.03 ? 246 ARG B CD  1 
ATOM   4156 N  NE  . ARG B 1 217 ? 14.789  11.576 7.515   1.00 24.96 ? 246 ARG B NE  1 
ATOM   4157 C  CZ  . ARG B 1 217 ? 13.680  10.859 7.323   1.00 26.07 ? 246 ARG B CZ  1 
ATOM   4158 N  NH1 . ARG B 1 217 ? 13.558  9.670  7.891   1.00 24.70 ? 246 ARG B NH1 1 
ATOM   4159 N  NH2 . ARG B 1 217 ? 12.699  11.322 6.566   1.00 24.10 ? 246 ARG B NH2 1 
ATOM   4160 N  N   . GLY B 1 218 ? 18.274  15.999 10.895  1.00 17.96 ? 247 GLY B N   1 
ATOM   4161 C  CA  . GLY B 1 218 ? 18.188  17.440 11.337  1.00 18.39 ? 247 GLY B CA  1 
ATOM   4162 C  C   . GLY B 1 218 ? 16.939  17.759 12.178  1.00 17.68 ? 247 GLY B C   1 
ATOM   4163 O  O   . GLY B 1 218 ? 16.652  18.946 12.437  1.00 19.47 ? 247 GLY B O   1 
ATOM   4164 N  N   . TYR B 1 219 ? 16.184  16.743 12.619  1.00 17.47 ? 248 TYR B N   1 
ATOM   4165 C  CA  . TYR B 1 219 ? 14.937  16.960 13.430  1.00 17.81 ? 248 TYR B CA  1 
ATOM   4166 C  C   . TYR B 1 219 ? 15.286  17.265 14.885  1.00 17.67 ? 248 TYR B C   1 
ATOM   4167 O  O   . TYR B 1 219 ? 16.175  16.645 15.458  1.00 18.99 ? 248 TYR B O   1 
ATOM   4168 C  CB  . TYR B 1 219 ? 13.998  15.744 13.366  1.00 18.13 ? 248 TYR B CB  1 
ATOM   4169 C  CG  . TYR B 1 219 ? 13.348  15.655 12.013  1.00 18.20 ? 248 TYR B CG  1 
ATOM   4170 C  CD1 . TYR B 1 219 ? 12.285  16.483 11.691  1.00 17.50 ? 248 TYR B CD1 1 
ATOM   4171 C  CD2 . TYR B 1 219 ? 13.882  14.854 11.014  1.00 17.08 ? 248 TYR B CD2 1 
ATOM   4172 C  CE1 . TYR B 1 219 ? 11.739  16.487 10.418  1.00 17.17 ? 248 TYR B CE1 1 
ATOM   4173 C  CE2 . TYR B 1 219 ? 13.351  14.851 9.736   1.00 17.61 ? 248 TYR B CE2 1 
ATOM   4174 C  CZ  . TYR B 1 219 ? 12.289  15.684 9.437   1.00 17.25 ? 248 TYR B CZ  1 
ATOM   4175 O  OH  . TYR B 1 219 ? 11.762  15.701 8.188   1.00 17.80 ? 248 TYR B OH  1 
ATOM   4176 N  N   . LEU B 1 220 ? 14.560  18.187 15.498  1.00 17.17 ? 249 LEU B N   1 
ATOM   4177 C  CA  . LEU B 1 220 ? 14.649  18.268 16.940  1.00 18.29 ? 249 LEU B CA  1 
ATOM   4178 C  C   . LEU B 1 220 ? 13.835  17.129 17.565  1.00 18.09 ? 249 LEU B C   1 
ATOM   4179 O  O   . LEU B 1 220 ? 12.852  16.638 16.981  1.00 18.34 ? 249 LEU B O   1 
ATOM   4180 C  CB  . LEU B 1 220 ? 14.213  19.652 17.385  1.00 19.03 ? 249 LEU B CB  1 
ATOM   4181 C  CG  . LEU B 1 220 ? 15.233  20.719 16.999  1.00 19.76 ? 249 LEU B CG  1 
ATOM   4182 C  CD1 . LEU B 1 220 ? 14.977  21.246 15.601  1.00 20.32 ? 249 LEU B CD1 1 
ATOM   4183 C  CD2 . LEU B 1 220 ? 15.226  21.852 17.986  1.00 22.17 ? 249 LEU B CD2 1 
ATOM   4184 N  N   . ILE B 1 221 ? 14.340  16.650 18.689  1.00 17.60 ? 250 ILE B N   1 
ATOM   4185 C  CA  . ILE B 1 221 ? 13.899  15.446 19.326  1.00 17.94 ? 250 ILE B CA  1 
ATOM   4186 C  C   . ILE B 1 221 ? 13.266  15.819 20.655  1.00 17.60 ? 250 ILE B C   1 
ATOM   4187 O  O   . ILE B 1 221 ? 13.932  16.338 21.556  1.00 18.19 ? 250 ILE B O   1 
ATOM   4188 C  CB  . ILE B 1 221 ? 15.058  14.455 19.539  1.00 18.88 ? 250 ILE B CB  1 
ATOM   4189 C  CG1 . ILE B 1 221 ? 15.868  14.247 18.255  1.00 19.30 ? 250 ILE B CG1 1 
ATOM   4190 C  CG2 . ILE B 1 221 ? 14.515  13.149 20.103  1.00 18.37 ? 250 ILE B CG2 1 
ATOM   4191 C  CD1 . ILE B 1 221 ? 15.089  13.608 17.119  1.00 20.22 ? 250 ILE B CD1 1 
ATOM   4192 N  N   . GLY B 1 222 ? 11.985  15.523 20.760  1.00 17.86 ? 251 GLY B N   1 
ATOM   4193 C  CA  . GLY B 1 222 ? 11.243  15.936 21.931  1.00 17.48 ? 251 GLY B CA  1 
ATOM   4194 C  C   . GLY B 1 222 ? 11.223  14.862 22.993  1.00 17.56 ? 251 GLY B C   1 
ATOM   4195 O  O   . GLY B 1 222 ? 10.402  13.927 22.941  1.00 17.72 ? 251 GLY B O   1 
ATOM   4196 N  N   . LEU B 1 223 ? 12.095  15.031 23.975  1.00 17.69 ? 252 LEU B N   1 
ATOM   4197 C  CA  . LEU B 1 223 ? 12.073  14.204 25.162  1.00 18.29 ? 252 LEU B CA  1 
ATOM   4198 C  C   . LEU B 1 223 ? 11.280  14.959 26.230  1.00 18.80 ? 252 LEU B C   1 
ATOM   4199 O  O   . LEU B 1 223 ? 11.855  15.704 27.051  1.00 18.68 ? 252 LEU B O   1 
ATOM   4200 C  CB  . LEU B 1 223 ? 13.511  13.958 25.608  1.00 19.31 ? 252 LEU B CB  1 
ATOM   4201 C  CG  . LEU B 1 223 ? 14.436  13.408 24.524  1.00 20.98 ? 252 LEU B CG  1 
ATOM   4202 C  CD1 . LEU B 1 223 ? 15.862  13.230 25.058  1.00 21.64 ? 252 LEU B CD1 1 
ATOM   4203 C  CD2 . LEU B 1 223 ? 13.901  12.085 23.975  1.00 20.94 ? 252 LEU B CD2 1 
ATOM   4204 N  N   . ASP B 1 224 ? 9.968   14.781 26.162  1.00 16.86 ? 253 ASP B N   1 
ATOM   4205 C  CA  . ASP B 1 224 ? 9.005   15.735 26.725  1.00 16.85 ? 253 ASP B CA  1 
ATOM   4206 C  C   . ASP B 1 224 ? 8.163   15.108 27.852  1.00 17.38 ? 253 ASP B C   1 
ATOM   4207 O  O   . ASP B 1 224 ? 7.340   15.820 28.418  1.00 18.15 ? 253 ASP B O   1 
ATOM   4208 C  CB  . ASP B 1 224 ? 8.127   16.318 25.601  1.00 16.56 ? 253 ASP B CB  1 
ATOM   4209 C  CG  . ASP B 1 224 ? 7.481   15.255 24.731  1.00 16.06 ? 253 ASP B CG  1 
ATOM   4210 O  OD1 . ASP B 1 224 ? 7.126   14.212 25.288  1.00 18.62 ? 253 ASP B OD1 1 
ATOM   4211 O  OD2 . ASP B 1 224 ? 7.330   15.465 23.504  1.00 17.12 ? 253 ASP B OD2 1 
ATOM   4212 N  N   . GLY B 1 225 ? 8.371   13.836 28.233  1.00 16.94 ? 254 GLY B N   1 
ATOM   4213 C  CA  . GLY B 1 225 ? 7.587   13.190 29.269  1.00 16.49 ? 254 GLY B CA  1 
ATOM   4214 C  C   . GLY B 1 225 ? 8.440   12.570 30.365  1.00 17.62 ? 254 GLY B C   1 
ATOM   4215 O  O   . GLY B 1 225 ? 8.078   11.532 30.913  1.00 16.19 ? 254 GLY B O   1 
ATOM   4216 N  N   . ILE B 1 226 ? 9.530   13.243 30.727  1.00 18.00 ? 255 ILE B N   1 
ATOM   4217 C  CA  . ILE B 1 226 ? 10.549  12.661 31.624  1.00 18.77 ? 255 ILE B CA  1 
ATOM   4218 C  C   . ILE B 1 226 ? 9.916   12.122 32.925  1.00 19.12 ? 255 ILE B C   1 
ATOM   4219 O  O   . ILE B 1 226 ? 10.252  11.018 33.339  1.00 19.98 ? 255 ILE B O   1 
ATOM   4220 C  CB  . ILE B 1 226 ? 11.663  13.687 31.909  1.00 18.80 ? 255 ILE B CB  1 
ATOM   4221 C  CG1 . ILE B 1 226 ? 12.243  14.240 30.601  1.00 18.56 ? 255 ILE B CG1 1 
ATOM   4222 C  CG2 . ILE B 1 226 ? 12.742  13.067 32.811  1.00 19.03 ? 255 ILE B CG2 1 
ATOM   4223 C  CD1 . ILE B 1 226 ? 12.511  13.174 29.545  1.00 17.97 ? 255 ILE B CD1 1 
ATOM   4224 N  N   . PRO B 1 227 ? 8.990   12.867 33.588  1.00 19.60 ? 256 PRO B N   1 
ATOM   4225 C  CA  . PRO B 1 227 ? 8.504   12.318 34.871  1.00 18.89 ? 256 PRO B CA  1 
ATOM   4226 C  C   . PRO B 1 227 ? 7.398   11.266 34.730  1.00 19.30 ? 256 PRO B C   1 
ATOM   4227 O  O   . PRO B 1 227 ? 6.828   10.825 35.753  1.00 18.50 ? 256 PRO B O   1 
ATOM   4228 C  CB  . PRO B 1 227 ? 7.978   13.539 35.618  1.00 19.22 ? 256 PRO B CB  1 
ATOM   4229 C  CG  . PRO B 1 227 ? 7.513   14.464 34.504  1.00 19.67 ? 256 PRO B CG  1 
ATOM   4230 C  CD  . PRO B 1 227 ? 8.520   14.238 33.397  1.00 19.41 ? 256 PRO B CD  1 
ATOM   4231 N  N   . TRP B 1 228 ? 7.083   10.845 33.504  1.00 20.45 ? 257 TRP B N   1 
ATOM   4232 C  CA  . TRP B 1 228 ? 5.921   9.963  33.316  1.00 20.14 ? 257 TRP B CA  1 
ATOM   4233 C  C   . TRP B 1 228 ? 6.334   8.536  33.630  1.00 20.89 ? 257 TRP B C   1 
ATOM   4234 O  O   . TRP B 1 228 ? 7.116   7.948  32.891  1.00 18.56 ? 257 TRP B O   1 
ATOM   4235 C  CB  . TRP B 1 228 ? 5.353   10.057 31.904  1.00 20.88 ? 257 TRP B CB  1 
ATOM   4236 C  CG  . TRP B 1 228 ? 4.548   11.289 31.604  1.00 21.70 ? 257 TRP B CG  1 
ATOM   4237 C  CD1 . TRP B 1 228 ? 4.802   12.590 31.947  1.00 21.95 ? 257 TRP B CD1 1 
ATOM   4238 C  CD2 . TRP B 1 228 ? 3.343   11.317 30.828  1.00 20.88 ? 257 TRP B CD2 1 
ATOM   4239 N  NE1 . TRP B 1 228 ? 3.819   13.418 31.463  1.00 20.81 ? 257 TRP B NE1 1 
ATOM   4240 C  CE2 . TRP B 1 228 ? 2.912   12.661 30.774  1.00 20.92 ? 257 TRP B CE2 1 
ATOM   4241 C  CE3 . TRP B 1 228 ? 2.574   10.327 30.210  1.00 21.05 ? 257 TRP B CE3 1 
ATOM   4242 C  CZ2 . TRP B 1 228 ? 1.753   13.031 30.098  1.00 21.28 ? 257 TRP B CZ2 1 
ATOM   4243 C  CZ3 . TRP B 1 228 ? 1.431   10.695 29.546  1.00 20.99 ? 257 TRP B CZ3 1 
ATOM   4244 C  CH2 . TRP B 1 228 ? 1.030   12.027 29.495  1.00 22.15 ? 257 TRP B CH2 1 
ATOM   4245 N  N   . SER B 1 229 ? 5.807   8.007  34.731  1.00 23.16 ? 258 SER B N   1 
ATOM   4246 C  CA  . SER B 1 229 ? 6.082   6.618  35.116  1.00 24.27 ? 258 SER B CA  1 
ATOM   4247 C  C   . SER B 1 229 ? 4.977   6.107  36.050  1.00 24.12 ? 258 SER B C   1 
ATOM   4248 O  O   . SER B 1 229 ? 4.557   6.786  36.999  1.00 23.12 ? 258 SER B O   1 
ATOM   4249 C  CB  . SER B 1 229 ? 7.443   6.459  35.762  1.00 23.84 ? 258 SER B CB  1 
ATOM   4250 O  OG  . SER B 1 229 ? 7.704   5.081  36.035  1.00 23.70 ? 258 SER B OG  1 
ATOM   4251 N  N   . ALA B 1 230 ? 4.525   4.897  35.765  1.00 23.91 ? 259 ALA B N   1 
ATOM   4252 C  CA  . ALA B 1 230 ? 3.571   4.205  36.618  1.00 27.11 ? 259 ALA B CA  1 
ATOM   4253 C  C   . ALA B 1 230 ? 4.295   3.173  37.492  1.00 29.28 ? 259 ALA B C   1 
ATOM   4254 O  O   . ALA B 1 230 ? 3.646   2.242  37.995  1.00 33.83 ? 259 ALA B O   1 
ATOM   4255 C  CB  . ALA B 1 230 ? 2.522   3.530  35.766  1.00 28.17 ? 259 ALA B CB  1 
ATOM   4256 N  N   . ILE B 1 231 ? 5.613   3.283  37.640  1.00 30.04 ? 260 ILE B N   1 
ATOM   4257 C  CA  . ILE B 1 231 ? 6.343   2.342  38.503  1.00 32.10 ? 260 ILE B CA  1 
ATOM   4258 C  C   . ILE B 1 231 ? 5.803   2.514  39.923  1.00 32.65 ? 260 ILE B C   1 
ATOM   4259 O  O   . ILE B 1 231 ? 5.708   3.634  40.425  1.00 28.26 ? 260 ILE B O   1 
ATOM   4260 C  CB  . ILE B 1 231 ? 7.872   2.544  38.425  1.00 32.62 ? 260 ILE B CB  1 
ATOM   4261 C  CG1 . ILE B 1 231 ? 8.418   2.051  37.078  1.00 32.85 ? 260 ILE B CG1 1 
ATOM   4262 C  CG2 . ILE B 1 231 ? 8.569   1.865  39.598  1.00 35.15 ? 260 ILE B CG2 1 
ATOM   4263 C  CD1 . ILE B 1 231 ? 9.923   2.175  36.905  1.00 33.34 ? 260 ILE B CD1 1 
ATOM   4264 N  N   . GLY B 1 232 ? 5.409   1.393  40.521  1.00 36.84 ? 261 GLY B N   1 
ATOM   4265 C  CA  . GLY B 1 232 ? 4.871   1.371  41.874  1.00 40.35 ? 261 GLY B CA  1 
ATOM   4266 C  C   . GLY B 1 232 ? 3.353   1.457  41.919  1.00 43.24 ? 261 GLY B C   1 
ATOM   4267 O  O   . GLY B 1 232 ? 2.782   1.384  42.997  1.00 47.13 ? 261 GLY B O   1 
ATOM   4268 N  N   . LEU B 1 233 ? 2.685   1.650  40.786  1.00 46.52 ? 262 LEU B N   1 
ATOM   4269 C  CA  . LEU B 1 233 ? 1.229   1.466  40.744  1.00 49.11 ? 262 LEU B CA  1 
ATOM   4270 C  C   . LEU B 1 233 ? 0.878   0.757  39.427  1.00 49.16 ? 262 LEU B C   1 
ATOM   4271 O  O   . LEU B 1 233 ? 0.063   1.201  38.618  1.00 52.79 ? 262 LEU B O   1 
ATOM   4272 C  CB  . LEU B 1 233 ? 0.435   2.763  41.030  1.00 51.02 ? 262 LEU B CB  1 
ATOM   4273 C  CG  . LEU B 1 233 ? 0.948   4.163  40.642  1.00 50.99 ? 262 LEU B CG  1 
ATOM   4274 C  CD1 . LEU B 1 233 ? 2.443   4.377  40.830  1.00 52.90 ? 262 LEU B CD1 1 
ATOM   4275 C  CD2 . LEU B 1 233 ? 0.535   4.529  39.230  1.00 54.20 ? 262 LEU B CD2 1 
ATOM   4276 N  N   . GLU B 1 234 ? 1.497   -0.418 39.287  1.00 47.56 ? 263 GLU B N   1 
ATOM   4277 C  CA  . GLU B 1 234 ? 1.360   -1.310 38.118  1.00 48.26 ? 263 GLU B CA  1 
ATOM   4278 C  C   . GLU B 1 234 ? -0.038  -1.937 38.068  1.00 45.87 ? 263 GLU B C   1 
ATOM   4279 O  O   . GLU B 1 234 ? -0.392  -2.483 37.037  1.00 47.50 ? 263 GLU B O   1 
ATOM   4280 C  CB  . GLU B 1 234 ? 2.358   -2.480 38.146  1.00 49.18 ? 263 GLU B CB  1 
ATOM   4281 C  CG  . GLU B 1 234 ? 3.825   -2.073 38.132  1.00 50.00 ? 263 GLU B CG  1 
ATOM   4282 C  CD  . GLU B 1 234 ? 4.460   -1.746 39.479  1.00 52.63 ? 263 GLU B CD  1 
ATOM   4283 O  OE1 . GLU B 1 234 ? 5.449   -0.978 39.484  1.00 51.35 ? 263 GLU B OE1 1 
ATOM   4284 O  OE2 . GLU B 1 234 ? 3.982   -2.261 40.522  1.00 55.87 ? 263 GLU B OE2 1 
ATOM   4285 N  N   . ASP B 1 235 ? -0.813  -1.892 39.154  1.00 41.80 ? 264 ASP B N   1 
ATOM   4286 C  CA  . ASP B 1 235 ? -2.172  -2.489 39.149  1.00 43.47 ? 264 ASP B CA  1 
ATOM   4287 C  C   . ASP B 1 235 ? -3.244  -1.416 38.886  1.00 37.72 ? 264 ASP B C   1 
ATOM   4288 O  O   . ASP B 1 235 ? -4.432  -1.698 38.994  1.00 33.11 ? 264 ASP B O   1 
ATOM   4289 C  CB  . ASP B 1 235 ? -2.445  -3.238 40.455  1.00 46.54 ? 264 ASP B CB  1 
ATOM   4290 C  CG  . ASP B 1 235 ? -2.134  -2.410 41.690  1.00 52.86 ? 264 ASP B CG  1 
ATOM   4291 O  OD1 . ASP B 1 235 ? -1.396  -1.398 41.564  1.00 52.72 ? 264 ASP B OD1 1 
ATOM   4292 O  OD2 . ASP B 1 235 ? -2.617  -2.786 42.768  1.00 63.44 ? 264 ASP B OD2 1 
ATOM   4293 N  N   . ASN B 1 236 ? -2.828  -0.191 38.557  1.00 31.93 ? 265 ASN B N   1 
ATOM   4294 C  CA  . ASN B 1 236 ? -3.710  0.797  37.928  1.00 30.29 ? 265 ASN B CA  1 
ATOM   4295 C  C   . ASN B 1 236 ? -3.503  0.704  36.408  1.00 29.89 ? 265 ASN B C   1 
ATOM   4296 O  O   . ASN B 1 236 ? -2.546  1.293  35.848  1.00 27.56 ? 265 ASN B O   1 
ATOM   4297 C  CB  . ASN B 1 236 ? -3.464  2.210  38.467  1.00 29.08 ? 265 ASN B CB  1 
ATOM   4298 C  CG  . ASN B 1 236 ? -4.443  3.248  37.948  1.00 28.69 ? 265 ASN B CG  1 
ATOM   4299 O  OD1 . ASN B 1 236 ? -5.021  3.114  36.860  1.00 26.73 ? 265 ASN B OD1 1 
ATOM   4300 N  ND2 . ASN B 1 236 ? -4.614  4.310  38.721  1.00 27.36 ? 265 ASN B ND2 1 
ATOM   4301 N  N   . ALA B 1 237 ? -4.384  -0.053 35.747  1.00 27.76 ? 266 ALA B N   1 
ATOM   4302 C  CA  . ALA B 1 237 ? -4.230  -0.311 34.322  1.00 29.27 ? 266 ALA B CA  1 
ATOM   4303 C  C   . ALA B 1 237 ? -4.272  1.013  33.554  1.00 28.88 ? 266 ALA B C   1 
ATOM   4304 O  O   . ALA B 1 237 ? -3.470  1.193  32.668  1.00 28.31 ? 266 ALA B O   1 
ATOM   4305 C  CB  . ALA B 1 237 ? -5.292  -1.264 33.822  1.00 30.75 ? 266 ALA B CB  1 
ATOM   4306 N  N   A SER B 1 238 ? -5.203  1.911  33.890  0.50 27.90 ? 267 SER B N   1 
ATOM   4307 N  N   B SER B 1 238 ? -5.205  1.909  33.910  0.50 26.82 ? 267 SER B N   1 
ATOM   4308 C  CA  A SER B 1 238 ? -5.385  3.152  33.118  0.50 27.51 ? 267 SER B CA  1 
ATOM   4309 C  CA  B SER B 1 238 ? -5.427  3.165  33.162  0.50 25.89 ? 267 SER B CA  1 
ATOM   4310 C  C   A SER B 1 238 ? -4.130  4.024  33.214  0.50 27.35 ? 267 SER B C   1 
ATOM   4311 C  C   B SER B 1 238 ? -4.169  4.040  33.229  0.50 26.45 ? 267 SER B C   1 
ATOM   4312 O  O   A SER B 1 238 ? -3.698  4.616  32.219  0.50 26.59 ? 267 SER B O   1 
ATOM   4313 O  O   B SER B 1 238 ? -3.767  4.641  32.229  0.50 25.81 ? 267 SER B O   1 
ATOM   4314 C  CB  A SER B 1 238 ? -6.595  3.916  33.576  0.50 26.44 ? 267 SER B CB  1 
ATOM   4315 C  CB  B SER B 1 238 ? -6.641  3.917  33.675  0.50 23.87 ? 267 SER B CB  1 
ATOM   4316 O  OG  A SER B 1 238 ? -7.696  3.647  32.734  0.50 28.64 ? 267 SER B OG  1 
ATOM   4317 O  OG  B SER B 1 238 ? -6.387  4.507  34.948  0.50 23.42 ? 267 SER B OG  1 
ATOM   4318 N  N   . ALA B 1 239 ? -3.569  4.092  34.417  1.00 26.25 ? 268 ALA B N   1 
ATOM   4319 C  CA  . ALA B 1 239 ? -2.376  4.869  34.665  1.00 27.94 ? 268 ALA B CA  1 
ATOM   4320 C  C   . ALA B 1 239 ? -1.125  4.196  34.068  1.00 27.73 ? 268 ALA B C   1 
ATOM   4321 O  O   . ALA B 1 239 ? -0.206  4.892  33.617  1.00 26.22 ? 268 ALA B O   1 
ATOM   4322 C  CB  . ALA B 1 239 ? -2.234  5.072  36.153  1.00 28.28 ? 268 ALA B CB  1 
ATOM   4323 N  N   . ALA B 1 240 ? -1.075  2.861  34.082  1.00 27.52 ? 269 ALA B N   1 
ATOM   4324 C  CA  . ALA B 1 240 ? 0.068   2.133  33.509  1.00 27.23 ? 269 ALA B CA  1 
ATOM   4325 C  C   . ALA B 1 240 ? 0.120   2.350  31.990  1.00 26.29 ? 269 ALA B C   1 
ATOM   4326 O  O   . ALA B 1 240 ? 1.200   2.566  31.449  1.00 25.40 ? 269 ALA B O   1 
ATOM   4327 C  CB  . ALA B 1 240 ? -0.033  0.671  33.849  1.00 27.95 ? 269 ALA B CB  1 
ATOM   4328 N  N   . ALA B 1 241 ? -1.045  2.280  31.333  1.00 25.51 ? 270 ALA B N   1 
ATOM   4329 C  CA  . ALA B 1 241 ? -1.205  2.580  29.881  1.00 25.22 ? 270 ALA B CA  1 
ATOM   4330 C  C   . ALA B 1 241 ? -0.747  4.010  29.561  1.00 25.52 ? 270 ALA B C   1 
ATOM   4331 O  O   . ALA B 1 241 ? -0.018  4.217  28.582  1.00 26.64 ? 270 ALA B O   1 
ATOM   4332 C  CB  . ALA B 1 241 ? -2.644  2.372  29.451  1.00 25.91 ? 270 ALA B CB  1 
ATOM   4333 N  N   . LEU B 1 242 ? -1.142  5.002  30.358  1.00 25.00 ? 271 LEU B N   1 
ATOM   4334 C  CA  . LEU B 1 242 ? -0.772  6.393  30.029  1.00 24.57 ? 271 LEU B CA  1 
ATOM   4335 C  C   . LEU B 1 242 ? 0.716   6.652  30.324  1.00 24.36 ? 271 LEU B C   1 
ATOM   4336 O  O   . LEU B 1 242 ? 1.415   7.228  29.476  1.00 25.01 ? 271 LEU B O   1 
ATOM   4337 C  CB  . LEU B 1 242 ? -1.654  7.366  30.814  1.00 25.63 ? 271 LEU B CB  1 
ATOM   4338 C  CG  . LEU B 1 242 ? -1.292  8.847  30.645  1.00 26.52 ? 271 LEU B CG  1 
ATOM   4339 C  CD1 . LEU B 1 242 ? -1.771  9.384  29.308  1.00 27.39 ? 271 LEU B CD1 1 
ATOM   4340 C  CD2 . LEU B 1 242 ? -1.849  9.686  31.789  1.00 26.27 ? 271 LEU B CD2 1 
ATOM   4341 N  N   . LEU B 1 243 ? 1.187   6.268  31.518  1.00 23.09 ? 272 LEU B N   1 
ATOM   4342 C  CA  . LEU B 1 243 ? 2.483   6.710  32.025  1.00 24.09 ? 272 LEU B CA  1 
ATOM   4343 C  C   . LEU B 1 243 ? 3.600   5.737  31.612  1.00 23.52 ? 272 LEU B C   1 
ATOM   4344 O  O   . LEU B 1 243 ? 4.762   6.128  31.645  1.00 24.02 ? 272 LEU B O   1 
ATOM   4345 C  CB  . LEU B 1 243 ? 2.421   6.867  33.551  1.00 25.24 ? 272 LEU B CB  1 
ATOM   4346 C  CG  . LEU B 1 243 ? 1.494   7.964  34.087  1.00 26.05 ? 272 LEU B CG  1 
ATOM   4347 C  CD1 . LEU B 1 243 ? 1.397   7.911  35.601  1.00 25.57 ? 272 LEU B CD1 1 
ATOM   4348 C  CD2 . LEU B 1 243 ? 1.955   9.348  33.651  1.00 26.50 ? 272 LEU B CD2 1 
ATOM   4349 N  N   . GLY B 1 244 ? 3.280   4.505  31.207  1.00 25.04 ? 273 GLY B N   1 
ATOM   4350 C  CA  . GLY B 1 244 ? 4.326   3.507  30.930  1.00 25.67 ? 273 GLY B CA  1 
ATOM   4351 C  C   . GLY B 1 244 ? 4.957   2.952  32.203  1.00 26.87 ? 273 GLY B C   1 
ATOM   4352 O  O   . GLY B 1 244 ? 4.682   3.413  33.315  1.00 26.16 ? 273 GLY B O   1 
ATOM   4353 N  N   . LEU B 1 245 ? 5.827   1.949  32.046  1.00 26.79 ? 274 LEU B N   1 
ATOM   4354 C  CA  . LEU B 1 245 ? 6.471   1.280  33.190  1.00 26.29 ? 274 LEU B CA  1 
ATOM   4355 C  C   . LEU B 1 245 ? 7.992   1.456  33.132  1.00 25.51 ? 274 LEU B C   1 
ATOM   4356 O  O   . LEU B 1 245 ? 8.723   0.702  33.742  1.00 25.50 ? 274 LEU B O   1 
ATOM   4357 C  CB  . LEU B 1 245 ? 6.070   -0.198 33.177  1.00 27.32 ? 274 LEU B CB  1 
ATOM   4358 C  CG  . LEU B 1 245 ? 4.574   -0.468 33.343  1.00 29.03 ? 274 LEU B CG  1 
ATOM   4359 C  CD1 . LEU B 1 245 ? 4.225   -1.927 33.031  1.00 31.18 ? 274 LEU B CD1 1 
ATOM   4360 C  CD2 . LEU B 1 245 ? 4.123   -0.095 34.742  1.00 28.84 ? 274 LEU B CD2 1 
ATOM   4361 N  N   . ARG B 1 246 ? 8.458   2.455  32.403  1.00 24.94 ? 275 ARG B N   1 
ATOM   4362 C  CA  . ARG B 1 246 ? 9.859   2.849  32.431  1.00 24.62 ? 275 ARG B CA  1 
