data_6GE3
# 
_entry.id   6GE3 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.299 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6GE3         
WWPDB D_1200009814 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6GE3 
_pdbx_database_status.recvd_initial_deposition_date   2018-04-25 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
_audit_author.name               'Kallen, J.' 
_audit_author.pdbx_ordinal       1 
_audit_author.identifier_ORCID   0000-0002-9389-9056 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Protein Sci.' 
_citation.journal_id_ASTM           PRCIEI 
_citation.journal_id_CSD            0795 
_citation.journal_id_ISSN           1469-896X 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            27 
_citation.language                  ? 
_citation.page_first                1810 
_citation.page_last                 1820 
_citation.title                     
'Adaptation of the bound intrinsically disordered protein YAP to mutations at the YAP:TEAD interface.' 
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1002/pro.3493 
_citation.pdbx_database_id_PubMed   30058229 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Mesrouze, Y.'   1  ?                   
primary 'Bokhovchuk, F.' 2  ?                   
primary 'Izaac, A.'      3  ?                   
primary 'Meyerhofer, M.' 4  ?                   
primary 'Zimmermann, C.' 5  ?                   
primary 'Fontana, P.'    6  ?                   
primary 'Schmelzle, T.'  7  ?                   
primary 'Erdmann, D.'    8  ?                   
primary 'Furet, P.'      9  ?                   
primary 'Kallen, J.'     10 ?                   
primary 'Chene, P.'      11 0000-0002-6010-9169 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6GE3 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     59.149 
_cell.length_a_esd                 ? 
_cell.length_b                     59.149 
_cell.length_b_esd                 ? 
_cell.length_c                     158.999 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6GE3 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                92 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 41 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Transcriptional enhancer factor TEF-3' 25500.721 1   ? ? 'C-terminal domain, YAP binding domain' ? 
2 polymer     nat 'Transcriptional coactivator YAP1'      4650.309  1   ? ? ?                                       ? 
3 non-polymer syn 'MYRISTIC ACID'                         228.371   1   ? ? ?                                       ? 
4 non-polymer syn GLYCEROL                                92.094    1   ? ? ?                                       ? 
5 water       nat water                                   18.015    195 ? ? ?                                       ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'TEA domain family member 4,TEAD-4,Transcription factor 13-like 1,Transcription factor RTEF-1' 
2 'Yes-associated protein 1,Protein yorkie homolog,Yes-associated protein YAP65 homolog'         
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;GRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFL
VKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIH
KLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE
;
;GRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFL
VKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIH
KLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE
;
A ? 
2 'polypeptide(L)' no no DSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPE DSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPE L ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ARG n 
1 3   SER n 
1 4   VAL n 
1 5   ALA n 
1 6   SER n 
1 7   SER n 
1 8   LYS n 
1 9   LEU n 
1 10  TRP n 
1 11  MET n 
1 12  LEU n 
1 13  GLU n 
1 14  PHE n 
1 15  SER n 
1 16  ALA n 
1 17  PHE n 
1 18  LEU n 
1 19  GLU n 
1 20  GLN n 
1 21  GLN n 
1 22  GLN n 
1 23  ASP n 
1 24  PRO n 
1 25  ASP n 
1 26  THR n 
1 27  TYR n 
1 28  ASN n 
1 29  LYS n 
1 30  HIS n 
1 31  LEU n 
1 32  PHE n 
1 33  VAL n 
1 34  HIS n 
1 35  ILE n 
1 36  GLY n 
1 37  GLN n 
1 38  SER n 
1 39  SER n 
1 40  PRO n 
1 41  SER n 
1 42  TYR n 
1 43  SER n 
1 44  ASP n 
1 45  PRO n 
1 46  TYR n 
1 47  LEU n 
1 48  GLU n 
1 49  ALA n 
1 50  VAL n 
1 51  ASP n 
1 52  ILE n 
1 53  ARG n 
1 54  GLN n 
1 55  ILE n 
1 56  TYR n 
1 57  ASP n 
1 58  LYS n 
1 59  PHE n 
1 60  PRO n 
1 61  GLU n 
1 62  LYS n 
1 63  LYS n 
1 64  GLY n 
1 65  GLY n 
1 66  LEU n 
1 67  LYS n 
1 68  ASP n 
1 69  LEU n 
1 70  PHE n 
1 71  GLU n 
1 72  ARG n 
1 73  GLY n 
1 74  PRO n 
1 75  SER n 
1 76  ASN n 
1 77  ALA n 
1 78  PHE n 
1 79  PHE n 
1 80  LEU n 
1 81  VAL n 
1 82  LYS n 
1 83  PHE n 
1 84  TRP n 
1 85  ALA n 
1 86  ASP n 
1 87  LEU n 
1 88  ASN n 
1 89  THR n 
1 90  ASN n 
1 91  ILE n 
1 92  GLU n 
1 93  ASP n 
1 94  GLU n 
1 95  GLY n 
1 96  SER n 
1 97  SER n 
1 98  PHE n 
1 99  TYR n 
1 100 GLY n 
1 101 VAL n 
1 102 SER n 
1 103 SER n 
1 104 GLN n 
1 105 TYR n 
1 106 GLU n 
1 107 SER n 
1 108 PRO n 
1 109 GLU n 
1 110 ASN n 
1 111 MET n 
1 112 ILE n 
1 113 ILE n 
1 114 THR n 
1 115 CYS n 
1 116 SER n 
1 117 THR n 
1 118 LYS n 
1 119 VAL n 
1 120 CYS n 
1 121 SER n 
1 122 PHE n 
1 123 GLY n 
1 124 LYS n 
1 125 GLN n 
1 126 VAL n 
1 127 VAL n 
1 128 GLU n 
1 129 LYS n 
1 130 VAL n 
1 131 GLU n 
1 132 THR n 
1 133 GLU n 
1 134 TYR n 
1 135 ALA n 
1 136 ARG n 
1 137 TYR n 
1 138 GLU n 
1 139 ASN n 
1 140 GLY n 
1 141 HIS n 
1 142 TYR n 
1 143 SER n 
1 144 TYR n 
1 145 ARG n 
1 146 ILE n 
1 147 HIS n 
1 148 ARG n 
1 149 SER n 
1 150 PRO n 
1 151 LEU n 
1 152 CYS n 
1 153 GLU n 
1 154 TYR n 
1 155 MET n 
1 156 ILE n 
1 157 ASN n 
1 158 PHE n 
1 159 ILE n 
1 160 HIS n 
1 161 LYS n 
1 162 LEU n 
1 163 LYS n 
1 164 HIS n 
1 165 LEU n 
1 166 PRO n 
1 167 GLU n 
1 168 LYS n 
1 169 TYR n 
1 170 MET n 
1 171 MET n 
1 172 ASN n 
1 173 SER n 
1 174 VAL n 
1 175 LEU n 
1 176 GLU n 
1 177 ASN n 
1 178 PHE n 
1 179 THR n 
1 180 ILE n 
1 181 LEU n 
1 182 GLN n 
1 183 VAL n 
1 184 VAL n 
1 185 THR n 
1 186 ASN n 
1 187 ARG n 
1 188 ASP n 
1 189 THR n 
1 190 GLN n 
1 191 GLU n 
1 192 THR n 
1 193 LEU n 
1 194 LEU n 
1 195 CYS n 
1 196 ILE n 
1 197 ALA n 
1 198 TYR n 
1 199 VAL n 
1 200 PHE n 
1 201 GLU n 
1 202 VAL n 
1 203 SER n 
1 204 ALA n 
1 205 SER n 
1 206 GLU n 
1 207 HIS n 
1 208 GLY n 
1 209 ALA n 
1 210 GLN n 
1 211 HIS n 
1 212 HIS n 
1 213 ILE n 
1 214 TYR n 
1 215 ARG n 
1 216 LEU n 
1 217 VAL n 
1 218 LYS n 
1 219 GLU n 
2 1   ASP n 
2 2   SER n 
2 3   GLU n 
2 4   THR n 
2 5   ASP n 
2 6   LEU n 
2 7   GLU n 
2 8   ALA n 
2 9   LEU n 
2 10  PHE n 
2 11  ASN n 
2 12  ALA n 
2 13  VAL n 
2 14  MET n 
2 15  ASN n 
2 16  PRO n 
2 17  LYS n 
2 18  THR n 
2 19  ALA n 
2 20  ASN n 
2 21  VAL n 
2 22  PRO n 
2 23  GLN n 
2 24  THR n 
2 25  VAL n 
2 26  PRO n 
2 27  MET n 
2 28  ARG n 
2 29  LEU n 
2 30  ARG n 
2 31  LYS n 
2 32  LEU n 
2 33  PRO n 
2 34  ASP n 
2 35  SER n 
2 36  PHE n 
2 37  PHE n 
2 38  LYS n 
2 39  PRO n 
2 40  PRO n 
2 41  GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   219 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'TEAD4, RTEF1, TCF13L1, TEF3' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'pET28-derived vector' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_entity_src_nat.entity_id                  2 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           1 
_entity_src_nat.pdbx_end_seq_num           41 
_entity_src_nat.common_name                Human 
_entity_src_nat.pdbx_organism_scientific   'Homo sapiens' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      9606 
_entity_src_nat.genus                      ? 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP TEAD4_HUMAN Q15561 ?        1 
;GRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFL
VKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIH
KLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE
;
216 
2 UNP YAP1_HUMAN  P46937 P46937-9 2 DSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPE 60  
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6GE3 A 1 ? 219 ? Q15561 216 ? 434 ? 216 434 
2 2 6GE3 L 1 ? 41  ? P46937 60  ? 100 ? 60  100 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                               'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ?                               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL        'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE       ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?                               'C5 H11 N O2 S'  149.211 
MYR non-polymer         . 'MYRISTIC ACID' ?                               'C14 H28 O2'     228.371 
PHE 'L-peptide linking' y PHENYLALANINE   ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ?                               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?                               'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6GE3 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.30 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         46.49 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '16% PEG 3350,2% tacsimate, 0.1M NaCit, pH 5.6' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2012-03-16 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'SI 111 channel' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.99984 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SLS BEAMLINE X10SA' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.99984 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   X10SA 
_diffrn_source.pdbx_synchrotron_site       SLS 
# 
_reflns.B_iso_Wilson_estimate            31.100 
_reflns.entry_id                         6GE3 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.850 
_reflns.d_resolution_low                 19.960 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       25036 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.800 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  12.800 
_reflns.pdbx_Rmerge_I_obs                0.068 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            26.300 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.070 
_reflns.pdbx_Rpim_I_all                  0.072 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         321014 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  1.850 
_reflns_shell.d_res_low                   1.900 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         3.600 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        100.000 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.704 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             12.900 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             0.733 
_reflns_shell.pdbx_Rpim_I_all             0.462 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            0.1100 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][2]                            0.1100 
_refine.aniso_B[2][3]                            0.0000 
_refine.aniso_B[3][3]                            -0.2300 
_refine.B_iso_max                                65.110 
_refine.B_iso_mean                               28.1250 
_refine.B_iso_min                                13.870 
_refine.correlation_coeff_Fo_to_Fc               0.9460 
_refine.correlation_coeff_Fo_to_Fc_free          0.9370 
_refine.details                                  
'HYDROGENS HAVE BEEN USED IF PRESENT IN THE INPUT U VALUES      : REFINED INDIVIDUALLY' 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6GE3 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.8500 
_refine.ls_d_res_low                             19.9600 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     23715 
_refine.ls_number_reflns_R_free                  1249 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.8700 
_refine.ls_percent_reflns_R_free                 5.0000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2193 
_refine.ls_R_factor_R_free                       0.2421 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2181 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       0.1610 
_refine.pdbx_overall_ESU_R_Free                  0.1400 
_refine.pdbx_solvent_vdw_probe_radii             1.2000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             3.1740 
_refine.overall_SU_ML                            0.0970 
_refine.overall_SU_R_Cruickshank_DPI             0.1607 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       1.8500 
_refine_hist.d_res_low                        19.9600 
_refine_hist.pdbx_number_atoms_ligand         22 
_refine_hist.number_atoms_solvent             195 
_refine_hist.number_atoms_total               2212 
_refine_hist.pdbx_number_residues_total       244 
_refine_hist.pdbx_B_iso_mean_ligand           39.78 
_refine_hist.pdbx_B_iso_mean_solvent          36.28 
_refine_hist.pdbx_number_atoms_protein        1995 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.007  0.022  2115 ? r_bond_refined_d       ? ? 
'X-RAY DIFFRACTION' ? 1.066  1.957  2868 ? r_angle_refined_deg    ? ? 
'X-RAY DIFFRACTION' ? 5.572  5.000  259  ? r_dihedral_angle_1_deg ? ? 
'X-RAY DIFFRACTION' ? 33.476 24.327 104  ? r_dihedral_angle_2_deg ? ? 
'X-RAY DIFFRACTION' ? 11.661 15.000 370  ? r_dihedral_angle_3_deg ? ? 
'X-RAY DIFFRACTION' ? 17.000 15.000 10   ? r_dihedral_angle_4_deg ? ? 
'X-RAY DIFFRACTION' ? 0.072  0.200  312  ? r_chiral_restr         ? ? 
'X-RAY DIFFRACTION' ? 0.004  0.021  1604 ? r_gen_planes_refined   ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       1.8500 
_refine_ls_shell.d_res_low                        1.8980 
_refine_ls_shell.number_reflns_all                1778 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             89 
_refine_ls_shell.number_reflns_R_work             1689 
_refine_ls_shell.percent_reflns_obs               100.0000 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.3680 
_refine_ls_shell.R_factor_R_free_error            0.0000 
_refine_ls_shell.R_factor_R_work                  0.2870 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
_struct.entry_id                     6GE3 
_struct.title                        
;X-ray structure of TEAD4 (wildtype) complexed with YAP (wildtype): The role of residual flexibility and water molecules in the adaptation of a bound intrinsically disordered protein to mutations at a binding interface
;
_struct.pdbx_descriptor              'Transcriptional enhancer factor TEF-3, Transcriptional coactivator YAP1' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6GE3 
_struct_keywords.text            'transcription factor, co-activator, transcription regulation, TRANSCRIPTION' 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 ARG A 53  ? PHE A 59  ? ARG A 268 PHE A 274 5 ? 7  
HELX_P HELX_P2 AA2 GLY A 65  ? GLY A 73  ? GLY A 280 GLY A 288 1 ? 9  
HELX_P HELX_P3 AA3 PRO A 74  ? ASN A 76  ? PRO A 289 ASN A 291 5 ? 3  
HELX_P HELX_P4 AA4 CYS A 152 ? HIS A 164 ? CYS A 367 HIS A 379 1 ? 13 
HELX_P HELX_P5 AA5 GLU A 167 ? GLU A 176 ? GLU A 382 GLU A 391 1 ? 10 
HELX_P HELX_P6 AA6 ASP B 5   ? ASN B 15  ? ASP L 64  ASN L 74  1 ? 11 
HELX_P HELX_P7 AA7 PRO B 16  ? ALA B 19  ? PRO L 75  ALA L 78  5 ? 4  
HELX_P HELX_P8 AA8 PRO B 26  ? ARG B 30  ? PRO L 85  ARG L 89  5 ? 5  
HELX_P HELX_P9 AA9 PRO B 33  ? LYS B 38  ? PRO L 92  LYS L 97  5 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          GLY 
_struct_mon_prot_cis.label_seq_id           73 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           GLY 
_struct_mon_prot_cis.auth_seq_id            288 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    74 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     289 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -0.25 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 5 ? 
AA2 ? 7 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA2 1 2 ? parallel      
AA2 2 3 ? anti-parallel 
AA2 3 4 ? parallel      
AA2 4 5 ? anti-parallel 
AA2 5 6 ? anti-parallel 
AA2 6 7 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 THR A 26  ? ILE A 35  ? THR A 241 ILE A 250 
AA1 2 TRP A 10  ? ASP A 23  ? TRP A 225 ASP A 238 
AA1 3 SER A 97  ? SER A 107 ? SER A 312 SER A 322 
AA1 4 HIS A 141 ? PRO A 150 ? HIS A 356 PRO A 365 
AA1 5 ARG A 136 ? GLU A 138 ? ARG A 351 GLU A 353 
AA2 1 GLU A 48  ? ASP A 51  ? GLU A 263 ASP A 266 
AA2 2 GLN A 210 ? VAL A 217 ? GLN A 425 VAL A 432 
AA2 3 PHE A 78  ? ALA A 85  ? PHE A 293 ALA A 300 
AA2 4 THR A 192 ? VAL A 202 ? THR A 407 VAL A 417 
AA2 5 PHE A 178 ? ASN A 186 ? PHE A 393 ASN A 401 
AA2 6 ILE A 113 ? SER A 121 ? ILE A 328 SER A 336 
AA2 7 LYS A 124 ? GLU A 133 ? LYS A 339 GLU A 348 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O ASN A 28  ? O ASN A 243 N GLN A 20  ? N GLN A 235 
AA1 2 3 N PHE A 17  ? N PHE A 232 O GLY A 100 ? O GLY A 315 
AA1 3 4 N TYR A 105 ? N TYR A 320 O TYR A 144 ? O TYR A 359 
AA1 4 5 O SER A 143 ? O SER A 358 N ARG A 136 ? N ARG A 351 
AA2 1 2 N VAL A 50  ? N VAL A 265 O ARG A 215 ? O ARG A 430 
AA2 2 3 O TYR A 214 ? O TYR A 429 N LEU A 80  ? N LEU A 295 
AA2 3 4 N VAL A 81  ? N VAL A 296 O ALA A 197 ? O ALA A 412 
AA2 4 5 O LEU A 194 ? O LEU A 409 N VAL A 184 ? N VAL A 399 
AA2 5 6 O THR A 179 ? O THR A 394 N CYS A 120 ? N CYS A 335 
AA2 6 7 N VAL A 119 ? N VAL A 334 O VAL A 126 ? O VAL A 341 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A MYR 501 ? 8  'binding site for residue MYR A 501' 
AC2 Software A GOL 502 ? 10 'binding site for residue GOL A 502' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 8  PHE A 14  ? PHE A 229 . ? 1_555 ? 
2  AC1 8  ALA A 16  ? ALA A 231 . ? 1_555 ? 
3  AC1 8  LYS A 129 ? LYS A 344 . ? 1_555 ? 
4  AC1 8  LEU A 151 ? LEU A 366 . ? 1_555 ? 
5  AC1 8  CYS A 152 ? CYS A 367 . ? 1_555 ? 
6  AC1 8  MET A 155 ? MET A 370 . ? 1_555 ? 
7  AC1 8  LEU A 175 ? LEU A 390 . ? 1_555 ? 
8  AC1 8  ILE A 180 ? ILE A 395 . ? 1_555 ? 
9  AC2 10 ASP A 57  ? ASP A 272 . ? 1_555 ? 
10 AC2 10 LYS A 58  ? LYS A 273 . ? 1_555 ? 
11 AC2 10 PHE A 122 ? PHE A 337 . ? 1_555 ? 
12 AC2 10 GLY A 123 ? GLY A 338 . ? 1_555 ? 
13 AC2 10 ASN A 177 ? ASN A 392 . ? 1_555 ? 
14 AC2 10 HOH E .   ? HOH A 601 . ? 1_555 ? 
15 AC2 10 HOH E .   ? HOH A 718 . ? 1_555 ? 
16 AC2 10 GLN B 23  ? GLN L 82  . ? 7_555 ? 
17 AC2 10 THR B 24  ? THR L 83  . ? 1_555 ? 
18 AC2 10 ARG B 30  ? ARG L 89  . ? 1_555 ? 
# 
_atom_sites.entry_id                    6GE3 
_atom_sites.fract_transf_matrix[1][1]   0.016906 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.016906 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006289 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ARG A 1 2   ? -5.262  -19.053 28.614 1.00 41.32 ? 217 ARG A N   1 
ATOM   2    C CA  . ARG A 1 2   ? -3.958  -18.850 27.915 1.00 40.97 ? 217 ARG A CA  1 
ATOM   3    C C   . ARG A 1 2   ? -4.141  -18.574 26.416 1.00 38.66 ? 217 ARG A C   1 
ATOM   4    O O   . ARG A 1 2   ? -3.887  -19.441 25.579 1.00 39.71 ? 217 ARG A O   1 
ATOM   5    C CB  . ARG A 1 2   ? -3.003  -20.031 28.164 1.00 44.73 ? 217 ARG A CB  1 
ATOM   6    C CG  . ARG A 1 2   ? -3.606  -21.425 27.972 1.00 48.81 ? 217 ARG A CG  1 
ATOM   7    C CD  . ARG A 1 2   ? -2.516  -22.479 27.786 1.00 52.72 ? 217 ARG A CD  1 
ATOM   8    N NE  . ARG A 1 2   ? -1.879  -22.390 26.469 1.00 55.72 ? 217 ARG A NE  1 
ATOM   9    C CZ  . ARG A 1 2   ? -0.707  -22.938 26.152 1.00 57.98 ? 217 ARG A CZ  1 
ATOM   10   N NH1 . ARG A 1 2   ? -0.014  -23.623 27.055 1.00 59.99 ? 217 ARG A NH1 1 
ATOM   11   N NH2 . ARG A 1 2   ? -0.221  -22.795 24.925 1.00 58.53 ? 217 ARG A NH2 1 
ATOM   12   N N   . SER A 1 3   ? -4.589  -17.363 26.089 1.00 36.35 ? 218 SER A N   1 
ATOM   13   C CA  . SER A 1 3   ? -4.801  -16.969 24.692 1.00 33.61 ? 218 SER A CA  1 
ATOM   14   C C   . SER A 1 3   ? -3.481  -16.623 24.010 1.00 31.51 ? 218 SER A C   1 
ATOM   15   O O   . SER A 1 3   ? -3.043  -17.330 23.096 1.00 30.62 ? 218 SER A O   1 
ATOM   16   C CB  . SER A 1 3   ? -5.772  -15.791 24.595 1.00 34.79 ? 218 SER A CB  1 
ATOM   17   O OG  . SER A 1 3   ? -7.064  -16.162 25.037 1.00 35.42 ? 218 SER A OG  1 
ATOM   18   N N   . VAL A 1 4   ? -2.848  -15.539 24.458 1.00 28.22 ? 219 VAL A N   1 
ATOM   19   C CA  . VAL A 1 4   ? -1.557  -15.136 23.905 1.00 26.08 ? 219 VAL A CA  1 
ATOM   20   C C   . VAL A 1 4   ? -0.476  -15.972 24.577 1.00 24.82 ? 219 VAL A C   1 
ATOM   21   O O   . VAL A 1 4   ? 0.196   -15.517 25.506 1.00 23.29 ? 219 VAL A O   1 
ATOM   22   C CB  . VAL A 1 4   ? -1.271  -13.621 24.077 1.00 25.55 ? 219 VAL A CB  1 
ATOM   23   C CG1 . VAL A 1 4   ? 0.016   -13.243 23.347 1.00 25.24 ? 219 VAL A CG1 1 
ATOM   24   C CG2 . VAL A 1 4   ? -2.432  -12.786 23.556 1.00 26.95 ? 219 VAL A CG2 1 
ATOM   25   N N   . ALA A 1 5   ? -0.334  -17.202 24.094 1.00 24.49 ? 220 ALA A N   1 
ATOM   26   C CA  . ALA A 1 5   ? 0.575   -18.169 24.674 1.00 23.99 ? 220 ALA A CA  1 
ATOM   27   C C   . ALA A 1 5   ? 1.132   -19.119 23.622 1.00 24.09 ? 220 ALA A C   1 
ATOM   28   O O   . ALA A 1 5   ? 0.381   -19.730 22.852 1.00 23.71 ? 220 ALA A O   1 
ATOM   29   C CB  . ALA A 1 5   ? -0.117  -18.947 25.795 1.00 23.92 ? 220 ALA A CB  1 
ATOM   30   N N   . SER A 1 6   ? 2.456   -19.219 23.582 1.00 23.38 ? 221 SER A N   1 
ATOM   31   C CA  . SER A 1 6   ? 3.132   -20.230 22.780 1.00 23.55 ? 221 SER A CA  1 
ATOM   32   C C   . SER A 1 6   ? 3.384   -21.442 23.673 1.00 23.79 ? 221 SER A C   1 
ATOM   33   O O   . SER A 1 6   ? 2.790   -21.553 24.747 1.00 24.74 ? 221 SER A O   1 
ATOM   34   C CB  . SER A 1 6   ? 4.452   -19.678 22.242 1.00 22.24 ? 221 SER A CB  1 
ATOM   35   O OG  . SER A 1 6   ? 5.349   -19.389 23.307 1.00 21.06 ? 221 SER A OG  1 
ATOM   36   N N   . SER A 1 7   ? 4.269   -22.336 23.243 1.00 24.66 ? 222 SER A N   1 
ATOM   37   C CA  A SER A 1 7   ? 4.653   -23.483 24.062 0.50 25.35 ? 222 SER A CA  1 
ATOM   38   C CA  B SER A 1 7   ? 4.653   -23.482 24.061 0.50 25.27 ? 222 SER A CA  1 
ATOM   39   C C   . SER A 1 7   ? 5.540   -23.055 25.230 1.00 25.47 ? 222 SER A C   1 
ATOM   40   O O   . SER A 1 7   ? 5.597   -23.738 26.255 1.00 26.25 ? 222 SER A O   1 
ATOM   41   C CB  A SER A 1 7   ? 5.363   -24.548 23.219 0.50 25.41 ? 222 SER A CB  1 
ATOM   42   C CB  B SER A 1 7   ? 5.367   -24.535 23.212 0.50 25.23 ? 222 SER A CB  1 
ATOM   43   O OG  A SER A 1 7   ? 6.721   -24.211 22.985 0.50 25.28 ? 222 SER A OG  1 
ATOM   44   O OG  B SER A 1 7   ? 4.526   -25.004 22.171 0.50 24.84 ? 222 SER A OG  1 
ATOM   45   N N   . LYS A 1 8   ? 6.216   -21.918 25.074 1.00 25.06 ? 223 LYS A N   1 
ATOM   46   C CA  . LYS A 1 8   ? 7.224   -21.475 26.049 1.00 24.64 ? 223 LYS A CA  1 
ATOM   47   C C   . LYS A 1 8   ? 6.888   -20.222 26.862 1.00 23.14 ? 223 LYS A C   1 
ATOM   48   O O   . LYS A 1 8   ? 7.517   -19.979 27.893 1.00 22.46 ? 223 LYS A O   1 
ATOM   49   C CB  . LYS A 1 8   ? 8.582   -21.266 25.365 1.00 26.05 ? 223 LYS A CB  1 
ATOM   50   C CG  . LYS A 1 8   ? 9.012   -22.338 24.368 1.00 28.22 ? 223 LYS A CG  1 
ATOM   51   C CD  . LYS A 1 8   ? 9.788   -23.475 25.011 1.00 29.27 ? 223 LYS A CD  1 
ATOM   52   C CE  . LYS A 1 8   ? 10.165  -24.536 23.971 1.00 29.65 ? 223 LYS A CE  1 
ATOM   53   N NZ  . LYS A 1 8   ? 11.349  -24.159 23.138 1.00 29.56 ? 223 LYS A NZ  1 
ATOM   54   N N   . LEU A 1 9   ? 5.940   -19.405 26.399 1.00 21.72 ? 224 LEU A N   1 
ATOM   55   C CA  . LEU A 1 9   ? 5.633   -18.147 27.098 1.00 20.69 ? 224 LEU A CA  1 
ATOM   56   C C   . LEU A 1 9   ? 4.176   -17.729 26.931 1.00 20.95 ? 224 LEU A C   1 
ATOM   57   O O   . LEU A 1 9   ? 3.597   -17.883 25.862 1.00 21.31 ? 224 LEU A O   1 
ATOM   58   C CB  . LEU A 1 9   ? 6.569   -17.017 26.624 1.00 19.74 ? 224 LEU A CB  1 
ATOM   59   C CG  . LEU A 1 9   ? 6.633   -15.729 27.452 1.00 19.54 ? 224 LEU A CG  1 
ATOM   60   C CD1 . LEU A 1 9   ? 7.377   -15.934 28.774 1.00 18.91 ? 224 LEU A CD1 1 
ATOM   61   C CD2 . LEU A 1 9   ? 7.298   -14.623 26.649 1.00 19.24 ? 224 LEU A CD2 1 
ATOM   62   N N   . TRP A 1 10  ? 3.605   -17.190 28.001 1.00 21.15 ? 225 TRP A N   1 
ATOM   63   C CA  . TRP A 1 10  ? 2.224   -16.735 28.018 1.00 21.36 ? 225 TRP A CA  1 
ATOM   64   C C   . TRP A 1 10  ? 2.192   -15.304 28.538 1.00 20.73 ? 225 TRP A C   1 
ATOM   65   O O   . TRP A 1 10  ? 2.695   -15.028 29.632 1.00 20.72 ? 225 TRP A O   1 
ATOM   66   C CB  . TRP A 1 10  ? 1.389   -17.667 28.907 1.00 22.86 ? 225 TRP A CB  1 
ATOM   67   C CG  . TRP A 1 10  ? -0.008  -17.187 29.250 1.00 24.80 ? 225 TRP A CG  1 
ATOM   68   C CD1 . TRP A 1 10  ? -0.857  -16.447 28.458 1.00 25.20 ? 225 TRP A CD1 1 
ATOM   69   C CD2 . TRP A 1 10  ? -0.731  -17.465 30.455 1.00 26.10 ? 225 TRP A CD2 1 
ATOM   70   N NE1 . TRP A 1 10  ? -2.047  -16.226 29.117 1.00 25.60 ? 225 TRP A NE1 1 
ATOM   71   C CE2 . TRP A 1 10  ? -2.001  -16.847 30.337 1.00 26.87 ? 225 TRP A CE2 1 
ATOM   72   C CE3 . TRP A 1 10  ? -0.428  -18.174 31.626 1.00 26.99 ? 225 TRP A CE3 1 
ATOM   73   C CZ2 . TRP A 1 10  ? -2.963  -16.917 31.348 1.00 27.33 ? 225 TRP A CZ2 1 
ATOM   74   C CZ3 . TRP A 1 10  ? -1.390  -18.243 32.634 1.00 27.92 ? 225 TRP A CZ3 1 
ATOM   75   C CH2 . TRP A 1 10  ? -2.639  -17.618 32.486 1.00 27.94 ? 225 TRP A CH2 1 
ATOM   76   N N   . MET A 1 11  ? 1.632   -14.394 27.740 1.00 20.01 ? 226 MET A N   1 
ATOM   77   C CA  . MET A 1 11  ? 1.411   -13.020 28.176 1.00 20.24 ? 226 MET A CA  1 
ATOM   78   C C   . MET A 1 11  ? 0.034   -12.958 28.827 1.00 21.21 ? 226 MET A C   1 
ATOM   79   O O   . MET A 1 11  ? -0.991  -13.047 28.139 1.00 21.14 ? 226 MET A O   1 
ATOM   80   C CB  . MET A 1 11  ? 1.517   -12.026 27.013 1.00 20.28 ? 226 MET A CB  1 
ATOM   81   C CG  . MET A 1 11  ? 1.473   -10.553 27.457 1.00 20.01 ? 226 MET A CG  1 
ATOM   82   S SD  . MET A 1 11  ? 1.619   -9.346  26.115 1.00 21.00 ? 226 MET A SD  1 
ATOM   83   C CE  . MET A 1 11  ? 0.026   -9.565  25.297 1.00 19.49 ? 226 MET A CE  1 
ATOM   84   N N   . LEU A 1 12  ? 0.028   -12.823 30.151 1.00 21.74 ? 227 LEU A N   1 
ATOM   85   C CA  A LEU A 1 12  ? -1.193  -12.821 30.965 0.50 22.70 ? 227 LEU A CA  1 
ATOM   86   C CA  B LEU A 1 12  ? -1.223  -12.836 30.899 0.50 23.18 ? 227 LEU A CA  1 
ATOM   87   C C   . LEU A 1 12  ? -1.856  -11.452 30.984 1.00 23.60 ? 227 LEU A C   1 
ATOM   88   O O   . LEU A 1 12  ? -3.087  -11.336 31.037 1.00 24.26 ? 227 LEU A O   1 
ATOM   89   C CB  A LEU A 1 12  ? -0.873  -13.211 32.414 0.50 21.82 ? 227 LEU A CB  1 
ATOM   90   C CB  B LEU A 1 12  ? -1.027  -13.458 32.290 0.50 23.28 ? 227 LEU A CB  1 
ATOM   91   C CG  A LEU A 1 12  ? -0.471  -14.637 32.797 0.50 21.72 ? 227 LEU A CG  1 
ATOM   92   C CG  B LEU A 1 12  ? -0.073  -12.825 33.302 0.50 23.60 ? 227 LEU A CG  1 
ATOM   93   C CD1 A LEU A 1 12  ? 1.013   -14.866 32.573 0.50 21.02 ? 227 LEU A CD1 1 
ATOM   94   C CD1 B LEU A 1 12  ? -0.846  -11.981 34.297 0.50 24.14 ? 227 LEU A CD1 1 
ATOM   95   C CD2 A LEU A 1 12  ? -0.823  -14.893 34.252 0.50 21.23 ? 227 LEU A CD2 1 
ATOM   96   C CD2 B LEU A 1 12  ? 0.702   -13.910 34.031 0.50 24.29 ? 227 LEU A CD2 1 
ATOM   97   N N   . GLU A 1 13  ? -1.017  -10.417 30.970 1.00 24.85 ? 228 GLU A N   1 
ATOM   98   C CA  . GLU A 1 13  ? -1.454  -9.034  31.139 1.00 26.91 ? 228 GLU A CA  1 
ATOM   99   C C   . GLU A 1 13  ? -0.710  -8.099  30.190 1.00 25.35 ? 228 GLU A C   1 
ATOM   100  O O   . GLU A 1 13  ? 0.488   -8.265  29.952 1.00 23.59 ? 228 GLU A O   1 
ATOM   101  C CB  . GLU A 1 13  ? -1.234  -8.602  32.600 1.00 29.86 ? 228 GLU A CB  1 
ATOM   102  C CG  . GLU A 1 13  ? -1.768  -7.217  32.982 1.00 34.56 ? 228 GLU A CG  1 
ATOM   103  C CD  . GLU A 1 13  ? -0.679  -6.145  33.064 1.00 37.41 ? 228 GLU A CD  1 
ATOM   104  O OE1 . GLU A 1 13  ? 0.339   -6.353  33.771 1.00 39.41 ? 228 GLU A OE1 1 
ATOM   105  O OE2 . GLU A 1 13  ? -0.854  -5.078  32.434 1.00 38.68 ? 228 GLU A OE2 1 
ATOM   106  N N   . PHE A 1 14  ? -1.437  -7.127  29.643 1.00 24.18 ? 229 PHE A N   1 
ATOM   107  C CA  . PHE A 1 14  ? -0.857  -6.065  28.835 1.00 24.98 ? 229 PHE A CA  1 
ATOM   108  C C   . PHE A 1 14  ? -1.773  -4.868  28.982 1.00 25.31 ? 229 PHE A C   1 
ATOM   109  O O   . PHE A 1 14  ? -2.968  -4.983  28.729 1.00 25.81 ? 229 PHE A O   1 
ATOM   110  C CB  . PHE A 1 14  ? -0.760  -6.479  27.356 1.00 24.74 ? 229 PHE A CB  1 
ATOM   111  C CG  . PHE A 1 14  ? -0.191  -5.407  26.451 1.00 25.57 ? 229 PHE A CG  1 
ATOM   112  C CD1 . PHE A 1 14  ? 1.167   -5.388  26.145 1.00 25.13 ? 229 PHE A CD1 1 
ATOM   113  C CD2 . PHE A 1 14  ? -1.016  -4.422  25.894 1.00 25.58 ? 229 PHE A CD2 1 
ATOM   114  C CE1 . PHE A 1 14  ? 1.701   -4.403  25.312 1.00 25.68 ? 229 PHE A CE1 1 
ATOM   115  C CE2 . PHE A 1 14  ? -0.490  -3.429  25.064 1.00 25.80 ? 229 PHE A CE2 1 
ATOM   116  C CZ  . PHE A 1 14  ? 0.870   -3.425  24.767 1.00 25.46 ? 229 PHE A CZ  1 
ATOM   117  N N   . SER A 1 15  ? -1.229  -3.734  29.409 1.00 25.33 ? 230 SER A N   1 
ATOM   118  C CA  . SER A 1 15  ? -2.022  -2.504  29.475 1.00 26.28 ? 230 SER A CA  1 
ATOM   119  C C   . SER A 1 15  ? -1.197  -1.249  29.208 1.00 25.70 ? 230 SER A C   1 
ATOM   120  O O   . SER A 1 15  ? -0.070  -1.120  29.688 1.00 26.71 ? 230 SER A O   1 
ATOM   121  C CB  . SER A 1 15  ? -2.782  -2.397  30.808 1.00 27.73 ? 230 SER A CB  1 
ATOM   122  O OG  . SER A 1 15  ? -1.931  -2.042  31.878 1.00 30.52 ? 230 SER A OG  1 
ATOM   123  N N   . ALA A 1 16  ? -1.766  -0.341  28.420 1.00 23.39 ? 231 ALA A N   1 
