data_6GL7
# 
_entry.id   6GL7 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.318 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6GL7         
WWPDB D_1200009732 
EMDB  EMD-0026     
# 
_pdbx_database_related.db_name        EMDB 
_pdbx_database_related.details        'Neurturin-GFRa2-RET extracellular complex' 
_pdbx_database_related.db_id          EMD-0026 
_pdbx_database_related.content_type   'associated EM volume' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6GL7 
_pdbx_database_status.recvd_initial_deposition_date   2018-05-23 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Bigalke, J.M.' 1 ? 
'Aibara, S.'    2 ? 
'Sandmark, J.'  3 ? 
'Amunts, A.'    4 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Sci Adv' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2375-2548 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            5 
_citation.language                  ? 
_citation.page_first                eaau4202 
_citation.page_last                 eaau4202 
_citation.title                     
'Cryo-EM structure of the activated RET signaling complex reveals the importance of its cysteine-rich domain.' 
_citation.year                      2019 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1126/sciadv.aau4202 
_citation.pdbx_database_id_PubMed   31392261 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Bigalke, J.M.' 1 0000-0002-3473-4390 
primary 'Aibara, S.'    2 ?                   
primary 'Roth, R.'      3 0000-0002-7084-6947 
primary 'Dahl, G.'      4 ?                   
primary 'Gordon, E.'    5 ?                   
primary 'Dorbeus, S.'   6 ?                   
primary 'Amunts, A.'    7 0000-0002-5302-1740 
primary 'Sandmark, J.'  8 0000-0002-3237-2429 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6GL7 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     1.000 
_cell.length_a_esd                 ? 
_cell.length_b                     1.000 
_cell.length_b_esd                 ? 
_cell.length_c                     1.000 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        1 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6GL7 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man Neurturin                                             11706.406 2 ?        ? ? ? 
2 polymer man 'GDNF family receptor alpha-2'                        47635.629 2 ?        ? ? ? 
3 polymer man 'Proto-oncogene tyrosine-protein kinase receptor Ret' 68651.352 2 2.7.10.1 ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
2 
;GFR-alpha-2,GDNF receptor beta,GDNFR-beta,Neurturin receptor alpha,NTNR-alpha,RET ligand 2,TGF-beta-related neurotrophic factor receptor 2
;
3 'Cadherin family member 12,Proto-oncogene c-Ret' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;ARLGARPCGLRELEVRVSELGLGYASDETVLFRYCAGACEAAARVYDLGLRRLRQRRRLRRERVRAQPCCRPTAYEDEVS
FLDAHSRYHTVHELSARECACV
;
;ARLGARPCGLRELEVRVSELGLGYASDETVLFRYCAGACEAAARVYDLGLRRLRQRRRLRRERVRAQPCCRPTAYEDEVS
FLDAHSRYHTVHELSARECACV
;
B,A ? 
2 'polypeptide(L)' no no 
;SPSSLQGPELHGWRPPVDCVRANELCAAESNCSSRYRTLRQCLAGRDRNTMLANKECQAALEVLQESPLYDCRCKRGMKK
ELQCLQIYWSIHLGLTEGEEFYEASPYEPVTSRLSDIFRLASIFSGTGADPVVSAKSNHCLDAAKACNLNDNCKKLRSSY
ISICNREISPTERCNRRKCHKALRQFFDRVPSEYTYRMLFCSCQDQACAERRRQTILPSCSYEDKEKPNCLDLRGVCRTD
HLCRSRLADFHANCRASYQTVTSCPADNYQACLGSYAGMIGFDMTPNYVDSSPTGIVVSPWCSCRGSGNMEEECEKFLRD
FTENPCLRNAIQAFGNGTDVNVSPKGPSFQATQAPRVEKTPSLPDDLSDSTSLGTSVITTCTSVQEQGLKANNSKELSMC
FTELTTNIIPGSNKVIKPNSHHHHHH
;
;SPSSLQGPELHGWRPPVDCVRANELCAAESNCSSRYRTLRQCLAGRDRNTMLANKECQAALEVLQESPLYDCRCKRGMKK
ELQCLQIYWSIHLGLTEGEEFYEASPYEPVTSRLSDIFRLASIFSGTGADPVVSAKSNHCLDAAKACNLNDNCKKLRSSY
ISICNREISPTERCNRRKCHKALRQFFDRVPSEYTYRMLFCSCQDQACAERRRQTILPSCSYEDKEKPNCLDLRGVCRTD
HLCRSRLADFHANCRASYQTVTSCPADNYQACLGSYAGMIGFDMTPNYVDSSPTGIVVSPWCSCRGSGNMEEECEKFLRD
FTENPCLRNAIQAFGNGTDVNVSPKGPSFQATQAPRVEKTPSLPDDLSDSTSLGTSVITTCTSVQEQGLKANNSKELSMC
FTELTTNIIPGSNKVIKPNSHHHHHH
;
D,C ? 
3 'polypeptide(L)' no no 
;LYFSRDAYWEKLYVDQAAGTPLLYVHALRDAPEEVPSFRLGQHLYGTYRTRLHENNWICIQEDTGLLYLNRSLDHSSWEK
LSVRNRGFPLLTVYLKVFLSPTSLREGECQWPGCARVYFSFFNTSFPACSSLKPRELCFPETRPSFRIRENRPPGTFHQF
RLLPVQFLCPNISVAYRLLEGEGLPFRCAPDSLEVSTRWALDREQREKYELVAVCTVHAGAREEVVMVPFPVTVYDEDDS
APTFPAGVDTASAVVEFKRKEDTVVATLRVFDADVVPASGELVRRYTSTLLPGDTWAQQTFRVEHWPNETSVQANGSFVR
ATVHDYRLVLNRNLSISENRTMQLAVLVNDSDFQGPGAGVLLLHFNVSVLPVSLHLPSTYSLSVSRRARRFAQIGKVCVE
NCQAFSGINVQYKLHSSGANCSTLGVVTSAEDTSGILFVNDTKALRRPKCAELHYMVVATDQQTSRQAQAQLLVTVEGSY
VAEEAGCPLSCAVSKRRLECEECGGLGSPTGRCEWRQGDGKGITRNFSTCSPSTKTCPDGHCDVVETQDINICPQDCLRG
SIVGGHEPGEPRGIKAGYGTCNCFPEEEKCFCEPEDIQDPLCDELCRENLYFQ
;
;LYFSRDAYWEKLYVDQAAGTPLLYVHALRDAPEEVPSFRLGQHLYGTYRTRLHENNWICIQEDTGLLYLNRSLDHSSWEK
LSVRNRGFPLLTVYLKVFLSPTSLREGECQWPGCARVYFSFFNTSFPACSSLKPRELCFPETRPSFRIRENRPPGTFHQF
RLLPVQFLCPNISVAYRLLEGEGLPFRCAPDSLEVSTRWALDREQREKYELVAVCTVHAGAREEVVMVPFPVTVYDEDDS
APTFPAGVDTASAVVEFKRKEDTVVATLRVFDADVVPASGELVRRYTSTLLPGDTWAQQTFRVEHWPNETSVQANGSFVR
ATVHDYRLVLNRNLSISENRTMQLAVLVNDSDFQGPGAGVLLLHFNVSVLPVSLHLPSTYSLSVSRRARRFAQIGKVCVE
NCQAFSGINVQYKLHSSGANCSTLGVVTSAEDTSGILFVNDTKALRRPKCAELHYMVVATDQQTSRQAQAQLLVTVEGSY
VAEEAGCPLSCAVSKRRLECEECGGLGSPTGRCEWRQGDGKGITRNFSTCSPSTKTCPDGHCDVVETQDINICPQDCLRG
SIVGGHEPGEPRGIKAGYGTCNCFPEEEKCFCEPEDIQDPLCDELCRENLYFQ
;
F,E ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   ARG n 
1 3   LEU n 
1 4   GLY n 
1 5   ALA n 
1 6   ARG n 
1 7   PRO n 
1 8   CYS n 
1 9   GLY n 
1 10  LEU n 
1 11  ARG n 
1 12  GLU n 
1 13  LEU n 
1 14  GLU n 
1 15  VAL n 
1 16  ARG n 
1 17  VAL n 
1 18  SER n 
1 19  GLU n 
1 20  LEU n 
1 21  GLY n 
1 22  LEU n 
1 23  GLY n 
1 24  TYR n 
1 25  ALA n 
1 26  SER n 
1 27  ASP n 
1 28  GLU n 
1 29  THR n 
1 30  VAL n 
1 31  LEU n 
1 32  PHE n 
1 33  ARG n 
1 34  TYR n 
1 35  CYS n 
1 36  ALA n 
1 37  GLY n 
1 38  ALA n 
1 39  CYS n 
1 40  GLU n 
1 41  ALA n 
1 42  ALA n 
1 43  ALA n 
1 44  ARG n 
1 45  VAL n 
1 46  TYR n 
1 47  ASP n 
1 48  LEU n 
1 49  GLY n 
1 50  LEU n 
1 51  ARG n 
1 52  ARG n 
1 53  LEU n 
1 54  ARG n 
1 55  GLN n 
1 56  ARG n 
1 57  ARG n 
1 58  ARG n 
1 59  LEU n 
1 60  ARG n 
1 61  ARG n 
1 62  GLU n 
1 63  ARG n 
1 64  VAL n 
1 65  ARG n 
1 66  ALA n 
1 67  GLN n 
1 68  PRO n 
1 69  CYS n 
1 70  CYS n 
1 71  ARG n 
1 72  PRO n 
1 73  THR n 
1 74  ALA n 
1 75  TYR n 
1 76  GLU n 
1 77  ASP n 
1 78  GLU n 
1 79  VAL n 
1 80  SER n 
1 81  PHE n 
1 82  LEU n 
1 83  ASP n 
1 84  ALA n 
1 85  HIS n 
1 86  SER n 
1 87  ARG n 
1 88  TYR n 
1 89  HIS n 
1 90  THR n 
1 91  VAL n 
1 92  HIS n 
1 93  GLU n 
1 94  LEU n 
1 95  SER n 
1 96  ALA n 
1 97  ARG n 
1 98  GLU n 
1 99  CYS n 
1 100 ALA n 
1 101 CYS n 
1 102 VAL n 
2 1   SER n 
2 2   PRO n 
2 3   SER n 
2 4   SER n 
2 5   LEU n 
2 6   GLN n 
2 7   GLY n 
2 8   PRO n 
2 9   GLU n 
2 10  LEU n 
2 11  HIS n 
2 12  GLY n 
2 13  TRP n 
2 14  ARG n 
2 15  PRO n 
2 16  PRO n 
2 17  VAL n 
2 18  ASP n 
2 19  CYS n 
2 20  VAL n 
2 21  ARG n 
2 22  ALA n 
2 23  ASN n 
2 24  GLU n 
2 25  LEU n 
2 26  CYS n 
2 27  ALA n 
2 28  ALA n 
2 29  GLU n 
2 30  SER n 
2 31  ASN n 
2 32  CYS n 
2 33  SER n 
2 34  SER n 
2 35  ARG n 
2 36  TYR n 
2 37  ARG n 
2 38  THR n 
2 39  LEU n 
2 40  ARG n 
2 41  GLN n 
2 42  CYS n 
2 43  LEU n 
2 44  ALA n 
2 45  GLY n 
2 46  ARG n 
2 47  ASP n 
2 48  ARG n 
2 49  ASN n 
2 50  THR n 
2 51  MET n 
2 52  LEU n 
2 53  ALA n 
2 54  ASN n 
2 55  LYS n 
2 56  GLU n 
2 57  CYS n 
2 58  GLN n 
2 59  ALA n 
2 60  ALA n 
2 61  LEU n 
2 62  GLU n 
2 63  VAL n 
2 64  LEU n 
2 65  GLN n 
2 66  GLU n 
2 67  SER n 
2 68  PRO n 
2 69  LEU n 
2 70  TYR n 
2 71  ASP n 
2 72  CYS n 
2 73  ARG n 
2 74  CYS n 
2 75  LYS n 
2 76  ARG n 
2 77  GLY n 
2 78  MET n 
2 79  LYS n 
2 80  LYS n 
2 81  GLU n 
2 82  LEU n 
2 83  GLN n 
2 84  CYS n 
2 85  LEU n 
2 86  GLN n 
2 87  ILE n 
2 88  TYR n 
2 89  TRP n 
2 90  SER n 
2 91  ILE n 
2 92  HIS n 
2 93  LEU n 
2 94  GLY n 
2 95  LEU n 
2 96  THR n 
2 97  GLU n 
2 98  GLY n 
2 99  GLU n 
2 100 GLU n 
2 101 PHE n 
2 102 TYR n 
2 103 GLU n 
2 104 ALA n 
2 105 SER n 
2 106 PRO n 
2 107 TYR n 
2 108 GLU n 
2 109 PRO n 
2 110 VAL n 
2 111 THR n 
2 112 SER n 
2 113 ARG n 
2 114 LEU n 
2 115 SER n 
2 116 ASP n 
2 117 ILE n 
2 118 PHE n 
2 119 ARG n 
2 120 LEU n 
2 121 ALA n 
2 122 SER n 
2 123 ILE n 
2 124 PHE n 
2 125 SER n 
2 126 GLY n 
2 127 THR n 
2 128 GLY n 
2 129 ALA n 
2 130 ASP n 
2 131 PRO n 
2 132 VAL n 
2 133 VAL n 
2 134 SER n 
2 135 ALA n 
2 136 LYS n 
2 137 SER n 
2 138 ASN n 
2 139 HIS n 
2 140 CYS n 
2 141 LEU n 
2 142 ASP n 
2 143 ALA n 
2 144 ALA n 
2 145 LYS n 
2 146 ALA n 
2 147 CYS n 
2 148 ASN n 
2 149 LEU n 
2 150 ASN n 
2 151 ASP n 
2 152 ASN n 
2 153 CYS n 
2 154 LYS n 
2 155 LYS n 
2 156 LEU n 
2 157 ARG n 
2 158 SER n 
2 159 SER n 
2 160 TYR n 
2 161 ILE n 
2 162 SER n 
2 163 ILE n 
2 164 CYS n 
2 165 ASN n 
2 166 ARG n 
2 167 GLU n 
2 168 ILE n 
2 169 SER n 
2 170 PRO n 
2 171 THR n 
2 172 GLU n 
2 173 ARG n 
2 174 CYS n 
2 175 ASN n 
2 176 ARG n 
2 177 ARG n 
2 178 LYS n 
2 179 CYS n 
2 180 HIS n 
2 181 LYS n 
2 182 ALA n 
2 183 LEU n 
2 184 ARG n 
2 185 GLN n 
2 186 PHE n 
2 187 PHE n 
2 188 ASP n 
2 189 ARG n 
2 190 VAL n 
2 191 PRO n 
2 192 SER n 
2 193 GLU n 
2 194 TYR n 
2 195 THR n 
2 196 TYR n 
2 197 ARG n 
2 198 MET n 
2 199 LEU n 
2 200 PHE n 
2 201 CYS n 
2 202 SER n 
2 203 CYS n 
2 204 GLN n 
2 205 ASP n 
2 206 GLN n 
2 207 ALA n 
2 208 CYS n 
2 209 ALA n 
2 210 GLU n 
2 211 ARG n 
2 212 ARG n 
2 213 ARG n 
2 214 GLN n 
2 215 THR n 
2 216 ILE n 
2 217 LEU n 
2 218 PRO n 
2 219 SER n 
2 220 CYS n 
2 221 SER n 
2 222 TYR n 
2 223 GLU n 
2 224 ASP n 
2 225 LYS n 
2 226 GLU n 
2 227 LYS n 
2 228 PRO n 
2 229 ASN n 
2 230 CYS n 
2 231 LEU n 
2 232 ASP n 
2 233 LEU n 
2 234 ARG n 
2 235 GLY n 
2 236 VAL n 
2 237 CYS n 
2 238 ARG n 
2 239 THR n 
2 240 ASP n 
2 241 HIS n 
2 242 LEU n 
2 243 CYS n 
2 244 ARG n 
2 245 SER n 
2 246 ARG n 
2 247 LEU n 
2 248 ALA n 
2 249 ASP n 
2 250 PHE n 
2 251 HIS n 
2 252 ALA n 
2 253 ASN n 
2 254 CYS n 
2 255 ARG n 
2 256 ALA n 
2 257 SER n 
2 258 TYR n 
2 259 GLN n 
2 260 THR n 
2 261 VAL n 
2 262 THR n 
2 263 SER n 
2 264 CYS n 
2 265 PRO n 
2 266 ALA n 
2 267 ASP n 
2 268 ASN n 
2 269 TYR n 
2 270 GLN n 
2 271 ALA n 
2 272 CYS n 
2 273 LEU n 
2 274 GLY n 
2 275 SER n 
2 276 TYR n 
2 277 ALA n 
2 278 GLY n 
2 279 MET n 
2 280 ILE n 
2 281 GLY n 
2 282 PHE n 
2 283 ASP n 
2 284 MET n 
2 285 THR n 
2 286 PRO n 
2 287 ASN n 
2 288 TYR n 
2 289 VAL n 
2 290 ASP n 
2 291 SER n 
2 292 SER n 
2 293 PRO n 
2 294 THR n 
2 295 GLY n 
2 296 ILE n 
2 297 VAL n 
2 298 VAL n 
2 299 SER n 
2 300 PRO n 
2 301 TRP n 
2 302 CYS n 
2 303 SER n 
2 304 CYS n 
2 305 ARG n 
2 306 GLY n 
2 307 SER n 
2 308 GLY n 
2 309 ASN n 
2 310 MET n 
2 311 GLU n 
2 312 GLU n 
2 313 GLU n 
2 314 CYS n 
2 315 GLU n 
2 316 LYS n 
2 317 PHE n 
2 318 LEU n 
2 319 ARG n 
2 320 ASP n 
2 321 PHE n 
2 322 THR n 
2 323 GLU n 
2 324 ASN n 
2 325 PRO n 
2 326 CYS n 
2 327 LEU n 
2 328 ARG n 
2 329 ASN n 
2 330 ALA n 
2 331 ILE n 
2 332 GLN n 
2 333 ALA n 
2 334 PHE n 
2 335 GLY n 
2 336 ASN n 
2 337 GLY n 
2 338 THR n 
2 339 ASP n 
2 340 VAL n 
2 341 ASN n 
2 342 VAL n 
2 343 SER n 
2 344 PRO n 
2 345 LYS n 
2 346 GLY n 
2 347 PRO n 
2 348 SER n 
2 349 PHE n 
2 350 GLN n 
2 351 ALA n 
2 352 THR n 
2 353 GLN n 
2 354 ALA n 
2 355 PRO n 
2 356 ARG n 
2 357 VAL n 
2 358 GLU n 
2 359 LYS n 
2 360 THR n 
2 361 PRO n 
2 362 SER n 
2 363 LEU n 
2 364 PRO n 
2 365 ASP n 
2 366 ASP n 
2 367 LEU n 
2 368 SER n 
2 369 ASP n 
2 370 SER n 
2 371 THR n 
2 372 SER n 
2 373 LEU n 
2 374 GLY n 
2 375 THR n 
2 376 SER n 
2 377 VAL n 
2 378 ILE n 
2 379 THR n 
2 380 THR n 
2 381 CYS n 
2 382 THR n 
2 383 SER n 
2 384 VAL n 
2 385 GLN n 
2 386 GLU n 
2 387 GLN n 
2 388 GLY n 
2 389 LEU n 
2 390 LYS n 
2 391 ALA n 
2 392 ASN n 
2 393 ASN n 
2 394 SER n 
2 395 LYS n 
2 396 GLU n 
2 397 LEU n 
2 398 SER n 
2 399 MET n 
2 400 CYS n 
2 401 PHE n 
2 402 THR n 
2 403 GLU n 
2 404 LEU n 
2 405 THR n 
2 406 THR n 
2 407 ASN n 
2 408 ILE n 
2 409 ILE n 
2 410 PRO n 
2 411 GLY n 
2 412 SER n 
2 413 ASN n 
2 414 LYS n 
2 415 VAL n 
2 416 ILE n 
2 417 LYS n 
2 418 PRO n 
2 419 ASN n 
2 420 SER n 
2 421 HIS n 
2 422 HIS n 
2 423 HIS n 
2 424 HIS n 
2 425 HIS n 
2 426 HIS n 
3 1   LEU n 
3 2   TYR n 
3 3   PHE n 
3 4   SER n 
3 5   ARG n 
3 6   ASP n 
3 7   ALA n 
3 8   TYR n 
3 9   TRP n 
3 10  GLU n 
3 11  LYS n 
3 12  LEU n 
3 13  TYR n 
3 14  VAL n 
3 15  ASP n 
3 16  GLN n 
3 17  ALA n 
3 18  ALA n 
3 19  GLY n 
3 20  THR n 
3 21  PRO n 
3 22  LEU n 
3 23  LEU n 
3 24  TYR n 
3 25  VAL n 
3 26  HIS n 
3 27  ALA n 
3 28  LEU n 
3 29  ARG n 
3 30  ASP n 
3 31  ALA n 
3 32  PRO n 
3 33  GLU n 
3 34  GLU n 
3 35  VAL n 
3 36  PRO n 
3 37  SER n 
3 38  PHE n 
3 39  ARG n 
3 40  LEU n 
3 41  GLY n 
3 42  GLN n 
3 43  HIS n 
3 44  LEU n 
3 45  TYR n 
3 46  GLY n 
3 47  THR n 
3 48  TYR n 
3 49  ARG n 
3 50  THR n 
3 51  ARG n 
3 52  LEU n 
3 53  HIS n 
3 54  GLU n 
3 55  ASN n 
3 56  ASN n 
3 57  TRP n 
3 58  ILE n 
3 59  CYS n 
3 60  ILE n 
3 61  GLN n 
3 62  GLU n 
3 63  ASP n 
3 64  THR n 
3 65  GLY n 
3 66  LEU n 
3 67  LEU n 
3 68  TYR n 
3 69  LEU n 
3 70  ASN n 
3 71  ARG n 
3 72  SER n 
3 73  LEU n 
3 74  ASP n 
3 75  HIS n 
3 76  SER n 
3 77  SER n 
3 78  TRP n 
3 79  GLU n 
3 80  LYS n 
3 81  LEU n 
3 82  SER n 
3 83  VAL n 
3 84  ARG n 
3 85  ASN n 
3 86  ARG n 
3 87  GLY n 
3 88  PHE n 
3 89  PRO n 
3 90  LEU n 
3 91  LEU n 
3 92  THR n 
3 93  VAL n 
3 94  TYR n 
3 95  LEU n 
3 96  LYS n 
3 97  VAL n 
3 98  PHE n 
3 99  LEU n 
3 100 SER n 
3 101 PRO n 
3 102 THR n 
3 103 SER n 
3 104 LEU n 
3 105 ARG n 
3 106 GLU n 
3 107 GLY n 
3 108 GLU n 
3 109 CYS n 
3 110 GLN n 
3 111 TRP n 
3 112 PRO n 
3 113 GLY n 
3 114 CYS n 
3 115 ALA n 
3 116 ARG n 
3 117 VAL n 
3 118 TYR n 
3 119 PHE n 
3 120 SER n 
3 121 PHE n 
3 122 PHE n 
3 123 ASN n 
3 124 THR n 
3 125 SER n 
3 126 PHE n 
3 127 PRO n 
3 128 ALA n 
3 129 CYS n 
3 130 SER n 
3 131 SER n 
3 132 LEU n 
3 133 LYS n 
3 134 PRO n 
3 135 ARG n 
3 136 GLU n 
3 137 LEU n 
3 138 CYS n 
3 139 PHE n 
3 140 PRO n 
3 141 GLU n 
3 142 THR n 
3 143 ARG n 
3 144 PRO n 
3 145 SER n 
3 146 PHE n 
3 147 ARG n 
3 148 ILE n 
3 149 ARG n 
3 150 GLU n 
3 151 ASN n 
3 152 ARG n 
3 153 PRO n 
3 154 PRO n 
3 155 GLY n 
3 156 THR n 
3 157 PHE n 
3 158 HIS n 
3 159 GLN n 
3 160 PHE n 
3 161 ARG n 
3 162 LEU n 
3 163 LEU n 
3 164 PRO n 
3 165 VAL n 
3 166 GLN n 
3 167 PHE n 
3 168 LEU n 
3 169 CYS n 
3 170 PRO n 
3 171 ASN n 
3 172 ILE n 
3 173 SER n 
3 174 VAL n 
3 175 ALA n 
3 176 TYR n 
3 177 ARG n 
3 178 LEU n 
3 179 LEU n 
3 180 GLU n 
3 181 GLY n 
3 182 GLU n 
3 183 GLY n 
3 184 LEU n 
3 185 PRO n 
3 186 PHE n 
3 187 ARG n 
3 188 CYS n 
3 189 ALA n 
3 190 PRO n 
3 191 ASP n 
3 192 SER n 
3 193 LEU n 
3 194 GLU n 
3 195 VAL n 
3 196 SER n 
3 197 THR n 
3 198 ARG n 
3 199 TRP n 
3 200 ALA n 
3 201 LEU n 
3 202 ASP n 
3 203 ARG n 
3 204 GLU n 
3 205 GLN n 
3 206 ARG n 
3 207 GLU n 
3 208 LYS n 
3 209 TYR n 
3 210 GLU n 
3 211 LEU n 
3 212 VAL n 
3 213 ALA n 
3 214 VAL n 
3 215 CYS n 
3 216 THR n 
3 217 VAL n 
3 218 HIS n 
3 219 ALA n 
3 220 GLY n 
3 221 ALA n 
3 222 ARG n 
3 223 GLU n 
3 224 GLU n 
3 225 VAL n 
3 226 VAL n 
3 227 MET n 
3 228 VAL n 
3 229 PRO n 
3 230 PHE n 
3 231 PRO n 
3 232 VAL n 
3 233 THR n 
3 234 VAL n 
3 235 TYR n 
3 236 ASP n 
3 237 GLU n 
3 238 ASP n 
3 239 ASP n 
3 240 SER n 
3 241 ALA n 
3 242 PRO n 
3 243 THR n 
3 244 PHE n 
3 245 PRO n 
3 246 ALA n 
3 247 GLY n 
3 248 VAL n 
3 249 ASP n 
3 250 THR n 
3 251 ALA n 
3 252 SER n 
3 253 ALA n 
3 254 VAL n 
3 255 VAL n 
3 256 GLU n 
3 257 PHE n 
3 258 LYS n 
3 259 ARG n 
3 260 LYS n 
3 261 GLU n 
3 262 ASP n 
3 263 THR n 
3 264 VAL n 
3 265 VAL n 
3 266 ALA n 
3 267 THR n 
3 268 LEU n 
3 269 ARG n 
3 270 VAL n 
3 271 PHE n 
3 272 ASP n 
3 273 ALA n 
3 274 ASP n 
3 275 VAL n 
3 276 VAL n 
3 277 PRO n 
3 278 ALA n 
3 279 SER n 
3 280 GLY n 
3 281 GLU n 
3 282 LEU n 
3 283 VAL n 
3 284 ARG n 
3 285 ARG n 
3 286 TYR n 
3 287 THR n 
3 288 SER n 
3 289 THR n 
3 290 LEU n 
3 291 LEU n 
3 292 PRO n 
3 293 GLY n 
3 294 ASP n 
3 295 THR n 
3 296 TRP n 
3 297 ALA n 
3 298 GLN n 
3 299 GLN n 
3 300 THR n 
3 301 PHE n 
3 302 ARG n 
3 303 VAL n 
3 304 GLU n 
3 305 HIS n 
3 306 TRP n 
3 307 PRO n 
3 308 ASN n 
3 309 GLU n 
3 310 THR n 
3 311 SER n 
3 312 VAL n 
3 313 GLN n 
3 314 ALA n 
3 315 ASN n 
3 316 GLY n 
3 317 SER n 
3 318 PHE n 
3 319 VAL n 
3 320 ARG n 
3 321 ALA n 
3 322 THR n 
3 323 VAL n 
3 324 HIS n 
3 325 ASP n 
3 326 TYR n 
3 327 ARG n 
3 328 LEU n 
3 329 VAL n 
3 330 LEU n 
3 331 ASN n 
3 332 ARG n 
3 333 ASN n 
3 334 LEU n 
3 335 SER n 
3 336 ILE n 
3 337 SER n 
3 338 GLU n 
3 339 ASN n 
3 340 ARG n 
3 341 THR n 
3 342 MET n 
3 343 GLN n 
3 344 LEU n 
3 345 ALA n 
3 346 VAL n 
3 347 LEU n 
3 348 VAL n 
3 349 ASN n 
3 350 ASP n 
3 351 SER n 
3 352 ASP n 
3 353 PHE n 
3 354 GLN n 
3 355 GLY n 
3 356 PRO n 
3 357 GLY n 
3 358 ALA n 
3 359 GLY n 
3 360 VAL n 
3 361 LEU n 
3 362 LEU n 
3 363 LEU n 
3 364 HIS n 
3 365 PHE n 
3 366 ASN n 
3 367 VAL n 
3 368 SER n 
3 369 VAL n 
3 370 LEU n 
3 371 PRO n 
3 372 VAL n 
3 373 SER n 
3 374 LEU n 
3 375 HIS n 
3 376 LEU n 
3 377 PRO n 
3 378 SER n 
3 379 THR n 
3 380 TYR n 
3 381 SER n 
3 382 LEU n 
3 383 SER n 
3 384 VAL n 
3 385 SER n 
3 386 ARG n 
3 387 ARG n 
3 388 ALA n 
3 389 ARG n 
3 390 ARG n 
3 391 PHE n 
3 392 ALA n 
3 393 GLN n 
3 394 ILE n 
3 395 GLY n 
3 396 LYS n 
3 397 VAL n 
3 398 CYS n 
3 399 VAL n 
3 400 GLU n 
3 401 ASN n 
3 402 CYS n 
3 403 GLN n 
3 404 ALA n 
3 405 PHE n 
3 406 SER n 
3 407 GLY n 
3 408 ILE n 
3 409 ASN n 
3 410 VAL n 
3 411 GLN n 
3 412 TYR n 
3 413 LYS n 
3 414 LEU n 
3 415 HIS n 
3 416 SER n 
3 417 SER n 
3 418 GLY n 
3 419 ALA n 
3 420 ASN n 
3 421 CYS n 
3 422 SER n 
3 423 THR n 
3 424 LEU n 
3 425 GLY n 
3 426 VAL n 
3 427 VAL n 
3 428 THR n 
3 429 SER n 
3 430 ALA n 
3 431 GLU n 
3 432 ASP n 
3 433 THR n 
3 434 SER n 
3 435 GLY n 
3 436 ILE n 
3 437 LEU n 
3 438 PHE n 
3 439 VAL n 
3 440 ASN n 
3 441 ASP n 
3 442 THR n 
3 443 LYS n 
3 444 ALA n 
3 445 LEU n 
3 446 ARG n 
3 447 ARG n 
3 448 PRO n 
3 449 LYS n 
3 450 CYS n 
3 451 ALA n 
3 452 GLU n 
3 453 LEU n 
3 454 HIS n 
3 455 TYR n 
3 456 MET n 
3 457 VAL n 
3 458 VAL n 
3 459 ALA n 
3 460 THR n 
3 461 ASP n 
3 462 GLN n 
3 463 GLN n 
3 464 THR n 
3 465 SER n 
3 466 ARG n 
3 467 GLN n 
3 468 ALA n 
3 469 GLN n 
3 470 ALA n 
3 471 GLN n 
3 472 LEU n 
3 473 LEU n 
3 474 VAL n 
3 475 THR n 
3 476 VAL n 
3 477 GLU n 
3 478 GLY n 
3 479 SER n 
3 480 TYR n 
3 481 VAL n 
3 482 ALA n 
3 483 GLU n 
3 484 GLU n 
3 485 ALA n 
3 486 GLY n 
3 487 CYS n 
3 488 PRO n 
3 489 LEU n 
3 490 SER n 
3 491 CYS n 
3 492 ALA n 
3 493 VAL n 
3 494 SER n 
3 495 LYS n 
3 496 ARG n 
3 497 ARG n 
3 498 LEU n 
3 499 GLU n 
3 500 CYS n 
3 501 GLU n 
3 502 GLU n 
3 503 CYS n 
3 504 GLY n 
3 505 GLY n 
3 506 LEU n 
3 507 GLY n 
3 508 SER n 
3 509 PRO n 
3 510 THR n 
3 511 GLY n 
3 512 ARG n 
3 513 CYS n 
3 514 GLU n 
3 515 TRP n 
3 516 ARG n 
3 517 GLN n 
3 518 GLY n 
3 519 ASP n 
3 520 GLY n 
3 521 LYS n 
3 522 GLY n 
3 523 ILE n 
3 524 THR n 
3 525 ARG n 
3 526 ASN n 
3 527 PHE n 
3 528 SER n 
3 529 THR n 
3 530 CYS n 
3 531 SER n 
3 532 PRO n 
3 533 SER n 
3 534 THR n 
3 535 LYS n 
3 536 THR n 
3 537 CYS n 
3 538 PRO n 
3 539 ASP n 
3 540 GLY n 
3 541 HIS n 
3 542 CYS n 
3 543 ASP n 
3 544 VAL n 
3 545 VAL n 
3 546 GLU n 
3 547 THR n 
3 548 GLN n 
3 549 ASP n 
3 550 ILE n 
3 551 ASN n 
3 552 ILE n 
3 553 CYS n 
3 554 PRO n 
3 555 GLN n 
3 556 ASP n 
3 557 CYS n 
3 558 LEU n 
3 559 ARG n 
3 560 GLY n 
3 561 SER n 
3 562 ILE n 
3 563 VAL n 
3 564 GLY n 
3 565 GLY n 
3 566 HIS n 
3 567 GLU n 
3 568 PRO n 
3 569 GLY n 
3 570 GLU n 
3 571 PRO n 
3 572 ARG n 
3 573 GLY n 
3 574 ILE n 
3 575 LYS n 
3 576 ALA n 
3 577 GLY n 
3 578 TYR n 
3 579 GLY n 
3 580 THR n 
3 581 CYS n 
3 582 ASN n 
3 583 CYS n 
3 584 PHE n 
3 585 PRO n 
3 586 GLU n 
3 587 GLU n 
3 588 GLU n 
3 589 LYS n 
3 590 CYS n 
3 591 PHE n 
3 592 CYS n 
3 593 GLU n 
3 594 PRO n 
3 595 GLU n 
3 596 ASP n 
3 597 ILE n 
3 598 GLN n 
3 599 ASP n 
3 600 PRO n 
3 601 LEU n 
3 602 CYS n 
3 603 ASP n 
3 604 GLU n 
3 605 LEU n 
3 606 CYS n 
3 607 ARG n 
3 608 GLU n 
3 609 ASN n 
3 610 LEU n 
3 611 TYR n 
3 612 PHE n 
3 613 GLN n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 102 Human ? NRTN                              ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli'   562   ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 426 Human ? 'GFRA2, GDNFRB, RETL2, TRNR2'     ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Cricetulus griseus' 10029 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample 'Biological sequence' 1 613 Human ? 'RET, CDHF12, CDHR16, PTC, RET51' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Cricetulus griseus' 10029 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP NRTN_HUMAN  Q99748 ? 1 
;ARLGARPCGLRELEVRVSELGLGYASDETVLFRYCAGACEAAARVYDLGLRRLRQRRRLRRERVRAQPCCRPTAYEDEVS
FLDAHSRYHTVHELSARECACV
;
96 
2 UNP GFRA2_HUMAN O00451 ? 2 
;SPSSLQGPELHGWRPPVDCVRANELCAAESNCSSRYRTLRQCLAGRDRNTMLANKECQAALEVLQESPLYDCRCKRGMKK
ELQCLQIYWSIHLGLTEGEEFYEASPYEPVTSRLSDIFRLASIFSGTGADPVVSAKSNHCLDAAKACNLNDNCKKLRSSY
ISICNREISPTERCNRRKCHKALRQFFDRVPSEYTYRMLFCSCQDQACAERRRQTILPSCSYEDKEKPNCLDLRGVCRTD
HLCRSRLADFHANCRASYQTVTSCPADNYQACLGSYAGMIGFDMTPNYVDSSPTGIVVSPWCSCRGSGNMEEECEKFLRD
FTENPCLRNAIQAFGNGTDVNVSPKGPSFQATQAPRVEKTPSLPDDLSDSTSLGTSVITTCTSVQEQGLKANNSKELSMC
FTELTTNIIPGSNKVIKPNS
;
22 
3 UNP RET_HUMAN   P07949 ? 3 
;LYFSRDAYWEKLYVDQAAGTPLLYVHALRDAPEEVPSFRLGQHLYGTYRTRLHENNWICIQEDTGLLYLNRSLDHSSWEK
LSVRNRGFPLLTVYLKVFLSPTSLREGECQWPGCARVYFSFFNTSFPACSSLKPRELCFPETRPSFRIRENRPPGTFHQF
RLLPVQFLCPNISVAYRLLEGEGLPFRCAPDSLEVSTRWALDREQREKYELVAVCTVHAGAREEVVMVPFPVTVYDEDDS
APTFPAGVDTASAVVEFKRKEDTVVATLRVFDADVVPASGELVRRYTSTLLPGDTWAQQTFRVEHWPNETSVQANGSFVR
ATVHDYRLVLNRNLSISENRTMQLAVLVNDSDFQGPGAGVLLLHFNVSVLPVSLHLPSTYSLSVSRRARRFAQIGKVCVE
NCQAFSGINVQYKLHSSGANCSTLGVVTSAEDTSGILFVNDTKALRRPKCAELHYMVVATDQQTSRQAQAQLLVTVEGSY
VAEEAGCPLSCAVSKRRLECEECGGLGSPTGRCEWRQGDGKGITRNFSTCSPSTKTCPDGHCDVVETQDINICPQDCLRG
SIVGGHEPGEPRGIKAGYGTCNCFPEEEKCFCEPEDIQDPLCDELCR
;
29 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6GL7 B 1 ? 102 ? Q99748 96 ? 197 ? 96 197 
2 2 6GL7 D 1 ? 420 ? O00451 22 ? 441 ? 22 441 
3 1 6GL7 A 1 ? 102 ? Q99748 96 ? 197 ? 96 197 
4 2 6GL7 C 1 ? 420 ? O00451 22 ? 441 ? 22 441 
5 3 6GL7 F 1 ? 607 ? P07949 29 ? 635 ? 29 635 
6 3 6GL7 E 1 ? 607 ? P07949 29 ? 635 ? 29 635 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
2 6GL7 HIS D 421 ? UNP O00451 ? ? 'expression tag' 442 1  
2 6GL7 HIS D 422 ? UNP O00451 ? ? 'expression tag' 443 2  
2 6GL7 HIS D 423 ? UNP O00451 ? ? 'expression tag' 444 3  
2 6GL7 HIS D 424 ? UNP O00451 ? ? 'expression tag' 445 4  
2 6GL7 HIS D 425 ? UNP O00451 ? ? 'expression tag' 446 5  
2 6GL7 HIS D 426 ? UNP O00451 ? ? 'expression tag' 447 6  
4 6GL7 HIS C 421 ? UNP O00451 ? ? 'expression tag' 442 7  
4 6GL7 HIS C 422 ? UNP O00451 ? ? 'expression tag' 443 8  
4 6GL7 HIS C 423 ? UNP O00451 ? ? 'expression tag' 444 9  
4 6GL7 HIS C 424 ? UNP O00451 ? ? 'expression tag' 445 10 
4 6GL7 HIS C 425 ? UNP O00451 ? ? 'expression tag' 446 11 
4 6GL7 HIS C 426 ? UNP O00451 ? ? 'expression tag' 447 12 
5 6GL7 GLU F 608 ? UNP P07949 ? ? 'expression tag' 636 13 
5 6GL7 ASN F 609 ? UNP P07949 ? ? 'expression tag' 637 14 
5 6GL7 LEU F 610 ? UNP P07949 ? ? 'expression tag' 638 15 
5 6GL7 TYR F 611 ? UNP P07949 ? ? 'expression tag' 639 16 
5 6GL7 PHE F 612 ? UNP P07949 ? ? 'expression tag' 640 17 
5 6GL7 GLN F 613 ? UNP P07949 ? ? 'expression tag' 641 18 
6 6GL7 GLU E 608 ? UNP P07949 ? ? 'expression tag' 636 19 
6 6GL7 ASN E 609 ? UNP P07949 ? ? 'expression tag' 637 20 
6 6GL7 LEU E 610 ? UNP P07949 ? ? 'expression tag' 638 21 
6 6GL7 TYR E 611 ? UNP P07949 ? ? 'expression tag' 639 22 
6 6GL7 PHE E 612 ? UNP P07949 ? ? 'expression tag' 640 23 
6 6GL7 GLN E 613 ? UNP P07949 ? ? 'expression tag' 641 24 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6GL7 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'ELECTRON MICROSCOPY' 
_exptl.method_details             ? 
# 
_struct.entry_id                     6GL7 
_struct.title                        'Neurturin-GFRa2-RET extracellular complex' 
_struct.pdbx_descriptor              
'Neurturin, GDNF family receptor alpha-2, Proto-oncogene tyrosine-protein kinase receptor Ret (E.C.2.7.10.1)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6GL7 
_struct_keywords.text            'Neurotrophic signalling, Receptor tyrosine kinase, GDNF family of ligands, SIGNALING PROTEIN' 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 SER A 18  ? GLY A 21  ? SER B 113 GLY B 116 5 ? 4  
HELX_P HELX_P2  AA2 ARG A 44  ? ARG A 56  ? ARG B 139 ARG B 151 1 ? 13 
HELX_P HELX_P3  AA3 CYS B 19  ? ALA B 28  ? CYS D 40  ALA D 49  1 ? 10 
HELX_P HELX_P4  AA4 GLU B 29  ? CYS B 42  ? GLU D 50  CYS D 63  1 ? 14 
HELX_P HELX_P5  AA5 ALA B 53  ? GLN B 65  ? ALA D 74  GLN D 86  1 ? 13 
HELX_P HELX_P6  AA6 LEU B 82  ? SER B 90  ? LEU D 103 SER D 111 1 ? 9  
HELX_P HELX_P7  AA7 THR B 111 ? GLY B 126 ? THR D 132 GLY D 147 1 ? 16 
HELX_P HELX_P8  AA8 ASN B 138 ? LEU B 149 ? ASN D 159 LEU D 170 1 ? 12 
HELX_P HELX_P9  AA9 ASN B 150 ? ASN B 165 ? ASN D 171 ASN D 186 1 ? 16 
HELX_P HELX_P10 AB1 ASN B 175 ? VAL B 190 ? ASN D 196 VAL D 211 1 ? 16 
HELX_P HELX_P11 AB2 PRO B 191 ? PHE B 200 ? PRO D 212 PHE D 221 1 ? 10 
HELX_P HELX_P12 AB3 ASP B 205 ? GLN B 214 ? ASP D 226 GLN D 235 1 ? 10 
HELX_P HELX_P13 AB4 LEU B 217 ? TYR B 222 ? LEU D 238 TYR D 243 1 ? 6  
HELX_P HELX_P14 AB5 ASN B 229 ? ASP B 240 ? ASN D 250 ASP D 261 1 ? 12 
HELX_P HELX_P15 AB6 ASP B 240 ? ARG B 255 ? ASP D 261 ARG D 276 1 ? 16 
HELX_P HELX_P16 AB7 CYS B 264 ? ASP B 267 ? CYS D 285 ASP D 288 5 ? 4  
HELX_P HELX_P17 AB8 ASN B 268 ? MET B 279 ? ASN D 289 MET D 300 1 ? 12 
HELX_P HELX_P18 AB9 SER B 307 ? ASN B 309 ? SER D 328 ASN D 330 5 ? 3  
HELX_P HELX_P19 AC1 MET B 310 ? GLU B 323 ? MET D 331 GLU D 344 1 ? 14 
HELX_P HELX_P20 AC2 ASN B 324 ? ASN B 336 ? ASN D 345 ASN D 357 1 ? 13 
HELX_P HELX_P21 AC3 SER C 18  ? GLY C 21  ? SER A 113 GLY A 116 5 ? 4  
HELX_P HELX_P22 AC4 ARG C 44  ? ARG C 56  ? ARG A 139 ARG A 151 1 ? 13 
HELX_P HELX_P23 AC5 CYS D 19  ? ALA D 28  ? CYS C 40  ALA C 49  1 ? 10 
HELX_P HELX_P24 AC6 GLU D 29  ? CYS D 42  ? GLU C 50  CYS C 63  1 ? 14 
HELX_P HELX_P25 AC7 ALA D 53  ? GLN D 65  ? ALA C 74  GLN C 86  1 ? 13 
HELX_P HELX_P26 AC8 LEU D 82  ? SER D 90  ? LEU C 103 SER C 111 1 ? 9  
HELX_P HELX_P27 AC9 THR D 111 ? GLY D 126 ? THR C 132 GLY C 147 1 ? 16 
HELX_P HELX_P28 AD1 ASN D 138 ? LEU D 149 ? ASN C 159 LEU C 170 1 ? 12 
HELX_P HELX_P29 AD2 ASN D 150 ? ASN D 165 ? ASN C 171 ASN C 186 1 ? 16 
HELX_P HELX_P30 AD3 ASN D 175 ? VAL D 190 ? ASN C 196 VAL C 211 1 ? 16 
HELX_P HELX_P31 AD4 PRO D 191 ? PHE D 200 ? PRO C 212 PHE C 221 1 ? 10 
HELX_P HELX_P32 AD5 ASP D 205 ? GLN D 214 ? ASP C 226 GLN C 235 1 ? 10 
HELX_P HELX_P33 AD6 LEU D 217 ? TYR D 222 ? LEU C 238 TYR C 243 1 ? 6  
HELX_P HELX_P34 AD7 ASN D 229 ? ARG D 238 ? ASN C 250 ARG C 259 1 ? 10 
HELX_P HELX_P35 AD8 ASP D 240 ? CYS D 254 ? ASP C 261 CYS C 275 1 ? 15 
HELX_P HELX_P36 AD9 CYS D 264 ? ASP D 267 ? CYS C 285 ASP C 288 5 ? 4  
HELX_P HELX_P37 AE1 ASN D 268 ? GLY D 278 ? ASN C 289 GLY C 299 1 ? 11 
HELX_P HELX_P38 AE2 SER D 307 ? ASN D 309 ? SER C 328 ASN C 330 5 ? 3  
HELX_P HELX_P39 AE3 MET D 310 ? GLU D 323 ? MET C 331 GLU C 344 1 ? 14 
HELX_P HELX_P40 AE4 ASN D 324 ? ASN D 336 ? ASN C 345 ASN C 357 1 ? 13 
HELX_P HELX_P41 AE5 ASP E 74  ? ARG E 84  ? ASP F 102 ARG F 112 1 ? 11 
HELX_P HELX_P42 AE6 ALA E 128 ? LEU E 132 ? ALA F 156 LEU F 160 5 ? 5  
HELX_P HELX_P43 AE7 LYS E 133 ? PHE E 139 ? LYS F 161 PHE F 167 1 ? 7  
HELX_P HELX_P44 AE8 LEU E 162 ? CYS E 169 ? LEU F 190 CYS F 197 1 ? 8  
HELX_P HELX_P45 AE9 ALA E 278 ? ARG E 284 ? ALA F 306 ARG F 312 1 ? 7  
HELX_P HELX_P46 AF1 GLU E 400 ? PHE E 405 ? GLU F 428 PHE F 433 1 ? 6  
HELX_P HELX_P47 AF2 ARG E 446 ? CYS E 450 ? ARG F 474 CYS F 478 5 ? 5  
HELX_P HELX_P48 AF3 ASP F 74  ? ARG F 84  ? ASP E 102 ARG E 112 1 ? 11 
HELX_P HELX_P49 AF4 ALA F 128 ? LEU F 132 ? ALA E 156 LEU E 160 5 ? 5  
HELX_P HELX_P50 AF5 LYS F 133 ? PHE F 139 ? LYS E 161 PHE E 167 1 ? 7  
HELX_P HELX_P51 AF6 LEU F 162 ? CYS F 169 ? LEU E 190 CYS E 197 1 ? 8  
HELX_P HELX_P52 AF7 ALA F 278 ? ARG F 284 ? ALA E 306 ARG E 312 1 ? 7  
HELX_P HELX_P53 AF8 GLU F 400 ? PHE F 405 ? GLU E 428 PHE E 433 1 ? 6  
HELX_P HELX_P54 AF9 ARG F 446 ? CYS F 450 ? ARG E 474 CYS E 478 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 8   SG ? ? ? 1_555 A CYS 70  SG ? ? B CYS 103 B CYS 165 1_555 ? ? ? ? ? ? ? 2.088 ? 
disulf2  disulf ? ? A CYS 35  SG ? ? ? 1_555 A CYS 99  SG ? ? B CYS 130 B CYS 194 1_555 ? ? ? ? ? ? ? 2.041 ? 
disulf3  disulf ? ? A CYS 39  SG ? ? ? 1_555 A CYS 101 SG ? ? B CYS 134 B CYS 196 1_555 ? ? ? ? ? ? ? 2.125 ? 
disulf4  disulf ? ? A CYS 69  SG ? ? ? 1_555 C CYS 69  SG ? ? B CYS 164 A CYS 164 1_555 ? ? ? ? ? ? ? 2.068 ? 
disulf5  disulf ? ? B CYS 19  SG ? ? ? 1_555 B CYS 72  SG ? ? D CYS 40  D CYS 93  1_555 ? ? ? ? ? ? ? 2.001 ? 
disulf6  disulf ? ? B CYS 26  SG ? ? ? 1_555 B CYS 32  SG ? ? D CYS 47  D CYS 53  1_555 ? ? ? ? ? ? ? 2.065 ? 
disulf7  disulf ? ? B CYS 42  SG ? ? ? 1_555 B CYS 57  SG ? ? D CYS 63  D CYS 78  1_555 ? ? ? ? ? ? ? 2.118 ? 
disulf8  disulf ? ? B CYS 74  SG ? ? ? 1_555 B CYS 84  SG ? ? D CYS 95  D CYS 105 1_555 ? ? ? ? ? ? ? 2.218 ? 
disulf9  disulf ? ? B CYS 140 SG ? ? ? 1_555 B CYS 201 SG ? ? D CYS 161 D CYS 222 1_555 ? ? ? ? ? ? ? 2.072 ? 
disulf10 disulf ? ? B CYS 147 SG ? ? ? 1_555 B CYS 153 SG ? ? D CYS 168 D CYS 174 1_555 ? ? ? ? ? ? ? 2.051 ? 
disulf11 disulf ? ? B CYS 164 SG ? ? ? 1_555 B CYS 179 SG ? ? D CYS 185 D CYS 200 1_555 ? ? ? ? ? ? ? 2.044 ? 
disulf12 disulf ? ? B CYS 174 SG ? ? ? 1_555 B CYS 220 SG ? ? D CYS 195 D CYS 241 1_555 ? ? ? ? ? ? ? 2.026 ? 
disulf13 disulf ? ? B CYS 203 SG ? ? ? 1_555 B CYS 208 SG ? ? D CYS 224 D CYS 229 1_555 ? ? ? ? ? ? ? 2.063 ? 
disulf14 disulf ? ? B CYS 230 SG ? ? ? 1_555 B CYS 302 SG ? ? D CYS 251 D CYS 323 1_555 ? ? ? ? ? ? ? 2.028 ? 
disulf15 disulf ? ? B CYS 237 SG ? ? ? 1_555 B CYS 243 SG ? ? D CYS 258 D CYS 264 1_555 ? ? ? ? ? ? ? 2.088 ? 
disulf16 disulf ? ? B CYS 254 SG ? ? ? 1_555 B CYS 272 SG ? ? D CYS 275 D CYS 293 1_555 ? ? ? ? ? ? ? 2.007 ? 
disulf17 disulf ? ? B CYS 264 SG ? ? ? 1_555 B CYS 326 SG ? ? D CYS 285 D CYS 347 1_555 ? ? ? ? ? ? ? 2.064 ? 
disulf18 disulf ? ? B CYS 304 SG ? ? ? 1_555 B CYS 314 SG ? ? D CYS 325 D CYS 335 1_555 ? ? ? ? ? ? ? 2.140 ? 
disulf19 disulf ? ? C CYS 8   SG ? ? ? 1_555 C CYS 70  SG ? ? A CYS 103 A CYS 165 1_555 ? ? ? ? ? ? ? 2.113 ? 
disulf20 disulf ? ? C CYS 35  SG ? ? ? 1_555 C CYS 99  SG ? ? A CYS 130 A CYS 194 1_555 ? ? ? ? ? ? ? 1.981 ? 
disulf21 disulf ? ? C CYS 39  SG ? ? ? 1_555 C CYS 101 SG ? ? A CYS 134 A CYS 196 1_555 ? ? ? ? ? ? ? 2.023 ? 
disulf22 disulf ? ? D CYS 19  SG ? ? ? 1_555 D CYS 72  SG ? ? C CYS 40  C CYS 93  1_555 ? ? ? ? ? ? ? 2.040 ? 
disulf23 disulf ? ? D CYS 26  SG ? ? ? 1_555 D CYS 32  SG ? ? C CYS 47  C CYS 53  1_555 ? ? ? ? ? ? ? 2.079 ? 
disulf24 disulf ? ? D CYS 42  SG ? ? ? 1_555 D CYS 57  SG ? ? C CYS 63  C CYS 78  1_555 ? ? ? ? ? ? ? 2.065 ? 
disulf25 disulf ? ? D CYS 74  SG ? ? ? 1_555 D CYS 84  SG ? ? C CYS 95  C CYS 105 1_555 ? ? ? ? ? ? ? 2.129 ? 
disulf26 disulf ? ? D CYS 140 SG ? ? ? 1_555 D CYS 201 SG ? ? C CYS 161 C CYS 222 1_555 ? ? ? ? ? ? ? 2.045 ? 
disulf27 disulf ? ? D CYS 147 SG ? ? ? 1_555 D CYS 153 SG ? ? C CYS 168 C CYS 174 1_555 ? ? ? ? ? ? ? 2.101 ? 
disulf28 disulf ? ? D CYS 164 SG ? ? ? 1_555 D CYS 179 SG ? ? C CYS 185 C CYS 200 1_555 ? ? ? ? ? ? ? 2.015 ? 
disulf29 disulf ? ? D CYS 174 SG ? ? ? 1_555 D CYS 220 SG ? ? C CYS 195 C CYS 241 1_555 ? ? ? ? ? ? ? 2.027 ? 
disulf30 disulf ? ? D CYS 203 SG ? ? ? 1_555 D CYS 208 SG ? ? C CYS 224 C CYS 229 1_555 ? ? ? ? ? ? ? 2.095 ? 
disulf31 disulf ? ? D CYS 230 SG ? ? ? 1_555 D CYS 302 SG ? ? C CYS 251 C CYS 323 1_555 ? ? ? ? ? ? ? 2.013 ? 
disulf32 disulf ? ? D CYS 237 SG ? ? ? 1_555 D CYS 243 SG ? ? C CYS 258 C CYS 264 1_555 ? ? ? ? ? ? ? 2.077 ? 
disulf33 disulf ? ? D CYS 254 SG ? ? ? 1_555 D CYS 272 SG ? ? C CYS 275 C CYS 293 1_555 ? ? ? ? ? ? ? 2.105 ? 
disulf34 disulf ? ? D CYS 264 SG ? ? ? 1_555 D CYS 326 SG ? ? C CYS 285 C CYS 347 1_555 ? ? ? ? ? ? ? 2.061 ? 
disulf35 disulf ? ? D CYS 304 SG ? ? ? 1_555 D CYS 314 SG ? ? C CYS 325 C CYS 335 1_555 ? ? ? ? ? ? ? 2.092 ? 
disulf36 disulf ? ? E CYS 109 SG ? ? ? 1_555 E CYS 114 SG ? ? F CYS 137 F CYS 142 1_555 ? ? ? ? ? ? ? 2.011 ? 
disulf37 disulf ? ? E CYS 129 SG ? ? ? 1_555 E CYS 169 SG ? ? F CYS 157 F CYS 197 1_555 ? ? ? ? ? ? ? 2.164 ? 
disulf38 disulf ? ? E CYS 138 SG ? ? ? 1_555 E CYS 215 SG ? ? F CYS 166 F CYS 243 1_555 ? ? ? ? ? ? ? 2.004 ? 
disulf39 disulf ? ? E CYS 421 SG ? ? ? 1_555 E CYS 450 SG ? ? F CYS 449 F CYS 478 1_555 ? ? ? ? ? ? ? 2.014 ? 
disulf40 disulf ? ? F CYS 109 SG ? ? ? 1_555 F CYS 114 SG ? ? E CYS 137 E CYS 142 1_555 ? ? ? ? ? ? ? 2.011 ? 
disulf41 disulf ? ? F CYS 129 SG ? ? ? 1_555 F CYS 169 SG ? ? E CYS 157 E CYS 197 1_555 ? ? ? ? ? ? ? 2.164 ? 
disulf42 disulf ? ? F CYS 138 SG ? ? ? 1_555 F CYS 215 SG ? ? E CYS 166 E CYS 243 1_555 ? ? ? ? ? ? ? 2.004 ? 
disulf43 disulf ? ? F CYS 421 SG ? ? ? 1_555 F CYS 450 SG ? ? E CYS 449 E CYS 478 1_555 ? ? ? ? ? ? ? 2.014 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TRP 111 E . ? TRP 139 F PRO 112 E ? PRO 140 F 1 4.08   
2 THR 243 E . ? THR 271 F PHE 244 E ? PHE 272 F 1 -10.06 
3 LEU 291 E . ? LEU 319 F PRO 292 E ? PRO 320 F 1 -1.44  
4 TRP 111 F . ? TRP 139 E PRO 112 F ? PRO 140 E 1 4.08   
5 THR 243 F . ? THR 271 E PHE 244 F ? PHE 272 E 1 -8.70  
6 LEU 291 F . ? LEU 319 E PRO 292 F ? PRO 320 E 1 -1.34  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 2 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 2 ? 
AA6 ? 2 ? 
AA7 ? 2 ? 
AA8 ? 2 ? 
AA9 ? 2 ? 
AB1 ? 4 ? 
AB2 ? 3 ? 
AB3 ? 2 ? 
AB4 ? 4 ? 
AB5 ? 3 ? 
AB6 ? 2 ? 
AB7 ? 3 ? 
AB8 ? 2 ? 
AB9 ? 2 ? 
AC1 ? 3 ? 
AC2 ? 2 ? 
AC3 ? 4 ? 
AC4 ? 3 ? 
AC5 ? 2 ? 
AC6 ? 4 ? 
AC7 ? 3 ? 
AC8 ? 2 ? 
AC9 ? 3 ? 
AD1 ? 2 ? 
AD2 ? 2 ? 
AD3 ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AB1 1 2 ? parallel      
AB1 2 3 ? anti-parallel 
AB1 3 4 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB2 2 3 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB4 1 2 ? parallel      
AB4 2 3 ? anti-parallel 
AB4 3 4 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB5 2 3 ? anti-parallel 
AB6 1 2 ? parallel      
AB7 1 2 ? anti-parallel 
AB7 2 3 ? anti-parallel 
AB8 1 2 ? anti-parallel 
AB9 1 2 ? anti-parallel 
AC1 1 2 ? anti-parallel 
AC1 2 3 ? anti-parallel 
AC2 1 2 ? anti-parallel 
AC3 1 2 ? parallel      
AC3 2 3 ? anti-parallel 
AC3 3 4 ? anti-parallel 
AC4 1 2 ? anti-parallel 
AC4 2 3 ? anti-parallel 
AC5 1 2 ? anti-parallel 
AC6 1 2 ? parallel      
AC6 2 3 ? anti-parallel 
AC6 3 4 ? anti-parallel 
AC7 1 2 ? anti-parallel 
AC7 2 3 ? anti-parallel 
AC8 1 2 ? parallel      
AC9 1 2 ? anti-parallel 
AC9 2 3 ? anti-parallel 
AD1 1 2 ? anti-parallel 
AD2 1 2 ? anti-parallel 
AD3 1 2 ? anti-parallel 
AD3 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 GLY A 9   ? ARG A 16  ? GLY B 104 ARG B 111 
AA1 2 THR A 29  ? ALA A 36  ? THR B 124 ALA B 131 
AA2 1 CYS A 70  ? TYR A 75  ? CYS B 165 TYR B 170 
AA2 2 ALA A 96  ? CYS A 101 ? ALA B 191 CYS B 196 
AA3 1 VAL A 79  ? LEU A 82  ? VAL B 174 LEU B 177 
AA3 2 TYR A 88  ? VAL A 91  ? TYR B 183 VAL B 186 
AA4 1 ASN B 287 ? TYR B 288 ? ASN D 308 TYR D 309 
AA4 2 VAL B 298 ? SER B 299 ? VAL D 319 SER D 320 
AA5 1 GLY C 9   ? ARG C 16  ? GLY A 104 ARG A 111 
AA5 2 THR C 29  ? ALA C 36  ? THR A 124 ALA A 131 
AA6 1 CYS C 70  ? TYR C 75  ? CYS A 165 TYR A 170 
AA6 2 ALA C 96  ? CYS C 101 ? ALA A 191 CYS A 196 
AA7 1 VAL C 79  ? LEU C 82  ? VAL A 174 LEU A 177 
AA7 2 TYR C 88  ? VAL C 91  ? TYR A 183 VAL A 186 
AA8 1 ASN D 287 ? TYR D 288 ? ASN C 308 TYR C 309 
AA8 2 VAL D 298 ? SER D 299 ? VAL C 319 SER C 320 
AA9 1 TYR E 2   ? PHE E 3   ? TYR F 30  PHE F 31  
AA9 2 ALA E 27  ? LEU E 28  ? ALA F 55  LEU F 56  
AB1 1 ALA E 7   ? LEU E 12  ? ALA F 35  LEU F 40  
AB1 2 CYS E 114 ? PHE E 121 ? CYS F 142 PHE F 149 
AB1 3 THR E 92  ? PHE E 98  ? THR F 120 PHE F 126 
AB1 4 ARG E 39  ? LEU E 40  ? ARG F 67  LEU F 68  
AB2 1 PRO E 21  ? TYR E 24  ? PRO F 49  TYR F 52  
AB2 2 LEU E 66  ? LEU E 69  ? LEU F 94  LEU F 97  
AB2 3 ILE E 58  ? ILE E 60  ? ILE F 86  ILE F 88  
AB3 1 HIS E 43  ? GLY E 46  ? HIS F 71  GLY F 74  
AB3 2 THR E 50  ? GLU E 54  ? THR F 78  GLU F 82  
AB4 1 PHE E 146 ? ILE E 148 ? PHE F 174 ILE F 176 
AB4 2 GLU E 224 ? VAL E 234 ? GLU F 252 VAL F 262 
AB4 3 LYS E 208 ? VAL E 217 ? LYS F 236 VAL F 245 
AB4 4 VAL E 174 ? LEU E 179 ? VAL F 202 LEU F 207 
AB5 1 THR E 156 ? GLN E 159 ? THR F 184 GLN F 187 
AB5 2 GLU E 194 ? THR E 197 ? GLU F 222 THR F 225 
AB5 3 PHE E 186 ? ARG E 187 ? PHE F 214 ARG F 215 
AB6 1 VAL E 254 ? VAL E 255 ? VAL F 282 VAL F 283 
AB6 2 VAL E 348 ? ASN E 349 ? VAL F 376 ASN F 377 
AB7 1 THR E 263 ? THR E 267 ? THR F 291 THR F 295 
AB7 2 SER E 311 ? ALA E 314 ? SER F 339 ALA F 342 
AB7 3 PHE E 301 ? GLU E 304 ? PHE F 329 GLU F 332 
AB8 1 HIS E 324 ? VAL E 329 ? HIS F 352 VAL F 357 
AB8 2 THR E 341 ? VAL E 346 ? THR F 369 VAL F 374 
AB9 1 PHE E 391 ? LYS E 396 ? PHE F 419 LYS F 424 
AB9 2 ILE E 436 ? ASN E 440 ? ILE F 464 ASN F 468 
AC1 1 LYS E 413 ? HIS E 415 ? LYS F 441 HIS F 443 
AC1 2 GLU E 452 ? ASP E 461 ? GLU F 480 ASP F 489 
AC1 3 THR E 464 ? THR E 475 ? THR F 492 THR F 503 
AC2 1 TYR F 2   ? PHE F 3   ? TYR E 30  PHE E 31  
AC2 2 ALA F 27  ? LEU F 28  ? ALA E 55  LEU E 56  
AC3 1 ALA F 7   ? LEU F 12  ? ALA E 35  LEU E 40  
AC3 2 CYS F 114 ? PHE F 121 ? CYS E 142 PHE E 149 
AC3 3 THR F 92  ? PHE F 98  ? THR E 120 PHE E 126 
AC3 4 ARG F 39  ? LEU F 40  ? ARG E 67  LEU E 68  
AC4 1 PRO F 21  ? TYR F 24  ? PRO E 49  TYR E 52  
AC4 2 LEU F 66  ? LEU F 69  ? LEU E 94  LEU E 97  
AC4 3 ILE F 58  ? ILE F 60  ? ILE E 86  ILE E 88  
AC5 1 HIS F 43  ? GLY F 46  ? HIS E 71  GLY E 74  
AC5 2 THR F 50  ? GLU F 54  ? THR E 78  GLU E 82  
AC6 1 PHE F 146 ? ILE F 148 ? PHE E 174 ILE E 176 
AC6 2 GLU F 224 ? VAL F 234 ? GLU E 252 VAL E 262 
AC6 3 LYS F 208 ? VAL F 217 ? LYS E 236 VAL E 245 
AC6 4 VAL F 174 ? LEU F 179 ? VAL E 202 LEU E 207 
AC7 1 THR F 156 ? GLN F 159 ? THR E 184 GLN E 187 
AC7 2 GLU F 194 ? THR F 197 ? GLU E 222 THR E 225 
AC7 3 PHE F 186 ? ARG F 187 ? PHE E 214 ARG E 215 
AC8 1 VAL F 254 ? VAL F 255 ? VAL E 282 VAL E 283 
AC8 2 VAL F 348 ? ASN F 349 ? VAL E 376 ASN E 377 
AC9 1 THR F 263 ? THR F 267 ? THR E 291 THR E 295 
AC9 2 SER F 311 ? ALA F 314 ? SER E 339 ALA E 342 
AC9 3 PHE F 301 ? GLU F 304 ? PHE E 329 GLU E 332 
AD1 1 HIS F 324 ? VAL F 329 ? HIS E 352 VAL E 357 
AD1 2 THR F 341 ? VAL F 346 ? THR E 369 VAL E 374 
AD2 1 PHE F 391 ? LYS F 396 ? PHE E 419 LYS E 424 
AD2 2 ILE F 436 ? ASN F 440 ? ILE E 464 ASN E 468 
AD3 1 LYS F 413 ? HIS F 415 ? LYS E 441 HIS E 443 
AD3 2 GLU F 452 ? ASP F 461 ? GLU E 480 ASP E 489 
AD3 3 THR F 464 ? THR F 475 ? THR E 492 THR E 503 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ARG A 11  ? N ARG B 106 O TYR A 34  ? O TYR B 129 
AA2 1 2 N ALA A 74  ? N ALA B 169 O ARG A 97  ? O ARG B 192 
AA3 1 2 N VAL A 79  ? N VAL B 174 O VAL A 91  ? O VAL B 186 
AA4 1 2 N ASN B 287 ? N ASN D 308 O SER B 299 ? O SER D 320 
AA5 1 2 N ARG C 11  ? N ARG A 106 O TYR C 34  ? O TYR A 129 
AA6 1 2 N ALA C 74  ? N ALA A 169 O ARG C 97  ? O ARG A 192 
AA7 1 2 N VAL C 79  ? N VAL A 174 O VAL C 91  ? O VAL A 186 
AA8 1 2 N ASN D 287 ? N ASN C 308 O SER D 299 ? O SER C 320 
AA9 1 2 N TYR E 2   ? N TYR F 30  O LEU E 28  ? O LEU F 56  
AB1 1 2 N TYR E 8   ? N TYR F 36  O TYR E 118 ? O TYR F 146 
AB1 2 3 O PHE E 119 ? O PHE F 147 N VAL E 93  ? N VAL F 121 
AB1 3 4 O PHE E 98  ? O PHE F 126 N ARG E 39  ? N ARG F 67  
AB2 1 2 N LEU E 23  ? N LEU F 51  O LEU E 67  ? O LEU F 95  
AB2 2 3 O TYR E 68  ? O TYR F 96  N CYS E 59  ? N CYS F 87  
AB3 1 2 N LEU E 44  ? N LEU F 72  O HIS E 53  ? O HIS F 81  
AB4 1 2 N PHE E 146 ? N PHE F 174 O THR E 233 ? O THR F 261 
AB4 2 3 O VAL E 228 ? O VAL F 256 N ALA E 213 ? N ALA F 241 
AB4 3 4 O VAL E 212 ? O VAL F 240 N LEU E 179 ? N LEU F 207 
AB5 1 2 N HIS E 158 ? N HIS F 186 O VAL E 195 ? O VAL F 223 
AB5 2 3 O SER E 196 ? O SER F 224 N ARG E 187 ? N ARG F 215 
AB6 1 2 N VAL E 254 ? N VAL F 282 O ASN E 349 ? O ASN F 377 
AB7 1 2 N THR E 263 ? N THR F 291 O ALA E 314 ? O ALA F 342 
AB7 2 3 O SER E 311 ? O SER F 339 N GLU E 304 ? N GLU F 332 
AB8 1 2 N LEU E 328 ? N LEU F 356 O MET E 342 ? O MET F 370 
AB9 1 2 N ALA E 392 ? N ALA F 420 O VAL E 439 ? O VAL F 467 
AC1 1 2 N LYS E 413 ? N LYS F 441 O VAL E 458 ? O VAL F 486 
AC1 2 3 N TYR E 455 ? N TYR F 483 O LEU E 472 ? O LEU F 500 
AC2 1 2 N TYR F 2   ? N TYR E 30  O LEU F 28  ? O LEU E 56  
AC3 1 2 N TYR F 8   ? N TYR E 36  O TYR F 118 ? O TYR E 146 
AC3 2 3 O PHE F 119 ? O PHE E 147 N VAL F 93  ? N VAL E 121 
AC3 3 4 O PHE F 98  ? O PHE E 126 N ARG F 39  ? N ARG E 67  
AC4 1 2 N LEU F 23  ? N LEU E 51  O LEU F 67  ? O LEU E 95  
AC4 2 3 O TYR F 68  ? O TYR E 96  N CYS F 59  ? N CYS E 87  
AC5 1 2 N LEU F 44  ? N LEU E 72  O HIS F 53  ? O HIS E 81  
AC6 1 2 N PHE F 146 ? N PHE E 174 O THR F 233 ? O THR E 261 
AC6 2 3 O VAL F 228 ? O VAL E 256 N ALA F 213 ? N ALA E 241 
AC6 3 4 O VAL F 212 ? O VAL E 240 N LEU F 179 ? N LEU E 207 
AC7 1 2 N HIS F 158 ? N HIS E 186 O VAL F 195 ? O VAL E 223 
AC7 2 3 O SER F 196 ? O SER E 224 N ARG F 187 ? N ARG E 215 
AC8 1 2 N VAL F 254 ? N VAL E 282 O ASN F 349 ? O ASN E 377 
AC9 1 2 N THR F 263 ? N THR E 291 O ALA F 314 ? O ALA E 342 
AC9 2 3 O SER F 311 ? O SER E 339 N GLU F 304 ? N GLU E 332 
AD1 1 2 N LEU F 328 ? N LEU E 356 O MET F 342 ? O MET E 370 
AD2 1 2 N ALA F 392 ? N ALA E 420 O VAL F 439 ? O VAL E 467 
AD3 1 2 N LYS F 413 ? N LYS E 441 O VAL F 458 ? O VAL E 486 
AD3 2 3 N TYR F 455 ? N TYR E 483 O LEU F 472 ? O LEU E 500 
# 
_atom_sites.entry_id                    6GL7 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . LEU A 1 3   ? 198.975 193.559 242.774 1.00 153.88 ? 98  LEU B N    1 
ATOM 2     C CA   . LEU A 1 3   ? 198.545 194.444 243.850 1.00 153.88 ? 98  LEU B CA   1 
ATOM 3     C C    . LEU A 1 3   ? 197.278 195.195 243.460 1.00 153.88 ? 98  LEU B C    1 
ATOM 4     O O    . LEU A 1 3   ? 196.845 195.149 242.309 1.00 153.88 ? 98  LEU B O    1 
ATOM 5     C CB   . LEU A 1 3   ? 199.656 195.443 244.194 1.00 153.88 ? 98  LEU B CB   1 
ATOM 6     C CG   . LEU A 1 3   ? 200.991 194.828 244.634 1.00 153.88 ? 98  LEU B CG   1 
ATOM 7     C CD1  . LEU A 1 3   ? 202.021 195.933 244.826 1.00 153.88 ? 98  LEU B CD1  1 
ATOM 8     C CD2  . LEU A 1 3   ? 200.788 194.041 245.920 1.00 153.88 ? 98  LEU B CD2  1 
ATOM 9     H H    . LEU A 1 3   ? 199.876 193.680 242.358 1.00 184.66 ? 98  LEU B H    1 
ATOM 10    H HA   . LEU A 1 3   ? 198.349 193.913 244.638 1.00 184.66 ? 98  LEU B HA   1 
ATOM 11    H HB2  . LEU A 1 3   ? 199.849 196.063 243.320 1.00 184.66 ? 98  LEU B HB2  1 
ATOM 12    H HB3  . LEU A 1 3   ? 199.306 196.088 245.001 1.00 184.66 ? 98  LEU B HB3  1 
ATOM 13    H HG   . LEU A 1 3   ? 201.359 194.161 243.854 1.00 184.66 ? 98  LEU B HG   1 
ATOM 14    H HD11 . LEU A 1 3   ? 202.969 195.496 245.138 1.00 184.66 ? 98  LEU B HD11 1 
ATOM 15    H HD12 . LEU A 1 3   ? 202.160 196.467 243.886 1.00 184.66 ? 98  LEU B HD12 1 
ATOM 16    H HD13 . LEU A 1 3   ? 201.672 196.627 245.590 1.00 184.66 ? 98  LEU B HD13 1 
ATOM 17    H HD21 . LEU A 1 3   ? 201.737 193.603 246.232 1.00 184.66 ? 98  LEU B HD21 1 
ATOM 18    H HD22 . LEU A 1 3   ? 200.421 194.707 246.701 1.00 184.66 ? 98  LEU B HD22 1 
ATOM 19    H HD23 . LEU A 1 3   ? 200.061 193.247 245.749 1.00 184.66 ? 98  LEU B HD23 1 
ATOM 20    N N    . GLY A 1 4   ? 196.684 195.891 244.432 1.00 167.20 ? 99  GLY B N    1 
ATOM 21    C CA   . GLY A 1 4   ? 195.552 196.755 244.149 1.00 167.20 ? 99  GLY B CA   1 
ATOM 22    C C    . GLY A 1 4   ? 195.916 198.023 243.404 1.00 167.20 ? 99  GLY B C    1 
ATOM 23    O O    . GLY A 1 4   ? 195.020 198.718 242.913 1.00 167.20 ? 99  GLY B O    1 
ATOM 24    H H    . GLY A 1 4   ? 196.921 195.877 245.259 1.00 200.64 ? 99  GLY B H    1 
ATOM 25    H HA2  . GLY A 1 4   ? 194.906 196.267 243.614 1.00 200.64 ? 99  GLY B HA2  1 
ATOM 26    H HA3  . GLY A 1 4   ? 195.127 197.006 244.984 1.00 200.64 ? 99  GLY B HA3  1 
ATOM 27    N N    . ALA A 1 5   ? 197.206 198.343 243.312 1.00 180.33 ? 100 ALA B N    1 
ATOM 28    C CA   . ALA A 1 5   ? 197.627 199.553 242.620 1.00 180.33 ? 100 ALA B CA   1 
ATOM 29    C C    . ALA A 1 5   ? 197.196 199.505 241.160 1.00 180.33 ? 100 ALA B C    1 
ATOM 30    O O    . ALA A 1 5   ? 197.232 198.454 240.516 1.00 180.33 ? 100 ALA B O    1 
ATOM 31    C CB   . ALA A 1 5   ? 199.144 199.718 242.716 1.00 180.33 ? 100 ALA B CB   1 
ATOM 32    H H    . ALA A 1 5   ? 197.854 197.885 243.641 1.00 216.40 ? 100 ALA B H    1 
ATOM 33    H HA   . ALA A 1 5   ? 197.210 200.323 243.036 1.00 216.40 ? 100 ALA B HA   1 
ATOM 34    H HB1  . ALA A 1 5   ? 199.402 200.533 242.257 1.00 216.40 ? 100 ALA B HB1  1 
ATOM 35    H HB2  . ALA A 1 5   ? 199.396 199.771 243.651 1.00 216.40 ? 100 ALA B HB2  1 
ATOM 36    H HB3  . ALA A 1 5   ? 199.572 198.953 242.300 1.00 216.40 ? 100 ALA B HB3  1 
ATOM 37    N N    . ARG A 1 6   ? 196.787 200.656 240.642 1.00 194.15 ? 101 ARG B N    1 
ATOM 38    C CA   . ARG A 1 6   ? 196.397 200.773 239.249 1.00 194.15 ? 101 ARG B CA   1 
ATOM 39    C C    . ARG A 1 6   ? 197.632 200.916 238.357 1.00 194.15 ? 101 ARG B C    1 
ATOM 40    O O    . ARG A 1 6   ? 198.682 201.382 238.809 1.00 194.15 ? 101 ARG B O    1 
ATOM 41    C CB   . ARG A 1 6   ? 195.477 201.969 239.049 1.00 194.15 ? 101 ARG B CB   1 
ATOM 42    C CG   . ARG A 1 6   ? 194.186 201.924 239.852 1.00 194.15 ? 101 ARG B CG   1 
ATOM 43    C CD   . ARG A 1 6   ? 193.333 200.774 239.455 1.00 194.15 ? 101 ARG B CD   1 
ATOM 44    N NE   . ARG A 1 6   ? 193.626 199.585 240.239 1.00 194.15 ? 101 ARG B NE   1 
ATOM 45    C CZ   . ARG A 1 6   ? 193.212 198.342 239.926 1.00 194.15 ? 101 ARG B CZ   1 
ATOM 46    N NH1  . ARG A 1 6   ? 192.490 198.141 238.846 1.00 194.15 ? 101 ARG B NH1  1 
ATOM 47    N NH2  . ARG A 1 6   ? 193.532 197.324 240.706 1.00 194.15 ? 101 ARG B NH2  1 
ATOM 48    H H    . ARG A 1 6   ? 196.726 201.392 241.084 1.00 232.98 ? 101 ARG B H    1 
ATOM 49    H HA   . ARG A 1 6   ? 195.922 199.967 239.011 1.00 232.98 ? 101 ARG B HA   1 
ATOM 50    H HB2  . ARG A 1 6   ? 196.003 202.882 239.323 1.00 232.98 ? 101 ARG B HB2  1 
ATOM 51    H HB3  . ARG A 1 6   ? 195.208 202.049 237.996 1.00 232.98 ? 101 ARG B HB3  1 
ATOM 52    H HG2  . ARG A 1 6   ? 194.420 201.828 240.912 1.00 232.98 ? 101 ARG B HG2  1 
ATOM 53    H HG3  . ARG A 1 6   ? 193.622 202.843 239.686 1.00 232.98 ? 101 ARG B HG3  1 
ATOM 54    H HD2  . ARG A 1 6   ? 192.285 201.031 239.605 1.00 232.98 ? 101 ARG B HD2  1 
ATOM 55    H HD3  . ARG A 1 6   ? 193.503 200.541 238.405 1.00 232.98 ? 101 ARG B HD3  1 
ATOM 56    H HE   . ARG A 1 6   ? 194.180 199.700 241.077 1.00 232.98 ? 101 ARG B HE   1 
ATOM 57    H HH11 . ARG A 1 6   ? 192.245 198.920 238.251 1.00 232.98 ? 101 ARG B HH11 1 
ATOM 58    H HH12 . ARG A 1 6   ? 192.180 197.209 238.612 1.00 232.98 ? 101 ARG B HH12 1 
ATOM 59    H HH21 . ARG A 1 6   ? 194.088 197.478 241.536 1.00 232.98 ? 101 ARG B HH21 1 
ATOM 60    H HH22 . ARG A 1 6   ? 193.222 196.392 240.472 1.00 232.98 ? 101 ARG B HH22 1 
ATOM 61    N N    . PRO A 1 7   ? 197.540 200.525 237.084 1.00 200.62 ? 102 PRO B N    1 
ATOM 62    C CA   . PRO A 1 7   ? 198.693 200.675 236.187 1.00 200.62 ? 102 PRO B CA   1 
ATOM 63    C C    . PRO A 1 7   ? 198.959 202.128 235.813 1.00 200.62 ? 102 PRO B C    1 
ATOM 64    O O    . PRO A 1 7   ? 198.089 202.999 235.886 1.00 200.62 ? 102 PRO B O    1 
ATOM 65    C CB   . PRO A 1 7   ? 198.297 199.854 234.957 1.00 200.62 ? 102 PRO B CB   1 
ATOM 66    C CG   . PRO A 1 7   ? 196.820 199.894 234.949 1.00 200.62 ? 102 PRO B CG   1 
ATOM 67    C CD   . PRO A 1 7   ? 196.397 199.875 236.388 1.00 200.62 ? 102 PRO B CD   1 
ATOM 68    H HA   . PRO A 1 7   ? 199.489 200.294 236.589 1.00 240.74 ? 102 PRO B HA   1 
ATOM 69    H HB2  . PRO A 1 7   ? 198.657 200.267 234.157 1.00 240.74 ? 102 PRO B HB2  1 
ATOM 70    H HB3  . PRO A 1 7   ? 198.617 198.943 235.051 1.00 240.74 ? 102 PRO B HB3  1 
ATOM 71    H HG2  . PRO A 1 7   ? 196.520 200.710 234.518 1.00 240.74 ? 102 PRO B HG2  1 
ATOM 72    H HG3  . PRO A 1 7   ? 196.477 199.116 234.483 1.00 240.74 ? 102 PRO B HG3  1 
ATOM 73    H HD2  . PRO A 1 7   ? 195.581 200.385 236.499 1.00 240.74 ? 102 PRO B HD2  1 
ATOM 74    H HD3  . PRO A 1 7   ? 196.287 198.961 236.693 1.00 240.74 ? 102 PRO B HD3  1 
ATOM 75    N N    . CYS A 1 8   ? 200.200 202.368 235.394 1.00 230.67 ? 103 CYS B N    1 
ATOM 76    C CA   . CYS A 1 8   ? 200.601 203.669 234.871 1.00 230.67 ? 103 CYS B CA   1 
ATOM 77    C C    . CYS A 1 8   ? 199.813 204.000 233.608 1.00 230.67 ? 103 CYS B C    1 
ATOM 78    O O    . CYS A 1 8   ? 199.847 203.250 232.627 1.00 230.67 ? 103 CYS B O    1 
ATOM 79    C CB   . CYS A 1 8   ? 202.098 203.692 234.559 1.00 230.67 ? 103 CYS B CB   1 
ATOM 80    S SG   . CYS A 1 8   ? 202.692 205.269 233.903 1.00 230.67 ? 103 CYS B SG   1 
ATOM 81    H H    . CYS A 1 8   ? 200.835 201.789 235.405 1.00 276.80 ? 103 CYS B H    1 
ATOM 82    H HA   . CYS A 1 8   ? 200.420 204.358 235.527 1.00 276.80 ? 103 CYS B HA   1 
ATOM 83    H HB2  . CYS A 1 8   ? 202.662 203.470 235.466 1.00 276.80 ? 103 CYS B HB2  1 
ATOM 84    H HB3  . CYS A 1 8   ? 202.329 202.915 233.831 1.00 276.80 ? 103 CYS B HB3  1 
ATOM 85    N N    . GLY A 1 9   ? 199.106 205.125 233.635 1.00 191.27 ? 104 GLY B N    1 
ATOM 86    C CA   . GLY A 1 9   ? 198.316 205.540 232.490 1.00 191.27 ? 104 GLY B CA   1 
ATOM 87    C C    . GLY A 1 9   ? 197.744 206.926 232.699 1.00 191.27 ? 104 GLY B C    1 
ATOM 88    O O    . GLY A 1 9   ? 198.094 207.632 233.649 1.00 191.27 ? 104 GLY B O    1 
ATOM 89    H H    . GLY A 1 9   ? 199.069 205.662 234.305 1.00 229.52 ? 104 GLY B H    1 
ATOM 90    H HA2  . GLY A 1 9   ? 198.874 205.551 231.696 1.00 229.52 ? 104 GLY B HA2  1 
ATOM 91    H HA3  . GLY A 1 9   ? 197.587 204.917 232.349 1.00 229.52 ? 104 GLY B HA3  1 
ATOM 92    N N    . LEU A 1 10  ? 196.836 207.303 231.802 1.00 167.27 ? 105 LEU B N    1 
ATOM 93    C CA   . LEU A 1 10  ? 196.209 208.620 231.839 1.00 167.27 ? 105 LEU B CA   1 
ATOM 94    C C    . LEU A 1 10  ? 195.076 208.643 232.859 1.00 167.27 ? 105 LEU B C    1 
ATOM 95    O O    . LEU A 1 10  ? 194.298 207.688 232.955 1.00 167.27 ? 105 LEU B O    1 
ATOM 96    C CB   . LEU A 1 10  ? 195.672 208.995 230.452 1.00 167.27 ? 105 LEU B CB   1 
ATOM 97    C CG   . LEU A 1 10  ? 196.732 209.220 229.366 1.00 167.27 ? 105 LEU B CG   1 
ATOM 98    C CD1  . LEU A 1 10  ? 196.048 209.388 228.016 1.00 167.27 ? 105 LEU B CD1  1 
ATOM 99    C CD2  . LEU A 1 10  ? 197.563 210.446 229.715 1.00 167.27 ? 105 LEU B CD2  1 
ATOM 100   H H    . LEU A 1 10  ? 196.566 206.808 231.153 1.00 200.72 ? 105 LEU B H    1 
ATOM 101   H HA   . LEU A 1 10  ? 196.869 209.281 232.099 1.00 200.72 ? 105 LEU B HA   1 
ATOM 102   H HB2  . LEU A 1 10  ? 195.010 208.201 230.109 1.00 200.72 ? 105 LEU B HB2  1 
ATOM 103   H HB3  . LEU A 1 10  ? 195.089 209.912 230.542 1.00 200.72 ? 105 LEU B HB3  1 
ATOM 104   H HG   . LEU A 1 10  ? 197.381 208.347 229.305 1.00 200.72 ? 105 LEU B HG   1 
ATOM 105   H HD11 . LEU A 1 10  ? 196.802 209.548 227.244 1.00 200.72 ? 105 LEU B HD11 1 
ATOM 106   H HD12 . LEU A 1 10  ? 195.477 208.490 227.783 1.00 200.72 ? 105 LEU B HD12 1 
ATOM 107   H HD13 . LEU A 1 10  ? 195.378 210.247 228.052 1.00 200.72 ? 105 LEU B HD13 1 
ATOM 108   H HD21 . LEU A 1 10  ? 198.317 210.606 228.943 1.00 200.72 ? 105 LEU B HD21 1 
ATOM 109   H HD22 . LEU A 1 10  ? 196.915 211.320 229.775 1.00 200.72 ? 105 LEU B HD22 1 
ATOM 110   H HD23 . LEU A 1 10  ? 198.054 210.291 230.676 1.00 200.72 ? 105 LEU B HD23 1 
ATOM 111   N N    . ARG A 1 11  ? 194.995 209.733 233.619 1.00 181.97 ? 106 ARG B N    1 
ATOM 112   C CA   . ARG A 1 11  ? 193.929 209.998 234.579 1.00 181.97 ? 106 ARG B CA   1 
ATOM 113   C C    . ARG A 1 11  ? 193.200 211.269 234.158 1.00 181.97 ? 106 ARG B C    1 
ATOM 114   O O    . ARG A 1 11  ? 193.591 211.939 233.200 1.00 181.97 ? 106 ARG B O    1 
ATOM 115   C CB   . ARG A 1 11  ? 194.481 210.157 235.988 1.00 181.97 ? 106 ARG B CB   1 
ATOM 116   C CG   . ARG A 1 11  ? 195.291 208.974 236.495 1.00 181.97 ? 106 ARG B CG   1 
ATOM 117   C CD   . ARG A 1 11  ? 194.427 207.799 236.781 1.00 181.97 ? 106 ARG B CD   1 
ATOM 118   N NE   . ARG A 1 11  ? 195.156 206.745 237.467 1.00 181.97 ? 106 ARG B NE   1 
ATOM 119   C CZ   . ARG A 1 11  ? 195.866 205.780 236.851 1.00 181.97 ? 106 ARG B CZ   1 
ATOM 120   N NH1  . ARG A 1 11  ? 195.933 205.749 235.539 1.00 181.97 ? 106 ARG B NH1  1 
ATOM 121   N NH2  . ARG A 1 11  ? 196.495 204.864 237.567 1.00 181.97 ? 106 ARG B NH2  1 
ATOM 122   H H    . ARG A 1 11  ? 195.578 210.365 233.593 1.00 218.36 ? 106 ARG B H    1 
ATOM 123   H HA   . ARG A 1 11  ? 193.293 209.266 234.576 1.00 218.36 ? 106 ARG B HA   1 
ATOM 124   H HB2  . ARG A 1 11  ? 195.121 211.037 236.031 1.00 218.36 ? 106 ARG B HB2  1 
ATOM 125   H HB3  . ARG A 1 11  ? 193.658 210.316 236.685 1.00 218.36 ? 106 ARG B HB3  1 
ATOM 126   H HG2  . ARG A 1 11  ? 196.024 208.685 235.741 1.00 218.36 ? 106 ARG B HG2  1 
ATOM 127   H HG3  . ARG A 1 11  ? 195.806 209.253 237.414 1.00 218.36 ? 106 ARG B HG3  1 
ATOM 128   H HD2  . ARG A 1 11  ? 193.595 208.106 237.413 1.00 218.36 ? 106 ARG B HD2  1 
ATOM 129   H HD3  . ARG A 1 11  ? 194.043 207.394 235.845 1.00 218.36 ? 106 ARG B HD3  1 
ATOM 130   H HE   . ARG A 1 11  ? 195.128 206.735 238.478 1.00 218.36 ? 106 ARG B HE   1 
ATOM 131   H HH11 . ARG A 1 11  ? 195.452 206.449 234.992 1.00 218.36 ? 106 ARG B HH11 1 
ATOM 132   H HH12 . ARG A 1 11  ? 196.465 205.026 235.077 1.00 218.36 ? 106 ARG B HH12 1 
ATOM 133   H HH21 . ARG A 1 11  ? 196.443 204.887 238.576 1.00 218.36 ? 106 ARG B HH21 1 
ATOM 134   H HH22 . ARG A 1 11  ? 197.027 204.141 237.105 1.00 218.36 ? 106 ARG B HH22 1 
ATOM 135   N N    . GLU A 1 12  ? 192.136 211.614 234.888 1.00 181.53 ? 107 GLU B N    1 
ATOM 136   C CA   . GLU A 1 12  ? 191.402 212.843 234.612 1.00 181.53 ? 107 GLU B CA   1 
ATOM 137   C C    . GLU A 1 12  ? 190.780 213.397 235.885 1.00 181.53 ? 107 GLU B C    1 
ATOM 138   O O    . GLU A 1 12  ? 190.406 212.649 236.792 1.00 181.53 ? 107 GLU B O    1 
ATOM 139   C CB   . GLU A 1 12  ? 190.313 212.594 233.565 1.00 181.53 ? 107 GLU B CB   1 
ATOM 140   C CG   . GLU A 1 12  ? 189.202 211.660 234.023 1.00 181.53 ? 107 GLU B CG   1 
ATOM 141   C CD   . GLU A 1 12  ? 188.170 211.413 232.959 1.00 181.53 ? 107 GLU B CD   1 
ATOM 142   O OE1  . GLU A 1 12  ? 188.507 211.486 231.802 1.00 181.53 ? 107 GLU B OE1  1 
ATOM 143   O OE2  . GLU A 1 12  ? 187.041 211.151 233.303 1.00 181.53 ? 107 GLU B OE2  1 
ATOM 144   H H    . GLU A 1 12  ? 191.825 211.156 235.545 1.00 217.84 ? 107 GLU B H    1 
ATOM 145   H HA   . GLU A 1 12  ? 192.010 213.517 234.281 1.00 217.84 ? 107 GLU B HA   1 
ATOM 146   H HB2  . GLU A 1 12  ? 189.857 213.543 233.282 1.00 217.84 ? 107 GLU B HB2  1 
ATOM 147   H HB3  . GLU A 1 12  ? 190.761 212.166 232.668 1.00 217.84 ? 107 GLU B HB3  1 
ATOM 148   H HG2  . GLU A 1 12  ? 189.641 210.707 234.316 1.00 217.84 ? 107 GLU B HG2  1 
ATOM 149   H HG3  . GLU A 1 12  ? 188.718 212.091 234.899 1.00 217.84 ? 107 GLU B HG3  1 
ATOM 150   N N    . LEU A 1 13  ? 190.679 214.727 235.938 1.00 167.63 ? 108 LEU B N    1 
ATOM 151   C CA   . LEU A 1 13  ? 189.906 215.404 236.972 1.00 167.63 ? 108 LEU B CA   1 
ATOM 152   C C    . LEU A 1 13  ? 189.441 216.753 236.441 1.00 167.63 ? 108 LEU B C    1 
ATOM 153   O O    . LEU A 1 13  ? 190.247 217.532 235.929 1.00 167.63 ? 108 LEU B O    1 
ATOM 154   C CB   . LEU A 1 13  ? 190.744 215.593 238.243 1.00 167.63 ? 108 LEU B CB   1 
ATOM 155   C CG   . LEU A 1 13  ? 190.052 216.341 239.390 1.00 167.63 ? 108 LEU B CG   1 
ATOM 156   C CD1  . LEU A 1 13  ? 188.893 215.505 239.915 1.00 167.63 ? 108 LEU B CD1  1 
ATOM 157   C CD2  . LEU A 1 13  ? 191.063 216.628 240.491 1.00 167.63 ? 108 LEU B CD2  1 
ATOM 158   H H    . LEU A 1 13  ? 191.055 215.262 235.379 1.00 201.16 ? 108 LEU B H    1 
ATOM 159   H HA   . LEU A 1 13  ? 189.125 214.871 237.180 1.00 201.16 ? 108 LEU B HA   1 
ATOM 160   H HB2  . LEU A 1 13  ? 191.037 214.613 238.615 1.00 201.16 ? 108 LEU B HB2  1 
ATOM 161   H HB3  . LEU A 1 13  ? 191.647 216.145 237.984 1.00 201.16 ? 108 LEU B HB3  1 
ATOM 162   H HG   . LEU A 1 13  ? 189.644 217.281 239.018 1.00 201.16 ? 108 LEU B HG   1 
ATOM 163   H HD11 . LEU A 1 13  ? 188.401 216.037 240.730 1.00 201.16 ? 108 LEU B HD11 1 
ATOM 164   H HD12 . LEU A 1 13  ? 188.176 215.332 239.112 1.00 201.16 ? 108 LEU B HD12 1 
ATOM 165   H HD13 . LEU A 1 13  ? 189.269 214.550 240.280 1.00 201.16 ? 108 LEU B HD13 1 
ATOM 166   H HD21 . LEU A 1 13  ? 190.571 217.160 241.306 1.00 201.16 ? 108 LEU B HD21 1 
ATOM 167   H HD22 . LEU A 1 13  ? 191.470 215.688 240.864 1.00 201.16 ? 108 LEU B HD22 1 
ATOM 168   H HD23 . LEU A 1 13  ? 191.871 217.241 240.092 1.00 201.16 ? 108 LEU B HD23 1 
ATOM 169   N N    . GLU A 1 14  ? 188.144 217.023 236.572 1.00 175.77 ? 109 GLU B N    1 
ATOM 170   C CA   . GLU A 1 14  ? 187.576 218.297 236.144 1.00 175.77 ? 109 GLU B CA   1 
ATOM 171   C C    . GLU A 1 14  ? 187.877 219.353 237.201 1.00 175.77 ? 109 GLU B C    1 
ATOM 172   O O    . GLU A 1 14  ? 187.434 219.227 238.348 1.00 175.77 ? 109 GLU B O    1 
ATOM 173   C CB   . GLU A 1 14  ? 186.066 218.178 235.923 1.00 175.77 ? 109 GLU B CB   1 
ATOM 174   C CG   . GLU A 1 14  ? 185.398 219.458 235.444 1.00 175.77 ? 109 GLU B CG   1 
ATOM 175   C CD   . GLU A 1 14  ? 183.918 219.301 235.230 1.00 175.77 ? 109 GLU B CD   1 
ATOM 176   O OE1  . GLU A 1 14  ? 183.419 218.221 235.434 1.00 175.77 ? 109 GLU B OE1  1 
ATOM 177   O OE2  . GLU A 1 14  ? 183.286 220.264 234.862 1.00 175.77 ? 109 GLU B OE2  1 
ATOM 178   H H    . GLU A 1 14  ? 187.569 216.480 236.908 1.00 210.92 ? 109 GLU B H    1 
ATOM 179   H HA   . GLU A 1 14  ? 187.980 218.572 235.307 1.00 210.92 ? 109 GLU B HA   1 
ATOM 180   H HB2  . GLU A 1 14  ? 185.866 217.400 235.186 1.00 210.92 ? 109 GLU B HB2  1 
ATOM 181   H HB3  . GLU A 1 14  ? 185.585 217.877 236.854 1.00 210.92 ? 109 GLU B HB3  1 
ATOM 182   H HG2  . GLU A 1 14  ? 185.565 220.242 236.183 1.00 210.92 ? 109 GLU B HG2  1 
ATOM 183   H HG3  . GLU A 1 14  ? 185.864 219.772 234.511 1.00 210.92 ? 109 GLU B HG3  1 
ATOM 184   N N    . VAL A 1 15  ? 188.628 220.391 236.822 1.00 163.11 ? 110 VAL B N    1 
ATOM 185   C CA   . VAL A 1 15  ? 189.043 221.434 237.759 1.00 163.11 ? 110 VAL B CA   1 
ATOM 186   C C    . VAL A 1 15  ? 188.856 222.797 237.103 1.00 163.11 ? 110 VAL B C    1 
ATOM 187   O O    . VAL A 1 15  ? 189.186 222.983 235.929 1.00 163.11 ? 110 VAL B O    1 
ATOM 188   C CB   . VAL A 1 15  ? 190.516 221.251 238.171 1.00 163.11 ? 110 VAL B CB   1 
ATOM 189   C CG1  . VAL A 1 15  ? 190.924 222.317 239.177 1.00 163.11 ? 110 VAL B CG1  1 
ATOM 190   C CG2  . VAL A 1 15  ? 190.722 219.858 238.747 1.00 163.11 ? 110 VAL B CG2  1 
ATOM 191   H H    . VAL A 1 15  ? 188.913 220.512 236.020 1.00 195.73 ? 110 VAL B H    1 
ATOM 192   H HA   . VAL A 1 15  ? 188.483 221.417 238.550 1.00 195.73 ? 110 VAL B HA   1 
ATOM 193   H HB   . VAL A 1 15  ? 191.148 221.379 237.292 1.00 195.73 ? 110 VAL B HB   1 
ATOM 194   H HG11 . VAL A 1 15  ? 191.968 222.172 239.457 1.00 195.73 ? 110 VAL B HG11 1 
ATOM 195   H HG12 . VAL A 1 15  ? 190.802 223.303 238.731 1.00 195.73 ? 110 VAL B HG12 1 
ATOM 196   H HG13 . VAL A 1 15  ? 190.297 222.238 240.065 1.00 195.73 ? 110 VAL B HG13 1 
ATOM 197   H HG21 . VAL A 1 15  ? 191.766 219.735 239.035 1.00 195.73 ? 110 VAL B HG21 1 
ATOM 198   H HG22 . VAL A 1 15  ? 190.086 219.728 239.622 1.00 195.73 ? 110 VAL B HG22 1 
ATOM 199   H HG23 . VAL A 1 15  ? 190.463 219.112 237.996 1.00 195.73 ? 110 VAL B HG23 1 
ATOM 200   N N    . ARG A 1 16  ? 188.334 223.752 237.873 1.00 162.28 ? 111 ARG B N    1 
ATOM 201   C CA   . ARG A 1 16  ? 188.230 225.128 237.404 1.00 162.28 ? 111 ARG B CA   1 
ATOM 202   C C    . ARG A 1 16  ? 189.617 225.736 237.211 1.00 162.28 ? 111 ARG B C    1 
ATOM 203   O O    . ARG A 1 16  ? 190.573 225.399 237.913 1.00 162.28 ? 111 ARG B O    1 
ATOM 204   C CB   . ARG A 1 16  ? 187.436 225.974 238.388 1.00 162.28 ? 111 ARG B CB   1 
ATOM 205   C CG   . ARG A 1 16  ? 185.941 225.699 238.407 1.00 162.28 ? 111 ARG B CG   1 
ATOM 206   C CD   . ARG A 1 16  ? 185.220 226.640 239.302 1.00 162.28 ? 111 ARG B CD   1 
ATOM 207   N NE   . ARG A 1 16  ? 185.556 226.424 240.700 1.00 162.28 ? 111 ARG B NE   1 
ATOM 208   C CZ   . ARG A 1 16  ? 185.182 227.232 241.710 1.00 162.28 ? 111 ARG B CZ   1 
ATOM 209   N NH1  . ARG A 1 16  ? 184.461 228.304 241.463 1.00 162.28 ? 111 ARG B NH1  1 
ATOM 210   N NH2  . ARG A 1 16  ? 185.539 226.948 242.951 1.00 162.28 ? 111 ARG B NH2  1 
ATOM 211   H H    . ARG A 1 16  ? 188.032 223.628 238.668 1.00 194.74 ? 111 ARG B H    1 
ATOM 212   H HA   . ARG A 1 16  ? 187.771 225.148 236.555 1.00 194.74 ? 111 ARG B HA   1 
ATOM 213   H HB2  . ARG A 1 16  ? 187.814 225.809 239.397 1.00 194.74 ? 111 ARG B HB2  1 
ATOM 214   H HB3  . ARG A 1 16  ? 187.574 227.030 238.156 1.00 194.74 ? 111 ARG B HB3  1 
ATOM 215   H HG2  . ARG A 1 16  ? 185.538 225.808 237.399 1.00 194.74 ? 111 ARG B HG2  1 
ATOM 216   H HG3  . ARG A 1 16  ? 185.762 224.683 238.761 1.00 194.74 ? 111 ARG B HG3  1 
ATOM 217   H HD2  . ARG A 1 16  ? 185.486 227.665 239.042 1.00 194.74 ? 111 ARG B HD2  1 
ATOM 218   H HD3  . ARG A 1 16  ? 184.146 226.503 239.184 1.00 194.74 ? 111 ARG B HD3  1 
ATOM 219   H HE   . ARG A 1 16  ? 186.109 225.609 240.930 1.00 194.74 ? 111 ARG B HE   1 
ATOM 220   H HH11 . ARG A 1 16  ? 184.188 228.521 240.515 1.00 194.74 ? 111 ARG B HH11 1 
ATOM 221   H HH12 . ARG A 1 16  ? 184.181 228.910 242.220 1.00 194.74 ? 111 ARG B HH12 1 
ATOM 222   H HH21 . ARG A 1 16  ? 186.092 226.124 243.141 1.00 194.74 ? 111 ARG B HH21 1 
ATOM 223   H HH22 . ARG A 1 16  ? 185.258 227.554 243.708 1.00 194.74 ? 111 ARG B HH22 1 
ATOM 224   N N    . VAL A 1 17  ? 189.715 226.651 236.244 1.00 166.95 ? 112 VAL B N    1 
ATOM 225   C CA   . VAL A 1 17  ? 191.001 227.267 235.922 1.00 166.95 ? 112 VAL B CA   1 
ATOM 226   C C    . VAL A 1 17  ? 191.578 227.954 237.155 1.00 166.95 ? 112 VAL B C    1 
ATOM 227   O O    . VAL A 1 17  ? 192.761 227.796 237.480 1.00 166.95 ? 112 VAL B O    1 
ATOM 228   C CB   . VAL A 1 17  ? 190.840 228.295 234.786 1.00 166.95 ? 112 VAL B CB   1 
ATOM 229   C CG1  . VAL A 1 17  ? 192.117 229.105 234.616 1.00 166.95 ? 112 VAL B CG1  1 
ATOM 230   C CG2  . VAL A 1 17  ? 190.476 227.584 233.492 1.00 166.95 ? 112 VAL B CG2  1 
ATOM 231   H H    . VAL A 1 17  ? 189.057 226.931 235.766 1.00 200.34 ? 112 VAL B H    1 
ATOM 232   H HA   . VAL A 1 17  ? 191.621 226.572 235.651 1.00 200.34 ? 112 VAL B HA   1 
ATOM 233   H HB   . VAL A 1 17  ? 190.048 228.996 235.052 1.00 200.34 ? 112 VAL B HB   1 
ATOM 234   H HG11 . VAL A 1 17  ? 191.985 229.827 233.810 1.00 200.34 ? 112 VAL B HG11 1 
ATOM 235   H HG12 . VAL A 1 17  ? 192.338 229.634 235.543 1.00 200.34 ? 112 VAL B HG12 1 
ATOM 236   H HG13 . VAL A 1 17  ? 192.942 228.436 234.373 1.00 200.34 ? 112 VAL B HG13 1 
ATOM 237   H HG21 . VAL A 1 17  ? 190.363 228.317 232.694 1.00 200.34 ? 112 VAL B HG21 1 
ATOM 238   H HG22 . VAL A 1 17  ? 191.265 226.879 233.230 1.00 200.34 ? 112 VAL B HG22 1 
ATOM 239   H HG23 . VAL A 1 17  ? 189.538 227.045 233.625 1.00 200.34 ? 112 VAL B HG23 1 
ATOM 240   N N    . SER A 1 18  ? 190.750 228.732 237.860 1.00 177.16 ? 113 SER B N    1 
ATOM 241   C CA   . SER A 1 18  ? 191.214 229.392 239.076 1.00 177.16 ? 113 SER B CA   1 
ATOM 242   C C    . SER A 1 18  ? 191.610 228.385 240.148 1.00 177.16 ? 113 SER B C    1 
ATOM 243   O O    . SER A 1 18  ? 192.550 228.631 240.912 1.00 177.16 ? 113 SER B O    1 
ATOM 244   C CB   . SER A 1 18  ? 190.133 230.310 239.613 1.00 177.16 ? 113 SER B CB   1 
ATOM 245   O OG   . SER A 1 18  ? 189.040 229.574 240.090 1.00 177.16 ? 113 SER B OG   1 
ATOM 246   H H    . SER A 1 18  ? 189.931 228.890 237.656 1.00 212.59 ? 113 SER B H    1 
ATOM 247   H HA   . SER A 1 18  ? 191.994 229.927 238.866 1.00 212.59 ? 113 SER B HA   1 
ATOM 248   H HB2  . SER A 1 18  ? 190.541 230.922 240.417 1.00 212.59 ? 113 SER B HB2  1 
ATOM 249   H HB3  . SER A 1 18  ? 189.804 230.984 238.823 1.00 212.59 ? 113 SER B HB3  1 
ATOM 250   H HG   . SER A 1 18  ? 188.304 230.189 240.130 1.00 212.59 ? 113 SER B HG   1 
ATOM 251   N N    . GLU A 1 19  ? 190.912 227.249 240.224 1.00 165.22 ? 114 GLU B N    1 
ATOM 252   C CA   . GLU A 1 19  ? 191.267 226.226 241.198 1.00 165.22 ? 114 GLU B CA   1 
ATOM 253   C C    . GLU A 1 19  ? 192.635 225.613 240.927 1.00 165.22 ? 114 GLU B C    1 
ATOM 254   O O    . GLU A 1 19  ? 193.272 225.119 241.862 1.00 165.22 ? 114 GLU B O    1 
ATOM 255   C CB   . GLU A 1 19  ? 190.206 225.124 241.212 1.00 165.22 ? 114 GLU B CB   1 
ATOM 256   C CG   . GLU A 1 19  ? 188.878 225.537 241.830 1.00 165.22 ? 114 GLU B CG   1 
ATOM 257   C CD   . GLU A 1 19  ? 187.860 224.431 241.822 1.00 165.22 ? 114 GLU B CD   1 
ATOM 258   O OE1  . GLU A 1 19  ? 187.904 223.614 240.934 1.00 165.22 ? 114 GLU B OE1  1 
ATOM 259   O OE2  . GLU A 1 19  ? 187.036 224.403 242.706 1.00 165.22 ? 114 GLU B OE2  1 
ATOM 260   H H    . GLU A 1 19  ? 190.238 227.052 239.728 1.00 198.26 ? 114 GLU B H    1 
ATOM 261   H HA   . GLU A 1 19  ? 191.297 226.632 242.080 1.00 198.26 ? 114 GLU B HA   1 
ATOM 262   H HB2  . GLU A 1 19  ? 190.012 224.793 240.191 1.00 198.26 ? 114 GLU B HB2  1 
ATOM 263   H HB3  . GLU A 1 19  ? 190.581 224.264 241.768 1.00 198.26 ? 114 GLU B HB3  1 
ATOM 264   H HG2  . GLU A 1 19  ? 189.050 225.850 242.859 1.00 198.26 ? 114 GLU B HG2  1 
ATOM 265   H HG3  . GLU A 1 19  ? 188.484 226.391 241.280 1.00 198.26 ? 114 GLU B HG3  1 
ATOM 266   N N    . LEU A 1 20  ? 193.107 225.636 239.678 1.00 159.42 ? 115 LEU B N    1 
ATOM 267   C CA   . LEU A 1 20  ? 194.434 225.117 239.368 1.00 159.42 ? 115 LEU B CA   1 
ATOM 268   C C    . LEU A 1 20  ? 195.554 225.916 240.025 1.00 159.42 ? 115 LEU B C    1 
ATOM 269   O O    . LEU A 1 20  ? 196.687 225.424 240.084 1.00 159.42 ? 115 LEU B O    1 
ATOM 270   C CB   . LEU A 1 20  ? 194.650 225.092 237.850 1.00 159.42 ? 115 LEU B CB   1 
ATOM 271   C CG   . LEU A 1 20  ? 193.790 224.123 237.031 1.00 159.42 ? 115 LEU B CG   1 
ATOM 272   C CD1  . LEU A 1 20  ? 193.962 224.403 235.545 1.00 159.42 ? 115 LEU B CD1  1 
ATOM 273   C CD2  . LEU A 1 20  ? 194.125 222.666 237.330 1.00 159.42 ? 115 LEU B CD2  1 
ATOM 274   H H    . LEU A 1 20  ? 192.683 225.944 238.997 1.00 191.30 ? 115 LEU B H    1 
ATOM 275   H HA   . LEU A 1 20  ? 194.497 224.210 239.700 1.00 191.30 ? 115 LEU B HA   1 
ATOM 276   H HB2  . LEU A 1 20  ? 194.477 225.983 237.508 1.00 191.30 ? 115 LEU B HB2  1 
ATOM 277   H HB3  . LEU A 1 20  ? 195.576 224.862 237.683 1.00 191.30 ? 115 LEU B HB3  1 
ATOM 278   H HG   . LEU A 1 20  ? 192.857 224.265 237.254 1.00 191.30 ? 115 LEU B HG   1 
ATOM 279   H HD11 . LEU A 1 20  ? 193.413 223.782 235.041 1.00 191.30 ? 115 LEU B HD11 1 
ATOM 280   H HD12 . LEU A 1 20  ? 193.685 225.315 235.361 1.00 191.30 ? 115 LEU B HD12 1 
ATOM 281   H HD13 . LEU A 1 20  ? 194.895 224.287 235.308 1.00 191.30 ? 115 LEU B HD13 1 
ATOM 282   H HD21 . LEU A 1 20  ? 193.593 222.097 236.753 1.00 191.30 ? 115 LEU B HD21 1 
ATOM 283   H HD22 . LEU A 1 20  ? 195.068 222.518 237.160 1.00 191.30 ? 115 LEU B HD22 1 
ATOM 284   H HD23 . LEU A 1 20  ? 193.920 222.472 238.258 1.00 191.30 ? 115 LEU B HD23 1 
ATOM 285   N N    . GLY A 1 21  ? 195.277 227.122 240.515 1.00 169.88 ? 116 GLY B N    1 
ATOM 286   C CA   . GLY A 1 21  ? 196.294 227.916 241.177 1.00 169.88 ? 116 GLY B CA   1 
ATOM 287   C C    . GLY A 1 21  ? 197.310 228.538 240.247 1.00 169.88 ? 116 GLY B C    1 
ATOM 288   O O    . GLY A 1 21  ? 198.448 228.782 240.663 1.00 169.88 ? 116 GLY B O    1 
ATOM 289   H H    . GLY A 1 21  ? 194.507 227.502 240.475 1.00 203.86 ? 116 GLY B H    1 
ATOM 290   H HA2  . GLY A 1 21  ? 195.864 228.630 241.673 1.00 203.86 ? 116 GLY B HA2  1 
ATOM 291   H HA3  . GLY A 1 21  ? 196.769 227.355 241.810 1.00 203.86 ? 116 GLY B HA3  1 
ATOM 292   N N    . LEU A 1 22  ? 196.930 228.808 238.999 1.00 180.92 ? 117 LEU B N    1 
ATOM 293   C CA   . LEU A 1 22  ? 197.831 229.365 237.999 1.00 180.92 ? 117 LEU B CA   1 
ATOM 294   C C    . LEU A 1 22  ? 197.721 230.880 237.877 1.00 180.92 ? 117 LEU B C    1 
ATOM 295   O O    . LEU A 1 22  ? 198.361 231.465 236.997 1.00 180.92 ? 117 LEU B O    1 
ATOM 296   C CB   . LEU A 1 22  ? 197.546 228.725 236.634 1.00 180.92 ? 117 LEU B CB   1 
ATOM 297   C CG   . LEU A 1 22  ? 197.704 227.200 236.569 1.00 180.92 ? 117 LEU B CG   1 
ATOM 298   C CD1  . LEU A 1 22  ? 197.283 226.704 235.192 1.00 180.92 ? 117 LEU B CD1  1 
ATOM 299   C CD2  . LEU A 1 22  ? 199.148 226.825 236.868 1.00 180.92 ? 117 LEU B CD2  1 
ATOM 300   H H    . LEU A 1 22  ? 196.133 228.673 238.704 1.00 217.10 ? 117 LEU B H    1 
ATOM 301   H HA   . LEU A 1 22  ? 198.746 229.167 238.242 1.00 217.10 ? 117 LEU B HA   1 
ATOM 302   H HB2  . LEU A 1 22  ? 196.525 228.965 236.344 1.00 217.10 ? 117 LEU B HB2  1 
ATOM 303   H HB3  . LEU A 1 22  ? 198.223 229.160 235.899 1.00 217.10 ? 117 LEU B HB3  1 
ATOM 304   H HG   . LEU A 1 22  ? 197.048 226.735 237.305 1.00 217.10 ? 117 LEU B HG   1 
ATOM 305   H HD11 . LEU A 1 22  ? 197.395 225.621 235.145 1.00 217.10 ? 117 LEU B HD11 1 
ATOM 306   H HD12 . LEU A 1 22  ? 196.241 226.969 235.012 1.00 217.10 ? 117 LEU B HD12 1 
ATOM 307   H HD13 . LEU A 1 22  ? 197.912 227.167 234.431 1.00 217.10 ? 117 LEU B HD13 1 
ATOM 308   H HD21 . LEU A 1 22  ? 199.259 225.742 236.822 1.00 217.10 ? 117 LEU B HD21 1 
ATOM 309   H HD22 . LEU A 1 22  ? 199.804 227.289 236.131 1.00 217.10 ? 117 LEU B HD22 1 
ATOM 310   H HD23 . LEU A 1 22  ? 199.416 227.176 237.864 1.00 217.10 ? 117 LEU B HD23 1 
ATOM 311   N N    . GLY A 1 23  ? 196.937 231.529 238.736 1.00 189.68 ? 118 GLY B N    1 
ATOM 312   C CA   . GLY A 1 23  ? 196.786 232.968 238.685 1.00 189.68 ? 118 GLY B CA   1 
ATOM 313   C C    . GLY A 1 23  ? 195.774 233.477 237.684 1.00 189.68 ? 118 GLY B C    1 
ATOM 314   O O    . GLY A 1 23  ? 195.668 234.696 237.504 1.00 189.68 ? 118 GLY B O    1 
ATOM 315   H H    . GLY A 1 23  ? 196.480 231.156 239.360 1.00 227.62 ? 118 GLY B H    1 
ATOM 316   H HA2  . GLY A 1 23  ? 196.522 233.286 239.562 1.00 227.62 ? 118 GLY B HA2  1 
ATOM 317   H HA3  . GLY A 1 23  ? 197.645 233.365 238.468 1.00 227.62 ? 118 GLY B HA3  1 
ATOM 318   N N    . TYR A 1 24  ? 195.027 232.590 237.029 1.00 152.14 ? 119 TYR B N    1 
ATOM 319   C CA   . TYR A 1 24  ? 194.060 232.964 235.998 1.00 152.14 ? 119 TYR B CA   1 
ATOM 320   C C    . TYR A 1 24  ? 192.672 232.905 236.628 1.00 152.14 ? 119 TYR B C    1 
ATOM 321   O O    . TYR A 1 24  ? 192.152 231.824 236.916 1.00 152.14 ? 119 TYR B O    1 
ATOM 322   C CB   . TYR A 1 24  ? 194.154 232.044 234.778 1.00 152.14 ? 119 TYR B CB   1 
ATOM 323   C CG   . TYR A 1 24  ? 195.474 232.134 234.046 1.00 152.14 ? 119 TYR B CG   1 
ATOM 324   C CD1  . TYR A 1 24  ? 195.835 233.312 233.410 1.00 152.14 ? 119 TYR B CD1  1 
ATOM 325   C CD2  . TYR A 1 24  ? 196.323 231.038 234.010 1.00 152.14 ? 119 TYR B CD2  1 
ATOM 326   C CE1  . TYR A 1 24  ? 197.041 233.394 232.741 1.00 152.14 ? 119 TYR B CE1  1 
ATOM 327   C CE2  . TYR A 1 24  ? 197.529 231.120 233.341 1.00 152.14 ? 119 TYR B CE2  1 
ATOM 328   C CZ   . TYR A 1 24  ? 197.886 232.304 232.705 1.00 152.14 ? 119 TYR B CZ   1 
ATOM 329   O OH   . TYR A 1 24  ? 199.087 232.386 232.038 1.00 152.14 ? 119 TYR B OH   1 
ATOM 330   H H    . TYR A 1 24  ? 195.056 231.742 237.163 1.00 182.57 ? 119 TYR B H    1 
ATOM 331   H HA   . TYR A 1 24  ? 194.192 233.881 235.718 1.00 182.57 ? 119 TYR B HA   1 
ATOM 332   H HB2  . TYR A 1 24  ? 194.008 231.009 235.091 1.00 182.57 ? 119 TYR B HB2  1 
ATOM 333   H HB3  . TYR A 1 24  ? 193.357 232.288 234.076 1.00 182.57 ? 119 TYR B HB3  1 
ATOM 334   H HD1  . TYR A 1 24  ? 195.168 234.174 233.439 1.00 182.57 ? 119 TYR B HD1  1 
ATOM 335   H HD2  . TYR A 1 24  ? 196.039 230.111 234.510 1.00 182.57 ? 119 TYR B HD2  1 
ATOM 336   H HE1  . TYR A 1 24  ? 197.325 234.321 232.241 1.00 182.57 ? 119 TYR B HE1  1 
ATOM 337   H HE2  . TYR A 1 24  ? 198.196 230.259 233.312 1.00 182.57 ? 119 TYR B HE2  1 
ATOM 338   H HH   . TYR A 1 24  ? 199.181 233.262 231.657 1.00 182.57 ? 119 TYR B HH   1 
ATOM 339   N N    . ALA A 1 25  ? 192.073 234.078 236.839 1.00 144.24 ? 120 ALA B N    1 
ATOM 340   C CA   . ALA A 1 25  ? 190.801 234.196 237.551 1.00 144.24 ? 120 ALA B CA   1 
ATOM 341   C C    . ALA A 1 25  ? 189.638 233.869 236.611 1.00 144.24 ? 120 ALA B C    1 
ATOM 342   O O    . ALA A 1 25  ? 188.964 234.745 236.067 1.00 144.24 ? 120 ALA B O    1 
ATOM 343   C CB   . ALA A 1 25  ? 190.660 235.591 238.143 1.00 144.24 ? 120 ALA B CB   1 
ATOM 344   H H    . ALA A 1 25  ? 192.390 234.832 236.574 1.00 173.09 ? 120 ALA B H    1 
ATOM 345   H HA   . ALA A 1 25  ? 190.785 233.557 238.281 1.00 173.09 ? 120 ALA B HA   1 
ATOM 346   H HB1  . ALA A 1 25  ? 189.819 235.648 238.623 1.00 173.09 ? 120 ALA B HB1  1 
ATOM 347   H HB2  . ALA A 1 25  ? 191.399 235.754 238.748 1.00 173.09 ? 120 ALA B HB2  1 
ATOM 348   H HB3  . ALA A 1 25  ? 190.672 236.241 237.422 1.00 173.09 ? 120 ALA B HB3  1 
ATOM 349   N N    . SER A 1 26  ? 189.410 232.569 236.433 1.00 155.91 ? 121 SER B N    1 
ATOM 350   C CA   . SER A 1 26  ? 188.400 232.056 235.516 1.00 155.91 ? 121 SER B CA   1 
ATOM 351   C C    . SER A 1 26  ? 187.630 230.932 236.191 1.00 155.91 ? 121 SER B C    1 
ATOM 352   O O    . SER A 1 26  ? 188.218 230.111 236.902 1.00 155.91 ? 121 SER B O    1 
ATOM 353   C CB   . SER A 1 26  ? 189.042 231.557 234.236 1.00 155.91 ? 121 SER B CB   1 
ATOM 354   O OG   . SER A 1 26  ? 188.112 230.874 233.441 1.00 155.91 ? 121 SER B OG   1 
ATOM 355   H H    . SER A 1 26  ? 189.843 231.950 236.842 1.00 187.09 ? 121 SER B H    1 
ATOM 356   H HA   . SER A 1 26  ? 187.769 232.756 235.289 1.00 187.09 ? 121 SER B HA   1 
ATOM 357   H HB2  . SER A 1 26  ? 189.449 232.401 233.680 1.00 187.09 ? 121 SER B HB2  1 
ATOM 358   H HB3  . SER A 1 26  ? 189.872 230.895 234.480 1.00 187.09 ? 121 SER B HB3  1 
ATOM 359   H HG   . SER A 1 26  ? 188.577 230.635 232.636 1.00 187.09 ? 121 SER B HG   1 
ATOM 360   N N    . ASP A 1 27  ? 186.321 230.891 235.954 1.00 152.28 ? 122 ASP B N    1 
ATOM 361   C CA   . ASP A 1 27  ? 185.451 229.864 236.514 1.00 152.28 ? 122 ASP B CA   1 
ATOM 362   C C    . ASP A 1 27  ? 185.182 228.709 235.550 1.00 152.28 ? 122 ASP B C    1 
ATOM 363   O O    . ASP A 1 27  ? 184.365 227.838 235.864 1.00 152.28 ? 122 ASP B O    1 
ATOM 364   C CB   . ASP A 1 27  ? 184.120 230.486 236.940 1.00 152.28 ? 122 ASP B CB   1 
ATOM 365   C CG   . ASP A 1 27  ? 184.266 231.459 238.103 1.00 152.28 ? 122 ASP B CG   1 
ATOM 366   O OD1  . ASP A 1 27  ? 184.989 231.153 239.021 1.00 152.28 ? 122 ASP B OD1  1 
ATOM 367   O OD2  . ASP A 1 27  ? 183.653 232.499 238.061 1.00 152.28 ? 122 ASP B OD2  1 
ATOM 368   H H    . ASP A 1 27  ? 185.914 231.461 235.456 1.00 182.74 ? 122 ASP B H    1 
ATOM 369   H HA   . ASP A 1 27  ? 185.874 229.491 237.302 1.00 182.74 ? 122 ASP B HA   1 
ATOM 370   H HB2  . ASP A 1 27  ? 183.679 231.016 236.095 1.00 182.74 ? 122 ASP B HB2  1 
ATOM 371   H HB3  . ASP A 1 27  ? 183.425 229.697 237.230 1.00 182.74 ? 122 ASP B HB3  1 
ATOM 372   N N    . GLU A 1 28  ? 185.842 228.678 234.394 1.00 154.51 ? 123 GLU B N    1 
ATOM 373   C CA   . GLU A 1 28  ? 185.718 227.542 233.493 1.00 154.51 ? 123 GLU B CA   1 
ATOM 374   C C    . GLU A 1 28  ? 186.460 226.333 234.047 1.00 154.51 ? 123 GLU B C    1 
ATOM 375   O O    . GLU A 1 28  ? 187.476 226.463 234.736 1.00 154.51 ? 123 GLU B O    1 
ATOM 376   C CB   . GLU A 1 28  ? 186.256 227.896 232.105 1.00 154.51 ? 123 GLU B CB   1 
ATOM 377   C CG   . GLU A 1 28  ? 185.405 228.898 231.338 1.00 154.51 ? 123 GLU B CG   1 
ATOM 378   C CD   . GLU A 1 28  ? 185.822 229.040 229.900 1.00 154.51 ? 123 GLU B CD   1 
ATOM 379   O OE1  . GLU A 1 28  ? 186.477 228.156 229.402 1.00 154.51 ? 123 GLU B OE1  1 
ATOM 380   O OE2  . GLU A 1 28  ? 185.484 230.033 229.300 1.00 154.51 ? 123 GLU B OE2  1 
ATOM 381   H H    . GLU A 1 28  ? 186.363 229.297 234.103 1.00 185.41 ? 123 GLU B H    1 
ATOM 382   H HA   . GLU A 1 28  ? 184.781 227.307 233.397 1.00 185.41 ? 123 GLU B HA   1 
ATOM 383   H HB2  . GLU A 1 28  ? 187.259 228.312 232.199 1.00 185.41 ? 123 GLU B HB2  1 
ATOM 384   H HB3  . GLU A 1 28  ? 186.332 226.991 231.503 1.00 185.41 ? 123 GLU B HB3  1 
ATOM 385   H HG2  . GLU A 1 28  ? 184.364 228.577 231.373 1.00 185.41 ? 123 GLU B HG2  1 
ATOM 386   H HG3  . GLU A 1 28  ? 185.474 229.868 231.828 1.00 185.41 ? 123 GLU B HG3  1 
ATOM 387   N N    . THR A 1 29  ? 185.938 225.147 233.739 1.00 158.03 ? 124 THR B N    1 
ATOM 388   C CA   . THR A 1 29  ? 186.582 223.891 234.092 1.00 158.03 ? 124 THR B CA   1 
ATOM 389   C C    . THR A 1 29  ? 187.247 223.289 232.863 1.00 158.03 ? 124 THR B C    1 
ATOM 390   O O    . THR A 1 29  ? 186.824 223.518 231.727 1.00 158.03 ? 124 THR B O    1 
ATOM 391   C CB   . THR A 1 29  ? 185.576 222.891 234.690 1.00 158.03 ? 124 THR B CB   1 
ATOM 392   O OG1  . THR A 1 29  ? 184.519 222.652 233.750 1.00 158.03 ? 124 THR B OG1  1 
ATOM 393   C CG2  . THR A 1 29  ? 184.986 223.435 235.982 1.00 158.03 ? 124 THR B CG2  1 
ATOM 394   H H    . THR A 1 29  ? 185.196 225.046 233.318 1.00 189.64 ? 124 THR B H    1 
ATOM 395   H HA   . THR A 1 29  ? 187.271 224.037 234.751 1.00 189.64 ? 124 THR B HA   1 
ATOM 396   H HB   . THR A 1 29  ? 186.080 221.947 234.896 1.00 189.64 ? 124 THR B HB   1 
ATOM 397   H HG1  . THR A 1 29  ? 184.068 221.835 233.977 1.00 189.64 ? 124 THR B HG1  1 
ATOM 398   H HG21 . THR A 1 29  ? 184.278 222.715 236.390 1.00 189.64 ? 124 THR B HG21 1 
ATOM 399   H HG22 . THR A 1 29  ? 185.786 223.607 236.702 1.00 189.64 ? 124 THR B HG22 1 
ATOM 400   H HG23 . THR A 1 29  ? 184.472 224.374 235.780 1.00 189.64 ? 124 THR B HG23 1 
ATOM 401   N N    . VAL A 1 30  ? 188.301 222.516 233.115 1.00 165.40 ? 125 VAL B N    1 
ATOM 402   C CA   . VAL A 1 30  ? 188.988 221.748 232.091 1.00 165.40 ? 125 VAL B CA   1 
ATOM 403   C C    . VAL A 1 30  ? 189.133 220.318 232.591 1.00 165.40 ? 125 VAL B C    1 
ATOM 404   O O    . VAL A 1 30  ? 189.157 220.050 233.797 1.00 165.40 ? 125 VAL B O    1 
ATOM 405   C CB   . VAL A 1 30  ? 190.374 222.347 231.784 1.00 165.40 ? 125 VAL B CB   1 
ATOM 406   C CG1  . VAL A 1 30  ? 190.236 223.774 231.276 1.00 165.40 ? 125 VAL B CG1  1 
ATOM 407   C CG2  . VAL A 1 30  ? 191.245 222.300 233.030 1.00 165.40 ? 125 VAL B CG2  1 
ATOM 408   H H    . VAL A 1 30  ? 188.644 222.421 233.897 1.00 198.48 ? 125 VAL B H    1 
ATOM 409   H HA   . VAL A 1 30  ? 188.452 221.724 231.283 1.00 198.48 ? 125 VAL B HA   1 
ATOM 410   H HB   . VAL A 1 30  ? 190.842 221.767 230.989 1.00 198.48 ? 125 VAL B HB   1 
ATOM 411   H HG11 . VAL A 1 30  ? 191.225 224.182 231.064 1.00 198.48 ? 125 VAL B HG11 1 
ATOM 412   H HG12 . VAL A 1 30  ? 189.639 223.780 230.364 1.00 198.48 ? 125 VAL B HG12 1 
ATOM 413   H HG13 . VAL A 1 30  ? 189.748 224.385 232.035 1.00 198.48 ? 125 VAL B HG13 1 
ATOM 414   H HG21 . VAL A 1 30  ? 192.223 222.724 232.806 1.00 198.48 ? 125 VAL B HG21 1 
ATOM 415   H HG22 . VAL A 1 30  ? 190.773 222.875 233.826 1.00 198.48 ? 125 VAL B HG22 1 
ATOM 416   H HG23 . VAL A 1 30  ? 191.364 221.265 233.352 1.00 198.48 ? 125 VAL B HG23 1 
ATOM 417   N N    . LEU A 1 31  ? 189.213 219.394 231.635 1.00 160.29 ? 126 LEU B N    1 
ATOM 418   C CA   . LEU A 1 31  ? 189.427 217.983 231.935 1.00 160.29 ? 126 LEU B CA   1 
ATOM 419   C C    . LEU A 1 31  ? 190.916 217.756 232.156 1.00 160.29 ? 126 LEU B C    1 
ATOM 420   O O    . LEU A 1 31  ? 191.639 217.376 231.229 1.00 160.29 ? 126 LEU B O    1 
ATOM 421   C CB   . LEU A 1 31  ? 188.915 217.096 230.793 1.00 160.29 ? 126 LEU B CB   1 
ATOM 422   C CG   . LEU A 1 31  ? 188.907 215.588 231.075 1.00 160.29 ? 126 LEU B CG   1 
ATOM 423   C CD1  . LEU A 1 31  ? 187.968 215.294 232.237 1.00 160.29 ? 126 LEU B CD1  1 
ATOM 424   C CD2  . LEU A 1 31  ? 188.478 214.840 229.822 1.00 160.29 ? 126 LEU B CD2  1 
ATOM 425   H H    . LEU A 1 31  ? 189.147 219.564 230.795 1.00 192.35 ? 126 LEU B H    1 
ATOM 426   H HA   . LEU A 1 31  ? 188.955 217.757 232.750 1.00 192.35 ? 126 LEU B HA   1 
ATOM 427   H HB2  . LEU A 1 31  ? 187.896 217.393 230.552 1.00 192.35 ? 126 LEU B HB2  1 
ATOM 428   H HB3  . LEU A 1 31  ? 189.538 217.265 229.915 1.00 192.35 ? 126 LEU B HB3  1 
ATOM 429   H HG   . LEU A 1 31  ? 189.907 215.266 231.365 1.00 192.35 ? 126 LEU B HG   1 
ATOM 430   H HD11 . LEU A 1 31  ? 187.962 214.222 232.437 1.00 192.35 ? 126 LEU B HD11 1 
ATOM 431   H HD12 . LEU A 1 31  ? 188.309 215.826 233.125 1.00 192.35 ? 126 LEU B HD12 1 
ATOM 432   H HD13 . LEU A 1 31  ? 186.960 215.620 231.982 1.00 192.35 ? 126 LEU B HD13 1 
ATOM 433   H HD21 . LEU A 1 31  ? 188.472 213.768 230.022 1.00 192.35 ? 126 LEU B HD21 1 
ATOM 434   H HD22 . LEU A 1 31  ? 187.477 215.159 229.532 1.00 192.35 ? 126 LEU B HD22 1 
ATOM 435   H HD23 . LEU A 1 31  ? 189.176 215.054 229.013 1.00 192.35 ? 126 LEU B HD23 1 
ATOM 436   N N    . PHE A 1 32  ? 191.375 217.989 233.380 1.00 179.54 ? 127 PHE B N    1 
ATOM 437   C CA   . PHE A 1 32  ? 192.794 217.953 233.702 1.00 179.54 ? 127 PHE B CA   1 
ATOM 438   C C    . PHE A 1 32  ? 193.217 216.488 233.741 1.00 179.54 ? 127 PHE B C    1 
ATOM 439   O O    . PHE A 1 32  ? 192.906 215.767 234.694 1.00 179.54 ? 127 PHE B O    1 
ATOM 440   C CB   . PHE A 1 32  ? 193.080 218.634 235.042 1.00 179.54 ? 127 PHE B CB   1 
ATOM 441   C CG   . PHE A 1 32  ? 194.541 218.707 235.384 1.00 179.54 ? 127 PHE B CG   1 
ATOM 442   C CD1  . PHE A 1 32  ? 195.192 217.621 235.949 1.00 179.54 ? 127 PHE B CD1  1 
ATOM 443   C CD2  . PHE A 1 32  ? 195.268 219.863 235.140 1.00 179.54 ? 127 PHE B CD2  1 
ATOM 444   C CE1  . PHE A 1 32  ? 196.535 217.687 236.265 1.00 179.54 ? 127 PHE B CE1  1 
ATOM 445   C CE2  . PHE A 1 32  ? 196.612 219.932 235.455 1.00 179.54 ? 127 PHE B CE2  1 
ATOM 446   C CZ   . PHE A 1 32  ? 197.246 218.844 236.017 1.00 179.54 ? 127 PHE B CZ   1 
ATOM 447   H H    . PHE A 1 32  ? 190.873 218.174 234.053 1.00 215.45 ? 127 PHE B H    1 
ATOM 448   H HA   . PHE A 1 32  ? 193.298 218.407 233.008 1.00 215.45 ? 127 PHE B HA   1 
ATOM 449   H HB2  . PHE A 1 32  ? 192.683 219.648 235.027 1.00 215.45 ? 127 PHE B HB2  1 
ATOM 450   H HB3  . PHE A 1 32  ? 192.571 218.095 235.840 1.00 215.45 ? 127 PHE B HB3  1 
ATOM 451   H HD1  . PHE A 1 32  ? 194.630 216.707 236.145 1.00 215.45 ? 127 PHE B HD1  1 
ATOM 452   H HD2  . PHE A 1 32  ? 194.767 220.724 234.697 1.00 215.45 ? 127 PHE B HD2  1 
ATOM 453   H HE1  . PHE A 1 32  ? 197.034 216.826 236.710 1.00 215.45 ? 127 PHE B HE1  1 
ATOM 454   H HE2  . PHE A 1 32  ? 197.172 220.846 235.258 1.00 215.45 ? 127 PHE B HE2  1 
ATOM 455   H HZ   . PHE A 1 32  ? 198.305 218.897 236.264 1.00 215.45 ? 127 PHE B HZ   1 
ATOM 456   N N    . ARG A 1 33  ? 193.886 216.043 232.680 1.00 171.93 ? 128 ARG B N    1 
ATOM 457   C CA   . ARG A 1 33  ? 194.376 214.678 232.574 1.00 171.93 ? 128 ARG B CA   1 
ATOM 458   C C    . ARG A 1 33  ? 195.818 214.631 233.056 1.00 171.93 ? 128 ARG B C    1 
ATOM 459   O O    . ARG A 1 33  ? 196.568 215.600 232.909 1.00 171.93 ? 128 ARG B O    1 
ATOM 460   C CB   . ARG A 1 33  ? 194.291 214.173 231.141 1.00 171.93 ? 128 ARG B CB   1 
ATOM 461   C CG   . ARG A 1 33  ? 192.880 214.050 230.589 1.00 171.93 ? 128 ARG B CG   1 
ATOM 462   C CD   . ARG A 1 33  ? 192.880 213.563 229.186 1.00 171.93 ? 128 ARG B CD   1 
ATOM 463   N NE   . ARG A 1 33  ? 191.533 213.461 228.647 1.00 171.93 ? 128 ARG B NE   1 
ATOM 464   C CZ   . ARG A 1 33  ? 191.239 213.077 227.389 1.00 171.93 ? 128 ARG B CZ   1 
ATOM 465   N NH1  . ARG A 1 33  ? 192.205 212.763 226.555 1.00 171.93 ? 128 ARG B NH1  1 
ATOM 466   N NH2  . ARG A 1 33  ? 189.979 213.016 226.995 1.00 171.93 ? 128 ARG B NH2  1 
ATOM 467   H H    . ARG A 1 33  ? 194.073 216.528 231.996 1.00 206.32 ? 128 ARG B H    1 
ATOM 468   H HA   . ARG A 1 33  ? 193.848 214.091 233.130 1.00 206.32 ? 128 ARG B HA   1 
ATOM 469   H HB2  . ARG A 1 33  ? 194.844 214.845 230.486 1.00 206.32 ? 128 ARG B HB2  1 
ATOM 470   H HB3  . ARG A 1 33  ? 194.759 213.191 231.073 1.00 206.32 ? 128 ARG B HB3  1 
ATOM 471   H HG2  . ARG A 1 33  ? 192.312 213.346 231.196 1.00 206.32 ? 128 ARG B HG2  1 
ATOM 472   H HG3  . ARG A 1 33  ? 192.393 215.026 230.613 1.00 206.32 ? 128 ARG B HG3  1 
ATOM 473   H HD2  . ARG A 1 33  ? 193.445 214.254 228.561 1.00 206.32 ? 128 ARG B HD2  1 
ATOM 474   H HD3  . ARG A 1 33  ? 193.340 212.576 229.143 1.00 206.32 ? 128 ARG B HD3  1 
ATOM 475   H HE   . ARG A 1 33  ? 190.763 213.695 229.259 1.00 206.32 ? 128 ARG B HE   1 
ATOM 476   H HH11 . ARG A 1 33  ? 193.168 212.809 226.857 1.00 206.32 ? 128 ARG B HH11 1 
ATOM 477   H HH12 . ARG A 1 33  ? 191.985 212.475 225.613 1.00 206.32 ? 128 ARG B HH12 1 
ATOM 478   H HH21 . ARG A 1 33  ? 189.236 213.257 227.636 1.00 206.32 ? 128 ARG B HH21 1 
ATOM 479   H HH22 . ARG A 1 33  ? 189.759 212.728 226.053 1.00 206.32 ? 128 ARG B HH22 1 
ATOM 480   N N    . TYR A 1 34  ? 196.209 213.499 233.638 1.00 191.79 ? 129 TYR B N    1 
ATOM 481   C CA   . TYR A 1 34  ? 197.582 213.374 234.100 1.00 191.79 ? 129 TYR B CA   1 
ATOM 482   C C    . TYR A 1 34  ? 198.026 211.919 234.112 1.00 191.79 ? 129 TYR B C    1 
ATOM 483   O O    . TYR A 1 34  ? 197.212 210.992 234.100 1.00 191.79 ? 129 TYR B O    1 
ATOM 484   C CB   . TYR A 1 34  ? 197.737 213.988 235.493 1.00 191.79 ? 129 TYR B CB   1 
ATOM 485   C CG   . TYR A 1 34  ? 196.892 213.317 236.553 1.00 191.79 ? 129 TYR B CG   1 
ATOM 486   C CD1  . TYR A 1 34  ? 195.581 213.722 236.754 1.00 191.79 ? 129 TYR B CD1  1 
ATOM 487   C CD2  . TYR A 1 34  ? 197.429 212.297 237.325 1.00 191.79 ? 129 TYR B CD2  1 
ATOM 488   C CE1  . TYR A 1 34  ? 194.809 213.109 237.722 1.00 191.79 ? 129 TYR B CE1  1 
ATOM 489   C CE2  . TYR A 1 34  ? 196.657 211.684 238.293 1.00 191.79 ? 129 TYR B CE2  1 
ATOM 490   C CZ   . TYR A 1 34  ? 195.343 212.094 238.490 1.00 191.79 ? 129 TYR B CZ   1 
ATOM 491   O OH   . TYR A 1 34  ? 194.575 211.484 239.454 1.00 191.79 ? 129 TYR B OH   1 
ATOM 492   H H    . TYR A 1 34  ? 195.712 212.811 233.775 1.00 230.15 ? 129 TYR B H    1 
ATOM 493   H HA   . TYR A 1 34  ? 198.163 213.853 233.490 1.00 230.15 ? 129 TYR B HA   1 
ATOM 494   H HB2  . TYR A 1 34  ? 198.781 213.931 235.803 1.00 230.15 ? 129 TYR B HB2  1 
ATOM 495   H HB3  . TYR A 1 34  ? 197.464 215.043 235.458 1.00 230.15 ? 129 TYR B HB3  1 
ATOM 496   H HD1  . TYR A 1 34  ? 195.159 214.523 236.147 1.00 230.15 ? 129 TYR B HD1  1 
ATOM 497   H HD2  . TYR A 1 34  ? 198.460 211.979 237.167 1.00 230.15 ? 129 TYR B HD2  1 
ATOM 498   H HE1  . TYR A 1 34  ? 193.778 213.427 237.879 1.00 230.15 ? 129 TYR B HE1  1 
ATOM 499   H HE2  . TYR A 1 34  ? 197.079 210.883 238.899 1.00 230.15 ? 129 TYR B HE2  1 
ATOM 500   H HH   . TYR A 1 34  ? 195.095 210.809 239.897 1.00 230.15 ? 129 TYR B HH   1 
ATOM 501   N N    . CYS A 1 35  ? 199.347 211.746 234.125 1.00 215.06 ? 130 CYS B N    1 
ATOM 502   C CA   . CYS A 1 35  ? 200.005 210.448 234.024 1.00 215.06 ? 130 CYS B CA   1 
ATOM 503   C C    . CYS A 1 35  ? 200.320 209.943 235.427 1.00 215.06 ? 130 CYS B C    1 
ATOM 504   O O    . CYS A 1 35  ? 201.028 210.615 236.184 1.00 215.06 ? 130 CYS B O    1 
ATOM 505   C CB   . CYS A 1 35  ? 201.293 210.543 233.205 1.00 215.06 ? 130 CYS B CB   1 
ATOM 506   S SG   . CYS A 1 35  ? 202.170 208.971 233.024 1.00 215.06 ? 130 CYS B SG   1 
ATOM 507   H H    . CYS A 1 35  ? 199.904 212.398 234.196 1.00 258.07 ? 130 CYS B H    1 
ATOM 508   H HA   . CYS A 1 35  ? 199.418 209.811 233.589 1.00 258.07 ? 130 CYS B HA   1 
ATOM 509   H HB2  . CYS A 1 35  ? 201.063 210.918 232.208 1.00 258.07 ? 130 CYS B HB2  1 
ATOM 510   H HB3  . CYS A 1 35  ? 201.971 211.255 233.675 1.00 258.07 ? 130 CYS B HB3  1 
ATOM 511   N N    . ALA A 1 36  ? 199.804 208.763 235.770 1.00 202.61 ? 131 ALA B N    1 
ATOM 512   C CA   . ALA A 1 36  ? 200.002 208.225 237.108 1.00 202.61 ? 131 ALA B CA   1 
ATOM 513   C C    . ALA A 1 36  ? 199.716 206.730 237.112 1.00 202.61 ? 131 ALA B C    1 
ATOM 514   O O    . ALA A 1 36  ? 198.936 206.229 236.298 1.00 202.61 ? 131 ALA B O    1 
ATOM 515   C CB   . ALA A 1 36  ? 199.096 208.922 238.127 1.00 202.61 ? 131 ALA B CB   1 
ATOM 516   H H    . ALA A 1 36  ? 199.342 208.260 235.248 1.00 243.13 ? 131 ALA B H    1 
ATOM 517   H HA   . ALA A 1 36  ? 200.924 208.360 237.376 1.00 243.13 ? 131 ALA B HA   1 
ATOM 518   H HB1  . ALA A 1 36  ? 199.394 208.683 239.016 1.00 243.13 ? 131 ALA B HB1  1 
ATOM 519   H HB2  . ALA A 1 36  ? 199.154 209.881 238.015 1.00 243.13 ? 131 ALA B HB2  1 
ATOM 520   H HB3  . ALA A 1 36  ? 198.181 208.629 237.989 1.00 243.13 ? 131 ALA B HB3  1 
ATOM 521   N N    . GLY A 1 37  ? 200.350 206.035 238.047 1.00 210.35 ? 132 GLY B N    1 
ATOM 522   C CA   . GLY A 1 37  ? 200.043 204.647 238.333 1.00 210.35 ? 132 GLY B CA   1 
ATOM 523   C C    . GLY A 1 37  ? 201.285 203.780 238.398 1.00 210.35 ? 132 GLY B C    1 
ATOM 524   O O    . GLY A 1 37  ? 202.399 204.198 238.085 1.00 210.35 ? 132 GLY B O    1 
ATOM 525   H H    . GLY A 1 37  ? 200.982 206.354 238.534 1.00 252.42 ? 132 GLY B H    1 
ATOM 526   H HA2  . GLY A 1 37  ? 199.601 204.596 239.192 1.00 252.42 ? 132 GLY B HA2  1 
ATOM 527   H HA3  . GLY A 1 37  ? 199.449 204.280 237.664 1.00 252.42 ? 132 GLY B HA3  1 
ATOM 528   N N    . ALA A 1 38  ? 201.057 202.537 238.817 1.00 210.73 ? 133 ALA B N    1 
ATOM 529   C CA   . ALA A 1 38  ? 202.134 201.564 238.938 1.00 210.73 ? 133 ALA B CA   1 
ATOM 530   C C    . ALA A 1 38  ? 202.720 201.232 237.572 1.00 210.73 ? 133 ALA B C    1 
ATOM 531   O O    . ALA A 1 38  ? 201.994 201.039 236.593 1.00 210.73 ? 133 ALA B O    1 
ATOM 532   C CB   . ALA A 1 38  ? 201.617 200.291 239.608 1.00 210.73 ? 133 ALA B CB   1 
ATOM 533   H H    . ALA A 1 38  ? 200.284 202.234 239.038 1.00 252.88 ? 133 ALA B H    1 
ATOM 534   H HA   . ALA A 1 38  ? 202.844 201.925 239.485 1.00 252.88 ? 133 ALA B HA   1 
ATOM 535   H HB1  . ALA A 1 38  ? 202.342 199.651 239.677 1.00 252.88 ? 133 ALA B HB1  1 
ATOM 536   H HB2  . ALA A 1 38  ? 201.287 200.513 240.493 1.00 252.88 ? 133 ALA B HB2  1 
ATOM 537   H HB3  . ALA A 1 38  ? 200.898 199.922 239.072 1.00 252.88 ? 133 ALA B HB3  1 
ATOM 538   N N    . CYS A 1 39  ? 204.047 201.166 237.512 1.00 233.98 ? 134 CYS B N    1 
ATOM 539   C CA   . CYS A 1 39  ? 204.731 200.833 236.271 1.00 233.98 ? 134 CYS B CA   1 
ATOM 540   C C    . CYS A 1 39  ? 204.707 199.327 236.046 1.00 233.98 ? 134 CYS B C    1 
ATOM 541   O O    . CYS A 1 39  ? 205.241 198.561 236.854 1.00 233.98 ? 134 CYS B O    1 
ATOM 542   C CB   . CYS A 1 39  ? 206.180 201.323 236.298 1.00 233.98 ? 134 CYS B CB   1 
ATOM 543   S SG   . CYS A 1 39  ? 206.349 203.121 236.393 1.00 233.98 ? 134 CYS B SG   1 
ATOM 544   H H    . CYS A 1 39  ? 204.574 201.308 238.178 1.00 280.78 ? 134 CYS B H    1 
ATOM 545   H HA   . CYS A 1 39  ? 204.273 201.261 235.531 1.00 280.78 ? 134 CYS B HA   1 
ATOM 546   H HB2  . CYS A 1 39  ? 206.694 200.890 237.157 1.00 280.78 ? 134 CYS B HB2  1 
ATOM 547   H HB3  . CYS A 1 39  ? 206.696 200.982 235.401 1.00 280.78 ? 134 CYS B HB3  1 
ATOM 548   N N    . GLU A 1 40  ? 204.079 198.903 234.946 1.00 243.92 ? 135 GLU B N    1 
ATOM 549   C CA   . GLU A 1 40  ? 204.024 197.480 234.629 1.00 243.92 ? 135 GLU B CA   1 
ATOM 550   C C    . GLU A 1 40  ? 205.388 196.964 234.193 1.00 243.92 ? 135 GLU B C    1 
ATOM 551   O O    . GLU A 1 40  ? 205.753 195.822 234.496 1.00 243.92 ? 135 GLU B O    1 
ATOM 552   C CB   . GLU A 1 40  ? 202.992 197.215 233.530 1.00 243.92 ? 135 GLU B CB   1 
ATOM 553   C CG   . GLU A 1 40  ? 201.549 197.458 233.951 1.00 243.92 ? 135 GLU B CG   1 
ATOM 554   C CD   . GLU A 1 40  ? 200.568 197.231 232.835 1.00 243.92 ? 135 GLU B CD   1 
ATOM 555   O OE1  . GLU A 1 40  ? 200.998 196.998 231.730 1.00 243.92 ? 135 GLU B OE1  1 
ATOM 556   O OE2  . GLU A 1 40  ? 199.388 197.291 233.087 1.00 243.92 ? 135 GLU B OE2  1 
ATOM 557   H H    . GLU A 1 40  ? 203.684 199.413 234.377 1.00 292.70 ? 135 GLU B H    1 
ATOM 558   H HA   . GLU A 1 40  ? 203.757 196.989 235.423 1.00 292.70 ? 135 GLU B HA   1 
ATOM 559   H HB2  . GLU A 1 40  ? 203.202 197.854 232.673 1.00 292.70 ? 135 GLU B HB2  1 