ATOM   4363 C  C   . ARG B 1 246 ? 9.986   4.009  33.426  1.00 24.21 ? 275 ARG B C   1 
ATOM   4364 O  O   . ARG B 1 246 ? 9.076   4.858  33.521  1.00 22.81 ? 275 ARG B O   1 
ATOM   4365 C  CB  . ARG B 1 246 ? 10.350  3.239  31.024  1.00 26.10 ? 275 ARG B CB  1 
ATOM   4366 C  CG  . ARG B 1 246 ? 10.502  2.087  30.027  1.00 24.09 ? 275 ARG B CG  1 
ATOM   4367 C  CD  . ARG B 1 246 ? 10.323  2.475  28.560  1.00 22.86 ? 275 ARG B CD  1 
ATOM   4368 N  NE  . ARG B 1 246 ? 11.386  3.337  28.038  1.00 22.68 ? 275 ARG B NE  1 
ATOM   4369 C  CZ  . ARG B 1 246 ? 11.297  4.653  27.809  1.00 22.74 ? 275 ARG B CZ  1 
ATOM   4370 N  NH1 . ARG B 1 246 ? 10.142  5.291  27.942  1.00 21.94 ? 275 ARG B NH1 1 
ATOM   4371 N  NH2 . ARG B 1 246 ? 12.371  5.334  27.437  1.00 20.52 ? 275 ARG B NH2 1 
ATOM   4372 N  N   . SER B 1 247 ? 11.111  4.023  34.148  1.00 23.79 ? 276 SER B N   1 
ATOM   4373 C  CA  . SER B 1 247 ? 11.430  5.060  35.184  1.00 23.59 ? 276 SER B CA  1 
ATOM   4374 C  C   . SER B 1 247 ? 11.731  6.423  34.551  1.00 20.79 ? 276 SER B C   1 
ATOM   4375 O  O   . SER B 1 247 ? 12.086  6.513  33.389  1.00 21.84 ? 276 SER B O   1 
ATOM   4376 C  CB  . SER B 1 247 ? 12.617  4.633  36.013  1.00 23.01 ? 276 SER B CB  1 
ATOM   4377 O  OG  . SER B 1 247 ? 13.744  4.407  35.172  1.00 21.37 ? 276 SER B OG  1 
ATOM   4378 N  N   . TRP B 1 248 ? 11.668  7.469  35.350  1.00 21.75 ? 277 TRP B N   1 
ATOM   4379 C  CA  . TRP B 1 248 ? 12.038  8.791  34.868  1.00 22.59 ? 277 TRP B CA  1 
ATOM   4380 C  C   . TRP B 1 248 ? 13.526  8.832  34.542  1.00 23.52 ? 277 TRP B C   1 
ATOM   4381 O  O   . TRP B 1 248 ? 13.945  9.574  33.654  1.00 23.84 ? 277 TRP B O   1 
ATOM   4382 C  CB  . TRP B 1 248 ? 11.652  9.905  35.853  1.00 21.86 ? 277 TRP B CB  1 
ATOM   4383 C  CG  . TRP B 1 248 ? 12.457  10.063 37.111  1.00 21.65 ? 277 TRP B CG  1 
ATOM   4384 C  CD1 . TRP B 1 248 ? 12.083  9.647  38.356  1.00 21.74 ? 277 TRP B CD1 1 
ATOM   4385 C  CD2 . TRP B 1 248 ? 13.688  10.792 37.289  1.00 20.94 ? 277 TRP B CD2 1 
ATOM   4386 N  NE1 . TRP B 1 248 ? 13.022  10.016 39.281  1.00 21.49 ? 277 TRP B NE1 1 
ATOM   4387 C  CE2 . TRP B 1 248 ? 14.016  10.722 38.660  1.00 21.57 ? 277 TRP B CE2 1 
ATOM   4388 C  CE3 . TRP B 1 248 ? 14.578  11.436 36.425  1.00 21.27 ? 277 TRP B CE3 1 
ATOM   4389 C  CZ2 . TRP B 1 248 ? 15.174  11.300 39.187  1.00 22.46 ? 277 TRP B CZ2 1 
ATOM   4390 C  CZ3 . TRP B 1 248 ? 15.718  12.013 36.940  1.00 20.99 ? 277 TRP B CZ3 1 
ATOM   4391 C  CH2 . TRP B 1 248 ? 16.018  11.940 38.306  1.00 22.45 ? 277 TRP B CH2 1 
ATOM   4392 N  N   . GLN B 1 249 ? 14.310  8.072  35.301  1.00 24.71 ? 278 GLN B N   1 
ATOM   4393 C  CA  . GLN B 1 249 ? 15.773  8.033  35.112  1.00 24.53 ? 278 GLN B CA  1 
ATOM   4394 C  C   . GLN B 1 249 ? 16.080  7.454  33.724  1.00 22.04 ? 278 GLN B C   1 
ATOM   4395 O  O   . GLN B 1 249 ? 16.931  7.962  33.013  1.00 21.04 ? 278 GLN B O   1 
ATOM   4396 C  CB  . GLN B 1 249 ? 16.462  7.213  36.217  1.00 24.64 ? 278 GLN B CB  1 
ATOM   4397 C  CG  . GLN B 1 249 ? 16.504  7.912  37.571  1.00 25.55 ? 278 GLN B CG  1 
ATOM   4398 C  CD  . GLN B 1 249 ? 15.394  7.471  38.495  1.00 26.71 ? 278 GLN B CD  1 
ATOM   4399 O  OE1 . GLN B 1 249 ? 14.322  7.053  38.073  1.00 29.81 ? 278 GLN B OE1 1 
ATOM   4400 N  NE2 . GLN B 1 249 ? 15.658  7.540  39.786  1.00 27.50 ? 278 GLN B NE2 1 
ATOM   4401 N  N   . THR B 1 250 ? 15.378  6.398  33.373  1.00 21.01 ? 279 THR B N   1 
ATOM   4402 C  CA  . THR B 1 250 ? 15.516  5.747  32.067  1.00 21.80 ? 279 THR B CA  1 
ATOM   4403 C  C   . THR B 1 250 ? 15.230  6.769  30.959  1.00 20.66 ? 279 THR B C   1 
ATOM   4404 O  O   . THR B 1 250 ? 15.996  6.929  30.011  1.00 19.81 ? 279 THR B O   1 
ATOM   4405 C  CB  . THR B 1 250 ? 14.546  4.556  32.003  1.00 22.45 ? 279 THR B CB  1 
ATOM   4406 O  OG1 . THR B 1 250 ? 14.995  3.583  32.935  1.00 22.09 ? 279 THR B OG1 1 
ATOM   4407 C  CG2 . THR B 1 250 ? 14.423  3.911  30.640  1.00 24.35 ? 279 THR B CG2 1 
ATOM   4408 N  N   . ARG B 1 251 ? 14.124  7.498  31.105  1.00 19.25 ? 280 ARG B N   1 
ATOM   4409 C  CA  . ARG B 1 251 ? 13.773  8.520  30.100  1.00 18.97 ? 280 ARG B CA  1 
ATOM   4410 C  C   . ARG B 1 251 ? 14.879  9.592  30.068  1.00 19.16 ? 280 ARG B C   1 
ATOM   4411 O  O   . ARG B 1 251 ? 15.359  9.980  28.979  1.00 20.80 ? 280 ARG B O   1 
ATOM   4412 C  CB  . ARG B 1 251 ? 12.412  9.162  30.404  1.00 18.07 ? 280 ARG B CB  1 
ATOM   4413 C  CG  . ARG B 1 251 ? 11.209  8.225  30.380  1.00 19.16 ? 280 ARG B CG  1 
ATOM   4414 C  CD  . ARG B 1 251 ? 9.978   9.076  30.671  1.00 19.69 ? 280 ARG B CD  1 
ATOM   4415 N  NE  . ARG B 1 251 ? 8.678   8.425  30.592  1.00 19.92 ? 280 ARG B NE  1 
ATOM   4416 C  CZ  . ARG B 1 251 ? 7.911   8.401  29.517  1.00 18.77 ? 280 ARG B CZ  1 
ATOM   4417 N  NH1 . ARG B 1 251 ? 8.288   9.075  28.435  1.00 18.45 ? 280 ARG B NH1 1 
ATOM   4418 N  NH2 . ARG B 1 251 ? 6.787   7.696  29.543  1.00 17.59 ? 280 ARG B NH2 1 
ATOM   4419 N  N   . ALA B 1 252 ? 15.330  10.052 31.237  1.00 18.52 ? 281 ALA B N   1 
ATOM   4420 C  CA  . ALA B 1 252 ? 16.274  11.170 31.282  1.00 18.79 ? 281 ALA B CA  1 
ATOM   4421 C  C   . ALA B 1 252 ? 17.625  10.770 30.662  1.00 21.20 ? 281 ALA B C   1 
ATOM   4422 O  O   . ALA B 1 252 ? 18.350  11.626 30.106  1.00 19.91 ? 281 ALA B O   1 
ATOM   4423 C  CB  . ALA B 1 252 ? 16.426  11.662 32.714  1.00 17.92 ? 281 ALA B CB  1 
ATOM   4424 N  N   . LEU B 1 253 ? 17.991  9.485  30.769  1.00 24.30 ? 282 LEU B N   1 
ATOM   4425 C  CA  . LEU B 1 253 ? 19.297  9.017  30.281  1.00 24.33 ? 282 LEU B CA  1 
ATOM   4426 C  C   . LEU B 1 253 ? 19.315  9.085  28.755  1.00 23.86 ? 282 LEU B C   1 
ATOM   4427 O  O   . LEU B 1 253 ? 20.376  9.182  28.190  1.00 22.70 ? 282 LEU B O   1 
ATOM   4428 C  CB  . LEU B 1 253 ? 19.592  7.594  30.786  1.00 27.06 ? 282 LEU B CB  1 
ATOM   4429 C  CG  . LEU B 1 253 ? 20.011  7.491  32.260  1.00 28.58 ? 282 LEU B CG  1 
ATOM   4430 C  CD1 . LEU B 1 253 ? 20.320  6.054  32.653  1.00 29.56 ? 282 LEU B CD1 1 
ATOM   4431 C  CD2 . LEU B 1 253 ? 21.190  8.405  32.566  1.00 30.97 ? 282 LEU B CD2 1 
ATOM   4432 N  N   . LEU B 1 254 ? 18.144  9.073  28.096  1.00 22.38 ? 283 LEU B N   1 
ATOM   4433 C  CA  . LEU B 1 254 ? 18.089  9.342  26.655  1.00 20.73 ? 283 LEU B CA  1 
ATOM   4434 C  C   . LEU B 1 254 ? 18.648  10.731 26.351  1.00 20.81 ? 283 LEU B C   1 
ATOM   4435 O  O   . LEU B 1 254 ? 19.220  10.915 25.255  1.00 20.10 ? 283 LEU B O   1 
ATOM   4436 C  CB  . LEU B 1 254 ? 16.655  9.240  26.129  1.00 20.23 ? 283 LEU B CB  1 
ATOM   4437 C  CG  . LEU B 1 254 ? 15.984  7.880  26.270  1.00 21.23 ? 283 LEU B CG  1 
ATOM   4438 C  CD1 . LEU B 1 254 ? 14.545  7.949  25.765  1.00 20.36 ? 283 LEU B CD1 1 
ATOM   4439 C  CD2 . LEU B 1 254 ? 16.770  6.786  25.564  1.00 21.96 ? 283 LEU B CD2 1 
ATOM   4440 N  N   . ILE B 1 255 ? 18.500  11.689 27.279  1.00 19.96 ? 284 ILE B N   1 
ATOM   4441 C  CA  . ILE B 1 255 ? 19.000  13.017 27.033  1.00 20.16 ? 284 ILE B CA  1 
ATOM   4442 C  C   . ILE B 1 255 ? 20.528  12.933 26.933  1.00 22.60 ? 284 ILE B C   1 
ATOM   4443 O  O   . ILE B 1 255 ? 21.158  13.470 25.998  1.00 22.09 ? 284 ILE B O   1 
ATOM   4444 C  CB  . ILE B 1 255 ? 18.557  14.029 28.117  1.00 20.49 ? 284 ILE B CB  1 
ATOM   4445 C  CG1 . ILE B 1 255 ? 17.043  14.083 28.323  1.00 19.13 ? 284 ILE B CG1 1 
ATOM   4446 C  CG2 . ILE B 1 255 ? 19.113  15.416 27.803  1.00 21.86 ? 284 ILE B CG2 1 
ATOM   4447 C  CD1 . ILE B 1 255 ? 16.610  14.936 29.501  1.00 18.49 ? 284 ILE B CD1 1 
ATOM   4448 N  N   . LYS B 1 256 ? 21.138  12.263 27.909  1.00 26.43 ? 285 LYS B N   1 
ATOM   4449 C  CA  . LYS B 1 256 ? 22.597  12.098 27.926  1.00 26.22 ? 285 LYS B CA  1 
ATOM   4450 C  C   . LYS B 1 256 ? 23.037  11.400 26.641  1.00 24.94 ? 285 LYS B C   1 
ATOM   4451 O  O   . LYS B 1 256 ? 23.923  11.873 25.952  1.00 27.56 ? 285 LYS B O   1 
ATOM   4452 C  CB  . LYS B 1 256 ? 23.037  11.290 29.151  1.00 28.22 ? 285 LYS B CB  1 
ATOM   4453 C  CG  . LYS B 1 256 ? 24.529  10.992 29.228  1.00 28.75 ? 285 LYS B CG  1 
ATOM   4454 C  CD  . LYS B 1 256 ? 24.944  10.440 30.588  1.00 30.18 ? 285 LYS B CD  1 
ATOM   4455 C  CE  . LYS B 1 256 ? 26.400  10.050 30.674  1.00 31.95 ? 285 LYS B CE  1 
ATOM   4456 N  NZ  . LYS B 1 256 ? 26.853  9.332  29.460  1.00 31.15 ? 285 LYS B NZ  1 
ATOM   4457 N  N   . ALA B 1 257 ? 22.388  10.284 26.349  1.00 24.21 ? 286 ALA B N   1 
ATOM   4458 C  CA  . ALA B 1 257 ? 22.690  9.471  25.180  1.00 24.63 ? 286 ALA B CA  1 
ATOM   4459 C  C   . ALA B 1 257 ? 22.710  10.319 23.900  1.00 24.95 ? 286 ALA B C   1 
ATOM   4460 O  O   . ALA B 1 257 ? 23.623  10.166 23.102  1.00 25.19 ? 286 ALA B O   1 
ATOM   4461 C  CB  . ALA B 1 257 ? 21.701  8.346  25.057  1.00 23.10 ? 286 ALA B CB  1 
ATOM   4462 N  N   . LEU B 1 258 ? 21.729  11.183 23.674  1.00 24.70 ? 287 LEU B N   1 
ATOM   4463 C  CA  . LEU B 1 258 ? 21.723  11.984 22.421  1.00 25.15 ? 287 LEU B CA  1 
ATOM   4464 C  C   . LEU B 1 258 ? 22.813  13.064 22.469  1.00 23.92 ? 287 LEU B C   1 
ATOM   4465 O  O   . LEU B 1 258 ? 23.328  13.465 21.429  1.00 25.47 ? 287 LEU B O   1 
ATOM   4466 C  CB  . LEU B 1 258 ? 20.334  12.599 22.201  1.00 26.69 ? 287 LEU B CB  1 
ATOM   4467 C  CG  . LEU B 1 258 ? 19.286  11.638 21.640  1.00 28.65 ? 287 LEU B CG  1 
ATOM   4468 C  CD1 . LEU B 1 258 ? 17.895  12.243 21.743  1.00 30.23 ? 287 LEU B CD1 1 
ATOM   4469 C  CD2 . LEU B 1 258 ? 19.599  11.282 20.190  1.00 29.71 ? 287 LEU B CD2 1 
ATOM   4470 N  N   . ILE B 1 259 ? 23.175  13.520 23.660  1.00 24.08 ? 288 ILE B N   1 
ATOM   4471 C  CA  . ILE B 1 259 ? 24.344  14.412 23.830  1.00 25.53 ? 288 ILE B CA  1 
ATOM   4472 C  C   . ILE B 1 259 ? 25.643  13.647 23.493  1.00 25.75 ? 288 ILE B C   1 
ATOM   4473 O  O   . ILE B 1 259 ? 26.528  14.220 22.874  1.00 26.19 ? 288 ILE B O   1 
ATOM   4474 C  CB  . ILE B 1 259 ? 24.402  15.026 25.247  1.00 25.93 ? 288 ILE B CB  1 
ATOM   4475 C  CG1 . ILE B 1 259 ? 23.220  15.965 25.540  1.00 25.29 ? 288 ILE B CG1 1 
ATOM   4476 C  CG2 . ILE B 1 259 ? 25.743  15.718 25.503  1.00 26.13 ? 288 ILE B CG2 1 
ATOM   4477 C  CD1 . ILE B 1 259 ? 22.986  16.194 27.029  1.00 24.92 ? 288 ILE B CD1 1 
ATOM   4478 N  N   . ASP B 1 260 ? 25.766  12.390 23.893  1.00 25.28 ? 289 ASP B N   1 
ATOM   4479 C  CA  . ASP B 1 260 ? 26.983  11.588 23.623  1.00 26.77 ? 289 ASP B CA  1 
ATOM   4480 C  C   . ASP B 1 260 ? 27.101  11.259 22.120  1.00 29.14 ? 289 ASP B C   1 
ATOM   4481 O  O   . ASP B 1 260 ? 28.185  11.110 21.590  1.00 29.55 ? 289 ASP B O   1 
ATOM   4482 C  CB  . ASP B 1 260 ? 26.989  10.313 24.470  1.00 25.56 ? 289 ASP B CB  1 
ATOM   4483 C  CG  . ASP B 1 260 ? 27.033  10.565 25.967  1.00 24.55 ? 289 ASP B CG  1 
ATOM   4484 O  OD1 . ASP B 1 260 ? 27.408  11.668 26.360  1.00 24.64 ? 289 ASP B OD1 1 
ATOM   4485 O  OD2 . ASP B 1 260 ? 26.697  9.642  26.725  1.00 24.03 ? 289 ASP B OD2 1 
ATOM   4486 N  N   . GLN B 1 261 ? 25.996  11.180 21.404  1.00 30.25 ? 290 GLN B N   1 
ATOM   4487 C  CA  . GLN B 1 261 ? 26.057  10.964 19.970  1.00 29.62 ? 290 GLN B CA  1 
ATOM   4488 C  C   . GLN B 1 261 ? 26.260  12.279 19.222  1.00 29.19 ? 290 GLN B C   1 
ATOM   4489 O  O   . GLN B 1 261 ? 26.229  12.257 18.002  1.00 29.82 ? 290 GLN B O   1 
ATOM   4490 C  CB  . GLN B 1 261 ? 24.762  10.333 19.482  1.00 31.26 ? 290 GLN B CB  1 
ATOM   4491 C  CG  . GLN B 1 261 ? 24.461  9.000  20.129  1.00 33.12 ? 290 GLN B CG  1 
ATOM   4492 C  CD  . GLN B 1 261 ? 25.376  7.940  19.586  1.00 37.57 ? 290 GLN B CD  1 
ATOM   4493 O  OE1 . GLN B 1 261 ? 26.257  7.456  20.288  1.00 44.58 ? 290 GLN B OE1 1 
ATOM   4494 N  NE2 . GLN B 1 261 ? 25.192  7.607  18.319  1.00 37.99 ? 290 GLN B NE2 1 
ATOM   4495 N  N   . GLY B 1 262 ? 26.416  13.410 19.927  1.00 28.64 ? 291 GLY B N   1 
ATOM   4496 C  CA  . GLY B 1 262 ? 26.746  14.698 19.302  1.00 25.89 ? 291 GLY B CA  1 
ATOM   4497 C  C   . GLY B 1 262 ? 25.531  15.559 18.960  1.00 26.29 ? 291 GLY B C   1 
ATOM   4498 O  O   . GLY B 1 262 ? 25.654  16.518 18.192  1.00 22.38 ? 291 GLY B O   1 
ATOM   4499 N  N   . TYR B 1 263 ? 24.361  15.284 19.542  1.00 26.77 ? 292 TYR B N   1 
ATOM   4500 C  CA  . TYR B 1 263 ? 23.152  15.967 19.081  1.00 27.70 ? 292 TYR B CA  1 
ATOM   4501 C  C   . TYR B 1 263 ? 22.546  16.906 20.129  1.00 27.77 ? 292 TYR B C   1 
ATOM   4502 O  O   . TYR B 1 263 ? 21.329  17.155 20.093  1.00 23.75 ? 292 TYR B O   1 
ATOM   4503 C  CB  . TYR B 1 263 ? 22.112  14.933 18.662  1.00 28.91 ? 292 TYR B CB  1 
ATOM   4504 C  CG  . TYR B 1 263 ? 22.555  14.092 17.502  1.00 27.31 ? 292 TYR B CG  1 
ATOM   4505 C  CD1 . TYR B 1 263 ? 22.738  14.653 16.253  1.00 27.74 ? 292 TYR B CD1 1 
ATOM   4506 C  CD2 . TYR B 1 263 ? 22.768  12.739 17.658  1.00 27.70 ? 292 TYR B CD2 1 
ATOM   4507 C  CE1 . TYR B 1 263 ? 23.125  13.891 15.169  1.00 28.10 ? 292 TYR B CE1 1 
ATOM   4508 C  CE2 . TYR B 1 263 ? 23.138  11.958 16.580  1.00 31.78 ? 292 TYR B CE2 1 
ATOM   4509 C  CZ  . TYR B 1 263 ? 23.314  12.534 15.333  1.00 30.54 ? 292 TYR B CZ  1 
ATOM   4510 O  OH  . TYR B 1 263 ? 23.712  11.756 14.284  1.00 36.72 ? 292 TYR B OH  1 
ATOM   4511 N  N   . ALA B 1 264 ? 23.361  17.452 21.019  1.00 24.96 ? 293 ALA B N   1 
ATOM   4512 C  CA  . ALA B 1 264 ? 22.831  18.341 22.057  1.00 26.92 ? 293 ALA B CA  1 
ATOM   4513 C  C   . ALA B 1 264 ? 22.058  19.528 21.438  1.00 26.54 ? 293 ALA B C   1 
ATOM   4514 O  O   . ALA B 1 264 ? 21.106  20.010 22.046  1.00 27.18 ? 293 ALA B O   1 
ATOM   4515 C  CB  . ALA B 1 264 ? 23.951  18.806 22.959  1.00 25.32 ? 293 ALA B CB  1 
ATOM   4516 N  N   . ASP B 1 265 ? 22.483  19.977 20.256  1.00 26.14 ? 294 ASP B N   1 
ATOM   4517 C  CA  . ASP B 1 265 ? 21.875  21.060 19.441  1.00 28.82 ? 294 ASP B CA  1 
ATOM   4518 C  C   . ASP B 1 265 ? 20.385  20.814 19.155  1.00 25.22 ? 294 ASP B C   1 
ATOM   4519 O  O   . ASP B 1 265 ? 19.666  21.726 18.764  1.00 22.19 ? 294 ASP B O   1 
ATOM   4520 C  CB  . ASP B 1 265 ? 22.484  21.061 18.027  1.00 34.44 ? 294 ASP B CB  1 
ATOM   4521 C  CG  . ASP B 1 265 ? 23.730  21.899 17.811  1.00 41.31 ? 294 ASP B CG  1 
ATOM   4522 O  OD1 . ASP B 1 265 ? 24.320  22.361 18.809  1.00 44.62 ? 294 ASP B OD1 1 
ATOM   4523 O  OD2 . ASP B 1 265 ? 24.106  22.068 16.631  1.00 45.23 ? 294 ASP B OD2 1 
ATOM   4524 N  N   . GLN B 1 266 ? 19.982  19.555 19.182  1.00 23.59 ? 295 GLN B N   1 
ATOM   4525 C  CA  . GLN B 1 266 ? 18.726  19.132 18.558  1.00 25.52 ? 295 GLN B CA  1 
ATOM   4526 C  C   . GLN B 1 266 ? 17.768  18.536 19.605  1.00 23.11 ? 295 GLN B C   1 
ATOM   4527 O  O   . GLN B 1 266 ? 16.796  17.891 19.225  1.00 23.49 ? 295 GLN B O   1 
ATOM   4528 C  CB  . GLN B 1 266 ? 19.040  18.147 17.419  1.00 26.15 ? 295 GLN B CB  1 
ATOM   4529 C  CG  . GLN B 1 266 ? 19.726  18.811 16.222  1.00 26.31 ? 295 GLN B CG  1 
ATOM   4530 C  CD  . GLN B 1 266 ? 20.119  17.855 15.120  1.00 29.49 ? 295 GLN B CD  1 
ATOM   4531 O  OE1 . GLN B 1 266 ? 21.249  17.884 14.637  1.00 30.61 ? 295 GLN B OE1 1 
ATOM   4532 N  NE2 . GLN B 1 266 ? 19.202  16.982 14.715  1.00 28.45 ? 295 GLN B NE2 1 
ATOM   4533 N  N   . ILE B 1 267 ? 18.043  18.713 20.906  1.00 21.45 ? 296 ILE B N   1 
ATOM   4534 C  CA  . ILE B 1 267 ? 17.230  18.086 21.968  1.00 18.97 ? 296 ILE B CA  1 
ATOM   4535 C  C   . ILE B 1 267 ? 16.283  19.135 22.541  1.00 17.52 ? 296 ILE B C   1 
ATOM   4536 O  O   . ILE B 1 267 ? 16.681  20.278 22.759  1.00 17.04 ? 296 ILE B O   1 
ATOM   4537 C  CB  . ILE B 1 267 ? 18.111  17.468 23.077  1.00 19.65 ? 296 ILE B CB  1 
ATOM   4538 C  CG1 . ILE B 1 267 ? 19.072  16.417 22.512  1.00 20.53 ? 296 ILE B CG1 1 
ATOM   4539 C  CG2 . ILE B 1 267 ? 17.270  16.852 24.182  1.00 19.67 ? 296 ILE B CG2 1 
ATOM   4540 C  CD1 . ILE B 1 267 ? 20.075  15.923 23.528  1.00 21.35 ? 296 ILE B CD1 1 
ATOM   4541 N  N   . LEU B 1 268 ? 15.046  18.739 22.794  1.00 16.31 ? 297 LEU B N   1 
ATOM   4542 C  CA  . LEU B 1 268 ? 14.151  19.575 23.530  1.00 16.23 ? 297 LEU B CA  1 
ATOM   4543 C  C   . LEU B 1 268 ? 13.536  18.764 24.671  1.00 15.90 ? 297 LEU B C   1 
ATOM   4544 O  O   . LEU B 1 268 ? 12.962  17.699 24.457  1.00 17.12 ? 297 LEU B O   1 
ATOM   4545 C  CB  . LEU B 1 268 ? 13.071  20.098 22.580  1.00 17.24 ? 297 LEU B CB  1 
ATOM   4546 C  CG  . LEU B 1 268 ? 13.537  21.063 21.498  1.00 16.49 ? 297 LEU B CG  1 
ATOM   4547 C  CD1 . LEU B 1 268 ? 12.337  21.539 20.680  1.00 16.84 ? 297 LEU B CD1 1 
ATOM   4548 C  CD2 . LEU B 1 268 ? 14.288  22.244 22.107  1.00 17.01 ? 297 LEU B CD2 1 
ATOM   4549 N  N   . VAL B 1 269 ? 13.660  19.297 25.879  1.00 16.63 ? 298 VAL B N   1 
ATOM   4550 C  CA  . VAL B 1 269 ? 13.306  18.582 27.092  1.00 15.90 ? 298 VAL B CA  1 
ATOM   4551 C  C   . VAL B 1 269 ? 12.089  19.242 27.763  1.00 15.62 ? 298 VAL B C   1 
ATOM   4552 O  O   . VAL B 1 269 ? 12.053  20.472 27.958  1.00 15.56 ? 298 VAL B O   1 
ATOM   4553 C  CB  . VAL B 1 269 ? 14.500  18.476 28.070  1.00 16.78 ? 298 VAL B CB  1 
ATOM   4554 C  CG1 . VAL B 1 269 ? 14.072  17.909 29.404  1.00 16.10 ? 298 VAL B CG1 1 
ATOM   4555 C  CG2 . VAL B 1 269 ? 15.623  17.624 27.518  1.00 16.59 ? 298 VAL B CG2 1 
ATOM   4556 N  N   . SER B 1 270 ? 11.153  18.397 28.204  1.00 15.46 ? 299 SER B N   1 
ATOM   4557 C  CA  . SER B 1 270 ? 9.941   18.887 28.875  1.00 16.34 ? 299 SER B CA  1 
ATOM   4558 C  C   . SER B 1 270 ? 9.332   17.830 29.817  1.00 16.16 ? 299 SER B C   1 
ATOM   4559 O  O   . SER B 1 270 ? 9.776   16.669 29.831  1.00 16.50 ? 299 SER B O   1 
ATOM   4560 C  CB  . SER B 1 270 ? 8.935   19.366 27.843  1.00 16.68 ? 299 SER B CB  1 
ATOM   4561 O  OG  . SER B 1 270 ? 8.427   20.646 28.217  1.00 19.19 ? 299 SER B OG  1 
ATOM   4562 N  N   . ASN B 1 271 ? 8.263   18.247 30.552  1.00 16.00 ? 300 ASN B N   1 
ATOM   4563 C  CA  . ASN B 1 271 ? 7.534   17.402 31.512  1.00 15.65 ? 300 ASN B CA  1 
ATOM   4564 C  C   . ASN B 1 271 ? 6.244   16.819 30.918  1.00 15.22 ? 300 ASN B C   1 
ATOM   4565 O  O   . ASN B 1 271 ? 5.752   15.779 31.396  1.00 14.46 ? 300 ASN B O   1 
ATOM   4566 C  CB  . ASN B 1 271 ? 7.107   18.206 32.742  1.00 16.86 ? 300 ASN B CB  1 
ATOM   4567 C  CG  . ASN B 1 271 ? 8.230   18.950 33.436  1.00 16.15 ? 300 ASN B CG  1 
ATOM   4568 O  OD1 . ASN B 1 271 ? 8.993   18.347 34.197  1.00 16.82 ? 300 ASN B OD1 1 
ATOM   4569 N  ND2 . ASN B 1 271 ? 8.316   20.251 33.205  1.00 15.61 ? 300 ASN B ND2 1 