ATOM   124  C CA  . ALA A 1 16  ? -1.172  0.964   28.169 1.00 22.37 ? 231 ALA A CA  1 
ATOM   125  C C   . ALA A 1 16  ? -2.085  1.993   28.811 1.00 21.86 ? 231 ALA A C   1 
ATOM   126  O O   . ALA A 1 16  ? -3.307  1.920   28.664 1.00 20.76 ? 231 ALA A O   1 
ATOM   127  C CB  . ALA A 1 16  ? -1.047  1.217   26.681 1.00 22.28 ? 231 ALA A CB  1 
ATOM   128  N N   . PHE A 1 17  ? -1.496  2.937   29.534 1.00 21.71 ? 232 PHE A N   1 
ATOM   129  C CA  . PHE A 1 17  ? -2.282  3.812   30.393 1.00 22.01 ? 232 PHE A CA  1 
ATOM   130  C C   . PHE A 1 17  ? -1.711  5.215   30.531 1.00 22.18 ? 232 PHE A C   1 
ATOM   131  O O   . PHE A 1 17  ? -0.525  5.449   30.283 1.00 21.58 ? 232 PHE A O   1 
ATOM   132  C CB  . PHE A 1 17  ? -2.432  3.187   31.788 1.00 22.16 ? 232 PHE A CB  1 
ATOM   133  C CG  . PHE A 1 17  ? -1.122  2.903   32.474 1.00 22.10 ? 232 PHE A CG  1 
ATOM   134  C CD1 . PHE A 1 17  ? -0.484  3.887   33.228 1.00 22.74 ? 232 PHE A CD1 1 
ATOM   135  C CD2 . PHE A 1 17  ? -0.534  1.642   32.380 1.00 22.99 ? 232 PHE A CD2 1 
ATOM   136  C CE1 . PHE A 1 17  ? 0.728   3.628   33.862 1.00 22.77 ? 232 PHE A CE1 1 
ATOM   137  C CE2 . PHE A 1 17  ? 0.678   1.375   33.010 1.00 22.76 ? 232 PHE A CE2 1 
ATOM   138  C CZ  . PHE A 1 17  ? 1.310   2.370   33.751 1.00 22.30 ? 232 PHE A CZ  1 
ATOM   139  N N   . LEU A 1 18  ? -2.579  6.137   30.940 1.00 22.48 ? 233 LEU A N   1 
ATOM   140  C CA  . LEU A 1 18  ? -2.164  7.458   31.371 1.00 23.61 ? 233 LEU A CA  1 
ATOM   141  C C   . LEU A 1 18  ? -2.533  7.624   32.841 1.00 24.44 ? 233 LEU A C   1 
ATOM   142  O O   . LEU A 1 18  ? -3.707  7.528   33.211 1.00 24.52 ? 233 LEU A O   1 
ATOM   143  C CB  . LEU A 1 18  ? -2.843  8.546   30.528 1.00 24.78 ? 233 LEU A CB  1 
ATOM   144  C CG  . LEU A 1 18  ? -2.710  10.001  31.008 1.00 25.56 ? 233 LEU A CG  1 
ATOM   145  C CD1 . LEU A 1 18  ? -1.250  10.430  31.157 1.00 26.10 ? 233 LEU A CD1 1 
ATOM   146  C CD2 . LEU A 1 18  ? -3.457  10.942  30.076 1.00 26.50 ? 233 LEU A CD2 1 
ATOM   147  N N   . GLU A 1 19  ? -1.522  7.871   33.664 1.00 25.95 ? 234 GLU A N   1 
ATOM   148  C CA  . GLU A 1 19  ? -1.714  8.099   35.088 1.00 27.58 ? 234 GLU A CA  1 
ATOM   149  C C   . GLU A 1 19  ? -1.498  9.569   35.411 1.00 27.73 ? 234 GLU A C   1 
ATOM   150  O O   . GLU A 1 19  ? -0.441  10.130  35.113 1.00 27.49 ? 234 GLU A O   1 
ATOM   151  C CB  . GLU A 1 19  ? -0.748  7.238   35.893 1.00 29.29 ? 234 GLU A CB  1 
ATOM   152  C CG  . GLU A 1 19  ? -0.788  7.487   37.390 1.00 31.28 ? 234 GLU A CG  1 
ATOM   153  C CD  . GLU A 1 19  ? 0.357   6.805   38.108 1.00 32.35 ? 234 GLU A CD  1 
ATOM   154  O OE1 . GLU A 1 19  ? 1.501   7.302   38.019 1.00 34.36 ? 234 GLU A OE1 1 
ATOM   155  O OE2 . GLU A 1 19  ? 0.107   5.774   38.756 1.00 32.22 ? 234 GLU A OE2 1 
ATOM   156  N N   . GLN A 1 20  ? -2.502  10.189  36.019 1.00 28.87 ? 235 GLN A N   1 
ATOM   157  C CA  . GLN A 1 20  ? -2.406  11.593  36.386 1.00 30.45 ? 235 GLN A CA  1 
ATOM   158  C C   . GLN A 1 20  ? -2.376  11.759  37.900 1.00 31.05 ? 235 GLN A C   1 
ATOM   159  O O   . GLN A 1 20  ? -3.244  11.244  38.607 1.00 29.50 ? 235 GLN A O   1 
ATOM   160  C CB  . GLN A 1 20  ? -3.538  12.406  35.745 1.00 33.09 ? 235 GLN A CB  1 
ATOM   161  C CG  . GLN A 1 20  ? -3.370  12.575  34.226 1.00 36.13 ? 235 GLN A CG  1 
ATOM   162  C CD  . GLN A 1 20  ? -4.361  13.545  33.595 1.00 38.75 ? 235 GLN A CD  1 
ATOM   163  O OE1 . GLN A 1 20  ? -5.406  13.859  34.170 1.00 40.90 ? 235 GLN A OE1 1 
ATOM   164  N NE2 . GLN A 1 20  ? -4.039  14.013  32.394 1.00 40.28 ? 235 GLN A NE2 1 
ATOM   165  N N   . GLN A 1 21  ? -1.349  12.451  38.385 1.00 31.99 ? 236 GLN A N   1 
ATOM   166  C CA  . GLN A 1 21  ? -1.219  12.754  39.805 1.00 35.51 ? 236 GLN A CA  1 
ATOM   167  C C   . GLN A 1 21  ? -1.989  14.029  40.117 1.00 37.68 ? 236 GLN A C   1 
ATOM   168  O O   . GLN A 1 21  ? -1.551  15.131  39.774 1.00 37.97 ? 236 GLN A O   1 
ATOM   169  C CB  . GLN A 1 21  ? 0.252   12.901  40.213 1.00 35.96 ? 236 GLN A CB  1 
ATOM   170  C CG  . GLN A 1 21  ? 0.462   13.198  41.707 1.00 37.78 ? 236 GLN A CG  1 
ATOM   171  C CD  . GLN A 1 21  ? 1.929   13.221  42.129 1.00 39.18 ? 236 GLN A CD  1 
ATOM   172  O OE1 . GLN A 1 21  ? 2.838   13.066  41.309 1.00 40.41 ? 236 GLN A OE1 1 
ATOM   173  N NE2 . GLN A 1 21  ? 2.163   13.414  43.421 1.00 38.83 ? 236 GLN A NE2 1 
ATOM   174  N N   . GLN A 1 22  ? -3.147  13.862  40.748 1.00 38.56 ? 237 GLN A N   1 
ATOM   175  C CA  . GLN A 1 22  ? -3.974  14.979  41.190 1.00 40.82 ? 237 GLN A CA  1 
ATOM   176  C C   . GLN A 1 22  ? -3.245  15.716  42.319 1.00 41.46 ? 237 GLN A C   1 
ATOM   177  O O   . GLN A 1 22  ? -2.945  16.909  42.210 1.00 40.53 ? 237 GLN A O   1 
ATOM   178  C CB  . GLN A 1 22  ? -5.332  14.450  41.652 1.00 43.14 ? 237 GLN A CB  1 
ATOM   179  C CG  . GLN A 1 22  ? -6.423  15.489  41.797 1.00 46.69 ? 237 GLN A CG  1 
ATOM   180  C CD  . GLN A 1 22  ? -7.765  14.865  42.136 1.00 47.79 ? 237 GLN A CD  1 
ATOM   181  O OE1 . GLN A 1 22  ? -8.254  13.983  41.425 1.00 50.70 ? 237 GLN A OE1 1 
ATOM   182  N NE2 . GLN A 1 22  ? -8.370  15.322  43.228 1.00 49.04 ? 237 GLN A NE2 1 
ATOM   183  N N   . ASP A 1 23  ? -2.951  14.985  43.391 1.00 40.97 ? 238 ASP A N   1 
ATOM   184  C CA  . ASP A 1 23  ? -2.123  15.473  44.494 1.00 39.41 ? 238 ASP A CA  1 
ATOM   185  C C   . ASP A 1 23  ? -1.207  14.334  44.973 1.00 38.02 ? 238 ASP A C   1 
ATOM   186  O O   . ASP A 1 23  ? -1.334  13.209  44.490 1.00 37.84 ? 238 ASP A O   1 
ATOM   187  C CB  . ASP A 1 23  ? -3.003  16.029  45.625 1.00 40.08 ? 238 ASP A CB  1 
ATOM   188  C CG  . ASP A 1 23  ? -4.020  15.023  46.134 1.00 39.67 ? 238 ASP A CG  1 
ATOM   189  O OD1 . ASP A 1 23  ? -5.234  15.302  46.024 1.00 40.06 ? 238 ASP A OD1 1 
ATOM   190  O OD2 . ASP A 1 23  ? -3.612  13.959  46.648 1.00 39.85 ? 238 ASP A OD2 1 
ATOM   191  N N   . PRO A 1 24  ? -0.271  14.618  45.907 1.00 37.42 ? 239 PRO A N   1 
ATOM   192  C CA  . PRO A 1 24  ? 0.647   13.591  46.425 1.00 36.21 ? 239 PRO A CA  1 
ATOM   193  C C   . PRO A 1 24  ? 0.027   12.229  46.782 1.00 34.50 ? 239 PRO A C   1 
ATOM   194  O O   . PRO A 1 24  ? 0.721   11.213  46.705 1.00 33.43 ? 239 PRO A O   1 
ATOM   195  C CB  . PRO A 1 24  ? 1.226   14.252  47.675 1.00 37.28 ? 239 PRO A CB  1 
ATOM   196  C CG  . PRO A 1 24  ? 1.249   15.700  47.340 1.00 36.81 ? 239 PRO A CG  1 
ATOM   197  C CD  . PRO A 1 24  ? 0.110   15.964  46.383 1.00 37.24 ? 239 PRO A CD  1 
ATOM   198  N N   . ASP A 1 25  ? -1.254  12.207  47.152 1.00 31.58 ? 240 ASP A N   1 
ATOM   199  C CA  . ASP A 1 25  ? -1.922  10.965  47.566 1.00 30.19 ? 240 ASP A CA  1 
ATOM   200  C C   . ASP A 1 25  ? -3.030  10.485  46.624 1.00 29.05 ? 240 ASP A C   1 
ATOM   201  O O   . ASP A 1 25  ? -3.714  9.498   46.919 1.00 28.51 ? 240 ASP A O   1 
ATOM   202  C CB  . ASP A 1 25  ? -2.496  11.120  48.979 1.00 29.74 ? 240 ASP A CB  1 
ATOM   203  C CG  . ASP A 1 25  ? -1.424  11.205  50.050 1.00 29.77 ? 240 ASP A CG  1 
ATOM   204  O OD1 . ASP A 1 25  ? -0.251  10.880  49.783 1.00 29.55 ? 240 ASP A OD1 1 
ATOM   205  O OD2 . ASP A 1 25  ? -1.765  11.598  51.181 1.00 30.18 ? 240 ASP A OD2 1 
ATOM   206  N N   . THR A 1 26  ? -3.202  11.165  45.493 1.00 28.03 ? 241 THR A N   1 
ATOM   207  C CA  . THR A 1 26  ? -4.329  10.891  44.604 1.00 28.14 ? 241 THR A CA  1 
ATOM   208  C C   . THR A 1 26  ? -3.879  10.721  43.158 1.00 27.61 ? 241 THR A C   1 
ATOM   209  O O   . THR A 1 26  ? -3.272  11.620  42.575 1.00 25.92 ? 241 THR A O   1 
ATOM   210  C CB  . THR A 1 26  ? -5.394  12.009  44.704 1.00 29.39 ? 241 THR A CB  1 
ATOM   211  O OG1 . THR A 1 26  ? -5.671  12.270  46.087 1.00 30.85 ? 241 THR A OG1 1 
ATOM   212  C CG2 . THR A 1 26  ? -6.685  11.613  43.993 1.00 30.13 ? 241 THR A CG2 1 
ATOM   213  N N   . TYR A 1 27  ? -4.177  9.554   42.597 1.00 27.91 ? 242 TYR A N   1 
ATOM   214  C CA  . TYR A 1 27  ? -3.792  9.223   41.227 1.00 28.58 ? 242 TYR A CA  1 
ATOM   215  C C   . TYR A 1 27  ? -4.994  8.722   40.433 1.00 29.04 ? 242 TYR A C   1 
ATOM   216  O O   . TYR A 1 27  ? -5.742  7.860   40.899 1.00 29.67 ? 242 TYR A O   1 
ATOM   217  C CB  . TYR A 1 27  ? -2.677  8.170   41.228 1.00 29.97 ? 242 TYR A CB  1 
ATOM   218  C CG  . TYR A 1 27  ? -1.386  8.655   41.850 1.00 30.44 ? 242 TYR A CG  1 
ATOM   219  C CD1 . TYR A 1 27  ? -0.352  9.157   41.055 1.00 30.66 ? 242 TYR A CD1 1 
ATOM   220  C CD2 . TYR A 1 27  ? -1.195  8.618   43.234 1.00 30.43 ? 242 TYR A CD2 1 
ATOM   221  C CE1 . TYR A 1 27  ? 0.837   9.606   41.622 1.00 31.72 ? 242 TYR A CE1 1 
ATOM   222  C CE2 . TYR A 1 27  ? -0.014  9.070   43.810 1.00 31.56 ? 242 TYR A CE2 1 
ATOM   223  C CZ  . TYR A 1 27  ? 0.995   9.561   43.002 1.00 31.94 ? 242 TYR A CZ  1 
ATOM   224  O OH  . TYR A 1 27  ? 2.161   10.005  43.571 1.00 33.50 ? 242 TYR A OH  1 
ATOM   225  N N   . ASN A 1 28  ? -5.187  9.284   39.242 1.00 28.09 ? 243 ASN A N   1 
ATOM   226  C CA  . ASN A 1 28  ? -6.233  8.830   38.339 1.00 27.76 ? 243 ASN A CA  1 
ATOM   227  C C   . ASN A 1 28  ? -5.595  8.132   37.149 1.00 27.19 ? 243 ASN A C   1 
ATOM   228  O O   . ASN A 1 28  ? -4.728  8.699   36.486 1.00 27.83 ? 243 ASN A O   1 
ATOM   229  C CB  . ASN A 1 28  ? -7.112  10.004  37.902 1.00 29.52 ? 243 ASN A CB  1 
ATOM   230  C CG  . ASN A 1 28  ? -7.844  10.649  39.074 1.00 31.07 ? 243 ASN A CG  1 
ATOM   231  O OD1 . ASN A 1 28  ? -8.460  9.958   39.892 1.00 33.87 ? 243 ASN A OD1 1 
ATOM   232  N ND2 . ASN A 1 28  ? -7.774  11.973  39.164 1.00 33.39 ? 243 ASN A ND2 1 
ATOM   233  N N   . LYS A 1 29  ? -6.000  6.891   36.908 1.00 26.10 ? 244 LYS A N   1 
ATOM   234  C CA  . LYS A 1 29  ? -5.429  6.096   35.829 1.00 26.09 ? 244 LYS A CA  1 
ATOM   235  C C   . LYS A 1 29  ? -6.471  5.771   34.765 1.00 25.28 ? 244 LYS A C   1 
ATOM   236  O O   . LYS A 1 29  ? -7.518  5.189   35.057 1.00 25.40 ? 244 LYS A O   1 
ATOM   237  C CB  . LYS A 1 29  ? -4.791  4.808   36.377 1.00 26.70 ? 244 LYS A CB  1 
ATOM   238  C CG  . LYS A 1 29  ? -4.296  3.846   35.297 1.00 28.88 ? 244 LYS A CG  1 
ATOM   239  C CD  . LYS A 1 29  ? -3.859  2.507   35.874 1.00 29.95 ? 244 LYS A CD  1 
ATOM   240  C CE  . LYS A 1 29  ? -2.366  2.456   36.117 1.00 31.63 ? 244 LYS A CE  1 
ATOM   241  N NZ  . LYS A 1 29  ? -1.946  1.110   36.610 1.00 32.19 ? 244 LYS A NZ  1 
ATOM   242  N N   . HIS A 1 30  ? -6.161  6.137   33.525 1.00 24.38 ? 245 HIS A N   1 
ATOM   243  C CA  . HIS A 1 30  ? -6.992  5.785   32.387 1.00 22.91 ? 245 HIS A CA  1 
ATOM   244  C C   . HIS A 1 30  ? -6.320  4.715   31.529 1.00 22.29 ? 245 HIS A C   1 
ATOM   245  O O   . HIS A 1 30  ? -5.169  4.872   31.133 1.00 21.16 ? 245 HIS A O   1 
ATOM   246  C CB  . HIS A 1 30  ? -7.266  7.023   31.540 1.00 24.34 ? 245 HIS A CB  1 
ATOM   247  C CG  . HIS A 1 30  ? -7.954  6.720   30.249 1.00 24.57 ? 245 HIS A CG  1 
ATOM   248  N ND1 . HIS A 1 30  ? -9.323  6.609   30.148 1.00 25.74 ? 245 HIS A ND1 1 
ATOM   249  C CD2 . HIS A 1 30  ? -7.464  6.491   29.008 1.00 24.77 ? 245 HIS A CD2 1 
ATOM   250  C CE1 . HIS A 1 30  ? -9.649  6.336   28.897 1.00 25.42 ? 245 HIS A CE1 1 
ATOM   251  N NE2 . HIS A 1 30  ? -8.539  6.256   28.185 1.00 25.20 ? 245 HIS A NE2 1 
ATOM   252  N N   . LEU A 1 31  ? -7.044  3.640   31.229 1.00 21.41 ? 246 LEU A N   1 
ATOM   253  C CA  . LEU A 1 31  ? -6.515  2.591   30.357 1.00 21.76 ? 246 LEU A CA  1 
ATOM   254  C C   . LEU A 1 31  ? -6.870  2.873   28.900 1.00 21.12 ? 246 LEU A C   1 
ATOM   255  O O   . LEU A 1 31  ? -8.045  3.043   28.577 1.00 20.05 ? 246 LEU A O   1 
ATOM   256  C CB  . LEU A 1 31  ? -7.034  1.209   30.779 1.00 21.77 ? 246 LEU A CB  1 
ATOM   257  C CG  . LEU A 1 31  ? -6.779  0.761   32.227 1.00 22.40 ? 246 LEU A CG  1 
ATOM   258  C CD1 . LEU A 1 31  ? -7.145  -0.703  32.404 1.00 22.50 ? 246 LEU A CD1 1 
ATOM   259  C CD2 . LEU A 1 31  ? -5.324  1.005   32.649 1.00 23.45 ? 246 LEU A CD2 1 
ATOM   260  N N   . PHE A 1 32  ? -5.859  2.933   28.030 1.00 20.38 ? 247 PHE A N   1 
ATOM   261  C CA  . PHE A 1 32  ? -6.104  3.104   26.591 1.00 20.25 ? 247 PHE A CA  1 
ATOM   262  C C   . PHE A 1 32  ? -6.488  1.770   25.970 1.00 20.33 ? 247 PHE A C   1 
ATOM   263  O O   . PHE A 1 32  ? -7.448  1.682   25.193 1.00 20.61 ? 247 PHE A O   1 
ATOM   264  C CB  . PHE A 1 32  ? -4.870  3.658   25.868 1.00 20.66 ? 247 PHE A CB  1 
ATOM   265  C CG  . PHE A 1 32  ? -4.489  5.054   26.276 1.00 21.16 ? 247 PHE A CG  1 
ATOM   266  C CD1 . PHE A 1 32  ? -5.233  6.153   25.844 1.00 21.17 ? 247 PHE A CD1 1 
ATOM   267  C CD2 . PHE A 1 32  ? -3.366  5.274   27.066 1.00 21.94 ? 247 PHE A CD2 1 
ATOM   268  C CE1 . PHE A 1 32  ? -4.874  7.446   26.214 1.00 21.79 ? 247 PHE A CE1 1 
ATOM   269  C CE2 . PHE A 1 32  ? -2.991  6.564   27.435 1.00 22.02 ? 247 PHE A CE2 1 
ATOM   270  C CZ  . PHE A 1 32  ? -3.754  7.657   27.007 1.00 22.01 ? 247 PHE A CZ  1 
ATOM   271  N N   . VAL A 1 33  ? -5.708  0.742   26.301 1.00 20.16 ? 248 VAL A N   1 
ATOM   272  C CA  . VAL A 1 33  ? -5.949  -0.634  25.867 1.00 20.60 ? 248 VAL A CA  1 
ATOM   273  C C   . VAL A 1 33  ? -5.554  -1.565  27.018 1.00 21.24 ? 248 VAL A C   1 
ATOM   274  O O   . VAL A 1 33  ? -4.715  -1.209  27.846 1.00 20.77 ? 248 VAL A O   1 
ATOM   275  C CB  . VAL A 1 33  ? -5.149  -1.009  24.580 1.00 20.40 ? 248 VAL A CB  1 
ATOM   276  C CG1 . VAL A 1 33  ? -5.647  -0.223  23.367 1.00 20.24 ? 248 VAL A CG1 1 
ATOM   277  C CG2 . VAL A 1 33  ? -3.636  -0.799  24.761 1.00 20.38 ? 248 VAL A CG2 1 
ATOM   278  N N   . HIS A 1 34  ? -6.167  -2.738  27.074 1.00 22.73 ? 249 HIS A N   1 
ATOM   279  C CA  . HIS A 1 34  ? -5.828  -3.721  28.104 1.00 24.83 ? 249 HIS A CA  1 
ATOM   280  C C   . HIS A 1 34  ? -6.224  -5.130  27.714 1.00 25.58 ? 249 HIS A C   1 
ATOM   281  O O   . HIS A 1 34  ? -7.291  -5.357  27.145 1.00 25.15 ? 249 HIS A O   1 
ATOM   282  C CB  . HIS A 1 34  ? -6.445  -3.355  29.463 1.00 26.80 ? 249 HIS A CB  1 
ATOM   283  C CG  . HIS A 1 34  ? -7.929  -3.154  29.428 1.00 29.63 ? 249 HIS A CG  1 
ATOM   284  N ND1 . HIS A 1 34  ? -8.825  -4.157  29.736 1.00 31.02 ? 249 HIS A ND1 1 
ATOM   285  C CD2 . HIS A 1 34  ? -8.674  -2.062  29.132 1.00 30.23 ? 249 HIS A CD2 1 
ATOM   286  C CE1 . HIS A 1 34  ? -10.058 -3.692  29.630 1.00 31.32 ? 249 HIS A CE1 1 
ATOM   287  N NE2 . HIS A 1 34  ? -9.994  -2.423  29.265 1.00 31.13 ? 249 HIS A NE2 1 
ATOM   288  N N   . ILE A 1 35  ? -5.322  -6.061  28.001 1.00 26.05 ? 250 ILE A N   1 
ATOM   289  C CA  . ILE A 1 35  ? -5.582  -7.488  27.954 1.00 26.47 ? 250 ILE A CA  1 
ATOM   290  C C   . ILE A 1 35  ? -5.290  -7.964  29.373 1.00 27.66 ? 250 ILE A C   1 
ATOM   291  O O   . ILE A 1 35  ? -4.255  -7.611  29.950 1.00 27.20 ? 250 ILE A O   1 
ATOM   292  C CB  . ILE A 1 35  ? -4.658  -8.212  26.935 1.00 26.67 ? 250 ILE A CB  1 
ATOM   293  C CG1 . ILE A 1 35  ? -4.923  -7.710  25.506 1.00 26.11 ? 250 ILE A CG1 1 
ATOM   294  C CG2 . ILE A 1 35  ? -4.840  -9.728  27.009 1.00 26.24 ? 250 ILE A CG2 1 
ATOM   295  C CD1 . ILE A 1 35  ? -3.852  -8.100  24.501 1.00 26.82 ? 250 ILE A CD1 1 
ATOM   296  N N   . GLY A 1 36  ? -6.210  -8.736  29.944 1.00 29.30 ? 251 GLY A N   1 
ATOM   297  C CA  . GLY A 1 36  ? -6.063  -9.208  31.322 1.00 32.75 ? 251 GLY A CA  1 
ATOM   298  C C   . GLY A 1 36  ? -6.891  -10.445 31.592 1.00 35.23 ? 251 GLY A C   1 
ATOM   299  O O   . GLY A 1 36  ? -6.989  -11.327 30.738 1.00 38.84 ? 251 GLY A O   1 
ATOM   300  N N   . LEU A 1 47  ? -9.698  -18.904 19.629 1.00 30.86 ? 262 LEU A N   1 
ATOM   301  C CA  . LEU A 1 47  ? -9.063  -17.887 18.786 1.00 30.15 ? 262 LEU A CA  1 
ATOM   302  C C   . LEU A 1 47  ? -9.245  -18.163 17.294 1.00 28.87 ? 262 LEU A C   1 
ATOM   303  O O   . LEU A 1 47  ? -8.827  -19.203 16.793 1.00 29.81 ? 262 LEU A O   1 
ATOM   304  C CB  . LEU A 1 47  ? -7.565  -17.767 19.110 1.00 30.48 ? 262 LEU A CB  1 
ATOM   305  C CG  . LEU A 1 47  ? -7.072  -16.833 20.224 1.00 31.08 ? 262 LEU A CG  1 
ATOM   306  C CD1 . LEU A 1 47  ? -7.639  -17.189 21.575 1.00 31.41 ? 262 LEU A CD1 1 
ATOM   307  C CD2 . LEU A 1 47  ? -5.541  -16.844 20.267 1.00 30.93 ? 262 LEU A CD2 1 
ATOM   308  N N   . GLU A 1 48  ? -9.861  -17.217 16.590 1.00 29.44 ? 263 GLU A N   1 
ATOM   309  C CA  . GLU A 1 48  ? -9.970  -17.282 15.131 1.00 28.56 ? 263 GLU A CA  1 
ATOM   310  C C   . GLU A 1 48  ? -8.589  -17.108 14.494 1.00 27.54 ? 263 GLU A C   1 
ATOM   311  O O   . GLU A 1 48  ? -7.668  -16.586 15.128 1.00 27.05 ? 263 GLU A O   1 
ATOM   312  C CB  . GLU A 1 48  ? -10.916 -16.195 14.614 1.00 30.50 ? 263 GLU A CB  1 
ATOM   313  C CG  . GLU A 1 48  ? -12.309 -16.211 15.232 1.00 31.69 ? 263 GLU A CG  1 
ATOM   314  C CD  . GLU A 1 48  ? -13.155 -15.042 14.771 1.00 32.46 ? 263 GLU A CD  1 
ATOM   315  O OE1 . GLU A 1 48  ? -13.635 -15.072 13.623 1.00 34.44 ? 263 GLU A OE1 1 
ATOM   316  O OE2 . GLU A 1 48  ? -13.342 -14.092 15.558 1.00 33.85 ? 263 GLU A OE2 1 
ATOM   317  N N   . ALA A 1 49  ? -8.452  -17.567 13.253 1.00 26.14 ? 264 ALA A N   1 
ATOM   318  C CA  . ALA A 1 49  ? -7.200  -17.463 12.510 1.00 25.21 ? 264 ALA A CA  1 
ATOM   319  C C   . ALA A 1 49  ? -7.251  -16.327 11.495 1.00 24.24 ? 264 ALA A C   1 
ATOM   320  O O   . ALA A 1 49  ? -8.291  -16.082 10.870 1.00 23.84 ? 264 ALA A O   1 
ATOM   321  C CB  . ALA A 1 49  ? -6.883  -18.781 11.811 1.00 24.99 ? 264 ALA A CB  1 
ATOM   322  N N   . VAL A 1 50  ? -6.126  -15.635 11.345 1.00 22.54 ? 265 VAL A N   1 
ATOM   323  C CA  . VAL A 1 50  ? -5.961  -14.618 10.309 1.00 22.07 ? 265 VAL A CA  1 
ATOM   324  C C   . VAL A 1 50  ? -4.789  -15.010 9.411  1.00 21.90 ? 265 VAL A C   1 
ATOM   325  O O   . VAL A 1 50  ? -3.716  -15.397 9.891  1.00 21.39 ? 265 VAL A O   1 
ATOM   326  C CB  . VAL A 1 50  ? -5.755  -13.195 10.906 1.00 21.91 ? 265 VAL A CB  1 
ATOM   327  C CG1 . VAL A 1 50  ? -5.248  -12.214 9.843  1.00 22.15 ? 265 VAL A CG1 1 
ATOM   328  C CG2 . VAL A 1 50  ? -7.050  -12.675 11.528 1.00 22.64 ? 265 VAL A CG2 1 
ATOM   329  N N   . ASP A 1 51  ? -5.014  -14.930 8.103  1.00 21.63 ? 266 ASP A N   1 
ATOM   330  C CA  . ASP A 1 51  ? -3.968  -15.142 7.119  1.00 21.79 ? 266 ASP A CA  1 
ATOM   331  C C   . ASP A 1 51  ? -2.962  -14.003 7.275  1.00 21.01 ? 266 ASP A C   1 
ATOM   332  O O   . ASP A 1 51  ? -3.284  -12.847 6.992  1.00 20.44 ? 266 ASP A O   1 
ATOM   333  C CB  . ASP A 1 51  ? -4.585  -15.128 5.713  1.00 22.75 ? 266 ASP A CB  1 
ATOM   334  C CG  . ASP A 1 51  ? -3.581  -15.425 4.610  1.00 24.34 ? 266 ASP A CG  1 
ATOM   335  O OD1 . ASP A 1 51  ? -2.353  -15.482 4.858  1.00 23.70 ? 266 ASP A OD1 1 
ATOM   336  O OD2 . ASP A 1 51  ? -4.044  -15.603 3.462  1.00 26.31 ? 266 ASP A OD2 1 
ATOM   337  N N   . ILE A 1 52  ? -1.750  -14.346 7.722  1.00 20.63 ? 267 ILE A N   1 
ATOM   338  C CA  . ILE A 1 52  ? -0.692  -13.362 7.982  1.00 20.14 ? 267 ILE A CA  1 
ATOM   339  C C   . ILE A 1 52  ? -0.330  -12.537 6.735  1.00 20.63 ? 267 ILE A C   1 
ATOM   340  O O   . ILE A 1 52  ? 0.053   -11.365 6.845  1.00 20.36 ? 267 ILE A O   1 
ATOM   341  C CB  . ILE A 1 52  ? 0.585   -14.027 8.620  1.00 20.13 ? 267 ILE A CB  1 
ATOM   342  C CG1 . ILE A 1 52  ? 1.501   -12.961 9.247  1.00 19.90 ? 267 ILE A CG1 1 
ATOM   343  C CG2 . ILE A 1 52  ? 1.336   -14.913 7.608  1.00 20.06 ? 267 ILE A CG2 1 
ATOM   344  C CD1 . ILE A 1 52  ? 2.658   -13.519 10.097 1.00 19.56 ? 267 ILE A CD1 1 
ATOM   345  N N   . ARG A 1 53  ? -0.462  -13.145 5.556  1.00 20.81 ? 268 ARG A N   1 
ATOM   346  C CA  . ARG A 1 53  ? -0.139  -12.467 4.297  1.00 21.08 ? 268 ARG A CA  1 
ATOM   347  C C   . ARG A 1 53  ? -1.000  -11.216 4.075  1.00 21.21 ? 268 ARG A C   1 
ATOM   348  O O   . ARG A 1 53  ? -0.604  -10.300 3.351  1.00 20.45 ? 268 ARG A O   1 
ATOM   349  C CB  . ARG A 1 53  ? -0.260  -13.430 3.113  1.00 22.48 ? 268 ARG A CB  1 
ATOM   350  C CG  . ARG A 1 53  ? 0.710   -14.607 3.157  1.00 23.33 ? 268 ARG A CG  1 
ATOM   351  C CD  . ARG A 1 53  ? 0.404   -15.636 2.074  1.00 25.92 ? 268 ARG A CD  1 
ATOM   352  N NE  . ARG A 1 53  ? -0.974  -16.127 2.144  1.00 26.96 ? 268 ARG A NE  1 
ATOM   353  C CZ  . ARG A 1 53  ? -1.577  -16.828 1.184  1.00 28.60 ? 268 ARG A CZ  1 
ATOM   354  N NH1 . ARG A 1 53  ? -0.925  -17.142 0.069  1.00 28.39 ? 268 ARG A NH1 1 
ATOM   355  N NH2 . ARG A 1 53  ? -2.836  -17.222 1.339  1.00 28.43 ? 268 ARG A NH2 1 
ATOM   356  N N   . GLN A 1 54  ? -2.165  -11.176 4.723  1.00 21.01 ? 269 GLN A N   1 
ATOM   357  C CA  . GLN A 1 54  ? -3.060  -10.022 4.639  1.00 20.68 ? 269 GLN A CA  1 
ATOM   358  C C   . GLN A 1 54  ? -2.545  -8.796  5.402  1.00 20.62 ? 269 GLN A C   1 
ATOM   359  O O   . GLN A 1 54  ? -3.056  -7.694  5.200  1.00 20.41 ? 269 GLN A O   1 
ATOM   360  C CB  . GLN A 1 54  ? -4.472  -10.378 5.126  1.00 21.25 ? 269 GLN A CB  1 
ATOM   361  C CG  . GLN A 1 54  ? -5.217  -11.377 4.241  1.00 21.37 ? 269 GLN A CG  1 
ATOM   362  C CD  . GLN A 1 54  ? -5.650  -10.782 2.908  1.00 21.42 ? 269 GLN A CD  1 
ATOM   363  O OE1 . GLN A 1 54  ? -5.936  -9.587  2.806  1.00 21.99 ? 269 GLN A OE1 1 
ATOM   364  N NE2 . GLN A 1 54  ? -5.692  -11.615 1.881  1.00 22.57 ? 269 GLN A NE2 1 
ATOM   365  N N   . ILE A 1 55  ? -1.549  -8.983  6.275  1.00 20.73 ? 270 ILE A N   1 
ATOM   366  C CA  . ILE A 1 55  ? -1.056  -7.880  7.109  1.00 19.89 ? 270 ILE A CA  1 
ATOM   367  C C   . ILE A 1 55  ? 0.432   -7.569  6.965  1.00 19.54 ? 270 ILE A C   1 
ATOM   368  O O   . ILE A 1 55  ? 0.902   -6.595  7.553  1.00 18.44 ? 270 ILE A O   1 
ATOM   369  C CB  . ILE A 1 55  ? -1.405  -8.045  8.631  1.00 20.61 ? 270 ILE A CB  1 
ATOM   370  C CG1 . ILE A 1 55  ? -0.696  -9.269  9.237  1.00 20.70 ? 270 ILE A CG1 1 
ATOM   371  C CG2 . ILE A 1 55  ? -2.921  -8.107  8.833  1.00 21.63 ? 270 ILE A CG2 1 
ATOM   372  C CD1 . ILE A 1 55  ? -0.409  -9.154  10.726 1.00 21.44 ? 270 ILE A CD1 1 
ATOM   373  N N   . TYR A 1 56  ? 1.162   -8.378  6.188  1.00 19.01 ? 271 TYR A N   1 
ATOM   374  C CA  . TYR A 1 56  ? 2.605   -8.175  6.000  1.00 19.49 ? 271 TYR A CA  1 
ATOM   375  C C   . TYR A 1 56  ? 2.956   -6.746  5.588  1.00 19.14 ? 271 TYR A C   1 
ATOM   376  O O   . TYR A 1 56  ? 3.985   -6.222  6.013  1.00 19.01 ? 271 TYR A O   1 
ATOM   377  C CB  . TYR A 1 56  ? 3.184   -9.135  4.952  1.00 19.89 ? 271 TYR A CB  1 
ATOM   378  C CG  . TYR A 1 56  ? 3.527   -10.537 5.419  1.00 20.16 ? 271 TYR A CG  1 
ATOM   379  C CD1 . TYR A 1 56  ? 3.927   -10.794 6.733  1.00 20.67 ? 271 TYR A CD1 1 
ATOM   380  C CD2 . TYR A 1 56  ? 3.515   -11.604 4.515  1.00 20.35 ? 271 TYR A CD2 1 
ATOM   381  C CE1 . TYR A 1 56  ? 4.259   -12.082 7.142  1.00 20.94 ? 271 TYR A CE1 1 
ATOM   382  C CE2 . TYR A 1 56  ? 3.855   -12.892 4.915  1.00 21.11 ? 271 TYR A CE2 1 
ATOM   383  C CZ  . TYR A 1 56  ? 4.227   -13.127 6.226  1.00 21.36 ? 271 TYR A CZ  1 
ATOM   384  O OH  . TYR A 1 56  ? 4.565   -14.413 6.615  1.00 22.06 ? 271 TYR A OH  1 
ATOM   385  N N   . ASP A 1 57  ? 2.109   -6.119  4.768  1.00 18.61 ? 272 ASP A N   1 
ATOM   386  C CA  . ASP A 1 57  ? 2.384   -4.752  4.287  1.00 18.15 ? 272 ASP A CA  1 
ATOM   387  C C   . ASP A 1 57  ? 2.386   -3.687  5.393  1.00 17.95 ? 272 ASP A C   1 
ATOM   388  O O   . ASP A 1 57  ? 2.959   -2.615  5.209  1.00 17.46 ? 272 ASP A O   1 
ATOM   389  C CB  . ASP A 1 57  ? 1.434   -4.345  3.148  1.00 18.38 ? 272 ASP A CB  1 
ATOM   390  C CG  . ASP A 1 57  ? -0.014  -4.240  3.603  1.00 18.92 ? 272 ASP A CG  1 
ATOM   391  O OD1 . ASP A 1 57  ? -0.637  -3.180  3.383  1.00 19.10 ? 272 ASP A OD1 1 
ATOM   392  O OD2 . ASP A 1 57  ? -0.521  -5.208  4.212  1.00 18.83 ? 272 ASP A OD2 1 
ATOM   393  N N   . LYS A 1 58  ? 1.773   -3.997  6.537  1.00 18.13 ? 273 LYS A N   1 
ATOM   394  C CA  . LYS A 1 58  ? 1.681   -3.053  7.656  1.00 18.75 ? 273 LYS A CA  1 
ATOM   395  C C   . LYS A 1 58  ? 2.835   -3.196  8.648  1.00 19.10 ? 273 LYS A C   1 
ATOM   396  O O   . LYS A 1 58  ? 2.869   -2.518  9.675  1.00 19.11 ? 273 LYS A O   1 
ATOM   397  C CB  . LYS A 1 58  ? 0.335   -3.204  8.374  1.00 19.48 ? 273 LYS A CB  1 
ATOM   398  C CG  . LYS A 1 58  ? -0.854  -2.967  7.452  1.00 20.82 ? 273 LYS A CG  1 
ATOM   399  C CD  . LYS A 1 58  ? -2.048  -2.406  8.197  1.00 23.14 ? 273 LYS A CD  1 
ATOM   400  C CE  . LYS A 1 58  ? -3.102  -1.913  7.212  1.00 23.30 ? 273 LYS A CE  1 
ATOM   401  N NZ  . LYS A 1 58  ? -2.686  -0.719  6.434  1.00 23.81 ? 273 LYS A NZ  1 
ATOM   402  N N   . PHE A 1 59  ? 3.781   -4.073  8.332  1.00 19.63 ? 274 PHE A N   1 
ATOM   403  C CA  . PHE A 1 59  ? 4.889   -4.356  9.242  1.00 20.43 ? 274 PHE A CA  1 
ATOM   404  C C   . PHE A 1 59  ? 6.218   -4.417  8.504  1.00 21.39 ? 274 PHE A C   1 
ATOM   405  O O   . PHE A 1 59  ? 6.238   -4.562  7.271  1.00 21.03 ? 274 PHE A O   1 
ATOM   406  C CB  . PHE A 1 59  ? 4.606   -5.638  10.027 1.00 20.30 ? 274 PHE A CB  1 
ATOM   407  C CG  . PHE A 1 59  ? 3.423   -5.525  10.934 1.00 20.26 ? 274 PHE A CG  1 
ATOM   408  C CD1 . PHE A 1 59  ? 3.551   -4.955  12.194 1.00 20.24 ? 274 PHE A CD1 1 
ATOM   409  C CD2 . PHE A 1 59  ? 2.166   -5.949  10.512 1.00 19.97 ? 274 PHE A CD2 1 
ATOM   410  C CE1 . PHE A 1 59  ? 2.445   -4.830  13.027 1.00 20.05 ? 274 PHE A CE1 1 
ATOM   411  C CE2 . PHE A 1 59  ? 1.056   -5.829  11.339 1.00 19.66 ? 274 PHE A CE2 1 
ATOM   412  C CZ  . PHE A 1 59  ? 1.194   -5.265  12.594 1.00 20.08 ? 274 PHE A CZ  1 
ATOM   413  N N   . PRO A 1 60  ? 7.339   -4.299  9.249  1.00 23.47 ? 275 PRO A N   1 
ATOM   414  C CA  . PRO A 1 60  ? 8.663   -4.271  8.628  1.00 24.58 ? 275 PRO A CA  1 
ATOM   415  C C   . PRO A 1 60  ? 8.950   -5.535  7.835  1.00 24.80 ? 275 PRO A C   1 
ATOM   416  O O   . PRO A 1 60  ? 8.559   -6.625  8.244  1.00 25.14 ? 275 PRO A O   1 
ATOM   417  C CB  . PRO A 1 60  ? 9.617   -4.169  9.828  1.00 24.76 ? 275 PRO A CB  1 
ATOM   418  C CG  . PRO A 1 60  ? 8.791   -3.553  10.908 1.00 24.78 ? 275 PRO A CG  1 
ATOM   419  C CD  . PRO A 1 60  ? 7.427   -4.149  10.714 1.00 23.81 ? 275 PRO A CD  1 
ATOM   420  N N   . GLU A 1 61  ? 9.603   -5.366  6.693  1.00 26.01 ? 276 GLU A N   1 
ATOM   421  C CA  . GLU A 1 61  ? 9.946   -6.472  5.820  1.00 28.45 ? 276 GLU A CA  1 
ATOM   422  C C   . GLU A 1 61  ? 11.437  -6.746  5.960  1.00 29.80 ? 276 GLU A C   1 
ATOM   423  O O   . GLU A 1 61  ? 12.071  -6.220  6.880  1.00 31.10 ? 276 GLU A O   1 
ATOM   424  C CB  . GLU A 1 61  ? 9.576   -6.133  4.377  1.00 30.24 ? 276 GLU A CB  1 
ATOM   425  C CG  . GLU A 1 61  ? 8.096   -5.832  4.191  1.00 32.08 ? 276 GLU A CG  1 
ATOM   426  C CD  . GLU A 1 61  ? 7.744   -5.341  2.791  1.00 34.13 ? 276 GLU A CD  1 
ATOM   427  O OE1 . GLU A 1 61  ? 6.532   -5.302  2.479  1.00 35.05 ? 276 GLU A OE1 1 
ATOM   428  O OE2 . GLU A 1 61  ? 8.662   -4.989  2.011  1.00 33.69 ? 276 GLU A OE2 1 
ATOM   429  N N   . LYS A 1 62  ? 11.987  -7.573  5.066  1.00 31.28 ? 277 LYS A N   1 
ATOM   430  C CA  . LYS A 1 62  ? 13.421  -7.930  5.081  1.00 31.64 ? 277 LYS A CA  1 
ATOM   431  C C   . LYS A 1 62  ? 13.788  -8.813  6.277  1.00 31.51 ? 277 LYS A C   1 
ATOM   432  O O   . LYS A 1 62  ? 12.924  -9.166  7.082  1.00 31.06 ? 277 LYS A O   1 
ATOM   433  C CB  . LYS A 1 62  ? 14.311  -6.678  5.037  1.00 33.63 ? 277 LYS A CB  1 
ATOM   434  C CG  . LYS A 1 62  ? 14.190  -5.875  3.745  1.00 35.21 ? 277 LYS A CG  1 
ATOM   435  C CD  . LYS A 1 62  ? 15.178  -4.715  3.703  1.00 36.92 ? 277 LYS A CD  1 
ATOM   436  C CE  . LYS A 1 62  ? 14.555  -3.425  4.199  1.00 38.61 ? 277 LYS A CE  1 
ATOM   437  N NZ  . LYS A 1 62  ? 13.548  -2.901  3.226  1.00 40.67 ? 277 LYS A NZ  1 
ATOM   438  N N   . LYS A 1 63  ? 15.067  -9.180  6.383  1.00 31.55 ? 278 LYS A N   1 
ATOM   439  C CA  . LYS A 1 63  ? 15.539  -10.026 7.483  1.00 30.58 ? 278 LYS A CA  1 
ATOM   440  C C   . LYS A 1 63  ? 15.173  -9.416  8.835  1.00 28.78 ? 278 LYS A C   1 
ATOM   441  O O   . LYS A 1 63  ? 15.363  -8.216  9.060  1.00 28.11 ? 278 LYS A O   1 
ATOM   442  C CB  . LYS A 1 63  ? 17.052  -10.252 7.388  1.00 32.73 ? 278 LYS A CB  1 
ATOM   443  C CG  . LYS A 1 63  ? 17.597  -11.241 8.413  1.00 34.42 ? 278 LYS A CG  1 
ATOM   444  C CD  . LYS A 1 63  ? 19.121  -11.301 8.381  1.00 36.10 ? 278 LYS A CD  1 
ATOM   445  C CE  . LYS A 1 63  ? 19.664  -12.182 9.506  1.00 37.15 ? 278 LYS A CE  1 
ATOM   446  N NZ  . LYS A 1 63  ? 19.159  -13.583 9.421  1.00 38.21 ? 278 LYS A NZ  1 
ATOM   447  N N   . GLY A 1 64  ? 14.630  -10.248 9.722  1.00 27.13 ? 279 GLY A N   1 
ATOM   448  C CA  . GLY A 1 64  ? 14.194  -9.798  11.039 1.00 25.60 ? 279 GLY A CA  1 
ATOM   449  C C   . GLY A 1 64  ? 12.802  -9.190  11.056 1.00 24.49 ? 279 GLY A C   1 
ATOM   450  O O   . GLY A 1 64  ? 12.265  -8.895  12.121 1.00 24.34 ? 279 GLY A O   1 
ATOM   451  N N   . GLY A 1 65  ? 12.220  -8.994  9.875  1.00 23.30 ? 280 GLY A N   1 
ATOM   452  C CA  . GLY A 1 65  ? 10.856  -8.485  9.770  1.00 22.10 ? 280 GLY A CA  1 
ATOM   453  C C   . GLY A 1 65  ? 9.841   -9.583  10.027 1.00 21.48 ? 280 GLY A C   1 
ATOM   454  O O   . GLY A 1 65  ? 10.211  -10.736 10.293 1.00 20.49 ? 280 GLY A O   1 
ATOM   455  N N   . LEU A 1 66  ? 8.559   -9.237  9.921  1.00 20.32 ? 281 LEU A N   1 
ATOM   456  C CA  . LEU A 1 66  ? 7.490   -10.160 10.307 1.00 19.82 ? 281 LEU A CA  1 
ATOM   457  C C   . LEU A 1 66  ? 7.463   -11.446 9.484  1.00 20.25 ? 281 LEU A C   1 
ATOM   458  O O   . LEU A 1 66  ? 7.264   -12.530 10.044 1.00 20.35 ? 281 LEU A O   1 
ATOM   459  C CB  . LEU A 1 66  ? 6.123   -9.464  10.276 1.00 18.99 ? 281 LEU A CB  1 
ATOM   460  C CG  . LEU A 1 66  ? 4.886   -10.274 10.682 1.00 18.03 ? 281 LEU A CG  1 