ATOM 560   H HB3  . GLU A 1 40  ? 203.073 196.181 233.196 1.00 292.70 ? 135 GLU B HB3  1 
ATOM 561   H HG2  . GLU A 1 40  ? 201.305 196.789 234.776 1.00 292.70 ? 135 GLU B HG2  1 
ATOM 562   H HG3  . GLU A 1 40  ? 201.454 198.482 234.310 1.00 292.70 ? 135 GLU B HG3  1 
ATOM 563   N N    . ALA A 1 41  ? 206.152 197.787 233.480 1.00 238.63 ? 136 ALA B N    1 
ATOM 564   C CA   . ALA A 1 41  ? 207.472 197.377 233.030 1.00 238.63 ? 136 ALA B CA   1 
ATOM 565   C C    . ALA A 1 41  ? 208.379 197.122 234.225 1.00 238.63 ? 136 ALA B C    1 
ATOM 566   O O    . ALA A 1 41  ? 208.385 197.886 235.196 1.00 238.63 ? 136 ALA B O    1 
ATOM 567   C CB   . ALA A 1 41  ? 208.083 198.449 232.127 1.00 238.63 ? 136 ALA B CB   1 
ATOM 568   H H    . ALA A 1 41  ? 205.928 198.584 233.248 1.00 286.36 ? 136 ALA B H    1 
ATOM 569   H HA   . ALA A 1 41  ? 207.398 196.555 232.521 1.00 286.36 ? 136 ALA B HA   1 
ATOM 570   H HB1  . ALA A 1 41  ? 208.945 198.140 231.808 1.00 286.36 ? 136 ALA B HB1  1 
ATOM 571   H HB2  . ALA A 1 41  ? 207.488 198.607 231.377 1.00 286.36 ? 136 ALA B HB2  1 
ATOM 572   H HB3  . ALA A 1 41  ? 208.193 199.266 232.637 1.00 286.36 ? 136 ALA B HB3  1 
ATOM 573   N N    . ALA A 1 42  ? 209.140 196.035 234.160 1.00 254.31 ? 137 ALA B N    1 
ATOM 574   C CA   . ALA A 1 42  ? 210.110 195.747 235.203 1.00 254.31 ? 137 ALA B CA   1 
ATOM 575   C C    . ALA A 1 42  ? 211.223 196.788 235.186 1.00 254.31 ? 137 ALA B C    1 
ATOM 576   O O    . ALA A 1 42  ? 211.544 197.374 234.148 1.00 254.31 ? 137 ALA B O    1 
ATOM 577   C CB   . ALA A 1 42  ? 210.699 194.349 235.016 1.00 254.31 ? 137 ALA B CB   1 
ATOM 578   H H    . ALA A 1 42  ? 209.113 195.455 233.525 1.00 305.17 ? 137 ALA B H    1 
ATOM 579   H HA   . ALA A 1 42  ? 209.673 195.782 236.068 1.00 305.17 ? 137 ALA B HA   1 
ATOM 580   H HB1  . ALA A 1 42  ? 211.351 194.186 235.716 1.00 305.17 ? 137 ALA B HB1  1 
ATOM 581   H HB2  . ALA A 1 42  ? 209.986 193.695 235.067 1.00 305.17 ? 137 ALA B HB2  1 
ATOM 582   H HB3  . ALA A 1 42  ? 211.130 194.303 234.147 1.00 305.17 ? 137 ALA B HB3  1 
ATOM 583   N N    . ALA A 1 43  ? 211.804 197.028 236.358 1.00 262.74 ? 138 ALA B N    1 
ATOM 584   C CA   . ALA A 1 43  ? 212.969 197.896 236.448 1.00 262.74 ? 138 ALA B CA   1 
ATOM 585   C C    . ALA A 1 43  ? 214.019 197.444 235.448 1.00 262.74 ? 138 ALA B C    1 
ATOM 586   O O    . ALA A 1 43  ? 214.302 196.248 235.330 1.00 262.74 ? 138 ALA B O    1 
ATOM 587   C CB   . ALA A 1 43  ? 213.538 197.878 237.868 1.00 262.74 ? 138 ALA B CB   1 
ATOM 588   H H    . ALA A 1 43  ? 211.544 196.703 237.110 1.00 315.29 ? 138 ALA B H    1 
ATOM 589   H HA   . ALA A 1 43  ? 212.711 198.806 236.232 1.00 315.29 ? 138 ALA B HA   1 
ATOM 590   H HB1  . ALA A 1 43  ? 214.305 198.471 237.905 1.00 315.29 ? 138 ALA B HB1  1 
ATOM 591   H HB2  . ALA A 1 43  ? 212.854 198.181 238.486 1.00 315.29 ? 138 ALA B HB2  1 
ATOM 592   H HB3  . ALA A 1 43  ? 213.808 196.972 238.087 1.00 315.29 ? 138 ALA B HB3  1 
ATOM 593   N N    . ARG A 1 44  ? 214.568 198.406 234.708 1.00 241.73 ? 139 ARG B N    1 
ATOM 594   C CA   . ARG A 1 44  ? 215.556 198.106 233.682 1.00 241.73 ? 139 ARG B CA   1 
ATOM 595   C C    . ARG A 1 44  ? 216.818 197.525 234.310 1.00 241.73 ? 139 ARG B C    1 
ATOM 596   O O    . ARG A 1 44  ? 217.104 197.740 235.491 1.00 241.73 ? 139 ARG B O    1 
ATOM 597   C CB   . ARG A 1 44  ? 215.909 199.357 232.892 1.00 241.73 ? 139 ARG B CB   1 
ATOM 598   C CG   . ARG A 1 44  ? 214.739 200.014 232.178 1.00 241.73 ? 139 ARG B CG   1 
ATOM 599   C CD   . ARG A 1 44  ? 214.179 199.137 231.118 1.00 241.73 ? 139 ARG B CD   1 
ATOM 600   N NE   . ARG A 1 44  ? 213.122 198.277 231.628 1.00 241.73 ? 139 ARG B NE   1 
ATOM 601   C CZ   . ARG A 1 44  ? 212.578 197.249 230.949 1.00 241.73 ? 139 ARG B CZ   1 
ATOM 602   N NH1  . ARG A 1 44  ? 212.999 196.966 229.736 1.00 241.73 ? 139 ARG B NH1  1 
ATOM 603   N NH2  . ARG A 1 44  ? 211.620 196.525 231.501 1.00 241.73 ? 139 ARG B NH2  1 
ATOM 604   H H    . ARG A 1 44  ? 214.382 199.243 234.782 1.00 290.08 ? 139 ARG B H    1 
ATOM 605   H HA   . ARG A 1 44  ? 215.196 197.446 233.071 1.00 290.08 ? 139 ARG B HA   1 
ATOM 606   H HB2  . ARG A 1 44  ? 216.346 200.098 233.559 1.00 290.08 ? 139 ARG B HB2  1 
ATOM 607   H HB3  . ARG A 1 44  ? 216.659 199.112 232.139 1.00 290.08 ? 139 ARG B HB3  1 
ATOM 608   H HG2  . ARG A 1 44  ? 213.948 200.230 232.897 1.00 290.08 ? 139 ARG B HG2  1 
ATOM 609   H HG3  . ARG A 1 44  ? 215.071 200.944 231.713 1.00 290.08 ? 139 ARG B HG3  1 
ATOM 610   H HD2  . ARG A 1 44  ? 213.763 199.751 230.320 1.00 290.08 ? 139 ARG B HD2  1 
ATOM 611   H HD3  . ARG A 1 44  ? 214.968 198.504 230.715 1.00 290.08 ? 139 ARG B HD3  1 
ATOM 612   H HE   . ARG A 1 44  ? 212.772 198.464 232.558 1.00 290.08 ? 139 ARG B HE   1 
ATOM 613   H HH11 . ARG A 1 44  ? 213.731 197.519 229.314 1.00 290.08 ? 139 ARG B HH11 1 
ATOM 614   H HH12 . ARG A 1 44  ? 212.591 196.195 229.227 1.00 290.08 ? 139 ARG B HH12 1 
ATOM 615   H HH21 . ARG A 1 44  ? 211.296 196.743 232.434 1.00 290.08 ? 139 ARG B HH21 1 
ATOM 616   H HH22 . ARG A 1 44  ? 211.212 195.755 230.992 1.00 290.08 ? 139 ARG B HH22 1 
ATOM 617   N N    . VAL A 1 45  ? 217.568 196.763 233.509 1.00 246.56 ? 140 VAL B N    1 
ATOM 618   C CA   . VAL A 1 45  ? 218.867 196.267 233.962 1.00 246.56 ? 140 VAL B CA   1 
ATOM 619   C C    . VAL A 1 45  ? 219.719 197.435 234.437 1.00 246.56 ? 140 VAL B C    1 
ATOM 620   O O    . VAL A 1 45  ? 220.422 197.348 235.450 1.00 246.56 ? 140 VAL B O    1 
ATOM 621   C CB   . VAL A 1 45  ? 219.594 195.521 232.828 1.00 246.56 ? 140 VAL B CB   1 
ATOM 622   C CG1  . VAL A 1 45  ? 221.028 195.207 233.231 1.00 246.56 ? 140 VAL B CG1  1 
ATOM 623   C CG2  . VAL A 1 45  ? 218.840 194.247 232.480 1.00 246.56 ? 140 VAL B CG2  1 
ATOM 624   H H    . VAL A 1 45  ? 217.352 196.529 232.711 1.00 295.87 ? 140 VAL B H    1 
ATOM 625   H HA   . VAL A 1 45  ? 218.729 195.673 234.716 1.00 295.87 ? 140 VAL B HA   1 
ATOM 626   H HB   . VAL A 1 45  ? 219.642 196.167 231.952 1.00 295.87 ? 140 VAL B HB   1 
ATOM 627   H HG11 . VAL A 1 45  ? 221.527 194.679 232.418 1.00 295.87 ? 140 VAL B HG11 1 
ATOM 628   H HG12 . VAL A 1 45  ? 221.558 196.135 233.441 1.00 295.87 ? 140 VAL B HG12 1 
ATOM 629   H HG13 . VAL A 1 45  ? 221.026 194.579 234.122 1.00 295.87 ? 140 VAL B HG13 1 
ATOM 630   H HG21 . VAL A 1 45  ? 219.360 193.724 231.677 1.00 295.87 ? 140 VAL B HG21 1 
ATOM 631   H HG22 . VAL A 1 45  ? 218.788 193.603 233.358 1.00 295.87 ? 140 VAL B HG22 1 
ATOM 632   H HG23 . VAL A 1 45  ? 217.831 194.499 232.155 1.00 295.87 ? 140 VAL B HG23 1 
ATOM 633   N N    . TYR A 1 46  ? 219.672 198.544 233.700 1.00 245.29 ? 141 TYR B N    1 
ATOM 634   C CA   . TYR A 1 46  ? 220.232 199.802 234.175 1.00 245.29 ? 141 TYR B CA   1 
ATOM 635   C C    . TYR A 1 46  ? 219.714 200.145 235.570 1.00 245.29 ? 141 TYR B C    1 
ATOM 636   O O    . TYR A 1 46  ? 220.493 200.420 236.491 1.00 245.29 ? 141 TYR B O    1 
ATOM 637   C CB   . TYR A 1 46  ? 219.875 200.900 233.177 1.00 245.29 ? 141 TYR B CB   1 
ATOM 638   C CG   . TYR A 1 46  ? 220.036 202.295 233.699 1.00 245.29 ? 141 TYR B CG   1 
ATOM 639   C CD1  . TYR A 1 46  ? 221.266 202.933 233.683 1.00 245.29 ? 141 TYR B CD1  1 
ATOM 640   C CD2  . TYR A 1 46  ? 218.951 202.975 234.221 1.00 245.29 ? 141 TYR B CD2  1 
ATOM 641   C CE1  . TYR A 1 46  ? 221.401 204.216 234.162 1.00 245.29 ? 141 TYR B CE1  1 
ATOM 642   C CE2  . TYR A 1 46  ? 219.072 204.248 234.690 1.00 245.29 ? 141 TYR B CE2  1 
ATOM 643   C CZ   . TYR A 1 46  ? 220.291 204.865 234.666 1.00 245.29 ? 141 TYR B CZ   1 
ATOM 644   O OH   . TYR A 1 46  ? 220.369 206.138 235.154 1.00 245.29 ? 141 TYR B OH   1 
ATOM 645   H H    . TYR A 1 46  ? 219.321 198.594 232.916 1.00 294.35 ? 141 TYR B H    1 
ATOM 646   H HA   . TYR A 1 46  ? 221.199 199.729 234.218 1.00 294.35 ? 141 TYR B HA   1 
ATOM 647   H HB2  . TYR A 1 46  ? 220.442 200.809 232.396 1.00 294.35 ? 141 TYR B HB2  1 
ATOM 648   H HB3  . TYR A 1 46  ? 218.946 200.791 232.920 1.00 294.35 ? 141 TYR B HB3  1 
ATOM 649   H HD1  . TYR A 1 46  ? 222.005 202.486 233.339 1.00 294.35 ? 141 TYR B HD1  1 
ATOM 650   H HD2  . TYR A 1 46  ? 218.117 202.563 234.234 1.00 294.35 ? 141 TYR B HD2  1 
ATOM 651   H HE1  . TYR A 1 46  ? 222.232 204.636 234.144 1.00 294.35 ? 141 TYR B HE1  1 
ATOM 652   H HE2  . TYR A 1 46  ? 218.334 204.695 235.035 1.00 294.35 ? 141 TYR B HE2  1 
ATOM 653   H HH   . TYR A 1 46  ? 219.613 206.397 235.411 1.00 294.35 ? 141 TYR B HH   1 
ATOM 654   N N    . ASP A 1 47  ? 218.388 200.141 235.740 1.00 246.36 ? 142 ASP B N    1 
ATOM 655   C CA   . ASP A 1 47  ? 217.812 200.483 237.037 1.00 246.36 ? 142 ASP B CA   1 
ATOM 656   C C    . ASP A 1 47  ? 218.256 199.500 238.111 1.00 246.36 ? 142 ASP B C    1 
ATOM 657   O O    . ASP A 1 47  ? 218.508 199.894 239.256 1.00 246.36 ? 142 ASP B O    1 
ATOM 658   C CB   . ASP A 1 47  ? 216.283 200.505 236.958 1.00 246.36 ? 142 ASP B CB   1 
ATOM 659   C CG   . ASP A 1 47  ? 215.748 201.689 236.164 1.00 246.36 ? 142 ASP B CG   1 
ATOM 660   O OD1  . ASP A 1 47  ? 216.290 202.761 236.295 1.00 246.36 ? 142 ASP B OD1  1 
ATOM 661   O OD2  . ASP A 1 47  ? 214.802 201.511 235.434 1.00 246.36 ? 142 ASP B OD2  1 
ATOM 662   H H    . ASP A 1 47  ? 217.814 199.949 235.131 1.00 295.63 ? 142 ASP B H    1 
ATOM 663   H HA   . ASP A 1 47  ? 218.126 201.361 237.298 1.00 295.63 ? 142 ASP B HA   1 
ATOM 664   H HB2  . ASP A 1 47  ? 215.930 199.585 236.492 1.00 295.63 ? 142 ASP B HB2  1 
ATOM 665   H HB3  . ASP A 1 47  ? 215.867 200.543 237.965 1.00 295.63 ? 142 ASP B HB3  1 
ATOM 666   N N    . LEU A 1 48  ? 218.373 198.218 237.767 1.00 247.40 ? 143 LEU B N    1 
ATOM 667   C CA   . LEU A 1 48  ? 218.833 197.248 238.754 1.00 247.40 ? 143 LEU B CA   1 
ATOM 668   C C    . LEU A 1 48  ? 220.264 197.549 239.179 1.00 247.40 ? 143 LEU B C    1 
ATOM 669   O O    . LEU A 1 48  ? 220.582 197.510 240.371 1.00 247.40 ? 143 LEU B O    1 
ATOM 670   C CB   . LEU A 1 48  ? 218.714 195.827 238.202 1.00 247.40 ? 143 LEU B CB   1 
ATOM 671   C CG   . LEU A 1 48  ? 217.303 195.345 237.827 1.00 247.40 ? 143 LEU B CG   1 
ATOM 672   C CD1  . LEU A 1 48  ? 217.352 193.987 237.105 1.00 247.40 ? 143 LEU B CD1  1 
ATOM 673   C CD2  . LEU A 1 48  ? 216.370 195.278 239.044 1.00 247.40 ? 143 LEU B CD2  1 
ATOM 674   H H    . LEU A 1 48  ? 218.197 197.892 236.991 1.00 296.88 ? 143 LEU B H    1 
ATOM 675   H HA   . LEU A 1 48  ? 218.279 197.321 239.546 1.00 296.88 ? 143 LEU B HA   1 
ATOM 676   H HB2  . LEU A 1 48  ? 219.261 195.767 237.403 1.00 296.88 ? 143 LEU B HB2  1 
ATOM 677   H HB3  . LEU A 1 48  ? 219.070 195.227 238.878 1.00 296.88 ? 143 LEU B HB3  1 
ATOM 678   H HG   . LEU A 1 48  ? 216.924 195.994 237.213 1.00 296.88 ? 143 LEU B HG   1 
ATOM 679   H HD11 . LEU A 1 48  ? 216.816 193.188 237.223 1.00 296.88 ? 143 LEU B HD11 1 
ATOM 680   H HD12 . LEU A 1 48  ? 216.490 194.297 236.788 1.00 296.88 ? 143 LEU B HD12 1 
ATOM 681   H HD13 . LEU A 1 48  ? 217.676 193.684 237.963 1.00 296.88 ? 143 LEU B HD13 1 
ATOM 682   H HD21 . LEU A 1 48  ? 215.519 194.897 238.778 1.00 296.88 ? 143 LEU B HD21 1 
ATOM 683   H HD22 . LEU A 1 48  ? 216.771 194.736 239.744 1.00 296.88 ? 143 LEU B HD22 1 
ATOM 684   H HD23 . LEU A 1 48  ? 216.226 196.176 239.378 1.00 296.88 ? 143 LEU B HD23 1 
ATOM 685   N N    . GLY A 1 49  ? 221.139 197.867 238.222 1.00 251.01 ? 144 GLY B N    1 
ATOM 686   C CA   . GLY A 1 49  ? 222.484 198.289 238.578 1.00 251.01 ? 144 GLY B CA   1 
ATOM 687   C C    . GLY A 1 49  ? 222.485 199.569 239.392 1.00 251.01 ? 144 GLY B C    1 
ATOM 688   O O    . GLY A 1 49  ? 223.216 199.691 240.382 1.00 251.01 ? 144 GLY B O    1 
ATOM 689   H H    . GLY A 1 49  ? 220.977 197.845 237.378 1.00 301.21 ? 144 GLY B H    1 
ATOM 690   H HA2  . GLY A 1 49  ? 222.917 197.594 239.096 1.00 301.21 ? 144 GLY B HA2  1 
ATOM 691   H HA3  . GLY A 1 49  ? 223.001 198.438 237.770 1.00 301.21 ? 144 GLY B HA3  1 
ATOM 692   N N    . LEU A 1 50  ? 221.668 200.546 238.976 1.00 251.44 ? 145 LEU B N    1 
ATOM 693   C CA   . LEU A 1 50  ? 221.572 201.804 239.715 1.00 251.44 ? 145 LEU B CA   1 
ATOM 694   C C    . LEU A 1 50  ? 221.128 201.558 241.152 1.00 251.44 ? 145 LEU B C    1 
ATOM 695   O O    . LEU A 1 50  ? 221.697 202.123 242.090 1.00 251.44 ? 145 LEU B O    1 
ATOM 696   C CB   . LEU A 1 50  ? 220.586 202.754 239.024 1.00 251.44 ? 145 LEU B CB   1 
ATOM 697   C CG   . LEU A 1 50  ? 220.362 204.102 239.723 1.00 251.44 ? 145 LEU B CG   1 
ATOM 698   C CD1  . LEU A 1 50  ? 221.684 204.849 239.824 1.00 251.44 ? 145 LEU B CD1  1 
ATOM 699   C CD2  . LEU A 1 50  ? 219.334 204.911 238.945 1.00 251.44 ? 145 LEU B CD2  1 
ATOM 700   H H    . LEU A 1 50  ? 221.169 200.504 238.276 1.00 301.73 ? 145 LEU B H    1 
ATOM 701   H HA   . LEU A 1 50  ? 222.444 202.227 239.738 1.00 301.73 ? 145 LEU B HA   1 
ATOM 702   H HB2  . LEU A 1 50  ? 220.949 202.959 238.018 1.00 301.73 ? 145 LEU B HB2  1 
ATOM 703   H HB3  . LEU A 1 50  ? 219.620 202.257 238.946 1.00 301.73 ? 145 LEU B HB3  1 
ATOM 704   H HG   . LEU A 1 50  ? 219.997 203.930 240.736 1.00 301.73 ? 145 LEU B HG   1 
ATOM 705   H HD11 . LEU A 1 50  ? 221.525 205.806 240.320 1.00 301.73 ? 145 LEU B HD11 1 
ATOM 706   H HD12 . LEU A 1 50  ? 222.394 204.256 240.401 1.00 301.73 ? 145 LEU B HD12 1 
ATOM 707   H HD13 . LEU A 1 50  ? 222.082 205.021 238.824 1.00 301.73 ? 145 LEU B HD13 1 
ATOM 708   H HD21 . LEU A 1 50  ? 219.174 205.869 239.442 1.00 301.73 ? 145 LEU B HD21 1 
ATOM 709   H HD22 . LEU A 1 50  ? 219.698 205.084 237.932 1.00 301.73 ? 145 LEU B HD22 1 
ATOM 710   H HD23 . LEU A 1 50  ? 218.394 204.362 238.904 1.00 301.73 ? 145 LEU B HD23 1 
ATOM 711   N N    . ARG A 1 51  ? 220.113 200.710 241.336 1.00 241.93 ? 146 ARG B N    1 
ATOM 712   C CA   . ARG A 1 51  ? 219.664 200.365 242.682 1.00 241.93 ? 146 ARG B CA   1 
ATOM 713   C C    . ARG A 1 51  ? 220.782 199.728 243.497 1.00 241.93 ? 146 ARG B C    1 
ATOM 714   O O    . ARG A 1 51  ? 221.040 200.137 244.636 1.00 241.93 ? 146 ARG B O    1 
ATOM 715   C CB   . ARG A 1 51  ? 218.480 199.411 242.623 1.00 241.93 ? 146 ARG B CB   1 
ATOM 716   C CG   . ARG A 1 51  ? 217.177 200.038 242.152 1.00 241.93 ? 146 ARG B CG   1 
ATOM 717   C CD   . ARG A 1 51  ? 216.090 199.030 242.044 1.00 241.93 ? 146 ARG B CD   1 
ATOM 718   N NE   . ARG A 1 51  ? 214.846 199.622 241.579 1.00 241.93 ? 146 ARG B NE   1 
ATOM 719   C CZ   . ARG A 1 51  ? 213.734 198.925 241.275 1.00 241.93 ? 146 ARG B CZ   1 
ATOM 720   N NH1  . ARG A 1 51  ? 213.727 197.615 241.392 1.00 241.93 ? 146 ARG B NH1  1 
ATOM 721   N NH2  . ARG A 1 51  ? 212.651 199.557 240.859 1.00 241.93 ? 146 ARG B NH2  1 
ATOM 722   H H    . ARG A 1 51  ? 219.674 200.325 240.705 1.00 290.32 ? 146 ARG B H    1 
ATOM 723   H HA   . ARG A 1 51  ? 219.384 201.174 243.139 1.00 290.32 ? 146 ARG B HA   1 
ATOM 724   H HB2  . ARG A 1 51  ? 218.711 198.587 241.950 1.00 290.32 ? 146 ARG B HB2  1 
ATOM 725   H HB3  . ARG A 1 51  ? 218.304 198.988 243.611 1.00 290.32 ? 146 ARG B HB3  1 
ATOM 726   H HG2  . ARG A 1 51  ? 216.864 200.805 242.861 1.00 290.32 ? 146 ARG B HG2  1 
ATOM 727   H HG3  . ARG A 1 51  ? 217.324 200.490 241.170 1.00 290.32 ? 146 ARG B HG3  1 
ATOM 728   H HD2  . ARG A 1 51  ? 216.383 198.254 241.339 1.00 290.32 ? 146 ARG B HD2  1 
ATOM 729   H HD3  . ARG A 1 51  ? 215.911 198.584 243.021 1.00 290.32 ? 146 ARG B HD3  1 
ATOM 730   H HE   . ARG A 1 51  ? 214.813 200.628 241.476 1.00 290.32 ? 146 ARG B HE   1 
ATOM 731   H HH11 . ARG A 1 51  ? 214.555 197.132 241.710 1.00 290.32 ? 146 ARG B HH11 1 
ATOM 732   H HH12 . ARG A 1 51  ? 212.894 197.093 241.164 1.00 290.32 ? 146 ARG B HH12 1 
ATOM 733   H HH21 . ARG A 1 51  ? 212.657 200.564 240.769 1.00 290.32 ? 146 ARG B HH21 1 
ATOM 734   H HH22 . ARG A 1 51  ? 211.818 199.035 240.631 1.00 290.32 ? 146 ARG B HH22 1 
ATOM 735   N N    . ARG A 1 52  ? 221.453 198.718 242.935 1.00 241.20 ? 147 ARG B N    1 
ATOM 736   C CA   . ARG A 1 52  ? 222.499 198.020 243.678 1.00 241.20 ? 147 ARG B CA   1 
ATOM 737   C C    . ARG A 1 52  ? 223.698 198.925 243.926 1.00 241.20 ? 147 ARG B C    1 
ATOM 738   O O    . ARG A 1 52  ? 224.252 198.940 245.032 1.00 241.20 ? 147 ARG B O    1 
ATOM 739   C CB   . ARG A 1 52  ? 222.953 196.779 242.923 1.00 241.20 ? 147 ARG B CB   1 
ATOM 740   C CG   . ARG A 1 52  ? 221.906 195.682 242.806 1.00 241.20 ? 147 ARG B CG   1 
ATOM 741   C CD   . ARG A 1 52  ? 221.550 195.119 244.133 1.00 241.20 ? 147 ARG B CD   1 
ATOM 742   N NE   . ARG A 1 52  ? 222.668 194.419 244.744 1.00 241.20 ? 147 ARG B NE   1 
ATOM 743   C CZ   . ARG A 1 52  ? 222.752 194.103 246.051 1.00 241.20 ? 147 ARG B CZ   1 
ATOM 744   N NH1  . ARG A 1 52  ? 221.777 194.431 246.870 1.00 241.20 ? 147 ARG B NH1  1 
ATOM 745   N NH2  . ARG A 1 52  ? 223.814 193.464 246.510 1.00 241.20 ? 147 ARG B NH2  1 
ATOM 746   H H    . ARG A 1 52  ? 221.323 198.426 242.138 1.00 289.44 ? 147 ARG B H    1 
ATOM 747   H HA   . ARG A 1 52  ? 222.150 197.762 244.543 1.00 289.44 ? 147 ARG B HA   1 
ATOM 748   H HB2  . ARG A 1 52  ? 223.254 197.056 241.914 1.00 289.44 ? 147 ARG B HB2  1 
ATOM 749   H HB3  . ARG A 1 52  ? 223.825 196.351 243.419 1.00 289.44 ? 147 ARG B HB3  1 
ATOM 750   H HG2  . ARG A 1 52  ? 221.003 196.089 242.352 1.00 289.44 ? 147 ARG B HG2  1 
ATOM 751   H HG3  . ARG A 1 52  ? 222.293 194.875 242.183 1.00 289.44 ? 147 ARG B HG3  1 
ATOM 752   H HD2  . ARG A 1 52  ? 221.247 195.925 244.801 1.00 289.44 ? 147 ARG B HD2  1 
ATOM 753   H HD3  . ARG A 1 52  ? 220.727 194.413 244.020 1.00 289.44 ? 147 ARG B HD3  1 
ATOM 754   H HE   . ARG A 1 52  ? 223.438 194.150 244.145 1.00 289.44 ? 147 ARG B HE   1 
ATOM 755   H HH11 . ARG A 1 52  ? 220.966 194.919 246.519 1.00 289.44 ? 147 ARG B HH11 1 
ATOM 756   H HH12 . ARG A 1 52  ? 221.840 194.194 247.849 1.00 289.44 ? 147 ARG B HH12 1 
ATOM 757   H HH21 . ARG A 1 52  ? 224.563 193.212 245.880 1.00 289.44 ? 147 ARG B HH21 1 
ATOM 758   H HH22 . ARG A 1 52  ? 223.876 193.227 247.489 1.00 289.44 ? 147 ARG B HH22 1 
ATOM 759   N N    . LEU A 1 53  ? 224.114 199.695 242.914 1.00 250.02 ? 148 LEU B N    1 
ATOM 760   C CA   . LEU A 1 53  ? 225.279 200.560 243.086 1.00 250.02 ? 148 LEU B CA   1 
ATOM 761   C C    . LEU A 1 53  ? 224.964 201.763 243.971 1.00 250.02 ? 148 LEU B C    1 
ATOM 762   O O    . LEU A 1 53  ? 225.853 202.273 244.663 1.00 250.02 ? 148 LEU B O    1 
ATOM 763   C CB   . LEU A 1 53  ? 225.800 201.013 241.723 1.00 250.02 ? 148 LEU B CB   1 
ATOM 764   C CG   . LEU A 1 53  ? 226.404 199.930 240.821 1.00 250.02 ? 148 LEU B CG   1 
ATOM 765   C CD1  . LEU A 1 53  ? 226.654 200.493 239.432 1.00 250.02 ? 148 LEU B CD1  1 
ATOM 766   C CD2  . LEU A 1 53  ? 227.697 199.359 241.400 1.00 250.02 ? 148 LEU B CD2  1 
ATOM 767   H H    . LEU A 1 53  ? 223.747 199.734 242.137 1.00 300.02 ? 148 LEU B H    1 
ATOM 768   H HA   . LEU A 1 53  ? 225.986 200.065 243.525 1.00 300.02 ? 148 LEU B HA   1 
ATOM 769   H HB2  . LEU A 1 53  ? 225.070 201.424 241.236 1.00 300.02 ? 148 LEU B HB2  1 
ATOM 770   H HB3  . LEU A 1 53  ? 226.497 201.668 241.875 1.00 300.02 ? 148 LEU B HB3  1 
ATOM 771   H HG   . LEU A 1 53  ? 225.769 199.202 240.737 1.00 300.02 ? 148 LEU B HG   1 
ATOM 772   H HD11 . LEU A 1 53  ? 226.982 199.783 238.860 1.00 300.02 ? 148 LEU B HD11 1 
ATOM 773   H HD12 . LEU A 1 53  ? 225.822 200.844 239.078 1.00 300.02 ? 148 LEU B HD12 1 
ATOM 774   H HD13 . LEU A 1 53  ? 227.312 201.204 239.493 1.00 300.02 ? 148 LEU B HD13 1 
ATOM 775   H HD21 . LEU A 1 53  ? 228.072 198.728 240.765 1.00 300.02 ? 148 LEU B HD21 1 
ATOM 776   H HD22 . LEU A 1 53  ? 228.324 200.085 241.549 1.00 300.02 ? 148 LEU B HD22 1 
ATOM 777   H HD23 . LEU A 1 53  ? 227.509 198.907 242.235 1.00 300.02 ? 148 LEU B HD23 1 
ATOM 778   N N    . ARG A 1 54  ? 223.712 202.230 243.970 1.00 245.34 ? 149 ARG B N    1 
ATOM 779   C CA   . ARG A 1 54  ? 223.329 203.322 244.862 1.00 245.34 ? 149 ARG B CA   1 
ATOM 780   C C    . ARG A 1 54  ? 223.229 202.841 246.304 1.00 245.34 ? 149 ARG B C    1 
ATOM 781   O O    . ARG A 1 54  ? 223.781 203.467 247.216 1.00 245.34 ? 149 ARG B O    1 
ATOM 782   C CB   . ARG A 1 54  ? 221.995 203.920 244.437 1.00 245.34 ? 149 ARG B CB   1 
ATOM 783   C CG   . ARG A 1 54  ? 221.506 205.070 245.302 1.00 245.34 ? 149 ARG B CG   1 
ATOM 784   C CD   . ARG A 1 54  ? 220.188 205.580 244.843 1.00 245.34 ? 149 ARG B CD   1 
ATOM 785   N NE   . ARG A 1 54  ? 219.147 204.571 244.954 1.00 245.34 ? 149 ARG B NE   1 
ATOM 786   C CZ   . ARG A 1 54  ? 218.509 204.253 246.097 1.00 245.34 ? 149 ARG B CZ   1 
ATOM 787   N NH1  . ARG A 1 54  ? 218.815 204.872 247.215 1.00 245.34 ? 149 ARG B NH1  1 
ATOM 788   N NH2  . ARG A 1 54  ? 217.574 203.318 246.094 1.00 245.34 ? 149 ARG B NH2  1 
ATOM 789   H H    . ARG A 1 54  ? 223.076 201.942 243.470 1.00 294.41 ? 149 ARG B H    1 
ATOM 790   H HA   . ARG A 1 54  ? 223.999 204.021 244.822 1.00 294.41 ? 149 ARG B HA   1 
ATOM 791   H HB2  . ARG A 1 54  ? 222.071 204.285 243.414 1.00 294.41 ? 149 ARG B HB2  1 
ATOM 792   H HB3  . ARG A 1 54  ? 221.228 203.145 244.452 1.00 294.41 ? 149 ARG B HB3  1 
ATOM 793   H HG2  . ARG A 1 54  ? 221.402 204.731 246.333 1.00 294.41 ? 149 ARG B HG2  1 
ATOM 794   H HG3  . ARG A 1 54  ? 222.224 205.889 245.260 1.00 294.41 ? 149 ARG B HG3  1 
ATOM 795   H HD2  . ARG A 1 54  ? 219.898 206.437 245.451 1.00 294.41 ? 149 ARG B HD2  1 
ATOM 796   H HD3  . ARG A 1 54  ? 220.259 205.883 243.799 1.00 294.41 ? 149 ARG B HD3  1 
ATOM 797   H HE   . ARG A 1 54  ? 218.884 204.073 244.114 1.00 294.41 ? 149 ARG B HE   1 
ATOM 798   H HH11 . ARG A 1 54  ? 219.529 205.586 247.218 1.00 294.41 ? 149 ARG B HH11 1 
ATOM 799   H HH12 . ARG A 1 54  ? 218.336 204.633 248.072 1.00 294.41 ? 149 ARG B HH12 1 
ATOM 800   H HH21 . ARG A 1 54  ? 217.339 202.842 245.233 1.00 294.41 ? 149 ARG B HH21 1 
ATOM 801   H HH22 . ARG A 1 54  ? 217.096 203.080 246.950 1.00 294.41 ? 149 ARG B HH22 1 
ATOM 802   N N    . GLN A 1 55  ? 222.518 201.733 246.530 1.00 252.68 ? 150 GLN B N    1 
ATOM 803   C CA   . GLN A 1 55  ? 222.328 201.239 247.890 1.00 252.68 ? 150 GLN B CA   1 
ATOM 804   C C    . GLN A 1 55  ? 223.661 200.922 248.555 1.00 252.68 ? 150 GLN B C    1 
ATOM 805   O O    . GLN A 1 55  ? 223.843 201.175 249.753 1.00 252.68 ? 150 GLN B O    1 
ATOM 806   C CB   . GLN A 1 55  ? 221.438 199.994 247.888 1.00 252.68 ? 150 GLN B CB   1 
ATOM 807   C CG   . GLN A 1 55  ? 219.989 200.265 247.523 1.00 252.68 ? 150 GLN B CG   1 
ATOM 808   C CD   . GLN A 1 55  ? 219.211 198.991 247.252 1.00 252.68 ? 150 GLN B CD   1 
ATOM 809   O OE1  . GLN A 1 55  ? 219.785 197.964 246.879 1.00 252.68 ? 150 GLN B OE1  1 
ATOM 810   N NE2  . GLN A 1 55  ? 217.898 199.050 247.439 1.00 252.68 ? 150 GLN B NE2  1 
ATOM 811   H H    . GLN A 1 55  ? 222.142 201.257 245.921 1.00 303.22 ? 150 GLN B H    1 
ATOM 812   H HA   . GLN A 1 55  ? 221.887 201.925 248.416 1.00 303.22 ? 150 GLN B HA   1 
ATOM 813   H HB2  . GLN A 1 55  ? 221.832 199.265 247.180 1.00 303.22 ? 150 GLN B HB2  1 
ATOM 814   H HB3  . GLN A 1 55  ? 221.455 199.533 248.876 1.00 303.22 ? 150 GLN B HB3  1 
ATOM 815   H HG2  . GLN A 1 55  ? 219.508 200.790 248.349 1.00 303.22 ? 150 GLN B HG2  1 
ATOM 816   H HG3  . GLN A 1 55  ? 219.961 200.880 246.623 1.00 303.22 ? 150 GLN B HG3  1 
ATOM 817   H HE21 . GLN A 1 55  ? 217.332 198.240 247.277 1.00 303.22 ? 150 GLN B HE21 1 
ATOM 818   H HE22 . GLN A 1 55  ? 217.473 199.903 247.743 1.00 303.22 ? 150 GLN B HE22 1 
ATOM 819   N N    . ARG A 1 56  ? 224.608 200.371 247.795 1.00 253.31 ? 151 ARG B N    1 
ATOM 820   C CA   . ARG A 1 56  ? 225.929 200.048 248.317 1.00 253.31 ? 151 ARG B CA   1 
ATOM 821   C C    . ARG A 1 56  ? 226.882 201.240 248.320 1.00 253.31 ? 151 ARG B C    1 
ATOM 822   O O    . ARG A 1 56  ? 228.051 201.070 248.681 1.00 253.31 ? 151 ARG B O    1 
ATOM 823   C CB   . ARG A 1 56  ? 226.549 198.923 247.501 1.00 253.31 ? 151 ARG B CB   1 
ATOM 824   C CG   . ARG A 1 56  ? 225.857 197.577 247.639 1.00 253.31 ? 151 ARG B CG   1 
ATOM 825   C CD   . ARG A 1 56  ? 226.439 196.563 246.722 1.00 253.31 ? 151 ARG B CD   1 
ATOM 826   N NE   . ARG A 1 56  ? 226.154 196.864 245.329 1.00 253.31 ? 151 ARG B NE   1 
ATOM 827   C CZ   . ARG A 1 56  ? 226.712 196.231 244.279 1.00 253.31 ? 151 ARG B CZ   1 
ATOM 828   N NH1  . ARG A 1 56  ? 227.583 195.267 244.481 1.00 253.31 ? 151 ARG B NH1  1 
ATOM 829   N NH2  . ARG A 1 56  ? 226.386 196.580 243.047 1.00 253.31 ? 151 ARG B NH2  1 
ATOM 830   H H    . ARG A 1 56  ? 224.504 200.174 246.964 1.00 303.97 ? 151 ARG B H    1 
ATOM 831   H HA   . ARG A 1 56  ? 225.841 199.741 249.232 1.00 303.97 ? 151 ARG B HA   1 
ATOM 832   H HB2  . ARG A 1 56  ? 226.540 199.192 246.445 1.00 303.97 ? 151 ARG B HB2  1 
ATOM 833   H HB3  . ARG A 1 56  ? 227.590 198.791 247.796 1.00 303.97 ? 151 ARG B HB3  1 
ATOM 834   H HG2  . ARG A 1 56  ? 225.964 197.215 248.662 1.00 303.97 ? 151 ARG B HG2  1 
ATOM 835   H HG3  . ARG A 1 56  ? 224.798 197.685 247.402 1.00 303.97 ? 151 ARG B HG3  1 
ATOM 836   H HD2  . ARG A 1 56  ? 227.521 196.536 246.850 1.00 303.97 ? 151 ARG B HD2  1 
ATOM 837   H HD3  . ARG A 1 56  ? 226.022 195.583 246.952 1.00 303.97 ? 151 ARG B HD3  1 
ATOM 838   H HE   . ARG A 1 56  ? 225.488 197.601 245.134 1.00 303.97 ? 151 ARG B HE   1 
ATOM 839   H HH11 . ARG A 1 56  ? 227.833 195.000 245.423 1.00 303.97 ? 151 ARG B HH11 1 
ATOM 840   H HH12 . ARG A 1 56  ? 228.002 194.792 243.694 1.00 303.97 ? 151 ARG B HH12 1 
ATOM 841   H HH21 . ARG A 1 56  ? 225.716 197.321 242.892 1.00 303.97 ? 151 ARG B HH21 1 
ATOM 842   H HH22 . ARG A 1 56  ? 226.804 196.105 242.261 1.00 303.97 ? 151 ARG B HH22 1 
ATOM 843   N N    . ARG A 1 57  ? 226.413 202.434 247.944 1.00 243.01 ? 152 ARG B N    1 
ATOM 844   C CA   . ARG A 1 57  ? 227.224 203.656 247.970 1.00 243.01 ? 152 ARG B CA   1 
ATOM 845   C C    . ARG A 1 57  ? 228.440 203.536 247.049 1.00 243.01 ? 152 ARG B C    1 
ATOM 846   O O    . ARG A 1 57  ? 229.550 203.960 247.382 1.00 243.01 ? 152 ARG B O    1 
ATOM 847   C CB   . ARG A 1 57  ? 227.636 204.016 249.407 1.00 243.01 ? 152 ARG B CB   1 
ATOM 848   C CG   . ARG A 1 57  ? 226.579 204.802 250.171 1.00 243.01 ? 152 ARG B CG   1 
ATOM 849   C CD   . ARG A 1 57  ? 225.350 203.965 250.481 1.00 243.01 ? 152 ARG B CD   1 
ATOM 850   N NE   . ARG A 1 57  ? 224.424 204.671 251.364 1.00 243.01 ? 152 ARG B NE   1 
ATOM 851   C CZ   . ARG A 1 57  ? 223.216 204.230 251.711 1.00 243.01 ? 152 ARG B CZ   1 
ATOM 852   N NH1  . ARG A 1 57  ? 222.751 203.069 251.260 1.00 243.01 ? 152 ARG B NH1  1 
ATOM 853   N NH2  . ARG A 1 57  ? 222.462 204.961 252.520 1.00 243.01 ? 152 ARG B NH2  1 
ATOM 854   H H    . ARG A 1 57  ? 225.614 202.574 247.661 1.00 291.61 ? 152 ARG B H    1 
ATOM 855   H HA   . ARG A 1 57  ? 226.681 204.386 247.633 1.00 291.61 ? 152 ARG B HA   1 
ATOM 856   H HB2  . ARG A 1 57  ? 227.827 203.213 249.912 1.00 291.61 ? 152 ARG B HB2  1 
ATOM 857   H HB3  . ARG A 1 57  ? 228.421 204.582 249.398 1.00 291.61 ? 152 ARG B HB3  1 
ATOM 858   H HG2  . ARG A 1 57  ? 226.958 205.105 251.012 1.00 291.61 ? 152 ARG B HG2  1 
ATOM 859   H HG3  . ARG A 1 57  ? 226.301 205.564 249.639 1.00 291.61 ? 152 ARG B HG3  1 
ATOM 860   H HD2  . ARG A 1 57  ? 224.882 203.766 249.657 1.00 291.61 ? 152 ARG B HD2  1 
ATOM 861   H HD3  . ARG A 1 57  ? 225.623 203.145 250.920 1.00 291.61 ? 152 ARG B HD3  1 
ATOM 862   H HE   . ARG A 1 57  ? 224.670 205.437 251.668 1.00 291.61 ? 152 ARG B HE   1 
ATOM 863   H HH11 . ARG A 1 57  ? 223.219 202.576 250.735 1.00 291.61 ? 152 ARG B HH11 1 
ATOM 864   H HH12 . ARG A 1 57  ? 221.969 202.806 251.498 1.00 291.61 ? 152 ARG B HH12 1 
ATOM 865   H HH21 . ARG A 1 57  ? 222.754 205.714 252.816 1.00 291.61 ? 152 ARG B HH21 1 
ATOM 866   H HH22 . ARG A 1 57  ? 221.681 204.682 252.749 1.00 291.61 ? 152 ARG B HH22 1 
ATOM 867   N N    . ARG A 1 58  ? 228.228 202.955 245.867 1.00 257.90 ? 153 ARG B N    1 
ATOM 868   C CA   . ARG A 1 58  ? 229.262 202.911 244.842 1.00 257.90 ? 153 ARG B CA   1 
ATOM 869   C C    . ARG A 1 58  ? 229.238 204.128 243.928 1.00 257.90 ? 153 ARG B C    1 
ATOM 870   O O    . ARG A 1 58  ? 230.267 204.444 243.319 1.00 257.90 ? 153 ARG B O    1 
ATOM 871   C CB   . ARG A 1 58  ? 229.109 201.654 243.998 1.00 257.90 ? 153 ARG B CB   1 
ATOM 872   C CG   . ARG A 1 58  ? 229.366 200.351 244.738 1.00 257.90 ? 153 ARG B CG   1 
ATOM 873   C CD   . ARG A 1 58  ? 230.801 200.189 245.082 1.00 257.90 ? 153 ARG B CD   1 
ATOM 874   N NE   . ARG A 1 58  ? 231.646 200.184 243.899 1.00 257.90 ? 153 ARG B NE   1 
ATOM 875   C CZ   . ARG A 1 58  ? 231.904 199.096 243.147 1.00 257.90 ? 153 ARG B CZ   1 
ATOM 876   N NH1  . ARG A 1 58  ? 231.376 197.935 243.468 1.00 257.90 ? 153 ARG B NH1  1 
ATOM 877   N NH2  . ARG A 1 58  ? 232.687 199.196 242.087 1.00 257.90 ? 153 ARG B NH2  1 
ATOM 878   H H    . ARG A 1 58  ? 227.490 202.578 245.636 1.00 309.48 ? 153 ARG B H    1 
ATOM 879   H HA   . ARG A 1 58  ? 230.133 202.892 245.265 1.00 309.48 ? 153 ARG B HA   1 
ATOM 880   H HB2  . ARG A 1 58  ? 228.099 201.610 243.592 1.00 309.48 ? 153 ARG B HB2  1 
ATOM 881   H HB3  . ARG A 1 58  ? 229.799 201.696 243.155 1.00 309.48 ? 153 ARG B HB3  1 
ATOM 882   H HG2  . ARG A 1 58  ? 228.787 200.337 245.662 1.00 309.48 ? 153 ARG B HG2  1 
ATOM 883   H HG3  . ARG A 1 58  ? 229.066 199.511 244.110 1.00 309.48 ? 153 ARG B HG3  1 
ATOM 884   H HD2  . ARG A 1 58  ? 231.117 201.011 245.723 1.00 309.48 ? 153 ARG B HD2  1 
ATOM 885   H HD3  . ARG A 1 58  ? 230.945 199.245 245.607 1.00 309.48 ? 153 ARG B HD3  1 
ATOM 886   H HE   . ARG A 1 58  ? 232.070 201.059 243.620 1.00 309.48 ? 153 ARG B HE   1 
ATOM 887   H HH11 . ARG A 1 58  ? 230.778 197.859 244.278 1.00 309.48 ? 153 ARG B HH11 1 
ATOM 888   H HH12 . ARG A 1 58  ? 231.570 197.120 242.904 1.00 309.48 ? 153 ARG B HH12 1 
ATOM 889   H HH21 . ARG A 1 58  ? 233.093 200.088 241.840 1.00 309.48 ? 153 ARG B HH21 1 
ATOM 890   H HH22 . ARG A 1 58  ? 232.880 198.381 241.524 1.00 309.48 ? 153 ARG B HH22 1 
ATOM 891   N N    . LEU A 1 59  ? 228.100 204.811 243.823 1.00 247.20 ? 154 LEU B N    1 
ATOM 892   C CA   . LEU A 1 59  ? 227.944 205.968 242.953 1.00 247.20 ? 154 LEU B CA   1 
ATOM 893   C C    . LEU A 1 59  ? 227.975 207.255 243.767 1.00 247.20 ? 154 LEU B C    1 
ATOM 894   O O    . LEU A 1 59  ? 227.649 207.270 244.957 1.00 247.20 ? 154 LEU B O    1 
ATOM 895   C CB   . LEU A 1 59  ? 226.627 205.874 242.172 1.00 247.20 ? 154 LEU B CB   1 
ATOM 896   C CG   . LEU A 1 59  ? 226.436 204.599 241.341 1.00 247.20 ? 154 LEU B CG   1 
ATOM 897   C CD1  . LEU A 1 59  ? 225.047 204.604 240.715 1.00 247.20 ? 154 LEU B CD1  1 
ATOM 898   C CD2  . LEU A 1 59  ? 227.516 204.523 240.273 1.00 247.20 ? 154 LEU B CD2  1 
ATOM 899   H H    . LEU A 1 59  ? 227.383 204.618 244.256 1.00 296.64 ? 154 LEU B H    1 
ATOM 900   H HA   . LEU A 1 59  ? 228.673 206.009 242.318 1.00 296.64 ? 154 LEU B HA   1 
ATOM 901   H HB2  . LEU A 1 59  ? 225.800 205.936 242.878 1.00 296.64 ? 154 LEU B HB2  1 
ATOM 902   H HB3  . LEU A 1 59  ? 226.564 206.725 241.494 1.00 296.64 ? 154 LEU B HB3  1 
ATOM 903   H HG   . LEU A 1 59  ? 226.506 203.727 241.991 1.00 296.64 ? 154 LEU B HG   1 
ATOM 904   H HD11 . LEU A 1 59  ? 224.911 203.698 240.125 1.00 296.64 ? 154 LEU B HD11 1 
ATOM 905   H HD12 . LEU A 1 59  ? 224.294 204.639 241.502 1.00 296.64 ? 154 LEU B HD12 1 
ATOM 906   H HD13 . LEU A 1 59  ? 224.942 205.476 240.071 1.00 296.64 ? 154 LEU B HD13 1 
ATOM 907   H HD21 . LEU A 1 59  ? 227.381 203.616 239.682 1.00 296.64 ? 154 LEU B HD21 1 
ATOM 908   H HD22 . LEU A 1 59  ? 227.446 205.394 239.621 1.00 296.64 ? 154 LEU B HD22 1 
ATOM 909   H HD23 . LEU A 1 59  ? 228.497 204.503 240.748 1.00 296.64 ? 154 LEU B HD23 1 
ATOM 910   N N    . ARG A 1 60  ? 228.378 208.337 243.106 1.00 241.86 ? 155 ARG B N    1 
ATOM 911   C CA   . ARG A 1 60  ? 228.334 209.656 243.719 1.00 241.86 ? 155 ARG B CA   1 
ATOM 912   C C    . ARG A 1 60  ? 226.912 209.981 244.159 1.00 241.86 ? 155 ARG B C    1 
ATOM 913   O O    . ARG A 1 60  ? 225.947 209.717 243.436 1.00 241.86 ? 155 ARG B O    1 
ATOM 914   C CB   . ARG A 1 60  ? 228.827 210.721 242.750 1.00 241.86 ? 155 ARG B CB   1 
ATOM 915   C CG   . ARG A 1 60  ? 228.957 212.114 243.344 1.00 241.86 ? 155 ARG B CG   1 
ATOM 916   C CD   . ARG A 1 60  ? 229.461 213.092 242.345 1.00 241.86 ? 155 ARG B CD   1 
ATOM 917   N NE   . ARG A 1 60  ? 229.657 214.410 242.928 1.00 241.86 ? 155 ARG B NE   1 
ATOM 918   C CZ   . ARG A 1 60  ? 228.699 215.351 243.030 1.00 241.86 ? 155 ARG B CZ   1 
ATOM 919   N NH1  . ARG A 1 60  ? 227.486 215.105 242.586 1.00 241.86 ? 155 ARG B NH1  1 
ATOM 920   N NH2  . ARG A 1 60  ? 228.978 216.521 243.577 1.00 241.86 ? 155 ARG B NH2  1 
ATOM 921   H H    . ARG A 1 60  ? 228.681 208.331 242.300 1.00 290.23 ? 155 ARG B H    1 
ATOM 922   H HA   . ARG A 1 60  ? 228.908 209.669 244.502 1.00 290.23 ? 155 ARG B HA   1 
ATOM 923   H HB2  . ARG A 1 60  ? 229.804 210.435 242.363 1.00 290.23 ? 155 ARG B HB2  1 
ATOM 924   H HB3  . ARG A 1 60  ? 228.145 210.785 241.903 1.00 290.23 ? 155 ARG B HB3  1 
ATOM 925   H HG2  . ARG A 1 60  ? 227.981 212.453 243.693 1.00 290.23 ? 155 ARG B HG2  1 
ATOM 926   H HG3  . ARG A 1 60  ? 229.654 212.090 244.182 1.00 290.23 ? 155 ARG B HG3  1 
ATOM 927   H HD2  . ARG A 1 60  ? 230.417 212.748 241.951 1.00 290.23 ? 155 ARG B HD2  1 
ATOM 928   H HD3  . ARG A 1 60  ? 228.744 213.182 241.531 1.00 290.23 ? 155 ARG B HD3  1 
ATOM 929   H HE   . ARG A 1 60  ? 230.578 214.636 243.280 1.00 290.23 ? 155 ARG B HE   1 
ATOM 930   H HH11 . ARG A 1 60  ? 227.273 214.211 242.168 1.00 290.23 ? 155 ARG B HH11 1 
ATOM 931   H HH12 . ARG A 1 60  ? 226.768 215.811 242.663 1.00 290.23 ? 155 ARG B HH12 1 
ATOM 932   H HH21 . ARG A 1 60  ? 229.910 216.710 243.919 1.00 290.23 ? 155 ARG B HH21 1 
ATOM 933   H HH22 . ARG A 1 60  ? 228.260 217.226 243.654 1.00 290.23 ? 155 ARG B HH22 1 
ATOM 934   N N    . ARG A 1 61  ? 226.785 210.540 245.362 1.00 241.01 ? 156 ARG B N    1 
ATOM 935   C CA   . ARG A 1 61  ? 225.488 210.995 245.847 1.00 241.01 ? 156 ARG B CA   1 
ATOM 936   C C    . ARG A 1 61  ? 224.962 212.084 244.923 1.00 241.01 ? 156 ARG B C    1 
ATOM 937   O O    . ARG A 1 61  ? 225.579 213.146 244.791 1.00 241.01 ? 156 ARG B O    1 
ATOM 938   C CB   . ARG A 1 61  ? 225.589 211.529 247.268 1.00 241.01 ? 156 ARG B CB   1 
ATOM 939   C CG   . ARG A 1 61  ? 224.266 211.949 247.889 1.00 241.01 ? 156 ARG B CG   1 
ATOM 940   C CD   . ARG A 1 61  ? 224.439 212.410 249.291 1.00 241.01 ? 156 ARG B CD   1 
ATOM 941   N NE   . ARG A 1 61  ? 223.178 212.826 249.884 1.00 241.01 ? 156 ARG B NE   1 
ATOM 942   C CZ   . ARG A 1 61  ? 223.037 213.265 251.150 1.00 241.01 ? 156 ARG B CZ   1 
ATOM 943   N NH1  . ARG A 1 61  ? 224.084 213.339 251.941 1.00 241.01 ? 156 ARG B NH1  1 
ATOM 944   N NH2  . ARG A 1 61  ? 221.845 213.620 251.597 1.00 241.01 ? 156 ARG B NH2  1 
ATOM 945   H H    . ARG A 1 61  ? 227.432 210.665 245.914 1.00 289.21 ? 156 ARG B H    1 
ATOM 946   H HA   . ARG A 1 61  ? 224.861 210.256 245.836 1.00 289.21 ? 156 ARG B HA   1 
ATOM 947   H HB2  . ARG A 1 61  ? 226.028 210.768 247.912 1.00 289.21 ? 156 ARG B HB2  1 
ATOM 948   H HB3  . ARG A 1 61  ? 226.251 212.394 247.286 1.00 289.21 ? 156 ARG B HB3  1 
ATOM 949   H HG2  . ARG A 1 61  ? 223.836 212.767 247.310 1.00 289.21 ? 156 ARG B HG2  1 
ATOM 950   H HG3  . ARG A 1 61  ? 223.578 211.103 247.889 1.00 289.21 ? 156 ARG B HG3  1 
ATOM 951   H HD2  . ARG A 1 61  ? 224.848 211.599 249.892 1.00 289.21 ? 156 ARG B HD2  1 
ATOM 952   H HD3  . ARG A 1 61  ? 225.122 213.258 249.313 1.00 289.21 ? 156 ARG B HD3  1 
ATOM 953   H HE   . ARG A 1 61  ? 222.350 212.783 249.306 1.00 289.21 ? 156 ARG B HE   1 
ATOM 954   H HH11 . ARG A 1 61  ? 224.995 213.067 251.600 1.00 289.21 ? 156 ARG B HH11 1 
ATOM 955   H HH12 . ARG A 1 61  ? 223.978 213.668 252.890 1.00 289.21 ? 156 ARG B HH12 1 
ATOM 956   H HH21 . ARG A 1 61  ? 221.039 213.563 250.989 1.00 289.21 ? 156 ARG B HH21 1 
ATOM 957   H HH22 . ARG A 1 61  ? 221.739 213.949 252.545 1.00 289.21 ? 156 ARG B HH22 1 
ATOM 958   N N    . GLU A 1 62  ? 223.827 211.823 244.281 1.00 244.96 ? 157 GLU B N    1 
ATOM 959   C CA   . GLU A 1 62  ? 223.334 212.721 243.248 1.00 244.96 ? 157 GLU B CA   1 
ATOM 960   C C    . GLU A 1 62  ? 221.822 212.582 243.157 1.00 244.96 ? 157 GLU B C    1 
ATOM 961   O O    . GLU A 1 62  ? 221.237 211.600 243.621 1.00 244.96 ? 157 GLU B O    1 
ATOM 962   C CB   . GLU A 1 62  ? 223.982 212.412 241.896 1.00 244.96 ? 157 GLU B CB   1 
ATOM 963   C CG   . GLU A 1 62  ? 223.608 213.381 240.783 1.00 244.96 ? 157 GLU B CG   1 
ATOM 964   C CD   . GLU A 1 62  ? 223.873 214.817 241.144 1.00 244.96 ? 157 GLU B CD   1 
ATOM 965   O OE1  . GLU A 1 62  ? 224.972 215.269 240.933 1.00 244.96 ? 157 GLU B OE1  1 
ATOM 966   O OE2  . GLU A 1 62  ? 222.974 215.462 241.630 1.00 244.96 ? 157 GLU B OE2  1 
ATOM 967   H H    . GLU A 1 62  ? 223.327 211.139 244.426 1.00 293.95 ? 157 GLU B H    1 
ATOM 968   H HA   . GLU A 1 62  ? 223.531 213.636 243.495 1.00 293.95 ? 157 GLU B HA   1 
ATOM 969   H HB2  . GLU A 1 62  ? 225.067 212.427 242.001 1.00 293.95 ? 157 GLU B HB2  1 
ATOM 970   H HB3  . GLU A 1 62  ? 223.697 211.410 241.577 1.00 293.95 ? 157 GLU B HB3  1 
ATOM 971   H HG2  . GLU A 1 62  ? 224.180 213.131 239.890 1.00 293.95 ? 157 GLU B HG2  1 
ATOM 972   H HG3  . GLU A 1 62  ? 222.551 213.259 240.550 1.00 293.95 ? 157 GLU B HG3  1 
ATOM 973   N N    . ARG A 1 63  ? 221.202 213.587 242.544 1.00 224.21 ? 158 ARG B N    1 
ATOM 974   C CA   . ARG A 1 63  ? 219.765 213.604 242.308 1.00 224.21 ? 158 ARG B CA   1 
ATOM 975   C C    . ARG A 1 63  ? 219.390 212.533 241.292 1.00 224.21 ? 158 ARG B C    1 
ATOM 976   O O    . ARG A 1 63  ? 219.265 212.820 240.097 1.00 224.21 ? 158 ARG B O    1 
ATOM 977   C CB   . ARG A 1 63  ? 219.315 214.967 241.805 1.00 224.21 ? 158 ARG B CB   1 
ATOM 978   C CG   . ARG A 1 63  ? 219.472 216.102 242.806 1.00 224.21 ? 158 ARG B CG   1 
ATOM 979   C CD   . ARG A 1 63  ? 219.087 217.410 242.218 1.00 224.21 ? 158 ARG B CD   1 
ATOM 980   N NE   . ARG A 1 63  ? 217.675 217.456 241.875 1.00 224.21 ? 158 ARG B NE   1 
ATOM 981   C CZ   . ARG A 1 63  ? 216.688 217.772 242.736 1.00 224.21 ? 158 ARG B CZ   1 
ATOM 982   N NH1  . ARG A 1 63  ? 216.975 218.067 243.985 1.00 224.21 ? 158 ARG B NH1  1 
ATOM 983   N NH2  . ARG A 1 63  ? 215.432 217.786 242.326 1.00 224.21 ? 158 ARG B NH2  1 
ATOM 984   H H    . ARG A 1 63  ? 221.604 214.288 242.250 1.00 269.05 ? 158 ARG B H    1 
ATOM 985   H HA   . ARG A 1 63  ? 219.298 213.417 243.137 1.00 269.05 ? 158 ARG B HA   1 
ATOM 986   H HB2  . ARG A 1 63  ? 219.882 215.233 240.915 1.00 269.05 ? 158 ARG B HB2  1 
ATOM 987   H HB3  . ARG A 1 63  ? 218.263 214.921 241.522 1.00 269.05 ? 158 ARG B HB3  1 
ATOM 988   H HG2  . ARG A 1 63  ? 218.836 215.914 243.671 1.00 269.05 ? 158 ARG B HG2  1 
ATOM 989   H HG3  . ARG A 1 63  ? 220.513 216.163 243.126 1.00 269.05 ? 158 ARG B HG3  1 
ATOM 990   H HD2  . ARG A 1 63  ? 219.290 218.205 242.935 1.00 269.05 ? 158 ARG B HD2  1 
ATOM 991   H HD3  . ARG A 1 63  ? 219.664 217.585 241.310 1.00 269.05 ? 158 ARG B HD3  1 
ATOM 992   H HE   . ARG A 1 63  ? 217.415 217.235 240.923 1.00 269.05 ? 158 ARG B HE   1 
ATOM 993   H HH11 . ARG A 1 63  ? 217.936 218.057 244.298 1.00 269.05 ? 158 ARG B HH11 1 
ATOM 994   H HH12 . ARG A 1 63  ? 216.236 218.304 244.630 1.00 269.05 ? 158 ARG B HH12 1 
ATOM 995   H HH21 . ARG A 1 63  ? 215.211 217.559 241.366 1.00 269.05 ? 158 ARG B HH21 1 
ATOM 996   H HH22 . ARG A 1 63  ? 214.693 218.023 242.971 1.00 269.05 ? 158 ARG B HH22 1 
ATOM 997   N N    . VAL A 1 64  ? 219.205 211.301 241.763 1.00 238.83 ? 159 VAL B N    1 
ATOM 998   C CA   . VAL A 1 64  ? 219.020 210.137 240.903 1.00 238.83 ? 159 VAL B CA   1 
ATOM 999   C C    . VAL A 1 64  ? 217.597 209.627 241.071 1.00 238.83 ? 159 VAL B C    1 
ATOM 1000  O O    . VAL A 1 64  ? 216.880 210.031 241.992 1.00 238.83 ? 159 VAL B O    1 
ATOM 1001  C CB   . VAL A 1 64  ? 220.042 209.013 241.204 1.00 238.83 ? 159 VAL B CB   1 
ATOM 1002  C CG1  . VAL A 1 64  ? 221.453 209.517 241.008 1.00 238.83 ? 159 VAL B CG1  1 
ATOM 1003  C CG2  . VAL A 1 64  ? 219.877 208.445 242.612 1.00 238.83 ? 159 VAL B CG2  1 
ATOM 1004  H H    . VAL A 1 64  ? 219.178 211.118 242.601 1.00 286.60 ? 159 VAL B H    1 
ATOM 1005  H HA   . VAL A 1 64  ? 219.135 210.391 239.975 1.00 286.60 ? 159 VAL B HA   1 
ATOM 1006  H HB   . VAL A 1 64  ? 219.899 208.288 240.575 1.00 286.60 ? 159 VAL B HB   1 
ATOM 1007  H HG11 . VAL A 1 64  ? 222.079 208.794 241.172 1.00 286.60 ? 159 VAL B HG11 1 
ATOM 1008  H HG12 . VAL A 1 64  ? 221.524 209.815 240.097 1.00 286.60 ? 159 VAL B HG12 1 
ATOM 1009  H HG13 . VAL A 1 64  ? 221.621 210.253 241.616 1.00 286.60 ? 159 VAL B HG13 1 
ATOM 1010  H HG21 . VAL A 1 64  ? 220.588 207.802 242.764 1.00 286.60 ? 159 VAL B HG21 1 
ATOM 1011  H HG22 . VAL A 1 64  ? 219.943 209.157 243.265 1.00 286.60 ? 159 VAL B HG22 1 
ATOM 1012  H HG23 . VAL A 1 64  ? 219.023 207.997 242.688 1.00 286.60 ? 159 VAL B HG23 1 
ATOM 1013  N N    . ARG A 1 65  ? 217.196 208.735 240.170 1.00 229.62 ? 160 ARG B N    1 
ATOM 1014  C CA   . ARG A 1 65  ? 215.915 208.042 240.238 1.00 229.62 ? 160 ARG B CA   1 
ATOM 1015  C C    . ARG A 1 65  ? 216.168 206.555 240.038 1.00 229.62 ? 160 ARG B C    1 
ATOM 1016  O O    . ARG A 1 65  ? 216.647 206.141 238.976 1.00 229.62 ? 160 ARG B O    1 
ATOM 1017  C CB   . ARG A 1 65  ? 214.949 208.555 239.180 1.00 229.62 ? 160 ARG B CB   1 
ATOM 1018  C CG   . ARG A 1 65  ? 214.521 210.004 239.353 1.00 229.62 ? 160 ARG B CG   1 
ATOM 1019  C CD   . ARG A 1 65  ? 213.602 210.171 240.507 1.00 229.62 ? 160 ARG B CD   1 
ATOM 1020  N NE   . ARG A 1 65  ? 213.145 211.545 240.642 1.00 229.62 ? 160 ARG B NE   1 
ATOM 1021  C CZ   . ARG A 1 65  ? 213.800 212.506 241.322 1.00 229.62 ? 160 ARG B CZ   1 
ATOM 1022  N NH1  . ARG A 1 65  ? 214.936 212.228 241.923 1.00 229.62 ? 160 ARG B NH1  1 
ATOM 1023  N NH2  . ARG A 1 65  ? 213.300 213.728 241.386 1.00 229.62 ? 160 ARG B NH2  1 
ATOM 1024  H H    . ARG A 1 65  ? 217.666 208.509 239.485 1.00 275.54 ? 160 ARG B H    1 
ATOM 1025  H HA   . ARG A 1 65  ? 215.514 208.159 241.111 1.00 275.54 ? 160 ARG B HA   1 
ATOM 1026  H HB2  . ARG A 1 65  ? 215.404 208.461 238.195 1.00 275.54 ? 160 ARG B HB2  1 
ATOM 1027  H HB3  . ARG A 1 65  ? 214.047 207.942 239.184 1.00 275.54 ? 160 ARG B HB3  1 
ATOM 1028  H HG2  . ARG A 1 65  ? 215.401 210.625 239.522 1.00 275.54 ? 160 ARG B HG2  1 
ATOM 1029  H HG3  . ARG A 1 65  ? 214.006 210.341 238.453 1.00 275.54 ? 160 ARG B HG3  1 
ATOM 1030  H HD2  . ARG A 1 65  ? 212.729 209.533 240.373 1.00 275.54 ? 160 ARG B HD2  1 
ATOM 1031  H HD3  . ARG A 1 65  ? 214.117 209.892 241.426 1.00 275.54 ? 160 ARG B HD3  1 
ATOM 1032  H HE   . ARG A 1 65  ? 212.274 211.797 240.193 1.00 275.54 ? 160 ARG B HE   1 
ATOM 1033  H HH11 . ARG A 1 65  ? 215.317 211.294 241.874 1.00 275.54 ? 160 ARG B HH11 1 
ATOM 1034  H HH12 . ARG A 1 65  ? 215.427 212.948 242.433 1.00 275.54 ? 160 ARG B HH12 1 
ATOM 1035  H HH21 . ARG A 1 65  ? 212.427 213.942 240.924 1.00 275.54 ? 160 ARG B HH21 1 
ATOM 1036  H HH22 . ARG A 1 65  ? 213.791 214.448 241.895 1.00 275.54 ? 160 ARG B HH22 1 
ATOM 1037  N N    . ALA A 1 66  ? 215.843 205.757 241.056 1.00 233.56 ? 161 ALA B N    1 
ATOM 1038  C CA   . ALA A 1 66  ? 216.141 204.331 241.064 1.00 233.56 ? 161 ALA B CA   1 
ATOM 1039  C C    . ALA A 1 66  ? 214.962 203.483 240.595 1.00 233.56 ? 161 ALA B C    1 
ATOM 1040  O O    . ALA A 1 66  ? 214.921 202.279 240.866 1.00 233.56 ? 161 ALA B O    1 
ATOM 1041  C CB   . ALA A 1 66  ? 216.579 203.896 242.462 1.00 233.56 ? 161 ALA B CB   1 
ATOM 1042  H H    . ALA A 1 66  ? 215.441 206.027 241.766 1.00 280.27 ? 161 ALA B H    1 
ATOM 1043  H HA   . ALA A 1 66  ? 216.882 204.160 240.463 1.00 280.27 ? 161 ALA B HA   1 
ATOM 1044  H HB1  . ALA A 1 66  ? 216.813 202.955 242.443 1.00 280.27 ? 161 ALA B HB1  1 
ATOM 1045  H HB2  . ALA A 1 66  ? 217.349 204.422 242.728 1.00 280.27 ? 161 ALA B HB2  1 
ATOM 1046  H HB3  . ALA A 1 66  ? 215.848 204.044 243.082 1.00 280.27 ? 161 ALA B HB3  1 
ATOM 1047  N N    . GLN A 1 67  ? 214.002 204.085 239.894 1.00 215.35 ? 162 GLN B N    1 
ATOM 1048  C CA   . GLN A 1 67  ? 212.870 203.336 239.365 1.00 215.35 ? 162 GLN B CA   1 
ATOM 1049  C C    . GLN A 1 67  ? 212.249 204.136 238.228 1.00 215.35 ? 162 GLN B C    1 
ATOM 1050  O O    . GLN A 1 67  ? 212.344 205.368 238.227 1.00 215.35 ? 162 GLN B O    1 
ATOM 1051  C CB   . GLN A 1 67  ? 211.834 203.054 240.456 1.00 215.35 ? 162 GLN B CB   1 
ATOM 1052  C CG   . GLN A 1 67  ? 211.189 204.300 241.039 1.00 215.35 ? 162 GLN B CG   1 
ATOM 1053  C CD   . GLN A 1 67  ? 212.125 205.058 241.961 1.00 215.35 ? 162 GLN B CD   1 
ATOM 1054  O OE1  . GLN A 1 67  ? 212.660 204.499 242.922 1.00 215.35 ? 162 GLN B OE1  1 
ATOM 1055  N NE2  . GLN A 1 67  ? 212.328 206.339 241.673 1.00 215.35 ? 162 GLN B NE2  1 
ATOM 1056  H H    . GLN A 1 67  ? 213.980 204.924 239.711 1.00 258.42 ? 162 GLN B H    1 
ATOM 1057  H HA   . GLN A 1 67  ? 213.214 202.494 239.039 1.00 258.42 ? 162 GLN B HA   1 
ATOM 1058  H HB2  . GLN A 1 67  ? 211.042 202.423 240.051 1.00 258.42 ? 162 GLN B HB2  1 
ATOM 1059  H HB3  . GLN A 1 67  ? 212.304 202.505 241.272 1.00 258.42 ? 162 GLN B HB3  1 
ATOM 1060  H HG2  . GLN A 1 67  ? 210.901 204.963 240.224 1.00 258.42 ? 162 GLN B HG2  1 
ATOM 1061  H HG3  . GLN A 1 67  ? 210.309 204.007 241.611 1.00 258.42 ? 162 GLN B HG3  1 
ATOM 1062  H HE21 . GLN A 1 67  ? 212.936 206.891 242.246 1.00 258.42 ? 162 GLN B HE21 1 
ATOM 1063  H HE22 . GLN A 1 67  ? 211.874 206.753 240.884 1.00 258.42 ? 162 GLN B HE22 1 
ATOM 1064  N N    . PRO A 1 68  ? 211.621 203.477 237.249 1.00 226.11 ? 163 PRO B N    1 
ATOM 1065  C CA   . PRO A 1 68  ? 210.912 204.232 236.207 1.00 226.11 ? 163 PRO B CA   1 
ATOM 1066  C C    . PRO A 1 68  ? 209.871 205.179 236.785 1.00 226.11 ? 163 PRO B C    1 
ATOM 1067  O O    . PRO A 1 68  ? 209.114 204.826 237.693 1.00 226.11 ? 163 PRO B O    1 
ATOM 1068  C CB   . PRO A 1 68  ? 210.255 203.128 235.372 1.00 226.11 ? 163 PRO B CB   1 
ATOM 1069  C CG   . PRO A 1 68  ? 211.116 201.933 235.604 1.00 226.11 ? 163 PRO B CG   1 
ATOM 1070  C CD   . PRO A 1 68  ? 211.505 202.028 237.055 1.00 226.11 ? 163 PRO B CD   1 
ATOM 1071  H HA   . PRO A 1 68  ? 211.541 204.730 235.663 1.00 271.33 ? 163 PRO B HA   1 
ATOM 1072  H HB2  . PRO A 1 68  ? 209.216 202.976 235.700 1.00 271.33 ? 163 PRO B HB2  1 
ATOM 1073  H HB3  . PRO A 1 68  ? 210.217 203.428 234.314 1.00 271.33 ? 163 PRO B HB3  1 
ATOM 1074  H HG2  . PRO A 1 68  ? 210.558 201.013 235.374 1.00 271.33 ? 163 PRO B HG2  1 
ATOM 1075  H HG3  . PRO A 1 68  ? 211.985 201.954 234.930 1.00 271.33 ? 163 PRO B HG3  1 
ATOM 1076  H HD2  . PRO A 1 68  ? 210.713 201.585 237.677 1.00 271.33 ? 163 PRO B HD2  1 
ATOM 1077  H HD3  . PRO A 1 68  ? 212.461 201.507 237.214 1.00 271.33 ? 163 PRO B HD3  1 
ATOM 1078  N N    . CYS A 1 69  ? 209.843 206.397 236.244 1.00 220.97 ? 164 CYS B N    1 
ATOM 1079  C CA   . CYS A 1 69  ? 208.901 207.431 236.651 1.00 220.97 ? 164 CYS B CA   1 
ATOM 1080  C C    . CYS A 1 69  ? 207.695 207.400 235.722 1.00 220.97 ? 164 CYS B C    1 
ATOM 1081  O O    . CYS A 1 69  ? 207.847 207.485 234.498 1.00 220.97 ? 164 CYS B O    1 
ATOM 1082  C CB   . CYS A 1 69  ? 209.550 208.818 236.613 1.00 220.97 ? 164 CYS B CB   1 
ATOM 1083  S SG   . CYS A 1 69  ? 210.803 209.154 237.873 1.00 220.97 ? 164 CYS B SG   1 
ATOM 1084  H H    . CYS A 1 69  ? 210.378 206.651 235.620 1.00 265.16 ? 164 CYS B H    1 
ATOM 1085  H HA   . CYS A 1 69  ? 208.594 207.269 237.557 1.00 265.16 ? 164 CYS B HA   1 
ATOM 1086  H HB2  . CYS A 1 69  ? 209.972 208.933 235.747 1.00 265.16 ? 164 CYS B HB2  1 
ATOM 1087  H HB3  . CYS A 1 69  ? 208.856 209.482 236.724 1.00 265.16 ? 164 CYS B HB3  1 
ATOM 1088  N N    . CYS A 1 70  ? 206.499 207.284 236.302 1.00 216.90 ? 165 CYS B N    1 
ATOM 1089  C CA   . CYS A 1 70  ? 205.252 207.304 235.535 1.00 216.90 ? 165 CYS B CA   1 
ATOM 1090  C C    . CYS A 1 70  ? 204.955 208.750 235.145 1.00 216.90 ? 165 CYS B C    1 
ATOM 1091  O O    . CYS A 1 70  ? 204.192 209.464 235.801 1.00 216.90 ? 165 CYS B O    1 
ATOM 1092  C CB   . CYS A 1 70  ? 204.088 206.733 236.344 1.00 216.90 ? 165 CYS B CB   1 
ATOM 1093  S SG   . CYS A 1 70  ? 202.521 206.670 235.442 1.00 216.90 ? 165 CYS B SG   1 
ATOM 1094  H H    . CYS A 1 70  ? 206.382 207.192 237.149 1.00 260.28 ? 165 CYS B H    1 
ATOM 1095  H HA   . CYS A 1 70  ? 205.362 206.787 234.724 1.00 260.28 ? 165 CYS B HA   1 
ATOM 1096  H HB2  . CYS A 1 70  ? 204.332 205.721 236.668 1.00 260.28 ? 165 CYS B HB2  1 
ATOM 1097  H HB3  . CYS A 1 70  ? 203.937 207.335 237.240 1.00 260.28 ? 165 CYS B HB3  1 
ATOM 1098  N N    . ARG A 1 71  ? 205.578 209.180 234.032 1.00 202.43 ? 166 ARG B N    1 
ATOM 1099  C CA   . ARG A 1 71  ? 205.527 210.561 233.578 1.00 202.43 ? 166 ARG B CA   1 
ATOM 1100  C C    . ARG A 1 71  ? 204.841 210.663 232.214 1.00 202.43 ? 166 ARG B C    1 
ATOM 1101  O O    . ARG A 1 71  ? 204.820 209.697 231.442 1.00 202.43 ? 166 ARG B O    1 
ATOM 1102  C CB   . ARG A 1 71  ? 206.937 211.158 233.474 1.00 202.43 ? 166 ARG B CB   1 
ATOM 1103  C CG   . ARG A 1 71  ? 207.668 211.305 234.805 1.00 202.43 ? 166 ARG B CG   1 
ATOM 1104  C CD   . ARG A 1 71  ? 207.205 212.522 235.610 1.00 202.43 ? 166 ARG B CD   1 
ATOM 1105  N NE   . ARG A 1 71  ? 207.542 213.786 234.952 1.00 202.43 ? 166 ARG B NE   1 
ATOM 1106  C CZ   . ARG A 1 71  ? 206.959 214.959 235.198 1.00 202.43 ? 166 ARG B CZ   1 
ATOM 1107  N NH1  . ARG A 1 71  ? 205.981 215.075 236.088 1.00 202.43 ? 166 ARG B NH1  1 
ATOM 1108  N NH2  . ARG A 1 71  ? 207.355 216.037 234.539 1.00 202.43 ? 166 ARG B NH2  1 
ATOM 1109  H H    . ARG A 1 71  ? 206.044 208.671 233.519 1.00 242.92 ? 166 ARG B H    1 
ATOM 1110  H HA   . ARG A 1 71  ? 205.024 211.074 234.221 1.00 242.92 ? 166 ARG B HA   1 
ATOM 1111  H HB2  . ARG A 1 71  ? 207.474 210.576 232.914 1.00 242.92 ? 166 ARG B HB2  1 
ATOM 1112  H HB3  . ARG A 1 71  ? 206.888 212.035 233.068 1.00 242.92 ? 166 ARG B HB3  1 
ATOM 1113  H HG2  . ARG A 1 71  ? 207.500 210.511 235.333 1.00 242.92 ? 166 ARG B HG2  1 
ATOM 1114  H HG3  . ARG A 1 71  ? 208.618 211.399 234.636 1.00 242.92 ? 166 ARG B HG3  1 
ATOM 1115  H HD2  . ARG A 1 71  ? 206.247 212.483 235.735 1.00 242.92 ? 166 ARG B HD2  1 
ATOM 1116  H HD3  . ARG A 1 71  ? 207.649 212.509 236.474 1.00 242.92 ? 166 ARG B HD3  1 
ATOM 1117  H HE   . ARG A 1 71  ? 208.108 213.755 234.306 1.00 242.92 ? 166 ARG B HE   1 
ATOM 1118  H HH11 . ARG A 1 71  ? 205.703 214.403 236.521 1.00 242.92 ? 166 ARG B HH11 1 
ATOM 1119  H HH12 . ARG A 1 71  ? 205.617 215.843 236.225 1.00 242.92 ? 166 ARG B HH12 1 
ATOM 1120  H HH21 . ARG A 1 71  ? 207.987 215.981 233.960 1.00 242.92 ? 166 ARG B HH21 1 
ATOM 1121  H HH22 . ARG A 1 71  ? 206.977 216.793 234.694 1.00 242.92 ? 166 ARG B HH22 1 
ATOM 1122  N N    . PRO A 1 72  ? 204.249 211.812 231.892 1.00 190.83 ? 167 PRO B N    1 
ATOM 1123  C CA   . PRO A 1 72  ? 203.678 211.980 230.554 1.00 190.83 ? 167 PRO B CA   1 
ATOM 1124  C C    . PRO A 1 72  ? 204.760 212.068 229.489 1.00 190.83 ? 167 PRO B C    1 
ATOM 1125  O O    . PRO A 1 72  ? 205.891 212.490 229.742 1.00 190.83 ? 167 PRO B O    1 
ATOM 1126  C CB   . PRO A 1 72  ? 202.902 213.296 230.674 1.00 190.83 ? 167 PRO B CB   1 
ATOM 1127  C CG   . PRO A 1 72  ? 203.660 214.076 231.693 1.00 190.83 ? 167 PRO B CG   1 
ATOM 1128  C CD   . PRO A 1 72  ? 204.102 213.049 232.700 1.00 190.83 ? 167 PRO B CD   1 
ATOM 1129  H HA   . PRO A 1 72  ? 203.065 211.260 230.343 1.00 229.00 ? 167 PRO B HA   1 
ATOM 1130  H HB2  . PRO A 1 72  ? 202.859 213.798 229.696 1.00 229.00 ? 167 PRO B HB2  1 
ATOM 1131  H HB3  . PRO A 1 72  ? 201.864 213.093 230.977 1.00 229.00 ? 167 PRO B HB3  1 
ATOM 1132  H HG2  . PRO A 1 72  ? 204.506 214.597 231.220 1.00 229.00 ? 167 PRO B HG2  1 
ATOM 1133  H HG3  . PRO A 1 72  ? 203.016 214.852 232.133 1.00 229.00 ? 167 PRO B HG3  1 
ATOM 1134  H HD2  . PRO A 1 72  ? 205.061 213.356 233.141 1.00 229.00 ? 167 PRO B HD2  1 
ATOM 1135  H HD3  . PRO A 1 72  ? 203.332 212.943 233.479 1.00 229.00 ? 167 PRO B HD3  1 
ATOM 1136  N N    . THR A 1 73  ? 204.381 211.655 228.280 1.00 183.31 ? 168 THR B N    1 
ATOM 1137  C CA   . THR A 1 73  ? 205.207 211.791 227.090 1.00 183.31 ? 168 THR B CA   1 
ATOM 1138  C C    . THR A 1 73  ? 204.664 212.815 226.101 1.00 183.31 ? 168 THR B C    1 
ATOM 1139  O O    . THR A 1 73  ? 205.376 213.173 225.158 1.00 183.31 ? 168 THR B O    1 
ATOM 1140  C CB   . THR A 1 73  ? 205.359 210.434 226.380 1.00 183.31 ? 168 THR B CB   1 
ATOM 1141  O OG1  . THR A 1 73  ? 204.070 209.959 225.969 1.00 183.31 ? 168 THR B OG1  1 
ATOM 1142  C CG2  . THR A 1 73  ? 205.998 209.414 227.310 1.00 183.31 ? 168 THR B CG2  1 
ATOM 1143  H H    . THR A 1 73  ? 203.625 211.278 228.124 1.00 219.97 ? 168 THR B H    1 
ATOM 1144  H HA   . THR A 1 73  ? 206.098 212.076 227.338 1.00 219.97 ? 168 THR B HA   1 
ATOM 1145  H HB   . THR A 1 73  ? 205.986 210.553 225.496 1.00 219.97 ? 168 THR B HB   1 
ATOM 1146  H HG1  . THR A 1 73  ? 203.943 210.148 225.036 1.00 219.97 ? 168 THR B HG1  1 
ATOM 1147  H HG21 . THR A 1 73  ? 206.098 208.461 226.791 1.00 219.97 ? 168 THR B HG21 1 
ATOM 1148  H HG22 . THR A 1 73  ? 206.983 209.766 227.615 1.00 219.97 ? 168 THR B HG22 1 
ATOM 1149  H HG23 . THR A 1 73  ? 205.371 209.283 228.191 1.00 219.97 ? 168 THR B HG23 1 
ATOM 1150  N N    . ALA A 1 74  ? 203.434 213.293 226.287 1.00 173.91 ? 169 ALA B N    1 
ATOM 1151  C CA   . ALA A 1 74  ? 202.867 214.311 225.415 1.00 173.91 ? 169 ALA B CA   1 
ATOM 1152  C C    . ALA A 1 74  ? 201.743 215.021 226.154 1.00 173.91 ? 169 ALA B C    1 
ATOM 1153  O O    . ALA A 1 74  ? 201.131 214.467 227.070 1.00 173.91 ? 169 ALA B O    1 
ATOM 1154  C CB   . ALA A 1 74  ? 202.350 213.706 224.108 1.00 173.91 ? 169 ALA B CB   1 
ATOM 1155  H H    . ALA A 1 74  ? 202.899 213.045 226.912 1.00 208.69 ? 169 ALA B H    1 
ATOM 1156  H HA   . ALA A 1 74  ? 203.551 214.964 225.200 1.00 208.69 ? 169 ALA B HA   1 
ATOM 1157  H HB1  . ALA A 1 74  ? 201.893 214.404 223.615 1.00 208.69 ? 169 ALA B HB1  1 
ATOM 1158  H HB2  . ALA A 1 74  ? 203.098 213.365 223.595 1.00 208.69 ? 169 ALA B HB2  1 
ATOM 1159  H HB3  . ALA A 1 74  ? 201.729 212.990 224.314 1.00 208.69 ? 169 ALA B HB3  1 
ATOM 1160  N N    . TYR A 1 75  ? 201.480 216.258 225.733 1.00 170.90 ? 170 TYR B N    1 
ATOM 1161  C CA   . TYR A 1 75  ? 200.412 217.081 226.280 1.00 170.90 ? 170 TYR B CA   1 
ATOM 1162  C C    . TYR A 1 75  ? 199.418 217.427 225.182 1.00 170.90 ? 170 TYR B C    1 
ATOM 1163  O O    . TYR A 1 75  ? 199.725 217.353 223.989 1.00 170.90 ? 170 TYR B O    1 
ATOM 1164  C CB   . TYR A 1 75  ? 200.975 218.352 226.920 1.00 170.90 ? 170 TYR B CB   1 
ATOM 1165  C CG   . TYR A 1 75  ? 201.897 218.089 228.090 1.00 170.90 ? 170 TYR B CG   1 
ATOM 1166  C CD1  . TYR A 1 75  ? 201.395 217.535 229.258 1.00 170.90 ? 170 TYR B CD1  1 
ATOM 1167  C CD2  . TYR A 1 75  ? 203.245 218.402 227.995 1.00 170.90 ? 170 TYR B CD2  1 
ATOM 1168  C CE1  . TYR A 1 75  ? 202.237 217.296 230.327 1.00 170.90 ? 170 TYR B CE1  1 
ATOM 1169  C CE2  . TYR A 1 75  ? 204.088 218.162 229.063 1.00 170.90 ? 170 TYR B CE2  1 
ATOM 1170  C CZ   . TYR A 1 75  ? 203.578 217.607 230.232 1.00 170.90 ? 170 TYR B CZ   1 
ATOM 1171  O OH   . TYR A 1 75  ? 204.417 217.368 231.296 1.00 170.90 ? 170 TYR B OH   1 
ATOM 1172  H H    . TYR A 1 75  ? 201.924 216.652 225.110 1.00 205.08 ? 170 TYR B H    1 
ATOM 1173  H HA   . TYR A 1 75  ? 199.915 216.593 226.953 1.00 205.08 ? 170 TYR B HA   1 
ATOM 1174  H HB2  . TYR A 1 75  ? 201.528 218.922 226.172 1.00 205.08 ? 170 TYR B HB2  1 
ATOM 1175  H HB3  . TYR A 1 75  ? 200.154 218.978 227.268 1.00 205.08 ? 170 TYR B HB3  1 
ATOM 1176  H HD1  . TYR A 1 75  ? 200.336 217.288 229.333 1.00 205.08 ? 170 TYR B HD1  1 
ATOM 1177  H HD2  . TYR A 1 75  ? 203.640 218.838 227.076 1.00 205.08 ? 170 TYR B HD2  1 
ATOM 1178  H HE1  . TYR A 1 75  ? 201.843 216.859 231.245 1.00 205.08 ? 170 TYR B HE1  1 
ATOM 1179  H HE2  . TYR A 1 75  ? 205.146 218.408 228.988 1.00 205.08 ? 170 TYR B HE2  1 
ATOM 1180  H HH   . TYR A 1 75  ? 203.915 216.984 232.018 1.00 205.08 ? 170 TYR B HH   1 
ATOM 1181  N N    . GLU A 1 76  ? 198.217 217.806 225.603 1.00 161.44 ? 171 GLU B N    1 
ATOM 1182  C CA   . GLU A 1 76  ? 197.206 218.262 224.664 1.00 161.44 ? 171 GLU B CA   1 
ATOM 1183  C C    . GLU A 1 76  ? 197.626 219.593 224.052 1.00 161.44 ? 171 GLU B C    1 
ATOM 1184  O O    . GLU A 1 76  ? 198.321 220.399 224.679 1.00 161.44 ? 171 GLU B O    1 
ATOM 1185  C CB   . GLU A 1 76  ? 195.849 218.403 225.357 1.00 161.44 ? 171 GLU B CB   1 
ATOM 1186  C CG   . GLU A 1 76  ? 195.242 217.087 225.823 1.00 161.44 ? 171 GLU B CG   1 
ATOM 1187  C CD   . GLU A 1 76  ? 193.895 217.260 226.469 1.00 161.44 ? 171 GLU B CD   1 
ATOM 1188  O OE1  . GLU A 1 76  ? 193.465 218.380 226.610 1.00 161.44 ? 171 GLU B OE1  1 
ATOM 1189  O OE2  . GLU A 1 76  ? 193.296 216.272 226.820 1.00 161.44 ? 171 GLU B OE2  1 
ATOM 1190  H H    . GLU A 1 76  ? 197.964 217.808 226.426 1.00 193.73 ? 171 GLU B H    1 
ATOM 1191  H HA   . GLU A 1 76  ? 197.114 217.613 223.950 1.00 193.73 ? 171 GLU B HA   1 
ATOM 1192  H HB2  . GLU A 1 76  ? 195.951 219.051 226.227 1.00 193.73 ? 171 GLU B HB2  1 
ATOM 1193  H HB3  . GLU A 1 76  ? 195.141 218.876 224.677 1.00 193.73 ? 171 GLU B HB3  1 
ATOM 1194  H HG2  . GLU A 1 76  ? 195.139 216.423 224.966 1.00 193.73 ? 171 GLU B HG2  1 
ATOM 1195  H HG3  . GLU A 1 76  ? 195.922 216.617 226.533 1.00 193.73 ? 171 GLU B HG3  1 
ATOM 1196  N N    . ASP A 1 77  ? 197.206 219.815 222.806 1.00 156.24 ? 172 ASP B N    1 
ATOM 1197  C CA   . ASP A 1 77  ? 197.636 221.000 222.073 1.00 156.24 ? 172 ASP B CA   1 
ATOM 1198  C C    . ASP A 1 77  ? 197.484 222.261 222.919 1.00 156.24 ? 172 ASP B C    1 
ATOM 1199  O O    . ASP A 1 77  ? 198.457 222.986 223.156 1.00 156.24 ? 172 ASP B O    1 
ATOM 1200  C CB   . ASP A 1 77  ? 196.835 221.148 220.777 1.00 156.24 ? 172 ASP B CB   1 
ATOM 1201  C CG   . ASP A 1 77  ? 197.143 220.055 219.762 1.00 156.24 ? 172 ASP B CG   1 
ATOM 1202  O OD1  . ASP A 1 77  ? 198.134 219.382 219.924 1.00 156.24 ? 172 ASP B OD1  1 
ATOM 1203  O OD2  . ASP A 1 77  ? 196.384 219.902 218.835 1.00 156.24 ? 172 ASP B OD2  1 
ATOM 1204  H H    . ASP A 1 77  ? 196.676 219.298 222.367 1.00 187.49 ? 172 ASP B H    1 
ATOM 1205  H HA   . ASP A 1 77  ? 198.577 220.911 221.854 1.00 187.49 ? 172 ASP B HA   1 
ATOM 1206  H HB2  . ASP A 1 77  ? 195.769 221.124 221.003 1.00 187.49 ? 172 ASP B HB2  1 
ATOM 1207  H HB3  . ASP A 1 77  ? 197.052 222.116 220.323 1.00 187.49 ? 172 ASP B HB3  1 
ATOM 1208  N N    . GLU A 1 78  ? 196.270 222.536 223.388 1.00 146.63 ? 173 GLU B N    1 
ATOM 1209  C CA   . GLU A 1 78  ? 196.020 223.756 224.146 1.00 146.63 ? 173 GLU B CA   1 
ATOM 1210  C C    . GLU A 1 78  ? 194.605 223.722 224.704 1.00 146.63 ? 173 GLU B C    1 
ATOM 1211  O O    . GLU A 1 78  ? 193.773 222.909 224.291 1.00 146.63 ? 173 GLU B O    1 
ATOM 1212  C CB   . GLU A 1 78  ? 196.214 224.995 223.270 1.00 146.63 ? 173 GLU B CB   1 
ATOM 1213  C CG   . GLU A 1 78  ? 195.236 225.104 222.109 1.00 146.63 ? 173 GLU B CG   1 
ATOM 1214  C CD   . GLU A 1 78  ? 195.514 226.282 221.218 1.00 146.63 ? 173 GLU B CD   1 
ATOM 1215  O OE1  . GLU A 1 78  ? 196.017 227.266 221.705 1.00 146.63 ? 173 GLU B OE1  1 
ATOM 1216  O OE2  . GLU A 1 78  ? 195.224 226.198 220.048 1.00 146.63 ? 173 GLU B OE2  1 
ATOM 1217  H H    . GLU A 1 78  ? 195.579 222.035 223.281 1.00 175.96 ? 173 GLU B H    1 
ATOM 1218  H HA   . GLU A 1 78  ? 196.639 223.802 224.890 1.00 175.96 ? 173 GLU B HA   1 
ATOM 1219  H HB2  . GLU A 1 78  ? 196.111 225.892 223.880 1.00 175.96 ? 173 GLU B HB2  1 
ATOM 1220  H HB3  . GLU A 1 78  ? 197.223 224.994 222.857 1.00 175.96 ? 173 GLU B HB3  1 
ATOM 1221  H HG2  . GLU A 1 78  ? 195.290 224.193 221.515 1.00 175.96 ? 173 GLU B HG2  1 
ATOM 1222  H HG3  . GLU A 1 78  ? 194.225 225.186 222.507 1.00 175.96 ? 173 GLU B HG3  1 
ATOM 1223  N N    . VAL A 1 79  ? 194.349 224.619 225.654 1.00 148.53 ? 174 VAL B N    1 
ATOM 1224  C CA   . VAL A 1 79  ? 192.993 224.921 226.095 1.00 148.53 ? 174 VAL B CA   1 
ATOM 1225  C C    . VAL A 1 79  ? 192.879 226.431 226.261 1.00 148.53 ? 174 VAL B C    1 
ATOM 1226  O O    . VAL A 1 79  ? 193.788 227.085 226.783 1.00 148.53 ? 174 VAL B O    1 
ATOM 1227  C CB   . VAL A 1 79  ? 192.610 224.159 227.388 1.00 148.53 ? 174 VAL B CB   1 
ATOM 1228  C CG1  . VAL A 1 79  ? 193.515 224.527 228.563 1.00 148.53 ? 174 VAL B CG1  1 
ATOM 1229  C CG2  . VAL A 1 79  ? 191.135 224.384 227.725 1.00 148.53 ? 174 VAL B CG2  1 
ATOM 1230  H H    . VAL A 1 79  ? 194.955 225.071 226.063 1.00 178.24 ? 174 VAL B H    1 
ATOM 1231  H HA   . VAL A 1 79  ? 192.379 224.625 225.427 1.00 178.24 ? 174 VAL B HA   1 
ATOM 1232  H HB   . VAL A 1 79  ? 192.726 223.211 227.223 1.00 178.24 ? 174 VAL B HB   1 
ATOM 1233  H HG11 . VAL A 1 79  ? 193.270 223.967 229.318 1.00 178.24 ? 174 VAL B HG11 1 
ATOM 1234  H HG12 . VAL A 1 79  ? 194.438 224.355 228.316 1.00 178.24 ? 174 VAL B HG12 1 
ATOM 1235  H HG13 . VAL A 1 79  ? 193.399 225.457 228.804 1.00 178.24 ? 174 VAL B HG13 1 
ATOM 1236  H HG21 . VAL A 1 79  ? 190.897 223.836 228.488 1.00 178.24 ? 174 VAL B HG21 1 
ATOM 1237  H HG22 . VAL A 1 79  ? 190.988 225.319 227.933 1.00 178.24 ? 174 VAL B HG22 1 
ATOM 1238  H HG23 . VAL A 1 79  ? 190.596 224.129 226.959 1.00 178.24 ? 174 VAL B HG23 1 
ATOM 1239  N N    . SER A 1 80  ? 191.763 226.983 225.789 1.00 147.58 ? 175 SER B N    1 
ATOM 1240  C CA   . SER A 1 80  ? 191.460 228.401 225.912 1.00 147.58 ? 175 SER B CA   1 
ATOM 1241  C C    . SER A 1 80  ? 190.275 228.606 226.843 1.00 147.58 ? 175 SER B C    1 
ATOM 1242  O O    . SER A 1 80  ? 189.432 227.719 227.011 1.00 147.58 ? 175 SER B O    1 
ATOM 1243  C CB   . SER A 1 80  ? 191.161 228.998 224.550 1.00 147.58 ? 175 SER B CB   1 
ATOM 1244  O OG   . SER A 1 80  ? 192.284 228.930 223.715 1.00 147.58 ? 175 SER B OG   1 
ATOM 1245  H H    . SER A 1 80  ? 191.150 226.540 225.380 1.00 177.10 ? 175 SER B H    1 
ATOM 1246  H HA   . SER A 1 80  ? 192.209 228.877 226.293 1.00 177.10 ? 175 SER B HA   1 
ATOM 1247  H HB2  . SER A 1 80  ? 190.330 228.461 224.092 1.00 177.10 ? 175 SER B HB2  1 
ATOM 1248  H HB3  . SER A 1 80  ? 190.854 230.036 224.668 1.00 177.10 ? 175 SER B HB3  1 
ATOM 1249  H HG   . SER A 1 80  ? 191.952 229.019 222.818 1.00 177.10 ? 175 SER B HG   1 
ATOM 1250  N N    . PHE A 1 81  ? 190.216 229.788 227.452 1.00 152.53 ? 176 PHE B N    1 
ATOM 1251  C CA   . PHE A 1 81  ? 189.121 230.083 228.367 1.00 152.53 ? 176 PHE B CA   1 
ATOM 1252  C C    . PHE A 1 81  ? 188.888 231.586 228.433 1.00 152.53 ? 176 PHE B C    1 
ATOM 1253  O O    . PHE A 1 81  ? 189.759 232.389 228.083 1.00 152.53 ? 176 PHE B O    1 
ATOM 1254  C CB   . PHE A 1 81  ? 189.419 229.538 229.765 1.00 152.53 ? 176 PHE B CB   1 
ATOM 1255  C CG   . PHE A 1 81  ? 190.660 230.112 230.387 1.00 152.53 ? 176 PHE B CG   1 
ATOM 1256  C CD1  . PHE A 1 81  ? 191.895 229.514 230.185 1.00 152.53 ? 176 PHE B CD1  1 
ATOM 1257  C CD2  . PHE A 1 81  ? 190.595 231.251 231.175 1.00 152.53 ? 176 PHE B CD2  1 
ATOM 1258  C CE1  . PHE A 1 81  ? 193.037 230.039 230.757 1.00 152.53 ? 176 PHE B CE1  1 
ATOM 1259  C CE2  . PHE A 1 81  ? 191.736 231.780 231.747 1.00 152.53 ? 176 PHE B CE2  1 
ATOM 1260  C CZ   . PHE A 1 81  ? 192.957 231.174 231.539 1.00 152.53 ? 176 PHE B CZ   1 
ATOM 1261  H H    . PHE A 1 81  ? 190.786 230.423 227.354 1.00 183.04 ? 176 PHE B H    1 
ATOM 1262  H HA   . PHE A 1 81  ? 188.312 229.675 228.024 1.00 183.04 ? 176 PHE B HA   1 
ATOM 1263  H HB2  . PHE A 1 81  ? 188.579 229.750 230.425 1.00 183.04 ? 176 PHE B HB2  1 
ATOM 1264  H HB3  . PHE A 1 81  ? 189.532 228.456 229.717 1.00 183.04 ? 176 PHE B HB3  1 
ATOM 1265  H HD1  . PHE A 1 81  ? 191.958 228.617 229.567 1.00 183.04 ? 176 PHE B HD1  1 
ATOM 1266  H HD2  . PHE A 1 81  ? 189.629 231.730 231.340 1.00 183.04 ? 176 PHE B HD2  1 
ATOM 1267  H HE1  . PHE A 1 81  ? 194.001 229.559 230.592 1.00 183.04 ? 176 PHE B HE1  1 
ATOM 1268  H HE2  . PHE A 1 81  ? 191.671 232.676 232.364 1.00 183.04 ? 176 PHE B HE2  1 
ATOM 1269  H HZ   . PHE A 1 81  ? 193.857 231.591 231.989 1.00 183.04 ? 176 PHE B HZ   1 
ATOM 1270  N N    . LEU A 1 82  ? 187.694 231.942 228.909 1.00 133.76 ? 177 LEU B N    1 
ATOM 1271  C CA   . LEU A 1 82  ? 187.273 233.310 229.184 1.00 133.76 ? 177 LEU B CA   1 
ATOM 1272  C C    . LEU A 1 82  ? 187.282 233.552 230.688 1.00 133.76 ? 177 LEU B C    1 
ATOM 1273  O O    . LEU A 1 82  ? 186.552 232.886 231.430 1.00 133.76 ? 177 LEU B O    1 
ATOM 1274  C CB   . LEU A 1 82  ? 185.873 233.571 228.615 1.00 133.76 ? 177 LEU B CB   1 
ATOM 1275  C CG   . LEU A 1 82  ? 185.285 234.958 228.905 1.00 133.76 ? 177 LEU B CG   1 
ATOM 1276  C CD1  . LEU A 1 82  ? 186.142 236.024 228.236 1.00 133.76 ? 177 LEU B CD1  1 
ATOM 1277  C CD2  . LEU A 1 82  ? 183.850 235.016 228.403 1.00 133.76 ? 177 LEU B CD2  1 
ATOM 1278  H H    . LEU A 1 82  ? 187.076 231.370 229.084 1.00 160.51 ? 177 LEU B H    1 
ATOM 1279  H HA   . LEU A 1 82  ? 187.887 233.934 228.767 1.00 160.51 ? 177 LEU B HA   1 
ATOM 1280  H HB2  . LEU A 1 82  ? 185.909 233.446 227.534 1.00 160.51 ? 177 LEU B HB2  1 
ATOM 1281  H HB3  . LEU A 1 82  ? 185.188 232.828 229.024 1.00 160.51 ? 177 LEU B HB3  1 
ATOM 1282  H HG   . LEU A 1 82  ? 185.301 235.143 229.980 1.00 160.51 ? 177 LEU B HG   1 
ATOM 1283  H HD11 . LEU A 1 82  ? 185.724 237.009 228.442 1.00 160.51 ? 177 LEU B HD11 1 
ATOM 1284  H HD12 . LEU A 1 82  ? 187.158 235.972 228.628 1.00 160.51 ? 177 LEU B HD12 1 
ATOM 1285  H HD13 . LEU A 1 82  ? 186.158 235.855 227.160 1.00 160.51 ? 177 LEU B HD13 1 
ATOM 1286  H HD21 . LEU A 1 82  ? 183.431 236.002 228.610 1.00 160.51 ? 177 LEU B HD21 1 
ATOM 1287  H HD22 . LEU A 1 82  ? 183.832 234.833 227.329 1.00 160.51 ? 177 LEU B HD22 1 
ATOM 1288  H HD23 . LEU A 1 82  ? 183.256 234.256 228.911 1.00 160.51 ? 177 LEU B HD23 1 
ATOM 1289  N N    . ASP A 1 83  ? 188.096 234.510 231.133 1.00 127.63 ? 178 ASP B N    1 
ATOM 1290  C CA   . ASP A 1 83  ? 188.313 234.738 232.554 1.00 127.63 ? 178 ASP B CA   1 
ATOM 1291  C C    . ASP A 1 83  ? 187.369 235.829 233.059 1.00 127.63 ? 178 ASP B C    1 
ATOM 1292  O O    . ASP A 1 83  ? 186.485 236.307 232.341 1.00 127.63 ? 178 ASP B O    1 
ATOM 1293  C CB   . ASP A 1 83  ? 189.767 235.133 232.823 1.00 127.63 ? 178 ASP B CB   1 
ATOM 1294  C CG   . ASP A 1 83  ? 190.115 236.515 232.284 1.00 127.63 ? 178 ASP B CG   1 
ATOM 1295  O OD1  . ASP A 1 83  ? 189.216 237.224 231.899 1.00 127.63 ? 178 ASP B OD1  1 
ATOM 1296  O OD2  . ASP A 1 83  ? 191.276 236.846 232.262 1.00 127.63 ? 178 ASP B OD2  1 
ATOM 1297  H H    . ASP A 1 83  ? 188.538 235.045 230.624 1.00 153.16 ? 178 ASP B H    1 
ATOM 1298  H HA   . ASP A 1 83  ? 188.108 233.932 233.044 1.00 153.16 ? 178 ASP B HA   1 
ATOM 1299  H HB2  . ASP A 1 83  ? 189.955 235.121 233.897 1.00 153.16 ? 178 ASP B HB2  1 
ATOM 1300  H HB3  . ASP A 1 83  ? 190.434 234.402 232.365 1.00 153.16 ? 178 ASP B HB3  1 
ATOM 1301  N N    . ALA A 1 84  ? 187.561 236.233 234.316 1.00 112.09 ? 179 ALA B N    1 
ATOM 1302  C CA   . ALA A 1 84  ? 186.673 237.203 234.944 1.00 112.09 ? 179 ALA B CA   1 
ATOM 1303  C C    . ALA A 1 84  ? 186.803 238.601 234.351 1.00 112.09 ? 179 ALA B C    1 
ATOM 1304  O O    . ALA A 1 84  ? 185.982 239.466 234.676 1.00 112.09 ? 179 ALA B O    1 
ATOM 1305  C CB   . ALA A 1 84  ? 186.946 237.259 236.447 1.00 112.09 ? 179 ALA B CB   1 
ATOM 1306  H H    . ALA A 1 84  ? 188.197 235.957 234.823 1.00 134.51 ? 179 ALA B H    1 
ATOM 1307  H HA   . ALA A 1 84  ? 185.757 236.912 234.820 1.00 134.51 ? 179 ALA B HA   1 
ATOM 1308  H HB1  . ALA A 1 84  ? 186.341 237.899 236.854 1.00 134.51 ? 179 ALA B HB1  1 
ATOM 1309  H HB2  . ALA A 1 84  ? 186.802 236.379 236.828 1.00 134.51 ? 179 ALA B HB2  1 
ATOM 1310  H HB3  . ALA A 1 84  ? 187.865 237.534 236.591 1.00 134.51 ? 179 ALA B HB3  1 
ATOM 1311  N N    . HIS A 1 85  ? 187.797 238.843 233.496 1.00 126.05 ? 180 HIS B N    1 
ATOM 1312  C CA   . HIS A 1 85  ? 188.070 240.170 232.960 1.00 126.05 ? 180 HIS B CA   1 
ATOM 1313  C C    . HIS A 1 85  ? 187.603 240.335 231.517 1.00 126.05 ? 180 HIS B C    1 
ATOM 1314  O O    . HIS A 1 85  ? 188.048 241.265 230.838 1.00 126.05 ? 180 HIS B O    1 
ATOM 1315  C CB   . HIS A 1 85  ? 189.569 240.476 233.045 1.00 126.05 ? 180 HIS B CB   1 
ATOM 1316  C CG   . HIS A 1 85  ? 190.112 240.441 234.440 1.00 126.05 ? 180 HIS B CG   1 
ATOM 1317  N ND1  . HIS A 1 85  ? 189.865 241.439 235.359 1.00 126.05 ? 180 HIS B ND1  1 
ATOM 1318  C CD2  . HIS A 1 85  ? 190.889 239.530 235.072 1.00 126.05 ? 180 HIS B CD2  1 
ATOM 1319  C CE1  . HIS A 1 85  ? 190.467 241.142 236.498 1.00 126.05 ? 180 HIS B CE1  1 
ATOM 1320  N NE2  . HIS A 1 85  ? 191.095 239.990 236.349 1.00 126.05 ? 180 HIS B NE2  1 
ATOM 1321  H H    . HIS A 1 85  ? 188.340 238.244 233.204 1.00 151.26 ? 180 HIS B H    1 
ATOM 1322  H HA   . HIS A 1 85  ? 187.606 240.831 233.497 1.00 151.26 ? 180 HIS B HA   1 
ATOM 1323  H HB2  . HIS A 1 85  ? 190.123 239.753 232.445 1.00 151.26 ? 180 HIS B HB2  1 
ATOM 1324  H HB3  . HIS A 1 85  ? 189.763 241.464 232.628 1.00 151.26 ? 180 HIS B HB3  1 
ATOM 1325  H HD1  . HIS A 1 85  ? 189.260 242.225 235.230 1.00 151.26 ? 180 HIS B HD1  1 
ATOM 1326  H HD2  . HIS A 1 85  ? 191.331 238.585 234.754 1.00 151.26 ? 180 HIS B HD2  1 
ATOM 1327  H HE1  . HIS A 1 85  ? 190.392 241.810 237.356 1.00 151.26 ? 180 HIS B HE1  1 
ATOM 1328  N N    . SER A 1 86  ? 186.710 239.466 231.040 1.00 134.24 ? 181 SER B N    1 
ATOM 1329  C CA   . SER A 1 86  ? 186.193 239.533 229.673 1.00 134.24 ? 181 SER B CA   1 
ATOM 1330  C C    . SER A 1 86  ? 187.320 239.438 228.643 1.00 134.24 ? 181 SER B C    1 
ATOM 1331  O O    . SER A 1 86  ? 187.296 240.126 227.618 1.00 134.24 ? 181 SER B O    1 
ATOM 1332  C CB   . SER A 1 86  ? 185.422 240.823 229.471 1.00 134.24 ? 181 SER B CB   1 
ATOM 1333  O OG   . SER A 1 86  ? 184.344 240.908 230.363 1.00 134.24 ? 181 SER B OG   1 
ATOM 1334  H H    . SER A 1 86  ? 186.380 238.816 231.497 1.00 161.09 ? 181 SER B H    1 
ATOM 1335  H HA   . SER A 1 86  ? 185.592 238.788 229.536 1.00 161.09 ? 181 SER B HA   1 
ATOM 1336  H HB2  . SER A 1 86  ? 186.088 241.672 229.620 1.00 161.09 ? 181 SER B HB2  1 
ATOM 1337  H HB3  . SER A 1 86  ? 185.055 240.871 228.447 1.00 161.09 ? 181 SER B HB3  1 
ATOM 1338  H HG   . SER A 1 86  ? 183.881 241.720 230.142 1.00 161.09 ? 181 SER B HG   1 
ATOM 1339  N N    . ARG A 1 87  ? 188.310 238.590 228.911 1.00 129.50 ? 182 ARG B N    1 
ATOM 1340  C CA   . ARG A 1 87  ? 189.422 238.340 228.004 1.00 129.50 ? 182 ARG B CA   1 
ATOM 1341  C C    . ARG A 1 87  ? 189.724 236.850 227.924 1.00 129.50 ? 182 ARG B C    1 
ATOM 1342  O O    . ARG A 1 87  ? 189.509 236.094 228.873 1.00 129.50 ? 182 ARG B O    1 
ATOM 1343  C CB   . ARG A 1 87  ? 190.667 239.087 228.458 1.00 129.50 ? 182 ARG B CB   1 
ATOM 1344  C CG   . ARG A 1 87  ? 191.198 238.676 229.822 1.00 129.50 ? 182 ARG B CG   1 
ATOM 1345  C CD   . ARG A 1 87  ? 192.339 239.527 230.247 1.00 129.50 ? 182 ARG B CD   1 
ATOM 1346  N NE   . ARG A 1 87  ? 192.859 239.128 231.545 1.00 129.50 ? 182 ARG B NE   1 
ATOM 1347  C CZ   . ARG A 1 87  ? 193.817 239.792 232.222 1.00 129.50 ? 182 ARG B CZ   1 
ATOM 1348  N NH1  . ARG A 1 87  ? 194.348 240.881 231.712 1.00 129.50 ? 182 ARG B NH1  1 
ATOM 1349  N NH2  . ARG A 1 87  ? 194.222 239.347 233.399 1.00 129.50 ? 182 ARG B NH2  1 
ATOM 1350  H H    . ARG A 1 87  ? 188.358 238.133 229.638 1.00 155.40 ? 182 ARG B H    1 
ATOM 1351  H HA   . ARG A 1 87  ? 189.199 238.641 227.109 1.00 155.40 ? 182 ARG B HA   1 
ATOM 1352  H HB2  . ARG A 1 87  ? 191.467 238.935 227.734 1.00 155.40 ? 182 ARG B HB2  1 
ATOM 1353  H HB3  . ARG A 1 87  ? 190.457 240.156 228.494 1.00 155.40 ? 182 ARG B HB3  1 
ATOM 1354  H HG2  . ARG A 1 87  ? 190.405 238.771 230.565 1.00 155.40 ? 182 ARG B HG2  1 
ATOM 1355  H HG3  . ARG A 1 87  ? 191.537 237.640 229.784 1.00 155.40 ? 182 ARG B HG3  1 
ATOM 1356  H HD2  . ARG A 1 87  ? 193.145 239.445 229.517 1.00 155.40 ? 182 ARG B HD2  1 
ATOM 1357  H HD3  . ARG A 1 87  ? 192.015 240.564 230.313 1.00 155.40 ? 182 ARG B HD3  1 
ATOM 1358  H HE   . ARG A 1 87  ? 192.475 238.295 231.970 1.00 155.40 ? 182 ARG B HE   1 
ATOM 1359  H HH11 . ARG A 1 87  ? 194.038 241.220 230.812 1.00 155.40 ? 182 ARG B HH11 1 
ATOM 1360  H HH12 . ARG A 1 87  ? 195.065 241.378 232.219 1.00 155.40 ? 182 ARG B HH12 1 
ATOM 1361  H HH21 . ARG A 1 87  ? 193.814 238.510 233.791 1.00 155.40 ? 182 ARG B HH21 1 
ATOM 1362  H HH22 . ARG A 1 87  ? 194.940 239.844 233.906 1.00 155.40 ? 182 ARG B HH22 1 
ATOM 1363  N N    . TYR A 1 88  ? 190.254 236.437 226.777 1.00 128.20 ? 183 TYR B N    1 
ATOM 1364  C CA   . TYR A 1 88  ? 190.562 235.040 226.514 1.00 128.20 ? 183 TYR B CA   1 
ATOM 1365  C C    . TYR A 1 88  ? 192.050 234.771 226.657 1.00 128.20 ? 183 TYR B C    1 
ATOM 1366  O O    . TYR A 1 88  ? 192.887 235.645 226.414 1.00 128.20 ? 183 TYR B O    1 
ATOM 1367  C CB   . TYR A 1 88  ? 190.082 234.640 225.118 1.00 128.20 ? 183 TYR B CB   1 
ATOM 1368  C CG   . TYR A 1 88  ? 188.594 234.378 225.035 1.00 128.20 ? 183 TYR B CG   1 
ATOM 1369  C CD1  . TYR A 1 88  ? 187.720 235.422 224.774 1.00 128.20 ? 183 TYR B CD1  1 
ATOM 1370  C CD2  . TYR A 1 88  ? 188.105 233.093 225.220 1.00 128.20 ? 183 TYR B CD2  1 
ATOM 1371  C CE1  . TYR A 1 88  ? 186.361 235.183 224.699 1.00 128.20 ? 183 TYR B CE1  1 
ATOM 1372  C CE2  . TYR A 1 88  ? 186.747 232.854 225.145 1.00 128.20 ? 183 TYR B CE2  1 
ATOM 1373  C CZ   . TYR A 1 88  ? 185.876 233.894 224.886 1.00 128.20 ? 183 TYR B CZ   1 
ATOM 1374  O OH   . TYR A 1 88  ? 184.523 233.656 224.811 1.00 128.20 ? 183 TYR B OH   1 
ATOM 1375  H H    . TYR A 1 88  ? 190.446 236.960 226.122 1.00 153.84 ? 183 TYR B H    1 
ATOM 1376  H HA   . TYR A 1 88  ? 190.133 234.484 227.172 1.00 153.84 ? 183 TYR B HA   1 
ATOM 1377  H HB2  . TYR A 1 88  ? 190.329 235.430 224.407 1.00 153.84 ? 183 TYR B HB2  1 
ATOM 1378  H HB3  . TYR A 1 88  ? 190.604 233.738 224.798 1.00 153.84 ? 183 TYR B HB3  1 
ATOM 1379  H HD1  . TYR A 1 88  ? 188.105 236.432 224.629 1.00 153.84 ? 183 TYR B HD1  1 
ATOM 1380  H HD2  . TYR A 1 88  ? 188.792 232.273 225.426 1.00 153.84 ? 183 TYR B HD2  1 
ATOM 1381  H HE1  . TYR A 1 88  ? 185.674 236.004 224.494 1.00 153.84 ? 183 TYR B HE1  1 
ATOM 1382  H HE2  . TYR A 1 88  ? 186.362 231.845 225.292 1.00 153.84 ? 183 TYR B HE2  1 
ATOM 1383  H HH   . TYR A 1 88  ? 184.070 234.465 224.562 1.00 153.84 ? 183 TYR B HH   1 
ATOM 1384  N N    . HIS A 1 89  ? 192.361 233.542 227.058 1.00 161.57 ? 184 HIS B N    1 
ATOM 1385  C CA   . HIS A 1 89  ? 193.741 233.108 227.215 1.00 161.57 ? 184 HIS B CA   1 
ATOM 1386  C C    . HIS A 1 89  ? 193.824 231.617 226.923 1.00 161.57 ? 184 HIS B C    1 
ATOM 1387  O O    . HIS A 1 89  ? 192.898 230.861 227.238 1.00 161.57 ? 184 HIS B O    1 
ATOM 1388  C CB   . HIS A 1 89  ? 194.262 233.403 228.625 1.00 161.57 ? 184 HIS B CB   1 
ATOM 1389  C CG   . HIS A 1 89  ? 195.713 233.085 228.809 1.00 161.57 ? 184 HIS B CG   1 
ATOM 1390  N ND1  . HIS A 1 89  ? 196.718 233.847 228.250 1.00 161.57 ? 184 HIS B ND1  1 
ATOM 1391  C CD2  . HIS A 1 89  ? 196.328 232.089 229.488 1.00 161.57 ? 184 HIS B CD2  1 
ATOM 1392  C CE1  . HIS A 1 89  ? 197.890 233.332 228.580 1.00 161.57 ? 184 HIS B CE1  1 
ATOM 1393  N NE2  . HIS A 1 89  ? 197.681 232.265 229.329 1.00 161.57 ? 184 HIS B NE2  1 
ATOM 1394  H H    . HIS A 1 89  ? 191.782 232.934 227.249 1.00 193.88 ? 184 HIS B H    1 
ATOM 1395  H HA   . HIS A 1 89  ? 194.296 233.573 226.570 1.00 193.88 ? 184 HIS B HA   1 
ATOM 1396  H HB2  . HIS A 1 89  ? 194.112 234.459 228.854 1.00 193.88 ? 184 HIS B HB2  1 
ATOM 1397  H HB3  . HIS A 1 89  ? 193.691 232.826 229.352 1.00 193.88 ? 184 HIS B HB3  1 
ATOM 1398  H HD2  . HIS A 1 89  ? 195.841 231.294 230.055 1.00 193.88 ? 184 HIS B HD2  1 
ATOM 1399  H HE1  . HIS A 1 89  ? 198.864 233.721 228.283 1.00 193.88 ? 184 HIS B HE1  1 
ATOM 1400  H HE2  . HIS A 1 89  ? 198.396 231.671 229.725 1.00 193.88 ? 184 HIS B HE2  1 
ATOM 1401  N N    . THR A 1 90  ? 194.929 231.218 226.300 1.00 149.49 ? 185 THR B N    1 
ATOM 1402  C CA   . THR A 1 90  ? 195.223 229.830 225.976 1.00 149.49 ? 185 THR B CA   1 
ATOM 1403  C C    . THR A 1 90  ? 196.377 229.357 226.847 1.00 149.49 ? 185 THR B C    1 
ATOM 1404  O O    . THR A 1 90  ? 197.298 230.127 227.137 1.00 149.49 ? 185 THR B O    1 
ATOM 1405  C CB   . THR A 1 90  ? 195.572 229.652 224.487 1.00 149.49 ? 185 THR B CB   1 
ATOM 1406  O OG1  . THR A 1 90  ? 195.800 228.265 224.209 1.00 149.49 ? 185 THR B OG1  1 
ATOM 1407  C CG2  . THR A 1 90  ? 196.819 230.448 224.133 1.00 149.49 ? 185 THR B CG2  1 
ATOM 1408  H H    . THR A 1 90  ? 195.546 231.758 226.042 1.00 179.39 ? 185 THR B H    1 
ATOM 1409  H HA   . THR A 1 90  ? 194.453 229.275 226.157 1.00 179.39 ? 185 THR B HA   1 
ATOM 1410  H HB   . THR A 1 90  ? 194.740 230.000 223.874 1.00 179.39 ? 185 THR B HB   1 
ATOM 1411  H HG1  . THR A 1 90  ? 196.007 228.155 223.277 1.00 179.39 ? 185 THR B HG1  1 
ATOM 1412  H HG21 . THR A 1 90  ? 197.050 230.311 223.077 1.00 179.39 ? 185 THR B HG21 1 
ATOM 1413  H HG22 . THR A 1 90  ? 196.645 231.505 224.332 1.00 179.39 ? 185 THR B HG22 1 
ATOM 1414  H HG23 . THR A 1 90  ? 197.657 230.099 224.735 1.00 179.39 ? 185 THR B HG23 1 
ATOM 1415  N N    . VAL A 1 91  ? 196.326 228.094 227.268 1.00 138.78 ? 186 VAL B N    1 
ATOM 1416  C CA   . VAL A 1 91  ? 197.384 227.493 228.068 1.00 138.78 ? 186 VAL B CA   1 
ATOM 1417  C C    . VAL A 1 91  ? 197.822 226.208 227.385 1.00 138.78 ? 186 VAL B C    1 
ATOM 1418  O O    . VAL A 1 91  ? 196.985 225.385 226.994 1.00 138.78 ? 186 VAL B O    1 
ATOM 1419  C CB   . VAL A 1 91  ? 196.898 227.192 229.498 1.00 138.78 ? 186 VAL B CB   1 
ATOM 1420  C CG1  . VAL A 1 91  ? 198.003 226.531 230.308 1.00 138.78 ? 186 VAL B CG1  1 
ATOM 1421  C CG2  . VAL A 1 91  ? 196.432 228.476 230.167 1.00 138.78 ? 186 VAL B CG2  1 
ATOM 1422  H H    . VAL A 1 91  ? 195.677 227.556 227.097 1.00 166.54 ? 186 VAL B H    1 
ATOM 1423  H HA   . VAL A 1 91  ? 198.152 228.084 228.100 1.00 166.54 ? 186 VAL B HA   1 
ATOM 1424  H HB   . VAL A 1 91  ? 196.069 226.485 229.448 1.00 166.54 ? 186 VAL B HB   1 
ATOM 1425  H HG11 . VAL A 1 91  ? 197.642 226.325 231.316 1.00 166.54 ? 186 VAL B HG11 1 
ATOM 1426  H HG12 . VAL A 1 91  ? 198.296 225.596 229.830 1.00 166.54 ? 186 VAL B HG12 1 
ATOM 1427  H HG13 . VAL A 1 91  ? 198.863 227.198 230.361 1.00 166.54 ? 186 VAL B HG13 1 
ATOM 1428  H HG21 . VAL A 1 91  ? 196.089 228.255 231.177 1.00 166.54 ? 186 VAL B HG21 1 
ATOM 1429  H HG22 . VAL A 1 91  ? 197.259 229.184 230.211 1.00 166.54 ? 186 VAL B HG22 1 
ATOM 1430  H HG23 . VAL A 1 91  ? 195.613 228.909 229.593 1.00 166.54 ? 186 VAL B HG23 1 
ATOM 1431  N N    . HIS A 1 92  ? 199.130 226.046 227.241 1.00 140.64 ? 187 HIS B N    1 
ATOM 1432  C CA   . HIS A 1 92  ? 199.725 224.867 226.639 1.00 140.64 ? 187 HIS B CA   1 
ATOM 1433  C C    . HIS A 1 92  ? 200.346 224.004 227.726 1.00 140.64 ? 187 HIS B C    1 
ATOM 1434  O O    . HIS A 1 92  ? 200.634 224.473 228.830 1.00 140.64 ? 187 HIS B O    1 
ATOM 1435  C CB   . HIS A 1 92  ? 200.784 225.251 225.600 1.00 140.64 ? 187 HIS B CB   1 
ATOM 1436  C CG   . HIS A 1 92  ? 200.230 225.993 224.423 1.00 140.64 ? 187 HIS B CG   1 
ATOM 1437  N ND1  . HIS A 1 92  ? 199.931 225.374 223.227 1.00 140.64 ? 187 HIS B ND1  1 
ATOM 1438  C CD2  . HIS A 1 92  ? 199.923 227.301 224.257 1.00 140.64 ? 187 HIS B CD2  1 
ATOM 1439  C CE1  . HIS A 1 92  ? 199.462 226.271 222.377 1.00 140.64 ? 187 HIS B CE1  1 
ATOM 1440  N NE2  . HIS A 1 92  ? 199.447 227.446 222.977 1.00 140.64 ? 187 HIS B NE2  1 
ATOM 1441  H H    . HIS A 1 92  ? 199.712 226.625 227.496 1.00 168.77 ? 187 HIS B H    1 
ATOM 1442  H HA   . HIS A 1 92  ? 199.048 224.347 226.180 1.00 168.77 ? 187 HIS B HA   1 
ATOM 1443  H HB2  . HIS A 1 92  ? 201.545 225.875 226.069 1.00 168.77 ? 187 HIS B HB2  1 
ATOM 1444  H HB3  . HIS A 1 92  ? 201.278 224.352 225.234 1.00 168.77 ? 187 HIS B HB3  1 
ATOM 1445  H HD1  . HIS A 1 92  ? 199.974 224.392 223.043 1.00 168.77 ? 187 HIS B HD1  1 
ATOM 1446  H HD2  . HIS A 1 92  ? 199.988 228.166 224.917 1.00 168.77 ? 187 HIS B HD2  1 
ATOM 1447  H HE1  . HIS A 1 92  ? 199.165 225.978 221.370 1.00 168.77 ? 187 HIS B HE1  1 
ATOM 1448  N N    . GLU A 1 93  ? 200.555 222.732 227.398 1.00 164.10 ? 188 GLU B N    1 
ATOM 1449  C CA   . GLU A 1 93  ? 201.204 221.772 228.285 1.00 164.10 ? 188 GLU B CA   1 
ATOM 1450  C C    . GLU A 1 93  ? 200.546 221.668 229.660 1.00 164.10 ? 188 GLU B C    1 
ATOM 1451  O O    . GLU A 1 93  ? 201.247 221.684 230.679 1.00 164.10 ? 188 GLU B O    1 
ATOM 1452  C CB   . GLU A 1 93  ? 202.678 222.144 228.456 1.00 164.10 ? 188 GLU B CB   1 
ATOM 1453  C CG   . GLU A 1 93  ? 203.483 222.136 227.164 1.00 164.10 ? 188 GLU B CG   1 
ATOM 1454  C CD   . GLU A 1 93  ? 204.942 222.425 227.382 1.00 164.10 ? 188 GLU B CD   1 
ATOM 1455  O OE1  . GLU A 1 93  ? 205.256 223.507 227.816 1.00 164.10 ? 188 GLU B OE1  1 
ATOM 1456  O OE2  . GLU A 1 93  ? 205.744 221.561 227.113 1.00 164.10 ? 188 GLU B OE2  1 
ATOM 1457  H H    . GLU A 1 93  ? 200.322 222.392 226.644 1.00 196.92 ? 188 GLU B H    1 
ATOM 1458  H HA   . GLU A 1 93  ? 201.153 220.896 227.874 1.00 196.92 ? 188 GLU B HA   1 
ATOM 1459  H HB2  . GLU A 1 93  ? 202.754 223.141 228.891 1.00 196.92 ? 188 GLU B HB2  1 
ATOM 1460  H HB3  . GLU A 1 93  ? 203.151 221.448 229.149 1.00 196.92 ? 188 GLU B HB3  1 
ATOM 1461  H HG2  . GLU A 1 93  ? 203.384 221.159 226.692 1.00 196.92 ? 188 GLU B HG2  1 
ATOM 1462  H HG3  . GLU A 1 93  ? 203.067 222.880 226.485 1.00 196.92 ? 188 GLU B HG3  1 
ATOM 1463  N N    . LEU A 1 94  ? 199.215 221.571 229.716 1.00 155.43 ? 189 LEU B N    1 
ATOM 1464  C CA   . LEU A 1 94  ? 198.475 221.524 230.976 1.00 155.43 ? 189 LEU B CA   1 
ATOM 1465  C C    . LEU A 1 94  ? 197.798 220.182 231.257 1.00 155.43 ? 189 LEU B C    1 
ATOM 1466  O O    . LEU A 1 94  ? 197.585 219.836 232.423 1.00 155.43 ? 189 LEU B O    1 
ATOM 1467  C CB   . LEU A 1 94  ? 197.413 222.630 230.983 1.00 155.43 ? 189 LEU B CB   1 
ATOM 1468  C CG   . LEU A 1 94  ? 196.553 222.718 232.250 1.00 155.43 ? 189 LEU B CG   1 
ATOM 1469  C CD1  . LEU A 1 94  ? 197.440 223.037 233.446 1.00 155.43 ? 189 LEU B CD1  1 
ATOM 1470  C CD2  . LEU A 1 94  ? 195.482 223.784 232.064 1.00 155.43 ? 189 LEU B CD2  1 
ATOM 1471  H H    . LEU A 1 94  ? 198.727 221.522 229.006 1.00 186.52 ? 189 LEU B H    1 
ATOM 1472  H HA   . LEU A 1 94  ? 199.175 221.694 231.794 1.00 186.52 ? 189 LEU B HA   1 
ATOM 1473  H HB2  . LEU A 1 94  ? 197.910 223.590 230.853 1.00 186.52 ? 189 LEU B HB2  1 
ATOM 1474  H HB3  . LEU A 1 94  ? 196.743 222.474 230.138 1.00 186.52 ? 189 LEU B HB3  1 
ATOM 1475  H HG   . LEU A 1 94  ? 196.077 221.755 232.435 1.00 186.52 ? 189 LEU B HG   1 
ATOM 1476  H HD11 . LEU A 1 94  ? 196.829 223.100 234.346 1.00 186.52 ? 189 LEU B HD11 1 
ATOM 1477  H HD12 . LEU A 1 94  ? 198.184 222.249 233.567 1.00 186.52 ? 189 LEU B HD12 1 
ATOM 1478  H HD13 . LEU A 1 94  ? 197.943 223.989 233.282 1.00 186.52 ? 189 LEU B HD13 1 
ATOM 1479  H HD21 . LEU A 1 94  ? 194.870 223.846 232.965 1.00 186.52 ? 189 LEU B HD21 1 
ATOM 1480  H HD22 . LEU A 1 94  ? 195.957 224.748 231.880 1.00 186.52 ? 189 LEU B HD22 1 
ATOM 1481  H HD23 . LEU A 1 94  ? 194.852 223.522 231.214 1.00 186.52 ? 189 LEU B HD23 1 
ATOM 1482  N N    . SER A 1 95  ? 197.453 219.427 230.213 1.00 166.49 ? 190 SER B N    1 
ATOM 1483  C CA   . SER A 1 95  ? 196.666 218.205 230.359 1.00 166.49 ? 190 SER B CA   1 
ATOM 1484  C C    . SER A 1 95  ? 197.363 217.092 229.596 1.00 166.49 ? 190 SER B C    1 
ATOM 1485  O O    . SER A 1 95  ? 197.617 217.230 228.395 1.00 166.49 ? 190 SER B O    1 
ATOM 1486  C CB   . SER A 1 95  ? 195.256 218.401 229.837 1.00 166.49 ? 190 SER B CB   1 
ATOM 1487  O OG   . SER A 1 95  ? 194.509 217.221 229.952 1.00 166.49 ? 190 SER B OG   1 
ATOM 1488  H H    . SER A 1 95  ? 197.666 219.596 229.398 1.00 199.79 ? 190 SER B H    1 
ATOM 1489  H HA   . SER A 1 95  ? 196.610 217.933 231.287 1.00 199.79 ? 190 SER B HA   1 
ATOM 1490  H HB2  . SER A 1 95  ? 194.769 219.199 230.398 1.00 199.79 ? 190 SER B HB2  1 
ATOM 1491  H HB3  . SER A 1 95  ? 195.294 218.711 228.794 1.00 199.79 ? 190 SER B HB3  1 
ATOM 1492  H HG   . SER A 1 95  ? 193.640 217.423 229.599 1.00 199.79 ? 190 SER B HG   1 
ATOM 1493  N N    . ALA A 1 96  ? 197.671 215.998 230.289 1.00 177.90 ? 191 ALA B N    1 
ATOM 1494  C CA   . ALA A 1 96  ? 198.429 214.914 229.682 1.00 177.90 ? 191 ALA B CA   1 
ATOM 1495  C C    . ALA A 1 96  ? 197.682 214.322 228.494 1.00 177.90 ? 191 ALA B C    1 
ATOM 1496  O O    . ALA A 1 96  ? 196.473 214.080 228.545 1.00 177.90 ? 191 ALA B O    1 
ATOM 1497  C CB   . ALA A 1 96  ? 198.716 213.819 230.708 1.00 177.90 ? 191 ALA B CB   1 
ATOM 1498  H H    . ALA A 1 96  ? 197.455 215.862 231.110 1.00 213.48 ? 191 ALA B H    1 
ATOM 1499  H HA   . ALA A 1 96  ? 199.275 215.257 229.364 1.00 213.48 ? 191 ALA B HA   1 
ATOM 1500  H HB1  . ALA A 1 96  ? 199.193 213.095 230.272 1.00 213.48 ? 191 ALA B HB1  1 
ATOM 1501  H HB2  . ALA A 1 96  ? 199.259 214.189 231.423 1.00 213.48 ? 191 ALA B HB2  1 
ATOM 1502  H HB3  . ALA A 1 96  ? 197.874 213.493 231.063 1.00 213.48 ? 191 ALA B HB3  1 
ATOM 1503  N N    . ARG A 1 97  ? 198.427 214.090 227.414 1.00 172.01 ? 192 ARG B N    1 
ATOM 1504  C CA   . ARG A 1 97  ? 197.930 213.394 226.235 1.00 172.01 ? 192 ARG B CA   1 
ATOM 1505  C C    . ARG A 1 97  ? 198.487 211.987 226.093 1.00 172.01 ? 192 ARG B C    1 
ATOM 1506  O O    . ARG A 1 97  ? 197.784 211.110 225.585 1.00 172.01 ? 192 ARG B O    1 
ATOM 1507  C CB   . ARG A 1 97  ? 198.270 214.186 224.981 1.00 172.01 ? 192 ARG B CB   1 
ATOM 1508  C CG   . ARG A 1 97  ? 197.773 213.570 223.682 1.00 172.01 ? 192 ARG B CG   1 
ATOM 1509  C CD   . ARG A 1 97  ? 198.023 214.462 222.521 1.00 172.01 ? 192 ARG B CD   1 
ATOM 1510  N NE   . ARG A 1 97  ? 197.603 213.852 221.269 1.00 172.01 ? 192 ARG B NE   1 
ATOM 1511  C CZ   . ARG A 1 97  ? 197.734 214.426 220.057 1.00 172.01 ? 192 ARG B CZ   1 
ATOM 1512  N NH1  . ARG A 1 97  ? 198.273 215.620 219.950 1.00 172.01 ? 192 ARG B NH1  1 
ATOM 1513  N NH2  . ARG A 1 97  ? 197.320 213.788 218.976 1.00 172.01 ? 192 ARG B NH2  1 
ATOM 1514  H H    . ARG A 1 97  ? 199.247 214.333 227.342 1.00 206.41 ? 192 ARG B H    1 
ATOM 1515  H HA   . ARG A 1 97  ? 196.964 213.327 226.283 1.00 206.41 ? 192 ARG B HA   1 
ATOM 1516  H HB2  . ARG A 1 97  ? 197.844 215.185 225.055 1.00 206.41 ? 192 ARG B HB2  1 
ATOM 1517  H HB3  . ARG A 1 97  ? 199.351 214.295 224.901 1.00 206.41 ? 192 ARG B HB3  1 
ATOM 1518  H HG2  . ARG A 1 97  ? 198.289 212.626 223.507 1.00 206.41 ? 192 ARG B HG2  1 
ATOM 1519  H HG3  . ARG A 1 97  ? 196.700 213.389 223.752 1.00 206.41 ? 192 ARG B HG3  1 
ATOM 1520  H HD2  . ARG A 1 97  ? 197.468 215.391 222.650 1.00 206.41 ? 192 ARG B HD2  1 
ATOM 1521  H HD3  . ARG A 1 97  ? 199.087 214.681 222.453 1.00 206.41 ? 192 ARG B HD3  1 
ATOM 1522  H HE   . ARG A 1 97  ? 197.184 212.933 221.311 1.00 206.41 ? 192 ARG B HE   1 
ATOM 1523  H HH11 . ARG A 1 97  ? 198.589 216.107 220.776 1.00 206.41 ? 192 ARG B HH11 1 
ATOM 1524  H HH12 . ARG A 1 97  ? 198.371 216.050 219.042 1.00 206.41 ? 192 ARG B HH12 1 
ATOM 1525  H HH21 . ARG A 1 97  ? 196.905 212.870 219.058 1.00 206.41 ? 192 ARG B HH21 1 
ATOM 1526  H HH22 . ARG A 1 97  ? 197.418 214.218 218.068 1.00 206.41 ? 192 ARG B HH22 1 
ATOM 1527  N N    . GLU A 1 98  ? 199.724 211.750 226.527 1.00 182.57 ? 193 GLU B N    1 
ATOM 1528  C CA   . GLU A 1 98  ? 200.331 210.426 226.508 1.00 182.57 ? 193 GLU B CA   1 
ATOM 1529  C C    . GLU A 1 98  ? 201.021 210.171 227.841 1.00 182.57 ? 193 GLU B C    1 
ATOM 1530  O O    . GLU A 1 98  ? 201.564 211.089 228.458 1.00 182.57 ? 193 GLU B O    1 
ATOM 1531  C CB   . GLU A 1 98  ? 201.332 210.301 225.357 1.00 182.57 ? 193 GLU B CB   1 
ATOM 1532  C CG   . GLU A 1 98  ? 200.717 210.432 223.971 1.00 182.57 ? 193 GLU B CG   1 
ATOM 1533  C CD   . GLU A 1 98  ? 201.735 210.340 222.869 1.00 182.57 ? 193 GLU B CD   1 
ATOM 1534  O OE1  . GLU A 1 98  ? 202.894 210.183 223.167 1.00 182.57 ? 193 GLU B OE1  1 
ATOM 1535  O OE2  . GLU A 1 98  ? 201.352 210.427 221.725 1.00 182.57 ? 193 GLU B OE2  1 
ATOM 1536  H H    . GLU A 1 98  ? 200.245 212.357 226.844 1.00 219.08 ? 193 GLU B H    1 
ATOM 1537  H HA   . GLU A 1 98  ? 199.641 209.755 226.391 1.00 219.08 ? 193 GLU B HA   1 
ATOM 1538  H HB2  . GLU A 1 98  ? 202.099 211.069 225.457 1.00 219.08 ? 193 GLU B HB2  1 
ATOM 1539  H HB3  . GLU A 1 98  ? 201.829 209.332 225.412 1.00 219.08 ? 193 GLU B HB3  1 
ATOM 1540  H HG2  . GLU A 1 98  ? 199.979 209.642 223.836 1.00 219.08 ? 193 GLU B HG2  1 
ATOM 1541  H HG3  . GLU A 1 98  ? 200.200 211.389 223.904 1.00 219.08 ? 193 GLU B HG3  1 
ATOM 1542  N N    . CYS A 1 99  ? 201.024 208.905 228.257 1.00 208.52 ? 194 CYS B N    1 
ATOM 1543  C CA   . CYS A 1 99  ? 201.537 208.482 229.556 1.00 208.52 ? 194 CYS B CA   1 
ATOM 1544  C C    . CYS A 1 99  ? 202.428 207.261 229.380 1.00 208.52 ? 194 CYS B C    1 
ATOM 1545  O O    . CYS A 1 99  ? 202.035 206.299 228.713 1.00 208.52 ? 194 CYS B O    1 
ATOM 1546  C CB   . CYS A 1 99  ? 200.395 208.151 230.517 1.00 208.52 ? 194 CYS B CB   1 
ATOM 1547  S SG   . CYS A 1 99  ? 200.941 207.596 232.149 1.00 208.52 ? 194 CYS B SG   1 
ATOM 1548  H H    . CYS A 1 99  ? 200.724 208.252 227.785 1.00 250.22 ? 194 CYS B H    1 
ATOM 1549  H HA   . CYS A 1 99  ? 202.066 209.189 229.956 1.00 250.22 ? 194 CYS B HA   1 
ATOM 1550  H HB2  . CYS A 1 99  ? 199.767 209.032 230.653 1.00 250.22 ? 194 CYS B HB2  1 
ATOM 1551  H HB3  . CYS A 1 99  ? 199.772 207.368 230.085 1.00 250.22 ? 194 CYS B HB3  1 
ATOM 1552  N N    . ALA A 1 100 ? 203.622 207.289 229.978 1.00 217.25 ? 195 ALA B N    1 
ATOM 1553  C CA   . ALA A 1 100 ? 204.463 206.097 229.999 1.00 217.25 ? 195 ALA B CA   1 
ATOM 1554  C C    . ALA A 1 100 ? 205.513 206.241 231.090 1.00 217.25 ? 195 ALA B C    1 
ATOM 1555  O O    . ALA A 1 100 ? 205.857 207.348 231.504 1.00 217.25 ? 195 ALA B O    1 
ATOM 1556  C CB   . ALA A 1 100 ? 205.130 205.856 228.640 1.00 217.25 ? 195 ALA B CB   1 
ATOM 1557  H H    . ALA A 1 100 ? 203.961 207.975 230.371 1.00 260.70 ? 195 ALA B H    1 
ATOM 1558  H HA   . ALA A 1 100 ? 203.913 205.325 230.207 1.00 260.70 ? 195 ALA B HA   1 
ATOM 1559  H HB1  . ALA A 1 100 ? 205.705 205.079 228.707 1.00 260.70 ? 195 ALA B HB1  1 
ATOM 1560  H HB2  . ALA A 1 100 ? 204.446 205.703 227.970 1.00 260.70 ? 195 ALA B HB2  1 
ATOM 1561  H HB3  . ALA A 1 100 ? 205.656 206.636 228.404 1.00 260.70 ? 195 ALA B HB3  1 
ATOM 1562  N N    . CYS A 1 101 ? 206.022 205.100 231.549 1.00 238.06 ? 196 CYS B N    1 
ATOM 1563  C CA   . CYS A 1 101 ? 207.091 205.065 232.537 1.00 238.06 ? 196 CYS B CA   1 
ATOM 1564  C C    . CYS A 1 101 ? 208.445 205.152 231.843 1.00 238.06 ? 196 CYS B C    1 
ATOM 1565  O O    . CYS A 1 101 ? 208.725 204.401 230.903 1.00 238.06 ? 196 CYS B O    1 
ATOM 1566  C CB   . CYS A 1 101 ? 207.023 203.785 233.370 1.00 238.06 ? 196 CYS B CB   1 
ATOM 1567  S SG   . CYS A 1 101 ? 205.606 203.709 234.491 1.00 238.06 ? 196 CYS B SG   1 
ATOM 1568  H H    . CYS A 1 101 ? 205.758 204.321 231.299 1.00 285.67 ? 196 CYS B H    1 
ATOM 1569  H HA   . CYS A 1 101 ? 207.021 205.822 233.134 1.00 285.67 ? 196 CYS B HA   1 
ATOM 1570  H HB2  . CYS A 1 101 ? 206.975 202.921 232.706 1.00 285.67 ? 196 CYS B HB2  1 
ATOM 1571  H HB3  . CYS A 1 101 ? 207.930 203.690 233.966 1.00 285.67 ? 196 CYS B HB3  1 
ATOM 1572  N N    . VAL A 1 102 ? 209.272 206.086 232.307 1.00 216.68 ? 197 VAL B N    1 
ATOM 1573  C CA   . VAL A 1 102 ? 210.607 206.314 231.760 1.00 216.68 ? 197 VAL B CA   1 
ATOM 1574  C C    . VAL A 1 102 ? 211.635 205.965 232.829 1.00 216.68 ? 197 VAL B C    1 
ATOM 1575  O O    . VAL A 1 102 ? 212.364 204.980 232.714 1.00 216.68 ? 197 VAL B O    1 
ATOM 1576  C CB   . VAL A 1 102 ? 210.783 207.779 231.320 1.00 216.68 ? 197 VAL B CB   1 
ATOM 1577  C CG1  . VAL A 1 102 ? 212.190 208.011 230.791 1.00 216.68 ? 197 VAL B CG1  1 
ATOM 1578  C CG2  . VAL A 1 102 ? 209.745 208.131 230.266 1.00 216.68 ? 197 VAL B CG2  1 
ATOM 1579  O OXT  . VAL A 1 102 ? 211.757 206.663 233.835 1.00 216.68 ? 197 VAL B OXT  1 
ATOM 1580  H H    . VAL A 1 102 ? 209.075 206.616 232.955 1.00 260.02 ? 197 VAL B H    1 
ATOM 1581  H HA   . VAL A 1 102 ? 210.764 205.733 231.001 1.00 260.02 ? 197 VAL B HA   1 