ATOM   4570 N  N   . ASP B 1 272 ? 5.663   17.500 29.913  1.00 14.69 ? 301 ASP B N   1 
ATOM   4571 C  CA  . ASP B 1 272 ? 4.323   17.192 29.412  1.00 13.89 ? 301 ASP B CA  1 
ATOM   4572 C  C   . ASP B 1 272 ? 3.323   17.184 30.575  1.00 13.42 ? 301 ASP B C   1 
ATOM   4573 O  O   . ASP B 1 272 ? 2.490   16.287 30.716  1.00 11.98 ? 301 ASP B O   1 
ATOM   4574 C  CB  . ASP B 1 272 ? 4.275   15.878 28.635  1.00 14.49 ? 301 ASP B CB  1 
ATOM   4575 C  CG  . ASP B 1 272 ? 3.005   15.741 27.816  1.00 15.86 ? 301 ASP B CG  1 
ATOM   4576 O  OD1 . ASP B 1 272 ? 2.367   16.795 27.581  1.00 14.35 ? 301 ASP B OD1 1 
ATOM   4577 O  OD2 . ASP B 1 272 ? 2.686   14.600 27.399  1.00 16.41 ? 301 ASP B OD2 1 
ATOM   4578 N  N   . TRP B 1 273 ? 3.412   18.215 31.404  1.00 14.20 ? 302 TRP B N   1 
ATOM   4579 C  CA  . TRP B 1 273 ? 2.597   18.293 32.608  1.00 15.02 ? 302 TRP B CA  1 
ATOM   4580 C  C   . TRP B 1 273 ? 1.309   19.069 32.318  1.00 15.99 ? 302 TRP B C   1 
ATOM   4581 O  O   . TRP B 1 273 ? 1.108   19.631 31.200  1.00 17.46 ? 302 TRP B O   1 
ATOM   4582 C  CB  . TRP B 1 273 ? 3.365   18.903 33.791  1.00 15.19 ? 302 TRP B CB  1 
ATOM   4583 C  CG  . TRP B 1 273 ? 2.938   18.232 35.057  1.00 15.59 ? 302 TRP B CG  1 
ATOM   4584 C  CD1 . TRP B 1 273 ? 2.270   18.771 36.120  1.00 15.86 ? 302 TRP B CD1 1 
ATOM   4585 C  CD2 . TRP B 1 273 ? 3.051   16.830 35.319  1.00 14.46 ? 302 TRP B CD2 1 
ATOM   4586 N  NE1 . TRP B 1 273 ? 1.970   17.787 37.029  1.00 15.69 ? 302 TRP B NE1 1 
ATOM   4587 C  CE2 . TRP B 1 273 ? 2.418   16.588 36.554  1.00 14.59 ? 302 TRP B CE2 1 
ATOM   4588 C  CE3 . TRP B 1 273 ? 3.637   15.759 34.633  1.00 14.96 ? 302 TRP B CE3 1 
ATOM   4589 C  CZ2 . TRP B 1 273 ? 2.370   15.313 37.122  1.00 15.25 ? 302 TRP B CZ2 1 
ATOM   4590 C  CZ3 . TRP B 1 273 ? 3.567   14.498 35.185  1.00 15.10 ? 302 TRP B CZ3 1 
ATOM   4591 C  CH2 . TRP B 1 273 ? 2.970   14.282 36.426  1.00 15.00 ? 302 TRP B CH2 1 
ATOM   4592 N  N   . THR B 1 274 ? 0.444   19.117 33.331  1.00 16.16 ? 303 THR B N   1 
ATOM   4593 C  CA  . THR B 1 274 ? -0.850  19.773 33.197  1.00 16.64 ? 303 THR B CA  1 
ATOM   4594 C  C   . THR B 1 274 ? -1.424  20.048 34.586  1.00 17.10 ? 303 THR B C   1 
ATOM   4595 O  O   . THR B 1 274 ? -0.966  19.471 35.576  1.00 16.84 ? 303 THR B O   1 
ATOM   4596 C  CB  . THR B 1 274 ? -1.788  18.914 32.333  1.00 16.97 ? 303 THR B CB  1 
ATOM   4597 O  OG1 . THR B 1 274 ? -2.917  19.721 31.986  1.00 15.82 ? 303 THR B OG1 1 
ATOM   4598 C  CG2 . THR B 1 274 ? -2.200  17.624 33.021  1.00 16.33 ? 303 THR B CG2 1 
ATOM   4599 N  N   . PHE B 1 275 ? -2.406  20.933 34.648  1.00 16.08 ? 304 PHE B N   1 
ATOM   4600 C  CA  . PHE B 1 275 ? -3.118  21.195 35.893  1.00 16.24 ? 304 PHE B CA  1 
ATOM   4601 C  C   . PHE B 1 275 ? -4.544  20.627 35.862  1.00 16.01 ? 304 PHE B C   1 
ATOM   4602 O  O   . PHE B 1 275 ? -5.163  20.492 36.913  1.00 15.04 ? 304 PHE B O   1 
ATOM   4603 C  CB  . PHE B 1 275 ? -3.054  22.691 36.169  1.00 16.04 ? 304 PHE B CB  1 
ATOM   4604 C  CG  . PHE B 1 275 ? -1.624  23.157 36.241  1.00 15.91 ? 304 PHE B CG  1 
ATOM   4605 C  CD1 . PHE B 1 275 ? -0.802  22.744 37.280  1.00 17.00 ? 304 PHE B CD1 1 
ATOM   4606 C  CD2 . PHE B 1 275 ? -1.067  23.898 35.215  1.00 15.51 ? 304 PHE B CD2 1 
ATOM   4607 C  CE1 . PHE B 1 275 ? 0.522   23.160 37.343  1.00 16.26 ? 304 PHE B CE1 1 
ATOM   4608 C  CE2 . PHE B 1 275 ? 0.262   24.290 35.266  1.00 15.57 ? 304 PHE B CE2 1 
ATOM   4609 C  CZ  . PHE B 1 275 ? 1.043   23.945 36.341  1.00 16.44 ? 304 PHE B CZ  1 
ATOM   4610 N  N   . GLY B 1 276 ? -5.012  20.243 34.671  1.00 16.55 ? 305 GLY B N   1 
ATOM   4611 C  CA  . GLY B 1 276 ? -6.294  19.609 34.457  1.00 17.58 ? 305 GLY B CA  1 
ATOM   4612 C  C   . GLY B 1 276 ? -6.209  18.596 33.322  1.00 17.63 ? 305 GLY B C   1 
ATOM   4613 O  O   . GLY B 1 276 ? -5.464  18.814 32.391  1.00 17.27 ? 305 GLY B O   1 
ATOM   4614 N  N   . PHE B 1 277 ? -6.924  17.479 33.408  1.00 18.52 ? 306 PHE B N   1 
ATOM   4615 C  CA  . PHE B 1 277 ? -6.855  16.470 32.320  1.00 18.55 ? 306 PHE B CA  1 
ATOM   4616 C  C   . PHE B 1 277 ? -8.218  15.780 32.171  1.00 19.94 ? 306 PHE B C   1 
ATOM   4617 O  O   . PHE B 1 277 ? -8.424  14.682 32.680  1.00 22.77 ? 306 PHE B O   1 
ATOM   4618 C  CB  . PHE B 1 277 ? -5.680  15.514 32.566  1.00 19.70 ? 306 PHE B CB  1 
ATOM   4619 C  CG  . PHE B 1 277 ? -5.210  14.690 31.393  1.00 19.39 ? 306 PHE B CG  1 
ATOM   4620 C  CD1 . PHE B 1 277 ? -5.736  14.851 30.121  1.00 20.61 ? 306 PHE B CD1 1 
ATOM   4621 C  CD2 . PHE B 1 277 ? -4.196  13.758 31.561  1.00 22.96 ? 306 PHE B CD2 1 
ATOM   4622 C  CE1 . PHE B 1 277 ? -5.266  14.097 29.057  1.00 20.76 ? 306 PHE B CE1 1 
ATOM   4623 C  CE2 . PHE B 1 277 ? -3.745  12.993 30.498  1.00 22.33 ? 306 PHE B CE2 1 
ATOM   4624 C  CZ  . PHE B 1 277 ? -4.289  13.160 29.248  1.00 20.42 ? 306 PHE B CZ  1 
ATOM   4625 N  N   . SER B 1 278 ? -9.149  16.428 31.455  1.00 19.80 ? 307 SER B N   1 
ATOM   4626 C  CA  . SER B 1 278 ? -10.494 15.893 31.282  1.00 18.28 ? 307 SER B CA  1 
ATOM   4627 C  C   . SER B 1 278 ? -10.525 14.849 30.165  1.00 18.55 ? 307 SER B C   1 
ATOM   4628 O  O   . SER B 1 278 ? -11.415 13.974 30.189  1.00 18.79 ? 307 SER B O   1 
ATOM   4629 C  CB  . SER B 1 278 ? -11.508 16.981 31.024  1.00 17.02 ? 307 SER B CB  1 
ATOM   4630 O  OG  . SER B 1 278 ? -11.270 17.627 29.778  1.00 15.19 ? 307 SER B OG  1 
ATOM   4631 N  N   . SER B 1 279 ? -9.612  14.926 29.193  1.00 18.92 ? 308 SER B N   1 
ATOM   4632 C  CA  . SER B 1 279 ? -9.648  13.972 28.068  1.00 19.46 ? 308 SER B CA  1 
ATOM   4633 C  C   . SER B 1 279 ? -8.864  12.705 28.425  1.00 19.40 ? 308 SER B C   1 
ATOM   4634 O  O   . SER B 1 279 ? -8.260  12.079 27.551  1.00 17.82 ? 308 SER B O   1 
ATOM   4635 C  CB  . SER B 1 279 ? -9.196  14.595 26.773  1.00 20.06 ? 308 SER B CB  1 
ATOM   4636 O  OG  . SER B 1 279 ? -8.127  15.481 27.020  1.00 22.88 ? 308 SER B OG  1 
ATOM   4637 N  N   . TYR B 1 280 ? -8.973  12.278 29.689  1.00 19.26 ? 309 TYR B N   1 
ATOM   4638 C  CA  . TYR B 1 280 ? -8.588  10.916 30.073  1.00 19.98 ? 309 TYR B CA  1 
ATOM   4639 C  C   . TYR B 1 280 ? -9.514  10.472 31.211  1.00 19.83 ? 309 TYR B C   1 
ATOM   4640 O  O   . TYR B 1 280 ? -10.483 11.168 31.540  1.00 18.93 ? 309 TYR B O   1 
ATOM   4641 C  CB  . TYR B 1 280 ? -7.092  10.835 30.421  1.00 21.04 ? 309 TYR B CB  1 
ATOM   4642 C  CG  . TYR B 1 280 ? -6.481  9.452  30.336  1.00 21.60 ? 309 TYR B CG  1 
ATOM   4643 C  CD1 . TYR B 1 280 ? -6.474  8.736  29.144  1.00 22.57 ? 309 TYR B CD1 1 
ATOM   4644 C  CD2 . TYR B 1 280 ? -5.917  8.835  31.446  1.00 22.15 ? 309 TYR B CD2 1 
ATOM   4645 C  CE1 . TYR B 1 280 ? -5.914  7.464  29.060  1.00 22.32 ? 309 TYR B CE1 1 
ATOM   4646 C  CE2 . TYR B 1 280 ? -5.363  7.562  31.379  1.00 20.33 ? 309 TYR B CE2 1 
ATOM   4647 C  CZ  . TYR B 1 280 ? -5.352  6.879  30.178  1.00 20.71 ? 309 TYR B CZ  1 
ATOM   4648 O  OH  . TYR B 1 280 ? -4.800  5.631  30.089  1.00 22.50 ? 309 TYR B OH  1 
ATOM   4649 N  N   . VAL B 1 281 ? -9.187  9.346  31.837  1.00 19.62 ? 310 VAL B N   1 
ATOM   4650 C  CA  . VAL B 1 281 ? -9.998  8.797  32.917  1.00 19.51 ? 310 VAL B CA  1 
ATOM   4651 C  C   . VAL B 1 281 ? -10.068 9.801  34.081  1.00 19.32 ? 310 VAL B C   1 
ATOM   4652 O  O   . VAL B 1 281 ? -9.139  10.592 34.318  1.00 16.30 ? 310 VAL B O   1 
ATOM   4653 C  CB  . VAL B 1 281 ? -9.509  7.395  33.348  1.00 20.54 ? 310 VAL B CB  1 
ATOM   4654 C  CG1 . VAL B 1 281 ? -9.573  6.430  32.179  1.00 20.95 ? 310 VAL B CG1 1 
ATOM   4655 C  CG2 . VAL B 1 281 ? -8.107  7.391  33.955  1.00 20.59 ? 310 VAL B CG2 1 
ATOM   4656 N  N   . THR B 1 282 ? -11.226 9.789  34.750  1.00 19.42 ? 311 THR B N   1 
ATOM   4657 C  CA  . THR B 1 282 ? -11.475 10.641 35.896  1.00 21.04 ? 311 THR B CA  1 
ATOM   4658 C  C   . THR B 1 282 ? -10.390 10.407 36.950  1.00 22.51 ? 311 THR B C   1 
ATOM   4659 O  O   . THR B 1 282 ? -9.922  9.261  37.141  1.00 23.54 ? 311 THR B O   1 
ATOM   4660 C  CB  . THR B 1 282 ? -12.869 10.373 36.498  1.00 21.85 ? 311 THR B CB  1 
ATOM   4661 O  OG1 . THR B 1 282 ? -13.829 10.550 35.457  1.00 21.29 ? 311 THR B OG1 1 
ATOM   4662 C  CG2 . THR B 1 282 ? -13.220 11.293 37.651  1.00 22.27 ? 311 THR B CG2 1 
ATOM   4663 N  N   . ASN B 1 283 ? -10.001 11.510 37.581  1.00 23.19 ? 312 ASN B N   1 
ATOM   4664 C  CA  . ASN B 1 283 ? -9.029  11.569 38.700  1.00 26.26 ? 312 ASN B CA  1 
ATOM   4665 C  C   . ASN B 1 283 ? -7.600  11.223 38.245  1.00 24.65 ? 312 ASN B C   1 
ATOM   4666 O  O   . ASN B 1 283 ? -6.729  11.047 39.106  1.00 22.05 ? 312 ASN B O   1 
ATOM   4667 C  CB  . ASN B 1 283 ? -9.443  10.676 39.879  1.00 27.57 ? 312 ASN B CB  1 
ATOM   4668 C  CG  . ASN B 1 283 ? -10.735 11.150 40.513  1.00 26.57 ? 312 ASN B CG  1 
ATOM   4669 O  OD1 . ASN B 1 283 ? -10.937 12.350 40.679  1.00 29.47 ? 312 ASN B OD1 1 
ATOM   4670 N  ND2 . ASN B 1 283 ? -11.597 10.218 40.858  1.00 27.52 ? 312 ASN B ND2 1 
ATOM   4671 N  N   . ILE B 1 284 ? -7.343  11.131 36.940  1.00 23.00 ? 313 ILE B N   1 
ATOM   4672 C  CA  . ILE B 1 284 ? -5.958  10.909 36.467  1.00 21.45 ? 313 ILE B CA  1 
ATOM   4673 C  C   . ILE B 1 284 ? -5.032  12.000 37.009  1.00 21.61 ? 313 ILE B C   1 
ATOM   4674 O  O   . ILE B 1 284 ? -3.831  11.748 37.161  1.00 19.78 ? 313 ILE B O   1 
ATOM   4675 C  CB  . ILE B 1 284 ? -5.846  10.865 34.937  1.00 21.76 ? 313 ILE B CB  1 
ATOM   4676 C  CG1 . ILE B 1 284 ? -4.466  10.358 34.493  1.00 22.26 ? 313 ILE B CG1 1 
ATOM   4677 C  CG2 . ILE B 1 284 ? -6.191  12.228 34.340  1.00 22.24 ? 313 ILE B CG2 1 
ATOM   4678 C  CD1 . ILE B 1 284 ? -4.186  8.895  34.842  1.00 22.12 ? 313 ILE B CD1 1 
ATOM   4679 N  N   . MET B 1 285 ? -5.556  13.200 37.228  1.00 19.47 ? 314 MET B N   1 
ATOM   4680 C  CA  . MET B 1 285 ? -4.722  14.293 37.644  1.00 21.75 ? 314 MET B CA  1 
ATOM   4681 C  C   . MET B 1 285 ? -4.202  14.046 39.077  1.00 23.81 ? 314 MET B C   1 
ATOM   4682 O  O   . MET B 1 285 ? -3.099  14.478 39.418  1.00 22.36 ? 314 MET B O   1 
ATOM   4683 C  CB  . MET B 1 285 ? -5.478  15.623 37.548  1.00 21.64 ? 314 MET B CB  1 
ATOM   4684 C  CG  . MET B 1 285 ? -4.660  16.847 37.914  1.00 21.31 ? 314 MET B CG  1 
ATOM   4685 S  SD  . MET B 1 285 ? -3.572  17.461 36.605  1.00 21.63 ? 314 MET B SD  1 
ATOM   4686 C  CE  . MET B 1 285 ? -2.117  16.418 36.770  1.00 21.87 ? 314 MET B CE  1 
ATOM   4687 N  N   . ASP B 1 286 ? -4.954  13.327 39.898  1.00 23.91 ? 315 ASP B N   1 
ATOM   4688 C  CA  . ASP B 1 286 ? -4.510  12.976 41.278  1.00 24.06 ? 315 ASP B CA  1 
ATOM   4689 C  C   . ASP B 1 286 ? -3.434  11.876 41.222  1.00 24.11 ? 315 ASP B C   1 
ATOM   4690 O  O   . ASP B 1 286 ? -2.478  11.858 42.044  1.00 23.26 ? 315 ASP B O   1 
ATOM   4691 C  CB  . ASP B 1 286 ? -5.713  12.534 42.129  1.00 25.49 ? 315 ASP B CB  1 
ATOM   4692 C  CG  . ASP B 1 286 ? -6.730  13.645 42.305  1.00 25.50 ? 315 ASP B CG  1 
ATOM   4693 O  OD1 . ASP B 1 286 ? -6.335  14.797 42.148  1.00 26.62 ? 315 ASP B OD1 1 
ATOM   4694 O  OD2 . ASP B 1 286 ? -7.899  13.347 42.570  1.00 29.47 ? 315 ASP B OD2 1 
ATOM   4695 N  N   . VAL B 1 287 ? -3.581  10.937 40.286  1.00 20.85 ? 316 VAL B N   1 
ATOM   4696 C  CA  . VAL B 1 287 ? -2.545  9.914  40.069  1.00 20.57 ? 316 VAL B CA  1 
ATOM   4697 C  C   . VAL B 1 287 ? -1.233  10.565 39.590  1.00 19.49 ? 316 VAL B C   1 
ATOM   4698 O  O   . VAL B 1 287 ? -0.145  10.256 40.070  1.00 16.83 ? 316 VAL B O   1 
ATOM   4699 C  CB  . VAL B 1 287 ? -3.019  8.846  39.066  1.00 21.26 ? 316 VAL B CB  1 
ATOM   4700 C  CG1 . VAL B 1 287 ? -1.927  7.807  38.789  1.00 20.69 ? 316 VAL B CG1 1 
ATOM   4701 C  CG2 . VAL B 1 287 ? -4.316  8.196  39.538  1.00 21.07 ? 316 VAL B CG2 1 
ATOM   4702 N  N   . MET B 1 288 ? -1.337  11.455 38.630  1.00 18.64 ? 317 MET B N   1 
ATOM   4703 C  CA  . MET B 1 288 ? -0.172  12.121 38.073  1.00 19.44 ? 317 MET B CA  1 
ATOM   4704 C  C   . MET B 1 288 ? 0.516   12.974 39.157  1.00 19.54 ? 317 MET B C   1 
ATOM   4705 O  O   . MET B 1 288 ? 1.740   12.959 39.292  1.00 16.82 ? 317 MET B O   1 
ATOM   4706 C  CB  . MET B 1 288 ? -0.590  12.998 36.885  1.00 19.28 ? 317 MET B CB  1 
ATOM   4707 C  CG  . MET B 1 288 ? -0.890  12.173 35.639  1.00 20.68 ? 317 MET B CG  1 
ATOM   4708 S  SD  . MET B 1 288 ? -1.468  13.168 34.234  1.00 20.19 ? 317 MET B SD  1 
ATOM   4709 C  CE  . MET B 1 288 ? 0.012   14.053 33.754  1.00 20.61 ? 317 MET B CE  1 
ATOM   4710 N  N   . ASP B 1 289 ? -0.277  13.685 39.954  1.00 19.64 ? 318 ASP B N   1 
ATOM   4711 C  CA  . ASP B 1 289 ? 0.301   14.583 40.937  1.00 20.85 ? 318 ASP B CA  1 
ATOM   4712 C  C   . ASP B 1 289 ? 0.983   13.776 42.040  1.00 22.15 ? 318 ASP B C   1 
ATOM   4713 O  O   . ASP B 1 289 ? 1.988   14.234 42.554  1.00 21.26 ? 318 ASP B O   1 
ATOM   4714 C  CB  . ASP B 1 289 ? -0.739  15.529 41.532  1.00 20.81 ? 318 ASP B CB  1 
ATOM   4715 C  CG  . ASP B 1 289 ? -1.048  16.675 40.603  1.00 21.62 ? 318 ASP B CG  1 
ATOM   4716 O  OD1 . ASP B 1 289 ? -0.182  17.033 39.793  1.00 22.66 ? 318 ASP B OD1 1 
ATOM   4717 O  OD2 . ASP B 1 289 ? -2.144  17.200 40.705  1.00 22.57 ? 318 ASP B OD2 1 
ATOM   4718 N  N   . ARG B 1 290 ? 0.459   12.602 42.376  1.00 23.18 ? 319 ARG B N   1 
ATOM   4719 C  CA  . ARG B 1 290 ? 1.164   11.644 43.285  1.00 25.98 ? 319 ARG B CA  1 
ATOM   4720 C  C   . ARG B 1 290 ? 2.551   11.261 42.728  1.00 23.63 ? 319 ARG B C   1 
ATOM   4721 O  O   . ARG B 1 290 ? 3.561   11.313 43.439  1.00 20.42 ? 319 ARG B O   1 
ATOM   4722 C  CB  . ARG B 1 290 ? 0.319   10.378 43.488  1.00 31.16 ? 319 ARG B CB  1 
ATOM   4723 C  CG  . ARG B 1 290 ? 0.993   9.274  44.306  1.00 37.39 ? 319 ARG B CG  1 
ATOM   4724 C  CD  . ARG B 1 290 ? 1.596   8.145  43.471  1.00 41.06 ? 319 ARG B CD  1 
ATOM   4725 N  NE  . ARG B 1 290 ? 2.260   7.113  44.268  1.00 45.98 ? 319 ARG B NE  1 
ATOM   4726 C  CZ  . ARG B 1 290 ? 1.673   6.003  44.734  1.00 51.58 ? 319 ARG B CZ  1 
ATOM   4727 N  NH1 . ARG B 1 290 ? 0.357   5.840  44.630  1.00 47.37 ? 319 ARG B NH1 1 
ATOM   4728 N  NH2 . ARG B 1 290 ? 2.414   5.059  45.304  1.00 49.66 ? 319 ARG B NH2 1 
ATOM   4729 N  N   . VAL B 1 291 ? 2.584   10.871 41.460  1.00 21.52 ? 320 VAL B N   1 
ATOM   4730 C  CA  . VAL B 1 291 ? 3.788   10.345 40.820  1.00 21.92 ? 320 VAL B CA  1 
ATOM   4731 C  C   . VAL B 1 291 ? 4.847   11.432 40.737  1.00 21.30 ? 320 VAL B C   1 
ATOM   4732 O  O   . VAL B 1 291 ? 5.989   11.142 41.002  1.00 21.39 ? 320 VAL B O   1 
ATOM   4733 C  CB  . VAL B 1 291 ? 3.494   9.800  39.418  1.00 22.91 ? 320 VAL B CB  1 
ATOM   4734 C  CG1 . VAL B 1 291 ? 4.770   9.670  38.601  1.00 25.29 ? 320 VAL B CG1 1 
ATOM   4735 C  CG2 . VAL B 1 291 ? 2.762   8.471  39.520  1.00 24.55 ? 320 VAL B CG2 1 
ATOM   4736 N  N   . ASN B 1 292 ? 4.452   12.657 40.356  1.00 20.39 ? 321 ASN B N   1 
ATOM   4737 C  CA  . ASN B 1 292 ? 5.406   13.791 40.227  1.00 18.07 ? 321 ASN B CA  1 
ATOM   4738 C  C   . ASN B 1 292 ? 4.825   15.029 40.911  1.00 17.83 ? 321 ASN B C   1 
ATOM   4739 O  O   . ASN B 1 292 ? 4.216   15.873 40.248  1.00 15.46 ? 321 ASN B O   1 
ATOM   4740 C  CB  . ASN B 1 292 ? 5.744   14.088 38.767  1.00 18.83 ? 321 ASN B CB  1 
ATOM   4741 C  CG  . ASN B 1 292 ? 6.434   15.418 38.547  1.00 17.68 ? 321 ASN B CG  1 
ATOM   4742 O  OD1 . ASN B 1 292 ? 7.228   15.870 39.362  1.00 17.98 ? 321 ASN B OD1 1 
ATOM   4743 N  ND2 . ASN B 1 292 ? 6.152   16.042 37.418  1.00 18.10 ? 321 ASN B ND2 1 
ATOM   4744 N  N   . PRO B 1 293 ? 5.043   15.143 42.241  1.00 18.22 ? 322 PRO B N   1 
ATOM   4745 C  CA  . PRO B 1 293 ? 4.593   16.294 43.087  1.00 18.46 ? 322 PRO B CA  1 
ATOM   4746 C  C   . PRO B 1 293 ? 5.230   17.632 42.705  1.00 17.78 ? 322 PRO B C   1 
ATOM   4747 O  O   . PRO B 1 293 ? 4.671   18.690 43.009  1.00 18.61 ? 322 PRO B O   1 
ATOM   4748 C  CB  . PRO B 1 293 ? 4.999   15.908 44.514  1.00 19.46 ? 322 PRO B CB  1 
ATOM   4749 C  CG  . PRO B 1 293 ? 4.963   14.395 44.488  1.00 19.42 ? 322 PRO B CG  1 
ATOM   4750 C  CD  . PRO B 1 293 ? 5.471   14.024 43.108  1.00 18.80 ? 322 PRO B CD  1 
ATOM   4751 N  N   . ASP B 1 294 ? 6.360   17.550 41.995  1.00 16.78 ? 323 ASP B N   1 
ATOM   4752 C  CA  . ASP B 1 294 ? 7.096   18.705 41.513  1.00 16.83 ? 323 ASP B CA  1 
ATOM   4753 C  C   . ASP B 1 294 ? 6.407   19.314 40.286  1.00 16.35 ? 323 ASP B C   1 
ATOM   4754 O  O   . ASP B 1 294 ? 6.669   20.470 39.951  1.00 15.51 ? 323 ASP B O   1 
ATOM   4755 C  CB  . ASP B 1 294 ? 8.549   18.335 41.158  1.00 16.93 ? 323 ASP B CB  1 
ATOM   4756 C  CG  . ASP B 1 294 ? 9.460   18.216 42.369  1.00 17.00 ? 323 ASP B CG  1 
ATOM   4757 O  OD1 . ASP B 1 294 ? 9.510   19.168 43.134  1.00 16.44 ? 323 ASP B OD1 1 
ATOM   4758 O  OD2 . ASP B 1 294 ? 10.064  17.156 42.543  1.00 17.66 ? 323 ASP B OD2 1 
ATOM   4759 N  N   . GLY B 1 295 ? 5.578   18.528 39.603  1.00 16.21 ? 324 GLY B N   1 
ATOM   4760 C  CA  . GLY B 1 295 ? 4.905   19.020 38.391  1.00 15.72 ? 324 GLY B CA  1 
ATOM   4761 C  C   . GLY B 1 295 ? 5.887   19.572 37.373  1.00 15.52 ? 324 GLY B C   1 
ATOM   4762 O  O   . GLY B 1 295 ? 6.821   18.886 36.951  1.00 12.33 ? 324 GLY B O   1 
ATOM   4763 N  N   . MET B 1 296 ? 5.673   20.829 36.977  1.00 15.98 ? 325 MET B N   1 
ATOM   4764 C  CA  . MET B 1 296 ? 6.431   21.381 35.886  1.00 16.25 ? 325 MET B CA  1 
ATOM   4765 C  C   . MET B 1 296 ? 7.835   21.719 36.375  1.00 16.03 ? 325 MET B C   1 
ATOM   4766 O  O   . MET B 1 296 ? 8.752   21.910 35.550  1.00 16.29 ? 325 MET B O   1 
ATOM   4767 C  CB  . MET B 1 296 ? 5.770   22.639 35.315  1.00 17.22 ? 325 MET B CB  1 
ATOM   4768 C  CG  . MET B 1 296 ? 4.578   22.323 34.422  1.00 16.97 ? 325 MET B CG  1 
ATOM   4769 S  SD  . MET B 1 296 ? 3.905   23.793 33.630  1.00 19.34 ? 325 MET B SD  1 
ATOM   4770 C  CE  . MET B 1 296 ? 2.511   23.017 32.818  1.00 20.33 ? 325 MET B CE  1 
ATOM   4771 N  N   . ALA B 1 297 ? 8.011   21.781 37.697  1.00 16.08 ? 326 ALA B N   1 
ATOM   4772 C  CA  . ALA B 1 297 ? 9.337   22.068 38.259  1.00 16.77 ? 326 ALA B CA  1 
ATOM   4773 C  C   . ALA B 1 297 ? 10.261  20.835 38.157  1.00 17.78 ? 326 ALA B C   1 
ATOM   4774 O  O   . ALA B 1 297 ? 11.477  20.895 38.466  1.00 18.73 ? 326 ALA B O   1 
ATOM   4775 C  CB  . ALA B 1 297 ? 9.164   22.548 39.676  1.00 16.32 ? 326 ALA B CB  1 