ATOM   461  C CD1 . LEU A 1 66  ? 5.020   -10.891 12.083 1.00 17.32 ? 281 LEU A CD1 1 
ATOM   462  C CD2 . LEU A 1 66  ? 3.647   -9.398  10.594 1.00 17.64 ? 281 LEU A CD2 1 
ATOM   463  N N   . LYS A 1 67  ? 7.649   -11.336 8.165  1.00 20.24 ? 282 LYS A N   1 
ATOM   464  C CA  . LYS A 1 67  ? 7.648   -12.530 7.310  1.00 20.86 ? 282 LYS A CA  1 
ATOM   465  C C   . LYS A 1 67  ? 8.814   -13.456 7.656  1.00 20.57 ? 282 LYS A C   1 
ATOM   466  O O   . LYS A 1 67  ? 8.628   -14.663 7.815  1.00 19.92 ? 282 LYS A O   1 
ATOM   467  C CB  . LYS A 1 67  ? 7.684   -12.168 5.820  1.00 22.23 ? 282 LYS A CB  1 
ATOM   468  C CG  . LYS A 1 67  ? 7.509   -13.362 4.893  1.00 24.48 ? 282 LYS A CG  1 
ATOM   469  C CD  . LYS A 1 67  ? 7.381   -12.910 3.448  1.00 26.88 ? 282 LYS A CD  1 
ATOM   470  C CE  . LYS A 1 67  ? 7.295   -14.083 2.491  1.00 28.69 ? 282 LYS A CE  1 
ATOM   471  N NZ  . LYS A 1 67  ? 8.643   -14.638 2.196  1.00 31.57 ? 282 LYS A NZ  1 
ATOM   472  N N   . ASP A 1 68  ? 10.004  -12.875 7.775  1.00 20.83 ? 283 ASP A N   1 
ATOM   473  C CA  . ASP A 1 68  ? 11.188  -13.627 8.170  1.00 21.92 ? 283 ASP A CA  1 
ATOM   474  C C   . ASP A 1 68  ? 10.938  -14.351 9.495  1.00 20.89 ? 283 ASP A C   1 
ATOM   475  O O   . ASP A 1 68  ? 11.186  -15.554 9.605  1.00 20.90 ? 283 ASP A O   1 
ATOM   476  C CB  . ASP A 1 68  ? 12.392  -12.697 8.284  1.00 22.90 ? 283 ASP A CB  1 
ATOM   477  C CG  . ASP A 1 68  ? 13.687  -13.443 8.554  1.00 25.07 ? 283 ASP A CG  1 
ATOM   478  O OD1 . ASP A 1 68  ? 13.890  -14.540 7.987  1.00 26.57 ? 283 ASP A OD1 1 
ATOM   479  O OD2 . ASP A 1 68  ? 14.509  -12.917 9.331  1.00 25.98 ? 283 ASP A OD2 1 
ATOM   480  N N   . LEU A 1 69  ? 10.425  -13.617 10.484 1.00 20.22 ? 284 LEU A N   1 
ATOM   481  C CA  . LEU A 1 69  ? 10.161  -14.181 11.811 1.00 19.92 ? 284 LEU A CA  1 
ATOM   482  C C   . LEU A 1 69  ? 9.151   -15.310 11.750 1.00 19.75 ? 284 LEU A C   1 
ATOM   483  O O   . LEU A 1 69  ? 9.360   -16.365 12.354 1.00 19.56 ? 284 LEU A O   1 
ATOM   484  C CB  . LEU A 1 69  ? 9.684   -13.104 12.792 1.00 20.19 ? 284 LEU A CB  1 
ATOM   485  C CG  . LEU A 1 69  ? 10.699  -12.075 13.302 1.00 20.37 ? 284 LEU A CG  1 
ATOM   486  C CD1 . LEU A 1 69  ? 9.955   -10.925 13.962 1.00 21.00 ? 284 LEU A CD1 1 
ATOM   487  C CD2 . LEU A 1 69  ? 11.695  -12.690 14.272 1.00 21.96 ? 284 LEU A CD2 1 
ATOM   488  N N   . PHE A 1 70  ? 8.061   -15.087 11.019 1.00 20.20 ? 285 PHE A N   1 
ATOM   489  C CA  . PHE A 1 70  ? 7.026   -16.103 10.866 1.00 21.74 ? 285 PHE A CA  1 
ATOM   490  C C   . PHE A 1 70  ? 7.549   -17.365 10.190 1.00 22.55 ? 285 PHE A C   1 
ATOM   491  O O   . PHE A 1 70  ? 7.302   -18.468 10.672 1.00 22.79 ? 285 PHE A O   1 
ATOM   492  C CB  . PHE A 1 70  ? 5.810   -15.560 10.114 1.00 22.26 ? 285 PHE A CB  1 
ATOM   493  C CG  . PHE A 1 70  ? 4.680   -16.544 10.026 1.00 22.48 ? 285 PHE A CG  1 
ATOM   494  C CD1 . PHE A 1 70  ? 4.447   -17.255 8.850  1.00 23.20 ? 285 PHE A CD1 1 
ATOM   495  C CD2 . PHE A 1 70  ? 3.871   -16.785 11.130 1.00 22.64 ? 285 PHE A CD2 1 
ATOM   496  C CE1 . PHE A 1 70  ? 3.408   -18.180 8.766  1.00 23.50 ? 285 PHE A CE1 1 
ATOM   497  C CE2 . PHE A 1 70  ? 2.825   -17.712 11.058 1.00 23.32 ? 285 PHE A CE2 1 
ATOM   498  C CZ  . PHE A 1 70  ? 2.598   -18.410 9.874  1.00 23.31 ? 285 PHE A CZ  1 
ATOM   499  N N   . GLU A 1 71  ? 8.276   -17.197 9.087  1.00 23.89 ? 286 GLU A N   1 
ATOM   500  C CA  . GLU A 1 71  ? 8.847   -18.331 8.354  1.00 25.70 ? 286 GLU A CA  1 
ATOM   501  C C   . GLU A 1 71  ? 9.787   -19.159 9.233  1.00 25.61 ? 286 GLU A C   1 
ATOM   502  O O   . GLU A 1 71  ? 9.808   -20.385 9.134  1.00 24.95 ? 286 GLU A O   1 
ATOM   503  C CB  . GLU A 1 71  ? 9.582   -17.860 7.100  1.00 27.20 ? 286 GLU A CB  1 
ATOM   504  C CG  . GLU A 1 71  ? 8.665   -17.350 5.997  1.00 30.54 ? 286 GLU A CG  1 
ATOM   505  C CD  . GLU A 1 71  ? 9.424   -16.840 4.786  1.00 32.80 ? 286 GLU A CD  1 
ATOM   506  O OE1 . GLU A 1 71  ? 10.603  -16.428 4.921  1.00 34.57 ? 286 GLU A OE1 1 
ATOM   507  O OE2 . GLU A 1 71  ? 8.832   -16.842 3.690  1.00 35.89 ? 286 GLU A OE2 1 
ATOM   508  N N   . ARG A 1 72  ? 10.543  -18.477 10.091 1.00 25.66 ? 287 ARG A N   1 
ATOM   509  C CA  . ARG A 1 72  ? 11.467  -19.129 11.024 1.00 26.52 ? 287 ARG A CA  1 
ATOM   510  C C   . ARG A 1 72  ? 10.765  -19.867 12.167 1.00 25.97 ? 287 ARG A C   1 
ATOM   511  O O   . ARG A 1 72  ? 11.319  -20.821 12.714 1.00 26.90 ? 287 ARG A O   1 
ATOM   512  C CB  . ARG A 1 72  ? 12.503  -18.132 11.559 1.00 28.60 ? 287 ARG A CB  1 
ATOM   513  C CG  . ARG A 1 72  ? 13.594  -17.799 10.539 1.00 31.13 ? 287 ARG A CG  1 
ATOM   514  C CD  . ARG A 1 72  ? 14.447  -16.604 10.951 1.00 33.86 ? 287 ARG A CD  1 
ATOM   515  N NE  . ARG A 1 72  ? 15.404  -16.922 12.016 1.00 37.02 ? 287 ARG A NE  1 
ATOM   516  C CZ  . ARG A 1 72  ? 16.602  -17.478 11.821 1.00 39.51 ? 287 ARG A CZ  1 
ATOM   517  N NH1 . ARG A 1 72  ? 17.012  -17.802 10.597 1.00 39.74 ? 287 ARG A NH1 1 
ATOM   518  N NH2 . ARG A 1 72  ? 17.396  -17.718 12.859 1.00 40.52 ? 287 ARG A NH2 1 
ATOM   519  N N   . GLY A 1 73  ? 9.556   -19.433 12.521 1.00 23.37 ? 288 GLY A N   1 
ATOM   520  C CA  . GLY A 1 73  ? 8.736   -20.132 13.516 1.00 23.36 ? 288 GLY A CA  1 
ATOM   521  C C   . GLY A 1 73  ? 9.172   -19.942 14.965 1.00 22.74 ? 288 GLY A C   1 
ATOM   522  O O   . GLY A 1 73  ? 10.067  -19.146 15.246 1.00 22.42 ? 288 GLY A O   1 
ATOM   523  N N   . PRO A 1 74  ? 8.533   -20.663 15.906 1.00 22.82 ? 289 PRO A N   1 
ATOM   524  C CA  . PRO A 1 74  ? 7.442   -21.622 15.678 1.00 23.75 ? 289 PRO A CA  1 
ATOM   525  C C   . PRO A 1 74  ? 6.133   -20.924 15.324 1.00 24.13 ? 289 PRO A C   1 
ATOM   526  O O   . PRO A 1 74  ? 5.898   -19.798 15.775 1.00 22.64 ? 289 PRO A O   1 
ATOM   527  C CB  . PRO A 1 74  ? 7.315   -22.334 17.028 1.00 23.66 ? 289 PRO A CB  1 
ATOM   528  C CG  . PRO A 1 74  ? 7.791   -21.327 18.029 1.00 23.69 ? 289 PRO A CG  1 
ATOM   529  C CD  . PRO A 1 74  ? 8.902   -20.577 17.332 1.00 23.11 ? 289 PRO A CD  1 
ATOM   530  N N   . SER A 1 75  ? 5.289   -21.591 14.533 1.00 25.53 ? 290 SER A N   1 
ATOM   531  C CA  . SER A 1 75  ? 4.025   -20.996 14.085 1.00 27.42 ? 290 SER A CA  1 
ATOM   532  C C   . SER A 1 75  ? 3.067   -20.662 15.228 1.00 26.90 ? 290 SER A C   1 
ATOM   533  O O   . SER A 1 75  ? 2.305   -19.696 15.138 1.00 29.28 ? 290 SER A O   1 
ATOM   534  C CB  . SER A 1 75  ? 3.338   -21.876 13.033 1.00 28.47 ? 290 SER A CB  1 
ATOM   535  O OG  . SER A 1 75  ? 3.211   -23.211 13.483 1.00 31.70 ? 290 SER A OG  1 
ATOM   536  N N   . ASN A 1 76  ? 3.128   -21.430 16.315 1.00 25.72 ? 291 ASN A N   1 
ATOM   537  C CA  . ASN A 1 76  ? 2.250   -21.197 17.467 1.00 24.27 ? 291 ASN A CA  1 
ATOM   538  C C   . ASN A 1 76  ? 2.645   -20.011 18.369 1.00 22.11 ? 291 ASN A C   1 
ATOM   539  O O   . ASN A 1 76  ? 2.047   -19.808 19.426 1.00 20.99 ? 291 ASN A O   1 
ATOM   540  C CB  . ASN A 1 76  ? 2.081   -22.485 18.296 1.00 25.50 ? 291 ASN A CB  1 
ATOM   541  C CG  . ASN A 1 76  ? 3.330   -22.852 19.083 1.00 26.90 ? 291 ASN A CG  1 
ATOM   542  O OD1 . ASN A 1 76  ? 4.387   -22.235 18.930 1.00 27.25 ? 291 ASN A OD1 1 
ATOM   543  N ND2 . ASN A 1 76  ? 3.212   -23.871 19.937 1.00 27.86 ? 291 ASN A ND2 1 
ATOM   544  N N   . ALA A 1 77  ? 3.642   -19.232 17.949 1.00 20.27 ? 292 ALA A N   1 
ATOM   545  C CA  . ALA A 1 77  ? 4.088   -18.075 18.724 1.00 19.46 ? 292 ALA A CA  1 
ATOM   546  C C   . ALA A 1 77  ? 3.521   -16.749 18.191 1.00 19.24 ? 292 ALA A C   1 
ATOM   547  O O   . ALA A 1 77  ? 3.732   -15.694 18.791 1.00 19.34 ? 292 ALA A O   1 
ATOM   548  C CB  . ALA A 1 77  ? 5.619   -18.031 18.779 1.00 18.93 ? 292 ALA A CB  1 
ATOM   549  N N   . PHE A 1 78  ? 2.773   -16.823 17.090 1.00 18.11 ? 293 PHE A N   1 
ATOM   550  C CA  . PHE A 1 78  ? 2.377   -15.638 16.327 1.00 18.04 ? 293 PHE A CA  1 
ATOM   551  C C   . PHE A 1 78  ? 0.908   -15.270 16.481 1.00 18.19 ? 293 PHE A C   1 
ATOM   552  O O   . PHE A 1 78  ? 0.013   -16.092 16.250 1.00 18.23 ? 293 PHE A O   1 
ATOM   553  C CB  . PHE A 1 78  ? 2.774   -15.810 14.859 1.00 17.60 ? 293 PHE A CB  1 
ATOM   554  C CG  . PHE A 1 78  ? 4.251   -15.736 14.647 1.00 17.85 ? 293 PHE A CG  1 
ATOM   555  C CD1 . PHE A 1 78  ? 5.075   -16.795 15.034 1.00 18.27 ? 293 PHE A CD1 1 
ATOM   556  C CD2 . PHE A 1 78  ? 4.833   -14.595 14.106 1.00 18.13 ? 293 PHE A CD2 1 
ATOM   557  C CE1 . PHE A 1 78  ? 6.458   -16.723 14.876 1.00 17.74 ? 293 PHE A CE1 1 
ATOM   558  C CE2 . PHE A 1 78  ? 6.215   -14.516 13.938 1.00 18.41 ? 293 PHE A CE2 1 
ATOM   559  C CZ  . PHE A 1 78  ? 7.027   -15.586 14.331 1.00 18.51 ? 293 PHE A CZ  1 
ATOM   560  N N   . PHE A 1 79  ? 0.681   -14.030 16.898 1.00 17.93 ? 294 PHE A N   1 
ATOM   561  C CA  . PHE A 1 79  ? -0.656  -13.533 17.193 1.00 18.00 ? 294 PHE A CA  1 
ATOM   562  C C   . PHE A 1 79  ? -0.888  -12.148 16.616 1.00 18.02 ? 294 PHE A C   1 
ATOM   563  O O   . PHE A 1 79  ? 0.050   -11.379 16.413 1.00 17.42 ? 294 PHE A O   1 
ATOM   564  C CB  . PHE A 1 79  ? -0.892  -13.515 18.707 1.00 18.08 ? 294 PHE A CB  1 
ATOM   565  C CG  . PHE A 1 79  ? -0.804  -14.872 19.342 1.00 18.36 ? 294 PHE A CG  1 
ATOM   566  C CD1 . PHE A 1 79  ? -1.933  -15.688 19.434 1.00 18.34 ? 294 PHE A CD1 1 
ATOM   567  C CD2 . PHE A 1 79  ? 0.412   -15.352 19.818 1.00 18.06 ? 294 PHE A CD2 1 
ATOM   568  C CE1 . PHE A 1 79  ? -1.852  -16.964 20.011 1.00 19.24 ? 294 PHE A CE1 1 
ATOM   569  C CE2 . PHE A 1 79  ? 0.505   -16.624 20.387 1.00 18.67 ? 294 PHE A CE2 1 
ATOM   570  C CZ  . PHE A 1 79  ? -0.636  -17.427 20.488 1.00 18.92 ? 294 PHE A CZ  1 
ATOM   571  N N   . LEU A 1 80  ? -2.156  -11.851 16.350 1.00 18.07 ? 295 LEU A N   1 
ATOM   572  C CA  . LEU A 1 80  ? -2.575  -10.527 15.931 1.00 18.64 ? 295 LEU A CA  1 
ATOM   573  C C   . LEU A 1 80  ? -3.659  -10.057 16.889 1.00 18.28 ? 295 LEU A C   1 
ATOM   574  O O   . LEU A 1 80  ? -4.640  -10.764 17.118 1.00 18.88 ? 295 LEU A O   1 
ATOM   575  C CB  . LEU A 1 80  ? -3.095  -10.573 14.488 1.00 19.30 ? 295 LEU A CB  1 
ATOM   576  C CG  . LEU A 1 80  ? -3.795  -9.364  13.868 1.00 20.58 ? 295 LEU A CG  1 
ATOM   577  C CD1 . LEU A 1 80  ? -2.876  -8.150  13.779 1.00 21.05 ? 295 LEU A CD1 1 
ATOM   578  C CD2 . LEU A 1 80  ? -4.310  -9.767  12.482 1.00 20.95 ? 295 LEU A CD2 1 
ATOM   579  N N   . VAL A 1 81  ? -3.463  -8.876  17.467 1.00 17.81 ? 296 VAL A N   1 
ATOM   580  C CA  . VAL A 1 81  ? -4.421  -8.302  18.397 1.00 17.93 ? 296 VAL A CA  1 
ATOM   581  C C   . VAL A 1 81  ? -5.033  -7.067  17.757 1.00 17.88 ? 296 VAL A C   1 
ATOM   582  O O   . VAL A 1 81  ? -4.317  -6.169  17.322 1.00 17.97 ? 296 VAL A O   1 
ATOM   583  C CB  . VAL A 1 81  ? -3.766  -7.935  19.761 1.00 18.09 ? 296 VAL A CB  1 
ATOM   584  C CG1 . VAL A 1 81  ? -4.739  -7.153  20.647 1.00 18.15 ? 296 VAL A CG1 1 
ATOM   585  C CG2 . VAL A 1 81  ? -3.292  -9.183  20.476 1.00 19.01 ? 296 VAL A CG2 1 
ATOM   586  N N   . LYS A 1 82  ? -6.360  -7.051  17.671 1.00 18.47 ? 297 LYS A N   1 
ATOM   587  C CA  . LYS A 1 82  ? -7.089  -5.881  17.225 1.00 19.20 ? 297 LYS A CA  1 
ATOM   588  C C   . LYS A 1 82  ? -7.622  -5.158  18.450 1.00 19.86 ? 297 LYS A C   1 
ATOM   589  O O   . LYS A 1 82  ? -8.473  -5.691  19.173 1.00 20.73 ? 297 LYS A O   1 
ATOM   590  C CB  . LYS A 1 82  ? -8.229  -6.273  16.266 1.00 19.85 ? 297 LYS A CB  1 
ATOM   591  C CG  . LYS A 1 82  ? -9.264  -5.162  15.989 1.00 20.46 ? 297 LYS A CG  1 
ATOM   592  C CD  . LYS A 1 82  ? -8.669  -3.989  15.225 1.00 21.56 ? 297 LYS A CD  1 
ATOM   593  C CE  . LYS A 1 82  ? -9.698  -2.876  15.001 1.00 22.05 ? 297 LYS A CE  1 
ATOM   594  N NZ  . LYS A 1 82  ? -10.624 -3.139  13.844 1.00 21.79 ? 297 LYS A NZ  1 
ATOM   595  N N   . PHE A 1 83  ? -7.106  -3.956  18.680 1.00 19.77 ? 298 PHE A N   1 
ATOM   596  C CA  . PHE A 1 83  ? -7.531  -3.111  19.783 1.00 20.72 ? 298 PHE A CA  1 
ATOM   597  C C   . PHE A 1 83  ? -8.519  -2.052  19.316 1.00 21.37 ? 298 PHE A C   1 
ATOM   598  O O   . PHE A 1 83  ? -8.306  -1.396  18.282 1.00 21.53 ? 298 PHE A O   1 
ATOM   599  C CB  . PHE A 1 83  ? -6.334  -2.381  20.398 1.00 20.38 ? 298 PHE A CB  1 
ATOM   600  C CG  . PHE A 1 83  ? -5.590  -3.164  21.457 1.00 20.57 ? 298 PHE A CG  1 
ATOM   601  C CD1 . PHE A 1 83  ? -4.193  -3.184  21.456 1.00 20.20 ? 298 PHE A CD1 1 
ATOM   602  C CD2 . PHE A 1 83  ? -6.273  -3.844  22.469 1.00 20.88 ? 298 PHE A CD2 1 
ATOM   603  C CE1 . PHE A 1 83  ? -3.488  -3.877  22.438 1.00 20.38 ? 298 PHE A CE1 1 
ATOM   604  C CE2 . PHE A 1 83  ? -5.573  -4.550  23.462 1.00 21.24 ? 298 PHE A CE2 1 
ATOM   605  C CZ  . PHE A 1 83  ? -4.173  -4.563  23.441 1.00 20.80 ? 298 PHE A CZ  1 
ATOM   606  N N   . TRP A 1 84  ? -9.592  -1.885  20.087 1.00 21.42 ? 299 TRP A N   1 
ATOM   607  C CA  . TRP A 1 84  ? -10.382 -0.666  20.040 1.00 21.63 ? 299 TRP A CA  1 
ATOM   608  C C   . TRP A 1 84  ? -9.935  0.162   21.238 1.00 21.67 ? 299 TRP A C   1 
ATOM   609  O O   . TRP A 1 84  ? -10.207 -0.197  22.391 1.00 21.06 ? 299 TRP A O   1 
ATOM   610  C CB  . TRP A 1 84  ? -11.885 -0.964  20.091 1.00 22.28 ? 299 TRP A CB  1 
ATOM   611  C CG  . TRP A 1 84  ? -12.425 -1.533  18.809 1.00 22.69 ? 299 TRP A CG  1 
ATOM   612  C CD1 . TRP A 1 84  ? -13.000 -0.836  17.781 1.00 22.79 ? 299 TRP A CD1 1 
ATOM   613  C CD2 . TRP A 1 84  ? -12.437 -2.909  18.414 1.00 22.80 ? 299 TRP A CD2 1 
ATOM   614  N NE1 . TRP A 1 84  ? -13.373 -1.693  16.775 1.00 22.71 ? 299 TRP A NE1 1 
ATOM   615  C CE2 . TRP A 1 84  ? -13.041 -2.972  17.135 1.00 22.84 ? 299 TRP A CE2 1 
ATOM   616  C CE3 . TRP A 1 84  ? -11.994 -4.098  19.012 1.00 22.82 ? 299 TRP A CE3 1 
ATOM   617  C CZ2 . TRP A 1 84  ? -13.216 -4.175  16.447 1.00 22.80 ? 299 TRP A CZ2 1 
ATOM   618  C CZ3 . TRP A 1 84  ? -12.169 -5.295  18.326 1.00 23.54 ? 299 TRP A CZ3 1 
ATOM   619  C CH2 . TRP A 1 84  ? -12.777 -5.323  17.054 1.00 23.28 ? 299 TRP A CH2 1 
ATOM   620  N N   . ALA A 1 85  ? -9.226  1.253   20.961 1.00 21.37 ? 300 ALA A N   1 
ATOM   621  C CA  . ALA A 1 85  ? -8.583  2.044   22.001 1.00 22.03 ? 300 ALA A CA  1 
ATOM   622  C C   . ALA A 1 85  ? -9.522  3.086   22.595 1.00 23.01 ? 300 ALA A C   1 
ATOM   623  O O   . ALA A 1 85  ? -10.311 3.709   21.877 1.00 22.46 ? 300 ALA A O   1 
ATOM   624  C CB  . ALA A 1 85  ? -7.319  2.712   21.465 1.00 22.30 ? 300 ALA A CB  1 
ATOM   625  N N   . ASP A 1 86  ? -9.436  3.254   23.912 1.00 23.60 ? 301 ASP A N   1 
ATOM   626  C CA  . ASP A 1 86  ? -10.218 4.259   24.624 1.00 24.53 ? 301 ASP A CA  1 
ATOM   627  C C   . ASP A 1 86  ? -9.382  5.519   24.761 1.00 25.22 ? 301 ASP A C   1 
ATOM   628  O O   . ASP A 1 86  ? -8.431  5.555   25.546 1.00 25.25 ? 301 ASP A O   1 
ATOM   629  C CB  . ASP A 1 86  ? -10.635 3.732   26.005 1.00 24.79 ? 301 ASP A CB  1 
ATOM   630  C CG  . ASP A 1 86  ? -11.500 4.723   26.795 1.00 25.28 ? 301 ASP A CG  1 
ATOM   631  O OD1 . ASP A 1 86  ? -11.544 5.924   26.455 1.00 25.51 ? 301 ASP A OD1 1 
ATOM   632  O OD2 . ASP A 1 86  ? -12.129 4.297   27.785 1.00 26.06 ? 301 ASP A OD2 1 
ATOM   633  N N   . LEU A 1 87  ? -9.748  6.546   23.995 1.00 26.27 ? 302 LEU A N   1 
ATOM   634  C CA  . LEU A 1 87  ? -9.044  7.821   24.001 1.00 28.69 ? 302 LEU A CA  1 
ATOM   635  C C   . LEU A 1 87  ? -9.793  8.891   24.798 1.00 30.11 ? 302 LEU A C   1 
ATOM   636  O O   . LEU A 1 87  ? -9.387  10.055  24.820 1.00 31.00 ? 302 LEU A O   1 
ATOM   637  C CB  . LEU A 1 87  ? -8.796  8.306   22.563 1.00 29.32 ? 302 LEU A CB  1 
ATOM   638  C CG  . LEU A 1 87  ? -8.101  7.368   21.567 1.00 29.57 ? 302 LEU A CG  1 
ATOM   639  C CD1 . LEU A 1 87  ? -7.956  8.045   20.205 1.00 29.93 ? 302 LEU A CD1 1 
ATOM   640  C CD2 . LEU A 1 87  ? -6.746  6.909   22.082 1.00 30.13 ? 302 LEU A CD2 1 
ATOM   641  N N   . ASN A 1 88  ? -10.877 8.486   25.454 1.00 32.54 ? 303 ASN A N   1 
ATOM   642  C CA  . ASN A 1 88  ? -11.703 9.392   26.249 1.00 35.53 ? 303 ASN A CA  1 
ATOM   643  C C   . ASN A 1 88  ? -11.041 9.702   27.596 1.00 35.42 ? 303 ASN A C   1 
ATOM   644  O O   . ASN A 1 88  ? -11.381 9.105   28.621 1.00 34.55 ? 303 ASN A O   1 
ATOM   645  C CB  . ASN A 1 88  ? -13.110 8.796   26.441 1.00 37.46 ? 303 ASN A CB  1 
ATOM   646  C CG  . ASN A 1 88  ? -14.104 9.790   27.045 1.00 40.65 ? 303 ASN A CG  1 
ATOM   647  O OD1 . ASN A 1 88  ? -14.858 9.448   27.960 1.00 41.84 ? 303 ASN A OD1 1 
ATOM   648  N ND2 . ASN A 1 88  ? -14.115 11.017  26.528 1.00 40.99 ? 303 ASN A ND2 1 
ATOM   649  N N   . THR A 1 89  ? -10.086 10.629  27.576 1.00 36.37 ? 304 THR A N   1 
ATOM   650  C CA  . THR A 1 89  ? -9.372  11.044  28.787 1.00 39.01 ? 304 THR A CA  1 
ATOM   651  C C   . THR A 1 89  ? -8.723  12.419  28.644 1.00 40.76 ? 304 THR A C   1 
ATOM   652  O O   . THR A 1 89  ? -8.399  12.848  27.535 1.00 41.63 ? 304 THR A O   1 
ATOM   653  C CB  . THR A 1 89  ? -8.286  10.015  29.208 1.00 39.09 ? 304 THR A CB  1 
ATOM   654  O OG1 . THR A 1 89  ? -7.748  10.380  30.486 1.00 40.46 ? 304 THR A OG1 1 
ATOM   655  C CG2 . THR A 1 89  ? -7.150  9.940   28.180 1.00 38.20 ? 304 THR A CG2 1 
ATOM   656  N N   . ASN A 1 90  ? -8.540  13.100  29.776 1.00 42.64 ? 305 ASN A N   1 
ATOM   657  C CA  . ASN A 1 90  ? -7.765  14.339  29.828 1.00 45.74 ? 305 ASN A CA  1 
ATOM   658  C C   . ASN A 1 90  ? -6.262  14.053  29.827 1.00 46.25 ? 305 ASN A C   1 
ATOM   659  O O   . ASN A 1 90  ? -5.530  14.495  28.938 1.00 47.01 ? 305 ASN A O   1 
ATOM   660  C CB  . ASN A 1 90  ? -8.136  15.158  31.067 1.00 47.28 ? 305 ASN A CB  1 
ATOM   661  C CG  . ASN A 1 90  ? -7.453  16.515  31.096 1.00 49.07 ? 305 ASN A CG  1 
ATOM   662  O OD1 . ASN A 1 90  ? -7.847  17.437  30.382 1.00 49.31 ? 305 ASN A OD1 1 
ATOM   663  N ND2 . ASN A 1 90  ? -6.420  16.643  31.927 1.00 50.01 ? 305 ASN A ND2 1 
ATOM   664  N N   . GLY A 1 95  ? 2.891   18.257  33.504 1.00 50.19 ? 310 GLY A N   1 
ATOM   665  C CA  . GLY A 1 95  ? 3.668   18.296  34.740 1.00 50.12 ? 310 GLY A CA  1 
ATOM   666  C C   . GLY A 1 95  ? 3.412   17.118  35.664 1.00 49.67 ? 310 GLY A C   1 
ATOM   667  O O   . GLY A 1 95  ? 4.315   16.675  36.376 1.00 51.29 ? 310 GLY A O   1 
ATOM   668  N N   . SER A 1 96  ? 2.181   16.608  35.653 1.00 47.67 ? 311 SER A N   1 
ATOM   669  C CA  . SER A 1 96  ? 1.785   15.514  36.543 1.00 45.03 ? 311 SER A CA  1 
ATOM   670  C C   . SER A 1 96  ? 1.214   14.301  35.794 1.00 42.12 ? 311 SER A C   1 
ATOM   671  O O   . SER A 1 96  ? 0.339   13.596  36.310 1.00 41.65 ? 311 SER A O   1 
ATOM   672  C CB  . SER A 1 96  ? 0.795   16.025  37.597 1.00 46.26 ? 311 SER A CB  1 
ATOM   673  O OG  . SER A 1 96  ? -0.356  16.593  36.991 1.00 47.31 ? 311 SER A OG  1 
ATOM   674  N N   . SER A 1 97  ? 1.729   14.056  34.589 1.00 38.28 ? 312 SER A N   1 
ATOM   675  C CA  . SER A 1 97  ? 1.280   12.942  33.748 1.00 35.18 ? 312 SER A CA  1 
ATOM   676  C C   . SER A 1 97  ? 2.360   11.881  33.581 1.00 32.60 ? 312 SER A C   1 
ATOM   677  O O   . SER A 1 97  ? 3.533   12.207  33.380 1.00 30.98 ? 312 SER A O   1 
ATOM   678  C CB  . SER A 1 97  ? 0.871   13.441  32.358 1.00 35.97 ? 312 SER A CB  1 
ATOM   679  O OG  . SER A 1 97  ? -0.407  14.049  32.371 1.00 37.60 ? 312 SER A OG  1 
ATOM   680  N N   . PHE A 1 98  ? 1.954   10.615  33.656 1.00 29.16 ? 313 PHE A N   1 
ATOM   681  C CA  . PHE A 1 98  ? 2.822   9.505   33.273 1.00 27.18 ? 313 PHE A CA  1 
ATOM   682  C C   . PHE A 1 98  ? 2.121   8.567   32.299 1.00 25.49 ? 313 PHE A C   1 
ATOM   683  O O   . PHE A 1 98  ? 1.094   7.972   32.625 1.00 25.00 ? 313 PHE A O   1 
ATOM   684  C CB  . PHE A 1 98  ? 3.331   8.730   34.491 1.00 28.24 ? 313 PHE A CB  1 
ATOM   685  C CG  . PHE A 1 98  ? 4.234   7.577   34.136 1.00 30.13 ? 313 PHE A CG  1 
ATOM   686  C CD1 . PHE A 1 98  ? 3.766   6.269   34.190 1.00 30.17 ? 313 PHE A CD1 1 
ATOM   687  C CD2 . PHE A 1 98  ? 5.545   7.804   33.720 1.00 30.86 ? 313 PHE A CD2 1 
ATOM   688  C CE1 . PHE A 1 98  ? 4.592   5.200   33.849 1.00 31.36 ? 313 PHE A CE1 1 
ATOM   689  C CE2 . PHE A 1 98  ? 6.379   6.741   33.376 1.00 31.74 ? 313 PHE A CE2 1 
ATOM   690  C CZ  . PHE A 1 98  ? 5.900   5.436   33.441 1.00 31.56 ? 313 PHE A CZ  1 
ATOM   691  N N   . TYR A 1 99  ? 2.687   8.452   31.100 1.00 24.52 ? 314 TYR A N   1 
ATOM   692  C CA  . TYR A 1 99  ? 2.212   7.514   30.092 1.00 23.58 ? 314 TYR A CA  1 
ATOM   693  C C   . TYR A 1 99  ? 3.046   6.243   30.191 1.00 23.48 ? 314 TYR A C   1 
ATOM   694  O O   . TYR A 1 99  ? 4.273   6.281   30.010 1.00 22.62 ? 314 TYR A O   1 
ATOM   695  C CB  . TYR A 1 99  ? 2.354   8.105   28.683 1.00 23.76 ? 314 TYR A CB  1 
ATOM   696  C CG  . TYR A 1 99  ? 1.428   9.257   28.362 1.00 24.16 ? 314 TYR A CG  1 
ATOM   697  C CD1 . TYR A 1 99  ? 1.747   10.563  28.745 1.00 24.48 ? 314 TYR A CD1 1 
ATOM   698  C CD2 . TYR A 1 99  ? 0.247   9.046   27.647 1.00 24.34 ? 314 TYR A CD2 1 
ATOM   699  C CE1 . TYR A 1 99  ? 0.899   11.635  28.441 1.00 25.13 ? 314 TYR A CE1 1 
ATOM   700  C CE2 . TYR A 1 99  ? -0.607  10.110  27.337 1.00 25.15 ? 314 TYR A CE2 1 
ATOM   701  C CZ  . TYR A 1 99  ? -0.274  11.396  27.738 1.00 25.33 ? 314 TYR A CZ  1 
ATOM   702  O OH  . TYR A 1 99  ? -1.112  12.446  27.428 1.00 26.35 ? 314 TYR A OH  1 
ATOM   703  N N   . GLY A 1 100 ? 2.388   5.118   30.465 1.00 22.76 ? 315 GLY A N   1 
ATOM   704  C CA  . GLY A 1 100 ? 3.105   3.859   30.661 1.00 22.77 ? 315 GLY A CA  1 
ATOM   705  C C   . GLY A 1 100 ? 2.447   2.625   30.088 1.00 22.61 ? 315 GLY A C   1 
ATOM   706  O O   . GLY A 1 100 ? 1.270   2.642   29.704 1.00 22.61 ? 315 GLY A O   1 
ATOM   707  N N   . VAL A 1 101 ? 3.228   1.554   30.011 1.00 21.90 ? 316 VAL A N   1 
ATOM   708  C CA  . VAL A 1 101 ? 2.755   0.257   29.568 1.00 22.16 ? 316 VAL A CA  1 
ATOM   709  C C   . VAL A 1 101 ? 3.283   -0.776  30.552 1.00 22.45 ? 316 VAL A C   1 
ATOM   710  O O   . VAL A 1 101 ? 4.461   -0.747  30.913 1.00 23.79 ? 316 VAL A O   1 
ATOM   711  C CB  . VAL A 1 101 ? 3.285   -0.105  28.152 1.00 23.03 ? 316 VAL A CB  1 
ATOM   712  C CG1 . VAL A 1 101 ? 2.643   -1.399  27.641 1.00 22.70 ? 316 VAL A CG1 1 
ATOM   713  C CG2 . VAL A 1 101 ? 3.037   1.024   27.180 1.00 24.65 ? 316 VAL A CG2 1 
ATOM   714  N N   . SER A 1 102 ? 2.417   -1.685  30.977 1.00 21.80 ? 317 SER A N   1 
ATOM   715  C CA  . SER A 1 102 ? 2.823   -2.773  31.842 1.00 21.99 ? 317 SER A CA  1 
ATOM   716  C C   . SER A 1 102 ? 2.385   -4.085  31.222 1.00 21.75 ? 317 SER A C   1 
ATOM   717  O O   . SER A 1 102 ? 1.335   -4.155  30.583 1.00 21.91 ? 317 SER A O   1 
ATOM   718  C CB  . SER A 1 102 ? 2.221   -2.604  33.240 1.00 22.49 ? 317 SER A CB  1 
ATOM   719  O OG  . SER A 1 102 ? 2.805   -1.488  33.901 1.00 23.78 ? 317 SER A OG  1 
ATOM   720  N N   . SER A 1 103 ? 3.206   -5.119  31.386 1.00 20.90 ? 318 SER A N   1 
ATOM   721  C CA  . SER A 1 103 ? 2.866   -6.444  30.900 1.00 20.39 ? 318 SER A CA  1 
ATOM   722  C C   . SER A 1 103 ? 3.450   -7.525  31.806 1.00 20.77 ? 318 SER A C   1 
ATOM   723  O O   . SER A 1 103 ? 4.442   -7.303  32.500 1.00 20.65 ? 318 SER A O   1 
ATOM   724  C CB  . SER A 1 103 ? 3.321   -6.637  29.450 1.00 20.36 ? 318 SER A CB  1 
ATOM   725  O OG  . SER A 1 103 ? 4.699   -6.373  29.312 1.00 21.29 ? 318 SER A OG  1 
ATOM   726  N N   . GLN A 1 104 ? 2.811   -8.684  31.811 1.00 21.37 ? 319 GLN A N   1 
ATOM   727  C CA  . GLN A 1 104 ? 3.223   -9.778  32.676 1.00 22.92 ? 319 GLN A CA  1 
ATOM   728  C C   . GLN A 1 104 ? 3.205   -11.076 31.881 1.00 22.11 ? 319 GLN A C   1 
ATOM   729  O O   . GLN A 1 104 ? 2.296   -11.305 31.076 1.00 20.76 ? 319 GLN A O   1 
ATOM   730  C CB  . GLN A 1 104 ? 2.288   -9.863  33.885 1.00 25.75 ? 319 GLN A CB  1 
ATOM   731  C CG  . GLN A 1 104 ? 2.753   -10.809 34.985 1.00 30.62 ? 319 GLN A CG  1 
ATOM   732  C CD  . GLN A 1 104 ? 2.037   -10.575 36.307 1.00 34.20 ? 319 GLN A CD  1 
ATOM   733  O OE1 . GLN A 1 104 ? 0.987   -9.928  36.362 1.00 36.75 ? 319 GLN A OE1 1 
ATOM   734  N NE2 . GLN A 1 104 ? 2.608   -11.106 37.386 1.00 36.87 ? 319 GLN A NE2 1 
ATOM   735  N N   . TYR A 1 105 ? 4.213   -11.917 32.113 1.00 20.84 ? 320 TYR A N   1 
ATOM   736  C CA  . TYR A 1 105 ? 4.387   -13.172 31.381 1.00 20.58 ? 320 TYR A CA  1 
ATOM   737  C C   . TYR A 1 105 ? 4.697   -14.322 32.330 1.00 20.65 ? 320 TYR A C   1 
ATOM   738  O O   . TYR A 1 105 ? 5.198   -14.100 33.430 1.00 20.22 ? 320 TYR A O   1 
ATOM   739  C CB  . TYR A 1 105 ? 5.533   -13.069 30.366 1.00 20.36 ? 320 TYR A CB  1 
ATOM   740  C CG  . TYR A 1 105 ? 5.504   -11.823 29.512 1.00 20.55 ? 320 TYR A CG  1 
ATOM   741  C CD1 . TYR A 1 105 ? 4.986   -11.853 28.217 1.00 20.03 ? 320 TYR A CD1 1 
ATOM   742  C CD2 . TYR A 1 105 ? 5.990   -10.610 30.005 1.00 20.68 ? 320 TYR A CD2 1 
ATOM   743  C CE1 . TYR A 1 105 ? 4.962   -10.703 27.430 1.00 20.89 ? 320 TYR A CE1 1 
ATOM   744  C CE2 . TYR A 1 105 ? 5.964   -9.454  29.231 1.00 20.97 ? 320 TYR A CE2 1 
ATOM   745  C CZ  . TYR A 1 105 ? 5.450   -9.508  27.945 1.00 21.00 ? 320 TYR A CZ  1 
ATOM   746  O OH  . TYR A 1 105 ? 5.412   -8.360  27.181 1.00 22.00 ? 320 TYR A OH  1 
ATOM   747  N N   . GLU A 1 106 ? 4.400   -15.540 31.880 1.00 20.95 ? 321 GLU A N   1 
ATOM   748  C CA  A GLU A 1 106 ? 4.720   -16.748 32.634 0.50 21.02 ? 321 GLU A CA  1 
ATOM   749  C CA  B GLU A 1 106 ? 4.686   -16.757 32.632 0.50 21.24 ? 321 GLU A CA  1 
ATOM   750  C C   . GLU A 1 106 ? 5.314   -17.814 31.721 1.00 21.24 ? 321 GLU A C   1 
ATOM   751  O O   . GLU A 1 106 ? 4.906   -17.964 30.566 1.00 20.27 ? 321 GLU A O   1 
ATOM   752  C CB  A GLU A 1 106 ? 3.491   -17.285 33.383 0.50 21.31 ? 321 GLU A CB  1 
ATOM   753  C CB  B GLU A 1 106 ? 3.399   -17.292 33.270 0.50 21.88 ? 321 GLU A CB  1 
ATOM   754  C CG  A GLU A 1 106 ? 3.134   -16.493 34.641 0.50 21.48 ? 321 GLU A CG  1 
ATOM   755  C CG  B GLU A 1 106 ? 3.547   -18.615 33.999 0.50 22.60 ? 321 GLU A CG  1 
ATOM   756  C CD  A GLU A 1 106 ? 1.920   -17.037 35.378 0.50 21.67 ? 321 GLU A CD  1 
ATOM   757  C CD  B GLU A 1 106 ? 2.222   -19.154 34.509 0.50 22.61 ? 321 GLU A CD  1 
ATOM   758  O OE1 A GLU A 1 106 ? 1.364   -18.064 34.939 0.50 21.97 ? 321 GLU A OE1 1 
ATOM   759  O OE1 B GLU A 1 106 ? 1.594   -18.485 35.354 0.50 23.11 ? 321 GLU A OE1 1 
ATOM   760  O OE2 A GLU A 1 106 ? 1.525   -16.431 36.399 0.50 21.26 ? 321 GLU A OE2 1 
ATOM   761  O OE2 B GLU A 1 106 ? 1.818   -20.248 34.069 0.50 22.80 ? 321 GLU A OE2 1 
ATOM   762  N N   . SER A 1 107 ? 6.298   -18.540 32.246 1.00 21.41 ? 322 SER A N   1 
ATOM   763  C CA  A SER A 1 107 ? 6.948   -19.626 31.509 0.50 21.50 ? 322 SER A CA  1 
ATOM   764  C CA  B SER A 1 107 ? 6.932   -19.630 31.509 0.50 22.10 ? 322 SER A CA  1 
ATOM   765  C C   . SER A 1 107 ? 7.266   -20.802 32.429 1.00 22.36 ? 322 SER A C   1 
ATOM   766  O O   . SER A 1 107 ? 7.496   -20.607 33.627 1.00 22.66 ? 322 SER A O   1 
ATOM   767  C CB  A SER A 1 107 ? 8.236   -19.126 30.857 0.50 20.69 ? 322 SER A CB  1 
ATOM   768  C CB  B SER A 1 107 ? 8.203   -19.134 30.833 0.50 22.02 ? 322 SER A CB  1 
ATOM   769  O OG  A SER A 1 107 ? 8.904   -20.168 30.157 0.50 20.07 ? 322 SER A OG  1 
ATOM   770  O OG  B SER A 1 107 ? 9.163   -18.745 31.795 0.50 23.44 ? 322 SER A OG  1 
ATOM   771  N N   . PRO A 1 108 ? 7.282   -22.037 31.874 1.00 23.55 ? 323 PRO A N   1 
ATOM   772  C CA  . PRO A 1 108 ? 7.764   -23.155 32.693 1.00 24.05 ? 323 PRO A CA  1 
ATOM   773  C C   . PRO A 1 108 ? 9.288   -23.116 32.847 1.00 24.78 ? 323 PRO A C   1 
ATOM   774  O O   . PRO A 1 108 ? 9.837   -23.769 33.735 1.00 24.59 ? 323 PRO A O   1 
ATOM   775  C CB  . PRO A 1 108 ? 7.344   -24.392 31.892 1.00 24.77 ? 323 PRO A CB  1 
ATOM   776  C CG  . PRO A 1 108 ? 7.149   -23.911 30.496 1.00 25.63 ? 323 PRO A CG  1 
ATOM   777  C CD  . PRO A 1 108 ? 6.676   -22.500 30.609 1.00 24.30 ? 323 PRO A CD  1 
ATOM   778  N N   . GLU A 1 109 ? 9.949   -22.337 31.992 1.00 25.49 ? 324 GLU A N   1 
ATOM   779  C CA  . GLU A 1 109 ? 11.409  -22.244 31.963 1.00 27.10 ? 324 GLU A CA  1 
ATOM   780  C C   . GLU A 1 109 ? 11.922  -20.922 32.536 1.00 25.71 ? 324 GLU A C   1 
ATOM   781  O O   . GLU A 1 109 ? 11.221  -19.905 32.497 1.00 23.87 ? 324 GLU A O   1 
ATOM   782  C CB  . GLU A 1 109 ? 11.921  -22.423 30.528 1.00 29.60 ? 324 GLU A CB  1 
ATOM   783  C CG  . GLU A 1 109 ? 11.963  -23.879 30.061 1.00 34.17 ? 324 GLU A CG  1 
ATOM   784  C CD  . GLU A 1 109 ? 12.101  -24.034 28.549 1.00 37.84 ? 324 GLU A CD  1 
ATOM   785  O OE1 . GLU A 1 109 ? 12.716  -23.163 27.893 1.00 40.34 ? 324 GLU A OE1 1 
ATOM   786  O OE2 . GLU A 1 109 ? 11.594  -25.046 28.013 1.00 40.71 ? 324 GLU A OE2 1 
ATOM   787  N N   . ASN A 1 110 ? 13.133  -20.965 33.093 1.00 25.36 ? 325 ASN A N   1 
ATOM   788  C CA  A ASN A 1 110 ? 13.855  -19.793 33.577 0.50 25.54 ? 325 ASN A CA  1 
ATOM   789  C CA  B ASN A 1 110 ? 13.793  -19.737 33.522 0.50 25.42 ? 325 ASN A CA  1 
ATOM   790  C C   . ASN A 1 110 ? 14.772  -19.274 32.461 1.00 26.01 ? 325 ASN A C   1 
ATOM   791  O O   . ASN A 1 110 ? 15.859  -19.819 32.260 1.00 27.80 ? 325 ASN A O   1 
ATOM   792  C CB  A ASN A 1 110 ? 14.660  -20.197 34.825 0.50 24.98 ? 325 ASN A CB  1 
ATOM   793  C CB  B ASN A 1 110 ? 14.411  -19.820 34.926 0.50 24.73 ? 325 ASN A CB  1 
ATOM   794  C CG  A ASN A 1 110 ? 15.560  -19.090 35.349 0.50 24.66 ? 325 ASN A CG  1 
ATOM   795  C CG  B ASN A 1 110 ? 15.359  -20.977 35.089 0.50 24.16 ? 325 ASN A CG  1 
ATOM   796  O OD1 A ASN A 1 110 ? 15.422  -17.927 34.983 0.50 24.35 ? 325 ASN A OD1 1 
ATOM   797  O OD1 B ASN A 1 110 ? 15.780  -21.597 34.115 0.50 23.53 ? 325 ASN A OD1 1 