ATOM 1582  H HB   . VAL A 1 102 ? 210.655 208.427 232.187 1.00 260.02 ? 197 VAL B HB   1 
ATOM 1583  H HG11 . VAL A 1 102 ? 212.297 209.052 230.484 1.00 260.02 ? 197 VAL B HG11 1 
ATOM 1584  H HG12 . VAL A 1 102 ? 212.915 207.787 231.574 1.00 260.02 ? 197 VAL B HG12 1 
ATOM 1585  H HG13 . VAL A 1 102 ? 212.368 207.361 229.934 1.00 260.02 ? 197 VAL B HG13 1 
ATOM 1586  H HG21 . VAL A 1 102 ? 209.875 209.169 229.960 1.00 260.02 ? 197 VAL B HG21 1 
ATOM 1587  H HG22 . VAL A 1 102 ? 209.869 207.479 229.401 1.00 260.02 ? 197 VAL B HG22 1 
ATOM 1588  H HG23 . VAL A 1 102 ? 208.745 207.997 230.680 1.00 260.02 ? 197 VAL B HG23 1 
ATOM 1589  N N    . ASP B 2 18  ? 174.142 216.397 195.389 1.00 248.48 ? 39  ASP D N    1 
ATOM 1590  C CA   . ASP B 2 18  ? 174.470 217.783 195.699 1.00 248.48 ? 39  ASP D CA   1 
ATOM 1591  C C    . ASP B 2 18  ? 174.566 218.618 194.423 1.00 248.48 ? 39  ASP D C    1 
ATOM 1592  O O    . ASP B 2 18  ? 174.403 218.092 193.324 1.00 248.48 ? 39  ASP D O    1 
ATOM 1593  C CB   . ASP B 2 18  ? 175.788 217.863 196.473 1.00 248.48 ? 39  ASP D CB   1 
ATOM 1594  C CG   . ASP B 2 18  ? 176.982 217.379 195.662 1.00 248.48 ? 39  ASP D CG   1 
ATOM 1595  O OD1  . ASP B 2 18  ? 176.849 217.241 194.469 1.00 248.48 ? 39  ASP D OD1  1 
ATOM 1596  O OD2  . ASP B 2 18  ? 178.016 217.152 196.243 1.00 248.48 ? 39  ASP D OD2  1 
ATOM 1597  H H    . ASP B 2 18  ? 174.768 215.664 195.654 1.00 298.18 ? 39  ASP D H    1 
ATOM 1598  H HA   . ASP B 2 18  ? 173.762 218.157 196.248 1.00 298.18 ? 39  ASP D HA   1 
ATOM 1599  H HB2  . ASP B 2 18  ? 175.969 218.894 196.779 1.00 298.18 ? 39  ASP D HB2  1 
ATOM 1600  H HB3  . ASP B 2 18  ? 175.715 217.261 197.380 1.00 298.18 ? 39  ASP D HB3  1 
ATOM 1601  N N    . CYS B 2 19  ? 174.841 219.916 194.579 1.00 284.61 ? 40  CYS D N    1 
ATOM 1602  C CA   . CYS B 2 19  ? 174.908 220.813 193.427 1.00 284.61 ? 40  CYS D CA   1 
ATOM 1603  C C    . CYS B 2 19  ? 176.104 220.502 192.535 1.00 284.61 ? 40  CYS D C    1 
ATOM 1604  O O    . CYS B 2 19  ? 176.019 220.646 191.310 1.00 284.61 ? 40  CYS D O    1 
ATOM 1605  C CB   . CYS B 2 19  ? 174.954 222.265 193.900 1.00 284.61 ? 40  CYS D CB   1 
ATOM 1606  S SG   . CYS B 2 19  ? 173.409 222.840 194.647 1.00 284.61 ? 40  CYS D SG   1 
ATOM 1607  H H    . CYS B 2 19  ? 174.990 220.298 195.335 1.00 341.53 ? 40  CYS D H    1 
ATOM 1608  H HA   . CYS B 2 19  ? 174.103 220.701 192.898 1.00 341.53 ? 40  CYS D HA   1 
ATOM 1609  H HB2  . CYS B 2 19  ? 175.654 222.354 194.566 1.00 341.53 ? 40  CYS D HB2  1 
ATOM 1610  H HB3  . CYS B 2 19  ? 175.148 222.836 193.140 1.00 341.53 ? 40  CYS D HB3  1 
ATOM 1611  N N    . VAL B 2 20  ? 177.221 220.070 193.125 1.00 258.22 ? 41  VAL D N    1 
ATOM 1612  C CA   . VAL B 2 20  ? 178.421 219.781 192.341 1.00 258.22 ? 41  VAL D CA   1 
ATOM 1613  C C    . VAL B 2 20  ? 178.175 218.578 191.437 1.00 258.22 ? 41  VAL D C    1 
ATOM 1614  O O    . VAL B 2 20  ? 178.437 218.615 190.226 1.00 258.22 ? 41  VAL D O    1 
ATOM 1615  C CB   . VAL B 2 20  ? 179.620 219.498 193.266 1.00 258.22 ? 41  VAL D CB   1 
ATOM 1616  C CG1  . VAL B 2 20  ? 180.829 219.061 192.452 1.00 258.22 ? 41  VAL D CG1  1 
ATOM 1617  C CG2  . VAL B 2 20  ? 179.943 220.735 194.089 1.00 258.22 ? 41  VAL D CG2  1 
ATOM 1618  H H    . VAL B 2 20  ? 177.304 219.933 193.970 1.00 309.86 ? 41  VAL D H    1 
ATOM 1619  H HA   . VAL B 2 20  ? 178.619 220.545 191.777 1.00 309.86 ? 41  VAL D HA   1 
ATOM 1620  H HB   . VAL B 2 20  ? 179.366 218.673 193.932 1.00 309.86 ? 41  VAL D HB   1 
ATOM 1621  H HG11 . VAL B 2 20  ? 181.667 218.864 193.121 1.00 309.86 ? 41  VAL D HG11 1 
ATOM 1622  H HG12 . VAL B 2 20  ? 180.586 218.154 191.898 1.00 309.86 ? 41  VAL D HG12 1 
ATOM 1623  H HG13 . VAL B 2 20  ? 181.102 219.851 191.753 1.00 309.86 ? 41  VAL D HG13 1 
ATOM 1624  H HG21 . VAL B 2 20  ? 180.791 220.527 194.741 1.00 309.86 ? 41  VAL D HG21 1 
ATOM 1625  H HG22 . VAL B 2 20  ? 180.191 221.561 193.423 1.00 309.86 ? 41  VAL D HG22 1 
ATOM 1626  H HG23 . VAL B 2 20  ? 179.077 221.005 194.695 1.00 309.86 ? 41  VAL D HG23 1 
ATOM 1627  N N    . ARG B 2 21  ? 177.657 217.493 192.017 1.00 273.55 ? 42  ARG D N    1 
ATOM 1628  C CA   . ARG B 2 21  ? 177.330 216.310 191.230 1.00 273.55 ? 42  ARG D CA   1 
ATOM 1629  C C    . ARG B 2 21  ? 176.158 216.579 190.296 1.00 273.55 ? 42  ARG D C    1 
ATOM 1630  O O    . ARG B 2 21  ? 176.151 216.108 189.155 1.00 273.55 ? 42  ARG D O    1 
ATOM 1631  C CB   . ARG B 2 21  ? 176.993 215.138 192.140 1.00 273.55 ? 42  ARG D CB   1 
ATOM 1632  C CG   . ARG B 2 21  ? 176.647 213.846 191.416 1.00 273.55 ? 42  ARG D CG   1 
ATOM 1633  C CD   . ARG B 2 21  ? 177.761 213.389 190.546 1.00 273.55 ? 42  ARG D CD   1 
ATOM 1634  N NE   . ARG B 2 21  ? 177.462 212.119 189.905 1.00 273.55 ? 42  ARG D NE   1 
ATOM 1635  C CZ   . ARG B 2 21  ? 178.134 211.617 188.850 1.00 273.55 ? 42  ARG D CZ   1 
ATOM 1636  N NH1  . ARG B 2 21  ? 179.137 212.289 188.330 1.00 273.55 ? 42  ARG D NH1  1 
ATOM 1637  N NH2  . ARG B 2 21  ? 177.784 210.450 188.338 1.00 273.55 ? 42  ARG D NH2  1 
ATOM 1638  H H    . ARG B 2 21  ? 177.488 217.419 192.857 1.00 328.26 ? 42  ARG D H    1 
ATOM 1639  H HA   . ARG B 2 21  ? 178.100 216.077 190.689 1.00 328.26 ? 42  ARG D HA   1 
ATOM 1640  H HB2  . ARG B 2 21  ? 177.837 214.932 192.796 1.00 328.26 ? 42  ARG D HB2  1 
ATOM 1641  H HB3  . ARG B 2 21  ? 176.144 215.400 192.771 1.00 328.26 ? 42  ARG D HB3  1 
ATOM 1642  H HG2  . ARG B 2 21  ? 176.440 213.064 192.147 1.00 328.26 ? 42  ARG D HG2  1 
ATOM 1643  H HG3  . ARG B 2 21  ? 175.766 214.003 190.793 1.00 328.26 ? 42  ARG D HG3  1 
ATOM 1644  H HD2  . ARG B 2 21  ? 177.941 214.130 189.767 1.00 328.26 ? 42  ARG D HD2  1 
ATOM 1645  H HD3  . ARG B 2 21  ? 178.663 213.266 191.144 1.00 328.26 ? 42  ARG D HD3  1 
ATOM 1646  H HE   . ARG B 2 21  ? 176.696 211.573 190.277 1.00 328.26 ? 42  ARG D HE   1 
ATOM 1647  H HH11 . ARG B 2 21  ? 179.405 213.181 188.722 1.00 328.26 ? 42  ARG D HH11 1 
ATOM 1648  H HH12 . ARG B 2 21  ? 179.640 211.913 187.540 1.00 328.26 ? 42  ARG D HH12 1 
ATOM 1649  H HH21 . ARG B 2 21  ? 177.012 209.934 188.738 1.00 328.26 ? 42  ARG D HH21 1 
ATOM 1650  H HH22 . ARG B 2 21  ? 178.287 210.075 187.548 1.00 328.26 ? 42  ARG D HH22 1 
ATOM 1651  N N    . ALA B 2 22  ? 175.158 217.334 190.759 1.00 283.02 ? 43  ALA D N    1 
ATOM 1652  C CA   . ALA B 2 22  ? 174.013 217.635 189.906 1.00 283.02 ? 43  ALA D CA   1 
ATOM 1653  C C    . ALA B 2 22  ? 174.456 218.294 188.604 1.00 283.02 ? 43  ALA D C    1 
ATOM 1654  O O    . ALA B 2 22  ? 173.869 218.044 187.545 1.00 283.02 ? 43  ALA D O    1 
ATOM 1655  C CB   . ALA B 2 22  ? 173.016 218.523 190.647 1.00 283.02 ? 43  ALA D CB   1 
ATOM 1656  H H    . ALA B 2 22  ? 175.120 217.677 191.546 1.00 339.62 ? 43  ALA D H    1 
ATOM 1657  H HA   . ALA B 2 22  ? 173.564 216.807 189.679 1.00 339.62 ? 43  ALA D HA   1 
ATOM 1658  H HB1  . ALA B 2 22  ? 172.232 218.638 190.089 1.00 339.62 ? 43  ALA D HB1  1 
ATOM 1659  H HB2  . ALA B 2 22  ? 172.761 218.089 191.475 1.00 339.62 ? 43  ALA D HB2  1 
ATOM 1660  H HB3  . ALA B 2 22  ? 173.428 219.381 190.830 1.00 339.62 ? 43  ALA D HB3  1 
ATOM 1661  N N    . ASN B 2 23  ? 175.491 219.138 188.657 1.00 283.94 ? 44  ASN D N    1 
ATOM 1662  C CA   . ASN B 2 23  ? 176.043 219.676 187.418 1.00 283.94 ? 44  ASN D CA   1 
ATOM 1663  C C    . ASN B 2 23  ? 176.685 218.570 186.596 1.00 283.94 ? 44  ASN D C    1 
ATOM 1664  O O    . ASN B 2 23  ? 176.395 218.423 185.405 1.00 283.94 ? 44  ASN D O    1 
ATOM 1665  C CB   . ASN B 2 23  ? 177.044 220.780 187.707 1.00 283.94 ? 44  ASN D CB   1 
ATOM 1666  C CG   . ASN B 2 23  ? 177.577 221.419 186.454 1.00 283.94 ? 44  ASN D CG   1 
ATOM 1667  O OD1  . ASN B 2 23  ? 176.816 221.982 185.659 1.00 283.94 ? 44  ASN D OD1  1 
ATOM 1668  N ND2  . ASN B 2 23  ? 178.869 221.342 186.264 1.00 283.94 ? 44  ASN D ND2  1 
ATOM 1669  H H    . ASN B 2 23  ? 175.879 219.407 189.376 1.00 340.73 ? 44  ASN D H    1 
ATOM 1670  H HA   . ASN B 2 23  ? 175.326 220.064 186.894 1.00 340.73 ? 44  ASN D HA   1 
ATOM 1671  H HB2  . ASN B 2 23  ? 176.572 221.548 188.320 1.00 340.73 ? 44  ASN D HB2  1 
ATOM 1672  H HB3  . ASN B 2 23  ? 177.880 220.373 188.277 1.00 340.73 ? 44  ASN D HB3  1 
ATOM 1673  H HD21 . ASN B 2 23  ? 179.279 221.750 185.447 1.00 340.73 ? 44  ASN D HD21 1 
ATOM 1674  H HD22 . ASN B 2 23  ? 179.446 220.877 186.934 1.00 340.73 ? 44  ASN D HD22 1 
ATOM 1675  N N    . GLU B 2 24  ? 177.555 217.772 187.227 1.00 281.10 ? 45  GLU D N    1 
ATOM 1676  C CA   . GLU B 2 24  ? 178.230 216.686 186.516 1.00 281.10 ? 45  GLU D CA   1 
ATOM 1677  C C    . GLU B 2 24  ? 177.247 215.723 185.857 1.00 281.10 ? 45  GLU D C    1 
ATOM 1678  O O    . GLU B 2 24  ? 177.560 215.140 184.813 1.00 281.10 ? 45  GLU D O    1 
ATOM 1679  C CB   . GLU B 2 24  ? 179.138 215.914 187.475 1.00 281.10 ? 45  GLU D CB   1 
ATOM 1680  C CG   . GLU B 2 24  ? 180.334 216.705 187.983 1.00 281.10 ? 45  GLU D CG   1 
ATOM 1681  C CD   . GLU B 2 24  ? 181.137 215.957 189.011 1.00 281.10 ? 45  GLU D CD   1 
ATOM 1682  O OE1  . GLU B 2 24  ? 180.742 214.875 189.373 1.00 281.10 ? 45  GLU D OE1  1 
ATOM 1683  O OE2  . GLU B 2 24  ? 182.146 216.469 189.436 1.00 281.10 ? 45  GLU D OE2  1 
ATOM 1684  H H    . GLU B 2 24  ? 177.767 217.838 188.058 1.00 337.32 ? 45  GLU D H    1 
ATOM 1685  H HA   . GLU B 2 24  ? 178.784 217.067 185.817 1.00 337.32 ? 45  GLU D HA   1 
ATOM 1686  H HB2  . GLU B 2 24  ? 178.560 215.588 188.340 1.00 337.32 ? 45  GLU D HB2  1 
ATOM 1687  H HB3  . GLU B 2 24  ? 179.515 215.020 186.978 1.00 337.32 ? 45  GLU D HB3  1 
ATOM 1688  H HG2  . GLU B 2 24  ? 180.981 216.948 187.141 1.00 337.32 ? 45  GLU D HG2  1 
ATOM 1689  H HG3  . GLU B 2 24  ? 179.980 217.640 188.416 1.00 337.32 ? 45  GLU D HG3  1 
ATOM 1690  N N    . LEU B 2 25  ? 176.062 215.537 186.445 1.00 292.35 ? 46  LEU D N    1 
ATOM 1691  C CA   . LEU B 2 25  ? 175.093 214.612 185.860 1.00 292.35 ? 46  LEU D CA   1 
ATOM 1692  C C    . LEU B 2 25  ? 174.693 215.024 184.445 1.00 292.35 ? 46  LEU D C    1 
ATOM 1693  O O    . LEU B 2 25  ? 174.428 214.155 183.605 1.00 292.35 ? 46  LEU D O    1 
ATOM 1694  C CB   . LEU B 2 25  ? 173.841 214.505 186.739 1.00 292.35 ? 46  LEU D CB   1 
ATOM 1695  C CG   . LEU B 2 25  ? 173.959 213.872 188.133 1.00 292.35 ? 46  LEU D CG   1 
ATOM 1696  C CD1  . LEU B 2 25  ? 172.653 214.024 188.901 1.00 292.35 ? 46  LEU D CD1  1 
ATOM 1697  C CD2  . LEU B 2 25  ? 174.391 212.410 188.090 1.00 292.35 ? 46  LEU D CD2  1 
ATOM 1698  H H    . LEU B 2 25  ? 175.799 215.924 187.167 1.00 350.82 ? 46  LEU D H    1 
ATOM 1699  H HA   . LEU B 2 25  ? 175.497 213.734 185.800 1.00 350.82 ? 46  LEU D HA   1 
ATOM 1700  H HB2  . LEU B 2 25  ? 173.494 215.401 186.868 1.00 350.82 ? 46  LEU D HB2  1 
ATOM 1701  H HB3  . LEU B 2 25  ? 173.186 213.981 186.252 1.00 350.82 ? 46  LEU D HB3  1 
ATOM 1702  H HG   . LEU B 2 25  ? 174.631 214.340 188.632 1.00 350.82 ? 46  LEU D HG   1 
ATOM 1703  H HD11 . LEU B 2 25  ? 172.763 213.645 189.787 1.00 350.82 ? 46  LEU D HD11 1 
ATOM 1704  H HD12 . LEU B 2 25  ? 172.435 214.967 188.971 1.00 350.82 ? 46  LEU D HD12 1 
ATOM 1705  H HD13 . LEU B 2 25  ? 171.949 213.556 188.425 1.00 350.82 ? 46  LEU D HD13 1 
ATOM 1706  H HD21 . LEU B 2 25  ? 174.443 212.079 189.000 1.00 350.82 ? 46  LEU D HD21 1 
ATOM 1707  H HD22 . LEU B 2 25  ? 173.739 211.899 187.587 1.00 350.82 ? 46  LEU D HD22 1 
ATOM 1708  H HD23 . LEU B 2 25  ? 175.263 212.348 187.672 1.00 350.82 ? 46  LEU D HD23 1 
ATOM 1709  N N    . CYS B 2 26  ? 174.652 216.333 184.155 1.00 317.09 ? 47  CYS D N    1 
ATOM 1710  C CA   . CYS B 2 26  ? 174.309 216.837 182.827 1.00 317.09 ? 47  CYS D CA   1 
ATOM 1711  C C    . CYS B 2 26  ? 175.418 217.649 182.167 1.00 317.09 ? 47  CYS D C    1 
ATOM 1712  O O    . CYS B 2 26  ? 175.298 217.965 180.978 1.00 317.09 ? 47  CYS D O    1 
ATOM 1713  C CB   . CYS B 2 26  ? 173.053 217.705 182.908 1.00 317.09 ? 47  CYS D CB   1 
ATOM 1714  S SG   . CYS B 2 26  ? 172.467 218.308 181.307 1.00 317.09 ? 47  CYS D SG   1 
ATOM 1715  H H    . CYS B 2 26  ? 174.823 216.955 184.724 1.00 380.51 ? 47  CYS D H    1 
ATOM 1716  H HA   . CYS B 2 26  ? 174.109 216.097 182.236 1.00 380.51 ? 47  CYS D HA   1 
ATOM 1717  H HB2  . CYS B 2 26  ? 172.246 217.135 183.370 1.00 380.51 ? 47  CYS D HB2  1 
ATOM 1718  H HB3  . CYS B 2 26  ? 173.249 218.569 183.543 1.00 380.51 ? 47  CYS D HB3  1 
ATOM 1719  N N    . ALA B 2 27  ? 176.499 217.975 182.883 1.00 303.09 ? 48  ALA D N    1 
ATOM 1720  C CA   . ALA B 2 27  ? 177.557 218.804 182.309 1.00 303.09 ? 48  ALA D CA   1 
ATOM 1721  C C    . ALA B 2 27  ? 178.167 218.171 181.064 1.00 303.09 ? 48  ALA D C    1 
ATOM 1722  O O    . ALA B 2 27  ? 178.638 218.888 180.173 1.00 303.09 ? 48  ALA D O    1 
ATOM 1723  C CB   . ALA B 2 27  ? 178.640 219.065 183.355 1.00 303.09 ? 48  ALA D CB   1 
ATOM 1724  H H    . ALA B 2 27  ? 176.644 217.732 183.695 1.00 363.71 ? 48  ALA D H    1 
ATOM 1725  H HA   . ALA B 2 27  ? 177.179 219.659 182.052 1.00 363.71 ? 48  ALA D HA   1 
ATOM 1726  H HB1  . ALA B 2 27  ? 179.329 219.624 182.964 1.00 363.71 ? 48  ALA D HB1  1 
ATOM 1727  H HB2  . ALA B 2 27  ? 178.240 219.517 184.116 1.00 363.71 ? 48  ALA D HB2  1 
ATOM 1728  H HB3  . ALA B 2 27  ? 179.020 218.218 183.637 1.00 363.71 ? 48  ALA D HB3  1 
ATOM 1729  N N    . ALA B 2 28  ? 178.171 216.838 180.981 1.00 325.84 ? 49  ALA D N    1 
ATOM 1730  C CA   . ALA B 2 28  ? 178.694 216.170 179.796 1.00 325.84 ? 49  ALA D CA   1 
ATOM 1731  C C    . ALA B 2 28  ? 177.799 216.377 178.581 1.00 325.84 ? 49  ALA D C    1 
ATOM 1732  O O    . ALA B 2 28  ? 178.256 216.197 177.446 1.00 325.84 ? 49  ALA D O    1 
ATOM 1733  C CB   . ALA B 2 28  ? 178.863 214.675 180.073 1.00 325.84 ? 49  ALA D CB   1 
ATOM 1734  H H    . ALA B 2 28  ? 177.881 216.306 181.591 1.00 391.01 ? 49  ALA D H    1 
ATOM 1735  H HA   . ALA B 2 28  ? 179.568 216.536 179.590 1.00 391.01 ? 49  ALA D HA   1 
ATOM 1736  H HB1  . ALA B 2 28  ? 179.210 214.245 179.277 1.00 391.01 ? 49  ALA D HB1  1 
ATOM 1737  H HB2  . ALA B 2 28  ? 179.482 214.560 180.811 1.00 391.01 ? 49  ALA D HB2  1 
ATOM 1738  H HB3  . ALA B 2 28  ? 177.999 214.300 180.304 1.00 391.01 ? 49  ALA D HB3  1 
ATOM 1739  N N    . GLU B 2 29  ? 176.538 216.753 178.786 1.00 339.50 ? 50  GLU D N    1 
ATOM 1740  C CA   . GLU B 2 29  ? 175.611 216.900 177.672 1.00 339.50 ? 50  GLU D CA   1 
ATOM 1741  C C    . GLU B 2 29  ? 175.930 218.158 176.875 1.00 339.50 ? 50  GLU D C    1 
ATOM 1742  O O    . GLU B 2 29  ? 176.304 219.193 177.435 1.00 339.50 ? 50  GLU D O    1 
ATOM 1743  C CB   . GLU B 2 29  ? 174.168 216.950 178.177 1.00 339.50 ? 50  GLU D CB   1 
ATOM 1744  C CG   . GLU B 2 29  ? 173.703 215.684 178.882 1.00 339.50 ? 50  GLU D CG   1 
ATOM 1745  C CD   . GLU B 2 29  ? 173.584 214.508 177.952 1.00 339.50 ? 50  GLU D CD   1 
ATOM 1746  O OE1  . GLU B 2 29  ? 173.475 214.719 176.768 1.00 339.50 ? 50  GLU D OE1  1 
ATOM 1747  O OE2  . GLU B 2 29  ? 173.602 213.397 178.427 1.00 339.50 ? 50  GLU D OE2  1 
ATOM 1748  H H    . GLU B 2 29  ? 176.196 216.927 179.555 1.00 407.40 ? 50  GLU D H    1 
ATOM 1749  H HA   . GLU B 2 29  ? 175.701 216.137 177.080 1.00 407.40 ? 50  GLU D HA   1 
ATOM 1750  H HB2  . GLU B 2 29  ? 174.055 217.781 178.874 1.00 407.40 ? 50  GLU D HB2  1 
ATOM 1751  H HB3  . GLU B 2 29  ? 173.495 217.132 177.339 1.00 407.40 ? 50  GLU D HB3  1 
ATOM 1752  H HG2  . GLU B 2 29  ? 174.414 215.438 179.670 1.00 407.40 ? 50  GLU D HG2  1 
ATOM 1753  H HG3  . GLU B 2 29  ? 172.737 215.873 179.347 1.00 407.40 ? 50  GLU D HG3  1 
ATOM 1754  N N    . SER B 2 30  ? 175.777 218.062 175.552 1.00 350.34 ? 51  SER D N    1 
ATOM 1755  C CA   . SER B 2 30  ? 175.980 219.227 174.697 1.00 350.34 ? 51  SER D CA   1 
ATOM 1756  C C    . SER B 2 30  ? 175.005 220.345 175.036 1.00 350.34 ? 51  SER D C    1 
ATOM 1757  O O    . SER B 2 30  ? 175.323 221.524 174.844 1.00 350.34 ? 51  SER D O    1 
ATOM 1758  C CB   . SER B 2 30  ? 175.825 218.836 173.240 1.00 350.34 ? 51  SER D CB   1 
ATOM 1759  O OG   . SER B 2 30  ? 174.499 218.487 172.952 1.00 350.34 ? 51  SER D OG   1 
ATOM 1760  H H    . SER B 2 30  ? 175.560 217.344 175.132 1.00 420.41 ? 51  SER D H    1 
ATOM 1761  H HA   . SER B 2 30  ? 176.879 219.564 174.831 1.00 420.41 ? 51  SER D HA   1 
ATOM 1762  H HB2  . SER B 2 30  ? 176.131 219.668 172.606 1.00 420.41 ? 51  SER D HB2  1 
ATOM 1763  H HB3  . SER B 2 30  ? 176.482 217.996 173.017 1.00 420.41 ? 51  SER D HB3  1 
ATOM 1764  H HG   . SER B 2 30  ? 174.526 218.013 172.118 1.00 420.41 ? 51  SER D HG   1 
ATOM 1765  N N    . ASN B 2 31  ? 173.817 219.998 175.538 1.00 338.66 ? 52  ASN D N    1 
ATOM 1766  C CA   . ASN B 2 31  ? 172.823 221.005 175.897 1.00 338.66 ? 52  ASN D CA   1 
ATOM 1767  C C    . ASN B 2 31  ? 173.288 221.833 177.088 1.00 338.66 ? 52  ASN D C    1 
ATOM 1768  O O    . ASN B 2 31  ? 173.375 223.068 177.008 1.00 338.66 ? 52  ASN D O    1 
ATOM 1769  C CB   . ASN B 2 31  ? 171.483 220.356 176.189 1.00 338.66 ? 52  ASN D CB   1 
ATOM 1770  C CG   . ASN B 2 31  ? 170.798 219.860 174.946 1.00 338.66 ? 52  ASN D CG   1 
ATOM 1771  O OD1  . ASN B 2 31  ? 171.132 220.276 173.830 1.00 338.66 ? 52  ASN D OD1  1 
ATOM 1772  N ND2  . ASN B 2 31  ? 169.846 218.978 175.116 1.00 338.66 ? 52  ASN D ND2  1 
ATOM 1773  H H    . ASN B 2 31  ? 173.565 219.188 175.680 1.00 406.39 ? 52  ASN D H    1 
ATOM 1774  H HA   . ASN B 2 31  ? 172.692 221.604 175.146 1.00 406.39 ? 52  ASN D HA   1 
ATOM 1775  H HB2  . ASN B 2 31  ? 171.626 219.516 176.871 1.00 406.39 ? 52  ASN D HB2  1 
ATOM 1776  H HB3  . ASN B 2 31  ? 170.831 221.074 176.687 1.00 406.39 ? 52  ASN D HB3  1 
ATOM 1777  H HD21 . ASN B 2 31  ? 169.355 218.613 174.324 1.00 406.39 ? 52  ASN D HD21 1 
ATOM 1778  H HD22 . ASN B 2 31  ? 169.609 218.670 176.036 1.00 406.39 ? 52  ASN D HD22 1 
ATOM 1779  N N    . CYS B 2 32  ? 173.575 221.166 178.210 1.00 334.62 ? 53  CYS D N    1 
ATOM 1780  C CA   . CYS B 2 32  ? 174.036 221.872 179.401 1.00 334.62 ? 53  CYS D CA   1 
ATOM 1781  C C    . CYS B 2 32  ? 175.389 222.528 179.167 1.00 334.62 ? 53  CYS D C    1 
ATOM 1782  O O    . CYS B 2 32  ? 175.613 223.659 179.602 1.00 334.62 ? 53  CYS D O    1 
ATOM 1783  C CB   . CYS B 2 32  ? 174.140 220.915 180.589 1.00 334.62 ? 53  CYS D CB   1 
ATOM 1784  S SG   . CYS B 2 32  ? 172.543 220.371 181.241 1.00 334.62 ? 53  CYS D SG   1 
ATOM 1785  H H    . CYS B 2 32  ? 173.512 220.314 178.305 1.00 401.54 ? 53  CYS D H    1 
ATOM 1786  H HA   . CYS B 2 32  ? 173.398 222.570 179.607 1.00 401.54 ? 53  CYS D HA   1 
ATOM 1787  H HB2  . CYS B 2 32  ? 174.703 220.029 180.293 1.00 401.54 ? 53  CYS D HB2  1 
ATOM 1788  H HB3  . CYS B 2 32  ? 174.688 221.397 181.398 1.00 401.54 ? 53  CYS D HB3  1 
ATOM 1789  N N    . SER B 2 33  ? 176.288 221.854 178.449 1.00 335.41 ? 54  SER D N    1 
ATOM 1790  C CA   . SER B 2 33  ? 177.616 222.410 178.201 1.00 335.41 ? 54  SER D CA   1 
ATOM 1791  C C    . SER B 2 33  ? 177.533 223.730 177.440 1.00 335.41 ? 54  SER D C    1 
ATOM 1792  O O    . SER B 2 33  ? 178.112 224.747 177.856 1.00 335.41 ? 54  SER D O    1 
ATOM 1793  C CB   . SER B 2 33  ? 178.458 221.419 177.421 1.00 335.41 ? 54  SER D CB   1 
ATOM 1794  O OG   . SER B 2 33  ? 179.748 221.920 177.201 1.00 335.41 ? 54  SER D OG   1 
ATOM 1795  H H    . SER B 2 33  ? 176.154 221.081 178.097 1.00 402.49 ? 54  SER D H    1 
ATOM 1796  H HA   . SER B 2 33  ? 178.054 222.578 179.051 1.00 402.49 ? 54  SER D HA   1 
ATOM 1797  H HB2  . SER B 2 33  ? 178.519 220.480 177.971 1.00 402.49 ? 54  SER D HB2  1 
ATOM 1798  H HB3  . SER B 2 33  ? 177.980 221.208 176.466 1.00 402.49 ? 54  SER D HB3  1 
ATOM 1799  H HG   . SER B 2 33  ? 180.343 221.173 177.302 1.00 402.49 ? 54  SER D HG   1 
ATOM 1800  N N    . SER B 2 34  ? 176.821 223.728 176.308 1.00 337.85 ? 55  SER D N    1 
ATOM 1801  C CA   . SER B 2 34  ? 176.713 224.930 175.489 1.00 337.85 ? 55  SER D CA   1 
ATOM 1802  C C    . SER B 2 34  ? 175.926 226.019 176.202 1.00 337.85 ? 55  SER D C    1 
ATOM 1803  O O    . SER B 2 34  ? 176.320 227.190 176.179 1.00 337.85 ? 55  SER D O    1 
ATOM 1804  C CB   . SER B 2 34  ? 176.050 224.601 174.165 1.00 337.85 ? 55  SER D CB   1 
ATOM 1805  O OG   . SER B 2 34  ? 176.877 223.788 173.378 1.00 337.85 ? 55  SER D OG   1 
ATOM 1806  H H    . SER B 2 34  ? 176.395 223.049 176.000 1.00 405.42 ? 55  SER D H    1 
ATOM 1807  H HA   . SER B 2 34  ? 177.601 225.276 175.315 1.00 405.42 ? 55  SER D HA   1 
ATOM 1808  H HB2  . SER B 2 34  ? 175.104 224.092 174.349 1.00 405.42 ? 55  SER D HB2  1 
ATOM 1809  H HB3  . SER B 2 34  ? 175.828 225.523 173.631 1.00 405.42 ? 55  SER D HB3  1 
ATOM 1810  H HG   . SER B 2 34  ? 176.300 223.365 172.738 1.00 405.42 ? 55  SER D HG   1 
ATOM 1811  N N    . ARG B 2 35  ? 174.827 225.657 176.865 1.00 322.16 ? 56  ARG D N    1 
ATOM 1812  C CA   . ARG B 2 35  ? 173.979 226.680 177.463 1.00 322.16 ? 56  ARG D CA   1 
ATOM 1813  C C    . ARG B 2 35  ? 174.561 227.204 178.774 1.00 322.16 ? 56  ARG D C    1 
ATOM 1814  O O    . ARG B 2 35  ? 174.356 228.376 179.114 1.00 322.16 ? 56  ARG D O    1 
ATOM 1815  C CB   . ARG B 2 35  ? 172.584 226.128 177.718 1.00 322.16 ? 56  ARG D CB   1 
ATOM 1816  C CG   . ARG B 2 35  ? 171.822 225.715 176.469 1.00 322.16 ? 56  ARG D CG   1 
ATOM 1817  C CD   . ARG B 2 35  ? 171.590 226.867 175.561 1.00 322.16 ? 56  ARG D CD   1 
ATOM 1818  N NE   . ARG B 2 35  ? 170.765 226.502 174.421 1.00 322.16 ? 56  ARG D NE   1 
ATOM 1819  C CZ   . ARG B 2 35  ? 170.521 227.303 173.365 1.00 322.16 ? 56  ARG D CZ   1 
ATOM 1820  N NH1  . ARG B 2 35  ? 171.045 228.508 173.319 1.00 322.16 ? 56  ARG D NH1  1 
ATOM 1821  N NH2  . ARG B 2 35  ? 169.755 226.877 172.376 1.00 322.16 ? 56  ARG D NH2  1 
ATOM 1822  H H    . ARG B 2 35  ? 174.558 224.848 176.979 1.00 386.59 ? 56  ARG D H    1 
ATOM 1823  H HA   . ARG B 2 35  ? 173.929 227.436 176.862 1.00 386.59 ? 56  ARG D HA   1 
ATOM 1824  H HB2  . ARG B 2 35  ? 172.651 225.255 178.366 1.00 386.59 ? 56  ARG D HB2  1 
ATOM 1825  H HB3  . ARG B 2 35  ? 171.986 226.876 178.237 1.00 386.59 ? 56  ARG D HB3  1 
ATOM 1826  H HG2  . ARG B 2 35  ? 172.392 224.961 175.927 1.00 386.59 ? 56  ARG D HG2  1 
ATOM 1827  H HG3  . ARG B 2 35  ? 170.853 225.303 176.754 1.00 386.59 ? 56  ARG D HG3  1 
ATOM 1828  H HD2  . ARG B 2 35  ? 171.085 227.664 176.106 1.00 386.59 ? 56  ARG D HD2  1 
ATOM 1829  H HD3  . ARG B 2 35  ? 172.546 227.233 175.187 1.00 386.59 ? 56  ARG D HD3  1 
ATOM 1830  H HE   . ARG B 2 35  ? 170.344 225.582 174.420 1.00 386.59 ? 56  ARG D HE   1 
ATOM 1831  H HH11 . ARG B 2 35  ? 171.630 228.833 174.075 1.00 386.59 ? 56  ARG D HH11 1 
ATOM 1832  H HH12 . ARG B 2 35  ? 170.862 229.108 172.528 1.00 386.59 ? 56  ARG D HH12 1 
ATOM 1833  H HH21 . ARG B 2 35  ? 169.352 225.951 172.411 1.00 386.59 ? 56  ARG D HH21 1 
ATOM 1834  H HH22 . ARG B 2 35  ? 169.573 227.477 171.585 1.00 386.59 ? 56  ARG D HH22 1 
ATOM 1835  N N    . TYR B 2 36  ? 175.332 226.382 179.492 1.00 317.21 ? 57  TYR D N    1 
ATOM 1836  C CA   . TYR B 2 36  ? 176.094 226.872 180.633 1.00 317.21 ? 57  TYR D CA   1 
ATOM 1837  C C    . TYR B 2 36  ? 177.022 228.002 180.213 1.00 317.21 ? 57  TYR D C    1 
ATOM 1838  O O    . TYR B 2 36  ? 177.036 229.075 180.827 1.00 317.21 ? 57  TYR D O    1 
ATOM 1839  C CB   . TYR B 2 36  ? 176.894 225.736 181.275 1.00 317.21 ? 57  TYR D CB   1 
ATOM 1840  C CG   . TYR B 2 36  ? 177.771 226.181 182.425 1.00 317.21 ? 57  TYR D CG   1 
ATOM 1841  C CD1  . TYR B 2 36  ? 179.017 226.736 182.172 1.00 317.21 ? 57  TYR D CD1  1 
ATOM 1842  C CD2  . TYR B 2 36  ? 177.329 226.034 183.731 1.00 317.21 ? 57  TYR D CD2  1 
ATOM 1843  C CE1  . TYR B 2 36  ? 179.817 227.142 183.221 1.00 317.21 ? 57  TYR D CE1  1 
ATOM 1844  C CE2  . TYR B 2 36  ? 178.130 226.440 184.781 1.00 317.21 ? 57  TYR D CE2  1 
ATOM 1845  C CZ   . TYR B 2 36  ? 179.378 226.996 184.521 1.00 317.21 ? 57  TYR D CZ   1 
ATOM 1846  O OH   . TYR B 2 36  ? 180.176 227.401 185.567 1.00 317.21 ? 57  TYR D OH   1 
ATOM 1847  H H    . TYR B 2 36  ? 175.428 225.542 179.338 1.00 380.65 ? 57  TYR D H    1 
ATOM 1848  H HA   . TYR B 2 36  ? 175.485 227.210 181.306 1.00 380.65 ? 57  TYR D HA   1 
ATOM 1849  H HB2  . TYR B 2 36  ? 176.208 224.972 181.646 1.00 380.65 ? 57  TYR D HB2  1 
ATOM 1850  H HB3  . TYR B 2 36  ? 177.529 225.268 180.524 1.00 380.65 ? 57  TYR D HB3  1 
ATOM 1851  H HD1  . TYR B 2 36  ? 179.363 226.852 181.145 1.00 380.65 ? 57  TYR D HD1  1 
ATOM 1852  H HD2  . TYR B 2 36  ? 176.350 225.598 183.930 1.00 380.65 ? 57  TYR D HD2  1 
ATOM 1853  H HE1  . TYR B 2 36  ? 180.796 227.579 183.023 1.00 380.65 ? 57  TYR D HE1  1 
ATOM 1854  H HE2  . TYR B 2 36  ? 177.784 226.325 185.808 1.00 380.65 ? 57  TYR D HE2  1 
ATOM 1855  H HH   . TYR B 2 36  ? 179.724 227.233 186.397 1.00 380.65 ? 57  TYR D HH   1 
ATOM 1856  N N    . ARG B 2 37  ? 177.807 227.773 179.156 1.00 336.71 ? 58  ARG D N    1 
ATOM 1857  C CA   . ARG B 2 37  ? 178.719 228.814 178.686 1.00 336.71 ? 58  ARG D CA   1 
ATOM 1858  C C    . ARG B 2 37  ? 177.951 230.053 178.238 1.00 336.71 ? 58  ARG D C    1 
ATOM 1859  O O    . ARG B 2 37  ? 178.410 231.186 178.433 1.00 336.71 ? 58  ARG D O    1 
ATOM 1860  C CB   . ARG B 2 37  ? 179.587 228.278 177.549 1.00 336.71 ? 58  ARG D CB   1 
ATOM 1861  C CG   . ARG B 2 37  ? 180.601 227.233 177.988 1.00 336.71 ? 58  ARG D CG   1 
ATOM 1862  C CD   . ARG B 2 37  ? 181.598 226.927 176.882 1.00 336.71 ? 58  ARG D CD   1 
ATOM 1863  N NE   . ARG B 2 37  ? 180.953 226.380 175.687 1.00 336.71 ? 58  ARG D NE   1 
ATOM 1864  C CZ   . ARG B 2 37  ? 180.593 225.108 175.520 1.00 336.71 ? 58  ARG D CZ   1 
ATOM 1865  N NH1  . ARG B 2 37  ? 180.792 224.198 176.469 1.00 336.71 ? 58  ARG D NH1  1 
ATOM 1866  N NH2  . ARG B 2 37  ? 180.019 224.736 174.384 1.00 336.71 ? 58  ARG D NH2  1 
ATOM 1867  H H    . ARG B 2 37  ? 177.830 227.042 178.705 1.00 404.05 ? 58  ARG D H    1 
ATOM 1868  H HA   . ARG B 2 37  ? 179.305 229.072 179.416 1.00 404.05 ? 58  ARG D HA   1 
ATOM 1869  H HB2  . ARG B 2 37  ? 179.012 227.871 176.882 1.00 404.05 ? 58  ARG D HB2  1 
ATOM 1870  H HB3  . ARG B 2 37  ? 180.075 229.018 177.155 1.00 404.05 ? 58  ARG D HB3  1 
ATOM 1871  H HG2  . ARG B 2 37  ? 181.092 227.566 178.756 1.00 404.05 ? 58  ARG D HG2  1 
ATOM 1872  H HG3  . ARG B 2 37  ? 180.138 226.412 178.216 1.00 404.05 ? 58  ARG D HG3  1 
ATOM 1873  H HD2  . ARG B 2 37  ? 182.036 227.754 176.624 1.00 404.05 ? 58  ARG D HD2  1 
ATOM 1874  H HD3  . ARG B 2 37  ? 182.262 226.300 177.206 1.00 404.05 ? 58  ARG D HD3  1 
ATOM 1875  H HE   . ARG B 2 37  ? 180.655 226.947 175.113 1.00 404.05 ? 58  ARG D HE   1 
ATOM 1876  H HH11 . ARG B 2 37  ? 181.161 224.404 177.216 1.00 404.05 ? 58  ARG D HH11 1 
ATOM 1877  H HH12 . ARG B 2 37  ? 180.547 223.387 176.330 1.00 404.05 ? 58  ARG D HH12 1 
ATOM 1878  H HH21 . ARG B 2 37  ? 179.881 225.315 173.763 1.00 404.05 ? 58  ARG D HH21 1 
ATOM 1879  H HH22 . ARG B 2 37  ? 179.780 223.919 174.270 1.00 404.05 ? 58  ARG D HH22 1 
ATOM 1880  N N    . THR B 2 38  ? 176.770 229.853 177.647 1.00 331.45 ? 59  THR D N    1 
ATOM 1881  C CA   . THR B 2 38  ? 175.959 230.973 177.178 1.00 331.45 ? 59  THR D CA   1 
ATOM 1882  C C    . THR B 2 38  ? 175.615 231.918 178.324 1.00 331.45 ? 59  THR D C    1 
ATOM 1883  O O    . THR B 2 38  ? 175.784 233.137 178.212 1.00 331.45 ? 59  THR D O    1 
ATOM 1884  C CB   . THR B 2 38  ? 174.664 230.480 176.507 1.00 331.45 ? 59  THR D CB   1 
ATOM 1885  O OG1  . THR B 2 38  ? 174.991 229.691 175.355 1.00 331.45 ? 59  THR D OG1  1 
ATOM 1886  C CG2  . THR B 2 38  ? 173.801 231.658 176.082 1.00 331.45 ? 59  THR D CG2  1 
ATOM 1887  H H    . THR B 2 38  ? 176.420 229.081 177.505 1.00 397.74 ? 59  THR D H    1 
ATOM 1888  H HA   . THR B 2 38  ? 176.462 231.474 176.517 1.00 397.74 ? 59  THR D HA   1 
ATOM 1889  H HB   . THR B 2 38  ? 174.105 229.861 177.207 1.00 397.74 ? 59  THR D HB   1 
ATOM 1890  H HG1  . THR B 2 38  ? 175.511 228.931 175.625 1.00 397.74 ? 59  THR D HG1  1 
ATOM 1891  H HG21 . THR B 2 38  ? 172.890 231.290 175.610 1.00 397.74 ? 59  THR D HG21 1 
ATOM 1892  H HG22 . THR B 2 38  ? 173.542 232.253 176.957 1.00 397.74 ? 59  THR D HG22 1 
ATOM 1893  H HG23 . THR B 2 38  ? 174.352 232.276 175.374 1.00 397.74 ? 59  THR D HG23 1 
ATOM 1894  N N    . LEU B 2 39  ? 175.122 231.372 179.439 1.00 322.22 ? 60  LEU D N    1 
ATOM 1895  C CA   . LEU B 2 39  ? 174.808 232.218 180.587 1.00 322.22 ? 60  LEU D CA   1 
ATOM 1896  C C    . LEU B 2 39  ? 176.054 232.895 181.139 1.00 322.22 ? 60  LEU D C    1 
ATOM 1897  O O    . LEU B 2 39  ? 175.981 234.037 181.608 1.00 322.22 ? 60  LEU D O    1 
ATOM 1898  C CB   . LEU B 2 39  ? 174.144 231.386 181.692 1.00 322.22 ? 60  LEU D CB   1 
ATOM 1899  C CG   . LEU B 2 39  ? 172.733 230.872 181.379 1.00 322.22 ? 60  LEU D CG   1 
ATOM 1900  C CD1  . LEU B 2 39  ? 172.253 229.981 182.518 1.00 322.22 ? 60  LEU D CD1  1 
ATOM 1901  C CD2  . LEU B 2 39  ? 171.795 232.052 181.177 1.00 322.22 ? 60  LEU D CD2  1 
ATOM 1902  H H    . LEU B 2 39  ? 174.963 230.534 179.553 1.00 386.66 ? 60  LEU D H    1 
ATOM 1903  H HA   . LEU B 2 39  ? 174.205 232.920 180.301 1.00 386.66 ? 60  LEU D HA   1 
ATOM 1904  H HB2  . LEU B 2 39  ? 174.772 230.523 181.902 1.00 386.66 ? 60  LEU D HB2  1 
ATOM 1905  H HB3  . LEU B 2 39  ? 174.083 231.994 182.595 1.00 386.66 ? 60  LEU D HB3  1 
ATOM 1906  H HG   . LEU B 2 39  ? 172.758 230.268 180.472 1.00 386.66 ? 60  LEU D HG   1 
ATOM 1907  H HD11 . LEU B 2 39  ? 171.250 229.615 182.296 1.00 386.66 ? 60  LEU D HD11 1 
ATOM 1908  H HD12 . LEU B 2 39  ? 172.931 229.135 182.628 1.00 386.66 ? 60  LEU D HD12 1 
ATOM 1909  H HD13 . LEU B 2 39  ? 172.233 230.554 183.444 1.00 386.66 ? 60  LEU D HD13 1 
ATOM 1910  H HD21 . LEU B 2 39  ? 170.792 231.687 180.954 1.00 386.66 ? 60  LEU D HD21 1 
ATOM 1911  H HD22 . LEU B 2 39  ? 171.768 232.656 182.084 1.00 386.66 ? 60  LEU D HD22 1 
ATOM 1912  H HD23 . LEU B 2 39  ? 172.151 232.662 180.346 1.00 386.66 ? 60  LEU D HD23 1 
ATOM 1913  N N    . ARG B 2 40  ? 177.202 232.214 181.102 1.00 327.78 ? 61  ARG D N    1 
ATOM 1914  C CA   . ARG B 2 40  ? 178.438 232.854 181.535 1.00 327.78 ? 61  ARG D CA   1 
ATOM 1915  C C    . ARG B 2 40  ? 178.677 234.144 180.762 1.00 327.78 ? 61  ARG D C    1 
ATOM 1916  O O    . ARG B 2 40  ? 179.154 235.135 181.326 1.00 327.78 ? 61  ARG D O    1 
ATOM 1917  C CB   . ARG B 2 40  ? 179.624 231.920 181.342 1.00 327.78 ? 61  ARG D CB   1 
ATOM 1918  C CG   . ARG B 2 40  ? 180.952 232.460 181.849 1.00 327.78 ? 61  ARG D CG   1 
ATOM 1919  C CD   . ARG B 2 40  ? 182.039 231.456 181.720 1.00 327.78 ? 61  ARG D CD   1 
ATOM 1920  N NE   . ARG B 2 40  ? 182.332 231.150 180.329 1.00 327.78 ? 61  ARG D NE   1 
ATOM 1921  C CZ   . ARG B 2 40  ? 183.065 230.099 179.914 1.00 327.78 ? 61  ARG D CZ   1 
ATOM 1922  N NH1  . ARG B 2 40  ? 183.572 229.264 180.794 1.00 327.78 ? 61  ARG D NH1  1 
ATOM 1923  N NH2  . ARG B 2 40  ? 183.275 229.907 178.624 1.00 327.78 ? 61  ARG D NH2  1 
ATOM 1924  H H    . ARG B 2 40  ? 177.288 231.400 180.837 1.00 393.34 ? 61  ARG D H    1 
ATOM 1925  H HA   . ARG B 2 40  ? 178.366 233.078 182.477 1.00 393.34 ? 61  ARG D HA   1 
ATOM 1926  H HB2  . ARG B 2 40  ? 179.433 230.979 181.855 1.00 393.34 ? 61  ARG D HB2  1 
ATOM 1927  H HB3  . ARG B 2 40  ? 179.743 231.697 180.282 1.00 393.34 ? 61  ARG D HB3  1 
ATOM 1928  H HG2  . ARG B 2 40  ? 181.230 233.343 181.273 1.00 393.34 ? 61  ARG D HG2  1 
ATOM 1929  H HG3  . ARG B 2 40  ? 180.857 232.729 182.902 1.00 393.34 ? 61  ARG D HG3  1 
ATOM 1930  H HD2  . ARG B 2 40  ? 182.947 231.841 182.182 1.00 393.34 ? 61  ARG D HD2  1 
ATOM 1931  H HD3  . ARG B 2 40  ? 181.742 230.533 182.216 1.00 393.34 ? 61  ARG D HD3  1 
ATOM 1932  H HE   . ARG B 2 40  ? 181.958 231.771 179.622 1.00 393.34 ? 61  ARG D HE   1 
ATOM 1933  H HH11 . ARG B 2 40  ? 183.411 229.410 181.780 1.00 393.34 ? 61  ARG D HH11 1 
ATOM 1934  H HH12 . ARG B 2 40  ? 184.121 228.476 180.483 1.00 393.34 ? 61  ARG D HH12 1 
ATOM 1935  H HH21 . ARG B 2 40  ? 182.885 230.549 177.947 1.00 393.34 ? 61  ARG D HH21 1 
ATOM 1936  H HH22 . ARG B 2 40  ? 183.824 229.120 178.313 1.00 393.34 ? 61  ARG D HH22 1 
ATOM 1937  N N    . GLN B 2 41  ? 178.350 234.153 179.466 1.00 334.44 ? 62  GLN D N    1 
ATOM 1938  C CA   . GLN B 2 41  ? 178.398 235.405 178.715 1.00 334.44 ? 62  GLN D CA   1 
ATOM 1939  C C    . GLN B 2 41  ? 177.382 236.413 179.243 1.00 334.44 ? 62  GLN D C    1 
ATOM 1940  O O    . GLN B 2 41  ? 177.672 237.615 179.280 1.00 334.44 ? 62  GLN D O    1 
ATOM 1941  C CB   . GLN B 2 41  ? 178.148 235.144 177.228 1.00 334.44 ? 62  GLN D CB   1 
ATOM 1942  C CG   . GLN B 2 41  ? 178.300 236.372 176.346 1.00 334.44 ? 62  GLN D CG   1 
ATOM 1943  C CD   . GLN B 2 41  ? 179.717 236.914 176.349 1.00 334.44 ? 62  GLN D CD   1 
ATOM 1944  O OE1  . GLN B 2 41  ? 180.675 236.186 176.072 1.00 334.44 ? 62  GLN D OE1  1 
ATOM 1945  N NE2  . GLN B 2 41  ? 179.859 238.197 176.662 1.00 334.44 ? 62  GLN D NE2  1 
ATOM 1946  H H    . GLN B 2 41  ? 178.104 233.466 179.010 1.00 401.33 ? 62  GLN D H    1 
ATOM 1947  H HA   . GLN B 2 41  ? 179.280 235.795 178.817 1.00 401.33 ? 62  GLN D HA   1 
ATOM 1948  H HB2  . GLN B 2 41  ? 178.842 234.384 176.869 1.00 401.33 ? 62  GLN D HB2  1 
ATOM 1949  H HB3  . GLN B 2 41  ? 177.139 234.755 177.091 1.00 401.33 ? 62  GLN D HB3  1 
ATOM 1950  H HG2  . GLN B 2 41  ? 178.038 236.107 175.322 1.00 401.33 ? 62  GLN D HG2  1 
ATOM 1951  H HG3  . GLN B 2 41  ? 177.635 237.154 176.712 1.00 401.33 ? 62  GLN D HG3  1 
ATOM 1952  H HE21 . GLN B 2 41  ? 180.770 238.610 176.680 1.00 401.33 ? 62  GLN D HE21 1 
ATOM 1953  H HE22 . GLN B 2 41  ? 179.055 238.750 176.880 1.00 401.33 ? 62  GLN D HE22 1 
ATOM 1954  N N    . CYS B 2 42  ? 176.198 235.960 179.651 1.00 328.03 ? 63  CYS D N    1 
ATOM 1955  C CA   . CYS B 2 42  ? 175.223 236.860 180.267 1.00 328.03 ? 63  CYS D CA   1 
ATOM 1956  C C    . CYS B 2 42  ? 174.135 236.104 181.027 1.00 328.03 ? 63  CYS D C    1 
ATOM 1957  O O    . CYS B 2 42  ? 173.258 236.712 181.641 1.00 328.03 ? 63  CYS D O    1 
ATOM 1958  C CB   . CYS B 2 42  ? 174.595 237.790 179.215 1.00 328.03 ? 63  CYS D CB   1 
ATOM 1959  S SG   . CYS B 2 42  ? 173.527 237.119 177.871 1.00 328.03 ? 63  CYS D SG   1 
ATOM 1960  H H    . CYS B 2 42  ? 175.936 235.144 179.582 1.00 393.64 ? 63  CYS D H    1 
ATOM 1961  H HA   . CYS B 2 42  ? 175.686 237.419 180.910 1.00 393.64 ? 63  CYS D HA   1 
ATOM 1962  H HB2  . CYS B 2 42  ? 174.053 238.438 179.692 1.00 393.64 ? 63  CYS D HB2  1 
ATOM 1963  H HB3  . CYS B 2 42  ? 175.320 238.260 178.775 1.00 393.64 ? 63  CYS D HB3  1 
ATOM 1964  N N    . LEU B 2 52  ? 170.455 238.127 169.791 1.00 273.59 ? 73  LEU D N    1 
ATOM 1965  C CA   . LEU B 2 52  ? 171.444 238.708 170.690 1.00 273.59 ? 73  LEU D CA   1 
ATOM 1966  C C    . LEU B 2 52  ? 171.766 237.739 171.824 1.00 273.59 ? 73  LEU D C    1 
ATOM 1967  O O    . LEU B 2 52  ? 171.072 236.739 172.016 1.00 273.59 ? 73  LEU D O    1 
ATOM 1968  C CB   . LEU B 2 52  ? 170.930 240.034 171.265 1.00 273.59 ? 73  LEU D CB   1 
ATOM 1969  C CG   . LEU B 2 52  ? 170.579 241.114 170.234 1.00 273.59 ? 73  LEU D CG   1 
ATOM 1970  C CD1  . LEU B 2 52  ? 169.985 242.322 170.945 1.00 273.59 ? 73  LEU D CD1  1 
ATOM 1971  C CD2  . LEU B 2 52  ? 171.829 241.498 169.455 1.00 273.59 ? 73  LEU D CD2  1 
ATOM 1972  H H    . LEU B 2 52  ? 169.577 238.585 169.650 1.00 328.31 ? 73  LEU D H    1 
ATOM 1973  H HA   . LEU B 2 52  ? 172.264 238.867 170.199 1.00 328.31 ? 73  LEU D HA   1 
ATOM 1974  H HB2  . LEU B 2 52  ? 170.035 239.834 171.853 1.00 328.31 ? 73  LEU D HB2  1 
ATOM 1975  H HB3  . LEU B 2 52  ? 171.691 240.444 171.928 1.00 328.31 ? 73  LEU D HB3  1 
ATOM 1976  H HG   . LEU B 2 52  ? 169.826 240.729 169.545 1.00 328.31 ? 73  LEU D HG   1 
ATOM 1977  H HD11 . LEU B 2 52  ? 169.735 243.090 170.213 1.00 328.31 ? 73  LEU D HD11 1 
ATOM 1978  H HD12 . LEU B 2 52  ? 169.082 242.023 171.478 1.00 328.31 ? 73  LEU D HD12 1 
ATOM 1979  H HD13 . LEU B 2 52  ? 170.710 242.720 171.654 1.00 328.31 ? 73  LEU D HD13 1 
ATOM 1980  H HD21 . LEU B 2 52  ? 171.579 242.265 168.722 1.00 328.31 ? 73  LEU D HD21 1 
ATOM 1981  H HD22 . LEU B 2 52  ? 172.581 241.884 170.143 1.00 328.31 ? 73  LEU D HD22 1 
ATOM 1982  H HD23 . LEU B 2 52  ? 172.222 240.620 168.943 1.00 328.31 ? 73  LEU D HD23 1 
ATOM 1983  N N    . ALA B 2 53  ? 172.827 238.040 172.577 1.00 297.54 ? 74  ALA D N    1 
ATOM 1984  C CA   . ALA B 2 53  ? 173.212 237.184 173.694 1.00 297.54 ? 74  ALA D CA   1 
ATOM 1985  C C    . ALA B 2 53  ? 172.080 237.051 174.705 1.00 297.54 ? 74  ALA D C    1 
ATOM 1986  O O    . ALA B 2 53  ? 171.866 235.969 175.265 1.00 297.54 ? 74  ALA D O    1 
ATOM 1987  C CB   . ALA B 2 53  ? 174.469 237.736 174.366 1.00 297.54 ? 74  ALA D CB   1 
ATOM 1988  H H    . ALA B 2 53  ? 173.334 238.726 172.459 1.00 357.05 ? 74  ALA D H    1 
ATOM 1989  H HA   . ALA B 2 53  ? 173.417 236.298 173.356 1.00 357.05 ? 74  ALA D HA   1 
ATOM 1990  H HB1  . ALA B 2 53  ? 174.708 237.161 175.108 1.00 357.05 ? 74  ALA D HB1  1 
ATOM 1991  H HB2  . ALA B 2 53  ? 175.189 237.757 173.717 1.00 357.05 ? 74  ALA D HB2  1 
ATOM 1992  H HB3  . ALA B 2 53  ? 174.286 238.634 174.687 1.00 357.05 ? 74  ALA D HB3  1 
ATOM 1993  N N    . ASN B 2 54  ? 171.352 238.143 174.962 1.00 290.37 ? 75  ASN D N    1 
ATOM 1994  C CA   . ASN B 2 54  ? 170.267 238.103 175.938 1.00 290.37 ? 75  ASN D CA   1 
ATOM 1995  C C    . ASN B 2 54  ? 169.195 237.096 175.540 1.00 290.37 ? 75  ASN D C    1 
ATOM 1996  O O    . ASN B 2 54  ? 168.610 236.436 176.407 1.00 290.37 ? 75  ASN D O    1 
ATOM 1997  C CB   . ASN B 2 54  ? 169.660 239.482 176.117 1.00 290.37 ? 75  ASN D CB   1 
ATOM 1998  C CG   . ASN B 2 54  ? 170.558 240.414 176.883 1.00 290.37 ? 75  ASN D CG   1 
ATOM 1999  O OD1  . ASN B 2 54  ? 171.454 239.972 177.612 1.00 290.37 ? 75  ASN D OD1  1 
ATOM 2000  N ND2  . ASN B 2 54  ? 170.336 241.694 176.732 1.00 290.37 ? 75  ASN D ND2  1 
ATOM 2001  H H    . ASN B 2 54  ? 171.468 238.909 174.588 1.00 348.44 ? 75  ASN D H    1 
ATOM 2002  H HA   . ASN B 2 54  ? 170.623 237.833 176.797 1.00 348.44 ? 75  ASN D HA   1 
ATOM 2003  H HB2  . ASN B 2 54  ? 169.453 239.918 175.139 1.00 348.44 ? 75  ASN D HB2  1 
ATOM 2004  H HB3  . ASN B 2 54  ? 168.710 239.396 176.644 1.00 348.44 ? 75  ASN D HB3  1 
ATOM 2005  H HD21 . ASN B 2 54  ? 170.902 242.361 177.217 1.00 348.44 ? 75  ASN D HD21 1 
ATOM 2006  H HD22 . ASN B 2 54  ? 169.600 242.007 176.132 1.00 348.44 ? 75  ASN D HD22 1 
ATOM 2007  N N    . LYS B 2 55  ? 168.927 236.968 174.238 1.00 283.21 ? 76  LYS D N    1 
ATOM 2008  C CA   . LYS B 2 55  ? 167.975 235.972 173.757 1.00 283.21 ? 76  LYS D CA   1 
ATOM 2009  C C    . LYS B 2 55  ? 168.477 234.559 174.027 1.00 283.21 ? 76  LYS D C    1 
ATOM 2010  O O    . LYS B 2 55  ? 167.741 233.717 174.558 1.00 283.21 ? 76  LYS D O    1 
ATOM 2011  C CB   . LYS B 2 55  ? 167.711 236.161 172.262 1.00 283.21 ? 76  LYS D CB   1 
ATOM 2012  C CG   . LYS B 2 55  ? 166.713 235.174 171.670 1.00 283.21 ? 76  LYS D CG   1 
ATOM 2013  C CD   . LYS B 2 55  ? 166.464 235.457 170.197 1.00 283.21 ? 76  LYS D CD   1 
ATOM 2014  C CE   . LYS B 2 55  ? 165.509 234.439 169.590 1.00 283.21 ? 76  LYS D CE   1 
ATOM 2015  N NZ   . LYS B 2 55  ? 165.267 234.695 168.145 1.00 283.21 ? 76  LYS D NZ   1 
ATOM 2016  H H    . LYS B 2 55  ? 169.283 237.446 173.618 1.00 339.85 ? 76  LYS D H    1 
ATOM 2017  H HA   . LYS B 2 55  ? 167.130 236.088 174.219 1.00 339.85 ? 76  LYS D HA   1 
ATOM 2018  H HB2  . LYS B 2 55  ? 167.331 237.167 172.084 1.00 339.85 ? 76  LYS D HB2  1 
ATOM 2019  H HB3  . LYS B 2 55  ? 168.646 236.061 171.712 1.00 339.85 ? 76  LYS D HB3  1 
ATOM 2020  H HG2  . LYS B 2 55  ? 167.098 234.159 171.777 1.00 339.85 ? 76  LYS D HG2  1 
ATOM 2021  H HG3  . LYS B 2 55  ? 165.769 235.243 172.210 1.00 339.85 ? 76  LYS D HG3  1 
ATOM 2022  H HD2  . LYS B 2 55  ? 166.037 236.455 170.085 1.00 339.85 ? 76  LYS D HD2  1 
ATOM 2023  H HD3  . LYS B 2 55  ? 167.408 235.422 169.654 1.00 339.85 ? 76  LYS D HD3  1 
ATOM 2024  H HE2  . LYS B 2 55  ? 165.924 233.439 169.705 1.00 339.85 ? 76  LYS D HE2  1 
ATOM 2025  H HE3  . LYS B 2 55  ? 164.556 234.475 170.117 1.00 339.85 ? 76  LYS D HE3  1 
ATOM 2026  H HZ1  . LYS B 2 55  ? 164.630 234.000 167.781 1.00 339.85 ? 76  LYS D HZ1  1 
ATOM 2027  H HZ2  . LYS B 2 55  ? 164.864 235.615 168.028 1.00 339.85 ? 76  LYS D HZ2  1 
ATOM 2028  H HZ3  . LYS B 2 55  ? 166.142 234.645 167.642 1.00 339.85 ? 76  LYS D HZ3  1 
ATOM 2029  N N    . GLU B 2 56  ? 169.738 234.288 173.683 1.00 296.19 ? 77  GLU D N    1 
ATOM 2030  C CA   . GLU B 2 56  ? 170.295 232.959 173.907 1.00 296.19 ? 77  GLU D CA   1 
ATOM 2031  C C    . GLU B 2 56  ? 170.466 232.673 175.392 1.00 296.19 ? 77  GLU D C    1 
ATOM 2032  O O    . GLU B 2 56  ? 170.247 231.544 175.833 1.00 296.19 ? 77  GLU D O    1 
ATOM 2033  C CB   . GLU B 2 56  ? 171.641 232.819 173.193 1.00 296.19 ? 77  GLU D CB   1 
ATOM 2034  C CG   . GLU B 2 56  ? 171.558 232.888 171.675 1.00 296.19 ? 77  GLU D CG   1 
ATOM 2035  C CD   . GLU B 2 56  ? 170.632 231.857 171.092 1.00 296.19 ? 77  GLU D CD   1 
ATOM 2036  O OE1  . GLU B 2 56  ? 170.765 230.706 171.432 1.00 296.19 ? 77  GLU D OE1  1 
ATOM 2037  O OE2  . GLU B 2 56  ? 169.789 232.221 170.306 1.00 296.19 ? 77  GLU D OE2  1 
ATOM 2038  H H    . GLU B 2 56  ? 170.282 234.848 173.323 1.00 355.43 ? 77  GLU D H    1 
ATOM 2039  H HA   . GLU B 2 56  ? 169.678 232.300 173.553 1.00 355.43 ? 77  GLU D HA   1 
ATOM 2040  H HB2  . GLU B 2 56  ? 172.314 233.609 173.527 1.00 355.43 ? 77  GLU D HB2  1 
ATOM 2041  H HB3  . GLU B 2 56  ? 172.097 231.866 173.460 1.00 355.43 ? 77  GLU D HB3  1 
ATOM 2042  H HG2  . GLU B 2 56  ? 171.208 233.878 171.385 1.00 355.43 ? 77  GLU D HG2  1 
ATOM 2043  H HG3  . GLU B 2 56  ? 172.555 232.749 171.260 1.00 355.43 ? 77  GLU D HG3  1 
ATOM 2044  N N    . CYS B 2 57  ? 170.829 233.681 176.190 1.00 313.71 ? 78  CYS D N    1 
ATOM 2045  C CA   . CYS B 2 57  ? 170.947 233.465 177.631 1.00 313.71 ? 78  CYS D CA   1 
ATOM 2046  C C    . CYS B 2 57  ? 169.594 233.125 178.253 1.00 313.71 ? 78  CYS D C    1 
ATOM 2047  O O    . CYS B 2 57  ? 169.503 232.238 179.115 1.00 313.71 ? 78  CYS D O    1 
ATOM 2048  C CB   . CYS B 2 57  ? 171.519 234.707 178.315 1.00 313.71 ? 78  CYS D CB   1 
ATOM 2049  S SG   . CYS B 2 57  ? 173.262 235.019 177.942 1.00 313.71 ? 78  CYS D SG   1 
ATOM 2050  H H    . CYS B 2 57  ? 171.010 234.480 175.928 1.00 376.45 ? 78  CYS D H    1 
ATOM 2051  H HA   . CYS B 2 57  ? 171.538 232.714 177.791 1.00 376.45 ? 78  CYS D HA   1 
ATOM 2052  H HB2  . CYS B 2 57  ? 170.948 235.585 178.013 1.00 376.45 ? 78  CYS D HB2  1 
ATOM 2053  H HB3  . CYS B 2 57  ? 171.418 234.606 179.395 1.00 376.45 ? 78  CYS D HB3  1 
ATOM 2054  N N    . GLN B 2 58  ? 168.531 233.818 177.838 1.00 289.73 ? 79  GLN D N    1 
ATOM 2055  C CA   . GLN B 2 58  ? 167.187 233.432 178.262 1.00 289.73 ? 79  GLN D CA   1 
ATOM 2056  C C    . GLN B 2 58  ? 166.864 231.985 177.880 1.00 289.73 ? 79  GLN D C    1 
ATOM 2057  O O    . GLN B 2 58  ? 166.357 231.213 178.708 1.00 289.73 ? 79  GLN D O    1 
ATOM 2058  C CB   . GLN B 2 58  ? 166.147 234.375 177.651 1.00 289.73 ? 79  GLN D CB   1 
ATOM 2059  C CG   . GLN B 2 58  ? 164.718 234.086 178.077 1.00 289.73 ? 79  GLN D CG   1 
ATOM 2060  C CD   . GLN B 2 58  ? 164.479 234.386 179.545 1.00 289.73 ? 79  GLN D CD   1 
ATOM 2061  O OE1  . GLN B 2 58  ? 164.742 235.496 180.016 1.00 289.73 ? 79  GLN D OE1  1 
ATOM 2062  N NE2  . GLN B 2 58  ? 163.979 233.398 180.276 1.00 289.73 ? 79  GLN D NE2  1 
ATOM 2063  H H    . GLN B 2 58  ? 168.562 234.504 177.319 1.00 347.68 ? 79  GLN D H    1 
ATOM 2064  H HA   . GLN B 2 58  ? 167.169 233.471 179.230 1.00 347.68 ? 79  GLN D HA   1 
ATOM 2065  H HB2  . GLN B 2 58  ? 166.380 235.403 177.931 1.00 347.68 ? 79  GLN D HB2  1 
ATOM 2066  H HB3  . GLN B 2 58  ? 166.194 234.314 176.564 1.00 347.68 ? 79  GLN D HB3  1 
ATOM 2067  H HG2  . GLN B 2 58  ? 164.042 234.704 177.487 1.00 347.68 ? 79  GLN D HG2  1 
ATOM 2068  H HG3  . GLN B 2 58  ? 164.506 233.031 177.905 1.00 347.68 ? 79  GLN D HG3  1 
ATOM 2069  H HE21 . GLN B 2 58  ? 163.800 233.537 181.251 1.00 347.68 ? 79  GLN D HE21 1 
ATOM 2070  H HE22 . GLN B 2 58  ? 163.780 232.513 179.854 1.00 347.68 ? 79  GLN D HE22 1 
ATOM 2071  N N    . ALA B 2 59  ? 167.178 231.585 176.639 1.00 293.12 ? 80  ALA D N    1 
ATOM 2072  C CA   . ALA B 2 59  ? 166.990 230.192 176.250 1.00 293.12 ? 80  ALA D CA   1 
ATOM 2073  C C    . ALA B 2 59  ? 167.842 229.264 177.108 1.00 293.12 ? 80  ALA D C    1 
ATOM 2074  O O    . ALA B 2 59  ? 167.390 228.188 177.510 1.00 293.12 ? 80  ALA D O    1 
ATOM 2075  C CB   . ALA B 2 59  ? 167.325 230.010 174.770 1.00 293.12 ? 80  ALA D CB   1 
ATOM 2076  H H    . ALA B 2 59  ? 167.491 232.093 176.020 1.00 351.74 ? 80  ALA D H    1 
ATOM 2077  H HA   . ALA B 2 59  ? 166.058 229.951 176.379 1.00 351.74 ? 80  ALA D HA   1 
ATOM 2078  H HB1  . ALA B 2 59  ? 167.200 229.079 174.531 1.00 351.74 ? 80  ALA D HB1  1 
ATOM 2079  H HB2  . ALA B 2 59  ? 166.735 230.571 174.243 1.00 351.74 ? 80  ALA D HB2  1 
ATOM 2080  H HB3  . ALA B 2 59  ? 168.249 230.270 174.624 1.00 351.74 ? 80  ALA D HB3  1 
ATOM 2081  N N    . ALA B 2 60  ? 169.074 229.671 177.414 1.00 306.17 ? 81  ALA D N    1 
ATOM 2082  C CA   . ALA B 2 60  ? 169.949 228.845 178.236 1.00 306.17 ? 81  ALA D CA   1 
ATOM 2083  C C    . ALA B 2 60  ? 169.334 228.581 179.599 1.00 306.17 ? 81  ALA D C    1 
ATOM 2084  O O    . ALA B 2 60  ? 169.483 227.485 180.152 1.00 306.17 ? 81  ALA D O    1 
ATOM 2085  C CB   . ALA B 2 60  ? 171.311 229.520 178.380 1.00 306.17 ? 81  ALA D CB   1 
ATOM 2086  H H    . ALA B 2 60  ? 169.422 230.415 177.160 1.00 367.40 ? 81  ALA D H    1 
ATOM 2087  H HA   . ALA B 2 60  ? 170.061 227.984 177.816 1.00 367.40 ? 81  ALA D HA   1 
ATOM 2088  H HB1  . ALA B 2 60  ? 171.830 229.036 179.035 1.00 367.40 ? 81  ALA D HB1  1 
ATOM 2089  H HB2  . ALA B 2 60  ? 171.762 229.511 177.521 1.00 367.40 ? 81  ALA D HB2  1 
ATOM 2090  H HB3  . ALA B 2 60  ? 171.180 230.434 178.679 1.00 367.40 ? 81  ALA D HB3  1 
ATOM 2091  N N    . LEU B 2 61  ? 168.650 229.576 180.163 1.00 284.21 ? 82  LEU D N    1 
ATOM 2092  C CA   . LEU B 2 61  ? 167.959 229.353 181.430 1.00 284.21 ? 82  LEU D CA   1 
ATOM 2093  C C    . LEU B 2 61  ? 166.884 228.285 181.265 1.00 284.21 ? 82  LEU D C    1 
ATOM 2094  O O    . LEU B 2 61  ? 166.824 227.318 182.037 1.00 284.21 ? 82  LEU D O    1 
ATOM 2095  C CB   . LEU B 2 61  ? 167.328 230.656 181.934 1.00 284.21 ? 82  LEU D CB   1 
ATOM 2096  C CG   . LEU B 2 61  ? 166.538 230.550 183.245 1.00 284.21 ? 82  LEU D CG   1 
ATOM 2097  C CD1  . LEU B 2 61  ? 167.476 230.139 184.371 1.00 284.21 ? 82  LEU D CD1  1 
ATOM 2098  C CD2  . LEU B 2 61  ? 165.872 231.884 183.546 1.00 284.21 ? 82  LEU D CD2  1 
ATOM 2099  H H    . LEU B 2 61  ? 168.573 230.371 179.842 1.00 341.05 ? 82  LEU D H    1 
ATOM 2100  H HA   . LEU B 2 61  ? 168.604 229.032 182.079 1.00 341.05 ? 82  LEU D HA   1 
ATOM 2101  H HB2  . LEU B 2 61  ? 168.119 231.390 182.083 1.00 341.05 ? 82  LEU D HB2  1 
ATOM 2102  H HB3  . LEU B 2 61  ? 166.650 231.033 181.168 1.00 341.05 ? 82  LEU D HB3  1 
ATOM 2103  H HG   . LEU B 2 61  ? 165.775 229.777 183.148 1.00 341.05 ? 82  LEU D HG   1 
ATOM 2104  H HD11 . LEU B 2 61  ? 166.915 230.063 185.303 1.00 341.05 ? 82  LEU D HD11 1 
ATOM 2105  H HD12 . LEU B 2 61  ? 167.924 229.173 184.139 1.00 341.05 ? 82  LEU D HD12 1 
ATOM 2106  H HD13 . LEU B 2 61  ? 168.261 230.886 184.481 1.00 341.05 ? 82  LEU D HD13 1 
ATOM 2107  H HD21 . LEU B 2 61  ? 165.310 231.808 184.477 1.00 341.05 ? 82  LEU D HD21 1 
ATOM 2108  H HD22 . LEU B 2 61  ? 166.634 232.657 183.645 1.00 341.05 ? 82  LEU D HD22 1 
ATOM 2109  H HD23 . LEU B 2 61  ? 165.194 232.144 182.733 1.00 341.05 ? 82  LEU D HD23 1 
ATOM 2110  N N    . GLU B 2 62  ? 166.045 228.422 180.233 1.00 286.32 ? 83  GLU D N    1 
ATOM 2111  C CA   . GLU B 2 62  ? 164.958 227.464 180.041 1.00 286.32 ? 83  GLU D CA   1 
ATOM 2112  C C    . GLU B 2 62  ? 165.459 226.039 179.789 1.00 286.32 ? 83  GLU D C    1 
ATOM 2113  O O    . GLU B 2 62  ? 164.850 225.074 180.266 1.00 286.32 ? 83  GLU D O    1 
ATOM 2114  C CB   . GLU B 2 62  ? 164.074 227.908 178.873 1.00 286.32 ? 83  GLU D CB   1 
ATOM 2115  C CG   . GLU B 2 62  ? 163.256 229.162 179.145 1.00 286.32 ? 83  GLU D CG   1 
ATOM 2116  C CD   . GLU B 2 62  ? 162.457 229.611 177.953 1.00 286.32 ? 83  GLU D CD   1 
ATOM 2117  O OE1  . GLU B 2 62  ? 162.611 229.029 176.906 1.00 286.32 ? 83  GLU D OE1  1 
ATOM 2118  O OE2  . GLU B 2 62  ? 161.692 230.536 178.089 1.00 286.32 ? 83  GLU D OE2  1 
ATOM 2119  H H    . GLU B 2 62  ? 166.084 229.047 179.644 1.00 343.58 ? 83  GLU D H    1 
ATOM 2120  H HA   . GLU B 2 62  ? 164.457 227.431 180.870 1.00 343.58 ? 83  GLU D HA   1 
ATOM 2121  H HB2  . GLU B 2 62  ? 164.696 228.099 177.998 1.00 343.58 ? 83  GLU D HB2  1 
ATOM 2122  H HB3  . GLU B 2 62  ? 163.382 227.107 178.615 1.00 343.58 ? 83  GLU D HB3  1 
ATOM 2123  H HG2  . GLU B 2 62  ? 162.573 228.966 179.972 1.00 343.58 ? 83  GLU D HG2  1 
ATOM 2124  H HG3  . GLU B 2 62  ? 163.928 229.964 179.449 1.00 343.58 ? 83  GLU D HG3  1 
ATOM 2125  N N    . VAL B 2 63  ? 166.566 225.883 179.053 1.00 302.40 ? 84  VAL D N    1 
ATOM 2126  C CA   . VAL B 2 63  ? 167.124 224.550 178.825 1.00 302.40 ? 84  VAL D CA   1 
ATOM 2127  C C    . VAL B 2 63  ? 167.747 224.013 180.109 1.00 302.40 ? 84  VAL D C    1 
ATOM 2128  O O    . VAL B 2 63  ? 167.475 222.879 180.522 1.00 302.40 ? 84  VAL D O    1 
ATOM 2129  C CB   . VAL B 2 63  ? 168.189 224.590 177.713 1.00 302.40 ? 84  VAL D CB   1 
ATOM 2130  C CG1  . VAL B 2 63  ? 168.887 223.243 177.596 1.00 302.40 ? 84  VAL D CG1  1 
ATOM 2131  C CG2  . VAL B 2 63  ? 167.544 224.980 176.392 1.00 302.40 ? 84  VAL D CG2  1 
ATOM 2132  H H    . VAL B 2 63  ? 167.005 226.522 178.680 1.00 362.88 ? 84  VAL D H    1 
ATOM 2133  H HA   . VAL B 2 63  ? 166.409 223.945 178.570 1.00 362.88 ? 84  VAL D HA   1 
ATOM 2134  H HB   . VAL B 2 63  ? 168.950 225.324 177.978 1.00 362.88 ? 84  VAL D HB   1 
ATOM 2135  H HG11 . VAL B 2 63  ? 169.637 223.289 176.806 1.00 362.88 ? 84  VAL D HG11 1 
ATOM 2136  H HG12 . VAL B 2 63  ? 169.372 223.001 178.542 1.00 362.88 ? 84  VAL D HG12 1 
ATOM 2137  H HG13 . VAL B 2 63  ? 168.154 222.473 177.355 1.00 362.88 ? 84  VAL D HG13 1 
ATOM 2138  H HG21 . VAL B 2 63  ? 168.302 225.006 175.611 1.00 362.88 ? 84  VAL D HG21 1 
ATOM 2139  H HG22 . VAL B 2 63  ? 166.779 224.248 176.131 1.00 362.88 ? 84  VAL D HG22 1 
ATOM 2140  H HG23 . VAL B 2 63  ? 167.086 225.964 176.487 1.00 362.88 ? 84  VAL D HG23 1 
ATOM 2141  N N    . LEU B 2 64  ? 168.592 224.816 180.763 1.00 286.75 ? 85  LEU D N    1 
ATOM 2142  C CA   . LEU B 2 64  ? 169.205 224.382 182.014 1.00 286.75 ? 85  LEU D CA   1 
ATOM 2143  C C    . LEU B 2 64  ? 168.190 224.230 183.138 1.00 286.75 ? 85  LEU D C    1 
ATOM 2144  O O    . LEU B 2 64  ? 168.471 223.515 184.105 1.00 286.75 ? 85  LEU D O    1 
ATOM 2145  C CB   . LEU B 2 64  ? 170.288 225.382 182.438 1.00 286.75 ? 85  LEU D CB   1 
ATOM 2146  C CG   . LEU B 2 64  ? 171.533 225.433 181.543 1.00 286.75 ? 85  LEU D CG   1 
ATOM 2147  C CD1  . LEU B 2 64  ? 172.399 226.620 181.944 1.00 286.75 ? 85  LEU D CD1  1 
ATOM 2148  C CD2  . LEU B 2 64  ? 172.304 224.127 181.669 1.00 286.75 ? 85  LEU D CD2  1 
ATOM 2149  H H    . LEU B 2 64  ? 168.822 225.604 180.507 1.00 344.10 ? 85  LEU D H    1 
ATOM 2150  H HA   . LEU B 2 64  ? 169.618 223.516 181.875 1.00 344.10 ? 85  LEU D HA   1 
ATOM 2151  H HB2  . LEU B 2 64  ? 169.852 226.379 182.456 1.00 344.10 ? 85  LEU D HB2  1 
ATOM 2152  H HB3  . LEU B 2 64  ? 170.616 225.132 183.447 1.00 344.10 ? 85  LEU D HB3  1 
ATOM 2153  H HG   . LEU B 2 64  ? 171.230 225.577 180.506 1.00 344.10 ? 85  LEU D HG   1 
ATOM 2154  H HD11 . LEU B 2 64  ? 173.283 226.657 181.308 1.00 344.10 ? 85  LEU D HD11 1 
ATOM 2155  H HD12 . LEU B 2 64  ? 171.829 227.542 181.825 1.00 344.10 ? 85  LEU D HD12 1 
ATOM 2156  H HD13 . LEU B 2 64  ? 172.704 226.513 182.984 1.00 344.10 ? 85  LEU D HD13 1 
ATOM 2157  H HD21 . LEU B 2 64  ? 173.188 224.163 181.032 1.00 344.10 ? 85  LEU D HD21 1 
ATOM 2158  H HD22 . LEU B 2 64  ? 172.608 223.983 182.706 1.00 344.10 ? 85  LEU D HD22 1 
ATOM 2159  H HD23 . LEU B 2 64  ? 171.667 223.298 181.360 1.00 344.10 ? 85  LEU D HD23 1 
ATOM 2160  N N    . GLN B 2 65  ? 167.033 224.899 183.042 1.00 255.15 ? 86  GLN D N    1 
ATOM 2161  C CA   . GLN B 2 65  ? 165.989 224.759 184.055 1.00 255.15 ? 86  GLN D CA   1 
ATOM 2162  C C    . GLN B 2 65  ? 165.610 223.302 184.309 1.00 255.15 ? 86  GLN D C    1 
ATOM 2163  O O    . GLN B 2 65  ? 165.168 222.967 185.413 1.00 255.15 ? 86  GLN D O    1 
ATOM 2164  C CB   . GLN B 2 65  ? 164.744 225.549 183.641 1.00 255.15 ? 86  GLN D CB   1 
ATOM 2165  C CG   . GLN B 2 65  ? 163.626 225.534 184.669 1.00 255.15 ? 86  GLN D CG   1 
ATOM 2166  C CD   . GLN B 2 65  ? 162.492 226.473 184.304 1.00 255.15 ? 86  GLN D CD   1 
ATOM 2167  O OE1  . GLN B 2 65  ? 161.781 226.257 183.319 1.00 255.15 ? 86  GLN D OE1  1 
ATOM 2168  N NE2  . GLN B 2 65  ? 162.316 227.523 185.098 1.00 255.15 ? 86  GLN D NE2  1 
ATOM 2169  H H    . GLN B 2 65  ? 166.830 225.440 182.408 1.00 306.18 ? 86  GLN D H    1 
ATOM 2170  H HA   . GLN B 2 65  ? 166.308 225.135 184.890 1.00 306.18 ? 86  GLN D HA   1 
ATOM 2171  H HB2  . GLN B 2 65  ? 165.018 226.588 183.456 1.00 306.18 ? 86  GLN D HB2  1 
ATOM 2172  H HB3  . GLN B 2 65  ? 164.350 225.145 182.709 1.00 306.18 ? 86  GLN D HB3  1 
ATOM 2173  H HG2  . GLN B 2 65  ? 163.224 224.523 184.738 1.00 306.18 ? 86  GLN D HG2  1 
ATOM 2174  H HG3  . GLN B 2 65  ? 164.029 225.843 185.633 1.00 306.18 ? 86  GLN D HG3  1 
ATOM 2175  H HE21 . GLN B 2 65  ? 161.583 228.178 184.907 1.00 306.18 ? 86  GLN D HE21 1 
ATOM 2176  H HE22 . GLN B 2 65  ? 162.915 227.661 185.886 1.00 306.18 ? 86  GLN D HE22 1 
ATOM 2177  N N    . GLU B 2 66  ? 165.771 222.431 183.315 1.00 252.27 ? 87  GLU D N    1 
ATOM 2178  C CA   . GLU B 2 66  ? 165.497 221.007 183.467 1.00 252.27 ? 87  GLU D CA   1 
ATOM 2179  C C    . GLU B 2 66  ? 166.708 220.204 183.930 1.00 252.27 ? 87  GLU D C    1 
ATOM 2180  O O    . GLU B 2 66  ? 166.584 218.989 184.118 1.00 252.27 ? 87  GLU D O    1 
ATOM 2181  C CB   . GLU B 2 66  ? 164.987 220.436 182.142 1.00 252.27 ? 87  GLU D CB   1 
ATOM 2182  C CG   . GLU B 2 66  ? 163.670 221.033 181.666 1.00 252.27 ? 87  GLU D CG   1 
ATOM 2183  C CD   . GLU B 2 66  ? 162.528 220.753 182.602 1.00 252.27 ? 87  GLU D CD   1 
ATOM 2184  O OE1  . GLU B 2 66  ? 162.355 219.618 182.975 1.00 252.27 ? 87  GLU D OE1  1 
ATOM 2185  O OE2  . GLU B 2 66  ? 161.827 221.676 182.945 1.00 252.27 ? 87  GLU D OE2  1 
ATOM 2186  H H    . GLU B 2 66  ? 166.044 222.646 182.528 1.00 302.72 ? 87  GLU D H    1 
ATOM 2187  H HA   . GLU B 2 66  ? 164.796 220.890 184.125 1.00 302.72 ? 87  GLU D HA   1 
ATOM 2188  H HB2  . GLU B 2 66  ? 165.731 220.602 181.363 1.00 302.72 ? 87  GLU D HB2  1 
ATOM 2189  H HB3  . GLU B 2 66  ? 164.849 219.359 182.240 1.00 302.72 ? 87  GLU D HB3  1 
ATOM 2190  H HG2  . GLU B 2 66  ? 163.787 222.112 181.566 1.00 302.72 ? 87  GLU D HG2  1 
ATOM 2191  H HG3  . GLU B 2 66  ? 163.435 220.629 180.682 1.00 302.72 ? 87  GLU D HG3  1 
ATOM 2192  N N    . SER B 2 67  ? 167.871 220.839 184.121 1.00 271.15 ? 88  SER D N    1 
ATOM 2193  C CA   . SER B 2 67  ? 169.062 220.097 184.506 1.00 271.15 ? 88  SER D CA   1 
ATOM 2194  C C    . SER B 2 67  ? 168.997 219.693 185.982 1.00 271.15 ? 88  SER D C    1 
ATOM 2195  O O    . SER B 2 67  ? 168.345 220.367 186.784 1.00 271.15 ? 88  SER D O    1 
ATOM 2196  C CB   . SER B 2 67  ? 170.301 220.931 184.248 1.00 271.15 ? 88  SER D CB   1 
ATOM 2197  O OG   . SER B 2 67  ? 170.368 222.018 185.129 1.00 271.15 ? 88  SER D OG   1 
ATOM 2198  H H    . SER B 2 67  ? 167.996 221.686 184.037 1.00 325.38 ? 88  SER D H    1 
ATOM 2199  H HA   . SER B 2 67  ? 169.107 219.318 183.935 1.00 325.38 ? 88  SER D HA   1 
ATOM 2200  H HB2  . SER B 2 67  ? 171.189 220.309 184.365 1.00 325.38 ? 88  SER D HB2  1 
ATOM 2201  H HB3  . SER B 2 67  ? 170.288 221.292 183.220 1.00 325.38 ? 88  SER D HB3  1 
ATOM 2202  H HG   . SER B 2 67  ? 169.809 222.701 184.750 1.00 325.38 ? 88  SER D HG   1 
ATOM 2203  N N    . PRO B 2 68  ? 169.660 218.596 186.372 1.00 271.80 ? 89  PRO D N    1 
ATOM 2204  C CA   . PRO B 2 68  ? 169.745 218.284 187.810 1.00 271.80 ? 89  PRO D CA   1 
ATOM 2205  C C    . PRO B 2 68  ? 170.351 219.399 188.645 1.00 271.80 ? 89  PRO D C    1 
ATOM 2206  O O    . PRO B 2 68  ? 169.998 219.529 189.824 1.00 271.80 ? 89  PRO D O    1 
ATOM 2207  C CB   . PRO B 2 68  ? 170.639 217.040 187.830 1.00 271.80 ? 89  PRO D CB   1 
ATOM 2208  C CG   . PRO B 2 68  ? 170.475 216.451 186.471 1.00 271.80 ? 89  PRO D CG   1 
ATOM 2209  C CD   . PRO B 2 68  ? 170.393 217.642 185.554 1.00 271.80 ? 89  PRO D CD   1 
ATOM 2210  H HA   . PRO B 2 68  ? 168.865 218.068 188.158 1.00 326.16 ? 89  PRO D HA   1 
ATOM 2211  H HB2  . PRO B 2 68  ? 171.678 217.327 188.049 1.00 326.16 ? 89  PRO D HB2  1 
ATOM 2212  H HB3  . PRO B 2 68  ? 170.318 216.359 188.632 1.00 326.16 ? 89  PRO D HB3  1 
ATOM 2213  H HG2  . PRO B 2 68  ? 171.326 215.794 186.237 1.00 326.16 ? 89  PRO D HG2  1 
ATOM 2214  H HG3  . PRO B 2 68  ? 169.571 215.825 186.434 1.00 326.16 ? 89  PRO D HG3  1 
ATOM 2215  H HD2  . PRO B 2 68  ? 171.408 217.989 185.311 1.00 326.16 ? 89  PRO D HD2  1 
ATOM 2216  H HD3  . PRO B 2 68  ? 169.849 217.364 184.639 1.00 326.16 ? 89  PRO D HD3  1 
ATOM 2217  N N    . LEU B 2 69  ? 171.259 220.200 188.079 1.00 280.31 ? 90  LEU D N    1 
ATOM 2218  C CA   . LEU B 2 69  ? 171.832 221.319 188.824 1.00 280.31 ? 90  LEU D CA   1 
ATOM 2219  C C    . LEU B 2 69  ? 170.766 222.343 189.187 1.00 280.31 ? 90  LEU D C    1 
ATOM 2220  O O    . LEU B 2 69  ? 170.727 222.832 190.322 1.00 280.31 ? 90  LEU D O    1 
ATOM 2221  C CB   . LEU B 2 69  ? 172.937 221.994 188.002 1.00 280.31 ? 90  LEU D CB   1 
ATOM 2222  C CG   . LEU B 2 69  ? 173.594 223.219 188.650 1.00 280.31 ? 90  LEU D CG   1 
ATOM 2223  C CD1  . LEU B 2 69  ? 174.256 222.808 189.958 1.00 280.31 ? 90  LEU D CD1  1 
ATOM 2224  C CD2  . LEU B 2 69  ? 174.609 223.819 187.689 1.00 280.31 ? 90  LEU D CD2  1 
ATOM 2225  H H    . LEU B 2 69  ? 171.555 220.117 187.276 1.00 336.37 ? 90  LEU D H    1 
ATOM 2226  H HA   . LEU B 2 69  ? 172.211 220.986 189.649 1.00 336.37 ? 90  LEU D HA   1 
ATOM 2227  H HB2  . LEU B 2 69  ? 173.720 221.263 187.806 1.00 336.37 ? 90  LEU D HB2  1 
ATOM 2228  H HB3  . LEU B 2 69  ? 172.517 222.309 187.047 1.00 336.37 ? 90  LEU D HB3  1 
ATOM 2229  H HG   . LEU B 2 69  ? 172.830 223.962 188.882 1.00 336.37 ? 90  LEU D HG   1 
ATOM 2230  H HD11 . LEU B 2 69  ? 174.723 223.679 190.419 1.00 336.37 ? 90  LEU D HD11 1 
ATOM 2231  H HD12 . LEU B 2 69  ? 173.504 222.400 190.634 1.00 336.37 ? 90  LEU D HD12 1 
ATOM 2232  H HD13 . LEU B 2 69  ? 175.015 222.052 189.760 1.00 336.37 ? 90  LEU D HD13 1 
ATOM 2233  H HD21 . LEU B 2 69  ? 175.076 224.691 188.149 1.00 336.37 ? 90  LEU D HD21 1 
ATOM 2234  H HD22 . LEU B 2 69  ? 175.374 223.078 187.457 1.00 336.37 ? 90  LEU D HD22 1 
ATOM 2235  H HD23 . LEU B 2 69  ? 174.106 224.120 186.769 1.00 336.37 ? 90  LEU D HD23 1 
ATOM 2236  N N    . TYR B 2 70  ? 169.899 222.680 188.239 1.00 249.22 ? 91  TYR D N    1 
ATOM 2237  C CA   . TYR B 2 70  ? 168.874 223.685 188.477 1.00 249.22 ? 91  TYR D CA   1 
ATOM 2238  C C    . TYR B 2 70  ? 167.942 223.227 189.592 1.00 249.22 ? 91  TYR D C    1 
ATOM 2239  O O    . TYR B 2 70  ? 167.443 222.098 189.578 1.00 249.22 ? 91  TYR D O    1 
ATOM 2240  C CB   . TYR B 2 70  ? 168.085 223.969 187.197 1.00 249.22 ? 91  TYR D CB   1 
ATOM 2241  C CG   . TYR B 2 70  ? 167.099 225.110 187.328 1.00 249.22 ? 91  TYR D CG   1 
ATOM 2242  C CD1  . TYR B 2 70  ? 165.845 224.883 187.874 1.00 249.22 ? 91  TYR D CD1  1 
ATOM 2243  C CD2  . TYR B 2 70  ? 167.450 226.382 186.901 1.00 249.22 ? 91  TYR D CD2  1 
ATOM 2244  C CE1  . TYR B 2 70  ? 164.945 225.924 187.994 1.00 249.22 ? 91  TYR D CE1  1 
ATOM 2245  C CE2  . TYR B 2 70  ? 166.550 227.423 187.021 1.00 249.22 ? 91  TYR D CE2  1 
ATOM 2246  C CZ   . TYR B 2 70  ? 165.294 227.190 187.569 1.00 249.22 ? 91  TYR D CZ   1 
ATOM 2247  O OH   . TYR B 2 70  ? 164.398 228.227 187.688 1.00 249.22 ? 91  TYR D OH   1 
ATOM 2248  H H    . TYR B 2 70  ? 169.883 222.342 187.448 1.00 299.06 ? 91  TYR D H    1 
ATOM 2249  H HA   . TYR B 2 70  ? 169.294 224.516 188.749 1.00 299.06 ? 91  TYR D HA   1 
ATOM 2250  H HB2  . TYR B 2 70  ? 168.777 224.208 186.388 1.00 299.06 ? 91  TYR D HB2  1 
ATOM 2251  H HB3  . TYR B 2 70  ? 167.534 223.076 186.904 1.00 299.06 ? 91  TYR D HB3  1 
ATOM 2252  H HD1  . TYR B 2 70  ? 165.569 223.883 188.210 1.00 299.06 ? 91  TYR D HD1  1 
ATOM 2253  H HD2  . TYR B 2 70  ? 168.436 226.560 186.472 1.00 299.06 ? 91  TYR D HD2  1 
ATOM 2254  H HE1  . TYR B 2 70  ? 163.959 225.746 188.424 1.00 299.06 ? 91  TYR D HE1  1 
ATOM 2255  H HE2  . TYR B 2 70  ? 166.826 228.423 186.685 1.00 299.06 ? 91  TYR D HE2  1 
ATOM 2256  H HH   . TYR B 2 70  ? 164.795 229.033 187.349 1.00 299.06 ? 91  TYR D HH   1 
ATOM 2257  N N    . ASP B 2 71  ? 167.721 224.110 190.568 1.00 244.87 ? 92  ASP D N    1 
ATOM 2258  C CA   . ASP B 2 71  ? 166.968 223.789 191.782 1.00 244.87 ? 92  ASP D CA   1 
ATOM 2259  C C    . ASP B 2 71  ? 167.648 222.688 192.596 1.00 244.87 ? 92  ASP D C    1 
ATOM 2260  O O    . ASP B 2 71  ? 166.982 221.887 193.257 1.00 244.87 ? 92  ASP D O    1 
ATOM 2261  C CB   . ASP B 2 71  ? 165.518 223.400 191.458 1.00 244.87 ? 92  ASP D CB   1 
ATOM 2262  C CG   . ASP B 2 71  ? 164.682 224.582 191.003 1.00 244.87 ? 92  ASP D CG   1 
ATOM 2263  O OD1  . ASP B 2 71  ? 165.013 225.730 191.368 1.00 244.87 ? 92  ASP D OD1  1 
ATOM 2264  O OD2  . ASP B 2 71  ? 163.682 224.358 190.289 1.00 244.87 ? 92  ASP D OD2  1 
ATOM 2265  H H    . ASP B 2 71  ? 168.005 224.922 190.548 1.00 293.84 ? 92  ASP D H    1 
ATOM 2266  H HA   . ASP B 2 71  ? 166.942 224.579 192.343 1.00 293.84 ? 92  ASP D HA   1 
ATOM 2267  H HB2  . ASP B 2 71  ? 165.500 222.732 190.757 1.00 293.84 ? 92  ASP D HB2  1 
ATOM 2268  H HB3  . ASP B 2 71  ? 165.097 223.047 192.258 1.00 293.84 ? 92  ASP D HB3  1 
ATOM 2269  N N    . CYS B 2 72  ? 168.977 222.636 192.556 1.00 261.65 ? 93  CYS D N    1 
ATOM 2270  C CA   . CYS B 2 72  ? 169.722 221.780 193.467 1.00 261.65 ? 93  CYS D CA   1 
ATOM 2271  C C    . CYS B 2 72  ? 169.760 222.412 194.857 1.00 261.65 ? 93  CYS D C    1 
ATOM 2272  O O    . CYS B 2 72  ? 169.341 223.555 195.063 1.00 261.65 ? 93  CYS D O    1 
ATOM 2273  C CB   . CYS B 2 72  ? 171.148 221.558 192.963 1.00 261.65 ? 93  CYS D CB   1 
ATOM 2274  S SG   . CYS B 2 72  ? 172.203 223.023 193.061 1.00 261.65 ? 93  CYS D SG   1 
ATOM 2275  H H    . CYS B 2 72  ? 169.469 223.085 192.012 1.00 313.98 ? 93  CYS D H    1 
ATOM 2276  H HA   . CYS B 2 72  ? 169.281 220.919 193.536 1.00 313.98 ? 93  CYS D HA   1 
ATOM 2277  H HB2  . CYS B 2 72  ? 171.619 220.763 193.542 1.00 313.98 ? 93  CYS D HB2  1 
ATOM 2278  H HB3  . CYS B 2 72  ? 171.119 221.231 191.923 1.00 313.98 ? 93  CYS D HB3  1 
ATOM 2279  N N    . ARG B 2 73  ? 170.271 221.649 195.825 1.00 230.99 ? 94  ARG D N    1 
ATOM 2280  C CA   . ARG B 2 73  ? 170.458 222.145 197.182 1.00 230.99 ? 94  ARG D CA   1 
ATOM 2281  C C    . ARG B 2 73  ? 171.798 221.673 197.724 1.00 230.99 ? 94  ARG D C    1 
ATOM 2282  O O    . ARG B 2 73  ? 172.238 220.553 197.454 1.00 230.99 ? 94  ARG D O    1 
ATOM 2283  C CB   . ARG B 2 73  ? 169.338 221.668 198.095 1.00 230.99 ? 94  ARG D CB   1 
ATOM 2284  C CG   . ARG B 2 73  ? 167.960 222.213 197.757 1.00 230.99 ? 94  ARG D CG   1 
ATOM 2285  C CD   . ARG B 2 73  ? 167.852 223.662 198.065 1.00 230.99 ? 94  ARG D CD   1 
ATOM 2286  N NE   . ARG B 2 73  ? 166.508 224.167 197.837 1.00 230.99 ? 94  ARG D NE   1 
ATOM 2287  C CZ   . ARG B 2 73  ? 166.044 224.599 196.648 1.00 230.99 ? 94  ARG D CZ   1 
ATOM 2288  N NH1  . ARG B 2 73  ? 166.827 224.582 195.592 1.00 230.99 ? 94  ARG D NH1  1 
ATOM 2289  N NH2  . ARG B 2 73  ? 164.803 225.040 196.544 1.00 230.99 ? 94  ARG D NH2  1 
ATOM 2290  H H    . ARG B 2 73  ? 170.517 220.833 195.716 1.00 277.19 ? 94  ARG D H    1 
ATOM 2291  H HA   . ARG B 2 73  ? 170.472 223.112 197.175 1.00 277.19 ? 94  ARG D HA   1 
ATOM 2292  H HB2  . ARG B 2 73  ? 169.280 220.581 198.061 1.00 277.19 ? 94  ARG D HB2  1 
ATOM 2293  H HB3  . ARG B 2 73  ? 169.562 221.951 199.124 1.00 277.19 ? 94  ARG D HB3  1 
ATOM 2294  H HG2  . ARG B 2 73  ? 167.764 222.074 196.693 1.00 277.19 ? 94  ARG D HG2  1 
ATOM 2295  H HG3  . ARG B 2 73  ? 167.205 221.682 198.338 1.00 277.19 ? 94  ARG D HG3  1 
ATOM 2296  H HD2  . ARG B 2 73  ? 168.107 223.832 199.111 1.00 277.19 ? 94  ARG D HD2  1 
ATOM 2297  H HD3  . ARG B 2 73  ? 168.538 224.221 197.430 1.00 277.19 ? 94  ARG D HD3  1 
ATOM 2298  H HE   . ARG B 2 73  ? 165.876 224.195 198.627 1.00 277.19 ? 94  ARG D HE   1 
ATOM 2299  H HH11 . ARG B 2 73  ? 167.776 224.245 195.672 1.00 277.19 ? 94  ARG D HH11 1 
ATOM 2300  H HH12 . ARG B 2 73  ? 166.479 224.906 194.701 1.00 277.19 ? 94  ARG D HH12 1 
ATOM 2301  H HH21 . ARG B 2 73  ? 164.201 225.053 197.356 1.00 277.19 ? 94  ARG D HH21 1 
ATOM 2302  H HH22 . ARG B 2 73  ? 164.455 225.364 195.654 1.00 277.19 ? 94  ARG D HH22 1 
ATOM 2303  N N    . CYS B 2 74  ? 172.439 222.549 198.497 1.00 225.14 ? 95  CYS D N    1 
ATOM 2304  C CA   . CYS B 2 74  ? 173.676 222.257 199.202 1.00 225.14 ? 95  CYS D CA   1 
ATOM 2305  C C    . CYS B 2 74  ? 173.370 222.225 200.701 1.00 225.14 ? 95  CYS D C    1 
ATOM 2306  O O    . CYS B 2 74  ? 172.206 222.274 201.114 1.00 225.14 ? 95  CYS D O    1 
ATOM 2307  C CB   . CYS B 2 74  ? 174.740 223.297 198.826 1.00 225.14 ? 95  CYS D CB   1 
ATOM 2308  S SG   . CYS B 2 74  ? 176.433 222.940 199.368 1.00 225.14 ? 95  CYS D SG   1 
ATOM 2309  H H    . CYS B 2 74  ? 172.161 223.352 198.629 1.00 270.17 ? 95  CYS D H    1 
ATOM 2310  H HA   . CYS B 2 74  ? 174.008 221.384 198.944 1.00 270.17 ? 95  CYS D HA   1 
ATOM 2311  H HB2  . CYS B 2 74  ? 174.760 223.371 197.859 1.00 270.17 ? 95  CYS D HB2  1 
ATOM 2312  H HB3  . CYS B 2 74  ? 174.485 224.151 199.209 1.00 270.17 ? 95  CYS D HB3  1 
ATOM 2313  N N    . LYS B 2 75  ? 174.416 222.134 201.524 1.00 207.74 ? 96  LYS D N    1 
ATOM 2314  C CA   . LYS B 2 75  ? 174.265 222.074 202.975 1.00 207.74 ? 96  LYS D CA   1 
ATOM 2315  C C    . LYS B 2 75  ? 175.414 222.816 203.638 1.00 207.74 ? 96  LYS D C    1 
ATOM 2316  O O    . LYS B 2 75  ? 176.512 222.904 203.083 1.00 207.74 ? 96  LYS D O    1 
ATOM 2317  C CB   . LYS B 2 75  ? 174.213 220.625 203.461 1.00 207.74 ? 96  LYS D CB   1 
ATOM 2318  C CG   . LYS B 2 75  ? 175.485 219.828 203.202 1.00 207.74 ? 96  LYS D CG   1 
ATOM 2319  C CD   . LYS B 2 75  ? 175.367 218.409 203.738 1.00 207.74 ? 96  LYS D CD   1 
ATOM 2320  C CE   . LYS B 2 75  ? 174.418 217.574 202.891 1.00 207.74 ? 96  LYS D CE   1 
ATOM 2321  N NZ   . LYS B 2 75  ? 174.424 216.142 203.296 1.00 207.74 ? 96  LYS D NZ   1 
ATOM 2322  H H    . LYS B 2 75  ? 175.234 222.104 201.259 1.00 249.29 ? 96  LYS D H    1 
ATOM 2323  H HA   . LYS B 2 75  ? 173.443 222.504 203.253 1.00 249.29 ? 96  LYS D HA   1 
ATOM 2324  H HB2  . LYS B 2 75  ? 174.020 220.608 204.534 1.00 249.29 ? 96  LYS D HB2  1 
ATOM 2325  H HB3  . LYS B 2 75  ? 173.388 220.106 202.972 1.00 249.29 ? 96  LYS D HB3  1 
ATOM 2326  H HG2  . LYS B 2 75  ? 175.677 219.788 202.130 1.00 249.29 ? 96  LYS D HG2  1 
ATOM 2327  H HG3  . LYS B 2 75  ? 176.328 220.321 203.686 1.00 249.29 ? 96  LYS D HG3  1 
ATOM 2328  H HD2  . LYS B 2 75  ? 176.351 217.937 203.739 1.00 249.29 ? 96  LYS D HD2  1 
ATOM 2329  H HD3  . LYS B 2 75  ? 174.996 218.436 204.762 1.00 249.29 ? 96  LYS D HD3  1 
ATOM 2330  H HE2  . LYS B 2 75  ? 173.405 217.962 202.991 1.00 249.29 ? 96  LYS D HE2  1 
ATOM 2331  H HE3  . LYS B 2 75  ? 174.708 217.643 201.843 1.00 249.29 ? 96  LYS D HE3  1 
ATOM 2332  H HZ1  . LYS B 2 75  ? 173.784 215.624 202.712 1.00 249.29 ? 96  LYS D HZ1  1 
ATOM 2333  H HZ2  . LYS B 2 75  ? 175.356 215.766 203.190 1.00 249.29 ? 96  LYS D HZ2  1 
ATOM 2334  H HZ3  . LYS B 2 75  ? 174.138 216.063 204.261 1.00 249.29 ? 96  LYS D HZ3  1 
ATOM 2335  N N    . ARG B 2 76  ? 175.146 223.350 204.828 1.00 183.69 ? 97  ARG D N    1 
ATOM 2336  C CA   . ARG B 2 76  ? 176.196 223.960 205.631 1.00 183.69 ? 97  ARG D CA   1 
ATOM 2337  C C    . ARG B 2 76  ? 177.247 222.922 205.997 1.00 183.69 ? 97  ARG D C    1 
ATOM 2338  O O    . ARG B 2 76  ? 176.922 221.818 206.444 1.00 183.69 ? 97  ARG D O    1 
ATOM 2339  C CB   . ARG B 2 76  ? 175.621 224.575 206.898 1.00 183.69 ? 97  ARG D CB   1 
ATOM 2340  C CG   . ARG B 2 76  ? 174.713 225.774 206.673 1.00 183.69 ? 97  ARG D CG   1 
ATOM 2341  C CD   . ARG B 2 76  ? 174.353 226.437 207.952 1.00 183.69 ? 97  ARG D CD   1 
ATOM 2342  N NE   . ARG B 2 76  ? 173.571 225.565 208.813 1.00 183.69 ? 97  ARG D NE   1 
ATOM 2343  C CZ   . ARG B 2 76  ? 172.228 225.459 208.778 1.00 183.69 ? 97  ARG D CZ   1 
ATOM 2344  N NH1  . ARG B 2 76  ? 171.534 226.174 207.921 1.00 183.69 ? 97  ARG D NH1  1 
ATOM 2345  N NH2  . ARG B 2 76  ? 171.609 224.635 209.606 1.00 183.69 ? 97  ARG D NH2  1 
ATOM 2346  H H    . ARG B 2 76  ? 174.367 223.370 205.192 1.00 220.43 ? 97  ARG D H    1 
ATOM 2347  H HA   . ARG B 2 76  ? 176.628 224.652 205.118 1.00 220.43 ? 97  ARG D HA   1 
ATOM 2348  H HB2  . ARG B 2 76  ? 175.046 223.823 207.438 1.00 220.43 ? 97  ARG D HB2  1 
ATOM 2349  H HB3  . ARG B 2 76  ? 176.435 224.894 207.549 1.00 220.43 ? 97  ARG D HB3  1 
ATOM 2350  H HG2  . ARG B 2 76  ? 175.222 226.501 206.040 1.00 220.43 ? 97  ARG D HG2  1 
ATOM 2351  H HG3  . ARG B 2 76  ? 173.794 225.448 206.184 1.00 220.43 ? 97  ARG D HG3  1 
ATOM 2352  H HD2  . ARG B 2 76  ? 175.260 226.718 208.484 1.00 220.43 ? 97  ARG D HD2  1 
ATOM 2353  H HD3  . ARG B 2 76  ? 173.763 227.329 207.745 1.00 220.43 ? 97  ARG D HD3  1 
ATOM 2354  H HE   . ARG B 2 76  ? 174.070 224.999 209.487 1.00 220.43 ? 97  ARG D HE   1 
ATOM 2355  H HH11 . ARG B 2 76  ? 172.007 226.803 207.289 1.00 220.43 ? 97  ARG D HH11 1 
ATOM 2356  H HH12 . ARG B 2 76  ? 170.528 226.094 207.895 1.00 220.43 ? 97  ARG D HH12 1 
ATOM 2357  H HH21 . ARG B 2 76  ? 172.143 224.085 210.265 1.00 220.43 ? 97  ARG D HH21 1 
ATOM 2358  H HH22 . ARG B 2 76  ? 170.603 224.555 209.580 1.00 220.43 ? 97  ARG D HH22 1 
ATOM 2359  N N    . GLY B 2 77  ? 178.514 223.282 205.805 1.00 193.29 ? 98  GLY D N    1 
ATOM 2360  C CA   . GLY B 2 77  ? 179.607 222.367 206.052 1.00 193.29 ? 98  GLY D CA   1 
ATOM 2361  C C    . GLY B 2 77  ? 179.847 221.344 204.964 1.00 193.29 ? 98  GLY D C    1 
ATOM 2362  O O    . GLY B 2 77  ? 180.570 220.371 205.206 1.00 193.29 ? 98  GLY D O    1 
ATOM 2363  H H    . GLY B 2 77  ? 178.762 224.058 205.531 1.00 231.95 ? 98  GLY D H    1 
ATOM 2364  H HA2  . GLY B 2 77  ? 180.424 222.878 206.166 1.00 231.95 ? 98  GLY D HA2  1 
ATOM 2365  H HA3  . GLY B 2 77  ? 179.436 221.888 206.879 1.00 231.95 ? 98  GLY D HA3  1 
ATOM 2366  N N    . MET B 2 78  ? 179.271 221.528 203.779 1.00 223.56 ? 99  MET D N    1 
ATOM 2367  C CA   . MET B 2 78  ? 179.451 220.560 202.707 1.00 223.56 ? 99  MET D CA   1 
ATOM 2368  C C    . MET B 2 78  ? 180.901 220.556 202.233 1.00 223.56 ? 99  MET D C    1 
ATOM 2369  O O    . MET B 2 78  ? 181.566 221.594 202.179 1.00 223.56 ? 99  MET D O    1 
ATOM 2370  C CB   . MET B 2 78  ? 178.504 220.869 201.548 1.00 223.56 ? 99  MET D CB   1 
ATOM 2371  C CG   . MET B 2 78  ? 178.523 219.837 200.429 1.00 223.56 ? 99  MET D CG   1 
ATOM 2372  S SD   . MET B 2 78  ? 177.953 218.214 200.970 1.00 223.56 ? 99  MET D SD   1 
ATOM 2373  C CE   . MET B 2 78  ? 178.437 217.203 199.573 1.00 223.56 ? 99  MET D CE   1 
ATOM 2374  H H    . MET B 2 78  ? 178.778 222.200 203.571 1.00 268.27 ? 99  MET D H    1 
ATOM 2375  H HA   . MET B 2 78  ? 179.226 219.678 203.038 1.00 268.27 ? 99  MET D HA   1 
ATOM 2376  H HB2  . MET B 2 78  ? 177.484 220.938 201.921 1.00 268.27 ? 99  MET D HB2  1 
ATOM 2377  H HB3  . MET B 2 78  ? 178.762 221.836 201.116 1.00 268.27 ? 99  MET D HB3  1 
ATOM 2378  H HG2  . MET B 2 78  ? 177.882 220.174 199.614 1.00 268.27 ? 99  MET D HG2  1 
ATOM 2379  H HG3  . MET B 2 78  ? 179.537 219.736 200.044 1.00 268.27 ? 99  MET D HG3  1 
ATOM 2380  H HE1  . MET B 2 78  ? 178.151 216.167 199.758 1.00 268.27 ? 99  MET D HE1  1 
ATOM 2381  H HE2  . MET B 2 78  ? 177.938 217.563 198.673 1.00 268.27 ? 99  MET D HE2  1 
ATOM 2382  H HE3  . MET B 2 78  ? 179.517 217.262 199.438 1.00 268.27 ? 99  MET D HE3  1 
ATOM 2383  N N    . LYS B 2 79  ? 181.389 219.359 201.914 1.00 241.56 ? 100 LYS D N    1 
ATOM 2384  C CA   . LYS B 2 79  ? 182.624 219.217 201.156 1.00 241.56 ? 100 LYS D CA   1 
ATOM 2385  C C    . LYS B 2 79  ? 182.516 219.980 199.842 1.00 241.56 ? 100 LYS D C    1 
ATOM 2386  O O    . LYS B 2 79  ? 181.604 219.743 199.045 1.00 241.56 ? 100 LYS D O    1 
ATOM 2387  C CB   . LYS B 2 79  ? 182.936 217.743 200.895 1.00 241.56 ? 100 LYS D CB   1 
ATOM 2388  C CG   . LYS B 2 79  ? 184.258 217.497 200.180 1.00 241.56 ? 100 LYS D CG   1 
ATOM 2389  C CD   . LYS B 2 79  ? 184.539 216.009 200.034 1.00 241.56 ? 100 LYS D CD   1 
ATOM 2390  C CE   . LYS B 2 79  ? 185.867 215.761 199.333 1.00 241.56 ? 100 LYS D CE   1 
ATOM 2391  N NZ   . LYS B 2 79  ? 186.156 214.309 199.186 1.00 241.56 ? 100 LYS D NZ   1 
ATOM 2392  H H    . LYS B 2 79  ? 181.022 218.612 202.129 1.00 289.87 ? 100 LYS D H    1 
ATOM 2393  H HA   . LYS B 2 79  ? 183.364 219.582 201.665 1.00 289.87 ? 100 LYS D HA   1 
ATOM 2394  H HB2  . LYS B 2 79  ? 182.962 217.203 201.841 1.00 289.87 ? 100 LYS D HB2  1 
ATOM 2395  H HB3  . LYS B 2 79  ? 182.142 217.305 200.290 1.00 289.87 ? 100 LYS D HB3  1 
ATOM 2396  H HG2  . LYS B 2 79  ? 184.226 217.951 199.188 1.00 289.87 ? 100 LYS D HG2  1 
ATOM 2397  H HG3  . LYS B 2 79  ? 185.068 217.957 200.744 1.00 289.87 ? 100 LYS D HG3  1 
ATOM 2398  H HD2  . LYS B 2 79  ? 184.566 215.545 201.021 1.00 289.87 ? 100 LYS D HD2  1 
ATOM 2399  H HD3  . LYS B 2 79  ? 183.742 215.543 199.455 1.00 289.87 ? 100 LYS D HD3  1 
ATOM 2400  H HE2  . LYS B 2 79  ? 185.847 216.218 198.345 1.00 289.87 ? 100 LYS D HE2  1 
ATOM 2401  H HE3  . LYS B 2 79  ? 186.672 216.223 199.905 1.00 289.87 ? 100 LYS D HE3  1 
ATOM 2402  H HZ1  . LYS B 2 79  ? 187.043 214.188 198.718 1.00 289.87 ? 100 LYS D HZ1  1 
ATOM 2403  H HZ2  . LYS B 2 79  ? 186.196 213.879 200.099 1.00 289.87 ? 100 LYS D HZ2  1 
ATOM 2404  H HZ3  . LYS B 2 79  ? 185.426 213.874 198.640 1.00 289.87 ? 100 LYS D HZ3  1 
ATOM 2405  N N    . LYS B 2 80  ? 183.453 220.903 199.617 1.00 242.20 ? 101 LYS D N    1 
ATOM 2406  C CA   . LYS B 2 80  ? 183.381 221.834 198.489 1.00 242.20 ? 101 LYS D CA   1 
ATOM 2407  C C    . LYS B 2 80  ? 182.120 222.693 198.577 1.00 242.20 ? 101 LYS D C    1 
ATOM 2408  O O    . LYS B 2 80  ? 181.409 222.892 197.590 1.00 242.20 ? 101 LYS D O    1 
ATOM 2409  C CB   . LYS B 2 80  ? 183.412 221.075 197.161 1.00 242.20 ? 101 LYS D CB   1 
ATOM 2410  C CG   . LYS B 2 80  ? 184.682 220.267 196.928 1.00 242.20 ? 101 LYS D CG   1 
ATOM 2411  C CD   . LYS B 2 80  ? 184.669 219.601 195.560 1.00 242.20 ? 101 LYS D CD   1 
ATOM 2412  C CE   . LYS B 2 80  ? 185.921 218.765 195.339 1.00 242.20 ? 101 LYS D CE   1 
ATOM 2413  N NZ   . LYS B 2 80  ? 185.905 218.075 194.021 1.00 242.20 ? 101 LYS D NZ   1 
ATOM 2414  H H    . LYS B 2 80  ? 184.150 221.012 200.111 1.00 290.64 ? 101 LYS D H    1 
ATOM 2415  H HA   . LYS B 2 80  ? 184.145 222.430 198.529 1.00 290.64 ? 101 LYS D HA   1 
ATOM 2416  H HB2  . LYS B 2 80  ? 182.566 220.389 197.114 1.00 290.64 ? 101 LYS D HB2  1 
ATOM 2417  H HB3  . LYS B 2 80  ? 183.308 221.781 196.336 1.00 290.64 ? 101 LYS D HB3  1 
ATOM 2418  H HG2  . LYS B 2 80  ? 185.549 220.925 196.994 1.00 290.64 ? 101 LYS D HG2  1 
ATOM 2419  H HG3  . LYS B 2 80  ? 184.770 219.499 197.696 1.00 290.64 ? 101 LYS D HG3  1 
ATOM 2420  H HD2  . LYS B 2 80  ? 183.793 218.957 195.476 1.00 290.64 ? 101 LYS D HD2  1 
ATOM 2421  H HD3  . LYS B 2 80  ? 184.613 220.365 194.784 1.00 290.64 ? 101 LYS D HD3  1 
ATOM 2422  H HE2  . LYS B 2 80  ? 186.800 219.406 195.389 1.00 290.64 ? 101 LYS D HE2  1 
ATOM 2423  H HE3  . LYS B 2 80  ? 186.001 218.015 196.126 1.00 290.64 ? 101 LYS D HE3  1 
ATOM 2424  H HZ1  . LYS B 2 80  ? 186.750 217.533 193.913 1.00 290.64 ? 101 LYS D HZ1  1 
ATOM 2425  H HZ2  . LYS B 2 80  ? 185.103 217.463 193.970 1.00 290.64 ? 101 LYS D HZ2  1 
ATOM 2426  H HZ3  . LYS B 2 80  ? 185.850 218.762 193.282 1.00 290.64 ? 101 LYS D HZ3  1 
ATOM 2427  N N    . GLU B 2 81  ? 181.841 223.206 199.779 1.00 220.43 ? 102 GLU D N    1 
ATOM 2428  C CA   . GLU B 2 81  ? 180.668 224.054 199.978 1.00 220.43 ? 102 GLU D CA   1 
ATOM 2429  C C    . GLU B 2 81  ? 180.725 225.300 199.101 1.00 220.43 ? 102 GLU D C    1 
ATOM 2430  O O    . GLU B 2 81  ? 179.685 225.892 198.789 1.00 220.43 ? 102 GLU D O    1 
ATOM 2431  C CB   . GLU B 2 81  ? 180.550 224.461 201.448 1.00 220.43 ? 102 GLU D CB   1 
ATOM 2432  C CG   . GLU B 2 81  ? 181.717 225.287 201.969 1.00 220.43 ? 102 GLU D CG   1 
ATOM 2433  C CD   . GLU B 2 81  ? 181.521 225.750 203.386 1.00 220.43 ? 102 GLU D CD   1 
ATOM 2434  O OE1  . GLU B 2 81  ? 180.467 225.516 203.926 1.00 220.43 ? 102 GLU D OE1  1 
ATOM 2435  O OE2  . GLU B 2 81  ? 182.428 226.337 203.928 1.00 220.43 ? 102 GLU D OE2  1 
ATOM 2436  H H    . GLU B 2 81  ? 182.311 223.077 200.488 1.00 264.52 ? 102 GLU D H    1 
ATOM 2437  H HA   . GLU B 2 81  ? 179.874 223.554 199.737 1.00 264.52 ? 102 GLU D HA   1 
ATOM 2438  H HB2  . GLU B 2 81  ? 179.638 225.042 201.593 1.00 264.52 ? 102 GLU D HB2  1 
ATOM 2439  H HB3  . GLU B 2 81  ? 180.470 223.568 202.068 1.00 264.52 ? 102 GLU D HB3  1 
ATOM 2440  H HG2  . GLU B 2 81  ? 182.625 224.687 201.917 1.00 264.52 ? 102 GLU D HG2  1 
ATOM 2441  H HG3  . GLU B 2 81  ? 181.851 226.154 201.323 1.00 264.52 ? 102 GLU D HG3  1 
ATOM 2442  N N    . LEU B 2 82  ? 181.927 225.724 198.708 1.00 208.87 ? 103 LEU D N    1 
ATOM 2443  C CA   . LEU B 2 82  ? 182.054 226.874 197.818 1.00 208.87 ? 103 LEU D CA   1 
ATOM 2444  C C    . LEU B 2 82  ? 181.674 226.506 196.388 1.00 208.87 ? 103 LEU D C    1 
ATOM 2445  O O    . LEU B 2 82  ? 180.874 227.200 195.747 1.00 208.87 ? 103 LEU D O    1 
ATOM 2446  C CB   . LEU B 2 82  ? 183.489 227.415 197.851 1.00 208.87 ? 103 LEU D CB   1 
ATOM 2447  C CG   . LEU B 2 82  ? 183.766 228.621 196.944 1.00 208.87 ? 103 LEU D CG   1 
ATOM 2448  C CD1  . LEU B 2 82  ? 182.880 229.786 197.363 1.00 208.87 ? 103 LEU D CD1  1 
ATOM 2449  C CD2  . LEU B 2 82  ? 185.238 228.995 197.032 1.00 208.87 ? 103 LEU D CD2  1 
ATOM 2450  H H    . LEU B 2 82  ? 182.676 225.370 198.940 1.00 250.64 ? 103 LEU D H    1 
ATOM 2451  H HA   . LEU B 2 82  ? 181.456 227.576 198.118 1.00 250.64 ? 103 LEU D HA   1 
ATOM 2452  H HB2  . LEU B 2 82  ? 183.727 227.707 198.872 1.00 250.64 ? 103 LEU D HB2  1 
ATOM 2453  H HB3  . LEU B 2 82  ? 184.168 226.616 197.555 1.00 250.64 ? 103 LEU D HB3  1 
ATOM 2454  H HG   . LEU B 2 82  ? 183.517 228.366 195.913 1.00 250.64 ? 103 LEU D HG   1 
ATOM 2455  H HD11 . LEU B 2 82  ? 183.076 230.643 196.718 1.00 250.64 ? 103 LEU D HD11 1 
ATOM 2456  H HD12 . LEU B 2 82  ? 181.832 229.498 197.272 1.00 250.64 ? 103 LEU D HD12 1 
ATOM 2457  H HD13 . LEU B 2 82  ? 183.095 230.053 198.397 1.00 250.64 ? 103 LEU D HD13 1 
ATOM 2458  H HD21 . LEU B 2 82  ? 185.435 229.852 196.387 1.00 250.64 ? 103 LEU D HD21 1 
ATOM 2459  H HD22 . LEU B 2 82  ? 185.488 229.251 198.062 1.00 250.64 ? 103 LEU D HD22 1 
ATOM 2460  H HD23 . LEU B 2 82  ? 185.848 228.150 196.710 1.00 250.64 ? 103 LEU D HD23 1 
ATOM 2461  N N    . GLN B 2 83  ? 182.234 225.410 195.872 1.00 235.05 ? 104 GLN D N    1 
ATOM 2462  C CA   . GLN B 2 83  ? 181.966 225.027 194.491 1.00 235.05 ? 104 GLN D CA   1 
ATOM 2463  C C    . GLN B 2 83  ? 180.499 224.674 194.280 1.00 235.05 ? 104 GLN D C    1 
ATOM 2464  O O    . GLN B 2 83  ? 179.953 224.932 193.200 1.00 235.05 ? 104 GLN D O    1 
ATOM 2465  C CB   . GLN B 2 83  ? 182.848 223.843 194.086 1.00 235.05 ? 104 GLN D CB   1 
ATOM 2466  C CG   . GLN B 2 83  ? 184.335 224.154 194.061 1.00 235.05 ? 104 GLN D CG   1 
ATOM 2467  C CD   . GLN B 2 83  ? 184.963 224.088 195.440 1.00 235.05 ? 104 GLN D CD   1 
ATOM 2468  O OE1  . GLN B 2 83  ? 184.264 224.106 196.457 1.00 235.05 ? 104 GLN D OE1  1 
ATOM 2469  N NE2  . GLN B 2 83  ? 186.288 224.011 195.483 1.00 235.05 ? 104 GLN D NE2  1 
ATOM 2470  H H    . GLN B 2 83  ? 182.758 224.880 196.299 1.00 282.06 ? 104 GLN D H    1 
ATOM 2471  H HA   . GLN B 2 83  ? 182.177 225.776 193.913 1.00 282.06 ? 104 GLN D HA   1 
ATOM 2472  H HB2  . GLN B 2 83  ? 182.689 223.016 194.779 1.00 282.06 ? 104 GLN D HB2  1 
ATOM 2473  H HB3  . GLN B 2 83  ? 182.560 223.497 193.093 1.00 282.06 ? 104 GLN D HB3  1 
ATOM 2474  H HG2  . GLN B 2 83  ? 184.837 223.428 193.421 1.00 282.06 ? 104 GLN D HG2  1 
ATOM 2475  H HG3  . GLN B 2 83  ? 184.478 225.160 193.668 1.00 282.06 ? 104 GLN D HG3  1 
ATOM 2476  H HE21 . GLN B 2 83  ? 186.759 223.965 196.365 1.00 282.06 ? 104 GLN D HE21 1 
ATOM 2477  H HE22 . GLN B 2 83  ? 186.816 224.000 194.633 1.00 282.06 ? 104 GLN D HE22 1 
ATOM 2478  N N    . CYS B 2 84  ? 179.838 224.107 195.297 1.00 238.18 ? 105 CYS D N    1 
ATOM 2479  C CA   . CYS B 2 84  ? 178.425 223.759 195.163 1.00 238.18 ? 105 CYS D CA   1 
ATOM 2480  C C    . CYS B 2 84  ? 177.568 224.992 194.903 1.00 238.18 ? 105 CYS D C    1 
ATOM 2481  O O    . CYS B 2 84  ? 176.452 224.870 194.385 1.00 238.18 ? 105 CYS D O    1 
ATOM 2482  C CB   . CYS B 2 84  ? 177.927 223.021 196.413 1.00 238.18 ? 105 CYS D CB   1 
ATOM 2483  S SG   . CYS B 2 84  ? 177.649 224.051 197.883 1.00 238.18 ? 105 CYS D SG   1 
ATOM 2484  H H    . CYS B 2 84  ? 180.181 223.917 196.063 1.00 285.82 ? 105 CYS D H    1 
ATOM 2485  H HA   . CYS B 2 84  ? 178.322 223.161 194.406 1.00 285.82 ? 105 CYS D HA   1 
ATOM 2486  H HB2  . CYS B 2 84  ? 177.084 222.592 196.198 1.00 285.82 ? 105 CYS D HB2  1 
ATOM 2487  H HB3  . CYS B 2 84  ? 178.581 222.346 196.652 1.00 285.82 ? 105 CYS D HB3  1 
ATOM 2488  N N    . LEU B 2 85  ? 178.070 226.181 195.251 1.00 214.50 ? 106 LEU D N    1 
ATOM 2489  C CA   . LEU B 2 85  ? 177.371 227.431 194.982 1.00 214.50 ? 106 LEU D CA   1 
ATOM 2490  C C    . LEU B 2 85  ? 177.908 228.146 193.752 1.00 214.50 ? 106 LEU D C    1 
ATOM 2491  O O    . LEU B 2 85  ? 177.125 228.723 192.995 1.00 214.50 ? 106 LEU D O    1 
ATOM 2492  C CB   . LEU B 2 85  ? 177.479 228.361 196.197 1.00 214.50 ? 106 LEU D CB   1 
ATOM 2493  C CG   . LEU B 2 85  ? 176.878 227.822 197.502 1.00 214.50 ? 106 LEU D CG   1 
ATOM 2494  C CD1  . LEU B 2 85  ? 177.113 228.826 198.622 1.00 214.50 ? 106 LEU D CD1  1 
ATOM 2495  C CD2  . LEU B 2 85  ? 175.393 227.557 197.307 1.00 214.50 ? 106 LEU D CD2  1 
ATOM 2496  H H    . LEU B 2 85  ? 178.822 226.291 195.653 1.00 257.40 ? 106 LEU D H    1 
ATOM 2497  H HA   . LEU B 2 85  ? 176.437 227.254 194.804 1.00 257.40 ? 106 LEU D HA   1 
ATOM 2498  H HB2  . LEU B 2 85  ? 178.531 228.573 196.380 1.00 257.40 ? 106 LEU D HB2  1 
ATOM 2499  H HB3  . LEU B 2 85  ? 176.975 229.299 195.963 1.00 257.40 ? 106 LEU D HB3  1 
ATOM 2500  H HG   . LEU B 2 85  ? 177.379 226.893 197.777 1.00 257.40 ? 106 LEU D HG   1 
ATOM 2501  H HD11 . LEU B 2 85  ? 176.686 228.443 199.550 1.00 257.40 ? 106 LEU D HD11 1 
ATOM 2502  H HD12 . LEU B 2 85  ? 178.184 228.981 198.754 1.00 257.40 ? 106 LEU D HD12 1 
ATOM 2503  H HD13 . LEU B 2 85  ? 176.637 229.772 198.368 1.00 257.40 ? 106 LEU D HD13 1 
ATOM 2504  H HD21 . LEU B 2 85  ? 174.966 227.174 198.234 1.00 257.40 ? 106 LEU D HD21 1 
ATOM 2505  H HD22 . LEU B 2 85  ? 174.891 228.486 197.033 1.00 257.40 ? 106 LEU D HD22 1 
ATOM 2506  H HD23 . LEU B 2 85  ? 175.255 226.823 196.513 1.00 257.40 ? 106 LEU D HD23 1 
ATOM 2507  N N    . GLN B 2 86  ? 179.229 228.144 193.549 1.00 216.34 ? 107 GLN D N    1 
ATOM 2508  C CA   . GLN B 2 86  ? 179.787 228.756 192.346 1.00 216.34 ? 107 GLN D CA   1 
ATOM 2509  C C    . GLN B 2 86  ? 179.241 228.087 191.089 1.00 216.34 ? 107 GLN D C    1 
ATOM 2510  O O    . GLN B 2 86  ? 178.913 228.764 190.105 1.00 216.34 ? 107 GLN D O    1 
ATOM 2511  C CB   . GLN B 2 86  ? 181.316 228.674 192.359 1.00 216.34 ? 107 GLN D CB   1 
ATOM 2512  C CG   . GLN B 2 86  ? 181.977 229.560 193.401 1.00 216.34 ? 107 GLN D CG   1 
ATOM 2513  C CD   . GLN B 2 86  ? 183.483 229.381 193.442 1.00 216.34 ? 107 GLN D CD   1 
ATOM 2514  O OE1  . GLN B 2 86  ? 184.004 228.313 193.110 1.00 216.34 ? 107 GLN D OE1  1 
ATOM 2515  N NE2  . GLN B 2 86  ? 184.191 230.427 193.852 1.00 216.34 ? 107 GLN D NE2  1 
ATOM 2516  H H    . GLN B 2 86  ? 179.812 227.804 194.083 1.00 259.61 ? 107 GLN D H    1 
ATOM 2517  H HA   . GLN B 2 86  ? 179.536 229.693 192.320 1.00 259.61 ? 107 GLN D HA   1 
ATOM 2518  H HB2  . GLN B 2 86  ? 181.624 227.646 192.548 1.00 259.61 ? 107 GLN D HB2  1 
ATOM 2519  H HB3  . GLN B 2 86  ? 181.704 228.958 191.381 1.00 259.61 ? 107 GLN D HB3  1 
ATOM 2520  H HG2  . GLN B 2 86  ? 181.763 230.603 193.165 1.00 259.61 ? 107 GLN D HG2  1 
ATOM 2521  H HG3  . GLN B 2 86  ? 181.576 229.310 194.383 1.00 259.61 ? 107 GLN D HG3  1 
ATOM 2522  H HE21 . GLN B 2 86  ? 185.189 230.368 193.900 1.00 259.61 ? 107 GLN D HE21 1 
ATOM 2523  H HE22 . GLN B 2 86  ? 183.728 231.274 194.112 1.00 259.61 ? 107 GLN D HE22 1 
ATOM 2524  N N    . ILE B 2 87  ? 179.104 226.760 191.123 1.00 262.21 ? 108 ILE D N    1 
ATOM 2525  C CA   . ILE B 2 87  ? 178.532 226.030 189.995 1.00 262.21 ? 108 ILE D CA   1 
ATOM 2526  C C    . ILE B 2 87  ? 177.066 226.405 189.804 1.00 262.21 ? 108 ILE D C    1 
ATOM 2527  O O    . ILE B 2 87  ? 176.631 226.720 188.690 1.00 262.21 ? 108 ILE D O    1 
ATOM 2528  C CB   . ILE B 2 87  ? 178.712 224.513 190.201 1.00 262.21 ? 108 ILE D CB   1 
ATOM 2529  C CG1  . ILE B 2 87  ? 180.204 224.139 190.141 1.00 262.21 ? 108 ILE D CG1  1 
ATOM 2530  C CG2  . ILE B 2 87  ? 177.917 223.724 189.156 1.00 262.21 ? 108 ILE D CG2  1 
ATOM 2531  C CD1  . ILE B 2 87  ? 180.534 222.735 190.633 1.00 262.21 ? 108 ILE D CD1  1 
ATOM 2532  H H    . ILE B 2 87  ? 179.336 226.262 191.785 1.00 314.65 ? 108 ILE D H    1 
ATOM 2533  H HA   . ILE B 2 87  ? 179.009 226.278 189.188 1.00 314.65 ? 108 ILE D HA   1 
ATOM 2534  H HB   . ILE B 2 87  ? 178.374 224.281 191.080 1.00 314.65 ? 108 ILE D HB   1 
ATOM 2535  H HG12 . ILE B 2 87  ? 180.500 224.202 189.219 1.00 314.65 ? 108 ILE D HG12 1 
ATOM 2536  H HG13 . ILE B 2 87  ? 180.719 224.752 190.685 1.00 314.65 ? 108 ILE D HG13 1 
ATOM 2537  H HG21 . ILE B 2 87  ? 178.195 222.799 189.180 1.00 314.65 ? 108 ILE D HG21 1 
ATOM 2538  H HG22 . ILE B 2 87  ? 176.967 223.760 189.347 1.00 314.65 ? 108 ILE D HG22 1 
ATOM 2539  H HG23 . ILE B 2 87  ? 178.096 224.094 188.277 1.00 314.65 ? 108 ILE D HG23 1 
ATOM 2540  H HD11 . ILE B 2 87  ? 181.498 222.635 190.667 1.00 314.65 ? 108 ILE D HD11 1 
ATOM 2541  H HD12 . ILE B 2 87  ? 180.160 222.617 191.520 1.00 314.65 ? 108 ILE D HD12 1 
ATOM 2542  H HD13 . ILE B 2 87  ? 180.161 222.077 190.026 1.00 314.65 ? 108 ILE D HD13 1 
ATOM 2543  N N    . TYR B 2 88  ? 176.281 226.377 190.883 1.00 264.79 ? 109 TYR D N    1 
ATOM 2544  C CA   . TYR B 2 88  ? 174.861 226.694 190.764 1.00 264.79 ? 109 TYR D CA   1 
ATOM 2545  C C    . TYR B 2 88  ? 174.652 228.146 190.352 1.00 264.79 ? 109 TYR D C    1 
ATOM 2546  O O    . TYR B 2 88  ? 173.885 228.436 189.428 1.00 264.79 ? 109 TYR D O    1 
ATOM 2547  C CB   . TYR B 2 88  ? 174.136 226.407 192.081 1.00 264.79 ? 109 TYR D CB   1 
ATOM 2548  C CG   . TYR B 2 88  ? 172.662 226.747 192.053 1.00 264.79 ? 109 TYR D CG   1 
ATOM 2549  C CD1  . TYR B 2 88  ? 171.764 225.893 191.429 1.00 264.79 ? 109 TYR D CD1  1 
ATOM 2550  C CD2  . TYR B 2 88  ? 172.209 227.914 192.650 1.00 264.79 ? 109 TYR D CD2  1 
ATOM 2551  C CE1  . TYR B 2 88  ? 170.418 226.204 191.404 1.00 264.79 ? 109 TYR D CE1  1 
ATOM 2552  C CE2  . TYR B 2 88  ? 170.863 228.225 192.624 1.00 264.79 ? 109 TYR D CE2  1 
ATOM 2553  C CZ   . TYR B 2 88  ? 169.970 227.375 192.004 1.00 264.79 ? 109 TYR D CZ   1 
ATOM 2554  O OH   . TYR B 2 88  ? 168.630 227.685 191.979 1.00 264.79 ? 109 TYR D OH   1 
ATOM 2555  H H    . TYR B 2 88  ? 176.541 226.179 191.679 1.00 317.75 ? 109 TYR D H    1 
ATOM 2556  H HA   . TYR B 2 88  ? 174.471 226.131 190.077 1.00 317.75 ? 109 TYR D HA   1 
ATOM 2557  H HB2  . TYR B 2 88  ? 174.236 225.349 192.329 1.00 317.75 ? 109 TYR D HB2  1 
ATOM 2558  H HB3  . TYR B 2 88  ? 174.601 226.977 192.884 1.00 317.75 ? 109 TYR D HB3  1 
ATOM 2559  H HD1  . TYR B 2 88  ? 172.121 224.976 190.960 1.00 317.75 ? 109 TYR D HD1  1 
ATOM 2560  H HD2  . TYR B 2 88  ? 172.914 228.586 193.139 1.00 317.75 ? 109 TYR D HD2  1 
ATOM 2561  H HE1  . TYR B 2 88  ? 169.713 225.533 190.914 1.00 317.75 ? 109 TYR D HE1  1 
ATOM 2562  H HE2  . TYR B 2 88  ? 170.507 229.143 193.093 1.00 317.75 ? 109 TYR D HE2  1 
ATOM 2563  H HH   . TYR B 2 88  ? 168.487 228.522 192.428 1.00 317.75 ? 109 TYR D HH   1 
ATOM 2564  N N    . TRP B 2 89  ? 175.318 229.081 191.035 1.00 244.43 ? 110 TRP D N    1 
ATOM 2565  C CA   . TRP B 2 89  ? 175.131 230.494 190.744 1.00 244.43 ? 110 TRP D CA   1 
ATOM 2566  C C    . TRP B 2 89  ? 175.566 230.851 189.331 1.00 244.43 ? 110 TRP D C    1 
ATOM 2567  O O    . TRP B 2 89  ? 175.027 231.800 188.753 1.00 244.43 ? 110 TRP D O    1 
ATOM 2568  C CB   . TRP B 2 89  ? 175.913 231.346 191.746 1.00 244.43 ? 110 TRP D CB   1 
ATOM 2569  C CG   . TRP B 2 89  ? 175.653 232.816 191.613 1.00 244.43 ? 110 TRP D CG   1 
ATOM 2570  C CD1  . TRP B 2 89  ? 176.552 233.773 191.249 1.00 244.43 ? 110 TRP D CD1  1 
ATOM 2571  C CD2  . TRP B 2 89  ? 174.402 233.508 191.843 1.00 244.43 ? 110 TRP D CD2  1 
ATOM 2572  N NE1  . TRP B 2 89  ? 175.951 235.007 191.238 1.00 244.43 ? 110 TRP D NE1  1 
ATOM 2573  C CE2  . TRP B 2 89  ? 174.634 234.864 191.597 1.00 244.43 ? 110 TRP D CE2  1 
ATOM 2574  C CE3  . TRP B 2 89  ? 173.122 233.091 192.230 1.00 244.43 ? 110 TRP D CE3  1 
ATOM 2575  C CZ2  . TRP B 2 89  ? 173.635 235.815 191.727 1.00 244.43 ? 110 TRP D CZ2  1 
ATOM 2576  C CZ3  . TRP B 2 89  ? 172.119 234.045 192.360 1.00 244.43 ? 110 TRP D CZ3  1 
ATOM 2577  C CH2  . TRP B 2 89  ? 172.370 235.372 192.114 1.00 244.43 ? 110 TRP D CH2  1 
ATOM 2578  H H    . TRP B 2 89  ? 175.879 228.919 191.667 1.00 293.32 ? 110 TRP D H    1 
ATOM 2579  H HA   . TRP B 2 89  ? 174.190 230.712 190.831 1.00 293.32 ? 110 TRP D HA   1 
ATOM 2580  H HB2  . TRP B 2 89  ? 175.655 231.043 192.761 1.00 293.32 ? 110 TRP D HB2  1 
ATOM 2581  H HB3  . TRP B 2 89  ? 176.981 231.174 191.615 1.00 293.32 ? 110 TRP D HB3  1 
ATOM 2582  H HD1  . TRP B 2 89  ? 177.596 233.586 191.004 1.00 293.32 ? 110 TRP D HD1  1 
ATOM 2583  H HE1  . TRP B 2 89  ? 176.403 235.880 191.004 1.00 293.32 ? 110 TRP D HE1  1 
ATOM 2584  H HE3  . TRP B 2 89  ? 172.917 232.039 192.424 1.00 293.32 ? 110 TRP D HE3  1 
ATOM 2585  H HZ2  . TRP B 2 89  ? 173.814 236.873 191.537 1.00 293.32 ? 110 TRP D HZ2  1 
ATOM 2586  H HZ3  . TRP B 2 89  ? 171.126 233.713 192.663 1.00 293.32 ? 110 TRP D HZ3  1 
ATOM 2587  H HH2  . TRP B 2 89  ? 171.560 236.093 192.225 1.00 293.32 ? 110 TRP D HH2  1 
ATOM 2588  N N    . SER B 2 90  ? 176.523 230.113 188.762 1.00 281.48 ? 111 SER D N    1 
ATOM 2589  C CA   . SER B 2 90  ? 176.995 230.426 187.419 1.00 281.48 ? 111 SER D CA   1 
ATOM 2590  C C    . SER B 2 90  ? 175.904 230.322 186.359 1.00 281.48 ? 111 SER D C    1 
ATOM 2591  O O    . SER B 2 90  ? 176.076 230.894 185.276 1.00 281.48 ? 111 SER D O    1 
ATOM 2592  C CB   . SER B 2 90  ? 178.139 229.499 187.057 1.00 281.48 ? 111 SER D CB   1 
ATOM 2593  O OG   . SER B 2 90  ? 179.262 229.751 187.856 1.00 281.48 ? 111 SER D OG   1 
ATOM 2594  H H    . SER B 2 90  ? 176.910 229.438 189.127 1.00 337.78 ? 111 SER D H    1 
ATOM 2595  H HA   . SER B 2 90  ? 177.327 231.337 187.412 1.00 337.78 ? 111 SER D HA   1 
ATOM 2596  H HB2  . SER B 2 90  ? 177.824 228.464 187.184 1.00 337.78 ? 111 SER D HB2  1 
ATOM 2597  H HB3  . SER B 2 90  ? 178.398 229.635 186.008 1.00 337.78 ? 111 SER D HB3  1 
ATOM 2598  H HG   . SER B 2 90  ? 179.437 228.936 188.331 1.00 337.78 ? 111 SER D HG   1 
ATOM 2599  N N    . ILE B 2 91  ? 174.801 229.621 186.632 1.00 290.96 ? 112 ILE D N    1 
ATOM 2600  C CA   . ILE B 2 91  ? 173.676 229.517 185.704 1.00 290.96 ? 112 ILE D CA   1 
ATOM 2601  C C    . ILE B 2 91  ? 172.502 230.397 186.132 1.00 290.96 ? 112 ILE D C    1 
ATOM 2602  O O    . ILE B 2 91  ? 171.377 230.186 185.671 1.00 290.96 ? 112 ILE D O    1 
ATOM 2603  C CB   . ILE B 2 91  ? 173.203 228.057 185.585 1.00 290.96 ? 112 ILE D CB   1 