ATOM   4776 N  N   . PHE B 1 298 ? 9.728   19.708 37.707  1.00 17.25 ? 327 PHE B N   1 
ATOM   4777 C  CA  . PHE B 1 298 ? 10.472  18.469 37.754  1.00 18.20 ? 327 PHE B CA  1 
ATOM   4778 C  C   . PHE B 1 298 ? 11.758  18.568 36.917  1.00 19.06 ? 327 PHE B C   1 
ATOM   4779 O  O   . PHE B 1 298 ? 12.830  18.084 37.366  1.00 18.57 ? 327 PHE B O   1 
ATOM   4780 C  CB  . PHE B 1 298 ? 9.603   17.305 37.297  1.00 18.34 ? 327 PHE B CB  1 
ATOM   4781 C  CG  . PHE B 1 298 ? 10.307  15.972 37.333  1.00 19.05 ? 327 PHE B CG  1 
ATOM   4782 C  CD1 . PHE B 1 298 ? 10.408  15.276 38.521  1.00 19.11 ? 327 PHE B CD1 1 
ATOM   4783 C  CD2 . PHE B 1 298 ? 10.841  15.422 36.179  1.00 19.16 ? 327 PHE B CD2 1 
ATOM   4784 C  CE1 . PHE B 1 298 ? 11.035  14.043 38.556  1.00 21.34 ? 327 PHE B CE1 1 
ATOM   4785 C  CE2 . PHE B 1 298 ? 11.479  14.196 36.214  1.00 19.80 ? 327 PHE B CE2 1 
ATOM   4786 C  CZ  . PHE B 1 298 ? 11.578  13.512 37.405  1.00 20.54 ? 327 PHE B CZ  1 
ATOM   4787 N  N   . ILE B 1 299 ? 11.700  19.187 35.742  1.00 18.44 ? 328 ILE B N   1 
ATOM   4788 C  CA  . ILE B 1 299 ? 12.903  19.236 34.899  1.00 19.75 ? 328 ILE B CA  1 
ATOM   4789 C  C   . ILE B 1 299 ? 13.992  20.003 35.669  1.00 21.79 ? 328 ILE B C   1 
ATOM   4790 O  O   . ILE B 1 299 ? 15.038  19.430 35.902  1.00 22.03 ? 328 ILE B O   1 
ATOM   4791 C  CB  . ILE B 1 299 ? 12.622  19.804 33.480  1.00 20.39 ? 328 ILE B CB  1 
ATOM   4792 C  CG1 . ILE B 1 299 ? 11.664  18.914 32.674  1.00 19.00 ? 328 ILE B CG1 1 
ATOM   4793 C  CG2 . ILE B 1 299 ? 13.909  20.072 32.700  1.00 20.94 ? 328 ILE B CG2 1 
ATOM   4794 C  CD1 . ILE B 1 299 ? 12.044  17.445 32.615  1.00 19.49 ? 328 ILE B CD1 1 
ATOM   4795 N  N   . PRO B 1 300 ? 13.742  21.276 36.083  1.00 22.41 ? 329 PRO B N   1 
ATOM   4796 C  CA  . PRO B 1 300 ? 14.821  22.040 36.727  1.00 22.95 ? 329 PRO B CA  1 
ATOM   4797 C  C   . PRO B 1 300 ? 15.274  21.439 38.070  1.00 24.63 ? 329 PRO B C   1 
ATOM   4798 O  O   . PRO B 1 300 ? 16.489  21.381 38.309  1.00 25.14 ? 329 PRO B O   1 
ATOM   4799 C  CB  . PRO B 1 300 ? 14.283  23.468 36.912  1.00 23.19 ? 329 PRO B CB  1 
ATOM   4800 C  CG  . PRO B 1 300 ? 12.775  23.320 36.785  1.00 22.60 ? 329 PRO B CG  1 
ATOM   4801 C  CD  . PRO B 1 300 ? 12.598  22.168 35.820  1.00 22.71 ? 329 PRO B CD  1 
ATOM   4802 N  N   . LEU B 1 301 ? 14.342  20.955 38.903  1.00 21.90 ? 330 LEU B N   1 
ATOM   4803 C  CA  . LEU B 1 301 ? 14.680  20.487 40.261  1.00 21.84 ? 330 LEU B CA  1 
ATOM   4804 C  C   . LEU B 1 301 ? 15.292  19.088 40.239  1.00 23.74 ? 330 LEU B C   1 
ATOM   4805 O  O   . LEU B 1 301 ? 16.040  18.786 41.134  1.00 26.19 ? 330 LEU B O   1 
ATOM   4806 C  CB  . LEU B 1 301 ? 13.436  20.484 41.156  1.00 21.19 ? 330 LEU B CB  1 
ATOM   4807 C  CG  . LEU B 1 301 ? 12.789  21.852 41.395  1.00 21.29 ? 330 LEU B CG  1 
ATOM   4808 C  CD1 . LEU B 1 301 ? 11.617  21.749 42.368  1.00 21.61 ? 330 LEU B CD1 1 
ATOM   4809 C  CD2 . LEU B 1 301 ? 13.797  22.862 41.911  1.00 22.60 ? 330 LEU B CD2 1 
ATOM   4810 N  N   . ARG B 1 302 ? 14.942  18.206 39.309  1.00 22.33 ? 331 ARG B N   1 
ATOM   4811 C  CA  . ARG B 1 302 ? 15.357  16.794 39.440  1.00 24.77 ? 331 ARG B CA  1 
ATOM   4812 C  C   . ARG B 1 302 ? 16.196  16.349 38.238  1.00 24.47 ? 331 ARG B C   1 
ATOM   4813 O  O   . ARG B 1 302 ? 17.176  15.642 38.389  1.00 21.79 ? 331 ARG B O   1 
ATOM   4814 C  CB  . ARG B 1 302 ? 14.146  15.868 39.570  1.00 26.83 ? 331 ARG B CB  1 
ATOM   4815 C  CG  . ARG B 1 302 ? 13.167  16.277 40.665  1.00 31.27 ? 331 ARG B CG  1 
ATOM   4816 C  CD  . ARG B 1 302 ? 13.735  16.255 42.091  1.00 35.16 ? 331 ARG B CD  1 
ATOM   4817 N  NE  . ARG B 1 302 ? 13.669  14.908 42.674  1.00 41.56 ? 331 ARG B NE  1 
ATOM   4818 C  CZ  . ARG B 1 302 ? 12.711  14.442 43.490  1.00 40.14 ? 331 ARG B CZ  1 
ATOM   4819 N  NH1 . ARG B 1 302 ? 12.654  13.152 43.760  1.00 38.58 ? 331 ARG B NH1 1 
ATOM   4820 N  NH2 . ARG B 1 302 ? 11.824  15.252 44.041  1.00 40.30 ? 331 ARG B NH2 1 
ATOM   4821 N  N   . VAL B 1 303 ? 15.783  16.718 37.034  1.00 23.74 ? 332 VAL B N   1 
ATOM   4822 C  CA  . VAL B 1 303 ? 16.420  16.173 35.872  1.00 23.23 ? 332 VAL B CA  1 
ATOM   4823 C  C   . VAL B 1 303 ? 17.721  16.931 35.583  1.00 22.36 ? 332 VAL B C   1 
ATOM   4824 O  O   . VAL B 1 303 ? 18.685  16.294 35.190  1.00 22.05 ? 332 VAL B O   1 
ATOM   4825 C  CB  . VAL B 1 303 ? 15.477  16.200 34.661  1.00 23.31 ? 332 VAL B CB  1 
ATOM   4826 C  CG1 . VAL B 1 303 ? 16.208  15.744 33.416  1.00 24.33 ? 332 VAL B CG1 1 
ATOM   4827 C  CG2 . VAL B 1 303 ? 14.228  15.371 34.918  1.00 22.48 ? 332 VAL B CG2 1 
ATOM   4828 N  N   . ILE B 1 304 ? 17.759  18.252 35.734  1.00 21.94 ? 333 ILE B N   1 
ATOM   4829 C  CA  . ILE B 1 304 ? 19.012  18.976 35.483  1.00 24.29 ? 333 ILE B CA  1 
ATOM   4830 C  C   . ILE B 1 304 ? 20.092  18.473 36.465  1.00 25.85 ? 333 ILE B C   1 
ATOM   4831 O  O   . ILE B 1 304 ? 21.143  18.012 36.023  1.00 28.37 ? 333 ILE B O   1 
ATOM   4832 C  CB  . ILE B 1 304 ? 18.795  20.505 35.524  1.00 24.21 ? 333 ILE B CB  1 
ATOM   4833 C  CG1 . ILE B 1 304 ? 17.954  20.986 34.342  1.00 27.02 ? 333 ILE B CG1 1 
ATOM   4834 C  CG2 . ILE B 1 304 ? 20.098  21.283 35.618  1.00 25.48 ? 333 ILE B CG2 1 
ATOM   4835 C  CD1 . ILE B 1 304 ? 18.461  20.578 32.990  1.00 28.42 ? 333 ILE B CD1 1 
ATOM   4836 N  N   . PRO B 1 305 ? 19.843  18.513 37.783  1.00 26.68 ? 334 PRO B N   1 
ATOM   4837 C  CA  . PRO B 1 305 ? 20.800  17.962 38.778  1.00 27.14 ? 334 PRO B CA  1 
ATOM   4838 C  C   . PRO B 1 305 ? 21.235  16.516 38.488  1.00 28.73 ? 334 PRO B C   1 
ATOM   4839 O  O   . PRO B 1 305 ? 22.403  16.177 38.677  1.00 28.93 ? 334 PRO B O   1 
ATOM   4840 C  CB  . PRO B 1 305 ? 20.050  18.013 40.118  1.00 27.95 ? 334 PRO B CB  1 
ATOM   4841 C  CG  . PRO B 1 305 ? 19.142  19.211 39.969  1.00 27.98 ? 334 PRO B CG  1 
ATOM   4842 C  CD  . PRO B 1 305 ? 18.773  19.233 38.501  1.00 28.12 ? 334 PRO B CD  1 
ATOM   4843 N  N   . PHE B 1 306 ? 20.332  15.689 37.976  1.00 27.24 ? 335 PHE B N   1 
ATOM   4844 C  CA  . PHE B 1 306 ? 20.645  14.278 37.661  1.00 28.30 ? 335 PHE B CA  1 
ATOM   4845 C  C   . PHE B 1 306 ? 21.635  14.160 36.493  1.00 28.13 ? 335 PHE B C   1 
ATOM   4846 O  O   . PHE B 1 306 ? 22.596  13.368 36.540  1.00 28.00 ? 335 PHE B O   1 
ATOM   4847 C  CB  . PHE B 1 306 ? 19.351  13.550 37.307  1.00 27.23 ? 335 PHE B CB  1 
ATOM   4848 C  CG  . PHE B 1 306 ? 19.519  12.148 36.792  1.00 27.06 ? 335 PHE B CG  1 
ATOM   4849 C  CD1 . PHE B 1 306 ? 19.706  11.088 37.667  1.00 27.34 ? 335 PHE B CD1 1 
ATOM   4850 C  CD2 . PHE B 1 306 ? 19.445  11.877 35.435  1.00 25.65 ? 335 PHE B CD2 1 
ATOM   4851 C  CE1 . PHE B 1 306 ? 19.821  9.789  37.194  1.00 26.13 ? 335 PHE B CE1 1 
ATOM   4852 C  CE2 . PHE B 1 306 ? 19.560  10.578 34.969  1.00 25.85 ? 335 PHE B CE2 1 
ATOM   4853 C  CZ  . PHE B 1 306 ? 19.729  9.533  35.849  1.00 25.84 ? 335 PHE B CZ  1 
ATOM   4854 N  N   . LEU B 1 307 ? 21.379  14.939 35.441  1.00 25.92 ? 336 LEU B N   1 
ATOM   4855 C  CA  . LEU B 1 307 ? 22.273  14.998 34.305  1.00 25.94 ? 336 LEU B CA  1 
ATOM   4856 C  C   . LEU B 1 307 ? 23.627  15.586 34.735  1.00 26.42 ? 336 LEU B C   1 
ATOM   4857 O  O   . LEU B 1 307 ? 24.669  15.072 34.329  1.00 26.36 ? 336 LEU B O   1 
ATOM   4858 C  CB  . LEU B 1 307 ? 21.618  15.807 33.181  1.00 22.93 ? 336 LEU B CB  1 
ATOM   4859 C  CG  . LEU B 1 307 ? 20.391  15.151 32.552  1.00 22.06 ? 336 LEU B CG  1 
ATOM   4860 C  CD1 . LEU B 1 307 ? 19.794  16.036 31.470  1.00 19.72 ? 336 LEU B CD1 1 
ATOM   4861 C  CD2 . LEU B 1 307 ? 20.745  13.777 31.990  1.00 21.51 ? 336 LEU B CD2 1 
ATOM   4862 N  N   . ARG B 1 308 ? 23.633  16.638 35.537  1.00 28.51 ? 337 ARG B N   1 
ATOM   4863 C  CA  . ARG B 1 308 ? 24.918  17.185 36.045  1.00 33.09 ? 337 ARG B CA  1 
ATOM   4864 C  C   . ARG B 1 308 ? 25.747  16.090 36.723  1.00 33.63 ? 337 ARG B C   1 
ATOM   4865 O  O   . ARG B 1 308 ? 26.926  15.923 36.426  1.00 30.73 ? 337 ARG B O   1 
ATOM   4866 C  CB  . ARG B 1 308 ? 24.709  18.297 37.072  1.00 34.72 ? 337 ARG B CB  1 
ATOM   4867 C  CG  . ARG B 1 308 ? 24.687  19.691 36.462  1.00 38.54 ? 337 ARG B CG  1 
ATOM   4868 C  CD  . ARG B 1 308 ? 25.118  20.757 37.455  1.00 41.31 ? 337 ARG B CD  1 
ATOM   4869 N  NE  . ARG B 1 308 ? 24.203  21.887 37.409  1.00 43.47 ? 337 ARG B NE  1 
ATOM   4870 C  CZ  . ARG B 1 308 ? 23.061  21.962 38.086  1.00 41.98 ? 337 ARG B CZ  1 
ATOM   4871 N  NH1 . ARG B 1 308 ? 22.742  21.026 38.966  1.00 41.98 ? 337 ARG B NH1 1 
ATOM   4872 N  NH2 . ARG B 1 308 ? 22.239  22.967 37.868  1.00 39.97 ? 337 ARG B NH2 1 
ATOM   4873 N  N   . GLU B 1 309 ? 25.101  15.350 37.612  1.00 33.09 ? 338 GLU B N   1 
ATOM   4874 C  CA  . GLU B 1 309 ? 25.750  14.300 38.379  1.00 35.05 ? 338 GLU B CA  1 
ATOM   4875 C  C   . GLU B 1 309 ? 26.210  13.163 37.451  1.00 32.64 ? 338 GLU B C   1 
ATOM   4876 O  O   . GLU B 1 309 ? 27.181  12.487 37.782  1.00 26.31 ? 338 GLU B O   1 
ATOM   4877 C  CB  . GLU B 1 309 ? 24.808  13.810 39.486  1.00 41.19 ? 338 GLU B CB  1 
ATOM   4878 C  CG  . GLU B 1 309 ? 25.500  13.011 40.580  1.00 49.20 ? 338 GLU B CG  1 
ATOM   4879 C  CD  . GLU B 1 309 ? 25.312  11.507 40.469  1.00 55.36 ? 338 GLU B CD  1 
ATOM   4880 O  OE1 . GLU B 1 309 ? 24.913  11.044 39.375  1.00 64.13 ? 338 GLU B OE1 1 
ATOM   4881 O  OE2 . GLU B 1 309 ? 25.557  10.801 41.468  1.00 53.88 ? 338 GLU B OE2 1 
ATOM   4882 N  N   . LYS B 1 310 ? 25.568  12.956 36.292  1.00 28.36 ? 339 LYS B N   1 
ATOM   4883 C  CA  . LYS B 1 310 ? 26.037  11.949 35.339  1.00 28.91 ? 339 LYS B CA  1 
ATOM   4884 C  C   . LYS B 1 310 ? 27.029  12.535 34.333  1.00 28.53 ? 339 LYS B C   1 
ATOM   4885 O  O   . LYS B 1 310 ? 27.237  11.933 33.285  1.00 31.44 ? 339 LYS B O   1 
ATOM   4886 C  CB  . LYS B 1 310 ? 24.877  11.374 34.529  1.00 31.08 ? 339 LYS B CB  1 
ATOM   4887 C  CG  . LYS B 1 310 ? 23.820  10.655 35.345  1.00 33.12 ? 339 LYS B CG  1 
ATOM   4888 C  CD  . LYS B 1 310 ? 24.236  9.275  35.771  1.00 35.54 ? 339 LYS B CD  1 
ATOM   4889 C  CE  . LYS B 1 310 ? 23.489  8.784  36.990  1.00 34.29 ? 339 LYS B CE  1 
ATOM   4890 N  NZ  . LYS B 1 310 ? 23.357  7.313  36.947  1.00 38.59 ? 339 LYS B NZ  1 
ATOM   4891 N  N   . GLY B 1 311 ? 27.579  13.719 34.603  1.00 28.11 ? 340 GLY B N   1 
ATOM   4892 C  CA  . GLY B 1 311 ? 28.733  14.250 33.879  1.00 28.79 ? 340 GLY B CA  1 
ATOM   4893 C  C   . GLY B 1 311 ? 28.356  15.215 32.767  1.00 28.23 ? 340 GLY B C   1 
ATOM   4894 O  O   . GLY B 1 311 ? 29.189  15.558 31.936  1.00 24.15 ? 340 GLY B O   1 
ATOM   4895 N  N   . VAL B 1 312 ? 27.109  15.645 32.709  1.00 26.87 ? 341 VAL B N   1 
ATOM   4896 C  CA  . VAL B 1 312 ? 26.735  16.578 31.659  1.00 28.35 ? 341 VAL B CA  1 
ATOM   4897 C  C   . VAL B 1 312 ? 27.143  17.989 32.096  1.00 27.74 ? 341 VAL B C   1 
ATOM   4898 O  O   . VAL B 1 312 ? 26.763  18.440 33.168  1.00 28.95 ? 341 VAL B O   1 
ATOM   4899 C  CB  . VAL B 1 312 ? 25.238  16.505 31.315  1.00 27.90 ? 341 VAL B CB  1 
ATOM   4900 C  CG1 . VAL B 1 312 ? 24.884  17.521 30.243  1.00 28.83 ? 341 VAL B CG1 1 
ATOM   4901 C  CG2 . VAL B 1 312 ? 24.814  15.103 30.904  1.00 25.88 ? 341 VAL B CG2 1 
ATOM   4902 N  N   . PRO B 1 313 ? 27.913  18.690 31.256  1.00 29.46 ? 342 PRO B N   1 
ATOM   4903 C  CA  . PRO B 1 313 ? 28.371  20.036 31.610  1.00 31.35 ? 342 PRO B CA  1 
ATOM   4904 C  C   . PRO B 1 313 ? 27.208  21.032 31.680  1.00 32.22 ? 342 PRO B C   1 
ATOM   4905 O  O   . PRO B 1 313 ? 26.193  20.874 30.968  1.00 29.84 ? 342 PRO B O   1 
ATOM   4906 C  CB  . PRO B 1 313 ? 29.348  20.464 30.509  1.00 32.03 ? 342 PRO B CB  1 
ATOM   4907 C  CG  . PRO B 1 313 ? 29.701  19.164 29.819  1.00 32.39 ? 342 PRO B CG  1 
ATOM   4908 C  CD  . PRO B 1 313 ? 28.443  18.331 29.940  1.00 30.68 ? 342 PRO B CD  1 
ATOM   4909 N  N   . ASP B 1 314 ? 27.390  22.038 32.530  1.00 31.87 ? 343 ASP B N   1 
ATOM   4910 C  CA  . ASP B 1 314 ? 26.376  23.094 32.729  1.00 36.26 ? 343 ASP B CA  1 
ATOM   4911 C  C   . ASP B 1 314 ? 26.097  23.831 31.415  1.00 32.85 ? 343 ASP B C   1 
ATOM   4912 O  O   . ASP B 1 314 ? 24.951  24.159 31.156  1.00 30.47 ? 343 ASP B O   1 
ATOM   4913 C  CB  . ASP B 1 314 ? 26.782  24.094 33.818  1.00 39.95 ? 343 ASP B CB  1 
ATOM   4914 C  CG  . ASP B 1 314 ? 26.482  23.592 35.222  1.00 47.13 ? 343 ASP B CG  1 
ATOM   4915 O  OD1 . ASP B 1 314 ? 25.323  23.204 35.476  1.00 52.15 ? 343 ASP B OD1 1 
ATOM   4916 O  OD2 . ASP B 1 314 ? 27.407  23.579 36.051  1.00 57.77 ? 343 ASP B OD2 1 
ATOM   4917 N  N   . GLU B 1 315 ? 27.130  24.114 30.612  1.00 31.10 ? 344 GLU B N   1 
ATOM   4918 C  CA  . GLU B 1 315 ? 26.953  24.856 29.354  1.00 29.74 ? 344 GLU B CA  1 
ATOM   4919 C  C   . GLU B 1 315 ? 26.029  24.057 28.430  1.00 24.70 ? 344 GLU B C   1 
ATOM   4920 O  O   . GLU B 1 315 ? 25.257  24.639 27.722  1.00 22.76 ? 344 GLU B O   1 
ATOM   4921 C  CB  . GLU B 1 315 ? 28.283  25.127 28.635  1.00 31.82 ? 344 GLU B CB  1 
ATOM   4922 C  CG  . GLU B 1 315 ? 29.246  26.021 29.405  1.00 36.65 ? 344 GLU B CG  1 
ATOM   4923 C  CD  . GLU B 1 315 ? 30.026  25.394 30.569  1.00 40.04 ? 344 GLU B CD  1 
ATOM   4924 O  OE1 . GLU B 1 315 ? 29.894  24.151 30.850  1.00 36.85 ? 344 GLU B OE1 1 
ATOM   4925 O  OE2 . GLU B 1 315 ? 30.765  26.156 31.222  1.00 46.29 ? 344 GLU B OE2 1 
ATOM   4926 N  N   . THR B 1 316 ? 26.170  22.738 28.418  1.00 23.20 ? 345 THR B N   1 
ATOM   4927 C  CA  . THR B 1 316 ? 25.367  21.861 27.593  1.00 25.29 ? 345 THR B CA  1 
ATOM   4928 C  C   . THR B 1 316 ? 23.888  21.978 28.002  1.00 26.03 ? 345 THR B C   1 
ATOM   4929 O  O   . THR B 1 316 ? 23.001  22.138 27.143  1.00 23.08 ? 345 THR B O   1 
ATOM   4930 C  CB  . THR B 1 316 ? 25.881  20.416 27.675  1.00 25.19 ? 345 THR B CB  1 
ATOM   4931 O  OG1 . THR B 1 316 ? 27.262  20.420 27.325  1.00 27.99 ? 345 THR B OG1 1 
ATOM   4932 C  CG2 . THR B 1 316 ? 25.160  19.463 26.748  1.00 25.59 ? 345 THR B CG2 1 
ATOM   4933 N  N   . LEU B 1 317 ? 23.626  21.977 29.306  1.00 26.48 ? 346 LEU B N   1 
ATOM   4934 C  CA  . LEU B 1 317 ? 22.229  22.003 29.778  1.00 29.00 ? 346 LEU B CA  1 
ATOM   4935 C  C   . LEU B 1 317 ? 21.623  23.388 29.515  1.00 29.53 ? 346 LEU B C   1 
ATOM   4936 O  O   . LEU B 1 317 ? 20.456  23.490 29.148  1.00 29.28 ? 346 LEU B O   1 
ATOM   4937 C  CB  . LEU B 1 317 ? 22.161  21.602 31.260  1.00 28.79 ? 346 LEU B CB  1 
ATOM   4938 C  CG  . LEU B 1 317 ? 22.663  20.189 31.574  1.00 29.16 ? 346 LEU B CG  1 
ATOM   4939 C  CD1 . LEU B 1 317 ? 22.929  20.013 33.063  1.00 30.28 ? 346 LEU B CD1 1 
ATOM   4940 C  CD2 . LEU B 1 317 ? 21.698  19.132 31.075  1.00 29.35 ? 346 LEU B CD2 1 
ATOM   4941 N  N   . GLU B 1 318 ? 22.404  24.442 29.704  1.00 28.56 ? 347 GLU B N   1 
ATOM   4942 C  CA  . GLU B 1 318 ? 21.972  25.794 29.337  1.00 30.35 ? 347 GLU B CA  1 
ATOM   4943 C  C   . GLU B 1 318 ? 21.570  25.806 27.850  1.00 29.68 ? 347 GLU B C   1 
ATOM   4944 O  O   . GLU B 1 318 ? 20.538  26.375 27.476  1.00 26.36 ? 347 GLU B O   1 
ATOM   4945 C  CB  . GLU B 1 318 ? 23.082  26.805 29.654  1.00 33.93 ? 347 GLU B CB  1 
ATOM   4946 C  CG  . GLU B 1 318 ? 22.985  28.116 28.890  1.00 38.37 ? 347 GLU B CG  1 
ATOM   4947 C  CD  . GLU B 1 318 ? 22.106  29.177 29.531  1.00 41.14 ? 347 GLU B CD  1 
ATOM   4948 O  OE1 . GLU B 1 318 ? 21.430  28.862 30.553  1.00 41.81 ? 347 GLU B OE1 1 
ATOM   4949 O  OE2 . GLU B 1 318 ? 22.093  30.319 29.003  1.00 42.08 ? 347 GLU B OE2 1 
ATOM   4950 N  N   . THR B 1 319 ? 22.375  25.179 26.993  1.00 25.91 ? 348 THR B N   1 
ATOM   4951 C  CA  . THR B 1 319 ? 22.070  25.158 25.547  1.00 25.41 ? 348 THR B CA  1 
ATOM   4952 C  C   . THR B 1 319 ? 20.715  24.462 25.297  1.00 22.06 ? 348 THR B C   1 
ATOM   4953 O  O   . THR B 1 319 ? 19.872  24.957 24.553  1.00 21.30 ? 348 THR B O   1 
ATOM   4954 C  CB  . THR B 1 319 ? 23.262  24.569 24.778  1.00 26.20 ? 348 THR B CB  1 
ATOM   4955 O  OG1 . THR B 1 319 ? 24.246  25.611 24.823  1.00 26.22 ? 348 THR B OG1 1 
ATOM   4956 C  CG2 . THR B 1 319 ? 22.937  24.165 23.355  1.00 27.59 ? 348 THR B CG2 1 
ATOM   4957 N  N   . ILE B 1 320 ? 20.488  23.340 25.960  1.00 21.42 ? 349 ILE B N   1 
ATOM   4958 C  CA  . ILE B 1 320 ? 19.265  22.571 25.737  1.00 21.30 ? 349 ILE B CA  1 
ATOM   4959 C  C   . ILE B 1 320 ? 18.045  23.337 26.275  1.00 21.07 ? 349 ILE B C   1 
ATOM   4960 O  O   . ILE B 1 320 ? 16.975  23.312 25.632  1.00 18.86 ? 349 ILE B O   1 
ATOM   4961 C  CB  . ILE B 1 320 ? 19.383  21.181 26.373  1.00 21.54 ? 349 ILE B CB  1 
ATOM   4962 C  CG1 . ILE B 1 320 ? 20.459  20.338 25.683  1.00 23.05 ? 349 ILE B CG1 1 
ATOM   4963 C  CG2 . ILE B 1 320 ? 18.031  20.473 26.376  1.00 21.90 ? 349 ILE B CG2 1 
ATOM   4964 C  CD1 . ILE B 1 320 ? 20.910  19.145 26.496  1.00 24.68 ? 349 ILE B CD1 1 
ATOM   4965 N  N   . MET B 1 321 ? 18.184  24.014 27.427  1.00 20.71 ? 350 MET B N   1 
ATOM   4966 C  CA  . MET B 1 321 ? 16.998  24.535 28.132  1.00 21.33 ? 350 MET B CA  1 
ATOM   4967 C  C   . MET B 1 321 ? 16.745  25.990 27.723  1.00 20.92 ? 350 MET B C   1 
ATOM   4968 O  O   . MET B 1 321 ? 15.659  26.509 27.991  1.00 19.53 ? 350 MET B O   1 
ATOM   4969 C  CB  . MET B 1 321 ? 17.140  24.435 29.658  1.00 21.84 ? 350 MET B CB  1 
ATOM   4970 C  CG  . MET B 1 321 ? 17.168  22.990 30.199  1.00 22.52 ? 350 MET B CG  1 
ATOM   4971 S  SD  . MET B 1 321 ? 15.943  21.833 29.467  1.00 21.95 ? 350 MET B SD  1 
ATOM   4972 C  CE  . MET B 1 321 ? 14.420  22.767 29.639  1.00 22.21 ? 350 MET B CE  1 
ATOM   4973 N  N   . VAL B 1 322 ? 17.709  26.629 27.051  1.00 18.37 ? 351 VAL B N   1 
ATOM   4974 C  CA  . VAL B 1 322 ? 17.592  28.045 26.751  1.00 18.92 ? 351 VAL B CA  1 
ATOM   4975 C  C   . VAL B 1 322 ? 17.813  28.303 25.266  1.00 17.98 ? 351 VAL B C   1 
ATOM   4976 O  O   . VAL B 1 322 ? 16.966  28.914 24.661  1.00 19.36 ? 351 VAL B O   1 
ATOM   4977 C  CB  . VAL B 1 322 ? 18.546  28.925 27.574  1.00 20.05 ? 351 VAL B CB  1 
ATOM   4978 C  CG1 . VAL B 1 322 ? 18.513  30.370 27.101  1.00 21.05 ? 351 VAL B CG1 1 
ATOM   4979 C  CG2 . VAL B 1 322 ? 18.250  28.847 29.063  1.00 21.49 ? 351 VAL B CG2 1 
ATOM   4980 N  N   . ASP B 1 323 ? 18.936  27.885 24.698  1.00 18.27 ? 352 ASP B N   1 
ATOM   4981 C  CA  . ASP B 1 323 ? 19.283  28.297 23.340  1.00 20.33 ? 352 ASP B CA  1 
ATOM   4982 C  C   . ASP B 1 323 ? 18.471  27.487 22.323  1.00 18.07 ? 352 ASP B C   1 