ATOM   798  N ND2 A ASN A 1 110 ? 16.493  -19.458 36.219 0.50 24.90 ? 325 ASN A ND2 1 
ATOM   799  N ND2 B ASN A 1 110 ? 15.705  -21.279 36.337 0.50 23.90 ? 325 ASN A ND2 1 
ATOM   800  N N   . MET A 1 111 ? 14.325  -18.265 31.735 1.00 26.63 ? 326 MET A N   1 
ATOM   801  C CA  . MET A 1 111 ? 15.056  -17.748 30.603 1.00 25.73 ? 326 MET A CA  1 
ATOM   802  C C   . MET A 1 111 ? 15.359  -16.299 30.870 1.00 23.41 ? 326 MET A C   1 
ATOM   803  O O   . MET A 1 111 ? 14.778  -15.690 31.762 1.00 24.30 ? 326 MET A O   1 
ATOM   804  C CB  . MET A 1 111 ? 14.194  -17.838 29.346 1.00 27.50 ? 326 MET A CB  1 
ATOM   805  C CG  . MET A 1 111 ? 13.516  -19.183 29.133 1.00 29.33 ? 326 MET A CG  1 
ATOM   806  S SD  . MET A 1 111 ? 12.254  -19.031 27.874 1.00 31.57 ? 326 MET A SD  1 
ATOM   807  C CE  . MET A 1 111 ? 11.012  -18.065 28.728 1.00 30.35 ? 326 MET A CE  1 
ATOM   808  N N   . ILE A 1 112 ? 16.305  -15.760 30.122 1.00 22.34 ? 327 ILE A N   1 
ATOM   809  C CA  . ILE A 1 112 ? 16.440  -14.327 30.017 1.00 21.26 ? 327 ILE A CA  1 
ATOM   810  C C   . ILE A 1 112 ? 15.726  -13.975 28.724 1.00 20.96 ? 327 ILE A C   1 
ATOM   811  O O   . ILE A 1 112 ? 16.044  -14.523 27.669 1.00 20.46 ? 327 ILE A O   1 
ATOM   812  C CB  . ILE A 1 112 ? 17.909  -13.880 29.975 1.00 21.04 ? 327 ILE A CB  1 
ATOM   813  C CG1 . ILE A 1 112 ? 18.618  -14.309 31.269 1.00 20.95 ? 327 ILE A CG1 1 
ATOM   814  C CG2 . ILE A 1 112 ? 17.987  -12.370 29.775 1.00 20.50 ? 327 ILE A CG2 1 
ATOM   815  C CD1 . ILE A 1 112 ? 20.130  -14.192 31.221 1.00 22.44 ? 327 ILE A CD1 1 
ATOM   816  N N   . ILE A 1 113 ? 14.742  -13.090 28.822 1.00 21.18 ? 328 ILE A N   1 
ATOM   817  C CA  . ILE A 1 113 ? 13.952  -12.712 27.654 1.00 21.39 ? 328 ILE A CA  1 
ATOM   818  C C   . ILE A 1 113 ? 14.228  -11.267 27.243 1.00 21.32 ? 328 ILE A C   1 
ATOM   819  O O   . ILE A 1 113 ? 14.555  -10.418 28.084 1.00 22.01 ? 328 ILE A O   1 
ATOM   820  C CB  . ILE A 1 113 ? 12.423  -12.978 27.850 1.00 22.21 ? 328 ILE A CB  1 
ATOM   821  C CG1 . ILE A 1 113 ? 11.794  -12.012 28.866 1.00 22.59 ? 328 ILE A CG1 1 
ATOM   822  C CG2 . ILE A 1 113 ? 12.180  -14.449 28.232 1.00 22.37 ? 328 ILE A CG2 1 
ATOM   823  C CD1 . ILE A 1 113 ? 10.268  -12.112 29.002 1.00 24.39 ? 328 ILE A CD1 1 
ATOM   824  N N   . THR A 1 114 ? 14.153  -11.010 25.939 1.00 20.66 ? 329 THR A N   1 
ATOM   825  C CA  A THR A 1 114 ? 14.181  -9.635  25.463 0.50 20.61 ? 329 THR A CA  1 
ATOM   826  C CA  B THR A 1 114 ? 14.222  -9.660  25.398 0.50 20.70 ? 329 THR A CA  1 
ATOM   827  C C   . THR A 1 114 ? 12.877  -9.332  24.756 1.00 20.65 ? 329 THR A C   1 
ATOM   828  O O   . THR A 1 114 ? 12.374  -10.128 23.965 1.00 20.29 ? 329 THR A O   1 
ATOM   829  C CB  A THR A 1 114 ? 15.382  -9.307  24.544 0.50 20.73 ? 329 THR A CB  1 
ATOM   830  C CB  B THR A 1 114 ? 15.316  -9.546  24.316 0.50 20.87 ? 329 THR A CB  1 
ATOM   831  O OG1 A THR A 1 114 ? 15.365  -10.158 23.393 0.50 20.74 ? 329 THR A OG1 1 
ATOM   832  O OG1 B THR A 1 114 ? 16.504  -10.218 24.752 0.50 20.86 ? 329 THR A OG1 1 
ATOM   833  C CG2 A THR A 1 114 ? 16.701  -9.469  25.296 0.50 20.53 ? 329 THR A CG2 1 
ATOM   834  C CG2 B THR A 1 114 ? 15.634  -8.099  24.031 0.50 20.87 ? 329 THR A CG2 1 
ATOM   835  N N   . CYS A 1 115 ? 12.319  -8.178  25.086 1.00 20.09 ? 330 CYS A N   1 
ATOM   836  C CA  . CYS A 1 115 ? 11.085  -7.731  24.463 1.00 20.45 ? 330 CYS A CA  1 
ATOM   837  C C   . CYS A 1 115 ? 11.391  -6.506  23.616 1.00 20.23 ? 330 CYS A C   1 
ATOM   838  O O   . CYS A 1 115 ? 11.814  -5.465  24.134 1.00 21.23 ? 330 CYS A O   1 
ATOM   839  C CB  . CYS A 1 115 ? 10.013  -7.428  25.513 1.00 20.74 ? 330 CYS A CB  1 
ATOM   840  S SG  . CYS A 1 115 ? 8.432   -6.849  24.804 1.00 23.91 ? 330 CYS A SG  1 
ATOM   841  N N   . SER A 1 116 ? 11.197  -6.658  22.311 1.00 20.03 ? 331 SER A N   1 
ATOM   842  C CA  . SER A 1 116 ? 11.374  -5.584  21.340 1.00 20.48 ? 331 SER A CA  1 
ATOM   843  C C   . SER A 1 116 ? 10.003  -5.098  20.903 1.00 20.12 ? 331 SER A C   1 
ATOM   844  O O   . SER A 1 116 ? 9.177   -5.891  20.449 1.00 19.81 ? 331 SER A O   1 
ATOM   845  C CB  . SER A 1 116 ? 12.147  -6.112  20.128 1.00 21.37 ? 331 SER A CB  1 
ATOM   846  O OG  . SER A 1 116 ? 11.885  -5.333  18.964 1.00 24.13 ? 331 SER A OG  1 
ATOM   847  N N   . THR A 1 117 ? 9.767   -3.799  21.044 1.00 20.23 ? 332 THR A N   1 
ATOM   848  C CA  . THR A 1 117 ? 8.513   -3.193  20.632 1.00 20.16 ? 332 THR A CA  1 
ATOM   849  C C   . THR A 1 117 ? 8.831   -2.190  19.532 1.00 19.51 ? 332 THR A C   1 
ATOM   850  O O   . THR A 1 117 ? 9.575   -1.227  19.751 1.00 19.56 ? 332 THR A O   1 
ATOM   851  C CB  . THR A 1 117 ? 7.815   -2.500  21.810 1.00 20.99 ? 332 THR A CB  1 
ATOM   852  O OG1 . THR A 1 117 ? 7.613   -3.454  22.855 1.00 22.43 ? 332 THR A OG1 1 
ATOM   853  C CG2 . THR A 1 117 ? 6.458   -1.933  21.387 1.00 21.51 ? 332 THR A CG2 1 
ATOM   854  N N   . LYS A 1 118 ? 8.287   -2.440  18.345 1.00 18.25 ? 333 LYS A N   1 
ATOM   855  C CA  . LYS A 1 118 ? 8.501   -1.557  17.205 1.00 18.11 ? 333 LYS A CA  1 
ATOM   856  C C   . LYS A 1 118 ? 7.226   -0.802  16.850 1.00 17.85 ? 333 LYS A C   1 
ATOM   857  O O   . LYS A 1 118 ? 6.177   -1.411  16.623 1.00 17.54 ? 333 LYS A O   1 
ATOM   858  C CB  . LYS A 1 118 ? 8.998   -2.348  15.995 1.00 19.17 ? 333 LYS A CB  1 
ATOM   859  C CG  . LYS A 1 118 ? 10.370  -2.956  16.194 1.00 20.03 ? 333 LYS A CG  1 
ATOM   860  C CD  . LYS A 1 118 ? 10.793  -3.774  15.008 1.00 21.89 ? 333 LYS A CD  1 
ATOM   861  C CE  . LYS A 1 118 ? 12.242  -4.226  15.176 1.00 22.67 ? 333 LYS A CE  1 
ATOM   862  N NZ  . LYS A 1 118 ? 12.734  -4.824  13.922 1.00 23.63 ? 333 LYS A NZ  1 
ATOM   863  N N   . VAL A 1 119 ? 7.321   0.521   16.815 1.00 17.13 ? 334 VAL A N   1 
ATOM   864  C CA  . VAL A 1 119 ? 6.216   1.348   16.343 1.00 17.38 ? 334 VAL A CA  1 
ATOM   865  C C   . VAL A 1 119 ? 6.402   1.532   14.843 1.00 17.27 ? 334 VAL A C   1 
ATOM   866  O O   . VAL A 1 119 ? 7.485   1.940   14.387 1.00 16.99 ? 334 VAL A O   1 
ATOM   867  C CB  . VAL A 1 119 ? 6.150   2.712   17.075 1.00 17.51 ? 334 VAL A CB  1 
ATOM   868  C CG1 . VAL A 1 119 ? 4.992   3.542   16.548 1.00 18.07 ? 334 VAL A CG1 1 
ATOM   869  C CG2 . VAL A 1 119 ? 6.004   2.505   18.582 1.00 18.08 ? 334 VAL A CG2 1 
ATOM   870  N N   . CYS A 1 120 ? 5.359   1.212   14.081 1.00 17.16 ? 335 CYS A N   1 
ATOM   871  C CA  . CYS A 1 120 ? 5.452   1.180   12.618 1.00 17.88 ? 335 CYS A CA  1 
ATOM   872  C C   . CYS A 1 120 ? 4.425   2.081   11.964 1.00 17.99 ? 335 CYS A C   1 
ATOM   873  O O   . CYS A 1 120 ? 3.297   2.183   12.429 1.00 17.93 ? 335 CYS A O   1 
ATOM   874  C CB  . CYS A 1 120 ? 5.276   -0.249  12.101 1.00 18.48 ? 335 CYS A CB  1 
ATOM   875  S SG  . CYS A 1 120 ? 6.464   -1.409  12.812 1.00 20.49 ? 335 CYS A SG  1 
ATOM   876  N N   . SER A 1 121 ? 4.831   2.746   10.889 1.00 18.14 ? 336 SER A N   1 
ATOM   877  C CA  . SER A 1 121 ? 3.912   3.594   10.134 1.00 18.74 ? 336 SER A CA  1 
ATOM   878  C C   . SER A 1 121 ? 4.095   3.324   8.657  1.00 19.73 ? 336 SER A C   1 
ATOM   879  O O   . SER A 1 121 ? 5.213   3.353   8.152  1.00 19.41 ? 336 SER A O   1 
ATOM   880  C CB  . SER A 1 121 ? 4.134   5.077   10.432 1.00 18.71 ? 336 SER A CB  1 
ATOM   881  O OG  . SER A 1 121 ? 3.232   5.875   9.689  1.00 18.83 ? 336 SER A OG  1 
ATOM   882  N N   . PHE A 1 122 ? 2.981   3.069   7.974  1.00 21.92 ? 337 PHE A N   1 
ATOM   883  C CA  . PHE A 1 122 ? 3.006   2.554   6.609  1.00 24.53 ? 337 PHE A CA  1 
ATOM   884  C C   . PHE A 1 122 ? 4.050   1.432   6.454  1.00 24.50 ? 337 PHE A C   1 
ATOM   885  O O   . PHE A 1 122 ? 4.855   1.428   5.519  1.00 24.99 ? 337 PHE A O   1 
ATOM   886  C CB  . PHE A 1 122 ? 3.227   3.684   5.604  1.00 26.47 ? 337 PHE A CB  1 
ATOM   887  C CG  . PHE A 1 122 ? 2.029   4.580   5.428  1.00 28.27 ? 337 PHE A CG  1 
ATOM   888  C CD1 . PHE A 1 122 ? 1.933   5.779   6.119  1.00 29.68 ? 337 PHE A CD1 1 
ATOM   889  C CD2 . PHE A 1 122 ? 0.993   4.217   4.577  1.00 29.07 ? 337 PHE A CD2 1 
ATOM   890  C CE1 . PHE A 1 122 ? 0.821   6.609   5.951  1.00 29.69 ? 337 PHE A CE1 1 
ATOM   891  C CE2 . PHE A 1 122 ? -0.119  5.043   4.405  1.00 29.94 ? 337 PHE A CE2 1 
ATOM   892  C CZ  . PHE A 1 122 ? -0.205  6.236   5.100  1.00 28.95 ? 337 PHE A CZ  1 
ATOM   893  N N   . GLY A 1 123 ? 4.031   0.497   7.400  1.00 24.88 ? 338 GLY A N   1 
ATOM   894  C CA  . GLY A 1 123 ? 4.932   -0.654  7.378  1.00 24.06 ? 338 GLY A CA  1 
ATOM   895  C C   . GLY A 1 123 ? 6.398   -0.385  7.676  1.00 24.12 ? 338 GLY A C   1 
ATOM   896  O O   . GLY A 1 123 ? 7.208   -1.324  7.660  1.00 24.78 ? 338 GLY A O   1 
ATOM   897  N N   . LYS A 1 124 ? 6.747   0.876   7.947  1.00 22.26 ? 339 LYS A N   1 
ATOM   898  C CA  . LYS A 1 124 ? 8.136   1.255   8.241  1.00 21.67 ? 339 LYS A CA  1 
ATOM   899  C C   . LYS A 1 124 ? 8.375   1.440   9.740  1.00 20.58 ? 339 LYS A C   1 
ATOM   900  O O   . LYS A 1 124 ? 7.564   2.039   10.433 1.00 18.38 ? 339 LYS A O   1 
ATOM   901  C CB  . LYS A 1 124 ? 8.537   2.541   7.499  1.00 22.71 ? 339 LYS A CB  1 
ATOM   902  C CG  . LYS A 1 124 ? 8.193   2.581   5.999  1.00 24.47 ? 339 LYS A CG  1 
ATOM   903  C CD  . LYS A 1 124 ? 8.760   1.397   5.226  1.00 25.13 ? 339 LYS A CD  1 
ATOM   904  C CE  . LYS A 1 124 ? 8.489   1.555   3.742  1.00 26.45 ? 339 LYS A CE  1 
ATOM   905  N NZ  . LYS A 1 124 ? 9.046   0.436   2.948  1.00 27.12 ? 339 LYS A NZ  1 
ATOM   906  N N   . GLN A 1 125 ? 9.506   0.940   10.231 1.00 20.46 ? 340 GLN A N   1 
ATOM   907  C CA  . GLN A 1 125 ? 9.861   1.110   11.638 1.00 20.53 ? 340 GLN A CA  1 
ATOM   908  C C   . GLN A 1 125 ? 10.154  2.579   11.955 1.00 20.35 ? 340 GLN A C   1 
ATOM   909  O O   . GLN A 1 125 ? 11.007  3.196   11.308 1.00 20.33 ? 340 GLN A O   1 
ATOM   910  C CB  . GLN A 1 125 ? 11.081  0.258   11.975 1.00 22.06 ? 340 GLN A CB  1 
ATOM   911  C CG  . GLN A 1 125 ? 11.524  0.346   13.427 1.00 24.39 ? 340 GLN A CG  1 
ATOM   912  C CD  . GLN A 1 125 ? 12.723  -0.536  13.702 1.00 26.02 ? 340 GLN A CD  1 
ATOM   913  O OE1 . GLN A 1 125 ? 12.803  -1.649  13.202 1.00 27.47 ? 340 GLN A OE1 1 
ATOM   914  N NE2 . GLN A 1 125 ? 13.668  -0.032  14.483 1.00 27.59 ? 340 GLN A NE2 1 
ATOM   915  N N   . VAL A 1 126 ? 9.444   3.132   12.938 1.00 19.51 ? 341 VAL A N   1 
ATOM   916  C CA  A VAL A 1 126 ? 9.707   4.508   13.344 0.50 20.01 ? 341 VAL A CA  1 
ATOM   917  C CA  B VAL A 1 126 ? 9.643   4.516   13.388 0.50 19.64 ? 341 VAL A CA  1 
ATOM   918  C C   . VAL A 1 126 ? 10.565  4.558   14.607 1.00 19.95 ? 341 VAL A C   1 
ATOM   919  O O   . VAL A 1 126 ? 11.501  5.357   14.674 1.00 19.57 ? 341 VAL A O   1 
ATOM   920  C CB  A VAL A 1 126 ? 8.428   5.409   13.433 0.50 20.52 ? 341 VAL A CB  1 
ATOM   921  C CB  B VAL A 1 126 ? 8.307   5.200   13.768 0.50 19.73 ? 341 VAL A CB  1 
ATOM   922  C CG1 A VAL A 1 126 ? 7.584   5.295   12.160 0.50 20.66 ? 341 VAL A CG1 1 
ATOM   923  C CG1 B VAL A 1 126 ? 8.542   6.663   14.136 0.50 19.28 ? 341 VAL A CG1 1 
ATOM   924  C CG2 A VAL A 1 126 ? 7.591   5.101   14.661 0.50 20.72 ? 341 VAL A CG2 1 
ATOM   925  C CG2 B VAL A 1 126 ? 7.287   5.090   12.640 0.50 19.62 ? 341 VAL A CG2 1 
ATOM   926  N N   . VAL A 1 127 ? 10.264  3.701   15.581 1.00 19.85 ? 342 VAL A N   1 
ATOM   927  C CA  . VAL A 1 127 ? 11.079  3.555   16.793 1.00 21.30 ? 342 VAL A CA  1 
ATOM   928  C C   . VAL A 1 127 ? 11.053  2.110   17.267 1.00 21.56 ? 342 VAL A C   1 
ATOM   929  O O   . VAL A 1 127 ? 10.100  1.369   16.989 1.00 20.22 ? 342 VAL A O   1 
ATOM   930  C CB  . VAL A 1 127 ? 10.648  4.499   17.969 1.00 21.90 ? 342 VAL A CB  1 
ATOM   931  C CG1 . VAL A 1 127 ? 10.928  5.941   17.645 1.00 23.12 ? 342 VAL A CG1 1 
ATOM   932  C CG2 . VAL A 1 127 ? 9.196   4.323   18.356 1.00 23.06 ? 342 VAL A CG2 1 
ATOM   933  N N   . GLU A 1 128 ? 12.110  1.710   17.965 1.00 21.91 ? 343 GLU A N   1 
ATOM   934  C CA  . GLU A 1 128 ? 12.139  0.420   18.641 1.00 22.44 ? 343 GLU A CA  1 
ATOM   935  C C   . GLU A 1 128 ? 12.540  0.616   20.105 1.00 23.42 ? 343 GLU A C   1 
ATOM   936  O O   . GLU A 1 128 ? 13.487  1.352   20.411 1.00 23.08 ? 343 GLU A O   1 
ATOM   937  C CB  . GLU A 1 128 ? 13.097  -0.552  17.949 1.00 23.62 ? 343 GLU A CB  1 
ATOM   938  C CG  . GLU A 1 128 ? 13.162  -1.934  18.620 1.00 24.46 ? 343 GLU A CG  1 
ATOM   939  C CD  . GLU A 1 128 ? 14.158  -2.881  17.978 1.00 25.87 ? 343 GLU A CD  1 
ATOM   940  O OE1 . GLU A 1 128 ? 15.155  -2.424  17.386 1.00 28.36 ? 343 GLU A OE1 1 
ATOM   941  O OE2 . GLU A 1 128 ? 13.949  -4.103  18.074 1.00 24.99 ? 343 GLU A OE2 1 
ATOM   942  N N   . LYS A 1 129 ? 11.793  -0.026  20.996 1.00 22.94 ? 344 LYS A N   1 
ATOM   943  C CA  . LYS A 1 129 ? 12.150  -0.095  22.407 1.00 24.32 ? 344 LYS A CA  1 
ATOM   944  C C   . LYS A 1 129 ? 12.579  -1.532  22.688 1.00 23.62 ? 344 LYS A C   1 
ATOM   945  O O   . LYS A 1 129 ? 11.924  -2.476  22.250 1.00 23.38 ? 344 LYS A O   1 
ATOM   946  C CB  . LYS A 1 129 ? 10.955  0.318   23.273 1.00 25.95 ? 344 LYS A CB  1 
ATOM   947  C CG  . LYS A 1 129 ? 11.189  0.243   24.773 1.00 28.86 ? 344 LYS A CG  1 
ATOM   948  C CD  . LYS A 1 129 ? 9.935   0.626   25.556 1.00 30.35 ? 344 LYS A CD  1 
ATOM   949  C CE  . LYS A 1 129 ? 8.838   -0.443  25.454 1.00 32.06 ? 344 LYS A CE  1 
ATOM   950  N NZ  . LYS A 1 129 ? 7.600   -0.073  26.213 1.00 33.36 ? 344 LYS A NZ  1 
ATOM   951  N N   . VAL A 1 130 ? 13.694  -1.698  23.394 1.00 23.70 ? 345 VAL A N   1 
ATOM   952  C CA  . VAL A 1 130 ? 14.211  -3.030  23.685 1.00 23.77 ? 345 VAL A CA  1 
ATOM   953  C C   . VAL A 1 130 ? 14.401  -3.191  25.190 1.00 24.35 ? 345 VAL A C   1 
ATOM   954  O O   . VAL A 1 130 ? 15.116  -2.413  25.823 1.00 23.57 ? 345 VAL A O   1 
ATOM   955  C CB  . VAL A 1 130 ? 15.534  -3.313  22.933 1.00 23.96 ? 345 VAL A CB  1 
ATOM   956  C CG1 . VAL A 1 130 ? 16.058  -4.698  23.279 1.00 24.38 ? 345 VAL A CG1 1 
ATOM   957  C CG2 . VAL A 1 130 ? 15.334  -3.191  21.436 1.00 24.68 ? 345 VAL A CG2 1 
ATOM   958  N N   . GLU A 1 131 ? 13.737  -4.193  25.756 1.00 24.64 ? 346 GLU A N   1 
ATOM   959  C CA  . GLU A 1 131 ? 13.773  -4.421  27.192 1.00 25.73 ? 346 GLU A CA  1 
ATOM   960  C C   . GLU A 1 131 ? 14.195  -5.837  27.524 1.00 25.34 ? 346 GLU A C   1 
ATOM   961  O O   . GLU A 1 131 ? 13.733  -6.796  26.910 1.00 25.57 ? 346 GLU A O   1 
ATOM   962  C CB  . GLU A 1 131 ? 12.418  -4.108  27.823 1.00 27.32 ? 346 GLU A CB  1 
ATOM   963  C CG  . GLU A 1 131 ? 12.043  -2.644  27.716 1.00 29.83 ? 346 GLU A CG  1 
ATOM   964  C CD  . GLU A 1 131 ? 10.592  -2.389  28.015 1.00 31.02 ? 346 GLU A CD  1 
ATOM   965  O OE1 . GLU A 1 131 ? 9.719   -2.926  27.292 1.00 32.49 ? 346 GLU A OE1 1 
ATOM   966  O OE2 . GLU A 1 131 ? 10.329  -1.636  28.970 1.00 32.10 ? 346 GLU A OE2 1 
ATOM   967  N N   . THR A 1 132 ? 15.071  -5.956  28.510 1.00 23.82 ? 347 THR A N   1 
ATOM   968  C CA  . THR A 1 132 ? 15.562  -7.249  28.949 1.00 23.07 ? 347 THR A CA  1 
ATOM   969  C C   . THR A 1 132 ? 14.934  -7.570  30.292 1.00 22.51 ? 347 THR A C   1 
ATOM   970  O O   . THR A 1 132 ? 14.908  -6.725  31.197 1.00 22.01 ? 347 THR A O   1 
ATOM   971  C CB  . THR A 1 132 ? 17.095  -7.245  29.051 1.00 23.86 ? 347 THR A CB  1 
ATOM   972  O OG1 . THR A 1 132 ? 17.646  -6.829  27.795 1.00 24.32 ? 347 THR A OG1 1 
ATOM   973  C CG2 . THR A 1 132 ? 17.626  -8.632  29.393 1.00 24.17 ? 347 THR A CG2 1 
ATOM   974  N N   . GLU A 1 133 ? 14.412  -8.785  30.412 1.00 22.04 ? 348 GLU A N   1 
ATOM   975  C CA  . GLU A 1 133 ? 13.736  -9.207  31.630 1.00 22.83 ? 348 GLU A CA  1 
ATOM   976  C C   . GLU A 1 133 ? 14.218  -10.564 32.119 1.00 21.79 ? 348 GLU A C   1 
ATOM   977  O O   . GLU A 1 133 ? 14.389  -11.502 31.339 1.00 20.80 ? 348 GLU A O   1 
ATOM   978  C CB  . GLU A 1 133 ? 12.217  -9.225  31.425 1.00 24.90 ? 348 GLU A CB  1 
ATOM   979  C CG  . GLU A 1 133 ? 11.600  -7.856  31.091 1.00 27.40 ? 348 GLU A CG  1 
ATOM   980  C CD  . GLU A 1 133 ? 11.834  -6.799  32.166 1.00 29.64 ? 348 GLU A CD  1 
ATOM   981  O OE1 . GLU A 1 133 ? 12.041  -5.625  31.798 1.00 32.67 ? 348 GLU A OE1 1 
ATOM   982  O OE2 . GLU A 1 133 ? 11.817  -7.129  33.375 1.00 31.51 ? 348 GLU A OE2 1 
ATOM   983  N N   . TYR A 1 134 ? 14.433  -10.652 33.426 1.00 21.71 ? 349 TYR A N   1 
ATOM   984  C CA  . TYR A 1 134 ? 14.911  -11.875 34.058 1.00 21.68 ? 349 TYR A CA  1 
ATOM   985  C C   . TYR A 1 134 ? 13.756  -12.520 34.812 1.00 20.84 ? 349 TYR A C   1 
ATOM   986  O O   . TYR A 1 134 ? 12.768  -11.849 35.142 1.00 20.74 ? 349 TYR A O   1 
ATOM   987  C CB  . TYR A 1 134 ? 16.065  -11.553 35.013 1.00 23.05 ? 349 TYR A CB  1 
ATOM   988  C CG  . TYR A 1 134 ? 17.292  -11.025 34.306 1.00 24.60 ? 349 TYR A CG  1 
ATOM   989  C CD1 . TYR A 1 134 ? 18.364  -11.865 34.018 1.00 25.68 ? 349 TYR A CD1 1 
ATOM   990  C CD2 . TYR A 1 134 ? 17.376  -9.687  33.913 1.00 25.69 ? 349 TYR A CD2 1 
ATOM   991  C CE1 . TYR A 1 134 ? 19.489  -11.388 33.363 1.00 26.09 ? 349 TYR A CE1 1 
ATOM   992  C CE2 . TYR A 1 134 ? 18.499  -9.200  33.254 1.00 26.51 ? 349 TYR A CE2 1 
ATOM   993  C CZ  . TYR A 1 134 ? 19.542  -10.060 32.975 1.00 26.92 ? 349 TYR A CZ  1 
ATOM   994  O OH  . TYR A 1 134 ? 20.655  -9.587  32.330 1.00 28.00 ? 349 TYR A OH  1 
ATOM   995  N N   . ALA A 1 135 ? 13.885  -13.814 35.090 1.00 20.40 ? 350 ALA A N   1 
ATOM   996  C CA  . ALA A 1 135 ? 12.807  -14.585 35.705 1.00 20.30 ? 350 ALA A CA  1 
ATOM   997  C C   . ALA A 1 135 ? 12.750  -14.448 37.219 1.00 21.09 ? 350 ALA A C   1 
ATOM   998  O O   . ALA A 1 135 ? 13.771  -14.235 37.889 1.00 21.00 ? 350 ALA A O   1 
ATOM   999  C CB  . ALA A 1 135 ? 12.928  -16.050 35.328 1.00 19.96 ? 350 ALA A CB  1 
ATOM   1000 N N   . ARG A 1 136 ? 11.540  -14.582 37.747 1.00 21.63 ? 351 ARG A N   1 
ATOM   1001 C CA  . ARG A 1 136 ? 11.321  -14.752 39.180 1.00 22.58 ? 351 ARG A CA  1 
ATOM   1002 C C   . ARG A 1 136 ? 10.586  -16.074 39.364 1.00 23.60 ? 351 ARG A C   1 
ATOM   1003 O O   . ARG A 1 136 ? 9.597   -16.336 38.673 1.00 22.05 ? 351 ARG A O   1 
ATOM   1004 C CB  . ARG A 1 136 ? 10.503  -13.581 39.741 1.00 23.88 ? 351 ARG A CB  1 
ATOM   1005 C CG  . ARG A 1 136 ? 10.184  -13.669 41.246 1.00 25.01 ? 351 ARG A CG  1 
ATOM   1006 C CD  . ARG A 1 136 ? 9.468   -12.410 41.732 1.00 25.75 ? 351 ARG A CD  1 
ATOM   1007 N NE  . ARG A 1 136 ? 10.390  -11.282 41.867 1.00 28.77 ? 351 ARG A NE  1 
ATOM   1008 C CZ  . ARG A 1 136 ? 10.064  -10.008 41.666 1.00 28.97 ? 351 ARG A CZ  1 
ATOM   1009 N NH1 . ARG A 1 136 ? 8.828   -9.678  41.319 1.00 31.43 ? 351 ARG A NH1 1 
ATOM   1010 N NH2 . ARG A 1 136 ? 10.975  -9.060  41.812 1.00 30.31 ? 351 ARG A NH2 1 
ATOM   1011 N N   . TYR A 1 137 ? 11.075  -16.913 40.274 1.00 23.74 ? 352 TYR A N   1 
ATOM   1012 C CA  . TYR A 1 137 ? 10.393  -18.164 40.586 1.00 25.89 ? 352 TYR A CA  1 
ATOM   1013 C C   . TYR A 1 137 ? 9.033   -17.844 41.203 1.00 26.92 ? 352 TYR A C   1 
ATOM   1014 O O   . TYR A 1 137 ? 8.923   -16.933 42.024 1.00 25.25 ? 352 TYR A O   1 
ATOM   1015 C CB  . TYR A 1 137 ? 11.231  -19.019 41.540 1.00 26.75 ? 352 TYR A CB  1 
ATOM   1016 C CG  . TYR A 1 137 ? 10.606  -20.353 41.899 1.00 28.94 ? 352 TYR A CG  1 
ATOM   1017 C CD1 . TYR A 1 137 ? 9.812   -20.490 43.040 1.00 29.30 ? 352 TYR A CD1 1 
ATOM   1018 C CD2 . TYR A 1 137 ? 10.820  -21.479 41.106 1.00 29.91 ? 352 TYR A CD2 1 
ATOM   1019 C CE1 . TYR A 1 137 ? 9.232   -21.716 43.374 1.00 30.38 ? 352 TYR A CE1 1 
ATOM   1020 C CE2 . TYR A 1 137 ? 10.252  -22.710 41.433 1.00 31.07 ? 352 TYR A CE2 1 
ATOM   1021 C CZ  . TYR A 1 137 ? 9.460   -22.820 42.566 1.00 31.50 ? 352 TYR A CZ  1 
ATOM   1022 O OH  . TYR A 1 137 ? 8.896   -24.037 42.889 1.00 32.83 ? 352 TYR A OH  1 
ATOM   1023 N N   . GLU A 1 138 ? 8.016   -18.598 40.795 1.00 30.56 ? 353 GLU A N   1 
ATOM   1024 C CA  . GLU A 1 138 ? 6.643   -18.393 41.245 1.00 35.30 ? 353 GLU A CA  1 
ATOM   1025 C C   . GLU A 1 138 ? 5.863   -19.697 41.099 1.00 36.93 ? 353 GLU A C   1 
ATOM   1026 O O   . GLU A 1 138 ? 5.471   -20.072 39.991 1.00 37.51 ? 353 GLU A O   1 
ATOM   1027 C CB  . GLU A 1 138 ? 5.983   -17.277 40.421 1.00 38.64 ? 353 GLU A CB  1 
ATOM   1028 C CG  . GLU A 1 138 ? 4.585   -16.869 40.871 1.00 40.95 ? 353 GLU A CG  1 
ATOM   1029 C CD  . GLU A 1 138 ? 3.861   -16.025 39.827 1.00 42.24 ? 353 GLU A CD  1 
ATOM   1030 O OE1 . GLU A 1 138 ? 3.464   -16.574 38.775 1.00 43.10 ? 353 GLU A OE1 1 
ATOM   1031 O OE2 . GLU A 1 138 ? 3.679   -14.812 40.063 1.00 43.43 ? 353 GLU A OE2 1 
ATOM   1032 N N   . ASN A 1 139 ? 5.661   -20.394 42.217 1.00 39.55 ? 354 ASN A N   1 
ATOM   1033 C CA  . ASN A 1 139 ? 4.814   -21.600 42.264 1.00 40.57 ? 354 ASN A CA  1 
ATOM   1034 C C   . ASN A 1 139 ? 5.141   -22.665 41.216 1.00 38.98 ? 354 ASN A C   1 
ATOM   1035 O O   . ASN A 1 139 ? 4.247   -23.188 40.545 1.00 40.32 ? 354 ASN A O   1 
ATOM   1036 C CB  . ASN A 1 139 ? 3.329   -21.214 42.172 1.00 43.79 ? 354 ASN A CB  1 
ATOM   1037 C CG  . ASN A 1 139 ? 2.869   -20.369 43.344 1.00 46.60 ? 354 ASN A CG  1 
ATOM   1038 O OD1 . ASN A 1 139 ? 2.993   -20.772 44.503 1.00 49.91 ? 354 ASN A OD1 1 
ATOM   1039 N ND2 . ASN A 1 139 ? 2.324   -19.192 43.048 1.00 47.77 ? 354 ASN A ND2 1 
ATOM   1040 N N   . GLY A 1 140 ? 6.423   -22.979 41.069 1.00 37.49 ? 355 GLY A N   1 
ATOM   1041 C CA  . GLY A 1 140 ? 6.847   -24.018 40.132 1.00 36.66 ? 355 GLY A CA  1 
ATOM   1042 C C   . GLY A 1 140 ? 7.134   -23.521 38.725 1.00 35.41 ? 355 GLY A C   1 
ATOM   1043 O O   . GLY A 1 140 ? 7.852   -24.177 37.966 1.00 36.63 ? 355 GLY A O   1 
ATOM   1044 N N   . HIS A 1 141 ? 6.573   -22.366 38.373 1.00 33.64 ? 356 HIS A N   1 
ATOM   1045 C CA  . HIS A 1 141 ? 6.867   -21.733 37.088 1.00 30.82 ? 356 HIS A CA  1 
ATOM   1046 C C   . HIS A 1 141 ? 7.664   -20.442 37.292 1.00 28.61 ? 356 HIS A C   1 
ATOM   1047 O O   . HIS A 1 141 ? 8.122   -20.153 38.403 1.00 29.20 ? 356 HIS A O   1 
ATOM   1048 C CB  . HIS A 1 141 ? 5.581   -21.493 36.283 1.00 31.07 ? 356 HIS A CB  1 
ATOM   1049 C CG  . HIS A 1 141 ? 4.620   -20.552 36.939 1.00 32.31 ? 356 HIS A CG  1 
ATOM   1050 N ND1 . HIS A 1 141 ? 3.474   -20.982 37.570 1.00 33.64 ? 356 HIS A ND1 1 
ATOM   1051 C CD2 . HIS A 1 141 ? 4.636   -19.205 37.066 1.00 32.75 ? 356 HIS A CD2 1 
ATOM   1052 C CE1 . HIS A 1 141 ? 2.825   -19.940 38.057 1.00 33.31 ? 356 HIS A CE1 1 
ATOM   1053 N NE2 . HIS A 1 141 ? 3.509   -18.850 37.766 1.00 33.45 ? 356 HIS A NE2 1 
ATOM   1054 N N   . TYR A 1 142 ? 7.849   -19.674 36.223 1.00 25.22 ? 357 TYR A N   1 
ATOM   1055 C CA  . TYR A 1 142 ? 8.631   -18.443 36.310 1.00 23.52 ? 357 TYR A CA  1 
ATOM   1056 C C   . TYR A 1 142 ? 7.847   -17.253 35.777 1.00 23.03 ? 357 TYR A C   1 
ATOM   1057 O O   . TYR A 1 142 ? 7.125   -17.375 34.788 1.00 22.39 ? 357 TYR A O   1 
ATOM   1058 C CB  . TYR A 1 142 ? 9.974   -18.604 35.588 1.00 23.11 ? 357 TYR A CB  1 
ATOM   1059 C CG  . TYR A 1 142 ? 10.810  -19.706 36.197 1.00 22.53 ? 357 TYR A CG  1 
ATOM   1060 C CD1 . TYR A 1 142 ? 11.661  -19.447 37.275 1.00 22.76 ? 357 TYR A CD1 1 
ATOM   1061 C CD2 . TYR A 1 142 ? 10.714  -21.017 35.733 1.00 22.07 ? 357 TYR A CD2 1 
ATOM   1062 C CE1 . TYR A 1 142 ? 12.412  -20.463 37.854 1.00 22.62 ? 357 TYR A CE1 1 
ATOM   1063 C CE2 . TYR A 1 142 ? 11.463  -22.043 36.306 1.00 22.16 ? 357 TYR A CE2 1 
ATOM   1064 C CZ  . TYR A 1 142 ? 12.307  -21.757 37.365 1.00 22.83 ? 357 TYR A CZ  1 
ATOM   1065 O OH  . TYR A 1 142 ? 13.050  -22.770 37.933 1.00 23.18 ? 357 TYR A OH  1 
ATOM   1066 N N   . SER A 1 143 ? 7.979   -16.116 36.455 1.00 22.13 ? 358 SER A N   1 
ATOM   1067 C CA  . SER A 1 143 ? 7.275   -14.899 36.067 1.00 22.38 ? 358 SER A CA  1 
ATOM   1068 C C   . SER A 1 143 ? 8.214   -13.818 35.555 1.00 21.77 ? 358 SER A C   1 
ATOM   1069 O O   . SER A 1 143 ? 9.364   -13.694 35.998 1.00 20.66 ? 358 SER A O   1 
ATOM   1070 C CB  . SER A 1 143 ? 6.417   -14.363 37.217 1.00 23.70 ? 358 SER A CB  1 
ATOM   1071 O OG  . SER A 1 143 ? 7.218   -14.027 38.336 1.00 26.52 ? 358 SER A OG  1 
ATOM   1072 N N   . TYR A 1 144 ? 7.705   -13.050 34.599 1.00 21.06 ? 359 TYR A N   1 
ATOM   1073 C CA  . TYR A 1 144 ? 8.418   -11.919 34.032 1.00 21.06 ? 359 TYR A CA  1 
ATOM   1074 C C   . TYR A 1 144 ? 7.442   -10.771 34.027 1.00 21.55 ? 359 TYR A C   1 
ATOM   1075 O O   . TYR A 1 144 ? 6.277   -10.952 33.683 1.00 20.98 ? 359 TYR A O   1 
ATOM   1076 C CB  . TYR A 1 144 ? 8.868   -12.211 32.595 1.00 19.09 ? 359 TYR A CB  1 
ATOM   1077 C CG  . TYR A 1 144 ? 9.686   -13.474 32.447 1.00 19.41 ? 359 TYR A CG  1 
ATOM   1078 C CD1 . TYR A 1 144 ? 11.079  -13.421 32.390 1.00 19.09 ? 359 TYR A CD1 1 
ATOM   1079 C CD2 . TYR A 1 144 ? 9.070   -14.723 32.366 1.00 19.24 ? 359 TYR A CD2 1 
ATOM   1080 C CE1 . TYR A 1 144 ? 11.832  -14.579 32.251 1.00 19.97 ? 359 TYR A CE1 1 
ATOM   1081 C CE2 . TYR A 1 144 ? 9.817   -15.887 32.233 1.00 20.12 ? 359 TYR A CE2 1 
ATOM   1082 C CZ  . TYR A 1 144 ? 11.194  -15.808 32.179 1.00 20.04 ? 359 TYR A CZ  1 
ATOM   1083 O OH  . TYR A 1 144 ? 11.939  -16.960 32.050 1.00 21.77 ? 359 TYR A OH  1 
ATOM   1084 N N   . ARG A 1 145 ? 7.912   -9.596  34.424 1.00 23.16 ? 360 ARG A N   1 
ATOM   1085 C CA  . ARG A 1 145 ? 7.073   -8.416  34.432 1.00 25.10 ? 360 ARG A CA  1 
ATOM   1086 C C   . ARG A 1 145 ? 7.828   -7.221  33.872 1.00 26.26 ? 360 ARG A C   1 
ATOM   1087 O O   . ARG A 1 145 ? 8.972   -6.944  34.262 1.00 25.39 ? 360 ARG A O   1 
ATOM   1088 C CB  . ARG A 1 145 ? 6.547   -8.122  35.847 1.00 27.56 ? 360 ARG A CB  1 
ATOM   1089 C CG  . ARG A 1 145 ? 5.547   -6.968  35.900 1.00 32.07 ? 360 ARG A CG  1 
ATOM   1090 C CD  . ARG A 1 145 ? 4.740   -6.934  37.192 1.00 34.78 ? 360 ARG A CD  1 
ATOM   1091 N NE  . ARG A 1 145 ? 3.859   -5.763  37.214 1.00 39.00 ? 360 ARG A NE  1 
ATOM   1092 C CZ  . ARG A 1 145 ? 2.638   -5.720  36.680 1.00 40.91 ? 360 ARG A CZ  1 
ATOM   1093 N NH1 . ARG A 1 145 ? 1.927   -4.596  36.740 1.00 41.97 ? 360 ARG A NH1 1 
ATOM   1094 N NH2 . ARG A 1 145 ? 2.119   -6.793  36.091 1.00 41.30 ? 360 ARG A NH2 1 
ATOM   1095 N N   . ILE A 1 146 ? 7.185   -6.533  32.935 1.00 25.78 ? 361 ILE A N   1 
ATOM   1096 C CA  . ILE A 1 146 ? 7.656   -5.238  32.480 1.00 26.34 ? 361 ILE A CA  1 
ATOM   1097 C C   . ILE A 1 146 ? 6.713   -4.230  33.129 1.00 26.36 ? 361 ILE A C   1 
ATOM   1098 O O   . ILE A 1 146 ? 5.566   -4.081  32.715 1.00 26.66 ? 361 ILE A O   1 
ATOM   1099 C CB  . ILE A 1 146 ? 7.682   -5.137  30.930 1.00 26.67 ? 361 ILE A CB  1 
ATOM   1100 C CG1 . ILE A 1 146 ? 8.527   -6.273  30.331 1.00 27.44 ? 361 ILE A CG1 1 
ATOM   1101 C CG2 . ILE A 1 146 ? 8.205   -3.771  30.492 1.00 26.70 ? 361 ILE A CG2 1 
ATOM   1102 C CD1 . ILE A 1 146 ? 8.456   -6.417  28.800 1.00 27.70 ? 361 ILE A CD1 1 
ATOM   1103 N N   . HIS A 1 147 ? 7.196   -3.579  34.183 1.00 26.76 ? 362 HIS A N   1 
ATOM   1104 C CA  . HIS A 1 147 ? 6.367   -2.733  35.037 1.00 27.09 ? 362 HIS A CA  1 
ATOM   1105 C C   . HIS A 1 147 ? 6.558   -1.255  34.710 1.00 26.74 ? 362 HIS A C   1 
ATOM   1106 O O   . HIS A 1 147 ? 7.676   -0.734  34.792 1.00 25.69 ? 362 HIS A O   1 
ATOM   1107 C CB  . HIS A 1 147 ? 6.699   -2.997  36.514 1.00 28.64 ? 362 HIS A CB  1 
ATOM   1108 C CG  . HIS A 1 147 ? 5.721   -2.400  37.480 1.00 29.61 ? 362 HIS A CG  1 
ATOM   1109 N ND1 . HIS A 1 147 ? 6.067   -1.400  38.365 1.00 30.45 ? 362 HIS A ND1 1 
ATOM   1110 C CD2 . HIS A 1 147 ? 4.412   -2.664  37.706 1.00 30.75 ? 362 HIS A CD2 1 
ATOM   1111 C CE1 . HIS A 1 147 ? 5.015   -1.076  39.094 1.00 31.04 ? 362 HIS A CE1 1 
ATOM   1112 N NE2 . HIS A 1 147 ? 3.997   -1.828  38.714 1.00 31.18 ? 362 HIS A NE2 1 
ATOM   1113 N N   . ARG A 1 148 ? 5.463   -0.600  34.326 1.00 26.22 ? 363 ARG A N   1 
ATOM   1114 C CA  . ARG A 1 148 ? 5.436   0.846   34.066 1.00 26.03 ? 363 ARG A CA  1 
ATOM   1115 C C   . ARG A 1 148 ? 6.556   1.313   33.134 1.00 25.98 ? 363 ARG A C   1 
ATOM   1116 O O   . ARG A 1 148 ? 7.263   2.282   33.425 1.00 26.38 ? 363 ARG A O   1 
ATOM   1117 C CB  . ARG A 1 148 ? 5.436   1.640   35.382 1.00 26.89 ? 363 ARG A CB  1 
ATOM   1118 C CG  . ARG A 1 148 ? 4.163   1.454   36.208 1.00 27.62 ? 363 ARG A CG  1 
ATOM   1119 C CD  . ARG A 1 148 ? 4.300   2.017   37.621 1.00 28.65 ? 363 ARG A CD  1 
ATOM   1120 N NE  . ARG A 1 148 ? 4.469   3.474   37.652 1.00 28.94 ? 363 ARG A NE  1 
ATOM   1121 C CZ  . ARG A 1 148 ? 3.471   4.352   37.723 1.00 29.06 ? 363 ARG A CZ  1 
ATOM   1122 N NH1 . ARG A 1 148 ? 2.208   3.944   37.758 1.00 28.99 ? 363 ARG A NH1 1 
ATOM   1123 N NH2 . ARG A 1 148 ? 3.739   5.649   37.753 1.00 29.63 ? 363 ARG A NH2 1 
ATOM   1124 N N   . SER A 1 149 ? 6.720   0.600   32.022 1.00 26.04 ? 364 SER A N   1 
ATOM   1125 C CA  . SER A 1 149 ? 7.631   1.016   30.967 1.00 26.92 ? 364 SER A CA  1 
ATOM   1126 C C   . SER A 1 149 ? 7.124   2.337   30.394 1.00 26.87 ? 364 SER A C   1 
ATOM   1127 O O   . SER A 1 149 ? 5.960   2.430   29.993 1.00 26.51 ? 364 SER A O   1 
ATOM   1128 C CB  . SER A 1 149 ? 7.687   -0.043  29.867 1.00 27.45 ? 364 SER A CB  1 
ATOM   1129 O OG  . SER A 1 149 ? 8.551   0.356   28.813 1.00 28.74 ? 364 SER A OG  1 
ATOM   1130 N N   . PRO A 1 150 ? 7.982   3.373   30.378 1.00 27.34 ? 365 PRO A N   1 
ATOM   1131 C CA  . PRO A 1 150 ? 7.540   4.672   29.874 1.00 26.10 ? 365 PRO A CA  1 
ATOM   1132 C C   . PRO A 1 150 ? 7.180   4.608   28.397 1.00 25.86 ? 365 PRO A C   1 
ATOM   1133 O O   . PRO A 1 150 ? 7.915   4.027   27.597 1.00 25.11 ? 365 PRO A O   1 
ATOM   1134 C CB  . PRO A 1 150 ? 8.764   5.572   30.092 1.00 27.28 ? 365 PRO A CB  1 
ATOM   1135 C CG  . PRO A 1 150 ? 9.587   4.868   31.114 1.00 28.41 ? 365 PRO A CG  1 