ATOM 2604  C CG1  . ILE B 2 91  ? 172.706 227.544 186.939 1.00 290.96 ? 112 ILE D CG1  1 
ATOM 2605  C CG2  . ILE B 2 91  ? 174.324 227.175 185.058 1.00 290.96 ? 112 ILE D CG2  1 
ATOM 2606  C CD1  . ILE B 2 91  ? 171.867 226.290 186.847 1.00 290.96 ? 112 ILE D CD1  1 
ATOM 2607  H H    . ILE B 2 91  ? 174.678 229.187 187.364 1.00 349.15 ? 112 ILE D H    1 
ATOM 2608  H HA   . ILE B 2 91  ? 173.953 229.826 184.830 1.00 349.15 ? 112 ILE D HA   1 
ATOM 2609  H HB   . ILE B 2 91  ? 172.358 228.003 184.899 1.00 349.15 ? 112 ILE D HB   1 
ATOM 2610  H HG12 . ILE B 2 91  ? 173.558 227.339 187.585 1.00 349.15 ? 112 ILE D HG12 1 
ATOM 2611  H HG13 . ILE B 2 91  ? 172.108 228.317 187.424 1.00 349.15 ? 112 ILE D HG13 1 
ATOM 2612  H HG21 . ILE B 2 91  ? 173.973 226.147 184.980 1.00 349.15 ? 112 ILE D HG21 1 
ATOM 2613  H HG22 . ILE B 2 91  ? 174.633 227.528 184.074 1.00 349.15 ? 112 ILE D HG22 1 
ATOM 2614  H HG23 . ILE B 2 91  ? 175.173 227.218 185.741 1.00 349.15 ? 112 ILE D HG23 1 
ATOM 2615  H HD11 . ILE B 2 91  ? 171.552 225.988 187.846 1.00 349.15 ? 112 ILE D HD11 1 
ATOM 2616  H HD12 . ILE B 2 91  ? 170.988 226.484 186.232 1.00 349.15 ? 112 ILE D HD12 1 
ATOM 2617  H HD13 . ILE B 2 91  ? 172.456 225.491 186.397 1.00 349.15 ? 112 ILE D HD13 1 
ATOM 2618  N N    . HIS B 2 92  ? 172.731 231.377 187.004 1.00 247.01 ? 113 HIS D N    1 
ATOM 2619  C CA   . HIS B 2 92  ? 171.732 232.406 187.257 1.00 247.01 ? 113 HIS D CA   1 
ATOM 2620  C C    . HIS B 2 92  ? 171.713 233.408 186.109 1.00 247.01 ? 113 HIS D C    1 
ATOM 2621  O O    . HIS B 2 92  ? 172.758 233.937 185.715 1.00 247.01 ? 113 HIS D O    1 
ATOM 2622  C CB   . HIS B 2 92  ? 172.011 233.129 188.579 1.00 247.01 ? 113 HIS D CB   1 
ATOM 2623  C CG   . HIS B 2 92  ? 170.970 234.142 188.942 1.00 247.01 ? 113 HIS D CG   1 
ATOM 2624  N ND1  . HIS B 2 92  ? 170.901 235.384 188.347 1.00 247.01 ? 113 HIS D ND1  1 
ATOM 2625  C CD2  . HIS B 2 92  ? 169.958 234.098 189.840 1.00 247.01 ? 113 HIS D CD2  1 
ATOM 2626  C CE1  . HIS B 2 92  ? 169.889 236.060 188.863 1.00 247.01 ? 113 HIS D CE1  1 
ATOM 2627  N NE2  . HIS B 2 92  ? 169.302 235.302 189.770 1.00 247.01 ? 113 HIS D NE2  1 
ATOM 2628  H H    . HIS B 2 92  ? 173.453 231.476 187.461 1.00 296.41 ? 113 HIS D H    1 
ATOM 2629  H HA   . HIS B 2 92  ? 170.853 232.003 187.326 1.00 296.41 ? 113 HIS D HA   1 
ATOM 2630  H HB2  . HIS B 2 92  ? 172.074 232.399 189.387 1.00 296.41 ? 113 HIS D HB2  1 
ATOM 2631  H HB3  . HIS B 2 92  ? 172.974 233.636 188.521 1.00 296.41 ? 113 HIS D HB3  1 
ATOM 2632  H HD1  . HIS B 2 92  ? 171.464 235.706 187.585 1.00 296.41 ? 113 HIS D HD1  1 
ATOM 2633  H HD2  . HIS B 2 92  ? 169.620 233.331 190.538 1.00 296.41 ? 113 HIS D HD2  1 
ATOM 2634  H HE1  . HIS B 2 92  ? 169.665 237.070 188.521 1.00 296.41 ? 113 HIS D HE1  1 
ATOM 2635  N N    . LEU B 2 93  ? 170.523 233.667 185.575 1.00 279.01 ? 114 LEU D N    1 
ATOM 2636  C CA   . LEU B 2 93  ? 170.353 234.558 184.435 1.00 279.01 ? 114 LEU D CA   1 
ATOM 2637  C C    . LEU B 2 93  ? 170.376 236.000 184.924 1.00 279.01 ? 114 LEU D C    1 
ATOM 2638  O O    . LEU B 2 93  ? 169.611 236.369 185.823 1.00 279.01 ? 114 LEU D O    1 
ATOM 2639  C CB   . LEU B 2 93  ? 169.035 234.265 183.707 1.00 279.01 ? 114 LEU D CB   1 
ATOM 2640  C CG   . LEU B 2 93  ? 168.724 235.166 182.505 1.00 279.01 ? 114 LEU D CG   1 
ATOM 2641  C CD1  . LEU B 2 93  ? 169.759 234.931 181.413 1.00 279.01 ? 114 LEU D CD1  1 
ATOM 2642  C CD2  . LEU B 2 93  ? 167.320 234.872 181.999 1.00 279.01 ? 114 LEU D CD2  1 
ATOM 2643  H H    . LEU B 2 93  ? 169.785 233.330 185.862 1.00 334.81 ? 114 LEU D H    1 
ATOM 2644  H HA   . LEU B 2 93  ? 171.090 234.430 183.819 1.00 334.81 ? 114 LEU D HA   1 
ATOM 2645  H HB2  . LEU B 2 93  ? 169.055 233.235 183.353 1.00 334.81 ? 114 LEU D HB2  1 
ATOM 2646  H HB3  . LEU B 2 93  ? 168.215 234.366 184.418 1.00 334.81 ? 114 LEU D HB3  1 
ATOM 2647  H HG   . LEU B 2 93  ? 168.790 236.211 182.807 1.00 334.81 ? 114 LEU D HG   1 
ATOM 2648  H HD11 . LEU B 2 93  ? 169.539 235.571 180.559 1.00 334.81 ? 114 LEU D HD11 1 
ATOM 2649  H HD12 . LEU B 2 93  ? 170.752 235.167 181.796 1.00 334.81 ? 114 LEU D HD12 1 
ATOM 2650  H HD13 . LEU B 2 93  ? 169.729 233.887 181.101 1.00 334.81 ? 114 LEU D HD13 1 
ATOM 2651  H HD21 . LEU B 2 93  ? 167.099 235.513 181.145 1.00 334.81 ? 114 LEU D HD21 1 
ATOM 2652  H HD22 . LEU B 2 93  ? 167.254 233.827 181.695 1.00 334.81 ? 114 LEU D HD22 1 
ATOM 2653  H HD23 . LEU B 2 93  ? 166.599 235.065 182.794 1.00 334.81 ? 114 LEU D HD23 1 
ATOM 2654  N N    . GLY B 2 94  ? 171.251 236.809 184.336 1.00 274.94 ? 115 GLY D N    1 
ATOM 2655  C CA   . GLY B 2 94  ? 171.364 238.209 184.701 1.00 274.94 ? 115 GLY D CA   1 
ATOM 2656  C C    . GLY B 2 94  ? 171.965 239.217 183.742 1.00 274.94 ? 115 GLY D C    1 
ATOM 2657  O O    . GLY B 2 94  ? 171.251 240.024 183.147 1.00 274.94 ? 115 GLY D O    1 
ATOM 2658  H H    . GLY B 2 94  ? 171.794 236.565 183.716 1.00 329.93 ? 115 GLY D H    1 
ATOM 2659  H HA2  . GLY B 2 94  ? 170.475 238.531 184.915 1.00 329.93 ? 115 GLY D HA2  1 
ATOM 2660  H HA3  . GLY B 2 94  ? 171.886 238.257 185.518 1.00 329.93 ? 115 GLY D HA3  1 
ATOM 2661  N N    . GLU B 2 100 ? 165.307 240.930 194.126 1.00 151.47 ? 121 GLU D N    1 
ATOM 2662  C CA   . GLU B 2 100 ? 166.696 240.610 194.432 1.00 151.47 ? 121 GLU D CA   1 
ATOM 2663  C C    . GLU B 2 100 ? 167.076 240.977 195.867 1.00 151.47 ? 121 GLU D C    1 
ATOM 2664  O O    . GLU B 2 100 ? 168.128 240.564 196.355 1.00 151.47 ? 121 GLU D O    1 
ATOM 2665  C CB   . GLU B 2 100 ? 167.627 241.330 193.454 1.00 151.47 ? 121 GLU D CB   1 
ATOM 2666  C CG   . GLU B 2 100 ? 167.495 240.872 192.008 1.00 151.47 ? 121 GLU D CG   1 
ATOM 2667  C CD   . GLU B 2 100 ? 168.405 241.618 191.073 1.00 151.47 ? 121 GLU D CD   1 
ATOM 2668  O OE1  . GLU B 2 100 ? 169.069 242.524 191.517 1.00 151.47 ? 121 GLU D OE1  1 
ATOM 2669  O OE2  . GLU B 2 100 ? 168.437 241.281 189.912 1.00 151.47 ? 121 GLU D OE2  1 
ATOM 2670  H H    . GLU B 2 100 ? 165.093 241.571 193.389 1.00 181.76 ? 121 GLU D H    1 
ATOM 2671  H HA   . GLU B 2 100 ? 166.826 239.654 194.333 1.00 181.76 ? 121 GLU D HA   1 
ATOM 2672  H HB2  . GLU B 2 100 ? 167.429 242.401 193.485 1.00 181.76 ? 121 GLU D HB2  1 
ATOM 2673  H HB3  . GLU B 2 100 ? 168.662 241.179 193.759 1.00 181.76 ? 121 GLU D HB3  1 
ATOM 2674  H HG2  . GLU B 2 100 ? 167.727 239.809 191.952 1.00 181.76 ? 121 GLU D HG2  1 
ATOM 2675  H HG3  . GLU B 2 100 ? 166.463 241.008 191.688 1.00 181.76 ? 121 GLU D HG3  1 
ATOM 2676  N N    . PHE B 2 101 ? 166.224 241.751 196.544 1.00 158.22 ? 122 PHE D N    1 
ATOM 2677  C CA   . PHE B 2 101 ? 166.512 242.147 197.918 1.00 158.22 ? 122 PHE D CA   1 
ATOM 2678  C C    . PHE B 2 101 ? 166.679 240.926 198.817 1.00 158.22 ? 122 PHE D C    1 
ATOM 2679  O O    . PHE B 2 101 ? 167.639 240.839 199.591 1.00 158.22 ? 122 PHE D O    1 
ATOM 2680  C CB   . PHE B 2 101 ? 165.396 243.040 198.462 1.00 158.22 ? 122 PHE D CB   1 
ATOM 2681  C CG   . PHE B 2 101 ? 165.670 243.583 199.836 1.00 158.22 ? 122 PHE D CG   1 
ATOM 2682  C CD1  . PHE B 2 101 ? 166.521 244.664 200.013 1.00 158.22 ? 122 PHE D CD1  1 
ATOM 2683  C CD2  . PHE B 2 101 ? 165.077 243.015 200.953 1.00 158.22 ? 122 PHE D CD2  1 
ATOM 2684  C CE1  . PHE B 2 101 ? 166.774 245.164 201.276 1.00 158.22 ? 122 PHE D CE1  1 
ATOM 2685  C CE2  . PHE B 2 101 ? 165.327 243.514 202.217 1.00 158.22 ? 122 PHE D CE2  1 
ATOM 2686  C CZ   . PHE B 2 101 ? 166.177 244.590 202.378 1.00 158.22 ? 122 PHE D CZ   1 
ATOM 2687  H H    . PHE B 2 101 ? 165.483 242.063 196.240 1.00 189.86 ? 122 PHE D H    1 
ATOM 2688  H HA   . PHE B 2 101 ? 167.345 242.645 197.934 1.00 189.86 ? 122 PHE D HA   1 
ATOM 2689  H HB2  . PHE B 2 101 ? 165.242 243.882 197.788 1.00 189.86 ? 122 PHE D HB2  1 
ATOM 2690  H HB3  . PHE B 2 101 ? 164.464 242.476 198.499 1.00 189.86 ? 122 PHE D HB3  1 
ATOM 2691  H HD1  . PHE B 2 101 ? 166.992 245.119 199.141 1.00 189.86 ? 122 PHE D HD1  1 
ATOM 2692  H HD2  . PHE B 2 101 ? 164.406 242.165 200.826 1.00 189.86 ? 122 PHE D HD2  1 
ATOM 2693  H HE1  . PHE B 2 101 ? 167.445 246.014 201.401 1.00 189.86 ? 122 PHE D HE1  1 
ATOM 2694  H HE2  . PHE B 2 101 ? 164.855 243.059 203.087 1.00 189.86 ? 122 PHE D HE2  1 
ATOM 2695  H HZ   . PHE B 2 101 ? 166.377 244.983 203.374 1.00 189.86 ? 122 PHE D HZ   1 
ATOM 2696  N N    . TYR B 2 102 ? 165.746 239.978 198.732 1.00 166.56 ? 123 TYR D N    1 
ATOM 2697  C CA   . TYR B 2 102 ? 165.880 238.676 199.377 1.00 166.56 ? 123 TYR D CA   1 
ATOM 2698  C C    . TYR B 2 102 ? 166.282 237.643 198.331 1.00 166.56 ? 123 TYR D C    1 
ATOM 2699  O O    . TYR B 2 102 ? 165.537 237.394 197.377 1.00 166.56 ? 123 TYR D O    1 
ATOM 2700  C CB   . TYR B 2 102 ? 164.579 238.270 200.073 1.00 166.56 ? 123 TYR D CB   1 
ATOM 2701  C CG   . TYR B 2 102 ? 164.240 239.120 201.277 1.00 166.56 ? 123 TYR D CG   1 
ATOM 2702  C CD1  . TYR B 2 102 ? 165.097 239.153 202.366 1.00 166.56 ? 123 TYR D CD1  1 
ATOM 2703  C CD2  . TYR B 2 102 ? 163.070 239.866 201.291 1.00 166.56 ? 123 TYR D CD2  1 
ATOM 2704  C CE1  . TYR B 2 102 ? 164.787 239.930 203.466 1.00 166.56 ? 123 TYR D CE1  1 
ATOM 2705  C CE2  . TYR B 2 102 ? 162.760 240.643 202.391 1.00 166.56 ? 123 TYR D CE2  1 
ATOM 2706  C CZ   . TYR B 2 102 ? 163.624 240.673 203.480 1.00 166.56 ? 123 TYR D CZ   1 
ATOM 2707  O OH   . TYR B 2 102 ? 163.314 241.446 204.575 1.00 166.56 ? 123 TYR D OH   1 
ATOM 2708  H H    . TYR B 2 102 ? 165.010 240.070 198.296 1.00 199.87 ? 123 TYR D H    1 
ATOM 2709  H HA   . TYR B 2 102 ? 166.592 238.684 200.033 1.00 199.87 ? 123 TYR D HA   1 
ATOM 2710  H HB2  . TYR B 2 102 ? 163.752 238.335 199.365 1.00 199.87 ? 123 TYR D HB2  1 
ATOM 2711  H HB3  . TYR B 2 102 ? 164.650 237.232 200.398 1.00 199.87 ? 123 TYR D HB3  1 
ATOM 2712  H HD1  . TYR B 2 102 ? 166.016 238.568 202.355 1.00 199.87 ? 123 TYR D HD1  1 
ATOM 2713  H HD2  . TYR B 2 102 ? 162.397 239.840 200.434 1.00 199.87 ? 123 TYR D HD2  1 
ATOM 2714  H HE1  . TYR B 2 102 ? 165.461 239.957 204.322 1.00 199.87 ? 123 TYR D HE1  1 
ATOM 2715  H HE2  . TYR B 2 102 ? 161.842 241.229 202.402 1.00 199.87 ? 123 TYR D HE2  1 
ATOM 2716  H HH   . TYR B 2 102 ? 164.000 241.346 205.240 1.00 199.87 ? 123 TYR D HH   1 
ATOM 2717  N N    . GLU B 2 103 ? 167.456 237.048 198.515 1.00 182.97 ? 124 GLU D N    1 
ATOM 2718  C CA   . GLU B 2 103 ? 168.012 236.078 197.584 1.00 182.97 ? 124 GLU D CA   1 
ATOM 2719  C C    . GLU B 2 103 ? 167.517 234.676 197.923 1.00 182.97 ? 124 GLU D C    1 
ATOM 2720  O O    . GLU B 2 103 ? 167.023 234.418 199.024 1.00 182.97 ? 124 GLU D O    1 
ATOM 2721  C CB   . GLU B 2 103 ? 169.541 236.119 197.614 1.00 182.97 ? 124 GLU D CB   1 
ATOM 2722  C CG   . GLU B 2 103 ? 170.145 237.431 197.134 1.00 182.97 ? 124 GLU D CG   1 
ATOM 2723  C CD   . GLU B 2 103 ? 169.950 237.662 195.662 1.00 182.97 ? 124 GLU D CD   1 
ATOM 2724  O OE1  . GLU B 2 103 ? 169.308 236.854 195.033 1.00 182.97 ? 124 GLU D OE1  1 
ATOM 2725  O OE2  . GLU B 2 103 ? 170.443 238.646 195.164 1.00 182.97 ? 124 GLU D OE2  1 
ATOM 2726  H H    . GLU B 2 103 ? 167.970 237.202 199.186 1.00 219.56 ? 124 GLU D H    1 
ATOM 2727  H HA   . GLU B 2 103 ? 167.720 236.291 196.685 1.00 219.56 ? 124 GLU D HA   1 
ATOM 2728  H HB2  . GLU B 2 103 ? 169.890 235.942 198.631 1.00 219.56 ? 124 GLU D HB2  1 
ATOM 2729  H HB3  . GLU B 2 103 ? 169.939 235.320 196.988 1.00 219.56 ? 124 GLU D HB3  1 
ATOM 2730  H HG2  . GLU B 2 103 ? 169.684 238.252 197.683 1.00 219.56 ? 124 GLU D HG2  1 
ATOM 2731  H HG3  . GLU B 2 103 ? 171.210 237.433 197.360 1.00 219.56 ? 124 GLU D HG3  1 
ATOM 2732  N N    . ALA B 2 104 ? 167.655 233.768 196.957 1.00 190.48 ? 125 ALA D N    1 
ATOM 2733  C CA   . ALA B 2 104 ? 167.300 232.373 197.174 1.00 190.48 ? 125 ALA D CA   1 
ATOM 2734  C C    . ALA B 2 104 ? 168.336 231.667 198.040 1.00 190.48 ? 125 ALA D C    1 
ATOM 2735  O O    . ALA B 2 104 ? 169.490 232.090 198.149 1.00 190.48 ? 125 ALA D O    1 
ATOM 2736  C CB   . ALA B 2 104 ? 167.154 231.648 195.837 1.00 190.48 ? 125 ALA D CB   1 
ATOM 2737  H H    . ALA B 2 104 ? 167.954 233.938 196.170 1.00 228.58 ? 125 ALA D H    1 
ATOM 2738  H HA   . ALA B 2 104 ? 166.470 232.317 197.639 1.00 228.58 ? 125 ALA D HA   1 
ATOM 2739  H HB1  . ALA B 2 104 ? 166.955 230.713 196.007 1.00 228.58 ? 125 ALA D HB1  1 
ATOM 2740  H HB2  . ALA B 2 104 ? 166.427 232.054 195.339 1.00 228.58 ? 125 ALA D HB2  1 
ATOM 2741  H HB3  . ALA B 2 104 ? 167.982 231.725 195.341 1.00 228.58 ? 125 ALA D HB3  1 
ATOM 2742  N N    . SER B 2 105 ? 167.899 230.567 198.661 1.00 196.79 ? 126 SER D N    1 
ATOM 2743  C CA   . SER B 2 105 ? 168.686 229.841 199.654 1.00 196.79 ? 126 SER D CA   1 
ATOM 2744  C C    . SER B 2 105 ? 168.992 228.435 199.156 1.00 196.79 ? 126 SER D C    1 
ATOM 2745  O O    . SER B 2 105 ? 168.702 227.450 199.849 1.00 196.79 ? 126 SER D O    1 
ATOM 2746  C CB   . SER B 2 105 ? 167.943 229.776 200.974 1.00 196.79 ? 126 SER D CB   1 
ATOM 2747  O OG   . SER B 2 105 ? 166.714 229.118 200.827 1.00 196.79 ? 126 SER D OG   1 
ATOM 2748  H H    . SER B 2 105 ? 167.128 230.215 198.518 1.00 236.15 ? 126 SER D H    1 
ATOM 2749  H HA   . SER B 2 105 ? 169.533 230.289 199.805 1.00 236.15 ? 126 SER D HA   1 
ATOM 2750  H HB2  . SER B 2 105 ? 168.553 229.252 201.710 1.00 236.15 ? 126 SER D HB2  1 
ATOM 2751  H HB3  . SER B 2 105 ? 167.775 230.785 201.348 1.00 236.15 ? 126 SER D HB3  1 
ATOM 2752  H HG   . SER B 2 105 ? 166.588 228.609 201.631 1.00 236.15 ? 126 SER D HG   1 
ATOM 2753  N N    . PRO B 2 106 ? 169.578 228.293 197.964 1.00 198.79 ? 127 PRO D N    1 
ATOM 2754  C CA   . PRO B 2 106 ? 169.941 226.946 197.494 1.00 198.79 ? 127 PRO D CA   1 
ATOM 2755  C C    . PRO B 2 106 ? 170.953 226.268 198.396 1.00 198.79 ? 127 PRO D C    1 
ATOM 2756  O O    . PRO B 2 106 ? 171.031 225.034 198.411 1.00 198.79 ? 127 PRO D O    1 
ATOM 2757  C CB   . PRO B 2 106 ? 170.517 227.205 196.098 1.00 198.79 ? 127 PRO D CB   1 
ATOM 2758  C CG   . PRO B 2 106 ? 170.948 228.630 196.138 1.00 198.79 ? 127 PRO D CG   1 
ATOM 2759  C CD   . PRO B 2 106 ? 169.950 229.340 197.006 1.00 198.79 ? 127 PRO D CD   1 
ATOM 2760  H HA   . PRO B 2 106 ? 169.150 226.389 197.419 1.00 238.55 ? 127 PRO D HA   1 
ATOM 2761  H HB2  . PRO B 2 106 ? 171.274 226.619 195.940 1.00 238.55 ? 127 PRO D HB2  1 
ATOM 2762  H HB3  . PRO B 2 106 ? 169.829 227.070 195.426 1.00 238.55 ? 127 PRO D HB3  1 
ATOM 2763  H HG2  . PRO B 2 106 ? 171.836 228.688 196.525 1.00 238.55 ? 127 PRO D HG2  1 
ATOM 2764  H HG3  . PRO B 2 106 ? 170.943 229.001 195.244 1.00 238.55 ? 127 PRO D HG3  1 
ATOM 2765  H HD2  . PRO B 2 106 ? 170.370 230.092 197.450 1.00 238.55 ? 127 PRO D HD2  1 
ATOM 2766  H HD3  . PRO B 2 106 ? 169.185 229.619 196.480 1.00 238.55 ? 127 PRO D HD3  1 
ATOM 2767  N N    . TYR B 2 107 ? 171.728 227.047 199.151 1.00 198.12 ? 128 TYR D N    1 
ATOM 2768  C CA   . TYR B 2 107 ? 172.683 226.490 200.100 1.00 198.12 ? 128 TYR D CA   1 
ATOM 2769  C C    . TYR B 2 107 ? 171.985 225.793 201.263 1.00 198.12 ? 128 TYR D C    1 
ATOM 2770  O O    . TYR B 2 107 ? 172.545 224.873 201.870 1.00 198.12 ? 128 TYR D O    1 
ATOM 2771  C CB   . TYR B 2 107 ? 173.611 227.589 200.625 1.00 198.12 ? 128 TYR D CB   1 
ATOM 2772  C CG   . TYR B 2 107 ? 174.786 227.067 201.421 1.00 198.12 ? 128 TYR D CG   1 
ATOM 2773  C CD1  . TYR B 2 107 ? 175.669 226.166 200.843 1.00 198.12 ? 128 TYR D CD1  1 
ATOM 2774  C CD2  . TYR B 2 107 ? 174.982 227.488 202.727 1.00 198.12 ? 128 TYR D CD2  1 
ATOM 2775  C CE1  . TYR B 2 107 ? 176.743 225.689 201.570 1.00 198.12 ? 128 TYR D CE1  1 
ATOM 2776  C CE2  . TYR B 2 107 ? 176.055 227.012 203.454 1.00 198.12 ? 128 TYR D CE2  1 
ATOM 2777  C CZ   . TYR B 2 107 ? 176.934 226.116 202.880 1.00 198.12 ? 128 TYR D CZ   1 
ATOM 2778  O OH   . TYR B 2 107 ? 178.003 225.641 203.603 1.00 198.12 ? 128 TYR D OH   1 
ATOM 2779  H H    . TYR B 2 107 ? 171.729 227.906 199.129 1.00 237.74 ? 128 TYR D H    1 
ATOM 2780  H HA   . TYR B 2 107 ? 173.246 225.843 199.648 1.00 237.74 ? 128 TYR D HA   1 
ATOM 2781  H HB2  . TYR B 2 107 ? 173.998 228.169 199.786 1.00 237.74 ? 128 TYR D HB2  1 
ATOM 2782  H HB3  . TYR B 2 107 ? 173.045 228.269 201.261 1.00 237.74 ? 128 TYR D HB3  1 
ATOM 2783  H HD1  . TYR B 2 107 ? 175.516 225.834 199.816 1.00 237.74 ? 128 TYR D HD1  1 
ATOM 2784  H HD2  . TYR B 2 107 ? 174.287 228.195 203.181 1.00 237.74 ? 128 TYR D HD2  1 
ATOM 2785  H HE1  . TYR B 2 107 ? 177.437 224.981 201.116 1.00 237.74 ? 128 TYR D HE1  1 
ATOM 2786  H HE2  . TYR B 2 107 ? 176.208 227.343 204.481 1.00 237.74 ? 128 TYR D HE2  1 
ATOM 2787  H HH   . TYR B 2 107 ? 178.515 225.038 203.058 1.00 237.74 ? 128 TYR D HH   1 
ATOM 2788  N N    . GLU B 2 108 ? 170.771 226.226 201.597 1.00 222.45 ? 129 GLU D N    1 
ATOM 2789  C CA   . GLU B 2 108 ? 170.073 225.741 202.782 1.00 222.45 ? 129 GLU D CA   1 
ATOM 2790  C C    . GLU B 2 108 ? 169.853 224.227 202.729 1.00 222.45 ? 129 GLU D C    1 
ATOM 2791  O O    . GLU B 2 108 ? 169.301 223.727 201.737 1.00 222.45 ? 129 GLU D O    1 
ATOM 2792  C CB   . GLU B 2 108 ? 168.728 226.456 202.931 1.00 222.45 ? 129 GLU D CB   1 
ATOM 2793  C CG   . GLU B 2 108 ? 167.946 226.071 204.179 1.00 222.45 ? 129 GLU D CG   1 
ATOM 2794  C CD   . GLU B 2 108 ? 166.559 226.651 204.203 1.00 222.45 ? 129 GLU D CD   1 
ATOM 2795  O OE1  . GLU B 2 108 ? 166.186 227.289 203.248 1.00 222.45 ? 129 GLU D OE1  1 
ATOM 2796  O OE2  . GLU B 2 108 ? 165.872 226.456 205.177 1.00 222.45 ? 129 GLU D OE2  1 
ATOM 2797  H H    . GLU B 2 108 ? 170.326 226.812 201.151 1.00 266.94 ? 129 GLU D H    1 
ATOM 2798  H HA   . GLU B 2 108 ? 170.593 226.002 203.552 1.00 266.94 ? 129 GLU D HA   1 
ATOM 2799  H HB2  . GLU B 2 108 ? 168.890 227.534 202.958 1.00 266.94 ? 129 GLU D HB2  1 
ATOM 2800  H HB3  . GLU B 2 108 ? 168.103 226.241 202.065 1.00 266.94 ? 129 GLU D HB3  1 
ATOM 2801  H HG2  . GLU B 2 108 ? 167.873 224.984 204.228 1.00 266.94 ? 129 GLU D HG2  1 
ATOM 2802  H HG3  . GLU B 2 108 ? 168.492 226.411 205.057 1.00 266.94 ? 129 GLU D HG3  1 
ATOM 2803  N N    . PRO B 2 109 ? 170.268 223.454 203.761 1.00 215.09 ? 130 PRO D N    1 
ATOM 2804  C CA   . PRO B 2 109 ? 169.967 222.012 203.767 1.00 215.09 ? 130 PRO D CA   1 
ATOM 2805  C C    . PRO B 2 109 ? 168.502 221.716 204.074 1.00 215.09 ? 130 PRO D C    1 
ATOM 2806  O O    . PRO B 2 109 ? 168.193 221.288 205.192 1.00 215.09 ? 130 PRO D O    1 
ATOM 2807  C CB   . PRO B 2 109 ? 170.882 221.480 204.874 1.00 215.09 ? 130 PRO D CB   1 
ATOM 2808  C CG   . PRO B 2 109 ? 170.977 222.608 205.844 1.00 215.09 ? 130 PRO D CG   1 
ATOM 2809  C CD   . PRO B 2 109 ? 171.020 223.841 204.981 1.00 215.09 ? 130 PRO D CD   1 
ATOM 2810  H HA   . PRO B 2 109 ? 170.208 221.616 202.915 1.00 258.11 ? 130 PRO D HA   1 
ATOM 2811  H HB2  . PRO B 2 109 ? 170.448 220.571 205.317 1.00 258.11 ? 130 PRO D HB2  1 
ATOM 2812  H HB3  . PRO B 2 109 ? 171.858 221.197 204.452 1.00 258.11 ? 130 PRO D HB3  1 
ATOM 2813  H HG2  . PRO B 2 109 ? 170.113 222.597 206.525 1.00 258.11 ? 130 PRO D HG2  1 
ATOM 2814  H HG3  . PRO B 2 109 ? 171.876 222.497 206.469 1.00 258.11 ? 130 PRO D HG3  1 
ATOM 2815  H HD2  . PRO B 2 109 ? 170.524 224.672 205.504 1.00 258.11 ? 130 PRO D HD2  1 
ATOM 2816  H HD3  . PRO B 2 109 ? 172.066 224.094 204.754 1.00 258.11 ? 130 PRO D HD3  1 
ATOM 2817  N N    . VAL B 2 110 ? 167.611 222.044 203.124 1.00 214.80 ? 131 VAL D N    1 
ATOM 2818  C CA   . VAL B 2 110 ? 166.149 222.022 203.336 1.00 214.80 ? 131 VAL D CA   1 
ATOM 2819  C C    . VAL B 2 110 ? 165.712 220.799 204.133 1.00 214.80 ? 131 VAL D C    1 
ATOM 2820  O O    . VAL B 2 110 ? 164.868 220.902 205.033 1.00 214.80 ? 131 VAL D O    1 
ATOM 2821  C CB   . VAL B 2 110 ? 165.410 222.029 201.985 1.00 214.80 ? 131 VAL D CB   1 
ATOM 2822  C CG1  . VAL B 2 110 ? 163.923 221.783 202.191 1.00 214.80 ? 131 VAL D CG1  1 
ATOM 2823  C CG2  . VAL B 2 110 ? 165.645 223.353 201.273 1.00 214.80 ? 131 VAL D CG2  1 
ATOM 2824  H H    . VAL B 2 110 ? 167.895 222.370 202.401 1.00 257.76 ? 131 VAL D H    1 
ATOM 2825  H HA   . VAL B 2 110 ? 165.902 222.807 203.844 1.00 257.76 ? 131 VAL D HA   1 
ATOM 2826  H HB   . VAL B 2 110 ? 165.788 221.213 201.370 1.00 257.76 ? 131 VAL D HB   1 
ATOM 2827  H HG11 . VAL B 2 110 ? 163.415 221.791 201.226 1.00 257.76 ? 131 VAL D HG11 1 
ATOM 2828  H HG12 . VAL B 2 110 ? 163.776 220.815 202.669 1.00 257.76 ? 131 VAL D HG12 1 
ATOM 2829  H HG13 . VAL B 2 110 ? 163.508 222.568 202.824 1.00 257.76 ? 131 VAL D HG13 1 
ATOM 2830  H HG21 . VAL B 2 110 ? 165.119 223.350 200.318 1.00 257.76 ? 131 VAL D HG21 1 
ATOM 2831  H HG22 . VAL B 2 110 ? 165.271 224.170 201.891 1.00 257.76 ? 131 VAL D HG22 1 
ATOM 2832  H HG23 . VAL B 2 110 ? 166.712 223.488 201.099 1.00 257.76 ? 131 VAL D HG23 1 
ATOM 2833  N N    . THR B 2 111 ? 166.252 219.626 203.803 1.00 242.40 ? 132 THR D N    1 
ATOM 2834  C CA   . THR B 2 111 ? 165.842 218.395 204.469 1.00 242.40 ? 132 THR D CA   1 
ATOM 2835  C C    . THR B 2 111 ? 166.189 218.398 205.952 1.00 242.40 ? 132 THR D C    1 
ATOM 2836  O O    . THR B 2 111 ? 165.512 217.717 206.733 1.00 242.40 ? 132 THR D O    1 
ATOM 2837  C CB   . THR B 2 111 ? 166.486 217.168 203.798 1.00 242.40 ? 132 THR D CB   1 
ATOM 2838  O OG1  . THR B 2 111 ? 167.913 217.297 203.828 1.00 242.40 ? 132 THR D OG1  1 
ATOM 2839  C CG2  . THR B 2 111 ? 166.022 217.046 202.354 1.00 242.40 ? 132 THR D CG2  1 
ATOM 2840  H H    . THR B 2 111 ? 166.860 219.529 203.206 1.00 290.88 ? 132 THR D H    1 
ATOM 2841  H HA   . THR B 2 111 ? 164.879 218.312 204.388 1.00 290.88 ? 132 THR D HA   1 
ATOM 2842  H HB   . THR B 2 111 ? 166.204 216.266 204.341 1.00 290.88 ? 132 THR D HB   1 
ATOM 2843  H HG1  . THR B 2 111 ? 168.315 216.434 203.705 1.00 290.88 ? 132 THR D HG1  1 
ATOM 2844  H HG21 . THR B 2 111 ? 166.487 216.173 201.896 1.00 290.88 ? 132 THR D HG21 1 
ATOM 2845  H HG22 . THR B 2 111 ? 164.938 216.936 202.328 1.00 290.88 ? 132 THR D HG22 1 
ATOM 2846  H HG23 . THR B 2 111 ? 166.309 217.940 201.803 1.00 290.88 ? 132 THR D HG23 1 
ATOM 2847  N N    . SER B 2 112 ? 167.192 219.185 206.358 1.00 232.21 ? 133 SER D N    1 
ATOM 2848  C CA   . SER B 2 112 ? 167.569 219.277 207.763 1.00 232.21 ? 133 SER D CA   1 
ATOM 2849  C C    . SER B 2 112 ? 166.536 220.023 208.595 1.00 232.21 ? 133 SER D C    1 
ATOM 2850  O O    . SER B 2 112 ? 166.618 219.970 209.826 1.00 232.21 ? 133 SER D O    1 
ATOM 2851  C CB   . SER B 2 112 ? 168.914 219.965 207.889 1.00 232.21 ? 133 SER D CB   1 
ATOM 2852  O OG   . SER B 2 112 ? 169.932 219.187 207.320 1.00 232.21 ? 133 SER D OG   1 
ATOM 2853  H H    . SER B 2 112 ? 167.667 219.678 205.835 1.00 278.65 ? 133 SER D H    1 
ATOM 2854  H HA   . SER B 2 112 ? 167.648 218.381 208.123 1.00 278.65 ? 133 SER D HA   1 
ATOM 2855  H HB2  . SER B 2 112 ? 168.875 220.935 207.395 1.00 278.65 ? 133 SER D HB2  1 
ATOM 2856  H HB3  . SER B 2 112 ? 169.134 220.142 208.941 1.00 278.65 ? 133 SER D HB3  1 
ATOM 2857  H HG   . SER B 2 112 ? 170.661 219.788 207.151 1.00 278.65 ? 133 SER D HG   1 
ATOM 2858  N N    . ARG B 2 113 ? 165.577 220.706 207.948 1.00 214.48 ? 134 ARG D N    1 
ATOM 2859  C CA   . ARG B 2 113 ? 164.557 221.466 208.670 1.00 214.48 ? 134 ARG D CA   1 
ATOM 2860  C C    . ARG B 2 113 ? 163.868 220.603 209.714 1.00 214.48 ? 134 ARG D C    1 
ATOM 2861  O O    . ARG B 2 113 ? 163.579 221.072 210.823 1.00 214.48 ? 134 ARG D O    1 
ATOM 2862  C CB   . ARG B 2 113 ? 163.514 222.018 207.709 1.00 214.48 ? 134 ARG D CB   1 
ATOM 2863  C CG   . ARG B 2 113 ? 163.989 223.178 206.848 1.00 214.48 ? 134 ARG D CG   1 
ATOM 2864  C CD   . ARG B 2 113 ? 162.957 223.588 205.862 1.00 214.48 ? 134 ARG D CD   1 
ATOM 2865  N NE   . ARG B 2 113 ? 163.411 224.690 205.028 1.00 214.48 ? 134 ARG D NE   1 
ATOM 2866  C CZ   . ARG B 2 113 ? 162.761 225.143 203.938 1.00 214.48 ? 134 ARG D CZ   1 
ATOM 2867  N NH1  . ARG B 2 113 ? 161.634 224.579 203.564 1.00 214.48 ? 134 ARG D NH1  1 
ATOM 2868  N NH2  . ARG B 2 113 ? 163.257 226.153 203.246 1.00 214.48 ? 134 ARG D NH2  1 
ATOM 2869  H H    . ARG B 2 113 ? 165.500 220.741 207.093 1.00 257.38 ? 134 ARG D H    1 
ATOM 2870  H HA   . ARG B 2 113 ? 164.976 222.194 209.147 1.00 257.38 ? 134 ARG D HA   1 
ATOM 2871  H HB2  . ARG B 2 113 ? 163.180 221.226 207.041 1.00 257.38 ? 134 ARG D HB2  1 
ATOM 2872  H HB3  . ARG B 2 113 ? 162.645 222.360 208.272 1.00 257.38 ? 134 ARG D HB3  1 
ATOM 2873  H HG2  . ARG B 2 113 ? 164.216 224.034 207.483 1.00 257.38 ? 134 ARG D HG2  1 
ATOM 2874  H HG3  . ARG B 2 113 ? 164.886 222.882 206.302 1.00 257.38 ? 134 ARG D HG3  1 
ATOM 2875  H HD2  . ARG B 2 113 ? 162.718 222.746 205.213 1.00 257.38 ? 134 ARG D HD2  1 
ATOM 2876  H HD3  . ARG B 2 113 ? 162.058 223.907 206.388 1.00 257.38 ? 134 ARG D HD3  1 
ATOM 2877  H HE   . ARG B 2 113 ? 164.275 225.148 205.285 1.00 257.38 ? 134 ARG D HE   1 
ATOM 2878  H HH11 . ARG B 2 113 ? 161.255 223.807 204.093 1.00 257.38 ? 134 ARG D HH11 1 
ATOM 2879  H HH12 . ARG B 2 113 ? 161.147 224.919 202.747 1.00 257.38 ? 134 ARG D HH12 1 
ATOM 2880  H HH21 . ARG B 2 113 ? 164.124 226.586 203.534 1.00 257.38 ? 134 ARG D HH21 1 
ATOM 2881  H HH22 . ARG B 2 113 ? 162.770 226.492 202.429 1.00 257.38 ? 134 ARG D HH22 1 
ATOM 2882  N N    . LEU B 2 114 ? 163.619 219.332 209.376 1.00 249.78 ? 135 LEU D N    1 
ATOM 2883  C CA   . LEU B 2 114 ? 163.098 218.378 210.350 1.00 249.78 ? 135 LEU D CA   1 
ATOM 2884  C C    . LEU B 2 114 ? 164.103 218.151 211.471 1.00 249.78 ? 135 LEU D C    1 
ATOM 2885  O O    . LEU B 2 114 ? 163.763 218.286 212.657 1.00 249.78 ? 135 LEU D O    1 
ATOM 2886  C CB   . LEU B 2 114 ? 162.771 217.043 209.668 1.00 249.78 ? 135 LEU D CB   1 
ATOM 2887  C CG   . LEU B 2 114 ? 162.264 215.930 210.594 1.00 249.78 ? 135 LEU D CG   1 
ATOM 2888  C CD1  . LEU B 2 114 ? 160.974 216.376 211.267 1.00 249.78 ? 135 LEU D CD1  1 
ATOM 2889  C CD2  . LEU B 2 114 ? 162.049 214.658 209.788 1.00 249.78 ? 135 LEU D CD2  1 
ATOM 2890  H H    . LEU B 2 114 ? 163.745 219.002 208.592 1.00 299.74 ? 135 LEU D H    1 
ATOM 2891  H HA   . LEU B 2 114 ? 162.285 218.732 210.739 1.00 299.74 ? 135 LEU D HA   1 
ATOM 2892  H HB2  . LEU B 2 114 ? 162.007 217.218 208.912 1.00 299.74 ? 135 LEU D HB2  1 
ATOM 2893  H HB3  . LEU B 2 114 ? 163.669 216.677 209.170 1.00 299.74 ? 135 LEU D HB3  1 
ATOM 2894  H HG   . LEU B 2 114 ? 163.001 215.744 211.376 1.00 299.74 ? 135 LEU D HG   1 
ATOM 2895  H HD11 . LEU B 2 114 ? 160.614 215.585 211.926 1.00 299.74 ? 135 LEU D HD11 1 
ATOM 2896  H HD12 . LEU B 2 114 ? 161.161 217.277 211.853 1.00 299.74 ? 135 LEU D HD12 1 
ATOM 2897  H HD13 . LEU B 2 114 ? 160.221 216.586 210.508 1.00 299.74 ? 135 LEU D HD13 1 
ATOM 2898  H HD21 . LEU B 2 114 ? 161.690 213.866 210.447 1.00 299.74 ? 135 LEU D HD21 1 
ATOM 2899  H HD22 . LEU B 2 114 ? 161.311 214.842 209.007 1.00 299.74 ? 135 LEU D HD22 1 
ATOM 2900  H HD23 . LEU B 2 114 ? 162.991 214.351 209.333 1.00 299.74 ? 135 LEU D HD23 1 
ATOM 2901  N N    . SER B 2 115 ? 165.366 217.904 211.101 1.00 248.56 ? 136 SER D N    1 
ATOM 2902  C CA   . SER B 2 115 ? 166.427 217.738 212.089 1.00 248.56 ? 136 SER D CA   1 
ATOM 2903  C C    . SER B 2 115 ? 166.538 218.963 212.981 1.00 248.56 ? 136 SER D C    1 
ATOM 2904  O O    . SER B 2 115 ? 166.772 218.836 214.190 1.00 248.56 ? 136 SER D O    1 
ATOM 2905  C CB   . SER B 2 115 ? 167.753 217.484 211.397 1.00 248.56 ? 136 SER D CB   1 
ATOM 2906  O OG   . SER B 2 115 ? 167.732 216.267 210.704 1.00 248.56 ? 136 SER D OG   1 
ATOM 2907  H H    . SER B 2 115 ? 165.628 217.830 210.286 1.00 298.27 ? 136 SER D H    1 
ATOM 2908  H HA   . SER B 2 115 ? 166.223 216.974 212.649 1.00 298.27 ? 136 SER D HA   1 
ATOM 2909  H HB2  . SER B 2 115 ? 167.963 218.298 210.703 1.00 298.27 ? 136 SER D HB2  1 
ATOM 2910  H HB3  . SER B 2 115 ? 168.552 217.471 212.137 1.00 298.27 ? 136 SER D HB3  1 
ATOM 2911  H HG   . SER B 2 115 ? 168.593 216.185 210.288 1.00 298.27 ? 136 SER D HG   1 
ATOM 2912  N N    . ASP B 2 116 ? 166.301 220.154 212.416 1.00 231.87 ? 137 ASP D N    1 
ATOM 2913  C CA   . ASP B 2 116 ? 166.294 221.365 213.225 1.00 231.87 ? 137 ASP D CA   1 
ATOM 2914  C C    . ASP B 2 116 ? 165.232 221.279 214.308 1.00 231.87 ? 137 ASP D C    1 
ATOM 2915  O O    . ASP B 2 116 ? 165.483 221.649 215.462 1.00 231.87 ? 137 ASP D O    1 
ATOM 2916  C CB   . ASP B 2 116 ? 166.046 222.598 212.353 1.00 231.87 ? 137 ASP D CB   1 
ATOM 2917  C CG   . ASP B 2 116 ? 167.245 222.961 211.486 1.00 231.87 ? 137 ASP D CG   1 
ATOM 2918  O OD1  . ASP B 2 116 ? 168.316 222.471 211.752 1.00 231.87 ? 137 ASP D OD1  1 
ATOM 2919  O OD2  . ASP B 2 116 ? 167.077 223.726 210.566 1.00 231.87 ? 137 ASP D OD2  1 
ATOM 2920  H H    . ASP B 2 116 ? 166.131 220.279 211.586 1.00 278.24 ? 137 ASP D H    1 
ATOM 2921  H HA   . ASP B 2 116 ? 167.153 221.458 213.665 1.00 278.24 ? 137 ASP D HA   1 
ATOM 2922  H HB2  . ASP B 2 116 ? 165.188 222.419 211.704 1.00 278.24 ? 137 ASP D HB2  1 
ATOM 2923  H HB3  . ASP B 2 116 ? 165.804 223.451 212.988 1.00 278.24 ? 137 ASP D HB3  1 
ATOM 2924  N N    . ILE B 2 117 ? 164.062 220.727 213.974 1.00 235.37 ? 138 ILE D N    1 
ATOM 2925  C CA   . ILE B 2 117 ? 163.031 220.553 214.992 1.00 235.37 ? 138 ILE D CA   1 
ATOM 2926  C C    . ILE B 2 117 ? 163.518 219.564 216.042 1.00 235.37 ? 138 ILE D C    1 
ATOM 2927  O O    . ILE B 2 117 ? 163.391 219.804 217.251 1.00 235.37 ? 138 ILE D O    1 
ATOM 2928  C CB   . ILE B 2 117 ? 161.711 220.055 214.376 1.00 235.37 ? 138 ILE D CB   1 
ATOM 2929  C CG1  . ILE B 2 117 ? 161.104 221.132 213.473 1.00 235.37 ? 138 ILE D CG1  1 
ATOM 2930  C CG2  . ILE B 2 117 ? 160.730 219.658 215.469 1.00 235.37 ? 138 ILE D CG2  1 
ATOM 2931  C CD1  . ILE B 2 117 ? 159.970 220.635 212.606 1.00 235.37 ? 138 ILE D CD1  1 
ATOM 2932  H H    . ILE B 2 117 ? 163.847 220.455 213.188 1.00 282.44 ? 138 ILE D H    1 
ATOM 2933  H HA   . ILE B 2 117 ? 162.883 221.403 215.433 1.00 282.44 ? 138 ILE D HA   1 
ATOM 2934  H HB   . ILE B 2 117 ? 161.907 219.189 213.745 1.00 282.44 ? 138 ILE D HB   1 
ATOM 2935  H HG12 . ILE B 2 117 ? 160.731 221.953 214.085 1.00 282.44 ? 138 ILE D HG12 1 
ATOM 2936  H HG13 . ILE B 2 117 ? 161.877 221.539 212.821 1.00 282.44 ? 138 ILE D HG13 1 
ATOM 2937  H HG21 . ILE B 2 117 ? 159.802 219.310 215.016 1.00 282.44 ? 138 ILE D HG21 1 
ATOM 2938  H HG22 . ILE B 2 117 ? 161.161 218.860 216.072 1.00 282.44 ? 138 ILE D HG22 1 
ATOM 2939  H HG23 . ILE B 2 117 ? 160.523 220.521 216.103 1.00 282.44 ? 138 ILE D HG23 1 
ATOM 2940  H HD11 . ILE B 2 117 ? 159.592 221.454 211.994 1.00 282.44 ? 138 ILE D HD11 1 
ATOM 2941  H HD12 . ILE B 2 117 ? 160.331 219.835 211.958 1.00 282.44 ? 138 ILE D HD12 1 
ATOM 2942  H HD13 . ILE B 2 117 ? 159.168 220.256 213.238 1.00 282.44 ? 138 ILE D HD13 1 
ATOM 2943  N N    . PHE B 2 118 ? 164.166 218.482 215.596 1.00 252.59 ? 139 PHE D N    1 
ATOM 2944  C CA   . PHE B 2 118 ? 164.680 217.490 216.531 1.00 252.59 ? 139 PHE D CA   1 
ATOM 2945  C C    . PHE B 2 118 ? 165.706 218.102 217.471 1.00 252.59 ? 139 PHE D C    1 
ATOM 2946  O O    . PHE B 2 118 ? 165.705 217.792 218.671 1.00 252.59 ? 139 PHE D O    1 
ATOM 2947  C CB   . PHE B 2 118 ? 165.308 216.317 215.776 1.00 252.59 ? 139 PHE D CB   1 
ATOM 2948  C CG   . PHE B 2 118 ? 164.310 215.452 215.060 1.00 252.59 ? 139 PHE D CG   1 
ATOM 2949  C CD1  . PHE B 2 118 ? 163.010 215.335 215.530 1.00 252.59 ? 139 PHE D CD1  1 
ATOM 2950  C CD2  . PHE B 2 118 ? 164.668 214.752 213.918 1.00 252.59 ? 139 PHE D CD2  1 
ATOM 2951  C CE1  . PHE B 2 118 ? 162.091 214.539 214.873 1.00 252.59 ? 139 PHE D CE1  1 
ATOM 2952  C CE2  . PHE B 2 118 ? 163.752 213.957 213.259 1.00 252.59 ? 139 PHE D CE2  1 
ATOM 2953  C CZ   . PHE B 2 118 ? 162.461 213.850 213.737 1.00 252.59 ? 139 PHE D CZ   1 
ATOM 2954  H H    . PHE B 2 118 ? 164.318 218.306 214.767 1.00 303.11 ? 139 PHE D H    1 
ATOM 2955  H HA   . PHE B 2 118 ? 163.965 217.184 217.109 1.00 303.11 ? 139 PHE D HA   1 
ATOM 2956  H HB2  . PHE B 2 118 ? 166.018 216.696 215.041 1.00 303.11 ? 139 PHE D HB2  1 
ATOM 2957  H HB3  . PHE B 2 118 ? 165.863 215.691 216.473 1.00 303.11 ? 139 PHE D HB3  1 
ATOM 2958  H HD1  . PHE B 2 118 ? 162.717 215.880 216.427 1.00 303.11 ? 139 PHE D HD1  1 
ATOM 2959  H HD2  . PHE B 2 118 ? 165.688 214.837 213.540 1.00 303.11 ? 139 PHE D HD2  1 
ATOM 2960  H HE1  . PHE B 2 118 ? 161.073 214.456 215.253 1.00 303.11 ? 139 PHE D HE1  1 
ATOM 2961  H HE2  . PHE B 2 118 ? 164.046 213.413 212.361 1.00 303.11 ? 139 PHE D HE2  1 
ATOM 2962  H HZ   . PHE B 2 118 ? 161.738 213.222 213.219 1.00 303.11 ? 139 PHE D HZ   1 
ATOM 2963  N N    . ARG B 2 119 ? 166.565 218.999 216.962 1.00 228.62 ? 140 ARG D N    1 
ATOM 2964  C CA   . ARG B 2 119 ? 167.551 219.624 217.837 1.00 228.62 ? 140 ARG D CA   1 
ATOM 2965  C C    . ARG B 2 119 ? 166.869 220.384 218.961 1.00 228.62 ? 140 ARG D C    1 
ATOM 2966  O O    . ARG B 2 119 ? 167.358 220.367 220.097 1.00 228.62 ? 140 ARG D O    1 
ATOM 2967  C CB   . ARG B 2 119 ? 168.443 220.575 217.053 1.00 228.62 ? 140 ARG D CB   1 
ATOM 2968  C CG   . ARG B 2 119 ? 169.413 219.899 216.096 1.00 228.62 ? 140 ARG D CG   1 
ATOM 2969  C CD   . ARG B 2 119 ? 170.315 220.882 215.444 1.00 228.62 ? 140 ARG D CD   1 
ATOM 2970  N NE   . ARG B 2 119 ? 171.199 220.250 214.478 1.00 228.62 ? 140 ARG D NE   1 
ATOM 2971  C CZ   . ARG B 2 119 ? 170.934 220.131 213.162 1.00 228.62 ? 140 ARG D CZ   1 
ATOM 2972  N NH1  . ARG B 2 119 ? 169.811 220.606 212.672 1.00 228.62 ? 140 ARG D NH1  1 
ATOM 2973  N NH2  . ARG B 2 119 ? 171.805 219.538 212.364 1.00 228.62 ? 140 ARG D NH2  1 
ATOM 2974  H H    . ARG B 2 119 ? 166.593 219.252 216.140 1.00 274.34 ? 140 ARG D H    1 
ATOM 2975  H HA   . ARG B 2 119 ? 168.102 218.932 218.235 1.00 274.34 ? 140 ARG D HA   1 
ATOM 2976  H HB2  . ARG B 2 119 ? 167.825 221.255 216.469 1.00 274.34 ? 140 ARG D HB2  1 
ATOM 2977  H HB3  . ARG B 2 119 ? 169.030 221.178 217.745 1.00 274.34 ? 140 ARG D HB3  1 
ATOM 2978  H HG2  . ARG B 2 119 ? 170.025 219.183 216.644 1.00 274.34 ? 140 ARG D HG2  1 
ATOM 2979  H HG3  . ARG B 2 119 ? 168.853 219.379 215.318 1.00 274.34 ? 140 ARG D HG3  1 
ATOM 2980  H HD2  . ARG B 2 119 ? 169.721 221.632 214.922 1.00 274.34 ? 140 ARG D HD2  1 
ATOM 2981  H HD3  . ARG B 2 119 ? 170.930 221.369 216.200 1.00 274.34 ? 140 ARG D HD3  1 
ATOM 2982  H HE   . ARG B 2 119 ? 172.074 219.872 214.817 1.00 274.34 ? 140 ARG D HE   1 
ATOM 2983  H HH11 . ARG B 2 119 ? 169.145 221.060 213.282 1.00 274.34 ? 140 ARG D HH11 1 
ATOM 2984  H HH12 . ARG B 2 119 ? 169.612 220.517 211.686 1.00 274.34 ? 140 ARG D HH12 1 
ATOM 2985  H HH21 . ARG B 2 119 ? 172.669 219.173 212.741 1.00 274.34 ? 140 ARG D HH21 1 
ATOM 2986  H HH22 . ARG B 2 119 ? 171.606 219.449 211.378 1.00 274.34 ? 140 ARG D HH22 1 
ATOM 2987  N N    . LEU B 2 120 ? 165.707 220.992 218.679 1.00 224.88 ? 141 LEU D N    1 
ATOM 2988  C CA   . LEU B 2 120 ? 164.938 221.641 219.737 1.00 224.88 ? 141 LEU D CA   1 
ATOM 2989  C C    . LEU B 2 120 ? 164.477 220.632 220.776 1.00 224.88 ? 141 LEU D C    1 
ATOM 2990  O O    . LEU B 2 120 ? 164.540 220.906 221.982 1.00 224.88 ? 141 LEU D O    1 
ATOM 2991  C CB   . LEU B 2 120 ? 163.722 222.364 219.144 1.00 224.88 ? 141 LEU D CB   1 
ATOM 2992  C CG   . LEU B 2 120 ? 164.036 223.546 218.219 1.00 224.88 ? 141 LEU D CG   1 
ATOM 2993  C CD1  . LEU B 2 120 ? 162.754 224.024 217.551 1.00 224.88 ? 141 LEU D CD1  1 
ATOM 2994  C CD2  . LEU B 2 120 ? 164.683 224.664 219.024 1.00 224.88 ? 141 LEU D CD2  1 
ATOM 2995  H H    . LEU B 2 120 ? 165.353 221.040 217.897 1.00 269.86 ? 141 LEU D H    1 
ATOM 2996  H HA   . LEU B 2 120 ? 165.503 222.287 220.187 1.00 269.86 ? 141 LEU D HA   1 
ATOM 2997  H HB2  . LEU B 2 120 ? 163.134 221.645 218.575 1.00 269.86 ? 141 LEU D HB2  1 
ATOM 2998  H HB3  . LEU B 2 120 ? 163.107 222.738 219.962 1.00 269.86 ? 141 LEU D HB3  1 
ATOM 2999  H HG   . LEU B 2 120 ? 164.720 223.222 217.434 1.00 269.86 ? 141 LEU D HG   1 
ATOM 3000  H HD11 . LEU B 2 120 ? 162.978 224.864 216.893 1.00 269.86 ? 141 LEU D HD11 1 
ATOM 3001  H HD12 . LEU B 2 120 ? 162.324 223.211 216.966 1.00 269.86 ? 141 LEU D HD12 1 
ATOM 3002  H HD13 . LEU B 2 120 ? 162.043 224.340 218.313 1.00 269.86 ? 141 LEU D HD13 1 
ATOM 3003  H HD21 . LEU B 2 120 ? 164.907 225.504 218.366 1.00 269.86 ? 141 LEU D HD21 1 
ATOM 3004  H HD22 . LEU B 2 120 ? 163.999 224.989 219.808 1.00 269.86 ? 141 LEU D HD22 1 
ATOM 3005  H HD23 . LEU B 2 120 ? 165.606 224.300 219.475 1.00 269.86 ? 141 LEU D HD23 1 
ATOM 3006  N N    . ALA B 2 121 ? 164.063 219.439 220.330 1.00 257.79 ? 142 ALA D N    1 
ATOM 3007  C CA   . ALA B 2 121 ? 163.714 218.381 221.272 1.00 257.79 ? 142 ALA D CA   1 
ATOM 3008  C C    . ALA B 2 121 ? 164.915 217.999 222.125 1.00 257.79 ? 142 ALA D C    1 
ATOM 3009  O O    . ALA B 2 121 ? 164.773 217.737 223.327 1.00 257.79 ? 142 ALA D O    1 
ATOM 3010  C CB   . ALA B 2 121 ? 163.177 217.162 220.523 1.00 257.79 ? 142 ALA D CB   1 
ATOM 3011  H H    . ALA B 2 121 ? 163.978 219.224 219.501 1.00 309.35 ? 142 ALA D H    1 
ATOM 3012  H HA   . ALA B 2 121 ? 163.016 218.702 221.863 1.00 309.35 ? 142 ALA D HA   1 
ATOM 3013  H HB1  . ALA B 2 121 ? 162.891 216.496 221.168 1.00 309.35 ? 142 ALA D HB1  1 
ATOM 3014  H HB2  . ALA B 2 121 ? 162.424 217.436 219.975 1.00 309.35 ? 142 ALA D HB2  1 
ATOM 3015  H HB3  . ALA B 2 121 ? 163.879 216.798 219.962 1.00 309.35 ? 142 ALA D HB3  1 
ATOM 3016  N N    . SER B 2 122 ? 166.113 218.006 221.531 1.00 235.53 ? 143 SER D N    1 
ATOM 3017  C CA   . SER B 2 122 ? 167.305 217.606 222.269 1.00 235.53 ? 143 SER D CA   1 
ATOM 3018  C C    . SER B 2 122 ? 167.632 218.617 223.359 1.00 235.53 ? 143 SER D C    1 
ATOM 3019  O O    . SER B 2 122 ? 167.806 218.246 224.526 1.00 235.53 ? 143 SER D O    1 
ATOM 3020  C CB   . SER B 2 122 ? 168.484 217.464 221.326 1.00 235.53 ? 143 SER D CB   1 
ATOM 3021  O OG   . SER B 2 122 ? 168.296 216.390 220.446 1.00 235.53 ? 143 SER D OG   1 
ATOM 3022  H H    . SER B 2 122 ? 166.257 218.235 220.714 1.00 282.64 ? 143 SER D H    1 
ATOM 3023  H HA   . SER B 2 122 ? 167.144 216.748 222.692 1.00 282.64 ? 143 SER D HA   1 
ATOM 3024  H HB2  . SER B 2 122 ? 168.608 218.386 220.758 1.00 282.64 ? 143 SER D HB2  1 
ATOM 3025  H HB3  . SER B 2 122 ? 169.395 217.310 221.903 1.00 282.64 ? 143 SER D HB3  1 
ATOM 3026  H HG   . SER B 2 122 ? 169.078 216.365 219.888 1.00 282.64 ? 143 SER D HG   1 
ATOM 3027  N N    . ILE B 2 123 ? 167.670 219.903 223.003 1.00 223.38 ? 144 ILE D N    1 
ATOM 3028  C CA   . ILE B 2 123 ? 168.053 220.924 223.970 1.00 223.38 ? 144 ILE D CA   1 
ATOM 3029  C C    . ILE B 2 123 ? 167.016 221.008 225.082 1.00 223.38 ? 144 ILE D C    1 
ATOM 3030  O O    . ILE B 2 123 ? 167.328 221.403 226.212 1.00 223.38 ? 144 ILE D O    1 
ATOM 3031  C CB   . ILE B 2 123 ? 168.207 222.300 223.296 1.00 223.38 ? 144 ILE D CB   1 
ATOM 3032  C CG1  . ILE B 2 123 ? 168.988 223.254 224.203 1.00 223.38 ? 144 ILE D CG1  1 
ATOM 3033  C CG2  . ILE B 2 123 ? 166.843 222.881 222.956 1.00 223.38 ? 144 ILE D CG2  1 
ATOM 3034  C CD1  . ILE B 2 123 ? 170.432 222.856 224.409 1.00 223.38 ? 144 ILE D CD1  1 
ATOM 3035  H H    . ILE B 2 123 ? 167.478 220.202 222.220 1.00 268.06 ? 144 ILE D H    1 
ATOM 3036  H HA   . ILE B 2 123 ? 168.892 220.669 224.381 1.00 268.06 ? 144 ILE D HA   1 
ATOM 3037  H HB   . ILE B 2 123 ? 168.785 222.193 222.379 1.00 268.06 ? 144 ILE D HB   1 
ATOM 3038  H HG12 . ILE B 2 123 ? 168.968 224.257 223.778 1.00 268.06 ? 144 ILE D HG12 1 
ATOM 3039  H HG13 . ILE B 2 123 ? 168.506 223.304 225.180 1.00 268.06 ? 144 ILE D HG13 1 
ATOM 3040  H HG21 . ILE B 2 123 ? 166.970 223.853 222.481 1.00 268.06 ? 144 ILE D HG21 1 
ATOM 3041  H HG22 . ILE B 2 123 ? 166.322 222.210 222.274 1.00 268.06 ? 144 ILE D HG22 1 
ATOM 3042  H HG23 . ILE B 2 123 ? 166.259 222.996 223.869 1.00 268.06 ? 144 ILE D HG23 1 
ATOM 3043  H HD11 . ILE B 2 123 ? 170.919 223.580 225.063 1.00 268.06 ? 144 ILE D HD11 1 
ATOM 3044  H HD12 . ILE B 2 123 ? 170.475 221.867 224.867 1.00 268.06 ? 144 ILE D HD12 1 
ATOM 3045  H HD13 . ILE B 2 123 ? 170.943 222.834 223.448 1.00 268.06 ? 144 ILE D HD13 1 
ATOM 3046  N N    . PHE B 2 124 ? 165.766 220.639 224.785 1.00 245.47 ? 145 PHE D N    1 
ATOM 3047  C CA   . PHE B 2 124 ? 164.760 220.568 225.838 1.00 245.47 ? 145 PHE D CA   1 
ATOM 3048  C C    . PHE B 2 124 ? 165.262 219.731 227.009 1.00 245.47 ? 145 PHE D C    1 
ATOM 3049  O O    . PHE B 2 124 ? 165.050 220.084 228.175 1.00 245.47 ? 145 PHE D O    1 
ATOM 3050  C CB   . PHE B 2 124 ? 163.458 219.976 225.298 1.00 245.47 ? 145 PHE D CB   1 
ATOM 3051  C CG   . PHE B 2 124 ? 162.359 219.894 226.319 1.00 245.47 ? 145 PHE D CG   1 
ATOM 3052  C CD1  . PHE B 2 124 ? 162.264 218.803 227.171 1.00 245.47 ? 145 PHE D CD1  1 
ATOM 3053  C CD2  . PHE B 2 124 ? 161.420 220.907 226.431 1.00 245.47 ? 145 PHE D CD2  1 
ATOM 3054  C CE1  . PHE B 2 124 ? 161.254 218.726 228.110 1.00 245.47 ? 145 PHE D CE1  1 
ATOM 3055  C CE2  . PHE B 2 124 ? 160.409 220.833 227.371 1.00 245.47 ? 145 PHE D CE2  1 
ATOM 3056  C CZ   . PHE B 2 124 ? 160.326 219.742 228.210 1.00 245.47 ? 145 PHE D CZ   1 
ATOM 3057  H H    . PHE B 2 124 ? 165.478 220.436 224.002 1.00 294.56 ? 145 PHE D H    1 
ATOM 3058  H HA   . PHE B 2 124 ? 164.583 221.465 226.165 1.00 294.56 ? 145 PHE D HA   1 
ATOM 3059  H HB2  . PHE B 2 124 ? 163.102 220.580 224.464 1.00 294.56 ? 145 PHE D HB2  1 
ATOM 3060  H HB3  . PHE B 2 124 ? 163.645 218.972 224.918 1.00 294.56 ? 145 PHE D HB3  1 
ATOM 3061  H HD1  . PHE B 2 124 ? 162.998 218.000 227.092 1.00 294.56 ? 145 PHE D HD1  1 
ATOM 3062  H HD2  . PHE B 2 124 ? 161.485 221.770 225.767 1.00 294.56 ? 145 PHE D HD2  1 
ATOM 3063  H HE1  . PHE B 2 124 ? 161.190 217.863 228.773 1.00 294.56 ? 145 PHE D HE1  1 
ATOM 3064  H HE2  . PHE B 2 124 ? 159.677 221.637 227.448 1.00 294.56 ? 145 PHE D HE2  1 
ATOM 3065  H HZ   . PHE B 2 124 ? 159.530 219.683 228.952 1.00 294.56 ? 145 PHE D HZ   1 
ATOM 3066  N N    . SER B 2 125 ? 165.940 218.615 226.712 1.00 270.85 ? 146 SER D N    1 
ATOM 3067  C CA   . SER B 2 125 ? 166.475 217.749 227.758 1.00 270.85 ? 146 SER D CA   1 
ATOM 3068  C C    . SER B 2 125 ? 167.918 218.111 228.089 1.00 270.85 ? 146 SER D C    1 
ATOM 3069  O O    . SER B 2 125 ? 168.290 218.201 229.264 1.00 270.85 ? 146 SER D O    1 
ATOM 3070  C CB   . SER B 2 125 ? 166.395 216.298 227.326 1.00 270.85 ? 146 SER D CB   1 
ATOM 3071  O OG   . SER B 2 125 ? 166.937 215.452 228.303 1.00 270.85 ? 146 SER D OG   1 
ATOM 3072  H H    . SER B 2 125 ? 166.101 218.335 225.916 1.00 325.02 ? 146 SER D H    1 
ATOM 3073  H HA   . SER B 2 125 ? 165.952 217.842 228.569 1.00 325.02 ? 146 SER D HA   1 
ATOM 3074  H HB2  . SER B 2 125 ? 165.355 216.029 227.145 1.00 325.02 ? 146 SER D HB2  1 
ATOM 3075  H HB3  . SER B 2 125 ? 166.935 216.167 226.389 1.00 325.02 ? 146 SER D HB3  1 
ATOM 3076  H HG   . SER B 2 125 ? 166.850 214.560 227.959 1.00 325.02 ? 146 SER D HG   1 
ATOM 3077  N N    . GLY B 2 126 ? 168.741 218.324 227.066 1.00 225.47 ? 147 GLY D N    1 
ATOM 3078  C CA   . GLY B 2 126 ? 170.132 218.685 227.264 1.00 225.47 ? 147 GLY D CA   1 
ATOM 3079  C C    . GLY B 2 126 ? 170.980 218.432 226.033 1.00 225.47 ? 147 GLY D C    1 
ATOM 3080  O O    . GLY B 2 126 ? 170.592 217.668 225.147 1.00 225.47 ? 147 GLY D O    1 
ATOM 3081  H H    . GLY B 2 126 ? 168.510 218.264 226.241 1.00 270.56 ? 147 GLY D H    1 
ATOM 3082  H HA2  . GLY B 2 126 ? 170.193 219.627 227.489 1.00 270.56 ? 147 GLY D HA2  1 
ATOM 3083  H HA3  . GLY B 2 126 ? 170.499 218.170 227.999 1.00 270.56 ? 147 GLY D HA3  1 
ATOM 3084  N N    . SER B 2 137 ? 172.668 230.952 238.539 1.00 161.87 ? 158 SER D N    1 
ATOM 3085  C CA   . SER B 2 137 ? 173.384 229.985 237.718 1.00 161.87 ? 158 SER D CA   1 
ATOM 3086  C C    . SER B 2 137 ? 173.835 230.614 236.406 1.00 161.87 ? 158 SER D C    1 
ATOM 3087  O O    . SER B 2 137 ? 173.024 231.148 235.650 1.00 161.87 ? 158 SER D O    1 
ATOM 3088  C CB   . SER B 2 137 ? 172.504 228.782 237.438 1.00 161.87 ? 158 SER D CB   1 
ATOM 3089  O OG   . SER B 2 137 ? 172.194 228.100 238.622 1.00 161.87 ? 158 SER D OG   1 
ATOM 3090  H H    . SER B 2 137 ? 171.720 230.777 238.806 1.00 194.24 ? 158 SER D H    1 
ATOM 3091  H HA   . SER B 2 137 ? 174.174 229.684 238.196 1.00 194.24 ? 158 SER D HA   1 
ATOM 3092  H HB2  . SER B 2 137 ? 171.584 229.109 236.953 1.00 194.24 ? 158 SER D HB2  1 
ATOM 3093  H HB3  . SER B 2 137 ? 173.015 228.110 236.750 1.00 194.24 ? 158 SER D HB3  1 
ATOM 3094  H HG   . SER B 2 137 ? 171.911 227.222 238.355 1.00 194.24 ? 158 SER D HG   1 
ATOM 3095  N N    . ASN B 2 138 ? 175.138 230.548 236.141 1.00 152.37 ? 159 ASN D N    1 
ATOM 3096  C CA   . ASN B 2 138 ? 175.707 231.053 234.894 1.00 152.37 ? 159 ASN D CA   1 
ATOM 3097  C C    . ASN B 2 138 ? 175.551 229.966 233.836 1.00 152.37 ? 159 ASN D C    1 
ATOM 3098  O O    . ASN B 2 138 ? 176.386 229.066 233.712 1.00 152.37 ? 159 ASN D O    1 
ATOM 3099  C CB   . ASN B 2 138 ? 177.160 231.456 235.065 1.00 152.37 ? 159 ASN D CB   1 
ATOM 3100  C CG   . ASN B 2 138 ? 177.723 232.121 233.840 1.00 152.37 ? 159 ASN D CG   1 
ATOM 3101  O OD1  . ASN B 2 138 ? 177.347 231.790 232.710 1.00 152.37 ? 159 ASN D OD1  1 
ATOM 3102  N ND2  . ASN B 2 138 ? 178.618 233.055 234.042 1.00 152.37 ? 159 ASN D ND2  1 
ATOM 3103  H H    . ASN B 2 138 ? 175.721 230.211 236.677 1.00 182.84 ? 159 ASN D H    1 
ATOM 3104  H HA   . ASN B 2 138 ? 175.213 231.835 234.606 1.00 182.84 ? 159 ASN D HA   1 
ATOM 3105  H HB2  . ASN B 2 138 ? 177.251 232.140 235.910 1.00 182.84 ? 159 ASN D HB2  1 
ATOM 3106  H HB3  . ASN B 2 138 ? 177.758 230.573 235.292 1.00 182.84 ? 159 ASN D HB3  1 
ATOM 3107  H HD21 . ASN B 2 138 ? 179.028 233.532 233.264 1.00 182.84 ? 159 ASN D HD21 1 
ATOM 3108  H HD22 . ASN B 2 138 ? 178.893 233.291 234.973 1.00 182.84 ? 159 ASN D HD22 1 
ATOM 3109  N N    . HIS B 2 139 ? 174.462 230.047 233.068 1.00 155.92 ? 160 HIS D N    1 
ATOM 3110  C CA   . HIS B 2 139 ? 174.104 228.963 232.156 1.00 155.92 ? 160 HIS D CA   1 
ATOM 3111  C C    . HIS B 2 139 ? 175.052 228.900 230.963 1.00 155.92 ? 160 HIS D C    1 
ATOM 3112  O O    . HIS B 2 139 ? 175.349 227.811 230.455 1.00 155.92 ? 160 HIS D O    1 
ATOM 3113  C CB   . HIS B 2 139 ? 172.664 229.127 231.660 1.00 155.92 ? 160 HIS D CB   1 
ATOM 3114  C CG   . HIS B 2 139 ? 171.635 228.951 232.732 1.00 155.92 ? 160 HIS D CG   1 
ATOM 3115  N ND1  . HIS B 2 139 ? 171.372 227.731 233.319 1.00 155.92 ? 160 HIS D ND1  1 
ATOM 3116  C CD2  . HIS B 2 139 ? 170.802 229.840 233.323 1.00 155.92 ? 160 HIS D CD2  1 
ATOM 3117  C CE1  . HIS B 2 139 ? 170.422 227.878 234.226 1.00 155.92 ? 160 HIS D CE1  1 
ATOM 3118  N NE2  . HIS B 2 139 ? 170.060 229.147 234.248 1.00 155.92 ? 160 HIS D NE2  1 
ATOM 3119  H H    . HIS B 2 139 ? 173.919 230.714 233.057 1.00 187.10 ? 160 HIS D H    1 
ATOM 3120  H HA   . HIS B 2 139 ? 174.172 228.118 232.626 1.00 187.10 ? 160 HIS D HA   1 
ATOM 3121  H HB2  . HIS B 2 139 ? 172.540 230.120 231.226 1.00 187.10 ? 160 HIS D HB2  1 
ATOM 3122  H HB3  . HIS B 2 139 ? 172.465 228.400 230.873 1.00 187.10 ? 160 HIS D HB3  1 
ATOM 3123  H HD1  . HIS B 2 139 ? 171.870 226.878 233.157 1.00 187.10 ? 160 HIS D HD1  1 
ATOM 3124  H HD2  . HIS B 2 139 ? 170.647 230.911 233.191 1.00 187.10 ? 160 HIS D HD2  1 
ATOM 3125  H HE1  . HIS B 2 139 ? 170.071 227.024 234.805 1.00 187.10 ? 160 HIS D HE1  1 
ATOM 3126  N N    . CYS B 2 140 ? 175.521 230.058 230.491 1.00 158.03 ? 161 CYS D N    1 
ATOM 3127  C CA   . CYS B 2 140 ? 176.492 230.074 229.403 1.00 158.03 ? 161 CYS D CA   1 
ATOM 3128  C C    . CYS B 2 140 ? 177.813 229.461 229.840 1.00 158.03 ? 161 CYS D C    1 
ATOM 3129  O O    . CYS B 2 140 ? 178.492 228.810 229.038 1.00 158.03 ? 161 CYS D O    1 
ATOM 3130  C CB   . CYS B 2 140 ? 176.736 231.503 228.918 1.00 158.03 ? 161 CYS D CB   1 
ATOM 3131  S SG   . CYS B 2 140 ? 175.316 232.254 228.087 1.00 158.03 ? 161 CYS D SG   1 
ATOM 3132  H H    . CYS B 2 140 ? 175.294 230.836 230.780 1.00 189.64 ? 161 CYS D H    1 
ATOM 3133  H HA   . CYS B 2 140 ? 176.146 229.553 228.661 1.00 189.64 ? 161 CYS D HA   1 
ATOM 3134  H HB2  . CYS B 2 140 ? 177.004 232.135 229.765 1.00 189.64 ? 161 CYS D HB2  1 
ATOM 3135  H HB3  . CYS B 2 140 ? 177.577 231.513 228.224 1.00 189.64 ? 161 CYS D HB3  1 
ATOM 3136  N N    . LEU B 2 141 ? 178.181 229.640 231.109 1.00 142.12 ? 162 LEU D N    1 
ATOM 3137  C CA   . LEU B 2 141 ? 179.364 228.976 231.639 1.00 142.12 ? 162 LEU D CA   1 
ATOM 3138  C C    . LEU B 2 141 ? 179.196 227.463 231.610 1.00 142.12 ? 162 LEU D C    1 
ATOM 3139  O O    . LEU B 2 141 ? 180.091 226.740 231.164 1.00 142.12 ? 162 LEU D O    1 
ATOM 3140  C CB   . LEU B 2 141 ? 179.637 229.442 233.075 1.00 142.12 ? 162 LEU D CB   1 
ATOM 3141  C CG   . LEU B 2 141 ? 180.832 228.780 233.773 1.00 142.12 ? 162 LEU D CG   1 
ATOM 3142  C CD1  . LEU B 2 141 ? 182.109 229.101 233.009 1.00 142.12 ? 162 LEU D CD1  1 
ATOM 3143  C CD2  . LEU B 2 141 ? 180.916 229.272 235.211 1.00 142.12 ? 162 LEU D CD2  1 
ATOM 3144  H H    . LEU B 2 141 ? 177.766 230.137 231.674 1.00 170.54 ? 162 LEU D H    1 
ATOM 3145  H HA   . LEU B 2 141 ? 180.124 229.205 231.082 1.00 170.54 ? 162 LEU D HA   1 
ATOM 3146  H HB2  . LEU B 2 141 ? 179.813 230.516 233.064 1.00 170.54 ? 162 LEU D HB2  1 
ATOM 3147  H HB3  . LEU B 2 141 ? 178.750 229.246 233.678 1.00 170.54 ? 162 LEU D HB3  1 
ATOM 3148  H HG   . LEU B 2 141 ? 180.703 227.697 233.767 1.00 170.54 ? 162 LEU D HG   1 
ATOM 3149  H HD11 . LEU B 2 141 ? 182.958 228.631 233.505 1.00 170.54 ? 162 LEU D HD11 1 
ATOM 3150  H HD12 . LEU B 2 141 ? 182.028 228.721 231.990 1.00 170.54 ? 162 LEU D HD12 1 
ATOM 3151  H HD13 . LEU B 2 141 ? 182.256 230.180 232.984 1.00 170.54 ? 162 LEU D HD13 1 
ATOM 3152  H HD21 . LEU B 2 141 ? 181.765 228.801 235.707 1.00 170.54 ? 162 LEU D HD21 1 
ATOM 3153  H HD22 . LEU B 2 141 ? 181.046 230.355 235.217 1.00 170.54 ? 162 LEU D HD22 1 
ATOM 3154  H HD23 . LEU B 2 141 ? 179.998 229.014 235.738 1.00 170.54 ? 162 LEU D HD23 1 
ATOM 3155  N N    . ASP B 2 142 ? 178.046 226.964 232.069 1.00 141.43 ? 163 ASP D N    1 
ATOM 3156  C CA   . ASP B 2 142 ? 177.790 225.528 231.997 1.00 141.43 ? 163 ASP D CA   1 
ATOM 3157  C C    . ASP B 2 142 ? 177.872 225.029 230.558 1.00 141.43 ? 163 ASP D C    1 
ATOM 3158  O O    . ASP B 2 142 ? 178.391 223.936 230.298 1.00 141.43 ? 163 ASP D O    1 
ATOM 3159  C CB   . ASP B 2 142 ? 176.415 225.197 232.582 1.00 141.43 ? 163 ASP D CB   1 
ATOM 3160  C CG   . ASP B 2 142 ? 176.370 225.325 234.099 1.00 141.43 ? 163 ASP D CG   1 
ATOM 3161  O OD1  . ASP B 2 142 ? 177.416 225.395 234.701 1.00 141.43 ? 163 ASP D OD1  1 
ATOM 3162  O OD2  . ASP B 2 142 ? 175.291 225.352 234.641 1.00 141.43 ? 163 ASP D OD2  1 
ATOM 3163  H H    . ASP B 2 142 ? 177.413 227.426 232.423 1.00 169.72 ? 163 ASP D H    1 
ATOM 3164  H HA   . ASP B 2 142 ? 178.467 225.059 232.509 1.00 169.72 ? 163 ASP D HA   1 
ATOM 3165  H HB2  . ASP B 2 142 ? 175.667 225.865 232.153 1.00 169.72 ? 163 ASP D HB2  1 
ATOM 3166  H HB3  . ASP B 2 142 ? 176.139 224.178 232.309 1.00 169.72 ? 163 ASP D HB3  1 
ATOM 3167  N N    . ALA B 2 143 ? 177.364 225.818 229.609 1.00 139.77 ? 164 ALA D N    1 
ATOM 3168  C CA   . ALA B 2 143 ? 177.517 225.464 228.200 1.00 139.77 ? 164 ALA D CA   1 
ATOM 3169  C C    . ALA B 2 143 ? 178.990 225.399 227.813 1.00 139.77 ? 164 ALA D C    1 
ATOM 3170  O O    . ALA B 2 143 ? 179.426 224.462 227.128 1.00 139.77 ? 164 ALA D O    1 
ATOM 3171  C CB   . ALA B 2 143 ? 176.771 226.472 227.325 1.00 139.77 ? 164 ALA D CB   1 
ATOM 3172  H H    . ALA B 2 143 ? 176.937 226.550 229.752 1.00 167.72 ? 164 ALA D H    1 
ATOM 3173  H HA   . ALA B 2 143 ? 177.127 224.589 228.048 1.00 167.72 ? 164 ALA D HA   1 
ATOM 3174  H HB1  . ALA B 2 143 ? 176.876 226.221 226.393 1.00 167.72 ? 164 ALA D HB1  1 
ATOM 3175  H HB2  . ALA B 2 143 ? 175.833 226.466 227.566 1.00 167.72 ? 164 ALA D HB2  1 
ATOM 3176  H HB3  . ALA B 2 143 ? 177.146 227.356 227.473 1.00 167.72 ? 164 ALA D HB3  1 
ATOM 3177  N N    . ALA B 2 144 ? 179.774 226.390 228.247 1.00 140.83 ? 165 ALA D N    1 
ATOM 3178  C CA   . ALA B 2 144 ? 181.206 226.380 227.971 1.00 140.83 ? 165 ALA D CA   1 
ATOM 3179  C C    . ALA B 2 144 ? 181.886 225.190 228.636 1.00 140.83 ? 165 ALA D C    1 
ATOM 3180  O O    . ALA B 2 144 ? 182.745 224.543 228.029 1.00 140.83 ? 165 ALA D O    1 
ATOM 3181  C CB   . ALA B 2 144 ? 181.836 227.693 228.435 1.00 140.83 ? 165 ALA D CB   1 
ATOM 3182  H H    . ALA B 2 144 ? 179.499 227.071 228.694 1.00 169.00 ? 165 ALA D H    1 
ATOM 3183  H HA   . ALA B 2 144 ? 181.339 226.305 227.012 1.00 169.00 ? 165 ALA D HA   1 
ATOM 3184  H HB1  . ALA B 2 144 ? 182.784 227.674 228.232 1.00 169.00 ? 165 ALA D HB1  1 
ATOM 3185  H HB2  . ALA B 2 144 ? 181.412 228.427 227.965 1.00 169.00 ? 165 ALA D HB2  1 
ATOM 3186  H HB3  . ALA B 2 144 ? 181.702 227.788 229.390 1.00 169.00 ? 165 ALA D HB3  1 
ATOM 3187  N N    . LYS B 2 145 ? 181.511 224.881 229.881 1.00 150.98 ? 166 LYS D N    1 
ATOM 3188  C CA   . LYS B 2 145 ? 182.101 223.738 230.574 1.00 150.98 ? 166 LYS D CA   1 
ATOM 3189  C C    . LYS B 2 145 ? 181.786 222.440 229.847 1.00 150.98 ? 166 LYS D C    1 
ATOM 3190  O O    . LYS B 2 145 ? 182.644 221.557 229.730 1.00 150.98 ? 166 LYS D O    1 
ATOM 3191  C CB   . LYS B 2 145 ? 181.603 223.667 232.018 1.00 150.98 ? 166 LYS D CB   1 
ATOM 3192  C CG   . LYS B 2 145 ? 182.138 224.768 232.924 1.00 150.98 ? 166 LYS D CG   1 
ATOM 3193  C CD   . LYS B 2 145 ? 181.790 224.503 234.381 1.00 150.98 ? 166 LYS D CD   1 
ATOM 3194  C CE   . LYS B 2 145 ? 180.304 224.705 234.641 1.00 150.98 ? 166 LYS D CE   1 
ATOM 3195  N NZ   . LYS B 2 145 ? 179.973 224.598 236.088 1.00 150.98 ? 166 LYS D NZ   1 
ATOM 3196  H H    . LYS B 2 145 ? 180.925 225.310 230.340 1.00 181.18 ? 166 LYS D H    1 
ATOM 3197  H HA   . LYS B 2 145 ? 183.065 223.842 230.598 1.00 181.18 ? 166 LYS D HA   1 
ATOM 3198  H HB2  . LYS B 2 145 ? 180.514 223.723 232.031 1.00 181.18 ? 166 LYS D HB2  1 
ATOM 3199  H HB3  . LYS B 2 145 ? 181.886 222.708 232.454 1.00 181.18 ? 166 LYS D HB3  1 
ATOM 3200  H HG2  . LYS B 2 145 ? 183.223 224.827 232.823 1.00 181.18 ? 166 LYS D HG2  1 
ATOM 3201  H HG3  . LYS B 2 145 ? 181.711 225.724 232.625 1.00 181.18 ? 166 LYS D HG3  1 
ATOM 3202  H HD2  . LYS B 2 145 ? 182.059 223.479 234.640 1.00 181.18 ? 166 LYS D HD2  1 
ATOM 3203  H HD3  . LYS B 2 145 ? 182.356 225.182 235.019 1.00 181.18 ? 166 LYS D HD3  1 
ATOM 3204  H HE2  . LYS B 2 145 ? 180.003 225.689 234.283 1.00 181.18 ? 166 LYS D HE2  1 
ATOM 3205  H HE3  . LYS B 2 145 ? 179.734 223.955 234.094 1.00 181.18 ? 166 LYS D HE3  1 
ATOM 3206  H HZ1  . LYS B 2 145 ? 178.980 224.738 236.217 1.00 181.18 ? 166 LYS D HZ1  1 
ATOM 3207  H HZ2  . LYS B 2 145 ? 180.231 223.682 236.426 1.00 181.18 ? 166 LYS D HZ2  1 
ATOM 3208  H HZ3  . LYS B 2 145 ? 180.481 225.303 236.603 1.00 181.18 ? 166 LYS D HZ3  1 
ATOM 3209  N N    . ALA B 2 146 ? 180.547 222.303 229.361 1.00 147.17 ? 167 ALA D N    1 
ATOM 3210  C CA   . ALA B 2 146 ? 180.174 221.139 228.563 1.00 147.17 ? 167 ALA D CA   1 
ATOM 3211  C C    . ALA B 2 146 ? 181.072 220.994 227.341 1.00 147.17 ? 167 ALA D C    1 
ATOM 3212  O O    . ALA B 2 146 ? 181.484 219.881 226.990 1.00 147.17 ? 167 ALA D O    1 
ATOM 3213  C CB   . ALA B 2 146 ? 178.709 221.241 228.142 1.00 147.17 ? 167 ALA D CB   1 
ATOM 3214  H H    . ALA B 2 146 ? 179.914 222.873 229.479 1.00 176.60 ? 167 ALA D H    1 
ATOM 3215  H HA   . ALA B 2 146 ? 180.278 220.343 229.105 1.00 176.60 ? 167 ALA D HA   1 
ATOM 3216  H HB1  . ALA B 2 146 ? 178.483 220.462 227.613 1.00 176.60 ? 167 ALA D HB1  1 
ATOM 3217  H HB2  . ALA B 2 146 ? 178.155 221.276 228.937 1.00 176.60 ? 167 ALA D HB2  1 
ATOM 3218  H HB3  . ALA B 2 146 ? 178.587 222.047 227.616 1.00 176.60 ? 167 ALA D HB3  1 
ATOM 3219  N N    . CYS B 2 147 ? 181.386 222.108 226.677 1.00 145.89 ? 168 CYS D N    1 
ATOM 3220  C CA   . CYS B 2 147 ? 182.329 222.056 225.563 1.00 145.89 ? 168 CYS D CA   1 
ATOM 3221  C C    . CYS B 2 147 ? 183.725 221.662 226.039 1.00 145.89 ? 168 CYS D C    1 
ATOM 3222  O O    . CYS B 2 147 ? 184.371 220.791 225.444 1.00 145.89 ? 168 CYS D O    1 
ATOM 3223  C CB   . CYS B 2 147 ? 182.401 223.410 224.856 1.00 145.89 ? 168 CYS D CB   1 
ATOM 3224  S SG   . CYS B 2 147 ? 183.518 223.442 223.434 1.00 145.89 ? 168 CYS D SG   1 
ATOM 3225  H H    . CYS B 2 147 ? 181.075 222.892 226.850 1.00 175.07 ? 168 CYS D H    1 
ATOM 3226  H HA   . CYS B 2 147 ? 182.031 221.388 224.927 1.00 175.07 ? 168 CYS D HA   1 
ATOM 3227  H HB2  . CYS B 2 147 ? 181.407 223.694 224.511 1.00 175.07 ? 168 CYS D HB2  1 
ATOM 3228  H HB3  . CYS B 2 147 ? 182.732 224.172 225.562 1.00 175.07 ? 168 CYS D HB3  1 
ATOM 3229  N N    . ASN B 2 148 ? 184.207 222.293 227.115 1.00 145.16 ? 169 ASN D N    1 
ATOM 3230  C CA   . ASN B 2 148 ? 185.555 222.014 227.599 1.00 145.16 ? 169 ASN D CA   1 
ATOM 3231  C C    . ASN B 2 148 ? 185.756 220.536 227.902 1.00 145.16 ? 169 ASN D C    1 
ATOM 3232  O O    . ASN B 2 148 ? 186.869 220.020 227.758 1.00 145.16 ? 169 ASN D O    1 
ATOM 3233  C CB   . ASN B 2 148 ? 185.860 222.850 228.828 1.00 145.16 ? 169 ASN D CB   1 
ATOM 3234  C CG   . ASN B 2 148 ? 186.077 224.301 228.500 1.00 145.16 ? 169 ASN D CG   1 
ATOM 3235  O OD1  . ASN B 2 148 ? 186.324 224.658 227.342 1.00 145.16 ? 169 ASN D OD1  1 
ATOM 3236  N ND2  . ASN B 2 148 ? 185.991 225.145 229.497 1.00 145.16 ? 169 ASN D ND2  1 
ATOM 3237  H H    . ASN B 2 148 ? 183.778 222.880 227.574 1.00 174.19 ? 169 ASN D H    1 
ATOM 3238  H HA   . ASN B 2 148 ? 186.194 222.268 226.916 1.00 174.19 ? 169 ASN D HA   1 
ATOM 3239  H HB2  . ASN B 2 148 ? 185.035 222.770 229.537 1.00 174.19 ? 169 ASN D HB2  1 
ATOM 3240  H HB3  . ASN B 2 148 ? 186.752 222.463 229.320 1.00 174.19 ? 169 ASN D HB3  1 
ATOM 3241  H HD21 . ASN B 2 148 ? 186.127 226.123 229.337 1.00 174.19 ? 169 ASN D HD21 1 
ATOM 3242  H HD22 . ASN B 2 148 ? 185.790 224.812 230.417 1.00 174.19 ? 169 ASN D HD22 1 
ATOM 3243  N N    . LEU B 2 149 ? 184.700 219.841 228.321 1.00 165.02 ? 170 LEU D N    1 
ATOM 3244  C CA   . LEU B 2 149 ? 184.790 218.412 228.589 1.00 165.02 ? 170 LEU D CA   1 
ATOM 3245  C C    . LEU B 2 149 ? 184.655 217.553 227.337 1.00 165.02 ? 170 LEU D C    1 
ATOM 3246  O O    . LEU B 2 149 ? 184.893 216.343 227.416 1.00 165.02 ? 170 LEU D O    1 
ATOM 3247  C CB   . LEU B 2 149 ? 183.707 218.010 229.598 1.00 165.02 ? 170 LEU D CB   1 
ATOM 3248  C CG   . LEU B 2 149 ? 183.799 218.678 230.975 1.00 165.02 ? 170 LEU D CG   1 
ATOM 3249  C CD1  . LEU B 2 149 ? 182.588 218.288 231.812 1.00 165.02 ? 170 LEU D CD1  1 
ATOM 3250  C CD2  . LEU B 2 149 ? 185.093 218.259 231.658 1.00 165.02 ? 170 LEU D CD2  1 
ATOM 3251  H H    . LEU B 2 149 ? 183.919 220.176 228.455 1.00 198.02 ? 170 LEU D H    1 
ATOM 3252  H HA   . LEU B 2 149 ? 185.663 218.224 228.964 1.00 198.02 ? 170 LEU D HA   1 
ATOM 3253  H HB2  . LEU B 2 149 ? 182.733 218.253 229.176 1.00 198.02 ? 170 LEU D HB2  1 
ATOM 3254  H HB3  . LEU B 2 149 ? 183.756 216.931 229.749 1.00 198.02 ? 170 LEU D HB3  1 
ATOM 3255  H HG   . LEU B 2 149 ? 183.786 219.762 230.856 1.00 198.02 ? 170 LEU D HG   1 
ATOM 3256  H HD11 . LEU B 2 149 ? 182.653 218.763 232.791 1.00 198.02 ? 170 LEU D HD11 1 
ATOM 3257  H HD12 . LEU B 2 149 ? 181.678 218.617 231.310 1.00 198.02 ? 170 LEU D HD12 1 
ATOM 3258  H HD13 . LEU B 2 149 ? 182.564 217.206 231.935 1.00 198.02 ? 170 LEU D HD13 1 
ATOM 3259  H HD21 . LEU B 2 149 ? 185.158 218.735 232.636 1.00 198.02 ? 170 LEU D HD21 1 
ATOM 3260  H HD22 . LEU B 2 149 ? 185.106 217.176 231.779 1.00 198.02 ? 170 LEU D HD22 1 
ATOM 3261  H HD23 . LEU B 2 149 ? 185.942 218.566 231.047 1.00 198.02 ? 170 LEU D HD23 1 
ATOM 3262  N N    . ASN B 2 150 ? 184.283 218.134 226.195 1.00 152.11 ? 171 ASN D N    1 
ATOM 3263  C CA   . ASN B 2 150 ? 184.110 217.388 224.952 1.00 152.11 ? 171 ASN D CA   1 
ATOM 3264  C C    . ASN B 2 150 ? 185.392 217.530 224.140 1.00 152.11 ? 171 ASN D C    1 
ATOM 3265  O O    . ASN B 2 150 ? 185.736 218.631 223.698 1.00 152.11 ? 171 ASN D O    1 
ATOM 3266  C CB   . ASN B 2 150 ? 182.902 217.874 224.172 1.00 152.11 ? 171 ASN D CB   1 
ATOM 3267  C CG   . ASN B 2 150 ? 182.657 217.069 222.925 1.00 152.11 ? 171 ASN D CG   1 
ATOM 3268  O OD1  . ASN B 2 150 ? 183.306 217.284 221.895 1.00 152.11 ? 171 ASN D OD1  1 
ATOM 3269  N ND2  . ASN B 2 150 ? 181.732 216.146 222.999 1.00 152.11 ? 171 ASN D ND2  1 
ATOM 3270  H H    . ASN B 2 150 ? 184.122 218.975 226.112 1.00 182.53 ? 171 ASN D H    1 
ATOM 3271  H HA   . ASN B 2 150 ? 183.971 216.448 225.141 1.00 182.53 ? 171 ASN D HA   1 
ATOM 3272  H HB2  . ASN B 2 150 ? 182.015 217.822 224.804 1.00 182.53 ? 171 ASN D HB2  1 
ATOM 3273  H HB3  . ASN B 2 150 ? 183.045 218.918 223.893 1.00 182.53 ? 171 ASN D HB3  1 
ATOM 3274  H HD21 . ASN B 2 150 ? 181.526 215.580 222.201 1.00 182.53 ? 171 ASN D HD21 1 
ATOM 3275  H HD22 . ASN B 2 150 ? 181.232 216.007 223.853 1.00 182.53 ? 171 ASN D HD22 1 
ATOM 3276  N N    . ASP B 2 151 ? 186.098 216.415 223.946 1.00 160.82 ? 172 ASP D N    1 
ATOM 3277  C CA   . ASP B 2 151 ? 187.418 216.475 223.332 1.00 160.82 ? 172 ASP D CA   1 
ATOM 3278  C C    . ASP B 2 151 ? 187.369 217.160 221.973 1.00 160.82 ? 172 ASP D C    1 
ATOM 3279  O O    . ASP B 2 151 ? 188.278 217.920 221.623 1.00 160.82 ? 172 ASP D O    1 
ATOM 3280  C CB   . ASP B 2 151 ? 188.001 215.068 223.179 1.00 160.82 ? 172 ASP D CB   1 
ATOM 3281  C CG   . ASP B 2 151 ? 188.401 214.444 224.509 1.00 160.82 ? 172 ASP D CG   1 
ATOM 3282  O OD1  . ASP B 2 151 ? 188.469 215.158 225.481 1.00 160.82 ? 172 ASP D OD1  1 
ATOM 3283  O OD2  . ASP B 2 151 ? 188.634 213.259 224.541 1.00 160.82 ? 172 ASP D OD2  1 
ATOM 3284  H H    . ASP B 2 151 ? 185.837 215.624 224.161 1.00 192.98 ? 172 ASP D H    1 
ATOM 3285  H HA   . ASP B 2 151 ? 188.007 216.996 223.901 1.00 192.98 ? 172 ASP D HA   1 
ATOM 3286  H HB2  . ASP B 2 151 ? 187.268 214.421 222.697 1.00 192.98 ? 172 ASP D HB2  1 
ATOM 3287  H HB3  . ASP B 2 151 ? 188.879 215.106 222.533 1.00 192.98 ? 172 ASP D HB3  1 
ATOM 3288  N N    . ASN B 2 152 ? 186.310 216.924 221.197 1.00 139.91 ? 173 ASN D N    1 
ATOM 3289  C CA   . ASN B 2 152 ? 186.205 217.535 219.874 1.00 139.91 ? 173 ASN D CA   1 
ATOM 3290  C C    . ASN B 2 152 ? 185.892 219.025 219.971 1.00 139.91 ? 173 ASN D C    1 
ATOM 3291  O O    . ASN B 2 152 ? 186.590 219.861 219.376 1.00 139.91 ? 173 ASN D O    1 
ATOM 3292  C CB   . ASN B 2 152 ? 185.155 216.823 219.041 1.00 139.91 ? 173 ASN D CB   1 
ATOM 3293  C CG   . ASN B 2 152 ? 185.108 217.322 217.623 1.00 139.91 ? 173 ASN D CG   1 
ATOM 3294  O OD1  . ASN B 2 152 ? 186.142 217.658 217.035 1.00 139.91 ? 173 ASN D OD1  1 
ATOM 3295  N ND2  . ASN B 2 152 ? 183.926 217.376 217.063 1.00 139.91 ? 173 ASN D ND2  1 
ATOM 3296  H H    . ASN B 2 152 ? 185.647 216.420 221.412 1.00 167.89 ? 173 ASN D H    1 
ATOM 3297  H HA   . ASN B 2 152 ? 187.052 217.437 219.413 1.00 167.89 ? 173 ASN D HA   1 
ATOM 3298  H HB2  . ASN B 2 152 ? 185.363 215.753 219.031 1.00 167.89 ? 173 ASN D HB2  1 
ATOM 3299  H HB3  . ASN B 2 152 ? 184.174 216.962 219.496 1.00 167.89 ? 173 ASN D HB3  1 
ATOM 3300  H HD21 . ASN B 2 152 ? 183.834 217.700 216.121 1.00 167.89 ? 173 ASN D HD21 1 
ATOM 3301  H HD22 . ASN B 2 152 ? 183.116 217.094 217.576 1.00 167.89 ? 173 ASN D HD22 1 
ATOM 3302  N N    . CYS B 2 153 ? 184.823 219.373 220.696 1.00 153.47 ? 174 CYS D N    1 
ATOM 3303  C CA   . CYS B 2 153 ? 184.428 220.770 220.839 1.00 153.47 ? 174 CYS D CA   1 
ATOM 3304  C C    . CYS B 2 153 ? 185.531 221.575 221.511 1.00 153.47 ? 174 CYS D C    1 
ATOM 3305  O O    . CYS B 2 153 ? 185.913 222.646 221.025 1.00 153.47 ? 174 CYS D O    1 
ATOM 3306  C CB   . CYS B 2 153 ? 183.143 220.888 221.658 1.00 153.47 ? 174 CYS D CB   1 
ATOM 3307  S SG   . CYS B 2 153 ? 182.541 222.584 221.848 1.00 153.47 ? 174 CYS D SG   1 
ATOM 3308  H H    . CYS B 2 153 ? 184.313 218.817 221.110 1.00 184.16 ? 174 CYS D H    1 
ATOM 3309  H HA   . CYS B 2 153 ? 184.271 221.148 219.961 1.00 184.16 ? 174 CYS D HA   1 
ATOM 3310  H HB2  . CYS B 2 153 ? 182.355 220.301 221.186 1.00 184.16 ? 174 CYS D HB2  1 
ATOM 3311  H HB3  . CYS B 2 153 ? 183.306 220.475 222.654 1.00 184.16 ? 174 CYS D HB3  1 
ATOM 3312  N N    . LYS B 2 154 ? 186.047 221.069 222.635 1.00 148.14 ? 175 LYS D N    1 
ATOM 3313  C CA   . LYS B 2 154 ? 187.107 221.754 223.371 1.00 148.14 ? 175 LYS D CA   1 
ATOM 3314  C C    . LYS B 2 154 ? 188.309 222.025 222.478 1.00 148.14 ? 175 LYS D C    1 
ATOM 3315  O O    . LYS B 2 154 ? 188.857 223.134 222.468 1.00 148.14 ? 175 LYS D O    1 
ATOM 3316  C CB   . LYS B 2 154 ? 187.533 220.933 224.589 1.00 148.14 ? 175 LYS D CB   1 
ATOM 3317  C CG   . LYS B 2 154 ? 188.629 221.576 225.429 1.00 148.14 ? 175 LYS D CG   1 
ATOM 3318  C CD   . LYS B 2 154 ? 189.984 220.947 225.142 1.00 148.14 ? 175 LYS D CD   1 
ATOM 3319  C CE   . LYS B 2 154 ? 190.099 219.566 225.771 1.00 148.14 ? 175 LYS D CE   1 
ATOM 3320  N NZ   . LYS B 2 154 ? 191.403 218.920 225.459 1.00 148.14 ? 175 LYS D NZ   1 
ATOM 3321  H H    . LYS B 2 154 ? 185.796 220.329 222.992 1.00 177.77 ? 175 LYS D H    1 
ATOM 3322  H HA   . LYS B 2 154 ? 186.772 222.604 223.698 1.00 177.77 ? 175 LYS D HA   1 
ATOM 3323  H HB2  . LYS B 2 154 ? 186.670 220.767 225.236 1.00 177.77 ? 175 LYS D HB2  1 
ATOM 3324  H HB3  . LYS B 2 154 ? 187.890 219.956 224.263 1.00 177.77 ? 175 LYS D HB3  1 
ATOM 3325  H HG2  . LYS B 2 154 ? 188.679 222.643 225.208 1.00 177.77 ? 175 LYS D HG2  1 
ATOM 3326  H HG3  . LYS B 2 154 ? 188.397 221.452 226.486 1.00 177.77 ? 175 LYS D HG3  1 
ATOM 3327  H HD2  . LYS B 2 154 ? 190.124 220.859 224.064 1.00 177.77 ? 175 LYS D HD2  1 
ATOM 3328  H HD3  . LYS B 2 154 ? 190.773 221.585 225.542 1.00 177.77 ? 175 LYS D HD3  1 
ATOM 3329  H HE2  . LYS B 2 154 ? 189.998 219.650 226.852 1.00 177.77 ? 175 LYS D HE2  1 
ATOM 3330  H HE3  . LYS B 2 154 ? 189.295 218.930 225.401 1.00 177.77 ? 175 LYS D HE3  1 
ATOM 3331  H HZ1  . LYS B 2 154 ? 191.439 218.008 225.893 1.00 177.77 ? 175 LYS D HZ1  1 
ATOM 3332  H HZ2  . LYS B 2 154 ? 191.500 218.820 224.459 1.00 177.77 ? 175 LYS D HZ2  1 
ATOM 3333  H HZ3  . LYS B 2 154 ? 192.156 219.491 225.815 1.00 177.77 ? 175 LYS D HZ3  1 
ATOM 3334  N N    . LYS B 2 155 ? 188.743 221.009 221.729 1.00 145.68 ? 176 LYS D N    1 
ATOM 3335  C CA   . LYS B 2 155 ? 189.871 221.175 220.821 1.00 145.68 ? 176 LYS D CA   1 
ATOM 3336  C C    . LYS B 2 155 ? 189.551 222.186 219.732 1.00 145.68 ? 176 LYS D C    1 
ATOM 3337  O O    . LYS B 2 155 ? 190.338 223.101 219.479 1.00 145.68 ? 176 LYS D O    1 
ATOM 3338  C CB   . LYS B 2 155 ? 190.260 219.834 220.197 1.00 145.68 ? 176 LYS D CB   1 
ATOM 3339  C CG   . LYS B 2 155 ? 191.440 219.906 219.237 1.00 145.68 ? 176 LYS D CG   1 
ATOM 3340  C CD   . LYS B 2 155 ? 191.802 218.529 218.701 1.00 145.68 ? 176 LYS D CD   1 
ATOM 3341  C CE   . LYS B 2 155 ? 192.874 218.617 217.625 1.00 145.68 ? 176 LYS D CE   1 
ATOM 3342  N NZ   . LYS B 2 155 ? 194.165 219.123 218.165 1.00 145.68 ? 176 LYS D NZ   1 
ATOM 3343  H H    . LYS B 2 155 ? 188.400 220.220 221.730 1.00 174.82 ? 176 LYS D H    1 
ATOM 3344  H HA   . LYS B 2 155 ? 190.632 221.507 221.323 1.00 174.82 ? 176 LYS D HA   1 
ATOM 3345  H HB2  . LYS B 2 155 ? 190.514 219.125 220.985 1.00 174.82 ? 176 LYS D HB2  1 
ATOM 3346  H HB3  . LYS B 2 155 ? 189.409 219.426 219.651 1.00 174.82 ? 176 LYS D HB3  1 
ATOM 3347  H HG2  . LYS B 2 155 ? 191.189 220.558 218.399 1.00 174.82 ? 176 LYS D HG2  1 
ATOM 3348  H HG3  . LYS B 2 155 ? 192.304 220.325 219.753 1.00 174.82 ? 176 LYS D HG3  1 
ATOM 3349  H HD2  . LYS B 2 155 ? 192.169 217.906 219.518 1.00 174.82 ? 176 LYS D HD2  1 
ATOM 3350  H HD3  . LYS B 2 155 ? 190.914 218.059 218.278 1.00 174.82 ? 176 LYS D HD3  1 
ATOM 3351  H HE2  . LYS B 2 155 ? 193.036 217.631 217.192 1.00 174.82 ? 176 LYS D HE2  1 
ATOM 3352  H HE3  . LYS B 2 155 ? 192.540 219.287 216.832 1.00 174.82 ? 176 LYS D HE3  1 
ATOM 3353  H HZ1  . LYS B 2 155 ? 194.848 219.166 217.422 1.00 174.82 ? 176 LYS D HZ1  1 
ATOM 3354  H HZ2  . LYS B 2 155 ? 194.030 220.046 218.553 1.00 174.82 ? 176 LYS D HZ2  1 
ATOM 3355  H HZ3  . LYS B 2 155 ? 194.495 218.499 218.888 1.00 174.82 ? 176 LYS D HZ3  1 
ATOM 3356  N N    . LEU B 2 156 ? 188.399 222.039 219.072 1.00 126.14 ? 177 LEU D N    1 
ATOM 3357  C CA   . LEU B 2 156 ? 188.033 223.004 218.036 1.00 126.14 ? 177 LEU D CA   1 
ATOM 3358  C C    . LEU B 2 156 ? 187.883 224.405 218.622 1.00 126.14 ? 177 LEU D C    1 
ATOM 3359  O O    . LEU B 2 156 ? 188.447 225.378 218.094 1.00 126.14 ? 177 LEU D O    1 
ATOM 3360  C CB   . LEU B 2 156 ? 186.724 222.584 217.357 1.00 126.14 ? 177 LEU D CB   1 
ATOM 3361  C CG   . LEU B 2 156 ? 186.803 221.330 216.477 1.00 126.14 ? 177 LEU D CG   1 
ATOM 3362  C CD1  . LEU B 2 156 ? 185.396 220.853 216.143 1.00 126.14 ? 177 LEU D CD1  1 
ATOM 3363  C CD2  . LEU B 2 156 ? 187.588 221.645 215.212 1.00 126.14 ? 177 LEU D CD2  1 
ATOM 3364  H H    . LEU B 2 156 ? 187.827 221.409 219.201 1.00 151.37 ? 177 LEU D H    1 
ATOM 3365  H HA   . LEU B 2 156 ? 188.742 223.041 217.377 1.00 151.37 ? 177 LEU D HA   1 
ATOM 3366  H HB2  . LEU B 2 156 ? 185.975 222.402 218.126 1.00 151.37 ? 177 LEU D HB2  1 
ATOM 3367  H HB3  . LEU B 2 156 ? 186.378 223.407 216.730 1.00 151.37 ? 177 LEU D HB3  1 
ATOM 3368  H HG   . LEU B 2 156 ? 187.304 220.532 217.026 1.00 151.37 ? 177 LEU D HG   1 
ATOM 3369  H HD11 . LEU B 2 156 ? 185.453 219.962 215.519 1.00 151.37 ? 177 LEU D HD11 1 
ATOM 3370  H HD12 . LEU B 2 156 ? 184.864 220.616 217.065 1.00 151.37 ? 177 LEU D HD12 1 
ATOM 3371  H HD13 . LEU B 2 156 ? 184.864 221.638 215.608 1.00 151.37 ? 177 LEU D HD13 1 
ATOM 3372  H HD21 . LEU B 2 156 ? 187.645 220.753 214.588 1.00 151.37 ? 177 LEU D HD21 1 
ATOM 3373  H HD22 . LEU B 2 156 ? 187.087 222.442 214.662 1.00 151.37 ? 177 LEU D HD22 1 
ATOM 3374  H HD23 . LEU B 2 156 ? 188.595 221.966 215.480 1.00 151.37 ? 177 LEU D HD23 1 
ATOM 3375  N N    . ARG B 2 157 ? 187.145 224.519 219.730 1.00 140.23 ? 178 ARG D N    1 
ATOM 3376  C CA   . ARG B 2 157 ? 186.916 225.805 220.373 1.00 140.23 ? 178 ARG D CA   1 
ATOM 3377  C C    . ARG B 2 157 ? 188.228 226.487 220.727 1.00 140.23 ? 178 ARG D C    1 
ATOM 3378  O O    . ARG B 2 157 ? 188.449 227.649 220.380 1.00 140.23 ? 178 ARG D O    1 
ATOM 3379  C CB   . ARG B 2 157 ? 186.083 225.632 221.635 1.00 140.23 ? 178 ARG D CB   1 
ATOM 3380  C CG   . ARG B 2 157 ? 185.799 226.918 222.395 1.00 140.23 ? 178 ARG D CG   1 
ATOM 3381  C CD   . ARG B 2 157 ? 184.774 226.716 223.451 1.00 140.23 ? 178 ARG D CD   1 
ATOM 3382  N NE   . ARG B 2 157 ? 184.511 227.939 224.191 1.00 140.23 ? 178 ARG D NE   1 
ATOM 3383  C CZ   . ARG B 2 157 ? 185.074 228.254 225.374 1.00 140.23 ? 178 ARG D CZ   1 
ATOM 3384  N NH1  . ARG B 2 157 ? 185.927 227.427 225.937 1.00 140.23 ? 178 ARG D NH1  1 
ATOM 3385  N NH2  . ARG B 2 157 ? 184.768 229.394 225.969 1.00 140.23 ? 178 ARG D NH2  1 
ATOM 3386  H H    . ARG B 2 157 ? 186.766 223.858 220.128 1.00 168.28 ? 178 ARG D H    1 
ATOM 3387  H HA   . ARG B 2 157 ? 186.456 226.398 219.766 1.00 168.28 ? 178 ARG D HA   1 
ATOM 3388  H HB2  . ARG B 2 157 ? 185.125 225.182 221.379 1.00 168.28 ? 178 ARG D HB2  1 
ATOM 3389  H HB3  . ARG B 2 157 ? 186.593 224.951 222.317 1.00 168.28 ? 178 ARG D HB3  1 
ATOM 3390  H HG2  . ARG B 2 157 ? 186.715 227.270 222.869 1.00 168.28 ? 178 ARG D HG2  1 
ATOM 3391  H HG3  . ARG B 2 157 ? 185.433 227.677 221.702 1.00 168.28 ? 178 ARG D HG3  1 
ATOM 3392  H HD2  . ARG B 2 157 ? 183.841 226.386 222.995 1.00 168.28 ? 178 ARG D HD2  1 
ATOM 3393  H HD3  . ARG B 2 157 ? 185.121 225.960 224.154 1.00 168.28 ? 178 ARG D HD3  1 
ATOM 3394  H HE   . ARG B 2 157 ? 183.859 228.600 223.790 1.00 168.28 ? 178 ARG D HE   1 
ATOM 3395  H HH11 . ARG B 2 157 ? 186.161 226.556 225.482 1.00 168.28 ? 178 ARG D HH11 1 
ATOM 3396  H HH12 . ARG B 2 157 ? 186.349 227.663 226.823 1.00 168.28 ? 178 ARG D HH12 1 
ATOM 3397  H HH21 . ARG B 2 157 ? 184.111 230.029 225.537 1.00 168.28 ? 178 ARG D HH21 1 
ATOM 3398  H HH22 . ARG B 2 157 ? 185.190 229.630 226.855 1.00 168.28 ? 178 ARG D HH22 1 
ATOM 3399  N N    . SER B 2 158 ? 189.109 225.782 221.434 1.00 146.69 ? 179 SER D N    1 
ATOM 3400  C CA   . SER B 2 158 ? 190.398 226.371 221.769 1.00 146.69 ? 179 SER D CA   1 
ATOM 3401  C C    . SER B 2 158 ? 191.215 226.659 220.519 1.00 146.69 ? 179 SER D C    1 
ATOM 3402  O O    . SER B 2 158 ? 191.834 227.726 220.412 1.00 146.69 ? 179 SER D O    1 
ATOM 3403  C CB   . SER B 2 158 ? 191.172 225.444 222.686 1.00 146.69 ? 179 SER D CB   1 
ATOM 3404  O OG   . SER B 2 158 ? 190.528 225.309 223.924 1.00 146.69 ? 179 SER D OG   1 
ATOM 3405  H H    . SER B 2 158 ? 188.987 224.983 221.725 1.00 176.03 ? 179 SER D H    1 
ATOM 3406  H HA   . SER B 2 158 ? 190.252 227.209 222.234 1.00 176.03 ? 179 SER D HA   1 
ATOM 3407  H HB2  . SER B 2 158 ? 191.271 224.466 222.216 1.00 176.03 ? 179 SER D HB2  1 
ATOM 3408  H HB3  . SER B 2 158 ? 192.177 225.838 222.837 1.00 176.03 ? 179 SER D HB3  1 
ATOM 3409  H HG   . SER B 2 158 ? 190.656 224.396 224.190 1.00 176.03 ? 179 SER D HG   1 
ATOM 3410  N N    . SER B 2 159 ? 191.200 225.736 219.551 1.00 149.30 ? 180 SER D N    1 
ATOM 3411  C CA   . SER B 2 159 ? 191.979 225.872 218.330 1.00 149.30 ? 180 SER D CA   1 
ATOM 3412  C C    . SER B 2 159 ? 191.614 227.112 217.533 1.00 149.30 ? 180 SER D C    1 
ATOM 3413  O O    . SER B 2 159 ? 192.437 227.570 216.738 1.00 149.30 ? 180 SER D O    1 
ATOM 3414  C CB   . SER B 2 159 ? 191.790 224.643 217.463 1.00 149.30 ? 180 SER D CB   1 
ATOM 3415  O OG   . SER B 2 159 ? 192.379 223.517 218.053 1.00 149.30 ? 180 SER D OG   1 
ATOM 3416  H H    . SER B 2 159 ? 190.735 225.015 219.585 1.00 179.16 ? 180 SER D H    1 
ATOM 3417  H HA   . SER B 2 159 ? 192.917 225.932 218.555 1.00 179.16 ? 180 SER D HA   1 
ATOM 3418  H HB2  . SER B 2 159 ? 190.726 224.463 217.314 1.00 179.16 ? 180 SER D HB2  1 
ATOM 3419  H HB3  . SER B 2 159 ? 192.233 224.817 216.484 1.00 179.16 ? 180 SER D HB3  1 
ATOM 3420  H HG   . SER B 2 159 ? 191.906 223.371 218.876 1.00 179.16 ? 180 SER D HG   1 
ATOM 3421  N N    . TYR B 2 160 ? 190.390 227.629 217.685 1.00 142.68 ? 181 TYR D N    1 
ATOM 3422  C CA   . TYR B 2 160 ? 189.982 228.854 217.004 1.00 142.68 ? 181 TYR D CA   1 
ATOM 3423  C C    . TYR B 2 160 ? 190.022 230.106 217.879 1.00 142.68 ? 181 TYR D C    1 
ATOM 3424  O O    . TYR B 2 160 ? 190.309 231.192 217.355 1.00 142.68 ? 181 TYR D O    1 
ATOM 3425  C CB   . TYR B 2 160 ? 188.574 228.676 216.431 1.00 142.68 ? 181 TYR D CB   1 
ATOM 3426  C CG   . TYR B 2 160 ? 188.460 227.546 215.433 1.00 142.68 ? 181 TYR D CG   1 
ATOM 3427  C CD1  . TYR B 2 160 ? 189.234 227.556 214.282 1.00 142.68 ? 181 TYR D CD1  1 
ATOM 3428  C CD2  . TYR B 2 160 ? 187.580 226.499 215.667 1.00 142.68 ? 181 TYR D CD2  1 
ATOM 3429  C CE1  . TYR B 2 160 ? 189.130 226.524 213.370 1.00 142.68 ? 181 TYR D CE1  1 
ATOM 3430  C CE2  . TYR B 2 160 ? 187.476 225.467 214.755 1.00 142.68 ? 181 TYR D CE2  1 
ATOM 3431  C CZ   . TYR B 2 160 ? 188.255 225.483 213.603 1.00 142.68 ? 181 TYR D CZ   1 
ATOM 3432  O OH   . TYR B 2 160 ? 188.151 224.455 212.695 1.00 142.68 ? 181 TYR D OH   1 
ATOM 3433  H H    . TYR B 2 160 ? 189.773 227.288 218.177 1.00 171.22 ? 181 TYR D H    1 
ATOM 3434  H HA   . TYR B 2 160 ? 190.594 229.074 216.289 1.00 171.22 ? 181 TYR D HA   1 
ATOM 3435  H HB2  . TYR B 2 160 ? 187.872 228.484 217.244 1.00 171.22 ? 181 TYR D HB2  1 
ATOM 3436  H HB3  . TYR B 2 160 ? 188.262 229.597 215.940 1.00 171.22 ? 181 TYR D HB3  1 
ATOM 3437  H HD1  . TYR B 2 160 ? 189.926 228.378 214.098 1.00 171.22 ? 181 TYR D HD1  1 
ATOM 3438  H HD2  . TYR B 2 160 ? 186.971 226.491 216.571 1.00 171.22 ? 181 TYR D HD2  1 
ATOM 3439  H HE1  . TYR B 2 160 ? 189.740 226.532 212.466 1.00 171.22 ? 181 TYR D HE1  1 
ATOM 3440  H HE2  . TYR B 2 160 ? 186.785 224.645 214.939 1.00 171.22 ? 181 TYR D HE2  1 
ATOM 3441  H HH   . TYR B 2 160 ? 188.745 224.619 211.958 1.00 171.22 ? 181 TYR D HH   1 
ATOM 3442  N N    . ILE B 2 161 ? 189.778 229.995 219.188 1.00 130.72 ? 182 ILE D N    1 
ATOM 3443  C CA   . ILE B 2 161 ? 189.976 231.146 220.066 1.00 130.72 ? 182 ILE D CA   1 
ATOM 3444  C C    . ILE B 2 161 ? 191.432 231.582 220.030 1.00 130.72 ? 182 ILE D C    1 
ATOM 3445  O O    . ILE B 2 161 ? 191.727 232.781 219.967 1.00 130.72 ? 182 ILE D O    1 
ATOM 3446  C CB   . ILE B 2 161 ? 189.566 230.822 221.514 1.00 130.72 ? 182 ILE D CB   1 
ATOM 3447  C CG1  . ILE B 2 161 ? 188.050 230.635 221.611 1.00 130.72 ? 182 ILE D CG1  1 
ATOM 3448  C CG2  . ILE B 2 161 ? 190.031 231.921 222.457 1.00 130.72 ? 182 ILE D CG2  1 
ATOM 3449  C CD1  . ILE B 2 161 ? 187.591 230.032 222.919 1.00 130.72 ? 182 ILE D CD1  1 
ATOM 3450  H H    . ILE B 2 161 ? 189.507 229.281 219.583 1.00 156.86 ? 182 ILE D H    1 
ATOM 3451  H HA   . ILE B 2 161 ? 189.439 231.883 219.736 1.00 156.86 ? 182 ILE D HA   1 
ATOM 3452  H HB   . ILE B 2 161 ? 190.020 229.879 221.818 1.00 156.86 ? 182 ILE D HB   1 
ATOM 3453  H HG12 . ILE B 2 161 ? 187.556 231.598 221.487 1.00 156.86 ? 182 ILE D HG12 1 
ATOM 3454  H HG13 . ILE B 2 161 ? 187.711 229.988 220.801 1.00 156.86 ? 182 ILE D HG13 1 
ATOM 3455  H HG21 . ILE B 2 161 ? 189.733 231.676 223.476 1.00 156.86 ? 182 ILE D HG21 1 
ATOM 3456  H HG22 . ILE B 2 161 ? 191.116 232.007 222.408 1.00 156.86 ? 182 ILE D HG22 1 
ATOM 3457  H HG23 . ILE B 2 161 ? 189.578 232.868 222.164 1.00 156.86 ? 182 ILE D HG23 1 
ATOM 3458  H HD11 . ILE B 2 161 ? 186.505 229.930 222.912 1.00 156.86 ? 182 ILE D HD11 1 
ATOM 3459  H HD12 . ILE B 2 161 ? 188.047 229.050 223.047 1.00 156.86 ? 182 ILE D HD12 1 
ATOM 3460  H HD13 . ILE B 2 161 ? 187.888 230.681 223.742 1.00 156.86 ? 182 ILE D HD13 1 
ATOM 3461  N N    . SER B 2 162 ? 192.367 230.622 220.054 1.00 134.67 ? 183 SER D N    1 
ATOM 3462  C CA   . SER B 2 162 ? 193.790 230.946 220.011 1.00 134.67 ? 183 SER D CA   1 
ATOM 3463  C C    . SER B 2 162 ? 194.183 231.684 218.740 1.00 134.67 ? 183 SER D C    1 
ATOM 3464  O O    . SER B 2 162 ? 195.277 232.255 218.680 1.00 134.67 ? 183 SER D O    1 
ATOM 3465  C CB   . SER B 2 162 ? 194.610 229.676 220.131 1.00 134.67 ? 183 SER D CB   1 
ATOM 3466  O OG   . SER B 2 162 ? 194.483 228.886 218.981 1.00 134.67 ? 183 SER D OG   1 
ATOM 3467  H H    . SER B 2 162 ? 192.197 229.780 220.096 1.00 161.60 ? 183 SER D H    1 
ATOM 3468  H HA   . SER B 2 162 ? 194.001 231.524 220.756 1.00 161.60 ? 183 SER D HA   1 
ATOM 3469  H HB2  . SER B 2 162 ? 195.658 229.933 220.284 1.00 161.60 ? 183 SER D HB2  1 
ATOM 3470  H HB3  . SER B 2 162 ? 194.281 229.112 221.002 1.00 161.60 ? 183 SER D HB3  1 
ATOM 3471  H HG   . SER B 2 162 ? 194.717 227.993 219.246 1.00 161.60 ? 183 SER D HG   1 
ATOM 3472  N N    . ILE B 2 163 ? 193.316 231.684 217.733 1.00 131.66 ? 184 ILE D N    1 
ATOM 3473  C CA   . ILE B 2 163 ? 193.502 232.490 216.537 1.00 131.66 ? 184 ILE D CA   1 
ATOM 3474  C C    . ILE B 2 163 ? 192.882 233.864 216.717 1.00 131.66 ? 184 ILE D C    1 
ATOM 3475  O O    . ILE B 2 163 ? 193.506 234.886 216.418 1.00 131.66 ? 184 ILE D O    1 
ATOM 3476  C CB   . ILE B 2 163 ? 192.888 231.801 215.305 1.00 131.66 ? 184 ILE D CB   1 
ATOM 3477  C CG1  . ILE B 2 163 ? 193.608 230.482 215.015 1.00 131.66 ? 184 ILE D CG1  1 
ATOM 3478  C CG2  . ILE B 2 163 ? 192.949 232.722 214.095 1.00 131.66 ? 184 ILE D CG2  1 
ATOM 3479  C CD1  . ILE B 2 163 ? 192.896 229.604 214.012 1.00 131.66 ? 184 ILE D CD1  1 
ATOM 3480  H H    . ILE B 2 163 ? 192.591 231.226 217.717 1.00 157.99 ? 184 ILE D H    1 
ATOM 3481  H HA   . ILE B 2 163 ? 194.447 232.615 216.372 1.00 157.99 ? 184 ILE D HA   1 
ATOM 3482  H HB   . ILE B 2 163 ? 191.846 231.553 215.508 1.00 157.99 ? 184 ILE D HB   1 
ATOM 3483  H HG12 . ILE B 2 163 ? 194.609 230.690 214.637 1.00 157.99 ? 184 ILE D HG12 1 
ATOM 3484  H HG13 . ILE B 2 163 ? 193.721 229.918 215.941 1.00 157.99 ? 184 ILE D HG13 1 
ATOM 3485  H HG21 . ILE B 2 163 ? 192.511 232.219 213.233 1.00 157.99 ? 184 ILE D HG21 1 
ATOM 3486  H HG22 . ILE B 2 163 ? 192.392 233.634 214.305 1.00 157.99 ? 184 ILE D HG22 1 
ATOM 3487  H HG23 . ILE B 2 163 ? 193.988 232.971 213.880 1.00 157.99 ? 184 ILE D HG23 1 
ATOM 3488  H HD11 . ILE B 2 163 ? 193.467 228.688 213.859 1.00 157.99 ? 184 ILE D HD11 1 
ATOM 3489  H HD12 . ILE B 2 163 ? 191.903 229.355 214.387 1.00 157.99 ? 184 ILE D HD12 1 
ATOM 3490  H HD13 . ILE B 2 163 ? 192.803 230.135 213.065 1.00 157.99 ? 184 ILE D HD13 1 
ATOM 3491  N N    . CYS B 2 164 ? 191.642 233.910 217.216 1.00 153.81 ? 185 CYS D N    1 
ATOM 3492  C CA   . CYS B 2 164 ? 190.942 235.188 217.300 1.00 153.81 ? 185 CYS D CA   1 
ATOM 3493  C C    . CYS B 2 164 ? 191.491 236.091 218.402 1.00 153.81 ? 185 CYS D C    1 
ATOM 3494  O O    . CYS B 2 164 ? 191.304 237.311 218.328 1.00 153.81 ? 185 CYS D O    1 
ATOM 3495  C CB   . CYS B 2 164 ? 189.451 234.955 217.546 1.00 153.81 ? 185 CYS D CB   1 
ATOM 3496  S SG   . CYS B 2 164 ? 188.579 234.210 216.148 1.00 153.81 ? 185 CYS D SG   1 
ATOM 3497  H H    . CYS B 2 164 ? 191.190 233.234 217.500 1.00 184.57 ? 185 CYS D H    1 
ATOM 3498  H HA   . CYS B 2 164 ? 191.045 235.660 216.461 1.00 184.57 ? 185 CYS D HA   1 
ATOM 3499  H HB2  . CYS B 2 164 ? 189.322 234.304 218.410 1.00 184.57 ? 185 CYS D HB2  1 
ATOM 3500  H HB3  . CYS B 2 164 ? 188.969 235.905 217.777 1.00 184.57 ? 185 CYS D HB3  1 
ATOM 3501  N N    . ASN B 2 165 ? 192.152 235.533 219.421 1.00 127.99 ? 186 ASN D N    1 
ATOM 3502  C CA   . ASN B 2 165 ? 192.748 236.327 220.494 1.00 127.99 ? 186 ASN D CA   1 
ATOM 3503  C C    . ASN B 2 165 ? 194.216 236.665 220.238 1.00 127.99 ? 186 ASN D C    1 
ATOM 3504  O O    . ASN B 2 165 ? 194.894 237.162 221.143 1.00 127.99 ? 186 ASN D O    1 
ATOM 3505  C CB   . ASN B 2 165 ? 192.600 235.604 221.820 1.00 127.99 ? 186 ASN D CB   1 
ATOM 3506  C CG   . ASN B 2 165 ? 193.430 234.352 221.891 1.00 127.99 ? 186 ASN D CG   1 
ATOM 3507  O OD1  . ASN B 2 165 ? 194.265 234.095 221.016 1.00 127.99 ? 186 ASN D OD1  1 
ATOM 3508  N ND2  . ASN B 2 165 ? 193.216 233.567 222.916 1.00 127.99 ? 186 ASN D ND2  1 
ATOM 3509  H H    . ASN B 2 165 ? 192.270 234.686 219.512 1.00 153.59 ? 186 ASN D H    1 
ATOM 3510  H HA   . ASN B 2 165 ? 192.274 237.167 220.582 1.00 153.59 ? 186 ASN D HA   1 
ATOM 3511  H HB2  . ASN B 2 165 ? 192.897 236.269 222.632 1.00 153.59 ? 186 ASN D HB2  1 
ATOM 3512  H HB3  . ASN B 2 165 ? 191.554 235.341 221.977 1.00 153.59 ? 186 ASN D HB3  1 
ATOM 3513  H HD21 . ASN B 2 165 ? 193.738 232.720 223.015 1.00 153.59 ? 186 ASN D HD21 1 
ATOM 3514  H HD22 . ASN B 2 165 ? 192.530 233.814 223.600 1.00 153.59 ? 186 ASN D HD22 1 
ATOM 3515  N N    . ARG B 2 166 ? 194.719 236.404 219.032 1.00 148.62 ? 187 ARG D N    1 
ATOM 3516  C CA   . ARG B 2 166 ? 196.129 236.597 218.723 1.00 148.62 ? 187 ARG D CA   1 
ATOM 3517  C C    . ARG B 2 166 ? 196.403 238.079 218.497 1.00 148.62 ? 187 ARG D C    1 
ATOM 3518  O O    . ARG B 2 166 ? 195.739 238.721 217.676 1.00 148.62 ? 187 ARG D O    1 
ATOM 3519  C CB   . ARG B 2 166 ? 196.531 235.804 217.489 1.00 148.62 ? 187 ARG D CB   1 
ATOM 3520  C CG   . ARG B 2 166 ? 198.007 235.878 217.133 1.00 148.62 ? 187 ARG D CG   1 
ATOM 3521  C CD   . ARG B 2 166 ? 198.324 235.067 215.930 1.00 148.62 ? 187 ARG D CD   1 
ATOM 3522  N NE   . ARG B 2 166 ? 198.103 233.648 216.159 1.00 148.62 ? 187 ARG D NE   1 
ATOM 3523  C CZ   . ARG B 2 166 ? 198.982 232.824 216.763 1.00 148.62 ? 187 ARG D CZ   1 
ATOM 3524  N NH1  . ARG B 2 166 ? 200.133 233.292 217.192 1.00 148.62 ? 187 ARG D NH1  1 
ATOM 3525  N NH2  . ARG B 2 166 ? 198.686 231.546 216.924 1.00 148.62 ? 187 ARG D NH2  1 
ATOM 3526  H H    . ARG B 2 166 ? 194.261 236.116 218.365 1.00 178.34 ? 187 ARG D H    1 
ATOM 3527  H HA   . ARG B 2 166 ? 196.667 236.296 219.471 1.00 178.34 ? 187 ARG D HA   1 
ATOM 3528  H HB2  . ARG B 2 166 ? 196.279 234.754 217.633 1.00 178.34 ? 187 ARG D HB2  1 
ATOM 3529  H HB3  . ARG B 2 166 ? 195.966 236.160 216.627 1.00 178.34 ? 187 ARG D HB3  1 
ATOM 3530  H HG2  . ARG B 2 166 ? 198.281 236.914 216.931 1.00 178.34 ? 187 ARG D HG2  1 
ATOM 3531  H HG3  . ARG B 2 166 ? 198.602 235.502 217.967 1.00 178.34 ? 187 ARG D HG3  1 
ATOM 3532  H HD2  . ARG B 2 166 ? 197.690 235.381 215.102 1.00 178.34 ? 187 ARG D HD2  1 
ATOM 3533  H HD3  . ARG B 2 166 ? 199.370 235.210 215.661 1.00 178.34 ? 187 ARG D HD3  1 
ATOM 3534  H HE   . ARG B 2 166 ? 197.228 233.252 215.843 1.00 178.34 ? 187 ARG D HE   1 
ATOM 3535  H HH11 . ARG B 2 166 ? 200.359 234.269 217.069 1.00 178.34 ? 187 ARG D HH11 1 
ATOM 3536  H HH12 . ARG B 2 166 ? 200.792 232.675 217.644 1.00 178.34 ? 187 ARG D HH12 1 
ATOM 3537  H HH21 . ARG B 2 166 ? 197.801 231.187 216.594 1.00 178.34 ? 187 ARG D HH21 1 
ATOM 3538  H HH22 . ARG B 2 166 ? 199.345 230.929 217.376 1.00 178.34 ? 187 ARG D HH22 1 
ATOM 3539  N N    . GLU B 2 167 ? 197.379 238.619 219.225 1.00 161.11 ? 188 GLU D N    1 
ATOM 3540  C CA   . GLU B 2 167 ? 197.797 240.003 219.038 1.00 161.11 ? 188 GLU D CA   1 
ATOM 3541  C C    . GLU B 2 167 ? 198.704 240.104 217.818 1.00 161.11 ? 188 GLU D C    1 
ATOM 3542  O O    . GLU B 2 167 ? 199.615 239.288 217.642 1.00 161.11 ? 188 GLU D O    1 
ATOM 3543  C CB   . GLU B 2 167 ? 198.521 240.525 220.282 1.00 161.11 ? 188 GLU D CB   1 
ATOM 3544  C CG   . GLU B 2 167 ? 198.922 241.992 220.207 1.00 161.11 ? 188 GLU D CG   1 
ATOM 3545  C CD   . GLU B 2 167 ? 199.641 242.465 221.439 1.00 161.11 ? 188 GLU D CD   1 
ATOM 3546  O OE1  . GLU B 2 167 ? 199.866 241.667 222.316 1.00 161.11 ? 188 GLU D OE1  1 
ATOM 3547  O OE2  . GLU B 2 167 ? 199.967 243.627 221.503 1.00 161.11 ? 188 GLU D OE2  1 
ATOM 3548  H H    . GLU B 2 167 ? 197.815 238.202 219.836 1.00 193.33 ? 188 GLU D H    1 
ATOM 3549  H HA   . GLU B 2 167 ? 197.017 240.561 218.888 1.00 193.33 ? 188 GLU D HA   1 
ATOM 3550  H HB2  . GLU B 2 167 ? 197.881 240.397 221.155 1.00 193.33 ? 188 GLU D HB2  1 
ATOM 3551  H HB3  . GLU B 2 167 ? 199.425 239.940 220.449 1.00 193.33 ? 188 GLU D HB3  1 
ATOM 3552  H HG2  . GLU B 2 167 ? 199.570 242.137 219.343 1.00 193.33 ? 188 GLU D HG2  1 
ATOM 3553  H HG3  . GLU B 2 167 ? 198.027 242.595 220.060 1.00 193.33 ? 188 GLU D HG3  1 
ATOM 3554  N N    . ILE B 2 168 ? 198.456 241.109 216.982 1.00 155.44 ? 189 ILE D N    1 
ATOM 3555  C CA   . ILE B 2 168 ? 199.238 241.319 215.764 1.00 155.44 ? 189 ILE D CA   1 
ATOM 3556  C C    . ILE B 2 168 ? 200.262 242.429 215.954 1.00 155.44 ? 189 ILE D C    1 
ATOM 3557  O O    . ILE B 2 168 ? 201.438 242.268 215.619 1.00 155.44 ? 189 ILE D O    1 
ATOM 3558  C CB   . ILE B 2 168 ? 198.323 241.664 214.574 1.00 155.44 ? 189 ILE D CB   1 
ATOM 3559  C CG1  . ILE B 2 168 ? 197.271 240.570 214.375 1.00 155.44 ? 189 ILE D CG1  1 
ATOM 3560  C CG2  . ILE B 2 168 ? 199.146 241.853 213.309 1.00 155.44 ? 189 ILE D CG2  1 
ATOM 3561  C CD1  . ILE B 2 168 ? 197.856 239.199 214.119 1.00 155.44 ? 189 ILE D CD1  1 
ATOM 3562  H H    . ILE B 2 168 ? 197.831 241.689 217.097 1.00 186.53 ? 189 ILE D H    1 
ATOM 3563  H HA   . ILE B 2 168 ? 199.734 240.514 215.555 1.00 186.53 ? 189 ILE D HA   1 
ATOM 3564  H HB   . ILE B 2 168 ? 197.783 242.586 214.786 1.00 186.53 ? 189 ILE D HB   1 
ATOM 3565  H HG12 . ILE B 2 168 ? 196.637 240.510 215.258 1.00 186.53 ? 189 ILE D HG12 1 
ATOM 3566  H HG13 . ILE B 2 168 ? 196.632 240.829 213.531 1.00 186.53 ? 189 ILE D HG13 1 
ATOM 3567  H HG21 . ILE B 2 168 ? 198.484 242.095 212.478 1.00 186.53 ? 189 ILE D HG21 1 
ATOM 3568  H HG22 . ILE B 2 168 ? 199.857 242.665 213.455 1.00 186.53 ? 189 ILE D HG22 1 
ATOM 3569  H HG23 . ILE B 2 168 ? 199.687 240.933 213.085 1.00 186.53 ? 189 ILE D HG23 1 
ATOM 3570  H HD11 . ILE B 2 168 ? 197.049 238.478 213.987 1.00 186.53 ? 189 ILE D HD11 1 
ATOM 3571  H HD12 . ILE B 2 168 ? 198.468 239.228 213.217 1.00 186.53 ? 189 ILE D HD12 1 
ATOM 3572  H HD13 . ILE B 2 168 ? 198.472 238.903 214.967 1.00 186.53 ? 189 ILE D HD13 1 
ATOM 3573  N N    . SER B 2 169 ? 199.833 243.566 216.492 1.00 151.45 ? 190 SER D N    1 
ATOM 3574  C CA   . SER B 2 169 ? 200.699 244.726 216.653 1.00 151.45 ? 190 SER D CA   1 
ATOM 3575  C C    . SER B 2 169 ? 200.142 245.571 217.791 1.00 151.45 ? 190 SER D C    1 
ATOM 3576  O O    . SER B 2 169 ? 199.011 245.342 218.245 1.00 151.45 ? 190 SER D O    1 
ATOM 3577  C CB   . SER B 2 169 ? 200.771 245.534 215.372 1.00 151.45 ? 190 SER D CB   1 
ATOM 3578  O OG   . SER B 2 169 ? 199.569 246.217 215.141 1.00 151.45 ? 190 SER D OG   1 
ATOM 3579  H H    . SER B 2 169 ? 199.031 243.692 216.775 1.00 181.74 ? 190 SER D H    1 
ATOM 3580  H HA   . SER B 2 169 ? 201.588 244.426 216.893 1.00 181.74 ? 190 SER D HA   1 
ATOM 3581  H HB2  . SER B 2 169 ? 201.591 246.248 215.438 1.00 181.74 ? 190 SER D HB2  1 
ATOM 3582  H HB3  . SER B 2 169 ? 200.982 244.870 214.535 1.00 181.74 ? 190 SER D HB3  1 
ATOM 3583  H HG   . SER B 2 169 ? 199.283 245.957 214.262 1.00 181.74 ? 190 SER D HG   1 
ATOM 3584  N N    . PRO B 2 170 ? 200.909 246.549 218.287 1.00 137.14 ? 191 PRO D N    1 
ATOM 3585  C CA   . PRO B 2 170 ? 200.395 247.388 219.385 1.00 137.14 ? 191 PRO D CA   1 
ATOM 3586  C C    . PRO B 2 170 ? 199.058 248.049 219.091 1.00 137.14 ? 191 PRO D C    1 
ATOM 3587  O O    . PRO B 2 170 ? 198.330 248.369 220.039 1.00 137.14 ? 191 PRO D O    1 
ATOM 3588  C CB   . PRO B 2 170 ? 201.498 248.439 219.543 1.00 137.14 ? 191 PRO D CB   1 
ATOM 3589  C CG   . PRO B 2 170 ? 202.737 247.739 219.099 1.00 137.14 ? 191 PRO D CG   1 
ATOM 3590  C CD   . PRO B 2 170 ? 202.295 246.905 217.926 1.00 137.14 ? 191 PRO D CD   1 
ATOM 3591  H HA   . PRO B 2 170 ? 200.315 246.861 220.196 1.00 164.57 ? 191 PRO D HA   1 
ATOM 3592  H HB2  . PRO B 2 170 ? 201.265 249.324 218.932 1.00 164.57 ? 191 PRO D HB2  1 
ATOM 3593  H HB3  . PRO B 2 170 ? 201.550 248.776 220.589 1.00 164.57 ? 191 PRO D HB3  1 
ATOM 3594  H HG2  . PRO B 2 170 ? 203.512 248.472 218.829 1.00 164.57 ? 191 PRO D HG2  1 
ATOM 3595  H HG3  . PRO B 2 170 ? 203.146 247.132 219.920 1.00 164.57 ? 191 PRO D HG3  1 
ATOM 3596  H HD2  . PRO B 2 170 ? 202.337 247.511 217.008 1.00 164.57 ? 191 PRO D HD2  1 
ATOM 3597  H HD3  . PRO B 2 170 ? 202.945 246.022 217.838 1.00 164.57 ? 191 PRO D HD3  1 
ATOM 3598  N N    . THR B 2 171 ? 198.714 248.265 217.821 1.00 131.63 ? 192 THR D N    1 
ATOM 3599  C CA   . THR B 2 171 ? 197.451 248.881 217.419 1.00 131.63 ? 192 THR D CA   1 
ATOM 3600  C C    . THR B 2 171 ? 196.711 247.993 216.427 1.00 131.63 ? 192 THR D C    1 
ATOM 3601  O O    . THR B 2 171 ? 196.119 248.472 215.456 1.00 131.63 ? 192 THR D O    1 
ATOM 3602  C CB   . THR B 2 171 ? 197.680 250.272 216.799 1.00 131.63 ? 192 THR D CB   1 
ATOM 3603  O OG1  . THR B 2 171 ? 198.544 250.155 215.661 1.00 131.63 ? 192 THR D OG1  1 
ATOM 3604  C CG2  . THR B 2 171 ? 198.310 251.212 217.816 1.00 131.63 ? 192 THR D CG2  1 
ATOM 3605  H H    . THR B 2 171 ? 199.213 248.056 217.152 1.00 157.96 ? 192 THR D H    1 
ATOM 3606  H HA   . THR B 2 171 ? 196.874 248.989 218.189 1.00 157.96 ? 192 THR D HA   1 
ATOM 3607  H HB   . THR B 2 171 ? 196.726 250.686 216.473 1.00 157.96 ? 192 THR D HB   1 
ATOM 3608  H HG1  . THR B 2 171 ? 198.047 249.804 214.918 1.00 157.96 ? 192 THR D HG1  1 
ATOM 3609  H HG21 . THR B 2 171 ? 198.464 252.190 217.361 1.00 157.96 ? 192 THR D HG21 1 
ATOM 3610  H HG22 . THR B 2 171 ? 197.650 251.311 218.677 1.00 157.96 ? 192 THR D HG22 1 
ATOM 3611  H HG23 . THR B 2 171 ? 199.269 250.808 218.138 1.00 157.96 ? 192 THR D HG23 1 
ATOM 3612  N N    . GLU B 2 172 ? 196.741 246.681 216.658 1.00 144.90 ? 193 GLU D N    1 
ATOM 3613  C CA   . GLU B 2 172 ? 195.946 245.735 215.877 1.00 144.90 ? 193 GLU D CA   1 
ATOM 3614  C C    . GLU B 2 172 ? 195.654 244.543 216.775 1.00 144.90 ? 193 GLU D C    1 
ATOM 3615  O O    . GLU B 2 172 ? 196.559 243.759 217.081 1.00 144.90 ? 193 GLU D O    1 
ATOM 3616  C CB   . GLU B 2 172 ? 196.677 245.307 214.606 1.00 144.90 ? 193 GLU D CB   1 
ATOM 3617  C CG   . GLU B 2 172 ? 195.846 244.437 213.672 1.00 144.90 ? 193 GLU D CG   1 
ATOM 3618  C CD   . GLU B 2 172 ? 196.541 244.169 212.352 1.00 144.90 ? 193 GLU D CD   1 
ATOM 3619  O OE1  . GLU B 2 172 ? 197.702 244.602 212.191 1.00 144.90 ? 193 GLU D OE1  1 
ATOM 3620  O OE2  . GLU B 2 172 ? 195.926 243.525 211.475 1.00 144.90 ? 193 GLU D OE2  1 
ATOM 3621  H H    . GLU B 2 172 ? 197.215 246.306 217.270 1.00 173.88 ? 193 GLU D H    1 
ATOM 3622  H HA   . GLU B 2 172 ? 195.101 246.139 215.624 1.00 173.88 ? 193 GLU D HA   1 
ATOM 3623  H HB2  . GLU B 2 172 ? 196.942 246.101 214.114 1.00 173.88 ? 193 GLU D HB2  1 
ATOM 3624  H HB3  . GLU B 2 172 ? 197.464 244.797 214.856 1.00 173.88 ? 193 GLU D HB3  1 
ATOM 3625  H HG2  . GLU B 2 172 ? 195.679 243.580 214.096 1.00 173.88 ? 193 GLU D HG2  1 