ATOM   4983 O  O   . ASP B 1 323 ? 18.069  28.076 21.360  1.00 18.02 ? 352 ASP B O   1 
ATOM   4984 C  CB  . ASP B 1 323 ? 20.782  28.151 23.040  1.00 24.14 ? 352 ASP B CB  1 
ATOM   4985 C  CG  . ASP B 1 323 ? 21.680  28.875 24.030  1.00 27.08 ? 352 ASP B CG  1 
ATOM   4986 O  OD1 . ASP B 1 323 ? 21.431  30.092 24.273  1.00 33.80 ? 352 ASP B OD1 1 
ATOM   4987 O  OD2 . ASP B 1 323 ? 22.607  28.215 24.571  1.00 32.12 ? 352 ASP B OD2 1 
ATOM   4988 N  N   . ASN B 1 324 ? 18.294  26.168 22.524  1.00 18.98 ? 353 ASN B N   1 
ATOM   4989 C  CA  . ASN B 1 324 ? 17.546  25.269 21.577  1.00 18.70 ? 353 ASN B CA  1 
ATOM   4990 C  C   . ASN B 1 324 ? 16.088  25.759 21.428  1.00 18.92 ? 353 ASN B C   1 
ATOM   4991 O  O   . ASN B 1 324 ? 15.617  25.987 20.314  1.00 20.35 ? 353 ASN B O   1 
ATOM   4992 C  CB  . ASN B 1 324 ? 17.565  23.801 22.018  1.00 19.70 ? 353 ASN B CB  1 
ATOM   4993 C  CG  . ASN B 1 324 ? 18.886  23.091 21.816  1.00 20.25 ? 353 ASN B CG  1 
ATOM   4994 O  OD1 . ASN B 1 324 ? 19.876  23.686 21.402  1.00 21.32 ? 353 ASN B OD1 1 
ATOM   4995 N  ND2 . ASN B 1 324 ? 18.917  21.813 22.142  1.00 20.66 ? 353 ASN B ND2 1 
ATOM   4996 N  N   . PRO B 1 325 ? 15.365  25.979 22.540  1.00 17.30 ? 354 PRO B N   1 
ATOM   4997 C  CA  . PRO B 1 325 ? 14.047  26.619 22.466  1.00 17.41 ? 354 PRO B CA  1 
ATOM   4998 C  C   . PRO B 1 325 ? 14.050  27.994 21.799  1.00 17.58 ? 354 PRO B C   1 
ATOM   4999 O  O   . PRO B 1 325 ? 13.154  28.277 21.039  1.00 17.02 ? 354 PRO B O   1 
ATOM   5000 C  CB  . PRO B 1 325 ? 13.585  26.827 23.913  1.00 17.81 ? 354 PRO B CB  1 
ATOM   5001 C  CG  . PRO B 1 325 ? 14.319  25.767 24.688  1.00 16.99 ? 354 PRO B CG  1 
ATOM   5002 C  CD  . PRO B 1 325 ? 15.625  25.585 23.930  1.00 17.47 ? 354 PRO B CD  1 
ATOM   5003 N  N   . ALA B 1 326 ? 15.047  28.830 22.084  1.00 18.11 ? 355 ALA B N   1 
ATOM   5004 C  CA  . ALA B 1 326 ? 15.106  30.147 21.457  1.00 19.89 ? 355 ALA B CA  1 
ATOM   5005 C  C   . ALA B 1 326 ? 15.214  30.023 19.932  1.00 20.61 ? 355 ALA B C   1 
ATOM   5006 O  O   . ALA B 1 326 ? 14.513  30.737 19.245  1.00 21.75 ? 355 ALA B O   1 
ATOM   5007 C  CB  . ALA B 1 326 ? 16.251  30.952 22.029  1.00 19.16 ? 355 ALA B CB  1 
ATOM   5008 N  N   . ARG B 1 327 ? 16.098  29.148 19.421  1.00 21.83 ? 356 ARG B N   1 
ATOM   5009 C  CA  . ARG B 1 327 ? 16.317  28.980 17.948  1.00 24.14 ? 356 ARG B CA  1 
ATOM   5010 C  C   . ARG B 1 327 ? 15.055  28.379 17.300  1.00 22.13 ? 356 ARG B C   1 
ATOM   5011 O  O   . ARG B 1 327 ? 14.630  28.759 16.236  1.00 21.53 ? 356 ARG B O   1 
ATOM   5012 C  CB  . ARG B 1 327 ? 17.510  28.054 17.639  1.00 27.88 ? 356 ARG B CB  1 
ATOM   5013 C  CG  . ARG B 1 327 ? 18.890  28.670 17.831  1.00 31.50 ? 356 ARG B CG  1 
ATOM   5014 C  CD  . ARG B 1 327 ? 20.061  27.676 17.791  1.00 34.74 ? 356 ARG B CD  1 
ATOM   5015 N  NE  . ARG B 1 327 ? 21.342  28.344 18.094  1.00 39.72 ? 356 ARG B NE  1 
ATOM   5016 C  CZ  . ARG B 1 327 ? 21.993  29.175 17.261  1.00 40.22 ? 356 ARG B CZ  1 
ATOM   5017 N  NH1 . ARG B 1 327 ? 21.560  29.330 16.015  1.00 36.44 ? 356 ARG B NH1 1 
ATOM   5018 N  NH2 . ARG B 1 327 ? 23.072  29.834 17.672  1.00 37.98 ? 356 ARG B NH2 1 
ATOM   5019 N  N   . PHE B 1 328 ? 14.475  27.408 17.966  1.00 20.50 ? 357 PHE B N   1 
ATOM   5020 C  CA  . PHE B 1 328 ? 13.326  26.710 17.445  1.00 19.68 ? 357 PHE B CA  1 
ATOM   5021 C  C   . PHE B 1 328 ? 12.104  27.633 17.325  1.00 18.95 ? 357 PHE B C   1 
ATOM   5022 O  O   . PHE B 1 328 ? 11.414  27.589 16.307  1.00 17.14 ? 357 PHE B O   1 
ATOM   5023 C  CB  . PHE B 1 328 ? 13.042  25.522 18.353  1.00 19.21 ? 357 PHE B CB  1 
ATOM   5024 C  CG  . PHE B 1 328 ? 11.946  24.617 17.873  1.00 18.00 ? 357 PHE B CG  1 
ATOM   5025 C  CD1 . PHE B 1 328 ? 12.149  23.779 16.791  1.00 18.82 ? 357 PHE B CD1 1 
ATOM   5026 C  CD2 . PHE B 1 328 ? 10.741  24.557 18.548  1.00 17.70 ? 357 PHE B CD2 1 
ATOM   5027 C  CE1 . PHE B 1 328 ? 11.150  22.911 16.371  1.00 19.33 ? 357 PHE B CE1 1 
ATOM   5028 C  CE2 . PHE B 1 328 ? 9.747   23.693 18.126  1.00 17.07 ? 357 PHE B CE2 1 
ATOM   5029 C  CZ  . PHE B 1 328 ? 9.951   22.875 17.044  1.00 17.68 ? 357 PHE B CZ  1 
ATOM   5030 N  N   . LEU B 1 329 ? 11.831  28.449 18.347  1.00 18.61 ? 358 LEU B N   1 
ATOM   5031 C  CA  . LEU B 1 329 ? 10.598  29.254 18.392  1.00 18.82 ? 358 LEU B CA  1 
ATOM   5032 C  C   . LEU B 1 329 ? 10.749  30.479 17.483  1.00 20.63 ? 358 LEU B C   1 
ATOM   5033 O  O   . LEU B 1 329 ? 9.768   30.952 16.916  1.00 18.95 ? 358 LEU B O   1 
ATOM   5034 C  CB  . LEU B 1 329 ? 10.277  29.683 19.831  1.00 17.62 ? 358 LEU B CB  1 
ATOM   5035 C  CG  . LEU B 1 329 ? 9.642   28.627 20.744  1.00 17.78 ? 358 LEU B CG  1 
ATOM   5036 C  CD1 . LEU B 1 329 ? 9.605   29.100 22.200  1.00 17.80 ? 358 LEU B CD1 1 
ATOM   5037 C  CD2 . LEU B 1 329 ? 8.240   28.263 20.279  1.00 17.24 ? 358 LEU B CD2 1 
ATOM   5038 N  N   A SER B 1 330 ? 11.960  31.014 17.358  0.50 21.98 ? 359 SER B N   1 
ATOM   5039 N  N   B SER B 1 330 ? 11.973  30.979 17.327  0.50 22.26 ? 359 SER B N   1 
ATOM   5040 C  CA  A SER B 1 330 ? 12.144  32.208 16.552  0.50 23.62 ? 359 SER B CA  1 
ATOM   5041 C  CA  B SER B 1 330 ? 12.184  32.157 16.508  0.50 24.18 ? 359 SER B CA  1 
ATOM   5042 C  C   A SER B 1 330 ? 11.714  31.894 15.111  0.50 25.28 ? 359 SER B C   1 
ATOM   5043 C  C   B SER B 1 330 ? 11.707  31.863 15.079  0.50 25.59 ? 359 SER B C   1 
ATOM   5044 O  O   A SER B 1 330 ? 12.209  30.914 14.517  0.50 23.77 ? 359 SER B O   1 
ATOM   5045 O  O   B SER B 1 330 ? 12.166  30.879 14.464  0.50 23.95 ? 359 SER B O   1 
ATOM   5046 C  CB  A SER B 1 330 ? 13.568  32.701 16.618  0.50 24.05 ? 359 SER B CB  1 
ATOM   5047 C  CB  B SER B 1 330 ? 13.627  32.599 16.532  0.50 24.93 ? 359 SER B CB  1 
ATOM   5048 O  OG  A SER B 1 330 ? 14.353  32.070 15.627  0.50 22.85 ? 359 SER B OG  1 
ATOM   5049 O  OG  B SER B 1 330 ? 13.719  33.970 16.176  0.50 25.02 ? 359 SER B OG  1 
ATOM   5050 N  N   . PRO B 1 331 ? 10.761  32.681 14.561  1.00 26.75 ? 360 PRO B N   1 
ATOM   5051 C  CA  . PRO B 1 331 ? 10.229  32.423 13.204  1.00 29.17 ? 360 PRO B CA  1 
ATOM   5052 C  C   . PRO B 1 331 ? 11.335  32.579 12.140  1.00 34.08 ? 360 PRO B C   1 
ATOM   5053 O  O   . PRO B 1 331 ? 12.123  33.538 12.197  1.00 30.54 ? 360 PRO B O   1 
ATOM   5054 C  CB  . PRO B 1 331 ? 9.081   33.422 13.002  1.00 30.12 ? 360 PRO B CB  1 
ATOM   5055 C  CG  . PRO B 1 331 ? 8.702   33.823 14.400  1.00 29.70 ? 360 PRO B CG  1 
ATOM   5056 C  CD  . PRO B 1 331 ? 10.010  33.801 15.163  1.00 27.56 ? 360 PRO B CD  1 
ATOM   5057 N  N   . THR B 1 332 ? 11.420  31.612 11.211  1.00 37.86 ? 361 THR B N   1 
ATOM   5058 C  CA  . THR B 1 332 ? 12.466  31.617 10.163  1.00 40.29 ? 361 THR B CA  1 
ATOM   5059 C  C   . THR B 1 332 ? 12.060  30.660 9.033   1.00 36.33 ? 361 THR B C   1 
ATOM   5060 O  O   . THR B 1 332 ? 11.517  29.591 9.311   1.00 33.32 ? 361 THR B O   1 
ATOM   5061 C  CB  . THR B 1 332 ? 13.860  31.300 10.746  1.00 44.12 ? 361 THR B CB  1 
ATOM   5062 O  OG1 . THR B 1 332 ? 14.605  30.646 9.720   1.00 52.04 ? 361 THR B OG1 1 
ATOM   5063 C  CG2 . THR B 1 332 ? 13.872  30.421 11.981  1.00 41.36 ? 361 THR B CG2 1 
HETATM 5064 C  C   . FMT C 2 .   ? -30.073 15.407 16.117  1.00 13.20 ? 401 FMT A C   1 
HETATM 5065 O  O1  . FMT C 2 .   ? -30.411 14.332 15.644  1.00 12.40 ? 401 FMT A O1  1 
HETATM 5066 O  O2  . FMT C 2 .   ? -30.010 16.495 15.360  1.00 12.53 ? 401 FMT A O2  1 
HETATM 5067 ZN ZN  . ZN  D 3 .   ? -31.050 17.285 13.846  1.00 12.67 ? 402 ZN  A ZN  1 
HETATM 5068 ZN ZN  . ZN  E 3 .   ? -29.906 13.454 13.955  1.00 12.50 ? 403 ZN  A ZN  1 
HETATM 5069 C  C1  . EDO F 4 .   ? -28.028 19.888 9.809   1.00 27.60 ? 404 EDO A C1  1 
HETATM 5070 O  O1  . EDO F 4 .   ? -27.631 20.428 11.090  1.00 29.65 ? 404 EDO A O1  1 
HETATM 5071 C  C2  . EDO F 4 .   ? -29.535 19.765 9.829   1.00 22.11 ? 404 EDO A C2  1 
HETATM 5072 O  O2  . EDO F 4 .   ? -29.633 18.536 10.559  1.00 20.45 ? 404 EDO A O2  1 
HETATM 5073 AS AS  . CAC G 5 .   ? -28.686 15.713 12.207  1.00 13.24 ? 405 CAC A AS  1 
HETATM 5074 O  O1  . CAC G 5 .   ? -28.323 14.209 12.997  1.00 12.34 ? 405 CAC A O1  1 
HETATM 5075 O  O2  . CAC G 5 .   ? -30.331 16.124 12.482  1.00 12.26 ? 405 CAC A O2  1 
HETATM 5076 C  C1  . CAC G 5 .   ? -27.639 17.252 12.845  1.00 13.71 ? 405 CAC A C1  1 
HETATM 5077 C  C2  . CAC G 5 .   ? -28.428 15.411 10.304  1.00 14.84 ? 405 CAC A C2  1 
HETATM 5078 C  C   . FMT H 2 .   ? 0.491   16.880 22.390  1.00 13.70 ? 401 FMT B C   1 
HETATM 5079 O  O1  . FMT H 2 .   ? 1.047   15.814 22.095  1.00 12.60 ? 401 FMT B O1  1 
HETATM 5080 O  O2  . FMT H 2 .   ? 0.179   17.210 23.657  1.00 13.42 ? 401 FMT B O2  1 
HETATM 5081 ZN ZN  . ZN  I 3 .   ? 1.214   17.027 25.376  1.00 13.08 ? 402 ZN  B ZN  1 
HETATM 5082 ZN ZN  . ZN  J 3 .   ? 0.915   13.957 22.819  1.00 15.67 ? 403 ZN  B ZN  1 
HETATM 5083 AS AS  . CAC K 5 .   ? -0.637  14.338 25.437  1.00 14.93 ? 404 CAC B AS  1 
HETATM 5084 O  O1  . CAC K 5 .   ? -0.769  13.701 23.856  1.00 14.54 ? 404 CAC B O1  1 
HETATM 5085 O  O2  . CAC K 5 .   ? 0.903   15.123 25.530  1.00 14.04 ? 404 CAC B O2  1 
HETATM 5086 C  C1  . CAC K 5 .   ? -2.138  15.583 25.716  1.00 14.68 ? 404 CAC B C1  1 
HETATM 5087 C  C2  . CAC K 5 .   ? -0.809  12.718 26.503  1.00 15.63 ? 404 CAC B C2  1 
HETATM 5088 C  C1  . EDO L 4 .   ? -0.349  15.829 28.761  1.00 24.89 ? 405 EDO B C1  1 
HETATM 5089 O  O1  . EDO L 4 .   ? -0.593  14.488 28.490  1.00 28.65 ? 405 EDO B O1  1 
HETATM 5090 C  C2  . EDO L 4 .   ? -1.239  16.323 29.867  1.00 27.62 ? 405 EDO B C2  1 
HETATM 5091 O  O2  . EDO L 4 .   ? -0.306  16.559 30.900  1.00 24.28 ? 405 EDO B O2  1 
HETATM 5092 O  O   . HOH M 6 .   ? -36.573 0.891  9.234   1.00 19.17 ? 501 HOH A O   1 
HETATM 5093 O  O   . HOH M 6 .   ? -25.674 -1.930 22.271  1.00 22.92 ? 502 HOH A O   1 
HETATM 5094 O  O   . HOH M 6 .   ? -47.876 21.337 -0.734  1.00 14.46 ? 503 HOH A O   1 
HETATM 5095 O  O   . HOH M 6 .   ? -24.313 8.288  -1.694  1.00 20.86 ? 504 HOH A O   1 
HETATM 5096 O  O   . HOH M 6 .   ? -15.282 20.355 18.927  1.00 19.26 ? 505 HOH A O   1 
HETATM 5097 O  O   . HOH M 6 .   ? -20.213 8.278  17.068  1.00 23.33 ? 506 HOH A O   1 
HETATM 5098 O  O   . HOH M 6 .   ? -48.964 33.310 7.004   1.00 22.69 ? 507 HOH A O   1 
HETATM 5099 O  O   . HOH M 6 .   ? -41.320 30.901 1.880   1.00 23.34 ? 508 HOH A O   1 
HETATM 5100 O  O   . HOH M 6 .   ? -24.395 39.014 14.702  1.00 27.54 ? 509 HOH A O   1 
HETATM 5101 O  O   . HOH M 6 .   ? -19.473 17.699 15.527  1.00 7.76  ? 510 HOH A O   1 
HETATM 5102 O  O   . HOH M 6 .   ? -46.965 17.136 29.567  1.00 21.17 ? 511 HOH A O   1 
HETATM 5103 O  O   . HOH M 6 .   ? -37.492 18.380 -0.637  1.00 19.70 ? 512 HOH A O   1 
HETATM 5104 O  O   . HOH M 6 .   ? -44.719 7.094  2.705   1.00 20.12 ? 513 HOH A O   1 
HETATM 5105 O  O   . HOH M 6 .   ? -39.002 21.437 28.755  1.00 21.20 ? 514 HOH A O   1 
HETATM 5106 O  O   . HOH M 6 .   ? -35.156 14.021 17.704  1.00 18.87 ? 515 HOH A O   1 
HETATM 5107 O  O   . HOH M 6 .   ? -20.130 22.316 5.149   1.00 18.47 ? 516 HOH A O   1 
HETATM 5108 O  O   . HOH M 6 .   ? -43.102 19.919 15.557  1.00 12.16 ? 517 HOH A O   1 
HETATM 5109 O  O   . HOH M 6 .   ? -32.161 32.198 5.520   1.00 14.45 ? 518 HOH A O   1 
HETATM 5110 O  O   . HOH M 6 .   ? -37.458 14.192 16.154  1.00 19.32 ? 519 HOH A O   1 
HETATM 5111 O  O   . HOH M 6 .   ? -25.191 29.459 33.101  1.00 19.09 ? 520 HOH A O   1 
HETATM 5112 O  O   . HOH M 6 .   ? -37.820 16.549 19.085  1.00 16.83 ? 521 HOH A O   1 
HETATM 5113 O  O   . HOH M 6 .   ? -38.721 24.425 -0.416  1.00 23.21 ? 522 HOH A O   1 
HETATM 5114 O  O   . HOH M 6 .   ? -23.673 26.819 23.875  1.00 20.37 ? 523 HOH A O   1 
HETATM 5115 O  O   . HOH M 6 .   ? -29.094 29.869 36.697  1.00 16.95 ? 524 HOH A O   1 
HETATM 5116 O  O   . HOH M 6 .   ? -23.416 37.289 16.210  1.00 18.91 ? 525 HOH A O   1 
HETATM 5117 O  O   . HOH M 6 .   ? -31.059 40.076 18.463  1.00 18.84 ? 526 HOH A O   1 
HETATM 5118 O  O   . HOH M 6 .   ? -18.855 8.426  38.199  1.00 18.63 ? 527 HOH A O   1 
HETATM 5119 O  O   . HOH M 6 .   ? -19.975 6.120  21.138  1.00 15.99 ? 528 HOH A O   1 
HETATM 5120 O  O   . HOH M 6 .   ? -24.492 3.373  17.416  1.00 17.85 ? 529 HOH A O   1 
HETATM 5121 O  O   . HOH M 6 .   ? -34.317 16.941 -3.973  1.00 20.04 ? 530 HOH A O   1 
HETATM 5122 O  O   . HOH M 6 .   ? -23.020 23.996 30.158  1.00 13.38 ? 531 HOH A O   1 
HETATM 5123 O  O   . HOH M 6 .   ? -9.293  30.496 16.187  1.00 14.55 ? 532 HOH A O   1 
HETATM 5124 O  O   . HOH M 6 .   ? -23.355 32.091 6.920   1.00 13.39 ? 533 HOH A O   1 
HETATM 5125 O  O   . HOH M 6 .   ? -31.973 7.565  10.189  1.00 15.96 ? 534 HOH A O   1 
HETATM 5126 O  O   . HOH M 6 .   ? -33.660 10.585 -10.895 1.00 21.50 ? 535 HOH A O   1 
HETATM 5127 O  O   . HOH M 6 .   ? -25.741 36.005 5.288   1.00 14.77 ? 536 HOH A O   1 
HETATM 5128 O  O   . HOH M 6 .   ? -33.058 26.936 2.754   1.00 11.48 ? 537 HOH A O   1 
HETATM 5129 O  O   . HOH M 6 .   ? -47.350 24.545 21.385  1.00 18.16 ? 538 HOH A O   1 
HETATM 5130 O  O   . HOH M 6 .   ? -23.615 26.046 16.092  1.00 20.40 ? 539 HOH A O   1 
HETATM 5131 O  O   . HOH M 6 .   ? -34.180 26.585 26.384  1.00 12.73 ? 540 HOH A O   1 
HETATM 5132 O  O   . HOH M 6 .   ? -45.258 18.463 15.621  1.00 11.17 ? 541 HOH A O   1 
HETATM 5133 O  O   . HOH M 6 .   ? -37.417 36.382 6.004   1.00 12.15 ? 542 HOH A O   1 
HETATM 5134 O  O   . HOH M 6 .   ? -25.369 19.122 37.901  1.00 12.93 ? 543 HOH A O   1 
HETATM 5135 O  O   . HOH M 6 .   ? -38.538 33.116 24.165  1.00 13.77 ? 544 HOH A O   1 
HETATM 5136 O  O   . HOH M 6 .   ? -27.369 7.765  11.951  1.00 17.94 ? 545 HOH A O   1 
HETATM 5137 O  O   . HOH M 6 .   ? -57.706 12.917 11.680  1.00 22.57 ? 546 HOH A O   1 
HETATM 5138 O  O   . HOH M 6 .   ? -29.819 1.196  18.625  1.00 18.39 ? 547 HOH A O   1 
HETATM 5139 O  O   . HOH M 6 .   ? -24.138 29.417 6.629   1.00 18.66 ? 548 HOH A O   1 
HETATM 5140 O  O   . HOH M 6 .   ? -18.449 33.032 16.366  1.00 20.03 ? 549 HOH A O   1 
HETATM 5141 O  O   . HOH M 6 .   ? -27.642 25.479 16.607  1.00 9.65  ? 550 HOH A O   1 
HETATM 5142 O  O   . HOH M 6 .   ? -33.389 5.853  36.178  1.00 28.26 ? 551 HOH A O   1 
HETATM 5143 O  O   . HOH M 6 .   ? -25.864 39.891 11.152  1.00 19.00 ? 552 HOH A O   1 
HETATM 5144 O  O   . HOH M 6 .   ? -34.976 10.910 1.108   1.00 11.13 ? 553 HOH A O   1 
HETATM 5145 O  O   . HOH M 6 .   ? -31.541 38.913 8.345   1.00 7.55  ? 554 HOH A O   1 
HETATM 5146 O  O   . HOH M 6 .   ? -40.255 8.563  -3.120  1.00 9.13  ? 555 HOH A O   1 
HETATM 5147 O  O   . HOH M 6 .   ? -33.458 29.773 29.875  1.00 16.66 ? 556 HOH A O   1 
HETATM 5148 O  O   . HOH M 6 .   ? -42.910 33.528 18.638  1.00 15.47 ? 557 HOH A O   1 
HETATM 5149 O  O   . HOH M 6 .   ? -49.078 25.962 22.811  1.00 19.64 ? 558 HOH A O   1 
HETATM 5150 O  O   . HOH M 6 .   ? -50.262 7.581  3.988   1.00 17.08 ? 559 HOH A O   1 
HETATM 5151 O  O   . HOH M 6 .   ? -32.932 -1.430 18.030  1.00 19.71 ? 560 HOH A O   1 
HETATM 5152 O  O   . HOH M 6 .   ? -25.269 19.389 25.319  1.00 15.19 ? 561 HOH A O   1 
HETATM 5153 O  O   . HOH M 6 .   ? -36.608 5.855  14.113  1.00 18.07 ? 562 HOH A O   1 
HETATM 5154 O  O   . HOH M 6 .   ? -30.678 27.407 5.416   1.00 11.50 ? 563 HOH A O   1 
HETATM 5155 O  O   . HOH M 6 .   ? -20.878 4.577  33.866  1.00 25.24 ? 564 HOH A O   1 
HETATM 5156 O  O   . HOH M 6 .   ? -18.074 18.376 18.839  1.00 20.28 ? 565 HOH A O   1 
HETATM 5157 O  O   . HOH M 6 .   ? -36.408 32.129 22.860  1.00 12.22 ? 566 HOH A O   1 
HETATM 5158 O  O   . HOH M 6 .   ? -21.607 20.086 -0.739  1.00 17.70 ? 567 HOH A O   1 
HETATM 5159 O  O   . HOH M 6 .   ? -22.239 25.457 6.479   1.00 13.01 ? 568 HOH A O   1 
HETATM 5160 O  O   . HOH M 6 .   ? -39.285 27.323 32.905  1.00 22.31 ? 569 HOH A O   1 
HETATM 5161 O  O   . HOH M 6 .   ? -22.948 1.156  28.550  1.00 17.30 ? 570 HOH A O   1 
HETATM 5162 O  O   . HOH M 6 .   ? -14.370 34.538 17.243  1.00 16.94 ? 571 HOH A O   1 
HETATM 5163 O  O   . HOH M 6 .   ? -38.161 23.710 30.163  1.00 14.59 ? 572 HOH A O   1 
HETATM 5164 O  O   . HOH M 6 .   ? -21.350 23.526 22.106  1.00 17.67 ? 573 HOH A O   1 
HETATM 5165 O  O   . HOH M 6 .   ? -29.713 23.740 21.560  1.00 12.32 ? 574 HOH A O   1 
HETATM 5166 O  O   . HOH M 6 .   ? -35.190 12.426 9.363   1.00 12.53 ? 575 HOH A O   1 
HETATM 5167 O  O   . HOH M 6 .   ? -54.979 9.572  14.735  1.00 15.47 ? 576 HOH A O   1 
HETATM 5168 O  O   . HOH M 6 .   ? -36.197 29.138 7.055   1.00 16.63 ? 577 HOH A O   1 
HETATM 5169 O  O   . HOH M 6 .   ? -39.637 24.840 33.057  1.00 19.75 ? 578 HOH A O   1 
HETATM 5170 O  O   . HOH M 6 .   ? -19.200 24.686 3.948   1.00 27.87 ? 579 HOH A O   1 
HETATM 5171 O  O   . HOH M 6 .   ? -40.661 15.424 -4.874  1.00 27.32 ? 580 HOH A O   1 
HETATM 5172 O  O   . HOH M 6 .   ? -39.352 5.260  27.757  1.00 26.60 ? 581 HOH A O   1 
HETATM 5173 O  O   . HOH M 6 .   ? -31.738 12.066 8.370   1.00 20.53 ? 582 HOH A O   1 
HETATM 5174 O  O   . HOH M 6 .   ? -20.186 13.903 -3.062  1.00 25.08 ? 583 HOH A O   1 
HETATM 5175 O  O   . HOH M 6 .   ? -34.884 8.780  2.722   1.00 11.73 ? 584 HOH A O   1 
HETATM 5176 O  O   . HOH M 6 .   ? -22.759 9.960  22.160  1.00 20.06 ? 585 HOH A O   1 
HETATM 5177 O  O   . HOH M 6 .   ? -33.442 6.888  1.011   1.00 16.89 ? 586 HOH A O   1 
HETATM 5178 O  O   . HOH M 6 .   ? -18.917 38.551 12.109  1.00 13.88 ? 587 HOH A O   1 
HETATM 5179 O  O   . HOH M 6 .   ? -25.603 9.871  22.115  1.00 17.74 ? 588 HOH A O   1 
HETATM 5180 O  O   . HOH M 6 .   ? -19.604 25.843 17.438  1.00 13.52 ? 589 HOH A O   1 
HETATM 5181 O  O   . HOH M 6 .   ? -17.175 26.656 4.163   1.00 14.41 ? 590 HOH A O   1 
HETATM 5182 O  O   . HOH M 6 .   ? -40.283 16.332 14.847  1.00 19.00 ? 591 HOH A O   1 
HETATM 5183 O  O   . HOH M 6 .   ? -17.041 36.563 12.359  1.00 14.31 ? 592 HOH A O   1 
HETATM 5184 O  O   . HOH M 6 .   ? -31.941 5.209  8.236   1.00 21.79 ? 593 HOH A O   1 
HETATM 5185 O  O   . HOH M 6 .   ? -25.650 27.236 17.505  1.00 12.25 ? 594 HOH A O   1 
HETATM 5186 O  O   . HOH M 6 .   ? -38.799 15.602 -2.924  1.00 23.84 ? 595 HOH A O   1 
HETATM 5187 O  O   . HOH M 6 .   ? -18.377 3.294  23.493  1.00 17.65 ? 596 HOH A O   1 
HETATM 5188 O  O   . HOH M 6 .   ? -39.504 12.094 33.131  1.00 18.59 ? 597 HOH A O   1 
HETATM 5189 O  O   . HOH M 6 .   ? -41.042 9.709  32.961  1.00 21.29 ? 598 HOH A O   1 