ATOM   1136 C CD  . PRO A 1 150 ? 9.373   3.417   30.866 1.00 27.40 ? 365 PRO A CD  1 
ATOM   1137 N N   . LEU A 1 151 ? 6.027   5.168   28.046 1.00 24.79 ? 366 LEU A N   1 
ATOM   1138 C CA  . LEU A 1 151 ? 5.637   5.283   26.655 1.00 24.73 ? 366 LEU A CA  1 
ATOM   1139 C C   . LEU A 1 151 ? 6.585   6.291   26.012 1.00 24.04 ? 366 LEU A C   1 
ATOM   1140 O O   . LEU A 1 151 ? 6.864   7.329   26.603 1.00 24.12 ? 366 LEU A O   1 
ATOM   1141 C CB  . LEU A 1 151 ? 4.191   5.772   26.568 1.00 25.17 ? 366 LEU A CB  1 
ATOM   1142 C CG  . LEU A 1 151 ? 3.342   5.413   25.353 1.00 26.67 ? 366 LEU A CG  1 
ATOM   1143 C CD1 . LEU A 1 151 ? 3.276   3.911   25.148 1.00 27.30 ? 366 LEU A CD1 1 
ATOM   1144 C CD2 . LEU A 1 151 ? 1.935   5.983   25.504 1.00 26.02 ? 366 LEU A CD2 1 
ATOM   1145 N N   . CYS A 1 152 ? 7.108   5.972   24.828 1.00 24.25 ? 367 CYS A N   1 
ATOM   1146 C CA  . CYS A 1 152 ? 8.075   6.857   24.167 1.00 24.99 ? 367 CYS A CA  1 
ATOM   1147 C C   . CYS A 1 152 ? 7.409   8.148   23.701 1.00 24.59 ? 367 CYS A C   1 
ATOM   1148 O O   . CYS A 1 152 ? 6.183   8.203   23.543 1.00 23.82 ? 367 CYS A O   1 
ATOM   1149 C CB  . CYS A 1 152 ? 8.763   6.163   22.987 1.00 25.80 ? 367 CYS A CB  1 
ATOM   1150 S SG  . CYS A 1 152 ? 7.689   5.820   21.583 1.00 28.89 ? 367 CYS A SG  1 
ATOM   1151 N N   . GLU A 1 153 ? 8.224   9.178   23.486 1.00 24.52 ? 368 GLU A N   1 
ATOM   1152 C CA  . GLU A 1 153 ? 7.723   10.493  23.084 1.00 25.48 ? 368 GLU A CA  1 
ATOM   1153 C C   . GLU A 1 153 ? 6.903   10.473  21.798 1.00 23.72 ? 368 GLU A C   1 
ATOM   1154 O O   . GLU A 1 153 ? 5.903   11.186  21.688 1.00 23.27 ? 368 GLU A O   1 
ATOM   1155 C CB  . GLU A 1 153 ? 8.863   11.509  22.974 1.00 27.43 ? 368 GLU A CB  1 
ATOM   1156 C CG  . GLU A 1 153 ? 9.488   11.888  24.314 1.00 31.08 ? 368 GLU A CG  1 
ATOM   1157 C CD  . GLU A 1 153 ? 8.469   12.355  25.354 1.00 33.64 ? 368 GLU A CD  1 
ATOM   1158 O OE1 . GLU A 1 153 ? 8.626   11.977  26.534 1.00 37.31 ? 368 GLU A OE1 1 
ATOM   1159 O OE2 . GLU A 1 153 ? 7.510   13.085  25.001 1.00 34.99 ? 368 GLU A OE2 1 
ATOM   1160 N N   . TYR A 1 154 ? 7.311   9.650   20.835 1.00 22.57 ? 369 TYR A N   1 
ATOM   1161 C CA  . TYR A 1 154 ? 6.550   9.507   19.599 1.00 21.82 ? 369 TYR A CA  1 
ATOM   1162 C C   . TYR A 1 154 ? 5.101   9.080   19.874 1.00 22.28 ? 369 TYR A C   1 
ATOM   1163 O O   . TYR A 1 154 ? 4.161   9.629   19.301 1.00 20.77 ? 369 TYR A O   1 
ATOM   1164 C CB  . TYR A 1 154 ? 7.216   8.499   18.672 1.00 21.74 ? 369 TYR A CB  1 
ATOM   1165 C CG  . TYR A 1 154 ? 6.473   8.308   17.381 1.00 22.92 ? 369 TYR A CG  1 
ATOM   1166 C CD1 . TYR A 1 154 ? 6.789   9.067   16.256 1.00 22.35 ? 369 TYR A CD1 1 
ATOM   1167 C CD2 . TYR A 1 154 ? 5.442   7.374   17.287 1.00 22.95 ? 369 TYR A CD2 1 
ATOM   1168 C CE1 . TYR A 1 154 ? 6.098   8.891   15.065 1.00 23.55 ? 369 TYR A CE1 1 
ATOM   1169 C CE2 . TYR A 1 154 ? 4.748   7.190   16.113 1.00 23.89 ? 369 TYR A CE2 1 
ATOM   1170 C CZ  . TYR A 1 154 ? 5.075   7.945   15.008 1.00 23.72 ? 369 TYR A CZ  1 
ATOM   1171 O OH  . TYR A 1 154 ? 4.376   7.740   13.853 1.00 24.82 ? 369 TYR A OH  1 
ATOM   1172 N N   . MET A 1 155 ? 4.944   8.085   20.742 1.00 22.40 ? 370 MET A N   1 
ATOM   1173 C CA  . MET A 1 155 ? 3.627   7.580   21.103 1.00 22.88 ? 370 MET A CA  1 
ATOM   1174 C C   . MET A 1 155 ? 2.791   8.621   21.841 1.00 22.66 ? 370 MET A C   1 
ATOM   1175 O O   . MET A 1 155 ? 1.597   8.754   21.576 1.00 21.89 ? 370 MET A O   1 
ATOM   1176 C CB  . MET A 1 155 ? 3.765   6.317   21.951 1.00 24.03 ? 370 MET A CB  1 
ATOM   1177 C CG  . MET A 1 155 ? 4.104   5.090   21.150 1.00 25.35 ? 370 MET A CG  1 
ATOM   1178 S SD  . MET A 1 155 ? 3.000   4.913   19.742 1.00 28.91 ? 370 MET A SD  1 
ATOM   1179 C CE  . MET A 1 155 ? 1.399   4.808   20.562 1.00 27.15 ? 370 MET A CE  1 
ATOM   1180 N N   . ILE A 1 156 ? 3.421   9.356   22.755 1.00 22.41 ? 371 ILE A N   1 
ATOM   1181 C CA  . ILE A 1 156 ? 2.734   10.426  23.487 1.00 23.67 ? 371 ILE A CA  1 
ATOM   1182 C C   . ILE A 1 156 ? 2.232   11.490  22.504 1.00 24.10 ? 371 ILE A C   1 
ATOM   1183 O O   . ILE A 1 156 ? 1.059   11.896  22.562 1.00 24.22 ? 371 ILE A O   1 
ATOM   1184 C CB  . ILE A 1 156 ? 3.623   11.052  24.601 1.00 23.56 ? 371 ILE A CB  1 
ATOM   1185 C CG1 . ILE A 1 156 ? 4.055   9.978   25.609 1.00 23.33 ? 371 ILE A CG1 1 
ATOM   1186 C CG2 . ILE A 1 156 ? 2.881   12.184  25.327 1.00 23.39 ? 371 ILE A CG2 1 
ATOM   1187 C CD1 . ILE A 1 156 ? 5.068   10.447  26.633 1.00 23.76 ? 371 ILE A CD1 1 
ATOM   1188 N N   . ASN A 1 157 ? 3.113   11.907  21.592 1.00 24.68 ? 372 ASN A N   1 
ATOM   1189 C CA  . ASN A 1 157 ? 2.780   12.891  20.549 1.00 25.05 ? 372 ASN A CA  1 
ATOM   1190 C C   . ASN A 1 157 ? 1.700   12.401  19.588 1.00 24.14 ? 372 ASN A C   1 
ATOM   1191 O O   . ASN A 1 157 ? 0.835   13.178  19.168 1.00 23.09 ? 372 ASN A O   1 
ATOM   1192 C CB  . ASN A 1 157 ? 4.035   13.291  19.761 1.00 26.96 ? 372 ASN A CB  1 
ATOM   1193 C CG  . ASN A 1 157 ? 5.036   14.071  20.602 1.00 28.66 ? 372 ASN A CG  1 
ATOM   1194 O OD1 . ASN A 1 157 ? 4.689   14.634  21.642 1.00 30.16 ? 372 ASN A OD1 1 
ATOM   1195 N ND2 . ASN A 1 157 ? 6.291   14.098  20.157 1.00 30.10 ? 372 ASN A ND2 1 
ATOM   1196 N N   . PHE A 1 158 ? 1.759   11.113  19.246 1.00 22.92 ? 373 PHE A N   1 
ATOM   1197 C CA  . PHE A 1 158 ? 0.777   10.487  18.360 1.00 22.89 ? 373 PHE A CA  1 
ATOM   1198 C C   . PHE A 1 158 ? -0.616  10.522  18.988 1.00 22.99 ? 373 PHE A C   1 
ATOM   1199 O O   . PHE A 1 158 ? -1.592  10.858  18.321 1.00 23.16 ? 373 PHE A O   1 
ATOM   1200 C CB  . PHE A 1 158 ? 1.187   9.041   18.033 1.00 22.48 ? 373 PHE A CB  1 
ATOM   1201 C CG  . PHE A 1 158 ? 0.377   8.414   16.937 1.00 22.91 ? 373 PHE A CG  1 
ATOM   1202 C CD1 . PHE A 1 158 ? 0.708   8.624   15.601 1.00 23.43 ? 373 PHE A CD1 1 
ATOM   1203 C CD2 . PHE A 1 158 ? -0.714  7.602   17.239 1.00 22.94 ? 373 PHE A CD2 1 
ATOM   1204 C CE1 . PHE A 1 158 ? -0.043  8.042   14.580 1.00 23.50 ? 373 PHE A CE1 1 
ATOM   1205 C CE2 . PHE A 1 158 ? -1.467  7.018   16.230 1.00 24.07 ? 373 PHE A CE2 1 
ATOM   1206 C CZ  . PHE A 1 158 ? -1.135  7.240   14.898 1.00 23.85 ? 373 PHE A CZ  1 
ATOM   1207 N N   . ILE A 1 159 ? -0.697  10.178  20.270 1.00 23.49 ? 374 ILE A N   1 
ATOM   1208 C CA  . ILE A 1 159 ? -1.964  10.217  21.006 1.00 23.75 ? 374 ILE A CA  1 
ATOM   1209 C C   . ILE A 1 159 ? -2.529  11.639  21.040 1.00 24.49 ? 374 ILE A C   1 
ATOM   1210 O O   . ILE A 1 159 ? -3.724  11.844  20.807 1.00 23.91 ? 374 ILE A O   1 
ATOM   1211 C CB  . ILE A 1 159 ? -1.807  9.660   22.441 1.00 23.36 ? 374 ILE A CB  1 
ATOM   1212 C CG1 . ILE A 1 159 ? -1.498  8.157   22.402 1.00 23.08 ? 374 ILE A CG1 1 
ATOM   1213 C CG2 . ILE A 1 159 ? -3.071  9.917   23.277 1.00 23.43 ? 374 ILE A CG2 1 
ATOM   1214 C CD1 . ILE A 1 159 ? -0.891  7.622   23.689 1.00 22.91 ? 374 ILE A CD1 1 
ATOM   1215 N N   . HIS A 1 160 ? -1.660  12.610  21.307 1.00 26.09 ? 375 HIS A N   1 
ATOM   1216 C CA  . HIS A 1 160 ? -2.053  14.021  21.356 1.00 27.36 ? 375 HIS A CA  1 
ATOM   1217 C C   . HIS A 1 160 ? -2.599  14.487  20.003 1.00 26.22 ? 375 HIS A C   1 
ATOM   1218 O O   . HIS A 1 160 ? -3.647  15.124  19.942 1.00 24.78 ? 375 HIS A O   1 
ATOM   1219 C CB  . HIS A 1 160 ? -0.879  14.897  21.816 1.00 30.45 ? 375 HIS A CB  1 
ATOM   1220 C CG  . HIS A 1 160 ? -0.570  14.785  23.283 1.00 34.05 ? 375 HIS A CG  1 
ATOM   1221 N ND1 . HIS A 1 160 ? 0.036   15.800  23.993 1.00 36.76 ? 375 HIS A ND1 1 
ATOM   1222 C CD2 . HIS A 1 160 ? -0.789  13.786  24.173 1.00 36.04 ? 375 HIS A CD2 1 
ATOM   1223 C CE1 . HIS A 1 160 ? 0.190   15.427  25.251 1.00 35.88 ? 375 HIS A CE1 1 
ATOM   1224 N NE2 . HIS A 1 160 ? -0.306  14.211  25.388 1.00 37.56 ? 375 HIS A NE2 1 
ATOM   1225 N N   . LYS A 1 161 ? -1.898  14.149  18.922 1.00 26.11 ? 376 LYS A N   1 
ATOM   1226 C CA  . LYS A 1 161 ? -2.351  14.495  17.576 1.00 26.57 ? 376 LYS A CA  1 
ATOM   1227 C C   . LYS A 1 161 ? -3.654  13.807  17.190 1.00 26.22 ? 376 LYS A C   1 
ATOM   1228 O O   . LYS A 1 161 ? -4.516  14.421  16.561 1.00 25.75 ? 376 LYS A O   1 
ATOM   1229 C CB  . LYS A 1 161 ? -1.266  14.205  16.537 1.00 27.53 ? 376 LYS A CB  1 
ATOM   1230 C CG  . LYS A 1 161 ? -0.173  15.243  16.493 1.00 29.85 ? 376 LYS A CG  1 
ATOM   1231 C CD  . LYS A 1 161 ? 0.856   14.907  15.419 1.00 31.95 ? 376 LYS A CD  1 
ATOM   1232 C CE  . LYS A 1 161 ? 2.053   15.828  15.504 1.00 34.84 ? 376 LYS A CE  1 
ATOM   1233 N NZ  . LYS A 1 161 ? 1.668   17.265  15.337 1.00 36.11 ? 376 LYS A NZ  1 
ATOM   1234 N N   . LEU A 1 162 ? -3.795  12.531  17.555 1.00 26.93 ? 377 LEU A N   1 
ATOM   1235 C CA  . LEU A 1 162 ? -5.032  11.788  17.289 1.00 28.16 ? 377 LEU A CA  1 
ATOM   1236 C C   . LEU A 1 162 ? -6.242  12.452  17.942 1.00 29.87 ? 377 LEU A C   1 
ATOM   1237 O O   . LEU A 1 162 ? -7.288  12.619  17.308 1.00 28.35 ? 377 LEU A O   1 
ATOM   1238 C CB  . LEU A 1 162 ? -4.933  10.350  17.792 1.00 28.68 ? 377 LEU A CB  1 
ATOM   1239 C CG  . LEU A 1 162 ? -4.430  9.206   16.920 1.00 29.05 ? 377 LEU A CG  1 
ATOM   1240 C CD1 . LEU A 1 162 ? -4.603  7.915   17.709 1.00 28.79 ? 377 LEU A CD1 1 
ATOM   1241 C CD2 . LEU A 1 162 ? -5.165  9.111   15.584 1.00 28.62 ? 377 LEU A CD2 1 
ATOM   1242 N N   . LYS A 1 163 ? -6.084  12.827  19.209 1.00 31.63 ? 378 LYS A N   1 
ATOM   1243 C CA  . LYS A 1 163 ? -7.170  13.419  19.994 1.00 33.98 ? 378 LYS A CA  1 
ATOM   1244 C C   . LYS A 1 163 ? -7.586  14.802  19.501 1.00 35.33 ? 378 LYS A C   1 
ATOM   1245 O O   . LYS A 1 163 ? -8.734  15.212  19.690 1.00 36.45 ? 378 LYS A O   1 
ATOM   1246 C CB  . LYS A 1 163 ? -6.786  13.478  21.475 1.00 34.59 ? 378 LYS A CB  1 
ATOM   1247 C CG  . LYS A 1 163 ? -7.034  12.177  22.229 1.00 35.83 ? 378 LYS A CG  1 
ATOM   1248 C CD  . LYS A 1 163 ? -6.803  12.345  23.731 1.00 37.05 ? 378 LYS A CD  1 
ATOM   1249 C CE  . LYS A 1 163 ? -7.824  13.293  24.362 1.00 38.06 ? 378 LYS A CE  1 
ATOM   1250 N NZ  . LYS A 1 163 ? -9.222  12.766  24.281 1.00 38.66 ? 378 LYS A NZ  1 
ATOM   1251 N N   . HIS A 1 164 ? -6.657  15.513  18.867 1.00 36.57 ? 379 HIS A N   1 
ATOM   1252 C CA  . HIS A 1 164 ? -6.937  16.848  18.334 1.00 38.29 ? 379 HIS A CA  1 
ATOM   1253 C C   . HIS A 1 164 ? -7.574  16.844  16.943 1.00 37.76 ? 379 HIS A C   1 
ATOM   1254 O O   . HIS A 1 164 ? -7.904  17.906  16.409 1.00 37.91 ? 379 HIS A O   1 
ATOM   1255 C CB  . HIS A 1 164 ? -5.683  17.726  18.368 1.00 40.48 ? 379 HIS A CB  1 
ATOM   1256 C CG  . HIS A 1 164 ? -5.394  18.297  19.721 1.00 43.39 ? 379 HIS A CG  1 
ATOM   1257 N ND1 . HIS A 1 164 ? -4.608  17.652  20.651 1.00 44.13 ? 379 HIS A ND1 1 
ATOM   1258 C CD2 . HIS A 1 164 ? -5.808  19.445  20.310 1.00 44.16 ? 379 HIS A CD2 1 
ATOM   1259 C CE1 . HIS A 1 164 ? -4.537  18.383  21.749 1.00 45.31 ? 379 HIS A CE1 1 
ATOM   1260 N NE2 . HIS A 1 164 ? -5.258  19.476  21.568 1.00 45.50 ? 379 HIS A NE2 1 
ATOM   1261 N N   . LEU A 1 165 ? -7.753  15.655  16.366 1.00 36.43 ? 380 LEU A N   1 
ATOM   1262 C CA  . LEU A 1 165 ? -8.516  15.510  15.126 1.00 36.96 ? 380 LEU A CA  1 
ATOM   1263 C C   . LEU A 1 165 ? -10.004 15.730  15.415 1.00 37.77 ? 380 LEU A C   1 
ATOM   1264 O O   . LEU A 1 165 ? -10.509 15.261  16.438 1.00 38.07 ? 380 LEU A O   1 
ATOM   1265 C CB  . LEU A 1 165 ? -8.296  14.130  14.491 1.00 35.18 ? 380 LEU A CB  1 
ATOM   1266 C CG  . LEU A 1 165 ? -6.912  13.798  13.918 1.00 34.30 ? 380 LEU A CG  1 
ATOM   1267 C CD1 . LEU A 1 165 ? -6.836  12.325  13.561 1.00 32.98 ? 380 LEU A CD1 1 
ATOM   1268 C CD2 . LEU A 1 165 ? -6.589  14.653  12.697 1.00 34.63 ? 380 LEU A CD2 1 
ATOM   1269 N N   . PRO A 1 166 ? -10.705 16.447  14.515 1.00 39.35 ? 381 PRO A N   1 
ATOM   1270 C CA  . PRO A 1 166 ? -12.107 16.825  14.734 1.00 40.39 ? 381 PRO A CA  1 
ATOM   1271 C C   . PRO A 1 166 ? -13.094 15.655  14.704 1.00 41.53 ? 381 PRO A C   1 
ATOM   1272 O O   . PRO A 1 166 ? -14.137 15.718  15.358 1.00 42.16 ? 381 PRO A O   1 
ATOM   1273 C CB  . PRO A 1 166 ? -12.402 17.781  13.569 1.00 39.71 ? 381 PRO A CB  1 
ATOM   1274 C CG  . PRO A 1 166 ? -11.070 18.179  13.025 1.00 39.71 ? 381 PRO A CG  1 
ATOM   1275 C CD  . PRO A 1 166 ? -10.182 17.006  13.256 1.00 39.01 ? 381 PRO A CD  1 
ATOM   1276 N N   . GLU A 1 167 ? -12.770 14.601  13.959 1.00 42.53 ? 382 GLU A N   1 
ATOM   1277 C CA  . GLU A 1 167 ? -13.713 13.509  13.730 1.00 43.42 ? 382 GLU A CA  1 
ATOM   1278 C C   . GLU A 1 167 ? -13.136 12.129  14.044 1.00 43.52 ? 382 GLU A C   1 
ATOM   1279 O O   . GLU A 1 167 ? -11.957 11.867  13.798 1.00 43.16 ? 382 GLU A O   1 
ATOM   1280 C CB  . GLU A 1 167 ? -14.211 13.537  12.281 1.00 46.81 ? 382 GLU A CB  1 
ATOM   1281 C CG  . GLU A 1 167 ? -14.759 14.886  11.790 1.00 49.18 ? 382 GLU A CG  1 
ATOM   1282 C CD  . GLU A 1 167 ? -16.013 15.345  12.530 1.00 51.82 ? 382 GLU A CD  1 
ATOM   1283 O OE1 . GLU A 1 167 ? -16.798 14.486  13.001 1.00 52.29 ? 382 GLU A OE1 1 
ATOM   1284 O OE2 . GLU A 1 167 ? -16.214 16.576  12.629 1.00 52.05 ? 382 GLU A OE2 1 
ATOM   1285 N N   . LYS A 1 168 ? -13.985 11.250  14.573 1.00 41.94 ? 383 LYS A N   1 
ATOM   1286 C CA  . LYS A 1 168 ? -13.600 9.877   14.901 1.00 41.43 ? 383 LYS A CA  1 
ATOM   1287 C C   . LYS A 1 168 ? -13.177 9.095   13.652 1.00 39.55 ? 383 LYS A C   1 
ATOM   1288 O O   . LYS A 1 168 ? -12.225 8.306   13.702 1.00 38.63 ? 383 LYS A O   1 
ATOM   1289 C CB  . LYS A 1 168 ? -14.738 9.157   15.639 1.00 42.70 ? 383 LYS A CB  1 
ATOM   1290 C CG  . LYS A 1 168 ? -14.404 7.736   16.108 1.00 44.21 ? 383 LYS A CG  1 
ATOM   1291 C CD  . LYS A 1 168 ? -15.502 7.141   16.986 1.00 45.62 ? 383 LYS A CD  1 
ATOM   1292 C CE  . LYS A 1 168 ? -16.647 6.553   16.165 1.00 46.48 ? 383 LYS A CE  1 
ATOM   1293 N NZ  . LYS A 1 168 ? -16.226 5.380   15.344 1.00 47.70 ? 383 LYS A NZ  1 
ATOM   1294 N N   . TYR A 1 169 ? -13.874 9.323   12.536 1.00 37.29 ? 384 TYR A N   1 
ATOM   1295 C CA  . TYR A 1 169 ? -13.538 8.648   11.277 1.00 37.07 ? 384 TYR A CA  1 
ATOM   1296 C C   . TYR A 1 169 ? -12.127 9.028   10.807 1.00 34.14 ? 384 TYR A C   1 
ATOM   1297 O O   . TYR A 1 169 ? -11.445 8.222   10.178 1.00 34.73 ? 384 TYR A O   1 
ATOM   1298 C CB  . TYR A 1 169 ? -14.592 8.920   10.186 1.00 38.44 ? 384 TYR A CB  1 
ATOM   1299 C CG  . TYR A 1 169 ? -14.321 10.128  9.314  1.00 41.80 ? 384 TYR A CG  1 
ATOM   1300 C CD1 . TYR A 1 169 ? -13.584 10.010  8.132  1.00 42.52 ? 384 TYR A CD1 1 
ATOM   1301 C CD2 . TYR A 1 169 ? -14.813 11.389  9.661  1.00 44.20 ? 384 TYR A CD2 1 
ATOM   1302 C CE1 . TYR A 1 169 ? -13.332 11.119  7.325  1.00 44.19 ? 384 TYR A CE1 1 
ATOM   1303 C CE2 . TYR A 1 169 ? -14.567 12.507  8.859  1.00 45.17 ? 384 TYR A CE2 1 
ATOM   1304 C CZ  . TYR A 1 169 ? -13.826 12.362  7.695  1.00 45.66 ? 384 TYR A CZ  1 
ATOM   1305 O OH  . TYR A 1 169 ? -13.579 13.457  6.900  1.00 48.16 ? 384 TYR A OH  1 
ATOM   1306 N N   . MET A 1 170 ? -11.708 10.257  11.117 1.00 32.74 ? 385 MET A N   1 
ATOM   1307 C CA  . MET A 1 170 ? -10.353 10.728  10.819 1.00 30.92 ? 385 MET A CA  1 
ATOM   1308 C C   . MET A 1 170 ? -9.305  9.977   11.648 1.00 28.90 ? 385 MET A C   1 
ATOM   1309 O O   . MET A 1 170 ? -8.248  9.614   11.134 1.00 27.24 ? 385 MET A O   1 
ATOM   1310 C CB  . MET A 1 170 ? -10.224 12.237  11.056 1.00 33.23 ? 385 MET A CB  1 
ATOM   1311 C CG  . MET A 1 170 ? -10.907 13.121  10.006 1.00 36.18 ? 385 MET A CG  1 
ATOM   1312 S SD  . MET A 1 170 ? -10.397 14.848  10.149 1.00 40.74 ? 385 MET A SD  1 
ATOM   1313 C CE  . MET A 1 170 ? -11.217 15.573  8.725  1.00 40.40 ? 385 MET A CE  1 
ATOM   1314 N N   . MET A 1 171 ? -9.605  9.759   12.928 1.00 27.51 ? 386 MET A N   1 
ATOM   1315 C CA  . MET A 1 171 ? -8.715  9.003   13.819 1.00 26.51 ? 386 MET A CA  1 
ATOM   1316 C C   . MET A 1 171 ? -8.516  7.579   13.297 1.00 25.33 ? 386 MET A C   1 
ATOM   1317 O O   . MET A 1 171 ? -7.389  7.084   13.244 1.00 25.32 ? 386 MET A O   1 
ATOM   1318 C CB  . MET A 1 171 ? -9.253  8.982   15.255 1.00 27.43 ? 386 MET A CB  1 
ATOM   1319 C CG  . MET A 1 171 ? -9.384  10.358  15.904 1.00 29.17 ? 386 MET A CG  1 
ATOM   1320 S SD  . MET A 1 171 ? -10.060 10.271  17.580 1.00 30.58 ? 386 MET A SD  1 
ATOM   1321 C CE  . MET A 1 171 ? -10.628 11.960  17.792 1.00 31.44 ? 386 MET A CE  1 
ATOM   1322 N N   . ASN A 1 172 ? -9.607  6.935   12.894 1.00 24.48 ? 387 ASN A N   1 
ATOM   1323 C CA  . ASN A 1 172 ? -9.540  5.592   12.332 1.00 24.58 ? 387 ASN A CA  1 
ATOM   1324 C C   . ASN A 1 172 ? -8.782  5.553   11.011 1.00 24.41 ? 387 ASN A C   1 
ATOM   1325 O O   . ASN A 1 172 ? -8.068  4.591   10.743 1.00 23.85 ? 387 ASN A O   1 
ATOM   1326 C CB  . ASN A 1 172 ? -10.929 4.978   12.191 1.00 24.97 ? 387 ASN A CB  1 
ATOM   1327 C CG  . ASN A 1 172 ? -11.506 4.548   13.521 1.00 25.81 ? 387 ASN A CG  1 
ATOM   1328 O OD1 . ASN A 1 172 ? -10.769 4.265   14.475 1.00 25.59 ? 387 ASN A OD1 1 
ATOM   1329 N ND2 . ASN A 1 172 ? -12.831 4.489   13.595 1.00 25.61 ? 387 ASN A ND2 1 
ATOM   1330 N N   . SER A 1 173 ? -8.920  6.621   10.220 1.00 24.44 ? 388 SER A N   1 
ATOM   1331 C CA  A SER A 1 173 ? -8.183  6.753   8.964  0.50 24.40 ? 388 SER A CA  1 
ATOM   1332 C CA  B SER A 1 173 ? -8.185  6.774   8.962  0.50 24.60 ? 388 SER A CA  1 
ATOM   1333 C C   . SER A 1 173 ? -6.676  6.766   9.220  1.00 24.70 ? 388 SER A C   1 
ATOM   1334 O O   . SER A 1 173 ? -5.930  6.046   8.554  1.00 24.49 ? 388 SER A O   1 
ATOM   1335 C CB  A SER A 1 173 ? -8.622  8.004   8.196  0.50 24.40 ? 388 SER A CB  1 
ATOM   1336 C CB  B SER A 1 173 ? -8.605  8.067   8.250  0.50 24.82 ? 388 SER A CB  1 
ATOM   1337 O OG  A SER A 1 173 ? -9.910  7.817   7.635  0.50 24.23 ? 388 SER A OG  1 
ATOM   1338 O OG  B SER A 1 173 ? -7.911  8.235   7.026  0.50 25.33 ? 388 SER A OG  1 
ATOM   1339 N N   . VAL A 1 174 ? -6.236  7.566   10.194 1.00 24.34 ? 389 VAL A N   1 
ATOM   1340 C CA  . VAL A 1 174 ? -4.814  7.609   10.581 1.00 24.81 ? 389 VAL A CA  1 
ATOM   1341 C C   . VAL A 1 174 ? -4.374  6.229   11.068 1.00 24.76 ? 389 VAL A C   1 
ATOM   1342 O O   . VAL A 1 174 ? -3.315  5.729   10.670 1.00 25.75 ? 389 VAL A O   1 
ATOM   1343 C CB  . VAL A 1 174 ? -4.525  8.667   11.678 1.00 24.51 ? 389 VAL A CB  1 
ATOM   1344 C CG1 . VAL A 1 174 ? -3.095  8.526   12.220 1.00 24.90 ? 389 VAL A CG1 1 
ATOM   1345 C CG2 . VAL A 1 174 ? -4.734  10.081  11.141 1.00 25.09 ? 389 VAL A CG2 1 
ATOM   1346 N N   . LEU A 1 175 ? -5.203  5.616   11.912 1.00 24.17 ? 390 LEU A N   1 
ATOM   1347 C CA  . LEU A 1 175 ? -4.885  4.325   12.522 1.00 25.20 ? 390 LEU A CA  1 
ATOM   1348 C C   . LEU A 1 175 ? -4.801  3.146   11.536 1.00 26.49 ? 390 LEU A C   1 
ATOM   1349 O O   . LEU A 1 175 ? -4.226  2.097   11.864 1.00 25.07 ? 390 LEU A O   1 
ATOM   1350 C CB  . LEU A 1 175 ? -5.848  4.018   13.677 1.00 24.30 ? 390 LEU A CB  1 
ATOM   1351 C CG  . LEU A 1 175 ? -5.702  4.906   14.920 1.00 23.76 ? 390 LEU A CG  1 
ATOM   1352 C CD1 . LEU A 1 175 ? -6.829  4.627   15.907 1.00 23.81 ? 390 LEU A CD1 1 
ATOM   1353 C CD2 . LEU A 1 175 ? -4.344  4.717   15.589 1.00 23.31 ? 390 LEU A CD2 1 
ATOM   1354 N N   . GLU A 1 176 ? -5.351  3.320   10.332 1.00 27.16 ? 391 GLU A N   1 
ATOM   1355 C CA  . GLU A 1 176 ? -5.202  2.314   9.275  1.00 28.55 ? 391 GLU A CA  1 
ATOM   1356 C C   . GLU A 1 176 ? -3.729  1.972   9.049  1.00 27.20 ? 391 GLU A C   1 
ATOM   1357 O O   . GLU A 1 176 ? -3.391  0.819   8.788  1.00 27.14 ? 391 GLU A O   1 
ATOM   1358 C CB  . GLU A 1 176 ? -5.822  2.796   7.954  1.00 31.35 ? 391 GLU A CB  1 
ATOM   1359 C CG  . GLU A 1 176 ? -7.353  2.782   7.916  1.00 33.96 ? 391 GLU A CG  1 
ATOM   1360 C CD  . GLU A 1 176 ? -7.944  1.446   7.483  1.00 35.74 ? 391 GLU A CD  1 
ATOM   1361 O OE1 . GLU A 1 176 ? -9.024  1.076   8.001  1.00 38.42 ? 391 GLU A OE1 1 
ATOM   1362 O OE2 . GLU A 1 176 ? -7.348  0.764   6.625  1.00 35.33 ? 391 GLU A OE2 1 
ATOM   1363 N N   . ASN A 1 177 ? -2.861  2.974   9.174  1.00 25.84 ? 392 ASN A N   1 
ATOM   1364 C CA  . ASN A 1 177 ? -1.445  2.826   8.864  1.00 25.60 ? 392 ASN A CA  1 
ATOM   1365 C C   . ASN A 1 177 ? -0.504  3.057   10.048 1.00 24.30 ? 392 ASN A C   1 
ATOM   1366 O O   . ASN A 1 177 ? 0.640   3.506   9.887  1.00 24.33 ? 392 ASN A O   1 
ATOM   1367 C CB  . ASN A 1 177 ? -1.094  3.724   7.689  1.00 27.30 ? 392 ASN A CB  1 
ATOM   1368 C CG  . ASN A 1 177 ? -1.913  3.389   6.469  1.00 29.29 ? 392 ASN A CG  1 
ATOM   1369 O OD1 . ASN A 1 177 ? -1.789  2.296   5.921  1.00 31.51 ? 392 ASN A OD1 1 
ATOM   1370 N ND2 . ASN A 1 177 ? -2.773  4.313   6.050  1.00 28.86 ? 392 ASN A ND2 1 
ATOM   1371 N N   . PHE A 1 178 ? -1.009  2.750   11.234 1.00 21.47 ? 393 PHE A N   1 
ATOM   1372 C CA  . PHE A 1 178 ? -0.224  2.791   12.448 1.00 20.28 ? 393 PHE A CA  1 
ATOM   1373 C C   . PHE A 1 178 ? -0.317  1.423   13.105 1.00 18.68 ? 393 PHE A C   1 
ATOM   1374 O O   . PHE A 1 178 ? -1.410  0.971   13.455 1.00 18.28 ? 393 PHE A O   1 
ATOM   1375 C CB  . PHE A 1 178 ? -0.746  3.870   13.404 1.00 20.43 ? 393 PHE A CB  1 
ATOM   1376 C CG  . PHE A 1 178 ? -0.108  3.822   14.762 1.00 20.80 ? 393 PHE A CG  1 
ATOM   1377 C CD1 . PHE A 1 178 ? 1.096   4.476   14.998 1.00 21.34 ? 393 PHE A CD1 1 
ATOM   1378 C CD2 . PHE A 1 178 ? -0.692  3.092   15.794 1.00 21.24 ? 393 PHE A CD2 1 
ATOM   1379 C CE1 . PHE A 1 178 ? 1.696   4.423   16.251 1.00 20.98 ? 393 PHE A CE1 1 
ATOM   1380 C CE2 . PHE A 1 178 ? -0.100  3.026   17.048 1.00 21.51 ? 393 PHE A CE2 1 
ATOM   1381 C CZ  . PHE A 1 178 ? 1.105   3.691   17.271 1.00 21.89 ? 393 PHE A CZ  1 
ATOM   1382 N N   . THR A 1 179 ? 0.825   0.761   13.272 1.00 17.61 ? 394 THR A N   1 
ATOM   1383 C CA  . THR A 1 179 ? 0.844   -0.551  13.923 1.00 16.67 ? 394 THR A CA  1 
ATOM   1384 C C   . THR A 1 179 ? 1.987   -0.669  14.931 1.00 16.54 ? 394 THR A C   1 
ATOM   1385 O O   . THR A 1 179 ? 2.929   0.138   14.935 1.00 15.87 ? 394 THR A O   1 
ATOM   1386 C CB  . THR A 1 179 ? 0.959   -1.728  12.908 1.00 16.70 ? 394 THR A CB  1 
ATOM   1387 O OG1 . THR A 1 179 ? 2.200   -1.639  12.199 1.00 17.22 ? 394 THR A OG1 1 
ATOM   1388 C CG2 . THR A 1 179 ? -0.202  -1.740  11.915 1.00 16.77 ? 394 THR A CG2 1 
ATOM   1389 N N   . ILE A 1 180 ? 1.880   -1.673  15.794 1.00 15.92 ? 395 ILE A N   1 
ATOM   1390 C CA  . ILE A 1 180 ? 2.943   -1.999  16.755 1.00 15.98 ? 395 ILE A CA  1 
ATOM   1391 C C   . ILE A 1 180 ? 3.274   -3.480  16.627 1.00 15.69 ? 395 ILE A C   1 
ATOM   1392 O O   . ILE A 1 180 ? 2.372   -4.319  16.497 1.00 15.55 ? 395 ILE A O   1 
ATOM   1393 C CB  . ILE A 1 180 ? 2.534   -1.607  18.200 1.00 16.60 ? 395 ILE A CB  1 
ATOM   1394 C CG1 . ILE A 1 180 ? 2.443   -0.077  18.301 1.00 17.16 ? 395 ILE A CG1 1 
ATOM   1395 C CG2 . ILE A 1 180 ? 3.536   -2.154  19.245 1.00 17.17 ? 395 ILE A CG2 1 
ATOM   1396 C CD1 . ILE A 1 180 ? 1.729   0.433   19.516 1.00 18.60 ? 395 ILE A CD1 1 
ATOM   1397 N N   . LEU A 1 181 ? 4.568   -3.793  16.599 1.00 15.21 ? 396 LEU A N   1 
ATOM   1398 C CA  . LEU A 1 181 ? 5.007   -5.181  16.578 1.00 15.61 ? 396 LEU A CA  1 
ATOM   1399 C C   . LEU A 1 181 ? 5.837   -5.494  17.815 1.00 16.26 ? 396 LEU A C   1 
ATOM   1400 O O   . LEU A 1 181 ? 6.855   -4.840  18.066 1.00 16.06 ? 396 LEU A O   1 
ATOM   1401 C CB  . LEU A 1 181 ? 5.804   -5.501  15.312 1.00 16.06 ? 396 LEU A CB  1 
ATOM   1402 C CG  . LEU A 1 181 ? 6.179   -6.984  15.151 1.00 16.29 ? 396 LEU A CG  1 
ATOM   1403 C CD1 . LEU A 1 181 ? 4.942   -7.871  14.884 1.00 16.38 ? 396 LEU A CD1 1 
ATOM   1404 C CD2 . LEU A 1 181 ? 7.210   -7.160  14.061 1.00 17.42 ? 396 LEU A CD2 1 
ATOM   1405 N N   . GLN A 1 182 ? 5.395   -6.492  18.572 1.00 16.15 ? 397 GLN A N   1 
ATOM   1406 C CA  . GLN A 1 182 ? 6.082   -6.917  19.788 1.00 17.14 ? 397 GLN A CA  1 
ATOM   1407 C C   . GLN A 1 182 ? 6.689   -8.291  19.570 1.00 16.95 ? 397 GLN A C   1 
ATOM   1408 O O   . GLN A 1 182 ? 5.982   -9.244  19.232 1.00 17.41 ? 397 GLN A O   1 
ATOM   1409 C CB  . GLN A 1 182 ? 5.104   -6.926  20.967 1.00 18.71 ? 397 GLN A CB  1 
ATOM   1410 C CG  . GLN A 1 182 ? 5.711   -7.340  22.303 1.00 20.58 ? 397 GLN A CG  1 
ATOM   1411 C CD  . GLN A 1 182 ? 4.680   -7.433  23.432 1.00 21.96 ? 397 GLN A CD  1 
ATOM   1412 O OE1 . GLN A 1 182 ? 3.541   -6.984  23.295 1.00 22.22 ? 397 GLN A OE1 1 
ATOM   1413 N NE2 . GLN A 1 182 ? 5.091   -8.012  24.562 1.00 22.09 ? 397 GLN A NE2 1 
ATOM   1414 N N   . VAL A 1 183 ? 8.007   -8.385  19.735 1.00 16.60 ? 398 VAL A N   1 
ATOM   1415 C CA  . VAL A 1 183 ? 8.709   -9.647  19.575 1.00 16.38 ? 398 VAL A CA  1 
ATOM   1416 C C   . VAL A 1 183 ? 9.456   -9.939  20.870 1.00 16.14 ? 398 VAL A C   1 
ATOM   1417 O O   . VAL A 1 183 ? 10.329  -9.168  21.288 1.00 15.72 ? 398 VAL A O   1 
ATOM   1418 C CB  . VAL A 1 183 ? 9.685   -9.639  18.370 1.00 16.65 ? 398 VAL A CB  1 
ATOM   1419 C CG1 . VAL A 1 183 ? 10.398  -10.977 18.243 1.00 17.15 ? 398 VAL A CG1 1 
ATOM   1420 C CG2 . VAL A 1 183 ? 8.949   -9.315  17.064 1.00 16.83 ? 398 VAL A CG2 1 
ATOM   1421 N N   . VAL A 1 184 ? 9.072   -11.041 21.504 1.00 15.92 ? 399 VAL A N   1 
ATOM   1422 C CA  . VAL A 1 184 ? 9.684   -11.490 22.750 1.00 15.67 ? 399 VAL A CA  1 
ATOM   1423 C C   . VAL A 1 184 ? 10.515  -12.711 22.409 1.00 15.71 ? 399 VAL A C   1 
ATOM   1424 O O   . VAL A 1 184 ? 10.000  -13.692 21.872 1.00 15.37 ? 399 VAL A O   1 
ATOM   1425 C CB  . VAL A 1 184 ? 8.648   -11.856 23.831 1.00 15.77 ? 399 VAL A CB  1 
ATOM   1426 C CG1 . VAL A 1 184 ? 9.373   -12.231 25.142 1.00 16.19 ? 399 VAL A CG1 1 
ATOM   1427 C CG2 . VAL A 1 184 ? 7.692   -10.694 24.078 1.00 16.49 ? 399 VAL A CG2 1 
ATOM   1428 N N   . THR A 1 185 ? 11.795  -12.635 22.753 1.00 16.13 ? 400 THR A N   1 
ATOM   1429 C CA  A THR A 1 185 ? 12.801  -13.589 22.332 0.50 16.19 ? 400 THR A CA  1 
ATOM   1430 C CA  B THR A 1 185 ? 12.742  -13.672 22.365 0.50 16.16 ? 400 THR A CA  1 
ATOM   1431 C C   . THR A 1 185 ? 13.535  -14.157 23.557 1.00 16.38 ? 400 THR A C   1 
ATOM   1432 O O   . THR A 1 185 ? 13.750  -13.430 24.530 1.00 16.55 ? 400 THR A O   1 
ATOM   1433 C CB  A THR A 1 185 ? 13.801  -12.841 21.416 0.50 16.36 ? 400 THR A CB  1 
ATOM   1434 C CB  B THR A 1 185 ? 13.755  -13.182 21.309 0.50 16.32 ? 400 THR A CB  1 
ATOM   1435 O OG1 A THR A 1 185 ? 13.080  -12.173 20.367 0.50 16.48 ? 400 THR A OG1 1 
ATOM   1436 O OG1 B THR A 1 185 ? 14.411  -12.003 21.793 0.50 15.85 ? 400 THR A OG1 1 
ATOM   1437 C CG2 A THR A 1 185 ? 14.810  -13.765 20.805 0.50 15.68 ? 400 THR A CG2 1 
ATOM   1438 C CG2 B THR A 1 185 ? 13.067  -12.888 19.976 0.50 16.31 ? 400 THR A CG2 1 
ATOM   1439 N N   . ASN A 1 186 ? 13.932  -15.424 23.493 1.00 16.60 ? 401 ASN A N   1 
ATOM   1440 C CA  . ASN A 1 186 ? 14.882  -15.965 24.454 1.00 17.84 ? 401 ASN A CA  1 
ATOM   1441 C C   . ASN A 1 186 ? 16.225  -15.333 24.063 1.00 17.77 ? 401 ASN A C   1 
ATOM   1442 O O   . ASN A 1 186 ? 16.692  -15.535 22.948 1.00 18.68 ? 401 ASN A O   1 
ATOM   1443 C CB  . ASN A 1 186 ? 14.908  -17.498 24.347 1.00 17.86 ? 401 ASN A CB  1 
ATOM   1444 C CG  . ASN A 1 186 ? 15.995  -18.138 25.205 1.00 18.67 ? 401 ASN A CG  1 
ATOM   1445 O OD1 . ASN A 1 186 ? 17.113  -17.637 25.286 1.00 19.53 ? 401 ASN A OD1 1 
ATOM   1446 N ND2 . ASN A 1 186 ? 15.666  -19.262 25.837 1.00 19.01 ? 401 ASN A ND2 1 
ATOM   1447 N N   . ARG A 1 187 ? 16.827  -14.549 24.952 1.00 18.61 ? 402 ARG A N   1 
ATOM   1448 C CA  . ARG A 1 187 ? 18.020  -13.779 24.588 1.00 19.80 ? 402 ARG A CA  1 
ATOM   1449 C C   . ARG A 1 187 ? 19.197  -14.641 24.131 1.00 20.81 ? 402 ARG A C   1 
ATOM   1450 O O   . ARG A 1 187 ? 19.843  -14.314 23.133 1.00 21.19 ? 402 ARG A O   1 
ATOM   1451 C CB  . ARG A 1 187 ? 18.471  -12.840 25.708 1.00 20.83 ? 402 ARG A CB  1 
ATOM   1452 C CG  . ARG A 1 187 ? 19.596  -11.879 25.259 1.00 22.19 ? 402 ARG A CG  1 
ATOM   1453 C CD  . ARG A 1 187 ? 20.047  -10.953 26.364 1.00 24.38 ? 402 ARG A CD  1 
ATOM   1454 N NE  . ARG A 1 187 ? 20.811  -11.649 27.395 1.00 25.50 ? 402 ARG A NE  1 
ATOM   1455 C CZ  . ARG A 1 187 ? 21.215  -11.084 28.532 1.00 26.51 ? 402 ARG A CZ  1 
ATOM   1456 N NH1 . ARG A 1 187 ? 20.925  -9.810  28.794 1.00 27.28 ? 402 ARG A NH1 1 
ATOM   1457 N NH2 . ARG A 1 187 ? 21.903  -11.790 29.411 1.00 25.09 ? 402 ARG A NH2 1 
ATOM   1458 N N   . ASP A 1 188 ? 19.456  -15.719 24.875 1.00 22.27 ? 403 ASP A N   1 
ATOM   1459 C CA  . ASP A 1 188 ? 20.556  -16.658 24.612 1.00 23.27 ? 403 ASP A CA  1 
ATOM   1460 C C   . ASP A 1 188 ? 20.382  -17.382 23.269 1.00 22.50 ? 403 ASP A C   1 
ATOM   1461 O O   . ASP A 1 188 ? 21.314  -17.456 22.466 1.00 23.87 ? 403 ASP A O   1 
ATOM   1462 C CB  . ASP A 1 188 ? 20.631  -17.716 25.733 1.00 24.54 ? 403 ASP A CB  1 
ATOM   1463 C CG  . ASP A 1 188 ? 21.105  -17.160 27.092 1.00 26.46 ? 403 ASP A CG  1 
ATOM   1464 O OD1 . ASP A 1 188 ? 21.584  -16.009 27.180 1.00 26.43 ? 403 ASP A OD1 1 
ATOM   1465 O OD2 . ASP A 1 188 ? 21.011  -17.915 28.094 1.00 27.18 ? 403 ASP A OD2 1 
ATOM   1466 N N   . THR A 1 189 ? 19.181  -17.911 23.036 1.00 21.72 ? 404 THR A N   1 
ATOM   1467 C CA  . THR A 1 189 ? 18.917  -18.805 21.903 1.00 20.46 ? 404 THR A CA  1 
ATOM   1468 C C   . THR A 1 189 ? 18.315  -18.101 20.678 1.00 20.31 ? 404 THR A C   1 
ATOM   1469 O O   . THR A 1 189 ? 18.350  -18.634 19.566 1.00 19.32 ? 404 THR A O   1 
ATOM   1470 C CB  . THR A 1 189 ? 17.989  -19.970 22.322 1.00 20.33 ? 404 THR A CB  1 
ATOM   1471 O OG1 . THR A 1 189 ? 16.636  -19.500 22.464 1.00 19.25 ? 404 THR A OG1 1 
ATOM   1472 C CG2 . THR A 1 189 ? 18.457  -20.586 23.648 1.00 20.28 ? 404 THR A CG2 1 