ATOM 3626  H HG3  . GLU B 2 172 ? 195.006 244.884 213.486 1.00 173.88 ? 193 GLU D HG3  1 
ATOM 3627  N N    . ARG B 2 173 ? 194.394 244.412 217.196 1.00 137.53 ? 194 ARG D N    1 
ATOM 3628  C CA   . ARG B 2 173 ? 194.047 243.417 218.205 1.00 137.53 ? 194 ARG D CA   1 
ATOM 3629  C C    . ARG B 2 173 ? 194.187 242.001 217.661 1.00 137.53 ? 194 ARG D C    1 
ATOM 3630  O O    . ARG B 2 173 ? 194.590 241.090 218.395 1.00 137.53 ? 194 ARG D O    1 
ATOM 3631  C CB   . ARG B 2 173 ? 192.622 243.629 218.695 1.00 137.53 ? 194 ARG D CB   1 
ATOM 3632  C CG   . ARG B 2 173 ? 192.132 242.599 219.701 1.00 137.53 ? 194 ARG D CG   1 
ATOM 3633  C CD   . ARG B 2 173 ? 192.883 242.681 220.980 1.00 137.53 ? 194 ARG D CD   1 
ATOM 3634  N NE   . ARG B 2 173 ? 192.467 241.651 221.919 1.00 137.53 ? 194 ARG D NE   1 
ATOM 3635  C CZ   . ARG B 2 173 ? 193.013 240.421 221.997 1.00 137.53 ? 194 ARG D CZ   1 
ATOM 3636  N NH1  . ARG B 2 173 ? 193.993 240.085 221.187 1.00 137.53 ? 194 ARG D NH1  1 
ATOM 3637  N NH2  . ARG B 2 173 ? 192.564 239.554 222.887 1.00 137.53 ? 194 ARG D NH2  1 
ATOM 3638  H H    . ARG B 2 173 ? 193.731 244.882 216.916 1.00 165.04 ? 194 ARG D H    1 
ATOM 3639  H HA   . ARG B 2 173 ? 194.653 243.512 218.955 1.00 165.04 ? 194 ARG D HA   1 
ATOM 3640  H HB2  . ARG B 2 173 ? 192.540 244.610 219.161 1.00 165.04 ? 194 ARG D HB2  1 
ATOM 3641  H HB3  . ARG B 2 173 ? 191.939 243.612 217.846 1.00 165.04 ? 194 ARG D HB3  1 
ATOM 3642  H HG2  . ARG B 2 173 ? 191.076 242.770 219.911 1.00 165.04 ? 194 ARG D HG2  1 
ATOM 3643  H HG3  . ARG B 2 173 ? 192.263 241.598 219.290 1.00 165.04 ? 194 ARG D HG3  1 
ATOM 3644  H HD2  . ARG B 2 173 ? 193.947 242.555 220.786 1.00 165.04 ? 194 ARG D HD2  1 
ATOM 3645  H HD3  . ARG B 2 173 ? 192.710 243.652 221.442 1.00 165.04 ? 194 ARG D HD3  1 
ATOM 3646  H HE   . ARG B 2 173 ? 191.716 241.873 222.558 1.00 165.04 ? 194 ARG D HE   1 
ATOM 3647  H HH11 . ARG B 2 173 ? 194.336 240.748 220.506 1.00 165.04 ? 194 ARG D HH11 1 
ATOM 3648  H HH12 . ARG B 2 173 ? 194.402 239.163 221.245 1.00 165.04 ? 194 ARG D HH12 1 
ATOM 3649  H HH21 . ARG B 2 173 ? 191.811 239.813 223.510 1.00 165.04 ? 194 ARG D HH21 1 
ATOM 3650  H HH22 . ARG B 2 173 ? 192.973 238.633 222.945 1.00 165.04 ? 194 ARG D HH22 1 
ATOM 3651  N N    . CYS B 2 174 ? 193.865 241.793 216.388 1.00 150.72 ? 195 CYS D N    1 
ATOM 3652  C CA   . CYS B 2 174 ? 193.859 240.456 215.811 1.00 150.72 ? 195 CYS D CA   1 
ATOM 3653  C C    . CYS B 2 174 ? 193.804 240.577 214.296 1.00 150.72 ? 195 CYS D C    1 
ATOM 3654  O O    . CYS B 2 174 ? 193.562 241.655 213.747 1.00 150.72 ? 195 CYS D O    1 
ATOM 3655  C CB   . CYS B 2 174 ? 192.665 239.644 216.316 1.00 150.72 ? 195 CYS D CB   1 
ATOM 3656  S SG   . CYS B 2 174 ? 191.093 240.292 215.701 1.00 150.72 ? 195 CYS D SG   1 
ATOM 3657  H H    . CYS B 2 174 ? 193.644 242.415 215.836 1.00 180.86 ? 195 CYS D H    1 
ATOM 3658  H HA   . CYS B 2 174 ? 194.675 239.994 216.052 1.00 180.86 ? 195 CYS D HA   1 
ATOM 3659  H HB2  . CYS B 2 174 ? 192.753 238.728 216.008 1.00 180.86 ? 195 CYS D HB2  1 
ATOM 3660  H HB3  . CYS B 2 174 ? 192.644 239.666 217.286 1.00 180.86 ? 195 CYS D HB3  1 
ATOM 3661  N N    . ASN B 2 175 ? 194.035 239.448 213.628 1.00 141.98 ? 196 ASN D N    1 
ATOM 3662  C CA   . ASN B 2 175 ? 193.764 239.321 212.198 1.00 141.98 ? 196 ASN D CA   1 
ATOM 3663  C C    . ASN B 2 175 ? 192.316 238.869 212.065 1.00 141.98 ? 196 ASN D C    1 
ATOM 3664  O O    . ASN B 2 175 ? 192.009 237.679 212.168 1.00 141.98 ? 196 ASN D O    1 
ATOM 3665  C CB   . ASN B 2 175 ? 194.718 238.353 211.524 1.00 141.98 ? 196 ASN D CB   1 
ATOM 3666  C CG   . ASN B 2 175 ? 194.523 238.292 210.035 1.00 141.98 ? 196 ASN D CG   1 
ATOM 3667  O OD1  . ASN B 2 175 ? 193.388 238.277 209.545 1.00 141.98 ? 196 ASN D OD1  1 
ATOM 3668  N ND2  . ASN B 2 175 ? 195.609 238.256 209.305 1.00 141.98 ? 196 ASN D ND2  1 
ATOM 3669  H H    . ASN B 2 175 ? 194.354 238.734 213.985 1.00 170.38 ? 196 ASN D H    1 
ATOM 3670  H HA   . ASN B 2 175 ? 193.858 240.184 211.766 1.00 170.38 ? 196 ASN D HA   1 
ATOM 3671  H HB2  . ASN B 2 175 ? 195.747 238.650 211.733 1.00 170.38 ? 196 ASN D HB2  1 
ATOM 3672  H HB3  . ASN B 2 175 ? 194.576 237.354 211.939 1.00 170.38 ? 196 ASN D HB3  1 
ATOM 3673  H HD21 . ASN B 2 175 ? 195.540 238.215 208.308 1.00 170.38 ? 196 ASN D HD21 1 
ATOM 3674  H HD22 . ASN B 2 175 ? 196.507 238.269 209.744 1.00 170.38 ? 196 ASN D HD22 1 
ATOM 3675  N N    . ARG B 2 176 ? 191.421 239.834 211.842 1.00 134.15 ? 197 ARG D N    1 
ATOM 3676  C CA   . ARG B 2 176 ? 189.990 239.550 211.845 1.00 134.15 ? 197 ARG D CA   1 
ATOM 3677  C C    . ARG B 2 176 ? 189.611 238.557 210.748 1.00 134.15 ? 197 ARG D C    1 
ATOM 3678  O O    . ARG B 2 176 ? 188.738 237.704 210.947 1.00 134.15 ? 197 ARG D O    1 
ATOM 3679  C CB   . ARG B 2 176 ? 189.193 240.832 211.659 1.00 134.15 ? 197 ARG D CB   1 
ATOM 3680  C CG   . ARG B 2 176 ? 187.690 240.681 211.825 1.00 134.15 ? 197 ARG D CG   1 
ATOM 3681  C CD   . ARG B 2 176 ? 186.994 241.992 211.752 1.00 134.15 ? 197 ARG D CD   1 
ATOM 3682  N NE   . ARG B 2 176 ? 185.561 241.858 211.961 1.00 134.15 ? 197 ARG D NE   1 
ATOM 3683  C CZ   . ARG B 2 176 ? 184.676 242.868 211.862 1.00 134.15 ? 197 ARG D CZ   1 
ATOM 3684  N NH1  . ARG B 2 176 ? 185.091 244.078 211.558 1.00 134.15 ? 197 ARG D NH1  1 
ATOM 3685  N NH2  . ARG B 2 176 ? 183.391 242.644 212.071 1.00 134.15 ? 197 ARG D NH2  1 
ATOM 3686  H H    . ARG B 2 176 ? 191.619 240.656 211.691 1.00 160.98 ? 197 ARG D H    1 
ATOM 3687  H HA   . ARG B 2 176 ? 189.749 239.159 212.699 1.00 160.98 ? 197 ARG D HA   1 
ATOM 3688  H HB2  . ARG B 2 176 ? 189.531 241.578 212.377 1.00 160.98 ? 197 ARG D HB2  1 
ATOM 3689  H HB3  . ARG B 2 176 ? 189.376 241.233 210.661 1.00 160.98 ? 197 ARG D HB3  1 
ATOM 3690  H HG2  . ARG B 2 176 ? 187.298 240.041 211.034 1.00 160.98 ? 197 ARG D HG2  1 
ATOM 3691  H HG3  . ARG B 2 176 ? 187.474 240.232 212.795 1.00 160.98 ? 197 ARG D HG3  1 
ATOM 3692  H HD2  . ARG B 2 176 ? 187.390 242.656 212.520 1.00 160.98 ? 197 ARG D HD2  1 
ATOM 3693  H HD3  . ARG B 2 176 ? 187.156 242.435 210.771 1.00 160.98 ? 197 ARG D HD3  1 
ATOM 3694  H HE   . ARG B 2 176 ? 185.204 240.941 212.197 1.00 160.98 ? 197 ARG D HE   1 
ATOM 3695  H HH11 . ARG B 2 176 ? 186.074 244.250 211.398 1.00 160.98 ? 197 ARG D HH11 1 
ATOM 3696  H HH12 . ARG B 2 176 ? 184.428 244.836 211.483 1.00 160.98 ? 197 ARG D HH12 1 
ATOM 3697  H HH21 . ARG B 2 176 ? 183.072 241.714 212.305 1.00 160.98 ? 197 ARG D HH21 1 
ATOM 3698  H HH22 . ARG B 2 176 ? 182.728 243.401 211.996 1.00 160.98 ? 197 ARG D HH22 1 
ATOM 3699  N N    . ARG B 2 177 ? 190.266 238.645 209.588 1.00 125.39 ? 198 ARG D N    1 
ATOM 3700  C CA   . ARG B 2 177 ? 189.989 237.713 208.496 1.00 125.39 ? 198 ARG D CA   1 
ATOM 3701  C C    . ARG B 2 177 ? 190.294 236.275 208.906 1.00 125.39 ? 198 ARG D C    1 
ATOM 3702  O O    . ARG B 2 177 ? 189.484 235.363 208.684 1.00 125.39 ? 198 ARG D O    1 
ATOM 3703  C CB   . ARG B 2 177 ? 190.809 238.110 207.269 1.00 125.39 ? 198 ARG D CB   1 
ATOM 3704  C CG   . ARG B 2 177 ? 190.567 237.266 206.023 1.00 125.39 ? 198 ARG D CG   1 
ATOM 3705  C CD   . ARG B 2 177 ? 191.526 237.652 204.908 1.00 125.39 ? 198 ARG D CD   1 
ATOM 3706  N NE   . ARG B 2 177 ? 192.914 237.330 205.242 1.00 125.39 ? 198 ARG D NE   1 
ATOM 3707  C CZ   . ARG B 2 177 ? 193.461 236.117 205.167 1.00 125.39 ? 198 ARG D CZ   1 
ATOM 3708  N NH1  . ARG B 2 177 ? 192.756 235.064 204.765 1.00 125.39 ? 198 ARG D NH1  1 
ATOM 3709  N NH2  . ARG B 2 177 ? 194.734 235.954 205.500 1.00 125.39 ? 198 ARG D NH2  1 
ATOM 3710  H H    . ARG B 2 177 ? 190.868 239.232 209.408 1.00 150.47 ? 198 ARG D H    1 
ATOM 3711  H HA   . ARG B 2 177 ? 189.049 237.768 208.263 1.00 150.47 ? 198 ARG D HA   1 
ATOM 3712  H HB2  . ARG B 2 177 ? 190.599 239.031 207.043 1.00 150.47 ? 198 ARG D HB2  1 
ATOM 3713  H HB3  . ARG B 2 177 ? 191.749 238.040 207.499 1.00 150.47 ? 198 ARG D HB3  1 
ATOM 3714  H HG2  . ARG B 2 177 ? 190.711 236.328 206.223 1.00 150.47 ? 198 ARG D HG2  1 
ATOM 3715  H HG3  . ARG B 2 177 ? 189.660 237.408 205.710 1.00 150.47 ? 198 ARG D HG3  1 
ATOM 3716  H HD2  . ARG B 2 177 ? 191.282 237.186 204.094 1.00 150.47 ? 198 ARG D HD2  1 
ATOM 3717  H HD3  . ARG B 2 177 ? 191.472 238.609 204.767 1.00 150.47 ? 198 ARG D HD3  1 
ATOM 3718  H HE   . ARG B 2 177 ? 193.375 237.943 205.632 1.00 150.47 ? 198 ARG D HE   1 
ATOM 3719  H HH11 . ARG B 2 177 ? 191.931 235.138 204.543 1.00 150.47 ? 198 ARG D HH11 1 
ATOM 3720  H HH12 . ARG B 2 177 ? 193.136 234.293 204.725 1.00 150.47 ? 198 ARG D HH12 1 
ATOM 3721  H HH21 . ARG B 2 177 ? 195.199 236.628 205.763 1.00 150.47 ? 198 ARG D HH21 1 
ATOM 3722  H HH22 . ARG B 2 177 ? 195.094 235.174 205.454 1.00 150.47 ? 198 ARG D HH22 1 
ATOM 3723  N N    . LYS B 2 178 ? 191.476 236.051 209.483 1.00 136.33 ? 199 LYS D N    1 
ATOM 3724  C CA   . LYS B 2 178 ? 191.817 234.718 209.967 1.00 136.33 ? 199 LYS D CA   1 
ATOM 3725  C C    . LYS B 2 178 ? 190.878 234.290 211.086 1.00 136.33 ? 199 LYS D C    1 
ATOM 3726  O O    . LYS B 2 178 ? 190.473 233.125 211.154 1.00 136.33 ? 199 LYS D O    1 
ATOM 3727  C CB   . LYS B 2 178 ? 193.267 234.676 210.451 1.00 136.33 ? 199 LYS D CB   1 
ATOM 3728  C CG   . LYS B 2 178 ? 194.304 234.742 209.338 1.00 136.33 ? 199 LYS D CG   1 
ATOM 3729  C CD   . LYS B 2 178 ? 195.719 234.730 209.898 1.00 136.33 ? 199 LYS D CD   1 
ATOM 3730  C CE   . LYS B 2 178 ? 196.756 234.776 208.786 1.00 136.33 ? 199 LYS D CE   1 
ATOM 3731  N NZ   . LYS B 2 178 ? 198.143 234.855 209.321 1.00 136.33 ? 199 LYS D NZ   1 
ATOM 3732  H H    . LYS B 2 178 ? 192.087 236.644 209.605 1.00 163.60 ? 199 LYS D H    1 
ATOM 3733  H HA   . LYS B 2 178 ? 191.722 234.085 209.239 1.00 163.60 ? 199 LYS D HA   1 
ATOM 3734  H HB2  . LYS B 2 178 ? 193.450 235.512 211.128 1.00 163.60 ? 199 LYS D HB2  1 
ATOM 3735  H HB3  . LYS B 2 178 ? 193.437 233.758 211.013 1.00 163.60 ? 199 LYS D HB3  1 
ATOM 3736  H HG2  . LYS B 2 178 ? 194.179 233.886 208.673 1.00 163.60 ? 199 LYS D HG2  1 
ATOM 3737  H HG3  . LYS B 2 178 ? 194.159 235.653 208.759 1.00 163.60 ? 199 LYS D HG3  1 
ATOM 3738  H HD2  . LYS B 2 178 ? 195.859 235.593 210.551 1.00 163.60 ? 199 LYS D HD2  1 
ATOM 3739  H HD3  . LYS B 2 178 ? 195.870 233.825 210.486 1.00 163.60 ? 199 LYS D HD3  1 
ATOM 3740  H HE2  . LYS B 2 178 ? 196.668 233.883 208.170 1.00 163.60 ? 199 LYS D HE2  1 
ATOM 3741  H HE3  . LYS B 2 178 ? 196.575 235.646 208.155 1.00 163.60 ? 199 LYS D HE3  1 
ATOM 3742  H HZ1  . LYS B 2 178 ? 198.799 234.884 208.554 1.00 163.60 ? 199 LYS D HZ1  1 
ATOM 3743  H HZ2  . LYS B 2 178 ? 198.241 235.691 209.881 1.00 163.60 ? 199 LYS D HZ2  1 
ATOM 3744  H HZ3  . LYS B 2 178 ? 198.330 234.044 209.893 1.00 163.60 ? 199 LYS D HZ3  1 
ATOM 3745  N N    . CYS B 2 179 ? 190.496 235.225 211.959 1.00 133.83 ? 200 CYS D N    1 
ATOM 3746  C CA   . CYS B 2 179 ? 189.498 234.914 212.976 1.00 133.83 ? 200 CYS D CA   1 
ATOM 3747  C C    . CYS B 2 179 ? 188.185 234.473 212.346 1.00 133.83 ? 200 CYS D C    1 
ATOM 3748  O O    . CYS B 2 179 ? 187.571 233.489 212.783 1.00 133.83 ? 200 CYS D O    1 
ATOM 3749  C CB   . CYS B 2 179 ? 189.243 236.129 213.869 1.00 133.83 ? 200 CYS D CB   1 
ATOM 3750  S SG   . CYS B 2 179 ? 187.966 235.869 215.123 1.00 133.83 ? 200 CYS D SG   1 
ATOM 3751  H H    . CYS B 2 179 ? 190.796 236.030 211.982 1.00 160.60 ? 200 CYS D H    1 
ATOM 3752  H HA   . CYS B 2 179 ? 189.832 234.184 213.518 1.00 160.60 ? 200 CYS D HA   1 
ATOM 3753  H HB2  . CYS B 2 179 ? 190.166 236.405 214.380 1.00 160.60 ? 200 CYS D HB2  1 
ATOM 3754  H HB3  . CYS B 2 179 ? 188.944 236.977 213.254 1.00 160.60 ? 200 CYS D HB3  1 
ATOM 3755  N N    . HIS B 2 180 ? 187.710 235.229 211.352 1.00 140.80 ? 201 HIS D N    1 
ATOM 3756  C CA   . HIS B 2 180 ? 186.475 234.855 210.676 1.00 140.80 ? 201 HIS D CA   1 
ATOM 3757  C C    . HIS B 2 180 ? 186.587 233.458 210.094 1.00 140.80 ? 201 HIS D C    1 
ATOM 3758  O O    . HIS B 2 180 ? 185.683 232.638 210.271 1.00 140.80 ? 201 HIS D O    1 
ATOM 3759  C CB   . HIS B 2 180 ? 186.135 235.854 209.565 1.00 140.80 ? 201 HIS D CB   1 
ATOM 3760  C CG   . HIS B 2 180 ? 185.502 237.116 210.063 1.00 140.80 ? 201 HIS D CG   1 
ATOM 3761  N ND1  . HIS B 2 180 ? 185.325 238.225 209.262 1.00 140.80 ? 201 HIS D ND1  1 
ATOM 3762  C CD2  . HIS B 2 180 ? 185.005 237.444 211.278 1.00 140.80 ? 201 HIS D CD2  1 
ATOM 3763  C CE1  . HIS B 2 180 ? 184.744 239.182 209.965 1.00 140.80 ? 201 HIS D CE1  1 
ATOM 3764  N NE2  . HIS B 2 180 ? 184.540 238.734 211.191 1.00 140.80 ? 201 HIS D NE2  1 
ATOM 3765  H H    . HIS B 2 180 ? 188.079 235.948 211.057 1.00 168.96 ? 201 HIS D H    1 
ATOM 3766  H HA   . HIS B 2 180 ? 185.750 234.841 211.320 1.00 168.96 ? 201 HIS D HA   1 
ATOM 3767  H HB2  . HIS B 2 180 ? 187.044 236.119 209.023 1.00 168.96 ? 201 HIS D HB2  1 
ATOM 3768  H HB3  . HIS B 2 180 ? 185.454 235.388 208.853 1.00 168.96 ? 201 HIS D HB3  1 
ATOM 3769  H HD2  . HIS B 2 180 ? 184.978 236.806 212.161 1.00 168.96 ? 201 HIS D HD2  1 
ATOM 3770  H HE1  . HIS B 2 180 ? 184.479 240.173 209.596 1.00 168.96 ? 201 HIS D HE1  1 
ATOM 3771  H HE2  . HIS B 2 180 ? 184.112 239.251 211.945 1.00 168.96 ? 201 HIS D HE2  1 
ATOM 3772  N N    . LYS B 2 181 ? 187.699 233.168 209.414 1.00 137.89 ? 202 LYS D N    1 
ATOM 3773  C CA   . LYS B 2 181 ? 187.958 231.811 208.933 1.00 137.89 ? 202 LYS D CA   1 
ATOM 3774  C C    . LYS B 2 181 ? 187.953 230.804 210.081 1.00 137.89 ? 202 LYS D C    1 
ATOM 3775  O O    . LYS B 2 181 ? 187.342 229.730 209.981 1.00 137.89 ? 202 LYS D O    1 
ATOM 3776  C CB   . LYS B 2 181 ? 189.293 231.752 208.189 1.00 137.89 ? 202 LYS D CB   1 
ATOM 3777  C CG   . LYS B 2 181 ? 189.625 230.388 207.599 1.00 137.89 ? 202 LYS D CG   1 
ATOM 3778  C CD   . LYS B 2 181 ? 190.931 230.426 206.819 1.00 137.89 ? 202 LYS D CD   1 
ATOM 3779  C CE   . LYS B 2 181 ? 191.285 229.054 206.263 1.00 137.89 ? 202 LYS D CE   1 
ATOM 3780  N NZ   . LYS B 2 181 ? 192.561 229.076 205.498 1.00 137.89 ? 202 LYS D NZ   1 
ATOM 3781  H H    . LYS B 2 181 ? 188.315 233.736 209.219 1.00 165.47 ? 202 LYS D H    1 
ATOM 3782  H HA   . LYS B 2 181 ? 187.263 231.556 208.306 1.00 165.47 ? 202 LYS D HA   1 
ATOM 3783  H HB2  . LYS B 2 181 ? 189.289 232.477 207.375 1.00 165.47 ? 202 LYS D HB2  1 
ATOM 3784  H HB3  . LYS B 2 181 ? 190.100 232.028 208.868 1.00 165.47 ? 202 LYS D HB3  1 
ATOM 3785  H HG2  . LYS B 2 181 ? 189.713 229.655 208.402 1.00 165.47 ? 202 LYS D HG2  1 
ATOM 3786  H HG3  . LYS B 2 181 ? 188.822 230.075 206.932 1.00 165.47 ? 202 LYS D HG3  1 
ATOM 3787  H HD2  . LYS B 2 181 ? 190.840 231.131 205.992 1.00 165.47 ? 202 LYS D HD2  1 
ATOM 3788  H HD3  . LYS B 2 181 ? 191.736 230.761 207.472 1.00 165.47 ? 202 LYS D HD3  1 
ATOM 3789  H HE2  . LYS B 2 181 ? 191.379 228.344 207.083 1.00 165.47 ? 202 LYS D HE2  1 
ATOM 3790  H HE3  . LYS B 2 181 ? 190.487 228.711 205.605 1.00 165.47 ? 202 LYS D HE3  1 
ATOM 3791  H HZ1  . LYS B 2 181 ? 192.760 228.150 205.147 1.00 165.47 ? 202 LYS D HZ1  1 
ATOM 3792  H HZ2  . LYS B 2 181 ? 192.479 229.719 204.723 1.00 165.47 ? 202 LYS D HZ2  1 
ATOM 3793  H HZ3  . LYS B 2 181 ? 193.312 229.375 206.104 1.00 165.47 ? 202 LYS D HZ3  1 
ATOM 3794  N N    . ALA B 2 182 ? 188.598 231.157 211.194 1.00 128.65 ? 203 ALA D N    1 
ATOM 3795  C CA   . ALA B 2 182 ? 188.577 230.320 212.386 1.00 128.65 ? 203 ALA D CA   1 
ATOM 3796  C C    . ALA B 2 182 ? 187.149 230.057 212.854 1.00 128.65 ? 203 ALA D C    1 
ATOM 3797  O O    . ALA B 2 182 ? 186.745 228.905 213.042 1.00 128.65 ? 203 ALA D O    1 
ATOM 3798  C CB   . ALA B 2 182 ? 189.400 230.989 213.488 1.00 128.65 ? 203 ALA D CB   1 
ATOM 3799  H H    . ALA B 2 182 ? 189.056 231.879 211.281 1.00 154.38 ? 203 ALA D H    1 
ATOM 3800  H HA   . ALA B 2 182 ? 188.988 229.466 212.182 1.00 154.38 ? 203 ALA D HA   1 
ATOM 3801  H HB1  . ALA B 2 182 ? 189.570 230.352 214.194 1.00 154.38 ? 203 ALA D HB1  1 
ATOM 3802  H HB2  . ALA B 2 182 ? 190.241 231.286 213.108 1.00 154.38 ? 203 ALA D HB2  1 
ATOM 3803  H HB3  . ALA B 2 182 ? 188.911 231.754 213.832 1.00 154.38 ? 203 ALA D HB3  1 
ATOM 3804  N N    . LEU B 2 183 ? 186.361 231.117 213.045 1.00 129.97 ? 204 LEU D N    1 
ATOM 3805  C CA   . LEU B 2 183 ? 184.986 230.917 213.499 1.00 129.97 ? 204 LEU D CA   1 
ATOM 3806  C C    . LEU B 2 183 ? 184.146 230.186 212.452 1.00 129.97 ? 204 LEU D C    1 
ATOM 3807  O O    . LEU B 2 183 ? 183.332 229.316 212.801 1.00 129.97 ? 204 LEU D O    1 
ATOM 3808  C CB   . LEU B 2 183 ? 184.337 232.268 213.826 1.00 129.97 ? 204 LEU D CB   1 
ATOM 3809  C CG   . LEU B 2 183 ? 184.921 233.010 215.035 1.00 129.97 ? 204 LEU D CG   1 
ATOM 3810  C CD1  . LEU B 2 183 ? 184.361 234.425 215.082 1.00 129.97 ? 204 LEU D CD1  1 
ATOM 3811  C CD2  . LEU B 2 183 ? 184.587 232.248 216.309 1.00 129.97 ? 204 LEU D CD2  1 
ATOM 3812  H H    . LEU B 2 183 ? 186.591 231.937 212.924 1.00 155.96 ? 204 LEU D H    1 
ATOM 3813  H HA   . LEU B 2 183 ? 185.006 230.362 214.290 1.00 155.96 ? 204 LEU D HA   1 
ATOM 3814  H HB2  . LEU B 2 183 ? 184.435 232.919 212.959 1.00 155.96 ? 204 LEU D HB2  1 
ATOM 3815  H HB3  . LEU B 2 183 ? 183.276 232.107 214.017 1.00 155.96 ? 204 LEU D HB3  1 
ATOM 3816  H HG   . LEU B 2 183 ? 186.004 233.084 214.929 1.00 155.96 ? 204 LEU D HG   1 
ATOM 3817  H HD11 . LEU B 2 183 ? 184.775 234.953 215.941 1.00 155.96 ? 204 LEU D HD11 1 
ATOM 3818  H HD12 . LEU B 2 183 ? 184.630 234.954 214.167 1.00 155.96 ? 204 LEU D HD12 1 
ATOM 3819  H HD13 . LEU B 2 183 ? 183.276 234.384 215.171 1.00 155.96 ? 204 LEU D HD13 1 
ATOM 3820  H HD21 . LEU B 2 183 ? 185.003 232.775 217.168 1.00 155.96 ? 204 LEU D HD21 1 
ATOM 3821  H HD22 . LEU B 2 183 ? 183.505 232.175 216.417 1.00 155.96 ? 204 LEU D HD22 1 
ATOM 3822  H HD23 . LEU B 2 183 ? 185.015 231.247 216.256 1.00 155.96 ? 204 LEU D HD23 1 
ATOM 3823  N N    . ARG B 2 184 ? 184.349 230.510 211.171 1.00 148.33 ? 205 ARG D N    1 
ATOM 3824  C CA   . ARG B 2 184 ? 183.602 229.890 210.085 1.00 148.33 ? 205 ARG D CA   1 
ATOM 3825  C C    . ARG B 2 184 ? 183.679 228.373 210.159 1.00 148.33 ? 205 ARG D C    1 
ATOM 3826  O O    . ARG B 2 184 ? 182.670 227.685 209.967 1.00 148.33 ? 205 ARG D O    1 
ATOM 3827  C CB   . ARG B 2 184 ? 184.132 230.357 208.738 1.00 148.33 ? 205 ARG D CB   1 
ATOM 3828  C CG   . ARG B 2 184 ? 183.268 229.978 207.545 1.00 148.33 ? 205 ARG D CG   1 
ATOM 3829  C CD   . ARG B 2 184 ? 183.845 230.475 206.269 1.00 148.33 ? 205 ARG D CD   1 
ATOM 3830  N NE   . ARG B 2 184 ? 184.019 231.919 206.279 1.00 148.33 ? 205 ARG D NE   1 
ATOM 3831  C CZ   . ARG B 2 184 ? 184.740 232.609 205.374 1.00 148.33 ? 205 ARG D CZ   1 
ATOM 3832  N NH1  . ARG B 2 184 ? 185.346 231.974 204.395 1.00 148.33 ? 205 ARG D NH1  1 
ATOM 3833  N NH2  . ARG B 2 184 ? 184.837 233.923 205.469 1.00 148.33 ? 205 ARG D NH2  1 
ATOM 3834  H H    . ARG B 2 184 ? 184.921 231.095 210.905 1.00 178.00 ? 205 ARG D H    1 
ATOM 3835  H HA   . ARG B 2 184 ? 182.670 230.152 210.147 1.00 178.00 ? 205 ARG D HA   1 
ATOM 3836  H HB2  . ARG B 2 184 ? 184.231 231.442 208.742 1.00 178.00 ? 205 ARG D HB2  1 
ATOM 3837  H HB3  . ARG B 2 184 ? 185.125 229.939 208.572 1.00 178.00 ? 205 ARG D HB3  1 
ATOM 3838  H HG2  . ARG B 2 184 ? 183.187 228.893 207.485 1.00 178.00 ? 205 ARG D HG2  1 
ATOM 3839  H HG3  . ARG B 2 184 ? 182.274 230.410 207.663 1.00 178.00 ? 205 ARG D HG3  1 
ATOM 3840  H HD2  . ARG B 2 184 ? 184.819 230.016 206.107 1.00 178.00 ? 205 ARG D HD2  1 
ATOM 3841  H HD3  . ARG B 2 184 ? 183.181 230.217 205.445 1.00 178.00 ? 205 ARG D HD3  1 
ATOM 3842  H HE   . ARG B 2 184 ? 183.567 232.442 207.017 1.00 178.00 ? 205 ARG D HE   1 
ATOM 3843  H HH11 . ARG B 2 184 ? 185.272 230.969 204.322 1.00 178.00 ? 205 ARG D HH11 1 
ATOM 3844  H HH12 . ARG B 2 184 ? 185.886 232.491 203.716 1.00 178.00 ? 205 ARG D HH12 1 
ATOM 3845  H HH21 . ARG B 2 184 ? 184.371 234.411 206.222 1.00 178.00 ? 205 ARG D HH21 1 
ATOM 3846  H HH22 . ARG B 2 184 ? 185.377 234.440 204.791 1.00 178.00 ? 205 ARG D HH22 1 
ATOM 3847  N N    . GLN B 2 185 ? 184.869 227.833 210.437 1.00 143.21 ? 206 GLN D N    1 
ATOM 3848  C CA   . GLN B 2 185 ? 184.999 226.392 210.637 1.00 143.21 ? 206 GLN D CA   1 
ATOM 3849  C C    . GLN B 2 185 ? 184.407 225.942 211.970 1.00 143.21 ? 206 GLN D C    1 
ATOM 3850  O O    . GLN B 2 185 ? 183.803 224.865 212.042 1.00 143.21 ? 206 GLN D O    1 
ATOM 3851  C CB   . GLN B 2 185 ? 186.471 225.979 210.559 1.00 143.21 ? 206 GLN D CB   1 
ATOM 3852  C CG   . GLN B 2 185 ? 187.094 226.153 209.184 1.00 143.21 ? 206 GLN D CG   1 
ATOM 3853  C CD   . GLN B 2 185 ? 188.535 225.680 209.138 1.00 143.21 ? 206 GLN D CD   1 
ATOM 3854  O OE1  . GLN B 2 185 ? 189.084 225.218 210.142 1.00 143.21 ? 206 GLN D OE1  1 
ATOM 3855  N NE2  . GLN B 2 185 ? 189.157 225.794 207.970 1.00 143.21 ? 206 GLN D NE2  1 
ATOM 3856  H H    . GLN B 2 185 ? 185.603 228.273 210.515 1.00 171.85 ? 206 GLN D H    1 
ATOM 3857  H HA   . GLN B 2 185 ? 184.521 225.928 209.935 1.00 171.85 ? 206 GLN D HA   1 
ATOM 3858  H HB2  . GLN B 2 185 ? 187.053 226.567 211.269 1.00 171.85 ? 206 GLN D HB2  1 
ATOM 3859  H HB3  . GLN B 2 185 ? 186.571 224.931 210.843 1.00 171.85 ? 206 GLN D HB3  1 
ATOM 3860  H HG2  . GLN B 2 185 ? 186.521 225.573 208.461 1.00 171.85 ? 206 GLN D HG2  1 
ATOM 3861  H HG3  . GLN B 2 185 ? 187.072 227.210 208.918 1.00 171.85 ? 206 GLN D HG3  1 
ATOM 3862  H HE21 . GLN B 2 185 ? 190.109 225.498 207.878 1.00 171.85 ? 206 GLN D HE21 1 
ATOM 3863  H HE22 . GLN B 2 185 ? 188.674 226.174 207.181 1.00 171.85 ? 206 GLN D HE22 1 
ATOM 3864  N N    . PHE B 2 186 ? 184.584 226.738 213.029 1.00 134.78 ? 207 PHE D N    1 
ATOM 3865  C CA   . PHE B 2 186 ? 184.044 226.384 214.341 1.00 134.78 ? 207 PHE D CA   1 
ATOM 3866  C C    . PHE B 2 186 ? 182.583 225.966 214.245 1.00 134.78 ? 207 PHE D C    1 
ATOM 3867  O O    . PHE B 2 186 ? 182.189 224.917 214.766 1.00 134.78 ? 207 PHE D O    1 
ATOM 3868  C CB   . PHE B 2 186 ? 184.179 227.560 215.310 1.00 134.78 ? 207 PHE D CB   1 
ATOM 3869  C CG   . PHE B 2 186 ? 183.514 227.330 216.638 1.00 134.78 ? 207 PHE D CG   1 
ATOM 3870  C CD1  . PHE B 2 186 ? 184.205 226.734 217.682 1.00 134.78 ? 207 PHE D CD1  1 
ATOM 3871  C CD2  . PHE B 2 186 ? 182.196 227.709 216.845 1.00 134.78 ? 207 PHE D CD2  1 
ATOM 3872  C CE1  . PHE B 2 186 ? 183.594 226.522 218.903 1.00 134.78 ? 207 PHE D CE1  1 
ATOM 3873  C CE2  . PHE B 2 186 ? 181.583 227.499 218.065 1.00 134.78 ? 207 PHE D CE2  1 
ATOM 3874  C CZ   . PHE B 2 186 ? 182.284 226.905 219.095 1.00 134.78 ? 207 PHE D CZ   1 
ATOM 3875  H H    . PHE B 2 186 ? 185.012 227.483 213.016 1.00 161.74 ? 207 PHE D H    1 
ATOM 3876  H HA   . PHE B 2 186 ? 184.547 225.635 214.698 1.00 161.74 ? 207 PHE D HA   1 
ATOM 3877  H HB2  . PHE B 2 186 ? 185.233 227.764 215.489 1.00 161.74 ? 207 PHE D HB2  1 
ATOM 3878  H HB3  . PHE B 2 186 ? 183.744 228.452 214.862 1.00 161.74 ? 207 PHE D HB3  1 
ATOM 3879  H HD1  . PHE B 2 186 ? 185.242 226.432 217.530 1.00 161.74 ? 207 PHE D HD1  1 
ATOM 3880  H HD2  . PHE B 2 186 ? 181.643 228.178 216.031 1.00 161.74 ? 207 PHE D HD2  1 
ATOM 3881  H HE1  . PHE B 2 186 ? 184.149 226.052 219.715 1.00 161.74 ? 207 PHE D HE1  1 
ATOM 3882  H HE2  . PHE B 2 186 ? 180.547 227.802 218.215 1.00 161.74 ? 207 PHE D HE2  1 
ATOM 3883  H HZ   . PHE B 2 186 ? 181.801 226.737 220.057 1.00 161.74 ? 207 PHE D HZ   1 
ATOM 3884  N N    . PHE B 2 187 ? 181.760 226.778 213.578 1.00 138.19 ? 208 PHE D N    1 
ATOM 3885  C CA   . PHE B 2 187 ? 180.313 226.565 213.618 1.00 138.19 ? 208 PHE D CA   1 
ATOM 3886  C C    . PHE B 2 187 ? 179.830 225.469 212.673 1.00 138.19 ? 208 PHE D C    1 
ATOM 3887  O O    . PHE B 2 187 ? 178.627 225.183 212.666 1.00 138.19 ? 208 PHE D O    1 
ATOM 3888  C CB   . PHE B 2 187 ? 179.588 227.869 213.281 1.00 138.19 ? 208 PHE D CB   1 
ATOM 3889  C CG   . PHE B 2 187 ? 179.643 228.894 214.378 1.00 138.19 ? 208 PHE D CG   1 
ATOM 3890  C CD1  . PHE B 2 187 ? 178.698 228.896 215.394 1.00 138.19 ? 208 PHE D CD1  1 
ATOM 3891  C CD2  . PHE B 2 187 ? 180.640 229.858 214.397 1.00 138.19 ? 208 PHE D CD2  1 
ATOM 3892  C CE1  . PHE B 2 187 ? 178.746 229.838 216.403 1.00 138.19 ? 208 PHE D CE1  1 
ATOM 3893  C CE2  . PHE B 2 187 ? 180.691 230.801 215.407 1.00 138.19 ? 208 PHE D CE2  1 
ATOM 3894  C CZ   . PHE B 2 187 ? 179.745 230.791 216.409 1.00 138.19 ? 208 PHE D CZ   1 
ATOM 3895  H H    . PHE B 2 187 ? 182.009 227.450 213.101 1.00 165.83 ? 208 PHE D H    1 
ATOM 3896  H HA   . PHE B 2 187 ? 180.062 226.237 214.494 1.00 165.83 ? 208 PHE D HA   1 
ATOM 3897  H HB2  . PHE B 2 187 ? 180.025 228.307 212.385 1.00 165.83 ? 208 PHE D HB2  1 
ATOM 3898  H HB3  . PHE B 2 187 ? 178.542 227.658 213.065 1.00 165.83 ? 208 PHE D HB3  1 
ATOM 3899  H HD1  . PHE B 2 187 ? 177.910 228.142 215.389 1.00 165.83 ? 208 PHE D HD1  1 
ATOM 3900  H HD2  . PHE B 2 187 ? 181.388 229.866 213.604 1.00 165.83 ? 208 PHE D HD2  1 
ATOM 3901  H HE1  . PHE B 2 187 ? 177.998 229.829 217.194 1.00 165.83 ? 208 PHE D HE1  1 
ATOM 3902  H HE2  . PHE B 2 187 ? 181.480 231.553 215.409 1.00 165.83 ? 208 PHE D HE2  1 
ATOM 3903  H HZ   . PHE B 2 187 ? 179.785 231.534 217.205 1.00 165.83 ? 208 PHE D HZ   1 
ATOM 3904  N N    . ASP B 2 188 ? 180.719 224.844 211.896 1.00 153.97 ? 209 ASP D N    1 
ATOM 3905  C CA   . ASP B 2 188 ? 180.376 223.678 211.089 1.00 153.97 ? 209 ASP D CA   1 
ATOM 3906  C C    . ASP B 2 188 ? 180.945 222.377 211.635 1.00 153.97 ? 209 ASP D C    1 
ATOM 3907  O O    . ASP B 2 188 ? 180.317 221.326 211.469 1.00 153.97 ? 209 ASP D O    1 
ATOM 3908  C CB   . ASP B 2 188 ? 180.866 223.876 209.652 1.00 153.97 ? 209 ASP D CB   1 
ATOM 3909  C CG   . ASP B 2 188 ? 180.165 225.024 208.939 1.00 153.97 ? 209 ASP D CG   1 
ATOM 3910  O OD1  . ASP B 2 188 ? 178.959 225.080 208.989 1.00 153.97 ? 209 ASP D OD1  1 
ATOM 3911  O OD2  . ASP B 2 188 ? 180.841 225.834 208.352 1.00 153.97 ? 209 ASP D OD2  1 
ATOM 3912  H H    . ASP B 2 188 ? 181.538 225.080 211.809 1.00 184.76 ? 209 ASP D H    1 
ATOM 3913  H HA   . ASP B 2 188 ? 179.416 223.563 211.047 1.00 184.76 ? 209 ASP D HA   1 
ATOM 3914  H HB2  . ASP B 2 188 ? 181.939 224.072 209.657 1.00 184.76 ? 209 ASP D HB2  1 
ATOM 3915  H HB3  . ASP B 2 188 ? 180.704 222.960 209.083 1.00 184.76 ? 209 ASP D HB3  1 
ATOM 3916  N N    . ARG B 2 189 ? 182.111 222.420 212.286 1.00 149.80 ? 210 ARG D N    1 
ATOM 3917  C CA   . ARG B 2 189 ? 182.774 221.214 212.767 1.00 149.80 ? 210 ARG D CA   1 
ATOM 3918  C C    . ARG B 2 189 ? 182.409 220.849 214.199 1.00 149.80 ? 210 ARG D C    1 
ATOM 3919  O O    . ARG B 2 189 ? 182.492 219.671 214.560 1.00 149.80 ? 210 ARG D O    1 
ATOM 3920  C CB   . ARG B 2 189 ? 184.284 221.380 212.674 1.00 149.80 ? 210 ARG D CB   1 
ATOM 3921  C CG   . ARG B 2 189 ? 184.827 221.517 211.260 1.00 149.80 ? 210 ARG D CG   1 
ATOM 3922  C CD   . ARG B 2 189 ? 186.298 221.722 211.254 1.00 149.80 ? 210 ARG D CD   1 
ATOM 3923  N NE   . ARG B 2 189 ? 186.820 221.862 209.905 1.00 149.80 ? 210 ARG D NE   1 
ATOM 3924  C CZ   . ARG B 2 189 ? 188.109 222.116 209.606 1.00 149.80 ? 210 ARG D CZ   1 
ATOM 3925  N NH1  . ARG B 2 189 ? 188.993 222.255 210.570 1.00 149.80 ? 210 ARG D NH1  1 
ATOM 3926  N NH2  . ARG B 2 189 ? 188.486 222.226 208.344 1.00 149.80 ? 210 ARG D NH2  1 
ATOM 3927  H H    . ARG B 2 189 ? 182.538 223.145 212.463 1.00 179.76 ? 210 ARG D H    1 
ATOM 3928  H HA   . ARG B 2 189 ? 182.529 220.465 212.202 1.00 179.76 ? 210 ARG D HA   1 
ATOM 3929  H HB2  . ARG B 2 189 ? 184.587 222.266 213.231 1.00 179.76 ? 210 ARG D HB2  1 
ATOM 3930  H HB3  . ARG B 2 189 ? 184.773 220.521 213.134 1.00 179.76 ? 210 ARG D HB3  1 
ATOM 3931  H HG2  . ARG B 2 189 ? 184.605 220.612 210.696 1.00 179.76 ? 210 ARG D HG2  1 
ATOM 3932  H HG3  . ARG B 2 189 ? 184.359 222.373 210.772 1.00 179.76 ? 210 ARG D HG3  1 
ATOM 3933  H HD2  . ARG B 2 189 ? 186.541 222.628 211.810 1.00 179.76 ? 210 ARG D HD2  1 
ATOM 3934  H HD3  . ARG B 2 189 ? 186.786 220.868 211.722 1.00 179.76 ? 210 ARG D HD3  1 
ATOM 3935  H HE   . ARG B 2 189 ? 186.171 221.762 209.136 1.00 179.76 ? 210 ARG D HE   1 
ATOM 3936  H HH11 . ARG B 2 189 ? 188.705 222.171 211.535 1.00 179.76 ? 210 ARG D HH11 1 
ATOM 3937  H HH12 . ARG B 2 189 ? 189.959 222.445 210.346 1.00 179.76 ? 210 ARG D HH12 1 
ATOM 3938  H HH21 . ARG B 2 189 ? 187.807 222.119 207.603 1.00 179.76 ? 210 ARG D HH21 1 
ATOM 3939  H HH22 . ARG B 2 189 ? 189.451 222.416 208.120 1.00 179.76 ? 210 ARG D HH22 1 
ATOM 3940  N N    . VAL B 2 190 ? 182.013 221.819 215.017 1.00 150.01 ? 211 VAL D N    1 
ATOM 3941  C CA   . VAL B 2 190 ? 181.667 221.569 216.414 1.00 150.01 ? 211 VAL D CA   1 
ATOM 3942  C C    . VAL B 2 190 ? 180.233 221.048 216.438 1.00 150.01 ? 211 VAL D C    1 
ATOM 3943  O O    . VAL B 2 190 ? 179.375 221.609 215.743 1.00 150.01 ? 211 VAL D O    1 
ATOM 3944  C CB   . VAL B 2 190 ? 181.786 222.851 217.260 1.00 150.01 ? 211 VAL D CB   1 
ATOM 3945  C CG1  . VAL B 2 190 ? 181.236 222.618 218.659 1.00 150.01 ? 211 VAL D CG1  1 
ATOM 3946  C CG2  . VAL B 2 190 ? 183.238 223.300 217.319 1.00 150.01 ? 211 VAL D CG2  1 
ATOM 3947  H H    . VAL B 2 190 ? 181.934 222.643 214.784 1.00 180.01 ? 211 VAL D H    1 
ATOM 3948  H HA   . VAL B 2 190 ? 182.279 220.903 216.754 1.00 180.01 ? 211 VAL D HA   1 
ATOM 3949  H HB   . VAL B 2 190 ? 181.180 223.634 216.803 1.00 180.01 ? 211 VAL D HB   1 
ATOM 3950  H HG11 . VAL B 2 190 ? 181.327 223.535 219.243 1.00 180.01 ? 211 VAL D HG11 1 
ATOM 3951  H HG12 . VAL B 2 190 ? 180.186 222.333 218.594 1.00 180.01 ? 211 VAL D HG12 1 
ATOM 3952  H HG13 . VAL B 2 190 ? 181.800 221.822 219.144 1.00 180.01 ? 211 VAL D HG13 1 
ATOM 3953  H HG21 . VAL B 2 190 ? 183.314 224.207 217.918 1.00 180.01 ? 211 VAL D HG21 1 
ATOM 3954  H HG22 . VAL B 2 190 ? 183.844 222.515 217.771 1.00 180.01 ? 211 VAL D HG22 1 
ATOM 3955  H HG23 . VAL B 2 190 ? 183.598 223.501 216.310 1.00 180.01 ? 211 VAL D HG23 1 
ATOM 3956  N N    . PRO B 2 191 ? 179.917 219.989 217.190 1.00 139.87 ? 212 PRO D N    1 
ATOM 3957  C CA   . PRO B 2 191 ? 178.557 219.445 217.125 1.00 139.87 ? 212 PRO D CA   1 
ATOM 3958  C C    . PRO B 2 191 ? 177.525 220.486 217.531 1.00 139.87 ? 212 PRO D C    1 
ATOM 3959  O O    . PRO B 2 191 ? 177.794 221.376 218.340 1.00 139.87 ? 212 PRO D O    1 
ATOM 3960  C CB   . PRO B 2 191 ? 178.601 218.280 218.119 1.00 139.87 ? 212 PRO D CB   1 
ATOM 3961  C CG   . PRO B 2 191 ? 180.034 217.871 218.141 1.00 139.87 ? 212 PRO D CG   1 
ATOM 3962  C CD   . PRO B 2 191 ? 180.794 219.165 218.026 1.00 139.87 ? 212 PRO D CD   1 
ATOM 3963  H HA   . PRO B 2 191 ? 178.361 219.118 216.233 1.00 167.84 ? 212 PRO D HA   1 
ATOM 3964  H HB2  . PRO B 2 191 ? 178.236 218.612 219.103 1.00 167.84 ? 212 PRO D HB2  1 
ATOM 3965  H HB3  . PRO B 2 191 ? 177.932 217.474 217.784 1.00 167.84 ? 212 PRO D HB3  1 
ATOM 3966  H HG2  . PRO B 2 191 ? 180.260 217.328 219.070 1.00 167.84 ? 212 PRO D HG2  1 
ATOM 3967  H HG3  . PRO B 2 191 ? 180.244 217.181 217.310 1.00 167.84 ? 212 PRO D HG3  1 
ATOM 3968  H HD2  . PRO B 2 191 ? 180.930 219.602 219.026 1.00 167.84 ? 212 PRO D HD2  1 
ATOM 3969  H HD3  . PRO B 2 191 ? 181.768 218.978 217.549 1.00 167.84 ? 212 PRO D HD3  1 
ATOM 3970  N N    . SER B 2 192 ? 176.335 220.370 216.937 1.00 147.68 ? 213 SER D N    1 
ATOM 3971  C CA   . SER B 2 192 ? 175.261 221.319 217.208 1.00 147.68 ? 213 SER D CA   1 
ATOM 3972  C C    . SER B 2 192 ? 174.973 221.435 218.698 1.00 147.68 ? 213 SER D C    1 
ATOM 3973  O O    . SER B 2 192 ? 174.793 222.547 219.216 1.00 147.68 ? 213 SER D O    1 
ATOM 3974  C CB   . SER B 2 192 ? 174.001 220.899 216.476 1.00 147.68 ? 213 SER D CB   1 
ATOM 3975  O OG   . SER B 2 192 ? 174.176 220.978 215.088 1.00 147.68 ? 213 SER D OG   1 
ATOM 3976  H H    . SER B 2 192 ? 176.128 219.752 216.376 1.00 177.22 ? 213 SER D H    1 
ATOM 3977  H HA   . SER B 2 192 ? 175.519 222.195 216.882 1.00 177.22 ? 213 SER D HA   1 
ATOM 3978  H HB2  . SER B 2 192 ? 173.740 219.879 216.755 1.00 177.22 ? 213 SER D HB2  1 
ATOM 3979  H HB3  . SER B 2 192 ? 173.174 221.542 216.777 1.00 177.22 ? 213 SER D HB3  1 
ATOM 3980  H HG   . SER B 2 192 ? 173.764 221.800 214.815 1.00 177.22 ? 213 SER D HG   1 
ATOM 3981  N N    . GLU B 2 193 ? 174.969 220.303 219.408 1.00 152.99 ? 214 GLU D N    1 
ATOM 3982  C CA   . GLU B 2 193 ? 174.646 220.285 220.829 1.00 152.99 ? 214 GLU D CA   1 
ATOM 3983  C C    . GLU B 2 193 ? 175.669 221.008 221.698 1.00 152.99 ? 214 GLU D C    1 
ATOM 3984  O O    . GLU B 2 193 ? 175.432 221.122 222.901 1.00 152.99 ? 214 GLU D O    1 
ATOM 3985  C CB   . GLU B 2 193 ? 174.510 218.838 221.307 1.00 152.99 ? 214 GLU D CB   1 
ATOM 3986  C CG   . GLU B 2 193 ? 175.796 218.027 221.231 1.00 152.99 ? 214 GLU D CG   1 
ATOM 3987  C CD   . GLU B 2 193 ? 175.988 217.359 219.898 1.00 152.99 ? 214 GLU D CD   1 
ATOM 3988  O OE1  . GLU B 2 193 ? 175.361 217.770 218.953 1.00 152.99 ? 214 GLU D OE1  1 
ATOM 3989  O OE2  . GLU B 2 193 ? 176.765 216.435 219.826 1.00 152.99 ? 214 GLU D OE2  1 
ATOM 3990  H H    . GLU B 2 193 ? 175.147 219.532 219.079 1.00 183.59 ? 214 GLU D H    1 
ATOM 3991  H HA   . GLU B 2 193 ? 173.796 220.735 220.953 1.00 183.59 ? 214 GLU D HA   1 
ATOM 3992  H HB2  . GLU B 2 193 ? 174.168 218.827 222.342 1.00 183.59 ? 214 GLU D HB2  1 
ATOM 3993  H HB3  . GLU B 2 193 ? 173.756 218.326 220.709 1.00 183.59 ? 214 GLU D HB3  1 
ATOM 3994  H HG2  . GLU B 2 193 ? 176.641 218.688 221.419 1.00 183.59 ? 214 GLU D HG2  1 
ATOM 3995  H HG3  . GLU B 2 193 ? 175.782 217.269 222.014 1.00 183.59 ? 214 GLU D HG3  1 
ATOM 3996  N N    . TYR B 2 194 ? 176.796 221.458 221.143 1.00 145.65 ? 215 TYR D N    1 
ATOM 3997  C CA   . TYR B 2 194 ? 177.706 222.390 221.807 1.00 145.65 ? 215 TYR D CA   1 
ATOM 3998  C C    . TYR B 2 194 ? 177.739 223.750 221.130 1.00 145.65 ? 215 TYR D C    1 
ATOM 3999  O O    . TYR B 2 194 ? 177.792 224.779 221.816 1.00 145.65 ? 215 TYR D O    1 
ATOM 4000  C CB   . TYR B 2 194 ? 179.118 221.802 221.860 1.00 145.65 ? 215 TYR D CB   1 
ATOM 4001  C CG   . TYR B 2 194 ? 179.209 220.501 222.626 1.00 145.65 ? 215 TYR D CG   1 
ATOM 4002  C CD1  . TYR B 2 194 ? 179.339 220.516 224.007 1.00 145.65 ? 215 TYR D CD1  1 
ATOM 4003  C CD2  . TYR B 2 194 ? 179.162 219.292 221.947 1.00 145.65 ? 215 TYR D CD2  1 
ATOM 4004  C CE1  . TYR B 2 194 ? 179.422 219.328 224.706 1.00 145.65 ? 215 TYR D CE1  1 
ATOM 4005  C CE2  . TYR B 2 194 ? 179.245 218.103 222.646 1.00 145.65 ? 215 TYR D CE2  1 
ATOM 4006  C CZ   . TYR B 2 194 ? 179.375 218.125 224.030 1.00 145.65 ? 215 TYR D CZ   1 
ATOM 4007  O OH   . TYR B 2 194 ? 179.458 216.941 224.727 1.00 145.65 ? 215 TYR D OH   1 
ATOM 4008  H H    . TYR B 2 194 ? 177.066 221.230 220.361 1.00 174.78 ? 215 TYR D H    1 
ATOM 4009  H HA   . TYR B 2 194 ? 177.410 222.558 222.713 1.00 174.78 ? 215 TYR D HA   1 
ATOM 4010  H HB2  . TYR B 2 194 ? 179.478 221.626 220.846 1.00 174.78 ? 215 TYR D HB2  1 
ATOM 4011  H HB3  . TYR B 2 194 ? 179.793 222.519 222.327 1.00 174.78 ? 215 TYR D HB3  1 
ATOM 4012  H HD1  . TYR B 2 194 ? 179.375 221.466 224.540 1.00 174.78 ? 215 TYR D HD1  1 
ATOM 4013  H HD2  . TYR B 2 194 ? 179.059 219.280 220.862 1.00 174.78 ? 215 TYR D HD2  1 
ATOM 4014  H HE1  . TYR B 2 194 ? 179.523 219.339 225.791 1.00 174.78 ? 215 TYR D HE1  1 
ATOM 4015  H HE2  . TYR B 2 194 ? 179.208 217.154 222.113 1.00 174.78 ? 215 TYR D HE2  1 
ATOM 4016  H HH   . TYR B 2 194 ? 179.547 217.128 225.664 1.00 174.78 ? 215 TYR D HH   1 
ATOM 4017  N N    . THR B 2 195 ? 177.720 223.758 219.793 1.00 150.23 ? 216 THR D N    1 
ATOM 4018  C CA   . THR B 2 195 ? 177.727 225.003 219.032 1.00 150.23 ? 216 THR D CA   1 
ATOM 4019  C C    . THR B 2 195 ? 176.506 225.851 219.366 1.00 150.23 ? 216 THR D C    1 
ATOM 4020  O O    . THR B 2 195 ? 176.630 227.032 219.716 1.00 150.23 ? 216 THR D O    1 
ATOM 4021  C CB   . THR B 2 195 ? 177.769 224.730 217.517 1.00 150.23 ? 216 THR D CB   1 
ATOM 4022  O OG1  . THR B 2 195 ? 178.982 224.040 217.187 1.00 150.23 ? 216 THR D OG1  1 
ATOM 4023  C CG2  . THR B 2 195 ? 177.704 226.034 216.738 1.00 150.23 ? 216 THR D CG2  1 
ATOM 4024  H H    . THR B 2 195 ? 177.705 223.050 219.304 1.00 180.28 ? 216 THR D H    1 
ATOM 4025  H HA   . THR B 2 195 ? 178.521 225.512 219.256 1.00 180.28 ? 216 THR D HA   1 
ATOM 4026  H HB   . THR B 2 195 ? 176.923 224.102 217.237 1.00 180.28 ? 216 THR D HB   1 
ATOM 4027  H HG1  . THR B 2 195 ? 178.881 223.606 216.337 1.00 180.28 ? 216 THR D HG1  1 
ATOM 4028  H HG21 . THR B 2 195 ? 177.734 225.821 215.669 1.00 180.28 ? 216 THR D HG21 1 
ATOM 4029  H HG22 . THR B 2 195 ? 176.777 226.555 216.978 1.00 180.28 ? 216 THR D HG22 1 
ATOM 4030  H HG23 . THR B 2 195 ? 178.552 226.662 217.007 1.00 180.28 ? 216 THR D HG23 1 
ATOM 4031  N N    . TYR B 2 196 ? 175.316 225.258 219.280 1.00 158.37 ? 217 TYR D N    1 
ATOM 4032  C CA   . TYR B 2 196 ? 174.109 226.040 219.520 1.00 158.37 ? 217 TYR D CA   1 
ATOM 4033  C C    . TYR B 2 196 ? 173.865 226.264 221.006 1.00 158.37 ? 217 TYR D C    1 
ATOM 4034  O O    . TYR B 2 196 ? 173.426 227.352 221.394 1.00 158.37 ? 217 TYR D O    1 
ATOM 4035  C CB   . TYR B 2 196 ? 172.897 225.354 218.885 1.00 158.37 ? 217 TYR D CB   1 
ATOM 4036  C CG   . TYR B 2 196 ? 172.968 225.263 217.377 1.00 158.37 ? 217 TYR D CG   1 
ATOM 4037  C CD1  . TYR B 2 196 ? 173.623 226.248 216.653 1.00 158.37 ? 217 TYR D CD1  1 
ATOM 4038  C CD2  . TYR B 2 196 ? 172.376 224.196 216.717 1.00 158.37 ? 217 TYR D CD2  1 
ATOM 4039  C CE1  . TYR B 2 196 ? 173.688 226.165 215.275 1.00 158.37 ? 217 TYR D CE1  1 
ATOM 4040  C CE2  . TYR B 2 196 ? 172.440 224.113 215.340 1.00 158.37 ? 217 TYR D CE2  1 
ATOM 4041  C CZ   . TYR B 2 196 ? 173.099 225.103 214.620 1.00 158.37 ? 217 TYR D CZ   1 
ATOM 4042  O OH   . TYR B 2 196 ? 173.163 225.021 213.247 1.00 158.37 ? 217 TYR D OH   1 
ATOM 4043  H H    . TYR B 2 196 ? 175.183 224.430 219.088 1.00 190.04 ? 217 TYR D H    1 
ATOM 4044  H HA   . TYR B 2 196 ? 174.217 226.910 219.105 1.00 190.04 ? 217 TYR D HA   1 
ATOM 4045  H HB2  . TYR B 2 196 ? 172.802 224.342 219.282 1.00 190.04 ? 217 TYR D HB2  1 
ATOM 4046  H HB3  . TYR B 2 196 ? 171.991 225.896 219.151 1.00 190.04 ? 217 TYR D HB3  1 
ATOM 4047  H HD1  . TYR B 2 196 ? 174.089 227.086 217.171 1.00 190.04 ? 217 TYR D HD1  1 
ATOM 4048  H HD2  . TYR B 2 196 ? 171.861 223.422 217.286 1.00 190.04 ? 217 TYR D HD2  1 
ATOM 4049  H HE1  . TYR B 2 196 ? 174.204 226.939 214.706 1.00 190.04 ? 217 TYR D HE1  1 
ATOM 4050  H HE2  . TYR B 2 196 ? 171.976 223.274 214.822 1.00 190.04 ? 217 TYR D HE2  1 
ATOM 4051  H HH   . TYR B 2 196 ? 173.653 225.773 212.905 1.00 190.04 ? 217 TYR D HH   1 
ATOM 4052  N N    . ARG B 2 197 ? 174.155 225.265 221.849 1.00 171.65 ? 218 ARG D N    1 
ATOM 4053  C CA   . ARG B 2 197 ? 174.034 225.450 223.293 1.00 171.65 ? 218 ARG D CA   1 
ATOM 4054  C C    . ARG B 2 197 ? 174.850 226.636 223.778 1.00 171.65 ? 218 ARG D C    1 
ATOM 4055  O O    . ARG B 2 197 ? 174.356 227.436 224.580 1.00 171.65 ? 218 ARG D O    1 
ATOM 4056  C CB   . ARG B 2 197 ? 174.486 224.200 224.033 1.00 171.65 ? 218 ARG D CB   1 
ATOM 4057  C CG   . ARG B 2 197 ? 174.366 224.274 225.547 1.00 171.65 ? 218 ARG D CG   1 
ATOM 4058  C CD   . ARG B 2 197 ? 174.780 223.002 226.194 1.00 171.65 ? 218 ARG D CD   1 
ATOM 4059  N NE   . ARG B 2 197 ? 174.723 223.088 227.644 1.00 171.65 ? 218 ARG D NE   1 
ATOM 4060  C CZ   . ARG B 2 197 ? 175.068 222.092 228.483 1.00 171.65 ? 218 ARG D CZ   1 
ATOM 4061  N NH1  . ARG B 2 197 ? 175.492 220.944 228.002 1.00 171.65 ? 218 ARG D NH1  1 
ATOM 4062  N NH2  . ARG B 2 197 ? 174.981 222.269 229.790 1.00 171.65 ? 218 ARG D NH2  1 
ATOM 4063  H H    . ARG B 2 197 ? 174.420 224.482 221.611 1.00 205.98 ? 218 ARG D H    1 
ATOM 4064  H HA   . ARG B 2 197 ? 173.104 225.614 223.515 1.00 205.98 ? 218 ARG D HA   1 
ATOM 4065  H HB2  . ARG B 2 197 ? 173.898 223.347 223.697 1.00 205.98 ? 218 ARG D HB2  1 
ATOM 4066  H HB3  . ARG B 2 197 ? 175.529 223.993 223.795 1.00 205.98 ? 218 ARG D HB3  1 
ATOM 4067  H HG2  . ARG B 2 197 ? 175.004 225.074 225.924 1.00 205.98 ? 218 ARG D HG2  1 
ATOM 4068  H HG3  . ARG B 2 197 ? 173.330 224.476 225.821 1.00 205.98 ? 218 ARG D HG3  1 
ATOM 4069  H HD2  . ARG B 2 197 ? 174.117 222.199 225.873 1.00 205.98 ? 218 ARG D HD2  1 
ATOM 4070  H HD3  . ARG B 2 197 ? 175.803 222.765 225.906 1.00 205.98 ? 218 ARG D HD3  1 
ATOM 4071  H HE   . ARG B 2 197 ? 174.402 223.956 228.052 1.00 205.98 ? 218 ARG D HE   1 
ATOM 4072  H HH11 . ARG B 2 197 ? 175.559 220.809 227.003 1.00 205.98 ? 218 ARG D HH11 1 
ATOM 4073  H HH12 . ARG B 2 197 ? 175.751 220.198 228.631 1.00 205.98 ? 218 ARG D HH12 1 
ATOM 4074  H HH21 . ARG B 2 197 ? 174.655 223.152 230.160 1.00 205.98 ? 218 ARG D HH21 1 
ATOM 4075  H HH22 . ARG B 2 197 ? 175.239 221.523 230.419 1.00 205.98 ? 218 ARG D HH22 1 
ATOM 4076  N N    . MET B 2 198 ? 176.087 226.771 223.303 1.00 158.40 ? 219 MET D N    1 
ATOM 4077  C CA   . MET B 2 198 ? 176.903 227.917 223.682 1.00 158.40 ? 219 MET D CA   1 
ATOM 4078  C C    . MET B 2 198 ? 176.451 229.197 222.993 1.00 158.40 ? 219 MET D C    1 
ATOM 4079  O O    . MET B 2 198 ? 176.382 230.253 223.630 1.00 158.40 ? 219 MET D O    1 
ATOM 4080  C CB   . MET B 2 198 ? 178.371 227.639 223.367 1.00 158.40 ? 219 MET D CB   1 
ATOM 4081  C CG   . MET B 2 198 ? 179.018 226.587 224.257 1.00 158.40 ? 219 MET D CG   1 
ATOM 4082  S SD   . MET B 2 198 ? 180.796 226.447 223.988 1.00 158.40 ? 219 MET D SD   1 
ATOM 4083  C CE   . MET B 2 198 ? 180.834 225.624 222.398 1.00 158.40 ? 219 MET D CE   1 
ATOM 4084  H H    . MET B 2 198 ? 176.471 226.219 222.767 1.00 190.08 ? 219 MET D H    1 
ATOM 4085  H HA   . MET B 2 198 ? 176.839 228.043 224.642 1.00 190.08 ? 219 MET D HA   1 
ATOM 4086  H HB2  . MET B 2 198 ? 178.463 227.305 222.334 1.00 190.08 ? 219 MET D HB2  1 
ATOM 4087  H HB3  . MET B 2 198 ? 178.946 228.560 223.466 1.00 190.08 ? 219 MET D HB3  1 
ATOM 4088  H HG2  . MET B 2 198 ? 178.846 226.841 225.303 1.00 190.08 ? 219 MET D HG2  1 
ATOM 4089  H HG3  . MET B 2 198 ? 178.563 225.616 224.063 1.00 190.08 ? 219 MET D HG3  1 
ATOM 4090  H HE1  . MET B 2 198 ? 181.869 225.466 222.094 1.00 190.08 ? 219 MET D HE1  1 
ATOM 4091  H HE2  . MET B 2 198 ? 180.326 224.661 222.474 1.00 190.08 ? 219 MET D HE2  1 
ATOM 4092  H HE3  . MET B 2 198 ? 180.328 226.243 221.656 1.00 190.08 ? 219 MET D HE3  1 
ATOM 4093  N N    . LEU B 2 199 ? 176.140 229.127 221.697 1.00 168.17 ? 220 LEU D N    1 
ATOM 4094  C CA   . LEU B 2 199 ? 175.789 230.338 220.963 1.00 168.17 ? 220 LEU D CA   1 
ATOM 4095  C C    . LEU B 2 199 ? 174.503 230.968 221.492 1.00 168.17 ? 220 LEU D C    1 
ATOM 4096  O O    . LEU B 2 199 ? 174.430 232.192 221.648 1.00 168.17 ? 220 LEU D O    1 
ATOM 4097  C CB   . LEU B 2 199 ? 175.630 230.020 219.471 1.00 168.17 ? 220 LEU D CB   1 
ATOM 4098  C CG   . LEU B 2 199 ? 175.234 231.202 218.577 1.00 168.17 ? 220 LEU D CG   1 
ATOM 4099  C CD1  . LEU B 2 199 ? 176.284 232.299 218.690 1.00 168.17 ? 220 LEU D CD1  1 
ATOM 4100  C CD2  . LEU B 2 199 ? 175.093 230.726 217.138 1.00 168.17 ? 220 LEU D CD2  1 
ATOM 4101  H H    . LEU B 2 199 ? 176.126 228.405 221.230 1.00 201.80 ? 220 LEU D H    1 
ATOM 4102  H HA   . LEU B 2 199 ? 176.504 230.984 221.072 1.00 201.80 ? 220 LEU D HA   1 
ATOM 4103  H HB2  . LEU B 2 199 ? 176.573 229.624 219.097 1.00 201.80 ? 220 LEU D HB2  1 
ATOM 4104  H HB3  . LEU B 2 199 ? 174.867 229.249 219.359 1.00 201.80 ? 220 LEU D HB3  1 
ATOM 4105  H HG   . LEU B 2 199 ? 174.283 231.613 218.917 1.00 201.80 ? 220 LEU D HG   1 
ATOM 4106  H HD11 . LEU B 2 199 ? 176.002 233.139 218.054 1.00 201.80 ? 220 LEU D HD11 1 
ATOM 4107  H HD12 . LEU B 2 199 ? 176.350 232.634 219.725 1.00 201.80 ? 220 LEU D HD12 1 
ATOM 4108  H HD13 . LEU B 2 199 ? 177.250 231.911 218.370 1.00 201.80 ? 220 LEU D HD13 1 
ATOM 4109  H HD21 . LEU B 2 199 ? 174.810 231.566 216.503 1.00 201.80 ? 220 LEU D HD21 1 
ATOM 4110  H HD22 . LEU B 2 199 ? 176.043 230.315 216.796 1.00 201.80 ? 220 LEU D HD22 1 
ATOM 4111  H HD23 . LEU B 2 199 ? 174.324 229.955 217.084 1.00 201.80 ? 220 LEU D HD23 1 
ATOM 4112  N N    . PHE B 2 200 ? 173.485 230.151 221.775 1.00 162.02 ? 221 PHE D N    1 
ATOM 4113  C CA   . PHE B 2 200 ? 172.160 230.622 222.172 1.00 162.02 ? 221 PHE D CA   1 
ATOM 4114  C C    . PHE B 2 200 ? 171.855 230.296 223.632 1.00 162.02 ? 221 PHE D C    1 
ATOM 4115  O O    . PHE B 2 200 ? 170.707 230.025 223.993 1.00 162.02 ? 221 PHE D O    1 
ATOM 4116  C CB   . PHE B 2 200 ? 171.086 230.003 221.275 1.00 162.02 ? 221 PHE D CB   1 
ATOM 4117  C CG   . PHE B 2 200 ? 171.337 230.199 219.806 1.00 162.02 ? 221 PHE D CG   1 
ATOM 4118  C CD1  . PHE B 2 200 ? 171.311 231.467 219.247 1.00 162.02 ? 221 PHE D CD1  1 
ATOM 4119  C CD2  . PHE B 2 200 ? 171.599 229.114 218.982 1.00 162.02 ? 221 PHE D CD2  1 
ATOM 4120  C CE1  . PHE B 2 200 ? 171.540 231.649 217.897 1.00 162.02 ? 221 PHE D CE1  1 
ATOM 4121  C CE2  . PHE B 2 200 ? 171.829 229.293 217.631 1.00 162.02 ? 221 PHE D CE2  1 
ATOM 4122  C CZ   . PHE B 2 200 ? 171.800 230.560 217.088 1.00 162.02 ? 221 PHE D CZ   1 
ATOM 4123  H H    . PHE B 2 200 ? 173.539 229.293 221.742 1.00 194.42 ? 221 PHE D H    1 
ATOM 4124  H HA   . PHE B 2 200 ? 172.114 231.588 222.128 1.00 194.42 ? 221 PHE D HA   1 
ATOM 4125  H HB2  . PHE B 2 200 ? 171.023 228.933 221.469 1.00 194.42 ? 221 PHE D HB2  1 
ATOM 4126  H HB3  . PHE B 2 200 ? 170.117 230.437 221.515 1.00 194.42 ? 221 PHE D HB3  1 
ATOM 4127  H HD1  . PHE B 2 200 ? 171.106 232.327 219.885 1.00 194.42 ? 221 PHE D HD1  1 
ATOM 4128  H HD2  . PHE B 2 200 ? 171.621 228.112 219.412 1.00 194.42 ? 221 PHE D HD2  1 
ATOM 4129  H HE1  . PHE B 2 200 ? 171.516 232.651 217.469 1.00 194.42 ? 221 PHE D HE1  1 
ATOM 4130  H HE2  . PHE B 2 200 ? 172.035 228.432 216.995 1.00 194.42 ? 221 PHE D HE2  1 
ATOM 4131  H HZ   . PHE B 2 200 ? 171.982 230.702 216.024 1.00 194.42 ? 221 PHE D HZ   1 
ATOM 4132  N N    . CYS B 2 201 ? 172.876 230.320 224.480 1.00 147.09 ? 222 CYS D N    1 
ATOM 4133  C CA   . CYS B 2 201 ? 172.696 230.071 225.903 1.00 147.09 ? 222 CYS D CA   1 
ATOM 4134  C C    . CYS B 2 201 ? 171.899 231.193 226.566 1.00 147.09 ? 222 CYS D C    1 
ATOM 4135  O O    . CYS B 2 201 ? 171.993 232.362 226.186 1.00 147.09 ? 222 CYS D O    1 
ATOM 4136  C CB   . CYS B 2 201 ? 174.062 229.916 226.566 1.00 147.09 ? 222 CYS D CB   1 
ATOM 4137  S SG   . CYS B 2 201 ? 175.159 231.313 226.248 1.00 147.09 ? 222 CYS D SG   1 
ATOM 4138  H H    . CYS B 2 201 ? 173.691 230.480 224.251 1.00 176.51 ? 222 CYS D H    1 
ATOM 4139  H HA   . CYS B 2 201 ? 172.208 229.241 226.023 1.00 176.51 ? 222 CYS D HA   1 
ATOM 4140  H HB2  . CYS B 2 201 ? 173.936 229.851 227.526 1.00 176.51 ? 222 CYS D HB2  1 
ATOM 4141  H HB3  . CYS B 2 201 ? 174.491 229.115 226.237 1.00 176.51 ? 222 CYS D HB3  1 
ATOM 4142  N N    . SER B 2 202 ? 171.102 230.819 227.567 1.00 158.97 ? 223 SER D N    1 
ATOM 4143  C CA   . SER B 2 202 ? 170.368 231.780 228.379 1.00 158.97 ? 223 SER D CA   1 
ATOM 4144  C C    . SER B 2 202 ? 171.256 232.310 229.501 1.00 158.97 ? 223 SER D C    1 
ATOM 4145  O O    . SER B 2 202 ? 172.350 231.802 229.755 1.00 158.97 ? 223 SER D O    1 
ATOM 4146  C CB   . SER B 2 202 ? 169.123 231.137 228.959 1.00 158.97 ? 223 SER D CB   1 
ATOM 4147  O OG   . SER B 2 202 ? 169.456 230.135 229.879 1.00 158.97 ? 223 SER D OG   1 
ATOM 4148  H H    . SER B 2 202 ? 170.968 230.001 227.795 1.00 190.76 ? 223 SER D H    1 
ATOM 4149  H HA   . SER B 2 202 ? 170.100 232.530 227.825 1.00 190.76 ? 223 SER D HA   1 
ATOM 4150  H HB2  . SER B 2 202 ? 168.516 231.898 229.450 1.00 190.76 ? 223 SER D HB2  1 
ATOM 4151  H HB3  . SER B 2 202 ? 168.525 230.712 228.154 1.00 190.76 ? 223 SER D HB3  1 
ATOM 4152  H HG   . SER B 2 202 ? 168.623 229.770 230.187 1.00 190.76 ? 223 SER D HG   1 
ATOM 4153  N N    . CYS B 2 203 ? 170.763 233.342 230.187 1.00 158.83 ? 224 CYS D N    1 
ATOM 4154  C CA   . CYS B 2 203 ? 171.485 233.919 231.313 1.00 158.83 ? 224 CYS D CA   1 
ATOM 4155  C C    . CYS B 2 203 ? 170.518 234.446 232.361 1.00 158.83 ? 224 CYS D C    1 
ATOM 4156  O O    . CYS B 2 203 ? 169.323 234.622 232.110 1.00 158.83 ? 224 CYS D O    1 
ATOM 4157  C CB   . CYS B 2 203 ? 172.416 235.047 230.854 1.00 158.83 ? 224 CYS D CB   1 
ATOM 4158  S SG   . CYS B 2 203 ? 173.816 234.469 229.899 1.00 158.83 ? 224 CYS D SG   1 
ATOM 4159  H H    . CYS B 2 203 ? 170.012 233.725 230.017 1.00 190.60 ? 224 CYS D H    1 
ATOM 4160  H HA   . CYS B 2 203 ? 172.019 233.232 231.738 1.00 190.60 ? 224 CYS D HA   1 
ATOM 4161  H HB2  . CYS B 2 203 ? 171.908 235.658 230.298 1.00 190.60 ? 224 CYS D HB2  1 
ATOM 4162  H HB3  . CYS B 2 203 ? 172.757 235.518 231.629 1.00 190.60 ? 224 CYS D HB3  1 
ATOM 4163  N N    . GLN B 2 204 ? 171.072 234.691 233.553 1.00 155.50 ? 225 GLN D N    1 
ATOM 4164  C CA   . GLN B 2 204 ? 170.355 235.290 234.668 1.00 155.50 ? 225 GLN D CA   1 
ATOM 4165  C C    . GLN B 2 204 ? 170.923 236.633 235.108 1.00 155.50 ? 225 GLN D C    1 
ATOM 4166  O O    . GLN B 2 204 ? 170.256 237.342 235.867 1.00 155.50 ? 225 GLN D O    1 
ATOM 4167  C CB   . GLN B 2 204 ? 170.348 234.326 235.857 1.00 155.50 ? 225 GLN D CB   1 
ATOM 4168  C CG   . GLN B 2 204 ? 169.608 233.024 235.600 1.00 155.50 ? 225 GLN D CG   1 
ATOM 4169  C CD   . GLN B 2 204 ? 169.567 232.130 236.824 1.00 155.50 ? 225 GLN D CD   1 
ATOM 4170  O OE1  . GLN B 2 204 ? 169.604 232.608 237.961 1.00 155.50 ? 225 GLN D OE1  1 
ATOM 4171  N NE2  . GLN B 2 204 ? 169.491 230.823 236.599 1.00 155.50 ? 225 GLN D NE2  1 
ATOM 4172  H H    . GLN B 2 204 ? 171.892 234.507 233.738 1.00 186.60 ? 225 GLN D H    1 
ATOM 4173  H HA   . GLN B 2 204 ? 169.432 235.441 234.413 1.00 186.60 ? 225 GLN D HA   1 
ATOM 4174  H HB2  . GLN B 2 204 ? 171.374 234.081 236.132 1.00 186.60 ? 225 GLN D HB2  1 
ATOM 4175  H HB3  . GLN B 2 204 ? 169.886 234.811 236.717 1.00 186.60 ? 225 GLN D HB3  1 
ATOM 4176  H HG2  . GLN B 2 204 ? 168.583 233.253 235.310 1.00 186.60 ? 225 GLN D HG2  1 
ATOM 4177  H HG3  . GLN B 2 204 ? 170.112 232.484 234.798 1.00 186.60 ? 225 GLN D HG3  1 
ATOM 4178  H HE21 . GLN B 2 204 ? 169.461 230.183 237.368 1.00 186.60 ? 225 GLN D HE21 1 
ATOM 4179  H HE22 . GLN B 2 204 ? 169.463 230.478 235.661 1.00 186.60 ? 225 GLN D HE22 1 
ATOM 4180  N N    . ASP B 2 205 ? 172.127 236.997 234.659 1.00 148.68 ? 226 ASP D N    1 
ATOM 4181  C CA   . ASP B 2 205 ? 172.793 238.221 235.089 1.00 148.68 ? 226 ASP D CA   1 
ATOM 4182  C C    . ASP B 2 205 ? 173.622 238.769 233.931 1.00 148.68 ? 226 ASP D C    1 
ATOM 4183  O O    . ASP B 2 205 ? 173.634 238.210 232.828 1.00 148.68 ? 226 ASP D O    1 
ATOM 4184  C CB   . ASP B 2 205 ? 173.686 237.964 236.306 1.00 148.68 ? 226 ASP D CB   1 
ATOM 4185  C CG   . ASP B 2 205 ? 174.781 236.942 236.032 1.00 148.68 ? 226 ASP D CG   1 
ATOM 4186  O OD1  . ASP B 2 205 ? 175.102 236.737 234.885 1.00 148.68 ? 226 ASP D OD1  1 
ATOM 4187  O OD2  . ASP B 2 205 ? 175.287 236.377 236.972 1.00 148.68 ? 226 ASP D OD2  1 
ATOM 4188  H H    . ASP B 2 205 ? 172.592 236.544 234.093 1.00 178.42 ? 226 ASP D H    1 
ATOM 4189  H HA   . ASP B 2 205 ? 172.129 238.891 235.313 1.00 178.42 ? 226 ASP D HA   1 
ATOM 4190  H HB2  . ASP B 2 205 ? 174.151 238.899 236.620 1.00 178.42 ? 226 ASP D HB2  1 
ATOM 4191  H HB3  . ASP B 2 205 ? 173.075 237.607 237.136 1.00 178.42 ? 226 ASP D HB3  1 
ATOM 4192  N N    . GLN B 2 206 ? 174.326 239.875 234.190 1.00 136.14 ? 227 GLN D N    1 
ATOM 4193  C CA   . GLN B 2 206 ? 175.123 240.515 233.147 1.00 136.14 ? 227 GLN D CA   1 
ATOM 4194  C C    . GLN B 2 206 ? 176.474 239.830 232.971 1.00 136.14 ? 227 GLN D C    1 
ATOM 4195  O O    . GLN B 2 206 ? 177.068 239.897 231.891 1.00 136.14 ? 227 GLN D O    1 
ATOM 4196  C CB   . GLN B 2 206 ? 175.331 241.998 233.469 1.00 136.14 ? 227 GLN D CB   1 
ATOM 4197  C CG   . GLN B 2 206 ? 174.053 242.820 233.471 1.00 136.14 ? 227 GLN D CG   1 
ATOM 4198  C CD   . GLN B 2 206 ? 173.288 242.697 234.775 1.00 136.14 ? 227 GLN D CD   1 
ATOM 4199  O OE1  . GLN B 2 206 ? 173.571 241.822 235.597 1.00 136.14 ? 227 GLN D OE1  1 
ATOM 4200  N NE2  . GLN B 2 206 ? 172.311 243.576 234.971 1.00 136.14 ? 227 GLN D NE2  1 
ATOM 4201  H H    . GLN B 2 206 ? 174.355 240.272 234.952 1.00 163.37 ? 227 GLN D H    1 
ATOM 4202  H HA   . GLN B 2 206 ? 174.649 240.458 232.302 1.00 163.37 ? 227 GLN D HA   1 
ATOM 4203  H HB2  . GLN B 2 206 ? 175.794 242.095 234.451 1.00 163.37 ? 227 GLN D HB2  1 
ATOM 4204  H HB3  . GLN B 2 206 ? 176.012 242.436 232.741 1.00 163.37 ? 227 GLN D HB3  1 
ATOM 4205  H HG2  . GLN B 2 206 ? 174.308 243.869 233.321 1.00 163.37 ? 227 GLN D HG2  1 
ATOM 4206  H HG3  . GLN B 2 206 ? 173.409 242.473 232.662 1.00 163.37 ? 227 GLN D HG3  1 
ATOM 4207  H HE21 . GLN B 2 206 ? 171.771 243.545 235.813 1.00 163.37 ? 227 GLN D HE21 1 
ATOM 4208  H HE22 . GLN B 2 206 ? 172.115 244.270 234.278 1.00 163.37 ? 227 GLN D HE22 1 
ATOM 4209  N N    . ALA B 2 207 ? 176.984 239.175 234.017 1.00 137.64 ? 228 ALA D N    1 
ATOM 4210  C CA   . ALA B 2 207 ? 178.235 238.432 233.880 1.00 137.64 ? 228 ALA D CA   1 
ATOM 4211  C C    . ALA B 2 207 ? 178.079 237.280 232.895 1.00 137.64 ? 228 ALA D C    1 
ATOM 4212  O O    . ALA B 2 207 ? 178.929 237.078 232.016 1.00 137.64 ? 228 ALA D O    1 
ATOM 4213  C CB   . ALA B 2 207 ? 178.690 237.917 235.244 1.00 137.64 ? 228 ALA D CB   1 
ATOM 4214  H H    . ALA B 2 207 ? 176.635 239.147 234.802 1.00 165.17 ? 228 ALA D H    1 
ATOM 4215  H HA   . ALA B 2 207 ? 178.920 239.028 233.539 1.00 165.17 ? 228 ALA D HA   1 
ATOM 4216  H HB1  . ALA B 2 207 ? 179.522 237.430 235.136 1.00 165.17 ? 228 ALA D HB1  1 
ATOM 4217  H HB2  . ALA B 2 207 ? 178.822 238.671 235.839 1.00 165.17 ? 228 ALA D HB2  1 
ATOM 4218  H HB3  . ALA B 2 207 ? 178.007 237.328 235.603 1.00 165.17 ? 228 ALA D HB3  1 
ATOM 4219  N N    . CYS B 2 208 ? 177.001 236.506 233.036 1.00 151.71 ? 229 CYS D N    1 
ATOM 4220  C CA   . CYS B 2 208 ? 176.661 235.500 232.037 1.00 151.71 ? 229 CYS D CA   1 
ATOM 4221  C C    . CYS B 2 208 ? 176.334 236.147 230.698 1.00 151.71 ? 229 CYS D C    1 
ATOM 4222  O O    . CYS B 2 208 ? 176.797 235.691 229.646 1.00 151.71 ? 229 CYS D O    1 
ATOM 4223  C CB   . CYS B 2 208 ? 175.467 234.664 232.498 1.00 151.71 ? 229 CYS D CB   1 
ATOM 4224  S SG   . CYS B 2 208 ? 174.922 233.428 231.295 1.00 151.71 ? 229 CYS D SG   1 
ATOM 4225  H H    . CYS B 2 208 ? 176.455 236.547 233.698 1.00 182.05 ? 229 CYS D H    1 
ATOM 4226  H HA   . CYS B 2 208 ? 177.419 234.907 231.910 1.00 182.05 ? 229 CYS D HA   1 
ATOM 4227  H HB2  . CYS B 2 208 ? 175.721 234.146 233.423 1.00 182.05 ? 229 CYS D HB2  1 
ATOM 4228  H HB3  . CYS B 2 208 ? 174.624 235.320 232.712 1.00 182.05 ? 229 CYS D HB3  1 
ATOM 4229  N N    . ALA B 2 209 ? 175.496 237.186 230.716 1.00 140.01 ? 230 ALA D N    1 
ATOM 4230  C CA   . ALA B 2 209 ? 175.050 237.799 229.472 1.00 140.01 ? 230 ALA D CA   1 
ATOM 4231  C C    . ALA B 2 209 ? 176.228 238.306 228.654 1.00 140.01 ? 230 ALA D C    1 
ATOM 4232  O O    . ALA B 2 209 ? 176.232 238.177 227.425 1.00 140.01 ? 230 ALA D O    1 
ATOM 4233  C CB   . ALA B 2 209 ? 174.079 238.937 229.770 1.00 140.01 ? 230 ALA D CB   1 
ATOM 4234  H H    . ALA B 2 209 ? 175.176 237.547 231.429 1.00 168.01 ? 230 ALA D H    1 
ATOM 4235  H HA   . ALA B 2 209 ? 174.581 237.134 228.943 1.00 168.01 ? 230 ALA D HA   1 
ATOM 4236  H HB1  . ALA B 2 209 ? 173.823 239.362 228.937 1.00 168.01 ? 230 ALA D HB1  1 
ATOM 4237  H HB2  . ALA B 2 209 ? 173.294 238.576 230.214 1.00 168.01 ? 230 ALA D HB2  1 
ATOM 4238  H HB3  . ALA B 2 209 ? 174.520 239.576 230.349 1.00 168.01 ? 230 ALA D HB3  1 
ATOM 4239  N N    . GLU B 2 210 ? 177.240 238.870 229.314 1.00 126.76 ? 231 GLU D N    1 
ATOM 4240  C CA   . GLU B 2 210 ? 178.449 239.275 228.609 1.00 126.76 ? 231 GLU D CA   1 
ATOM 4241  C C    . GLU B 2 210 ? 179.208 238.056 228.104 1.00 126.76 ? 231 GLU D C    1 
ATOM 4242  O O    . GLU B 2 210 ? 179.709 238.055 226.980 1.00 126.76 ? 231 GLU D O    1 
ATOM 4243  C CB   . GLU B 2 210 ? 179.348 240.111 229.522 1.00 126.76 ? 231 GLU D CB   1 
ATOM 4244  C CG   . GLU B 2 210 ? 180.576 240.692 228.834 1.00 126.76 ? 231 GLU D CG   1 
ATOM 4245  C CD   . GLU B 2 210 ? 180.230 241.695 227.770 1.00 126.76 ? 231 GLU D CD   1 
ATOM 4246  O OE1  . GLU B 2 210 ? 179.377 242.516 228.009 1.00 126.76 ? 231 GLU D OE1  1 
ATOM 4247  O OE2  . GLU B 2 210 ? 180.819 241.641 226.716 1.00 126.76 ? 231 GLU D OE2  1 
ATOM 4248  H H    . GLU B 2 210 ? 177.249 239.027 230.159 1.00 152.11 ? 231 GLU D H    1 
ATOM 4249  H HA   . GLU B 2 210 ? 178.197 239.810 227.841 1.00 152.11 ? 231 GLU D HA   1 
ATOM 4250  H HB2  . GLU B 2 210 ? 178.775 240.939 229.939 1.00 152.11 ? 231 GLU D HB2  1 
ATOM 4251  H HB3  . GLU B 2 210 ? 179.691 239.498 230.356 1.00 152.11 ? 231 GLU D HB3  1 
ATOM 4252  H HG2  . GLU B 2 210 ? 181.204 241.175 229.582 1.00 152.11 ? 231 GLU D HG2  1 
ATOM 4253  H HG3  . GLU B 2 210 ? 181.148 239.879 228.389 1.00 152.11 ? 231 GLU D HG3  1 
ATOM 4254  N N    . ARG B 2 211 ? 179.310 237.011 228.927 1.00 138.22 ? 232 ARG D N    1 
ATOM 4255  C CA   . ARG B 2 211 ? 179.902 235.757 228.460 1.00 138.22 ? 232 ARG D CA   1 
ATOM 4256  C C    . ARG B 2 211 ? 179.235 235.286 227.170 1.00 138.22 ? 232 ARG D C    1 
ATOM 4257  O O    . ARG B 2 211 ? 179.908 234.843 226.226 1.00 138.22 ? 232 ARG D O    1 
ATOM 4258  C CB   . ARG B 2 211 ? 179.772 234.673 229.520 1.00 138.22 ? 232 ARG D CB   1 
ATOM 4259  C CG   . ARG B 2 211 ? 180.238 233.293 229.085 1.00 138.22 ? 232 ARG D CG   1 
ATOM 4260  C CD   . ARG B 2 211 ? 180.255 232.336 230.220 1.00 138.22 ? 232 ARG D CD   1 
ATOM 4261  N NE   . ARG B 2 211 ? 181.334 232.619 231.152 1.00 138.22 ? 232 ARG D NE   1 
ATOM 4262  C CZ   . ARG B 2 211 ? 182.606 232.200 231.000 1.00 138.22 ? 232 ARG D CZ   1 
ATOM 4263  N NH1  . ARG B 2 211 ? 182.941 231.482 229.951 1.00 138.22 ? 232 ARG D NH1  1 
ATOM 4264  N NH2  . ARG B 2 211 ? 183.517 232.511 231.906 1.00 138.22 ? 232 ARG D NH2  1 
ATOM 4265  H H    . ARG B 2 211 ? 179.049 237.001 229.746 1.00 165.86 ? 232 ARG D H    1 
ATOM 4266  H HA   . ARG B 2 211 ? 180.844 235.896 228.280 1.00 165.86 ? 232 ARG D HA   1 
ATOM 4267  H HB2  . ARG B 2 211 ? 180.350 234.954 230.399 1.00 165.86 ? 232 ARG D HB2  1 
ATOM 4268  H HB3  . ARG B 2 211 ? 178.730 234.588 229.828 1.00 165.86 ? 232 ARG D HB3  1 
ATOM 4269  H HG2  . ARG B 2 211 ? 179.564 232.906 228.320 1.00 165.86 ? 232 ARG D HG2  1 
ATOM 4270  H HG3  . ARG B 2 211 ? 181.247 233.361 228.678 1.00 165.86 ? 232 ARG D HG3  1 
ATOM 4271  H HD2  . ARG B 2 211 ? 179.312 232.397 230.762 1.00 165.86 ? 232 ARG D HD2  1 
ATOM 4272  H HD3  . ARG B 2 211 ? 180.389 231.324 229.840 1.00 165.86 ? 232 ARG D HD3  1 
ATOM 4273  H HE   . ARG B 2 211 ? 181.115 233.169 231.972 1.00 165.86 ? 232 ARG D HE   1 
ATOM 4274  H HH11 . ARG B 2 211 ? 182.245 231.245 229.259 1.00 165.86 ? 232 ARG D HH11 1 
ATOM 4275  H HH12 . ARG B 2 211 ? 183.894 231.169 229.837 1.00 165.86 ? 232 ARG D HH12 1 
ATOM 4276  H HH21 . ARG B 2 211 ? 183.259 233.063 232.713 1.00 165.86 ? 232 ARG D HH21 1 
ATOM 4277  H HH22 . ARG B 2 211 ? 184.469 232.197 231.793 1.00 165.86 ? 232 ARG D HH22 1 
ATOM 4278  N N    . ARG B 2 212 ? 177.907 235.388 227.116 1.00 140.94 ? 233 ARG D N    1 
ATOM 4279  C CA   . ARG B 2 212 ? 177.165 235.100 225.893 1.00 140.94 ? 233 ARG D CA   1 
ATOM 4280  C C    . ARG B 2 212 ? 177.618 236.003 224.752 1.00 140.94 ? 233 ARG D C    1 
ATOM 4281  O O    . ARG B 2 212 ? 177.918 235.531 223.649 1.00 140.94 ? 233 ARG D O    1 
ATOM 4282  C CB   . ARG B 2 212 ? 175.671 235.280 226.117 1.00 140.94 ? 233 ARG D CB   1 
ATOM 4283  C CG   . ARG B 2 212 ? 174.794 234.874 224.943 1.00 140.94 ? 233 ARG D CG   1 
ATOM 4284  C CD   . ARG B 2 212 ? 173.350 235.015 225.261 1.00 140.94 ? 233 ARG D CD   1 
ATOM 4285  N NE   . ARG B 2 212 ? 172.960 236.408 225.404 1.00 140.94 ? 233 ARG D NE   1 
ATOM 4286  C CZ   . ARG B 2 212 ? 172.565 236.978 226.559 1.00 140.94 ? 233 ARG D CZ   1 
ATOM 4287  N NH1  . ARG B 2 212 ? 172.514 236.262 227.661 1.00 140.94 ? 233 ARG D NH1  1 
ATOM 4288  N NH2  . ARG B 2 212 ? 172.229 238.256 226.585 1.00 140.94 ? 233 ARG D NH2  1 
ATOM 4289  H H    . ARG B 2 212 ? 177.412 235.622 227.779 1.00 169.13 ? 233 ARG D H    1 
ATOM 4290  H HA   . ARG B 2 212 ? 177.322 234.179 225.633 1.00 169.13 ? 233 ARG D HA   1 
ATOM 4291  H HB2  . ARG B 2 212 ? 175.359 234.693 226.980 1.00 169.13 ? 233 ARG D HB2  1 
ATOM 4292  H HB3  . ARG B 2 212 ? 175.460 236.326 226.340 1.00 169.13 ? 233 ARG D HB3  1 
ATOM 4293  H HG2  . ARG B 2 212 ? 175.019 235.507 224.084 1.00 169.13 ? 233 ARG D HG2  1 
ATOM 4294  H HG3  . ARG B 2 212 ? 174.989 233.832 224.687 1.00 169.13 ? 233 ARG D HG3  1 
ATOM 4295  H HD2  . ARG B 2 212 ? 172.757 234.575 224.460 1.00 169.13 ? 233 ARG D HD2  1 
ATOM 4296  H HD3  . ARG B 2 212 ? 173.132 234.502 226.197 1.00 169.13 ? 233 ARG D HD3  1 
ATOM 4297  H HE   . ARG B 2 212 ? 172.986 236.991 224.577 1.00 169.13 ? 233 ARG D HE   1 
ATOM 4298  H HH11 . ARG B 2 212 ? 172.771 235.285 227.641 1.00 169.13 ? 233 ARG D HH11 1 
ATOM 4299  H HH12 . ARG B 2 212 ? 172.218 236.689 228.527 1.00 169.13 ? 233 ARG D HH12 1 
ATOM 4300  H HH21 . ARG B 2 212 ? 172.269 238.806 225.738 1.00 169.13 ? 233 ARG D HH21 1 
ATOM 4301  H HH22 . ARG B 2 212 ? 171.934 238.682 227.450 1.00 169.13 ? 233 ARG D HH22 1 
ATOM 4302  N N    . ARG B 2 213 ? 177.671 237.312 225.003 1.00 116.44 ? 234 ARG D N    1 
ATOM 4303  C CA   . ARG B 2 213 ? 178.169 238.248 224.001 1.00 116.44 ? 234 ARG D CA   1 
ATOM 4304  C C    . ARG B 2 213 ? 179.606 237.935 223.609 1.00 116.44 ? 234 ARG D C    1 
ATOM 4305  O O    . ARG B 2 213 ? 179.982 238.109 222.445 1.00 116.44 ? 234 ARG D O    1 
ATOM 4306  C CB   . ARG B 2 213 ? 178.090 239.676 224.520 1.00 116.44 ? 234 ARG D CB   1 
ATOM 4307  C CG   . ARG B 2 213 ? 178.451 240.747 223.502 1.00 116.44 ? 234 ARG D CG   1 
ATOM 4308  C CD   . ARG B 2 213 ? 178.048 242.100 223.962 1.00 116.44 ? 234 ARG D CD   1 
ATOM 4309  N NE   . ARG B 2 213 ? 178.284 243.112 222.944 1.00 116.44 ? 234 ARG D NE   1 
ATOM 4310  C CZ   . ARG B 2 213 ? 179.434 243.800 222.803 1.00 116.44 ? 234 ARG D CZ   1 
ATOM 4311  N NH1  . ARG B 2 213 ? 180.439 243.576 223.620 1.00 116.44 ? 234 ARG D NH1  1 
ATOM 4312  N NH2  . ARG B 2 213 ? 179.550 244.702 221.843 1.00 116.44 ? 234 ARG D NH2  1 
ATOM 4313  H H    . ARG B 2 213 ? 177.426 237.679 225.741 1.00 139.73 ? 234 ARG D H    1 
ATOM 4314  H HA   . ARG B 2 213 ? 177.618 238.180 223.206 1.00 139.73 ? 234 ARG D HA   1 
ATOM 4315  H HB2  . ARG B 2 213 ? 177.078 239.881 224.868 1.00 139.73 ? 234 ARG D HB2  1 
ATOM 4316  H HB3  . ARG B 2 213 ? 178.759 239.792 225.372 1.00 139.73 ? 234 ARG D HB3  1 
ATOM 4317  H HG2  . ARG B 2 213 ? 179.529 240.746 223.341 1.00 139.73 ? 234 ARG D HG2  1 
ATOM 4318  H HG3  . ARG B 2 213 ? 177.943 240.539 222.559 1.00 139.73 ? 234 ARG D HG3  1 
ATOM 4319  H HD2  . ARG B 2 213 ? 176.985 242.101 224.202 1.00 139.73 ? 234 ARG D HD2  1 
ATOM 4320  H HD3  . ARG B 2 213 ? 178.620 242.369 224.849 1.00 139.73 ? 234 ARG D HD3  1 
ATOM 4321  H HE   . ARG B 2 213 ? 177.533 243.312 222.297 1.00 139.73 ? 234 ARG D HE   1 
ATOM 4322  H HH11 . ARG B 2 213 ? 180.350 242.887 224.353 1.00 139.73 ? 234 ARG D HH11 1 
ATOM 4323  H HH12 . ARG B 2 213 ? 181.300 244.092 223.514 1.00 139.73 ? 234 ARG D HH12 1 
ATOM 4324  H HH21 . ARG B 2 213 ? 178.777 244.874 221.215 1.00 139.73 ? 234 ARG D HH21 1 
ATOM 4325  H HH22 . ARG B 2 213 ? 180.411 245.218 221.738 1.00 139.73 ? 234 ARG D HH22 1 
ATOM 4326  N N    . GLN B 2 214 ? 180.419 237.468 224.555 1.00 111.90 ? 235 GLN D N    1 
ATOM 4327  C CA   . GLN B 2 214 ? 181.832 237.215 224.314 1.00 111.90 ? 235 GLN D CA   1 
ATOM 4328  C C    . GLN B 2 214 ? 182.091 235.878 223.629 1.00 111.90 ? 235 GLN D C    1 
ATOM 4329  O O    . GLN B 2 214 ? 183.262 235.544 223.420 1.00 111.90 ? 235 GLN D O    1 
ATOM 4330  C CB   . GLN B 2 214 ? 182.605 237.272 225.634 1.00 111.90 ? 235 GLN D CB   1 
ATOM 4331  C CG   . GLN B 2 214 ? 182.740 238.669 226.216 1.00 111.90 ? 235 GLN D CG   1 
ATOM 4332  C CD   . GLN B 2 214 ? 183.579 239.581 225.342 1.00 111.90 ? 235 GLN D CD   1 
ATOM 4333  O OE1  . GLN B 2 214 ? 184.550 239.145 224.717 1.00 111.90 ? 235 GLN D OE1  1 
ATOM 4334  N NE2  . GLN B 2 214 ? 183.210 240.856 225.292 1.00 111.90 ? 235 GLN D NE2  1 
ATOM 4335  H H    . GLN B 2 214 ? 180.168 237.286 225.357 1.00 134.28 ? 235 GLN D H    1 
ATOM 4336  H HA   . GLN B 2 214 ? 182.159 237.910 223.749 1.00 134.28 ? 235 GLN D HA   1 
ATOM 4337  H HB2  . GLN B 2 214 ? 182.107 236.646 226.374 1.00 134.28 ? 235 GLN D HB2  1 
ATOM 4338  H HB3  . GLN B 2 214 ? 183.607 236.871 225.486 1.00 134.28 ? 235 GLN D HB3  1 
ATOM 4339  H HG2  . GLN B 2 214 ? 181.747 239.108 226.314 1.00 134.28 ? 235 GLN D HG2  1 
ATOM 4340  H HG3  . GLN B 2 214 ? 183.216 238.600 227.194 1.00 134.28 ? 235 GLN D HG3  1 
ATOM 4341  H HE21 . GLN B 2 214 ? 183.726 241.505 224.732 1.00 134.28 ? 235 GLN D HE21 1 
ATOM 4342  H HE22 . GLN B 2 214 ? 182.416 241.168 225.814 1.00 134.28 ? 235 GLN D HE22 1 
ATOM 4343  N N    . THR B 2 215 ? 181.034 235.109 223.341 1.00 132.71 ? 236 THR D N    1 
ATOM 4344  C CA   . THR B 2 215 ? 181.166 233.775 222.749 1.00 132.71 ? 236 THR D CA   1 
ATOM 4345  C C    . THR B 2 215 ? 182.170 233.723 221.594 1.00 132.71 ? 236 THR D C    1 
ATOM 4346  O O    . THR B 2 215 ? 183.005 232.813 221.537 1.00 132.71 ? 236 THR D O    1 
ATOM 4347  C CB   . THR B 2 215 ? 179.800 233.267 222.253 1.00 132.71 ? 236 THR D CB   1 
ATOM 4348  O OG1  . THR B 2 215 ? 178.889 233.182 223.356 1.00 132.71 ? 236 THR D OG1  1 
ATOM 4349  C CG2  . THR B 2 215 ? 179.942 231.895 221.611 1.00 132.71 ? 236 THR D CG2  1 
ATOM 4350  H H    . THR B 2 215 ? 180.215 235.328 223.483 1.00 159.25 ? 236 THR D H    1 
ATOM 4351  H HA   . THR B 2 215 ? 181.469 233.156 223.431 1.00 159.25 ? 236 THR D HA   1 
ATOM 4352  H HB   . THR B 2 215 ? 179.396 233.965 221.519 1.00 159.25 ? 236 THR D HB   1 
ATOM 4353  H HG1  . THR B 2 215 ? 178.549 234.057 223.558 1.00 159.25 ? 236 THR D HG1  1 
ATOM 4354  H HG21 . THR B 2 215 ? 178.967 231.552 221.265 1.00 159.25 ? 236 THR D HG21 1 
ATOM 4355  H HG22 . THR B 2 215 ? 180.625 231.959 220.764 1.00 159.25 ? 236 THR D HG22 1 
ATOM 4356  H HG23 . THR B 2 215 ? 180.336 231.191 222.342 1.00 159.25 ? 236 THR D HG23 1 
ATOM 4357  N N    . ILE B 2 216 ? 182.117 234.692 220.676 1.00 133.81 ? 237 ILE D N    1 
ATOM 4358  C CA   . ILE B 2 216 ? 183.001 234.709 219.507 1.00 133.81 ? 237 ILE D CA   1 
ATOM 4359  C C    . ILE B 2 216 ? 183.965 235.899 219.518 1.00 133.81 ? 237 ILE D C    1 
ATOM 4360  O O    . ILE B 2 216 ? 184.399 236.344 218.453 1.00 133.81 ? 237 ILE D O    1 
ATOM 4361  C CB   . ILE B 2 216 ? 182.176 234.739 218.208 1.00 133.81 ? 237 ILE D CB   1 
ATOM 4362  C CG1  . ILE B 2 216 ? 181.290 235.987 218.166 1.00 133.81 ? 237 ILE D CG1  1 
ATOM 4363  C CG2  . ILE B 2 216 ? 181.333 233.479 218.084 1.00 133.81 ? 237 ILE D CG2  1 
ATOM 4364  C CD1  . ILE B 2 216 ? 180.652 236.237 216.818 1.00 133.81 ? 237 ILE D CD1  1 
ATOM 4365  H H    . ILE B 2 216 ? 181.574 235.358 220.711 1.00 160.57 ? 237 ILE D H    1 
ATOM 4366  H HA   . ILE B 2 216 ? 183.545 233.908 219.506 1.00 160.57 ? 237 ILE D HA   1 
ATOM 4367  H HB   . ILE B 2 216 ? 182.848 234.800 217.352 1.00 160.57 ? 237 ILE D HB   1 
ATOM 4368  H HG12 . ILE B 2 216 ? 180.497 235.895 218.907 1.00 160.57 ? 237 ILE D HG12 1 
ATOM 4369  H HG13 . ILE B 2 216 ? 181.883 236.863 218.429 1.00 160.57 ? 237 ILE D HG13 1 
ATOM 4370  H HG21 . ILE B 2 216 ? 180.756 233.517 217.160 1.00 160.57 ? 237 ILE D HG21 1 
ATOM 4371  H HG22 . ILE B 2 216 ? 181.983 232.606 218.070 1.00 160.57 ? 237 ILE D HG22 1 
ATOM 4372  H HG23 . ILE B 2 216 ? 180.653 233.411 218.934 1.00 160.57 ? 237 ILE D HG23 1 
ATOM 4373  H HD11 . ILE B 2 216 ? 180.040 237.138 216.868 1.00 160.57 ? 237 ILE D HD11 1 
ATOM 4374  H HD12 . ILE B 2 216 ? 181.430 236.367 216.065 1.00 160.57 ? 237 ILE D HD12 1 
ATOM 4375  H HD13 . ILE B 2 216 ? 180.025 235.388 216.550 1.00 160.57 ? 237 ILE D HD13 1 
ATOM 4376  N N    . LEU B 2 217 ? 184.334 236.406 220.700 1.00 131.98 ? 238 LEU D N    1 
ATOM 4377  C CA   . LEU B 2 217 ? 185.335 237.465 220.844 1.00 131.98 ? 238 LEU D CA   1 
ATOM 4378  C C    . LEU B 2 217 ? 184.957 238.702 220.043 1.00 131.98 ? 238 LEU D C    1 
ATOM 4379  O O    . LEU B 2 217 ? 185.600 239.008 219.030 1.00 131.98 ? 238 LEU D O    1 
ATOM 4380  C CB   . LEU B 2 217 ? 186.711 236.961 220.389 1.00 131.98 ? 238 LEU D CB   1 
ATOM 4381  C CG   . LEU B 2 217 ? 187.462 236.079 221.395 1.00 131.98 ? 238 LEU D CG   1 
ATOM 4382  C CD1  . LEU B 2 217 ? 186.814 234.702 221.447 1.00 131.98 ? 238 LEU D CD1  1 
ATOM 4383  C CD2  . LEU B 2 217 ? 188.925 235.980 220.990 1.00 131.98 ? 238 LEU D CD2  1 
ATOM 4384  H H    . LEU B 2 217 ? 184.009 236.144 221.451 1.00 158.38 ? 238 LEU D H    1 
ATOM 4385  H HA   . LEU B 2 217 ? 185.369 237.729 221.773 1.00 158.38 ? 238 LEU D HA   1 
ATOM 4386  H HB2  . LEU B 2 217 ? 186.585 236.386 219.474 1.00 158.38 ? 238 LEU D HB2  1 
ATOM 4387  H HB3  . LEU B 2 217 ? 187.341 237.823 220.169 1.00 158.38 ? 238 LEU D HB3  1 
ATOM 4388  H HG   . LEU B 2 217 ? 187.390 236.519 222.390 1.00 158.38 ? 238 LEU D HG   1 
ATOM 4389  H HD11 . LEU B 2 217 ? 187.348 234.076 222.162 1.00 158.38 ? 238 LEU D HD11 1 
ATOM 4390  H HD12 . LEU B 2 217 ? 185.774 234.801 221.758 1.00 158.38 ? 238 LEU D HD12 1 
ATOM 4391  H HD13 . LEU B 2 217 ? 186.856 234.243 220.460 1.00 158.38 ? 238 LEU D HD13 1 
ATOM 4392  H HD21 . LEU B 2 217 ? 189.459 235.354 221.705 1.00 158.38 ? 238 LEU D HD21 1 
ATOM 4393  H HD22 . LEU B 2 217 ? 188.998 235.539 219.995 1.00 158.38 ? 238 LEU D HD22 1 
ATOM 4394  H HD23 . LEU B 2 217 ? 189.368 236.976 220.978 1.00 158.38 ? 238 LEU D HD23 1 
ATOM 4395  N N    . PRO B 2 218 ? 183.902 239.411 220.424 1.00 118.87 ? 239 PRO D N    1 
ATOM 4396  C CA   . PRO B 2 218 ? 183.541 240.608 219.660 1.00 118.87 ? 239 PRO D CA   1 
ATOM 4397  C C    . PRO B 2 218 ? 184.715 241.544 219.441 1.00 118.87 ? 239 PRO D C    1 
ATOM 4398  O O    . PRO B 2 218 ? 184.818 242.166 218.379 1.00 118.87 ? 239 PRO D O    1 
ATOM 4399  C CB   . PRO B 2 218 ? 182.470 241.260 220.541 1.00 118.87 ? 239 PRO D CB   1 
ATOM 4400  C CG   . PRO B 2 218 ? 181.843 240.116 221.262 1.00 118.87 ? 239 PRO D CG   1 
ATOM 4401  C CD   . PRO B 2 218 ? 182.987 239.179 221.545 1.00 118.87 ? 239 PRO D CD   1 
ATOM 4402  H HA   . PRO B 2 218 ? 183.192 240.299 218.824 1.00 142.64 ? 239 PRO D HA   1 
ATOM 4403  H HB2  . PRO B 2 218 ? 182.936 241.989 221.221 1.00 142.64 ? 239 PRO D HB2  1 
ATOM 4404  H HB3  . PRO B 2 218 ? 181.755 241.815 219.916 1.00 142.64 ? 239 PRO D HB3  1 
ATOM 4405  H HG2  . PRO B 2 218 ? 181.348 240.469 222.178 1.00 142.64 ? 239 PRO D HG2  1 
ATOM 4406  H HG3  . PRO B 2 218 ? 181.063 239.655 220.637 1.00 142.64 ? 239 PRO D HG3  1 
ATOM 4407  H HD2  . PRO B 2 218 ? 183.453 239.448 222.505 1.00 142.64 ? 239 PRO D HD2  1 
ATOM 4408  H HD3  . PRO B 2 218 ? 182.616 238.144 221.571 1.00 142.64 ? 239 PRO D HD3  1 
ATOM 4409  N N    . SER B 2 219 ? 185.617 241.651 220.418 1.00 116.01 ? 240 SER D N    1 
ATOM 4410  C CA   . SER B 2 219 ? 186.778 242.520 220.280 1.00 116.01 ? 240 SER D CA   1 
ATOM 4411  C C    . SER B 2 219 ? 187.639 242.172 219.071 1.00 116.01 ? 240 SER D C    1 
ATOM 4412  O O    . SER B 2 219 ? 188.524 242.961 218.722 1.00 116.01 ? 240 SER D O    1 
ATOM 4413  C CB   . SER B 2 219 ? 187.621 242.448 221.538 1.00 116.01 ? 240 SER D CB   1 
ATOM 4414  O OG   . SER B 2 219 ? 188.147 241.162 221.717 1.00 116.01 ? 240 SER D OG   1 
ATOM 4415  H H    . SER B 2 219 ? 185.577 241.230 221.167 1.00 139.21 ? 240 SER D H    1 
ATOM 4416  H HA   . SER B 2 219 ? 186.472 243.434 220.172 1.00 139.21 ? 240 SER D HA   1 
ATOM 4417  H HB2  . SER B 2 219 ? 188.434 243.171 221.474 1.00 139.21 ? 240 SER D HB2  1 
ATOM 4418  H HB3  . SER B 2 219 ? 187.011 242.717 222.400 1.00 139.21 ? 240 SER D HB3  1 
ATOM 4419  H HG   . SER B 2 219 ? 188.711 241.212 222.493 1.00 139.21 ? 240 SER D HG   1 
ATOM 4420  N N    . CYS B 2 220 ? 187.404 241.024 218.430 1.00 123.19 ? 241 CYS D N    1 
ATOM 4421  C CA   . CYS B 2 220 ? 188.125 240.616 217.228 1.00 123.19 ? 241 CYS D CA   1 
ATOM 4422  C C    . CYS B 2 220 ? 187.206 240.399 216.038 1.00 123.19 ? 241 CYS D C    1 
ATOM 4423  O O    . CYS B 2 220 ? 187.441 240.973 214.968 1.00 123.19 ? 241 CYS D O    1 
ATOM 4424  C CB   . CYS B 2 220 ? 188.906 239.328 217.490 1.00 123.19 ? 241 CYS D CB   1 
ATOM 4425  S SG   . CYS B 2 220 ? 189.851 238.734 216.067 1.00 123.19 ? 241 CYS D SG   1 
ATOM 4426  H H    . CYS B 2 220 ? 186.818 240.447 218.681 1.00 147.83 ? 241 CYS D H    1 
ATOM 4427  H HA   . CYS B 2 220 ? 188.765 241.298 216.977 1.00 147.83 ? 241 CYS D HA   1 
ATOM 4428  H HB2  . CYS B 2 220 ? 189.601 239.485 218.315 1.00 147.83 ? 241 CYS D HB2  1 
ATOM 4429  H HB3  . CYS B 2 220 ? 188.215 238.539 217.789 1.00 147.83 ? 241 CYS D HB3  1 
ATOM 4430  N N    . SER B 2 221 ? 186.160 239.587 216.194 1.00 123.66 ? 242 SER D N    1 
ATOM 4431  C CA   . SER B 2 221 ? 185.344 239.153 215.066 1.00 123.66 ? 242 SER D CA   1 
ATOM 4432  C C    . SER B 2 221 ? 184.230 240.127 214.705 1.00 123.66 ? 242 SER D C    1 
ATOM 4433  O O    . SER B 2 221 ? 183.804 240.150 213.544 1.00 123.66 ? 242 SER D O    1 
ATOM 4434  C CB   . SER B 2 221 ? 184.741 237.796 215.373 1.00 123.66 ? 242 SER D CB   1 
ATOM 4435  O OG   . SER B 2 221 ? 183.845 237.876 216.447 1.00 123.66 ? 242 SER D OG   1 
ATOM 4436  H H    . SER B 2 221 ? 185.901 239.272 216.951 1.00 148.39 ? 242 SER D H    1 
ATOM 4437  H HA   . SER B 2 221 ? 185.914 239.052 214.287 1.00 148.39 ? 242 SER D HA   1 
ATOM 4438  H HB2  . SER B 2 221 ? 184.223 237.421 214.491 1.00 148.39 ? 242 SER D HB2  1 
ATOM 4439  H HB3  . SER B 2 221 ? 185.536 237.090 215.610 1.00 148.39 ? 242 SER D HB3  1 
ATOM 4440  H HG   . SER B 2 221 ? 183.986 237.083 216.969 1.00 148.39 ? 242 SER D HG   1 
ATOM 4441  N N    . TYR B 2 222 ? 183.758 240.931 215.658 1.00 125.75 ? 243 TYR D N    1 
ATOM 4442  C CA   . TYR B 2 222 ? 182.569 241.760 215.486 1.00 125.75 ? 243 TYR D CA   1 
ATOM 4443  C C    . TYR B 2 222 ? 182.883 243.249 215.533 1.00 125.75 ? 243 TYR D C    1 
ATOM 4444  O O    . TYR B 2 222 ? 182.535 243.987 214.608 1.00 125.75 ? 243 TYR D O    1 
ATOM 4445  C CB   . TYR B 2 222 ? 181.527 241.415 216.553 1.00 125.75 ? 243 TYR D CB   1 
ATOM 4446  C CG   . TYR B 2 222 ? 180.230 242.180 216.410 1.00 125.75 ? 243 TYR D CG   1 
ATOM 4447  C CD1  . TYR B 2 222 ? 179.375 241.904 215.353 1.00 125.75 ? 243 TYR D CD1  1 
ATOM 4448  C CD2  . TYR B 2 222 ? 179.896 243.158 217.335 1.00 125.75 ? 243 TYR D CD2  1 
ATOM 4449  C CE1  . TYR B 2 222 ? 178.190 242.603 215.223 1.00 125.75 ? 243 TYR D CE1  1 
ATOM 4450  C CE2  . TYR B 2 222 ? 178.712 243.857 217.204 1.00 125.75 ? 243 TYR D CE2  1 
ATOM 4451  C CZ   . TYR B 2 222 ? 177.861 243.582 216.153 1.00 125.75 ? 243 TYR D CZ   1 
ATOM 4452  O OH   . TYR B 2 222 ? 176.681 244.278 216.023 1.00 125.75 ? 243 TYR D OH   1 
ATOM 4453  H H    . TYR B 2 222 ? 184.118 241.012 216.435 1.00 150.90 ? 243 TYR D H    1 
ATOM 4454  H HA   . TYR B 2 222 ? 182.148 241.570 214.635 1.00 150.90 ? 243 TYR D HA   1 
ATOM 4455  H HB2  . TYR B 2 222 ? 181.300 240.349 216.508 1.00 150.90 ? 243 TYR D HB2  1 
ATOM 4456  H HB3  . TYR B 2 222 ? 181.937 241.621 217.541 1.00 150.90 ? 243 TYR D HB3  1 
ATOM 4457  H HD1  . TYR B 2 222 ? 179.637 241.135 214.626 1.00 150.90 ? 243 TYR D HD1  1 
ATOM 4458  H HD2  . TYR B 2 222 ? 180.569 243.376 218.164 1.00 150.90 ? 243 TYR D HD2  1 
ATOM 4459  H HE1  . TYR B 2 222 ? 177.518 242.386 214.393 1.00 150.90 ? 243 TYR D HE1  1 
ATOM 4460  H HE2  . TYR B 2 222 ? 178.450 244.626 217.931 1.00 150.90 ? 243 TYR D HE2  1 
ATOM 4461  H HH   . TYR B 2 222 ? 176.208 243.962 215.249 1.00 150.90 ? 243 TYR D HH   1 
ATOM 4462  N N    . GLU B 2 223 ? 183.562 243.702 216.580 1.00 131.80 ? 244 GLU D N    1 
ATOM 4463  C CA   . GLU B 2 223 ? 183.829 245.118 216.759 1.00 131.80 ? 244 GLU D CA   1 
ATOM 4464  C C    . GLU B 2 223 ? 184.998 245.559 215.888 1.00 131.80 ? 244 GLU D C    1 
ATOM 4465  O O    . GLU B 2 223 ? 185.867 244.764 215.519 1.00 131.80 ? 244 GLU D O    1 
ATOM 4466  C CB   . GLU B 2 223 ? 184.124 245.426 218.228 1.00 131.80 ? 244 GLU D CB   1 
ATOM 4467  C CG   . GLU B 2 223 ? 182.999 245.058 219.186 1.00 131.80 ? 244 GLU D CG   1 
ATOM 4468  C CD   . GLU B 2 223 ? 183.365 245.272 220.628 1.00 131.80 ? 244 GLU D CD   1 
ATOM 4469  O OE1  . GLU B 2 223 ? 184.524 245.161 220.950 1.00 131.80 ? 244 GLU D OE1  1 
ATOM 4470  O OE2  . GLU B 2 223 ? 182.485 245.546 221.409 1.00 131.80 ? 244 GLU D OE2  1 
ATOM 4471  H H    . GLU B 2 223 ? 183.876 243.205 217.202 1.00 158.16 ? 244 GLU D H    1 
ATOM 4472  H HA   . GLU B 2 223 ? 183.045 245.624 216.493 1.00 158.16 ? 244 GLU D HA   1 
ATOM 4473  H HB2  . GLU B 2 223 ? 185.018 244.888 218.541 1.00 158.16 ? 244 GLU D HB2  1 
ATOM 4474  H HB3  . GLU B 2 223 ? 184.326 246.491 218.343 1.00 158.16 ? 244 GLU D HB3  1 
ATOM 4475  H HG2  . GLU B 2 223 ? 182.124 245.664 218.952 1.00 158.16 ? 244 GLU D HG2  1 
ATOM 4476  H HG3  . GLU B 2 223 ? 182.734 244.013 219.034 1.00 158.16 ? 244 GLU D HG3  1 
ATOM 4477  N N    . ASP B 2 224 ? 185.006 246.847 215.566 1.00 133.24 ? 245 ASP D N    1 
ATOM 4478  C CA   . ASP B 2 224 ? 186.041 247.437 214.730 1.00 133.24 ? 245 ASP D CA   1 
ATOM 4479  C C    . ASP B 2 224 ? 186.001 248.942 214.959 1.00 133.24 ? 245 ASP D C    1 
ATOM 4480  O O    . ASP B 2 224 ? 185.174 249.449 215.720 1.00 133.24 ? 245 ASP D O    1 
ATOM 4481  C CB   . ASP B 2 224 ? 185.827 247.107 213.251 1.00 133.24 ? 245 ASP D CB   1 
ATOM 4482  C CG   . ASP B 2 224 ? 187.121 247.117 212.449 1.00 133.24 ? 245 ASP D CG   1 
ATOM 4483  O OD1  . ASP B 2 224 ? 187.961 247.942 212.722 1.00 133.24 ? 245 ASP D OD1  1 
ATOM 4484  O OD2  . ASP B 2 224 ? 187.258 246.300 211.570 1.00 133.24 ? 245 ASP D OD2  1 
ATOM 4485  H H    . ASP B 2 224 ? 184.409 247.409 215.825 1.00 159.89 ? 245 ASP D H    1 
ATOM 4486  H HA   . ASP B 2 224 ? 186.908 247.104 215.010 1.00 159.89 ? 245 ASP D HA   1 
ATOM 4487  H HB2  . ASP B 2 224 ? 185.368 246.123 213.160 1.00 159.89 ? 245 ASP D HB2  1 
ATOM 4488  H HB3  . ASP B 2 224 ? 185.140 247.831 212.813 1.00 159.89 ? 245 ASP D HB3  1 
ATOM 4489  N N    . LYS B 2 225 ? 186.919 249.656 214.309 1.00 139.65 ? 246 LYS D N    1 
ATOM 4490  C CA   . LYS B 2 225 ? 186.956 251.107 214.460 1.00 139.65 ? 246 LYS D CA   1 
ATOM 4491  C C    . LYS B 2 225 ? 185.702 251.760 213.887 1.00 139.65 ? 246 LYS D C    1 
ATOM 4492  O O    . LYS B 2 225 ? 185.204 252.747 214.442 1.00 139.65 ? 246 LYS D O    1 
ATOM 4493  C CB   . LYS B 2 225 ? 188.202 251.682 213.786 1.00 139.65 ? 246 LYS D CB   1 
ATOM 4494  C CG   . LYS B 2 225 ? 189.510 251.345 214.490 1.00 139.65 ? 246 LYS D CG   1 
ATOM 4495  C CD   . LYS B 2 225 ? 190.704 251.922 213.743 1.00 139.65 ? 246 LYS D CD   1 
ATOM 4496  C CE   . LYS B 2 225 ? 192.013 251.571 214.435 1.00 139.65 ? 246 LYS D CE   1 
ATOM 4497  N NZ   . LYS B 2 225 ? 193.192 252.088 213.690 1.00 139.65 ? 246 LYS D NZ   1 
ATOM 4498  H H    . LYS B 2 225 ? 187.521 249.332 213.789 1.00 167.58 ? 246 LYS D H    1 
ATOM 4499  H HA   . LYS B 2 225 ? 187.001 251.323 215.406 1.00 167.58 ? 246 LYS D HA   1 
ATOM 4500  H HB2  . LYS B 2 225 ? 188.267 251.310 212.763 1.00 167.58 ? 246 LYS D HB2  1 
ATOM 4501  H HB3  . LYS B 2 225 ? 188.120 252.768 213.735 1.00 167.58 ? 246 LYS D HB3  1 
ATOM 4502  H HG2  . LYS B 2 225 ? 189.494 251.751 215.502 1.00 167.58 ? 246 LYS D HG2  1 
ATOM 4503  H HG3  . LYS B 2 225 ? 189.621 250.263 214.553 1.00 167.58 ? 246 LYS D HG3  1 
ATOM 4504  H HD2  . LYS B 2 225 ? 190.722 251.528 212.726 1.00 167.58 ? 246 LYS D HD2  1 
ATOM 4505  H HD3  . LYS B 2 225 ? 190.611 253.007 213.692 1.00 167.58 ? 246 LYS D HD3  1 
ATOM 4506  H HE2  . LYS B 2 225 ? 192.018 251.993 215.439 1.00 167.58 ? 246 LYS D HE2  1 
ATOM 4507  H HE3  . LYS B 2 225 ? 192.100 250.487 214.520 1.00 167.58 ? 246 LYS D HE3  1 
ATOM 4508  H HZ1  . LYS B 2 225 ? 194.038 251.834 214.180 1.00 167.58 ? 246 LYS D HZ1  1 
ATOM 4509  H HZ2  . LYS B 2 225 ? 193.208 251.688 212.762 1.00 167.58 ? 246 LYS D HZ2  1 
ATOM 4510  H HZ3  . LYS B 2 225 ? 193.133 253.094 213.621 1.00 167.58 ? 246 LYS D HZ3  1 
ATOM 4511  N N    . GLU B 2 226 ? 185.176 251.220 212.789 1.00 129.45 ? 247 GLU D N    1 
ATOM 4512  C CA   . GLU B 2 226 ? 184.047 251.800 212.074 1.00 129.45 ? 247 GLU D CA   1 
ATOM 4513  C C    . GLU B 2 226 ? 182.891 250.813 211.975 1.00 129.45 ? 247 GLU D C    1 
ATOM 4514  O O    . GLU B 2 226 ? 183.085 249.596 212.044 1.00 129.45 ? 247 GLU D O    1 
ATOM 4515  C CB   . GLU B 2 226 ? 184.474 252.242 210.673 1.00 129.45 ? 247 GLU D CB   1 
ATOM 4516  C CG   . GLU B 2 226 ? 185.539 253.330 210.654 1.00 129.45 ? 247 GLU D CG   1 
ATOM 4517  C CD   . GLU B 2 226 ? 185.916 253.756 209.263 1.00 129.45 ? 247 GLU D CD   1 
ATOM 4518  O OE1  . GLU B 2 226 ? 185.399 253.192 208.328 1.00 129.45 ? 247 GLU D OE1  1 
ATOM 4519  O OE2  . GLU B 2 226 ? 186.723 254.646 209.133 1.00 129.45 ? 247 GLU D OE2  1 
ATOM 4520  H H    . GLU B 2 226 ? 185.467 250.495 212.427 1.00 155.34 ? 247 GLU D H    1 
ATOM 4521  H HA   . GLU B 2 226 ? 183.725 252.586 212.537 1.00 155.34 ? 247 GLU D HA   1 
ATOM 4522  H HB2  . GLU B 2 226 ? 184.862 251.385 210.123 1.00 155.34 ? 247 GLU D HB2  1 
ATOM 4523  H HB3  . GLU B 2 226 ? 183.606 252.615 210.128 1.00 155.34 ? 247 GLU D HB3  1 
ATOM 4524  H HG2  . GLU B 2 226 ? 185.168 254.197 211.199 1.00 155.34 ? 247 GLU D HG2  1 
ATOM 4525  H HG3  . GLU B 2 226 ? 186.426 252.964 211.170 1.00 155.34 ? 247 GLU D HG3  1 
ATOM 4526  N N    . LYS B 2 227 ? 181.684 251.358 211.799 1.00 118.18 ? 248 LYS D N    1 
ATOM 4527  C CA   . LYS B 2 227 ? 180.469 250.598 211.510 1.00 118.18 ? 248 LYS D CA   1 
ATOM 4528  C C    . LYS B 2 227 ? 180.005 250.967 210.104 1.00 118.18 ? 248 LYS D C    1 
ATOM 4529  O O    . LYS B 2 227 ? 179.282 251.960 209.933 1.00 118.18 ? 248 LYS D O    1 
ATOM 4530  C CB   . LYS B 2 227 ? 179.373 250.883 212.538 1.00 118.18 ? 248 LYS D CB   1 
ATOM 4531  C CG   . LYS B 2 227 ? 179.679 250.374 213.941 1.00 118.18 ? 248 LYS D CG   1 
ATOM 4532  C CD   . LYS B 2 227 ? 178.591 250.780 214.925 1.00 118.18 ? 248 LYS D CD   1 
ATOM 4533  C CE   . LYS B 2 227 ? 177.291 250.039 214.649 1.00 118.18 ? 248 LYS D CE   1 
ATOM 4534  N NZ   . LYS B 2 227 ? 176.263 250.313 215.690 1.00 118.18 ? 248 LYS D NZ   1 
ATOM 4535  H H    . LYS B 2 227 ? 181.545 252.203 211.842 1.00 141.82 ? 248 LYS D H    1 
ATOM 4536  H HA   . LYS B 2 227 ? 180.652 249.645 211.540 1.00 141.82 ? 248 LYS D HA   1 
ATOM 4537  H HB2  . LYS B 2 227 ? 179.205 251.959 212.602 1.00 141.82 ? 248 LYS D HB2  1 
ATOM 4538  H HB3  . LYS B 2 227 ? 178.439 250.425 212.212 1.00 141.82 ? 248 LYS D HB3  1 
ATOM 4539  H HG2  . LYS B 2 227 ? 179.755 249.287 213.925 1.00 141.82 ? 248 LYS D HG2  1 
ATOM 4540  H HG3  . LYS B 2 227 ? 180.631 250.783 214.277 1.00 141.82 ? 248 LYS D HG3  1 
ATOM 4541  H HD2  . LYS B 2 227 ? 178.918 250.557 215.941 1.00 141.82 ? 248 LYS D HD2  1 
ATOM 4542  H HD3  . LYS B 2 227 ? 178.411 251.852 214.847 1.00 141.82 ? 248 LYS D HD3  1 
ATOM 4543  H HE2  . LYS B 2 227 ? 176.898 250.342 213.680 1.00 141.82 ? 248 LYS D HE2  1 
ATOM 4544  H HE3  . LYS B 2 227 ? 177.482 248.967 214.620 1.00 141.82 ? 248 LYS D HE3  1 
ATOM 4545  H HZ1  . LYS B 2 227 ? 175.418 249.805 215.472 1.00 141.82 ? 248 LYS D HZ1  1 
ATOM 4546  H HZ2  . LYS B 2 227 ? 176.610 250.018 216.592 1.00 141.82 ? 248 LYS D HZ2  1 
ATOM 4547  H HZ3  . LYS B 2 227 ? 176.063 251.303 215.714 1.00 141.82 ? 248 LYS D HZ3  1 
ATOM 4548  N N    . PRO B 2 228 ? 180.391 250.227 209.062 1.00 121.60 ? 249 PRO D N    1 
ATOM 4549  C CA   . PRO B 2 228 ? 179.956 250.605 207.709 1.00 121.60 ? 249 PRO D CA   1 
ATOM 4550  C C    . PRO B 2 228 ? 178.438 250.600 207.583 1.00 121.60 ? 249 PRO D C    1 
ATOM 4551  O O    . PRO B 2 228 ? 177.708 250.082 208.429 1.00 121.60 ? 249 PRO D O    1 
ATOM 4552  C CB   . PRO B 2 228 ? 180.594 249.526 206.828 1.00 121.60 ? 249 PRO D CB   1 
ATOM 4553  C CG   . PRO B 2 228 ? 181.767 249.054 207.619 1.00 121.60 ? 249 PRO D CG   1 
ATOM 4554  C CD   . PRO B 2 228 ? 181.290 249.078 209.046 1.00 121.60 ? 249 PRO D CD   1 
ATOM 4555  H HA   . PRO B 2 228 ? 180.298 251.482 207.478 1.00 145.92 ? 249 PRO D HA   1 
ATOM 4556  H HB2  . PRO B 2 228 ? 179.866 248.726 206.626 1.00 145.92 ? 249 PRO D HB2  1 
ATOM 4557  H HB3  . PRO B 2 228 ? 180.879 249.954 205.856 1.00 145.92 ? 249 PRO D HB3  1 
ATOM 4558  H HG2  . PRO B 2 228 ? 182.067 248.049 207.289 1.00 145.92 ? 249 PRO D HG2  1 
ATOM 4559  H HG3  . PRO B 2 228 ? 182.630 249.715 207.449 1.00 145.92 ? 249 PRO D HG3  1 
ATOM 4560  H HD2  . PRO B 2 228 ? 180.766 248.138 209.274 1.00 145.92 ? 249 PRO D HD2  1 
ATOM 4561  H HD3  . PRO B 2 228 ? 182.150 249.216 209.718 1.00 145.92 ? 249 PRO D HD3  1 
ATOM 4562  N N    . ASN B 2 229 ? 177.963 251.195 206.491 1.00 127.60 ? 250 ASN D N    1 
ATOM 4563  C CA   . ASN B 2 229 ? 176.541 251.167 206.164 1.00 127.60 ? 250 ASN D CA   1 
ATOM 4564  C C    . ASN B 2 229 ? 176.078 249.741 205.882 1.00 127.60 ? 250 ASN D C    1 
ATOM 4565  O O    . ASN B 2 229 ? 176.655 249.053 205.036 1.00 127.60 ? 250 ASN D O    1 
ATOM 4566  C CB   . ASN B 2 229 ? 176.243 252.071 204.983 1.00 127.60 ? 250 ASN D CB   1 
ATOM 4567  C CG   . ASN B 2 229 ? 174.770 252.310 204.794 1.00 127.60 ? 250 ASN D CG   1 
ATOM 4568  O OD1  . ASN B 2 229 ? 173.986 251.362 204.672 1.00 127.60 ? 250 ASN D OD1  1 
ATOM 4569  N ND2  . ASN B 2 229 ? 174.379 253.558 204.769 1.00 127.60 ? 250 ASN D ND2  1 
ATOM 4570  H H    . ASN B 2 229 ? 178.444 251.623 205.922 1.00 153.12 ? 250 ASN D H    1 
ATOM 4571  H HA   . ASN B 2 229 ? 176.034 251.512 206.916 1.00 153.12 ? 250 ASN D HA   1 
ATOM 4572  H HB2  . ASN B 2 229 ? 176.739 253.032 205.126 1.00 153.12 ? 250 ASN D HB2  1 
ATOM 4573  H HB3  . ASN B 2 229 ? 176.647 251.627 204.073 1.00 153.12 ? 250 ASN D HB3  1 
ATOM 4574  H HD21 . ASN B 2 229 ? 173.411 253.777 204.646 1.00 153.12 ? 250 ASN D HD21 1 
ATOM 4575  H HD22 . ASN B 2 229 ? 175.048 254.294 204.872 1.00 153.12 ? 250 ASN D HD22 1 
ATOM 4576  N N    . CYS B 2 230 ? 175.015 249.314 206.576 1.00 141.63 ? 251 CYS D N    1 
ATOM 4577  C CA   . CYS B 2 230 ? 174.517 247.946 206.432 1.00 141.63 ? 251 CYS D CA   1 
ATOM 4578  C C    . CYS B 2 230 ? 174.128 247.639 204.990 1.00 141.63 ? 251 CYS D C    1 
ATOM 4579  O O    . CYS B 2 230 ? 174.231 246.491 204.546 1.00 141.63 ? 251 CYS D O    1 
ATOM 4580  C CB   . CYS B 2 230 ? 173.306 247.717 207.337 1.00 141.63 ? 251 CYS D CB   1 
ATOM 4581  S SG   . CYS B 2 230 ? 173.683 247.772 209.105 1.00 141.63 ? 251 CYS D SG   1 
ATOM 4582  H H    . CYS B 2 230 ? 174.571 249.794 207.134 1.00 169.96 ? 251 CYS D H    1 
ATOM 4583  H HA   . CYS B 2 230 ? 175.215 247.325 206.693 1.00 169.96 ? 251 CYS D HA   1 
ATOM 4584  H HB2  . CYS B 2 230 ? 172.549 248.474 207.130 1.00 169.96 ? 251 CYS D HB2  1 
ATOM 4585  H HB3  . CYS B 2 230 ? 172.865 246.745 207.116 1.00 169.96 ? 251 CYS D HB3  1 
ATOM 4586  N N    . LEU B 2 231 ? 173.665 248.648 204.248 1.00 151.22 ? 252 LEU D N    1 
ATOM 4587  C CA   . LEU B 2 231 ? 173.281 248.417 202.860 1.00 151.22 ? 252 LEU D CA   1 
ATOM 4588  C C    . LEU B 2 231 ? 174.506 248.133 201.998 1.00 151.22 ? 252 LEU D C    1 
ATOM 4589  O O    . LEU B 2 231 ? 174.518 247.178 201.212 1.00 151.22 ? 252 LEU D O    1 
ATOM 4590  C CB   . LEU B 2 231 ? 172.527 249.633 202.307 1.00 151.22 ? 252 LEU D CB   1 
ATOM 4591  C CG   . LEU B 2 231 ? 172.034 249.508 200.860 1.00 151.22 ? 252 LEU D CG   1 
ATOM 4592  C CD1  . LEU B 2 231 ? 171.067 248.337 200.751 1.00 151.22 ? 252 LEU D CD1  1 
ATOM 4593  C CD2  . LEU B 2 231 ? 171.367 250.809 200.437 1.00 151.22 ? 252 LEU D CD2  1 
ATOM 4594  H H    . LEU B 2 231 ? 173.566 249.458 204.520 1.00 181.46 ? 252 LEU D H    1 
ATOM 4595  H HA   . LEU B 2 231 ? 172.704 247.638 202.825 1.00 181.46 ? 252 LEU D HA   1 
ATOM 4596  H HB2  . LEU B 2 231 ? 171.660 249.820 202.938 1.00 181.46 ? 252 LEU D HB2  1 
ATOM 4597  H HB3  . LEU B 2 231 ? 173.183 250.502 202.360 1.00 181.46 ? 252 LEU D HB3  1 
ATOM 4598  H HG   . LEU B 2 231 ? 172.880 249.304 200.203 1.00 181.46 ? 252 LEU D HG   1 
ATOM 4599  H HD11 . LEU B 2 231 ? 170.717 248.248 199.723 1.00 181.46 ? 252 LEU D HD11 1 
ATOM 4600  H HD12 . LEU B 2 231 ? 171.576 247.417 201.041 1.00 181.46 ? 252 LEU D HD12 1 
ATOM 4601  H HD13 . LEU B 2 231 ? 170.217 248.505 201.411 1.00 181.46 ? 252 LEU D HD13 1 
ATOM 4602  H HD21 . LEU B 2 231 ? 171.017 250.720 199.408 1.00 181.46 ? 252 LEU D HD21 1 
ATOM 4603  H HD22 . LEU B 2 231 ? 170.520 251.013 201.092 1.00 181.46 ? 252 LEU D HD22 1 
ATOM 4604  H HD23 . LEU B 2 231 ? 172.085 251.626 200.507 1.00 181.46 ? 252 LEU D HD23 1 
ATOM 4605  N N    . ASP B 2 232 ? 175.558 248.942 202.142 1.00 137.91 ? 253 ASP D N    1 
ATOM 4606  C CA   . ASP B 2 232 ? 176.808 248.641 201.453 1.00 137.91 ? 253 ASP D CA   1 
ATOM 4607  C C    . ASP B 2 232 ? 177.395 247.323 201.945 1.00 137.91 ? 253 ASP D C    1 
ATOM 4608  O O    . ASP B 2 232 ? 177.924 246.536 201.150 1.00 137.91 ? 253 ASP D O    1 
ATOM 4609  C CB   . ASP B 2 232 ? 177.823 249.769 201.660 1.00 137.91 ? 253 ASP D CB   1 
ATOM 4610  C CG   . ASP B 2 232 ? 177.448 251.045 200.919 1.00 137.91 ? 253 ASP D CG   1 
ATOM 4611  O OD1  . ASP B 2 232 ? 176.610 250.981 200.051 1.00 137.91 ? 253 ASP D OD1  1 
ATOM 4612  O OD2  . ASP B 2 232 ? 178.004 252.072 201.228 1.00 137.91 ? 253 ASP D OD2  1 
ATOM 4613  H H    . ASP B 2 232 ? 175.571 249.655 202.621 1.00 165.49 ? 253 ASP D H    1 
ATOM 4614  H HA   . ASP B 2 232 ? 176.630 248.547 200.504 1.00 165.49 ? 253 ASP D HA   1 
ATOM 4615  H HB2  . ASP B 2 232 ? 177.905 249.994 202.723 1.00 165.49 ? 253 ASP D HB2  1 
ATOM 4616  H HB3  . ASP B 2 232 ? 178.805 249.442 201.318 1.00 165.49 ? 253 ASP D HB3  1 
ATOM 4617  N N    . LEU B 2 233 ? 177.308 247.060 203.252 1.00 140.73 ? 254 LEU D N    1 
ATOM 4618  C CA   . LEU B 2 233 ? 177.845 245.812 203.784 1.00 140.73 ? 254 LEU D CA   1 
ATOM 4619  C C    . LEU B 2 233 ? 177.119 244.612 203.189 1.00 140.73 ? 254 LEU D C    1 
ATOM 4620  O O    . LEU B 2 233 ? 177.752 243.623 202.808 1.00 140.73 ? 254 LEU D O    1 
ATOM 4621  C CB   . LEU B 2 233 ? 177.724 245.788 205.312 1.00 140.73 ? 254 LEU D CB   1 
ATOM 4622  C CG   . LEU B 2 233 ? 178.277 244.536 206.004 1.00 140.73 ? 254 LEU D CG   1 
ATOM 4623  C CD1  . LEU B 2 233 ? 179.764 244.405 205.704 1.00 140.73 ? 254 LEU D CD1  1 
ATOM 4624  C CD2  . LEU B 2 233 ? 178.028 244.631 207.502 1.00 140.73 ? 254 LEU D CD2  1 
ATOM 4625  H H    . LEU B 2 233 ? 176.948 247.578 203.838 1.00 168.88 ? 254 LEU D H    1 
ATOM 4626  H HA   . LEU B 2 233 ? 178.782 245.744 203.542 1.00 168.88 ? 254 LEU D HA   1 
ATOM 4627  H HB2  . LEU B 2 233 ? 178.252 246.650 205.716 1.00 168.88 ? 254 LEU D HB2  1 
ATOM 4628  H HB3  . LEU B 2 233 ? 176.671 245.876 205.579 1.00 168.88 ? 254 LEU D HB3  1 
ATOM 4629  H HG   . LEU B 2 233 ? 177.778 243.651 205.609 1.00 168.88 ? 254 LEU D HG   1 
ATOM 4630  H HD11 . LEU B 2 233 ? 180.158 243.515 206.195 1.00 168.88 ? 254 LEU D HD11 1 
ATOM 4631  H HD12 . LEU B 2 233 ? 179.912 244.319 204.627 1.00 168.88 ? 254 LEU D HD12 1 
ATOM 4632  H HD13 . LEU B 2 233 ? 180.289 245.285 206.074 1.00 168.88 ? 254 LEU D HD13 1 
ATOM 4633  H HD21 . LEU B 2 233 ? 178.421 243.740 207.994 1.00 168.88 ? 254 LEU D HD21 1 
ATOM 4634  H HD22 . LEU B 2 233 ? 178.528 245.515 207.899 1.00 168.88 ? 254 LEU D HD22 1 
ATOM 4635  H HD23 . LEU B 2 233 ? 176.957 244.706 207.689 1.00 168.88 ? 254 LEU D HD23 1 
ATOM 4636  N N    . ARG B 2 234 ? 175.789 244.685 203.097 1.00 148.02 ? 255 ARG D N    1 
ATOM 4637  C CA   . ARG B 2 234 ? 175.028 243.634 202.424 1.00 148.02 ? 255 ARG D CA   1 
ATOM 4638  C C    . ARG B 2 234 ? 175.455 243.502 200.967 1.00 148.02 ? 255 ARG D C    1 
ATOM 4639  O O    . ARG B 2 234 ? 175.611 242.387 200.456 1.00 148.02 ? 255 ARG D O    1 
ATOM 4640  C CB   . ARG B 2 234 ? 173.536 243.924 202.489 1.00 148.02 ? 255 ARG D CB   1 
ATOM 4641  C CG   . ARG B 2 234 ? 172.647 242.834 201.912 1.00 148.02 ? 255 ARG D CG   1 
ATOM 4642  C CD   . ARG B 2 234 ? 171.210 243.202 201.985 1.00 148.02 ? 255 ARG D CD   1 
ATOM 4643  N NE   . ARG B 2 234 ? 170.893 244.324 201.117 1.00 148.02 ? 255 ARG D NE   1 
ATOM 4644  C CZ   . ARG B 2 234 ? 170.682 244.229 199.789 1.00 148.02 ? 255 ARG D CZ   1 
ATOM 4645  N NH1  . ARG B 2 234 ? 170.756 243.060 199.194 1.00 148.02 ? 255 ARG D NH1  1 
ATOM 4646  N NH2  . ARG B 2 234 ? 170.399 245.312 199.086 1.00 148.02 ? 255 ARG D NH2  1 
ATOM 4647  H H    . ARG B 2 234 ? 175.309 245.326 203.411 1.00 177.62 ? 255 ARG D H    1 