HETATM 5190 O  O   . HOH M 6 .   ? -34.650 39.185 7.838   1.00 22.51 ? 599 HOH A O   1 
HETATM 5191 O  O   . HOH M 6 .   ? -22.058 24.265 4.089   1.00 19.79 ? 600 HOH A O   1 
HETATM 5192 O  O   . HOH M 6 .   ? -44.944 3.044  4.432   1.00 17.35 ? 601 HOH A O   1 
HETATM 5193 O  O   . HOH M 6 .   ? -21.627 8.633  20.248  1.00 22.16 ? 602 HOH A O   1 
HETATM 5194 O  O   . HOH M 6 .   ? -25.349 11.329 39.180  1.00 28.01 ? 603 HOH A O   1 
HETATM 5195 O  O   . HOH M 6 .   ? -28.535 39.305 12.160  1.00 23.67 ? 604 HOH A O   1 
HETATM 5196 O  O   . HOH M 6 .   ? -34.592 32.478 4.349   1.00 16.22 ? 605 HOH A O   1 
HETATM 5197 O  O   . HOH M 6 .   ? -31.607 20.811 -5.786  1.00 21.05 ? 606 HOH A O   1 
HETATM 5198 O  O   . HOH M 6 .   ? -29.090 8.148  9.852   1.00 22.04 ? 607 HOH A O   1 
HETATM 5199 O  O   . HOH M 6 .   ? -24.906 29.507 3.546   1.00 21.03 ? 608 HOH A O   1 
HETATM 5200 O  O   . HOH M 6 .   ? -19.952 15.018 -5.616  1.00 21.28 ? 609 HOH A O   1 
HETATM 5201 O  O   . HOH M 6 .   ? -34.066 19.141 -5.447  1.00 16.93 ? 610 HOH A O   1 
HETATM 5202 O  O   . HOH M 6 .   ? -21.696 33.940 3.515   1.00 21.78 ? 611 HOH A O   1 
HETATM 5203 O  O   . HOH M 6 .   ? -37.152 17.578 -3.087  1.00 17.75 ? 612 HOH A O   1 
HETATM 5204 O  O   . HOH M 6 .   ? -41.043 11.962 -6.596  1.00 23.56 ? 613 HOH A O   1 
HETATM 5205 O  O   . HOH M 6 .   ? -39.425 15.543 17.278  1.00 19.38 ? 614 HOH A O   1 
HETATM 5206 O  O   . HOH M 6 .   ? -30.169 40.364 10.296  1.00 16.02 ? 615 HOH A O   1 
HETATM 5207 O  O   . HOH M 6 .   ? -57.775 11.949 9.454   1.00 25.19 ? 616 HOH A O   1 
HETATM 5208 O  O   . HOH M 6 .   ? -17.316 5.792  22.769  1.00 31.19 ? 617 HOH A O   1 
HETATM 5209 O  O   . HOH N 6 .   ? -9.571  32.734 38.475  1.00 25.34 ? 501 HOH B O   1 
HETATM 5210 O  O   . HOH N 6 .   ? 1.503   38.737 19.800  1.00 28.39 ? 502 HOH B O   1 
HETATM 5211 O  O   . HOH N 6 .   ? 7.448   21.020 21.393  1.00 17.60 ? 503 HOH B O   1 
HETATM 5212 O  O   . HOH N 6 .   ? 2.957   7.758  11.389  1.00 14.75 ? 504 HOH B O   1 
HETATM 5213 O  O   . HOH N 6 .   ? 6.491   36.757 32.688  1.00 25.34 ? 505 HOH B O   1 
HETATM 5214 O  O   . HOH N 6 .   ? -14.367 28.929 41.831  1.00 29.67 ? 506 HOH B O   1 
HETATM 5215 O  O   . HOH N 6 .   ? 7.570   32.117 41.421  1.00 22.52 ? 507 HOH B O   1 
HETATM 5216 O  O   . HOH N 6 .   ? -7.188  24.839 42.967  1.00 14.47 ? 508 HOH B O   1 
HETATM 5217 O  O   . HOH N 6 .   ? 9.765   12.609 1.734   1.00 17.54 ? 509 HOH B O   1 
HETATM 5218 O  O   . HOH N 6 .   ? -10.453 15.958 23.465  1.00 18.62 ? 510 HOH B O   1 
HETATM 5219 O  O   . HOH N 6 .   ? 9.081   9.611  18.428  1.00 21.07 ? 511 HOH B O   1 
HETATM 5220 O  O   . HOH N 6 .   ? -0.703  7.085  6.311   1.00 21.83 ? 512 HOH B O   1 
HETATM 5221 O  O   . HOH N 6 .   ? -7.813  10.795 11.816  1.00 14.82 ? 513 HOH B O   1 
HETATM 5222 O  O   . HOH N 6 .   ? -5.648  24.479 17.122  1.00 11.83 ? 514 HOH B O   1 
HETATM 5223 O  O   . HOH N 6 .   ? 16.103  33.170 25.205  1.00 22.28 ? 515 HOH B O   1 
HETATM 5224 O  O   . HOH N 6 .   ? 4.505   22.577 1.216   1.00 21.73 ? 516 HOH B O   1 
HETATM 5225 O  O   . HOH N 6 .   ? 5.624   17.711 20.567  1.00 17.84 ? 517 HOH B O   1 
HETATM 5226 O  O   . HOH N 6 .   ? 15.160  30.608 25.358  1.00 19.48 ? 518 HOH B O   1 
HETATM 5227 O  O   . HOH N 6 .   ? -14.743 26.001 3.621   1.00 17.26 ? 519 HOH B O   1 
HETATM 5228 O  O   . HOH N 6 .   ? 2.563   34.935 28.217  1.00 15.79 ? 520 HOH B O   1 
HETATM 5229 O  O   . HOH N 6 .   ? 10.445  2.857  18.980  1.00 17.89 ? 521 HOH B O   1 
HETATM 5230 O  O   . HOH N 6 .   ? 12.217  22.718 26.676  1.00 14.53 ? 522 HOH B O   1 
HETATM 5231 O  O   . HOH N 6 .   ? -10.370 27.315 20.500  1.00 16.35 ? 523 HOH B O   1 
HETATM 5232 O  O   . HOH N 6 .   ? -7.601  36.181 30.459  1.00 18.52 ? 524 HOH B O   1 
HETATM 5233 O  O   . HOH N 6 .   ? 7.312   12.711 -2.330  1.00 22.18 ? 525 HOH B O   1 
HETATM 5234 O  O   . HOH N 6 .   ? -18.702 25.352 25.513  1.00 19.88 ? 526 HOH B O   1 
HETATM 5235 O  O   . HOH N 6 .   ? 2.347   17.645 40.696  1.00 23.66 ? 527 HOH B O   1 
HETATM 5236 O  O   . HOH N 6 .   ? -11.258 23.053 0.207   1.00 19.47 ? 528 HOH B O   1 
HETATM 5237 O  O   . HOH N 6 .   ? 8.785   34.632 32.740  1.00 25.13 ? 529 HOH B O   1 
HETATM 5238 O  O   . HOH N 6 .   ? -11.850 12.482 8.449   1.00 21.23 ? 530 HOH B O   1 
HETATM 5239 O  O   . HOH N 6 .   ? -0.736  19.164 38.343  1.00 16.59 ? 531 HOH B O   1 
HETATM 5240 O  O   . HOH N 6 .   ? -13.595 16.276 19.145  1.00 24.64 ? 532 HOH B O   1 
HETATM 5241 O  O   . HOH N 6 .   ? -14.749 27.694 32.310  1.00 21.33 ? 533 HOH B O   1 
HETATM 5242 O  O   . HOH N 6 .   ? 7.007   31.232 17.470  1.00 25.02 ? 534 HOH B O   1 
HETATM 5243 O  O   . HOH N 6 .   ? 13.075  1.836  33.541  1.00 23.58 ? 535 HOH B O   1 
HETATM 5244 O  O   . HOH N 6 .   ? 3.326   28.276 44.236  1.00 14.53 ? 536 HOH B O   1 
HETATM 5245 O  O   . HOH N 6 .   ? -12.823 30.988 27.525  1.00 26.38 ? 537 HOH B O   1 
HETATM 5246 O  O   . HOH N 6 .   ? -0.201  7.903  20.691  1.00 17.11 ? 538 HOH B O   1 
HETATM 5247 O  O   . HOH N 6 .   ? -4.430  6.041  14.471  1.00 19.91 ? 539 HOH B O   1 
HETATM 5248 O  O   . HOH N 6 .   ? -8.513  28.910 22.912  1.00 16.77 ? 540 HOH B O   1 
HETATM 5249 O  O   . HOH N 6 .   ? -6.691  32.187 7.277   1.00 17.34 ? 541 HOH B O   1 
HETATM 5250 O  O   . HOH N 6 .   ? -9.427  10.603 19.844  1.00 19.96 ? 542 HOH B O   1 
HETATM 5251 O  O   . HOH N 6 .   ? 14.631  21.948 25.736  1.00 13.69 ? 543 HOH B O   1 
HETATM 5252 O  O   . HOH N 6 .   ? -7.592  20.396 38.134  1.00 19.02 ? 544 HOH B O   1 
HETATM 5253 O  O   . HOH N 6 .   ? 3.120   26.360 45.945  1.00 14.82 ? 545 HOH B O   1 
HETATM 5254 O  O   . HOH N 6 .   ? -8.575  36.901 17.299  1.00 12.32 ? 546 HOH B O   1 
HETATM 5255 O  O   . HOH N 6 .   ? -4.525  12.268 3.114   1.00 18.24 ? 547 HOH B O   1 
HETATM 5256 O  O   . HOH N 6 .   ? -0.285  23.175 41.230  1.00 18.93 ? 548 HOH B O   1 
HETATM 5257 O  O   . HOH N 6 .   ? 15.703  24.738 15.283  1.00 21.83 ? 549 HOH B O   1 
HETATM 5258 O  O   . HOH N 6 .   ? -10.253 24.870 22.211  1.00 15.21 ? 550 HOH B O   1 
HETATM 5259 O  O   . HOH N 6 .   ? 26.159  16.712 21.745  1.00 24.69 ? 551 HOH B O   1 
HETATM 5260 O  O   . HOH N 6 .   ? -11.984 23.412 26.878  1.00 12.73 ? 552 HOH B O   1 
HETATM 5261 O  O   . HOH N 6 .   ? -5.955  14.940 13.776  1.00 17.93 ? 553 HOH B O   1 
HETATM 5262 O  O   . HOH N 6 .   ? -6.622  25.733 28.081  1.00 12.21 ? 554 HOH B O   1 
HETATM 5263 O  O   . HOH N 6 .   ? 3.465   9.743  26.289  1.00 23.86 ? 555 HOH B O   1 
HETATM 5264 O  O   . HOH N 6 .   ? -0.155  23.235 45.556  1.00 22.94 ? 556 HOH B O   1 
HETATM 5265 O  O   . HOH N 6 .   ? -10.897 31.937 35.605  1.00 20.83 ? 557 HOH B O   1 
HETATM 5266 O  O   . HOH N 6 .   ? -7.890  23.504 28.371  1.00 21.14 ? 558 HOH B O   1 
HETATM 5267 O  O   . HOH N 6 .   ? 3.955   7.630  28.418  1.00 21.86 ? 559 HOH B O   1 
HETATM 5268 O  O   . HOH N 6 .   ? -4.199  37.218 35.874  1.00 21.25 ? 560 HOH B O   1 
HETATM 5269 O  O   . HOH N 6 .   ? 8.222   21.643 43.225  1.00 23.02 ? 561 HOH B O   1 
HETATM 5270 O  O   . HOH N 6 .   ? 6.667   11.560 26.236  1.00 19.77 ? 562 HOH B O   1 
HETATM 5271 O  O   . HOH N 6 .   ? -8.503  16.823 35.625  1.00 16.08 ? 563 HOH B O   1 
HETATM 5272 O  O   . HOH N 6 .   ? -4.186  24.138 28.132  1.00 15.91 ? 564 HOH B O   1 
HETATM 5273 O  O   . HOH N 6 .   ? -13.305 35.878 15.362  1.00 21.30 ? 565 HOH B O   1 
HETATM 5274 O  O   . HOH N 6 .   ? -1.425  15.123 11.848  1.00 22.73 ? 566 HOH B O   1 
HETATM 5275 O  O   . HOH N 6 .   ? 3.753   22.567 38.079  1.00 20.37 ? 567 HOH B O   1 
HETATM 5276 O  O   . HOH N 6 .   ? -2.066  26.425 23.324  1.00 14.49 ? 568 HOH B O   1 
HETATM 5277 O  O   . HOH N 6 .   ? 1.308   32.461 21.802  1.00 16.03 ? 569 HOH B O   1 
HETATM 5278 O  O   . HOH N 6 .   ? -0.291  36.898 20.754  1.00 19.30 ? 570 HOH B O   1 
HETATM 5279 O  O   . HOH N 6 .   ? -12.202 18.435 21.375  1.00 22.51 ? 571 HOH B O   1 
HETATM 5280 O  O   . HOH N 6 .   ? -13.172 7.810  33.972  1.00 19.97 ? 572 HOH B O   1 
HETATM 5281 O  O   . HOH N 6 .   ? -7.461  7.915  37.810  1.00 19.59 ? 573 HOH B O   1 
HETATM 5282 O  O   . HOH N 6 .   ? 4.284   37.134 27.769  1.00 16.99 ? 574 HOH B O   1 
HETATM 5283 O  O   . HOH N 6 .   ? -8.159  14.149 36.420  1.00 18.11 ? 575 HOH B O   1 
HETATM 5284 O  O   . HOH N 6 .   ? -8.817  9.980  8.161   1.00 17.49 ? 576 HOH B O   1 
HETATM 5285 O  O   . HOH N 6 .   ? -13.814 25.473 26.929  1.00 17.13 ? 577 HOH B O   1 
HETATM 5286 O  O   . HOH N 6 .   ? 16.042  13.347 5.493   1.00 24.06 ? 578 HOH B O   1 
HETATM 5287 O  O   . HOH N 6 .   ? 5.686   33.378 17.254  1.00 14.82 ? 579 HOH B O   1 
HETATM 5288 O  O   . HOH N 6 .   ? -12.311 38.011 16.082  1.00 25.39 ? 580 HOH B O   1 
HETATM 5289 O  O   . HOH N 6 .   ? -16.374 27.999 37.096  1.00 12.13 ? 581 HOH B O   1 
HETATM 5290 O  O   . HOH N 6 .   ? 16.133  31.929 32.054  1.00 20.66 ? 582 HOH B O   1 
HETATM 5291 O  O   . HOH N 6 .   ? 11.299  25.250 6.638   1.00 18.07 ? 583 HOH B O   1 
HETATM 5292 O  O   . HOH N 6 .   ? 7.678   4.421  29.368  1.00 23.73 ? 584 HOH B O   1 
HETATM 5293 O  O   . HOH N 6 .   ? -14.858 29.825 38.591  1.00 18.06 ? 585 HOH B O   1 
HETATM 5294 O  O   . HOH N 6 .   ? 16.536  24.901 17.681  1.00 19.27 ? 586 HOH B O   1 
HETATM 5295 O  O   . HOH N 6 .   ? -4.571  24.503 44.107  1.00 24.82 ? 587 HOH B O   1 
HETATM 5296 O  O   . HOH N 6 .   ? 4.271   12.031 27.292  1.00 22.44 ? 588 HOH B O   1 
HETATM 5297 O  O   . HOH N 6 .   ? -3.299  15.630 13.659  1.00 18.52 ? 589 HOH B O   1 
HETATM 5298 O  O   . HOH N 6 .   ? 10.085  16.596 -1.712  1.00 25.75 ? 590 HOH B O   1 
HETATM 5299 O  O   . HOH N 6 .   ? -6.685  12.773 14.303  1.00 15.53 ? 591 HOH B O   1 
HETATM 5300 O  O   . HOH N 6 .   ? -1.576  10.503 24.438  1.00 24.32 ? 592 HOH B O   1 
HETATM 5301 O  O   . HOH N 6 .   ? -0.000  9.187  0.000   0.50 28.75 ? 593 HOH B O   1 
HETATM 5302 O  O   . HOH N 6 .   ? -19.707 10.422 12.401  1.00 18.32 ? 594 HOH B O   1 
HETATM 5303 O  O   . HOH N 6 .   ? 4.859   39.818 27.972  1.00 23.98 ? 595 HOH B O   1 
HETATM 5304 O  O   . HOH N 6 .   ? -16.741 28.979 34.493  1.00 24.01 ? 596 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ILE 1   30  ?   ?   ?   A . n 
A 1 2   THR 2   31  ?   ?   ?   A . n 
A 1 3   ASN 3   32  ?   ?   ?   A . n 
A 1 4   SER 4   33  ?   ?   ?   A . n 
A 1 5   GLY 5   34  ?   ?   ?   A . n 
A 1 6   ASP 6   35  35  ASP ASP A . n 
A 1 7   ARG 7   36  36  ARG ARG A . n 
A 1 8   ILE 8   37  37  ILE ILE A . n 
A 1 9   ASN 9   38  38  ASN ASN A . n 
A 1 10  THR 10  39  39  THR THR A . n 
A 1 11  VAL 11  40  40  VAL VAL A . n 
A 1 12  ARG 12  41  41  ARG ARG A . n 
A 1 13  GLY 13  42  42  GLY GLY A . n 
A 1 14  PRO 14  43  43  PRO PRO A . n 
A 1 15  ILE 15  44  44  ILE ILE A . n 
A 1 16  THR 16  45  45  THR THR A . n 
A 1 17  ILE 17  46  46  ILE ILE A . n 
A 1 18  SER 18  47  47  SER SER A . n 
A 1 19  GLU 19  48  48  GLU GLU A . n 
A 1 20  ALA 20  49  49  ALA ALA A . n 
A 1 21  GLY 21  50  50  GLY GLY A . n 
A 1 22  PHE 22  51  51  PHE PHE A . n 
A 1 23  THR 23  52  52  THR THR A . n 
A 1 24  LEU 24  53  53  LEU LEU A . n 
A 1 25  MET 25  54  54  MET MET A . n 
A 1 26  HIS 26  55  55  HIS HIS A . n 
A 1 27  GLU 27  56  56  GLU GLU A . n 
A 1 28  HIS 28  57  57  HIS HIS A . n 
A 1 29  ILE 29  58  58  ILE ILE A . n 
A 1 30  CYS 30  59  59  CYS CYS A . n 
A 1 31  GLY 31  60  60  GLY GLY A . n 
A 1 32  SER 32  61  61  SER SER A . n 
A 1 33  SER 33  62  62  SER SER A . n 
A 1 34  ALA 34  63  63  ALA ALA A . n 
A 1 35  GLY 35  64  64  GLY GLY A . n 
A 1 36  PHE 36  65  65  PHE PHE A . n 
A 1 37  LEU 37  66  66  LEU LEU A . n 
A 1 38  ARG 38  67  67  ARG ARG A . n 
A 1 39  ALA 39  68  68  ALA ALA A . n 
A 1 40  TRP 40  69  69  TRP TRP A . n 
A 1 41  PRO 41  70  70  PRO PRO A . n 
A 1 42  GLU 42  71  71  GLU GLU A . n 
A 1 43  PHE 43  72  72  PHE PHE A . n 
A 1 44  PHE 44  73  73  PHE PHE A . n 
A 1 45  GLY 45  74  74  GLY GLY A . n 
A 1 46  SER 46  75  75  SER SER A . n 
A 1 47  ARG 47  76  76  ARG ARG A . n 
A 1 48  ASP 48  77  77  ASP ASP A . n 
A 1 49  ALA 49  78  78  ALA ALA A . n 
A 1 50  LEU 50  79  79  LEU LEU A . n 
A 1 51  ALA 51  80  80  ALA ALA A . n 
A 1 52  GLU 52  81  81  GLU GLU A . n 
A 1 53  LYS 53  82  82  LYS LYS A . n 
A 1 54  ALA 54  83  83  ALA ALA A . n 
A 1 55  VAL 55  84  84  VAL VAL A . n 
A 1 56  ARG 56  85  85  ARG ARG A . n 
A 1 57  GLY 57  86  86  GLY GLY A . n 
A 1 58  LEU 58  87  87  LEU LEU A . n 
A 1 59  ARG 59  88  88  ARG ARG A . n 
A 1 60  ARG 60  89  89  ARG ARG A . n 
A 1 61  ALA 61  90  90  ALA ALA A . n 
A 1 62  ARG 62  91  91  ARG ARG A . n 
A 1 63  ALA 63  92  92  ALA ALA A . n 
A 1 64  ALA 64  93  93  ALA ALA A . n 
A 1 65  GLY 65  94  94  GLY GLY A . n 
A 1 66  VAL 66  95  95  VAL VAL A . n 
A 1 67  ARG 67  96  96  ARG ARG A . n 
A 1 68  THR 68  97  97  THR THR A . n 
A 1 69  ILE 69  98  98  ILE ILE A . n 
A 1 70  VAL 70  99  99  VAL VAL A . n 
A 1 71  ASP 71  100 100 ASP ASP A . n 
A 1 72  VAL 72  101 101 VAL VAL A . n 
A 1 73  SER 73  102 102 SER SER A . n 
A 1 74  THR 74  103 103 THR THR A . n 
A 1 75  PHE 75  104 104 PHE PHE A . n 
A 1 76  ASP 76  105 105 ASP ASP A . n 
A 1 77  LEU 77  106 106 LEU LEU A . n 
A 1 78  GLY 78  107 107 GLY GLY A . n 
A 1 79  ARG 79  108 108 ARG ARG A . n 
A 1 80  ASP 80  109 109 ASP ASP A . n 
A 1 81  VAL 81  110 110 VAL VAL A . n 
A 1 82  GLU 82  111 111 GLU GLU A . n 
A 1 83  LEU 83  112 112 LEU LEU A . n 
A 1 84  LEU 84  113 113 LEU LEU A . n 
A 1 85  ALA 85  114 114 ALA ALA A . n 
A 1 86  GLU 86  115 115 GLU GLU A . n 
A 1 87  VAL 87  116 116 VAL VAL A . n 
A 1 88  SER 88  117 117 SER SER A . n 
A 1 89  GLU 89  118 118 GLU GLU A . n 
A 1 90  ALA 90  119 119 ALA ALA A . n 
A 1 91  ALA 91  120 120 ALA ALA A . n 
A 1 92  ASP 92  121 121 ASP ASP A . n 
A 1 93  VAL 93  122 122 VAL VAL A . n 
A 1 94  HIS 94  123 123 HIS HIS A . n 
A 1 95  ILE 95  124 124 ILE ILE A . n 
A 1 96  VAL 96  125 125 VAL VAL A . n 
A 1 97  ALA 97  126 126 ALA ALA A . n 
A 1 98  ALA 98  127 127 ALA ALA A . n 
A 1 99  THR 99  128 128 THR THR A . n 
A 1 100 GLY 100 129 129 GLY GLY A . n 
A 1 101 LEU 101 130 130 LEU LEU A . n 
A 1 102 TRP 102 131 131 TRP TRP A . n 
A 1 103 PHE 103 132 132 PHE PHE A . n 
A 1 104 ASP 104 133 133 ASP ASP A . n 
A 1 105 PRO 105 134 134 PRO PRO A . n 
A 1 106 PRO 106 135 135 PRO PRO A . n 
A 1 107 LEU 107 136 136 LEU LEU A . n 
A 1 108 SER 108 137 137 SER SER A . n 
A 1 109 MET 109 138 138 MET MET A . n 
A 1 110 ARG 110 139 139 ARG ARG A . n 
A 1 111 LEU 111 140 140 LEU LEU A . n 
A 1 112 ARG 112 141 141 ARG ARG A . n 
A 1 113 SER 113 142 142 SER SER A . n 
A 1 114 VAL 114 143 143 VAL VAL A . n 
A 1 115 GLU 115 144 144 GLU GLU A . n 
A 1 116 GLU 116 145 145 GLU GLU A . n 
A 1 117 LEU 117 146 146 LEU LEU A . n 
A 1 118 THR 118 147 147 THR THR A . n 
A 1 119 GLN 119 148 148 GLN GLN A . n 
A 1 120 PHE 120 149 149 PHE PHE A . n 
A 1 121 PHE 121 150 150 PHE PHE A . n 
A 1 122 LEU 122 151 151 LEU LEU A . n 
A 1 123 ARG 123 152 152 ARG ARG A . n 
A 1 124 GLU 124 153 153 GLU GLU A . n 
A 1 125 ILE 125 154 154 ILE ILE A . n 
A 1 126 GLN 126 155 155 GLN GLN A . n 
A 1 127 TYR 127 156 156 TYR TYR A . n 
A 1 128 GLY 128 157 157 GLY GLY A . n 
A 1 129 ILE 129 158 158 ILE ILE A . n 
A 1 130 GLU 130 159 159 GLU GLU A . n 
A 1 131 ASP 131 160 160 ASP ASP A . n 
A 1 132 THR 132 161 161 THR THR A . n 
A 1 133 GLY 133 162 162 GLY GLY A . n 
A 1 134 ILE 134 163 163 ILE ILE A . n 
A 1 135 ARG 135 164 164 ARG ARG A . n 
A 1 136 ALA 136 165 165 ALA ALA A . n 
A 1 137 GLY 137 166 166 GLY GLY A . n 
A 1 138 ILE 138 167 167 ILE ILE A . n 
A 1 139 ILE 139 168 168 ILE ILE A . n 
A 1 140 LYS 140 169 169 LYS LYS A . n 
A 1 141 VAL 141 170 170 VAL VAL A . n 
A 1 142 ALA 142 171 171 ALA ALA A . n 
A 1 143 THR 143 172 172 THR THR A . n 
A 1 144 THR 144 173 173 THR THR A . n 
A 1 145 GLY 145 174 174 GLY GLY A . n 
A 1 146 LYS 146 175 175 LYS LYS A . n 
A 1 147 ALA 147 176 176 ALA ALA A . n 
A 1 148 THR 148 177 177 THR THR A . n 
A 1 149 PRO 149 178 178 PRO PRO A . n 
A 1 150 PHE 150 179 179 PHE PHE A . n 
A 1 151 GLN 151 180 180 GLN GLN A . n 
A 1 152 GLU 152 181 181 GLU GLU A . n 
A 1 153 ARG 153 182 182 ARG ARG A . n 
A 1 154 VAL 154 183 183 VAL VAL A . n 
A 1 155 LEU 155 184 184 LEU LEU A . n 
A 1 156 ARG 156 185 185 ARG ARG A . n 
A 1 157 ALA 157 186 186 ALA ALA A . n 
A 1 158 ALA 158 187 187 ALA ALA A . n 
A 1 159 ALA 159 188 188 ALA ALA A . n 
A 1 160 ARG 160 189 189 ARG ARG A . n 
A 1 161 ALA 161 190 190 ALA ALA A . n 
A 1 162 SER 162 191 191 SER SER A . n 
A 1 163 LEU 163 192 192 LEU LEU A . n 
A 1 164 ALA 164 193 193 ALA ALA A . n 
A 1 165 THR 165 194 194 THR THR A . n 
A 1 166 GLY 166 195 195 GLY GLY A . n 
A 1 167 VAL 167 196 196 VAL VAL A . n 
A 1 168 PRO 168 197 197 PRO PRO A . n 
A 1 169 VAL 169 198 198 VAL VAL A . n 
A 1 170 THR 170 199 199 THR THR A . n 
A 1 171 THR 171 200 200 THR THR A . n 
A 1 172 HIS 172 201 201 HIS HIS A . n 
A 1 173 THR 173 202 202 THR THR A . n 
A 1 174 ASP 174 203 203 ASP ASP A . n 
A 1 175 ALA 175 204 204 ALA ALA A . n 
A 1 176 SER 176 205 205 SER SER A . n 
A 1 177 GLN 177 206 206 GLN GLN A . n 
A 1 178 ARG 178 207 207 ARG ARG A . n 
A 1 179 ASP 179 208 208 ASP ASP A . n 
A 1 180 GLY 180 209 209 GLY GLY A . n 
A 1 181 GLU 181 210 210 GLU GLU A . n 
A 1 182 GLN 182 211 211 GLN GLN A . n 
A 1 183 GLN 183 212 212 GLN GLN A . n 
A 1 184 ALA 184 213 213 ALA ALA A . n 
A 1 185 ASP 185 214 214 ASP ASP A . n 
A 1 186 ILE 186 215 215 ILE ILE A . n 
A 1 187 PHE 187 216 216 PHE PHE A . n 
A 1 188 GLU 188 217 217 GLU GLU A . n 
A 1 189 SER 189 218 218 SER SER A . n 
A 1 190 GLU 190 219 219 GLU GLU A . n 
A 1 191 GLY 191 220 220 GLY GLY A . n 
A 1 192 LEU 192 221 221 LEU LEU A . n 
A 1 193 ASP 193 222 222 ASP ASP A . n 
A 1 194 PRO 194 223 223 PRO PRO A . n 
A 1 195 SER 195 224 224 SER SER A . n 
A 1 196 ARG 196 225 225 ARG ARG A . n 
A 1 197 VAL 197 226 226 VAL VAL A . n 
A 1 198 CYS 198 227 227 CYS CYS A . n 
A 1 199 ILE 199 228 228 ILE ILE A . n 
A 1 200 GLY 200 229 229 GLY GLY A . n 
A 1 201 HIS 201 230 230 HIS HIS A . n 
A 1 202 SER 202 231 231 SER SER A . n 
A 1 203 ASP 203 232 232 ASP ASP A . n 
A 1 204 ASP 204 233 233 ASP ASP A . n 
A 1 205 THR 205 234 234 THR THR A . n 
A 1 206 ASP 206 235 235 ASP ASP A . n 
A 1 207 ASP 207 236 236 ASP ASP A . n 