ATOM   1473 N N   . GLN A 1 190 ? 17.763  -16.910 20.902 1.00 19.55 ? 405 GLN A N   1 
ATOM   1474 C CA  . GLN A 1 190 ? 17.071  -16.130 19.865 1.00 20.38 ? 405 GLN A CA  1 
ATOM   1475 C C   . GLN A 1 190 ? 15.778  -16.771 19.343 1.00 19.46 ? 405 GLN A C   1 
ATOM   1476 O O   . GLN A 1 190 ? 15.223  -16.329 18.333 1.00 19.17 ? 405 GLN A O   1 
ATOM   1477 C CB  . GLN A 1 190 ? 18.020  -15.724 18.722 1.00 21.78 ? 405 GLN A CB  1 
ATOM   1478 C CG  . GLN A 1 190 ? 19.102  -14.720 19.157 1.00 24.05 ? 405 GLN A CG  1 
ATOM   1479 C CD  . GLN A 1 190 ? 18.522  -13.400 19.653 1.00 25.65 ? 405 GLN A CD  1 
ATOM   1480 O OE1 . GLN A 1 190 ? 17.880  -12.668 18.896 1.00 28.16 ? 405 GLN A OE1 1 
ATOM   1481 N NE2 . GLN A 1 190 ? 18.742  -13.092 20.930 1.00 26.53 ? 405 GLN A NE2 1 
ATOM   1482 N N   . GLU A 1 191 ? 15.286  -17.791 20.046 1.00 18.90 ? 406 GLU A N   1 
ATOM   1483 C CA  . GLU A 1 191 ? 13.975  -18.374 19.734 1.00 19.46 ? 406 GLU A CA  1 
ATOM   1484 C C   . GLU A 1 191 ? 12.887  -17.327 19.950 1.00 18.50 ? 406 GLU A C   1 
ATOM   1485 O O   . GLU A 1 191 ? 12.891  -16.621 20.963 1.00 17.66 ? 406 GLU A O   1 
ATOM   1486 C CB  . GLU A 1 191 ? 13.672  -19.612 20.602 1.00 21.19 ? 406 GLU A CB  1 
ATOM   1487 C CG  . GLU A 1 191 ? 12.314  -20.280 20.255 1.00 22.73 ? 406 GLU A CG  1 
ATOM   1488 C CD  . GLU A 1 191 ? 11.868  -21.396 21.210 1.00 24.77 ? 406 GLU A CD  1 
ATOM   1489 O OE1 . GLU A 1 191 ? 10.708  -21.848 21.073 1.00 24.76 ? 406 GLU A OE1 1 
ATOM   1490 O OE2 . GLU A 1 191 ? 12.653  -21.823 22.086 1.00 25.90 ? 406 GLU A OE2 1 
ATOM   1491 N N   . THR A 1 192 ? 11.965  -17.227 18.997 1.00 17.55 ? 407 THR A N   1 
ATOM   1492 C CA  . THR A 1 192 ? 10.782  -16.377 19.169 1.00 17.10 ? 407 THR A CA  1 
ATOM   1493 C C   . THR A 1 192 ? 9.814   -17.050 20.134 1.00 16.85 ? 407 THR A C   1 
ATOM   1494 O O   . THR A 1 192 ? 9.270   -18.113 19.832 1.00 16.43 ? 407 THR A O   1 
ATOM   1495 C CB  . THR A 1 192 ? 10.080  -16.116 17.814 1.00 17.22 ? 407 THR A CB  1 
ATOM   1496 O OG1 . THR A 1 192 ? 11.009  -15.503 16.920 1.00 16.65 ? 407 THR A OG1 1 
ATOM   1497 C CG2 . THR A 1 192 ? 8.884   -15.184 17.987 1.00 17.12 ? 407 THR A CG2 1 
ATOM   1498 N N   . LEU A 1 193 ? 9.601   -16.419 21.290 1.00 17.04 ? 408 LEU A N   1 
ATOM   1499 C CA  . LEU A 1 193 ? 8.695   -16.931 22.320 1.00 17.00 ? 408 LEU A CA  1 
ATOM   1500 C C   . LEU A 1 193 ? 7.266   -16.450 22.072 1.00 17.36 ? 408 LEU A C   1 
ATOM   1501 O O   . LEU A 1 193 ? 6.315   -17.222 22.197 1.00 17.21 ? 408 LEU A O   1 
ATOM   1502 C CB  . LEU A 1 193 ? 9.188   -16.514 23.720 1.00 17.21 ? 408 LEU A CB  1 
ATOM   1503 C CG  . LEU A 1 193 ? 10.635  -16.934 24.049 1.00 16.91 ? 408 LEU A CG  1 
ATOM   1504 C CD1 . LEU A 1 193 ? 11.116  -16.313 25.370 1.00 16.91 ? 408 LEU A CD1 1 
ATOM   1505 C CD2 . LEU A 1 193 ? 10.787  -18.454 24.090 1.00 17.79 ? 408 LEU A CD2 1 
ATOM   1506 N N   . LEU A 1 194 ? 7.132   -15.167 21.727 1.00 17.01 ? 409 LEU A N   1 
ATOM   1507 C CA  . LEU A 1 194 ? 5.873   -14.578 21.288 1.00 16.98 ? 409 LEU A CA  1 
ATOM   1508 C C   . LEU A 1 194 ? 6.166   -13.485 20.278 1.00 17.18 ? 409 LEU A C   1 
ATOM   1509 O O   . LEU A 1 194 ? 7.106   -12.702 20.443 1.00 17.22 ? 409 LEU A O   1 
ATOM   1510 C CB  . LEU A 1 194 ? 5.093   -13.961 22.461 1.00 17.36 ? 409 LEU A CB  1 
ATOM   1511 C CG  . LEU A 1 194 ? 4.476   -14.845 23.545 1.00 17.73 ? 409 LEU A CG  1 
ATOM   1512 C CD1 . LEU A 1 194 ? 4.008   -13.980 24.708 1.00 18.73 ? 409 LEU A CD1 1 
ATOM   1513 C CD2 . LEU A 1 194 ? 3.318   -15.679 22.993 1.00 18.02 ? 409 LEU A CD2 1 
ATOM   1514 N N   . CYS A 1 195 ? 5.347   -13.429 19.235 1.00 17.20 ? 410 CYS A N   1 
ATOM   1515 C CA  . CYS A 1 195 ? 5.368   -12.296 18.321 1.00 17.14 ? 410 CYS A CA  1 
ATOM   1516 C C   . CYS A 1 195 ? 3.932   -11.807 18.176 1.00 17.50 ? 410 CYS A C   1 
ATOM   1517 O O   . CYS A 1 195 ? 3.046   -12.570 17.779 1.00 18.23 ? 410 CYS A O   1 
ATOM   1518 C CB  . CYS A 1 195 ? 5.965   -12.702 16.972 1.00 16.85 ? 410 CYS A CB  1 
ATOM   1519 S SG  . CYS A 1 195 ? 5.898   -11.399 15.708 1.00 17.75 ? 410 CYS A SG  1 
ATOM   1520 N N   . ILE A 1 196 ? 3.693   -10.555 18.549 1.00 17.16 ? 411 ILE A N   1 
ATOM   1521 C CA  . ILE A 1 196 ? 2.333   -10.024 18.570 1.00 17.58 ? 411 ILE A CA  1 
ATOM   1522 C C   . ILE A 1 196 ? 2.244   -8.772  17.704 1.00 17.15 ? 411 ILE A C   1 
ATOM   1523 O O   . ILE A 1 196 ? 2.944   -7.779  17.943 1.00 16.22 ? 411 ILE A O   1 
ATOM   1524 C CB  . ILE A 1 196 ? 1.843   -9.694  19.999 1.00 18.31 ? 411 ILE A CB  1 
ATOM   1525 C CG1 . ILE A 1 196 ? 2.069   -10.884 20.951 1.00 19.19 ? 411 ILE A CG1 1 
ATOM   1526 C CG2 . ILE A 1 196 ? 0.364   -9.322  19.963 1.00 18.47 ? 411 ILE A CG2 1 
ATOM   1527 C CD1 . ILE A 1 196 ? 2.240   -10.493 22.411 1.00 19.98 ? 411 ILE A CD1 1 
ATOM   1528 N N   . ALA A 1 197 ? 1.377   -8.840  16.702 1.00 16.73 ? 412 ALA A N   1 
ATOM   1529 C CA  . ALA A 1 197 ? 1.121   -7.722  15.814 1.00 16.65 ? 412 ALA A CA  1 
ATOM   1530 C C   . ALA A 1 197 ? -0.118  -7.014  16.337 1.00 17.01 ? 412 ALA A C   1 
ATOM   1531 O O   . ALA A 1 197 ? -1.129  -7.666  16.605 1.00 17.49 ? 412 ALA A O   1 
ATOM   1532 C CB  . ALA A 1 197 ? 0.898   -8.228  14.397 1.00 16.91 ? 412 ALA A CB  1 
ATOM   1533 N N   . TYR A 1 198 ? -0.024  -5.697  16.517 1.00 17.15 ? 413 TYR A N   1 
ATOM   1534 C CA  . TYR A 1 198 ? -1.141  -4.899  17.023 1.00 17.24 ? 413 TYR A CA  1 
ATOM   1535 C C   . TYR A 1 198 ? -1.682  -3.944  15.970 1.00 17.26 ? 413 TYR A C   1 
ATOM   1536 O O   . TYR A 1 198 ? -0.924  -3.182  15.349 1.00 16.78 ? 413 TYR A O   1 
ATOM   1537 C CB  . TYR A 1 198 ? -0.737  -4.077  18.246 1.00 17.49 ? 413 TYR A CB  1 
ATOM   1538 C CG  . TYR A 1 198 ? -0.308  -4.882  19.450 1.00 17.82 ? 413 TYR A CG  1 
ATOM   1539 C CD1 . TYR A 1 198 ? -1.238  -5.327  20.379 1.00 17.86 ? 413 TYR A CD1 1 
ATOM   1540 C CD2 . TYR A 1 198 ? 1.035   -5.167  19.672 1.00 18.13 ? 413 TYR A CD2 1 
ATOM   1541 C CE1 . TYR A 1 198 ? -0.845  -6.061  21.501 1.00 18.38 ? 413 TYR A CE1 1 
ATOM   1542 C CE2 . TYR A 1 198 ? 1.442   -5.895  20.787 1.00 18.09 ? 413 TYR A CE2 1 
ATOM   1543 C CZ  . TYR A 1 198 ? 0.499   -6.331  21.700 1.00 18.43 ? 413 TYR A CZ  1 
ATOM   1544 O OH  . TYR A 1 198 ? 0.902   -7.050  22.800 1.00 18.80 ? 413 TYR A OH  1 
ATOM   1545 N N   . VAL A 1 199 ? -2.999  -4.001  15.787 1.00 17.11 ? 414 VAL A N   1 
ATOM   1546 C CA  A VAL A 1 199 ? -3.721  -3.124  14.865 0.50 17.52 ? 414 VAL A CA  1 
ATOM   1547 C CA  B VAL A 1 199 ? -3.700  -3.090  14.882 0.50 17.51 ? 414 VAL A CA  1 
ATOM   1548 C C   . VAL A 1 199 ? -4.783  -2.358  15.664 1.00 17.45 ? 414 VAL A C   1 
ATOM   1549 O O   . VAL A 1 199 ? -5.289  -2.868  16.667 1.00 17.42 ? 414 VAL A O   1 
ATOM   1550 C CB  A VAL A 1 199 ? -4.336  -3.939  13.692 0.50 17.29 ? 414 VAL A CB  1 
ATOM   1551 C CB  B VAL A 1 199 ? -4.288  -3.805  13.633 0.50 17.28 ? 414 VAL A CB  1 
ATOM   1552 C CG1 A VAL A 1 199 ? -5.297  -3.102  12.865 0.50 17.23 ? 414 VAL A CG1 1 
ATOM   1553 C CG1 B VAL A 1 199 ? -3.166  -4.313  12.724 0.50 17.24 ? 414 VAL A CG1 1 
ATOM   1554 C CG2 A VAL A 1 199 ? -3.227  -4.501  12.800 0.50 17.30 ? 414 VAL A CG2 1 
ATOM   1555 C CG2 B VAL A 1 199 ? -5.228  -4.934  14.032 0.50 17.27 ? 414 VAL A CG2 1 
ATOM   1556 N N   . PHE A 1 200 ? -5.114  -1.145  15.225 1.00 18.76 ? 415 PHE A N   1 
ATOM   1557 C CA  . PHE A 1 200 ? -5.934  -0.248  16.041 1.00 19.79 ? 415 PHE A CA  1 
ATOM   1558 C C   . PHE A 1 200 ? -7.120  0.415   15.347 1.00 21.05 ? 415 PHE A C   1 
ATOM   1559 O O   . PHE A 1 200 ? -7.032  0.827   14.187 1.00 20.48 ? 415 PHE A O   1 
ATOM   1560 C CB  . PHE A 1 200 ? -5.050  0.864   16.628 1.00 20.45 ? 415 PHE A CB  1 
ATOM   1561 C CG  . PHE A 1 200 ? -3.950  0.364   17.526 1.00 21.26 ? 415 PHE A CG  1 
ATOM   1562 C CD1 . PHE A 1 200 ? -2.703  0.028   17.000 1.00 21.79 ? 415 PHE A CD1 1 
ATOM   1563 C CD2 . PHE A 1 200 ? -4.161  0.233   18.896 1.00 21.87 ? 415 PHE A CD2 1 
ATOM   1564 C CE1 . PHE A 1 200 ? -1.677  -0.438  17.829 1.00 21.96 ? 415 PHE A CE1 1 
ATOM   1565 C CE2 . PHE A 1 200 ? -3.143  -0.235  19.736 1.00 22.13 ? 415 PHE A CE2 1 
ATOM   1566 C CZ  . PHE A 1 200 ? -1.900  -0.571  19.196 1.00 22.23 ? 415 PHE A CZ  1 
ATOM   1567 N N   . GLU A 1 201 ? -8.220  0.513   16.093 1.00 22.06 ? 416 GLU A N   1 
ATOM   1568 C CA  . GLU A 1 201 ? -9.310  1.454   15.818 1.00 24.04 ? 416 GLU A CA  1 
ATOM   1569 C C   . GLU A 1 201 ? -9.637  2.200   17.114 1.00 24.80 ? 416 GLU A C   1 
ATOM   1570 O O   . GLU A 1 201 ? -9.159  1.829   18.191 1.00 23.99 ? 416 GLU A O   1 
ATOM   1571 C CB  . GLU A 1 201 ? -10.563 0.723   15.321 1.00 25.74 ? 416 GLU A CB  1 
ATOM   1572 C CG  . GLU A 1 201 ? -10.583 0.452   13.832 1.00 27.67 ? 416 GLU A CG  1 
ATOM   1573 C CD  . GLU A 1 201 ? -11.946 0.009   13.324 1.00 29.30 ? 416 GLU A CD  1 
ATOM   1574 O OE1 . GLU A 1 201 ? -12.423 -1.075  13.719 1.00 29.59 ? 416 GLU A OE1 1 
ATOM   1575 O OE2 . GLU A 1 201 ? -12.535 0.742   12.502 1.00 31.83 ? 416 GLU A OE2 1 
ATOM   1576 N N   . VAL A 1 202 ? -10.457 3.244   17.007 1.00 25.81 ? 417 VAL A N   1 
ATOM   1577 C CA  . VAL A 1 202 ? -10.945 3.972   18.175 1.00 27.55 ? 417 VAL A CA  1 
ATOM   1578 C C   . VAL A 1 202 ? -12.192 3.272   18.728 1.00 27.96 ? 417 VAL A C   1 
ATOM   1579 O O   . VAL A 1 202 ? -13.039 2.797   17.972 1.00 28.72 ? 417 VAL A O   1 
ATOM   1580 C CB  . VAL A 1 202 ? -11.244 5.453   17.824 1.00 28.26 ? 417 VAL A CB  1 
ATOM   1581 C CG1 . VAL A 1 202 ? -12.041 6.144   18.931 1.00 29.31 ? 417 VAL A CG1 1 
ATOM   1582 C CG2 . VAL A 1 202 ? -9.944  6.205   17.554 1.00 28.23 ? 417 VAL A CG2 1 
ATOM   1583 N N   . SER A 1 203 ? -12.296 3.199   20.050 1.00 28.98 ? 418 SER A N   1 
ATOM   1584 C CA  . SER A 1 203 ? -13.477 2.617   20.680 1.00 31.14 ? 418 SER A CA  1 
ATOM   1585 C C   . SER A 1 203 ? -14.661 3.582   20.622 1.00 32.79 ? 418 SER A C   1 
ATOM   1586 O O   . SER A 1 203 ? -14.500 4.785   20.814 1.00 31.76 ? 418 SER A O   1 
ATOM   1587 C CB  . SER A 1 203 ? -13.194 2.242   22.133 1.00 31.06 ? 418 SER A CB  1 
ATOM   1588 O OG  . SER A 1 203 ? -14.261 1.473   22.654 1.00 34.35 ? 418 SER A OG  1 
ATOM   1589 N N   . ALA A 1 204 ? -15.841 3.038   20.342 1.00 36.80 ? 419 ALA A N   1 
ATOM   1590 C CA  . ALA A 1 204 ? -17.088 3.799   20.401 1.00 41.85 ? 419 ALA A CA  1 
ATOM   1591 C C   . ALA A 1 204 ? -17.966 3.251   21.520 1.00 45.54 ? 419 ALA A C   1 
ATOM   1592 O O   . ALA A 1 204 ? -18.960 3.871   21.907 1.00 48.06 ? 419 ALA A O   1 
ATOM   1593 C CB  . ALA A 1 204 ? -17.816 3.725   19.070 1.00 42.58 ? 419 ALA A CB  1 
ATOM   1594 N N   . SER A 1 205 ? -17.578 2.085   22.034 1.00 49.42 ? 420 SER A N   1 
ATOM   1595 C CA  . SER A 1 205 ? -18.343 1.348   23.038 1.00 51.72 ? 420 SER A CA  1 
ATOM   1596 C C   . SER A 1 205 ? -18.473 2.097   24.360 1.00 54.01 ? 420 SER A C   1 
ATOM   1597 O O   . SER A 1 205 ? -17.586 2.865   24.748 1.00 54.91 ? 420 SER A O   1 
ATOM   1598 C CB  . SER A 1 205 ? -17.707 -0.027  23.275 1.00 52.54 ? 420 SER A CB  1 
ATOM   1599 O OG  . SER A 1 205 ? -18.390 -0.752  24.285 1.00 53.27 ? 420 SER A OG  1 
ATOM   1600 N N   . GLU A 1 206 ? -19.593 1.861   25.039 1.00 55.60 ? 421 GLU A N   1 
ATOM   1601 C CA  . GLU A 1 206 ? -19.856 2.426   26.359 1.00 56.12 ? 421 GLU A CA  1 
ATOM   1602 C C   . GLU A 1 206 ? -19.021 1.718   27.425 1.00 55.29 ? 421 GLU A C   1 
ATOM   1603 O O   . GLU A 1 206 ? -18.696 2.304   28.461 1.00 54.50 ? 421 GLU A O   1 
ATOM   1604 C CB  . GLU A 1 206 ? -21.344 2.310   26.689 1.00 58.35 ? 421 GLU A CB  1 
ATOM   1605 C CG  . GLU A 1 206 ? -21.838 3.298   27.738 1.00 60.74 ? 421 GLU A CG  1 
ATOM   1606 C CD  . GLU A 1 206 ? -23.355 3.338   27.847 1.00 61.86 ? 421 GLU A CD  1 
ATOM   1607 O OE1 . GLU A 1 206 ? -24.029 2.458   27.265 1.00 62.28 ? 421 GLU A OE1 1 
ATOM   1608 O OE2 . GLU A 1 206 ? -23.873 4.255   28.520 1.00 62.18 ? 421 GLU A OE2 1 
ATOM   1609 N N   . HIS A 1 207 ? -18.677 0.457   27.157 1.00 55.46 ? 422 HIS A N   1 
ATOM   1610 C CA  . HIS A 1 207 ? -17.826 -0.341  28.041 1.00 54.97 ? 422 HIS A CA  1 
ATOM   1611 C C   . HIS A 1 207 ? -16.357 0.109   28.013 1.00 51.04 ? 422 HIS A C   1 
ATOM   1612 O O   . HIS A 1 207 ? -15.596 -0.194  28.932 1.00 51.52 ? 422 HIS A O   1 
ATOM   1613 C CB  . HIS A 1 207 ? -17.931 -1.831  27.690 1.00 59.08 ? 422 HIS A CB  1 
ATOM   1614 C CG  . HIS A 1 207 ? -19.305 -2.404  27.863 1.00 62.43 ? 422 HIS A CG  1 
ATOM   1615 N ND1 . HIS A 1 207 ? -19.849 -2.675  29.102 1.00 63.84 ? 422 HIS A ND1 1 
ATOM   1616 C CD2 . HIS A 1 207 ? -20.242 -2.764  26.954 1.00 63.82 ? 422 HIS A CD2 1 
ATOM   1617 C CE1 . HIS A 1 207 ? -21.063 -3.174  28.948 1.00 64.30 ? 422 HIS A CE1 1 
ATOM   1618 N NE2 . HIS A 1 207 ? -21.326 -3.237  27.655 1.00 65.11 ? 422 HIS A NE2 1 
ATOM   1619 N N   . GLY A 1 208 ? -15.969 0.826   26.959 1.00 46.04 ? 423 GLY A N   1 
ATOM   1620 C CA  . GLY A 1 208 ? -14.604 1.338   26.820 1.00 39.11 ? 423 GLY A CA  1 
ATOM   1621 C C   . GLY A 1 208 ? -13.761 0.537   25.842 1.00 35.52 ? 423 GLY A C   1 
ATOM   1622 O O   . GLY A 1 208 ? -14.259 0.070   24.813 1.00 34.54 ? 423 GLY A O   1 
ATOM   1623 N N   . ALA A 1 209 ? -12.482 0.376   26.173 1.00 31.72 ? 424 ALA A N   1 
ATOM   1624 C CA  . ALA A 1 209 ? -11.538 -0.367  25.337 1.00 29.41 ? 424 ALA A CA  1 
ATOM   1625 C C   . ALA A 1 209 ? -11.939 -1.829  25.165 1.00 28.62 ? 424 ALA A C   1 
ATOM   1626 O O   . ALA A 1 209 ? -12.417 -2.476  26.104 1.00 27.44 ? 424 ALA A O   1 
ATOM   1627 C CB  . ALA A 1 209 ? -10.127 -0.262  25.911 1.00 29.35 ? 424 ALA A CB  1 
ATOM   1628 N N   . GLN A 1 210 ? -11.758 -2.342  23.954 1.00 27.07 ? 425 GLN A N   1 
ATOM   1629 C CA  . GLN A 1 210 ? -12.050 -3.740  23.664 1.00 27.25 ? 425 GLN A CA  1 
ATOM   1630 C C   . GLN A 1 210 ? -10.933 -4.349  22.818 1.00 25.77 ? 425 GLN A C   1 
ATOM   1631 O O   . GLN A 1 210 ? -10.053 -3.633  22.344 1.00 25.01 ? 425 GLN A O   1 
ATOM   1632 C CB  . GLN A 1 210 ? -13.402 -3.887  22.940 1.00 29.46 ? 425 GLN A CB  1 
ATOM   1633 C CG  . GLN A 1 210 ? -14.612 -3.294  23.668 1.00 32.26 ? 425 GLN A CG  1 
ATOM   1634 C CD  . GLN A 1 210 ? -15.056 -4.107  24.875 1.00 35.43 ? 425 GLN A CD  1 
ATOM   1635 O OE1 . GLN A 1 210 ? -14.975 -5.339  24.885 1.00 38.33 ? 425 GLN A OE1 1 
ATOM   1636 N NE2 . GLN A 1 210 ? -15.545 -3.415  25.899 1.00 37.30 ? 425 GLN A NE2 1 
ATOM   1637 N N   . HIS A 1 211 ? -10.973 -5.666  22.635 1.00 25.29 ? 426 HIS A N   1 
ATOM   1638 C CA  . HIS A 1 211 ? -9.999  -6.355  21.793 1.00 25.60 ? 426 HIS A CA  1 
ATOM   1639 C C   . HIS A 1 211 ? -10.508 -7.698  21.279 1.00 25.76 ? 426 HIS A C   1 
ATOM   1640 O O   . HIS A 1 211 ? -11.390 -8.316  21.879 1.00 25.86 ? 426 HIS A O   1 
ATOM   1641 C CB  . HIS A 1 211 ? -8.688  -6.569  22.556 1.00 26.40 ? 426 HIS A CB  1 
ATOM   1642 C CG  . HIS A 1 211 ? -8.824  -7.466  23.746 1.00 26.84 ? 426 HIS A CG  1 
ATOM   1643 N ND1 . HIS A 1 211 ? -8.999  -6.984  25.025 1.00 27.27 ? 426 HIS A ND1 1 
ATOM   1644 C CD2 . HIS A 1 211 ? -8.827  -8.816  23.850 1.00 27.53 ? 426 HIS A CD2 1 
ATOM   1645 C CE1 . HIS A 1 211 ? -9.091  -7.997  25.867 1.00 27.29 ? 426 HIS A CE1 1 
ATOM   1646 N NE2 . HIS A 1 211 ? -8.996  -9.120  25.178 1.00 28.27 ? 426 HIS A NE2 1 
ATOM   1647 N N   . HIS A 1 212 ? -9.944  -8.126  20.156 1.00 24.86 ? 427 HIS A N   1 
ATOM   1648 C CA  . HIS A 1 212 ? -10.058 -9.490  19.672 1.00 25.45 ? 427 HIS A CA  1 
ATOM   1649 C C   . HIS A 1 212 ? -8.628  -9.979  19.498 1.00 23.96 ? 427 HIS A C   1 
ATOM   1650 O O   . HIS A 1 212 ? -7.767  -9.225  19.024 1.00 23.49 ? 427 HIS A O   1 
ATOM   1651 C CB  . HIS A 1 212 ? -10.742 -9.540  18.302 1.00 26.90 ? 427 HIS A CB  1 
ATOM   1652 C CG  . HIS A 1 212 ? -12.240 -9.523  18.348 1.00 29.87 ? 427 HIS A CG  1 
ATOM   1653 N ND1 . HIS A 1 212 ? -12.982 -10.502 18.975 1.00 31.20 ? 427 HIS A ND1 1 
ATOM   1654 C CD2 . HIS A 1 212 ? -13.135 -8.664  17.805 1.00 30.71 ? 427 HIS A CD2 1 
ATOM   1655 C CE1 . HIS A 1 212 ? -14.268 -10.231 18.840 1.00 31.50 ? 427 HIS A CE1 1 
ATOM   1656 N NE2 . HIS A 1 212 ? -14.388 -9.123  18.131 1.00 30.94 ? 427 HIS A NE2 1 
ATOM   1657 N N   . ILE A 1 213 ? -8.380  -11.235 19.856 1.00 22.27 ? 428 ILE A N   1 
ATOM   1658 C CA  . ILE A 1 213 ? -7.070  -11.858 19.650 1.00 22.02 ? 428 ILE A CA  1 
ATOM   1659 C C   . ILE A 1 213 ? -7.185  -12.953 18.588 1.00 21.86 ? 428 ILE A C   1 
ATOM   1660 O O   . ILE A 1 213 ? -8.110  -13.773 18.631 1.00 21.97 ? 428 ILE A O   1 
ATOM   1661 C CB  . ILE A 1 213 ? -6.483  -12.437 20.974 1.00 22.35 ? 428 ILE A CB  1 
ATOM   1662 C CG1 . ILE A 1 213 ? -6.472  -11.366 22.076 1.00 22.86 ? 428 ILE A CG1 1 
ATOM   1663 C CG2 . ILE A 1 213 ? -5.067  -12.991 20.739 1.00 21.96 ? 428 ILE A CG2 1 
ATOM   1664 C CD1 . ILE A 1 213 ? -6.315  -11.921 23.503 1.00 23.29 ? 428 ILE A CD1 1 
ATOM   1665 N N   . TYR A 1 214 ? -6.249  -12.955 17.640 1.00 21.20 ? 429 TYR A N   1 
ATOM   1666 C CA  . TYR A 1 214 ? -6.240  -13.915 16.536 1.00 20.81 ? 429 TYR A CA  1 
ATOM   1667 C C   . TYR A 1 214 ? -4.922  -14.675 16.470 1.00 21.32 ? 429 TYR A C   1 
ATOM   1668 O O   . TYR A 1 214 ? -3.869  -14.144 16.832 1.00 20.80 ? 429 TYR A O   1 
ATOM   1669 C CB  . TYR A 1 214 ? -6.470  -13.202 15.196 1.00 20.70 ? 429 TYR A CB  1 
ATOM   1670 C CG  . TYR A 1 214 ? -7.752  -12.405 15.138 1.00 20.30 ? 429 TYR A CG  1 
ATOM   1671 C CD1 . TYR A 1 214 ? -8.954  -13.010 14.756 1.00 20.44 ? 429 TYR A CD1 1 
ATOM   1672 C CD2 . TYR A 1 214 ? -7.768  -11.049 15.471 1.00 20.38 ? 429 TYR A CD2 1 
ATOM   1673 C CE1 . TYR A 1 214 ? -10.131 -12.292 14.711 1.00 20.46 ? 429 TYR A CE1 1 
ATOM   1674 C CE2 . TYR A 1 214 ? -8.944  -10.319 15.432 1.00 20.76 ? 429 TYR A CE2 1 
ATOM   1675 C CZ  . TYR A 1 214 ? -10.124 -10.947 15.048 1.00 20.99 ? 429 TYR A CZ  1 
ATOM   1676 O OH  . TYR A 1 214 ? -11.300 -10.227 15.005 1.00 21.22 ? 429 TYR A OH  1 
ATOM   1677 N N   . ARG A 1 215 ? -4.992  -15.919 16.008 1.00 22.02 ? 430 ARG A N   1 
ATOM   1678 C CA  . ARG A 1 215 ? -3.805  -16.684 15.637 1.00 22.55 ? 430 ARG A CA  1 
ATOM   1679 C C   . ARG A 1 215 ? -3.399  -16.310 14.219 1.00 22.04 ? 430 ARG A C   1 
ATOM   1680 O O   . ARG A 1 215 ? -4.239  -16.294 13.314 1.00 22.85 ? 430 ARG A O   1 
ATOM   1681 C CB  . ARG A 1 215 ? -4.090  -18.192 15.693 1.00 25.01 ? 430 ARG A CB  1 
ATOM   1682 C CG  . ARG A 1 215 ? -4.538  -18.707 17.051 1.00 28.11 ? 430 ARG A CG  1 
ATOM   1683 C CD  . ARG A 1 215 ? -5.006  -20.161 16.992 1.00 30.41 ? 430 ARG A CD  1 
ATOM   1684 N NE  . ARG A 1 215 ? -6.330  -20.301 16.378 1.00 32.55 ? 430 ARG A NE  1 
ATOM   1685 C CZ  . ARG A 1 215 ? -6.561  -20.865 15.194 1.00 32.89 ? 430 ARG A CZ  1 
ATOM   1686 N NH1 . ARG A 1 215 ? -7.805  -20.940 14.728 1.00 32.83 ? 430 ARG A NH1 1 
ATOM   1687 N NH2 . ARG A 1 215 ? -5.561  -21.359 14.474 1.00 33.63 ? 430 ARG A NH2 1 
ATOM   1688 N N   . LEU A 1 216 ? -2.122  -15.995 14.023 1.00 20.84 ? 431 LEU A N   1 
ATOM   1689 C CA  . LEU A 1 216 ? -1.597  -15.748 12.683 1.00 20.56 ? 431 LEU A CA  1 
ATOM   1690 C C   . LEU A 1 216 ? -1.201  -17.065 12.036 1.00 20.66 ? 431 LEU A C   1 
ATOM   1691 O O   . LEU A 1 216 ? -0.460  -17.852 12.627 1.00 20.02 ? 431 LEU A O   1 
ATOM   1692 C CB  . LEU A 1 216 ? -0.406  -14.784 12.716 1.00 20.33 ? 431 LEU A CB  1 
ATOM   1693 C CG  . LEU A 1 216 ? -0.742  -13.312 12.965 1.00 20.35 ? 431 LEU A CG  1 
ATOM   1694 C CD1 . LEU A 1 216 ? 0.525   -12.511 13.216 1.00 20.63 ? 431 LEU A CD1 1 
ATOM   1695 C CD2 . LEU A 1 216 ? -1.548  -12.713 11.790 1.00 20.62 ? 431 LEU A CD2 1 
ATOM   1696 N N   . VAL A 1 217 ? -1.721  -17.305 10.833 1.00 21.42 ? 432 VAL A N   1 
ATOM   1697 C CA  . VAL A 1 217 ? -1.484  -18.556 10.105 1.00 22.76 ? 432 VAL A CA  1 
ATOM   1698 C C   . VAL A 1 217 ? -0.987  -18.288 8.687  1.00 24.50 ? 432 VAL A C   1 
ATOM   1699 O O   . VAL A 1 217 ? -1.166  -17.183 8.159  1.00 24.02 ? 432 VAL A O   1 
ATOM   1700 C CB  . VAL A 1 217 ? -2.747  -19.477 10.065 1.00 22.69 ? 432 VAL A CB  1 
ATOM   1701 C CG1 . VAL A 1 217 ? -3.176  -19.884 11.480 1.00 23.53 ? 432 VAL A CG1 1 
ATOM   1702 C CG2 . VAL A 1 217 ? -3.897  -18.818 9.307  1.00 22.48 ? 432 VAL A CG2 1 
ATOM   1703 N N   . LYS A 1 218 ? -0.386  -19.310 8.078  1.00 26.71 ? 433 LYS A N   1 
ATOM   1704 C CA  . LYS A 1 218 ? 0.320   -19.170 6.797  1.00 30.50 ? 433 LYS A CA  1 
ATOM   1705 C C   . LYS A 1 218 ? -0.588  -18.892 5.592  1.00 32.15 ? 433 LYS A C   1 
ATOM   1706 O O   . LYS A 1 218 ? -0.150  -18.289 4.605  1.00 32.33 ? 433 LYS A O   1 
ATOM   1707 C CB  . LYS A 1 218 ? 1.221   -20.385 6.533  1.00 31.29 ? 433 LYS A CB  1 
ATOM   1708 C CG  . LYS A 1 218 ? 0.484   -21.696 6.267  1.00 33.80 ? 433 LYS A CG  1 
ATOM   1709 C CD  . LYS A 1 218 ? 1.366   -22.668 5.483  1.00 35.95 ? 433 LYS A CD  1 
ATOM   1710 C CE  . LYS A 1 218 ? 0.548   -23.781 4.842  1.00 37.03 ? 433 LYS A CE  1 
ATOM   1711 N NZ  . LYS A 1 218 ? 0.108   -24.804 5.834  1.00 38.13 ? 433 LYS A NZ  1 
ATOM   1712 N N   . GLU A 1 219 ? -1.839  -19.341 5.684  1.00 35.75 ? 434 GLU A N   1 
ATOM   1713 C CA  . GLU A 1 219 ? -2.836  -19.161 4.624  1.00 38.62 ? 434 GLU A CA  1 
ATOM   1714 C C   . GLU A 1 219 ? -4.253  -19.214 5.202  1.00 40.33 ? 434 GLU A C   1 
ATOM   1715 O O   . GLU A 1 219 ? -5.237  -18.946 4.504  1.00 42.04 ? 434 GLU A O   1 
ATOM   1716 C CB  . GLU A 1 219 ? -2.658  -20.218 3.525  1.00 40.48 ? 434 GLU A CB  1 
ATOM   1717 C CG  . GLU A 1 219 ? -2.789  -21.664 4.011  1.00 43.30 ? 434 GLU A CG  1 
ATOM   1718 C CD  . GLU A 1 219 ? -2.344  -22.694 2.980  1.00 46.21 ? 434 GLU A CD  1 
ATOM   1719 O OE1 . GLU A 1 219 ? -1.551  -22.355 2.070  1.00 47.55 ? 434 GLU A OE1 1 
ATOM   1720 O OE2 . GLU A 1 219 ? -2.784  -23.857 3.091  1.00 47.89 ? 434 GLU A OE2 1 
ATOM   1721 N N   . ASP B 2 1   ? 6.678   11.385  -5.757 1.00 41.56 ? 60  ASP L N   1 
ATOM   1722 C CA  . ASP B 2 1   ? 6.977   10.390  -4.686 1.00 40.56 ? 60  ASP L CA  1 
ATOM   1723 C C   . ASP B 2 1   ? 6.370   10.840  -3.362 1.00 39.56 ? 60  ASP L C   1 
ATOM   1724 O O   . ASP B 2 1   ? 6.279   12.042  -3.093 1.00 40.30 ? 60  ASP L O   1 
ATOM   1725 C CB  . ASP B 2 1   ? 8.492   10.198  -4.545 1.00 42.55 ? 60  ASP L CB  1 
ATOM   1726 C CG  . ASP B 2 1   ? 9.143   9.678   -5.825 1.00 42.83 ? 60  ASP L CG  1 
ATOM   1727 O OD1 . ASP B 2 1   ? 8.527   9.775   -6.910 1.00 42.71 ? 60  ASP L OD1 1 
ATOM   1728 O OD2 . ASP B 2 1   ? 10.278  9.166   -5.742 1.00 43.78 ? 60  ASP L OD2 1 
ATOM   1729 N N   . SER B 2 2   ? 5.959   9.876   -2.539 1.00 37.28 ? 61  SER L N   1 
ATOM   1730 C CA  . SER B 2 2   ? 5.281   10.177  -1.272 1.00 35.71 ? 61  SER L CA  1 
ATOM   1731 C C   . SER B 2 2   ? 6.243   10.340  -0.091 1.00 34.88 ? 61  SER L C   1 
ATOM   1732 O O   . SER B 2 2   ? 7.390   9.889   -0.149 1.00 34.71 ? 61  SER L O   1 
ATOM   1733 C CB  . SER B 2 2   ? 4.213   9.114   -0.958 1.00 35.16 ? 61  SER L CB  1 
ATOM   1734 O OG  . SER B 2 2   ? 4.782   7.835   -0.715 1.00 32.38 ? 61  SER L OG  1 
ATOM   1735 N N   . GLU B 2 3   ? 5.763   11.003  0.965  1.00 35.47 ? 62  GLU L N   1 
ATOM   1736 C CA  . GLU B 2 3   ? 6.464   11.089  2.252  1.00 35.61 ? 62  GLU L CA  1 
ATOM   1737 C C   . GLU B 2 3   ? 5.776   10.178  3.273  1.00 35.50 ? 62  GLU L C   1 
ATOM   1738 O O   . GLU B 2 3   ? 4.582   9.885   3.135  1.00 35.91 ? 62  GLU L O   1 
ATOM   1739 C CB  . GLU B 2 3   ? 6.501   12.537  2.761  1.00 35.19 ? 62  GLU L CB  1 
ATOM   1740 C CG  . GLU B 2 3   ? 7.478   13.464  1.999  1.00 35.74 ? 62  GLU L CG  1 
ATOM   1741 C CD  . GLU B 2 3   ? 6.827   14.259  0.867  1.00 35.93 ? 62  GLU L CD  1 
ATOM   1742 O OE1 . GLU B 2 3   ? 5.594   14.458  0.891  1.00 35.74 ? 62  GLU L OE1 1 
ATOM   1743 O OE2 . GLU B 2 3   ? 7.559   14.709  -0.044 1.00 35.29 ? 62  GLU L OE2 1 
ATOM   1744 N N   . THR B 2 4   ? 6.513   9.735   4.293  1.00 34.57 ? 63  THR L N   1 
ATOM   1745 C CA  . THR B 2 4   ? 5.980   8.750   5.261  1.00 33.84 ? 63  THR L CA  1 
ATOM   1746 C C   . THR B 2 4   ? 6.108   9.201   6.738  1.00 35.05 ? 63  THR L C   1 
ATOM   1747 O O   . THR B 2 4   ? 5.989   8.384   7.672  1.00 33.17 ? 63  THR L O   1 
ATOM   1748 C CB  . THR B 2 4   ? 6.619   7.327   5.064  1.00 35.34 ? 63  THR L CB  1 
ATOM   1749 O OG1 . THR B 2 4   ? 6.590   6.938   3.678  1.00 36.02 ? 63  THR L OG1 1 
ATOM   1750 C CG2 . THR B 2 4   ? 5.883   6.269   5.883  1.00 34.50 ? 63  THR L CG2 1 
ATOM   1751 N N   . ASP B 2 5   ? 6.332   10.501  6.936  1.00 35.74 ? 64  ASP L N   1 
ATOM   1752 C CA  . ASP B 2 5   ? 6.597   11.087  8.263  1.00 34.78 ? 64  ASP L CA  1 
ATOM   1753 C C   . ASP B 2 5   ? 5.334   11.539  9.004  1.00 34.61 ? 64  ASP L C   1 
ATOM   1754 O O   . ASP B 2 5   ? 4.246   11.597  8.423  1.00 34.74 ? 64  ASP L O   1 
ATOM   1755 C CB  . ASP B 2 5   ? 7.568   12.267  8.129  1.00 35.96 ? 64  ASP L CB  1 
ATOM   1756 C CG  . ASP B 2 5   ? 7.020   13.385  7.248  1.00 35.95 ? 64  ASP L CG  1 
ATOM   1757 O OD1 . ASP B 2 5   ? 6.262   14.239  7.756  1.00 33.70 ? 64  ASP L OD1 1 
ATOM   1758 O OD2 . ASP B 2 5   ? 7.373   13.421  6.047  1.00 38.64 ? 64  ASP L OD2 1 
ATOM   1759 N N   . LEU B 2 6   ? 5.504   11.898  10.277 1.00 32.90 ? 65  LEU L N   1 
ATOM   1760 C CA  . LEU B 2 6   ? 4.393   12.144  11.199 1.00 32.06 ? 65  LEU L CA  1 
ATOM   1761 C C   . LEU B 2 6   ? 3.425   13.259  10.784 1.00 33.40 ? 65  LEU L C   1 
ATOM   1762 O O   . LEU B 2 6   ? 2.207   13.065  10.817 1.00 32.71 ? 65  LEU L O   1 
ATOM   1763 C CB  . LEU B 2 6   ? 4.917   12.384  12.620 1.00 31.96 ? 65  LEU L CB  1 
ATOM   1764 C CG  . LEU B 2 6   ? 3.942   12.478  13.801 1.00 30.35 ? 65  LEU L CG  1 
ATOM   1765 C CD1 . LEU B 2 6   ? 3.148   11.187  14.009 1.00 28.87 ? 65  LEU L CD1 1 
ATOM   1766 C CD2 . LEU B 2 6   ? 4.706   12.842  15.073 1.00 30.44 ? 65  LEU L CD2 1 
ATOM   1767 N N   . GLU B 2 7   ? 3.957   14.422  10.411 1.00 33.47 ? 66  GLU L N   1 
ATOM   1768 C CA  . GLU B 2 7   ? 3.107   15.512  9.926  1.00 33.67 ? 66  GLU L CA  1 
ATOM   1769 C C   . GLU B 2 7   ? 2.355   15.114  8.658  1.00 31.09 ? 66  GLU L C   1 
ATOM   1770 O O   . GLU B 2 7   ? 1.160   15.381  8.537  1.00 31.52 ? 66  GLU L O   1 
ATOM   1771 C CB  . GLU B 2 7   ? 3.908   16.796  9.693  1.00 35.63 ? 66  GLU L CB  1 
ATOM   1772 C CG  . GLU B 2 7   ? 4.308   17.529  10.972 1.00 39.31 ? 66  GLU L CG  1 
ATOM   1773 C CD  . GLU B 2 7   ? 3.129   17.864  11.873 1.00 41.37 ? 66  GLU L CD  1 
ATOM   1774 O OE1 . GLU B 2 7   ? 2.090   18.344  11.366 1.00 42.41 ? 66  GLU L OE1 1 
ATOM   1775 O OE2 . GLU B 2 7   ? 3.250   17.658  13.099 1.00 42.76 ? 66  GLU L OE2 1 
ATOM   1776 N N   . ALA B 2 8   ? 3.055   14.468  7.730  1.00 30.62 ? 67  ALA L N   1 
ATOM   1777 C CA  . ALA B 2 8   ? 2.446   13.994  6.483  1.00 29.52 ? 67  ALA L CA  1 
ATOM   1778 C C   . ALA B 2 8   ? 1.285   13.027  6.750  1.00 29.13 ? 67  ALA L C   1 
ATOM   1779 O O   . ALA B 2 8   ? 0.258   13.072  6.066  1.00 28.76 ? 67  ALA L O   1 
ATOM   1780 C CB  . ALA B 2 8   ? 3.490   13.351  5.593  1.00 29.50 ? 67  ALA L CB  1 
ATOM   1781 N N   . LEU B 2 9   ? 1.452   12.173  7.760  1.00 28.35 ? 68  LEU L N   1 
ATOM   1782 C CA  . LEU B 2 9   ? 0.445   11.174  8.134  1.00 27.16 ? 68  LEU L CA  1 
ATOM   1783 C C   . LEU B 2 9   ? -0.878  11.828  8.539  1.00 26.57 ? 68  LEU L C   1 
ATOM   1784 O O   . LEU B 2 9   ? -1.951  11.444  8.048  1.00 26.15 ? 68  LEU L O   1 
ATOM   1785 C CB  . LEU B 2 9   ? 0.999   10.292  9.264  1.00 28.93 ? 68  LEU L CB  1 
ATOM   1786 C CG  . LEU B 2 9   ? 0.168   9.200   9.932  1.00 29.77 ? 68  LEU L CG  1 
ATOM   1787 C CD1 . LEU B 2 9   ? -0.064  8.027   8.993  1.00 29.86 ? 68  LEU L CD1 1 
ATOM   1788 C CD2 . LEU B 2 9   ? 0.911   8.736   11.174 1.00 30.31 ? 68  LEU L CD2 1 
ATOM   1789 N N   . PHE B 2 10  ? -0.796  12.820  9.419  1.00 25.09 ? 69  PHE L N   1 
ATOM   1790 C CA  . PHE B 2 10  ? -1.972  13.567  9.861  1.00 25.61 ? 69  PHE L CA  1 
ATOM   1791 C C   . PHE B 2 10  ? -2.460  14.593  8.831  1.00 26.31 ? 69  PHE L C   1 
ATOM   1792 O O   . PHE B 2 10  ? -3.666  14.813  8.699  1.00 26.94 ? 69  PHE L O   1 
ATOM   1793 C CB  . PHE B 2 10  ? -1.714  14.220  11.222 1.00 25.48 ? 69  PHE L CB  1 
ATOM   1794 C CG  . PHE B 2 10  ? -1.791  13.251  12.366 1.00 25.03 ? 69  PHE L CG  1 
ATOM   1795 C CD1 . PHE B 2 10  ? -2.979  13.076  13.066 1.00 24.58 ? 69  PHE L CD1 1 
ATOM   1796 C CD2 . PHE B 2 10  ? -0.687  12.480  12.715 1.00 24.40 ? 69  PHE L CD2 1 
ATOM   1797 C CE1 . PHE B 2 10  ? -3.062  12.154  14.114 1.00 24.90 ? 69  PHE L CE1 1 
ATOM   1798 C CE2 . PHE B 2 10  ? -0.755  11.567  13.763 1.00 23.68 ? 69  PHE L CE2 1 
ATOM   1799 C CZ  . PHE B 2 10  ? -1.939  11.397  14.460 1.00 24.01 ? 69  PHE L CZ  1 
ATOM   1800 N N   . ASN B 2 11  ? -1.522  15.203  8.109  1.00 27.59 ? 70  ASN L N   1 
ATOM   1801 C CA  . ASN B 2 11  ? -1.831  16.112  6.992  1.00 30.06 ? 70  ASN L CA  1 
ATOM   1802 C C   . ASN B 2 11  ? -2.702  15.442  5.927  1.00 29.45 ? 70  ASN L C   1 
ATOM   1803 O O   . ASN B 2 11  ? -3.665  16.041  5.434  1.00 29.77 ? 70  ASN L O   1 
ATOM   1804 C CB  . ASN B 2 11  ? -0.531  16.648  6.368  1.00 31.05 ? 70  ASN L CB  1 
ATOM   1805 C CG  . ASN B 2 11  ? -0.775  17.564  5.168  1.00 32.84 ? 70  ASN L CG  1 
ATOM   1806 O OD1 . ASN B 2 11  ? -1.205  18.710  5.319  1.00 33.55 ? 70  ASN L OD1 1 
ATOM   1807 N ND2 . ASN B 2 11  ? -0.475  17.063  3.971  1.00 32.38 ? 70  ASN L ND2 1 
ATOM   1808 N N   . ALA B 2 12  ? -2.364  14.196  5.593  1.00 29.32 ? 71  ALA L N   1 
ATOM   1809 C CA  . ALA B 2 12  ? -3.085  13.418  4.582  1.00 29.68 ? 71  ALA L CA  1 