ATOM 4648  H HA   . ARG B 2 234 ? 175.196 242.788 202.865 1.00 177.62 ? 255 ARG D HA   1 
ATOM 4649  H HB2  . ARG B 2 234 ? 173.240 244.077 203.526 1.00 177.62 ? 255 ARG D HB2  1 
ATOM 4650  H HB3  . ARG B 2 234 ? 173.321 244.846 201.948 1.00 177.62 ? 255 ARG D HB3  1 
ATOM 4651  H HG2  . ARG B 2 234 ? 172.906 242.668 200.866 1.00 177.62 ? 255 ARG D HG2  1 
ATOM 4652  H HG3  . ARG B 2 234 ? 172.793 241.910 202.474 1.00 177.62 ? 255 ARG D HG3  1 
ATOM 4653  H HD2  . ARG B 2 234 ? 170.601 242.352 201.678 1.00 177.62 ? 255 ARG D HD2  1 
ATOM 4654  H HD3  . ARG B 2 234 ? 170.957 243.479 203.007 1.00 177.62 ? 255 ARG D HD3  1 
ATOM 4655  H HE   . ARG B 2 234 ? 170.827 245.241 201.539 1.00 177.62 ? 255 ARG D HE   1 
ATOM 4656  H HH11 . ARG B 2 234 ? 170.973 242.232 199.731 1.00 177.62 ? 255 ARG D HH11 1 
ATOM 4657  H HH12 . ARG B 2 234 ? 170.598 242.989 198.199 1.00 177.62 ? 255 ARG D HH12 1 
ATOM 4658  H HH21 . ARG B 2 234 ? 170.341 246.212 199.544 1.00 177.62 ? 255 ARG D HH21 1 
ATOM 4659  H HH22 . ARG B 2 234 ? 170.240 245.241 198.092 1.00 177.62 ? 255 ARG D HH22 1 
ATOM 4660  N N    . GLY B 2 235 ? 175.630 244.632 200.281 1.00 156.88 ? 256 GLY D N    1 
ATOM 4661  C CA   . GLY B 2 235 ? 176.101 244.591 198.906 1.00 156.88 ? 256 GLY D CA   1 
ATOM 4662  C C    . GLY B 2 235 ? 177.441 243.893 198.768 1.00 156.88 ? 256 GLY D C    1 
ATOM 4663  O O    . GLY B 2 235 ? 177.667 243.152 197.808 1.00 156.88 ? 256 GLY D O    1 
ATOM 4664  H H    . GLY B 2 235 ? 175.483 245.422 200.587 1.00 188.26 ? 256 GLY D H    1 
ATOM 4665  H HA2  . GLY B 2 235 ? 175.453 244.121 198.358 1.00 188.26 ? 256 GLY D HA2  1 
ATOM 4666  H HA3  . GLY B 2 235 ? 176.190 245.496 198.569 1.00 188.26 ? 256 GLY D HA3  1 
ATOM 4667  N N    . VAL B 2 236 ? 178.346 244.119 199.722 1.00 155.51 ? 257 VAL D N    1 
ATOM 4668  C CA   . VAL B 2 236 ? 179.626 243.411 199.717 1.00 155.51 ? 257 VAL D CA   1 
ATOM 4669  C C    . VAL B 2 236 ? 179.403 241.919 199.950 1.00 155.51 ? 257 VAL D C    1 
ATOM 4670  O O    . VAL B 2 236 ? 179.932 241.074 199.220 1.00 155.51 ? 257 VAL D O    1 
ATOM 4671  C CB   . VAL B 2 236 ? 180.559 243.970 200.807 1.00 155.51 ? 257 VAL D CB   1 
ATOM 4672  C CG1  . VAL B 2 236 ? 181.797 243.096 200.948 1.00 155.51 ? 257 VAL D CG1  1 
ATOM 4673  C CG2  . VAL B 2 236 ? 180.946 245.403 200.472 1.00 155.51 ? 257 VAL D CG2  1 
ATOM 4674  H H    . VAL B 2 236 ? 178.244 244.670 200.375 1.00 186.61 ? 257 VAL D H    1 
ATOM 4675  H HA   . VAL B 2 236 ? 180.036 243.516 198.844 1.00 186.61 ? 257 VAL D HA   1 
ATOM 4676  H HB   . VAL B 2 236 ? 180.039 243.947 201.764 1.00 186.61 ? 257 VAL D HB   1 
ATOM 4677  H HG11 . VAL B 2 236 ? 182.445 243.506 201.722 1.00 186.61 ? 257 VAL D HG11 1 
ATOM 4678  H HG12 . VAL B 2 236 ? 181.498 242.085 201.222 1.00 186.61 ? 257 VAL D HG12 1 
ATOM 4679  H HG13 . VAL B 2 236 ? 182.335 243.072 200.000 1.00 186.61 ? 257 VAL D HG13 1 
ATOM 4680  H HG21 . VAL B 2 236 ? 181.605 245.792 201.248 1.00 186.61 ? 257 VAL D HG21 1 
ATOM 4681  H HG22 . VAL B 2 236 ? 181.461 245.426 199.512 1.00 186.61 ? 257 VAL D HG22 1 
ATOM 4682  H HG23 . VAL B 2 236 ? 180.048 246.018 200.417 1.00 186.61 ? 257 VAL D HG23 1 
ATOM 4683  N N    . CYS B 2 237 ? 178.619 241.578 200.977 1.00 164.24 ? 258 CYS D N    1 
ATOM 4684  C CA   . CYS B 2 237 ? 178.291 240.183 201.253 1.00 164.24 ? 258 CYS D CA   1 
ATOM 4685  C C    . CYS B 2 237 ? 177.676 239.503 200.038 1.00 164.24 ? 258 CYS D C    1 
ATOM 4686  O O    . CYS B 2 237 ? 177.957 238.331 199.762 1.00 164.24 ? 258 CYS D O    1 
ATOM 4687  C CB   . CYS B 2 237 ? 177.319 240.084 202.429 1.00 164.24 ? 258 CYS D CB   1 
ATOM 4688  S SG   . CYS B 2 237 ? 176.841 238.391 202.851 1.00 164.24 ? 258 CYS D SG   1 
ATOM 4689  H H    . CYS B 2 237 ? 178.267 242.138 201.526 1.00 197.09 ? 258 CYS D H    1 
ATOM 4690  H HA   . CYS B 2 237 ? 179.101 239.705 201.489 1.00 197.09 ? 258 CYS D HA   1 
ATOM 4691  H HB2  . CYS B 2 237 ? 177.769 240.537 203.312 1.00 197.09 ? 258 CYS D HB2  1 
ATOM 4692  H HB3  . CYS B 2 237 ? 176.412 240.643 202.200 1.00 197.09 ? 258 CYS D HB3  1 
ATOM 4693  N N    . ARG B 2 238 ? 176.824 240.222 199.304 1.00 163.23 ? 259 ARG D N    1 
ATOM 4694  C CA   . ARG B 2 238 ? 176.141 239.632 198.158 1.00 163.23 ? 259 ARG D CA   1 
ATOM 4695  C C    . ARG B 2 238 ? 177.128 239.071 197.141 1.00 163.23 ? 259 ARG D C    1 
ATOM 4696  O O    . ARG B 2 238 ? 176.798 238.131 196.411 1.00 163.23 ? 259 ARG D O    1 
ATOM 4697  C CB   . ARG B 2 238 ? 175.254 240.664 197.478 1.00 163.23 ? 259 ARG D CB   1 
ATOM 4698  C CG   . ARG B 2 238 ? 174.398 240.124 196.344 1.00 163.23 ? 259 ARG D CG   1 
ATOM 4699  C CD   . ARG B 2 238 ? 173.485 241.162 195.802 1.00 163.23 ? 259 ARG D CD   1 
ATOM 4700  N NE   . ARG B 2 238 ? 172.644 240.642 194.736 1.00 163.23 ? 259 ARG D NE   1 
ATOM 4701  C CZ   . ARG B 2 238 ? 172.990 240.611 193.434 1.00 163.23 ? 259 ARG D CZ   1 
ATOM 4702  N NH1  . ARG B 2 238 ? 174.161 241.073 193.054 1.00 163.23 ? 259 ARG D NH1  1 
ATOM 4703  N NH2  . ARG B 2 238 ? 172.153 240.117 192.539 1.00 163.23 ? 259 ARG D NH2  1 
ATOM 4704  H H    . ARG B 2 238 ? 176.624 241.046 199.450 1.00 195.88 ? 259 ARG D H    1 
ATOM 4705  H HA   . ARG B 2 238 ? 175.579 238.904 198.465 1.00 195.88 ? 259 ARG D HA   1 
ATOM 4706  H HB2  . ARG B 2 238 ? 174.584 241.108 198.213 1.00 195.88 ? 259 ARG D HB2  1 
ATOM 4707  H HB3  . ARG B 2 238 ? 175.872 241.465 197.072 1.00 195.88 ? 259 ARG D HB3  1 
ATOM 4708  H HG2  . ARG B 2 238 ? 175.042 239.778 195.535 1.00 195.88 ? 259 ARG D HG2  1 
ATOM 4709  H HG3  . ARG B 2 238 ? 173.794 239.292 196.708 1.00 195.88 ? 259 ARG D HG3  1 
ATOM 4710  H HD2  . ARG B 2 238 ? 172.838 241.529 196.598 1.00 195.88 ? 259 ARG D HD2  1 
ATOM 4711  H HD3  . ARG B 2 238 ? 174.071 241.988 195.401 1.00 195.88 ? 259 ARG D HD3  1 
ATOM 4712  H HE   . ARG B 2 238 ? 171.735 240.278 194.989 1.00 195.88 ? 259 ARG D HE   1 
ATOM 4713  H HH11 . ARG B 2 238 ? 174.801 241.451 193.739 1.00 195.88 ? 259 ARG D HH11 1 
ATOM 4714  H HH12 . ARG B 2 238 ? 174.420 241.050 192.079 1.00 195.88 ? 259 ARG D HH12 1 
ATOM 4715  H HH21 . ARG B 2 238 ? 171.252 239.762 192.831 1.00 195.88 ? 259 ARG D HH21 1 
ATOM 4716  H HH22 . ARG B 2 238 ? 172.412 240.094 191.564 1.00 195.88 ? 259 ARG D HH22 1 
ATOM 4717  N N    . THR B 2 239 ? 178.337 239.629 197.079 1.00 165.25 ? 260 THR D N    1 
ATOM 4718  C CA   . THR B 2 239 ? 179.311 239.203 196.082 1.00 165.25 ? 260 THR D CA   1 
ATOM 4719  C C    . THR B 2 239 ? 180.008 237.902 196.460 1.00 165.25 ? 260 THR D C    1 
ATOM 4720  O O    . THR B 2 239 ? 180.568 237.240 195.579 1.00 165.25 ? 260 THR D O    1 
ATOM 4721  C CB   . THR B 2 239 ? 180.370 240.298 195.855 1.00 165.25 ? 260 THR D CB   1 
ATOM 4722  O OG1  . THR B 2 239 ? 181.156 240.461 197.043 1.00 165.25 ? 260 THR D OG1  1 
ATOM 4723  C CG2  . THR B 2 239 ? 179.703 241.621 195.508 1.00 165.25 ? 260 THR D CG2  1 
ATOM 4724  H H    . THR B 2 239 ? 178.617 240.252 197.601 1.00 198.30 ? 260 THR D H    1 
ATOM 4725  H HA   . THR B 2 239 ? 178.853 239.060 195.240 1.00 198.30 ? 260 THR D HA   1 
ATOM 4726  H HB   . THR B 2 239 ? 181.028 240.004 195.038 1.00 198.30 ? 260 THR D HB   1 
ATOM 4727  H HG1  . THR B 2 239 ? 180.585 240.715 197.772 1.00 198.30 ? 260 THR D HG1  1 
ATOM 4728  H HG21 . THR B 2 239 ? 180.466 242.383 195.351 1.00 198.30 ? 260 THR D HG21 1 
ATOM 4729  H HG22 . THR B 2 239 ? 179.114 241.504 194.599 1.00 198.30 ? 260 THR D HG22 1 
ATOM 4730  H HG23 . THR B 2 239 ? 179.051 241.925 196.326 1.00 198.30 ? 260 THR D HG23 1 
ATOM 4731  N N    . ASP B 2 240 ? 179.987 237.522 197.735 1.00 183.95 ? 261 ASP D N    1 
ATOM 4732  C CA   . ASP B 2 240 ? 180.594 236.280 198.200 1.00 183.95 ? 261 ASP D CA   1 
ATOM 4733  C C    . ASP B 2 240 ? 179.531 235.189 198.193 1.00 183.95 ? 261 ASP D C    1 
ATOM 4734  O O    . ASP B 2 240 ? 178.437 235.378 198.737 1.00 183.95 ? 261 ASP D O    1 
ATOM 4735  C CB   . ASP B 2 240 ? 181.183 236.442 199.603 1.00 183.95 ? 261 ASP D CB   1 
ATOM 4736  C CG   . ASP B 2 240 ? 181.916 235.197 200.085 1.00 183.95 ? 261 ASP D CG   1 
ATOM 4737  O OD1  . ASP B 2 240 ? 183.059 235.030 199.731 1.00 183.95 ? 261 ASP D OD1  1 
ATOM 4738  O OD2  . ASP B 2 240 ? 181.325 234.426 200.802 1.00 183.95 ? 261 ASP D OD2  1 
ATOM 4739  H H    . ASP B 2 240 ? 179.619 237.979 198.364 1.00 220.74 ? 261 ASP D H    1 
ATOM 4740  H HA   . ASP B 2 240 ? 181.306 236.020 197.597 1.00 220.74 ? 261 ASP D HA   1 
ATOM 4741  H HB2  . ASP B 2 240 ? 181.879 237.281 199.611 1.00 220.74 ? 261 ASP D HB2  1 
ATOM 4742  H HB3  . ASP B 2 240 ? 180.384 236.672 200.309 1.00 220.74 ? 261 ASP D HB3  1 
ATOM 4743  N N    . HIS B 2 241 ? 179.855 234.049 197.578 1.00 202.08 ? 262 HIS D N    1 
ATOM 4744  C CA   . HIS B 2 241 ? 178.870 232.983 197.426 1.00 202.08 ? 262 HIS D CA   1 
ATOM 4745  C C    . HIS B 2 241 ? 178.404 232.449 198.775 1.00 202.08 ? 262 HIS D C    1 
ATOM 4746  O O    . HIS B 2 241 ? 177.201 232.298 199.007 1.00 202.08 ? 262 HIS D O    1 
ATOM 4747  C CB   . HIS B 2 241 ? 179.445 231.835 196.590 1.00 202.08 ? 262 HIS D CB   1 
ATOM 4748  C CG   . HIS B 2 241 ? 179.591 232.163 195.137 1.00 202.08 ? 262 HIS D CG   1 
ATOM 4749  N ND1  . HIS B 2 241 ? 180.627 232.932 194.649 1.00 202.08 ? 262 HIS D ND1  1 
ATOM 4750  C CD2  . HIS B 2 241 ? 178.833 231.829 194.066 1.00 202.08 ? 262 HIS D CD2  1 
ATOM 4751  C CE1  . HIS B 2 241 ? 180.500 233.055 193.339 1.00 202.08 ? 262 HIS D CE1  1 
ATOM 4752  N NE2  . HIS B 2 241 ? 179.420 232.395 192.962 1.00 202.08 ? 262 HIS D NE2  1 
ATOM 4753  H H    . HIS B 2 241 ? 180.628 233.872 197.244 1.00 242.50 ? 262 HIS D H    1 
ATOM 4754  H HA   . HIS B 2 241 ? 178.095 233.337 196.963 1.00 242.50 ? 262 HIS D HA   1 
ATOM 4755  H HB2  . HIS B 2 241 ? 180.426 231.558 196.978 1.00 242.50 ? 262 HIS D HB2  1 
ATOM 4756  H HB3  . HIS B 2 241 ? 178.800 230.961 196.679 1.00 242.50 ? 262 HIS D HB3  1 
ATOM 4757  H HD2  . HIS B 2 241 ? 177.927 231.223 194.079 1.00 242.50 ? 262 HIS D HD2  1 
ATOM 4758  H HE1  . HIS B 2 241 ? 181.172 233.606 192.682 1.00 242.50 ? 262 HIS D HE1  1 
ATOM 4759  H HE2  . HIS B 2 241 ? 179.076 232.317 192.015 1.00 242.50 ? 262 HIS D HE2  1 
ATOM 4760  N N    . LEU B 2 242 ? 179.342 232.159 199.682 1.00 183.20 ? 263 LEU D N    1 
ATOM 4761  C CA   . LEU B 2 242 ? 178.990 231.576 200.975 1.00 183.20 ? 263 LEU D CA   1 
ATOM 4762  C C    . LEU B 2 242 ? 178.263 232.579 201.867 1.00 183.20 ? 263 LEU D C    1 
ATOM 4763  O O    . LEU B 2 242 ? 177.251 232.243 202.503 1.00 183.20 ? 263 LEU D O    1 
ATOM 4764  C CB   . LEU B 2 242 ? 180.252 231.074 201.689 1.00 183.20 ? 263 LEU D CB   1 
ATOM 4765  C CG   . LEU B 2 242 ? 180.929 229.850 201.060 1.00 183.20 ? 263 LEU D CG   1 
ATOM 4766  C CD1  . LEU B 2 242 ? 182.270 229.605 201.740 1.00 183.20 ? 263 LEU D CD1  1 
ATOM 4767  C CD2  . LEU B 2 242 ? 180.018 228.640 201.196 1.00 183.20 ? 263 LEU D CD2  1 
ATOM 4768  H H    . LEU B 2 242 ? 180.184 232.291 199.571 1.00 219.84 ? 263 LEU D H    1 
ATOM 4769  H HA   . LEU B 2 242 ? 178.398 230.825 200.827 1.00 219.84 ? 263 LEU D HA   1 
ATOM 4770  H HB2  . LEU B 2 242 ? 180.982 231.882 201.711 1.00 219.84 ? 263 LEU D HB2  1 
ATOM 4771  H HB3  . LEU B 2 242 ? 179.992 230.818 202.716 1.00 219.84 ? 263 LEU D HB3  1 
ATOM 4772  H HG   . LEU B 2 242 ? 181.122 230.043 200.004 1.00 219.84 ? 263 LEU D HG   1 
ATOM 4773  H HD11 . LEU B 2 242 ? 182.751 228.736 201.293 1.00 219.84 ? 263 LEU D HD11 1 
ATOM 4774  H HD12 . LEU B 2 242 ? 182.908 230.479 201.611 1.00 219.84 ? 263 LEU D HD12 1 
ATOM 4775  H HD13 . LEU B 2 242 ? 182.110 229.426 202.803 1.00 219.84 ? 263 LEU D HD13 1 
ATOM 4776  H HD21 . LEU B 2 242 ? 180.499 227.769 200.748 1.00 219.84 ? 263 LEU D HD21 1 
ATOM 4777  H HD22 . LEU B 2 242 ? 179.826 228.445 202.251 1.00 219.84 ? 263 LEU D HD22 1 
ATOM 4778  H HD23 . LEU B 2 242 ? 179.075 228.835 200.686 1.00 219.84 ? 263 LEU D HD23 1 
ATOM 4779  N N    . CYS B 2 243 ? 178.780 233.809 201.934 1.00 172.27 ? 264 CYS D N    1 
ATOM 4780  C CA   . CYS B 2 243 ? 178.134 234.855 202.721 1.00 172.27 ? 264 CYS D CA   1 
ATOM 4781  C C    . CYS B 2 243 ? 176.749 235.160 202.173 1.00 172.27 ? 264 CYS D C    1 
ATOM 4782  O O    . CYS B 2 243 ? 175.754 235.132 202.911 1.00 172.27 ? 264 CYS D O    1 
ATOM 4783  C CB   . CYS B 2 243 ? 179.006 236.113 202.728 1.00 172.27 ? 264 CYS D CB   1 
ATOM 4784  S SG   . CYS B 2 243 ? 178.430 237.443 203.819 1.00 172.27 ? 264 CYS D SG   1 
ATOM 4785  H H    . CYS B 2 243 ? 179.499 234.060 201.535 1.00 206.72 ? 264 CYS D H    1 
ATOM 4786  H HA   . CYS B 2 243 ? 178.035 234.551 203.627 1.00 206.72 ? 264 CYS D HA   1 
ATOM 4787  H HB2  . CYS B 2 243 ? 179.901 235.870 203.011 1.00 206.72 ? 264 CYS D HB2  1 
ATOM 4788  H HB3  . CYS B 2 243 ? 179.037 236.470 201.826 1.00 206.72 ? 264 CYS D HB3  1 
ATOM 4789  N N    . ARG B 2 244 ? 176.674 235.455 200.874 1.00 185.02 ? 265 ARG D N    1 
ATOM 4790  C CA   . ARG B 2 244 ? 175.400 235.767 200.236 1.00 185.02 ? 265 ARG D CA   1 
ATOM 4791  C C    . ARG B 2 244 ? 174.400 234.633 200.421 1.00 185.02 ? 265 ARG D C    1 
ATOM 4792  O O    . ARG B 2 244 ? 173.267 234.864 200.853 1.00 185.02 ? 265 ARG D O    1 
ATOM 4793  C CB   . ARG B 2 244 ? 175.596 236.030 198.750 1.00 185.02 ? 265 ARG D CB   1 
ATOM 4794  C CG   . ARG B 2 244 ? 174.330 236.404 197.995 1.00 185.02 ? 265 ARG D CG   1 
ATOM 4795  C CD   . ARG B 2 244 ? 173.735 235.231 197.306 1.00 185.02 ? 265 ARG D CD   1 
ATOM 4796  N NE   . ARG B 2 244 ? 174.626 234.685 196.295 1.00 185.02 ? 265 ARG D NE   1 
ATOM 4797  C CZ   . ARG B 2 244 ? 174.463 233.489 195.696 1.00 185.02 ? 265 ARG D CZ   1 
ATOM 4798  N NH1  . ARG B 2 244 ? 173.441 232.727 196.017 1.00 185.02 ? 265 ARG D NH1  1 
ATOM 4799  N NH2  . ARG B 2 244 ? 175.331 233.082 194.787 1.00 185.02 ? 265 ARG D NH2  1 
ATOM 4800  H H    . ARG B 2 244 ? 177.349 235.481 200.342 1.00 222.02 ? 265 ARG D H    1 
ATOM 4801  H HA   . ARG B 2 244 ? 175.030 236.568 200.640 1.00 222.02 ? 265 ARG D HA   1 
ATOM 4802  H HB2  . ARG B 2 244 ? 176.312 236.839 198.615 1.00 222.02 ? 265 ARG D HB2  1 
ATOM 4803  H HB3  . ARG B 2 244 ? 176.013 235.142 198.275 1.00 222.02 ? 265 ARG D HB3  1 
ATOM 4804  H HG2  . ARG B 2 244 ? 173.594 236.802 198.693 1.00 222.02 ? 265 ARG D HG2  1 
ATOM 4805  H HG3  . ARG B 2 244 ? 174.565 237.160 197.244 1.00 222.02 ? 265 ARG D HG3  1 
ATOM 4806  H HD2  . ARG B 2 244 ? 173.526 234.448 198.035 1.00 222.02 ? 265 ARG D HD2  1 
ATOM 4807  H HD3  . ARG B 2 244 ? 172.807 235.528 196.818 1.00 222.02 ? 265 ARG D HD3  1 
ATOM 4808  H HE   . ARG B 2 244 ? 175.424 235.242 196.022 1.00 222.02 ? 265 ARG D HE   1 
ATOM 4809  H HH11 . ARG B 2 244 ? 172.777 233.039 196.712 1.00 222.02 ? 265 ARG D HH11 1 
ATOM 4810  H HH12 . ARG B 2 244 ? 173.318 231.831 195.569 1.00 222.02 ? 265 ARG D HH12 1 
ATOM 4811  H HH21 . ARG B 2 244 ? 176.117 233.667 194.540 1.00 222.02 ? 265 ARG D HH21 1 
ATOM 4812  H HH22 . ARG B 2 244 ? 175.209 232.186 194.339 1.00 222.02 ? 265 ARG D HH22 1 
ATOM 4813  N N    . SER B 2 245 ? 174.810 233.397 200.134 1.00 192.76 ? 266 SER D N    1 
ATOM 4814  C CA   . SER B 2 245 ? 173.887 232.271 200.222 1.00 192.76 ? 266 SER D CA   1 
ATOM 4815  C C    . SER B 2 245 ? 173.486 231.989 201.665 1.00 192.76 ? 266 SER D C    1 
ATOM 4816  O O    . SER B 2 245 ? 172.308 231.741 201.952 1.00 192.76 ? 266 SER D O    1 
ATOM 4817  C CB   . SER B 2 245 ? 174.517 231.034 199.612 1.00 192.76 ? 266 SER D CB   1 
ATOM 4818  O OG   . SER B 2 245 ? 174.732 231.205 198.238 1.00 192.76 ? 266 SER D OG   1 
ATOM 4819  H H    . SER B 2 245 ? 175.607 233.186 199.888 1.00 231.31 ? 266 SER D H    1 
ATOM 4820  H HA   . SER B 2 245 ? 173.083 232.484 199.723 1.00 231.31 ? 266 SER D HA   1 
ATOM 4821  H HB2  . SER B 2 245 ? 175.464 230.827 200.109 1.00 231.31 ? 266 SER D HB2  1 
ATOM 4822  H HB3  . SER B 2 245 ? 173.866 230.176 199.777 1.00 231.31 ? 266 SER D HB3  1 
ATOM 4823  H HG   . SER B 2 245 ? 175.534 231.728 198.159 1.00 231.31 ? 266 SER D HG   1 
ATOM 4824  N N    . ARG B 2 246 ? 174.448 232.003 202.592 1.00 180.58 ? 267 ARG D N    1 
ATOM 4825  C CA   . ARG B 2 246 ? 174.068 231.832 203.995 1.00 180.58 ? 267 ARG D CA   1 
ATOM 4826  C C    . ARG B 2 246 ? 173.255 233.023 204.486 1.00 180.58 ? 267 ARG D C    1 
ATOM 4827  O O    . ARG B 2 246 ? 172.393 232.874 205.359 1.00 180.58 ? 267 ARG D O    1 
ATOM 4828  C CB   . ARG B 2 246 ? 175.301 231.668 204.871 1.00 180.58 ? 267 ARG D CB   1 
ATOM 4829  C CG   . ARG B 2 246 ? 176.040 230.350 204.695 1.00 180.58 ? 267 ARG D CG   1 
ATOM 4830  C CD   . ARG B 2 246 ? 177.103 230.176 205.717 1.00 180.58 ? 267 ARG D CD   1 
ATOM 4831  N NE   . ARG B 2 246 ? 177.865 228.956 205.504 1.00 180.58 ? 267 ARG D NE   1 
ATOM 4832  C CZ   . ARG B 2 246 ? 178.735 228.432 206.390 1.00 180.58 ? 267 ARG D CZ   1 
ATOM 4833  N NH1  . ARG B 2 246 ? 178.940 229.032 207.542 1.00 180.58 ? 267 ARG D NH1  1 
ATOM 4834  N NH2  . ARG B 2 246 ? 179.380 227.316 206.102 1.00 180.58 ? 267 ARG D NH2  1 
ATOM 4835  H H    . ARG B 2 246 ? 175.288 232.110 202.446 1.00 216.70 ? 267 ARG D H    1 
ATOM 4836  H HA   . ARG B 2 246 ? 173.511 231.042 204.075 1.00 216.70 ? 267 ARG D HA   1 
ATOM 4837  H HB2  . ARG B 2 246 ? 176.006 232.471 204.662 1.00 216.70 ? 267 ARG D HB2  1 
ATOM 4838  H HB3  . ARG B 2 246 ? 175.016 231.748 205.920 1.00 216.70 ? 267 ARG D HB3  1 
ATOM 4839  H HG2  . ARG B 2 246 ? 175.335 229.523 204.788 1.00 216.70 ? 267 ARG D HG2  1 
ATOM 4840  H HG3  . ARG B 2 246 ? 176.504 230.322 203.709 1.00 216.70 ? 267 ARG D HG3  1 
ATOM 4841  H HD2  . ARG B 2 246 ? 177.791 231.019 205.674 1.00 216.70 ? 267 ARG D HD2  1 
ATOM 4842  H HD3  . ARG B 2 246 ? 176.651 230.126 206.707 1.00 216.70 ? 267 ARG D HD3  1 
ATOM 4843  H HE   . ARG B 2 246 ? 177.734 228.466 204.629 1.00 216.70 ? 267 ARG D HE   1 
ATOM 4844  H HH11 . ARG B 2 246 ? 178.446 229.885 207.763 1.00 216.70 ? 267 ARG D HH11 1 
ATOM 4845  H HH12 . ARG B 2 246 ? 179.592 228.639 208.206 1.00 216.70 ? 267 ARG D HH12 1 
ATOM 4846  H HH21 . ARG B 2 246 ? 179.222 226.855 205.216 1.00 216.70 ? 267 ARG D HH21 1 
ATOM 4847  H HH22 . ARG B 2 246 ? 180.032 226.924 206.766 1.00 216.70 ? 267 ARG D HH22 1 
ATOM 4848  N N    . LEU B 2 247 ? 173.500 234.217 203.935 1.00 163.01 ? 268 LEU D N    1 
ATOM 4849  C CA   . LEU B 2 247 ? 172.591 235.328 204.195 1.00 163.01 ? 268 LEU D CA   1 
ATOM 4850  C C    . LEU B 2 247 ? 171.189 235.000 203.698 1.00 163.01 ? 268 LEU D C    1 
ATOM 4851  O O    . LEU B 2 247 ? 170.194 235.256 204.387 1.00 163.01 ? 268 LEU D O    1 
ATOM 4852  C CB   . LEU B 2 247 ? 173.099 236.605 203.515 1.00 163.01 ? 268 LEU D CB   1 
ATOM 4853  C CG   . LEU B 2 247 ? 172.359 237.897 203.888 1.00 163.01 ? 268 LEU D CG   1 
ATOM 4854  C CD1  . LEU B 2 247 ? 173.325 239.072 203.822 1.00 163.01 ? 268 LEU D CD1  1 
ATOM 4855  C CD2  . LEU B 2 247 ? 171.185 238.100 202.943 1.00 163.01 ? 268 LEU D CD2  1 
ATOM 4856  H H    . LEU B 2 247 ? 174.171 234.403 203.430 1.00 195.61 ? 268 LEU D H    1 
ATOM 4857  H HA   . LEU B 2 247 ? 172.545 235.483 205.151 1.00 195.61 ? 268 LEU D HA   1 
ATOM 4858  H HB2  . LEU B 2 247 ? 174.149 236.740 203.769 1.00 195.61 ? 268 LEU D HB2  1 
ATOM 4859  H HB3  . LEU B 2 247 ? 173.021 236.479 202.435 1.00 195.61 ? 268 LEU D HB3  1 
ATOM 4860  H HG   . LEU B 2 247 ? 171.993 237.823 204.912 1.00 195.61 ? 268 LEU D HG   1 
ATOM 4861  H HD11 . LEU B 2 247 ? 172.799 239.990 204.087 1.00 195.61 ? 268 LEU D HD11 1 
ATOM 4862  H HD12 . LEU B 2 247 ? 174.144 238.910 204.522 1.00 195.61 ? 268 LEU D HD12 1 
ATOM 4863  H HD13 . LEU B 2 247 ? 173.722 239.161 202.812 1.00 195.61 ? 268 LEU D HD13 1 
ATOM 4864  H HD21 . LEU B 2 247 ? 170.658 239.018 203.208 1.00 195.61 ? 268 LEU D HD21 1 
ATOM 4865  H HD22 . LEU B 2 247 ? 171.550 238.175 201.918 1.00 195.61 ? 268 LEU D HD22 1 
ATOM 4866  H HD23 . LEU B 2 247 ? 170.502 237.254 203.023 1.00 195.61 ? 268 LEU D HD23 1 
ATOM 4867  N N    . ALA B 2 248 ? 171.096 234.457 202.483 1.00 174.24 ? 269 ALA D N    1 
ATOM 4868  C CA   . ALA B 2 248 ? 169.822 233.973 201.975 1.00 174.24 ? 269 ALA D CA   1 
ATOM 4869  C C    . ALA B 2 248 ? 169.235 232.932 202.915 1.00 174.24 ? 269 ALA D C    1 
ATOM 4870  O O    . ALA B 2 248 ? 168.035 232.958 203.205 1.00 174.24 ? 269 ALA D O    1 
ATOM 4871  C CB   . ALA B 2 248 ? 170.014 233.403 200.570 1.00 174.24 ? 269 ALA D CB   1 
ATOM 4872  H H    . ALA B 2 248 ? 171.757 234.362 201.941 1.00 209.09 ? 269 ALA D H    1 
ATOM 4873  H HA   . ALA B 2 248 ? 169.200 234.711 201.921 1.00 209.09 ? 269 ALA D HA   1 
ATOM 4874  H HB1  . ALA B 2 248 ? 169.176 233.453 200.088 1.00 209.09 ? 269 ALA D HB1  1 
ATOM 4875  H HB2  . ALA B 2 248 ? 170.685 233.934 200.113 1.00 209.09 ? 269 ALA D HB2  1 
ATOM 4876  H HB3  . ALA B 2 248 ? 170.320 232.485 200.638 1.00 209.09 ? 269 ALA D HB3  1 
ATOM 4877  N N    . ASP B 2 249 ? 170.074 232.023 203.418 1.00 186.76 ? 270 ASP D N    1 
ATOM 4878  C CA   . ASP B 2 249 ? 169.614 231.058 204.417 1.00 186.76 ? 270 ASP D CA   1 
ATOM 4879  C C    . ASP B 2 249 ? 169.064 231.765 205.649 1.00 186.76 ? 270 ASP D C    1 
ATOM 4880  O O    . ASP B 2 249 ? 168.061 231.320 206.234 1.00 186.76 ? 270 ASP D O    1 
ATOM 4881  C CB   . ASP B 2 249 ? 170.753 230.121 204.826 1.00 186.76 ? 270 ASP D CB   1 
ATOM 4882  C CG   . ASP B 2 249 ? 171.241 229.245 203.680 1.00 186.76 ? 270 ASP D CG   1 
ATOM 4883  O OD1  . ASP B 2 249 ? 170.589 229.215 202.663 1.00 186.76 ? 270 ASP D OD1  1 
ATOM 4884  O OD2  . ASP B 2 249 ? 172.260 228.616 203.833 1.00 186.76 ? 270 ASP D OD2  1 
ATOM 4885  H H    . ASP B 2 249 ? 170.904 231.944 203.201 1.00 224.11 ? 270 ASP D H    1 
ATOM 4886  H HA   . ASP B 2 249 ? 168.902 230.522 204.036 1.00 224.11 ? 270 ASP D HA   1 
ATOM 4887  H HB2  . ASP B 2 249 ? 171.592 230.709 205.198 1.00 224.11 ? 270 ASP D HB2  1 
ATOM 4888  H HB3  . ASP B 2 249 ? 170.419 229.477 205.640 1.00 224.11 ? 270 ASP D HB3  1 
ATOM 4889  N N    . PHE B 2 250 ? 169.710 232.863 206.057 1.00 160.52 ? 271 PHE D N    1 
ATOM 4890  C CA   . PHE B 2 250 ? 169.277 233.586 207.248 1.00 160.52 ? 271 PHE D CA   1 
ATOM 4891  C C    . PHE B 2 250 ? 167.835 234.032 207.104 1.00 160.52 ? 271 PHE D C    1 
ATOM 4892  O O    . PHE B 2 250 ? 166.961 233.522 207.799 1.00 160.52 ? 271 PHE D O    1 
ATOM 4893  C CB   . PHE B 2 250 ? 170.171 234.802 207.498 1.00 160.52 ? 271 PHE D CB   1 
ATOM 4894  C CG   . PHE B 2 250 ? 169.615 235.765 208.508 1.00 160.52 ? 271 PHE D CG   1 
ATOM 4895  C CD1  . PHE B 2 250 ? 169.631 235.460 209.861 1.00 160.52 ? 271 PHE D CD1  1 
ATOM 4896  C CD2  . PHE B 2 250 ? 169.073 236.977 208.107 1.00 160.52 ? 271 PHE D CD2  1 
ATOM 4897  C CE1  . PHE B 2 250 ? 169.119 236.346 210.791 1.00 160.52 ? 271 PHE D CE1  1 
ATOM 4898  C CE2  . PHE B 2 250 ? 168.562 237.865 209.035 1.00 160.52 ? 271 PHE D CE2  1 
ATOM 4899  C CZ   . PHE B 2 250 ? 168.585 237.548 210.378 1.00 160.52 ? 271 PHE D CZ   1 
ATOM 4900  H H    . PHE B 2 250 ? 170.394 233.204 205.664 1.00 192.62 ? 271 PHE D H    1 
ATOM 4901  H HA   . PHE B 2 250 ? 169.317 233.008 208.020 1.00 192.62 ? 271 PHE D HA   1 
ATOM 4902  H HB2  . PHE B 2 250 ? 171.147 234.469 207.848 1.00 192.62 ? 271 PHE D HB2  1 
ATOM 4903  H HB3  . PHE B 2 250 ? 170.324 235.340 206.564 1.00 192.62 ? 271 PHE D HB3  1 
ATOM 4904  H HD1  . PHE B 2 250 ? 170.054 234.510 210.188 1.00 192.62 ? 271 PHE D HD1  1 
ATOM 4905  H HD2  . PHE B 2 250 ? 169.055 237.227 207.046 1.00 192.62 ? 271 PHE D HD2  1 
ATOM 4906  H HE1  . PHE B 2 250 ? 169.138 236.093 211.851 1.00 192.62 ? 271 PHE D HE1  1 
ATOM 4907  H HE2  . PHE B 2 250 ? 168.141 238.814 208.706 1.00 192.62 ? 271 PHE D HE2  1 
ATOM 4908  H HZ   . PHE B 2 250 ? 168.181 238.246 211.110 1.00 192.62 ? 271 PHE D HZ   1 
ATOM 4909  N N    . HIS B 2 251 ? 167.543 234.912 206.144 1.00 161.71 ? 272 HIS D N    1 
ATOM 4910  C CA   . HIS B 2 251 ? 166.165 235.395 206.048 1.00 161.71 ? 272 HIS D CA   1 
ATOM 4911  C C    . HIS B 2 251 ? 165.219 234.349 205.461 1.00 161.71 ? 272 HIS D C    1 
ATOM 4912  O O    . HIS B 2 251 ? 163.997 234.508 205.561 1.00 161.71 ? 272 HIS D O    1 
ATOM 4913  C CB   . HIS B 2 251 ? 166.104 236.669 205.199 1.00 161.71 ? 272 HIS D CB   1 
ATOM 4914  C CG   . HIS B 2 251 ? 166.500 236.458 203.770 1.00 161.71 ? 272 HIS D CG   1 
ATOM 4915  N ND1  . HIS B 2 251 ? 165.706 235.776 202.872 1.00 161.71 ? 272 HIS D ND1  1 
ATOM 4916  C CD2  . HIS B 2 251 ? 167.604 236.838 203.085 1.00 161.71 ? 272 HIS D CD2  1 
ATOM 4917  C CE1  . HIS B 2 251 ? 166.306 235.746 201.694 1.00 161.71 ? 272 HIS D CE1  1 
ATOM 4918  N NE2  . HIS B 2 251 ? 167.458 236.383 201.797 1.00 161.71 ? 272 HIS D NE2  1 
ATOM 4919  H H    . HIS B 2 251 ? 168.094 235.230 205.566 1.00 194.05 ? 272 HIS D H    1 
ATOM 4920  H HA   . HIS B 2 251 ? 165.851 235.588 206.946 1.00 194.05 ? 272 HIS D HA   1 
ATOM 4921  H HB2  . HIS B 2 251 ? 165.090 237.070 205.216 1.00 194.05 ? 272 HIS D HB2  1 
ATOM 4922  H HB3  . HIS B 2 251 ? 166.763 237.424 205.627 1.00 194.05 ? 272 HIS D HB3  1 
ATOM 4923  H HD2  . HIS B 2 251 ? 168.450 237.399 203.481 1.00 194.05 ? 272 HIS D HD2  1 
ATOM 4924  H HE1  . HIS B 2 251 ? 165.916 235.276 200.792 1.00 194.05 ? 272 HIS D HE1  1 
ATOM 4925  H HE2  . HIS B 2 251 ? 168.128 236.517 201.054 1.00 194.05 ? 272 HIS D HE2  1 
ATOM 4926  N N    . ALA B 2 252 ? 165.753 233.284 204.849 1.00 154.59 ? 273 ALA D N    1 
ATOM 4927  C CA   . ALA B 2 252 ? 164.929 232.142 204.481 1.00 154.59 ? 273 ALA D CA   1 
ATOM 4928  C C    . ALA B 2 252 ? 164.262 231.524 205.703 1.00 154.59 ? 273 ALA D C    1 
ATOM 4929  O O    . ALA B 2 252 ? 163.109 231.086 205.619 1.00 154.59 ? 273 ALA D O    1 
ATOM 4930  C CB   . ALA B 2 252 ? 165.781 231.097 203.760 1.00 154.59 ? 273 ALA D CB   1 
ATOM 4931  H H    . ALA B 2 252 ? 166.580 233.202 204.628 1.00 185.51 ? 273 ALA D H    1 
ATOM 4932  H HA   . ALA B 2 252 ? 164.233 232.425 203.869 1.00 185.51 ? 273 ALA D HA   1 
ATOM 4933  H HB1  . ALA B 2 252 ? 165.229 230.325 203.555 1.00 185.51 ? 273 ALA D HB1  1 
ATOM 4934  H HB2  . ALA B 2 252 ? 166.133 231.481 202.942 1.00 185.51 ? 273 ALA D HB2  1 
ATOM 4935  H HB3  . ALA B 2 252 ? 166.512 230.832 204.341 1.00 185.51 ? 273 ALA D HB3  1 
ATOM 4936  N N    . ASN B 2 253 ? 164.963 231.488 206.848 1.00 169.79 ? 274 ASN D N    1 
ATOM 4937  C CA   . ASN B 2 253 ? 164.375 230.987 208.090 1.00 169.79 ? 274 ASN D CA   1 
ATOM 4938  C C    . ASN B 2 253 ? 164.155 232.036 209.179 1.00 169.79 ? 274 ASN D C    1 
ATOM 4939  O O    . ASN B 2 253 ? 163.436 231.745 210.141 1.00 169.79 ? 274 ASN D O    1 
ATOM 4940  C CB   . ASN B 2 253 ? 165.234 229.861 208.636 1.00 169.79 ? 274 ASN D CB   1 
ATOM 4941  C CG   . ASN B 2 253 ? 165.228 228.648 207.748 1.00 169.79 ? 274 ASN D CG   1 
ATOM 4942  O OD1  . ASN B 2 253 ? 164.163 228.142 207.375 1.00 169.79 ? 274 ASN D OD1  1 
ATOM 4943  N ND2  . ASN B 2 253 ? 166.396 228.171 207.403 1.00 169.79 ? 274 ASN D ND2  1 
ATOM 4944  H H    . ASN B 2 253 ? 165.779 231.749 206.927 1.00 203.75 ? 274 ASN D H    1 
ATOM 4945  H HA   . ASN B 2 253 ? 163.515 230.596 207.896 1.00 203.75 ? 274 ASN D HA   1 
ATOM 4946  H HB2  . ASN B 2 253 ? 166.262 230.209 208.748 1.00 203.75 ? 274 ASN D HB2  1 
ATOM 4947  H HB3  . ASN B 2 253 ? 164.875 229.576 209.624 1.00 203.75 ? 274 ASN D HB3  1 
ATOM 4948  H HD21 . ASN B 2 253 ? 166.453 227.364 206.813 1.00 203.75 ? 274 ASN D HD21 1 
ATOM 4949  H HD22 . ASN B 2 253 ? 167.232 228.612 207.728 1.00 203.75 ? 274 ASN D HD22 1 
ATOM 4950  N N    . CYS B 2 254 ? 164.707 233.243 209.041 1.00 170.12 ? 275 CYS D N    1 
ATOM 4951  C CA   . CYS B 2 254 ? 164.659 234.273 210.072 1.00 170.12 ? 275 CYS D CA   1 
ATOM 4952  C C    . CYS B 2 254 ? 163.889 235.520 209.671 1.00 170.12 ? 275 CYS D C    1 
ATOM 4953  O O    . CYS B 2 254 ? 163.828 236.460 210.472 1.00 170.12 ? 275 CYS D O    1 
ATOM 4954  C CB   . CYS B 2 254 ? 166.083 234.706 210.464 1.00 170.12 ? 275 CYS D CB   1 
ATOM 4955  S SG   . CYS B 2 254 ? 167.082 233.428 211.215 1.00 170.12 ? 275 CYS D SG   1 
ATOM 4956  H H    . CYS B 2 254 ? 165.127 233.495 208.335 1.00 204.14 ? 275 CYS D H    1 
ATOM 4957  H HA   . CYS B 2 254 ? 164.233 233.920 210.866 1.00 204.14 ? 275 CYS D HA   1 
ATOM 4958  H HB2  . CYS B 2 254 ? 166.545 235.009 209.667 1.00 204.14 ? 275 CYS D HB2  1 
ATOM 4959  H HB3  . CYS B 2 254 ? 166.028 235.433 211.103 1.00 204.14 ? 275 CYS D HB3  1 
ATOM 4960  N N    . ARG B 2 255 ? 163.335 235.576 208.461 1.00 168.51 ? 276 ARG D N    1 
ATOM 4961  C CA   . ARG B 2 255 ? 162.538 236.724 208.054 1.00 168.51 ? 276 ARG D CA   1 
ATOM 4962  C C    . ARG B 2 255 ? 161.396 236.935 209.036 1.00 168.51 ? 276 ARG D C    1 
ATOM 4963  O O    . ARG B 2 255 ? 160.735 235.978 209.450 1.00 168.51 ? 276 ARG D O    1 
ATOM 4964  C CB   . ARG B 2 255 ? 161.981 236.530 206.652 1.00 168.51 ? 276 ARG D CB   1 
ATOM 4965  C CG   . ARG B 2 255 ? 161.160 237.696 206.122 1.00 168.51 ? 276 ARG D CG   1 
ATOM 4966  C CD   . ARG B 2 255 ? 160.667 237.439 204.745 1.00 168.51 ? 276 ARG D CD   1 
ATOM 4967  N NE   . ARG B 2 255 ? 159.774 236.293 204.694 1.00 168.51 ? 276 ARG D NE   1 
ATOM 4968  C CZ   . ARG B 2 255 ? 158.462 236.330 205.000 1.00 168.51 ? 276 ARG D CZ   1 
ATOM 4969  N NH1  . ARG B 2 255 ? 157.907 237.461 205.376 1.00 168.51 ? 276 ARG D NH1  1 
ATOM 4970  N NH2  . ARG B 2 255 ? 157.734 235.230 204.921 1.00 168.51 ? 276 ARG D NH2  1 
ATOM 4971  H H    . ARG B 2 255 ? 163.406 234.967 207.858 1.00 202.21 ? 276 ARG D H    1 
ATOM 4972  H HA   . ARG B 2 255 ? 163.095 237.520 208.055 1.00 202.21 ? 276 ARG D HA   1 
ATOM 4973  H HB2  . ARG B 2 255 ? 162.800 236.360 205.955 1.00 202.21 ? 276 ARG D HB2  1 
ATOM 4974  H HB3  . ARG B 2 255 ? 161.346 235.644 206.632 1.00 202.21 ? 276 ARG D HB3  1 
ATOM 4975  H HG2  . ARG B 2 255 ? 160.299 237.859 206.771 1.00 202.21 ? 276 ARG D HG2  1 
ATOM 4976  H HG3  . ARG B 2 255 ? 161.776 238.596 206.104 1.00 202.21 ? 276 ARG D HG3  1 
ATOM 4977  H HD2  . ARG B 2 255 ? 160.122 238.312 204.386 1.00 202.21 ? 276 ARG D HD2  1 
ATOM 4978  H HD3  . ARG B 2 255 ? 161.512 237.243 204.086 1.00 202.21 ? 276 ARG D HD3  1 
ATOM 4979  H HE   . ARG B 2 255 ? 160.165 235.405 204.408 1.00 202.21 ? 276 ARG D HE   1 
ATOM 4980  H HH11 . ARG B 2 255 ? 158.464 238.301 205.436 1.00 202.21 ? 276 ARG D HH11 1 
ATOM 4981  H HH12 . ARG B 2 255 ? 156.924 237.488 205.606 1.00 202.21 ? 276 ARG D HH12 1 
ATOM 4982  H HH21 . ARG B 2 255 ? 158.161 234.361 204.632 1.00 202.21 ? 276 ARG D HH21 1 
ATOM 4983  H HH22 . ARG B 2 255 ? 156.752 235.258 205.151 1.00 202.21 ? 276 ARG D HH22 1 
ATOM 4984  N N    . ALA B 2 256 ? 161.164 238.190 209.413 1.00 180.36 ? 277 ALA D N    1 
ATOM 4985  C CA   . ALA B 2 256 ? 160.136 238.467 210.404 1.00 180.36 ? 277 ALA D CA   1 
ATOM 4986  C C    . ALA B 2 256 ? 158.775 238.228 209.771 1.00 180.36 ? 277 ALA D C    1 
ATOM 4987  O O    . ALA B 2 256 ? 158.090 239.172 209.364 1.00 180.36 ? 277 ALA D O    1 
ATOM 4988  C CB   . ALA B 2 256 ? 160.255 239.897 210.930 1.00 180.36 ? 277 ALA D CB   1 
ATOM 4989  H H    . ALA B 2 256 ? 161.580 238.882 209.118 1.00 216.43 ? 277 ALA D H    1 
ATOM 4990  H HA   . ALA B 2 256 ? 160.238 237.856 211.151 1.00 216.43 ? 277 ALA D HA   1 
ATOM 4991  H HB1  . ALA B 2 256 ? 159.548 240.056 211.573 1.00 216.43 ? 277 ALA D HB1  1 
ATOM 4992  H HB2  . ALA B 2 256 ? 161.120 240.005 211.357 1.00 216.43 ? 277 ALA D HB2  1 
ATOM 4993  H HB3  . ALA B 2 256 ? 160.173 240.515 210.186 1.00 216.43 ? 277 ALA D HB3  1 
ATOM 4994  N N    . SER B 2 257 ? 158.381 236.961 209.689 1.00 186.33 ? 278 SER D N    1 
ATOM 4995  C CA   . SER B 2 257 ? 157.126 236.567 209.074 1.00 186.33 ? 278 SER D CA   1 
ATOM 4996  C C    . SER B 2 257 ? 155.965 236.857 210.014 1.00 186.33 ? 278 SER D C    1 
ATOM 4997  O O    . SER B 2 257 ? 156.120 236.874 211.239 1.00 186.33 ? 278 SER D O    1 
ATOM 4998  C CB   . SER B 2 257 ? 157.153 235.094 208.717 1.00 186.33 ? 278 SER D CB   1 
ATOM 4999  O OG   . SER B 2 257 ? 155.895 234.660 208.278 1.00 186.33 ? 278 SER D OG   1 
ATOM 5000  H H    . SER B 2 257 ? 158.840 236.299 209.989 1.00 223.60 ? 278 SER D H    1 
ATOM 5001  H HA   . SER B 2 257 ? 156.993 237.076 208.259 1.00 223.60 ? 278 SER D HA   1 
ATOM 5002  H HB2  . SER B 2 257 ? 157.893 234.923 207.936 1.00 223.60 ? 278 SER D HB2  1 
ATOM 5003  H HB3  . SER B 2 257 ? 157.457 234.514 209.588 1.00 223.60 ? 278 SER D HB3  1 
ATOM 5004  H HG   . SER B 2 257 ? 156.008 233.744 208.015 1.00 223.60 ? 278 SER D HG   1 
ATOM 5005  N N    . TYR B 2 258 ? 154.794 237.087 209.416 1.00 193.14 ? 279 TYR D N    1 
ATOM 5006  C CA   . TYR B 2 258 ? 153.568 237.367 210.146 1.00 193.14 ? 279 TYR D CA   1 
ATOM 5007  C C    . TYR B 2 258 ? 152.556 236.234 210.078 1.00 193.14 ? 279 TYR D C    1 
ATOM 5008  O O    . TYR B 2 258 ? 151.693 236.147 210.958 1.00 193.14 ? 279 TYR D O    1 
ATOM 5009  C CB   . TYR B 2 258 ? 152.934 238.658 209.622 1.00 193.14 ? 279 TYR D CB   1 
ATOM 5010  C CG   . TYR B 2 258 ? 153.771 239.893 209.871 1.00 193.14 ? 279 TYR D CG   1 
ATOM 5011  C CD1  . TYR B 2 258 ? 153.650 240.583 211.068 1.00 193.14 ? 279 TYR D CD1  1 
ATOM 5012  C CD2  . TYR B 2 258 ? 154.659 240.336 208.902 1.00 193.14 ? 279 TYR D CD2  1 
ATOM 5013  C CE1  . TYR B 2 258 ? 154.415 241.711 211.296 1.00 193.14 ? 279 TYR D CE1  1 
ATOM 5014  C CE2  . TYR B 2 258 ? 155.424 241.463 209.130 1.00 193.14 ? 279 TYR D CE2  1 
ATOM 5015  C CZ   . TYR B 2 258 ? 155.304 242.151 210.321 1.00 193.14 ? 279 TYR D CZ   1 
ATOM 5016  O OH   . TYR B 2 258 ? 156.065 243.274 210.548 1.00 193.14 ? 279 TYR D OH   1 
ATOM 5017  H H    . TYR B 2 258 ? 154.691 237.082 208.563 1.00 231.77 ? 279 TYR D H    1 
ATOM 5018  H HA   . TYR B 2 258 ? 153.767 237.520 211.081 1.00 231.77 ? 279 TYR D HA   1 
ATOM 5019  H HB2  . TYR B 2 258 ? 151.963 238.804 210.095 1.00 231.77 ? 279 TYR D HB2  1 
ATOM 5020  H HB3  . TYR B 2 258 ? 152.055 238.901 210.220 1.00 231.77 ? 279 TYR D HB3  1 
ATOM 5021  H HD1  . TYR B 2 258 ? 152.952 240.235 211.829 1.00 231.77 ? 279 TYR D HD1  1 
ATOM 5022  H HD2  . TYR B 2 258 ? 154.753 239.795 207.961 1.00 231.77 ? 279 TYR D HD2  1 
ATOM 5023  H HE1  . TYR B 2 258 ? 154.320 242.253 212.236 1.00 231.77 ? 279 TYR D HE1  1 
ATOM 5024  H HE2  . TYR B 2 258 ? 156.121 241.813 208.368 1.00 231.77 ? 279 TYR D HE2  1 
ATOM 5025  H HH   . TYR B 2 258 ? 155.866 243.623 211.419 1.00 231.77 ? 279 TYR D HH   1 
ATOM 5026  N N    . GLN B 2 259 ? 152.638 235.372 209.061 1.00 185.81 ? 280 GLN D N    1 
ATOM 5027  C CA   . GLN B 2 259 ? 151.662 234.300 208.904 1.00 185.81 ? 280 GLN D CA   1 
ATOM 5028  C C    . GLN B 2 259 ? 151.798 233.250 209.997 1.00 185.81 ? 280 GLN D C    1 
ATOM 5029  O O    . GLN B 2 259 ? 150.794 232.671 210.427 1.00 185.81 ? 280 GLN D O    1 
ATOM 5030  C CB   . GLN B 2 259 ? 151.812 233.639 207.530 1.00 185.81 ? 280 GLN D CB   1 
ATOM 5031  C CG   . GLN B 2 259 ? 151.415 234.529 206.365 1.00 185.81 ? 280 GLN D CG   1 
ATOM 5032  C CD   . GLN B 2 259 ? 151.601 233.845 205.024 1.00 185.81 ? 280 GLN D CD   1 
ATOM 5033  O OE1  . GLN B 2 259 ? 152.457 232.970 204.872 1.00 185.81 ? 280 GLN D OE1  1 
ATOM 5034  N NE2  . GLN B 2 259 ? 150.798 234.241 204.043 1.00 185.81 ? 280 GLN D NE2  1 
ATOM 5035  H H    . GLN B 2 259 ? 153.247 235.390 208.453 1.00 222.97 ? 280 GLN D H    1 
ATOM 5036  H HA   . GLN B 2 259 ? 150.769 234.675 208.956 1.00 222.97 ? 280 GLN D HA   1 
ATOM 5037  H HB2  . GLN B 2 259 ? 152.849 233.336 207.384 1.00 222.97 ? 280 GLN D HB2  1 
ATOM 5038  H HB3  . GLN B 2 259 ? 151.199 232.739 207.490 1.00 222.97 ? 280 GLN D HB3  1 
ATOM 5039  H HG2  . GLN B 2 259 ? 150.363 234.798 206.469 1.00 222.97 ? 280 GLN D HG2  1 
ATOM 5040  H HG3  . GLN B 2 259 ? 152.033 235.427 206.380 1.00 222.97 ? 280 GLN D HG3  1 
ATOM 5041  H HE21 . GLN B 2 259 ? 150.875 233.825 203.135 1.00 222.97 ? 280 GLN D HE21 1 
ATOM 5042  H HE22 . GLN B 2 259 ? 150.118 234.954 204.209 1.00 222.97 ? 280 GLN D HE22 1 
ATOM 5043  N N    . THR B 2 260 ? 153.018 232.994 210.455 1.00 183.00 ? 281 THR D N    1 
ATOM 5044  C CA   . THR B 2 260 ? 153.268 232.020 211.504 1.00 183.00 ? 281 THR D CA   1 
ATOM 5045  C C    . THR B 2 260 ? 153.176 232.679 212.877 1.00 183.00 ? 281 THR D C    1 
ATOM 5046  O O    . THR B 2 260 ? 153.080 233.901 213.010 1.00 183.00 ? 281 THR D O    1 
ATOM 5047  C CB   . THR B 2 260 ? 154.648 231.359 211.332 1.00 183.00 ? 281 THR D CB   1 
ATOM 5048  O OG1  . THR B 2 260 ? 155.676 232.348 211.477 1.00 183.00 ? 281 THR D OG1  1 
ATOM 5049  C CG2  . THR B 2 260 ? 154.763 230.713 209.960 1.00 183.00 ? 281 THR D CG2  1 
ATOM 5050  H H    . THR B 2 260 ? 153.729 233.383 210.168 1.00 219.60 ? 281 THR D H    1 
ATOM 5051  H HA   . THR B 2 260 ? 152.599 231.320 211.459 1.00 219.60 ? 281 THR D HA   1 
ATOM 5052  H HB   . THR B 2 260 ? 154.785 230.597 212.099 1.00 219.60 ? 281 THR D HB   1 
ATOM 5053  H HG1  . THR B 2 260 ? 156.411 231.975 211.971 1.00 219.60 ? 281 THR D HG1  1 
ATOM 5054  H HG21 . THR B 2 260 ? 155.744 230.250 209.856 1.00 219.60 ? 281 THR D HG21 1 
ATOM 5055  H HG22 . THR B 2 260 ? 153.989 229.953 209.850 1.00 219.60 ? 281 THR D HG22 1 
ATOM 5056  H HG23 . THR B 2 260 ? 154.636 231.472 209.189 1.00 219.60 ? 281 THR D HG23 1 
ATOM 5057  N N    . VAL B 2 261 ? 153.199 231.838 213.913 1.00 175.26 ? 282 VAL D N    1 
ATOM 5058  C CA   . VAL B 2 261 ? 153.026 232.319 215.280 1.00 175.26 ? 282 VAL D CA   1 
ATOM 5059  C C    . VAL B 2 261 ? 154.295 233.000 215.774 1.00 175.26 ? 282 VAL D C    1 
ATOM 5060  O O    . VAL B 2 261 ? 154.241 234.078 216.375 1.00 175.26 ? 282 VAL D O    1 
ATOM 5061  C CB   . VAL B 2 261 ? 152.669 231.153 216.220 1.00 175.26 ? 282 VAL D CB   1 
ATOM 5062  C CG1  . VAL B 2 261 ? 152.630 231.627 217.665 1.00 175.26 ? 282 VAL D CG1  1 
ATOM 5063  C CG2  . VAL B 2 261 ? 151.333 230.550 215.814 1.00 175.26 ? 282 VAL D CG2  1 
ATOM 5064  H H    . VAL B 2 261 ? 153.316 230.989 213.848 1.00 210.31 ? 282 VAL D H    1 
ATOM 5065  H HA   . VAL B 2 261 ? 152.312 232.976 215.294 1.00 210.31 ? 282 VAL D HA   1 
ATOM 5066  H HB   . VAL B 2 261 ? 153.447 230.392 216.152 1.00 210.31 ? 282 VAL D HB   1 
ATOM 5067  H HG11 . VAL B 2 261 ? 152.377 230.790 218.316 1.00 210.31 ? 282 VAL D HG11 1 
ATOM 5068  H HG12 . VAL B 2 261 ? 153.607 232.021 217.945 1.00 210.31 ? 282 VAL D HG12 1 
ATOM 5069  H HG13 . VAL B 2 261 ? 151.879 232.408 217.772 1.00 210.31 ? 282 VAL D HG13 1 
ATOM 5070  H HG21 . VAL B 2 261 ? 151.087 229.726 216.483 1.00 210.31 ? 282 VAL D HG21 1 
ATOM 5071  H HG22 . VAL B 2 261 ? 150.556 231.312 215.877 1.00 210.31 ? 282 VAL D HG22 1 
ATOM 5072  H HG23 . VAL B 2 261 ? 151.397 230.180 214.791 1.00 210.31 ? 282 VAL D HG23 1 
ATOM 5073  N N    . THR B 2 262 ? 155.450 232.388 215.522 1.00 190.10 ? 283 THR D N    1 
ATOM 5074  C CA   . THR B 2 262 ? 156.729 232.859 216.036 1.00 190.10 ? 283 THR D CA   1 
ATOM 5075  C C    . THR B 2 262 ? 157.545 233.620 214.999 1.00 190.10 ? 283 THR D C    1 
ATOM 5076  O O    . THR B 2 262 ? 158.735 233.856 215.225 1.00 190.10 ? 283 THR D O    1 
ATOM 5077  C CB   . THR B 2 262 ? 157.563 231.680 216.571 1.00 190.10 ? 283 THR D CB   1 
ATOM 5078  O OG1  . THR B 2 262 ? 157.885 230.791 215.493 1.00 190.10 ? 283 THR D OG1  1 
ATOM 5079  C CG2  . THR B 2 262 ? 156.790 230.919 217.637 1.00 190.10 ? 283 THR D CG2  1 
ATOM 5080  H H    . THR B 2 262 ? 155.518 231.677 215.042 1.00 228.12 ? 283 THR D H    1 
ATOM 5081  H HA   . THR B 2 262 ? 156.576 233.454 216.786 1.00 228.12 ? 283 THR D HA   1 
ATOM 5082  H HB   . THR B 2 262 ? 158.490 232.057 217.002 1.00 228.12 ? 283 THR D HB   1 
ATOM 5083  H HG1  . THR B 2 262 ? 158.839 230.733 215.401 1.00 228.12 ? 283 THR D HG1  1 
ATOM 5084  H HG21 . THR B 2 262 ? 157.395 230.090 218.003 1.00 228.12 ? 283 THR D HG21 1 
ATOM 5085  H HG22 . THR B 2 262 ? 156.554 231.590 218.463 1.00 228.12 ? 283 THR D HG22 1 
ATOM 5086  H HG23 . THR B 2 262 ? 155.866 230.532 217.209 1.00 228.12 ? 283 THR D HG23 1 
ATOM 5087  N N    . SER B 2 263 ? 156.947 233.992 213.866 1.00 187.50 ? 284 SER D N    1 
ATOM 5088  C CA   . SER B 2 263 ? 157.625 234.618 212.732 1.00 187.50 ? 284 SER D CA   1 
ATOM 5089  C C    . SER B 2 263 ? 158.700 233.736 212.107 1.00 187.50 ? 284 SER D C    1 
ATOM 5090  O O    . SER B 2 263 ? 159.480 234.227 211.280 1.00 187.50 ? 284 SER D O    1 
ATOM 5091  C CB   . SER B 2 263 ? 158.248 235.928 213.174 1.00 187.50 ? 284 SER D CB   1 
ATOM 5092  O OG   . SER B 2 263 ? 157.269 236.820 213.633 1.00 187.50 ? 284 SER D OG   1 
ATOM 5093  H H    . SER B 2 263 ? 156.106 233.890 213.723 1.00 225.00 ? 284 SER D H    1 
ATOM 5094  H HA   . SER B 2 263 ? 156.964 234.792 212.045 1.00 225.00 ? 284 SER D HA   1 
ATOM 5095  H HB2  . SER B 2 263 ? 158.971 235.738 213.966 1.00 225.00 ? 284 SER D HB2  1 
ATOM 5096  H HB3  . SER B 2 263 ? 158.786 236.374 212.339 1.00 225.00 ? 284 SER D HB3  1 
ATOM 5097  H HG   . SER B 2 263 ? 156.670 236.959 212.896 1.00 225.00 ? 284 SER D HG   1 
ATOM 5098  N N    . CYS B 2 264 ? 158.758 232.444 212.459 1.00 193.75 ? 285 CYS D N    1 
ATOM 5099  C CA   . CYS B 2 264 ? 159.686 231.476 211.895 1.00 193.75 ? 285 CYS D CA   1 
ATOM 5100  C C    . CYS B 2 264 ? 158.924 230.519 210.978 1.00 193.75 ? 285 CYS D C    1 
ATOM 5101  O O    . CYS B 2 264 ? 157.753 230.232 211.243 1.00 193.75 ? 285 CYS D O    1 
ATOM 5102  C CB   . CYS B 2 264 ? 160.374 230.674 213.004 1.00 193.75 ? 285 CYS D CB   1 
ATOM 5103  S SG   . CYS B 2 264 ? 161.227 231.671 214.265 1.00 193.75 ? 285 CYS D SG   1 
ATOM 5104  H H    . CYS B 2 264 ? 158.242 232.088 213.045 1.00 232.50 ? 285 CYS D H    1 
ATOM 5105  H HA   . CYS B 2 264 ? 160.371 231.950 211.406 1.00 232.50 ? 285 CYS D HA   1 
ATOM 5106  H HB2  . CYS B 2 264 ? 159.703 230.142 213.459 1.00 232.50 ? 285 CYS D HB2  1 
ATOM 5107  H HB3  . CYS B 2 264 ? 161.033 230.088 212.600 1.00 232.50 ? 285 CYS D HB3  1 
ATOM 5108  N N    . PRO B 2 265 ? 159.517 230.007 209.897 1.00 184.62 ? 286 PRO D N    1 
ATOM 5109  C CA   . PRO B 2 265 ? 158.816 228.985 209.107 1.00 184.62 ? 286 PRO D CA   1 
ATOM 5110  C C    . PRO B 2 265 ? 158.368 227.808 209.961 1.00 184.62 ? 286 PRO D C    1 
ATOM 5111  O O    . PRO B 2 265 ? 159.130 227.275 210.770 1.00 184.62 ? 286 PRO D O    1 
ATOM 5112  C CB   . PRO B 2 265 ? 159.871 228.559 208.082 1.00 184.62 ? 286 PRO D CB   1 
ATOM 5113  C CG   . PRO B 2 265 ? 160.760 229.749 207.957 1.00 184.62 ? 286 PRO D CG   1 
ATOM 5114  C CD   . PRO B 2 265 ? 160.856 230.294 209.357 1.00 184.62 ? 286 PRO D CD   1 
ATOM 5115  H HA   . PRO B 2 265 ? 158.049 229.371 208.656 1.00 221.54 ? 286 PRO D HA   1 
ATOM 5116  H HB2  . PRO B 2 265 ? 160.403 227.665 208.439 1.00 221.54 ? 286 PRO D HB2  1 
ATOM 5117  H HB3  . PRO B 2 265 ? 159.386 228.287 207.133 1.00 221.54 ? 286 PRO D HB3  1 
ATOM 5118  H HG2  . PRO B 2 265 ? 161.738 229.452 207.550 1.00 221.54 ? 286 PRO D HG2  1 
ATOM 5119  H HG3  . PRO B 2 265 ? 160.328 230.472 207.250 1.00 221.54 ? 286 PRO D HG3  1 
ATOM 5120  H HD2  . PRO B 2 265 ? 161.649 229.762 209.904 1.00 221.54 ? 286 PRO D HD2  1 
ATOM 5121  H HD3  . PRO B 2 265 ? 161.068 231.372 209.318 1.00 221.54 ? 286 PRO D HD3  1 
ATOM 5122  N N    . ALA B 2 266 ? 157.106 227.411 209.776 1.00 196.42 ? 287 ALA D N    1 
ATOM 5123  C CA   . ALA B 2 266 ? 156.462 226.394 210.600 1.00 196.42 ? 287 ALA D CA   1 
ATOM 5124  C C    . ALA B 2 266 ? 156.799 226.562 212.079 1.00 196.42 ? 287 ALA D C    1 
ATOM 5125  O O    . ALA B 2 266 ? 156.946 225.569 212.799 1.00 196.42 ? 287 ALA D O    1 
ATOM 5126  C CB   . ALA B 2 266 ? 156.859 224.993 210.128 1.00 196.42 ? 287 ALA D CB   1 
ATOM 5127  H H    . ALA B 2 266 ? 156.594 227.727 209.162 1.00 235.70 ? 287 ALA D H    1 
ATOM 5128  H HA   . ALA B 2 266 ? 155.500 226.479 210.505 1.00 235.70 ? 287 ALA D HA   1 
ATOM 5129  H HB1  . ALA B 2 266 ? 156.339 224.337 210.618 1.00 235.70 ? 287 ALA D HB1  1 
ATOM 5130  H HB2  . ALA B 2 266 ? 156.675 224.918 209.179 1.00 235.70 ? 287 ALA D HB2  1 
ATOM 5131  H HB3  . ALA B 2 266 ? 157.804 224.850 210.291 1.00 235.70 ? 287 ALA D HB3  1 
ATOM 5132  N N    . ASP B 2 267 ? 156.910 227.812 212.540 1.00 190.36 ? 288 ASP D N    1 
ATOM 5133  C CA   . ASP B 2 267 ? 157.266 228.118 213.929 1.00 190.36 ? 288 ASP D CA   1 
ATOM 5134  C C    . ASP B 2 267 ? 158.516 227.356 214.368 1.00 190.36 ? 288 ASP D C    1 
ATOM 5135  O O    . ASP B 2 267 ? 158.641 226.952 215.527 1.00 190.36 ? 288 ASP D O    1 
ATOM 5136  C CB   . ASP B 2 267 ? 156.104 227.780 214.867 1.00 190.36 ? 288 ASP D CB   1 
ATOM 5137  C CG   . ASP B 2 267 ? 154.841 228.570 214.553 1.00 190.36 ? 288 ASP D CG   1 
ATOM 5138  O OD1  . ASP B 2 267 ? 154.949 229.742 214.280 1.00 190.36 ? 288 ASP D OD1  1 
ATOM 5139  O OD2  . ASP B 2 267 ? 153.780 227.994 214.590 1.00 190.36 ? 288 ASP D OD2  1 
ATOM 5140  H H    . ASP B 2 267 ? 156.780 228.515 212.064 1.00 228.43 ? 288 ASP D H    1 
ATOM 5141  H HA   . ASP B 2 267 ? 157.471 229.064 213.993 1.00 228.43 ? 288 ASP D HA   1 
ATOM 5142  H HB2  . ASP B 2 267 ? 155.877 226.716 214.796 1.00 228.43 ? 288 ASP D HB2  1 
ATOM 5143  H HB3  . ASP B 2 267 ? 156.397 227.984 215.897 1.00 228.43 ? 288 ASP D HB3  1 
ATOM 5144  N N    . ASN B 2 268 ? 159.453 227.161 213.441 1.00 192.17 ? 289 ASN D N    1 
ATOM 5145  C CA   . ASN B 2 268 ? 160.657 226.371 213.692 1.00 192.17 ? 289 ASN D CA   1 
ATOM 5146  C C    . ASN B 2 268 ? 161.733 227.296 214.247 1.00 192.17 ? 289 ASN D C    1 
ATOM 5147  O O    . ASN B 2 268 ? 162.293 228.122 213.520 1.00 192.17 ? 289 ASN D O    1 
ATOM 5148  C CB   . ASN B 2 268 ? 161.131 225.666 212.435 1.00 192.17 ? 289 ASN D CB   1 
ATOM 5149  C CG   . ASN B 2 268 ? 162.318 224.777 212.684 1.00 192.17 ? 289 ASN D CG   1 
ATOM 5150  O OD1  . ASN B 2 268 ? 163.093 225.003 213.619 1.00 192.17 ? 289 ASN D OD1  1 
ATOM 5151  N ND2  . ASN B 2 268 ? 162.474 223.769 211.864 1.00 192.17 ? 289 ASN D ND2  1 
ATOM 5152  H H    . ASN B 2 268 ? 159.415 227.481 212.644 1.00 230.60 ? 289 ASN D H    1 
ATOM 5153  H HA   . ASN B 2 268 ? 160.473 225.686 214.353 1.00 230.60 ? 289 ASN D HA   1 
ATOM 5154  H HB2  . ASN B 2 268 ? 160.319 225.063 212.027 1.00 230.60 ? 289 ASN D HB2  1 
ATOM 5155  H HB3  . ASN B 2 268 ? 161.399 226.407 211.682 1.00 230.60 ? 289 ASN D HB3  1 
ATOM 5156  H HD21 . ASN B 2 268 ? 163.246 223.144 211.981 1.00 230.60 ? 289 ASN D HD21 1 
ATOM 5157  H HD22 . ASN B 2 268 ? 161.822 223.624 211.120 1.00 230.60 ? 289 ASN D HD22 1 
ATOM 5158  N N    . TYR B 2 269 ? 162.022 227.157 215.542 1.00 185.69 ? 290 TYR D N    1 
ATOM 5159  C CA   . TYR B 2 269 ? 163.006 228.022 216.181 1.00 185.69 ? 290 TYR D CA   1 
ATOM 5160  C C    . TYR B 2 269 ? 164.402 227.763 215.632 1.00 185.69 ? 290 TYR D C    1 
ATOM 5161  O O    . TYR B 2 269 ? 165.110 228.701 215.246 1.00 185.69 ? 290 TYR D O    1 
ATOM 5162  C CB   . TYR B 2 269 ? 162.988 227.827 217.698 1.00 185.69 ? 290 TYR D CB   1 
ATOM 5163  C CG   . TYR B 2 269 ? 161.709 228.292 218.358 1.00 185.69 ? 290 TYR D CG   1 
ATOM 5164  C CD1  . TYR B 2 269 ? 161.260 229.589 218.164 1.00 185.69 ? 290 TYR D CD1  1 
ATOM 5165  C CD2  . TYR B 2 269 ? 160.985 227.420 219.159 1.00 185.69 ? 290 TYR D CD2  1 
ATOM 5166  C CE1  . TYR B 2 269 ? 160.092 230.014 218.767 1.00 185.69 ? 290 TYR D CE1  1 
ATOM 5167  C CE2  . TYR B 2 269 ? 159.817 227.845 219.761 1.00 185.69 ? 290 TYR D CE2  1 
ATOM 5168  C CZ   . TYR B 2 269 ? 159.372 229.147 219.563 1.00 185.69 ? 290 TYR D CZ   1 
ATOM 5169  O OH   . TYR B 2 269 ? 158.208 229.570 220.163 1.00 185.69 ? 290 TYR D OH   1 
ATOM 5170  H H    . TYR B 2 269 ? 161.665 226.574 216.064 1.00 222.83 ? 290 TYR D H    1 
ATOM 5171  H HA   . TYR B 2 269 ? 162.809 228.949 215.977 1.00 222.83 ? 290 TYR D HA   1 
ATOM 5172  H HB2  . TYR B 2 269 ? 163.127 226.770 217.931 1.00 222.83 ? 290 TYR D HB2  1 
ATOM 5173  H HB3  . TYR B 2 269 ? 163.819 228.372 218.145 1.00 222.83 ? 290 TYR D HB3  1 
ATOM 5174  H HD1  . TYR B 2 269 ? 161.829 230.274 217.534 1.00 222.83 ? 290 TYR D HD1  1 
ATOM 5175  H HD2  . TYR B 2 269 ? 161.338 226.400 219.312 1.00 222.83 ? 290 TYR D HD2  1 
ATOM 5176  H HE1  . TYR B 2 269 ? 159.739 231.034 218.613 1.00 222.83 ? 290 TYR D HE1  1 
ATOM 5177  H HE2  . TYR B 2 269 ? 159.248 227.160 220.390 1.00 222.83 ? 290 TYR D HE2  1 
ATOM 5178  H HH   . TYR B 2 269 ? 157.832 228.848 220.673 1.00 222.83 ? 290 TYR D HH   1 
ATOM 5179  N N    . GLN B 2 270 ? 164.802 226.487 215.575 1.00 198.64 ? 291 GLN D N    1 
ATOM 5180  C CA   . GLN B 2 270 ? 166.172 226.128 215.220 1.00 198.64 ? 291 GLN D CA   1 
ATOM 5181  C C    . GLN B 2 270 ? 166.494 226.432 213.763 1.00 198.64 ? 291 GLN D C    1 
ATOM 5182  O O    . GLN B 2 270 ? 167.627 226.809 213.458 1.00 198.64 ? 291 GLN D O    1 
ATOM 5183  C CB   . GLN B 2 270 ? 166.418 224.644 215.503 1.00 198.64 ? 291 GLN D CB   1 
ATOM 5184  C CG   . GLN B 2 270 ? 167.843 224.188 215.238 1.00 198.64 ? 291 GLN D CG   1 
ATOM 5185  C CD   . GLN B 2 270 ? 168.847 224.866 216.151 1.00 198.64 ? 291 GLN D CD   1 
ATOM 5186  O OE1  . GLN B 2 270 ? 169.537 225.807 215.749 1.00 198.64 ? 291 GLN D OE1  1 
ATOM 5187  N NE2  . GLN B 2 270 ? 168.935 224.391 217.388 1.00 198.64 ? 291 GLN D NE2  1 
ATOM 5188  H H    . GLN B 2 270 ? 164.295 225.812 215.739 1.00 238.37 ? 291 GLN D H    1 
ATOM 5189  H HA   . GLN B 2 270 ? 166.778 226.645 215.771 1.00 238.37 ? 291 GLN D HA   1 
ATOM 5190  H HB2  . GLN B 2 270 ? 166.184 224.429 216.546 1.00 238.37 ? 291 GLN D HB2  1 
ATOM 5191  H HB3  . GLN B 2 270 ? 165.752 224.041 214.887 1.00 238.37 ? 291 GLN D HB3  1 
ATOM 5192  H HG2  . GLN B 2 270 ? 167.905 223.112 215.401 1.00 238.37 ? 291 GLN D HG2  1 
ATOM 5193  H HG3  . GLN B 2 270 ? 168.103 224.425 214.207 1.00 238.37 ? 291 GLN D HG3  1 
ATOM 5194  H HE21 . GLN B 2 270 ? 169.580 224.797 218.036 1.00 238.37 ? 291 GLN D HE21 1 
ATOM 5195  H HE22 . GLN B 2 270 ? 168.357 223.625 217.673 1.00 238.37 ? 291 GLN D HE22 1 
ATOM 5196  N N    . ALA B 2 271 ? 165.524 226.293 212.858 1.00 187.34 ? 292 ALA D N    1 
ATOM 5197  C CA   . ALA B 2 271 ? 165.787 226.585 211.453 1.00 187.34 ? 292 ALA D CA   1 
ATOM 5198  C C    . ALA B 2 271 ? 166.381 227.976 211.283 1.00 187.34 ? 292 ALA D C    1 
ATOM 5199  O O    . ALA B 2 271 ? 167.340 228.169 210.519 1.00 187.34 ? 292 ALA D O    1 
ATOM 5200  C CB   . ALA B 2 271 ? 164.498 226.461 210.643 1.00 187.34 ? 292 ALA D CB   1 
ATOM 5201  H H    . ALA B 2 271 ? 164.722 226.037 213.028 1.00 224.81 ? 292 ALA D H    1 
ATOM 5202  H HA   . ALA B 2 271 ? 166.430 225.946 211.118 1.00 224.81 ? 292 ALA D HA   1 
ATOM 5203  H HB1  . ALA B 2 271 ? 164.698 226.614 209.706 1.00 224.81 ? 292 ALA D HB1  1 
ATOM 5204  H HB2  . ALA B 2 271 ? 164.135 225.572 210.766 1.00 224.81 ? 292 ALA D HB2  1 
ATOM 5205  H HB3  . ALA B 2 271 ? 163.864 227.122 210.960 1.00 224.81 ? 292 ALA D HB3  1 
ATOM 5206  N N    . CYS B 2 272 ? 165.818 228.958 211.985 1.00 190.19 ? 293 CYS D N    1 
ATOM 5207  C CA   . CYS B 2 272 ? 166.399 230.292 211.996 1.00 190.19 ? 293 CYS D CA   1 
ATOM 5208  C C    . CYS B 2 272 ? 167.754 230.287 212.688 1.00 190.19 ? 293 CYS D C    1 
ATOM 5209  O O    . CYS B 2 272 ? 168.734 230.826 212.164 1.00 190.19 ? 293 CYS D O    1 
ATOM 5210  C CB   . CYS B 2 272 ? 165.453 231.269 212.692 1.00 190.19 ? 293 CYS D CB   1 
ATOM 5211  S SG   . CYS B 2 272 ? 166.105 232.942 212.899 1.00 190.19 ? 293 CYS D SG   1 
ATOM 5212  H H    . CYS B 2 272 ? 165.106 228.876 212.460 1.00 228.23 ? 293 CYS D H    1 
ATOM 5213  H HA   . CYS B 2 272 ? 166.524 230.550 211.074 1.00 228.23 ? 293 CYS D HA   1 
ATOM 5214  H HB2  . CYS B 2 272 ? 164.628 231.322 212.192 1.00 228.23 ? 293 CYS D HB2  1 
ATOM 5215  H HB3  . CYS B 2 272 ? 165.266 230.925 213.579 1.00 228.23 ? 293 CYS D HB3  1 
ATOM 5216  N N    . LEU B 2 273 ? 167.818 229.684 213.876 1.00 175.49 ? 294 LEU D N    1 
ATOM 5217  C CA   . LEU B 2 273 ? 169.034 229.738 214.679 1.00 175.49 ? 294 LEU D CA   1 
ATOM 5218  C C    . LEU B 2 273 ? 170.216 229.133 213.927 1.00 175.49 ? 294 LEU D C    1 
ATOM 5219  O O    . LEU B 2 273 ? 171.330 229.673 213.962 1.00 175.49 ? 294 LEU D O    1 
ATOM 5220  C CB   . LEU B 2 273 ? 168.787 229.021 216.010 1.00 175.49 ? 294 LEU D CB   1 
ATOM 5221  C CG   . LEU B 2 273 ? 167.750 229.654 216.955 1.00 175.49 ? 294 LEU D CG   1 
ATOM 5222  C CD1  . LEU B 2 273 ? 167.502 228.741 218.150 1.00 175.49 ? 294 LEU D CD1  1 
ATOM 5223  C CD2  . LEU B 2 273 ? 168.116 231.061 217.436 1.00 175.49 ? 294 LEU D CD2  1 
ATOM 5224  H H    . LEU B 2 273 ? 167.175 229.242 214.236 1.00 210.59 ? 294 LEU D H    1 
ATOM 5225  H HA   . LEU B 2 273 ? 169.256 230.664 214.857 1.00 210.59 ? 294 LEU D HA   1 
ATOM 5226  H HB2  . LEU B 2 273 ? 168.452 228.137 215.793 1.00 210.59 ? 294 LEU D HB2  1 
ATOM 5227  H HB3  . LEU B 2 273 ? 169.614 228.921 216.495 1.00 210.59 ? 294 LEU D HB3  1 
ATOM 5228  H HG   . LEU B 2 273 ? 166.913 229.738 216.482 1.00 210.59 ? 294 LEU D HG   1 
ATOM 5229  H HD11 . LEU B 2 273 ? 166.863 229.166 218.744 1.00 210.59 ? 294 LEU D HD11 1 
ATOM 5230  H HD12 . LEU B 2 273 ? 167.147 227.896 217.836 1.00 210.59 ? 294 LEU D HD12 1 
ATOM 5231  H HD13 . LEU B 2 273 ? 168.341 228.597 218.616 1.00 210.59 ? 294 LEU D HD13 1 
ATOM 5232  H HD21 . LEU B 2 273 ? 167.370 231.418 217.937 1.00 210.59 ? 294 LEU D HD21 1 
ATOM 5233  H HD22 . LEU B 2 273 ? 168.884 231.014 218.016 1.00 210.59 ? 294 LEU D HD22 1 
ATOM 5234  H HD23 . LEU B 2 273 ? 168.297 231.635 216.680 1.00 210.59 ? 294 LEU D HD23 1 
ATOM 5235  N N    . GLY B 2 274 ? 169.982 228.035 213.206 1.00 168.03 ? 295 GLY D N    1 
ATOM 5236  C CA   . GLY B 2 274 ? 171.037 227.445 212.401 1.00 168.03 ? 295 GLY D CA   1 
ATOM 5237  C C    . GLY B 2 274 ? 171.502 228.363 211.290 1.00 168.03 ? 295 GLY D C    1 
ATOM 5238  O O    . GLY B 2 274 ? 172.698 228.627 211.147 1.00 168.03 ? 295 GLY D O    1 
ATOM 5239  H H    . GLY B 2 274 ? 169.228 227.623 213.168 1.00 201.64 ? 295 GLY D H    1 
ATOM 5240  H HA2  . GLY B 2 274 ? 171.798 227.254 212.960 1.00 201.64 ? 295 GLY D HA2  1 
ATOM 5241  H HA3  . GLY B 2 274 ? 170.723 226.615 212.009 1.00 201.64 ? 295 GLY D HA3  1 
ATOM 5242  N N    . SER B 2 275 ? 170.561 228.863 210.484 1.00 164.55 ? 296 SER D N    1 
ATOM 5243  C CA   . SER B 2 275 ? 170.946 229.782 209.418 1.00 164.55 ? 296 SER D CA   1 
ATOM 5244  C C    . SER B 2 275 ? 171.591 231.041 209.985 1.00 164.55 ? 296 SER D C    1 
ATOM 5245  O O    . SER B 2 275 ? 172.561 231.561 209.419 1.00 164.55 ? 296 SER D O    1 
ATOM 5246  C CB   . SER B 2 275 ? 169.735 230.155 208.585 1.00 164.55 ? 296 SER D CB   1 
ATOM 5247  O OG   . SER B 2 275 ? 169.254 229.048 207.874 1.00 164.55 ? 296 SER D OG   1 
ATOM 5248  H H    . SER B 2 275 ? 169.720 228.690 210.532 1.00 197.46 ? 296 SER D H    1 
ATOM 5249  H HA   . SER B 2 275 ? 171.596 229.346 208.844 1.00 197.46 ? 296 SER D HA   1 
ATOM 5250  H HB2  . SER B 2 275 ? 168.951 230.541 209.236 1.00 197.46 ? 296 SER D HB2  1 
ATOM 5251  H HB3  . SER B 2 275 ? 170.003 230.949 207.890 1.00 197.46 ? 296 SER D HB3  1 
ATOM 5252  H HG   . SER B 2 275 ? 168.677 229.401 207.193 1.00 197.46 ? 296 SER D HG   1 
ATOM 5253  N N    . TYR B 2 276 ? 171.070 231.543 211.106 1.00 154.41 ? 297 TYR D N    1 
ATOM 5254  C CA   . TYR B 2 276 ? 171.688 232.681 211.772 1.00 154.41 ? 297 TYR D CA   1 
ATOM 5255  C C    . TYR B 2 276 ? 173.144 232.389 212.108 1.00 154.41 ? 297 TYR D C    1 
ATOM 5256  O O    . TYR B 2 276 ? 174.043 233.162 211.754 1.00 154.41 ? 297 TYR D O    1 
ATOM 5257  C CB   . TYR B 2 276 ? 170.913 233.048 213.040 1.00 154.41 ? 297 TYR D CB   1 
ATOM 5258  C CG   . TYR B 2 276 ? 171.633 234.035 213.932 1.00 154.41 ? 297 TYR D CG   1 
ATOM 5259  C CD1  . TYR B 2 276 ? 171.503 235.397 213.705 1.00 154.41 ? 297 TYR D CD1  1 
ATOM 5260  C CD2  . TYR B 2 276 ? 172.424 233.578 214.976 1.00 154.41 ? 297 TYR D CD2  1 
ATOM 5261  C CE1  . TYR B 2 276 ? 172.160 236.299 214.519 1.00 154.41 ? 297 TYR D CE1  1 
ATOM 5262  C CE2  . TYR B 2 276 ? 173.081 234.480 215.790 1.00 154.41 ? 297 TYR D CE2  1 
ATOM 5263  C CZ   . TYR B 2 276 ? 172.951 235.835 215.565 1.00 154.41 ? 297 TYR D CZ   1 
ATOM 5264  O OH   . TYR B 2 276 ? 173.606 236.733 216.376 1.00 154.41 ? 297 TYR D OH   1 
ATOM 5265  H H    . TYR B 2 276 ? 170.364 231.242 211.494 1.00 185.29 ? 297 TYR D H    1 
ATOM 5266  H HA   . TYR B 2 276 ? 171.664 233.449 211.182 1.00 185.29 ? 297 TYR D HA   1 
ATOM 5267  H HB2  . TYR B 2 276 ? 169.949 233.477 212.765 1.00 185.29 ? 297 TYR D HB2  1 
ATOM 5268  H HB3  . TYR B 2 276 ? 170.717 232.146 213.620 1.00 185.29 ? 297 TYR D HB3  1 
ATOM 5269  H HD1  . TYR B 2 276 ? 170.882 235.756 212.884 1.00 185.29 ? 297 TYR D HD1  1 
ATOM 5270  H HD2  . TYR B 2 276 ? 172.527 232.507 215.153 1.00 185.29 ? 297 TYR D HD2  1 
ATOM 5271  H HE1  . TYR B 2 276 ? 172.058 237.369 214.341 1.00 185.29 ? 297 TYR D HE1  1 
ATOM 5272  H HE2  . TYR B 2 276 ? 173.703 234.120 216.610 1.00 185.29 ? 297 TYR D HE2  1 
ATOM 5273  H HH   . TYR B 2 276 ? 174.122 236.255 217.030 1.00 185.29 ? 297 TYR D HH   1 
ATOM 5274  N N    . ALA B 2 277 ? 173.398 231.277 212.805 1.00 162.71 ? 298 ALA D N    1 
ATOM 5275  C CA   . ALA B 2 277 ? 174.766 230.944 213.188 1.00 162.71 ? 298 ALA D CA   1 
ATOM 5276  C C    . ALA B 2 277 ? 175.680 230.824 211.977 1.00 162.71 ? 298 ALA D C    1 
ATOM 5277  O O    . ALA B 2 277 ? 176.863 231.166 212.062 1.00 162.71 ? 298 ALA D O    1 
ATOM 5278  C CB   . ALA B 2 277 ? 174.787 229.639 213.985 1.00 162.71 ? 298 ALA D CB   1 
ATOM 5279  H H    . ALA B 2 277 ? 172.805 230.710 213.062 1.00 195.25 ? 298 ALA D H    1 
ATOM 5280  H HA   . ALA B 2 277 ? 175.115 231.648 213.756 1.00 195.25 ? 298 ALA D HA   1 
ATOM 5281  H HB1  . ALA B 2 277 ? 175.702 229.442 214.241 1.00 195.25 ? 298 ALA D HB1  1 
ATOM 5282  H HB2  . ALA B 2 277 ? 174.235 229.743 214.776 1.00 195.25 ? 298 ALA D HB2  1 
ATOM 5283  H HB3  . ALA B 2 277 ? 174.438 228.926 213.429 1.00 195.25 ? 298 ALA D HB3  1 
ATOM 5284  N N    . GLY B 2 278 ? 175.154 230.344 210.847 1.00 166.00 ? 299 GLY D N    1 
ATOM 5285  C CA   . GLY B 2 278 ? 175.968 230.216 209.653 1.00 166.00 ? 299 GLY D CA   1 
ATOM 5286  C C    . GLY B 2 278 ? 176.635 231.504 209.214 1.00 166.00 ? 299 GLY D C    1 
ATOM 5287  O O    . GLY B 2 278 ? 177.693 231.465 208.577 1.00 166.00 ? 299 GLY D O    1 
ATOM 5288  H H    . GLY B 2 278 ? 174.339 230.091 210.751 1.00 199.20 ? 299 GLY D H    1 
ATOM 5289  H HA2  . GLY B 2 278 ? 176.659 229.552 209.808 1.00 199.20 ? 299 GLY D HA2  1 
ATOM 5290  H HA3  . GLY B 2 278 ? 175.409 229.903 208.924 1.00 199.20 ? 299 GLY D HA3  1 
ATOM 5291  N N    . MET B 2 279 ? 176.042 232.650 209.537 1.00 165.72 ? 300 MET D N    1 
ATOM 5292  C CA   . MET B 2 279 ? 176.568 233.944 209.121 1.00 165.72 ? 300 MET D CA   1 
ATOM 5293  C C    . MET B 2 279 ? 177.811 234.363 209.891 1.00 165.72 ? 300 MET D C    1 
ATOM 5294  O O    . MET B 2 279 ? 178.522 235.270 209.443 1.00 165.72 ? 300 MET D O    1 
ATOM 5295  C CB   . MET B 2 279 ? 175.483 235.009 209.266 1.00 165.72 ? 300 MET D CB   1 
ATOM 5296  C CG   . MET B 2 279 ? 174.331 234.873 208.281 1.00 165.72 ? 300 MET D CG   1 
ATOM 5297  S SD   . MET B 2 279 ? 174.887 234.796 206.566 1.00 165.72 ? 300 MET D SD   1 
ATOM 5298  C CE   . MET B 2 279 ? 175.577 236.436 206.361 1.00 165.72 ? 300 MET D CE   1 
ATOM 5299  H H    . MET B 2 279 ? 175.322 232.704 210.004 1.00 198.86 ? 300 MET D H    1 
ATOM 5300  H HA   . MET B 2 279 ? 176.790 233.898 208.178 1.00 198.86 ? 300 MET D HA   1 
ATOM 5301  H HB2  . MET B 2 279 ? 175.069 234.972 210.272 1.00 198.86 ? 300 MET D HB2  1 
ATOM 5302  H HB3  . MET B 2 279 ? 175.924 235.998 209.130 1.00 198.86 ? 300 MET D HB3  1 
ATOM 5303  H HG2  . MET B 2 279 ? 173.769 233.966 208.502 1.00 198.86 ? 300 MET D HG2  1 
ATOM 5304  H HG3  . MET B 2 279 ? 173.659 235.724 208.387 1.00 198.86 ? 300 MET D HG3  1 
ATOM 5305  H HE1  . MET B 2 279 ? 175.964 236.543 205.347 1.00 198.86 ? 300 MET D HE1  1 
ATOM 5306  H HE2  . MET B 2 279 ? 174.801 237.182 206.535 1.00 198.86 ? 300 MET D HE2  1 
ATOM 5307  H HE3  . MET B 2 279 ? 176.388 236.582 207.076 1.00 198.86 ? 300 MET D HE3  1 
ATOM 5308  N N    . ILE B 2 280 ? 178.079 233.742 211.033 1.00 158.33 ? 301 ILE D N    1 
ATOM 5309  C CA   . ILE B 2 280 ? 179.230 234.093 211.859 1.00 158.33 ? 301 ILE D CA   1 
ATOM 5310  C C    . ILE B 2 280 ? 180.490 233.569 211.181 1.00 158.33 ? 301 ILE D C    1 
ATOM 5311  O O    . ILE B 2 280 ? 180.585 232.382 210.852 1.00 158.33 ? 301 ILE D O    1 
ATOM 5312  C CB   . ILE B 2 280 ? 179.109 233.511 213.279 1.00 158.33 ? 301 ILE D CB   1 
ATOM 5313  C CG1  . ILE B 2 280 ? 177.878 234.083 213.988 1.00 158.33 ? 301 ILE D CG1  1 
ATOM 5314  C CG2  . ILE B 2 280 ? 180.369 233.796 214.080 1.00 158.33 ? 301 ILE D CG2  1 
ATOM 5315  C CD1  . ILE B 2 280 ? 177.513 233.354 215.260 1.00 158.33 ? 301 ILE D CD1  1 
ATOM 5316  H H    . ILE B 2 280 ? 177.606 233.102 211.357 1.00 190.00 ? 301 ILE D H    1 
ATOM 5317  H HA   . ILE B 2 280 ? 179.296 235.058 211.912 1.00 190.00 ? 301 ILE D HA   1 
ATOM 5318  H HB   . ILE B 2 280 ? 178.964 232.433 213.218 1.00 190.00 ? 301 ILE D HB   1 
ATOM 5319  H HG12 . ILE B 2 280 ? 178.054 235.130 214.232 1.00 190.00 ? 301 ILE D HG12 1 
ATOM 5320  H HG13 . ILE B 2 280 ? 177.021 234.045 213.316 1.00 190.00 ? 301 ILE D HG13 1 
ATOM 5321  H HG21 . ILE B 2 280 ? 180.267 233.378 215.081 1.00 190.00 ? 301 ILE D HG21 1 
ATOM 5322  H HG22 . ILE B 2 280 ? 181.226 233.342 213.584 1.00 190.00 ? 301 ILE D HG22 1 
ATOM 5323  H HG23 . ILE B 2 280 ? 180.520 234.874 214.150 1.00 190.00 ? 301 ILE D HG23 1 
ATOM 5324  H HD11 . ILE B 2 280 ? 176.631 233.817 215.705 1.00 190.00 ? 301 ILE D HD11 1 
ATOM 5325  H HD12 . ILE B 2 280 ? 177.298 232.309 215.032 1.00 190.00 ? 301 ILE D HD12 1 
ATOM 5326  H HD13 . ILE B 2 280 ? 178.343 233.409 215.962 1.00 190.00 ? 301 ILE D HD13 1 
ATOM 5327  N N    . GLY B 2 281 ? 181.454 234.455 210.975 1.00 152.64 ? 302 GLY D N    1 
ATOM 5328  C CA   . GLY B 2 281 ? 182.643 234.162 210.212 1.00 152.64 ? 302 GLY D CA   1 
ATOM 5329  C C    . GLY B 2 281 ? 182.667 234.780 208.823 1.00 152.64 ? 302 GLY D C    1 
ATOM 5330  O O    . GLY B 2 281 ? 183.527 234.403 208.018 1.00 152.64 ? 302 GLY D O    1 
ATOM 5331  H H    . GLY B 2 281 ? 181.436 235.258 211.282 1.00 183.17 ? 302 GLY D H    1 
ATOM 5332  H HA2  . GLY B 2 281 ? 183.415 234.497 210.697 1.00 183.17 ? 302 GLY D HA2  1 
ATOM 5333  H HA3  . GLY B 2 281 ? 182.747 233.203 210.117 1.00 183.17 ? 302 GLY D HA3  1 
ATOM 5334  N N    . PHE B 2 282 ? 181.755 235.707 208.523 1.00 145.79 ? 303 PHE D N    1 
ATOM 5335  C CA   . PHE B 2 282 ? 181.720 236.429 207.260 1.00 145.79 ? 303 PHE D CA   1 
ATOM 5336  C C    . PHE B 2 282 ? 181.617 237.920 207.550 1.00 145.79 ? 303 PHE D C    1 
ATOM 5337  O O    . PHE B 2 282 ? 181.516 238.347 208.703 1.00 145.79 ? 303 PHE D O    1 
ATOM 5338  C CB   . PHE B 2 282 ? 180.541 235.974 206.398 1.00 145.79 ? 303 PHE D CB   1 
ATOM 5339  C CG   . PHE B 2 282 ? 180.610 234.529 205.993 1.00 145.79 ? 303 PHE D CG   1 
ATOM 5340  C CD1  . PHE B 2 282 ? 181.263 234.149 204.831 1.00 145.79 ? 303 PHE D CD1  1 
ATOM 5341  C CD2  . PHE B 2 282 ? 180.021 233.546 206.775 1.00 145.79 ? 303 PHE D CD2  1 
ATOM 5342  C CE1  . PHE B 2 282 ? 181.326 232.821 204.456 1.00 145.79 ? 303 PHE D CE1  1 
ATOM 5343  C CE2  . PHE B 2 282 ? 180.083 232.216 206.403 1.00 145.79 ? 303 PHE D CE2  1 
ATOM 5344  C CZ   . PHE B 2 282 ? 180.735 231.853 205.244 1.00 145.79 ? 303 PHE D CZ   1 
ATOM 5345  H H    . PHE B 2 282 ? 181.122 235.940 209.056 1.00 174.95 ? 303 PHE D H    1 
ATOM 5346  H HA   . PHE B 2 282 ? 182.548 236.317 206.770 1.00 174.95 ? 303 PHE D HA   1 
ATOM 5347  H HB2  . PHE B 2 282 ? 179.611 236.130 206.942 1.00 174.95 ? 303 PHE D HB2  1 
ATOM 5348  H HB3  . PHE B 2 282 ? 180.497 236.578 205.493 1.00 174.95 ? 303 PHE D HB3  1 
ATOM 5349  H HD1  . PHE B 2 282 ? 181.730 234.913 204.208 1.00 174.95 ? 303 PHE D HD1  1 
ATOM 5350  H HD2  . PHE B 2 282 ? 179.504 233.833 207.691 1.00 174.95 ? 303 PHE D HD2  1 
ATOM 5351  H HE1  . PHE B 2 282 ? 181.843 232.536 203.540 1.00 174.95 ? 303 PHE D HE1  1 
ATOM 5352  H HE2  . PHE B 2 282 ? 179.616 231.454 207.027 1.00 174.95 ? 303 PHE D HE2  1 
ATOM 5353  H HZ   . PHE B 2 282 ? 180.786 230.806 204.951 1.00 174.95 ? 303 PHE D HZ   1 
ATOM 5354  N N    . ASP B 2 283 ? 181.644 238.721 206.481 1.00 154.02 ? 304 ASP D N    1 
ATOM 5355  C CA   . ASP B 2 283 ? 181.573 240.169 206.633 1.00 154.02 ? 304 ASP D CA   1 
ATOM 5356  C C    . ASP B 2 283 ? 180.336 240.597 207.411 1.00 154.02 ? 304 ASP D C    1 
ATOM 5357  O O    . ASP B 2 283 ? 180.371 241.616 208.111 1.00 154.02 ? 304 ASP D O    1 
ATOM 5358  C CB   . ASP B 2 283 ? 181.577 240.850 205.262 1.00 154.02 ? 304 ASP D CB   1 
ATOM 5359  C CG   . ASP B 2 283 ? 182.924 240.758 204.559 1.00 154.02 ? 304 ASP D CG   1 
ATOM 5360  O OD1  . ASP B 2 283 ? 183.886 240.409 205.202 1.00 154.02 ? 304 ASP D OD1  1 
ATOM 5361  O OD2  . ASP B 2 283 ? 182.980 241.039 203.385 1.00 154.02 ? 304 ASP D OD2  1 
ATOM 5362  H H    . ASP B 2 283 ? 181.702 238.451 205.667 1.00 184.82 ? 304 ASP D H    1 
ATOM 5363  H HA   . ASP B 2 283 ? 182.352 240.473 207.125 1.00 184.82 ? 304 ASP D HA   1 
ATOM 5364  H HB2  . ASP B 2 283 ? 180.820 240.390 204.626 1.00 184.82 ? 304 ASP D HB2  1 
ATOM 5365  H HB3  . ASP B 2 283 ? 181.314 241.901 205.377 1.00 184.82 ? 304 ASP D HB3  1 
ATOM 5366  N N    . MET B 2 284 ? 179.244 239.837 207.310 1.00 142.21 ? 305 MET D N    1 
ATOM 5367  C CA   . MET B 2 284 ? 177.967 240.191 207.917 1.00 142.21 ? 305 MET D CA   1 
ATOM 5368  C C    . MET B 2 284 ? 177.775 239.555 209.292 1.00 142.21 ? 305 MET D C    1 
ATOM 5369  O O    . MET B 2 284 ? 176.653 239.559 209.806 1.00 142.21 ? 305 MET D O    1 
ATOM 5370  C CB   . MET B 2 284 ? 176.824 239.789 206.987 1.00 142.21 ? 305 MET D CB   1 
ATOM 5371  C CG   . MET B 2 284 ? 175.467 240.359 207.374 1.00 142.21 ? 305 MET D CG   1 
ATOM 5372  S SD   . MET B 2 284 ? 175.434 242.162 207.335 1.00 142.21 ? 305 MET D SD   1 
ATOM 5373  C CE   . MET B 2 284 ? 175.383 242.461 205.571 1.00 142.21 ? 305 MET D CE   1 
ATOM 5374  H H    . MET B 2 284 ? 179.219 239.092 206.880 1.00 170.65 ? 305 MET D H    1 
ATOM 5375  H HA   . MET B 2 284 ? 177.932 241.155 208.022 1.00 170.65 ? 305 MET D HA   1 
ATOM 5376  H HB2  . MET B 2 284 ? 177.048 240.117 205.973 1.00 170.65 ? 305 MET D HB2  1 
ATOM 5377  H HB3  . MET B 2 284 ? 176.737 238.702 206.967 1.00 170.65 ? 305 MET D HB3  1 
ATOM 5378  H HG2  . MET B 2 284 ? 174.707 239.985 206.689 1.00 170.65 ? 305 MET D HG2  1 
ATOM 5379  H HG3  . MET B 2 284 ? 175.209 240.032 208.381 1.00 170.65 ? 305 MET D HG3  1 
ATOM 5380  H HE1  . MET B 2 284 ? 175.359 243.535 205.384 1.00 170.65 ? 305 MET D HE1  1 
ATOM 5381  H HE2  . MET B 2 284 ? 176.270 242.031 205.103 1.00 170.65 ? 305 MET D HE2  1 
ATOM 5382  H HE3  . MET B 2 284 ? 174.490 242.000 205.148 1.00 170.65 ? 305 MET D HE3  1 
ATOM 5383  N N    . THR B 2 285 ? 178.855 239.052 209.912 1.00 136.87 ? 306 THR D N    1 
ATOM 5384  C CA   . THR B 2 285 ? 178.836 238.398 211.220 1.00 136.87 ? 306 THR D CA   1 
ATOM 5385  C C    . THR B 2 285 ? 177.954 239.140 212.224 1.00 136.87 ? 306 THR D C    1 
ATOM 5386  O O    . THR B 2 285 ? 178.361 240.200 212.717 1.00 136.87 ? 306 THR D O    1 
ATOM 5387  C CB   . THR B 2 285 ? 180.261 238.269 211.789 1.00 136.87 ? 306 THR D CB   1 
ATOM 5388  O OG1  . THR B 2 285 ? 181.038 237.405 210.949 1.00 136.87 ? 306 THR D OG1  1 
ATOM 5389  C CG2  . THR B 2 285 ? 180.224 237.700 213.199 1.00 136.87 ? 306 THR D CG2  1 
ATOM 5390  H H    . THR B 2 285 ? 179.646 239.083 209.578 1.00 164.24 ? 306 THR D H    1 
ATOM 5391  H HA   . THR B 2 285 ? 178.542 237.484 211.101 1.00 164.24 ? 306 THR D HA   1 
ATOM 5392  H HB   . THR B 2 285 ? 180.734 239.251 211.812 1.00 164.24 ? 306 THR D HB   1 
ATOM 5393  H HG1  . THR B 2 285 ? 181.560 237.934 210.342 1.00 164.24 ? 306 THR D HG1  1 
ATOM 5394  H HG21 . THR B 2 285 ? 181.240 237.617 213.585 1.00 164.24 ? 306 THR D HG21 1 
ATOM 5395  H HG22 . THR B 2 285 ? 179.644 238.362 213.843 1.00 164.24 ? 306 THR D HG22 1 
ATOM 5396  H HG23 . THR B 2 285 ? 179.761 236.714 213.181 1.00 164.24 ? 306 THR D HG23 1 
ATOM 5397  N N    . PRO B 2 286 ? 176.768 238.633 212.571 1.00 139.71 ? 307 PRO D N    1 
ATOM 5398  C CA   . PRO B 2 286 ? 175.996 239.260 213.648 1.00 139.71 ? 307 PRO D CA   1 
ATOM 5399  C C    . PRO B 2 286 ? 176.566 238.928 215.020 1.00 139.71 ? 307 PRO D C    1 
ATOM 5400  O O    . PRO B 2 286 ? 177.277 237.939 215.207 1.00 139.71 ? 307 PRO D O    1 
ATOM 5401  C CB   . PRO B 2 286 ? 174.599 238.662 213.469 1.00 139.71 ? 307 PRO D CB   1 
ATOM 5402  C CG   . PRO B 2 286 ? 174.864 237.313 212.934 1.00 139.71 ? 307 PRO D CG   1 
ATOM 5403  C CD   . PRO B 2 286 ? 176.061 237.439 212.040 1.00 139.71 ? 307 PRO D CD   1 
ATOM 5404  H HA   . PRO B 2 286 ? 175.941 240.216 213.537 1.00 167.65 ? 307 PRO D HA   1 
ATOM 5405  H HB2  . PRO B 2 286 ? 174.149 238.632 214.322 1.00 167.65 ? 307 PRO D HB2  1 
ATOM 5406  H HB3  . PRO B 2 286 ? 174.095 239.195 212.833 1.00 167.65 ? 307 PRO D HB3  1 
ATOM 5407  H HG2  . PRO B 2 286 ? 175.049 236.703 213.664 1.00 167.65 ? 307 PRO D HG2  1 
ATOM 5408  H HG3  . PRO B 2 286 ? 174.092 237.014 212.428 1.00 167.65 ? 307 PRO D HG3  1 
ATOM 5409  H HD2  . PRO B 2 286 ? 176.618 236.649 212.112 1.00 167.65 ? 307 PRO D HD2  1 
ATOM 5410  H HD3  . PRO B 2 286 ? 175.767 237.572 211.130 1.00 167.65 ? 307 PRO D HD3  1 
ATOM 5411  N N    . ASN B 2 287 ? 176.238 239.782 215.989 1.00 127.96 ? 308 ASN D N    1 
ATOM 5412  C CA   . ASN B 2 287 ? 176.588 239.524 217.379 1.00 127.96 ? 308 ASN D CA   1 
ATOM 5413  C C    . ASN B 2 287 ? 175.571 240.202 218.287 1.00 127.96 ? 308 ASN D C    1 
ATOM 5414  O O    . ASN B 2 287 ? 174.762 241.021 217.844 1.00 127.96 ? 308 ASN D O    1 
ATOM 5415  C CB   . ASN B 2 287 ? 177.997 239.996 217.686 1.00 127.96 ? 308 ASN D CB   1 
ATOM 5416  C CG   . ASN B 2 287 ? 178.617 239.254 218.836 1.00 127.96 ? 308 ASN D CG   1 
ATOM 5417  O OD1  . ASN B 2 287 ? 177.998 239.094 219.895 1.00 127.96 ? 308 ASN D OD1  1 
ATOM 5418  N ND2  . ASN B 2 287 ? 179.829 238.796 218.650 1.00 127.96 ? 308 ASN D ND2  1 
ATOM 5419  H H    . ASN B 2 287 ? 175.811 240.517 215.863 1.00 153.55 ? 308 ASN D H    1 
ATOM 5420  H HA   . ASN B 2 287 ? 176.556 238.569 217.544 1.00 153.55 ? 308 ASN D HA   1 
ATOM 5421  H HB2  . ASN B 2 287 ? 178.625 239.867 216.804 1.00 153.55 ? 308 ASN D HB2  1 
ATOM 5422  H HB3  . ASN B 2 287 ? 177.980 241.060 217.922 1.00 153.55 ? 308 ASN D HB3  1 
ATOM 5423  H HD21 . ASN B 2 287 ? 180.292 238.294 219.381 1.00 153.55 ? 308 ASN D HD21 1 
ATOM 5424  H HD22 . ASN B 2 287 ? 180.292 238.949 217.778 1.00 153.55 ? 308 ASN D HD22 1 
ATOM 5425  N N    . TYR B 2 288 ? 175.624 239.836 219.570 1.00 136.89 ? 309 TYR D N    1 
ATOM 5426  C CA   . TYR B 2 288 ? 174.775 240.441 220.588 1.00 136.89 ? 309 TYR D CA   1 
ATOM 5427  C C    . TYR B 2 288 ? 175.133 241.908 220.789 1.00 136.89 ? 309 TYR D C    1 
ATOM 5428  O O    . TYR B 2 288 ? 176.305 242.289 220.770 1.00 136.89 ? 309 TYR D O    1 
ATOM 5429  C CB   . TYR B 2 288 ? 174.892 239.678 221.909 1.00 136.89 ? 309 TYR D CB   1 
ATOM 5430  C CG   . TYR B 2 288 ? 174.427 238.241 221.827 1.00 136.89 ? 309 TYR D CG   1 
ATOM 5431  C CD1  . TYR B 2 288 ? 173.092 237.931 222.036 1.00 136.89 ? 309 TYR D CD1  1 
ATOM 5432  C CD2  . TYR B 2 288 ? 175.337 237.233 221.544 1.00 136.89 ? 309 TYR D CD2  1 
ATOM 5433  C CE1  . TYR B 2 288 ? 172.668 236.618 221.961 1.00 136.89 ? 309 TYR D CE1  1 
ATOM 5434  C CE2  . TYR B 2 288 ? 174.913 235.921 221.469 1.00 136.89 ? 309 TYR D CE2  1 
ATOM 5435  C CZ   . TYR B 2 288 ? 173.573 235.616 221.679 1.00 136.89 ? 309 TYR D CZ   1 
ATOM 5436  O OH   . TYR B 2 288 ? 173.151 234.308 221.605 1.00 136.89 ? 309 TYR D OH   1 
ATOM 5437  H H    . TYR B 2 288 ? 176.152 239.229 219.874 1.00 164.27 ? 309 TYR D H    1 
ATOM 5438  H HA   . TYR B 2 288 ? 173.848 240.396 220.314 1.00 164.27 ? 309 TYR D HA   1 
ATOM 5439  H HB2  . TYR B 2 288 ? 175.931 239.682 222.241 1.00 164.27 ? 309 TYR D HB2  1 
ATOM 5440  H HB3  . TYR B 2 288 ? 174.302 240.183 222.674 1.00 164.27 ? 309 TYR D HB3  1 
ATOM 5441  H HD1  . TYR B 2 288 ? 172.377 238.723 222.258 1.00 164.27 ? 309 TYR D HD1  1 
ATOM 5442  H HD2  . TYR B 2 288 ? 176.387 237.477 221.380 1.00 164.27 ? 309 TYR D HD2  1 
ATOM 5443  H HE1  . TYR B 2 288 ? 171.618 236.375 222.124 1.00 164.27 ? 309 TYR D HE1  1 
ATOM 5444  H HE2  . TYR B 2 288 ? 175.628 235.129 221.246 1.00 164.27 ? 309 TYR D HE2  1 
ATOM 5445  H HH   . TYR B 2 288 ? 173.904 233.739 221.428 1.00 164.27 ? 309 TYR D HH   1 
ATOM 5446  N N    . VAL B 2 289 ? 174.102 242.733 220.982 1.00 129.22 ? 310 VAL D N    1 
ATOM 5447  C CA   . VAL B 2 289 ? 174.308 244.175 221.085 1.00 129.22 ? 310 VAL D CA   1 
ATOM 5448  C C    . VAL B 2 289 ? 174.936 244.527 222.427 1.00 129.22 ? 310 VAL D C    1 
ATOM 5449  O O    . VAL B 2 289 ? 175.919 245.276 222.491 1.00 129.22 ? 310 VAL D O    1 
ATOM 5450  C CB   . VAL B 2 289 ? 172.971 244.925 220.929 1.00 129.22 ? 310 VAL D CB   1 
ATOM 5451  C CG1  . VAL B 2 289 ? 173.154 246.406 221.222 1.00 129.22 ? 310 VAL D CG1  1 
ATOM 5452  C CG2  . VAL B 2 289 ? 172.420 244.715 219.527 1.00 129.22 ? 310 VAL D CG2  1 
ATOM 5453  H H    . VAL B 2 289 ? 173.283 242.484 221.057 1.00 155.06 ? 310 VAL D H    1 
ATOM 5454  H HA   . VAL B 2 289 ? 174.922 244.454 220.387 1.00 155.06 ? 310 VAL D HA   1 
ATOM 5455  H HB   . VAL B 2 289 ? 172.262 244.538 221.661 1.00 155.06 ? 310 VAL D HB   1 
ATOM 5456  H HG11 . VAL B 2 289 ? 172.200 246.921 221.107 1.00 155.06 ? 310 VAL D HG11 1 
ATOM 5457  H HG12 . VAL B 2 289 ? 173.515 246.534 222.242 1.00 155.06 ? 310 VAL D HG12 1 
ATOM 5458  H HG13 . VAL B 2 289 ? 173.878 246.828 220.524 1.00 155.06 ? 310 VAL D HG13 1 
ATOM 5459  H HG21 . VAL B 2 289 ? 171.475 245.247 219.425 1.00 155.06 ? 310 VAL D HG21 1 
ATOM 5460  H HG22 . VAL B 2 289 ? 173.133 245.097 218.796 1.00 155.06 ? 310 VAL D HG22 1 
ATOM 5461  H HG23 . VAL B 2 289 ? 172.258 243.651 219.355 1.00 155.06 ? 310 VAL D HG23 1 
ATOM 5462  N N    . ASP B 2 290 ? 174.381 243.997 223.516 1.00 143.47 ? 311 ASP D N    1 
ATOM 5463  C CA   . ASP B 2 290 ? 174.815 244.336 224.867 1.00 143.47 ? 311 ASP D CA   1 
ATOM 5464  C C    . ASP B 2 290 ? 174.795 243.068 225.717 1.00 143.47 ? 311 ASP D C    1 
ATOM 5465  O O    . ASP B 2 290 ? 174.711 241.949 225.201 1.00 143.47 ? 311 ASP D O    1 
ATOM 5466  C CB   . ASP B 2 290 ? 173.913 245.407 225.486 1.00 143.47 ? 311 ASP D CB   1 
ATOM 5467  C CG   . ASP B 2 290 ? 172.476 244.938 225.668 1.00 143.47 ? 311 ASP D CG   1 
ATOM 5468  O OD1  . ASP B 2 290 ? 172.263 243.751 225.740 1.00 143.47 ? 311 ASP D OD1  1 
ATOM 5469  O OD2  . ASP B 2 290 ? 171.604 245.772 225.735 1.00 143.47 ? 311 ASP D OD2  1 
ATOM 5470  H H    . ASP B 2 290 ? 173.739 243.425 223.495 1.00 172.16 ? 311 ASP D H    1 
ATOM 5471  H HA   . ASP B 2 290 ? 175.728 244.658 224.855 1.00 172.16 ? 311 ASP D HA   1 
ATOM 5472  H HB2  . ASP B 2 290 ? 174.310 245.700 226.458 1.00 172.16 ? 311 ASP D HB2  1 
ATOM 5473  H HB3  . ASP B 2 290 ? 173.913 246.294 224.851 1.00 172.16 ? 311 ASP D HB3  1 
ATOM 5474  N N    . SER B 2 291 ? 174.873 243.256 227.036 1.00 141.76 ? 312 SER D N    1 
ATOM 5475  C CA   . SER B 2 291 ? 174.925 242.167 228.005 1.00 141.76 ? 312 SER D CA   1 
ATOM 5476  C C    . SER B 2 291 ? 173.677 242.128 228.882 1.00 141.76 ? 312 SER D C    1 
ATOM 5477  O O    . SER B 2 291 ? 173.758 241.810 230.072 1.00 141.76 ? 312 SER D O    1 
ATOM 5478  C CB   . SER B 2 291 ? 176.158 242.309 228.876 1.00 141.76 ? 312 SER D CB   1 
ATOM 5479  O OG   . SER B 2 291 ? 176.171 243.548 229.530 1.00 141.76 ? 312 SER D OG   1 
ATOM 5480  H H    . SER B 2 291 ? 174.900 244.033 227.403 1.00 170.11 ? 312 SER D H    1 
ATOM 5481  H HA   . SER B 2 291 ? 174.982 241.320 227.538 1.00 170.11 ? 312 SER D HA   1 
ATOM 5482  H HB2  . SER B 2 291 ? 176.178 241.505 229.611 1.00 170.11 ? 312 SER D HB2  1 
ATOM 5483  H HB3  . SER B 2 291 ? 177.051 242.211 228.260 1.00 170.11 ? 312 SER D HB3  1 
ATOM 5484  H HG   . SER B 2 291 ? 176.963 243.552 230.074 1.00 170.11 ? 312 SER D HG   1 
ATOM 5485  N N    . SER B 2 292 ? 172.524 242.471 228.320 1.00 144.69 ? 313 SER D N    1 
ATOM 5486  C CA   . SER B 2 292 ? 171.280 242.383 229.070 1.00 144.69 ? 313 SER D CA   1 
ATOM 5487  C C    . SER B 2 292 ? 171.091 240.954 229.578 1.00 144.69 ? 313 SER D C    1 
ATOM 5488  O O    . SER B 2 292 ? 171.289 240.003 228.807 1.00 144.69 ? 313 SER D O    1 
ATOM 5489  C CB   . SER B 2 292 ? 170.107 242.795 228.203 1.00 144.69 ? 313 SER D CB   1 
ATOM 5490  O OG   . SER B 2 292 ? 168.895 242.632 228.887 1.00 144.69 ? 313 SER D OG   1 
ATOM 5491  H H    . SER B 2 292 ? 172.437 242.755 227.513 1.00 173.63 ? 313 SER D H    1 
ATOM 5492  H HA   . SER B 2 292 ? 171.341 243.018 229.794 1.00 173.63 ? 313 SER D HA   1 
ATOM 5493  H HB2  . SER B 2 292 ? 170.222 243.837 227.905 1.00 173.63 ? 313 SER D HB2  1 
ATOM 5494  H HB3  . SER B 2 292 ? 170.098 242.195 227.294 1.00 173.63 ? 313 SER D HB3  1 
ATOM 5495  H HG   . SER B 2 292 ? 168.240 243.124 228.386 1.00 173.63 ? 313 SER D HG   1 
ATOM 5496  N N    . PRO B 2 293 ? 170.721 240.747 230.852 1.00 141.77 ? 314 PRO D N    1 
ATOM 5497  C CA   . PRO B 2 293 ? 170.534 239.361 231.323 1.00 141.77 ? 314 PRO D CA   1 
ATOM 5498  C C    . PRO B 2 293 ? 169.613 238.532 230.443 1.00 141.77 ? 314 PRO D C    1 
ATOM 5499  O O    . PRO B 2 293 ? 169.870 237.337 230.246 1.00 141.77 ? 314 PRO D O    1 
ATOM 5500  C CB   . PRO B 2 293 ? 169.925 239.560 232.714 1.00 141.77 ? 314 PRO D CB   1 
ATOM 5501  C CG   . PRO B 2 293 ? 170.489 240.860 233.178 1.00 141.77 ? 314 PRO D CG   1 
ATOM 5502  C CD   . PRO B 2 293 ? 170.495 241.726 231.946 1.00 141.77 ? 314 PRO D CD   1 
ATOM 5503  H HA   . PRO B 2 293 ? 171.391 238.914 231.393 1.00 170.12 ? 314 PRO D HA   1 
ATOM 5504  H HB2  . PRO B 2 293 ? 168.827 239.572 232.647 1.00 170.12 ? 314 PRO D HB2  1 
ATOM 5505  H HB3  . PRO B 2 293 ? 170.198 238.719 233.368 1.00 170.12 ? 314 PRO D HB3  1 
ATOM 5506  H HG2  . PRO B 2 293 ? 169.870 241.276 233.986 1.00 170.12 ? 314 PRO D HG2  1 
ATOM 5507  H HG3  . PRO B 2 293 ? 171.496 240.710 233.594 1.00 170.12 ? 314 PRO D HG3  1 
ATOM 5508  H HD2  . PRO B 2 293 ? 169.522 242.229 231.847 1.00 170.12 ? 314 PRO D HD2  1 
ATOM 5509  H HD3  . PRO B 2 293 ? 171.307 242.464 232.020 1.00 170.12 ? 314 PRO D HD3  1 
ATOM 5510  N N    . THR B 2 294 ? 168.544 239.133 229.911 1.00 126.98 ? 315 THR D N    1 
ATOM 5511  C CA   . THR B 2 294 ? 167.588 238.435 229.055 1.00 126.98 ? 315 THR D CA   1 
ATOM 5512  C C    . THR B 2 294 ? 167.189 239.206 227.804 1.00 126.98 ? 315 THR D C    1 
ATOM 5513  O O    . THR B 2 294 ? 166.650 238.589 226.877 1.00 126.98 ? 315 THR D O    1 
ATOM 5514  C CB   . THR B 2 294 ? 166.316 238.086 229.849 1.00 126.98 ? 315 THR D CB   1 
ATOM 5515  O OG1  . THR B 2 294 ? 165.646 239.292 230.237 1.00 126.98 ? 315 THR D OG1  1 
ATOM 5516  C CG2  . THR B 2 294 ? 166.668 237.282 231.092 1.00 126.98 ? 315 THR D CG2  1 
ATOM 5517  H H    . THR B 2 294 ? 168.349 239.962 230.038 1.00 152.38 ? 315 THR D H    1 
ATOM 5518  H HA   . THR B 2 294 ? 167.970 237.598 228.751 1.00 152.38 ? 315 THR D HA   1 
ATOM 5519  H HB   . THR B 2 294 ? 165.645 237.499 229.222 1.00 152.38 ? 315 THR D HB   1 
ATOM 5520  H HG1  . THR B 2 294 ? 164.731 239.093 230.453 1.00 152.38 ? 315 THR D HG1  1 
ATOM 5521  H HG21 . THR B 2 294 ? 165.757 237.044 231.640 1.00 152.38 ? 315 THR D HG21 1 
ATOM 5522  H HG22 . THR B 2 294 ? 167.167 236.359 230.799 1.00 152.38 ? 315 THR D HG22 1 
ATOM 5523  H HG23 . THR B 2 294 ? 167.331 237.868 231.728 1.00 152.38 ? 315 THR D HG23 1 
ATOM 5524  N N    . GLY B 2 295 ? 167.427 240.514 227.739 1.00 130.99 ? 316 GLY D N    1 
ATOM 5525  C CA   . GLY B 2 295 ? 166.999 241.307 226.602 1.00 130.99 ? 316 GLY D CA   1 
ATOM 5526  C C    . GLY B 2 295 ? 167.866 241.064 225.384 1.00 130.99 ? 316 GLY D C    1 
ATOM 5527  O O    . GLY B 2 295 ? 168.673 241.918 225.006 1.00 130.99 ? 316 GLY D O    1 
ATOM 5528  H H    . GLY B 2 295 ? 167.835 240.965 228.346 1.00 157.19 ? 316 GLY D H    1 
ATOM 5529  H HA2  . GLY B 2 295 ? 166.082 241.085 226.378 1.00 157.19 ? 316 GLY D HA2  1 
ATOM 5530  H HA3  . GLY B 2 295 ? 167.042 242.249 226.828 1.00 157.19 ? 316 GLY D HA3  1 
ATOM 5531  N N    . ILE B 2 296 ? 167.705 239.900 224.762 1.00 144.11 ? 317 ILE D N    1 
ATOM 5532  C CA   . ILE B 2 296 ? 168.616 239.452 223.714 1.00 144.11 ? 317 ILE D CA   1 
ATOM 5533  C C    . ILE B 2 296 ? 168.316 240.211 222.427 1.00 144.11 ? 317 ILE D C    1 
ATOM 5534  O O    . ILE B 2 296 ? 167.218 240.109 221.871 1.00 144.11 ? 317 ILE D O    1 
ATOM 5535  C CB   . ILE B 2 296 ? 168.511 237.934 223.500 1.00 144.11 ? 317 ILE D CB   1 
ATOM 5536  C CG1  . ILE B 2 296 ? 169.001 237.188 224.751 1.00 144.11 ? 317 ILE D CG1  1 
ATOM 5537  C CG2  . ILE B 2 296 ? 169.302 237.514 222.246 1.00 144.11 ? 317 ILE D CG2  1 
ATOM 5538  C CD1  . ILE B 2 296 ? 168.711 235.695 224.766 1.00 144.11 ? 317 ILE D CD1  1 
ATOM 5539  H H    . ILE B 2 296 ? 167.069 239.346 224.932 1.00 172.93 ? 317 ILE D H    1 
ATOM 5540  H HA   . ILE B 2 296 ? 169.526 239.655 223.979 1.00 172.93 ? 317 ILE D HA   1 
ATOM 5541  H HB   . ILE B 2 296 ? 167.577 237.710 223.359 1.00 172.93 ? 317 ILE D HB   1 
ATOM 5542  H HG12 . ILE B 2 296 ? 169.962 237.303 224.823 1.00 172.93 ? 317 ILE D HG12 1 
ATOM 5543  H HG13 . ILE B 2 296 ? 168.571 237.562 225.535 1.00 172.93 ? 317 ILE D HG13 1 
ATOM 5544  H HG21 . ILE B 2 296 ? 169.483 236.564 222.269 1.00 172.93 ? 317 ILE D HG21 1 
ATOM 5545  H HG22 . ILE B 2 296 ? 168.783 237.713 221.451 1.00 172.93 ? 317 ILE D HG22 1 
ATOM 5546  H HG23 . ILE B 2 296 ? 170.139 238.003 222.227 1.00 172.93 ? 317 ILE D HG23 1 
ATOM 5547  H HD11 . ILE B 2 296 ? 168.945 235.341 225.639 1.00 172.93 ? 317 ILE D HD11 1 
ATOM 5548  H HD12 . ILE B 2 296 ? 167.768 235.556 224.596 1.00 172.93 ? 317 ILE D HD12 1 
ATOM 5549  H HD13 . ILE B 2 296 ? 169.239 235.253 224.085 1.00 172.93 ? 317 ILE D HD13 1 
ATOM 5550  N N    . VAL B 2 297 ? 169.298 240.978 221.957 1.00 136.48 ? 318 VAL D N    1 
ATOM 5551  C CA   . VAL B 2 297 ? 169.219 241.715 220.701 1.00 136.48 ? 318 VAL D CA   1 
ATOM 5552  C C    . VAL B 2 297 ? 170.538 241.496 219.976 1.00 136.48 ? 318 VAL D C    1 
ATOM 5553  O O    . VAL B 2 297 ? 171.607 241.631 220.582 1.00 136.48 ? 318 VAL D O    1 
ATOM 5554  C CB   . VAL B 2 297 ? 168.983 243.218 220.942 1.00 136.48 ? 318 VAL D CB   1 
ATOM 5555  C CG1  . VAL B 2 297 ? 168.870 243.958 219.618 1.00 136.48 ? 318 VAL D CG1  1 
ATOM 5556  C CG2  . VAL B 2 297 ? 167.728 243.417 221.779 1.00 136.48 ? 318 VAL D CG2  1 
ATOM 5557  H H    . VAL B 2 297 ? 170.048 241.087 222.364 1.00 163.78 ? 318 VAL D H    1 
ATOM 5558  H HA   . VAL B 2 297 ? 168.504 241.354 220.153 1.00 163.78 ? 318 VAL D HA   1 
ATOM 5559  H HB   . VAL B 2 297 ? 169.842 243.632 221.469 1.00 163.78 ? 318 VAL D HB   1 
ATOM 5560  H HG11 . VAL B 2 297 ? 168.703 245.019 219.807 1.00 163.78 ? 318 VAL D HG11 1 
ATOM 5561  H HG12 . VAL B 2 297 ? 169.792 243.832 219.051 1.00 163.78 ? 318 VAL D HG12 1 
ATOM 5562  H HG13 . VAL B 2 297 ? 168.033 243.557 219.046 1.00 163.78 ? 318 VAL D HG13 1 
ATOM 5563  H HG21 . VAL B 2 297 ? 167.568 244.482 221.946 1.00 163.78 ? 318 VAL D HG21 1 
ATOM 5564  H HG22 . VAL B 2 297 ? 166.870 242.998 221.254 1.00 163.78 ? 318 VAL D HG22 1 
ATOM 5565  H HG23 . VAL B 2 297 ? 167.848 242.913 222.739 1.00 163.78 ? 318 VAL D HG23 1 
ATOM 5566  N N    . VAL B 2 298 ? 170.464 241.157 218.688 1.00 139.70 ? 319 VAL D N    1 
ATOM 5567  C CA   . VAL B 2 298 ? 171.645 240.903 217.871 1.00 139.70 ? 319 VAL D CA   1 
ATOM 5568  C C    . VAL B 2 298 ? 171.560 241.720 216.590 1.00 139.70 ? 319 VAL D C    1 
ATOM 5569  O O    . VAL B 2 298 ? 170.472 242.086 216.135 1.00 139.70 ? 319 VAL D O    1 
ATOM 5570  C CB   . VAL B 2 298 ? 171.810 239.401 217.539 1.00 139.70 ? 319 VAL D CB   1 
ATOM 5571  C CG1  . VAL B 2 298 ? 171.968 238.572 218.808 1.00 139.70 ? 319 VAL D CG1  1 
ATOM 5572  C CG2  . VAL B 2 298 ? 170.639 238.872 216.702 1.00 139.70 ? 319 VAL D CG2  1 
ATOM 5573  H H    . VAL B 2 298 ? 169.725 241.063 218.260 1.00 167.64 ? 319 VAL D H    1 
ATOM 5574  H HA   . VAL B 2 298 ? 172.441 241.187 218.342 1.00 167.64 ? 319 VAL D HA   1 
ATOM 5575  H HB   . VAL B 2 298 ? 172.617 239.313 217.018 1.00 167.64 ? 319 VAL D HB   1 
ATOM 5576  H HG11 . VAL B 2 298 ? 172.040 237.636 218.561 1.00 167.64 ? 319 VAL D HG11 1 
ATOM 5577  H HG12 . VAL B 2 298 ? 172.772 238.846 219.271 1.00 167.64 ? 319 VAL D HG12 1 
ATOM 5578  H HG13 . VAL B 2 298 ? 171.193 238.703 219.375 1.00 167.64 ? 319 VAL D HG13 1 
ATOM 5579  H HG21 . VAL B 2 298 ? 170.755 237.916 216.586 1.00 167.64 ? 319 VAL D HG21 1 
ATOM 5580  H HG22 . VAL B 2 298 ? 169.808 239.044 217.170 1.00 167.64 ? 319 VAL D HG22 1 
ATOM 5581  H HG23 . VAL B 2 298 ? 170.627 239.297 215.831 1.00 167.64 ? 319 VAL D HG23 1 
ATOM 5582  N N    . SER B 2 299 ? 172.720 241.990 216.001 1.00 142.34 ? 320 SER D N    1 
ATOM 5583  C CA   . SER B 2 299 ? 172.809 242.670 214.715 1.00 142.34 ? 320 SER D CA   1 
ATOM 5584  C C    . SER B 2 299 ? 174.239 242.529 214.193 1.00 142.34 ? 320 SER D C    1 
ATOM 5585  O O    . SER B 2 299 ? 175.159 242.284 214.976 1.00 142.34 ? 320 SER D O    1 
ATOM 5586  C CB   . SER B 2 299 ? 172.432 244.132 214.850 1.00 142.34 ? 320 SER D CB   1 
ATOM 5587  O OG   . SER B 2 299 ? 173.370 244.823 215.629 1.00 142.34 ? 320 SER D OG   1 
ATOM 5588  H H    . SER B 2 299 ? 173.486 241.786 216.335 1.00 170.81 ? 320 SER D H    1 
ATOM 5589  H HA   . SER B 2 299 ? 172.185 242.238 214.113 1.00 170.81 ? 320 SER D HA   1 
ATOM 5590  H HB2  . SER B 2 299 ? 172.372 244.585 213.861 1.00 170.81 ? 320 SER D HB2  1 
ATOM 5591  H HB3  . SER B 2 299 ? 171.447 244.213 215.307 1.00 170.81 ? 320 SER D HB3  1 
ATOM 5592  H HG   . SER B 2 299 ? 173.946 245.277 215.009 1.00 170.81 ? 320 SER D HG   1 
ATOM 5593  N N    . PRO B 2 300 ? 174.445 242.669 212.863 1.00 137.85 ? 321 PRO D N    1 
ATOM 5594  C CA   . PRO B 2 300 ? 175.808 242.805 212.332 1.00 137.85 ? 321 PRO D CA   1 
ATOM 5595  C C    . PRO B 2 300 ? 176.479 244.094 212.771 1.00 137.85 ? 321 PRO D C    1 
ATOM 5596  O O    . PRO B 2 300 ? 175.906 244.877 213.534 1.00 137.85 ? 321 PRO D O    1 
ATOM 5597  C CB   . PRO B 2 300 ? 175.587 242.784 210.816 1.00 137.85 ? 321 PRO D CB   1 
ATOM 5598  C CG   . PRO B 2 300 ? 174.226 243.364 210.637 1.00 137.85 ? 321 PRO D CG   1 
ATOM 5599  C CD   . PRO B 2 300 ? 173.433 242.824 211.797 1.00 137.85 ? 321 PRO D CD   1 
ATOM 5600  H HA   . PRO B 2 300 ? 176.357 242.056 212.577 1.00 165.42 ? 321 PRO D HA   1 
ATOM 5601  H HB2  . PRO B 2 300 ? 176.371 243.371 210.314 1.00 165.42 ? 321 PRO D HB2  1 
ATOM 5602  H HB3  . PRO B 2 300 ? 175.665 241.754 210.439 1.00 165.42 ? 321 PRO D HB3  1 
ATOM 5603  H HG2  . PRO B 2 300 ? 174.279 244.463 210.636 1.00 165.42 ? 321 PRO D HG2  1 
ATOM 5604  H HG3  . PRO B 2 300 ? 173.810 243.065 209.664 1.00 165.42 ? 321 PRO D HG3  1 
ATOM 5605  H HD2  . PRO B 2 300 ? 172.651 243.546 212.076 1.00 165.42 ? 321 PRO D HD2  1 
ATOM 5606  H HD3  . PRO B 2 300 ? 172.988 241.857 211.519 1.00 165.42 ? 321 PRO D HD3  1 
ATOM 5607  N N    . TRP B 2 301 ? 177.700 244.316 212.287 1.00 123.48 ? 322 TRP D N    1 
ATOM 5608  C CA   . TRP B 2 301 ? 178.522 245.445 212.710 1.00 123.48 ? 322 TRP D CA   1 
ATOM 5609  C C    . TRP B 2 301 ? 178.444 246.532 211.640 1.00 123.48 ? 322 TRP D C    1 
ATOM 5610  O O    . TRP B 2 301 ? 179.347 246.711 210.822 1.00 123.48 ? 322 TRP D O    1 
ATOM 5611  C CB   . TRP B 2 301 ? 179.975 245.018 212.928 1.00 123.48 ? 322 TRP D CB   1 
ATOM 5612  C CG   . TRP B 2 301 ? 180.856 246.125 213.422 1.00 123.48 ? 322 TRP D CG   1 
ATOM 5613  C CD1  . TRP B 2 301 ? 181.917 246.676 212.766 1.00 123.48 ? 322 TRP D CD1  1 
ATOM 5614  C CD2  . TRP B 2 301 ? 180.758 246.826 214.685 1.00 123.48 ? 322 TRP D CD2  1 
ATOM 5615  N NE1  . TRP B 2 301 ? 182.483 247.666 213.531 1.00 123.48 ? 322 TRP D NE1  1 
ATOM 5616  C CE2  . TRP B 2 301 ? 181.785 247.772 214.708 1.00 123.48 ? 322 TRP D CE2  1 
ATOM 5617  C CE3  . TRP B 2 301 ? 179.892 246.727 215.782 1.00 123.48 ? 322 TRP D CE3  1 
ATOM 5618  C CZ2  . TRP B 2 301 ? 181.978 248.620 215.788 1.00 123.48 ? 322 TRP D CZ2  1 
ATOM 5619  C CZ3  . TRP B 2 301 ? 180.084 247.579 216.863 1.00 123.48 ? 322 TRP D CZ3  1 
ATOM 5620  C CH2  . TRP B 2 301 ? 181.100 248.501 216.865 1.00 123.48 ? 322 TRP D CH2  1 
ATOM 5621  H H    . TRP B 2 301 ? 178.081 243.817 211.699 1.00 148.18 ? 322 TRP D H    1 
ATOM 5622  H HA   . TRP B 2 301 ? 178.178 245.810 213.540 1.00 148.18 ? 322 TRP D HA   1 
ATOM 5623  H HB2  . TRP B 2 301 ? 180.010 244.204 213.652 1.00 148.18 ? 322 TRP D HB2  1 
ATOM 5624  H HB3  . TRP B 2 301 ? 180.388 244.642 211.993 1.00 148.18 ? 322 TRP D HB3  1 
ATOM 5625  H HD1  . TRP B 2 301 ? 182.264 246.375 211.780 1.00 148.18 ? 322 TRP D HD1  1 
ATOM 5626  H HE1  . TRP B 2 301 ? 183.283 248.225 213.272 1.00 148.18 ? 322 TRP D HE1  1 
ATOM 5627  H HE3  . TRP B 2 301 ? 179.082 245.999 215.784 1.00 148.18 ? 322 TRP D HE3  1 
ATOM 5628  H HZ2  . TRP B 2 301 ? 182.779 249.359 215.808 1.00 148.18 ? 322 TRP D HZ2  1 
ATOM 5629  H HZ3  . TRP B 2 301 ? 179.406 247.495 217.713 1.00 148.18 ? 322 TRP D HZ3  1 
ATOM 5630  H HH2  . TRP B 2 301 ? 181.222 249.153 217.730 1.00 148.18 ? 322 TRP D HH2  1 
ATOM 5631  N N    . CYS B 2 302 ? 177.334 247.264 211.653 1.00 111.11 ? 323 CYS D N    1 
ATOM 5632  C CA   . CYS B 2 302 ? 177.054 248.254 210.622 1.00 111.11 ? 323 CYS D CA   1 
ATOM 5633  C C    . CYS B 2 302 ? 175.942 249.163 211.125 1.00 111.11 ? 323 CYS D C    1 
ATOM 5634  O O    . CYS B 2 302 ? 175.351 248.931 212.183 1.00 111.11 ? 323 CYS D O    1 
ATOM 5635  C CB   . CYS B 2 302 ? 176.679 247.586 209.294 1.00 111.11 ? 323 CYS D CB   1 
ATOM 5636  S SG   . CYS B 2 302 ? 175.240 246.498 209.359 1.00 111.11 ? 323 CYS D SG   1 
ATOM 5637  H H    . CYS B 2 302 ? 176.722 247.202 212.255 1.00 133.33 ? 323 CYS D H    1 
ATOM 5638  H HA   . CYS B 2 302 ? 177.845 248.794 210.477 1.00 133.33 ? 323 CYS D HA   1 
ATOM 5639  H HB2  . CYS B 2 302 ? 176.488 248.274 208.639 1.00 133.33 ? 323 CYS D HB2  1 
ATOM 5640  H HB3  . CYS B 2 302 ? 177.432 247.053 208.993 1.00 133.33 ? 323 CYS D HB3  1 
ATOM 5641  N N    . SER B 2 303 ? 175.665 250.209 210.350 1.00 105.32 ? 324 SER D N    1 
ATOM 5642  C CA   . SER B 2 303 ? 174.567 251.124 210.638 1.00 105.32 ? 324 SER D CA   1 
ATOM 5643  C C    . SER B 2 303 ? 173.963 251.576 209.312 1.00 105.32 ? 324 SER D C    1 
ATOM 5644  O O    . SER B 2 303 ? 174.284 251.035 208.250 1.00 105.32 ? 324 SER D O    1 
ATOM 5645  C CB   . SER B 2 303 ? 175.051 252.318 211.438 1.00 105.32 ? 324 SER D CB   1 
ATOM 5646  O OG   . SER B 2 303 ? 173.973 253.092 211.888 1.00 105.32 ? 324 SER D OG   1 
ATOM 5647  H H    . SER B 2 303 ? 176.106 250.410 209.640 1.00 126.38 ? 324 SER D H    1 
ATOM 5648  H HA   . SER B 2 303 ? 173.880 250.656 211.138 1.00 126.38 ? 324 SER D HA   1 
ATOM 5649  H HB2  . SER B 2 303 ? 175.635 251.972 212.290 1.00 126.38 ? 324 SER D HB2  1 
ATOM 5650  H HB3  . SER B 2 303 ? 175.707 252.929 210.818 1.00 126.38 ? 324 SER D HB3  1 
ATOM 5651  H HG   . SER B 2 303 ? 174.357 253.806 212.402 1.00 126.38 ? 324 SER D HG   1 
ATOM 5652  N N    . CYS B 2 304 ? 173.081 252.578 209.377 1.00 117.91 ? 325 CYS D N    1 
ATOM 5653  C CA   . CYS B 2 304 ? 172.390 253.113 208.207 1.00 117.91 ? 325 CYS D CA   1 
ATOM 5654  C C    . CYS B 2 304 ? 172.740 254.580 207.967 1.00 117.91 ? 325 CYS D C    1 
ATOM 5655  O O    . CYS B 2 304 ? 171.952 255.325 207.383 1.00 117.91 ? 325 CYS D O    1 
ATOM 5656  C CB   . CYS B 2 304 ? 170.876 252.978 208.374 1.00 117.91 ? 325 CYS D CB   1 
ATOM 5657  S SG   . CYS B 2 304 ? 170.285 251.269 208.402 1.00 117.91 ? 325 CYS D SG   1 
ATOM 5658  H H    . CYS B 2 304 ? 172.862 252.972 210.109 1.00 141.49 ? 325 CYS D H    1 
ATOM 5659  H HA   . CYS B 2 304 ? 172.659 252.629 207.413 1.00 141.49 ? 325 CYS D HA   1 
ATOM 5660  H HB2  . CYS B 2 304 ? 170.568 253.457 209.304 1.00 141.49 ? 325 CYS D HB2  1 
ATOM 5661  H HB3  . CYS B 2 304 ? 170.373 253.496 207.558 1.00 141.49 ? 325 CYS D HB3  1 
ATOM 5662  N N    . ARG B 2 305 ? 173.920 255.010 208.409 1.00 107.19 ? 326 ARG D N    1 
ATOM 5663  C CA   . ARG B 2 305 ? 174.360 256.376 208.151 1.00 107.19 ? 326 ARG D CA   1 
ATOM 5664  C C    . ARG B 2 305 ? 174.797 256.506 206.697 1.00 107.19 ? 326 ARG D C    1 
ATOM 5665  O O    . ARG B 2 305 ? 175.589 255.699 206.202 1.00 107.19 ? 326 ARG D O    1 
ATOM 5666  C CB   . ARG B 2 305 ? 175.509 256.762 209.071 1.00 107.19 ? 326 ARG D CB   1 
ATOM 5667  C CG   . ARG B 2 305 ? 175.998 258.194 208.916 1.00 107.19 ? 326 ARG D CG   1 
ATOM 5668  C CD   . ARG B 2 305 ? 177.035 258.531 209.925 1.00 107.19 ? 326 ARG D CD   1 
ATOM 5669  N NE   . ARG B 2 305 ? 177.555 259.877 209.738 1.00 107.19 ? 326 ARG D NE   1 