A 1 208 LEU 208 237 237 LEU LEU A . n 
A 1 209 ASP 209 238 238 ASP ASP A . n 
A 1 210 TYR 210 239 239 TYR TYR A . n 
A 1 211 LEU 211 240 240 LEU LEU A . n 
A 1 212 THR 212 241 241 THR THR A . n 
A 1 213 ALA 213 242 242 ALA ALA A . n 
A 1 214 LEU 214 243 243 LEU LEU A . n 
A 1 215 ALA 215 244 244 ALA ALA A . n 
A 1 216 ALA 216 245 245 ALA ALA A . n 
A 1 217 ARG 217 246 246 ARG ARG A . n 
A 1 218 GLY 218 247 247 GLY GLY A . n 
A 1 219 TYR 219 248 248 TYR TYR A . n 
A 1 220 LEU 220 249 249 LEU LEU A . n 
A 1 221 ILE 221 250 250 ILE ILE A . n 
A 1 222 GLY 222 251 251 GLY GLY A . n 
A 1 223 LEU 223 252 252 LEU LEU A . n 
A 1 224 ASP 224 253 253 ASP ASP A . n 
A 1 225 GLY 225 254 254 GLY GLY A . n 
A 1 226 ILE 226 255 255 ILE ILE A . n 
A 1 227 PRO 227 256 256 PRO PRO A . n 
A 1 228 TRP 228 257 257 TRP TRP A . n 
A 1 229 SER 229 258 258 SER SER A . n 
A 1 230 ALA 230 259 259 ALA ALA A . n 
A 1 231 ILE 231 260 260 ILE ILE A . n 
A 1 232 GLY 232 261 261 GLY GLY A . n 
A 1 233 LEU 233 262 262 LEU LEU A . n 
A 1 234 GLU 234 263 263 GLU GLU A . n 
A 1 235 ASP 235 264 264 ASP ASP A . n 
A 1 236 ASN 236 265 265 ASN ASN A . n 
A 1 237 ALA 237 266 266 ALA ALA A . n 
A 1 238 SER 238 267 267 SER SER A . n 
A 1 239 ALA 239 268 268 ALA ALA A . n 
A 1 240 ALA 240 269 269 ALA ALA A . n 
A 1 241 ALA 241 270 270 ALA ALA A . n 
A 1 242 LEU 242 271 271 LEU LEU A . n 
A 1 243 LEU 243 272 272 LEU LEU A . n 
A 1 244 GLY 244 273 273 GLY GLY A . n 
A 1 245 LEU 245 274 274 LEU LEU A . n 
A 1 246 ARG 246 275 275 ARG ARG A . n 
A 1 247 SER 247 276 276 SER SER A . n 
A 1 248 TRP 248 277 277 TRP TRP A . n 
A 1 249 GLN 249 278 278 GLN GLN A . n 
A 1 250 THR 250 279 279 THR THR A . n 
A 1 251 ARG 251 280 280 ARG ARG A . n 
A 1 252 ALA 252 281 281 ALA ALA A . n 
A 1 253 LEU 253 282 282 LEU LEU A . n 
A 1 254 LEU 254 283 283 LEU LEU A . n 
A 1 255 ILE 255 284 284 ILE ILE A . n 
A 1 256 LYS 256 285 285 LYS LYS A . n 
A 1 257 ALA 257 286 286 ALA ALA A . n 
A 1 258 LEU 258 287 287 LEU LEU A . n 
A 1 259 ILE 259 288 288 ILE ILE A . n 
A 1 260 ASP 260 289 289 ASP ASP A . n 
A 1 261 GLN 261 290 290 GLN GLN A . n 
A 1 262 GLY 262 291 291 GLY GLY A . n 
A 1 263 TYR 263 292 292 TYR TYR A . n 
A 1 264 ALA 264 293 293 ALA ALA A . n 
A 1 265 ASP 265 294 294 ASP ASP A . n 
A 1 266 GLN 266 295 295 GLN GLN A . n 
A 1 267 ILE 267 296 296 ILE ILE A . n 
A 1 268 LEU 268 297 297 LEU LEU A . n 
A 1 269 VAL 269 298 298 VAL VAL A . n 
A 1 270 SER 270 299 299 SER SER A . n 
A 1 271 ASN 271 300 300 ASN ASN A . n 
A 1 272 ASP 272 301 301 ASP ASP A . n 
A 1 273 TRP 273 302 302 TRP TRP A . n 
A 1 274 THR 274 303 303 THR THR A . n 
A 1 275 PHE 275 304 304 PHE PHE A . n 
A 1 276 GLY 276 305 305 GLY GLY A . n 
A 1 277 PHE 277 306 306 PHE PHE A . n 
A 1 278 SER 278 307 307 SER SER A . n 
A 1 279 SER 279 308 308 SER SER A . n 
A 1 280 TYR 280 309 309 TYR TYR A . n 
A 1 281 VAL 281 310 310 VAL VAL A . n 
A 1 282 THR 282 311 311 THR THR A . n 
A 1 283 ASN 283 312 312 ASN ASN A . n 
A 1 284 ILE 284 313 313 ILE ILE A . n 
A 1 285 MET 285 314 314 MET MET A . n 
A 1 286 ASP 286 315 315 ASP ASP A . n 
A 1 287 VAL 287 316 316 VAL VAL A . n 
A 1 288 MET 288 317 317 MET MET A . n 
A 1 289 ASP 289 318 318 ASP ASP A . n 
A 1 290 ARG 290 319 319 ARG ARG A . n 
A 1 291 VAL 291 320 320 VAL VAL A . n 
A 1 292 ASN 292 321 321 ASN ASN A . n 
A 1 293 PRO 293 322 322 PRO PRO A . n 
A 1 294 ASP 294 323 323 ASP ASP A . n 
A 1 295 GLY 295 324 324 GLY GLY A . n 
A 1 296 MET 296 325 325 MET MET A . n 
A 1 297 ALA 297 326 326 ALA ALA A . n 
A 1 298 PHE 298 327 327 PHE PHE A . n 
A 1 299 ILE 299 328 328 ILE ILE A . n 
A 1 300 PRO 300 329 329 PRO PRO A . n 
A 1 301 LEU 301 330 330 LEU LEU A . n 
A 1 302 ARG 302 331 331 ARG ARG A . n 
A 1 303 VAL 303 332 332 VAL VAL A . n 
A 1 304 ILE 304 333 333 ILE ILE A . n 
A 1 305 PRO 305 334 334 PRO PRO A . n 
A 1 306 PHE 306 335 335 PHE PHE A . n 
A 1 307 LEU 307 336 336 LEU LEU A . n 
A 1 308 ARG 308 337 337 ARG ARG A . n 
A 1 309 GLU 309 338 338 GLU GLU A . n 
A 1 310 LYS 310 339 339 LYS LYS A . n 
A 1 311 GLY 311 340 340 GLY GLY A . n 
A 1 312 VAL 312 341 341 VAL VAL A . n 
A 1 313 PRO 313 342 342 PRO PRO A . n 
A 1 314 ASP 314 343 343 ASP ASP A . n 
A 1 315 GLU 315 344 344 GLU GLU A . n 
A 1 316 THR 316 345 345 THR THR A . n 
A 1 317 LEU 317 346 346 LEU LEU A . n 
A 1 318 GLU 318 347 347 GLU GLU A . n 
A 1 319 THR 319 348 348 THR THR A . n 
A 1 320 ILE 320 349 349 ILE ILE A . n 
A 1 321 MET 321 350 350 MET MET A . n 
A 1 322 VAL 322 351 351 VAL VAL A . n 
A 1 323 ASP 323 352 352 ASP ASP A . n 
A 1 324 ASN 324 353 353 ASN ASN A . n 
A 1 325 PRO 325 354 354 PRO PRO A . n 
A 1 326 ALA 326 355 355 ALA ALA A . n 
A 1 327 ARG 327 356 356 ARG ARG A . n 
A 1 328 PHE 328 357 357 PHE PHE A . n 
A 1 329 LEU 329 358 358 LEU LEU A . n 
A 1 330 SER 330 359 359 SER SER A . n 
A 1 331 PRO 331 360 360 PRO PRO A . n 
A 1 332 THR 332 361 361 THR THR A . n 
A 1 333 LEU 333 362 362 LEU LEU A . n 
A 1 334 ARG 334 363 ?   ?   ?   A . n 
A 1 335 ALA 335 364 ?   ?   ?   A . n 
A 1 336 SER 336 365 ?   ?   ?   A . n 
B 1 1   ILE 1   30  ?   ?   ?   B . n 
B 1 2   THR 2   31  ?   ?   ?   B . n 
B 1 3   ASN 3   32  ?   ?   ?   B . n 
B 1 4   SER 4   33  ?   ?   ?   B . n 
B 1 5   GLY 5   34  ?   ?   ?   B . n 
B 1 6   ASP 6   35  35  ASP ASP B . n 
B 1 7   ARG 7   36  36  ARG ARG B . n 
B 1 8   ILE 8   37  37  ILE ILE B . n 
B 1 9   ASN 9   38  38  ASN ASN B . n 
B 1 10  THR 10  39  39  THR THR B . n 
B 1 11  VAL 11  40  40  VAL VAL B . n 
B 1 12  ARG 12  41  41  ARG ARG B . n 
B 1 13  GLY 13  42  42  GLY GLY B . n 
B 1 14  PRO 14  43  43  PRO PRO B . n 
B 1 15  ILE 15  44  44  ILE ILE B . n 
B 1 16  THR 16  45  45  THR THR B . n 
B 1 17  ILE 17  46  46  ILE ILE B . n 
B 1 18  SER 18  47  47  SER SER B . n 
B 1 19  GLU 19  48  48  GLU GLU B . n 
B 1 20  ALA 20  49  49  ALA ALA B . n 
B 1 21  GLY 21  50  50  GLY GLY B . n 
B 1 22  PHE 22  51  51  PHE PHE B . n 
B 1 23  THR 23  52  52  THR THR B . n 
B 1 24  LEU 24  53  53  LEU LEU B . n 
B 1 25  MET 25  54  54  MET MET B . n 
B 1 26  HIS 26  55  55  HIS HIS B . n 
B 1 27  GLU 27  56  56  GLU GLU B . n 
B 1 28  HIS 28  57  57  HIS HIS B . n 
B 1 29  ILE 29  58  58  ILE ILE B . n 
B 1 30  CYS 30  59  59  CYS CYS B . n 
B 1 31  GLY 31  60  60  GLY GLY B . n 
B 1 32  SER 32  61  61  SER SER B . n 
B 1 33  SER 33  62  62  SER SER B . n 
B 1 34  ALA 34  63  63  ALA ALA B . n 
B 1 35  GLY 35  64  64  GLY GLY B . n 
B 1 36  PHE 36  65  65  PHE PHE B . n 
B 1 37  LEU 37  66  66  LEU LEU B . n 
B 1 38  ARG 38  67  67  ARG ARG B . n 
B 1 39  ALA 39  68  68  ALA ALA B . n 
B 1 40  TRP 40  69  69  TRP TRP B . n 
B 1 41  PRO 41  70  70  PRO PRO B . n 
B 1 42  GLU 42  71  71  GLU GLU B . n 
B 1 43  PHE 43  72  72  PHE PHE B . n 
B 1 44  PHE 44  73  73  PHE PHE B . n 
B 1 45  GLY 45  74  74  GLY GLY B . n 
B 1 46  SER 46  75  75  SER SER B . n 
B 1 47  ARG 47  76  76  ARG ARG B . n 
B 1 48  ASP 48  77  77  ASP ASP B . n 
B 1 49  ALA 49  78  78  ALA ALA B . n 
B 1 50  LEU 50  79  79  LEU LEU B . n 
B 1 51  ALA 51  80  80  ALA ALA B . n 
B 1 52  GLU 52  81  81  GLU GLU B . n 
B 1 53  LYS 53  82  82  LYS LYS B . n 
B 1 54  ALA 54  83  83  ALA ALA B . n 
B 1 55  VAL 55  84  84  VAL VAL B . n 
B 1 56  ARG 56  85  85  ARG ARG B . n 
B 1 57  GLY 57  86  86  GLY GLY B . n 
B 1 58  LEU 58  87  87  LEU LEU B . n 
B 1 59  ARG 59  88  88  ARG ARG B . n 
B 1 60  ARG 60  89  89  ARG ARG B . n 
B 1 61  ALA 61  90  90  ALA ALA B . n 
B 1 62  ARG 62  91  91  ARG ARG B . n 
B 1 63  ALA 63  92  92  ALA ALA B . n 
B 1 64  ALA 64  93  93  ALA ALA B . n 
B 1 65  GLY 65  94  94  GLY GLY B . n 
B 1 66  VAL 66  95  95  VAL VAL B . n 
B 1 67  ARG 67  96  96  ARG ARG B . n 
B 1 68  THR 68  97  97  THR THR B . n 
B 1 69  ILE 69  98  98  ILE ILE B . n 
B 1 70  VAL 70  99  99  VAL VAL B . n 
B 1 71  ASP 71  100 100 ASP ASP B . n 
B 1 72  VAL 72  101 101 VAL VAL B . n 
B 1 73  SER 73  102 102 SER SER B . n 
B 1 74  THR 74  103 103 THR THR B . n 
B 1 75  PHE 75  104 104 PHE PHE B . n 
B 1 76  ASP 76  105 105 ASP ASP B . n 
B 1 77  LEU 77  106 106 LEU LEU B . n 
B 1 78  GLY 78  107 107 GLY GLY B . n 
B 1 79  ARG 79  108 108 ARG ARG B . n 
B 1 80  ASP 80  109 109 ASP ASP B . n 
B 1 81  VAL 81  110 110 VAL VAL B . n 
B 1 82  GLU 82  111 111 GLU GLU B . n 
B 1 83  LEU 83  112 112 LEU LEU B . n 
B 1 84  LEU 84  113 113 LEU LEU B . n 
B 1 85  ALA 85  114 114 ALA ALA B . n 
B 1 86  GLU 86  115 115 GLU GLU B . n 
B 1 87  VAL 87  116 116 VAL VAL B . n 
B 1 88  SER 88  117 117 SER SER B . n 
B 1 89  GLU 89  118 118 GLU GLU B . n 
B 1 90  ALA 90  119 119 ALA ALA B . n 
B 1 91  ALA 91  120 120 ALA ALA B . n 
B 1 92  ASP 92  121 121 ASP ASP B . n 
B 1 93  VAL 93  122 122 VAL VAL B . n 
B 1 94  HIS 94  123 123 HIS HIS B . n 
B 1 95  ILE 95  124 124 ILE ILE B . n 
B 1 96  VAL 96  125 125 VAL VAL B . n 
B 1 97  ALA 97  126 126 ALA ALA B . n 
B 1 98  ALA 98  127 127 ALA ALA B . n 
B 1 99  THR 99  128 128 THR THR B . n 
B 1 100 GLY 100 129 129 GLY GLY B . n 
B 1 101 LEU 101 130 130 LEU LEU B . n 
B 1 102 TRP 102 131 131 TRP TRP B . n 
B 1 103 PHE 103 132 132 PHE PHE B . n 
B 1 104 ASP 104 133 133 ASP ASP B . n 
B 1 105 PRO 105 134 134 PRO PRO B . n 
B 1 106 PRO 106 135 135 PRO PRO B . n 
B 1 107 LEU 107 136 136 LEU LEU B . n 
B 1 108 SER 108 137 137 SER SER B . n 
B 1 109 MET 109 138 138 MET MET B . n 
B 1 110 ARG 110 139 139 ARG ARG B . n 
B 1 111 LEU 111 140 140 LEU LEU B . n 
B 1 112 ARG 112 141 141 ARG ARG B . n 
B 1 113 SER 113 142 142 SER SER B . n 
B 1 114 VAL 114 143 143 VAL VAL B . n 
B 1 115 GLU 115 144 144 GLU GLU B . n 
B 1 116 GLU 116 145 145 GLU GLU B . n 
B 1 117 LEU 117 146 146 LEU LEU B . n 
B 1 118 THR 118 147 147 THR THR B . n 
B 1 119 GLN 119 148 148 GLN GLN B . n 
B 1 120 PHE 120 149 149 PHE PHE B . n 
B 1 121 PHE 121 150 150 PHE PHE B . n 
B 1 122 LEU 122 151 151 LEU LEU B . n 
B 1 123 ARG 123 152 152 ARG ARG B . n 
B 1 124 GLU 124 153 153 GLU GLU B . n 
B 1 125 ILE 125 154 154 ILE ILE B . n 
B 1 126 GLN 126 155 155 GLN GLN B . n 
B 1 127 TYR 127 156 156 TYR TYR B . n 
B 1 128 GLY 128 157 157 GLY GLY B . n 
B 1 129 ILE 129 158 158 ILE ILE B . n 
B 1 130 GLU 130 159 159 GLU GLU B . n 
B 1 131 ASP 131 160 160 ASP ASP B . n 
B 1 132 THR 132 161 161 THR THR B . n 
B 1 133 GLY 133 162 162 GLY GLY B . n 
B 1 134 ILE 134 163 163 ILE ILE B . n 
B 1 135 ARG 135 164 164 ARG ARG B . n 
B 1 136 ALA 136 165 165 ALA ALA B . n 
B 1 137 GLY 137 166 166 GLY GLY B . n 
B 1 138 ILE 138 167 167 ILE ILE B . n 
B 1 139 ILE 139 168 168 ILE ILE B . n 
B 1 140 LYS 140 169 169 LYS LYS B . n 
B 1 141 VAL 141 170 170 VAL VAL B . n 
B 1 142 ALA 142 171 171 ALA ALA B . n 
B 1 143 THR 143 172 172 THR THR B . n 
B 1 144 THR 144 173 173 THR THR B . n 
B 1 145 GLY 145 174 174 GLY GLY B . n 
B 1 146 LYS 146 175 175 LYS LYS B . n 
B 1 147 ALA 147 176 176 ALA ALA B . n 
B 1 148 THR 148 177 177 THR THR B . n 
B 1 149 PRO 149 178 178 PRO PRO B . n 
B 1 150 PHE 150 179 179 PHE PHE B . n 
B 1 151 GLN 151 180 180 GLN GLN B . n 
B 1 152 GLU 152 181 181 GLU GLU B . n 
B 1 153 ARG 153 182 182 ARG ARG B . n 
B 1 154 VAL 154 183 183 VAL VAL B . n 
B 1 155 LEU 155 184 184 LEU LEU B . n 
B 1 156 ARG 156 185 185 ARG ARG B . n 
B 1 157 ALA 157 186 186 ALA ALA B . n 
B 1 158 ALA 158 187 187 ALA ALA B . n 
B 1 159 ALA 159 188 188 ALA ALA B . n 
B 1 160 ARG 160 189 189 ARG ARG B . n 
B 1 161 ALA 161 190 190 ALA ALA B . n 
B 1 162 SER 162 191 191 SER SER B . n 
B 1 163 LEU 163 192 192 LEU LEU B . n 
B 1 164 ALA 164 193 193 ALA ALA B . n 
B 1 165 THR 165 194 194 THR THR B . n 
B 1 166 GLY 166 195 195 GLY GLY B . n 
B 1 167 VAL 167 196 196 VAL VAL B . n 
B 1 168 PRO 168 197 197 PRO PRO B . n 
B 1 169 VAL 169 198 198 VAL VAL B . n 
B 1 170 THR 170 199 199 THR THR B . n 
B 1 171 THR 171 200 200 THR THR B . n 
B 1 172 HIS 172 201 201 HIS HIS B . n 
B 1 173 THR 173 202 202 THR THR B . n 
B 1 174 ASP 174 203 203 ASP ASP B . n 
B 1 175 ALA 175 204 204 ALA ALA B . n 
B 1 176 SER 176 205 205 SER SER B . n 
B 1 177 GLN 177 206 206 GLN GLN B . n 
B 1 178 ARG 178 207 207 ARG ARG B . n 
B 1 179 ASP 179 208 208 ASP ASP B . n 
B 1 180 GLY 180 209 209 GLY GLY B . n 
B 1 181 GLU 181 210 210 GLU GLU B . n 
B 1 182 GLN 182 211 211 GLN GLN B . n 
B 1 183 GLN 183 212 212 GLN GLN B . n 
B 1 184 ALA 184 213 213 ALA ALA B . n 
B 1 185 ASP 185 214 214 ASP ASP B . n 
B 1 186 ILE 186 215 215 ILE ILE B . n 
B 1 187 PHE 187 216 216 PHE PHE B . n 
B 1 188 GLU 188 217 217 GLU GLU B . n 
B 1 189 SER 189 218 218 SER SER B . n 
B 1 190 GLU 190 219 219 GLU GLU B . n 
B 1 191 GLY 191 220 220 GLY GLY B . n 
B 1 192 LEU 192 221 221 LEU LEU B . n 
B 1 193 ASP 193 222 222 ASP ASP B . n 
B 1 194 PRO 194 223 223 PRO PRO B . n 
B 1 195 SER 195 224 224 SER SER B . n 
B 1 196 ARG 196 225 225 ARG ARG B . n 
B 1 197 VAL 197 226 226 VAL VAL B . n 
B 1 198 CYS 198 227 227 CYS CYS B . n 
B 1 199 ILE 199 228 228 ILE ILE B . n 
B 1 200 GLY 200 229 229 GLY GLY B . n 
B 1 201 HIS 201 230 230 HIS HIS B . n 
B 1 202 SER 202 231 231 SER SER B . n 
B 1 203 ASP 203 232 232 ASP ASP B . n 
B 1 204 ASP 204 233 233 ASP ASP B . n 
B 1 205 THR 205 234 234 THR THR B . n 
B 1 206 ASP 206 235 235 ASP ASP B . n 
B 1 207 ASP 207 236 236 ASP ASP B . n 
B 1 208 LEU 208 237 237 LEU LEU B . n 
B 1 209 ASP 209 238 238 ASP ASP B . n 
B 1 210 TYR 210 239 239 TYR TYR B . n 
B 1 211 LEU 211 240 240 LEU LEU B . n 
B 1 212 THR 212 241 241 THR THR B . n 
B 1 213 ALA 213 242 242 ALA ALA B . n 
B 1 214 LEU 214 243 243 LEU LEU B . n 
B 1 215 ALA 215 244 244 ALA ALA B . n 
B 1 216 ALA 216 245 245 ALA ALA B . n 
B 1 217 ARG 217 246 246 ARG ARG B . n 
B 1 218 GLY 218 247 247 GLY GLY B . n 
B 1 219 TYR 219 248 248 TYR TYR B . n 
B 1 220 LEU 220 249 249 LEU LEU B . n 
B 1 221 ILE 221 250 250 ILE ILE B . n 
B 1 222 GLY 222 251 251 GLY GLY B . n 
B 1 223 LEU 223 252 252 LEU LEU B . n 
B 1 224 ASP 224 253 253 ASP ASP B . n 
B 1 225 GLY 225 254 254 GLY GLY B . n 
B 1 226 ILE 226 255 255 ILE ILE B . n 
B 1 227 PRO 227 256 256 PRO PRO B . n 
B 1 228 TRP 228 257 257 TRP TRP B . n 
B 1 229 SER 229 258 258 SER SER B . n 
B 1 230 ALA 230 259 259 ALA ALA B . n 
B 1 231 ILE 231 260 260 ILE ILE B . n 
B 1 232 GLY 232 261 261 GLY GLY B . n 
B 1 233 LEU 233 262 262 LEU LEU B . n 
B 1 234 GLU 234 263 263 GLU GLU B . n 
B 1 235 ASP 235 264 264 ASP ASP B . n 
B 1 236 ASN 236 265 265 ASN ASN B . n 
B 1 237 ALA 237 266 266 ALA ALA B . n 
B 1 238 SER 238 267 267 SER SER B . n 
B 1 239 ALA 239 268 268 ALA ALA B . n 
B 1 240 ALA 240 269 269 ALA ALA B . n 
B 1 241 ALA 241 270 270 ALA ALA B . n 
B 1 242 LEU 242 271 271 LEU LEU B . n 
B 1 243 LEU 243 272 272 LEU LEU B . n 
B 1 244 GLY 244 273 273 GLY GLY B . n 
B 1 245 LEU 245 274 274 LEU LEU B . n 
B 1 246 ARG 246 275 275 ARG ARG B . n 
B 1 247 SER 247 276 276 SER SER B . n 
B 1 248 TRP 248 277 277 TRP TRP B . n 
B 1 249 GLN 249 278 278 GLN GLN B . n 
B 1 250 THR 250 279 279 THR THR B . n 
B 1 251 ARG 251 280 280 ARG ARG B . n 
B 1 252 ALA 252 281 281 ALA ALA B . n 
B 1 253 LEU 253 282 282 LEU LEU B . n 
B 1 254 LEU 254 283 283 LEU LEU B . n 
B 1 255 ILE 255 284 284 ILE ILE B . n 
B 1 256 LYS 256 285 285 LYS LYS B . n 
B 1 257 ALA 257 286 286 ALA ALA B . n 
B 1 258 LEU 258 287 287 LEU LEU B . n 
B 1 259 ILE 259 288 288 ILE ILE B . n 
B 1 260 ASP 260 289 289 ASP ASP B . n 
B 1 261 GLN 261 290 290 GLN GLN B . n 
B 1 262 GLY 262 291 291 GLY GLY B . n 
B 1 263 TYR 263 292 292 TYR TYR B . n 
B 1 264 ALA 264 293 293 ALA ALA B . n 
B 1 265 ASP 265 294 294 ASP ASP B . n 
B 1 266 GLN 266 295 295 GLN GLN B . n 
B 1 267 ILE 267 296 296 ILE ILE B . n 
B 1 268 LEU 268 297 297 LEU LEU B . n 
B 1 269 VAL 269 298 298 VAL VAL B . n 
B 1 270 SER 270 299 299 SER SER B . n 
B 1 271 ASN 271 300 300 ASN ASN B . n 
B 1 272 ASP 272 301 301 ASP ASP B . n 
B 1 273 TRP 273 302 302 TRP TRP B . n 
B 1 274 THR 274 303 303 THR THR B . n 
B 1 275 PHE 275 304 304 PHE PHE B . n 
B 1 276 GLY 276 305 305 GLY GLY B . n 
B 1 277 PHE 277 306 306 PHE PHE B . n 
B 1 278 SER 278 307 307 SER SER B . n 
B 1 279 SER 279 308 308 SER SER B . n 
B 1 280 TYR 280 309 309 TYR TYR B . n 
B 1 281 VAL 281 310 310 VAL VAL B . n 
B 1 282 THR 282 311 311 THR THR B . n 
B 1 283 ASN 283 312 312 ASN ASN B . n 
B 1 284 ILE 284 313 313 ILE ILE B . n 
B 1 285 MET 285 314 314 MET MET B . n 
B 1 286 ASP 286 315 315 ASP ASP B . n 
B 1 287 VAL 287 316 316 VAL VAL B . n 
B 1 288 MET 288 317 317 MET MET B . n 
B 1 289 ASP 289 318 318 ASP ASP B . n 
B 1 290 ARG 290 319 319 ARG ARG B . n 
B 1 291 VAL 291 320 320 VAL VAL B . n 
B 1 292 ASN 292 321 321 ASN ASN B . n 
B 1 293 PRO 293 322 322 PRO PRO B . n 
B 1 294 ASP 294 323 323 ASP ASP B . n 
B 1 295 GLY 295 324 324 GLY GLY B . n 
B 1 296 MET 296 325 325 MET MET B . n 
B 1 297 ALA 297 326 326 ALA ALA B . n 
B 1 298 PHE 298 327 327 PHE PHE B . n 
B 1 299 ILE 299 328 328 ILE ILE B . n 
B 1 300 PRO 300 329 329 PRO PRO B . n 
B 1 301 LEU 301 330 330 LEU LEU B . n 
B 1 302 ARG 302 331 331 ARG ARG B . n 
B 1 303 VAL 303 332 332 VAL VAL B . n 
B 1 304 ILE 304 333 333 ILE ILE B . n 
B 1 305 PRO 305 334 334 PRO PRO B . n 
B 1 306 PHE 306 335 335 PHE PHE B . n 
B 1 307 LEU 307 336 336 LEU LEU B . n 
B 1 308 ARG 308 337 337 ARG ARG B . n 
B 1 309 GLU 309 338 338 GLU GLU B . n 
B 1 310 LYS 310 339 339 LYS LYS B . n 
B 1 311 GLY 311 340 340 GLY GLY B . n 
B 1 312 VAL 312 341 341 VAL VAL B . n 
B 1 313 PRO 313 342 342 PRO PRO B . n 
B 1 314 ASP 314 343 343 ASP ASP B . n 
B 1 315 GLU 315 344 344 GLU GLU B . n 
B 1 316 THR 316 345 345 THR THR B . n 
B 1 317 LEU 317 346 346 LEU LEU B . n 
B 1 318 GLU 318 347 347 GLU GLU B . n 
B 1 319 THR 319 348 348 THR THR B . n 
B 1 320 ILE 320 349 349 ILE ILE B . n 
B 1 321 MET 321 350 350 MET MET B . n 
B 1 322 VAL 322 351 351 VAL VAL B . n 
B 1 323 ASP 323 352 352 ASP ASP B . n 
B 1 324 ASN 324 353 353 ASN ASN B . n 
B 1 325 PRO 325 354 354 PRO PRO B . n 
B 1 326 ALA 326 355 355 ALA ALA B . n 
B 1 327 ARG 327 356 356 ARG ARG B . n 
B 1 328 PHE 328 357 357 PHE PHE B . n 
B 1 329 LEU 329 358 358 LEU LEU B . n 
B 1 330 SER 330 359 359 SER SER B . n 
B 1 331 PRO 331 360 360 PRO PRO B . n 
B 1 332 THR 332 361 361 THR THR B . n 
B 1 333 LEU 333 362 ?   ?   ?   B . n 
B 1 334 ARG 334 363 ?   ?   ?   B . n 
B 1 335 ALA 335 364 ?   ?   ?   B . n 
B 1 336 SER 336 365 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 FMT 1   401 369 FMT FMT A . 