ATOM   1810 C C   . ALA B 2 12  ? -4.567  13.265  4.904  1.00 29.72 ? 71  ALA L C   1 
ATOM   1811 O O   . ALA B 2 12  ? -5.408  13.235  4.003  1.00 29.29 ? 71  ALA L O   1 
ATOM   1812 C CB  . ALA B 2 12  ? -2.449  12.052  4.417  1.00 29.69 ? 71  ALA L CB  1 
ATOM   1813 N N   . VAL B 2 13  ? -4.873  13.156  6.191  1.00 29.87 ? 72  VAL L N   1 
ATOM   1814 C CA  . VAL B 2 13  ? -6.247  13.010  6.655  1.00 31.30 ? 72  VAL L CA  1 
ATOM   1815 C C   . VAL B 2 13  ? -6.913  14.378  6.878  1.00 32.01 ? 72  VAL L C   1 
ATOM   1816 O O   . VAL B 2 13  ? -8.055  14.579  6.482  1.00 33.23 ? 72  VAL L O   1 
ATOM   1817 C CB  . VAL B 2 13  ? -6.318  12.114  7.926  1.00 31.02 ? 72  VAL L CB  1 
ATOM   1818 C CG1 . VAL B 2 13  ? -7.737  11.958  8.393  1.00 31.69 ? 72  VAL L CG1 1 
ATOM   1819 C CG2 . VAL B 2 13  ? -5.720  10.741  7.637  1.00 30.30 ? 72  VAL L CG2 1 
ATOM   1820 N N   . MET B 2 14  ? -6.194  15.317  7.492  1.00 34.65 ? 73  MET L N   1 
ATOM   1821 C CA  . MET B 2 14  ? -6.748  16.651  7.768  1.00 35.71 ? 73  MET L CA  1 
ATOM   1822 C C   . MET B 2 14  ? -6.945  17.487  6.509  1.00 36.10 ? 73  MET L C   1 
ATOM   1823 O O   . MET B 2 14  ? -7.990  18.120  6.334  1.00 35.42 ? 73  MET L O   1 
ATOM   1824 C CB  . MET B 2 14  ? -5.871  17.420  8.757  1.00 38.05 ? 73  MET L CB  1 
ATOM   1825 C CG  . MET B 2 14  ? -6.193  17.144  10.210 1.00 41.65 ? 73  MET L CG  1 
ATOM   1826 S SD  . MET B 2 14  ? -5.163  18.080  11.361 1.00 48.25 ? 73  MET L SD  1 
ATOM   1827 C CE  . MET B 2 14  ? -3.555  17.350  11.074 1.00 43.54 ? 73  MET L CE  1 
ATOM   1828 N N   . ASN B 2 15  ? -5.931  17.489  5.647  1.00 36.13 ? 74  ASN L N   1 
ATOM   1829 C CA  . ASN B 2 15  ? -5.927  18.283  4.419  1.00 35.93 ? 74  ASN L CA  1 
ATOM   1830 C C   . ASN B 2 15  ? -5.688  17.364  3.218  1.00 34.36 ? 74  ASN L C   1 
ATOM   1831 O O   . ASN B 2 15  ? -4.583  17.340  2.668  1.00 34.11 ? 74  ASN L O   1 
ATOM   1832 C CB  . ASN B 2 15  ? -4.828  19.357  4.482  1.00 37.15 ? 74  ASN L CB  1 
ATOM   1833 C CG  . ASN B 2 15  ? -4.668  19.965  5.872  1.00 39.23 ? 74  ASN L CG  1 
ATOM   1834 O OD1 . ASN B 2 15  ? -3.599  19.876  6.483  1.00 40.09 ? 74  ASN L OD1 1 
ATOM   1835 N ND2 . ASN B 2 15  ? -5.733  20.580  6.379  1.00 39.50 ? 74  ASN L ND2 1 
ATOM   1836 N N   . PRO B 2 16  ? -6.717  16.594  2.811  1.00 34.25 ? 75  PRO L N   1 
ATOM   1837 C CA  . PRO B 2 16  ? -6.521  15.555  1.787  1.00 34.60 ? 75  PRO L CA  1 
ATOM   1838 C C   . PRO B 2 16  ? -6.074  16.067  0.409  1.00 35.94 ? 75  PRO L C   1 
ATOM   1839 O O   . PRO B 2 16  ? -5.525  15.293  -0.377 1.00 36.29 ? 75  PRO L O   1 
ATOM   1840 C CB  . PRO B 2 16  ? -7.893  14.878  1.700  1.00 34.50 ? 75  PRO L CB  1 
ATOM   1841 C CG  . PRO B 2 16  ? -8.852  15.868  2.270  1.00 35.06 ? 75  PRO L CG  1 
ATOM   1842 C CD  . PRO B 2 16  ? -8.103  16.611  3.316  1.00 34.81 ? 75  PRO L CD  1 
ATOM   1843 N N   . LYS B 2 17  ? -6.288  17.355  0.130  1.00 36.61 ? 76  LYS L N   1 
ATOM   1844 C CA  . LYS B 2 17  ? -5.864  17.960  -1.142 1.00 36.19 ? 76  LYS L CA  1 
ATOM   1845 C C   . LYS B 2 17  ? -4.340  17.996  -1.315 1.00 35.47 ? 76  LYS L C   1 
ATOM   1846 O O   . LYS B 2 17  ? -3.838  18.043  -2.441 1.00 35.41 ? 76  LYS L O   1 
ATOM   1847 C CB  . LYS B 2 17  ? -6.436  19.376  -1.288 1.00 37.51 ? 76  LYS L CB  1 
ATOM   1848 C CG  . LYS B 2 17  ? -7.952  19.438  -1.421 1.00 39.74 ? 76  LYS L CG  1 
ATOM   1849 C CD  . LYS B 2 17  ? -8.423  20.873  -1.611 1.00 42.04 ? 76  LYS L CD  1 
ATOM   1850 C CE  . LYS B 2 17  ? -9.927  20.940  -1.824 1.00 43.55 ? 76  LYS L CE  1 
ATOM   1851 N NZ  . LYS B 2 17  ? -10.409 22.347  -1.934 1.00 45.38 ? 76  LYS L NZ  1 
ATOM   1852 N N   . THR B 2 18  ? -3.612  17.989  -0.198 1.00 33.54 ? 77  THR L N   1 
ATOM   1853 C CA  . THR B 2 18  ? -2.148  18.004  -0.221 1.00 32.76 ? 77  THR L CA  1 
ATOM   1854 C C   . THR B 2 18  ? -1.536  16.683  0.252  1.00 31.51 ? 77  THR L C   1 
ATOM   1855 O O   . THR B 2 18  ? -0.327  16.603  0.483  1.00 30.99 ? 77  THR L O   1 
ATOM   1856 C CB  . THR B 2 18  ? -1.568  19.158  0.635  1.00 33.27 ? 77  THR L CB  1 
ATOM   1857 O OG1 . THR B 2 18  ? -2.141  19.113  1.949  1.00 34.13 ? 77  THR L OG1 1 
ATOM   1858 C CG2 . THR B 2 18  ? -1.855  20.508  -0.007 1.00 34.14 ? 77  THR L CG2 1 
ATOM   1859 N N   . ALA B 2 19  ? -2.370  15.652  0.382  1.00 30.16 ? 78  ALA L N   1 
ATOM   1860 C CA  . ALA B 2 19  ? -1.920  14.334  0.840  1.00 29.75 ? 78  ALA L CA  1 
ATOM   1861 C C   . ALA B 2 19  ? -0.824  13.772  -0.061 1.00 29.00 ? 78  ALA L C   1 
ATOM   1862 O O   . ALA B 2 19  ? -0.937  13.811  -1.287 1.00 29.41 ? 78  ALA L O   1 
ATOM   1863 C CB  . ALA B 2 19  ? -3.089  13.372  0.913  1.00 29.52 ? 78  ALA L CB  1 
ATOM   1864 N N   . ASN B 2 20  ? 0.238   13.260  0.555  1.00 27.97 ? 79  ASN L N   1 
ATOM   1865 C CA  . ASN B 2 20  ? 1.337   12.659  -0.183 1.00 28.31 ? 79  ASN L CA  1 
ATOM   1866 C C   . ASN B 2 20  ? 1.962   11.501  0.600  1.00 27.84 ? 79  ASN L C   1 
ATOM   1867 O O   . ASN B 2 20  ? 3.155   11.492  0.867  1.00 29.94 ? 79  ASN L O   1 
ATOM   1868 C CB  . ASN B 2 20  ? 2.383   13.727  -0.556 1.00 30.63 ? 79  ASN L CB  1 
ATOM   1869 C CG  . ASN B 2 20  ? 3.346   13.259  -1.639 1.00 31.81 ? 79  ASN L CG  1 
ATOM   1870 O OD1 . ASN B 2 20  ? 2.989   12.464  -2.514 1.00 33.49 ? 79  ASN L OD1 1 
ATOM   1871 N ND2 . ASN B 2 20  ? 4.576   13.754  -1.584 1.00 32.87 ? 79  ASN L ND2 1 
ATOM   1872 N N   . VAL B 2 21  ? 1.126   10.541  0.985  1.00 25.37 ? 80  VAL L N   1 
ATOM   1873 C CA  . VAL B 2 21  ? 1.565   9.335   1.693  1.00 23.42 ? 80  VAL L CA  1 
ATOM   1874 C C   . VAL B 2 21  ? 1.228   8.118   0.824  1.00 21.49 ? 80  VAL L C   1 
ATOM   1875 O O   . VAL B 2 21  ? 0.449   8.245   -0.126 1.00 21.04 ? 80  VAL L O   1 
ATOM   1876 C CB  . VAL B 2 21  ? 0.902   9.202   3.098  1.00 23.51 ? 80  VAL L CB  1 
ATOM   1877 C CG1 . VAL B 2 21  ? 1.406   10.303  4.045  1.00 24.08 ? 80  VAL L CG1 1 
ATOM   1878 C CG2 . VAL B 2 21  ? -0.635  9.203   3.005  1.00 23.72 ? 80  VAL L CG2 1 
ATOM   1879 N N   . PRO B 2 22  ? 1.815   6.940   1.133  1.00 20.35 ? 81  PRO L N   1 
ATOM   1880 C CA  . PRO B 2 22  ? 1.489   5.742   0.357  1.00 19.57 ? 81  PRO L CA  1 
ATOM   1881 C C   . PRO B 2 22  ? 0.001   5.439   0.364  1.00 19.39 ? 81  PRO L C   1 
ATOM   1882 O O   . PRO B 2 22  ? -0.690  5.715   1.345  1.00 18.96 ? 81  PRO L O   1 
ATOM   1883 C CB  . PRO B 2 22  ? 2.236   4.632   1.100  1.00 19.61 ? 81  PRO L CB  1 
ATOM   1884 C CG  . PRO B 2 22  ? 3.407   5.329   1.703  1.00 19.69 ? 81  PRO L CG  1 
ATOM   1885 C CD  . PRO B 2 22  ? 2.880   6.673   2.119  1.00 20.01 ? 81  PRO L CD  1 
ATOM   1886 N N   . GLN B 2 23  ? -0.469  4.868   -0.739 1.00 20.19 ? 82  GLN L N   1 
ATOM   1887 C CA  . GLN B 2 23  ? -1.864  4.483   -0.890 1.00 21.35 ? 82  GLN L CA  1 
ATOM   1888 C C   . GLN B 2 23  ? -2.004  3.007   -0.525 1.00 20.57 ? 82  GLN L C   1 
ATOM   1889 O O   . GLN B 2 23  ? -1.104  2.205   -0.789 1.00 19.66 ? 82  GLN L O   1 
ATOM   1890 C CB  . GLN B 2 23  ? -2.318  4.777   -2.326 1.00 22.23 ? 82  GLN L CB  1 
ATOM   1891 C CG  . GLN B 2 23  ? -2.067  6.257   -2.683 1.00 23.50 ? 82  GLN L CG  1 
ATOM   1892 C CD  . GLN B 2 23  ? -2.478  6.669   -4.091 1.00 24.66 ? 82  GLN L CD  1 
ATOM   1893 O OE1 . GLN B 2 23  ? -3.060  5.892   -4.854 1.00 25.97 ? 82  GLN L OE1 1 
ATOM   1894 N NE2 . GLN B 2 23  ? -2.163  7.911   -4.441 1.00 24.85 ? 82  GLN L NE2 1 
ATOM   1895 N N   . THR B 2 24  ? -3.110  2.655   0.117  1.00 20.76 ? 83  THR L N   1 
ATOM   1896 C CA  . THR B 2 24  ? -3.276  1.291   0.586  1.00 21.12 ? 83  THR L CA  1 
ATOM   1897 C C   . THR B 2 24  ? -4.704  0.760   0.496  1.00 21.43 ? 83  THR L C   1 
ATOM   1898 O O   . THR B 2 24  ? -5.655  1.527   0.331  1.00 20.84 ? 83  THR L O   1 
ATOM   1899 C CB  . THR B 2 24  ? -2.729  1.112   2.018  1.00 21.07 ? 83  THR L CB  1 
ATOM   1900 O OG1 . THR B 2 24  ? -2.535  -0.282  2.260  1.00 22.82 ? 83  THR L OG1 1 
ATOM   1901 C CG2 . THR B 2 24  ? -3.674  1.699   3.073  1.00 20.68 ? 83  THR L CG2 1 
ATOM   1902 N N   . VAL B 2 25  ? -4.832  -0.565  0.601  1.00 21.16 ? 84  VAL L N   1 
ATOM   1903 C CA  . VAL B 2 25  ? -6.144  -1.205  0.674  1.00 20.72 ? 84  VAL L CA  1 
ATOM   1904 C C   . VAL B 2 25  ? -6.704  -1.039  2.088  1.00 20.96 ? 84  VAL L C   1 
ATOM   1905 O O   . VAL B 2 25  ? -6.055  -1.437  3.063  1.00 20.31 ? 84  VAL L O   1 
ATOM   1906 C CB  . VAL B 2 25  ? -6.074  -2.701  0.292  1.00 20.29 ? 84  VAL L CB  1 
ATOM   1907 C CG1 . VAL B 2 25  ? -7.471  -3.342  0.328  1.00 20.72 ? 84  VAL L CG1 1 
ATOM   1908 C CG2 . VAL B 2 25  ? -5.470  -2.861  -1.099 1.00 20.17 ? 84  VAL L CG2 1 
ATOM   1909 N N   . PRO B 2 26  ? -7.914  -0.455  2.206  1.00 22.01 ? 85  PRO L N   1 
ATOM   1910 C CA  . PRO B 2 26  ? -8.569  -0.353  3.512  1.00 23.10 ? 85  PRO L CA  1 
ATOM   1911 C C   . PRO B 2 26  ? -8.743  -1.722  4.157  1.00 23.09 ? 85  PRO L C   1 
ATOM   1912 O O   . PRO B 2 26  ? -9.047  -2.705  3.469  1.00 22.72 ? 85  PRO L O   1 
ATOM   1913 C CB  . PRO B 2 26  ? -9.930  0.261   3.168  1.00 23.20 ? 85  PRO L CB  1 
ATOM   1914 C CG  . PRO B 2 26  ? -9.659  1.055   1.932  1.00 23.49 ? 85  PRO L CG  1 
ATOM   1915 C CD  . PRO B 2 26  ? -8.734  0.164   1.149  1.00 22.38 ? 85  PRO L CD  1 
ATOM   1916 N N   . MET B 2 27  ? -8.537  -1.784  5.473  1.00 24.07 ? 86  MET L N   1 
ATOM   1917 C CA  . MET B 2 27  ? -8.652  -3.031  6.218  1.00 25.30 ? 86  MET L CA  1 
ATOM   1918 C C   . MET B 2 27  ? -9.996  -3.735  5.981  1.00 25.58 ? 86  MET L C   1 
ATOM   1919 O O   . MET B 2 27  ? -10.044 -4.954  5.850  1.00 23.67 ? 86  MET L O   1 
ATOM   1920 C CB  . MET B 2 27  ? -8.411  -2.788  7.715  1.00 25.96 ? 86  MET L CB  1 
ATOM   1921 C CG  . MET B 2 27  ? -6.959  -2.483  8.051  1.00 27.03 ? 86  MET L CG  1 
ATOM   1922 S SD  . MET B 2 27  ? -5.850  -3.866  7.702  1.00 29.49 ? 86  MET L SD  1 
ATOM   1923 C CE  . MET B 2 27  ? -5.963  -4.782  9.231  1.00 28.69 ? 86  MET L CE  1 
ATOM   1924 N N   . ARG B 2 28  ? -11.073 -2.956  5.884  1.00 29.09 ? 87  ARG L N   1 
ATOM   1925 C CA  . ARG B 2 28  ? -12.416 -3.513  5.654  1.00 31.24 ? 87  ARG L CA  1 
ATOM   1926 C C   . ARG B 2 28  ? -12.573 -4.277  4.342  1.00 31.75 ? 87  ARG L C   1 
ATOM   1927 O O   . ARG B 2 28  ? -13.467 -5.118  4.201  1.00 32.26 ? 87  ARG L O   1 
ATOM   1928 C CB  . ARG B 2 28  ? -13.483 -2.426  5.770  1.00 34.46 ? 87  ARG L CB  1 
ATOM   1929 C CG  . ARG B 2 28  ? -13.702 -1.986  7.199  1.00 37.90 ? 87  ARG L CG  1 
ATOM   1930 C CD  . ARG B 2 28  ? -15.108 -1.475  7.443  1.00 40.04 ? 87  ARG L CD  1 
ATOM   1931 N NE  . ARG B 2 28  ? -15.406 -1.438  8.875  1.00 42.08 ? 87  ARG L NE  1 
ATOM   1932 C CZ  . ARG B 2 28  ? -15.019 -0.470  9.704  1.00 43.92 ? 87  ARG L CZ  1 
ATOM   1933 N NH1 . ARG B 2 28  ? -14.313 0.563   9.255  1.00 45.44 ? 87  ARG L NH1 1 
ATOM   1934 N NH2 . ARG B 2 28  ? -15.341 -0.534  10.989 1.00 45.13 ? 87  ARG L NH2 1 
ATOM   1935 N N   . LEU B 2 29  ? -11.693 -4.000  3.387  1.00 30.07 ? 88  LEU L N   1 
ATOM   1936 C CA  . LEU B 2 29  ? -11.808 -4.609  2.073  1.00 29.35 ? 88  LEU L CA  1 
ATOM   1937 C C   . LEU B 2 29  ? -10.877 -5.811  1.904  1.00 28.26 ? 88  LEU L C   1 
ATOM   1938 O O   . LEU B 2 29  ? -10.842 -6.436  0.844  1.00 27.96 ? 88  LEU L O   1 
ATOM   1939 C CB  . LEU B 2 29  ? -11.619 -3.548  0.976  1.00 31.38 ? 88  LEU L CB  1 
ATOM   1940 C CG  . LEU B 2 29  ? -12.398 -2.227  1.154  1.00 31.83 ? 88  LEU L CG  1 
ATOM   1941 C CD1 . LEU B 2 29  ? -12.065 -1.254  0.041  1.00 32.85 ? 88  LEU L CD1 1 
ATOM   1942 C CD2 . LEU B 2 29  ? -13.918 -2.415  1.247  1.00 33.19 ? 88  LEU L CD2 1 
ATOM   1943 N N   . ARG B 2 30  ? -10.140 -6.144  2.966  1.00 26.39 ? 89  ARG L N   1 
ATOM   1944 C CA  . ARG B 2 30  ? -9.235  -7.287  2.947  1.00 26.29 ? 89  ARG L CA  1 
ATOM   1945 C C   . ARG B 2 30  ? -9.941  -8.567  3.385  1.00 27.91 ? 89  ARG L C   1 
ATOM   1946 O O   . ARG B 2 30  ? -11.037 -8.514  3.952  1.00 28.75 ? 89  ARG L O   1 
ATOM   1947 C CB  . ARG B 2 30  ? -8.009  -7.024  3.838  1.00 24.43 ? 89  ARG L CB  1 
ATOM   1948 C CG  . ARG B 2 30  ? -7.274  -5.734  3.499  1.00 22.80 ? 89  ARG L CG  1 
ATOM   1949 C CD  . ARG B 2 30  ? -5.995  -5.566  4.310  1.00 21.01 ? 89  ARG L CD  1 
ATOM   1950 N NE  . ARG B 2 30  ? -5.352  -4.304  3.976  1.00 19.70 ? 89  ARG L NE  1 
ATOM   1951 C CZ  . ARG B 2 30  ? -4.048  -4.068  4.073  1.00 19.52 ? 89  ARG L CZ  1 
ATOM   1952 N NH1 . ARG B 2 30  ? -3.224  -5.022  4.483  1.00 18.86 ? 89  ARG L NH1 1 
ATOM   1953 N NH2 . ARG B 2 30  ? -3.572  -2.877  3.737  1.00 18.86 ? 89  ARG L NH2 1 
ATOM   1954 N N   . LYS B 2 31  ? -9.305  -9.706  3.115  1.00 28.87 ? 90  LYS L N   1 
ATOM   1955 C CA  . LYS B 2 31  ? -9.785  -11.013 3.565  1.00 30.35 ? 90  LYS L CA  1 
ATOM   1956 C C   . LYS B 2 31  ? -9.501  -11.204 5.059  1.00 29.57 ? 90  LYS L C   1 
ATOM   1957 O O   . LYS B 2 31  ? -8.494  -11.804 5.445  1.00 29.79 ? 90  LYS L O   1 
ATOM   1958 C CB  . LYS B 2 31  ? -9.141  -12.138 2.746  1.00 31.55 ? 90  LYS L CB  1 
ATOM   1959 C CG  . LYS B 2 31  ? -9.476  -12.120 1.251  1.00 33.99 ? 90  LYS L CG  1 
ATOM   1960 C CD  . LYS B 2 31  ? -8.677  -13.184 0.507  1.00 35.19 ? 90  LYS L CD  1 
ATOM   1961 C CE  . LYS B 2 31  ? -8.939  -13.149 -0.994 1.00 35.74 ? 90  LYS L CE  1 
ATOM   1962 N NZ  . LYS B 2 31  ? -8.009  -14.080 -1.713 1.00 35.41 ? 90  LYS L NZ  1 
ATOM   1963 N N   . LEU B 2 32  ? -10.399 -10.675 5.886  1.00 29.11 ? 91  LEU L N   1 
ATOM   1964 C CA  . LEU B 2 32  ? -10.273 -10.726 7.345  1.00 29.29 ? 91  LEU L CA  1 
ATOM   1965 C C   . LEU B 2 32  ? -11.597 -11.180 7.961  1.00 29.86 ? 91  LEU L C   1 
ATOM   1966 O O   . LEU B 2 32  ? -12.650 -10.957 7.367  1.00 29.61 ? 91  LEU L O   1 
ATOM   1967 C CB  . LEU B 2 32  ? -9.887  -9.346  7.891  1.00 28.36 ? 91  LEU L CB  1 
ATOM   1968 C CG  . LEU B 2 32  ? -8.499  -8.795  7.544  1.00 28.13 ? 91  LEU L CG  1 
ATOM   1969 C CD1 . LEU B 2 32  ? -8.389  -7.331  7.936  1.00 27.85 ? 91  LEU L CD1 1 
ATOM   1970 C CD2 . LEU B 2 32  ? -7.386  -9.630  8.192  1.00 27.38 ? 91  LEU L CD2 1 
ATOM   1971 N N   . PRO B 2 33  ? -11.555 -11.808 9.156  1.00 30.42 ? 92  PRO L N   1 
ATOM   1972 C CA  . PRO B 2 33  ? -12.802 -12.279 9.776  1.00 30.31 ? 92  PRO L CA  1 
ATOM   1973 C C   . PRO B 2 33  ? -13.773 -11.140 10.058 1.00 30.92 ? 92  PRO L C   1 
ATOM   1974 O O   . PRO B 2 33  ? -13.345 -10.004 10.284 1.00 30.19 ? 92  PRO L O   1 
ATOM   1975 C CB  . PRO B 2 33  ? -12.329 -12.910 11.091 1.00 30.71 ? 92  PRO L CB  1 
ATOM   1976 C CG  . PRO B 2 33  ? -10.882 -13.211 10.882 1.00 30.94 ? 92  PRO L CG  1 
ATOM   1977 C CD  . PRO B 2 33  ? -10.379 -12.125 9.985  1.00 30.62 ? 92  PRO L CD  1 
ATOM   1978 N N   . ASP B 2 34  ? -15.071 -11.439 10.033 1.00 32.91 ? 93  ASP L N   1 
ATOM   1979 C CA  . ASP B 2 34  ? -16.109 -10.437 10.295 1.00 34.15 ? 93  ASP L CA  1 
ATOM   1980 C C   . ASP B 2 34  ? -15.949 -9.778  11.663 1.00 33.38 ? 93  ASP L C   1 
ATOM   1981 O O   . ASP B 2 34  ? -16.248 -8.590  11.831 1.00 32.50 ? 93  ASP L O   1 
ATOM   1982 C CB  . ASP B 2 34  ? -17.507 -11.060 10.179 1.00 38.39 ? 93  ASP L CB  1 
ATOM   1983 C CG  . ASP B 2 34  ? -17.800 -11.602 8.785  1.00 41.36 ? 93  ASP L CG  1 
ATOM   1984 O OD1 . ASP B 2 34  ? -17.277 -11.049 7.788  1.00 42.51 ? 93  ASP L OD1 1 
ATOM   1985 O OD2 . ASP B 2 34  ? -18.571 -12.583 8.688  1.00 44.69 ? 93  ASP L OD2 1 
ATOM   1986 N N   . SER B 2 35  ? -15.470 -10.554 12.634 1.00 32.73 ? 94  SER L N   1 
ATOM   1987 C CA  . SER B 2 35  ? -15.288 -10.071 14.001 1.00 30.79 ? 94  SER L CA  1 
ATOM   1988 C C   . SER B 2 35  ? -14.271 -8.936  14.068 1.00 29.69 ? 94  SER L C   1 
ATOM   1989 O O   . SER B 2 35  ? -14.264 -8.155  15.021 1.00 28.37 ? 94  SER L O   1 
ATOM   1990 C CB  . SER B 2 35  ? -14.854 -11.215 14.919 1.00 31.20 ? 94  SER L CB  1 
ATOM   1991 O OG  . SER B 2 35  ? -13.555 -11.671 14.576 1.00 31.09 ? 94  SER L OG  1 
ATOM   1992 N N   . PHE B 2 36  ? -13.424 -8.839  13.042 1.00 28.14 ? 95  PHE L N   1 
ATOM   1993 C CA  . PHE B 2 36  ? -12.369 -7.831  13.009 1.00 26.91 ? 95  PHE L CA  1 
ATOM   1994 C C   . PHE B 2 36  ? -12.912 -6.416  13.118 1.00 26.76 ? 95  PHE L C   1 
ATOM   1995 O O   . PHE B 2 36  ? -12.231 -5.527  13.621 1.00 24.62 ? 95  PHE L O   1 
ATOM   1996 C CB  . PHE B 2 36  ? -11.526 -7.963  11.740 1.00 27.07 ? 95  PHE L CB  1 
ATOM   1997 C CG  . PHE B 2 36  ? -10.097 -7.542  11.920 1.00 27.79 ? 95  PHE L CG  1 
ATOM   1998 C CD1 . PHE B 2 36  ? -9.138  -8.467  12.323 1.00 27.98 ? 95  PHE L CD1 1 
ATOM   1999 C CD2 . PHE B 2 36  ? -9.711  -6.226  11.695 1.00 27.43 ? 95  PHE L CD2 1 
ATOM   2000 C CE1 . PHE B 2 36  ? -7.813  -8.089  12.497 1.00 28.28 ? 95  PHE L CE1 1 
ATOM   2001 C CE2 . PHE B 2 36  ? -8.384  -5.835  11.870 1.00 28.12 ? 95  PHE L CE2 1 
ATOM   2002 C CZ  . PHE B 2 36  ? -7.437  -6.772  12.269 1.00 27.39 ? 95  PHE L CZ  1 
ATOM   2003 N N   . PHE B 2 37  ? -14.144 -6.211  12.655 1.00 27.87 ? 96  PHE L N   1 
ATOM   2004 C CA  . PHE B 2 37  ? -14.719 -4.872  12.609 1.00 29.03 ? 96  PHE L CA  1 
ATOM   2005 C C   . PHE B 2 37  ? -15.966 -4.746  13.481 1.00 31.79 ? 96  PHE L C   1 
ATOM   2006 O O   . PHE B 2 37  ? -16.634 -3.709  13.476 1.00 33.22 ? 96  PHE L O   1 
ATOM   2007 C CB  . PHE B 2 37  ? -15.001 -4.478  11.156 1.00 28.79 ? 96  PHE L CB  1 
ATOM   2008 C CG  . PHE B 2 37  ? -13.890 -4.852  10.207 1.00 28.73 ? 96  PHE L CG  1 
ATOM   2009 C CD1 . PHE B 2 37  ? -12.755 -4.048  10.091 1.00 28.50 ? 96  PHE L CD1 1 
ATOM   2010 C CD2 . PHE B 2 37  ? -13.968 -6.019  9.455  1.00 28.23 ? 96  PHE L CD2 1 
ATOM   2011 C CE1 . PHE B 2 37  ? -11.722 -4.395  9.227  1.00 28.07 ? 96  PHE L CE1 1 
ATOM   2012 C CE2 . PHE B 2 37  ? -12.937 -6.382  8.584  1.00 28.77 ? 96  PHE L CE2 1 
ATOM   2013 C CZ  . PHE B 2 37  ? -11.814 -5.569  8.470  1.00 28.12 ? 96  PHE L CZ  1 
ATOM   2014 N N   . LYS B 2 38  ? -16.258 -5.803  14.236 1.00 33.04 ? 97  LYS L N   1 
ATOM   2015 C CA  . LYS B 2 38  ? -17.361 -5.806  15.198 1.00 34.73 ? 97  LYS L CA  1 
ATOM   2016 C C   . LYS B 2 38  ? -16.842 -6.120  16.606 1.00 34.04 ? 97  LYS L C   1 
ATOM   2017 O O   . LYS B 2 38  ? -16.597 -7.283  16.931 1.00 33.02 ? 97  LYS L O   1 
ATOM   2018 C CB  . LYS B 2 38  ? -18.441 -6.807  14.777 1.00 36.10 ? 97  LYS L CB  1 
ATOM   2019 C CG  . LYS B 2 38  ? -19.223 -6.381  13.538 1.00 39.16 ? 97  LYS L CG  1 
ATOM   2020 C CD  . LYS B 2 38  ? -20.073 -7.513  12.974 1.00 40.09 ? 97  LYS L CD  1 
ATOM   2021 C CE  . LYS B 2 38  ? -20.667 -7.120  11.625 1.00 40.96 ? 97  LYS L CE  1 
ATOM   2022 N NZ  . LYS B 2 38  ? -21.157 -8.304  10.867 1.00 41.73 ? 97  LYS L NZ  1 
ATOM   2023 N N   . PRO B 2 39  ? -16.662 -5.076  17.441 1.00 34.37 ? 98  PRO L N   1 
ATOM   2024 C CA  . PRO B 2 39  ? -16.119 -5.259  18.791 1.00 34.91 ? 98  PRO L CA  1 
ATOM   2025 C C   . PRO B 2 39  ? -17.084 -5.983  19.736 1.00 36.46 ? 98  PRO L C   1 
ATOM   2026 O O   . PRO B 2 39  ? -18.303 -5.887  19.555 1.00 35.85 ? 98  PRO L O   1 
ATOM   2027 C CB  . PRO B 2 39  ? -15.873 -3.824  19.272 1.00 34.44 ? 98  PRO L CB  1 
ATOM   2028 C CG  . PRO B 2 39  ? -16.806 -2.985  18.471 1.00 34.60 ? 98  PRO L CG  1 
ATOM   2029 C CD  . PRO B 2 39  ? -16.923 -3.656  17.138 1.00 33.74 ? 98  PRO L CD  1 
ATOM   2030 N N   . PRO B 2 40  ? -16.541 -6.727  20.723 1.00 37.54 ? 99  PRO L N   1 
ATOM   2031 C CA  . PRO B 2 40  ? -17.387 -7.358  21.739 1.00 37.77 ? 99  PRO L CA  1 
ATOM   2032 C C   . PRO B 2 40  ? -17.798 -6.362  22.822 1.00 39.01 ? 99  PRO L C   1 
ATOM   2033 O O   . PRO B 2 40  ? -18.617 -5.480  22.568 1.00 38.64 ? 99  PRO L O   1 
ATOM   2034 C CB  . PRO B 2 40  ? -16.482 -8.446  22.328 1.00 37.61 ? 99  PRO L CB  1 
ATOM   2035 C CG  . PRO B 2 40  ? -15.095 -7.946  22.120 1.00 37.74 ? 99  PRO L CG  1 
ATOM   2036 C CD  . PRO B 2 40  ? -15.117 -7.091  20.879 1.00 36.97 ? 99  PRO L CD  1 
HETATM 2037 C C1  . MYR C 3 .   ? 6.754   2.555   23.373 1.00 41.37 ? 501 MYR A C1  1 
HETATM 2038 O O1  . MYR C 3 .   ? 6.289   3.791   23.568 1.00 42.83 ? 501 MYR A O1  1 
HETATM 2039 O O2  . MYR C 3 .   ? 7.808   2.224   23.848 1.00 43.41 ? 501 MYR A O2  1 
HETATM 2040 C C2  . MYR C 3 .   ? 5.957   1.576   22.563 1.00 42.35 ? 501 MYR A C2  1 
HETATM 2041 C C3  . MYR C 3 .   ? 4.979   0.880   23.508 1.00 41.47 ? 501 MYR A C3  1 
HETATM 2042 C C4  . MYR C 3 .   ? 3.749   0.463   22.709 1.00 42.12 ? 501 MYR A C4  1 
HETATM 2043 C C5  . MYR C 3 .   ? 2.772   -0.260  23.637 1.00 41.82 ? 501 MYR A C5  1 
HETATM 2044 C C6  . MYR C 3 .   ? 1.358   -0.187  23.063 1.00 41.53 ? 501 MYR A C6  1 
HETATM 2045 C C7  . MYR C 3 .   ? 0.695   1.114   23.504 1.00 41.72 ? 501 MYR A C7  1 
HETATM 2046 C C8  . MYR C 3 .   ? -0.713  1.187   22.915 1.00 41.53 ? 501 MYR A C8  1 
HETATM 2047 C C9  . MYR C 3 .   ? -0.957  2.616   22.447 1.00 42.49 ? 501 MYR A C9  1 
HETATM 2048 C C10 . MYR C 3 .   ? -2.143  3.226   23.192 1.00 42.99 ? 501 MYR A C10 1 
HETATM 2049 C C11 . MYR C 3 .   ? -3.317  3.393   22.222 1.00 44.34 ? 501 MYR A C11 1 
HETATM 2050 C C12 . MYR C 3 .   ? -3.313  4.793   21.595 1.00 44.76 ? 501 MYR A C12 1 
HETATM 2051 C C13 . MYR C 3 .   ? -2.945  4.705   20.108 1.00 44.63 ? 501 MYR A C13 1 
HETATM 2052 C C14 . MYR C 3 .   ? -4.207  4.492   19.268 1.00 44.35 ? 501 MYR A C14 1 
HETATM 2053 C C1  . GOL D 4 .   ? 1.989   1.257   2.957  1.00 31.16 ? 502 GOL A C1  1 
HETATM 2054 O O1  . GOL D 4 .   ? 3.311   0.997   2.556  1.00 32.64 ? 502 GOL A O1  1 
HETATM 2055 C C2  . GOL D 4 .   ? 1.420   0.058   3.705  1.00 32.02 ? 502 GOL A C2  1 
HETATM 2056 O O2  . GOL D 4 .   ? 2.056   -0.121  4.947  1.00 31.44 ? 502 GOL A O2  1 
HETATM 2057 C C3  . GOL D 4 .   ? -0.046  0.335   3.988  1.00 32.10 ? 502 GOL A C3  1 
HETATM 2058 O O3  . GOL D 4 .   ? -0.675  -0.842  4.446  1.00 32.03 ? 502 GOL A O3  1 
HETATM 2059 O O   . HOH E 5 .   ? 5.094   1.794   3.042  1.00 32.12 ? 601 HOH A O   1 
HETATM 2060 O O   . HOH E 5 .   ? 22.235  -14.031 26.094 1.00 31.81 ? 602 HOH A O   1 
HETATM 2061 O O   . HOH E 5 .   ? 5.431   8.628   11.941 1.00 26.02 ? 603 HOH A O   1 
HETATM 2062 O O   . HOH E 5 .   ? 4.851   -6.972  2.943  1.00 36.64 ? 604 HOH A O   1 
HETATM 2063 O O   . HOH E 5 .   ? 16.368  -13.570 10.768 1.00 34.29 ? 605 HOH A O   1 
HETATM 2064 O O   . HOH E 5 .   ? 15.084  -6.280  17.642 1.00 34.32 ? 606 HOH A O   1 
HETATM 2065 O O   . HOH E 5 .   ? -11.082 0.213   6.869  1.00 39.29 ? 607 HOH A O   1 
HETATM 2066 O O   . HOH E 5 .   ? -14.860 -1.588  14.209 1.00 36.72 ? 608 HOH A O   1 
HETATM 2067 O O   . HOH E 5 .   ? -3.666  -0.145  13.037 1.00 22.88 ? 609 HOH A O   1 
HETATM 2068 O O   . HOH E 5 .   ? 8.569   -20.439 21.264 1.00 19.73 ? 610 HOH A O   1 
HETATM 2069 O O   . HOH E 5 .   ? -0.745  14.426  29.024 1.00 34.31 ? 611 HOH A O   1 
HETATM 2070 O O   . HOH E 5 .   ? -4.056  13.954  26.902 1.00 43.20 ? 612 HOH A O   1 
HETATM 2071 O O   . HOH E 5 .   ? 5.698   -13.753 41.270 1.00 39.61 ? 613 HOH A O   1 
HETATM 2072 O O   . HOH E 5 .   ? 13.408  -14.540 17.140 1.00 43.57 ? 614 HOH A O   1 
HETATM 2073 O O   . HOH E 5 .   ? 7.252   -8.171  39.898 0.50 26.41 ? 615 HOH A O   1 
HETATM 2074 O O   . HOH E 5 .   ? 10.439  -9.900  6.828  1.00 23.21 ? 616 HOH A O   1 
HETATM 2075 O O   . HOH E 5 .   ? 4.175   8.308   9.564  1.00 31.47 ? 617 HOH A O   1 
HETATM 2076 O O   . HOH E 5 .   ? 20.076  -7.628  27.259 1.00 31.95 ? 618 HOH A O   1 
HETATM 2077 O O   . HOH E 5 .   ? -14.358 3.246   15.760 1.00 27.22 ? 619 HOH A O   1 
HETATM 2078 O O   . HOH E 5 .   ? -10.723 7.462   32.185 1.00 38.99 ? 620 HOH A O   1 
HETATM 2079 O O   . HOH E 5 .   ? 22.707  -14.257 29.049 1.00 23.86 ? 621 HOH A O   1 
HETATM 2080 O O   . HOH E 5 .   ? 15.313  -21.757 22.603 1.00 33.12 ? 622 HOH A O   1 
HETATM 2081 O O   . HOH E 5 .   ? -6.276  11.591  32.285 1.00 51.90 ? 623 HOH A O   1 
HETATM 2082 O O   . HOH E 5 .   ? 14.345  -23.524 33.065 1.00 33.19 ? 624 HOH A O   1 
HETATM 2083 O O   . HOH E 5 .   ? 4.531   -16.291 4.776  1.00 31.34 ? 625 HOH A O   1 
HETATM 2084 O O   . HOH E 5 .   ? -9.251  -15.178 8.595  1.00 42.36 ? 626 HOH A O   1 
HETATM 2085 O O   . HOH E 5 .   ? -5.230  -0.175  5.373  1.00 25.44 ? 627 HOH A O   1 
HETATM 2086 O O   . HOH E 5 .   ? -12.724 -6.717  24.749 1.00 26.38 ? 628 HOH A O   1 
HETATM 2087 O O   . HOH E 5 .   ? -9.942  -4.934  26.401 1.00 38.22 ? 629 HOH A O   1 
HETATM 2088 O O   . HOH E 5 .   ? 21.466  -20.520 28.063 1.00 38.42 ? 630 HOH A O   1 
HETATM 2089 O O   . HOH E 5 .   ? 8.144   -25.248 35.130 1.00 40.64 ? 631 HOH A O   1 
HETATM 2090 O O   . HOH E 5 .   ? 10.910  -16.668 14.480 1.00 21.13 ? 632 HOH A O   1 
HETATM 2091 O O   . HOH E 5 .   ? 3.038   10.053  46.116 1.00 44.94 ? 633 HOH A O   1 
HETATM 2092 O O   . HOH E 5 .   ? 5.419   -4.456  23.971 1.00 33.28 ? 634 HOH A O   1 
HETATM 2093 O O   . HOH E 5 .   ? 13.894  2.603   14.749 1.00 39.28 ? 635 HOH A O   1 
HETATM 2094 O O   . HOH E 5 .   ? 22.861  -11.230 31.827 1.00 33.47 ? 636 HOH A O   1 
HETATM 2095 O O   . HOH E 5 .   ? 17.350  -4.291  27.058 1.00 42.11 ? 637 HOH A O   1 
HETATM 2096 O O   . HOH E 5 .   ? 13.812  -9.185  14.269 1.00 34.82 ? 638 HOH A O   1 
HETATM 2097 O O   . HOH E 5 .   ? 16.353  -13.585 38.002 1.00 16.46 ? 639 HOH A O   1 
HETATM 2098 O O   . HOH E 5 .   ? 13.079  -9.586  21.015 1.00 23.50 ? 640 HOH A O   1 
HETATM 2099 O O   . HOH E 5 .   ? 6.003   -7.611  7.077  1.00 27.33 ? 641 HOH A O   1 
HETATM 2100 O O   . HOH E 5 .   ? 9.760   -3.435  24.450 1.00 23.03 ? 642 HOH A O   1 
HETATM 2101 O O   . HOH E 5 .   ? 2.483   -18.028 4.175  1.00 40.89 ? 643 HOH A O   1 
HETATM 2102 O O   . HOH E 5 .   ? -15.507 -13.554 12.449 1.00 34.25 ? 644 HOH A O   1 
HETATM 2103 O O   . HOH E 5 .   ? -10.434 -14.976 17.949 1.00 26.63 ? 645 HOH A O   1 
HETATM 2104 O O   . HOH E 5 .   ? -6.219  18.130  14.329 1.00 43.75 ? 646 HOH A O   1 
HETATM 2105 O O   . HOH E 5 .   ? 12.889  -16.771 6.875  1.00 52.76 ? 647 HOH A O   1 
HETATM 2106 O O   . HOH E 5 .   ? -13.013 2.565   10.583 1.00 36.44 ? 648 HOH A O   1 
HETATM 2107 O O   . HOH E 5 .   ? 6.102   8.133   29.332 1.00 35.80 ? 649 HOH A O   1 
HETATM 2108 O O   . HOH E 5 .   ? 17.549  -10.733 21.931 1.00 32.17 ? 650 HOH A O   1 
HETATM 2109 O O   . HOH E 5 .   ? -11.868 -12.714 17.911 1.00 47.95 ? 651 HOH A O   1 
HETATM 2110 O O   . HOH E 5 .   ? -5.754  -16.423 28.975 1.00 41.41 ? 652 HOH A O   1 
HETATM 2111 O O   . HOH E 5 .   ? 9.891   -0.318  33.304 1.00 46.40 ? 653 HOH A O   1 
HETATM 2112 O O   . HOH E 5 .   ? 16.110  -6.344  33.588 1.00 36.70 ? 654 HOH A O   1 
HETATM 2113 O O   . HOH E 5 .   ? 12.237  -19.136 16.868 1.00 20.77 ? 655 HOH A O   1 
HETATM 2114 O O   . HOH E 5 .   ? 3.912   -21.558 32.953 1.00 40.60 ? 656 HOH A O   1 
HETATM 2115 O O   . HOH E 5 .   ? 6.217   -22.203 20.935 1.00 25.78 ? 657 HOH A O   1 
HETATM 2116 O O   . HOH E 5 .   ? 5.183   -3.709  29.090 1.00 33.32 ? 658 HOH A O   1 
HETATM 2117 O O   . HOH E 5 .   ? 8.760   3.970   34.940 1.00 30.54 ? 659 HOH A O   1 
HETATM 2118 O O   . HOH E 5 .   ? -14.959 -0.808  21.350 1.00 49.42 ? 660 HOH A O   1 
HETATM 2119 O O   . HOH E 5 .   ? 7.390   -24.639 20.379 1.00 34.17 ? 661 HOH A O   1 
HETATM 2120 O O   . HOH E 5 .   ? 11.256  -4.124  1.961  1.00 37.84 ? 662 HOH A O   1 
HETATM 2121 O O   . HOH E 5 .   ? 16.159  -15.060 34.210 1.00 26.44 ? 663 HOH A O   1 
HETATM 2122 O O   . HOH E 5 .   ? -0.443  -18.736 16.823 1.00 33.45 ? 664 HOH A O   1 
HETATM 2123 O O   . HOH E 5 .   ? 13.985  5.794   15.764 1.00 32.68 ? 665 HOH A O   1 
HETATM 2124 O O   . HOH E 5 .   ? 3.328   15.638  32.787 1.00 45.98 ? 666 HOH A O   1 
HETATM 2125 O O   . HOH E 5 .   ? 1.072   -0.977  35.982 1.00 31.10 ? 667 HOH A O   1 
HETATM 2126 O O   . HOH E 5 .   ? -12.971 -1.801  28.721 1.00 32.80 ? 668 HOH A O   1 
HETATM 2127 O O   . HOH E 5 .   ? 1.537   -10.496 1.612  1.00 17.99 ? 669 HOH A O   1 
HETATM 2128 O O   . HOH E 5 .   ? 12.228  7.542   13.136 1.00 36.04 ? 670 HOH A O   1 
HETATM 2129 O O   . HOH E 5 .   ? 15.395  -22.725 28.449 1.00 42.77 ? 671 HOH A O   1 
HETATM 2130 O O   . HOH E 5 .   ? 17.000  -19.049 17.182 1.00 26.34 ? 672 HOH A O   1 
HETATM 2131 O O   . HOH E 5 .   ? -4.664  4.799   4.076  1.00 34.59 ? 673 HOH A O   1 
HETATM 2132 O O   . HOH E 5 .   ? -3.236  6.788   7.225  1.00 35.57 ? 674 HOH A O   1 
HETATM 2133 O O   . HOH E 5 .   ? -4.336  -1.210  10.439 1.00 28.67 ? 675 HOH A O   1 
HETATM 2134 O O   . HOH E 5 .   ? -4.032  16.588  14.870 1.00 35.93 ? 676 HOH A O   1 
HETATM 2135 O O   . HOH E 5 .   ? 0.551   -21.505 28.789 1.00 45.15 ? 677 HOH A O   1 
HETATM 2136 O O   . HOH E 5 .   ? -7.732  16.276  34.369 1.00 54.41 ? 678 HOH A O   1 
HETATM 2137 O O   . HOH E 5 .   ? 6.925   -2.682  27.198 1.00 34.23 ? 679 HOH A O   1 
HETATM 2138 O O   . HOH E 5 .   ? 13.230  -23.916 25.236 1.00 38.87 ? 680 HOH A O   1 
HETATM 2139 O O   . HOH E 5 .   ? -10.364 -19.413 12.335 1.00 39.46 ? 681 HOH A O   1 
HETATM 2140 O O   . HOH E 5 .   ? 4.997   -4.960  0.144  1.00 33.55 ? 682 HOH A O   1 
HETATM 2141 O O   . HOH E 5 .   ? 11.550  -24.989 38.822 1.00 39.13 ? 683 HOH A O   1 
HETATM 2142 O O   . HOH E 5 .   ? 10.879  -9.545  34.495 1.00 24.62 ? 684 HOH A O   1 
HETATM 2143 O O   . HOH E 5 .   ? 13.703  -16.166 14.139 1.00 32.59 ? 685 HOH A O   1 
HETATM 2144 O O   . HOH E 5 .   ? 19.539  -21.146 19.032 1.00 19.41 ? 686 HOH A O   1 
HETATM 2145 O O   . HOH E 5 .   ? 9.456   -5.834  17.539 1.00 24.35 ? 687 HOH A O   1 
HETATM 2146 O O   . HOH E 5 .   ? 0.047   -7.645  2.600  1.00 25.27 ? 688 HOH A O   1 