ATOM 5670  C CZ   . ARG B 2 305 ? 178.496 260.448 210.515 1.00 107.19 ? 326 ARG D CZ   1 
ATOM 5671  N NH1  . ARG B 2 305 ? 179.009 259.780 211.525 1.00 107.19 ? 326 ARG D NH1  1 
ATOM 5672  N NH2  . ARG B 2 305 ? 178.903 261.679 210.263 1.00 107.19 ? 326 ARG D NH2  1 
ATOM 5673  H H    . ARG B 2 305 ? 174.482 254.538 208.855 1.00 128.63 ? 326 ARG D H    1 
ATOM 5674  H HA   . ARG B 2 305 ? 173.622 256.987 208.305 1.00 128.63 ? 326 ARG D HA   1 
ATOM 5675  H HB2  . ARG B 2 305 ? 175.205 256.628 210.108 1.00 128.63 ? 326 ARG D HB2  1 
ATOM 5676  H HB3  . ARG B 2 305 ? 176.357 256.102 208.890 1.00 128.63 ? 326 ARG D HB3  1 
ATOM 5677  H HG2  . ARG B 2 305 ? 176.429 258.326 207.924 1.00 128.63 ? 326 ARG D HG2  1 
ATOM 5678  H HG3  . ARG B 2 305 ? 175.160 258.880 209.043 1.00 128.63 ? 326 ARG D HG3  1 
ATOM 5679  H HD2  . ARG B 2 305 ? 176.605 258.468 210.924 1.00 128.63 ? 326 ARG D HD2  1 
ATOM 5680  H HD3  . ARG B 2 305 ? 177.865 257.831 209.842 1.00 128.63 ? 326 ARG D HD3  1 
ATOM 5681  H HE   . ARG B 2 305 ? 177.184 260.422 208.972 1.00 128.63 ? 326 ARG D HE   1 
ATOM 5682  H HH11 . ARG B 2 305 ? 178.698 258.838 211.718 1.00 128.63 ? 326 ARG D HH11 1 
ATOM 5683  H HH12 . ARG B 2 305 ? 179.714 260.208 212.107 1.00 128.63 ? 326 ARG D HH12 1 
ATOM 5684  H HH21 . ARG B 2 305 ? 178.508 262.193 209.487 1.00 128.63 ? 326 ARG D HH21 1 
ATOM 5685  H HH22 . ARG B 2 305 ? 179.608 262.107 210.845 1.00 128.63 ? 326 ARG D HH22 1 
ATOM 5686  N N    . GLY B 2 306 ? 174.278 257.523 206.016 1.00 147.75 ? 327 GLY D N    1 
ATOM 5687  C CA   . GLY B 2 306 ? 174.572 257.734 204.615 1.00 147.75 ? 327 GLY D CA   1 
ATOM 5688  C C    . GLY B 2 306 ? 173.732 256.929 203.650 1.00 147.75 ? 327 GLY D C    1 
ATOM 5689  O O    . GLY B 2 306 ? 174.152 256.743 202.501 1.00 147.75 ? 327 GLY D O    1 
ATOM 5690  H H    . GLY B 2 306 ? 173.745 258.108 206.353 1.00 177.30 ? 327 GLY D H    1 
ATOM 5691  H HA2  . GLY B 2 306 ? 174.440 258.672 204.408 1.00 177.30 ? 327 GLY D HA2  1 
ATOM 5692  H HA3  . GLY B 2 306 ? 175.503 257.522 204.450 1.00 177.30 ? 327 GLY D HA3  1 
ATOM 5693  N N    . SER B 2 307 ? 172.559 256.450 204.075 1.00 144.75 ? 328 SER D N    1 
ATOM 5694  C CA   . SER B 2 307 ? 171.666 255.715 203.185 1.00 144.75 ? 328 SER D CA   1 
ATOM 5695  C C    . SER B 2 307 ? 170.799 256.657 202.357 1.00 144.75 ? 328 SER D C    1 
ATOM 5696  O O    . SER B 2 307 ? 170.555 256.397 201.173 1.00 144.75 ? 328 SER D O    1 
ATOM 5697  C CB   . SER B 2 307 ? 170.783 254.782 203.990 1.00 144.75 ? 328 SER D CB   1 
ATOM 5698  O OG   . SER B 2 307 ? 171.544 253.784 204.613 1.00 144.75 ? 328 SER D OG   1 
ATOM 5699  H H    . SER B 2 307 ? 172.260 256.541 204.877 1.00 173.70 ? 328 SER D H    1 
ATOM 5700  H HA   . SER B 2 307 ? 172.181 255.169 202.573 1.00 173.70 ? 328 SER D HA   1 
ATOM 5701  H HB2  . SER B 2 307 ? 170.241 255.353 204.743 1.00 173.70 ? 328 SER D HB2  1 
ATOM 5702  H HB3  . SER B 2 307 ? 170.045 254.323 203.334 1.00 173.70 ? 328 SER D HB3  1 
ATOM 5703  H HG   . SER B 2 307 ? 171.003 253.448 205.332 1.00 173.70 ? 328 SER D HG   1 
ATOM 5704  N N    . GLY B 2 308 ? 170.336 257.748 202.960 1.00 144.01 ? 329 GLY D N    1 
ATOM 5705  C CA   . GLY B 2 308 ? 169.498 258.719 202.270 1.00 144.01 ? 329 GLY D CA   1 
ATOM 5706  C C    . GLY B 2 308 ? 168.262 258.083 201.660 1.00 144.01 ? 329 GLY D C    1 
ATOM 5707  O O    . GLY B 2 308 ? 167.400 257.530 202.356 1.00 144.01 ? 329 GLY D O    1 
ATOM 5708  H H    . GLY B 2 308 ? 170.492 257.948 203.782 1.00 172.81 ? 329 GLY D H    1 
ATOM 5709  H HA2  . GLY B 2 308 ? 169.202 259.387 202.907 1.00 172.81 ? 329 GLY D HA2  1 
ATOM 5710  H HA3  . GLY B 2 308 ? 169.997 259.171 201.576 1.00 172.81 ? 329 GLY D HA3  1 
ATOM 5711  N N    . ASN B 2 309 ? 168.176 258.140 200.328 1.00 150.87 ? 330 ASN D N    1 
ATOM 5712  C CA   . ASN B 2 309 ? 167.032 257.576 199.617 1.00 150.87 ? 330 ASN D CA   1 
ATOM 5713  C C    . ASN B 2 309 ? 166.823 256.092 199.909 1.00 150.87 ? 330 ASN D C    1 
ATOM 5714  O O    . ASN B 2 309 ? 165.720 255.584 199.678 1.00 150.87 ? 330 ASN D O    1 
ATOM 5715  C CB   . ASN B 2 309 ? 167.187 257.799 198.124 1.00 150.87 ? 330 ASN D CB   1 
ATOM 5716  C CG   . ASN B 2 309 ? 167.038 259.244 197.737 1.00 150.87 ? 330 ASN D CG   1 
ATOM 5717  O OD1  . ASN B 2 309 ? 166.465 260.044 198.485 1.00 150.87 ? 330 ASN D OD1  1 
ATOM 5718  N ND2  . ASN B 2 309 ? 167.544 259.595 196.582 1.00 150.87 ? 330 ASN D ND2  1 
ATOM 5719  H H    . ASN B 2 309 ? 168.766 258.499 199.816 1.00 181.04 ? 330 ASN D H    1 
ATOM 5720  H HA   . ASN B 2 309 ? 166.229 258.045 199.891 1.00 181.04 ? 330 ASN D HA   1 
ATOM 5721  H HB2  . ASN B 2 309 ? 168.168 257.448 197.802 1.00 181.04 ? 330 ASN D HB2  1 
ATOM 5722  H HB3  . ASN B 2 309 ? 166.438 257.213 197.589 1.00 181.04 ? 330 ASN D HB3  1 
ATOM 5723  H HD21 . ASN B 2 309 ? 167.475 260.544 196.273 1.00 181.04 ? 330 ASN D HD21 1 
ATOM 5724  H HD22 . ASN B 2 309 ? 167.999 258.914 196.009 1.00 181.04 ? 330 ASN D HD22 1 
ATOM 5725  N N    . MET B 2 310 ? 167.848 255.391 200.406 1.00 158.62 ? 331 MET D N    1 
ATOM 5726  C CA   . MET B 2 310 ? 167.788 253.959 200.662 1.00 158.62 ? 331 MET D CA   1 
ATOM 5727  C C    . MET B 2 310 ? 167.684 253.617 202.151 1.00 158.62 ? 331 MET D C    1 
ATOM 5728  O O    . MET B 2 310 ? 167.905 252.453 202.511 1.00 158.62 ? 331 MET D O    1 
ATOM 5729  C CB   . MET B 2 310 ? 169.015 253.282 200.052 1.00 158.62 ? 331 MET D CB   1 
ATOM 5730  C CG   . MET B 2 310 ? 169.142 253.450 198.545 1.00 158.62 ? 331 MET D CG   1 
ATOM 5731  S SD   . MET B 2 310 ? 167.761 252.719 197.644 1.00 158.62 ? 331 MET D SD   1 
ATOM 5732  C CE   . MET B 2 310 ? 168.092 250.974 197.875 1.00 158.62 ? 331 MET D CE   1 
ATOM 5733  H H    . MET B 2 310 ? 168.612 255.730 200.601 1.00 190.34 ? 331 MET D H    1 
ATOM 5734  H HA   . MET B 2 310 ? 167.016 253.591 200.216 1.00 190.34 ? 331 MET D HA   1 
ATOM 5735  H HB2  . MET B 2 310 ? 169.917 253.684 200.510 1.00 190.34 ? 331 MET D HB2  1 
ATOM 5736  H HB3  . MET B 2 310 ? 168.986 252.214 200.269 1.00 190.34 ? 331 MET D HB3  1 
ATOM 5737  H HG2  . MET B 2 310 ? 169.191 254.510 198.299 1.00 190.34 ? 331 MET D HG2  1 
ATOM 5738  H HG3  . MET B 2 310 ? 170.063 252.979 198.203 1.00 190.34 ? 331 MET D HG3  1 
ATOM 5739  H HE1  . MET B 2 310 ? 167.321 250.388 197.374 1.00 190.34 ? 331 MET D HE1  1 
ATOM 5740  H HE2  . MET B 2 310 ? 169.067 250.730 197.452 1.00 190.34 ? 331 MET D HE2  1 
ATOM 5741  H HE3  . MET B 2 310 ? 168.090 250.741 198.940 1.00 190.34 ? 331 MET D HE3  1 
ATOM 5742  N N    . GLU B 2 311 ? 167.340 254.597 203.012 1.00 144.90 ? 332 GLU D N    1 
ATOM 5743  C CA   . GLU B 2 311 ? 167.227 254.348 204.455 1.00 144.90 ? 332 GLU D CA   1 
ATOM 5744  C C    . GLU B 2 311 ? 166.245 253.229 204.771 1.00 144.90 ? 332 GLU D C    1 
ATOM 5745  O O    . GLU B 2 311 ? 166.496 252.416 205.671 1.00 144.90 ? 332 GLU D O    1 
ATOM 5746  C CB   . GLU B 2 311 ? 166.794 255.623 205.182 1.00 144.90 ? 332 GLU D CB   1 
ATOM 5747  C CG   . GLU B 2 311 ? 167.891 256.669 205.323 1.00 144.90 ? 332 GLU D CG   1 
ATOM 5748  C CD   . GLU B 2 311 ? 167.402 257.950 205.938 1.00 144.90 ? 332 GLU D CD   1 
ATOM 5749  O OE1  . GLU B 2 311 ? 166.220 258.068 206.160 1.00 144.90 ? 332 GLU D OE1  1 
ATOM 5750  O OE2  . GLU B 2 311 ? 168.210 258.814 206.186 1.00 144.90 ? 332 GLU D OE2  1 
ATOM 5751  H H    . GLU B 2 311 ? 167.164 255.407 202.785 1.00 173.88 ? 332 GLU D H    1 
ATOM 5752  H HA   . GLU B 2 311 ? 168.094 254.082 204.797 1.00 173.88 ? 332 GLU D HA   1 
ATOM 5753  H HB2  . GLU B 2 311 ? 165.961 256.081 204.648 1.00 173.88 ? 332 GLU D HB2  1 
ATOM 5754  H HB3  . GLU B 2 311 ? 166.442 255.370 206.182 1.00 173.88 ? 332 GLU D HB3  1 
ATOM 5755  H HG2  . GLU B 2 311 ? 168.688 256.262 205.945 1.00 173.88 ? 332 GLU D HG2  1 
ATOM 5756  H HG3  . GLU B 2 311 ? 168.307 256.879 204.339 1.00 173.88 ? 332 GLU D HG3  1 
ATOM 5757  N N    . GLU B 2 312 ? 165.135 253.167 204.028 1.00 169.74 ? 333 GLU D N    1 
ATOM 5758  C CA   . GLU B 2 312 ? 164.138 252.123 204.243 1.00 169.74 ? 333 GLU D CA   1 
ATOM 5759  C C    . GLU B 2 312 ? 164.734 250.744 203.998 1.00 169.74 ? 333 GLU D C    1 
ATOM 5760  O O    . GLU B 2 312 ? 164.644 249.864 204.864 1.00 169.74 ? 333 GLU D O    1 
ATOM 5761  C CB   . GLU B 2 312 ? 162.930 252.338 203.329 1.00 169.74 ? 333 GLU D CB   1 
ATOM 5762  C CG   . GLU B 2 312 ? 161.831 251.297 203.484 1.00 169.74 ? 333 GLU D CG   1 
ATOM 5763  C CD   . GLU B 2 312 ? 160.641 251.567 202.606 1.00 169.74 ? 333 GLU D CD   1 
ATOM 5764  O OE1  . GLU B 2 312 ? 160.650 252.557 201.914 1.00 169.74 ? 333 GLU D OE1  1 
ATOM 5765  O OE2  . GLU B 2 312 ? 159.722 250.783 202.627 1.00 169.74 ? 333 GLU D OE2  1 
ATOM 5766  H H    . GLU B 2 312 ? 164.941 253.715 203.395 1.00 203.69 ? 333 GLU D H    1 
ATOM 5767  H HA   . GLU B 2 312 ? 163.839 252.159 205.164 1.00 203.69 ? 333 GLU D HA   1 
ATOM 5768  H HB2  . GLU B 2 312 ? 162.494 253.317 203.527 1.00 203.69 ? 333 GLU D HB2  1 
ATOM 5769  H HB3  . GLU B 2 312 ? 163.256 252.329 202.288 1.00 203.69 ? 333 GLU D HB3  1 
ATOM 5770  H HG2  . GLU B 2 312 ? 162.236 250.316 203.235 1.00 203.69 ? 333 GLU D HG2  1 
ATOM 5771  H HG3  . GLU B 2 312 ? 161.511 251.273 204.525 1.00 203.69 ? 333 GLU D HG3  1 
ATOM 5772  N N    . GLU B 2 313 ? 165.406 250.564 202.852 1.00 161.75 ? 334 GLU D N    1 
ATOM 5773  C CA   . GLU B 2 313 ? 165.973 249.259 202.518 1.00 161.75 ? 334 GLU D CA   1 
ATOM 5774  C C    . GLU B 2 313 ? 167.046 248.863 203.518 1.00 161.75 ? 334 GLU D C    1 
ATOM 5775  O O    . GLU B 2 313 ? 167.114 247.695 203.925 1.00 161.75 ? 334 GLU D O    1 
ATOM 5776  C CB   . GLU B 2 313 ? 166.561 249.273 201.105 1.00 161.75 ? 334 GLU D CB   1 
ATOM 5777  C CG   . GLU B 2 313 ? 165.526 249.371 199.994 1.00 161.75 ? 334 GLU D CG   1 
ATOM 5778  C CD   . GLU B 2 313 ? 164.957 250.755 199.845 1.00 161.75 ? 334 GLU D CD   1 
ATOM 5779  O OE1  . GLU B 2 313 ? 165.407 251.639 200.534 1.00 161.75 ? 334 GLU D OE1  1 
ATOM 5780  O OE2  . GLU B 2 313 ? 164.071 250.928 199.041 1.00 161.75 ? 334 GLU D OE2  1 
ATOM 5781  H H    . GLU B 2 313 ? 165.552 251.178 202.270 1.00 194.10 ? 334 GLU D H    1 
ATOM 5782  H HA   . GLU B 2 313 ? 165.270 248.593 202.551 1.00 194.10 ? 334 GLU D HA   1 
ATOM 5783  H HB2  . GLU B 2 313 ? 167.243 250.117 201.003 1.00 194.10 ? 334 GLU D HB2  1 
ATOM 5784  H HB3  . GLU B 2 313 ? 167.140 248.363 200.944 1.00 194.10 ? 334 GLU D HB3  1 
ATOM 5785  H HG2  . GLU B 2 313 ? 165.989 249.078 199.053 1.00 194.10 ? 334 GLU D HG2  1 
ATOM 5786  H HG3  . GLU B 2 313 ? 164.717 248.672 200.203 1.00 194.10 ? 334 GLU D HG3  1 
ATOM 5787  N N    . CYS B 2 314 ? 167.850 249.834 203.966 1.00 149.02 ? 335 CYS D N    1 
ATOM 5788  C CA   . CYS B 2 314 ? 168.873 249.552 204.967 1.00 149.02 ? 335 CYS D CA   1 
ATOM 5789  C C    . CYS B 2 314 ? 168.234 249.014 206.237 1.00 149.02 ? 335 CYS D C    1 
ATOM 5790  O O    . CYS B 2 314 ? 168.570 247.915 206.701 1.00 149.02 ? 335 CYS D O    1 
ATOM 5791  C CB   . CYS B 2 314 ? 169.678 250.810 205.295 1.00 149.02 ? 335 CYS D CB   1 
ATOM 5792  S SG   . CYS B 2 314 ? 170.990 250.551 206.513 1.00 149.02 ? 335 CYS D SG   1 
ATOM 5793  H H    . CYS B 2 314 ? 167.821 250.653 203.707 1.00 178.82 ? 335 CYS D H    1 
ATOM 5794  H HA   . CYS B 2 314 ? 169.478 248.876 204.622 1.00 178.82 ? 335 CYS D HA   1 
ATOM 5795  H HB2  . CYS B 2 314 ? 170.134 251.198 204.384 1.00 178.82 ? 335 CYS D HB2  1 
ATOM 5796  H HB3  . CYS B 2 314 ? 169.008 251.580 205.679 1.00 178.82 ? 335 CYS D HB3  1 
ATOM 5797  N N    . GLU B 2 315 ? 167.246 249.740 206.765 1.00 144.46 ? 336 GLU D N    1 
ATOM 5798  C CA   . GLU B 2 315 ? 166.545 249.268 207.952 1.00 144.46 ? 336 GLU D CA   1 
ATOM 5799  C C    . GLU B 2 315 ? 165.758 248.006 207.642 1.00 144.46 ? 336 GLU D C    1 
ATOM 5800  O O    . GLU B 2 315 ? 165.747 247.061 208.440 1.00 144.46 ? 336 GLU D O    1 
ATOM 5801  C CB   . GLU B 2 315 ? 165.607 250.351 208.490 1.00 144.46 ? 336 GLU D CB   1 
ATOM 5802  C CG   . GLU B 2 315 ? 166.317 251.552 209.099 1.00 144.46 ? 336 GLU D CG   1 
ATOM 5803  C CD   . GLU B 2 315 ? 165.366 252.621 209.561 1.00 144.46 ? 336 GLU D CD   1 
ATOM 5804  O OE1  . GLU B 2 315 ? 164.203 252.529 209.250 1.00 144.46 ? 336 GLU D OE1  1 
ATOM 5805  O OE2  . GLU B 2 315 ? 165.803 253.530 210.226 1.00 144.46 ? 336 GLU D OE2  1 
ATOM 5806  H H    . GLU B 2 315 ? 166.969 250.495 206.459 1.00 173.35 ? 336 GLU D H    1 
ATOM 5807  H HA   . GLU B 2 315 ? 167.196 249.056 208.640 1.00 173.35 ? 336 GLU D HA   1 
ATOM 5808  H HB2  . GLU B 2 315 ? 164.969 250.713 207.683 1.00 173.35 ? 336 GLU D HB2  1 
ATOM 5809  H HB3  . GLU B 2 315 ? 164.958 249.923 209.254 1.00 173.35 ? 336 GLU D HB3  1 
ATOM 5810  H HG2  . GLU B 2 315 ? 166.910 251.217 209.949 1.00 173.35 ? 336 GLU D HG2  1 
ATOM 5811  H HG3  . GLU B 2 315 ? 166.997 251.972 208.359 1.00 173.35 ? 336 GLU D HG3  1 
ATOM 5812  N N    . LYS B 2 316 ? 165.155 247.940 206.450 1.00 147.62 ? 337 LYS D N    1 
ATOM 5813  C CA   . LYS B 2 316 ? 164.343 246.782 206.100 1.00 147.62 ? 337 LYS D CA   1 
ATOM 5814  C C    . LYS B 2 316 ? 165.108 245.495 206.360 1.00 147.62 ? 337 LYS D C    1 
ATOM 5815  O O    . LYS B 2 316 ? 164.540 244.514 206.855 1.00 147.62 ? 337 LYS D O    1 
ATOM 5816  C CB   . LYS B 2 316 ? 163.905 246.851 204.637 1.00 147.62 ? 337 LYS D CB   1 
ATOM 5817  C CG   . LYS B 2 316 ? 162.989 245.715 204.200 1.00 147.62 ? 337 LYS D CG   1 
ATOM 5818  C CD   . LYS B 2 316 ? 162.509 245.911 202.770 1.00 147.62 ? 337 LYS D CD   1 
ATOM 5819  C CE   . LYS B 2 316 ? 161.625 244.758 202.319 1.00 147.62 ? 337 LYS D CE   1 
ATOM 5820  N NZ   . LYS B 2 316 ? 161.096 244.966 200.944 1.00 147.62 ? 337 LYS D NZ   1 
ATOM 5821  H H    . LYS B 2 316 ? 165.219 248.528 205.832 1.00 177.14 ? 337 LYS D H    1 
ATOM 5822  H HA   . LYS B 2 316 ? 163.547 246.774 206.655 1.00 177.14 ? 337 LYS D HA   1 
ATOM 5823  H HB2  . LYS B 2 316 ? 163.382 247.790 204.457 1.00 177.14 ? 337 LYS D HB2  1 
ATOM 5824  H HB3  . LYS B 2 316 ? 164.784 246.838 203.992 1.00 177.14 ? 337 LYS D HB3  1 
ATOM 5825  H HG2  . LYS B 2 316 ? 163.526 244.768 204.268 1.00 177.14 ? 337 LYS D HG2  1 
ATOM 5826  H HG3  . LYS B 2 316 ? 162.124 245.671 204.862 1.00 177.14 ? 337 LYS D HG3  1 
ATOM 5827  H HD2  . LYS B 2 316 ? 161.943 246.841 202.700 1.00 177.14 ? 337 LYS D HD2  1 
ATOM 5828  H HD3  . LYS B 2 316 ? 163.369 245.979 202.103 1.00 177.14 ? 337 LYS D HD3  1 
ATOM 5829  H HE2  . LYS B 2 316 ? 162.198 243.831 202.338 1.00 177.14 ? 337 LYS D HE2  1 
ATOM 5830  H HE3  . LYS B 2 316 ? 160.785 244.653 203.005 1.00 177.14 ? 337 LYS D HE3  1 
ATOM 5831  H HZ1  . LYS B 2 316 ? 160.516 244.182 200.683 1.00 177.14 ? 337 LYS D HZ1  1 
ATOM 5832  H HZ2  . LYS B 2 316 ? 160.547 245.814 200.919 1.00 177.14 ? 337 LYS D HZ2  1 
ATOM 5833  H HZ3  . LYS B 2 316 ? 161.866 245.045 200.295 1.00 177.14 ? 337 LYS D HZ3  1 
ATOM 5834  N N    . PHE B 2 317 ? 166.406 245.481 206.035 1.00 148.05 ? 338 PHE D N    1 
ATOM 5835  C CA   . PHE B 2 317 ? 167.220 244.312 206.330 1.00 148.05 ? 338 PHE D CA   1 
ATOM 5836  C C    . PHE B 2 317 ? 167.712 244.299 207.770 1.00 148.05 ? 338 PHE D C    1 
ATOM 5837  O O    . PHE B 2 317 ? 167.618 243.260 208.431 1.00 148.05 ? 338 PHE D O    1 
ATOM 5838  C CB   . PHE B 2 317 ? 168.420 244.254 205.383 1.00 148.05 ? 338 PHE D CB   1 
ATOM 5839  C CG   . PHE B 2 317 ? 169.312 243.067 205.608 1.00 148.05 ? 338 PHE D CG   1 
ATOM 5840  C CD1  . PHE B 2 317 ? 168.799 241.778 205.574 1.00 148.05 ? 338 PHE D CD1  1 
ATOM 5841  C CD2  . PHE B 2 317 ? 170.666 243.235 205.854 1.00 148.05 ? 338 PHE D CD2  1 
ATOM 5842  C CE1  . PHE B 2 317 ? 169.619 240.686 205.781 1.00 148.05 ? 338 PHE D CE1  1 
ATOM 5843  C CE2  . PHE B 2 317 ? 171.489 242.145 206.060 1.00 148.05 ? 338 PHE D CE2  1 
ATOM 5844  C CZ   . PHE B 2 317 ? 170.964 240.868 206.024 1.00 148.05 ? 338 PHE D CZ   1 
ATOM 5845  H H    . PHE B 2 317 ? 166.829 246.119 205.645 1.00 177.66 ? 338 PHE D H    1 
ATOM 5846  H HA   . PHE B 2 317 ? 166.705 243.504 206.186 1.00 177.66 ? 338 PHE D HA   1 
ATOM 5847  H HB2  . PHE B 2 317 ? 168.068 244.224 204.352 1.00 177.66 ? 338 PHE D HB2  1 
ATOM 5848  H HB3  . PHE B 2 317 ? 169.018 245.156 205.498 1.00 177.66 ? 338 PHE D HB3  1 
ATOM 5849  H HD1  . PHE B 2 317 ? 167.736 241.634 205.382 1.00 177.66 ? 338 PHE D HD1  1 
ATOM 5850  H HD2  . PHE B 2 317 ? 171.081 244.243 205.883 1.00 177.66 ? 338 PHE D HD2  1 
ATOM 5851  H HE1  . PHE B 2 317 ? 169.203 239.679 205.753 1.00 177.66 ? 338 PHE D HE1  1 
ATOM 5852  H HE2  . PHE B 2 317 ? 172.552 242.291 206.252 1.00 177.66 ? 338 PHE D HE2  1 
ATOM 5853  H HZ   . PHE B 2 317 ? 171.611 240.008 206.188 1.00 177.66 ? 338 PHE D HZ   1 
ATOM 5854  N N    . LEU B 2 318 ? 168.223 245.424 208.273 1.00 132.44 ? 339 LEU D N    1 
ATOM 5855  C CA   . LEU B 2 318 ? 168.743 245.447 209.635 1.00 132.44 ? 339 LEU D CA   1 
ATOM 5856  C C    . LEU B 2 318 ? 167.677 245.103 210.666 1.00 132.44 ? 339 LEU D C    1 
ATOM 5857  O O    . LEU B 2 318 ? 167.995 244.469 211.680 1.00 132.44 ? 339 LEU D O    1 
ATOM 5858  C CB   . LEU B 2 318 ? 169.329 246.829 209.947 1.00 132.44 ? 339 LEU D CB   1 
ATOM 5859  C CG   . LEU B 2 318 ? 170.022 246.966 211.309 1.00 132.44 ? 339 LEU D CG   1 
ATOM 5860  C CD1  . LEU B 2 318 ? 171.170 245.970 211.397 1.00 132.44 ? 339 LEU D CD1  1 
ATOM 5861  C CD2  . LEU B 2 318 ? 170.521 248.393 211.484 1.00 132.44 ? 339 LEU D CD2  1 
ATOM 5862  H H    . LEU B 2 318 ? 168.281 246.172 207.853 1.00 158.93 ? 339 LEU D H    1 
ATOM 5863  H HA   . LEU B 2 318 ? 169.447 244.783 209.703 1.00 158.93 ? 339 LEU D HA   1 
ATOM 5864  H HB2  . LEU B 2 318 ? 170.058 247.080 209.178 1.00 158.93 ? 339 LEU D HB2  1 
ATOM 5865  H HB3  . LEU B 2 318 ? 168.525 247.564 209.909 1.00 158.93 ? 339 LEU D HB3  1 
ATOM 5866  H HG   . LEU B 2 318 ? 169.313 246.730 212.103 1.00 158.93 ? 339 LEU D HG   1 
ATOM 5867  H HD11 . LEU B 2 318 ? 171.662 246.067 212.365 1.00 158.93 ? 339 LEU D HD11 1 
ATOM 5868  H HD12 . LEU B 2 318 ? 170.782 244.957 211.288 1.00 158.93 ? 339 LEU D HD12 1 
ATOM 5869  H HD13 . LEU B 2 318 ? 171.888 246.172 210.603 1.00 158.93 ? 339 LEU D HD13 1 
ATOM 5870  H HD21 . LEU B 2 318 ? 171.013 248.490 212.452 1.00 158.93 ? 339 LEU D HD21 1 
ATOM 5871  H HD22 . LEU B 2 318 ? 171.230 248.630 210.691 1.00 158.93 ? 339 LEU D HD22 1 
ATOM 5872  H HD23 . LEU B 2 318 ? 169.678 249.082 211.434 1.00 158.93 ? 339 LEU D HD23 1 
ATOM 5873  N N    . ARG B 2 319 ? 166.423 245.499 210.430 1.00 136.22 ? 340 ARG D N    1 
ATOM 5874  C CA   . ARG B 2 319 ? 165.355 245.190 211.375 1.00 136.22 ? 340 ARG D CA   1 
ATOM 5875  C C    . ARG B 2 319 ? 165.205 243.687 211.569 1.00 136.22 ? 340 ARG D C    1 
ATOM 5876  O O    . ARG B 2 319 ? 164.831 243.237 212.660 1.00 136.22 ? 340 ARG D O    1 
ATOM 5877  C CB   . ARG B 2 319 ? 164.032 245.769 210.895 1.00 136.22 ? 340 ARG D CB   1 
ATOM 5878  C CG   . ARG B 2 319 ? 163.934 247.285 210.968 1.00 136.22 ? 340 ARG D CG   1 
ATOM 5879  C CD   . ARG B 2 319 ? 162.667 247.782 210.372 1.00 136.22 ? 340 ARG D CD   1 
ATOM 5880  N NE   . ARG B 2 319 ? 162.655 249.231 210.256 1.00 136.22 ? 340 ARG D NE   1 
ATOM 5881  C CZ   . ARG B 2 319 ? 162.269 250.074 211.233 1.00 136.22 ? 340 ARG D CZ   1 
ATOM 5882  N NH1  . ARG B 2 319 ? 161.867 249.598 212.391 1.00 136.22 ? 340 ARG D NH1  1 
ATOM 5883  N NH2  . ARG B 2 319 ? 162.294 251.379 211.028 1.00 136.22 ? 340 ARG D NH2  1 
ATOM 5884  H H    . ARG B 2 319 ? 166.170 245.943 209.737 1.00 163.46 ? 340 ARG D H    1 
ATOM 5885  H HA   . ARG B 2 319 ? 165.574 245.582 212.234 1.00 163.46 ? 340 ARG D HA   1 
ATOM 5886  H HB2  . ARG B 2 319 ? 163.861 245.477 209.860 1.00 163.46 ? 340 ARG D HB2  1 
ATOM 5887  H HB3  . ARG B 2 319 ? 163.217 245.357 211.491 1.00 163.46 ? 340 ARG D HB3  1 
ATOM 5888  H HG2  . ARG B 2 319 ? 163.971 247.602 212.010 1.00 163.46 ? 340 ARG D HG2  1 
ATOM 5889  H HG3  . ARG B 2 319 ? 164.767 247.730 210.423 1.00 163.46 ? 340 ARG D HG3  1 
ATOM 5890  H HD2  . ARG B 2 319 ? 162.543 247.359 209.376 1.00 163.46 ? 340 ARG D HD2  1 
ATOM 5891  H HD3  . ARG B 2 319 ? 161.828 247.483 211.000 1.00 163.46 ? 340 ARG D HD3  1 
ATOM 5892  H HE   . ARG B 2 319 ? 162.957 249.635 209.379 1.00 163.46 ? 340 ARG D HE   1 
ATOM 5893  H HH11 . ARG B 2 319 ? 161.848 248.600 212.547 1.00 163.46 ? 340 ARG D HH11 1 
ATOM 5894  H HH12 . ARG B 2 319 ? 161.578 250.230 213.123 1.00 163.46 ? 340 ARG D HH12 1 
ATOM 5895  H HH21 . ARG B 2 319 ? 162.603 251.745 210.138 1.00 163.46 ? 340 ARG D HH21 1 
ATOM 5896  H HH22 . ARG B 2 319 ? 162.005 252.011 211.760 1.00 163.46 ? 340 ARG D HH22 1 
ATOM 5897  N N    . ASP B 2 320 ? 165.538 242.896 210.543 1.00 152.70 ? 341 ASP D N    1 
ATOM 5898  C CA   . ASP B 2 320 ? 165.439 241.441 210.617 1.00 152.70 ? 341 ASP D CA   1 
ATOM 5899  C C    . ASP B 2 320 ? 166.327 240.841 211.700 1.00 152.70 ? 341 ASP D C    1 
ATOM 5900  O O    . ASP B 2 320 ? 166.150 239.664 212.037 1.00 152.70 ? 341 ASP D O    1 
ATOM 5901  C CB   . ASP B 2 320 ? 165.802 240.821 209.265 1.00 152.70 ? 341 ASP D CB   1 
ATOM 5902  C CG   . ASP B 2 320 ? 164.725 241.031 208.209 1.00 152.70 ? 341 ASP D CG   1 
ATOM 5903  O OD1  . ASP B 2 320 ? 163.627 241.380 208.570 1.00 152.70 ? 341 ASP D OD1  1 
ATOM 5904  O OD2  . ASP B 2 320 ? 165.012 240.839 207.051 1.00 152.70 ? 341 ASP D OD2  1 
ATOM 5905  H H    . ASP B 2 320 ? 165.828 243.185 209.786 1.00 183.24 ? 341 ASP D H    1 
ATOM 5906  H HA   . ASP B 2 320 ? 164.523 241.199 210.821 1.00 183.24 ? 341 ASP D HA   1 
ATOM 5907  H HB2  . ASP B 2 320 ? 166.735 241.256 208.904 1.00 183.24 ? 341 ASP D HB2  1 
ATOM 5908  H HB3  . ASP B 2 320 ? 165.967 239.751 209.388 1.00 183.24 ? 341 ASP D HB3  1 
ATOM 5909  N N    . PHE B 2 321 ? 167.278 241.604 212.237 1.00 139.96 ? 342 PHE D N    1 
ATOM 5910  C CA   . PHE B 2 321 ? 168.166 241.141 213.294 1.00 139.96 ? 342 PHE D CA   1 
ATOM 5911  C C    . PHE B 2 321 ? 167.677 241.553 214.677 1.00 139.96 ? 342 PHE D C    1 
ATOM 5912  O O    . PHE B 2 321 ? 167.748 240.758 215.620 1.00 139.96 ? 342 PHE D O    1 
ATOM 5913  C CB   . PHE B 2 321 ? 169.579 241.683 213.070 1.00 139.96 ? 342 PHE D CB   1 
ATOM 5914  C CG   . PHE B 2 321 ? 170.250 241.137 211.841 1.00 139.96 ? 342 PHE D CG   1 
ATOM 5915  C CD1  . PHE B 2 321 ? 170.946 239.939 211.888 1.00 139.96 ? 342 PHE D CD1  1 
ATOM 5916  C CD2  . PHE B 2 321 ? 170.184 241.821 210.636 1.00 139.96 ? 342 PHE D CD2  1 
ATOM 5917  C CE1  . PHE B 2 321 ? 171.564 239.436 210.760 1.00 139.96 ? 342 PHE D CE1  1 
ATOM 5918  C CE2  . PHE B 2 321 ? 170.801 241.319 209.506 1.00 139.96 ? 342 PHE D CE2  1 
ATOM 5919  C CZ   . PHE B 2 321 ? 171.491 240.127 209.567 1.00 139.96 ? 342 PHE D CZ   1 
ATOM 5920  H H    . PHE B 2 321 ? 167.431 242.415 211.997 1.00 167.95 ? 342 PHE D H    1 
ATOM 5921  H HA   . PHE B 2 321 ? 168.190 240.173 213.310 1.00 167.95 ? 342 PHE D HA   1 
ATOM 5922  H HB2  . PHE B 2 321 ? 169.542 242.768 212.983 1.00 167.95 ? 342 PHE D HB2  1 
ATOM 5923  H HB3  . PHE B 2 321 ? 170.201 241.444 213.931 1.00 167.95 ? 342 PHE D HB3  1 
ATOM 5924  H HD1  . PHE B 2 321 ? 171.004 239.393 212.830 1.00 167.95 ? 342 PHE D HD1  1 
ATOM 5925  H HD2  . PHE B 2 321 ? 169.639 242.764 210.588 1.00 167.95 ? 342 PHE D HD2  1 
ATOM 5926  H HE1  . PHE B 2 321 ? 172.109 238.494 210.810 1.00 167.95 ? 342 PHE D HE1  1 
ATOM 5927  H HE2  . PHE B 2 321 ? 170.742 241.867 208.565 1.00 167.95 ? 342 PHE D HE2  1 
ATOM 5928  H HZ   . PHE B 2 321 ? 171.977 239.731 208.676 1.00 167.95 ? 342 PHE D HZ   1 
ATOM 5929  N N    . THR B 2 322 ? 167.170 242.780 214.813 1.00 129.15 ? 343 THR D N    1 
ATOM 5930  C CA   . THR B 2 322 ? 166.861 243.357 216.118 1.00 129.15 ? 343 THR D CA   1 
ATOM 5931  C C    . THR B 2 322 ? 165.372 243.411 216.422 1.00 129.15 ? 343 THR D C    1 
ATOM 5932  O O    . THR B 2 322 ? 164.990 243.312 217.593 1.00 129.15 ? 343 THR D O    1 
ATOM 5933  C CB   . THR B 2 322 ? 167.446 244.777 216.232 1.00 129.15 ? 343 THR D CB   1 
ATOM 5934  O OG1  . THR B 2 322 ? 166.864 245.618 215.227 1.00 129.15 ? 343 THR D OG1  1 
ATOM 5935  C CG2  . THR B 2 322 ? 168.956 244.747 216.050 1.00 129.15 ? 343 THR D CG2  1 
ATOM 5936  H H    . THR B 2 322 ? 166.995 243.304 214.155 1.00 154.98 ? 343 THR D H    1 
ATOM 5937  H HA   . THR B 2 322 ? 167.283 242.830 216.814 1.00 154.98 ? 343 THR D HA   1 
ATOM 5938  H HB   . THR B 2 322 ? 167.212 245.189 217.213 1.00 154.98 ? 343 THR D HB   1 
ATOM 5939  H HG1  . THR B 2 322 ? 166.411 246.352 215.649 1.00 154.98 ? 343 THR D HG1  1 
ATOM 5940  H HG21 . THR B 2 322 ? 169.352 245.759 216.134 1.00 154.98 ? 343 THR D HG21 1 
ATOM 5941  H HG22 . THR B 2 322 ? 169.402 244.117 216.819 1.00 154.98 ? 343 THR D HG22 1 
ATOM 5942  H HG23 . THR B 2 322 ? 169.196 244.344 215.067 1.00 154.98 ? 343 THR D HG23 1 
ATOM 5943  N N    . GLU B 2 323 ? 164.528 243.559 215.400 1.00 144.93 ? 344 GLU D N    1 
ATOM 5944  C CA   . GLU B 2 323 ? 163.085 243.682 215.568 1.00 144.93 ? 344 GLU D CA   1 
ATOM 5945  C C    . GLU B 2 323 ? 162.369 242.435 215.060 1.00 144.93 ? 344 GLU D C    1 
ATOM 5946  O O    . GLU B 2 323 ? 161.230 242.506 214.594 1.00 144.93 ? 344 GLU D O    1 
ATOM 5947  C CB   . GLU B 2 323 ? 162.565 244.919 214.832 1.00 144.93 ? 344 GLU D CB   1 
ATOM 5948  C CG   . GLU B 2 323 ? 163.115 246.239 215.354 1.00 144.93 ? 344 GLU D CG   1 
ATOM 5949  C CD   . GLU B 2 323 ? 162.499 247.435 214.683 1.00 144.93 ? 344 GLU D CD   1 
ATOM 5950  O OE1  . GLU B 2 323 ? 161.722 247.251 213.777 1.00 144.93 ? 344 GLU D OE1  1 
ATOM 5951  O OE2  . GLU B 2 323 ? 162.806 248.536 215.077 1.00 144.93 ? 344 GLU D OE2  1 
ATOM 5952  H H    . GLU B 2 323 ? 164.779 243.590 214.578 1.00 173.92 ? 344 GLU D H    1 
ATOM 5953  H HA   . GLU B 2 323 ? 162.873 243.780 216.509 1.00 173.92 ? 344 GLU D HA   1 
ATOM 5954  H HB2  . GLU B 2 323 ? 162.818 244.846 213.774 1.00 173.92 ? 344 GLU D HB2  1 
ATOM 5955  H HB3  . GLU B 2 323 ? 161.478 244.957 214.906 1.00 173.92 ? 344 GLU D HB3  1 
ATOM 5956  H HG2  . GLU B 2 323 ? 162.926 246.301 216.425 1.00 173.92 ? 344 GLU D HG2  1 
ATOM 5957  H HG3  . GLU B 2 323 ? 164.193 246.257 215.200 1.00 173.92 ? 344 GLU D HG3  1 
ATOM 5958  N N    . ASN B 2 324 ? 163.038 241.285 215.149 1.00 150.16 ? 345 ASN D N    1 
ATOM 5959  C CA   . ASN B 2 324 ? 162.590 240.048 214.519 1.00 150.16 ? 345 ASN D CA   1 
ATOM 5960  C C    . ASN B 2 324 ? 162.078 239.090 215.589 1.00 150.16 ? 345 ASN D C    1 
ATOM 5961  O O    . ASN B 2 324 ? 162.885 238.494 216.318 1.00 150.16 ? 345 ASN D O    1 
ATOM 5962  C CB   . ASN B 2 324 ? 163.704 239.414 213.707 1.00 150.16 ? 345 ASN D CB   1 
ATOM 5963  C CG   . ASN B 2 324 ? 163.272 238.144 213.027 1.00 150.16 ? 345 ASN D CG   1 
ATOM 5964  O OD1  . ASN B 2 324 ? 162.086 237.952 212.737 1.00 150.16 ? 345 ASN D OD1  1 
ATOM 5965  N ND2  . ASN B 2 324 ? 164.213 237.272 212.767 1.00 150.16 ? 345 ASN D ND2  1 
ATOM 5966  H H    . ASN B 2 324 ? 163.774 241.196 215.584 1.00 180.19 ? 345 ASN D H    1 
ATOM 5967  H HA   . ASN B 2 324 ? 161.905 240.243 213.866 1.00 180.19 ? 345 ASN D HA   1 
ATOM 5968  H HB2  . ASN B 2 324 ? 164.049 240.118 212.949 1.00 180.19 ? 345 ASN D HB2  1 
ATOM 5969  H HB3  . ASN B 2 324 ? 164.549 239.194 214.358 1.00 180.19 ? 345 ASN D HB3  1 
ATOM 5970  H HD21 . ASN B 2 324 ? 163.984 236.409 212.316 1.00 180.19 ? 345 ASN D HD21 1 
ATOM 5971  H HD22 . ASN B 2 324 ? 165.160 237.468 213.020 1.00 180.19 ? 345 ASN D HD22 1 
ATOM 5972  N N    . PRO B 2 325 ? 160.761 238.904 215.742 1.00 154.47 ? 346 PRO D N    1 
ATOM 5973  C CA   . PRO B 2 325 ? 160.286 237.961 216.768 1.00 154.47 ? 346 PRO D CA   1 
ATOM 5974  C C    . PRO B 2 325 ? 160.823 236.553 216.594 1.00 154.47 ? 346 PRO D C    1 
ATOM 5975  O O    . PRO B 2 325 ? 160.870 235.803 217.576 1.00 154.47 ? 346 PRO D O    1 
ATOM 5976  C CB   . PRO B 2 325 ? 158.766 237.994 216.576 1.00 154.47 ? 346 PRO D CB   1 
ATOM 5977  C CG   . PRO B 2 325 ? 158.503 239.333 215.975 1.00 154.47 ? 346 PRO D CG   1 
ATOM 5978  C CD   . PRO B 2 325 ? 159.661 239.558 215.040 1.00 154.47 ? 346 PRO D CD   1 
ATOM 5979  H HA   . PRO B 2 325 ? 160.520 238.283 217.653 1.00 185.36 ? 346 PRO D HA   1 
ATOM 5980  H HB2  . PRO B 2 325 ? 158.451 237.165 215.925 1.00 185.36 ? 346 PRO D HB2  1 
ATOM 5981  H HB3  . PRO B 2 325 ? 158.261 237.854 217.543 1.00 185.36 ? 346 PRO D HB3  1 
ATOM 5982  H HG2  . PRO B 2 325 ? 157.533 239.332 215.455 1.00 185.36 ? 346 PRO D HG2  1 
ATOM 5983  H HG3  . PRO B 2 325 ? 158.440 240.097 216.763 1.00 185.36 ? 346 PRO D HG3  1 
ATOM 5984  H HD2  . PRO B 2 325 ? 159.449 239.081 214.071 1.00 185.36 ? 346 PRO D HD2  1 
ATOM 5985  H HD3  . PRO B 2 325 ? 159.826 240.638 214.913 1.00 185.36 ? 346 PRO D HD3  1 
ATOM 5986  N N    . CYS B 2 326 ? 161.234 236.169 215.382 1.00 145.73 ? 347 CYS D N    1 
ATOM 5987  C CA   . CYS B 2 326 ? 161.760 234.826 215.164 1.00 145.73 ? 347 CYS D CA   1 
ATOM 5988  C C    . CYS B 2 326 ? 163.050 234.616 215.948 1.00 145.73 ? 347 CYS D C    1 
ATOM 5989  O O    . CYS B 2 326 ? 163.134 233.720 216.795 1.00 145.73 ? 347 CYS D O    1 
ATOM 5990  C CB   . CYS B 2 326 ? 162.025 234.585 213.678 1.00 145.73 ? 347 CYS D CB   1 
ATOM 5991  S SG   . CYS B 2 326 ? 162.563 232.903 213.287 1.00 145.73 ? 347 CYS D SG   1 
ATOM 5992  H H    . CYS B 2 326 ? 161.218 236.663 214.679 1.00 174.88 ? 347 CYS D H    1 
ATOM 5993  H HA   . CYS B 2 326 ? 161.112 234.187 215.488 1.00 174.88 ? 347 CYS D HA   1 
ATOM 5994  H HB2  . CYS B 2 326 ? 161.118 234.790 213.108 1.00 174.88 ? 347 CYS D HB2  1 
ATOM 5995  H HB3  . CYS B 2 326 ? 162.793 235.274 213.328 1.00 174.88 ? 347 CYS D HB3  1 
ATOM 5996  N N    . LEU B 2 327 ? 164.062 235.450 215.688 1.00 160.65 ? 348 LEU D N    1 
ATOM 5997  C CA   . LEU B 2 327 ? 165.297 235.389 216.465 1.00 160.65 ? 348 LEU D CA   1 
ATOM 5998  C C    . LEU B 2 327 ? 165.029 235.583 217.951 1.00 160.65 ? 348 LEU D C    1 
ATOM 5999  O O    . LEU B 2 327 ? 165.597 234.871 218.788 1.00 160.65 ? 348 LEU D O    1 
ATOM 6000  C CB   . LEU B 2 327 ? 166.284 236.457 215.977 1.00 160.65 ? 348 LEU D CB   1 
ATOM 6001  C CG   . LEU B 2 327 ? 166.957 236.173 214.628 1.00 160.65 ? 348 LEU D CG   1 
ATOM 6002  C CD1  . LEU B 2 327 ? 167.672 237.427 214.143 1.00 160.65 ? 348 LEU D CD1  1 
ATOM 6003  C CD2  . LEU B 2 327 ? 167.930 235.013 214.780 1.00 160.65 ? 348 LEU D CD2  1 
ATOM 6004  H H    . LEU B 2 327 ? 164.057 236.052 215.074 1.00 192.78 ? 348 LEU D H    1 
ATOM 6005  H HA   . LEU B 2 327 ? 165.695 234.513 216.357 1.00 192.78 ? 348 LEU D HA   1 
ATOM 6006  H HB2  . LEU B 2 327 ? 165.754 237.405 215.890 1.00 192.78 ? 348 LEU D HB2  1 
ATOM 6007  H HB3  . LEU B 2 327 ? 167.070 236.571 216.722 1.00 192.78 ? 348 LEU D HB3  1 
ATOM 6008  H HG   . LEU B 2 327 ? 166.198 235.916 213.889 1.00 192.78 ? 348 LEU D HG   1 
ATOM 6009  H HD11 . LEU B 2 327 ? 168.150 237.225 213.184 1.00 192.78 ? 348 LEU D HD11 1 
ATOM 6010  H HD12 . LEU B 2 327 ? 166.950 238.235 214.024 1.00 192.78 ? 348 LEU D HD12 1 
ATOM 6011  H HD13 . LEU B 2 327 ? 168.428 237.719 214.871 1.00 192.78 ? 348 LEU D HD13 1 
ATOM 6012  H HD21 . LEU B 2 327 ? 168.408 234.811 213.821 1.00 192.78 ? 348 LEU D HD21 1 
ATOM 6013  H HD22 . LEU B 2 327 ? 168.690 235.271 215.518 1.00 192.78 ? 348 LEU D HD22 1 
ATOM 6014  H HD23 . LEU B 2 327 ? 167.389 234.126 215.110 1.00 192.78 ? 348 LEU D HD23 1 
ATOM 6015  N N    . ARG B 2 328 ? 164.165 236.542 218.295 1.00 159.01 ? 349 ARG D N    1 
ATOM 6016  C CA   . ARG B 2 328 ? 163.869 236.822 219.697 1.00 159.01 ? 349 ARG D CA   1 
ATOM 6017  C C    . ARG B 2 328 ? 163.331 235.585 220.403 1.00 159.01 ? 349 ARG D C    1 
ATOM 6018  O O    . ARG B 2 328 ? 163.863 235.168 221.441 1.00 159.01 ? 349 ARG D O    1 
ATOM 6019  C CB   . ARG B 2 328 ? 162.855 237.950 219.817 1.00 159.01 ? 349 ARG D CB   1 
ATOM 6020  C CG   . ARG B 2 328 ? 162.451 238.299 221.240 1.00 159.01 ? 349 ARG D CG   1 
ATOM 6021  C CD   . ARG B 2 328 ? 163.593 238.846 222.017 1.00 159.01 ? 349 ARG D CD   1 
ATOM 6022  N NE   . ARG B 2 328 ? 164.114 240.069 221.427 1.00 159.01 ? 349 ARG D NE   1 
ATOM 6023  C CZ   . ARG B 2 328 ? 163.612 241.299 221.648 1.00 159.01 ? 349 ARG D CZ   1 
ATOM 6024  N NH1  . ARG B 2 328 ? 162.579 241.454 222.447 1.00 159.01 ? 349 ARG D NH1  1 
ATOM 6025  N NH2  . ARG B 2 328 ? 164.158 242.351 221.063 1.00 159.01 ? 349 ARG D NH2  1 
ATOM 6026  H H    . ARG B 2 328 ? 163.739 237.039 217.737 1.00 190.81 ? 349 ARG D H    1 
ATOM 6027  H HA   . ARG B 2 328 ? 164.684 237.097 220.145 1.00 190.81 ? 349 ARG D HA   1 
ATOM 6028  H HB2  . ARG B 2 328 ? 163.258 238.852 219.358 1.00 190.81 ? 349 ARG D HB2  1 
ATOM 6029  H HB3  . ARG B 2 328 ? 161.948 237.684 219.273 1.00 190.81 ? 349 ARG D HB3  1 
ATOM 6030  H HG2  . ARG B 2 328 ? 161.660 239.049 221.221 1.00 190.81 ? 349 ARG D HG2  1 
ATOM 6031  H HG3  . ARG B 2 328 ? 162.090 237.403 221.746 1.00 190.81 ? 349 ARG D HG3  1 
ATOM 6032  H HD2  . ARG B 2 328 ? 163.269 239.069 223.033 1.00 190.81 ? 349 ARG D HD2  1 
ATOM 6033  H HD3  . ARG B 2 328 ? 164.398 238.112 222.045 1.00 190.81 ? 349 ARG D HD3  1 
ATOM 6034  H HE   . ARG B 2 328 ? 164.909 239.990 220.807 1.00 190.81 ? 349 ARG D HE   1 
ATOM 6035  H HH11 . ARG B 2 328 ? 162.161 240.650 222.894 1.00 190.81 ? 349 ARG D HH11 1 
ATOM 6036  H HH12 . ARG B 2 328 ? 162.202 242.376 222.613 1.00 190.81 ? 349 ARG D HH12 1 
ATOM 6037  H HH21 . ARG B 2 328 ? 164.952 242.232 220.449 1.00 190.81 ? 349 ARG D HH21 1 
ATOM 6038  H HH22 . ARG B 2 328 ? 163.782 243.273 221.229 1.00 190.81 ? 349 ARG D HH22 1 
ATOM 6039  N N    . ASN B 2 329 ? 162.268 234.991 219.855 1.00 156.80 ? 350 ASN D N    1 
ATOM 6040  C CA   . ASN B 2 329 ? 161.679 233.794 220.440 1.00 156.80 ? 350 ASN D CA   1 
ATOM 6041  C C    . ASN B 2 329 ? 162.577 232.581 220.258 1.00 156.80 ? 350 ASN D C    1 
ATOM 6042  O O    . ASN B 2 329 ? 162.748 231.793 221.193 1.00 156.80 ? 350 ASN D O    1 
ATOM 6043  C CB   . ASN B 2 329 ? 160.307 233.532 219.846 1.00 156.80 ? 350 ASN D CB   1 
ATOM 6044  C CG   . ASN B 2 329 ? 159.292 234.561 220.261 1.00 156.80 ? 350 ASN D CG   1 
ATOM 6045  O OD1  . ASN B 2 329 ? 159.447 235.223 221.294 1.00 156.80 ? 350 ASN D OD1  1 
ATOM 6046  N ND2  . ASN B 2 329 ? 158.255 234.708 219.477 1.00 156.80 ? 350 ASN D ND2  1 
ATOM 6047  H H    . ASN B 2 329 ? 161.873 235.265 219.142 1.00 188.16 ? 350 ASN D H    1 
ATOM 6048  H HA   . ASN B 2 329 ? 161.556 233.935 221.391 1.00 188.16 ? 350 ASN D HA   1 
ATOM 6049  H HB2  . ASN B 2 329 ? 160.376 233.526 218.757 1.00 188.16 ? 350 ASN D HB2  1 
ATOM 6050  H HB3  . ASN B 2 329 ? 159.958 232.548 220.157 1.00 188.16 ? 350 ASN D HB3  1 
ATOM 6051  H HD21 . ASN B 2 329 ? 157.547 235.378 219.703 1.00 188.16 ? 350 ASN D HD21 1 
ATOM 6052  H HD22 . ASN B 2 329 ? 158.170 234.151 218.651 1.00 188.16 ? 350 ASN D HD22 1 
ATOM 6053  N N    . ALA B 2 330 ? 163.188 232.428 219.080 1.00 156.70 ? 351 ALA D N    1 
ATOM 6054  C CA   . ALA B 2 330 ? 164.016 231.257 218.831 1.00 156.70 ? 351 ALA D CA   1 
ATOM 6055  C C    . ALA B 2 330 ? 165.210 231.212 219.774 1.00 156.70 ? 351 ALA D C    1 
ATOM 6056  O O    . ALA B 2 330 ? 165.503 230.163 220.355 1.00 156.70 ? 351 ALA D O    1 
ATOM 6057  C CB   . ALA B 2 330 ? 164.467 231.247 217.370 1.00 156.70 ? 351 ALA D CB   1 
ATOM 6058  H H    . ALA B 2 330 ? 163.138 232.980 218.423 1.00 188.04 ? 351 ALA D H    1 
ATOM 6059  H HA   . ALA B 2 330 ? 163.487 230.461 218.988 1.00 188.04 ? 351 ALA D HA   1 
ATOM 6060  H HB1  . ALA B 2 330 ? 164.993 230.450 217.206 1.00 188.04 ? 351 ALA D HB1  1 
ATOM 6061  H HB2  . ALA B 2 330 ? 163.682 231.250 216.799 1.00 188.04 ? 351 ALA D HB2  1 
ATOM 6062  H HB3  . ALA B 2 330 ? 165.001 232.039 217.200 1.00 188.04 ? 351 ALA D HB3  1 
ATOM 6063  N N    . ILE B 2 331 ? 165.903 232.341 219.957 1.00 165.54 ? 352 ILE D N    1 
ATOM 6064  C CA   . ILE B 2 331 ? 167.090 232.349 220.808 1.00 165.54 ? 352 ILE D CA   1 
ATOM 6065  C C    . ILE B 2 331 ? 166.694 232.150 222.267 1.00 165.54 ? 352 ILE D C    1 
ATOM 6066  O O    . ILE B 2 331 ? 167.308 231.352 222.988 1.00 165.54 ? 352 ILE D O    1 
ATOM 6067  C CB   . ILE B 2 331 ? 167.896 233.651 220.603 1.00 165.54 ? 352 ILE D CB   1 
ATOM 6068  C CG1  . ILE B 2 331 ? 168.426 233.733 219.161 1.00 165.54 ? 352 ILE D CG1  1 
ATOM 6069  C CG2  . ILE B 2 331 ? 169.085 233.731 221.591 1.00 165.54 ? 352 ILE D CG2  1 
ATOM 6070  C CD1  . ILE B 2 331 ? 169.015 235.086 218.766 1.00 165.54 ? 352 ILE D CD1  1 
ATOM 6071  H H    . ILE B 2 331 ? 165.709 233.101 219.605 1.00 198.65 ? 352 ILE D H    1 
ATOM 6072  H HA   . ILE B 2 331 ? 167.661 231.607 220.552 1.00 198.65 ? 352 ILE D HA   1 
ATOM 6073  H HB   . ILE B 2 331 ? 167.310 234.407 220.762 1.00 198.65 ? 352 ILE D HB   1 
ATOM 6074  H HG12 . ILE B 2 331 ? 169.126 233.070 219.055 1.00 198.65 ? 352 ILE D HG12 1 
ATOM 6075  H HG13 . ILE B 2 331 ? 167.710 233.549 218.537 1.00 198.65 ? 352 ILE D HG13 1 
ATOM 6076  H HG21 . ILE B 2 331 ? 169.628 234.504 221.385 1.00 198.65 ? 352 ILE D HG21 1 
ATOM 6077  H HG22 . ILE B 2 331 ? 168.776 233.821 222.504 1.00 198.65 ? 352 ILE D HG22 1 
ATOM 6078  H HG23 . ILE B 2 331 ? 169.621 232.928 221.500 1.00 198.65 ? 352 ILE D HG23 1 
ATOM 6079  H HD11 . ILE B 2 331 ? 169.248 235.060 217.825 1.00 198.65 ? 352 ILE D HD11 1 
ATOM 6080  H HD12 . ILE B 2 331 ? 168.355 235.778 218.922 1.00 198.65 ? 352 ILE D HD12 1 
ATOM 6081  H HD13 . ILE B 2 331 ? 169.811 235.265 219.288 1.00 198.65 ? 352 ILE D HD13 1 
ATOM 6082  N N    . GLN B 2 332 ? 165.661 232.866 222.725 1.00 177.07 ? 353 GLN D N    1 
ATOM 6083  C CA   . GLN B 2 332 ? 165.205 232.704 224.103 1.00 177.07 ? 353 GLN D CA   1 
ATOM 6084  C C    . GLN B 2 332 ? 164.618 231.315 224.329 1.00 177.07 ? 353 GLN D C    1 
ATOM 6085  O O    . GLN B 2 332 ? 164.977 230.628 225.292 1.00 177.07 ? 353 GLN D O    1 
ATOM 6086  C CB   . GLN B 2 332 ? 164.166 233.773 224.454 1.00 177.07 ? 353 GLN D CB   1 
ATOM 6087  C CG   . GLN B 2 332 ? 164.732 235.179 224.561 1.00 177.07 ? 353 GLN D CG   1 
ATOM 6088  C CD   . GLN B 2 332 ? 163.655 236.219 224.804 1.00 177.07 ? 353 GLN D CD   1 
ATOM 6089  O OE1  . GLN B 2 332 ? 162.503 236.048 224.395 1.00 177.07 ? 353 GLN D OE1  1 
ATOM 6090  N NE2  . GLN B 2 332 ? 164.023 237.305 225.473 1.00 177.07 ? 353 GLN D NE2  1 
ATOM 6091  H H    . GLN B 2 332 ? 165.217 233.441 222.265 1.00 212.48 ? 353 GLN D H    1 
ATOM 6092  H HA   . GLN B 2 332 ? 165.962 232.810 224.699 1.00 212.48 ? 353 GLN D HA   1 
ATOM 6093  H HB2  . GLN B 2 332 ? 163.383 233.782 223.697 1.00 212.48 ? 353 GLN D HB2  1 
ATOM 6094  H HB3  . GLN B 2 332 ? 163.698 233.526 225.407 1.00 212.48 ? 353 GLN D HB3  1 
ATOM 6095  H HG2  . GLN B 2 332 ? 165.436 235.214 225.393 1.00 212.48 ? 353 GLN D HG2  1 
ATOM 6096  H HG3  . GLN B 2 332 ? 165.242 235.426 223.630 1.00 212.48 ? 353 GLN D HG3  1 
ATOM 6097  H HE21 . GLN B 2 332 ? 163.356 238.026 225.664 1.00 212.48 ? 353 GLN D HE21 1 
ATOM 6098  H HE22 . GLN B 2 332 ? 164.968 237.403 225.787 1.00 212.48 ? 353 GLN D HE22 1 
ATOM 6099  N N    . ALA B 2 333 ? 163.722 230.878 223.442 1.00 179.56 ? 354 ALA D N    1 
ATOM 6100  C CA   . ALA B 2 333 ? 163.088 229.577 223.609 1.00 179.56 ? 354 ALA D CA   1 
ATOM 6101  C C    . ALA B 2 333 ? 164.120 228.459 223.632 1.00 179.56 ? 354 ALA D C    1 
ATOM 6102  O O    . ALA B 2 333 ? 164.069 227.572 224.491 1.00 179.56 ? 354 ALA D O    1 
ATOM 6103  C CB   . ALA B 2 333 ? 162.078 229.348 222.490 1.00 179.56 ? 354 ALA D CB   1 
ATOM 6104  H H    . ALA B 2 333 ? 163.469 231.312 222.744 1.00 215.47 ? 354 ALA D H    1 
ATOM 6105  H HA   . ALA B 2 333 ? 162.609 229.564 224.452 1.00 215.47 ? 354 ALA D HA   1 
ATOM 6106  H HB1  . ALA B 2 333 ? 161.661 228.482 222.608 1.00 215.47 ? 354 ALA D HB1  1 
ATOM 6107  H HB2  . ALA B 2 333 ? 161.407 230.048 222.520 1.00 215.47 ? 354 ALA D HB2  1 
ATOM 6108  H HB3  . ALA B 2 333 ? 162.551 229.379 221.644 1.00 215.47 ? 354 ALA D HB3  1 
ATOM 6109  N N    . PHE B 2 334 ? 165.055 228.473 222.677 1.00 194.86 ? 355 PHE D N    1 
ATOM 6110  C CA   . PHE B 2 334 ? 166.121 227.480 222.652 1.00 194.86 ? 355 PHE D CA   1 
ATOM 6111  C C    . PHE B 2 334 ? 166.940 227.534 223.934 1.00 194.86 ? 355 PHE D C    1 
ATOM 6112  O O    . PHE B 2 334 ? 167.142 226.515 224.605 1.00 194.86 ? 355 PHE D O    1 
ATOM 6113  C CB   . PHE B 2 334 ? 167.035 227.703 221.445 1.00 194.86 ? 355 PHE D CB   1 
ATOM 6114  C CG   . PHE B 2 334 ? 168.198 226.755 221.382 1.00 194.86 ? 355 PHE D CG   1 
ATOM 6115  C CD1  . PHE B 2 334 ? 169.348 226.996 222.119 1.00 194.86 ? 355 PHE D CD1  1 
ATOM 6116  C CD2  . PHE B 2 334 ? 168.145 225.620 220.587 1.00 194.86 ? 355 PHE D CD2  1 
ATOM 6117  C CE1  . PHE B 2 334 ? 170.420 226.126 222.062 1.00 194.86 ? 355 PHE D CE1  1 
ATOM 6118  C CE2  . PHE B 2 334 ? 169.215 224.747 220.529 1.00 194.86 ? 355 PHE D CE2  1 
ATOM 6119  C CZ   . PHE B 2 334 ? 170.353 225.000 221.266 1.00 194.86 ? 355 PHE D CZ   1 
ATOM 6120  H H    . PHE B 2 334 ? 165.092 229.048 222.038 1.00 233.83 ? 355 PHE D H    1 
ATOM 6121  H HA   . PHE B 2 334 ? 165.734 226.595 222.576 1.00 233.83 ? 355 PHE D HA   1 
ATOM 6122  H HB2  . PHE B 2 334 ? 166.458 227.593 220.527 1.00 233.83 ? 355 PHE D HB2  1 
ATOM 6123  H HB3  . PHE B 2 334 ? 167.425 228.719 221.467 1.00 233.83 ? 355 PHE D HB3  1 
ATOM 6124  H HD1  . PHE B 2 334 ? 169.401 227.885 222.748 1.00 233.83 ? 355 PHE D HD1  1 
ATOM 6125  H HD2  . PHE B 2 334 ? 167.246 225.420 220.004 1.00 233.83 ? 355 PHE D HD2  1 
ATOM 6126  H HE1  . PHE B 2 334 ? 171.318 226.328 222.645 1.00 233.83 ? 355 PHE D HE1  1 
ATOM 6127  H HE2  . PHE B 2 334 ? 169.160 223.859 219.900 1.00 233.83 ? 355 PHE D HE2  1 
ATOM 6128  H HZ   . PHE B 2 334 ? 171.196 224.313 221.222 1.00 233.83 ? 355 PHE D HZ   1 
ATOM 6129  N N    . GLY B 2 335 ? 167.427 228.725 224.287 1.00 180.48 ? 356 GLY D N    1 
ATOM 6130  C CA   . GLY B 2 335 ? 168.223 228.855 225.492 1.00 180.48 ? 356 GLY D CA   1 
ATOM 6131  C C    . GLY B 2 335 ? 167.482 228.421 226.740 1.00 180.48 ? 356 GLY D C    1 
ATOM 6132  O O    . GLY B 2 335 ? 168.100 227.965 227.707 1.00 180.48 ? 356 GLY D O    1 
ATOM 6133  H H    . GLY B 2 335 ? 167.309 229.457 223.851 1.00 216.58 ? 356 GLY D H    1 
ATOM 6134  H HA2  . GLY B 2 335 ? 169.024 228.314 225.408 1.00 216.58 ? 356 GLY D HA2  1 
ATOM 6135  H HA3  . GLY B 2 335 ? 168.489 229.781 225.585 1.00 216.58 ? 356 GLY D HA3  1 
ATOM 6136  N N    . ASN B 2 336 ? 166.154 228.551 226.743 1.00 181.49 ? 357 ASN D N    1 
ATOM 6137  C CA   . ASN B 2 336 ? 165.336 228.155 227.882 1.00 181.49 ? 357 ASN D CA   1 
ATOM 6138  C C    . ASN B 2 336 ? 164.979 226.672 227.881 1.00 181.49 ? 357 ASN D C    1 
ATOM 6139  O O    . ASN B 2 336 ? 164.305 226.221 228.814 1.00 181.49 ? 357 ASN D O    1 
ATOM 6140  C CB   . ASN B 2 336 ? 164.073 228.995 227.930 1.00 181.49 ? 357 ASN D CB   1 
ATOM 6141  C CG   . ASN B 2 336 ? 164.342 230.419 228.333 1.00 181.49 ? 357 ASN D CG   1 
ATOM 6142  O OD1  . ASN B 2 336 ? 165.327 230.707 229.022 1.00 181.49 ? 357 ASN D OD1  1 
ATOM 6143  N ND2  . ASN B 2 336 ? 163.484 231.315 227.916 1.00 181.49 ? 357 ASN D ND2  1 
ATOM 6144  H H    . ASN B 2 336 ? 165.699 228.873 226.088 1.00 217.79 ? 357 ASN D H    1 
ATOM 6145  H HA   . ASN B 2 336 ? 165.825 228.339 228.699 1.00 217.79 ? 357 ASN D HA   1 
ATOM 6146  H HB2  . ASN B 2 336 ? 163.595 228.991 226.949 1.00 217.79 ? 357 ASN D HB2  1 
ATOM 6147  H HB3  . ASN B 2 336 ? 163.370 228.556 228.638 1.00 217.79 ? 357 ASN D HB3  1 
ATOM 6148  H HD21 . ASN B 2 336 ? 163.612 232.279 228.153 1.00 217.79 ? 357 ASN D HD21 1 
ATOM 6149  H HD22 . ASN B 2 336 ? 162.701 231.037 227.360 1.00 217.79 ? 357 ASN D HD22 1 
ATOM 6150  N N    . GLY B 2 337 ? 165.402 225.911 226.869 1.00 200.75 ? 358 GLY D N    1 
ATOM 6151  C CA   . GLY B 2 337 ? 165.084 224.497 226.779 1.00 200.75 ? 358 GLY D CA   1 
ATOM 6152  C C    . GLY B 2 337 ? 163.859 224.200 225.938 1.00 200.75 ? 358 GLY D C    1 
ATOM 6153  O O    . GLY B 2 337 ? 163.184 223.189 226.157 1.00 200.75 ? 358 GLY D O    1 
ATOM 6154  H H    . GLY B 2 337 ? 165.879 226.193 226.212 1.00 240.90 ? 358 GLY D H    1 
ATOM 6155  H HA2  . GLY B 2 337 ? 165.836 224.035 226.378 1.00 240.90 ? 358 GLY D HA2  1 
ATOM 6156  H HA3  . GLY B 2 337 ? 164.943 224.123 227.662 1.00 240.90 ? 358 GLY D HA3  1 
ATOM 6157  N N    . THR B 2 338 ? 163.566 225.074 224.976 1.00 201.55 ? 359 THR D N    1 
ATOM 6158  C CA   . THR B 2 338 ? 162.469 224.874 224.028 1.00 201.55 ? 359 THR D CA   1 
ATOM 6159  C C    . THR B 2 338 ? 162.993 225.031 222.605 1.00 201.55 ? 359 THR D C    1 
ATOM 6160  O O    . THR B 2 338 ? 162.546 224.341 221.689 1.00 201.55 ? 359 THR D O    1 
ATOM 6161  C CB   . THR B 2 338 ? 161.315 225.863 224.277 1.00 201.55 ? 359 THR D CB   1 
ATOM 6162  O OG1  . THR B 2 338 ? 160.782 225.658 225.592 1.00 201.55 ? 359 THR D OG1  1 
ATOM 6163  C CG2  . THR B 2 338 ? 160.211 225.664 223.250 1.00 201.55 ? 359 THR D CG2  1 
ATOM 6164  H H    . THR B 2 338 ? 163.997 225.808 224.851 1.00 241.86 ? 359 THR D H    1 
ATOM 6165  H HA   . THR B 2 338 ? 162.105 223.980 224.109 1.00 241.86 ? 359 THR D HA   1 
ATOM 6166  H HB   . THR B 2 338 ? 161.689 226.884 224.207 1.00 241.86 ? 359 THR D HB   1 
ATOM 6167  H HG1  . THR B 2 338 ? 161.353 226.081 226.238 1.00 241.86 ? 359 THR D HG1  1 
ATOM 6168  H HG21 . THR B 2 338 ? 159.405 226.371 223.442 1.00 241.86 ? 359 THR D HG21 1 
ATOM 6169  H HG22 . THR B 2 338 ? 160.611 225.830 222.250 1.00 241.86 ? 359 THR D HG22 1 
ATOM 6170  H HG23 . THR B 2 338 ? 159.826 224.647 223.322 1.00 241.86 ? 359 THR D HG23 1 
ATOM 6171  N N    . LEU C 1 3   ? 221.879 226.630 243.643 1.00 207.86 ? 98  LEU A N    1 
ATOM 6172  C CA   . LEU C 1 3   ? 222.213 225.510 244.514 1.00 207.86 ? 98  LEU A CA   1 
ATOM 6173  C C    . LEU C 1 3   ? 223.450 224.777 244.006 1.00 207.86 ? 98  LEU A C    1 
ATOM 6174  O O    . LEU C 1 3   ? 223.838 224.923 242.847 1.00 207.86 ? 98  LEU A O    1 
ATOM 6175  C CB   . LEU C 1 3   ? 221.037 224.535 244.612 1.00 207.86 ? 98  LEU A CB   1 
ATOM 6176  C CG   . LEU C 1 3   ? 219.706 225.071 245.163 1.00 207.86 ? 98  LEU A CG   1 
ATOM 6177  C CD1  . LEU C 1 3   ? 218.654 223.976 245.082 1.00 207.86 ? 98  LEU A CD1  1 
ATOM 6178  C CD2  . LEU C 1 3   ? 219.785 225.633 246.607 1.00 207.86 ? 98  LEU A CD2  1 
ATOM 6179  H H    . LEU C 1 3   ? 220.990 226.660 243.186 1.00 249.43 ? 98  LEU A H    1 
ATOM 6180  H HA   . LEU C 1 3   ? 222.407 225.846 245.402 1.00 249.43 ? 98  LEU A HA   1 
ATOM 6181  H HB2  . LEU C 1 3   ? 220.858 224.191 243.724 1.00 249.43 ? 98  LEU A HB2  1 
ATOM 6182  H HB3  . LEU C 1 3   ? 221.305 223.802 245.188 1.00 249.43 ? 98  LEU A HB3  1 
ATOM 6183  H HG   . LEU C 1 3   ? 219.411 225.796 244.590 1.00 249.43 ? 98  LEU A HG   1 
ATOM 6184  H HD11 . LEU C 1 3   ? 217.817 224.315 245.435 1.00 249.43 ? 98  LEU A HD11 1 
ATOM 6185  H HD12 . LEU C 1 3   ? 218.541 223.715 244.154 1.00 249.43 ? 98  LEU A HD12 1 
ATOM 6186  H HD13 . LEU C 1 3   ? 218.950 223.215 245.605 1.00 249.43 ? 98  LEU A HD13 1 
ATOM 6187  H HD21 . LEU C 1 3   ? 218.905 225.941 246.872 1.00 249.43 ? 98  LEU A HD21 1 
ATOM 6188  H HD22 . LEU C 1 3   ? 220.081 224.927 247.202 1.00 249.43 ? 98  LEU A HD22 1 
ATOM 6189  H HD23 . LEU C 1 3   ? 220.415 226.370 246.629 1.00 249.43 ? 98  LEU A HD23 1 
ATOM 6190  N N    . GLY C 1 4   ? 224.066 223.985 244.886 1.00 219.91 ? 99  GLY A N    1 
ATOM 6191  C CA   . GLY C 1 4   ? 225.212 223.184 244.495 1.00 219.91 ? 99  GLY A CA   1 
ATOM 6192  C C    . GLY C 1 4   ? 224.863 221.992 243.627 1.00 219.91 ? 99  GLY A C    1 
ATOM 6193  O O    . GLY C 1 4   ? 225.769 221.327 243.115 1.00 219.91 ? 99  GLY A O    1 
ATOM 6194  H H    . GLY C 1 4   ? 223.838 223.899 245.711 1.00 263.89 ? 99  GLY A H    1 
ATOM 6195  H HA2  . GLY C 1 4   ? 225.836 223.741 244.004 1.00 263.89 ? 99  GLY A HA2  1 
ATOM 6196  H HA3  . GLY C 1 4   ? 225.659 222.858 245.291 1.00 263.89 ? 99  GLY A HA3  1 
ATOM 6197  N N    . ALA C 1 5   ? 223.574 221.703 243.455 1.00 235.24 ? 100 ALA A N    1 
ATOM 6198  C CA   . ALA C 1 5   ? 223.165 220.565 242.645 1.00 235.24 ? 100 ALA A CA   1 
ATOM 6199  C C    . ALA C 1 5   ? 223.729 220.687 241.236 1.00 235.24 ? 100 ALA A C    1 
ATOM 6200  O O    . ALA C 1 5   ? 223.680 221.754 240.617 1.00 235.24 ? 100 ALA A O    1 
ATOM 6201  C CB   . ALA C 1 5   ? 221.640 220.468 242.597 1.00 235.24 ? 100 ALA A CB   1 
ATOM 6202  H H    . ALA C 1 5   ? 222.919 222.144 243.794 1.00 282.29 ? 100 ALA A H    1 
ATOM 6203  H HA   . ALA C 1 5   ? 223.510 219.749 243.042 1.00 282.29 ? 100 ALA A HA   1 
ATOM 6204  H HB1  . ALA C 1 5   ? 221.391 219.700 242.058 1.00 282.29 ? 100 ALA A HB1  1 
ATOM 6205  H HB2  . ALA C 1 5   ? 221.302 220.363 243.500 1.00 282.29 ? 100 ALA A HB2  1 
ATOM 6206  H HB3  . ALA C 1 5   ? 221.285 221.279 242.202 1.00 282.29 ? 100 ALA A HB3  1 
ATOM 6207  N N    . ARG C 1 6   ? 224.266 219.583 240.731 1.00 247.97 ? 101 ARG A N    1 
ATOM 6208  C CA   . ARG C 1 6   ? 224.822 219.546 239.391 1.00 247.97 ? 101 ARG A CA   1 
ATOM 6209  C C    . ARG C 1 6   ? 223.714 219.330 238.357 1.00 247.97 ? 101 ARG A C    1 
ATOM 6210  O O    . ARG C 1 6   ? 222.642 218.815 238.684 1.00 247.97 ? 101 ARG A O    1 
ATOM 6211  C CB   . ARG C 1 6   ? 225.858 218.438 239.273 1.00 247.97 ? 101 ARG A CB   1 
ATOM 6212  C CG   . ARG C 1 6   ? 227.056 218.581 240.198 1.00 247.97 ? 101 ARG A CG   1 
ATOM 6213  C CD   . ARG C 1 6   ? 227.880 219.767 239.850 1.00 247.97 ? 101 ARG A CD   1 
ATOM 6214  N NE   . ARG C 1 6   ? 227.417 220.967 240.528 1.00 247.97 ? 101 ARG A NE   1 
ATOM 6215  C CZ   . ARG C 1 6   ? 227.797 222.220 240.211 1.00 247.97 ? 101 ARG A CZ   1 
ATOM 6216  N NH1  . ARG C 1 6   ? 228.644 222.421 239.226 1.00 247.97 ? 101 ARG A NH1  1 
ATOM 6217  N NH2  . ARG C 1 6   ? 227.318 223.248 240.890 1.00 247.97 ? 101 ARG A NH2  1 
ATOM 6218  H H    . ARG C 1 6   ? 224.319 218.835 241.152 1.00 297.56 ? 101 ARG A H    1 
ATOM 6219  H HA   . ARG C 1 6   ? 225.251 220.397 239.230 1.00 297.56 ? 101 ARG A HA   1 
ATOM 6220  H HB2  . ARG C 1 6   ? 225.390 217.478 239.486 1.00 297.56 ? 101 ARG A HB2  1 
ATOM 6221  H HB3  . ARG C 1 6   ? 226.234 218.399 238.250 1.00 297.56 ? 101 ARG A HB3  1 
ATOM 6222  H HG2  . ARG C 1 6   ? 226.711 218.694 241.226 1.00 297.56 ? 101 ARG A HG2  1 
ATOM 6223  H HG3  . ARG C 1 6   ? 227.684 217.693 240.121 1.00 297.56 ? 101 ARG A HG3  1 
ATOM 6224  H HD2  . ARG C 1 6   ? 228.915 219.589 240.141 1.00 297.56 ? 101 ARG A HD2  1 
ATOM 6225  H HD3  . ARG C 1 6   ? 227.830 219.942 238.776 1.00 297.56 ? 101 ARG A HD3  1 
ATOM 6226  H HE   . ARG C 1 6   ? 226.764 220.853 241.292 1.00 297.56 ? 101 ARG A HE   1 
ATOM 6227  H HH11 . ARG C 1 6   ? 229.010 221.635 238.707 1.00 297.56 ? 101 ARG A HH11 1 
ATOM 6228  H HH12 . ARG C 1 6   ? 228.928 223.360 238.988 1.00 297.56 ? 101 ARG A HH12 1 
ATOM 6229  H HH21 . ARG C 1 6   ? 226.666 223.094 241.647 1.00 297.56 ? 101 ARG A HH21 1 
ATOM 6230  H HH22 . ARG C 1 6   ? 227.602 224.187 240.652 1.00 297.56 ? 101 ARG A HH22 1 
ATOM 6231  N N    . PRO C 1 7   ? 223.943 219.713 237.098 1.00 257.70 ? 102 PRO A N    1 
ATOM 6232  C CA   . PRO C 1 7   ? 222.890 219.562 236.085 1.00 257.70 ? 102 PRO A CA   1 
ATOM 6233  C C    . PRO C 1 7   ? 222.633 218.106 235.723 1.00 257.70 ? 102 PRO A C    1 
ATOM 6234  O O    . PRO C 1 7   ? 223.484 217.225 235.874 1.00 257.70 ? 102 PRO A O    1 
ATOM 6235  C CB   . PRO C 1 7   ? 223.437 220.340 234.886 1.00 257.70 ? 102 PRO A CB   1 
ATOM 6236  C CG   . PRO C 1 7   ? 224.903 220.324 235.075 1.00 257.70 ? 102 PRO A CG   1 
ATOM 6237  C CD   . PRO C 1 7   ? 225.131 220.404 236.555 1.00 257.70 ? 102 PRO A CD   1 
ATOM 6238  H HA   . PRO C 1 7   ? 222.066 219.971 236.388 1.00 309.24 ? 102 PRO A HA   1 
ATOM 6239  H HB2  . PRO C 1 7   ? 223.190 219.890 234.063 1.00 309.24 ? 102 PRO A HB2  1 
ATOM 6240  H HB3  . PRO C 1 7   ? 223.097 221.249 234.899 1.00 309.24 ? 102 PRO A HB3  1 
ATOM 6241  H HG2  . PRO C 1 7   ? 225.266 219.498 234.719 1.00 309.24 ? 102 PRO A HG2  1 
ATOM 6242  H HG3  . PRO C 1 7   ? 225.295 221.090 234.628 1.00 309.24 ? 102 PRO A HG3  1 
ATOM 6243  H HD2  . PRO C 1 7   ? 225.950 219.943 236.787 1.00 309.24 ? 102 PRO A HD2  1 
ATOM 6244  H HD3  . PRO C 1 7   ? 225.152 221.330 236.842 1.00 309.24 ? 102 PRO A HD3  1 
ATOM 6245  N N    . CYS C 1 8   ? 221.421 217.870 235.220 1.00 277.53 ? 103 CYS A N    1 
ATOM 6246  C CA   . CYS C 1 8   ? 221.031 216.556 234.724 1.00 277.53 ? 103 CYS A CA   1 
ATOM 6247  C C    . CYS C 1 8   ? 221.893 216.163 233.528 1.00 277.53 ? 103 CYS A C    1 
ATOM 6248  O O    . CYS C 1 8   ? 221.960 216.887 232.531 1.00 277.53 ? 103 CYS A O    1 
ATOM 6249  C CB   . CYS C 1 8   ? 219.558 216.545 234.317 1.00 277.53 ? 103 CYS A CB   1 
ATOM 6250  S SG   . CYS C 1 8   ? 218.973 214.946 233.703 1.00 277.53 ? 103 CYS A SG   1 
ATOM 6251  H H    . CYS C 1 8   ? 220.802 218.464 235.158 1.00 333.04 ? 103 CYS A H    1 
ATOM 6252  H HA   . CYS C 1 8   ? 221.156 215.892 235.416 1.00 333.04 ? 103 CYS A HA   1 
ATOM 6253  H HB2  . CYS C 1 8   ? 218.942 216.824 235.172 1.00 333.04 ? 103 CYS A HB2  1 
ATOM 6254  H HB3  . CYS C 1 8   ? 219.390 217.287 233.536 1.00 333.04 ? 103 CYS A HB3  1 
ATOM 6255  N N    . GLY C 1 9   ? 222.552 215.013 233.633 1.00 275.28 ? 104 GLY A N    1 
ATOM 6256  C CA   . GLY C 1 9   ? 223.409 214.540 232.562 1.00 275.28 ? 104 GLY A CA   1 
ATOM 6257  C C    . GLY C 1 9   ? 223.954 213.162 232.870 1.00 275.28 ? 104 GLY A C    1 
ATOM 6258  O O    . GLY C 1 9   ? 223.590 212.532 233.866 1.00 275.28 ? 104 GLY A O    1 
ATOM 6259  H H    . GLY C 1 9   ? 222.515 214.490 234.315 1.00 330.34 ? 104 GLY A H    1 
ATOM 6260  H HA2  . GLY C 1 9   ? 222.903 214.495 231.735 1.00 330.34 ? 104 GLY A HA2  1 
ATOM 6261  H HA3  . GLY C 1 9   ? 224.151 215.152 232.441 1.00 330.34 ? 104 GLY A HA3  1 
ATOM 6262  N N    . LEU C 1 10  ? 224.857 212.705 232.004 1.00 256.18 ? 105 LEU A N    1 
ATOM 6263  C CA   . LEU C 1 10  ? 225.420 211.363 232.107 1.00 256.18 ? 105 LEU A CA   1 
ATOM 6264  C C    . LEU C 1 10  ? 226.669 211.374 232.980 1.00 256.18 ? 105 LEU A C    1 
ATOM 6265  O O    . LEU C 1 10  ? 227.563 212.205 232.787 1.00 256.18 ? 105 LEU A O    1 
ATOM 6266  C CB   . LEU C 1 10  ? 225.761 210.818 230.715 1.00 256.18 ? 105 LEU A CB   1 
ATOM 6267  C CG   . LEU C 1 10  ? 224.562 210.528 229.802 1.00 256.18 ? 105 LEU A CG   1 
ATOM 6268  C CD1  . LEU C 1 10  ? 225.059 210.186 228.404 1.00 256.18 ? 105 LEU A CD1  1 
ATOM 6269  C CD2  . LEU C 1 10  ? 223.745 209.385 230.386 1.00 256.18 ? 105 LEU A CD2  1 
ATOM 6270  H H    . LEU C 1 10  ? 225.159 213.160 231.340 1.00 307.42 ? 105 LEU A H    1 
ATOM 6271  H HA   . LEU C 1 10  ? 224.767 210.773 232.513 1.00 307.42 ? 105 LEU A HA   1 
ATOM 6272  H HB2  . LEU C 1 10  ? 226.397 211.540 230.206 1.00 307.42 ? 105 LEU A HB2  1 
ATOM 6273  H HB3  . LEU C 1 10  ? 226.321 209.891 230.832 1.00 307.42 ? 105 LEU A HB3  1 
ATOM 6274  H HG   . LEU C 1 10  ? 223.938 211.419 229.726 1.00 307.42 ? 105 LEU A HG   1 
ATOM 6275  H HD11 . LEU C 1 10  ? 224.208 209.980 227.756 1.00 307.42 ? 105 LEU A HD11 1 
ATOM 6276  H HD12 . LEU C 1 10  ? 225.624 211.028 228.003 1.00 307.42 ? 105 LEU A HD12 1 
ATOM 6277  H HD13 . LEU C 1 10  ? 225.701 209.307 228.451 1.00 307.42 ? 105 LEU A HD13 1 
ATOM 6278  H HD21 . LEU C 1 10  ? 222.892 209.179 229.738 1.00 307.42 ? 105 LEU A HD21 1 
ATOM 6279  H HD22 . LEU C 1 10  ? 224.367 208.493 230.462 1.00 307.42 ? 105 LEU A HD22 1 
ATOM 6280  H HD23 . LEU C 1 10  ? 223.387 209.663 231.378 1.00 307.42 ? 105 LEU A HD23 1 
ATOM 6281  N N    . ARG C 1 11  ? 226.720 210.453 233.941 1.00 258.94 ? 106 ARG A N    1 
ATOM 6282  C CA   . ARG C 1 11  ? 227.904 210.148 234.735 1.00 258.94 ? 106 ARG A CA   1 
ATOM 6283  C C    . ARG C 1 11  ? 228.405 208.760 234.350 1.00 258.94 ? 106 ARG A C    1 
ATOM 6284  O O    . ARG C 1 11  ? 227.754 208.035 233.595 1.00 258.94 ? 106 ARG A O    1 
ATOM 6285  C CB   . ARG C 1 11  ? 227.596 210.197 236.225 1.00 258.94 ? 106 ARG A CB   1 
ATOM 6286  C CG   . ARG C 1 11  ? 227.626 211.588 236.839 1.00 258.94 ? 106 ARG A CG   1 
ATOM 6287  C CD   . ARG C 1 11  ? 226.490 212.421 236.366 1.00 258.94 ? 106 ARG A CD   1 
ATOM 6288  N NE   . ARG C 1 11  ? 226.364 213.650 237.132 1.00 258.94 ? 106 ARG A NE   1 
ATOM 6289  C CZ   . ARG C 1 11  ? 225.544 214.670 236.813 1.00 258.94 ? 106 ARG A CZ   1 
ATOM 6290  N NH1  . ARG C 1 11  ? 224.786 214.593 235.741 1.00 258.94 ? 106 ARG A NH1  1 
ATOM 6291  N NH2  . ARG C 1 11  ? 225.501 215.748 237.576 1.00 258.94 ? 106 ARG A NH2  1 
ATOM 6292  H H    . ARG C 1 11  ? 226.044 209.968 234.158 1.00 310.73 ? 106 ARG A H    1 
ATOM 6293  H HA   . ARG C 1 11  ? 228.605 210.789 234.543 1.00 310.73 ? 106 ARG A HA   1 
ATOM 6294  H HB2  . ARG C 1 11  ? 226.608 209.778 236.406 1.00 310.73 ? 106 ARG A HB2  1 
ATOM 6295  H HB3  . ARG C 1 11  ? 228.316 209.583 236.765 1.00 310.73 ? 106 ARG A HB3  1 
ATOM 6296  H HG2  . ARG C 1 11  ? 227.564 211.508 237.924 1.00 310.73 ? 106 ARG A HG2  1 
ATOM 6297  H HG3  . ARG C 1 11  ? 228.555 212.087 236.564 1.00 310.73 ? 106 ARG A HG3  1 
ATOM 6298  H HD2  . ARG C 1 11  ? 226.643 212.685 235.320 1.00 310.73 ? 106 ARG A HD2  1 
ATOM 6299  H HD3  . ARG C 1 11  ? 225.561 211.860 236.466 1.00 310.73 ? 106 ARG A HD3  1 
ATOM 6300  H HE   . ARG C 1 11  ? 226.931 213.746 237.964 1.00 310.73 ? 106 ARG A HE   1 
ATOM 6301  H HH11 . ARG C 1 11  ? 224.818 213.769 235.158 1.00 310.73 ? 106 ARG A HH11 1 
ATOM 6302  H HH12 . ARG C 1 11  ? 224.171 215.357 235.501 1.00 310.73 ? 106 ARG A HH12 1 
ATOM 6303  H HH21 . ARG C 1 11  ? 226.084 215.808 238.400 1.00 310.73 ? 106 ARG A HH21 1 
ATOM 6304  H HH22 . ARG C 1 11  ? 224.887 216.512 237.336 1.00 310.73 ? 106 ARG A HH22 1 
ATOM 6305  N N    . GLU C 1 12  ? 229.568 208.377 234.884 1.00 262.17 ? 107 GLU A N    1 
ATOM 6306  C CA   . GLU C 1 12  ? 230.135 207.067 234.589 1.00 262.17 ? 107 GLU A CA   1 
ATOM 6307  C C    . GLU C 1 12  ? 230.881 206.519 235.797 1.00 262.17 ? 107 GLU A C    1 
ATOM 6308  O O    . GLU C 1 12  ? 231.432 207.273 236.604 1.00 262.17 ? 107 GLU A O    1 
ATOM 6309  C CB   . GLU C 1 12  ? 231.077 207.148 233.386 1.00 262.17 ? 107 GLU A CB   1 
ATOM 6310  C CG   . GLU C 1 12  ? 232.317 208.000 233.615 1.00 262.17 ? 107 GLU A CG   1 
ATOM 6311  C CD   . GLU C 1 12  ? 233.191 208.102 232.395 1.00 262.17 ? 107 GLU A CD   1 
ATOM 6312  O OE1  . GLU C 1 12  ? 232.674 208.002 231.308 1.00 262.17 ? 107 GLU A OE1  1 
ATOM 6313  O OE2  . GLU C 1 12  ? 234.376 208.280 232.551 1.00 262.17 ? 107 GLU A OE2  1 
ATOM 6314  H H    . GLU C 1 12  ? 230.043 208.858 235.416 1.00 314.60 ? 107 GLU A H    1 
ATOM 6315  H HA   . GLU C 1 12  ? 229.424 206.443 234.393 1.00 314.60 ? 107 GLU A HA   1 
ATOM 6316  H HB2  . GLU C 1 12  ? 231.406 206.145 233.113 1.00 314.60 ? 107 GLU A HB2  1 
ATOM 6317  H HB3  . GLU C 1 12  ? 230.541 207.561 232.531 1.00 314.60 ? 107 GLU A HB3  1 
ATOM 6318  H HG2  . GLU C 1 12  ? 232.008 209.002 233.910 1.00 314.60 ? 107 GLU A HG2  1 
ATOM 6319  H HG3  . GLU C 1 12  ? 232.893 207.572 234.434 1.00 314.60 ? 107 GLU A HG3  1 
ATOM 6320  N N    . LEU C 1 13  ? 230.888 205.190 235.908 1.00 254.31 ? 108 LEU A N    1 
ATOM 6321  C CA   . LEU C 1 13  ? 231.742 204.497 236.865 1.00 254.31 ? 108 LEU A CA   1 
ATOM 6322  C C    . LEU C 1 13  ? 232.091 203.122 236.314 1.00 254.31 ? 108 LEU A C    1 
ATOM 6323  O O    . LEU C 1 13  ? 231.210 202.389 235.863 1.00 254.31 ? 108 LEU A O    1 
ATOM 6324  C CB   . LEU C 1 13  ? 231.042 204.363 238.223 1.00 254.31 ? 108 LEU A CB   1 
ATOM 6325  C CG   . LEU C 1 13  ? 231.800 203.556 239.285 1.00 254.31 ? 108 LEU A CG   1 
ATOM 6326  C CD1  . LEU C 1 13  ? 233.047 204.318 239.709 1.00 254.31 ? 108 LEU A CD1  1 
ATOM 6327  C CD2  . LEU C 1 13  ? 230.886 203.297 240.474 1.00 254.31 ? 108 LEU A CD2  1 
ATOM 6328  H H    . LEU C 1 13  ? 230.400 204.663 235.434 1.00 305.17 ? 108 LEU A H    1 
ATOM 6329  H HA   . LEU C 1 13  ? 232.563 205.001 236.976 1.00 305.17 ? 108 LEU A HA   1 
ATOM 6330  H HB2  . LEU C 1 13  ? 230.871 205.360 238.626 1.00 305.17 ? 108 LEU A HB2  1 
ATOM 6331  H HB3  . LEU C 1 13  ? 230.075 203.884 238.070 1.00 305.17 ? 108 LEU A HB3  1 
ATOM 6332  H HG   . LEU C 1 13  ? 232.119 202.604 238.859 1.00 305.17 ? 108 LEU A HG   1 
ATOM 6333  H HD11 . LEU C 1 13  ? 233.586 203.744 240.464 1.00 305.17 ? 108 LEU A HD11 1 
ATOM 6334  H HD12 . LEU C 1 13  ? 233.692 204.472 238.844 1.00 305.17 ? 108 LEU A HD12 1 
ATOM 6335  H HD13 . LEU C 1 13  ? 232.760 205.283 240.125 1.00 305.17 ? 108 LEU A HD13 1 
ATOM 6336  H HD21 . LEU C 1 13  ? 231.424 202.722 241.228 1.00 305.17 ? 108 LEU A HD21 1 
ATOM 6337  H HD22 . LEU C 1 13  ? 230.567 204.248 240.901 1.00 305.17 ? 108 LEU A HD22 1 
ATOM 6338  H HD23 . LEU C 1 13  ? 230.012 202.735 240.145 1.00 305.17 ? 108 LEU A HD23 1 
ATOM 6339  N N    . GLU C 1 14  ? 233.377 202.777 236.359 1.00 262.69 ? 109 GLU A N    1 
ATOM 6340  C CA   . GLU C 1 14  ? 233.839 201.467 235.915 1.00 262.69 ? 109 GLU A CA   1 
ATOM 6341  C C    . GLU C 1 14  ? 233.530 200.438 236.998 1.00 262.69 ? 109 GLU A C    1 
ATOM 6342  O O    . GLU C 1 14  ? 234.034 200.552 238.121 1.00 262.69 ? 109 GLU A O    1 
ATOM 6343  C CB   . GLU C 1 14  ? 235.339 201.488 235.611 1.00 262.69 ? 109 GLU A CB   1 
ATOM 6344  C CG   . GLU C 1 14  ? 235.896 200.167 235.101 1.00 262.69 ? 109 GLU A CG   1 
ATOM 6345  C CD   . GLU C 1 14  ? 237.367 200.231 234.795 1.00 262.69 ? 109 GLU A CD   1 
ATOM 6346  O OE1  . GLU C 1 14  ? 237.943 201.279 234.960 1.00 262.69 ? 109 GLU A OE1  1 
ATOM 6347  O OE2  . GLU C 1 14  ? 237.915 199.230 234.397 1.00 262.69 ? 109 GLU A OE2  1 
ATOM 6348  H H    . GLU C 1 14  ? 234.005 203.289 236.646 1.00 315.23 ? 109 GLU A H    1 
ATOM 6349  H HA   . GLU C 1 14  ? 233.372 201.211 235.104 1.00 315.23 ? 109 GLU A HA   1 
ATOM 6350  H HB2  . GLU C 1 14  ? 235.547 202.251 234.860 1.00 315.23 ? 109 GLU A HB2  1 
ATOM 6351  H HB3  . GLU C 1 14  ? 235.889 201.758 236.512 1.00 315.23 ? 109 GLU A HB3  1 
ATOM 6352  H HG2  . GLU C 1 14  ? 235.727 199.398 235.855 1.00 315.23 ? 109 GLU A HG2  1 
ATOM 6353  H HG3  . GLU C 1 14  ? 235.355 199.880 234.201 1.00 315.23 ? 109 GLU A HG3  1 
ATOM 6354  N N    . VAL C 1 15  ? 232.706 199.442 236.668 1.00 254.21 ? 110 VAL A N    1 
ATOM 6355  C CA   . VAL C 1 15  ? 232.256 198.449 237.644 1.00 254.21 ? 110 VAL A CA   1 
ATOM 6356  C C    . VAL C 1 15  ? 232.354 197.060 237.026 1.00 254.21 ? 110 VAL A C    1 
ATOM 6357  O O    . VAL C 1 15  ? 232.049 196.872 235.844 1.00 254.21 ? 110 VAL A O    1 
ATOM 6358  C CB   . VAL C 1 15  ? 230.805 198.725 238.080 1.00 254.21 ? 110 VAL A CB   1 
ATOM 6359  C CG1  . VAL C 1 15  ? 230.358 197.707 239.119 1.00 254.21 ? 110 VAL A CG1  1 
ATOM 6360  C CG2  . VAL C 1 15  ? 230.689 200.140 238.626 1.00 254.21 ? 110 VAL A CG2  1 
ATOM 6361  H H    . VAL C 1 15  ? 232.392 199.317 235.877 1.00 305.05 ? 110 VAL A H    1 
ATOM 6362  H HA   . VAL C 1 15  ? 232.832 198.459 238.422 1.00 305.05 ? 110 VAL A HA   1 
ATOM 6363  H HB   . VAL C 1 15  ? 230.148 198.613 237.217 1.00 305.05 ? 110 VAL A HB   1 
ATOM 6364  H HG11 . VAL C 1 15  ? 229.330 197.917 239.415 1.00 305.05 ? 110 VAL A HG11 1 
ATOM 6365  H HG12 . VAL C 1 15  ? 230.416 196.705 238.694 1.00 305.05 ? 110 VAL A HG12 1 
ATOM 6366  H HG13 . VAL C 1 15  ? 231.007 197.770 239.992 1.00 305.05 ? 110 VAL A HG13 1 
ATOM 6367  H HG21 . VAL C 1 15  ? 229.660 200.328 238.931 1.00 305.05 ? 110 VAL A HG21 1 
ATOM 6368  H HG22 . VAL C 1 15  ? 231.350 200.254 239.485 1.00 305.05 ? 110 VAL A HG22 1 
ATOM 6369  H HG23 . VAL C 1 15  ? 230.973 200.853 237.852 1.00 305.05 ? 110 VAL A HG23 1 
ATOM 6370  N N    . ARG C 1 16  ? 232.771 196.087 237.834 1.00 264.22 ? 111 ARG A N    1 
ATOM 6371  C CA   . ARG C 1 16  ? 232.850 194.705 237.375 1.00 264.22 ? 111 ARG A CA   1 
ATOM 6372  C C    . ARG C 1 16  ? 231.455 194.134 237.148 1.00 264.22 ? 111 ARG A C    1 
ATOM 6373  O O    . ARG C 1 16  ? 230.479 194.542 237.783 1.00 264.22 ? 111 ARG A O    1 
ATOM 6374  C CB   . ARG C 1 16  ? 233.594 193.844 238.385 1.00 264.22 ? 111 ARG A CB   1 
ATOM 6375  C CG   . ARG C 1 16  ? 235.087 194.117 238.482 1.00 264.22 ? 111 ARG A CG   1 
ATOM 6376  C CD   . ARG C 1 16  ? 235.751 193.203 239.446 1.00 264.22 ? 111 ARG A CD   1 
ATOM 6377  N NE   . ARG C 1 16  ? 235.326 193.456 240.814 1.00 264.22 ? 111 ARG A NE   1 
ATOM 6378  C CZ   . ARG C 1 16  ? 235.665 192.696 241.873 1.00 264.22 ? 111 ARG A CZ   1 
ATOM 6379  N NH1  . ARG C 1 16  ? 236.432 191.641 241.707 1.00 264.22 ? 111 ARG A NH1  1 
ATOM 6380  N NH2  . ARG C 1 16  ? 235.227 193.010 243.080 1.00 264.22 ? 111 ARG A NH2  1 
ATOM 6381  H H    . ARG C 1 16  ? 233.016 196.201 238.650 1.00 317.06 ? 111 ARG A H    1 
ATOM 6382  H HA   . ARG C 1 16  ? 233.333 194.669 236.540 1.00 317.06 ? 111 ARG A HA   1 
ATOM 6383  H HB2  . ARG C 1 16  ? 233.167 193.994 239.375 1.00 317.06 ? 111 ARG A HB2  1 
ATOM 6384  H HB3  . ARG C 1 16  ? 233.467 192.792 238.129 1.00 317.06 ? 111 ARG A HB3  1 
ATOM 6385  H HG2  . ARG C 1 16  ? 235.547 193.976 237.504 1.00 317.06 ? 111 ARG A HG2  1 
ATOM 6386  H HG3  . ARG C 1 16  ? 235.248 195.143 238.815 1.00 317.06 ? 111 ARG A HG3  1 
ATOM 6387  H HD2  . ARG C 1 16  ? 235.504 192.171 239.198 1.00 317.06 ? 111 ARG A HD2  1 
ATOM 6388  H HD3  . ARG C 1 16  ? 236.830 193.341 239.394 1.00 317.06 ? 111 ARG A HD3  1 
ATOM 6389  H HE   . ARG C 1 16  ? 234.734 194.259 240.981 1.00 317.06 ? 111 ARG A HE   1 
ATOM 6390  H HH11 . ARG C 1 16  ? 236.768 191.401 240.785 1.00 317.06 ? 111 ARG A HH11 1 
ATOM 6391  H HH12 . ARG C 1 16  ? 236.687 191.072 242.501 1.00 317.06 ? 111 ARG A HH12 1 
ATOM 6392  H HH21 . ARG C 1 16  ? 234.637 193.821 243.207 1.00 317.06 ? 111 ARG A HH21 1 
ATOM 6393  H HH22 . ARG C 1 16  ? 235.481 192.441 243.873 1.00 317.06 ? 111 ARG A HH22 1 
ATOM 6394  N N    . VAL C 1 17  ? 231.370 193.169 236.229 1.00 255.11 ? 112 VAL A N    1 
ATOM 6395  C CA   . VAL C 1 17  ? 230.075 192.610 235.846 1.00 255.11 ? 112 VAL A CA   1 
ATOM 6396  C C    . VAL C 1 17  ? 229.408 191.953 237.050 1.00 255.11 ? 112 VAL A C    1 
ATOM 6397  O O    . VAL C 1 17  ? 228.234 192.206 237.348 1.00 255.11 ? 112 VAL A O    1 
ATOM 6398  C CB   . VAL C 1 17  ? 230.243 191.572 234.720 1.00 255.11 ? 112 VAL A CB   1 
ATOM 6399  C CG1  . VAL C 1 17  ? 228.943 190.817 234.493 1.00 255.11 ? 112 VAL A CG1  1 
ATOM 6400  C CG2  . VAL C 1 17  ? 230.696 192.263 233.443 1.00 255.11 ? 112 VAL A CG2  1 
ATOM 6401  H H    . VAL C 1 17  ? 232.041 192.823 235.817 1.00 306.13 ? 112 VAL A H    1 
ATOM 6402  H HA   . VAL C 1 17  ? 229.500 193.331 235.544 1.00 306.13 ? 112 VAL A HA   1 
ATOM 6403  H HB   . VAL C 1 17  ? 230.992 190.840 235.023 1.00 306.13 ? 112 VAL A HB   1 
ATOM 6404  H HG11 . VAL C 1 17  ? 229.080 190.087 233.694 1.00 306.13 ? 112 VAL A HG11 1 
ATOM 6405  H HG12 . VAL C 1 17  ? 228.657 190.301 235.410 1.00 306.13 ? 112 VAL A HG12 1 
ATOM 6406  H HG13 . VAL C 1 17  ? 228.158 191.519 234.211 1.00 306.13 ? 112 VAL A HG13 1 
ATOM 6407  H HG21 . VAL C 1 17  ? 230.814 191.524 232.652 1.00 306.13 ? 112 VAL A HG21 1 
ATOM 6408  H HG22 . VAL C 1 17  ? 229.950 193.000 233.144 1.00 306.13 ? 112 VAL A HG22 1 
ATOM 6409  H HG23 . VAL C 1 17  ? 231.649 192.763 233.617 1.00 306.13 ? 112 VAL A HG23 1 
ATOM 6410  N N    . SER C 1 18  ? 230.147 191.098 237.760 1.00 263.52 ? 113 SER A N    1 
ATOM 6411  C CA   . SER C 1 18  ? 229.581 190.418 238.921 1.00 263.52 ? 113 SER A CA   1 
ATOM 6412  C C    . SER C 1 18  ? 229.151 191.405 239.999 1.00 263.52 ? 113 SER A C    1 
ATOM 6413  O O    . SER C 1 18  ? 228.210 191.130 240.750 1.00 263.52 ? 113 SER A O    1 
ATOM 6414  C CB   . SER C 1 18  ? 230.590 189.443 239.496 1.00 263.52 ? 113 SER A CB   1 
ATOM 6415  O OG   . SER C 1 18  ? 231.682 190.121 240.054 1.00 263.52 ? 113 SER A OG   1 
ATOM 6416  H H    . SER C 1 18  ? 230.966 190.896 237.592 1.00 316.22 ? 113 SER A H    1 
ATOM 6417  H HA   . SER C 1 18  ? 228.795 189.921 238.643 1.00 316.22 ? 113 SER A HA   1 
ATOM 6418  H HB2  . SER C 1 18  ? 230.110 188.830 240.258 1.00 316.22 ? 113 SER A HB2  1 
ATOM 6419  H HB3  . SER C 1 18  ? 230.938 188.775 238.709 1.00 316.22 ? 113 SER A HB3  1 
ATOM 6420  H HG   . SER C 1 18  ? 232.381 189.470 240.142 1.00 316.22 ? 113 SER A HG   1 
ATOM 6421  N N    . GLU C 1 19  ? 229.824 192.554 240.092 1.00 262.95 ? 114 GLU A N    1 
ATOM 6422  C CA   . GLU C 1 19  ? 229.460 193.544 241.098 1.00 262.95 ? 114 GLU A CA   1 
ATOM 6423  C C    . GLU C 1 19  ? 228.071 194.125 240.869 1.00 262.95 ? 114 GLU A C    1 
ATOM 6424  O O    . GLU C 1 19  ? 227.484 194.675 241.806 1.00 262.95 ? 114 GLU A O    1 
ATOM 6425  C CB   . GLU C 1 19  ? 230.490 194.676 241.118 1.00 262.95 ? 114 GLU A CB   1 
ATOM 6426  C CG   . GLU C 1 19  ? 231.835 194.291 241.718 1.00 262.95 ? 114 GLU A CG   1 
ATOM 6427  C CD   . GLU C 1 19  ? 232.832 195.416 241.687 1.00 262.95 ? 114 GLU A CD   1 
ATOM 6428  O OE1  . GLU C 1 19  ? 232.782 196.204 240.774 1.00 262.95 ? 114 GLU A OE1  1 
ATOM 6429  O OE2  . GLU C 1 19  ? 233.646 195.486 242.579 1.00 262.95 ? 114 GLU A OE2  1 
ATOM 6430  H H    . GLU C 1 19  ? 230.486 192.781 239.591 1.00 315.54 ? 114 GLU A H    1 
ATOM 6431  H HA   . GLU C 1 19  ? 229.461 193.118 241.969 1.00 315.54 ? 114 GLU A HA   1 
ATOM 6432  H HB2  . GLU C 1 19  ? 230.666 195.025 240.100 1.00 315.54 ? 114 GLU A HB2  1 
ATOM 6433  H HB3  . GLU C 1 19  ? 230.097 195.516 241.689 1.00 315.54 ? 114 GLU A HB3  1 
ATOM 6434  H HG2  . GLU C 1 19  ? 231.684 193.983 242.752 1.00 315.54 ? 114 GLU A HG2  1 
ATOM 6435  H HG3  . GLU C 1 19  ? 232.236 193.441 241.169 1.00 315.54 ? 114 GLU A HG3  1 
ATOM 6436  N N    . LEU C 1 20  ? 227.524 194.011 239.656 1.00 248.32 ? 115 LEU A N    1 
ATOM 6437  C CA   . LEU C 1 20  ? 226.195 194.542 239.379 1.00 248.32 ? 115 LEU A CA   1 
ATOM 6438  C C    . LEU C 1 20  ? 225.081 193.726 240.025 1.00 248.32 ? 115 LEU A C    1 
ATOM 6439  O O    . LEU C 1 20  ? 223.929 194.171 240.013 1.00 248.32 ? 115 LEU A O    1 
ATOM 6440  C CB   . LEU C 1 20  ? 225.967 194.600 237.863 1.00 248.32 ? 115 LEU A CB   1 
ATOM 6441  C CG   . LEU C 1 20  ? 226.430 195.887 237.169 1.00 248.32 ? 115 LEU A CG   1 
ATOM 6442  C CD1  . LEU C 1 20  ? 225.614 197.065 237.685 1.00 248.32 ? 115 LEU A CD1  1 
ATOM 6443  C CD2  . LEU C 1 20  ? 227.915 196.097 237.425 1.00 248.32 ? 115 LEU A CD2  1 
ATOM 6444  H H    . LEU C 1 20  ? 227.901 193.636 238.980 1.00 297.98 ? 115 LEU A H    1 
ATOM 6445  H HA   . LEU C 1 20  ? 226.138 195.440 239.739 1.00 297.98 ? 115 LEU A HA   1 
ATOM 6446  H HB2  . LEU C 1 20  ? 226.494 193.767 237.401 1.00 297.98 ? 115 LEU A HB2  1 
ATOM 6447  H HB3  . LEU C 1 20  ? 224.901 194.483 237.667 1.00 297.98 ? 115 LEU A HB3  1 
ATOM 6448  H HG   . LEU C 1 20  ? 226.255 195.805 236.096 1.00 297.98 ? 115 LEU A HG   1 
ATOM 6449  H HD11 . LEU C 1 20  ? 225.943 197.979 237.192 1.00 297.98 ? 115 LEU A HD11 1 
ATOM 6450  H HD12 . LEU C 1 20  ? 224.559 196.898 237.472 1.00 297.98 ? 115 LEU A HD12 1 
ATOM 6451  H HD13 . LEU C 1 20  ? 225.756 197.162 238.761 1.00 297.98 ? 115 LEU A HD13 1 
ATOM 6452  H HD21 . LEU C 1 20  ? 228.244 197.011 236.931 1.00 297.98 ? 115 LEU A HD21 1 
ATOM 6453  H HD22 . LEU C 1 20  ? 228.091 196.180 238.498 1.00 297.98 ? 115 LEU A HD22 1 
ATOM 6454  H HD23 . LEU C 1 20  ? 228.476 195.249 237.031 1.00 297.98 ? 115 LEU A HD23 1 
ATOM 6455  N N    . GLY C 1 21  ? 225.388 192.556 240.581 1.00 248.09 ? 116 GLY A N    1 
ATOM 6456  C CA   . GLY C 1 21  ? 224.379 191.752 241.244 1.00 248.09 ? 116 GLY A CA   1 
ATOM 6457  C C    . GLY C 1 21  ? 223.388 191.093 240.311 1.00 248.09 ? 116 GLY A C    1 
ATOM 6458  O O    . GLY C 1 21  ? 222.257 190.814 240.721 1.00 248.09 ? 116 GLY A O    1 
ATOM 6459  H H    . GLY C 1 21  ? 226.174 192.207 240.588 1.00 297.71 ? 116 GLY A H    1 
ATOM 6460  H HA2  . GLY C 1 21  ? 224.816 191.056 241.757 1.00 297.71 ? 116 GLY A HA2  1 
ATOM 6461  H HA3  . GLY C 1 21  ? 223.882 192.313 241.859 1.00 297.71 ? 116 GLY A HA3  1 
ATOM 6462  N N    . LEU C 1 22  ? 223.785 190.833 239.066 1.00 251.96 ? 117 LEU A N    1 
ATOM 6463  C CA   . LEU C 1 22  ? 222.906 190.249 238.060 1.00 251.96 ? 117 LEU A CA   1 
ATOM 6464  C C    . LEU C 1 22  ? 223.037 188.732 237.965 1.00 251.96 ? 117 LEU A C    1 
ATOM 6465  O O    . LEU C 1 22  ? 222.371 188.118 237.127 1.00 251.96 ? 117 LEU A O    1 
ATOM 6466  C CB   . LEU C 1 22  ? 223.203 190.870 236.689 1.00 251.96 ? 117 LEU A CB   1 
ATOM 6467  C CG   . LEU C 1 22  ? 222.961 192.381 236.577 1.00 251.96 ? 117 LEU A CG   1 
ATOM 6468  C CD1  . LEU C 1 22  ? 223.397 192.864 235.201 1.00 251.96 ? 117 LEU A CD1  1 
ATOM 6469  C CD2  . LEU C 1 22  ? 221.490 192.679 236.822 1.00 251.96 ? 117 LEU A CD2  1 
ATOM 6470  H H    . LEU C 1 22  ? 224.578 190.990 238.774 1.00 302.35 ? 117 LEU A H    1 
ATOM 6471  H HA   . LEU C 1 22  ? 221.985 190.428 238.290 1.00 302.35 ? 117 LEU A HA   1 
ATOM 6472  H HB2  . LEU C 1 22  ? 224.247 190.682 236.442 1.00 302.35 ? 117 LEU A HB2  1 
ATOM 6473  H HB3  . LEU C 1 22  ? 222.580 190.378 235.942 1.00 302.35 ? 117 LEU A HB3  1 
ATOM 6474  H HG   . LEU C 1 22  ? 223.566 192.902 237.320 1.00 302.35 ? 117 LEU A HG   1 
ATOM 6475  H HD11 . LEU C 1 22  ? 223.225 193.938 235.121 1.00 302.35 ? 117 LEU A HD11 1 
ATOM 6476  H HD12 . LEU C 1 22  ? 224.458 192.656 235.061 1.00 302.35 ? 117 LEU A HD12 1 
ATOM 6477  H HD13 . LEU C 1 22  ? 222.820 192.348 234.435 1.00 302.35 ? 117 LEU A HD13 1 
ATOM 6478  H HD21 . LEU C 1 22  ? 221.318 193.753 236.743 1.00 302.35 ? 117 LEU A HD21 1 
ATOM 6479  H HD22 . LEU C 1 22  ? 220.885 192.159 236.078 1.00 302.35 ? 117 LEU A HD22 1 
ATOM 6480  H HD23 . LEU C 1 22  ? 221.210 192.339 237.819 1.00 302.35 ? 117 LEU A HD23 1 
ATOM 6481  N N    . GLY C 1 23  ? 223.871 188.115 238.801 1.00 252.30 ? 118 GLY A N    1 
ATOM 6482  C CA   . GLY C 1 23  ? 224.078 186.684 238.744 1.00 252.30 ? 118 GLY A CA   1 
ATOM 6483  C C    . GLY C 1 23  ? 225.081 186.218 237.713 1.00 252.30 ? 118 GLY A C    1 
ATOM 6484  O O    . GLY C 1 23  ? 225.220 185.003 237.518 1.00 252.30 ? 118 GLY A O    1 
ATOM 6485  H H    . GLY C 1 23  ? 224.328 188.506 239.415 1.00 302.76 ? 118 GLY A H    1 
ATOM 6486  H HA2  . GLY C 1 23  ? 224.379 186.376 239.613 1.00 302.76 ? 118 GLY A HA2  1 
ATOM 6487  H HA3  . GLY C 1 23  ? 223.231 186.252 238.551 1.00 302.76 ? 118 GLY A HA3  1 
ATOM 6488  N N    . TYR C 1 24  ? 225.786 187.135 237.050 1.00 226.43 ? 119 TYR A N    1 
ATOM 6489  C CA   . TYR C 1 24  ? 226.739 186.802 235.994 1.00 226.43 ? 119 TYR A CA   1 
ATOM 6490  C C    . TYR C 1 24  ? 228.133 186.820 236.612 1.00 226.43 ? 119 TYR A C    1 
ATOM 6491  O O    . TYR C 1 24  ? 228.688 187.885 236.892 1.00 226.43 ? 119 TYR A O    1 
ATOM 6492  C CB   . TYR C 1 24  ? 226.641 187.778 234.820 1.00 226.43 ? 119 TYR A CB   1 
ATOM 6493  C CG   . TYR C 1 24  ? 225.305 187.748 234.111 1.00 226.43 ? 119 TYR A CG   1 
ATOM 6494  C CD1  . TYR C 1 24  ? 224.898 186.601 233.448 1.00 226.43 ? 119 TYR A CD1  1 
ATOM 6495  C CD2  . TYR C 1 24  ? 224.488 188.869 234.124 1.00 226.43 ? 119 TYR A CD2  1 
ATOM 6496  C CE1  . TYR C 1 24  ? 223.678 186.573 232.800 1.00 226.43 ? 119 TYR A CE1  1 
ATOM 6497  C CE2  . TYR C 1 24  ? 223.268 188.842 233.477 1.00 226.43 ? 119 TYR A CE2  1 
ATOM 6498  C CZ   . TYR C 1 24  ? 222.865 187.688 232.813 1.00 226.43 ? 119 TYR A CZ   1 
ATOM 6499  O OH   . TYR C 1 24  ? 221.650 187.661 232.168 1.00 226.43 ? 119 TYR A OH   1 
ATOM 6500  H H    . TYR C 1 24  ? 225.732 187.979 237.197 1.00 271.72 ? 119 TYR A H    1 
ATOM 6501  H HA   . TYR C 1 24  ? 226.596 185.899 235.673 1.00 271.72 ? 119 TYR A HA   1 
ATOM 6502  H HB2  . TYR C 1 24  ? 226.815 188.795 235.176 1.00 271.72 ? 119 TYR A HB2  1 
ATOM 6503  H HB3  . TYR C 1 24  ? 227.418 187.550 234.091 1.00 271.72 ? 119 TYR A HB3  1 
ATOM 6504  H HD1  . TYR C 1 24  ? 225.540 185.720 233.438 1.00 271.72 ? 119 TYR A HD1  1 
ATOM 6505  H HD2  . TYR C 1 24  ? 224.808 189.771 234.646 1.00 271.72 ? 119 TYR A HD2  1 
ATOM 6506  H HE1  . TYR C 1 24  ? 223.357 185.671 232.279 1.00 271.72 ? 119 TYR A HE1  1 
ATOM 6507  H HE2  . TYR C 1 24  ? 222.626 189.722 233.487 1.00 271.72 ? 119 TYR A HE2  1 
ATOM 6508  H HH   . TYR C 1 24  ? 221.523 186.800 231.763 1.00 271.72 ? 119 TYR A HH   1 
ATOM 6509  N N    . ALA C 1 25  ? 228.696 185.630 236.823 1.00 230.39 ? 120 ALA A N    1 
ATOM 6510  C CA   . ALA C 1 25  ? 229.968 185.475 237.530 1.00 230.39 ? 120 ALA A CA   1 
ATOM 6511  C C    . ALA C 1 25  ? 231.135 185.791 236.593 1.00 230.39 ? 120 ALA A C    1 
ATOM 6512  O O    . ALA C 1 25  ? 231.792 184.911 236.035 1.00 230.39 ? 120 ALA A O    1 
ATOM 6513  C CB   . ALA C 1 25  ? 230.082 184.068 238.101 1.00 230.39 ? 120 ALA A CB   1 
ATOM 6514  H H    . ALA C 1 25  ? 228.356 184.885 236.560 1.00 276.47 ? 120 ALA A H    1 
ATOM 6515  H HA   . ALA C 1 25  ? 229.998 186.102 238.270 1.00 276.47 ? 120 ALA A HA   1 
ATOM 6516  H HB1  . ALA C 1 25  ? 230.925 183.985 238.572 1.00 276.47 ? 120 ALA A HB1  1 
ATOM 6517  H HB2  . ALA C 1 25  ? 229.342 183.913 238.709 1.00 276.47 ? 120 ALA A HB2  1 
ATOM 6518  H HB3  . ALA C 1 25  ? 230.048 183.430 237.370 1.00 276.47 ? 120 ALA A HB3  1 
ATOM 6519  N N    . SER C 1 26  ? 231.388 187.089 236.432 1.00 231.84 ? 121 SER A N    1 
ATOM 6520  C CA   . SER C 1 26  ? 232.421 187.595 235.536 1.00 231.84 ? 121 SER A CA   1 
ATOM 6521  C C    . SER C 1 26  ? 233.188 188.711 236.229 1.00 231.84 ? 121 SER A C    1 
ATOM 6522  O O    . SER C 1 26  ? 232.588 189.559 236.898 1.00 231.84 ? 121 SER A O    1 
ATOM 6523  C CB   . SER C 1 26  ? 231.810 188.102 234.245 1.00 231.84 ? 121 SER A CB   1 
ATOM 6524  O OG   . SER C 1 26  ? 232.772 188.736 233.448 1.00 231.84 ? 121 SER A OG   1 
ATOM 6525  H H    . SER C 1 26  ? 230.959 187.712 236.842 1.00 278.21 ? 121 SER A H    1 
ATOM 6526  H HA   . SER C 1 26  ? 233.050 186.889 235.321 1.00 278.21 ? 121 SER A HA   1 
ATOM 6527  H HB2  . SER C 1 26  ? 231.373 187.267 233.697 1.00 278.21 ? 121 SER A HB2  1 
ATOM 6528  H HB3  . SER C 1 26  ? 231.005 188.800 234.473 1.00 278.21 ? 121 SER A HB3  1 
ATOM 6529  H HG   . SER C 1 26  ? 232.315 189.013 232.651 1.00 278.21 ? 121 SER A HG   1 
ATOM 6530  N N    . ASP C 1 27  ? 234.507 188.714 236.053 1.00 232.90 ? 122 ASP A N    1 
ATOM 6531  C CA   . ASP C 1 27  ? 235.371 189.753 236.600 1.00 232.90 ? 122 ASP A CA   1 
ATOM 6532  C C    . ASP C 1 27  ? 235.720 190.843 235.588 1.00 232.90 ? 122 ASP A C    1 
ATOM 6533  O O    . ASP C 1 27  ? 236.599 191.666 235.866 1.00 232.90 ? 122 ASP A O    1 
ATOM 6534  C CB   . ASP C 1 27  ? 236.655 189.127 237.160 1.00 232.90 ? 122 ASP A CB   1 
ATOM 6535  C CG   . ASP C 1 27  ? 237.375 188.242 236.150 1.00 232.90 ? 122 ASP A CG   1 
ATOM 6536  O OD1  . ASP C 1 27  ? 236.845 188.035 235.038 1.00 232.90 ? 122 ASP A OD1  1 
ATOM 6537  O OD2  . ASP C 1 27  ? 238.474 187.748 236.477 1.00 232.90 ? 122 ASP A OD2  1 
ATOM 6538  H H    . ASP C 1 27  ? 234.925 188.110 235.608 1.00 279.48 ? 122 ASP A H    1 
ATOM 6539  H HA   . ASP C 1 27  ? 234.916 190.181 237.342 1.00 279.48 ? 122 ASP A HA   1 
ATOM 6540  H HB2  . ASP C 1 27  ? 237.264 189.835 237.425 1.00 279.48 ? 122 ASP A HB2  1 
ATOM 6541  H HB3  . ASP C 1 27  ? 236.430 188.580 237.927 1.00 279.48 ? 122 ASP A HB3  1 
ATOM 6542  N N    . GLU C 1 28  ? 235.063 190.870 234.431 1.00 236.49 ? 123 GLU A N    1 
ATOM 6543  C CA   . GLU C 1 28  ? 235.223 191.984 233.507 1.00 236.49 ? 123 GLU A CA   1 
ATOM 6544  C C    . GLU C 1 28  ? 234.506 193.223 234.028 1.00 236.49 ? 123 GLU A C    1 
ATOM 6545  O O    . GLU C 1 28  ? 233.539 193.133 234.789 1.00 236.49 ? 123 GLU A O    1 
ATOM 6546  C CB   . GLU C 1 28  ? 234.689 191.613 232.122 1.00 236.49 ? 123 GLU A CB   1 
ATOM 6547  C CG   . GLU C 1 28  ? 235.496 190.541 231.404 1.00 236.49 ? 123 GLU A CG   1 
ATOM 6548  C CD   . GLU C 1 28  ? 235.027 190.301 229.996 1.00 236.49 ? 123 GLU A CD   1 
ATOM 6549  O OE1  . GLU C 1 28  ? 234.397 191.170 229.443 1.00 236.49 ? 123 GLU A OE1  1 
ATOM 6550  O OE2  . GLU C 1 28  ? 235.298 189.246 229.472 1.00 236.49 ? 123 GLU A OE2  1 
ATOM 6551  H H    . GLU C 1 28  ? 234.522 190.264 234.152 1.00 283.79 ? 123 GLU A H    1 
ATOM 6552  H HA   . GLU C 1 28  ? 236.162 192.204 233.418 1.00 283.79 ? 123 GLU A HA   1 
ATOM 6553  H HB2  . GLU C 1 28  ? 233.663 191.255 232.212 1.00 283.79 ? 123 GLU A HB2  1 
ATOM 6554  H HB3  . GLU C 1 28  ? 234.672 192.500 231.489 1.00 283.79 ? 123 GLU A HB3  1 
ATOM 6555  H HG2  . GLU C 1 28  ? 236.542 190.844 231.379 1.00 283.79 ? 123 GLU A HG2  1 
ATOM 6556  H HG3  . GLU C 1 28  ? 235.429 189.611 231.967 1.00 283.79 ? 123 GLU A HG3  1 
ATOM 6557  N N    . THR C 1 29  ? 234.994 194.388 233.607 1.00 251.83 ? 124 THR A N    1 
ATOM 6558  C CA   . THR C 1 29  ? 234.403 195.664 233.977 1.00 251.83 ? 124 THR A CA   1 
ATOM 6559  C C    . THR C 1 29  ? 233.669 196.259 232.786 1.00 251.83 ? 124 THR A C    1 
ATOM 6560  O O    . THR C 1 29  ? 233.990 195.978 231.627 1.00 251.83 ? 124 THR A O    1 
ATOM 6561  C CB   . THR C 1 29  ? 235.468 196.653 234.485 1.00 251.83 ? 124 THR A CB   1 
ATOM 6562  O OG1  . THR C 1 29  ? 236.477 196.830 233.482 1.00 251.83 ? 124 THR A OG1  1 
ATOM 6563  C CG2  . THR C 1 29  ? 236.113 196.133 235.761 1.00 251.83 ? 124 THR A CG2  1 
ATOM 6564  H H    . THR C 1 29  ? 235.682 194.463 233.096 1.00 302.20 ? 124 THR A H    1 
ATOM 6565  H HA   . THR C 1 29  ? 233.758 195.547 234.685 1.00 302.20 ? 124 THR A HA   1 
ATOM 6566  H HB   . THR C 1 29  ? 235.003 197.618 234.687 1.00 302.20 ? 124 THR A HB   1 
ATOM 6567  H HG1  . THR C 1 29  ? 236.983 197.623 233.674 1.00 302.20 ? 124 THR A HG1  1 
ATOM 6568  H HG21 . THR C 1 29  ? 236.863 196.845 236.106 1.00 302.20 ? 124 THR A HG21 1 
ATOM 6569  H HG22 . THR C 1 29  ? 235.350 196.009 236.529 1.00 302.20 ? 124 THR A HG22 1 
ATOM 6570  H HG23 . THR C 1 29  ? 236.588 195.173 235.563 1.00 302.20 ? 124 THR A HG23 1 
ATOM 6571  N N    . VAL C 1 30  ? 232.670 197.085 233.092 1.00 251.09 ? 125 VAL A N    1 
ATOM 6572  C CA   . VAL C 1 30  ? 231.918 197.829 232.098 1.00 251.09 ? 125 VAL A CA   1 
ATOM 6573  C C    . VAL C 1 30  ? 231.879 199.288 232.530 1.00 251.09 ? 125 VAL A C    1 
ATOM 6574  O O    . VAL C 1 30  ? 232.011 199.619 233.714 1.00 251.09 ? 125 VAL A O    1 
ATOM 6575  C CB   . VAL C 1 30  ? 230.487 197.278 231.958 1.00 251.09 ? 125 VAL A CB   1 
ATOM 6576  C CG1  . VAL C 1 30  ? 230.518 195.819 231.528 1.00 251.09 ? 125 VAL A CG1  1 
ATOM 6577  C CG2  . VAL C 1 30  ? 229.739 197.438 233.273 1.00 251.09 ? 125 VAL A CG2  1 
ATOM 6578  H H    . VAL C 1 30  ? 232.405 197.230 233.897 1.00 301.31 ? 125 VAL A H    1 
ATOM 6579  H HA   . VAL C 1 30  ? 232.374 197.789 231.243 1.00 301.31 ? 125 VAL A HA   1 
ATOM 6580  H HB   . VAL C 1 30  ? 229.969 197.833 231.175 1.00 301.31 ? 125 VAL A HB   1 
ATOM 6581  H HG11 . VAL C 1 30  ? 229.498 195.446 231.434 1.00 301.31 ? 125 VAL A HG11 1 
ATOM 6582  H HG12 . VAL C 1 30  ? 231.025 195.733 230.568 1.00 301.31 ? 125 VAL A HG12 1 
ATOM 6583  H HG13 . VAL C 1 30  ? 231.050 195.231 232.276 1.00 301.31 ? 125 VAL A HG13 1 
ATOM 6584  H HG21 . VAL C 1 30  ? 228.728 197.046 233.166 1.00 301.31 ? 125 VAL A HG21 1 
ATOM 6585  H HG22 . VAL C 1 30  ? 230.261 196.888 234.057 1.00 301.31 ? 125 VAL A HG22 1 
ATOM 6586  H HG23 . VAL C 1 30  ? 229.693 198.494 233.540 1.00 301.31 ? 125 VAL A HG23 1 
ATOM 6587  N N    . LEU C 1 31  ? 231.711 200.164 231.541 1.00 260.44 ? 126 LEU A N    1 
ATOM 6588  C CA   . LEU C 1 31  ? 231.592 201.596 231.783 1.00 260.44 ? 126 LEU A CA   1 
ATOM 6589  C C    . LEU C 1 31  ? 230.137 201.917 232.086 1.00 260.44 ? 126 LEU A C    1 
ATOM 6590  O O    . LEU C 1 31  ? 229.362 202.244 231.180 1.00 260.44 ? 126 LEU A O    1 
ATOM 6591  C CB   . LEU C 1 31  ? 232.074 202.399 230.568 1.00 260.44 ? 126 LEU A CB   1 
ATOM 6592  C CG   . LEU C 1 31  ? 232.150 203.919 230.763 1.00 260.44 ? 126 LEU A CG   1 
ATOM 6593  C CD1  . LEU C 1 31  ? 233.146 204.240 231.869 1.00 260.44 ? 126 LEU A CD1  1 
ATOM 6594  C CD2  . LEU C 1 31  ? 232.555 204.579 229.454 1.00 260.44 ? 126 LEU A CD2  1 
ATOM 6595  H H    . LEU C 1 31  ? 231.660 199.947 230.710 1.00 312.53 ? 126 LEU A H    1 
ATOM 6596  H HA   . LEU C 1 31  ? 232.128 201.832 232.556 1.00 312.53 ? 126 LEU A HA   1 
ATOM 6597  H HB2  . LEU C 1 31  ? 233.069 202.051 230.294 1.00 312.53 ? 126 LEU A HB2  1 
ATOM 6598  H HB3  . LEU C 1 31  ? 231.401 202.205 229.734 1.00 312.53 ? 126 LEU A HB3  1 
ATOM 6599  H HG   . LEU C 1 31  ? 231.175 204.295 231.073 1.00 312.53 ? 126 LEU A HG   1 
ATOM 6600  H HD11 . LEU C 1 31  ? 233.200 205.320 232.008 1.00 312.53 ? 126 LEU A HD11 1 
ATOM 6601  H HD12 . LEU C 1 31  ? 232.822 203.772 232.798 1.00 312.53 ? 126 LEU A HD12 1 
ATOM 6602  H HD13 . LEU C 1 31  ? 234.130 203.861 231.595 1.00 312.53 ? 126 LEU A HD13 1 
ATOM 6603  H HD21 . LEU C 1 31  ? 232.608 205.660 229.592 1.00 312.53 ? 126 LEU A HD21 1 
ATOM 6604  H HD22 . LEU C 1 31  ? 233.531 204.205 229.144 1.00 312.53 ? 126 LEU A HD22 1 
ATOM 6605  H HD23 . LEU C 1 31  ? 231.817 204.348 228.686 1.00 312.53 ? 126 LEU A HD23 1 
ATOM 6606  N N    . PHE C 1 32  ? 229.761 201.825 233.356 1.00 268.45 ? 127 PHE A N    1 
ATOM 6607  C CA   . PHE C 1 32  ? 228.383 202.024 233.779 1.00 268.45 ? 127 PHE A CA   1 
ATOM 6608  C C    . PHE C 1 32  ? 228.110 203.525 233.754 1.00 268.45 ? 127 PHE A C    1 
ATOM 6609  O O    . PHE C 1 32  ? 228.576 204.266 234.625 1.00 268.45 ? 127 PHE A O    1 
ATOM 6610  C CB   . PHE C 1 32  ? 228.139 201.455 235.178 1.00 268.45 ? 127 PHE A CB   1 
ATOM 6611  C CG   . PHE C 1 32  ? 226.726 201.621 235.662 1.00 268.45 ? 127 PHE A CG   1 
ATOM 6612  C CD1  . PHE C 1 32  ? 225.723 200.770 235.222 1.00 268.45 ? 127 PHE A CD1  1 
ATOM 6613  C CD2  . PHE C 1 32  ? 226.398 202.627 236.558 1.00 268.45 ? 127 PHE A CD2  1 
ATOM 6614  C CE1  . PHE C 1 32  ? 224.423 200.922 235.666 1.00 268.45 ? 127 PHE A CE1  1 
ATOM 6615  C CE2  . PHE C 1 32  ? 225.100 202.780 237.005 1.00 268.45 ? 127 PHE A CE2  1 
ATOM 6616  C CZ   . PHE C 1 32  ? 224.111 201.927 236.558 1.00 268.45 ? 127 PHE A CZ   1 
ATOM 6617  H H    . PHE C 1 32  ? 230.298 201.643 234.002 1.00 322.14 ? 127 PHE A H    1 
ATOM 6618  H HA   . PHE C 1 32  ? 227.781 201.586 233.157 1.00 322.14 ? 127 PHE A HA   1 
ATOM 6619  H HB2  . PHE C 1 32  ? 228.378 200.392 235.185 1.00 322.14 ? 127 PHE A HB2  1 
ATOM 6620  H HB3  . PHE C 1 32  ? 228.802 201.943 235.890 1.00 322.14 ? 127 PHE A HB3  1 
ATOM 6621  H HD1  . PHE C 1 32  ? 225.969 199.975 234.518 1.00 322.14 ? 127 PHE A HD1  1 
ATOM 6622  H HD2  . PHE C 1 32  ? 227.179 203.301 236.910 1.00 322.14 ? 127 PHE A HD2  1 
ATOM 6623  H HE1  . PHE C 1 32  ? 223.644 200.247 235.312 1.00 322.14 ? 127 PHE A HE1  1 
ATOM 6624  H HE2  . PHE C 1 32  ? 224.855 203.575 237.709 1.00 322.14 ? 127 PHE A HE2  1 
ATOM 6625  H HZ   . PHE C 1 32  ? 223.087 202.048 236.908 1.00 322.14 ? 127 PHE A HZ   1 
ATOM 6626  N N    . ARG C 1 33  ? 227.392 203.973 232.728 1.00 258.49 ? 128 ARG A N    1 
ATOM 6627  C CA   . ARG C 1 33  ? 226.947 205.353 232.619 1.00 258.49 ? 128 ARG A CA   1 
ATOM 6628  C C    . ARG C 1 33  ? 225.528 205.459 233.157 1.00 258.49 ? 128 ARG A C    1 
ATOM 6629  O O    . ARG C 1 33  ? 224.748 204.506 233.082 1.00 258.49 ? 128 ARG A O    1 
ATOM 6630  C CB   . ARG C 1 33  ? 226.991 205.833 231.176 1.00 258.49 ? 128 ARG A CB   1 
ATOM 6631  C CG   . ARG C 1 33  ? 228.380 205.886 230.561 1.00 258.49 ? 128 ARG A CG   1 
ATOM 6632  C CD   . ARG C 1 33  ? 228.332 206.264 229.126 1.00 258.49 ? 128 ARG A CD   1 
ATOM 6633  N NE   . ARG C 1 33  ? 229.653 206.250 228.517 1.00 258.49 ? 128 ARG A NE   1 
ATOM 6634  C CZ   . ARG C 1 33  ? 229.892 206.436 227.204 1.00 258.49 ? 128 ARG A CZ   1 
ATOM 6635  N NH1  . ARG C 1 33  ? 228.892 206.648 226.377 1.00 258.49 ? 128 ARG A NH1  1 
ATOM 6636  N NH2  . ARG C 1 33  ? 231.131 206.405 226.747 1.00 258.49 ? 128 ARG A NH2  1 
ATOM 6637  H H    . ARG C 1 33  ? 227.145 203.481 232.067 1.00 310.19 ? 128 ARG A H    1 
ATOM 6638  H HA   . ARG C 1 33  ? 227.518 205.929 233.145 1.00 310.19 ? 128 ARG A HA   1 
ATOM 6639  H HB2  . ARG C 1 33  ? 226.381 205.178 230.556 1.00 310.19 ? 128 ARG A HB2  1 
ATOM 6640  H HB3  . ARG C 1 33  ? 226.564 206.834 231.112 1.00 310.19 ? 128 ARG A HB3  1 
ATOM 6641  H HG2  . ARG C 1 33  ? 228.984 206.625 231.090 1.00 310.19 ? 128 ARG A HG2  1 
ATOM 6642  H HG3  . ARG C 1 33  ? 228.852 204.906 230.643 1.00 310.19 ? 128 ARG A HG3  1 
ATOM 6643  H HD2  . ARG C 1 33  ? 227.700 205.559 228.585 1.00 310.19 ? 128 ARG A HD2  1 
ATOM 6644  H HD3  . ARG C 1 33  ? 227.922 207.268 229.027 1.00 310.19 ? 128 ARG A HD3  1 
ATOM 6645  H HE   . ARG C 1 33  ? 230.447 206.090 229.121 1.00 310.19 ? 128 ARG A HE   1 
ATOM 6646  H HH11 . ARG C 1 33  ? 227.944 206.672 226.727 1.00 310.19 ? 128 ARG A HH11 1 
ATOM 6647  H HH12 . ARG C 1 33  ? 229.071 206.787 225.393 1.00 310.19 ? 128 ARG A HH12 1 
ATOM 6648  H HH21 . ARG C 1 33  ? 231.900 206.242 227.383 1.00 310.19 ? 128 ARG A HH21 1 
ATOM 6649  H HH22 . ARG C 1 33  ? 231.310 206.544 225.764 1.00 310.19 ? 128 ARG A HH22 1 
ATOM 6650  N N    . TYR C 1 34  ? 225.191 206.624 233.708 1.00 253.36 ? 129 TYR A N    1 
ATOM 6651  C CA   . TYR C 1 34  ? 223.841 206.806 234.217 1.00 253.36 ? 129 TYR A CA   1 
ATOM 6652  C C    . TYR C 1 34  ? 223.437 208.273 234.184 1.00 253.36 ? 129 TYR A C    1 
ATOM 6653  O O    . TYR C 1 34  ? 224.276 209.177 234.165 1.00 253.36 ? 129 TYR A O    1 
ATOM 6654  C CB   . TYR C 1 34  ? 223.726 206.254 235.640 1.00 253.36 ? 129 TYR A CB   1 
ATOM 6655  C CG   . TYR C 1 34  ? 224.600 206.972 236.645 1.00 253.36 ? 129 TYR A CG   1 
ATOM 6656  C CD1  . TYR C 1 34  ? 225.905 206.551 236.854 1.00 253.36 ? 129 TYR A CD1  1 
ATOM 6657  C CD2  . TYR C 1 34  ? 224.096 208.050 237.357 1.00 253.36 ? 129 TYR A CD2  1 
ATOM 6658  C CE1  . TYR C 1 34  ? 226.703 207.206 237.772 1.00 253.36 ? 129 TYR A CE1  1 
ATOM 6659  C CE2  . TYR C 1 34  ? 224.894 208.705 238.275 1.00 253.36 ? 129 TYR A CE2  1 
ATOM 6660  C CZ   . TYR C 1 34  ? 226.202 208.278 238.481 1.00 253.36 ? 129 TYR A CZ   1 
ATOM 6661  O OH   . TYR C 1 34  ? 226.997 208.931 239.395 1.00 253.36 ? 129 TYR A OH   1 
ATOM 6662  H H    . TYR C 1 34  ? 225.712 207.303 233.797 1.00 304.03 ? 129 TYR A H    1 
ATOM 6663  H HA   . TYR C 1 34  ? 223.284 206.335 233.604 1.00 304.03 ? 129 TYR A HA   1 
ATOM 6664  H HB2  . TYR C 1 34  ? 222.691 206.327 235.976 1.00 304.03 ? 129 TYR A HB2  1 
ATOM 6665  H HB3  . TYR C 1 34  ? 223.999 205.200 235.643 1.00 304.03 ? 129 TYR A HB3  1 
ATOM 6666  H HD1  . TYR C 1 34  ? 226.301 205.705 236.293 1.00 304.03 ? 129 TYR A HD1  1 
ATOM 6667  H HD2  . TYR C 1 34  ? 223.070 208.380 237.193 1.00 304.03 ? 129 TYR A HD2  1 
ATOM 6668  H HE1  . TYR C 1 34  ? 227.729 206.876 237.935 1.00 304.03 ? 129 TYR A HE1  1 
ATOM 6669  H HE2  . TYR C 1 34  ? 224.499 209.551 238.835 1.00 304.03 ? 129 TYR A HE2  1 
ATOM 6670  H HH   . TYR C 1 34  ? 227.862 208.514 239.420 1.00 304.03 ? 129 TYR A HH   1 
ATOM 6671  N N    . CYS C 1 35  ? 222.121 208.482 234.169 1.00 277.80 ? 130 CYS A N    1 
ATOM 6672  C CA   . CYS C 1 35  ? 221.501 209.792 234.020 1.00 277.80 ? 130 CYS A CA   1 
ATOM 6673  C C    . CYS C 1 35  ? 221.133 210.325 235.399 1.00 277.80 ? 130 CYS A C    1 
ATOM 6674  O O    . CYS C 1 35  ? 220.363 209.689 236.126 1.00 277.80 ? 130 CYS A O    1 
ATOM 6675  C CB   . CYS C 1 35  ? 220.251 209.716 233.143 1.00 277.80 ? 130 CYS A CB   1 
ATOM 6676  S SG   . CYS C 1 35  ? 219.422 211.305 232.899 1.00 277.80 ? 130 CYS A SG   1 
ATOM 6677  H H    . CYS C 1 35  ? 221.545 207.847 234.248 1.00 333.36 ? 130 CYS A H    1 
ATOM 6678  H HA   . CYS C 1 35  ? 222.122 210.409 233.603 1.00 333.36 ? 130 CYS A HA   1 
ATOM 6679  H HB2  . CYS C 1 35  ? 220.518 209.321 232.163 1.00 333.36 ? 130 CYS A HB2  1 
ATOM 6680  H HB3  . CYS C 1 35  ? 219.534 209.027 233.590 1.00 333.36 ? 130 CYS A HB3  1 
ATOM 6681  N N    . ALA C 1 36  ? 221.677 211.488 235.758 1.00 271.15 ? 131 ALA A N    1 
ATOM 6682  C CA   . ALA C 1 36  ? 221.453 212.036 237.088 1.00 271.15 ? 131 ALA A CA   1 
ATOM 6683  C C    . ALA C 1 36  ? 221.707 213.536 237.079 1.00 271.15 ? 131 ALA A C    1 
ATOM 6684  O O    . ALA C 1 36  ? 222.454 214.051 236.244 1.00 271.15 ? 131 ALA A O    1 
ATOM 6685  C CB   . ALA C 1 36  ? 222.363 211.369 238.122 1.00 271.15 ? 131 ALA A CB   1 
ATOM 6686  H H    . ALA C 1 36  ? 222.171 211.975 235.249 1.00 325.38 ? 131 ALA A H    1 
ATOM 6687  H HA   . ALA C 1 36  ? 220.531 211.884 237.348 1.00 325.38 ? 131 ALA A HA   1 
ATOM 6688  H HB1  . ALA C 1 36  ? 222.189 211.760 238.993 1.00 325.38 ? 131 ALA A HB1  1 
ATOM 6689  H HB2  . ALA C 1 36  ? 222.187 210.417 238.140 1.00 325.38 ? 131 ALA A HB2  1 
ATOM 6690  H HB3  . ALA C 1 36  ? 223.286 211.527 237.872 1.00 325.38 ? 131 ALA A HB3  1 