D 3 ZN  1   402 401 ZN  ZN  A . 
E 3 ZN  1   403 402 ZN  ZN  A . 
F 4 EDO 1   404 501 EDO EDO A . 
G 5 CAC 1   405 463 CAC CAC A . 
H 2 FMT 1   401 369 FMT FMT B . 
I 3 ZN  1   402 401 ZN  ZN  B . 
J 3 ZN  1   403 402 ZN  ZN  B . 
K 5 CAC 1   404 463 CAC CAC B . 
L 4 EDO 1   405 501 EDO EDO B . 
M 6 HOH 1   501 199 HOH HOH A . 
M 6 HOH 2   502 149 HOH HOH A . 
M 6 HOH 3   503 98  HOH HOH A . 
M 6 HOH 4   504 107 HOH HOH A . 
M 6 HOH 5   505 87  HOH HOH A . 
M 6 HOH 6   506 113 HOH HOH A . 
M 6 HOH 7   507 187 HOH HOH A . 
M 6 HOH 8   508 206 HOH HOH A . 
M 6 HOH 9   509 193 HOH HOH A . 
M 6 HOH 10  510 14  HOH HOH A . 
M 6 HOH 11  511 43  HOH HOH A . 
M 6 HOH 12  512 124 HOH HOH A . 
M 6 HOH 13  513 210 HOH HOH A . 
M 6 HOH 14  514 133 HOH HOH A . 
M 6 HOH 15  515 75  HOH HOH A . 
M 6 HOH 16  516 79  HOH HOH A . 
M 6 HOH 17  517 6   HOH HOH A . 
M 6 HOH 18  518 159 HOH HOH A . 
M 6 HOH 19  519 83  HOH HOH A . 
M 6 HOH 20  520 119 HOH HOH A . 
M 6 HOH 21  521 109 HOH HOH A . 
M 6 HOH 22  522 146 HOH HOH A . 
M 6 HOH 23  523 93  HOH HOH A . 
M 6 HOH 24  524 195 HOH HOH A . 
M 6 HOH 25  525 185 HOH HOH A . 
M 6 HOH 26  526 66  HOH HOH A . 
M 6 HOH 27  527 125 HOH HOH A . 
M 6 HOH 28  528 84  HOH HOH A . 
M 6 HOH 29  529 120 HOH HOH A . 
M 6 HOH 30  530 198 HOH HOH A . 
M 6 HOH 31  531 4   HOH HOH A . 
M 6 HOH 32  532 69  HOH HOH A . 
M 6 HOH 33  533 25  HOH HOH A . 
M 6 HOH 34  534 22  HOH HOH A . 
M 6 HOH 35  535 77  HOH HOH A . 
M 6 HOH 36  536 65  HOH HOH A . 
M 6 HOH 37  537 35  HOH HOH A . 
M 6 HOH 38  538 103 HOH HOH A . 
M 6 HOH 39  539 44  HOH HOH A . 
M 6 HOH 40  540 11  HOH HOH A . 
M 6 HOH 41  541 8   HOH HOH A . 
M 6 HOH 42  542 37  HOH HOH A . 
M 6 HOH 43  543 46  HOH HOH A . 
M 6 HOH 44  544 48  HOH HOH A . 
M 6 HOH 45  545 54  HOH HOH A . 
M 6 HOH 46  546 150 HOH HOH A . 
M 6 HOH 47  547 74  HOH HOH A . 
M 6 HOH 48  548 158 HOH HOH A . 
M 6 HOH 49  549 151 HOH HOH A . 
M 6 HOH 50  550 27  HOH HOH A . 
M 6 HOH 51  551 200 HOH HOH A . 
M 6 HOH 52  552 170 HOH HOH A . 
M 6 HOH 53  553 18  HOH HOH A . 
M 6 HOH 54  554 15  HOH HOH A . 
M 6 HOH 55  555 28  HOH HOH A . 
M 6 HOH 56  556 118 HOH HOH A . 
M 6 HOH 57  557 76  HOH HOH A . 
M 6 HOH 58  558 121 HOH HOH A . 
M 6 HOH 59  559 81  HOH HOH A . 
M 6 HOH 60  560 166 HOH HOH A . 
M 6 HOH 61  561 5   HOH HOH A . 
M 6 HOH 62  562 16  HOH HOH A . 
M 6 HOH 63  563 17  HOH HOH A . 
M 6 HOH 64  564 202 HOH HOH A . 
M 6 HOH 65  565 95  HOH HOH A . 
M 6 HOH 66  566 23  HOH HOH A . 
M 6 HOH 67  567 106 HOH HOH A . 
M 6 HOH 68  568 45  HOH HOH A . 
M 6 HOH 69  569 190 HOH HOH A . 
M 6 HOH 70  570 89  HOH HOH A . 
M 6 HOH 71  571 85  HOH HOH A . 
M 6 HOH 72  572 94  HOH HOH A . 
M 6 HOH 73  573 13  HOH HOH A . 
M 6 HOH 74  574 10  HOH HOH A . 
M 6 HOH 75  575 32  HOH HOH A . 
M 6 HOH 76  576 39  HOH HOH A . 
M 6 HOH 77  577 92  HOH HOH A . 
M 6 HOH 78  578 143 HOH HOH A . 
M 6 HOH 79  579 218 HOH HOH A . 
M 6 HOH 80  580 176 HOH HOH A . 
M 6 HOH 81  581 56  HOH HOH A . 
M 6 HOH 82  582 160 HOH HOH A . 
M 6 HOH 83  583 181 HOH HOH A . 
M 6 HOH 84  584 59  HOH HOH A . 
M 6 HOH 85  585 134 HOH HOH A . 
M 6 HOH 86  586 139 HOH HOH A . 
M 6 HOH 87  587 47  HOH HOH A . 
M 6 HOH 88  588 131 HOH HOH A . 
M 6 HOH 89  589 137 HOH HOH A . 
M 6 HOH 90  590 49  HOH HOH A . 
M 6 HOH 91  591 136 HOH HOH A . 
M 6 HOH 92  592 55  HOH HOH A . 
M 6 HOH 93  593 205 HOH HOH A . 
M 6 HOH 94  594 36  HOH HOH A . 
M 6 HOH 95  595 172 HOH HOH A . 
M 6 HOH 96  596 90  HOH HOH A . 
M 6 HOH 97  597 57  HOH HOH A . 
M 6 HOH 98  598 145 HOH HOH A . 
M 6 HOH 99  599 188 HOH HOH A . 
M 6 HOH 100 600 115 HOH HOH A . 
M 6 HOH 101 601 42  HOH HOH A . 
M 6 HOH 102 602 127 HOH HOH A . 
M 6 HOH 103 603 217 HOH HOH A . 
M 6 HOH 104 604 40  HOH HOH A . 
M 6 HOH 105 605 155 HOH HOH A . 
M 6 HOH 106 606 161 HOH HOH A . 
M 6 HOH 107 607 173 HOH HOH A . 
M 6 HOH 108 608 96  HOH HOH A . 
M 6 HOH 109 609 102 HOH HOH A . 
M 6 HOH 110 610 153 HOH HOH A . 
M 6 HOH 111 611 182 HOH HOH A . 
M 6 HOH 112 612 111 HOH HOH A . 
M 6 HOH 113 613 214 HOH HOH A . 
M 6 HOH 114 614 88  HOH HOH A . 
M 6 HOH 115 615 30  HOH HOH A . 
M 6 HOH 116 616 208 HOH HOH A . 
M 6 HOH 117 617 126 HOH HOH A . 
N 6 HOH 1   501 53  HOH HOH B . 
N 6 HOH 2   502 211 HOH HOH B . 
N 6 HOH 3   503 70  HOH HOH B . 
N 6 HOH 4   504 101 HOH HOH B . 
N 6 HOH 5   505 144 HOH HOH B . 
N 6 HOH 6   506 177 HOH HOH B . 
N 6 HOH 7   507 164 HOH HOH B . 
N 6 HOH 8   508 73  HOH HOH B . 
N 6 HOH 9   509 61  HOH HOH B . 
N 6 HOH 10  510 19  HOH HOH B . 
N 6 HOH 11  511 33  HOH HOH B . 
N 6 HOH 12  512 156 HOH HOH B . 
N 6 HOH 13  513 62  HOH HOH B . 
N 6 HOH 14  514 3   HOH HOH B . 
N 6 HOH 15  515 105 HOH HOH B . 
N 6 HOH 16  516 157 HOH HOH B . 
N 6 HOH 17  517 58  HOH HOH B . 
N 6 HOH 18  518 114 HOH HOH B . 
N 6 HOH 19  519 100 HOH HOH B . 
N 6 HOH 20  520 86  HOH HOH B . 
N 6 HOH 21  521 189 HOH HOH B . 
N 6 HOH 22  522 7   HOH HOH B . 
N 6 HOH 23  523 50  HOH HOH B . 
N 6 HOH 24  524 152 HOH HOH B . 
N 6 HOH 25  525 99  HOH HOH B . 
N 6 HOH 26  526 192 HOH HOH B . 
N 6 HOH 27  527 216 HOH HOH B . 
N 6 HOH 28  528 82  HOH HOH B . 
N 6 HOH 29  529 175 HOH HOH B . 
N 6 HOH 30  530 108 HOH HOH B . 
N 6 HOH 31  531 29  HOH HOH B . 
N 6 HOH 32  532 165 HOH HOH B . 
N 6 HOH 33  533 116 HOH HOH B . 
N 6 HOH 34  534 184 HOH HOH B . 
N 6 HOH 35  535 169 HOH HOH B . 
N 6 HOH 36  536 129 HOH HOH B . 
N 6 HOH 37  537 212 HOH HOH B . 
N 6 HOH 38  538 80  HOH HOH B . 
N 6 HOH 39  539 196 HOH HOH B . 
N 6 HOH 40  540 178 HOH HOH B . 
N 6 HOH 41  541 64  HOH HOH B . 
N 6 HOH 42  542 213 HOH HOH B . 
N 6 HOH 43  543 9   HOH HOH B . 
N 6 HOH 44  544 123 HOH HOH B . 
N 6 HOH 45  545 117 HOH HOH B . 
N 6 HOH 46  546 67  HOH HOH B . 
N 6 HOH 47  547 24  HOH HOH B . 
N 6 HOH 48  548 60  HOH HOH B . 
N 6 HOH 49  549 207 HOH HOH B . 
N 6 HOH 50  550 91  HOH HOH B . 
N 6 HOH 51  551 174 HOH HOH B . 
N 6 HOH 52  552 26  HOH HOH B . 
N 6 HOH 53  553 130 HOH HOH B . 
N 6 HOH 54  554 51  HOH HOH B . 
N 6 HOH 55  555 138 HOH HOH B . 
N 6 HOH 56  556 203 HOH HOH B . 
N 6 HOH 57  557 171 HOH HOH B . 
N 6 HOH 58  558 63  HOH HOH B . 
N 6 HOH 59  559 148 HOH HOH B . 
N 6 HOH 60  560 215 HOH HOH B . 
N 6 HOH 61  561 110 HOH HOH B . 
N 6 HOH 62  562 72  HOH HOH B . 
N 6 HOH 63  563 41  HOH HOH B . 
N 6 HOH 64  564 71  HOH HOH B . 
N 6 HOH 65  565 194 HOH HOH B . 
N 6 HOH 66  566 183 HOH HOH B . 
N 6 HOH 67  567 186 HOH HOH B . 
N 6 HOH 68  568 20  HOH HOH B . 
N 6 HOH 69  569 12  HOH HOH B . 
N 6 HOH 70  570 167 HOH HOH B . 
N 6 HOH 71  571 142 HOH HOH B . 
N 6 HOH 72  572 52  HOH HOH B . 
N 6 HOH 73  573 163 HOH HOH B . 
N 6 HOH 74  574 180 HOH HOH B . 
N 6 HOH 75  575 168 HOH HOH B . 
N 6 HOH 76  576 78  HOH HOH B . 
N 6 HOH 77  577 34  HOH HOH B . 
N 6 HOH 78  578 31  HOH HOH B . 
N 6 HOH 79  579 162 HOH HOH B . 
N 6 HOH 80  580 209 HOH HOH B . 
N 6 HOH 81  581 21  HOH HOH B . 
N 6 HOH 82  582 140 HOH HOH B . 
N 6 HOH 83  583 68  HOH HOH B . 
N 6 HOH 84  584 147 HOH HOH B . 
N 6 HOH 85  585 38  HOH HOH B . 
N 6 HOH 86  586 201 HOH HOH B . 
N 6 HOH 87  587 197 HOH HOH B . 
N 6 HOH 88  588 112 HOH HOH B . 
N 6 HOH 89  589 132 HOH HOH B . 
N 6 HOH 90  590 104 HOH HOH B . 
N 6 HOH 91  591 97  HOH HOH B . 
N 6 HOH 92  592 122 HOH HOH B . 
N 6 HOH 93  593 154 HOH HOH B . 
N 6 HOH 94  594 128 HOH HOH B . 
N 6 HOH 95  595 179 HOH HOH B . 
N 6 HOH 96  596 204 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4710  ? 
1 MORE         -151  ? 
1 'SSA (A^2)'  22450 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    B 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     593 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   N 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  NE2 ? A HIS 26  ? A HIS 55  ? 1_555 ZN ? D ZN . ? A ZN 402 ? 1_555 NE2 ? A HIS 28  ? A HIS 57  ? 1_555 118.8 ? 
2  NE2 ? A HIS 26  ? A HIS 55  ? 1_555 ZN ? D ZN . ? A ZN 402 ? 1_555 OD1 ? A ASP 272 ? A ASP 301 ? 1_555 83.9  ? 
3  NE2 ? A HIS 28  ? A HIS 57  ? 1_555 ZN ? D ZN . ? A ZN 402 ? 1_555 OD1 ? A ASP 272 ? A ASP 301 ? 1_555 87.3  ? 
4  NE2 ? A HIS 26  ? A HIS 55  ? 1_555 ZN ? D ZN . ? A ZN 402 ? 1_555 O2  ? C FMT .   ? A FMT 401 ? 1_555 97.9  ? 
5  NE2 ? A HIS 28  ? A HIS 57  ? 1_555 ZN ? D ZN . ? A ZN 402 ? 1_555 O2  ? C FMT .   ? A FMT 401 ? 1_555 93.7  ? 
6  OD1 ? A ASP 272 ? A ASP 301 ? 1_555 ZN ? D ZN . ? A ZN 402 ? 1_555 O2  ? C FMT .   ? A FMT 401 ? 1_555 177.2 ? 
7  NE2 ? A HIS 26  ? A HIS 55  ? 1_555 ZN ? D ZN . ? A ZN 402 ? 1_555 O2  ? G CAC .   ? A CAC 405 ? 1_555 114.5 ? 
8  NE2 ? A HIS 28  ? A HIS 57  ? 1_555 ZN ? D ZN . ? A ZN 402 ? 1_555 O2  ? G CAC .   ? A CAC 405 ? 1_555 123.7 ? 
9  OD1 ? A ASP 272 ? A ASP 301 ? 1_555 ZN ? D ZN . ? A ZN 402 ? 1_555 O2  ? G CAC .   ? A CAC 405 ? 1_555 81.4  ? 
10 O2  ? C FMT .   ? A FMT 401 ? 1_555 ZN ? D ZN . ? A ZN 402 ? 1_555 O2  ? G CAC .   ? A CAC 405 ? 1_555 96.0  ? 
11 ND1 ? A HIS 172 ? A HIS 201 ? 1_555 ZN ? E ZN . ? A ZN 403 ? 1_555 NE2 ? A HIS 201 ? A HIS 230 ? 1_555 98.3  ? 
12 ND1 ? A HIS 172 ? A HIS 201 ? 1_555 ZN ? E ZN . ? A ZN 403 ? 1_555 O1  ? C FMT .   ? A FMT 401 ? 1_555 113.4 ? 
13 NE2 ? A HIS 201 ? A HIS 230 ? 1_555 ZN ? E ZN . ? A ZN 403 ? 1_555 O1  ? C FMT .   ? A FMT 401 ? 1_555 104.1 ? 
14 ND1 ? A HIS 172 ? A HIS 201 ? 1_555 ZN ? E ZN . ? A ZN 403 ? 1_555 O1  ? G CAC .   ? A CAC 405 ? 1_555 94.7  ? 
15 NE2 ? A HIS 201 ? A HIS 230 ? 1_555 ZN ? E ZN . ? A ZN 403 ? 1_555 O1  ? G CAC .   ? A CAC 405 ? 1_555 127.6 ? 
16 O1  ? C FMT .   ? A FMT 401 ? 1_555 ZN ? E ZN . ? A ZN 403 ? 1_555 O1  ? G CAC .   ? A CAC 405 ? 1_555 116.5 ? 
17 NE2 ? B HIS 26  ? B HIS 55  ? 1_555 ZN ? I ZN . ? B ZN 402 ? 1_555 NE2 ? B HIS 28  ? B HIS 57  ? 1_555 122.1 ? 
18 NE2 ? B HIS 26  ? B HIS 55  ? 1_555 ZN ? I ZN . ? B ZN 402 ? 1_555 OD1 ? B ASP 272 ? B ASP 301 ? 1_555 83.2  ? 
19 NE2 ? B HIS 28  ? B HIS 57  ? 1_555 ZN ? I ZN . ? B ZN 402 ? 1_555 OD1 ? B ASP 272 ? B ASP 301 ? 1_555 87.8  ? 
20 NE2 ? B HIS 26  ? B HIS 55  ? 1_555 ZN ? I ZN . ? B ZN 402 ? 1_555 O2  ? H FMT .   ? B FMT 401 ? 1_555 100.2 ? 
21 NE2 ? B HIS 28  ? B HIS 57  ? 1_555 ZN ? I ZN . ? B ZN 402 ? 1_555 O2  ? H FMT .   ? B FMT 401 ? 1_555 89.9  ? 
22 OD1 ? B ASP 272 ? B ASP 301 ? 1_555 ZN ? I ZN . ? B ZN 402 ? 1_555 O2  ? H FMT .   ? B FMT 401 ? 1_555 176.6 ? 
23 NE2 ? B HIS 26  ? B HIS 55  ? 1_555 ZN ? I ZN . ? B ZN 402 ? 1_555 O2  ? K CAC .   ? B CAC 404 ? 1_555 112.4 ? 
24 NE2 ? B HIS 28  ? B HIS 57  ? 1_555 ZN ? I ZN . ? B ZN 402 ? 1_555 O2  ? K CAC .   ? B CAC 404 ? 1_555 123.5 ? 
25 OD1 ? B ASP 272 ? B ASP 301 ? 1_555 ZN ? I ZN . ? B ZN 402 ? 1_555 O2  ? K CAC .   ? B CAC 404 ? 1_555 85.0  ? 
26 O2  ? H FMT .   ? B FMT 401 ? 1_555 ZN ? I ZN . ? B ZN 402 ? 1_555 O2  ? K CAC .   ? B CAC 404 ? 1_555 94.3  ? 
27 ND1 ? B HIS 172 ? B HIS 201 ? 1_555 ZN ? J ZN . ? B ZN 403 ? 1_555 NE2 ? B HIS 201 ? B HIS 230 ? 1_555 98.0  ? 
28 ND1 ? B HIS 172 ? B HIS 201 ? 1_555 ZN ? J ZN . ? B ZN 403 ? 1_555 O1  ? H FMT .   ? B FMT 401 ? 1_555 114.6 ? 
29 NE2 ? B HIS 201 ? B HIS 230 ? 1_555 ZN ? J ZN . ? B ZN 403 ? 1_555 O1  ? H FMT .   ? B FMT 401 ? 1_555 111.6 ? 
30 ND1 ? B HIS 172 ? B HIS 201 ? 1_555 ZN ? J ZN . ? B ZN 403 ? 1_555 O1  ? K CAC .   ? B CAC 404 ? 1_555 96.0  ? 
31 NE2 ? B HIS 201 ? B HIS 230 ? 1_555 ZN ? J ZN . ? B ZN 403 ? 1_555 O1  ? K CAC .   ? B CAC 404 ? 1_555 123.4 ? 
32 O1  ? H FMT .   ? B FMT 401 ? 1_555 ZN ? J ZN . ? B ZN 403 ? 1_555 O1  ? K CAC .   ? B CAC 404 ? 1_555 111.3 ? 
# 
_pdbx_audit_revision_history.ordinal             1 
_pdbx_audit_revision_history.data_content_type   'Structure model' 
_pdbx_audit_revision_history.major_revision      1 
_pdbx_audit_revision_history.minor_revision      0 
_pdbx_audit_revision_history.revision_date       2018-10-24 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0222 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? MOSFLM ? ? ? .        2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? SCALA  ? ? ? .        3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? .        4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 NZ A LYS 169 ? ? O1 A FMT 401 ? ? 2.15 
2 1 NZ B LYS 169 ? ? O1 B FMT 401 ? ? 2.15 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 NH1 B ARG 189 ? ? 1_555 NH1 B ARG 189 ? ? 2_555 1.23 
2 1 CZ  B ARG 189 ? ? 1_555 NH1 B ARG 189 ? ? 2_555 2.08 
3 1 CZ  B ARG 189 ? ? 1_555 CZ  B ARG 189 ? ? 2_555 2.10 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 SER A 61  ? ? -146.48 -147.92 
2  1 TRP A 69  ? ? -147.84 59.42   
3  1 THR A 128 ? ? -110.43 -167.38 
4  1 TRP A 131 ? ? -90.45  -155.06 
5  1 GLU A 159 ? ? 50.60   -130.04 
6  1 PHE A 306 ? ? -152.90 84.87   
7  1 SER A 308 ? ? -91.85  35.47   
8  1 SER B 61  ? ? -139.98 -150.17 
9  1 TRP B 69  ? ? -142.17 56.51   
10 1 THR B 128 ? ? -103.80 -165.40 
11 1 TRP B 131 ? ? -88.57  -155.04 
12 1 GLU B 159 ? ? 51.56   -129.71 
13 1 SER B 308 ? ? -87.18  37.94   
14 1 VAL B 351 ? ? -127.92 -55.72  
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1 1 THR A 202 ? ? ASP A 203 ? ? 148.33 
2 1 THR B 202 ? ? ASP B 203 ? ? 149.79 
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1 1 ARG A 36  ? ? 0.093 'SIDE CHAIN' 
2 1 ARG A 182 ? ? 0.105 'SIDE CHAIN' 
3 1 ARG A 356 ? ? 0.076 'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 B ARG 164 ? CZ  ? B ARG 135 CZ  
2 1 Y 1 B ARG 164 ? NH1 ? B ARG 135 NH1 
3 1 Y 1 B ARG 164 ? NH2 ? B ARG 135 NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A ILE 30  ? A ILE 1   
2  1 Y 1 A THR 31  ? A THR 2   
3  1 Y 1 A ASN 32  ? A ASN 3   
4  1 Y 1 A SER 33  ? A SER 4   
5  1 Y 1 A GLY 34  ? A GLY 5   
6  1 Y 1 A ARG 363 ? A ARG 334 
7  1 Y 1 A ALA 364 ? A ALA 335 
8  1 Y 1 A SER 365 ? A SER 336 
9  1 Y 1 B ILE 30  ? B ILE 1   
10 1 Y 1 B THR 31  ? B THR 2   
11 1 Y 1 B ASN 32  ? B ASN 3   
12 1 Y 1 B SER 33  ? B SER 4   
13 1 Y 1 B GLY 34  ? B GLY 5   
14 1 Y 1 B LEU 362 ? B LEU 333 
15 1 Y 1 B ARG 363 ? B ARG 334 
16 1 Y 1 B ALA 364 ? B ALA 335 
17 1 Y 1 B SER 365 ? B SER 336 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'FORMIC ACID'    FMT 
3 'ZINC ION'       ZN  
4 1,2-ETHANEDIOL   EDO 
5 'CACODYLATE ION' CAC 
6 water            HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'gel filtration' 
_pdbx_struct_assembly_auth_evidence.details                ? 
#