HETATM 2147 O O   . HOH E 5 .   ? -3.281  -14.293 27.024 1.00 28.47 ? 689 HOH A O   1 
HETATM 2148 O O   . HOH E 5 .   ? 14.177  -8.282  34.970 1.00 33.42 ? 690 HOH A O   1 
HETATM 2149 O O   . HOH E 5 .   ? 4.901   10.175  30.579 1.00 28.63 ? 691 HOH A O   1 
HETATM 2150 O O   . HOH E 5 .   ? 11.823  -13.909 4.342  1.00 41.63 ? 692 HOH A O   1 
HETATM 2151 O O   . HOH E 5 .   ? -16.578 10.279  12.629 1.00 39.78 ? 693 HOH A O   1 
HETATM 2152 O O   . HOH E 5 .   ? 10.813  -9.163  2.972  1.00 40.85 ? 694 HOH A O   1 
HETATM 2153 O O   . HOH E 5 .   ? -9.395  9.779   32.771 1.00 38.97 ? 695 HOH A O   1 
HETATM 2154 O O   . HOH E 5 .   ? -9.201  -2.501  11.415 1.00 26.83 ? 696 HOH A O   1 
HETATM 2155 O O   . HOH E 5 .   ? -8.522  1.895   11.951 1.00 38.65 ? 697 HOH A O   1 
HETATM 2156 O O   . HOH E 5 .   ? 16.149  -3.558  29.714 1.00 41.00 ? 698 HOH A O   1 
HETATM 2157 O O   . HOH E 5 .   ? 11.000  8.573   24.029 1.00 23.51 ? 699 HOH A O   1 
HETATM 2158 O O   . HOH E 5 .   ? 15.126  0.723   24.076 1.00 33.13 ? 700 HOH A O   1 
HETATM 2159 O O   . HOH E 5 .   ? 6.150   -24.244 13.757 1.00 43.20 ? 701 HOH A O   1 
HETATM 2160 O O   . HOH E 5 .   ? 3.660   -20.543 30.102 1.00 42.53 ? 702 HOH A O   1 
HETATM 2161 O O   . HOH E 5 .   ? -5.705  9.764   33.965 1.00 30.88 ? 703 HOH A O   1 
HETATM 2162 O O   . HOH E 5 .   ? 7.773   -9.050  6.363  1.00 26.12 ? 704 HOH A O   1 
HETATM 2163 O O   . HOH E 5 .   ? 10.928  -0.719  8.299  1.00 31.17 ? 705 HOH A O   1 
HETATM 2164 O O   . HOH E 5 .   ? 8.673   -3.403  -0.439 1.00 32.37 ? 706 HOH A O   1 
HETATM 2165 O O   . HOH E 5 .   ? 10.035  -3.941  34.765 1.00 33.19 ? 707 HOH A O   1 
HETATM 2166 O O   . HOH E 5 .   ? -16.406 0.331   19.398 1.00 35.28 ? 708 HOH A O   1 
HETATM 2167 O O   . HOH E 5 .   ? 2.189   0.344   9.672  1.00 22.65 ? 709 HOH A O   1 
HETATM 2168 O O   . HOH E 5 .   ? 6.732   -23.926 44.878 1.00 45.72 ? 710 HOH A O   1 
HETATM 2169 O O   . HOH E 5 .   ? 17.253  -8.429  4.547  1.00 33.75 ? 711 HOH A O   1 
HETATM 2170 O O   . HOH E 5 .   ? -12.317 6.302   22.553 1.00 31.13 ? 712 HOH A O   1 
HETATM 2171 O O   . HOH E 5 .   ? -7.743  -21.089 19.197 1.00 54.83 ? 713 HOH A O   1 
HETATM 2172 O O   . HOH E 5 .   ? 13.166  -20.725 25.118 1.00 33.95 ? 714 HOH A O   1 
HETATM 2173 O O   . HOH E 5 .   ? -12.347 5.765   8.733  1.00 36.69 ? 715 HOH A O   1 
HETATM 2174 O O   . HOH E 5 .   ? 4.293   -24.188 16.382 1.00 31.95 ? 716 HOH A O   1 
HETATM 2175 O O   . HOH E 5 .   ? -9.063  -8.774  29.002 1.00 35.42 ? 717 HOH A O   1 
HETATM 2176 O O   . HOH E 5 .   ? 0.440   0.464   7.416  1.00 41.70 ? 718 HOH A O   1 
HETATM 2177 O O   . HOH E 5 .   ? -10.397 -12.528 21.677 1.00 35.26 ? 719 HOH A O   1 
HETATM 2178 O O   . HOH E 5 .   ? 0.405   -21.454 10.046 1.00 29.43 ? 720 HOH A O   1 
HETATM 2179 O O   . HOH E 5 .   ? -12.793 14.598  18.304 1.00 41.58 ? 721 HOH A O   1 
HETATM 2180 O O   . HOH E 5 .   ? 1.756   5.760   41.326 1.00 40.91 ? 722 HOH A O   1 
HETATM 2181 O O   . HOH E 5 .   ? 14.280  3.857   17.880 1.00 33.04 ? 723 HOH A O   1 
HETATM 2182 O O   . HOH E 5 .   ? -10.255 -0.127  10.537 1.00 41.66 ? 724 HOH A O   1 
HETATM 2183 O O   . HOH E 5 .   ? -7.344  -12.973 33.304 1.00 53.94 ? 725 HOH A O   1 
HETATM 2184 O O   . HOH E 5 .   ? -5.568  6.862   5.564  1.00 43.35 ? 726 HOH A O   1 
HETATM 2185 O O   . HOH E 5 .   ? -6.653  -0.088  11.262 1.00 53.45 ? 727 HOH A O   1 
HETATM 2186 O O   . HOH E 5 .   ? -10.738 3.532   8.776  1.00 38.11 ? 728 HOH A O   1 
HETATM 2187 O O   . HOH E 5 .   ? -8.477  -3.381  25.010 1.00 23.96 ? 729 HOH A O   1 
HETATM 2188 O O   . HOH E 5 .   ? 1.118   -1.118  39.747 0.50 54.93 ? 730 HOH A O   1 
HETATM 2189 O O   . HOH E 5 .   ? 0.173   18.524  31.818 1.00 45.64 ? 731 HOH A O   1 
HETATM 2190 O O   . HOH E 5 .   ? 1.089   0.898   37.823 1.00 38.86 ? 732 HOH A O   1 
HETATM 2191 O O   . HOH E 5 .   ? -12.090 -5.414  27.495 1.00 42.23 ? 733 HOH A O   1 
HETATM 2192 O O   . HOH E 5 .   ? 14.644  -5.920  11.341 1.00 45.01 ? 734 HOH A O   1 
HETATM 2193 O O   . HOH E 5 .   ? 18.706  -20.756 12.474 1.00 54.88 ? 735 HOH A O   1 
HETATM 2194 O O   . HOH E 5 .   ? -9.612  -20.799 22.441 1.00 42.91 ? 736 HOH A O   1 
HETATM 2195 O O   . HOH E 5 .   ? 10.885  -7.104  15.624 1.00 29.37 ? 737 HOH A O   1 
HETATM 2196 O O   . HOH E 5 .   ? 14.357  -11.803 4.318  1.00 41.68 ? 738 HOH A O   1 
HETATM 2197 O O   . HOH E 5 .   ? 5.499   -18.363 44.956 1.00 34.88 ? 739 HOH A O   1 
HETATM 2198 O O   . HOH E 5 .   ? -6.679  -5.681  31.984 1.00 49.96 ? 740 HOH A O   1 
HETATM 2199 O O   . HOH E 5 .   ? 12.519  -2.202  9.767  1.00 35.25 ? 741 HOH A O   1 
HETATM 2200 O O   . HOH E 5 .   ? -7.589  16.401  26.850 1.00 37.63 ? 742 HOH A O   1 
HETATM 2201 O O   . HOH E 5 .   ? -4.353  17.782  29.320 1.00 55.24 ? 743 HOH A O   1 
HETATM 2202 O O   . HOH E 5 .   ? 14.655  -17.497 38.922 1.00 42.55 ? 744 HOH A O   1 
HETATM 2203 O O   . HOH E 5 .   ? -1.541  16.835  13.763 1.00 51.31 ? 745 HOH A O   1 
HETATM 2204 O O   . HOH E 5 .   ? 20.883  -13.505 12.584 1.00 49.61 ? 746 HOH A O   1 
HETATM 2205 O O   . HOH E 5 .   ? 12.931  -8.285  17.181 1.00 30.86 ? 747 HOH A O   1 
HETATM 2206 O O   . HOH E 5 .   ? -4.572  4.572   39.752 0.50 29.84 ? 748 HOH A O   1 
HETATM 2207 O O   . HOH E 5 .   ? -7.146  -18.730 7.659  1.00 48.78 ? 749 HOH A O   1 
HETATM 2208 O O   . HOH E 5 .   ? -1.579  -20.396 18.621 1.00 33.75 ? 750 HOH A O   1 
HETATM 2209 O O   . HOH E 5 .   ? 12.955  -8.495  1.532  1.00 39.90 ? 751 HOH A O   1 
HETATM 2210 O O   . HOH E 5 .   ? -15.857 1.027   15.923 1.00 42.48 ? 752 HOH A O   1 
HETATM 2211 O O   . HOH E 5 .   ? -5.975  -13.346 27.697 1.00 31.12 ? 753 HOH A O   1 
HETATM 2212 O O   . HOH E 5 .   ? 8.307   -23.301 11.058 1.00 48.02 ? 754 HOH A O   1 
HETATM 2213 O O   . HOH E 5 .   ? 6.041   -25.734 18.191 1.00 41.68 ? 755 HOH A O   1 
HETATM 2214 O O   . HOH E 5 .   ? 16.393  -6.301  20.018 1.00 53.76 ? 756 HOH A O   1 
HETATM 2215 O O   . HOH E 5 .   ? 5.068   -9.053  40.767 1.00 44.58 ? 757 HOH A O   1 
HETATM 2216 O O   . HOH E 5 .   ? -5.608  -14.960 31.675 1.00 43.98 ? 758 HOH A O   1 
HETATM 2217 O O   . HOH E 5 .   ? 13.168  -19.560 7.114  1.00 41.47 ? 759 HOH A O   1 
HETATM 2218 O O   . HOH E 5 .   ? -2.461  17.849  31.772 1.00 49.04 ? 760 HOH A O   1 
HETATM 2219 O O   . HOH E 5 .   ? 6.754   -9.310  3.568  1.00 29.68 ? 761 HOH A O   1 
HETATM 2220 O O   . HOH E 5 .   ? -13.178 8.699   21.364 1.00 44.60 ? 762 HOH A O   1 
HETATM 2221 O O   . HOH E 5 .   ? 18.257  -14.903 35.842 1.00 37.64 ? 763 HOH A O   1 
HETATM 2222 O O   . HOH E 5 .   ? 5.498   -11.242 1.217  1.00 35.02 ? 764 HOH A O   1 
HETATM 2223 O O   . HOH E 5 .   ? 17.795  -23.322 18.280 1.00 31.16 ? 765 HOH A O   1 
HETATM 2224 O O   . HOH E 5 .   ? 2.973   -12.647 0.697  1.00 28.93 ? 766 HOH A O   1 
HETATM 2225 O O   . HOH F 5 .   ? -2.049  -2.217  1.035  1.00 30.05 ? 201 HOH L O   1 
HETATM 2226 O O   . HOH F 5 .   ? 9.765   13.731  -0.555 1.00 40.93 ? 202 HOH L O   1 
HETATM 2227 O O   . HOH F 5 .   ? -0.398  -0.154  -0.438 0.50 13.87 ? 203 HOH L O   1 
HETATM 2228 O O   . HOH F 5 .   ? -9.644  12.921  5.486  1.00 35.77 ? 204 HOH L O   1 
HETATM 2229 O O   . HOH F 5 .   ? -3.105  6.227   1.869  1.00 27.21 ? 205 HOH L O   1 
HETATM 2230 O O   . HOH F 5 .   ? 6.951   7.463   0.525  0.50 20.90 ? 206 HOH L O   1 
HETATM 2231 O O   . HOH F 5 .   ? -5.993  12.769  -0.638 1.00 29.56 ? 207 HOH L O   1 
HETATM 2232 O O   . HOH F 5 .   ? 12.600  10.354  -5.396 1.00 47.72 ? 208 HOH L O   1 
HETATM 2233 O O   . HOH F 5 .   ? 6.511   16.483  6.378  1.00 41.43 ? 209 HOH L O   1 
HETATM 2234 O O   . HOH F 5 .   ? -2.320  9.223   6.657  1.00 36.87 ? 210 HOH L O   1 
HETATM 2235 O O   . HOH F 5 .   ? -1.238  20.991  3.629  1.00 44.82 ? 211 HOH L O   1 
HETATM 2236 O O   . HOH F 5 .   ? 4.122   6.425   -2.926 1.00 30.61 ? 212 HOH L O   1 
HETATM 2237 O O   . HOH F 5 .   ? 8.641   15.289  4.552  1.00 41.28 ? 213 HOH L O   1 
HETATM 2238 O O   . HOH F 5 .   ? -7.552  -13.753 7.113  1.00 28.68 ? 214 HOH L O   1 
HETATM 2239 O O   . HOH F 5 .   ? 0.678   11.776  -3.868 1.00 40.53 ? 215 HOH L O   1 
HETATM 2240 O O   . HOH F 5 .   ? 3.486   15.018  2.599  1.00 38.35 ? 216 HOH L O   1 
HETATM 2241 O O   . HOH F 5 .   ? 7.789   9.018   -9.486 1.00 39.65 ? 217 HOH L O   1 
HETATM 2242 O O   . HOH F 5 .   ? -7.151  3.898   0.759  1.00 41.97 ? 218 HOH L O   1 
HETATM 2243 O O   . HOH F 5 .   ? -2.402  10.007  -6.362 1.00 26.84 ? 219 HOH L O   1 
HETATM 2244 O O   . HOH F 5 .   ? 3.792   11.555  -5.106 1.00 38.68 ? 220 HOH L O   1 
HETATM 2245 O O   . HOH F 5 .   ? -1.571  10.298  -0.302 1.00 26.66 ? 221 HOH L O   1 
HETATM 2246 O O   . HOH F 5 .   ? 0.602   14.142  3.384  1.00 28.51 ? 222 HOH L O   1 
HETATM 2247 O O   . HOH F 5 .   ? -15.151 -9.255  6.935  1.00 45.41 ? 223 HOH L O   1 
HETATM 2248 O O   . HOH F 5 .   ? -13.120 -11.279 4.438  1.00 43.30 ? 224 HOH L O   1 
HETATM 2249 O O   . HOH F 5 .   ? -7.833  2.532   -1.612 1.00 28.68 ? 225 HOH L O   1 
HETATM 2250 O O   . HOH F 5 .   ? -5.688  -15.712 -0.263 1.00 42.72 ? 226 HOH L O   1 
HETATM 2251 O O   . HOH F 5 .   ? -1.526  18.756  8.899  1.00 44.36 ? 227 HOH L O   1 
HETATM 2252 O O   . HOH F 5 .   ? -6.749  2.857   3.242  1.00 37.46 ? 228 HOH L O   1 
HETATM 2253 O O   . HOH F 5 .   ? 2.228   18.426  5.635  1.00 35.92 ? 229 HOH L O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   216 ?   ?   ?   A . n 
A 1 2   ARG 2   217 217 ARG ARG A . n 
A 1 3   SER 3   218 218 SER SER A . n 
A 1 4   VAL 4   219 219 VAL VAL A . n 
A 1 5   ALA 5   220 220 ALA ALA A . n 
A 1 6   SER 6   221 221 SER SER A . n 
A 1 7   SER 7   222 222 SER SER A . n 
A 1 8   LYS 8   223 223 LYS LYS A . n 
A 1 9   LEU 9   224 224 LEU LEU A . n 
A 1 10  TRP 10  225 225 TRP TRP A . n 
A 1 11  MET 11  226 226 MET MET A . n 
A 1 12  LEU 12  227 227 LEU LEU A . n 
A 1 13  GLU 13  228 228 GLU GLU A . n 
A 1 14  PHE 14  229 229 PHE PHE A . n 
A 1 15  SER 15  230 230 SER SER A . n 
A 1 16  ALA 16  231 231 ALA ALA A . n 
A 1 17  PHE 17  232 232 PHE PHE A . n 
A 1 18  LEU 18  233 233 LEU LEU A . n 
A 1 19  GLU 19  234 234 GLU GLU A . n 
A 1 20  GLN 20  235 235 GLN GLN A . n 
A 1 21  GLN 21  236 236 GLN GLN A . n 
A 1 22  GLN 22  237 237 GLN GLN A . n 
A 1 23  ASP 23  238 238 ASP ASP A . n 
A 1 24  PRO 24  239 239 PRO PRO A . n 
A 1 25  ASP 25  240 240 ASP ASP A . n 
A 1 26  THR 26  241 241 THR THR A . n 
A 1 27  TYR 27  242 242 TYR TYR A . n 
A 1 28  ASN 28  243 243 ASN ASN A . n 
A 1 29  LYS 29  244 244 LYS LYS A . n 
A 1 30  HIS 30  245 245 HIS HIS A . n 
A 1 31  LEU 31  246 246 LEU LEU A . n 
A 1 32  PHE 32  247 247 PHE PHE A . n 
A 1 33  VAL 33  248 248 VAL VAL A . n 
A 1 34  HIS 34  249 249 HIS HIS A . n 
A 1 35  ILE 35  250 250 ILE ILE A . n 
A 1 36  GLY 36  251 251 GLY GLY A . n 
A 1 37  GLN 37  252 ?   ?   ?   A . n 
A 1 38  SER 38  253 ?   ?   ?   A . n 
A 1 39  SER 39  254 ?   ?   ?   A . n 
A 1 40  PRO 40  255 ?   ?   ?   A . n 
A 1 41  SER 41  256 ?   ?   ?   A . n 
A 1 42  TYR 42  257 ?   ?   ?   A . n 
A 1 43  SER 43  258 ?   ?   ?   A . n 
A 1 44  ASP 44  259 ?   ?   ?   A . n 
A 1 45  PRO 45  260 ?   ?   ?   A . n 
A 1 46  TYR 46  261 ?   ?   ?   A . n 
A 1 47  LEU 47  262 262 LEU LEU A . n 
A 1 48  GLU 48  263 263 GLU GLU A . n 
A 1 49  ALA 49  264 264 ALA ALA A . n 
A 1 50  VAL 50  265 265 VAL VAL A . n 
A 1 51  ASP 51  266 266 ASP ASP A . n 
A 1 52  ILE 52  267 267 ILE ILE A . n 
A 1 53  ARG 53  268 268 ARG ARG A . n 
A 1 54  GLN 54  269 269 GLN GLN A . n 
A 1 55  ILE 55  270 270 ILE ILE A . n 
A 1 56  TYR 56  271 271 TYR TYR A . n 
A 1 57  ASP 57  272 272 ASP ASP A . n 
A 1 58  LYS 58  273 273 LYS LYS A . n 
A 1 59  PHE 59  274 274 PHE PHE A . n 
A 1 60  PRO 60  275 275 PRO PRO A . n 
A 1 61  GLU 61  276 276 GLU GLU A . n 
A 1 62  LYS 62  277 277 LYS LYS A . n 
A 1 63  LYS 63  278 278 LYS LYS A . n 
A 1 64  GLY 64  279 279 GLY GLY A . n 
A 1 65  GLY 65  280 280 GLY GLY A . n 
A 1 66  LEU 66  281 281 LEU LEU A . n 
A 1 67  LYS 67  282 282 LYS LYS A . n 
A 1 68  ASP 68  283 283 ASP ASP A . n 
A 1 69  LEU 69  284 284 LEU LEU A . n 
A 1 70  PHE 70  285 285 PHE PHE A . n 
A 1 71  GLU 71  286 286 GLU GLU A . n 
A 1 72  ARG 72  287 287 ARG ARG A . n 
A 1 73  GLY 73  288 288 GLY GLY A . n 
A 1 74  PRO 74  289 289 PRO PRO A . n 
A 1 75  SER 75  290 290 SER SER A . n 
A 1 76  ASN 76  291 291 ASN ASN A . n 
A 1 77  ALA 77  292 292 ALA ALA A . n 
A 1 78  PHE 78  293 293 PHE PHE A . n 
A 1 79  PHE 79  294 294 PHE PHE A . n 
A 1 80  LEU 80  295 295 LEU LEU A . n 
A 1 81  VAL 81  296 296 VAL VAL A . n 
A 1 82  LYS 82  297 297 LYS LYS A . n 
A 1 83  PHE 83  298 298 PHE PHE A . n 
A 1 84  TRP 84  299 299 TRP TRP A . n 
A 1 85  ALA 85  300 300 ALA ALA A . n 
A 1 86  ASP 86  301 301 ASP ASP A . n 
A 1 87  LEU 87  302 302 LEU LEU A . n 
A 1 88  ASN 88  303 303 ASN ASN A . n 
A 1 89  THR 89  304 304 THR THR A . n 
A 1 90  ASN 90  305 305 ASN ASN A . n 
A 1 91  ILE 91  306 ?   ?   ?   A . n 
A 1 92  GLU 92  307 ?   ?   ?   A . n 
A 1 93  ASP 93  308 ?   ?   ?   A . n 
A 1 94  GLU 94  309 ?   ?   ?   A . n 
A 1 95  GLY 95  310 310 GLY GLY A . n 
A 1 96  SER 96  311 311 SER SER A . n 
A 1 97  SER 97  312 312 SER SER A . n 
A 1 98  PHE 98  313 313 PHE PHE A . n 
A 1 99  TYR 99  314 314 TYR TYR A . n 
A 1 100 GLY 100 315 315 GLY GLY A . n 
A 1 101 VAL 101 316 316 VAL VAL A . n 
A 1 102 SER 102 317 317 SER SER A . n 
A 1 103 SER 103 318 318 SER SER A . n 
A 1 104 GLN 104 319 319 GLN GLN A . n 
A 1 105 TYR 105 320 320 TYR TYR A . n 
A 1 106 GLU 106 321 321 GLU GLU A . n 
A 1 107 SER 107 322 322 SER SER A . n 
A 1 108 PRO 108 323 323 PRO PRO A . n 
A 1 109 GLU 109 324 324 GLU GLU A . n 
A 1 110 ASN 110 325 325 ASN ASN A . n 
A 1 111 MET 111 326 326 MET MET A . n 
A 1 112 ILE 112 327 327 ILE ILE A . n 
A 1 113 ILE 113 328 328 ILE ILE A . n 
A 1 114 THR 114 329 329 THR THR A . n 
A 1 115 CYS 115 330 330 CYS CYS A . n 
A 1 116 SER 116 331 331 SER SER A . n 
A 1 117 THR 117 332 332 THR THR A . n 
A 1 118 LYS 118 333 333 LYS LYS A . n 
A 1 119 VAL 119 334 334 VAL VAL A . n 
A 1 120 CYS 120 335 335 CYS CYS A . n 
A 1 121 SER 121 336 336 SER SER A . n 
A 1 122 PHE 122 337 337 PHE PHE A . n 
A 1 123 GLY 123 338 338 GLY GLY A . n 
A 1 124 LYS 124 339 339 LYS LYS A . n 
A 1 125 GLN 125 340 340 GLN GLN A . n 
A 1 126 VAL 126 341 341 VAL VAL A . n 
A 1 127 VAL 127 342 342 VAL VAL A . n 
A 1 128 GLU 128 343 343 GLU GLU A . n 
A 1 129 LYS 129 344 344 LYS LYS A . n 
A 1 130 VAL 130 345 345 VAL VAL A . n 
A 1 131 GLU 131 346 346 GLU GLU A . n 
A 1 132 THR 132 347 347 THR THR A . n 
A 1 133 GLU 133 348 348 GLU GLU A . n 
A 1 134 TYR 134 349 349 TYR TYR A . n 
A 1 135 ALA 135 350 350 ALA ALA A . n 
A 1 136 ARG 136 351 351 ARG ARG A . n 
A 1 137 TYR 137 352 352 TYR TYR A . n 
A 1 138 GLU 138 353 353 GLU GLU A . n 
A 1 139 ASN 139 354 354 ASN ASN A . n 
A 1 140 GLY 140 355 355 GLY GLY A . n 
A 1 141 HIS 141 356 356 HIS HIS A . n 
A 1 142 TYR 142 357 357 TYR TYR A . n 
A 1 143 SER 143 358 358 SER SER A . n 
A 1 144 TYR 144 359 359 TYR TYR A . n 
A 1 145 ARG 145 360 360 ARG ARG A . n 
A 1 146 ILE 146 361 361 ILE ILE A . n 
A 1 147 HIS 147 362 362 HIS HIS A . n 
A 1 148 ARG 148 363 363 ARG ARG A . n 
A 1 149 SER 149 364 364 SER SER A . n 
A 1 150 PRO 150 365 365 PRO PRO A . n 
A 1 151 LEU 151 366 366 LEU LEU A . n 
A 1 152 CYS 152 367 367 CYS CYS A . n 
A 1 153 GLU 153 368 368 GLU GLU A . n 
A 1 154 TYR 154 369 369 TYR TYR A . n 
A 1 155 MET 155 370 370 MET MET A . n 
A 1 156 ILE 156 371 371 ILE ILE A . n 
A 1 157 ASN 157 372 372 ASN ASN A . n 
A 1 158 PHE 158 373 373 PHE PHE A . n 
A 1 159 ILE 159 374 374 ILE ILE A . n 
A 1 160 HIS 160 375 375 HIS HIS A . n 
A 1 161 LYS 161 376 376 LYS LYS A . n 
A 1 162 LEU 162 377 377 LEU LEU A . n 
A 1 163 LYS 163 378 378 LYS LYS A . n 
A 1 164 HIS 164 379 379 HIS HIS A . n 
A 1 165 LEU 165 380 380 LEU LEU A . n 
A 1 166 PRO 166 381 381 PRO PRO A . n 
A 1 167 GLU 167 382 382 GLU GLU A . n 
A 1 168 LYS 168 383 383 LYS LYS A . n 
A 1 169 TYR 169 384 384 TYR TYR A . n 
A 1 170 MET 170 385 385 MET MET A . n 
A 1 171 MET 171 386 386 MET MET A . n 
A 1 172 ASN 172 387 387 ASN ASN A . n 
A 1 173 SER 173 388 388 SER SER A . n 
A 1 174 VAL 174 389 389 VAL VAL A . n 
A 1 175 LEU 175 390 390 LEU LEU A . n 
A 1 176 GLU 176 391 391 GLU GLU A . n 
A 1 177 ASN 177 392 392 ASN ASN A . n 
A 1 178 PHE 178 393 393 PHE PHE A . n 
A 1 179 THR 179 394 394 THR THR A . n 
A 1 180 ILE 180 395 395 ILE ILE A . n 
A 1 181 LEU 181 396 396 LEU LEU A . n 
A 1 182 GLN 182 397 397 GLN GLN A . n 
A 1 183 VAL 183 398 398 VAL VAL A . n 
A 1 184 VAL 184 399 399 VAL VAL A . n 
A 1 185 THR 185 400 400 THR THR A . n 
A 1 186 ASN 186 401 401 ASN ASN A . n 
A 1 187 ARG 187 402 402 ARG ARG A . n 
A 1 188 ASP 188 403 403 ASP ASP A . n 
A 1 189 THR 189 404 404 THR THR A . n 
A 1 190 GLN 190 405 405 GLN GLN A . n 
A 1 191 GLU 191 406 406 GLU GLU A . n 
A 1 192 THR 192 407 407 THR THR A . n 
A 1 193 LEU 193 408 408 LEU LEU A . n 
A 1 194 LEU 194 409 409 LEU LEU A . n 
A 1 195 CYS 195 410 410 CYS CYS A . n 
A 1 196 ILE 196 411 411 ILE ILE A . n 
A 1 197 ALA 197 412 412 ALA ALA A . n 
A 1 198 TYR 198 413 413 TYR TYR A . n 
A 1 199 VAL 199 414 414 VAL VAL A . n 
A 1 200 PHE 200 415 415 PHE PHE A . n 
A 1 201 GLU 201 416 416 GLU GLU A . n 
A 1 202 VAL 202 417 417 VAL VAL A . n 
A 1 203 SER 203 418 418 SER SER A . n 
A 1 204 ALA 204 419 419 ALA ALA A . n 
A 1 205 SER 205 420 420 SER SER A . n 
A 1 206 GLU 206 421 421 GLU GLU A . n 
A 1 207 HIS 207 422 422 HIS HIS A . n 
A 1 208 GLY 208 423 423 GLY GLY A . n 
A 1 209 ALA 209 424 424 ALA ALA A . n 
A 1 210 GLN 210 425 425 GLN GLN A . n 
A 1 211 HIS 211 426 426 HIS HIS A . n 
A 1 212 HIS 212 427 427 HIS HIS A . n 
A 1 213 ILE 213 428 428 ILE ILE A . n 
A 1 214 TYR 214 429 429 TYR TYR A . n 
A 1 215 ARG 215 430 430 ARG ARG A . n 
A 1 216 LEU 216 431 431 LEU LEU A . n 
A 1 217 VAL 217 432 432 VAL VAL A . n 
A 1 218 LYS 218 433 433 LYS LYS A . n 
A 1 219 GLU 219 434 434 GLU GLU A . n 
B 2 1   ASP 1   60  60  ASP ASP L . n 
B 2 2   SER 2   61  61  SER SER L . n 
B 2 3   GLU 3   62  62  GLU GLU L . n 
B 2 4   THR 4   63  63  THR THR L . n 
B 2 5   ASP 5   64  64  ASP ASP L . n 
B 2 6   LEU 6   65  65  LEU LEU L . n 
B 2 7   GLU 7   66  66  GLU GLU L . n 
B 2 8   ALA 8   67  67  ALA ALA L . n 
B 2 9   LEU 9   68  68  LEU LEU L . n 
B 2 10  PHE 10  69  69  PHE PHE L . n 
B 2 11  ASN 11  70  70  ASN ASN L . n 
B 2 12  ALA 12  71  71  ALA ALA L . n 
B 2 13  VAL 13  72  72  VAL VAL L . n 
B 2 14  MET 14  73  73  MET MET L . n 
B 2 15  ASN 15  74  74  ASN ASN L . n 
B 2 16  PRO 16  75  75  PRO PRO L . n 
B 2 17  LYS 17  76  76  LYS LYS L . n 
B 2 18  THR 18  77  77  THR THR L . n 
B 2 19  ALA 19  78  78  ALA ALA L . n 
B 2 20  ASN 20  79  79  ASN ASN L . n 
B 2 21  VAL 21  80  80  VAL VAL L . n 
B 2 22  PRO 22  81  81  PRO PRO L . n 
B 2 23  GLN 23  82  82  GLN GLN L . n 
B 2 24  THR 24  83  83  THR THR L . n 
B 2 25  VAL 25  84  84  VAL VAL L . n 
B 2 26  PRO 26  85  85  PRO PRO L . n 
B 2 27  MET 27  86  86  MET MET L . n 
B 2 28  ARG 28  87  87  ARG ARG L . n 
B 2 29  LEU 29  88  88  LEU LEU L . n 
B 2 30  ARG 30  89  89  ARG ARG L . n 
B 2 31  LYS 31  90  90  LYS LYS L . n 
B 2 32  LEU 32  91  91  LEU LEU L . n 
B 2 33  PRO 33  92  92  PRO PRO L . n 
B 2 34  ASP 34  93  93  ASP ASP L . n 
B 2 35  SER 35  94  94  SER SER L . n 
B 2 36  PHE 36  95  95  PHE PHE L . n 
B 2 37  PHE 37  96  96  PHE PHE L . n 
B 2 38  LYS 38  97  97  LYS LYS L . n 
B 2 39  PRO 39  98  98  PRO PRO L . n 
B 2 40  PRO 40  99  99  PRO PRO L . n 
B 2 41  GLU 41  100 ?   ?   ?   L . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 MYR 1   501 1   MYR MYR A . 
D 4 GOL 1   502 1   GOL GOL A . 
E 5 HOH 1   601 66  HOH HOH A . 
E 5 HOH 2   602 71  HOH HOH A . 
E 5 HOH 3   603 19  HOH HOH A . 
E 5 HOH 4   604 115 HOH HOH A . 
E 5 HOH 5   605 95  HOH HOH A . 
E 5 HOH 6   606 76  HOH HOH A . 
E 5 HOH 7   607 123 HOH HOH A . 
E 5 HOH 8   608 96  HOH HOH A . 
E 5 HOH 9   609 9   HOH HOH A . 
E 5 HOH 10  610 5   HOH HOH A . 
E 5 HOH 11  611 74  HOH HOH A . 
E 5 HOH 12  612 167 HOH HOH A . 
E 5 HOH 13  613 109 HOH HOH A . 
E 5 HOH 14  614 159 HOH HOH A . 
E 5 HOH 15  615 21  HOH HOH A . 
E 5 HOH 16  616 13  HOH HOH A . 
E 5 HOH 17  617 65  HOH HOH A . 
E 5 HOH 18  618 53  HOH HOH A . 
E 5 HOH 19  619 29  HOH HOH A . 
E 5 HOH 20  620 125 HOH HOH A . 
E 5 HOH 21  621 17  HOH HOH A . 
E 5 HOH 22  622 63  HOH HOH A . 
E 5 HOH 23  623 182 HOH HOH A . 
E 5 HOH 24  624 68  HOH HOH A . 
E 5 HOH 25  625 60  HOH HOH A . 
E 5 HOH 26  626 166 HOH HOH A . 
E 5 HOH 27  627 23  HOH HOH A . 
E 5 HOH 28  628 18  HOH HOH A . 
E 5 HOH 29  629 118 HOH HOH A . 
E 5 HOH 30  630 92  HOH HOH A . 
E 5 HOH 31  631 133 HOH HOH A . 
E 5 HOH 32  632 7   HOH HOH A . 
E 5 HOH 33  633 164 HOH HOH A . 
E 5 HOH 34  634 84  HOH HOH A . 
E 5 HOH 35  635 151 HOH HOH A . 
E 5 HOH 36  636 69  HOH HOH A . 
E 5 HOH 37  637 170 HOH HOH A . 
E 5 HOH 38  638 82  HOH HOH A . 
E 5 HOH 39  639 2   HOH HOH A . 
E 5 HOH 40  640 15  HOH HOH A . 
E 5 HOH 41  641 26  HOH HOH A . 
E 5 HOH 42  642 10  HOH HOH A . 
E 5 HOH 43  643 124 HOH HOH A . 
E 5 HOH 44  644 61  HOH HOH A . 
E 5 HOH 45  645 30  HOH HOH A . 
E 5 HOH 46  646 173 HOH HOH A . 
E 5 HOH 47  647 193 HOH HOH A . 
E 5 HOH 48  648 126 HOH HOH A . 
E 5 HOH 49  649 94  HOH HOH A . 
E 5 HOH 50  650 51  HOH HOH A . 
E 5 HOH 51  651 177 HOH HOH A . 
E 5 HOH 52  652 154 HOH HOH A . 
E 5 HOH 53  653 160 HOH HOH A . 
E 5 HOH 54  654 110 HOH HOH A . 
E 5 HOH 55  655 6   HOH HOH A . 
E 5 HOH 56  656 121 HOH HOH A . 
E 5 HOH 57  657 25  HOH HOH A . 
E 5 HOH 58  658 70  HOH HOH A . 
E 5 HOH 59  659 56  HOH HOH A . 
E 5 HOH 60  660 179 HOH HOH A . 
E 5 HOH 61  661 93  HOH HOH A . 
E 5 HOH 62  662 112 HOH HOH A . 
E 5 HOH 63  663 34  HOH HOH A . 
E 5 HOH 64  664 75  HOH HOH A . 
E 5 HOH 65  665 62  HOH HOH A . 
E 5 HOH 66  666 175 HOH HOH A . 
E 5 HOH 67  667 79  HOH HOH A . 
E 5 HOH 68  668 58  HOH HOH A . 
E 5 HOH 69  669 3   HOH HOH A . 
E 5 HOH 70  670 114 HOH HOH A . 
E 5 HOH 71  671 146 HOH HOH A . 
E 5 HOH 72  672 28  HOH HOH A . 
E 5 HOH 73  673 91  HOH HOH A . 
E 5 HOH 74  674 102 HOH HOH A . 
E 5 HOH 75  675 38  HOH HOH A . 
E 5 HOH 76  676 103 HOH HOH A . 
E 5 HOH 77  677 158 HOH HOH A . 
E 5 HOH 78  678 186 HOH HOH A . 
E 5 HOH 79  679 77  HOH HOH A . 
E 5 HOH 80  680 130 HOH HOH A . 
E 5 HOH 81  681 155 HOH HOH A . 
E 5 HOH 82  682 78  HOH HOH A . 
E 5 HOH 83  683 105 HOH HOH A . 
E 5 HOH 84  684 24  HOH HOH A . 
E 5 HOH 85  685 72  HOH HOH A . 
E 5 HOH 86  686 4   HOH HOH A . 
E 5 HOH 87  687 16  HOH HOH A . 
E 5 HOH 88  688 20  HOH HOH A . 
E 5 HOH 89  689 35  HOH HOH A . 
E 5 HOH 90  690 87  HOH HOH A . 
E 5 HOH 91  691 33  HOH HOH A . 
E 5 HOH 92  692 136 HOH HOH A . 
E 5 HOH 93  693 119 HOH HOH A . 
E 5 HOH 94  694 139 HOH HOH A . 
E 5 HOH 95  695 128 HOH HOH A . 
E 5 HOH 96  696 27  HOH HOH A . 
E 5 HOH 97  697 116 HOH HOH A . 
E 5 HOH 98  698 122 HOH HOH A . 
E 5 HOH 99  699 11  HOH HOH A . 
E 5 HOH 100 700 73  HOH HOH A . 
E 5 HOH 101 701 145 HOH HOH A . 
E 5 HOH 102 702 131 HOH HOH A . 
E 5 HOH 103 703 57  HOH HOH A . 
E 5 HOH 104 704 22  HOH HOH A . 
E 5 HOH 105 705 52  HOH HOH A . 
E 5 HOH 106 706 83  HOH HOH A . 
E 5 HOH 107 707 59  HOH HOH A . 
E 5 HOH 108 708 107 HOH HOH A . 
E 5 HOH 109 709 14  HOH HOH A . 
E 5 HOH 110 710 178 HOH HOH A . 
E 5 HOH 111 711 108 HOH HOH A . 
E 5 HOH 112 712 67  HOH HOH A . 
E 5 HOH 113 713 188 HOH HOH A . 
E 5 HOH 114 714 64  HOH HOH A . 
E 5 HOH 115 715 98  HOH HOH A . 
E 5 HOH 116 716 55  HOH HOH A . 
E 5 HOH 117 717 86  HOH HOH A . 
E 5 HOH 118 718 149 HOH HOH A . 
E 5 HOH 119 719 90  HOH HOH A . 
E 5 HOH 120 720 47  HOH HOH A . 
E 5 HOH 121 721 132 HOH HOH A . 
E 5 HOH 122 722 127 HOH HOH A . 
E 5 HOH 123 723 81  HOH HOH A . 
E 5 HOH 124 724 135 HOH HOH A . 
E 5 HOH 125 725 185 HOH HOH A . 
E 5 HOH 126 726 152 HOH HOH A . 
E 5 HOH 127 727 192 HOH HOH A . 
E 5 HOH 128 728 97  HOH HOH A . 
E 5 HOH 129 729 12  HOH HOH A . 
E 5 HOH 130 730 190 HOH HOH A . 
E 5 HOH 131 731 165 HOH HOH A . 
E 5 HOH 132 732 117 HOH HOH A . 
E 5 HOH 133 733 147 HOH HOH A . 
E 5 HOH 134 734 171 HOH HOH A . 
E 5 HOH 135 735 191 HOH HOH A . 
E 5 HOH 136 736 150 HOH HOH A . 
E 5 HOH 137 737 43  HOH HOH A . 
E 5 HOH 138 738 137 HOH HOH A . 
E 5 HOH 139 739 88  HOH HOH A . 
E 5 HOH 140 740 187 HOH HOH A . 
E 5 HOH 141 741 89  HOH HOH A . 
E 5 HOH 142 742 134 HOH HOH A . 
E 5 HOH 143 743 194 HOH HOH A . 
E 5 HOH 144 744 148 HOH HOH A . 
E 5 HOH 145 745 189 HOH HOH A . 
E 5 HOH 146 746 195 HOH HOH A . 
E 5 HOH 147 747 54  HOH HOH A . 
E 5 HOH 148 748 40  HOH HOH A . 
E 5 HOH 149 749 176 HOH HOH A . 
E 5 HOH 150 750 85  HOH HOH A . 
E 5 HOH 151 751 101 HOH HOH A . 
E 5 HOH 152 752 161 HOH HOH A . 
E 5 HOH 153 753 49  HOH HOH A . 
E 5 HOH 154 754 181 HOH HOH A . 
E 5 HOH 155 755 141 HOH HOH A . 
E 5 HOH 156 756 184 HOH HOH A . 
E 5 HOH 157 757 180 HOH HOH A . 
E 5 HOH 158 758 143 HOH HOH A . 
E 5 HOH 159 759 120 HOH HOH A . 
E 5 HOH 160 760 183 HOH HOH A . 
E 5 HOH 161 761 39  HOH HOH A . 
E 5 HOH 162 762 162 HOH HOH A . 
E 5 HOH 163 763 106 HOH HOH A . 
E 5 HOH 164 764 80  HOH HOH A . 
E 5 HOH 165 765 48  HOH HOH A . 
E 5 HOH 166 766 46  HOH HOH A . 
F 5 HOH 1   201 45  HOH HOH L . 
F 5 HOH 2   202 129 HOH HOH L . 
F 5 HOH 3   203 1   HOH HOH L . 
F 5 HOH 4   204 99  HOH HOH L . 
F 5 HOH 5   205 36  HOH HOH L . 
F 5 HOH 6   206 8   HOH HOH L . 
F 5 HOH 7   207 42  HOH HOH L . 
F 5 HOH 8   208 168 HOH HOH L . 
F 5 HOH 9   209 157 HOH HOH L . 
F 5 HOH 10  210 111 HOH HOH L . 
F 5 HOH 11  211 169 HOH HOH L . 
F 5 HOH 12  212 50  HOH HOH L . 
F 5 HOH 13  213 142 HOH HOH L . 
F 5 HOH 14  214 44  HOH HOH L . 
F 5 HOH 15  215 156 HOH HOH L . 
F 5 HOH 16  216 140 HOH HOH L . 
F 5 HOH 17  217 138 HOH HOH L . 
F 5 HOH 18  218 153 HOH HOH L . 
F 5 HOH 19  219 31  HOH HOH L . 
F 5 HOH 20  220 113 HOH HOH L . 
F 5 HOH 21  221 32  HOH HOH L . 
F 5 HOH 22  222 41  HOH HOH L . 
F 5 HOH 23  223 174 HOH HOH L . 
F 5 HOH 24  224 144 HOH HOH L . 
F 5 HOH 25  225 37  HOH HOH L . 
F 5 HOH 26  226 163 HOH HOH L . 
F 5 HOH 27  227 172 HOH HOH L . 
F 5 HOH 28  228 100 HOH HOH L . 
F 5 HOH 29  229 104 HOH HOH L . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3480  ? 
1 MORE         -17   ? 
1 'SSA (A^2)'  12530 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A HOH 730 ? E HOH . 
2 1 A HOH 748 ? E HOH . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2018-09-19 
2 'Structure model' 1 1 2018-10-31 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Data collection'     
2 2 'Structure model' 'Database references' 
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    2 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            citation 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_citation.journal_volume' 
2 2 'Structure model' '_citation.page_first'     
3 2 'Structure model' '_citation.page_last'      
# 
_phasing.method   MR 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? 'data reduction'  ? ? 'Wolfgang Kabsch'    Wolfgang.Kabsch@mpimf-heidelberg.mpg.de ?              ? ? ? ?          
http://www.mpimf-heidelberg.mpg.de/~kabsch/xds/                             ? XDS         ? ? package .    1 
? 'data scaling'    ? ? 'Wolfgang Kabsch'    ?                                       ?              ? ? ? ?          
http://www.mpimf-heidelberg.mpg.de/~kabsch/xds/html_doc/xscale_program.html ? XSCALE      ? ? package .    2 
? phasing           ? ? 'Randy J. Read'      cimr-phaser@lists.cam.ac.uk             ?              ? ? ? ?          
http://www-structmed.cimr.cam.ac.uk/phaser/                                 ? PHASER      ? ? program .    3 
? refinement        ? ? 'Garib N. Murshudov' garib@ysbl.york.ac.uk                   ?              ? ? ? Fortran_77 
http://www.ccp4.ac.uk/dist/html/refmac5.html                                ? REFMAC      ? ? program .    4 
? 'data extraction' ? ? PDB                  deposit@deposit.rcsb.org                'Sep. 1, 2017' ? ? ? C++        
http://sw-tools.pdb.org/apps/PDB_EXTRACT/                                   ? PDB_EXTRACT ? ? package 3.24 5 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O1 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   GOL 
_pdbx_validate_close_contact.auth_seq_id_1    502 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    601 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.01 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 O   L HOH 201 ? ? 1_555 O   L HOH 201 ? ? 7_555 2.08 
2 1 OD1 A ASN 243 ? ? 1_555 OD1 A ASN 243 ? ? 8_555 2.14 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 GLU A 276 ? ? -105.32 -168.67 
2 1 LYS A 277 ? ? 69.45   -179.49 
3 1 ASN L 79  ? ? -146.83 54.92   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 216 ? A GLY 1  
2  1 Y 1 A GLN 252 ? A GLN 37 
3  1 Y 1 A SER 253 ? A SER 38 
4  1 Y 1 A SER 254 ? A SER 39 
5  1 Y 1 A PRO 255 ? A PRO 40 
6  1 Y 1 A SER 256 ? A SER 41 
7  1 Y 1 A TYR 257 ? A TYR 42 
8  1 Y 1 A SER 258 ? A SER 43 
9  1 Y 1 A ASP 259 ? A ASP 44 
10 1 Y 1 A PRO 260 ? A PRO 45 
11 1 Y 1 A TYR 261 ? A TYR 46 
12 1 Y 1 A ILE 306 ? A ILE 91 
13 1 Y 1 A GLU 307 ? A GLU 92 
14 1 Y 1 A ASP 308 ? A ASP 93 
15 1 Y 1 A GLU 309 ? A GLU 94 
16 1 Y 1 L GLU 100 ? B GLU 41 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'MYRISTIC ACID' MYR 
4 GLYCEROL        GOL 
5 water           HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   none 
_pdbx_struct_assembly_auth_evidence.details                ? 
#