ATOM 6691  N N    . GLY C 1 37  ? 221.082 214.222 238.027 1.00 263.37 ? 132 GLY A N    1 
ATOM 6692  C CA   . GLY C 1 37  ? 221.342 215.626 238.278 1.00 263.37 ? 132 GLY A CA   1 
ATOM 6693  C C    . GLY C 1 37  ? 220.077 216.463 238.252 1.00 263.37 ? 132 GLY A C    1 
ATOM 6694  O O    . GLY C 1 37  ? 218.985 215.999 237.929 1.00 263.37 ? 132 GLY A O    1 
ATOM 6695  H H    . GLY C 1 37  ? 220.482 213.885 238.544 1.00 316.04 ? 132 GLY A H    1 
ATOM 6696  H HA2  . GLY C 1 37  ? 221.739 215.718 239.155 1.00 316.04 ? 132 GLY A HA2  1 
ATOM 6697  H HA3  . GLY C 1 37  ? 221.958 215.983 237.626 1.00 316.04 ? 132 GLY A HA3  1 
ATOM 6698  N N    . ALA C 1 38  ? 220.262 217.734 238.605 1.00 253.35 ? 133 ALA A N    1 
ATOM 6699  C CA   . ALA C 1 38  ? 219.158 218.682 238.646 1.00 253.35 ? 133 ALA A CA   1 
ATOM 6700  C C    . ALA C 1 38  ? 218.578 218.901 237.255 1.00 253.35 ? 133 ALA A C    1 
ATOM 6701  O O    . ALA C 1 38  ? 219.309 219.007 236.267 1.00 253.35 ? 133 ALA A O    1 
ATOM 6702  C CB   . ALA C 1 38  ? 219.629 220.012 239.233 1.00 253.35 ? 133 ALA A CB   1 
ATOM 6703  H H    . ALA C 1 38  ? 221.021 218.070 238.825 1.00 304.02 ? 133 ALA A H    1 
ATOM 6704  H HA   . ALA C 1 38  ? 218.454 218.332 239.215 1.00 304.02 ? 133 ALA A HA   1 
ATOM 6705  H HB1  . ALA C 1 38  ? 218.885 220.634 239.249 1.00 304.02 ? 133 ALA A HB1  1 
ATOM 6706  H HB2  . ALA C 1 38  ? 219.956 219.860 240.133 1.00 304.02 ? 133 ALA A HB2  1 
ATOM 6707  H HB3  . ALA C 1 38  ? 220.344 220.364 238.678 1.00 304.02 ? 133 ALA A HB3  1 
ATOM 6708  N N    . CYS C 1 39  ? 217.251 218.969 237.186 1.00 263.15 ? 134 CYS A N    1 
ATOM 6709  C CA   . CYS C 1 39  ? 216.573 219.206 235.919 1.00 263.15 ? 134 CYS A CA   1 
ATOM 6710  C C    . CYS C 1 39  ? 216.499 220.702 235.638 1.00 263.15 ? 134 CYS A C    1 
ATOM 6711  O O    . CYS C 1 39  ? 215.971 221.470 236.448 1.00 263.15 ? 134 CYS A O    1 
ATOM 6712  C CB   . CYS C 1 39  ? 215.162 218.618 235.937 1.00 263.15 ? 134 CYS A CB   1 
ATOM 6713  S SG   . CYS C 1 39  ? 215.116 216.814 236.068 1.00 263.15 ? 134 CYS A SG   1 
ATOM 6714  H H    . CYS C 1 39  ? 216.722 218.882 237.857 1.00 315.78 ? 134 CYS A H    1 
ATOM 6715  H HA   . CYS C 1 39  ? 217.077 218.786 235.205 1.00 315.78 ? 134 CYS A HA   1 
ATOM 6716  H HB2  . CYS C 1 39  ? 214.606 219.032 236.779 1.00 315.78 ? 134 CYS A HB2  1 
ATOM 6717  H HB3  . CYS C 1 39  ? 214.637 218.903 235.026 1.00 315.78 ? 134 CYS A HB3  1 
ATOM 6718  N N    . GLU C 1 40  ? 217.035 221.116 234.488 1.00 274.38 ? 135 GLU A N    1 
ATOM 6719  C CA   . GLU C 1 40  ? 216.999 222.528 234.120 1.00 274.38 ? 135 GLU A CA   1 
ATOM 6720  C C    . GLU C 1 40  ? 215.584 222.965 233.769 1.00 274.38 ? 135 GLU A C    1 
ATOM 6721  O O    . GLU C 1 40  ? 215.193 224.106 234.043 1.00 274.38 ? 135 GLU A O    1 
ATOM 6722  C CB   . GLU C 1 40  ? 217.934 222.798 232.939 1.00 274.38 ? 135 GLU A CB   1 
ATOM 6723  C CG   . GLU C 1 40  ? 219.413 222.624 233.255 1.00 274.38 ? 135 GLU A CG   1 
ATOM 6724  C CD   . GLU C 1 40  ? 220.295 222.828 232.056 1.00 274.38 ? 135 GLU A CD   1 
ATOM 6725  O OE1  . GLU C 1 40  ? 219.774 222.993 230.979 1.00 274.38 ? 135 GLU A OE1  1 
ATOM 6726  O OE2  . GLU C 1 40  ? 221.493 222.819 232.216 1.00 274.38 ? 135 GLU A OE2  1 
ATOM 6727  H H    . GLU C 1 40  ? 217.421 220.605 233.912 1.00 329.26 ? 135 GLU A H    1 
ATOM 6728  H HA   . GLU C 1 40  ? 217.299 223.059 234.874 1.00 329.26 ? 135 GLU A HA   1 
ATOM 6729  H HB2  . GLU C 1 40  ? 217.687 222.125 232.118 1.00 329.26 ? 135 GLU A HB2  1 
ATOM 6730  H HB3  . GLU C 1 40  ? 217.785 223.817 232.583 1.00 329.26 ? 135 GLU A HB3  1 
ATOM 6731  H HG2  . GLU C 1 40  ? 219.695 223.342 234.026 1.00 329.26 ? 135 GLU A HG2  1 
ATOM 6732  H HG3  . GLU C 1 40  ? 219.573 221.623 233.653 1.00 329.26 ? 135 GLU A HG3  1 
ATOM 6733  N N    . ALA C 1 41  ? 214.803 222.075 233.164 1.00 267.67 ? 136 ALA A N    1 
ATOM 6734  C CA   . ALA C 1 41  ? 213.468 222.435 232.716 1.00 267.67 ? 136 ALA A CA   1 
ATOM 6735  C C    . ALA C 1 41  ? 212.607 222.841 233.904 1.00 267.67 ? 136 ALA A C    1 
ATOM 6736  O O    . ALA C 1 41  ? 212.615 222.187 234.950 1.00 267.67 ? 136 ALA A O    1 
ATOM 6737  C CB   . ALA C 1 41  ? 212.820 221.266 231.975 1.00 267.67 ? 136 ALA A CB   1 
ATOM 6738  H H    . ALA C 1 41  ? 215.023 221.260 233.004 1.00 321.20 ? 136 ALA A H    1 
ATOM 6739  H HA   . ALA C 1 41  ? 213.524 223.188 232.107 1.00 321.20 ? 136 ALA A HA   1 
ATOM 6740  H HB1  . ALA C 1 41  ? 211.948 221.540 231.651 1.00 321.20 ? 136 ALA A HB1  1 
ATOM 6741  H HB2  . ALA C 1 41  ? 213.386 221.012 231.228 1.00 321.20 ? 136 ALA A HB2  1 
ATOM 6742  H HB3  . ALA C 1 41  ? 212.726 220.519 232.586 1.00 321.20 ? 136 ALA A HB3  1 
ATOM 6743  N N    . ALA C 1 42  ? 211.871 223.936 233.744 1.00 240.66 ? 137 ALA A N    1 
ATOM 6744  C CA   . ALA C 1 42  ? 210.939 224.358 234.776 1.00 240.66 ? 137 ALA A CA   1 
ATOM 6745  C C    . ALA C 1 42  ? 209.701 223.469 234.760 1.00 240.66 ? 137 ALA A C    1 
ATOM 6746  O O    . ALA C 1 42  ? 209.336 222.889 233.733 1.00 240.66 ? 137 ALA A O    1 
ATOM 6747  C CB   . ALA C 1 42  ? 210.535 225.818 234.571 1.00 240.66 ? 137 ALA A CB   1 
ATOM 6748  H H    . ALA C 1 42  ? 211.892 224.446 233.053 1.00 288.79 ? 137 ALA A H    1 
ATOM 6749  H HA   . ALA C 1 42  ? 211.361 224.276 235.646 1.00 288.79 ? 137 ALA A HA   1 
ATOM 6750  H HB1  . ALA C 1 42  ? 209.902 226.069 235.263 1.00 288.79 ? 137 ALA A HB1  1 
ATOM 6751  H HB2  . ALA C 1 42  ? 211.327 226.376 234.627 1.00 288.79 ? 137 ALA A HB2  1 
ATOM 6752  H HB3  . ALA C 1 42  ? 210.124 225.910 233.698 1.00 288.79 ? 137 ALA A HB3  1 
ATOM 6753  N N    . ALA C 1 43  ? 209.062 223.351 235.920 1.00 208.31 ? 138 ALA A N    1 
ATOM 6754  C CA   . ALA C 1 43  ? 207.806 222.619 236.008 1.00 208.31 ? 138 ALA A CA   1 
ATOM 6755  C C    . ALA C 1 43  ? 206.801 223.215 235.037 1.00 208.31 ? 138 ALA A C    1 
ATOM 6756  O O    . ALA C 1 43  ? 206.612 224.434 234.996 1.00 208.31 ? 138 ALA A O    1 
ATOM 6757  C CB   . ALA C 1 43  ? 207.263 222.664 237.437 1.00 208.31 ? 138 ALA A CB   1 
ATOM 6758  H H    . ALA C 1 43  ? 209.333 223.683 236.666 1.00 249.97 ? 138 ALA A H    1 
ATOM 6759  H HA   . ALA C 1 43  ? 207.955 221.692 235.765 1.00 249.97 ? 138 ALA A HA   1 
ATOM 6760  H HB1  . ALA C 1 43  ? 206.438 222.155 237.475 1.00 249.97 ? 138 ALA A HB1  1 
ATOM 6761  H HB2  . ALA C 1 43  ? 207.919 222.276 238.036 1.00 249.97 ? 138 ALA A HB2  1 
ATOM 6762  H HB3  . ALA C 1 43  ? 207.093 223.587 237.681 1.00 249.97 ? 138 ALA A HB3  1 
ATOM 6763  N N    . ARG C 1 44  ? 206.182 222.347 234.238 1.00 172.55 ? 139 ARG A N    1 
ATOM 6764  C CA   . ARG C 1 44  ? 205.127 222.771 233.329 1.00 172.55 ? 139 ARG A CA   1 
ATOM 6765  C C    . ARG C 1 44  ? 203.883 223.180 234.109 1.00 172.55 ? 139 ARG A C    1 
ATOM 6766  O O    . ARG C 1 44  ? 203.732 222.856 235.289 1.00 172.55 ? 139 ARG A O    1 
ATOM 6767  C CB   . ARG C 1 44  ? 204.774 221.655 232.356 1.00 172.55 ? 139 ARG A CB   1 
ATOM 6768  C CG   . ARG C 1 44  ? 205.935 221.149 231.516 1.00 172.55 ? 139 ARG A CG   1 
ATOM 6769  C CD   . ARG C 1 44  ? 206.431 222.190 230.580 1.00 172.55 ? 139 ARG A CD   1 
ATOM 6770  N NE   . ARG C 1 44  ? 207.425 223.050 231.202 1.00 172.55 ? 139 ARG A NE   1 
ATOM 6771  C CZ   . ARG C 1 44  ? 207.882 224.201 230.670 1.00 172.55 ? 139 ARG A CZ   1 
ATOM 6772  N NH1  . ARG C 1 44  ? 207.425 224.615 229.510 1.00 172.55 ? 139 ARG A NH1  1 
ATOM 6773  N NH2  . ARG C 1 44  ? 208.789 224.913 231.316 1.00 172.55 ? 139 ARG A NH2  1 
ATOM 6774  H H    . ARG C 1 44  ? 206.360 221.506 234.203 1.00 207.06 ? 139 ARG A H    1 
ATOM 6775  H HA   . ARG C 1 44  ? 205.427 223.540 232.822 1.00 207.06 ? 139 ARG A HA   1 
ATOM 6776  H HB2  . ARG C 1 44  ? 204.371 220.807 232.907 1.00 207.06 ? 139 ARG A HB2  1 
ATOM 6777  H HB3  . ARG C 1 44  ? 203.998 222.001 231.673 1.00 207.06 ? 139 ARG A HB3  1 
ATOM 6778  H HG2  . ARG C 1 44  ? 206.757 220.856 232.169 1.00 207.06 ? 139 ARG A HG2  1 
ATOM 6779  H HG3  . ARG C 1 44  ? 205.612 220.287 230.930 1.00 207.06 ? 139 ARG A HG3  1 
ATOM 6780  H HD2  . ARG C 1 44  ? 206.888 221.713 229.713 1.00 207.06 ? 139 ARG A HD2  1 
ATOM 6781  H HD3  . ARG C 1 44  ? 205.598 222.813 230.254 1.00 207.06 ? 139 ARG A HD3  1 
ATOM 6782  H HE   . ARG C 1 44  ? 207.800 222.764 232.096 1.00 207.06 ? 139 ARG A HE   1 
ATOM 6783  H HH11 . ARG C 1 44  ? 206.732 224.071 229.016 1.00 207.06 ? 139 ARG A HH11 1 
ATOM 6784  H HH12 . ARG C 1 44  ? 207.767 225.478 229.111 1.00 207.06 ? 139 ARG A HH12 1 
ATOM 6785  H HH21 . ARG C 1 44  ? 209.140 224.594 232.209 1.00 207.06 ? 139 ARG A HH21 1 
ATOM 6786  H HH22 . ARG C 1 44  ? 209.130 225.775 230.918 1.00 207.06 ? 139 ARG A HH22 1 
ATOM 6787  N N    . VAL C 1 45  ? 202.993 223.918 233.440 1.00 177.36 ? 140 VAL A N    1 
ATOM 6788  C CA   . VAL C 1 45  ? 201.713 224.271 234.052 1.00 177.36 ? 140 VAL A CA   1 
ATOM 6789  C C    . VAL C 1 45  ? 200.930 223.002 234.356 1.00 177.36 ? 140 VAL A C    1 
ATOM 6790  O O    . VAL C 1 45  ? 200.095 222.966 235.267 1.00 177.36 ? 140 VAL A O    1 
ATOM 6791  C CB   . VAL C 1 45  ? 200.891 225.178 233.118 1.00 177.36 ? 140 VAL A CB   1 
ATOM 6792  C CG1  . VAL C 1 45  ? 201.596 226.510 232.911 1.00 177.36 ? 140 VAL A CG1  1 
ATOM 6793  C CG2  . VAL C 1 45  ? 200.660 224.478 231.787 1.00 177.36 ? 140 VAL A CG2  1 
ATOM 6794  H H    . VAL C 1 45  ? 203.105 224.216 232.642 1.00 212.83 ? 140 VAL A H    1 
ATOM 6795  H HA   . VAL C 1 45  ? 201.880 224.718 234.892 1.00 212.83 ? 140 VAL A HA   1 
ATOM 6796  H HB   . VAL C 1 45  ? 199.931 225.392 233.588 1.00 212.83 ? 140 VAL A HB   1 
ATOM 6797  H HG11 . VAL C 1 45  ? 201.001 227.139 232.249 1.00 212.83 ? 140 VAL A HG11 1 
ATOM 6798  H HG12 . VAL C 1 45  ? 201.719 227.010 233.872 1.00 212.83 ? 140 VAL A HG12 1 
ATOM 6799  H HG13 . VAL C 1 45  ? 202.575 226.338 232.464 1.00 212.83 ? 140 VAL A HG13 1 
ATOM 6800  H HG21 . VAL C 1 45  ? 200.077 225.125 231.132 1.00 212.83 ? 140 VAL A HG21 1 
ATOM 6801  H HG22 . VAL C 1 45  ? 201.620 224.258 231.320 1.00 212.83 ? 140 VAL A HG22 1 
ATOM 6802  H HG23 . VAL C 1 45  ? 200.117 223.548 231.955 1.00 212.83 ? 140 VAL A HG23 1 
ATOM 6803  N N    . TYR C 1 46  ? 201.186 221.946 233.586 1.00 173.18 ? 141 TYR A N    1 
ATOM 6804  C CA   . TYR C 1 46  ? 200.770 220.603 233.967 1.00 173.18 ? 141 TYR A CA   1 
ATOM 6805  C C    . TYR C 1 46  ? 201.269 220.248 235.365 1.00 173.18 ? 141 TYR A C    1 
ATOM 6806  O O    . TYR C 1 46  ? 200.483 219.892 236.254 1.00 173.18 ? 141 TYR A O    1 
ATOM 6807  C CB   . TYR C 1 46  ? 201.270 219.579 232.947 1.00 173.18 ? 141 TYR A CB   1 
ATOM 6808  C CG   . TYR C 1 46  ? 201.153 218.145 233.413 1.00 173.18 ? 141 TYR A CG   1 
ATOM 6809  C CD1  . TYR C 1 46  ? 199.937 217.483 233.321 1.00 173.18 ? 141 TYR A CD1  1 
ATOM 6810  C CD2  . TYR C 1 46  ? 202.260 217.492 233.932 1.00 173.18 ? 141 TYR A CD2  1 
ATOM 6811  C CE1  . TYR C 1 46  ? 199.830 216.173 233.747 1.00 173.18 ? 141 TYR A CE1  1 
ATOM 6812  C CE2  . TYR C 1 46  ? 202.153 216.182 234.358 1.00 173.18 ? 141 TYR A CE2  1 
ATOM 6813  C CZ   . TYR C 1 46  ? 200.944 215.523 234.267 1.00 173.18 ? 141 TYR A CZ   1 
ATOM 6814  O OH   . TYR C 1 46  ? 200.837 214.219 234.691 1.00 173.18 ? 141 TYR A OH   1 
ATOM 6815  H H    . TYR C 1 46  ? 201.598 221.982 232.832 1.00 207.82 ? 141 TYR A H    1 
ATOM 6816  H HA   . TYR C 1 46  ? 199.801 220.553 233.968 1.00 207.82 ? 141 TYR A HA   1 
ATOM 6817  H HB2  . TYR C 1 46  ? 200.705 219.683 232.019 1.00 207.82 ? 141 TYR A HB2  1 
ATOM 6818  H HB3  . TYR C 1 46  ? 202.316 219.777 232.716 1.00 207.82 ? 141 TYR A HB3  1 
ATOM 6819  H HD1  . TYR C 1 46  ? 199.066 217.996 232.912 1.00 207.82 ? 141 TYR A HD1  1 
ATOM 6820  H HD2  . TYR C 1 46  ? 203.215 218.012 234.006 1.00 207.82 ? 141 TYR A HD2  1 
ATOM 6821  H HE1  . TYR C 1 46  ? 198.875 215.653 233.674 1.00 207.82 ? 141 TYR A HE1  1 
ATOM 6822  H HE2  . TYR C 1 46  ? 203.024 215.669 234.767 1.00 207.82 ? 141 TYR A HE2  1 
ATOM 6823  H HH   . TYR C 1 46  ? 201.684 213.925 235.035 1.00 207.82 ? 141 TYR A HH   1 
ATOM 6824  N N    . ASP C 1 47  ? 202.586 220.329 235.576 1.00 190.97 ? 142 ASP A N    1 
ATOM 6825  C CA   . ASP C 1 47  ? 203.148 219.972 236.875 1.00 190.97 ? 142 ASP A CA   1 
ATOM 6826  C C    . ASP C 1 47  ? 202.735 220.975 237.945 1.00 190.97 ? 142 ASP A C    1 
ATOM 6827  O O    . ASP C 1 47  ? 202.493 220.597 239.096 1.00 190.97 ? 142 ASP A O    1 
ATOM 6828  C CB   . ASP C 1 47  ? 204.675 219.898 236.798 1.00 190.97 ? 142 ASP A CB   1 
ATOM 6829  C CG   . ASP C 1 47  ? 205.172 218.654 236.073 1.00 190.97 ? 142 ASP A CG   1 
ATOM 6830  O OD1  . ASP C 1 47  ? 204.650 217.594 236.327 1.00 190.97 ? 142 ASP A OD1  1 
ATOM 6831  O OD2  . ASP C 1 47  ? 206.068 218.776 235.273 1.00 190.97 ? 142 ASP A OD2  1 
ATOM 6832  H H    . ASP C 1 47  ? 203.165 220.582 234.992 1.00 229.16 ? 142 ASP A H    1 
ATOM 6833  H HA   . ASP C 1 47  ? 202.803 219.107 237.139 1.00 229.16 ? 142 ASP A HA   1 
ATOM 6834  H HB2  . ASP C 1 47  ? 205.057 220.778 236.282 1.00 229.16 ? 142 ASP A HB2  1 
ATOM 6835  H HB3  . ASP C 1 47  ? 205.091 219.903 237.806 1.00 229.16 ? 142 ASP A HB3  1 
ATOM 6836  N N    . LEU C 1 48  ? 202.636 222.255 237.588 1.00 182.07 ? 143 LEU A N    1 
ATOM 6837  C CA   . LEU C 1 48  ? 202.217 223.244 238.574 1.00 182.07 ? 143 LEU A CA   1 
ATOM 6838  C C    . LEU C 1 48  ? 200.790 222.976 239.036 1.00 182.07 ? 143 LEU A C    1 
ATOM 6839  O O    . LEU C 1 48  ? 200.501 223.037 240.233 1.00 182.07 ? 143 LEU A O    1 
ATOM 6840  C CB   . LEU C 1 48  ? 202.348 224.657 238.002 1.00 182.07 ? 143 LEU A CB   1 
ATOM 6841  C CG   . LEU C 1 48  ? 203.762 225.115 237.607 1.00 182.07 ? 143 LEU A CG   1 
ATOM 6842  C CD1  . LEU C 1 48  ? 203.723 226.460 236.860 1.00 182.07 ? 143 LEU A CD1  1 
ATOM 6843  C CD2  . LEU C 1 48  ? 204.705 225.194 238.817 1.00 182.07 ? 143 LEU A CD2  1 
ATOM 6844  H H    . LEU C 1 48  ? 202.799 222.569 236.803 1.00 218.48 ? 143 LEU A H    1 
ATOM 6845  H HA   . LEU C 1 48  ? 202.786 223.170 239.353 1.00 218.48 ? 143 LEU A HA   1 
ATOM 6846  H HB2  . LEU C 1 48  ? 201.795 224.714 237.208 1.00 218.48 ? 143 LEU A HB2  1 
ATOM 6847  H HB3  . LEU C 1 48  ? 202.020 225.283 238.665 1.00 218.48 ? 143 LEU A HB3  1 
ATOM 6848  H HG   . LEU C 1 48  ? 204.134 224.459 236.997 1.00 218.48 ? 143 LEU A HG   1 
ATOM 6849  H HD11 . LEU C 1 48  ? 204.630 226.711 236.623 1.00 218.48 ? 143 LEU A HD11 1 
ATOM 6850  H HD12 . LEU C 1 48  ? 203.185 226.376 236.061 1.00 218.48 ? 143 LEU A HD12 1 
ATOM 6851  H HD13 . LEU C 1 48  ? 203.339 227.131 237.446 1.00 218.48 ? 143 LEU A HD13 1 
ATOM 6852  H HD21 . LEU C 1 48  ? 205.561 225.538 238.521 1.00 218.48 ? 143 LEU A HD21 1 
ATOM 6853  H HD22 . LEU C 1 48  ? 204.321 225.790 239.478 1.00 218.48 ? 143 LEU A HD22 1 
ATOM 6854  H HD23 . LEU C 1 48  ? 204.823 224.309 239.195 1.00 218.48 ? 143 LEU A HD23 1 
ATOM 6855  N N    . GLY C 1 49  ? 199.889 222.661 238.105 1.00 162.16 ? 144 GLY A N    1 
ATOM 6856  C CA   . GLY C 1 49  ? 198.550 222.249 238.497 1.00 162.16 ? 144 GLY A CA   1 
ATOM 6857  C C    . GLY C 1 49  ? 198.564 220.975 239.321 1.00 162.16 ? 144 GLY A C    1 
ATOM 6858  O O    . GLY C 1 49  ? 197.891 220.882 240.354 1.00 162.16 ? 144 GLY A O    1 
ATOM 6859  H H    . GLY C 1 49  ? 200.026 222.679 237.256 1.00 194.59 ? 144 GLY A H    1 
ATOM 6860  H HA2  . GLY C 1 49  ? 198.134 222.950 239.021 1.00 194.59 ? 144 GLY A HA2  1 
ATOM 6861  H HA3  . GLY C 1 49  ? 198.012 222.096 237.704 1.00 194.59 ? 144 GLY A HA3  1 
ATOM 6862  N N    . LEU C 1 50  ? 199.325 219.973 238.865 1.00 172.52 ? 145 LEU A N    1 
ATOM 6863  C CA   . LEU C 1 50  ? 199.435 218.720 239.611 1.00 172.52 ? 145 LEU A CA   1 
ATOM 6864  C C    . LEU C 1 50  ? 199.909 218.974 241.035 1.00 172.52 ? 145 LEU A C    1 
ATOM 6865  O O    . LEU C 1 50  ? 199.340 218.440 241.992 1.00 172.52 ? 145 LEU A O    1 
ATOM 6866  C CB   . LEU C 1 50  ? 200.405 217.763 238.906 1.00 172.52 ? 145 LEU A CB   1 
ATOM 6867  C CG   . LEU C 1 50  ? 200.486 216.348 239.491 1.00 172.52 ? 145 LEU A CG   1 
ATOM 6868  C CD1  . LEU C 1 50  ? 200.796 215.355 238.379 1.00 172.52 ? 145 LEU A CD1  1 
ATOM 6869  C CD2  . LEU C 1 50  ? 201.553 216.306 240.574 1.00 172.52 ? 145 LEU A CD2  1 
ATOM 6870  H H    . LEU C 1 50  ? 199.780 219.994 238.135 1.00 207.02 ? 145 LEU A H    1 
ATOM 6871  H HA   . LEU C 1 50  ? 198.562 218.300 239.656 1.00 207.02 ? 145 LEU A HA   1 
ATOM 6872  H HB2  . LEU C 1 50  ? 200.108 217.674 237.862 1.00 207.02 ? 145 LEU A HB2  1 
ATOM 6873  H HB3  . LEU C 1 50  ? 201.406 218.194 238.941 1.00 207.02 ? 145 LEU A HB3  1 
ATOM 6874  H HG   . LEU C 1 50  ? 199.521 216.076 239.921 1.00 207.02 ? 145 LEU A HG   1 
ATOM 6875  H HD11 . LEU C 1 50  ? 200.853 214.349 238.794 1.00 207.02 ? 145 LEU A HD11 1 
ATOM 6876  H HD12 . LEU C 1 50  ? 200.007 215.392 237.627 1.00 207.02 ? 145 LEU A HD12 1 
ATOM 6877  H HD13 . LEU C 1 50  ? 201.749 215.611 237.918 1.00 207.02 ? 145 LEU A HD13 1 
ATOM 6878  H HD21 . LEU C 1 50  ? 201.610 215.300 240.991 1.00 207.02 ? 145 LEU A HD21 1 
ATOM 6879  H HD22 . LEU C 1 50  ? 202.518 216.576 240.145 1.00 207.02 ? 145 LEU A HD22 1 
ATOM 6880  H HD23 . LEU C 1 50  ? 201.297 217.012 241.365 1.00 207.02 ? 145 LEU A HD23 1 
ATOM 6881  N N    . ARG C 1 51  ? 200.951 219.796 241.191 1.00 182.17 ? 146 ARG A N    1 
ATOM 6882  C CA   . ARG C 1 51  ? 201.466 220.105 242.522 1.00 182.17 ? 146 ARG A CA   1 
ATOM 6883  C C    . ARG C 1 51  ? 200.389 220.721 243.407 1.00 182.17 ? 146 ARG A C    1 
ATOM 6884  O O    . ARG C 1 51  ? 200.218 220.313 244.562 1.00 182.17 ? 146 ARG A O    1 
ATOM 6885  C CB   . ARG C 1 51  ? 202.646 221.061 242.429 1.00 182.17 ? 146 ARG A CB   1 
ATOM 6886  C CG   . ARG C 1 51  ? 203.931 220.441 241.905 1.00 182.17 ? 146 ARG A CG   1 
ATOM 6887  C CD   . ARG C 1 51  ? 205.008 221.453 241.754 1.00 182.17 ? 146 ARG A CD   1 
ATOM 6888  N NE   . ARG C 1 51  ? 206.235 220.868 241.238 1.00 182.17 ? 146 ARG A NE   1 
ATOM 6889  C CZ   . ARG C 1 51  ? 207.325 221.572 240.875 1.00 182.17 ? 146 ARG A CZ   1 
ATOM 6890  N NH1  . ARG C 1 51  ? 207.325 222.882 240.977 1.00 182.17 ? 146 ARG A NH1  1 
ATOM 6891  N NH2  . ARG C 1 51  ? 208.394 220.944 240.416 1.00 182.17 ? 146 ARG A NH2  1 
ATOM 6892  H H    . ARG C 1 51  ? 201.371 220.182 240.548 1.00 218.60 ? 146 ARG A H    1 
ATOM 6893  H HA   . ARG C 1 51  ? 201.767 219.285 242.944 1.00 218.60 ? 146 ARG A HA   1 
ATOM 6894  H HB2  . ARG C 1 51  ? 202.390 221.892 241.774 1.00 218.60 ? 146 ARG A HB2  1 
ATOM 6895  H HB3  . ARG C 1 51  ? 202.857 221.475 243.415 1.00 218.60 ? 146 ARG A HB3  1 
ATOM 6896  H HG2  . ARG C 1 51  ? 204.276 219.675 242.601 1.00 218.60 ? 146 ARG A HG2  1 
ATOM 6897  H HG3  . ARG C 1 51  ? 203.746 219.989 240.930 1.00 218.60 ? 146 ARG A HG3  1 
ATOM 6898  H HD2  . ARG C 1 51  ? 204.683 222.229 241.061 1.00 218.60 ? 146 ARG A HD2  1 
ATOM 6899  H HD3  . ARG C 1 51  ? 205.225 221.901 242.723 1.00 218.60 ? 146 ARG A HD3  1 
ATOM 6900  H HE   . ARG C 1 51  ? 206.272 219.861 241.145 1.00 218.60 ? 146 ARG A HE   1 
ATOM 6901  H HH11 . ARG C 1 51  ? 206.508 223.362 241.327 1.00 218.60 ? 146 ARG A HH11 1 
ATOM 6902  H HH12 . ARG C 1 51  ? 208.142 223.410 240.704 1.00 218.60 ? 146 ARG A HH12 1 
ATOM 6903  H HH21 . ARG C 1 51  ? 208.394 219.936 240.338 1.00 218.60 ? 146 ARG A HH21 1 
ATOM 6904  H HH22 . ARG C 1 51  ? 209.210 221.471 240.144 1.00 218.60 ? 146 ARG A HH22 1 
ATOM 6905  N N    . ARG C 1 52  ? 199.657 221.710 242.886 1.00 170.56 ? 147 ARG A N    1 
ATOM 6906  C CA   . ARG C 1 52  ? 198.591 222.332 243.665 1.00 170.56 ? 147 ARG A CA   1 
ATOM 6907  C C    . ARG C 1 52  ? 197.453 221.354 243.927 1.00 170.56 ? 147 ARG A C    1 
ATOM 6908  O O    . ARG C 1 52  ? 196.896 221.322 245.030 1.00 170.56 ? 147 ARG A O    1 
ATOM 6909  C CB   . ARG C 1 52  ? 198.047 223.557 242.946 1.00 170.56 ? 147 ARG A CB   1 
ATOM 6910  C CG   . ARG C 1 52  ? 199.027 224.713 242.819 1.00 170.56 ? 147 ARG A CG   1 
ATOM 6911  C CD   . ARG C 1 52  ? 199.427 225.242 244.148 1.00 170.56 ? 147 ARG A CD   1 
ATOM 6912  N NE   . ARG C 1 52  ? 198.303 225.834 244.857 1.00 170.56 ? 147 ARG A NE   1 
ATOM 6913  C CZ   . ARG C 1 52  ? 198.280 226.087 246.180 1.00 170.56 ? 147 ARG A CZ   1 
ATOM 6914  N NH1  . ARG C 1 52  ? 199.324 225.794 246.923 1.00 170.56 ? 147 ARG A NH1  1 
ATOM 6915  N NH2  . ARG C 1 52  ? 197.208 226.629 246.731 1.00 170.56 ? 147 ARG A NH2  1 
ATOM 6916  H H    . ARG C 1 52  ? 199.757 222.031 242.095 1.00 204.67 ? 147 ARG A H    1 
ATOM 6917  H HA   . ARG C 1 52  ? 198.946 222.596 244.528 1.00 204.67 ? 147 ARG A HA   1 
ATOM 6918  H HB2  . ARG C 1 52  ? 197.734 223.279 241.940 1.00 204.67 ? 147 ARG A HB2  1 
ATOM 6919  H HB3  . ARG C 1 52  ? 197.167 223.927 243.472 1.00 204.67 ? 147 ARG A HB3  1 
ATOM 6920  H HG2  . ARG C 1 52  ? 199.924 224.374 242.301 1.00 204.67 ? 147 ARG A HG2  1 
ATOM 6921  H HG3  . ARG C 1 52  ? 198.565 225.522 242.253 1.00 204.67 ? 147 ARG A HG3  1 
ATOM 6922  H HD2  . ARG C 1 52  ? 199.825 224.431 244.758 1.00 204.67 ? 147 ARG A HD2  1 
ATOM 6923  H HD3  . ARG C 1 52  ? 200.190 226.008 244.020 1.00 204.67 ? 147 ARG A HD3  1 
ATOM 6924  H HE   . ARG C 1 52  ? 197.481 226.073 244.318 1.00 204.67 ? 147 ARG A HE   1 
ATOM 6925  H HH11 . ARG C 1 52  ? 200.144 225.380 246.502 1.00 204.67 ? 147 ARG A HH11 1 
ATOM 6926  H HH12 . ARG C 1 52  ? 199.307 225.984 247.915 1.00 204.67 ? 147 ARG A HH12 1 
ATOM 6927  H HH21 . ARG C 1 52  ? 196.405 226.853 246.159 1.00 204.67 ? 147 ARG A HH21 1 
ATOM 6928  H HH22 . ARG C 1 52  ? 197.191 226.818 247.722 1.00 204.67 ? 147 ARG A HH22 1 
ATOM 6929  N N    . LEU C 1 53  ? 197.095 220.541 242.927 1.00 180.89 ? 148 LEU A N    1 
ATOM 6930  C CA   . LEU C 1 53  ? 196.041 219.551 243.135 1.00 180.89 ? 148 LEU A CA   1 
ATOM 6931  C C    . LEU C 1 53  ? 196.511 218.402 244.023 1.00 180.89 ? 148 LEU A C    1 
ATOM 6932  O O    . LEU C 1 53  ? 195.696 217.779 244.713 1.00 180.89 ? 148 LEU A O    1 
ATOM 6933  C CB   . LEU C 1 53  ? 195.544 219.024 241.789 1.00 180.89 ? 148 LEU A CB   1 
ATOM 6934  C CG   . LEU C 1 53  ? 194.844 220.032 240.870 1.00 180.89 ? 148 LEU A CG   1 
ATOM 6935  C CD1  . LEU C 1 53  ? 194.599 219.408 239.507 1.00 180.89 ? 148 LEU A CD1  1 
ATOM 6936  C CD2  . LEU C 1 53  ? 193.529 220.532 241.466 1.00 180.89 ? 148 LEU A CD2  1 
ATOM 6937  H H    . LEU C 1 53  ? 197.440 220.541 242.139 1.00 217.07 ? 148 LEU A H    1 
ATOM 6938  H HA   . LEU C 1 53  ? 195.292 219.965 243.588 1.00 217.07 ? 148 LEU A HA   1 
ATOM 6939  H HB2  . LEU C 1 53  ? 196.301 218.663 241.301 1.00 217.07 ? 148 LEU A HB2  1 
ATOM 6940  H HB3  . LEU C 1 53  ? 194.905 218.317 241.964 1.00 217.07 ? 148 LEU A HB3  1 
ATOM 6941  H HG   . LEU C 1 53  ? 195.424 220.799 240.747 1.00 217.07 ? 148 LEU A HG   1 
ATOM 6942  H HD11 . LEU C 1 53  ? 194.152 220.054 238.939 1.00 217.07 ? 148 LEU A HD11 1 
ATOM 6943  H HD12 . LEU C 1 53  ? 195.451 219.156 239.117 1.00 217.07 ? 148 LEU A HD12 1 
ATOM 6944  H HD13 . LEU C 1 53  ? 194.040 218.622 239.618 1.00 217.07 ? 148 LEU A HD13 1 
ATOM 6945  H HD21 . LEU C 1 53  ? 193.119 221.145 240.841 1.00 217.07 ? 148 LEU A HD21 1 
ATOM 6946  H HD22 . LEU C 1 53  ? 192.943 219.775 241.623 1.00 217.07 ? 148 LEU A HD22 1 
ATOM 6947  H HD23 . LEU C 1 53  ? 193.703 220.996 242.298 1.00 217.07 ? 148 LEU A HD23 1 
ATOM 6948  N N    . ARG C 1 54  ? 197.814 218.107 244.028 1.00 185.32 ? 149 ARG A N    1 
ATOM 6949  C CA   . ARG C 1 54  ? 198.336 217.074 244.919 1.00 185.32 ? 149 ARG A CA   1 
ATOM 6950  C C    . ARG C 1 54  ? 198.418 217.581 246.354 1.00 185.32 ? 149 ARG A C    1 
ATOM 6951  O O    . ARG C 1 54  ? 197.975 216.902 247.288 1.00 185.32 ? 149 ARG A O    1 
ATOM 6952  C CB   . ARG C 1 54  ? 199.715 216.620 244.464 1.00 185.32 ? 149 ARG A CB   1 
ATOM 6953  C CG   . ARG C 1 54  ? 200.333 215.512 245.303 1.00 185.32 ? 149 ARG A CG   1 
ATOM 6954  C CD   . ARG C 1 54  ? 201.634 215.062 244.746 1.00 185.32 ? 149 ARG A CD   1 
ATOM 6955  N NE   . ARG C 1 54  ? 202.255 214.042 245.575 1.00 185.32 ? 149 ARG A NE   1 
ATOM 6956  C CZ   . ARG C 1 54  ? 203.462 213.493 245.338 1.00 185.32 ? 149 ARG A CZ   1 
ATOM 6957  N NH1  . ARG C 1 54  ? 204.165 213.876 244.295 1.00 185.32 ? 149 ARG A NH1  1 
ATOM 6958  N NH2  . ARG C 1 54  ? 203.941 212.570 246.153 1.00 185.32 ? 149 ARG A NH2  1 
ATOM 6959  H H    . ARG C 1 54  ? 198.408 218.478 243.530 1.00 222.38 ? 149 ARG A H    1 
ATOM 6960  H HA   . ARG C 1 54  ? 197.745 216.305 244.903 1.00 222.38 ? 149 ARG A HA   1 
ATOM 6961  H HB2  . ARG C 1 54  ? 199.660 216.264 243.436 1.00 222.38 ? 149 ARG A HB2  1 
ATOM 6962  H HB3  . ARG C 1 54  ? 200.401 217.467 244.480 1.00 222.38 ? 149 ARG A HB3  1 
ATOM 6963  H HG2  . ARG C 1 54  ? 200.500 215.874 246.317 1.00 222.38 ? 149 ARG A HG2  1 
ATOM 6964  H HG3  . ARG C 1 54  ? 199.657 214.657 245.330 1.00 222.38 ? 149 ARG A HG3  1 
ATOM 6965  H HD2  . ARG C 1 54  ? 201.480 214.646 243.751 1.00 222.38 ? 149 ARG A HD2  1 
ATOM 6966  H HD3  . ARG C 1 54  ? 202.315 215.910 244.683 1.00 222.38 ? 149 ARG A HD3  1 
ATOM 6967  H HE   . ARG C 1 54  ? 201.745 213.721 246.387 1.00 222.38 ? 149 ARG A HE   1 
ATOM 6968  H HH11 . ARG C 1 54  ? 203.799 214.582 243.671 1.00 222.38 ? 149 ARG A HH11 1 
ATOM 6969  H HH12 . ARG C 1 54  ? 205.070 213.465 244.117 1.00 222.38 ? 149 ARG A HH12 1 
ATOM 6970  H HH21 . ARG C 1 54  ? 203.401 212.275 246.955 1.00 222.38 ? 149 ARG A HH21 1 
ATOM 6971  H HH22 . ARG C 1 54  ? 204.845 212.159 245.975 1.00 222.38 ? 149 ARG A HH22 1 
ATOM 6972  N N    . GLN C 1 55  ? 198.992 218.770 246.549 1.00 181.85 ? 150 GLN A N    1 
ATOM 6973  C CA   . GLN C 1 55  ? 199.161 219.300 247.898 1.00 181.85 ? 150 GLN A CA   1 
ATOM 6974  C C    . GLN C 1 55  ? 197.819 219.455 248.602 1.00 181.85 ? 150 GLN A C    1 
ATOM 6975  O O    . GLN C 1 55  ? 197.703 219.176 249.802 1.00 181.85 ? 150 GLN A O    1 
ATOM 6976  C CB   . GLN C 1 55  ? 199.889 220.646 247.859 1.00 181.85 ? 150 GLN A CB   1 
ATOM 6977  C CG   . GLN C 1 55  ? 201.349 220.553 247.447 1.00 181.85 ? 150 GLN A CG   1 
ATOM 6978  C CD   . GLN C 1 55  ? 201.942 221.907 247.108 1.00 181.85 ? 150 GLN A CD   1 
ATOM 6979  O OE1  . GLN C 1 55  ? 201.225 222.838 246.729 1.00 181.85 ? 150 GLN A OE1  1 
ATOM 6980  N NE2  . GLN C 1 55  ? 203.258 222.026 247.243 1.00 181.85 ? 150 GLN A NE2  1 
ATOM 6981  H H    . GLN C 1 55  ? 199.288 219.281 245.924 1.00 218.22 ? 150 GLN A H    1 
ATOM 6982  H HA   . GLN C 1 55  ? 199.700 218.680 248.415 1.00 218.22 ? 150 GLN A HA   1 
ATOM 6983  H HB2  . GLN C 1 55  ? 199.384 221.312 247.159 1.00 218.22 ? 150 GLN A HB2  1 
ATOM 6984  H HB3  . GLN C 1 55  ? 199.847 221.112 248.843 1.00 218.22 ? 150 GLN A HB3  1 
ATOM 6985  H HG2  . GLN C 1 55  ? 201.921 220.125 248.270 1.00 218.22 ? 150 GLN A HG2  1 
ATOM 6986  H HG3  . GLN C 1 55  ? 201.427 219.916 246.566 1.00 218.22 ? 150 GLN A HG3  1 
ATOM 6987  H HE21 . GLN C 1 55  ? 203.706 222.896 247.034 1.00 218.22 ? 150 GLN A HE21 1 
ATOM 6988  H HE22 . GLN C 1 55  ? 203.802 221.246 247.554 1.00 218.22 ? 150 GLN A HE22 1 
ATOM 6989  N N    . ARG C 1 56  ? 196.795 219.898 247.875 1.00 176.21 ? 151 ARG A N    1 
ATOM 6990  C CA   . ARG C 1 56  ? 195.459 220.060 248.435 1.00 176.21 ? 151 ARG A CA   1 
ATOM 6991  C C    . ARG C 1 56  ? 194.659 218.761 248.467 1.00 176.21 ? 151 ARG A C    1 
ATOM 6992  O O    . ARG C 1 56  ? 193.496 218.786 248.888 1.00 176.21 ? 151 ARG A O    1 
ATOM 6993  C CB   . ARG C 1 56  ? 194.683 221.098 247.636 1.00 176.21 ? 151 ARG A CB   1 
ATOM 6994  C CG   . ARG C 1 56  ? 195.213 222.519 247.750 1.00 176.21 ? 151 ARG A CG   1 
ATOM 6995  C CD   . ARG C 1 56  ? 194.519 223.439 246.812 1.00 176.21 ? 151 ARG A CD   1 
ATOM 6996  N NE   . ARG C 1 56  ? 194.848 223.150 245.426 1.00 176.21 ? 151 ARG A NE   1 
ATOM 6997  C CZ   . ARG C 1 56  ? 194.219 223.688 244.362 1.00 176.21 ? 151 ARG A CZ   1 
ATOM 6998  N NH1  . ARG C 1 56  ? 193.233 224.538 244.543 1.00 176.21 ? 151 ARG A NH1  1 
ATOM 6999  N NH2  . ARG C 1 56  ? 194.594 223.360 243.138 1.00 176.21 ? 151 ARG A NH2  1 
ATOM 7000  H H    . ARG C 1 56  ? 196.851 220.112 247.043 1.00 211.45 ? 151 ARG A H    1 
ATOM 7001  H HA   . ARG C 1 56  ? 195.536 220.381 249.346 1.00 211.45 ? 151 ARG A HA   1 
ATOM 7002  H HB2  . ARG C 1 56  ? 194.692 220.826 246.582 1.00 211.45 ? 151 ARG A HB2  1 
ATOM 7003  H HB3  . ARG C 1 56  ? 193.644 221.106 247.964 1.00 211.45 ? 151 ARG A HB3  1 
ATOM 7004  H HG2  . ARG C 1 56  ? 195.060 222.884 248.765 1.00 211.45 ? 151 ARG A HG2  1 
ATOM 7005  H HG3  . ARG C 1 56  ? 196.278 222.530 247.516 1.00 211.45 ? 151 ARG A HG3  1 
ATOM 7006  H HD2  . ARG C 1 56  ? 193.441 223.339 246.935 1.00 211.45 ? 151 ARG A HD2  1 
ATOM 7007  H HD3  . ARG C 1 56  ? 194.815 224.466 247.026 1.00 211.45 ? 151 ARG A HD3  1 
ATOM 7008  H HE   . ARG C 1 56  ? 195.602 222.500 245.247 1.00 211.45 ? 151 ARG A HE   1 
ATOM 7009  H HH11 . ARG C 1 56  ? 192.947 224.789 245.478 1.00 211.45 ? 151 ARG A HH11 1 
ATOM 7010  H HH12 . ARG C 1 56  ? 192.762 224.941 243.746 1.00 211.45 ? 151 ARG A HH12 1 
ATOM 7011  H HH21 . ARG C 1 56  ? 195.353 222.706 242.999 1.00 211.45 ? 151 ARG A HH21 1 
ATOM 7012  H HH22 . ARG C 1 56  ? 194.123 223.763 242.341 1.00 211.45 ? 151 ARG A HH22 1 
ATOM 7013  N N    . ARG C 1 57  ? 195.248 217.636 248.051 1.00 173.30 ? 152 ARG A N    1 
ATOM 7014  C CA   . ARG C 1 57  ? 194.579 216.331 248.059 1.00 173.30 ? 152 ARG A CA   1 
ATOM 7015  C C    . ARG C 1 57  ? 193.346 216.336 247.151 1.00 173.30 ? 152 ARG A C    1 
ATOM 7016  O O    . ARG C 1 57  ? 192.302 215.765 247.475 1.00 173.30 ? 152 ARG A O    1 
ATOM 7017  C CB   . ARG C 1 57  ? 194.226 215.898 249.491 1.00 173.30 ? 152 ARG A CB   1 
ATOM 7018  C CG   . ARG C 1 57  ? 195.373 215.224 250.230 1.00 173.30 ? 152 ARG A CG   1 
ATOM 7019  C CD   . ARG C 1 57  ? 196.507 216.188 250.537 1.00 173.30 ? 152 ARG A CD   1 
ATOM 7020  N NE   . ARG C 1 57  ? 197.533 215.569 251.373 1.00 173.30 ? 152 ARG A NE   1 
ATOM 7021  C CZ   . ARG C 1 57  ? 198.688 216.139 251.711 1.00 173.30 ? 152 ARG A CZ   1 
ATOM 7022  N NH1  . ARG C 1 57  ? 198.997 217.363 251.296 1.00 173.30 ? 152 ARG A NH1  1 
ATOM 7023  N NH2  . ARG C 1 57  ? 199.544 215.476 252.476 1.00 173.30 ? 152 ARG A NH2  1 
ATOM 7024  H H    . ARG C 1 57  ? 196.053 217.593 247.751 1.00 207.96 ? 152 ARG A H    1 
ATOM 7025  H HA   . ARG C 1 57  ? 195.195 215.673 247.701 1.00 207.96 ? 152 ARG A HA   1 
ATOM 7026  H HB2  . ARG C 1 57  ? 193.949 216.666 250.013 1.00 207.96 ? 152 ARG A HB2  1 
ATOM 7027  H HB3  . ARG C 1 57  ? 193.510 215.246 249.477 1.00 207.96 ? 152 ARG A HB3  1 
ATOM 7028  H HG2  . ARG C 1 57  ? 195.043 214.871 251.071 1.00 207.96 ? 152 ARG A HG2  1 
ATOM 7029  H HG3  . ARG C 1 57  ? 195.727 214.505 249.684 1.00 207.96 ? 152 ARG A HG3  1 
ATOM 7030  H HD2  . ARG C 1 57  ? 196.925 216.466 249.708 1.00 207.96 ? 152 ARG A HD2  1 
ATOM 7031  H HD3  . ARG C 1 57  ? 196.153 216.958 251.009 1.00 207.96 ? 152 ARG A HD3  1 
ATOM 7032  H HE   . ARG C 1 57  ? 197.417 214.746 251.596 1.00 207.96 ? 152 ARG A HE   1 
ATOM 7033  H HH11 . ARG C 1 57  ? 198.461 217.815 250.800 1.00 207.96 ? 152 ARG A HH11 1 
ATOM 7034  H HH12 . ARG C 1 57  ? 199.750 217.709 251.529 1.00 207.96 ? 152 ARG A HH12 1 
ATOM 7035  H HH21 . ARG C 1 57  ? 199.351 214.683 252.749 1.00 207.96 ? 152 ARG A HH21 1 
ATOM 7036  H HH22 . ARG C 1 57  ? 200.291 215.838 252.699 1.00 207.96 ? 152 ARG A HH22 1 
ATOM 7037  N N    . ARG C 1 58  ? 193.471 216.983 245.992 1.00 175.90 ? 153 ARG A N    1 
ATOM 7038  C CA   . ARG C 1 58  ? 192.436 216.921 244.968 1.00 175.90 ? 153 ARG A CA   1 
ATOM 7039  C C    . ARG C 1 58  ? 192.592 215.721 244.045 1.00 175.90 ? 153 ARG A C    1 
ATOM 7040  O O    . ARG C 1 58  ? 191.618 215.337 243.386 1.00 175.90 ? 153 ARG A O    1 
ATOM 7041  C CB   . ARG C 1 58  ? 192.448 218.192 244.133 1.00 175.90 ? 153 ARG A CB   1 
ATOM 7042  C CG   . ARG C 1 58  ? 192.071 219.457 244.887 1.00 175.90 ? 153 ARG A CG   1 
ATOM 7043  C CD   . ARG C 1 58  ? 190.628 219.478 245.238 1.00 175.90 ? 153 ARG A CD   1 
ATOM 7044  N NE   . ARG C 1 58  ? 189.782 219.454 244.056 1.00 175.90 ? 153 ARG A NE   1 
ATOM 7045  C CZ   . ARG C 1 58  ? 189.423 220.544 243.350 1.00 175.90 ? 153 ARG A CZ   1 
ATOM 7046  N NH1  . ARG C 1 58  ? 189.842 221.734 243.719 1.00 175.90 ? 153 ARG A NH1  1 
ATOM 7047  N NH2  . ARG C 1 58  ? 188.648 220.417 242.287 1.00 175.90 ? 153 ARG A NH2  1 
ATOM 7048  H H    . ARG C 1 58  ? 194.149 217.466 245.776 1.00 211.08 ? 153 ARG A H    1 
ATOM 7049  H HA   . ARG C 1 58  ? 191.570 216.842 245.392 1.00 211.08 ? 153 ARG A HA   1 
ATOM 7050  H HB2  . ARG C 1 58  ? 193.442 218.342 243.714 1.00 211.08 ? 153 ARG A HB2  1 
ATOM 7051  H HB3  . ARG C 1 58  ? 191.754 218.086 243.299 1.00 211.08 ? 153 ARG A HB3  1 
ATOM 7052  H HG2  . ARG C 1 58  ? 192.649 219.517 245.810 1.00 211.08 ? 153 ARG A HG2  1 
ATOM 7053  H HG3  . ARG C 1 58  ? 192.286 220.329 244.267 1.00 211.08 ? 153 ARG A HG3  1 
ATOM 7054  H HD2  . ARG C 1 58  ? 190.389 218.606 245.846 1.00 211.08 ? 153 ARG A HD2  1 
ATOM 7055  H HD3  . ARG C 1 58  ? 190.403 220.384 245.799 1.00 211.08 ? 153 ARG A HD3  1 
ATOM 7056  H HE   . ARG C 1 58  ? 189.440 218.556 243.741 1.00 211.08 ? 153 ARG A HE   1 
ATOM 7057  H HH11 . ARG C 1 58  ? 190.434 221.831 244.532 1.00 211.08 ? 153 ARG A HH11 1 
ATOM 7058  H HH12 . ARG C 1 58  ? 189.573 222.551 243.190 1.00 211.08 ? 153 ARG A HH12 1 
ATOM 7059  H HH21 . ARG C 1 58  ? 188.325 219.502 242.003 1.00 211.08 ? 153 ARG A HH21 1 
ATOM 7060  H HH22 . ARG C 1 58  ? 188.379 221.233 241.758 1.00 211.08 ? 153 ARG A HH22 1 
ATOM 7061  N N    . LEU C 1 59  ? 193.780 215.122 243.987 1.00 178.99 ? 154 LEU A N    1 
ATOM 7062  C CA   . LEU C 1 59  ? 194.051 213.970 243.141 1.00 178.99 ? 154 LEU A CA   1 
ATOM 7063  C C    . LEU C 1 59  ? 193.974 212.683 243.951 1.00 178.99 ? 154 LEU A C    1 
ATOM 7064  O O    . LEU C 1 59  ? 194.255 212.662 245.153 1.00 178.99 ? 154 LEU A O    1 
ATOM 7065  C CB   . LEU C 1 59  ? 195.435 214.098 242.493 1.00 178.99 ? 154 LEU A CB   1 
ATOM 7066  C CG   . LEU C 1 59  ? 195.684 215.390 241.704 1.00 178.99 ? 154 LEU A CG   1 
ATOM 7067  C CD1  . LEU C 1 59  ? 197.120 215.409 241.200 1.00 178.99 ? 154 LEU A CD1  1 
ATOM 7068  C CD2  . LEU C 1 59  ? 194.697 215.477 240.549 1.00 178.99 ? 154 LEU A CD2  1 
ATOM 7069  H H    . LEU C 1 59  ? 194.465 215.373 244.442 1.00 214.79 ? 154 LEU A H    1 
ATOM 7070  H HA   . LEU C 1 59  ? 193.390 213.911 242.437 1.00 214.79 ? 154 LEU A HA   1 
ATOM 7071  H HB2  . LEU C 1 59  ? 196.191 214.037 243.274 1.00 214.79 ? 154 LEU A HB2  1 
ATOM 7072  H HB3  . LEU C 1 59  ? 195.578 213.260 241.811 1.00 214.79 ? 154 LEU A HB3  1 
ATOM 7073  H HG   . LEU C 1 59  ? 195.549 216.249 242.361 1.00 214.79 ? 154 LEU A HG   1 
ATOM 7074  H HD11 . LEU C 1 59  ? 197.297 216.327 240.639 1.00 214.79 ? 154 LEU A HD11 1 
ATOM 7075  H HD12 . LEU C 1 59  ? 197.804 215.366 242.047 1.00 214.79 ? 154 LEU A HD12 1 
ATOM 7076  H HD13 . LEU C 1 59  ? 197.290 214.550 240.551 1.00 214.79 ? 154 LEU A HD13 1 
ATOM 7077  H HD21 . LEU C 1 59  ? 194.873 216.396 239.988 1.00 214.79 ? 154 LEU A HD21 1 
ATOM 7078  H HD22 . LEU C 1 59  ? 194.832 214.619 239.890 1.00 214.79 ? 154 LEU A HD22 1 
ATOM 7079  H HD23 . LEU C 1 59  ? 193.679 215.479 240.939 1.00 214.79 ? 154 LEU A HD23 1 
ATOM 7080  N N    . ARG C 1 60  ? 193.583 211.606 243.273 1.00 196.51 ? 155 ARG A N    1 
ATOM 7081  C CA   . ARG C 1 60  ? 193.621 210.282 243.875 1.00 196.51 ? 155 ARG A CA   1 
ATOM 7082  C C    . ARG C 1 60  ? 195.043 209.942 244.302 1.00 196.51 ? 155 ARG A C    1 
ATOM 7083  O O    . ARG C 1 60  ? 196.003 210.188 243.566 1.00 196.51 ? 155 ARG A O    1 
ATOM 7084  C CB   . ARG C 1 60  ? 193.112 209.230 242.901 1.00 196.51 ? 155 ARG A CB   1 
ATOM 7085  C CG   . ARG C 1 60  ? 192.995 207.828 243.478 1.00 196.51 ? 155 ARG A CG   1 
ATOM 7086  C CD   . ARG C 1 60  ? 192.428 206.874 242.491 1.00 196.51 ? 155 ARG A CD   1 
ATOM 7087  N NE   . ARG C 1 60  ? 192.270 205.542 243.053 1.00 196.51 ? 155 ARG A NE   1 
ATOM 7088  C CZ   . ARG C 1 60  ? 193.220 204.587 243.037 1.00 196.51 ? 155 ARG A CZ   1 
ATOM 7089  N NH1  . ARG C 1 60  ? 194.388 204.832 242.485 1.00 196.51 ? 155 ARG A NH1  1 
ATOM 7090  N NH2  . ARG C 1 60  ? 192.979 203.405 243.576 1.00 196.51 ? 155 ARG A NH2  1 
ATOM 7091  H H    . ARG C 1 60  ? 193.292 211.620 242.464 1.00 235.81 ? 155 ARG A H    1 
ATOM 7092  H HA   . ARG C 1 60  ? 193.052 210.267 244.660 1.00 235.81 ? 155 ARG A HA   1 
ATOM 7093  H HB2  . ARG C 1 60  ? 192.128 209.519 242.534 1.00 235.81 ? 155 ARG A HB2  1 
ATOM 7094  H HB3  . ARG C 1 60  ? 193.780 209.177 242.041 1.00 235.81 ? 155 ARG A HB3  1 
ATOM 7095  H HG2  . ARG C 1 60  ? 193.982 207.471 243.772 1.00 235.81 ? 155 ARG A HG2  1 
ATOM 7096  H HG3  . ARG C 1 60  ? 192.341 207.848 244.351 1.00 235.81 ? 155 ARG A HG3  1 
ATOM 7097  H HD2  . ARG C 1 60  ? 191.449 207.225 242.167 1.00 235.81 ? 155 ARG A HD2  1 
ATOM 7098  H HD3  . ARG C 1 60  ? 193.091 206.804 241.630 1.00 235.81 ? 155 ARG A HD3  1 
ATOM 7099  H HE   . ARG C 1 60  ? 191.385 205.317 243.487 1.00 235.81 ? 155 ARG A HE   1 
ATOM 7100  H HH11 . ARG C 1 60  ? 194.573 205.735 242.073 1.00 235.81 ? 155 ARG A HH11 1 
ATOM 7101  H HH12 . ARG C 1 60  ? 195.100 204.116 242.473 1.00 235.81 ? 155 ARG A HH12 1 
ATOM 7102  H HH21 . ARG C 1 60  ? 192.081 203.217 244.001 1.00 235.81 ? 155 ARG A HH21 1 
ATOM 7103  H HH22 . ARG C 1 60  ? 193.691 202.690 243.564 1.00 235.81 ? 155 ARG A HH22 1 
ATOM 7104  N N    . ARG C 1 61  ? 195.176 209.389 245.507 1.00 191.67 ? 156 ARG A N    1 
ATOM 7105  C CA   . ARG C 1 61  ? 196.474 208.927 245.984 1.00 191.67 ? 156 ARG A CA   1 
ATOM 7106  C C    . ARG C 1 61  ? 197.010 207.870 245.032 1.00 191.67 ? 156 ARG A C    1 
ATOM 7107  O O    . ARG C 1 61  ? 196.429 206.787 244.904 1.00 191.67 ? 156 ARG A O    1 
ATOM 7108  C CB   . ARG C 1 61  ? 196.356 208.366 247.402 1.00 191.67 ? 156 ARG A CB   1 
ATOM 7109  C CG   . ARG C 1 61  ? 197.691 207.987 248.038 1.00 191.67 ? 156 ARG A CG   1 
ATOM 7110  C CD   . ARG C 1 61  ? 197.501 207.458 249.449 1.00 191.67 ? 156 ARG A CD   1 
ATOM 7111  N NE   . ARG C 1 61  ? 196.944 208.473 250.343 1.00 191.67 ? 156 ARG A NE   1 
ATOM 7112  C CZ   . ARG C 1 61  ? 197.645 209.427 250.956 1.00 191.67 ? 156 ARG A CZ   1 
ATOM 7113  N NH1  . ARG C 1 61  ? 198.960 209.534 250.790 1.00 191.67 ? 156 ARG A NH1  1 
ATOM 7114  N NH2  . ARG C 1 61  ? 197.020 210.289 251.744 1.00 191.67 ? 156 ARG A NH2  1 
ATOM 7115  H H    . ARG C 1 61  ? 194.532 209.270 246.064 1.00 230.00 ? 156 ARG A H    1 
ATOM 7116  H HA   . ARG C 1 61  ? 197.095 209.672 245.998 1.00 230.00 ? 156 ARG A HA   1 
ATOM 7117  H HB2  . ARG C 1 61  ? 195.938 209.036 247.964 1.00 230.00 ? 156 ARG A HB2  1 
ATOM 7118  H HB3  . ARG C 1 61  ? 195.806 207.569 247.375 1.00 230.00 ? 156 ARG A HB3  1 
ATOM 7119  H HG2  . ARG C 1 61  ? 198.117 207.291 247.514 1.00 230.00 ? 156 ARG A HG2  1 
ATOM 7120  H HG3  . ARG C 1 61  ? 198.260 208.771 248.080 1.00 230.00 ? 156 ARG A HG3  1 
ATOM 7121  H HD2  . ARG C 1 61  ? 196.878 206.715 249.420 1.00 230.00 ? 156 ARG A HD2  1 
ATOM 7122  H HD3  . ARG C 1 61  ? 198.353 207.158 249.800 1.00 230.00 ? 156 ARG A HD3  1 
ATOM 7123  H HE   . ARG C 1 61  ? 196.086 208.528 250.387 1.00 230.00 ? 156 ARG A HE   1 
ATOM 7124  H HH11 . ARG C 1 61  ? 199.391 208.991 250.285 1.00 230.00 ? 156 ARG A HH11 1 
ATOM 7125  H HH12 . ARG C 1 61  ? 199.386 210.161 251.198 1.00 230.00 ? 156 ARG A HH12 1 
ATOM 7126  H HH21 . ARG C 1 61  ? 196.169 210.228 251.858 1.00 230.00 ? 156 ARG A HH21 1 
ATOM 7127  H HH22 . ARG C 1 61  ? 197.464 210.908 252.143 1.00 230.00 ? 156 ARG A HH22 1 
ATOM 7128  N N    . GLU C 1 62  ? 198.116 208.179 244.359 1.00 200.82 ? 157 GLU A N    1 
ATOM 7129  C CA   . GLU C 1 62  ? 198.575 207.347 243.259 1.00 200.82 ? 157 GLU A CA   1 
ATOM 7130  C C    . GLU C 1 62  ? 200.060 207.590 243.045 1.00 200.82 ? 157 GLU A C    1 
ATOM 7131  O O    . GLU C 1 62  ? 200.624 208.581 243.515 1.00 200.82 ? 157 GLU A O    1 
ATOM 7132  C CB   . GLU C 1 62  ? 197.793 207.651 241.978 1.00 200.82 ? 157 GLU A CB   1 
ATOM 7133  C CG   . GLU C 1 62  ? 198.119 206.731 240.810 1.00 200.82 ? 157 GLU A CG   1 
ATOM 7134  C CD   . GLU C 1 62  ? 197.983 205.274 241.157 1.00 200.82 ? 157 GLU A CD   1 
ATOM 7135  O OE1  . GLU C 1 62  ? 198.897 204.732 241.729 1.00 200.82 ? 157 GLU A OE1  1 
ATOM 7136  O OE2  . GLU C 1 62  ? 196.963 204.704 240.849 1.00 200.82 ? 157 GLU A OE2  1 
ATOM 7137  H H    . GLU C 1 62  ? 198.616 208.860 244.524 1.00 240.98 ? 157 GLU A H    1 
ATOM 7138  H HA   . GLU C 1 62  ? 198.459 206.414 243.490 1.00 240.98 ? 157 GLU A HA   1 
ATOM 7139  H HB2  . GLU C 1 62  ? 196.724 207.573 242.178 1.00 240.98 ? 157 GLU A HB2  1 
ATOM 7140  H HB3  . GLU C 1 62  ? 197.994 208.675 241.664 1.00 240.98 ? 157 GLU A HB3  1 
ATOM 7141  H HG2  . GLU C 1 62  ? 197.447 206.960 239.983 1.00 240.98 ? 157 GLU A HG2  1 
ATOM 7142  H HG3  . GLU C 1 62  ? 199.138 206.927 240.480 1.00 240.98 ? 157 GLU A HG3  1 
ATOM 7143  N N    . ARG C 1 63  ? 200.684 206.662 242.322 1.00 194.38 ? 158 ARG A N    1 
ATOM 7144  C CA   . ARG C 1 63  ? 202.084 206.764 241.941 1.00 194.38 ? 158 ARG A CA   1 
ATOM 7145  C C    . ARG C 1 63  ? 202.281 207.927 240.977 1.00 194.38 ? 158 ARG A C    1 
ATOM 7146  O O    . ARG C 1 63  ? 202.302 207.734 239.756 1.00 194.38 ? 158 ARG A O    1 
ATOM 7147  C CB   . ARG C 1 63  ? 202.565 205.475 241.293 1.00 194.38 ? 158 ARG A CB   1 
ATOM 7148  C CG   . ARG C 1 63  ? 203.016 204.399 242.268 1.00 194.38 ? 158 ARG A CG   1 
ATOM 7149  C CD   . ARG C 1 63  ? 201.871 203.822 243.018 1.00 194.38 ? 158 ARG A CD   1 
ATOM 7150  N NE   . ARG C 1 63  ? 202.278 202.705 243.855 1.00 194.38 ? 158 ARG A NE   1 
ATOM 7151  C CZ   . ARG C 1 63  ? 201.467 202.057 244.713 1.00 194.38 ? 158 ARG A CZ   1 
ATOM 7152  N NH1  . ARG C 1 63  ? 200.211 202.426 244.837 1.00 194.38 ? 158 ARG A NH1  1 
ATOM 7153  N NH2  . ARG C 1 63  ? 201.933 201.050 245.431 1.00 194.38 ? 158 ARG A NH2  1 
ATOM 7154  H H    . ARG C 1 63  ? 200.303 205.946 242.037 1.00 233.26 ? 158 ARG A H    1 
ATOM 7155  H HA   . ARG C 1 63  ? 202.625 206.926 242.730 1.00 233.26 ? 158 ARG A HA   1 
ATOM 7156  H HB2  . ARG C 1 63  ? 201.767 205.054 240.684 1.00 233.26 ? 158 ARG A HB2  1 
ATOM 7157  H HB3  . ARG C 1 63  ? 203.403 205.691 240.630 1.00 233.26 ? 158 ARG A HB3  1 
ATOM 7158  H HG2  . ARG C 1 63  ? 203.507 203.594 241.720 1.00 233.26 ? 158 ARG A HG2  1 
ATOM 7159  H HG3  . ARG C 1 63  ? 203.716 204.828 242.986 1.00 233.26 ? 158 ARG A HG3  1 
ATOM 7160  H HD2  . ARG C 1 63  ? 201.435 204.587 243.660 1.00 233.26 ? 158 ARG A HD2  1 
ATOM 7161  H HD3  . ARG C 1 63  ? 201.119 203.466 242.316 1.00 233.26 ? 158 ARG A HD3  1 
ATOM 7162  H HE   . ARG C 1 63  ? 203.237 202.392 243.788 1.00 233.26 ? 158 ARG A HE   1 
ATOM 7163  H HH11 . ARG C 1 63  ? 199.854 203.195 244.288 1.00 233.26 ? 158 ARG A HH11 1 
ATOM 7164  H HH12 . ARG C 1 63  ? 199.603 201.940 245.480 1.00 233.26 ? 158 ARG A HH12 1 
ATOM 7165  H HH21 . ARG C 1 63  ? 202.899 200.766 245.336 1.00 233.26 ? 158 ARG A HH21 1 
ATOM 7166  H HH22 . ARG C 1 63  ? 201.326 200.565 246.074 1.00 233.26 ? 158 ARG A HH22 1 
ATOM 7167  N N    . VAL C 1 64  ? 202.424 209.136 241.521 1.00 189.47 ? 159 VAL A N    1 
ATOM 7168  C CA   . VAL C 1 64  ? 202.557 210.355 240.731 1.00 189.47 ? 159 VAL A CA   1 
ATOM 7169  C C    . VAL C 1 64  ? 203.951 210.926 240.943 1.00 189.47 ? 159 VAL A C    1 
ATOM 7170  O O    . VAL C 1 64  ? 204.671 210.522 241.862 1.00 189.47 ? 159 VAL A O    1 
ATOM 7171  C CB   . VAL C 1 64  ? 201.497 211.396 241.139 1.00 189.47 ? 159 VAL A CB   1 
ATOM 7172  C CG1  . VAL C 1 64  ? 200.097 210.852 240.896 1.00 189.47 ? 159 VAL A CG1  1 
ATOM 7173  C CG2  . VAL C 1 64  ? 201.682 211.778 242.599 1.00 189.47 ? 159 VAL A CG2  1 
ATOM 7174  H H    . VAL C 1 64  ? 202.456 209.268 242.368 1.00 227.36 ? 159 VAL A H    1 
ATOM 7175  H HA   . VAL C 1 64  ? 202.462 210.149 239.789 1.00 227.36 ? 159 VAL A HA   1 
ATOM 7176  H HB   . VAL C 1 64  ? 201.611 212.281 240.513 1.00 227.36 ? 159 VAL A HB   1 
ATOM 7177  H HG11 . VAL C 1 64  ? 199.360 211.601 241.190 1.00 227.36 ? 159 VAL A HG11 1 
ATOM 7178  H HG12 . VAL C 1 64  ? 199.975 210.619 239.839 1.00 227.36 ? 159 VAL A HG12 1 
ATOM 7179  H HG13 . VAL C 1 64  ? 199.950 209.949 241.488 1.00 227.36 ? 159 VAL A HG13 1 
ATOM 7180  H HG21 . VAL C 1 64  ? 200.930 212.515 242.880 1.00 227.36 ? 159 VAL A HG21 1 
ATOM 7181  H HG22 . VAL C 1 64  ? 201.574 210.892 243.224 1.00 227.36 ? 159 VAL A HG22 1 
ATOM 7182  H HG23 . VAL C 1 64  ? 202.676 212.203 242.741 1.00 227.36 ? 159 VAL A HG23 1 
ATOM 7183  N N    . ARG C 1 65  ? 204.323 211.869 240.082 1.00 204.61 ? 160 ARG A N    1 
ATOM 7184  C CA   . ARG C 1 65  ? 205.595 212.575 240.163 1.00 204.61 ? 160 ARG A CA   1 
ATOM 7185  C C    . ARG C 1 65  ? 205.326 214.062 239.986 1.00 204.61 ? 160 ARG A C    1 
ATOM 7186  O O    . ARG C 1 65  ? 204.719 214.471 238.989 1.00 204.61 ? 160 ARG A O    1 
ATOM 7187  C CB   . ARG C 1 65  ? 206.569 212.090 239.099 1.00 204.61 ? 160 ARG A CB   1 
ATOM 7188  C CG   . ARG C 1 65  ? 207.014 210.644 239.250 1.00 204.61 ? 160 ARG A CG   1 
ATOM 7189  C CD   . ARG C 1 65  ? 207.929 210.469 240.407 1.00 204.61 ? 160 ARG A CD   1 
ATOM 7190  N NE   . ARG C 1 65  ? 208.400 209.098 240.523 1.00 204.61 ? 160 ARG A NE   1 
ATOM 7191  C CZ   . ARG C 1 65  ? 207.753 208.120 241.187 1.00 204.61 ? 160 ARG A CZ   1 
ATOM 7192  N NH1  . ARG C 1 65  ? 206.612 208.377 241.787 1.00 204.61 ? 160 ARG A NH1  1 
ATOM 7193  N NH2  . ARG C 1 65  ? 208.265 206.903 241.234 1.00 204.61 ? 160 ARG A NH2  1 
ATOM 7194  H H    . ARG C 1 65  ? 203.838 212.123 239.419 1.00 245.53 ? 160 ARG A H    1 
ATOM 7195  H HA   . ARG C 1 65  ? 205.996 212.450 241.036 1.00 245.53 ? 160 ARG A HA   1 
ATOM 7196  H HB2  . ARG C 1 65  ? 206.115 212.194 238.115 1.00 245.53 ? 160 ARG A HB2  1 
ATOM 7197  H HB3  . ARG C 1 65  ? 207.464 212.713 239.114 1.00 245.53 ? 160 ARG A HB3  1 
ATOM 7198  H HG2  . ARG C 1 65  ? 206.141 210.009 239.405 1.00 245.53 ? 160 ARG A HG2  1 
ATOM 7199  H HG3  . ARG C 1 65  ? 207.537 210.328 238.348 1.00 245.53 ? 160 ARG A HG3  1 
ATOM 7200  H HD2  . ARG C 1 65  ? 208.796 211.118 240.287 1.00 245.53 ? 160 ARG A HD2  1 
ATOM 7201  H HD3  . ARG C 1 65  ? 207.407 210.729 241.327 1.00 245.53 ? 160 ARG A HD3  1 
ATOM 7202  H HE   . ARG C 1 65  ? 209.275 208.862 240.074 1.00 245.53 ? 160 ARG A HE   1 
ATOM 7203  H HH11 . ARG C 1 65  ? 206.220 209.308 241.751 1.00 245.53 ? 160 ARG A HH11 1 
ATOM 7204  H HH12 . ARG C 1 65  ? 206.127 207.645 242.285 1.00 245.53 ? 160 ARG A HH12 1 
ATOM 7205  H HH21 . ARG C 1 65  ? 209.142 206.705 240.773 1.00 245.53 ? 160 ARG A HH21 1 
ATOM 7206  H HH22 . ARG C 1 65  ? 207.780 206.171 241.731 1.00 245.53 ? 160 ARG A HH22 1 
ATOM 7207  N N    . ALA C 1 66  ? 205.777 214.865 240.949 1.00 189.46 ? 161 ALA A N    1 
ATOM 7208  C CA   . ALA C 1 66  ? 205.520 216.299 240.965 1.00 189.46 ? 161 ALA A CA   1 
ATOM 7209  C C    . ALA C 1 66  ? 206.684 217.110 240.404 1.00 189.46 ? 161 ALA A C    1 
ATOM 7210  O O    . ALA C 1 66  ? 206.763 218.320 240.638 1.00 189.46 ? 161 ALA A O    1 
ATOM 7211  C CB   . ALA C 1 66  ? 205.196 216.756 242.387 1.00 189.46 ? 161 ALA A CB   1 
ATOM 7212  H H    . ALA C 1 66  ? 206.247 214.594 241.618 1.00 227.35 ? 161 ALA A H    1 
ATOM 7213  H HA   . ALA C 1 66  ? 204.742 216.485 240.416 1.00 227.35 ? 161 ALA A HA   1 
ATOM 7214  H HB1  . ALA C 1 66  ? 204.985 217.704 242.376 1.00 227.35 ? 161 ALA A HB1  1 
ATOM 7215  H HB2  . ALA C 1 66  ? 204.434 216.253 242.713 1.00 227.35 ? 161 ALA A HB2  1 
ATOM 7216  H HB3  . ALA C 1 66  ? 205.966 216.595 242.954 1.00 227.35 ? 161 ALA A HB3  1 
ATOM 7217  N N    . GLN C 1 67  ? 207.590 216.472 239.664 1.00 192.70 ? 162 GLN A N    1 
ATOM 7218  C CA   . GLN C 1 67  ? 208.695 217.185 239.039 1.00 192.70 ? 162 GLN A CA   1 
ATOM 7219  C C    . GLN C 1 67  ? 209.280 216.307 237.942 1.00 192.70 ? 162 GLN A C    1 
ATOM 7220  O O    . GLN C 1 67  ? 209.179 215.077 238.027 1.00 192.70 ? 162 GLN A O    1 
ATOM 7221  C CB   . GLN C 1 67  ? 209.769 217.553 240.066 1.00 192.70 ? 162 GLN A CB   1 
ATOM 7222  C CG   . GLN C 1 67  ? 210.449 216.358 240.711 1.00 192.70 ? 162 GLN A CG   1 
ATOM 7223  C CD   . GLN C 1 67  ? 211.455 216.766 241.770 1.00 192.70 ? 162 GLN A CD   1 
ATOM 7224  O OE1  . GLN C 1 67  ? 212.587 217.145 241.458 1.00 192.70 ? 162 GLN A OE1  1 
ATOM 7225  N NE2  . GLN C 1 67  ? 211.047 216.692 243.032 1.00 192.70 ? 162 GLN A NE2  1 
ATOM 7226  H H    . GLN C 1 67  ? 207.588 215.627 239.509 1.00 231.24 ? 162 GLN A H    1 
ATOM 7227  H HA   . GLN C 1 67  ? 208.331 218.000 238.665 1.00 231.24 ? 162 GLN A HA   1 
ATOM 7228  H HB2  . GLN C 1 67  ? 210.537 218.160 239.587 1.00 231.24 ? 162 GLN A HB2  1 
ATOM 7229  H HB3  . GLN C 1 67  ? 209.323 218.154 240.859 1.00 231.24 ? 162 GLN A HB3  1 
ATOM 7230  H HG2  . GLN C 1 67  ? 209.691 215.732 241.182 1.00 231.24 ? 162 GLN A HG2  1 
ATOM 7231  H HG3  . GLN C 1 67  ? 210.974 215.793 239.941 1.00 231.24 ? 162 GLN A HG3  1 
ATOM 7232  H HE21 . GLN C 1 67  ? 211.667 216.948 243.775 1.00 231.24 ? 162 GLN A HE21 1 
ATOM 7233  H HE22 . GLN C 1 67  ? 210.120 216.379 243.241 1.00 231.24 ? 162 GLN A HE22 1 
ATOM 7234  N N    . PRO C 1 68  ? 209.884 216.893 236.904 1.00 212.46 ? 163 PRO A N    1 
ATOM 7235  C CA   . PRO C 1 68  ? 210.574 216.066 235.904 1.00 212.46 ? 163 PRO A CA   1 
ATOM 7236  C C    . PRO C 1 68  ? 211.626 215.161 236.529 1.00 212.46 ? 163 PRO A C    1 
ATOM 7237  O O    . PRO C 1 68  ? 212.389 215.573 237.406 1.00 212.46 ? 163 PRO A O    1 
ATOM 7238  C CB   . PRO C 1 68  ? 211.216 217.109 234.982 1.00 212.46 ? 163 PRO A CB   1 
ATOM 7239  C CG   . PRO C 1 68  ? 210.361 218.319 235.148 1.00 212.46 ? 163 PRO A CG   1 
ATOM 7240  C CD   . PRO C 1 68  ? 210.000 218.325 236.609 1.00 212.46 ? 163 PRO A CD   1 
ATOM 7241  H HA   . PRO C 1 68  ? 209.935 215.531 235.410 1.00 254.95 ? 163 PRO A HA   1 
ATOM 7242  H HB2  . PRO C 1 68  ? 212.261 217.281 235.279 1.00 254.95 ? 163 PRO A HB2  1 
ATOM 7243  H HB3  . PRO C 1 68  ? 211.232 216.736 233.947 1.00 254.95 ? 163 PRO A HB3  1 
ATOM 7244  H HG2  . PRO C 1 68  ? 210.915 219.219 234.845 1.00 254.95 ? 163 PRO A HG2  1 
ATOM 7245  H HG3  . PRO C 1 68  ? 209.479 218.253 234.494 1.00 254.95 ? 163 PRO A HG3  1 
ATOM 7246  H HD2  . PRO C 1 68  ? 210.805 218.805 237.185 1.00 254.95 ? 163 PRO A HD2  1 
ATOM 7247  H HD3  . PRO C 1 68  ? 209.050 218.860 236.751 1.00 254.95 ? 163 PRO A HD3  1 
ATOM 7248  N N    . CYS C 1 69  ? 211.654 213.914 236.063 1.00 235.28 ? 164 CYS A N    1 
ATOM 7249  C CA   . CYS C 1 69  ? 212.603 212.908 236.527 1.00 235.28 ? 164 CYS A CA   1 
ATOM 7250  C C    . CYS C 1 69  ? 213.820 212.913 235.610 1.00 235.28 ? 164 CYS A C    1 
ATOM 7251  O O    . CYS C 1 69  ? 213.681 212.770 234.390 1.00 235.28 ? 164 CYS A O    1 
ATOM 7252  C CB   . CYS C 1 69  ? 211.971 211.514 236.544 1.00 235.28 ? 164 CYS A CB   1 
ATOM 7253  S SG   . CYS C 1 69  ? 210.710 211.219 237.806 1.00 235.28 ? 164 CYS A SG   1 
ATOM 7254  H H    . CYS C 1 69  ? 211.117 213.619 235.460 1.00 282.34 ? 164 CYS A H    1 
ATOM 7255  H HA   . CYS C 1 69  ? 212.898 213.115 237.427 1.00 282.34 ? 164 CYS A HA   1 
ATOM 7256  H HB2  . CYS C 1 69  ? 211.563 211.350 235.679 1.00 282.34 ? 164 CYS A HB2  1 
ATOM 7257  H HB3  . CYS C 1 69  ? 212.675 210.868 236.700 1.00 282.34 ? 164 CYS A HB3  1 
ATOM 7258  N N    . CYS C 1 70  ? 215.007 213.069 236.197 1.00 256.50 ? 165 CYS A N    1 
ATOM 7259  C CA   . CYS C 1 70  ? 216.262 213.025 235.445 1.00 256.50 ? 165 CYS A CA   1 
ATOM 7260  C C    . CYS C 1 70  ? 216.568 211.568 235.109 1.00 256.50 ? 165 CYS A C    1 
ATOM 7261  O O    . CYS C 1 70  ? 217.329 210.880 235.795 1.00 256.50 ? 165 CYS A O    1 
ATOM 7262  C CB   . CYS C 1 70  ? 217.417 213.627 236.246 1.00 256.50 ? 165 CYS A CB   1 
ATOM 7263  S SG   . CYS C 1 70  ? 218.997 213.644 235.367 1.00 256.50 ? 165 CYS A SG   1 
ATOM 7264  H H    . CYS C 1 70  ? 215.113 213.202 237.040 1.00 307.80 ? 165 CYS A H    1 
ATOM 7265  H HA   . CYS C 1 70  ? 216.162 213.515 234.615 1.00 307.80 ? 165 CYS A HA   1 
ATOM 7266  H HB2  . CYS C 1 70  ? 217.172 214.654 236.520 1.00 307.80 ? 165 CYS A HB2  1 
ATOM 7267  H HB3  . CYS C 1 70  ? 217.551 213.065 237.170 1.00 307.80 ? 165 CYS A HB3  1 
ATOM 7268  N N    . ARG C 1 71  ? 215.954 211.096 234.006 1.00 238.00 ? 166 ARG A N    1 
ATOM 7269  C CA   . ARG C 1 71  ? 216.007 209.700 233.605 1.00 238.00 ? 166 ARG A CA   1 
ATOM 7270  C C    . ARG C 1 71  ? 216.701 209.546 232.250 1.00 238.00 ? 166 ARG A C    1 
ATOM 7271  O O    . ARG C 1 71  ? 216.731 210.485 231.444 1.00 238.00 ? 166 ARG A O    1 
ATOM 7272  C CB   . ARG C 1 71  ? 214.598 209.099 233.517 1.00 238.00 ? 166 ARG A CB   1 
ATOM 7273  C CG   . ARG C 1 71  ? 213.861 209.003 234.850 1.00 238.00 ? 166 ARG A CG   1 
ATOM 7274  C CD   . ARG C 1 71  ? 214.303 207.804 235.693 1.00 238.00 ? 166 ARG A CD   1 
ATOM 7275  N NE   . ARG C 1 71  ? 213.972 206.526 235.062 1.00 238.00 ? 166 ARG A NE   1 
ATOM 7276  C CZ   . ARG C 1 71  ? 214.547 205.358 235.344 1.00 238.00 ? 166 ARG A CZ   1 
ATOM 7277  N NH1  . ARG C 1 71  ? 215.513 205.260 236.251 1.00 238.00 ? 166 ARG A NH1  1 
ATOM 7278  N NH2  . ARG C 1 71  ? 214.157 204.264 234.707 1.00 238.00 ? 166 ARG A NH2  1 
ATOM 7279  H H    . ARG C 1 71  ? 215.493 211.586 233.472 1.00 285.60 ? 166 ARG A H    1 
ATOM 7280  H HA   . ARG C 1 71  ? 216.506 209.211 234.271 1.00 285.60 ? 166 ARG A HA   1 
ATOM 7281  H HB2  . ARG C 1 71  ? 214.064 209.659 232.933 1.00 285.60 ? 166 ARG A HB2  1 
ATOM 7282  H HB3  . ARG C 1 71  ? 214.649 208.206 233.145 1.00 285.60 ? 166 ARG A HB3  1 
ATOM 7283  H HG2  . ARG C 1 71  ? 214.037 209.810 235.354 1.00 285.60 ? 166 ARG A HG2  1 
ATOM 7284  H HG3  . ARG C 1 71  ? 212.910 208.916 234.680 1.00 285.60 ? 166 ARG A HG3  1 
ATOM 7285  H HD2  . ARG C 1 71  ? 215.259 207.843 235.841 1.00 285.60 ? 166 ARG A HD2  1 
ATOM 7286  H HD3  . ARG C 1 71  ? 213.841 207.841 236.545 1.00 285.60 ? 166 ARG A HD3  1 
ATOM 7287  H HE   . ARG C 1 71  ? 213.406 206.541 234.414 1.00 285.60 ? 166 ARG A HE   1 
ATOM 7288  H HH11 . ARG C 1 71  ? 215.786 205.952 236.683 1.00 285.60 ? 166 ARG A HH11 1 
ATOM 7289  H HH12 . ARG C 1 71  ? 215.868 204.495 236.414 1.00 285.60 ? 166 ARG A HH12 1 
ATOM 7290  H HH21 . ARG C 1 71  ? 213.535 204.309 234.115 1.00 285.60 ? 166 ARG A HH21 1 
ATOM 7291  H HH22 . ARG C 1 71  ? 214.529 203.510 234.885 1.00 285.60 ? 166 ARG A HH22 1 
ATOM 7292  N N    . PRO C 1 72  ? 217.286 208.384 231.971 1.00 251.53 ? 167 PRO A N    1 
ATOM 7293  C CA   . PRO C 1 72  ? 217.859 208.164 230.642 1.00 251.53 ? 167 PRO A CA   1 
ATOM 7294  C C    . PRO C 1 72  ? 216.780 208.051 229.576 1.00 251.53 ? 167 PRO A C    1 
ATOM 7295  O O    . PRO C 1 72  ? 215.642 207.655 229.840 1.00 251.53 ? 167 PRO A O    1 
ATOM 7296  C CB   . PRO C 1 72  ? 218.622 206.846 230.808 1.00 251.53 ? 167 PRO A CB   1 
ATOM 7297  C CG   . PRO C 1 72  ? 217.855 206.109 231.853 1.00 251.53 ? 167 PRO A CG   1 
ATOM 7298  C CD   . PRO C 1 72  ? 217.424 207.176 232.823 1.00 251.53 ? 167 PRO A CD   1 
ATOM 7299  H HA   . PRO C 1 72  ? 218.481 208.871 230.407 1.00 301.84 ? 167 PRO A HA   1 
ATOM 7300  H HB2  . PRO C 1 72  ? 218.660 206.310 229.849 1.00 301.84 ? 167 PRO A HB2  1 
ATOM 7301  H HB3  . PRO C 1 72  ? 219.662 207.048 231.105 1.00 301.84 ? 167 PRO A HB3  1 
ATOM 7302  H HG2  . PRO C 1 72  ? 217.003 205.582 231.397 1.00 301.84 ? 167 PRO A HG2  1 
ATOM 7303  H HG3  . PRO C 1 72  ? 218.490 205.343 232.320 1.00 301.84 ? 167 PRO A HG3  1 
ATOM 7304  H HD2  . PRO C 1 72  ? 216.463 206.893 233.277 1.00 301.84 ? 167 PRO A HD2  1 
ATOM 7305  H HD3  . PRO C 1 72  ? 218.196 207.302 233.597 1.00 301.84 ? 167 PRO A HD3  1 
ATOM 7306  N N    . THR C 1 73  ? 217.167 208.414 228.354 1.00 255.73 ? 168 THR A N    1 
ATOM 7307  C CA   . THR C 1 73  ? 216.332 208.274 227.171 1.00 255.73 ? 168 THR A CA   1 
ATOM 7308  C C    . THR C 1 73  ? 216.848 207.224 226.197 1.00 255.73 ? 168 THR A C    1 
ATOM 7309  O O    . THR C 1 73  ? 216.143 206.901 225.235 1.00 255.73 ? 168 THR A O    1 
ATOM 7310  C CB   . THR C 1 73  ? 216.201 209.622 226.439 1.00 255.73 ? 168 THR A CB   1 
ATOM 7311  O OG1  . THR C 1 73  ? 217.498 210.071 226.024 1.00 255.73 ? 168 THR A OG1  1 
ATOM 7312  C CG2  . THR C 1 73  ? 215.575 210.666 227.351 1.00 255.73 ? 168 THR A CG2  1 
ATOM 7313  H H    . THR C 1 73  ? 217.937 208.758 228.185 1.00 306.88 ? 168 THR A H    1 
ATOM 7314  H HA   . THR C 1 73  ? 215.436 208.012 227.431 1.00 306.88 ? 168 THR A HA   1 
ATOM 7315  H HB   . THR C 1 73  ? 215.575 209.497 225.556 1.00 306.88 ? 168 THR A HB   1 
ATOM 7316  H HG1  . THR C 1 73  ? 217.625 209.867 225.095 1.00 306.88 ? 168 THR A HG1  1 
ATOM 7317  H HG21 . THR C 1 73  ? 215.490 211.612 226.817 1.00 306.88 ? 168 THR A HG21 1 
ATOM 7318  H HG22 . THR C 1 73  ? 214.584 210.333 227.659 1.00 306.88 ? 168 THR A HG22 1 
ATOM 7319  H HG23 . THR C 1 73  ? 216.201 210.802 228.232 1.00 306.88 ? 168 THR A HG23 1 
ATOM 7320  N N    . ALA C 1 74  ? 218.047 206.683 226.414 1.00 259.07 ? 169 ALA A N    1 
ATOM 7321  C CA   . ALA C 1 74  ? 218.606 205.675 225.528 1.00 259.07 ? 169 ALA A CA   1 
ATOM 7322  C C    . ALA C 1 74  ? 219.710 204.932 226.263 1.00 259.07 ? 169 ALA A C    1 
ATOM 7323  O O    . ALA C 1 74  ? 220.336 205.464 227.184 1.00 259.07 ? 169 ALA A O    1 
ATOM 7324  C CB   . ALA C 1 74  ? 219.146 206.297 224.239 1.00 259.07 ? 169 ALA A CB   1 
ATOM 7325  H H    . ALA C 1 74  ? 218.564 206.884 227.071 1.00 310.88 ? 169 ALA A H    1 
ATOM 7326  H HA   . ALA C 1 74  ? 217.913 205.037 225.293 1.00 310.88 ? 169 ALA A HA   1 
ATOM 7327  H HB1  . ALA C 1 74  ? 219.594 205.602 223.736 1.00 310.88 ? 169 ALA A HB1  1 
ATOM 7328  H HB2  . ALA C 1 74  ? 218.409 206.662 223.726 1.00 310.88 ? 169 ALA A HB2  1 
ATOM 7329  H HB3  . ALA C 1 74  ? 219.778 206.998 224.466 1.00 310.88 ? 169 ALA A HB3  1 
ATOM 7330  N N    . TYR C 1 75  ? 219.943 203.691 225.833 1.00 243.28 ? 170 TYR A N    1 
ATOM 7331  C CA   . TYR C 1 75  ? 220.989 202.838 226.377 1.00 243.28 ? 170 TYR A CA   1 
ATOM 7332  C C    . TYR C 1 75  ? 221.907 202.377 225.255 1.00 243.28 ? 170 TYR A C    1 
ATOM 7333  O O    . TYR C 1 75  ? 221.567 202.453 224.071 1.00 243.28 ? 170 TYR A O    1 
ATOM 7334  C CB   . TYR C 1 75  ? 220.388 201.638 227.111 1.00 243.28 ? 170 TYR A CB   1 
ATOM 7335  C CG   . TYR C 1 75  ? 219.515 202.016 228.288 1.00 243.28 ? 170 TYR A CG   1 
ATOM 7336  C CD1  . TYR C 1 75  ? 220.086 202.566 229.426 1.00 243.28 ? 170 TYR A CD1  1 
ATOM 7337  C CD2  . TYR C 1 75  ? 218.144 201.813 228.228 1.00 243.28 ? 170 TYR A CD2  1 
ATOM 7338  C CE1  . TYR C 1 75  ? 219.289 202.912 230.500 1.00 243.28 ? 170 TYR A CE1  1 
ATOM 7339  C CE2  . TYR C 1 75  ? 217.348 202.159 229.303 1.00 243.28 ? 170 TYR A CE2  1 
ATOM 7340  C CZ   . TYR C 1 75  ? 217.926 202.710 230.441 1.00 243.28 ? 170 TYR A CZ   1 
ATOM 7341  O OH   . TYR C 1 75  ? 217.132 203.054 231.511 1.00 243.28 ? 170 TYR A OH   1 
ATOM 7342  H H    . TYR C 1 75  ? 219.490 203.314 225.208 1.00 291.94 ? 170 TYR A H    1 
ATOM 7343  H HA   . TYR C 1 75  ? 221.544 203.332 226.999 1.00 291.94 ? 170 TYR A HA   1 
ATOM 7344  H HB2  . TYR C 1 75  ? 219.786 201.049 226.417 1.00 291.94 ? 170 TYR A HB2  1 
ATOM 7345  H HB3  . TYR C 1 75  ? 221.189 200.995 227.475 1.00 291.94 ? 170 TYR A HB3  1 
ATOM 7346  H HD1  . TYR C 1 75  ? 221.163 202.727 229.472 1.00 291.94 ? 170 TYR A HD1  1 
ATOM 7347  H HD2  . TYR C 1 75  ? 217.696 201.381 227.334 1.00 291.94 ? 170 TYR A HD2  1 
ATOM 7348  H HE1  . TYR C 1 75  ? 219.738 203.345 231.394 1.00 291.94 ? 170 TYR A HE1  1 
ATOM 7349  H HE2  . TYR C 1 75  ? 216.271 201.999 229.256 1.00 291.94 ? 170 TYR A HE2  1 
ATOM 7350  H HH   . TYR C 1 75  ? 216.215 202.855 231.305 1.00 291.94 ? 170 TYR A HH   1 
ATOM 7351  N N    . GLU C 1 76  ? 223.082 201.896 225.647 1.00 256.23 ? 171 GLU A N    1 
ATOM 7352  C CA   . GLU C 1 76  ? 223.965 201.226 224.706 1.00 256.23 ? 171 GLU A CA   1 
ATOM 7353  C C    . GLU C 1 76  ? 223.289 199.976 224.157 1.00 256.23 ? 171 GLU A C    1 
ATOM 7354  O O    . GLU C 1 76  ? 222.469 199.342 224.826 1.00 256.23 ? 171 GLU A O    1 
ATOM 7355  C CB   . GLU C 1 76  ? 225.291 200.860 225.376 1.00 256.23 ? 171 GLU A CB   1 
ATOM 7356  C CG   . GLU C 1 76  ? 225.177 199.792 226.455 1.00 256.23 ? 171 GLU A CG   1 
ATOM 7357  C CD   . GLU C 1 76  ? 226.490 199.490 227.120 1.00 256.23 ? 171 GLU A CD   1 
ATOM 7358  O OE1  . GLU C 1 76  ? 227.475 200.080 226.745 1.00 256.23 ? 171 GLU A OE1  1 
ATOM 7359  O OE2  . GLU C 1 76  ? 226.509 198.667 228.006 1.00 256.23 ? 171 GLU A OE2  1 
ATOM 7360  H H    . GLU C 1 76  ? 223.389 201.945 226.448 1.00 307.48 ? 171 GLU A H    1 
ATOM 7361  H HA   . GLU C 1 76  ? 224.156 201.821 223.963 1.00 307.48 ? 171 GLU A HA   1 
ATOM 7362  H HB2  . GLU C 1 76  ? 225.993 200.501 224.623 1.00 307.48 ? 171 GLU A HB2  1 
ATOM 7363  H HB3  . GLU C 1 76  ? 225.727 201.750 225.831 1.00 307.48 ? 171 GLU A HB3  1 
ATOM 7364  H HG2  . GLU C 1 76  ? 224.468 200.130 227.211 1.00 307.48 ? 171 GLU A HG2  1 
ATOM 7365  H HG3  . GLU C 1 76  ? 224.782 198.881 226.008 1.00 307.48 ? 171 GLU A HG3  1 
ATOM 7366  N N    . ASP C 1 77  ? 223.634 199.630 222.916 1.00 231.16 ? 172 ASP A N    1 
ATOM 7367  C CA   . ASP C 1 77  ? 223.089 198.426 222.298 1.00 231.16 ? 172 ASP A CA   1 
ATOM 7368  C C    . ASP C 1 77  ? 223.288 197.206 223.191 1.00 231.16 ? 172 ASP A C    1 
ATOM 7369  O O    . ASP C 1 77  ? 222.318 196.571 223.622 1.00 231.16 ? 172 ASP A O    1 
ATOM 7370  C CB   . ASP C 1 77  ? 223.743 198.180 220.936 1.00 231.16 ? 172 ASP A CB   1 
ATOM 7371  C CG   . ASP C 1 77  ? 223.369 199.233 219.901 1.00 231.16 ? 172 ASP A CG   1 
ATOM 7372  O OD1  . ASP C 1 77  ? 222.430 199.958 220.131 1.00 231.16 ? 172 ASP A OD1  1 
ATOM 7373  O OD2  . ASP C 1 77  ? 224.026 199.302 218.890 1.00 231.16 ? 172 ASP A OD2  1 
ATOM 7374  H H    . ASP C 1 77  ? 224.177 200.071 222.416 1.00 277.39 ? 172 ASP A H    1 
ATOM 7375  H HA   . ASP C 1 77  ? 222.135 198.542 222.173 1.00 277.39 ? 172 ASP A HA   1 
ATOM 7376  H HB2  . ASP C 1 77  ? 224.827 198.172 221.049 1.00 277.39 ? 172 ASP A HB2  1 
ATOM 7377  H HB3  . ASP C 1 77  ? 223.445 197.201 220.560 1.00 277.39 ? 172 ASP A HB3  1 
ATOM 7378  N N    . GLU C 1 78  ? 224.539 196.863 223.485 1.00 230.69 ? 173 GLU A N    1 
ATOM 7379  C CA   . GLU C 1 78  ? 224.819 195.746 224.379 1.00 230.69 ? 173 GLU A CA   1 
ATOM 7380  C C    . GLU C 1 78  ? 226.304 195.723 224.707 1.00 230.69 ? 173 GLU A C    1 
ATOM 7381  O O    . GLU C 1 78  ? 227.119 196.360 224.035 1.00 230.69 ? 173 GLU A O    1 
ATOM 7382  C CB   . GLU C 1 78  ? 224.395 194.419 223.747 1.00 230.69 ? 173 GLU A CB   1 
ATOM 7383  C CG   . GLU C 1 78  ? 225.198 194.023 222.516 1.00 230.69 ? 173 GLU A CG   1 
ATOM 7384  C CD   . GLU C 1 78  ? 224.669 192.786 221.845 1.00 230.69 ? 173 GLU A CD   1 
ATOM 7385  O OE1  . GLU C 1 78  ? 224.024 192.006 222.504 1.00 230.69 ? 173 GLU A OE1  1 
ATOM 7386  O OE2  . GLU C 1 78  ? 224.910 192.621 220.673 1.00 230.69 ? 173 GLU A OE2  1 
ATOM 7387  H H    . GLU C 1 78  ? 225.240 197.260 223.182 1.00 276.83 ? 173 GLU A H    1 
ATOM 7388  H HA   . GLU C 1 78  ? 224.328 195.866 225.206 1.00 276.83 ? 173 GLU A HA   1 
ATOM 7389  H HB2  . GLU C 1 78  ? 224.492 193.619 224.481 1.00 276.83 ? 173 GLU A HB2  1 
ATOM 7390  H HB3  . GLU C 1 78  ? 223.345 194.472 223.459 1.00 276.83 ? 173 GLU A HB3  1 
ATOM 7391  H HG2  . GLU C 1 78  ? 225.177 194.846 221.802 1.00 276.83 ? 173 GLU A HG2  1 
ATOM 7392  H HG3  . GLU C 1 78  ? 226.234 193.858 222.809 1.00 276.83 ? 173 GLU A HG3  1 
ATOM 7393  N N    . VAL C 1 79  ? 226.640 194.976 225.756 1.00 229.53 ? 174 VAL A N    1 
ATOM 7394  C CA   . VAL C 1 79  ? 228.029 194.700 226.102 1.00 229.53 ? 174 VAL A CA   1 
ATOM 7395  C C    . VAL C 1 79  ? 228.174 193.194 226.291 1.00 229.53 ? 174 VAL A C    1 
ATOM 7396  O O    . VAL C 1 79  ? 227.305 192.538 226.875 1.00 229.53 ? 174 VAL A O    1 
ATOM 7397  C CB   . VAL C 1 79  ? 228.441 195.439 227.389 1.00 229.53 ? 174 VAL A CB   1 
ATOM 7398  C CG1  . VAL C 1 79  ? 227.570 195.001 228.557 1.00 229.53 ? 174 VAL A CG1  1 
ATOM 7399  C CG2  . VAL C 1 79  ? 229.910 195.183 227.686 1.00 229.53 ? 174 VAL A CG2  1 
ATOM 7400  H H    . VAL C 1 79  ? 226.073 194.615 226.291 1.00 275.44 ? 174 VAL A H    1 
ATOM 7401  H HA   . VAL C 1 79  ? 228.594 194.958 225.357 1.00 275.44 ? 174 VAL A HA   1 
ATOM 7402  H HB   . VAL C 1 79  ? 228.278 196.508 227.250 1.00 275.44 ? 174 VAL A HB   1 
ATOM 7403  H HG11 . VAL C 1 79  ? 227.874 195.534 229.458 1.00 275.44 ? 174 VAL A HG11 1 
ATOM 7404  H HG12 . VAL C 1 79  ? 226.526 195.227 228.337 1.00 275.44 ? 174 VAL A HG12 1 
ATOM 7405  H HG13 . VAL C 1 79  ? 227.685 193.929 228.714 1.00 275.44 ? 174 VAL A HG13 1 
ATOM 7406  H HG21 . VAL C 1 79  ? 230.194 195.710 228.597 1.00 275.44 ? 174 VAL A HG21 1 
ATOM 7407  H HG22 . VAL C 1 79  ? 230.074 194.114 227.819 1.00 275.44 ? 174 VAL A HG22 1 
ATOM 7408  H HG23 . VAL C 1 79  ? 230.518 195.543 226.855 1.00 275.44 ? 174 VAL A HG23 1 
ATOM 7409  N N    . SER C 1 80  ? 229.270 192.648 225.769 1.00 227.63 ? 175 SER A N    1 
ATOM 7410  C CA   . SER C 1 80  ? 229.582 191.228 225.867 1.00 227.63 ? 175 SER A CA   1 
ATOM 7411  C C    . SER C 1 80  ? 230.678 191.001 226.896 1.00 227.63 ? 175 SER A C    1 
ATOM 7412  O O    . SER C 1 80  ? 231.488 191.889 227.175 1.00 227.63 ? 175 SER A O    1 
ATOM 7413  C CB   . SER C 1 80  ? 230.014 190.686 224.518 1.00 227.63 ? 175 SER A CB   1 
ATOM 7414  O OG   . SER C 1 80  ? 231.200 191.297 224.089 1.00 227.63 ? 175 SER A OG   1 
ATOM 7415  H H    . SER C 1 80  ? 229.866 193.095 225.339 1.00 273.16 ? 175 SER A H    1 
ATOM 7416  H HA   . SER C 1 80  ? 228.806 190.731 226.159 1.00 273.16 ? 175 SER A HA   1 
ATOM 7417  H HB2  . SER C 1 80  ? 230.161 189.609 224.589 1.00 273.16 ? 175 SER A HB2  1 
ATOM 7418  H HB3  . SER C 1 80  ? 229.226 190.862 223.787 1.00 273.16 ? 175 SER A HB3  1 
ATOM 7419  H HG   . SER C 1 80  ? 231.246 191.148 223.141 1.00 273.16 ? 175 SER A HG   1 
ATOM 7420  N N    . PHE C 1 81  ? 230.697 189.796 227.462 1.00 222.20 ? 176 PHE A N    1 
ATOM 7421  C CA   . PHE C 1 81  ? 231.775 189.437 228.373 1.00 222.20 ? 176 PHE A CA   1 
ATOM 7422  C C    . PHE C 1 81  ? 231.934 187.924 228.421 1.00 222.20 ? 176 PHE A C    1 
ATOM 7423  O O    . PHE C 1 81  ? 231.030 187.169 228.053 1.00 222.20 ? 176 PHE A O    1 
ATOM 7424  C CB   . PHE C 1 81  ? 231.501 189.979 229.778 1.00 222.20 ? 176 PHE A CB   1 
ATOM 7425  C CG   . PHE C 1 81  ? 230.257 189.423 230.410 1.00 222.20 ? 176 PHE A CG   1 
ATOM 7426  C CD1  . PHE C 1 81  ? 229.031 190.046 230.229 1.00 222.20 ? 176 PHE A CD1  1 
ATOM 7427  C CD2  . PHE C 1 81  ? 230.310 188.275 231.186 1.00 222.20 ? 176 PHE A CD2  1 
ATOM 7428  C CE1  . PHE C 1 81  ? 227.887 189.536 230.810 1.00 222.20 ? 176 PHE A CE1  1 
ATOM 7429  C CE2  . PHE C 1 81  ? 229.166 187.762 231.768 1.00 222.20 ? 176 PHE A CE2  1 
ATOM 7430  C CZ   . PHE C 1 81  ? 227.955 188.393 231.581 1.00 222.20 ? 176 PHE A CZ   1 
ATOM 7431  H H    . PHE C 1 81  ? 230.109 189.181 227.335 1.00 266.64 ? 176 PHE A H    1 
ATOM 7432  H HA   . PHE C 1 81  ? 232.603 189.812 228.038 1.00 266.64 ? 176 PHE A HA   1 
ATOM 7433  H HB2  . PHE C 1 81  ? 232.345 189.749 230.427 1.00 266.64 ? 176 PHE A HB2  1 
ATOM 7434  H HB3  . PHE C 1 81  ? 231.406 191.063 229.737 1.00 266.64 ? 176 PHE A HB3  1 
ATOM 7435  H HD1  . PHE C 1 81  ? 228.978 190.949 229.620 1.00 266.64 ? 176 PHE A HD1  1 
ATOM 7436  H HD2  . PHE C 1 81  ? 231.269 187.777 231.336 1.00 266.64 ? 176 PHE A HD2  1 
ATOM 7437  H HE1  . PHE C 1 81  ? 226.930 190.036 230.661 1.00 266.64 ? 176 PHE A HE1  1 
ATOM 7438  H HE2  . PHE C 1 81  ? 229.222 186.859 232.376 1.00 266.64 ? 176 PHE A HE2  1 
ATOM 7439  H HZ   . PHE C 1 81  ? 227.052 187.989 232.038 1.00 266.64 ? 176 PHE A HZ   1 
ATOM 7440  N N    . LEU C 1 82  ? 233.107 187.506 228.901 1.00 200.18 ? 177 LEU A N    1 
ATOM 7441  C CA   . LEU C 1 82  ? 233.459 186.115 229.160 1.00 200.18 ? 177 LEU A CA   1 
ATOM 7442  C C    . LEU C 1 82  ? 233.441 185.859 230.662 1.00 200.18 ? 177 LEU A C    1 
ATOM 7443  O O    . LEU C 1 82  ? 234.175 186.507 231.414 1.00 200.18 ? 177 LEU A O    1 
ATOM 7444  C CB   . LEU C 1 82  ? 234.844 185.790 228.585 1.00 200.18 ? 177 LEU A CB   1 
ATOM 7445  C CG   . LEU C 1 82  ? 235.335 184.354 228.806 1.00 200.18 ? 177 LEU A CG   1 
ATOM 7446  C CD1  . LEU C 1 82  ? 234.446 183.388 228.035 1.00 200.18 ? 177 LEU A CD1  1 
ATOM 7447  C CD2  . LEU C 1 82  ? 236.785 184.239 228.359 1.00 200.18 ? 177 LEU A CD2  1 
ATOM 7448  H H    . LEU C 1 82  ? 233.749 188.045 229.088 1.00 240.22 ? 177 LEU A H    1 
ATOM 7449  H HA   . LEU C 1 82  ? 232.815 185.526 228.738 1.00 240.22 ? 177 LEU A HA   1 
ATOM 7450  H HB2  . LEU C 1 82  ? 234.826 185.972 227.512 1.00 240.22 ? 177 LEU A HB2  1 
ATOM 7451  H HB3  . LEU C 1 82  ? 235.574 186.463 229.035 1.00 240.22 ? 177 LEU A HB3  1 
ATOM 7452  H HG   . LEU C 1 82  ? 235.261 184.102 229.864 1.00 240.22 ? 177 LEU A HG   1 
ATOM 7453  H HD11 . LEU C 1 82  ? 234.796 182.367 228.192 1.00 240.22 ? 177 LEU A HD11 1 
ATOM 7454  H HD12 . LEU C 1 82  ? 233.419 183.477 228.388 1.00 240.22 ? 177 LEU A HD12 1 
ATOM 7455  H HD13 . LEU C 1 82  ? 234.487 183.626 226.972 1.00 240.22 ? 177 LEU A HD13 1 
ATOM 7456  H HD21 . LEU C 1 82  ? 237.135 183.218 228.517 1.00 240.22 ? 177 LEU A HD21 1 
ATOM 7457  H HD22 . LEU C 1 82  ? 236.860 184.489 227.300 1.00 240.22 ? 177 LEU A HD22 1 
ATOM 7458  H HD23 . LEU C 1 82  ? 237.400 184.927 228.939 1.00 240.22 ? 177 LEU A HD23 1 
ATOM 7459  N N    . ASP C 1 83  ? 232.614 184.904 231.093 1.00 198.36 ? 178 ASP A N    1 
ATOM 7460  C CA   . ASP C 1 83  ? 232.341 184.704 232.508 1.00 198.36 ? 178 ASP A CA   1 
ATOM 7461  C C    . ASP C 1 83  ? 233.313 183.677 233.088 1.00 198.36 ? 178 ASP A C    1 
ATOM 7462  O O    . ASP C 1 83  ? 234.221 183.187 232.411 1.00 198.36 ? 178 ASP A O    1 
ATOM 7463  C CB   . ASP C 1 83  ? 230.898 184.244 232.722 1.00 198.36 ? 178 ASP A CB   1 
ATOM 7464  C CG   . ASP C 1 83  ? 230.632 182.851 232.167 1.00 198.36 ? 178 ASP A CG   1 
ATOM 7465  O OD1  . ASP C 1 83  ? 231.576 182.178 231.826 1.00 198.36 ? 178 ASP A OD1  1 
ATOM 7466  O OD2  . ASP C 1 83  ? 229.487 182.472 232.090 1.00 198.36 ? 178 ASP A OD2  1 
ATOM 7467  H H    . ASP C 1 83  ? 232.196 184.357 230.577 1.00 238.03 ? 178 ASP A H    1 
ATOM 7468  H HA   . ASP C 1 83  ? 232.483 185.533 232.984 1.00 238.03 ? 178 ASP A HA   1 
ATOM 7469  H HB2  . ASP C 1 83  ? 230.670 184.243 233.788 1.00 238.03 ? 178 ASP A HB2  1 
ATOM 7470  H HB3  . ASP C 1 83  ? 230.216 184.946 232.242 1.00 238.03 ? 178 ASP A HB3  1 
ATOM 7471  N N    . ALA C 1 84  ? 233.117 183.343 234.365 1.00 180.08 ? 179 ALA A N    1 
ATOM 7472  C CA   . ALA C 1 84  ? 233.995 182.398 235.044 1.00 180.08 ? 179 ALA A CA   1 
ATOM 7473  C C    . ALA C 1 84  ? 233.896 180.983 234.484 1.00 180.08 ? 179 ALA A C    1 
ATOM 7474  O O    . ALA C 1 84  ? 234.761 180.156 234.791 1.00 180.08 ? 179 ALA A O    1 
ATOM 7475  C CB   . ALA C 1 84  ? 233.678 182.377 236.540 1.00 180.08 ? 179 ALA A CB   1 
ATOM 7476  H H    . ALA C 1 84  ? 232.484 183.652 234.858 1.00 216.10 ? 179 ALA A H    1 
ATOM 7477  H HA   . ALA C 1 84  ? 234.912 182.694 234.939 1.00 216.10 ? 179 ALA A HA   1 
ATOM 7478  H HB1  . ALA C 1 84  ? 234.271 181.748 236.979 1.00 216.10 ? 179 ALA A HB1  1 
ATOM 7479  H HB2  . ALA C 1 84  ? 233.810 183.267 236.903 1.00 216.10 ? 179 ALA A HB2  1 
ATOM 7480  H HB3  . ALA C 1 84  ? 232.755 182.104 236.663 1.00 216.10 ? 179 ALA A HB3  1 
ATOM 7481  N N    . HIS C 1 85  ? 232.878 180.685 233.675 1.00 182.22 ? 180 HIS A N    1 
ATOM 7482  C CA   . HIS C 1 85  ? 232.654 179.345 233.151 1.00 182.22 ? 180 HIS A CA   1 
ATOM 7483  C C    . HIS C 1 85  ? 233.067 179.204 231.689 1.00 182.22 ? 180 HIS A C    1 
ATOM 7484  O O    . HIS C 1 85  ? 232.626 178.261 231.023 1.00 182.22 ? 180 HIS A O    1 
ATOM 7485  C CB   . HIS C 1 85  ? 231.180 178.965 233.312 1.00 182.22 ? 180 HIS A CB   1 
ATOM 7486  C CG   . HIS C 1 85  ? 230.704 178.982 234.731 1.00 182.22 ? 180 HIS A CG   1 
ATOM 7487  N ND1  . HIS C 1 85  ? 231.017 177.986 235.632 1.00 182.22 ? 180 HIS A ND1  1 
ATOM 7488  C CD2  . HIS C 1 85  ? 229.938 179.871 235.404 1.00 182.22 ? 180 HIS A CD2  1 
ATOM 7489  C CE1  . HIS C 1 85  ? 230.464 178.262 236.799 1.00 182.22 ? 180 HIS A CE1  1 
ATOM 7490  N NE2  . HIS C 1 85  ? 229.803 179.401 236.688 1.00 182.22 ? 180 HIS A NE2  1 
ATOM 7491  H H    . HIS C 1 85  ? 232.290 181.254 233.410 1.00 218.66 ? 180 HIS A H    1 
ATOM 7492  H HA   . HIS C 1 85  ? 233.175 178.711 233.667 1.00 218.66 ? 180 HIS A HA   1 
ATOM 7493  H HB2  . HIS C 1 85  ? 230.639 179.594 232.809 1.00 218.66 ? 180 HIS A HB2  1 
ATOM 7494  H HB3  . HIS C 1 85  ? 231.040 178.067 232.974 1.00 218.66 ? 180 HIS A HB3  1 
ATOM 7495  H HD2  . HIS C 1 85  ? 229.571 180.654 235.062 1.00 218.66 ? 180 HIS A HD2  1 
ATOM 7496  H HE1  . HIS C 1 85  ? 230.529 177.743 237.567 1.00 218.66 ? 180 HIS A HE1  1 
ATOM 7497  H HE2  . HIS C 1 85  ? 229.362 179.785 237.318 1.00 218.66 ? 180 HIS A HE2  1 
ATOM 7498  N N    . SER C 1 86  ? 233.908 180.106 231.181 1.00 202.29 ? 181 SER A N    1 
ATOM 7499  C CA   . SER C 1 86  ? 234.343 180.082 229.784 1.00 202.29 ? 181 SER A CA   1 
ATOM 7500  C C    . SER C 1 86  ? 233.157 180.184 228.825 1.00 202.29 ? 181 SER A C    1 
ATOM 7501  O O    . SER C 1 86  ? 233.103 179.483 227.811 1.00 202.29 ? 181 SER A O    1 
ATOM 7502  C CB   . SER C 1 86  ? 235.121 178.812 229.503 1.00 202.29 ? 181 SER A CB   1 
ATOM 7503  O OG   . SER C 1 86  ? 236.236 178.709 230.345 1.00 202.29 ? 181 SER A OG   1 
ATOM 7504  H H    . SER C 1 86  ? 234.249 180.753 231.632 1.00 242.75 ? 181 SER A H    1 
ATOM 7505  H HA   . SER C 1 86  ? 234.924 180.841 229.633 1.00 242.75 ? 181 SER A HA   1 
ATOM 7506  H HB2  . SER C 1 86  ? 234.472 177.948 229.648 1.00 242.75 ? 181 SER A HB2  1 
ATOM 7507  H HB3  . SER C 1 86  ? 235.445 178.806 228.463 1.00 242.75 ? 181 SER A HB3  1 
ATOM 7508  H HG   . SER C 1 86  ? 236.701 177.915 230.073 1.00 242.75 ? 181 SER A HG   1 
ATOM 7509  N N    . ARG C 1 87  ? 232.200 181.055 229.144 1.00 193.40 ? 182 ARG A N    1 
ATOM 7510  C CA   . ARG C 1 87  ? 231.035 181.311 228.307 1.00 193.40 ? 182 ARG A CA   1 
ATOM 7511  C C    . ARG C 1 87  ? 230.828 182.808 228.119 1.00 193.40 ? 182 ARG A C    1 
ATOM 7512  O O    . ARG C 1 87  ? 231.139 183.619 228.993 1.00 193.40 ? 182 ARG A O    1 
ATOM 7513  C CB   . ARG C 1 87  ? 229.785 180.698 228.921 1.00 193.40 ? 182 ARG A CB   1 
ATOM 7514  C CG   . ARG C 1 87  ? 229.814 179.183 229.052 1.00 193.40 ? 182 ARG A CG   1 
ATOM 7515  C CD   . ARG C 1 87  ? 229.737 178.515 227.727 1.00 193.40 ? 182 ARG A CD   1 
ATOM 7516  N NE   . ARG C 1 87  ? 229.686 177.068 227.852 1.00 193.40 ? 182 ARG A NE   1 
ATOM 7517  C CZ   . ARG C 1 87  ? 230.767 176.266 227.910 1.00 193.40 ? 182 ARG A CZ   1 
ATOM 7518  N NH1  . ARG C 1 87  ? 231.974 176.785 227.854 1.00 193.40 ? 182 ARG A NH1  1 
ATOM 7519  N NH2  . ARG C 1 87  ? 230.615 174.958 228.024 1.00 193.40 ? 182 ARG A NH2  1 
ATOM 7520  H H    . ARG C 1 87  ? 232.208 181.525 229.864 1.00 232.08 ? 182 ARG A H    1 
ATOM 7521  H HA   . ARG C 1 87  ? 231.162 180.921 227.428 1.00 232.08 ? 182 ARG A HA   1 
ATOM 7522  H HB2  . ARG C 1 87  ? 229.629 181.111 229.916 1.00 232.08 ? 182 ARG A HB2  1 
ATOM 7523  H HB3  . ARG C 1 87  ? 228.917 180.960 228.317 1.00 232.08 ? 182 ARG A HB3  1 
ATOM 7524  H HG2  . ARG C 1 87  ? 230.742 178.877 229.536 1.00 232.08 ? 182 ARG A HG2  1 
ATOM 7525  H HG3  . ARG C 1 87  ? 228.966 178.853 229.652 1.00 232.08 ? 182 ARG A HG3  1 
ATOM 7526  H HD2  . ARG C 1 87  ? 228.839 178.845 227.206 1.00 232.08 ? 182 ARG A HD2  1 
ATOM 7527  H HD3  . ARG C 1 87  ? 230.615 178.776 227.137 1.00 232.08 ? 182 ARG A HD3  1 
ATOM 7528  H HE   . ARG C 1 87  ? 228.774 176.632 227.898 1.00 232.08 ? 182 ARG A HE   1 
ATOM 7529  H HH11 . ARG C 1 87  ? 232.090 177.785 227.768 1.00 232.08 ? 182 ARG A HH11 1 
ATOM 7530  H HH12 . ARG C 1 87  ? 232.784 176.184 227.898 1.00 232.08 ? 182 ARG A HH12 1 
ATOM 7531  H HH21 . ARG C 1 87  ? 229.687 174.559 228.067 1.00 232.08 ? 182 ARG A HH21 1 
ATOM 7532  H HH22 . ARG C 1 87  ? 231.424 174.358 228.067 1.00 232.08 ? 182 ARG A HH22 1 
ATOM 7533  N N    . TYR C 1 88  ? 230.271 183.164 226.966 1.00 189.24 ? 183 TYR A N    1 
ATOM 7534  C CA   . TYR C 1 88  ? 229.997 184.551 226.625 1.00 189.24 ? 183 TYR A CA   1 
ATOM 7535  C C    . TYR C 1 88  ? 228.531 184.890 226.837 1.00 189.24 ? 183 TYR A C    1 
ATOM 7536  O O    . TYR C 1 88  ? 227.650 184.036 226.702 1.00 189.24 ? 183 TYR A O    1 
ATOM 7537  C CB   . TYR C 1 88  ? 230.404 184.837 225.177 1.00 189.24 ? 183 TYR A CB   1 
ATOM 7538  C CG   . TYR C 1 88  ? 231.898 184.961 224.976 1.00 189.24 ? 183 TYR A CG   1 
ATOM 7539  C CD1  . TYR C 1 88  ? 232.653 183.837 224.677 1.00 189.24 ? 183 TYR A CD1  1 
ATOM 7540  C CD2  . TYR C 1 88  ? 232.512 186.199 225.091 1.00 189.24 ? 183 TYR A CD2  1 
ATOM 7541  C CE1  . TYR C 1 88  ? 234.018 183.950 224.493 1.00 189.24 ? 183 TYR A CE1  1 
ATOM 7542  C CE2  . TYR C 1 88  ? 233.877 186.313 224.907 1.00 189.24 ? 183 TYR A CE2  1 
ATOM 7543  C CZ   . TYR C 1 88  ? 234.628 185.194 224.609 1.00 189.24 ? 183 TYR A CZ   1 
ATOM 7544  O OH   . TYR C 1 88  ? 235.987 185.307 224.426 1.00 189.24 ? 183 TYR A OH   1 
ATOM 7545  H H    . TYR C 1 88  ? 230.038 182.608 226.354 1.00 227.09 ? 183 TYR A H    1 
ATOM 7546  H HA   . TYR C 1 88  ? 230.485 185.133 227.216 1.00 227.09 ? 183 TYR A HA   1 
ATOM 7547  H HB2  . TYR C 1 88  ? 230.039 184.036 224.532 1.00 227.09 ? 183 TYR A HB2  1 
ATOM 7548  H HB3  . TYR C 1 88  ? 229.937 185.763 224.845 1.00 227.09 ? 183 TYR A HB3  1 
ATOM 7549  H HD1  . TYR C 1 88  ? 232.170 182.863 224.587 1.00 227.09 ? 183 TYR A HD1  1 
ATOM 7550  H HD2  . TYR C 1 88  ? 231.919 187.082 225.327 1.00 227.09 ? 183 TYR A HD2  1 
ATOM 7551  H HE1  . TYR C 1 88  ? 234.611 183.067 224.258 1.00 227.09 ? 183 TYR A HE1  1 
ATOM 7552  H HE2  . TYR C 1 88  ? 234.360 187.286 224.998 1.00 227.09 ? 183 TYR A HE2  1 
ATOM 7553  H HH   . TYR C 1 88  ? 236.354 184.445 224.216 1.00 227.09 ? 183 TYR A HH   1 
ATOM 7554  N N    . HIS C 1 89  ? 228.291 186.154 227.173 1.00 229.10 ? 184 HIS A N    1 
ATOM 7555  C CA   . HIS C 1 89  ? 226.939 186.661 227.349 1.00 229.10 ? 184 HIS A CA   1 
ATOM 7556  C C    . HIS C 1 89  ? 226.927 188.150 227.040 1.00 229.10 ? 184 HIS A C    1 
ATOM 7557  O O    . HIS C 1 89  ? 227.912 188.853 227.293 1.00 229.10 ? 184 HIS A O    1 
ATOM 7558  C CB   . HIS C 1 89  ? 226.431 186.410 228.772 1.00 229.10 ? 184 HIS A CB   1 
ATOM 7559  C CG   . HIS C 1 89  ? 225.001 186.802 228.978 1.00 229.10 ? 184 HIS A CG   1 
ATOM 7560  N ND1  . HIS C 1 89  ? 223.949 186.079 228.456 1.00 229.10 ? 184 HIS A ND1  1 
ATOM 7561  C CD2  . HIS C 1 89  ? 224.448 187.840 229.648 1.00 229.10 ? 184 HIS A CD2  1 
ATOM 7562  C CE1  . HIS C 1 89  ? 222.810 186.656 228.797 1.00 229.10 ? 184 HIS A CE1  1 
ATOM 7563  N NE2  . HIS C 1 89  ? 223.086 187.726 229.520 1.00 229.10 ? 184 HIS A NE2  1 
ATOM 7564  H H    . HIS C 1 89  ? 228.903 186.743 227.308 1.00 274.92 ? 184 HIS A H    1 
ATOM 7565  H HA   . HIS C 1 89  ? 226.348 186.216 226.721 1.00 274.92 ? 184 HIS A HA   1 
ATOM 7566  H HB2  . HIS C 1 89  ? 226.533 185.351 229.014 1.00 274.92 ? 184 HIS A HB2  1 
ATOM 7567  H HB3  . HIS C 1 89  ? 227.043 186.967 229.481 1.00 274.92 ? 184 HIS A HB3  1 
ATOM 7568  H HD2  . HIS C 1 89  ? 224.984 188.621 230.189 1.00 274.92 ? 184 HIS A HD2  1 
ATOM 7569  H HE1  . HIS C 1 89  ? 221.813 186.309 228.528 1.00 274.92 ? 184 HIS A HE1  1 
ATOM 7570  H HE2  . HIS C 1 89  ? 222.408 188.362 229.917 1.00 274.92 ? 184 HIS A HE2  1 
ATOM 7571  N N    . THR C 1 90  ? 225.815 188.607 226.469 1.00 214.62 ? 185 THR A N    1 
ATOM 7572  C CA   . THR C 1 90  ? 225.567 190.011 226.183 1.00 214.62 ? 185 THR A CA   1 
ATOM 7573  C C    . THR C 1 90  ? 224.486 190.520 227.126 1.00 214.62 ? 185 THR A C    1 
ATOM 7574  O O    . THR C 1 90  ? 223.568 189.776 227.486 1.00 214.62 ? 185 THR A O    1 
ATOM 7575  C CB   . THR C 1 90  ? 225.143 190.230 224.719 1.00 214.62 ? 185 THR A CB   1 
ATOM 7576  O OG1  . THR C 1 90  ? 223.957 189.472 224.444 1.00 214.62 ? 185 THR A OG1  1 
ATOM 7577  C CG2  . THR C 1 90  ? 226.250 189.793 223.772 1.00 214.62 ? 185 THR A CG2  1 
ATOM 7578  H H    . THR C 1 90  ? 225.166 188.097 226.227 1.00 257.54 ? 185 THR A H    1 
ATOM 7579  H HA   . THR C 1 90  ? 226.369 190.528 226.327 1.00 257.54 ? 185 THR A HA   1 
ATOM 7580  H HB   . THR C 1 90  ? 224.929 191.286 224.556 1.00 257.54 ? 185 THR A HB   1 
ATOM 7581  H HG1  . THR C 1 90  ? 223.514 189.840 223.675 1.00 257.54 ? 185 THR A HG1  1 
ATOM 7582  H HG21 . THR C 1 90  ? 225.933 189.954 222.742 1.00 257.54 ? 185 THR A HG21 1 
ATOM 7583  H HG22 . THR C 1 90  ? 227.150 190.375 223.971 1.00 257.54 ? 185 THR A HG22 1 
ATOM 7584  H HG23 . THR C 1 90  ? 226.462 188.735 223.924 1.00 257.54 ? 185 THR A HG23 1 
ATOM 7585  N N    . VAL C 1 91  ? 224.596 191.785 227.528 1.00 221.53 ? 186 VAL A N    1 
ATOM 7586  C CA   . VAL C 1 91  ? 223.618 192.415 228.405 1.00 221.53 ? 186 VAL A CA   1 
ATOM 7587  C C    . VAL C 1 91  ? 223.147 193.697 227.743 1.00 221.53 ? 186 VAL A C    1 
ATOM 7588  O O    . VAL C 1 91  ? 223.958 194.476 227.226 1.00 221.53 ? 186 VAL A O    1 
ATOM 7589  C CB   . VAL C 1 91  ? 224.227 192.725 229.785 1.00 221.53 ? 186 VAL A CB   1 
ATOM 7590  C CG1  . VAL C 1 91  ? 223.214 193.444 230.665 1.00 221.53 ? 186 VAL A CG1  1 
ATOM 7591  C CG2  . VAL C 1 91  ? 224.698 191.438 230.445 1.00 221.53 ? 186 VAL A CG2  1 
ATOM 7592  H H    . VAL C 1 91  ? 225.241 192.308 227.300 1.00 265.84 ? 186 VAL A H    1 
ATOM 7593  H HA   . VAL C 1 91  ? 222.846 191.836 228.508 1.00 265.84 ? 186 VAL A HA   1 
ATOM 7594  H HB   . VAL C 1 91  ? 225.074 193.399 229.655 1.00 265.84 ? 186 VAL A HB   1 
ATOM 7595  H HG11 . VAL C 1 91  ? 223.661 193.656 231.636 1.00 265.84 ? 186 VAL A HG11 1 
ATOM 7596  H HG12 . VAL C 1 91  ? 222.919 194.379 230.190 1.00 265.84 ? 186 VAL A HG12 1 
ATOM 7597  H HG13 . VAL C 1 91  ? 222.337 192.811 230.800 1.00 265.84 ? 186 VAL A HG13 1 
ATOM 7598  H HG21 . VAL C 1 91  ? 225.127 191.666 231.421 1.00 265.84 ? 186 VAL A HG21 1 
ATOM 7599  H HG22 . VAL C 1 91  ? 223.851 190.763 230.570 1.00 265.84 ? 186 VAL A HG22 1 
ATOM 7600  H HG23 . VAL C 1 91  ? 225.452 190.963 229.819 1.00 265.84 ? 186 VAL A HG23 1 
ATOM 7601  N N    . HIS C 1 92  ? 221.837 193.910 227.758 1.00 216.78 ? 187 HIS A N    1 
ATOM 7602  C CA   . HIS C 1 92  ? 221.213 195.085 227.180 1.00 216.78 ? 187 HIS A CA   1 
ATOM 7603  C C    . HIS C 1 92  ? 220.862 196.066 228.286 1.00 216.78 ? 187 HIS A C    1 
ATOM 7604  O O    . HIS C 1 92  ? 220.647 195.681 229.440 1.00 216.78 ? 187 HIS A O    1 
ATOM 7605  C CB   . HIS C 1 92  ? 219.957 194.709 226.386 1.00 216.78 ? 187 HIS A CB   1 
ATOM 7606  C CG   . HIS C 1 92  ? 220.229 193.812 225.219 1.00 216.78 ? 187 HIS A CG   1 
ATOM 7607  N ND1  . HIS C 1 92  ? 220.853 194.254 224.071 1.00 216.78 ? 187 HIS A ND1  1 
ATOM 7608  C CD2  . HIS C 1 92  ? 219.962 192.500 225.021 1.00 216.78 ? 187 HIS A CD2  1 
ATOM 7609  C CE1  . HIS C 1 92  ? 220.958 193.250 223.217 1.00 216.78 ? 187 HIS A CE1  1 
ATOM 7610  N NE2  . HIS C 1 92  ? 220.425 192.176 223.769 1.00 216.78 ? 187 HIS A NE2  1 
ATOM 7611  H H    . HIS C 1 92  ? 221.272 193.367 228.114 1.00 260.14 ? 187 HIS A H    1 
ATOM 7612  H HA   . HIS C 1 92  ? 221.824 195.519 226.564 1.00 260.14 ? 187 HIS A HA   1 
ATOM 7613  H HB2  . HIS C 1 92  ? 219.247 194.207 227.044 1.00 260.14 ? 187 HIS A HB2  1 
ATOM 7614  H HB3  . HIS C 1 92  ? 219.477 195.614 226.016 1.00 260.14 ? 187 HIS A HB3  1 
ATOM 7615  H HD1  . HIS C 1 92  ? 221.246 195.162 223.923 1.00 260.14 ? 187 HIS A HD1  1 
ATOM 7616  H HD2  . HIS C 1 92  ? 219.484 191.740 225.640 1.00 260.14 ? 187 HIS A HD2  1 
ATOM 7617  H HE1  . HIS C 1 92  ? 221.426 193.396 222.244 1.00 260.14 ? 187 HIS A HE1  1 
ATOM 7618  N N    . GLU C 1 93  ? 220.799 197.344 227.921 1.00 249.37 ? 188 GLU A N    1 
ATOM 7619  C CA   . GLU C 1 93  ? 220.272 198.397 228.781 1.00 249.37 ? 188 GLU A CA   1 
ATOM 7620  C C    . GLU C 1 93  ? 220.934 198.455 230.156 1.00 249.37 ? 188 GLU A C    1 
ATOM 7621  O O    . GLU C 1 93  ? 220.235 198.512 231.174 1.00 249.37 ? 188 GLU A O    1 
ATOM 7622  C CB   . GLU C 1 93  ? 218.763 198.213 228.955 1.00 249.37 ? 188 GLU A CB   1 
ATOM 7623  C CG   . GLU C 1 93  ? 217.968 198.279 227.659 1.00 249.37 ? 188 GLU A CG   1 
ATOM 7624  C CD   . GLU C 1 93  ? 216.482 198.230 227.880 1.00 249.37 ? 188 GLU A CD   1 
ATOM 7625  O OE1  . GLU C 1 93  ? 216.062 197.605 228.825 1.00 249.37 ? 188 GLU A OE1  1 
ATOM 7626  O OE2  . GLU C 1 93  ? 215.766 198.818 227.104 1.00 249.37 ? 188 GLU A OE2  1 
ATOM 7627  H H    . GLU C 1 93  ? 221.064 197.632 227.155 1.00 299.24 ? 188 GLU A H    1 
ATOM 7628  H HA   . GLU C 1 93  ? 220.430 199.251 228.349 1.00 299.24 ? 188 GLU A HA   1 
ATOM 7629  H HB2  . GLU C 1 93  ? 218.565 197.247 229.419 1.00 299.24 ? 188 GLU A HB2  1 
ATOM 7630  H HB3  . GLU C 1 93  ? 218.377 198.982 229.624 1.00 299.24 ? 188 GLU A HB3  1 
ATOM 7631  H HG2  . GLU C 1 93  ? 218.216 199.205 227.140 1.00 299.24 ? 188 GLU A HG2  1 
ATOM 7632  H HG3  . GLU C 1 93  ? 218.263 197.447 227.021 1.00 299.24 ? 188 GLU A HG3  1 
ATOM 7633  N N    . LEU C 1 94  ? 222.270 198.433 230.213 1.00 242.36 ? 189 LEU A N    1 
ATOM 7634  C CA   . LEU C 1 94  ? 223.010 198.515 231.470 1.00 242.36 ? 189 LEU A CA   1 
ATOM 7635  C C    . LEU C 1 94  ? 223.810 199.806 231.645 1.00 242.36 ? 189 LEU A C    1 
ATOM 7636  O O    . LEU C 1 94  ? 224.309 200.076 232.741 1.00 242.36 ? 189 LEU A O    1 
ATOM 7637  C CB   . LEU C 1 94  ? 223.965 197.319 231.576 1.00 242.36 ? 189 LEU A CB   1 
ATOM 7638  C CG   . LEU C 1 94  ? 224.912 197.328 232.783 1.00 242.36 ? 189 LEU A CG   1 
ATOM 7639  C CD1  . LEU C 1 94  ? 224.096 197.368 234.068 1.00 242.36 ? 189 LEU A CD1  1 
ATOM 7640  C CD2  . LEU C 1 94  ? 225.803 196.095 232.739 1.00 242.36 ? 189 LEU A CD2  1 
ATOM 7641  H H    . LEU C 1 94  ? 222.776 198.371 229.521 1.00 290.83 ? 189 LEU A H    1 
ATOM 7642  H HA   . LEU C 1 94  ? 222.369 198.541 232.192 1.00 290.83 ? 189 LEU A HA   1 
ATOM 7643  H HB2  . LEU C 1 94  ? 223.373 196.406 231.626 1.00 290.83 ? 189 LEU A HB2  1 
ATOM 7644  H HB3  . LEU C 1 94  ? 224.577 197.281 230.675 1.00 290.83 ? 189 LEU A HB3  1 
ATOM 7645  H HG   . LEU C 1 94  ? 225.531 198.225 232.753 1.00 290.83 ? 189 LEU A HG   1 
ATOM 7646  H HD11 . LEU C 1 94  ? 224.769 197.374 234.926 1.00 290.83 ? 189 LEU A HD11 1 
ATOM 7647  H HD12 . LEU C 1 94  ? 223.483 198.269 234.083 1.00 290.83 ? 189 LEU A HD12 1 
ATOM 7648  H HD13 . LEU C 1 94  ? 223.454 196.490 234.119 1.00 290.83 ? 189 LEU A HD13 1 
ATOM 7649  H HD21 . LEU C 1 94  ? 226.476 196.102 233.596 1.00 290.83 ? 189 LEU A HD21 1 
ATOM 7650  H HD22 . LEU C 1 94  ? 225.184 195.198 232.770 1.00 290.83 ? 189 LEU A HD22 1 
ATOM 7651  H HD23 . LEU C 1 94  ? 226.387 196.102 231.818 1.00 290.83 ? 189 LEU A HD23 1 
ATOM 7652  N N    . SER C 1 95  ? 223.944 200.605 230.585 1.00 257.21 ? 190 SER A N    1 
ATOM 7653  C CA   . SER C 1 95  ? 224.717 201.843 230.633 1.00 257.21 ? 190 SER A CA   1 
ATOM 7654  C C    . SER C 1 95  ? 223.984 202.898 229.821 1.00 257.21 ? 190 SER A C    1 
ATOM 7655  O O    . SER C 1 95  ? 223.776 202.719 228.617 1.00 257.21 ? 190 SER A O    1 
ATOM 7656  C CB   . SER C 1 95  ? 226.115 201.633 230.087 1.00 257.21 ? 190 SER A CB   1 
ATOM 7657  O OG   . SER C 1 95  ? 226.864 202.815 230.153 1.00 257.21 ? 190 SER A OG   1 
ATOM 7658  H H    . SER C 1 95  ? 223.591 200.457 229.816 1.00 308.65 ? 190 SER A H    1 
ATOM 7659  H HA   . SER C 1 95  ? 224.793 202.174 231.541 1.00 308.65 ? 190 SER A HA   1 
ATOM 7660  H HB2  . SER C 1 95  ? 226.615 200.851 230.658 1.00 308.65 ? 190 SER A HB2  1 
ATOM 7661  H HB3  . SER C 1 95  ? 226.055 201.295 229.053 1.00 308.65 ? 190 SER A HB3  1 
ATOM 7662  H HG   . SER C 1 95  ? 227.760 202.550 230.374 1.00 308.65 ? 190 SER A HG   1 
ATOM 7663  N N    . ALA C 1 96  ? 223.593 203.989 230.478 1.00 259.72 ? 191 ALA A N    1 
ATOM 7664  C CA   . ALA C 1 96  ? 222.837 205.037 229.809 1.00 259.72 ? 191 ALA A CA   1 
ATOM 7665  C C    . ALA C 1 96  ? 223.647 205.658 228.679 1.00 259.72 ? 191 ALA A C    1 
ATOM 7666  O O    . ALA C 1 96  ? 224.823 206.001 228.836 1.00 259.72 ? 191 ALA A O    1 
ATOM 7667  C CB   . ALA C 1 96  ? 222.423 206.119 230.804 1.00 259.72 ? 191 ALA A CB   1 
ATOM 7668  H H    . ALA C 1 96  ? 223.752 204.142 231.310 1.00 311.66 ? 191 ALA A H    1 
ATOM 7669  H HA   . ALA C 1 96  ? 222.034 204.655 229.428 1.00 311.66 ? 191 ALA A HA   1 
ATOM 7670  H HB1  . ALA C 1 96  ? 221.914 206.799 230.337 1.00 311.66 ? 191 ALA A HB1  1 
ATOM 7671  H HB2  . ALA C 1 96  ? 221.877 205.718 231.499 1.00 311.66 ? 191 ALA A HB2  1 
ATOM 7672  H HB3  . ALA C 1 96  ? 223.221 206.512 231.191 1.00 311.66 ? 191 ALA A HB3  1 
ATOM 7673  N N    . ARG C 1 97  ? 222.995 205.803 227.526 1.00 259.90 ? 192 ARG A N    1 
ATOM 7674  C CA   . ARG C 1 97  ? 223.558 206.483 226.369 1.00 259.90 ? 192 ARG A CA   1 
ATOM 7675  C C    . ARG C 1 97  ? 223.056 207.911 226.213 1.00 259.90 ? 192 ARG A C    1 
ATOM 7676  O O    . ARG C 1 97  ? 223.803 208.761 225.727 1.00 259.90 ? 192 ARG A O    1 
ATOM 7677  C CB   . ARG C 1 97  ? 223.236 205.708 225.100 1.00 259.90 ? 192 ARG A CB   1 
ATOM 7678  C CG   . ARG C 1 97  ? 223.852 206.275 223.830 1.00 259.90 ? 192 ARG A CG   1 
ATOM 7679  C CD   . ARG C 1 97  ? 223.546 205.431 222.647 1.00 259.90 ? 192 ARG A CD   1 
ATOM 7680  N NE   . ARG C 1 97  ? 222.127 205.440 222.326 1.00 259.90 ? 192 ARG A NE   1 
ATOM 7681  C CZ   . ARG C 1 97  ? 221.520 204.551 221.517 1.00 259.90 ? 192 ARG A CZ   1 
ATOM 7682  N NH1  . ARG C 1 97  ? 222.219 203.589 220.955 1.00 259.90 ? 192 ARG A NH1  1 
ATOM 7683  N NH2  . ARG C 1 97  ? 220.222 204.644 221.288 1.00 259.90 ? 192 ARG A NH2  1 
ATOM 7684  H H    . ARG C 1 97  ? 222.201 205.504 227.389 1.00 311.88 ? 192 ARG A H    1 
ATOM 7685  H HA   . ARG C 1 97  ? 224.523 206.518 226.452 1.00 311.88 ? 192 ARG A HA   1 
ATOM 7686  H HB2  . ARG C 1 97  ? 223.584 204.681 225.204 1.00 311.88 ? 192 ARG A HB2  1 
ATOM 7687  H HB3  . ARG C 1 97  ? 222.156 205.675 224.957 1.00 311.88 ? 192 ARG A HB3  1 
ATOM 7688  H HG2  . ARG C 1 97  ? 223.456 207.275 223.650 1.00 311.88 ? 192 ARG A HG2  1 
ATOM 7689  H HG3  . ARG C 1 97  ? 224.935 206.328 223.943 1.00 311.88 ? 192 ARG A HG3  1 
ATOM 7690  H HD2  . ARG C 1 97  ? 224.093 205.805 221.782 1.00 311.88 ? 192 ARG A HD2  1 
ATOM 7691  H HD3  . ARG C 1 97  ? 223.843 204.403 222.847 1.00 311.88 ? 192 ARG A HD3  1 
ATOM 7692  H HE   . ARG C 1 97  ? 221.557 206.166 222.740 1.00 311.88 ? 192 ARG A HE   1 
ATOM 7693  H HH11 . ARG C 1 97  ? 223.212 203.517 221.131 1.00 311.88 ? 192 ARG A HH11 1 
ATOM 7694  H HH12 . ARG C 1 97  ? 221.764 202.922 220.349 1.00 311.88 ? 192 ARG A HH12 1 
ATOM 7695  H HH21 . ARG C 1 97  ? 219.685 205.384 221.719 1.00 311.88 ? 192 ARG A HH21 1 
ATOM 7696  H HH22 . ARG C 1 97  ? 219.767 203.978 220.681 1.00 311.88 ? 192 ARG A HH22 1 
ATOM 7697  N N    . GLU C 1 98  ? 221.815 208.192 226.612 1.00 272.15 ? 193 GLU A N    1 
ATOM 7698  C CA   . GLU C 1 98  ? 221.252 209.532 226.560 1.00 272.15 ? 193 GLU A CA   1 
ATOM 7699  C C    . GLU C 1 98  ? 220.571 209.842 227.886 1.00 272.15 ? 193 GLU A C    1 
ATOM 7700  O O    . GLU C 1 98  ? 220.026 208.951 228.541 1.00 272.15 ? 193 GLU A O    1 
ATOM 7701  C CB   . GLU C 1 98  ? 220.255 209.661 225.406 1.00 272.15 ? 193 GLU A CB   1 
ATOM 7702  C CG   . GLU C 1 98  ? 220.865 209.471 224.024 1.00 272.15 ? 193 GLU A CG   1 
ATOM 7703  C CD   . GLU C 1 98  ? 219.847 209.546 222.920 1.00 272.15 ? 193 GLU A CD   1 
ATOM 7704  O OE1  . GLU C 1 98  ? 218.688 209.715 223.217 1.00 272.15 ? 193 GLU A OE1  1 
ATOM 7705  O OE2  . GLU C 1 98  ? 220.228 209.435 221.779 1.00 272.15 ? 193 GLU A OE2  1 
ATOM 7706  H H    . GLU C 1 98  ? 221.270 207.605 226.923 1.00 326.58 ? 193 GLU A H    1 
ATOM 7707  H HA   . GLU C 1 98  ? 221.963 210.178 226.428 1.00 326.58 ? 193 GLU A HA   1 
ATOM 7708  H HB2  . GLU C 1 98  ? 219.462 208.923 225.526 1.00 326.58 ? 193 GLU A HB2  1 
ATOM 7709  H HB3  . GLU C 1 98  ? 219.791 210.647 225.434 1.00 326.58 ? 193 GLU A HB3  1 
ATOM 7710  H HG2  . GLU C 1 98  ? 221.617 210.242 223.861 1.00 326.58 ? 193 GLU A HG2  1 
ATOM 7711  H HG3  . GLU C 1 98  ? 221.362 208.503 223.988 1.00 326.58 ? 193 GLU A HG3  1 
ATOM 7712  N N    . CYS C 1 99  ? 220.578 211.123 228.254 1.00 282.34 ? 194 CYS A N    1 
ATOM 7713  C CA   . CYS C 1 99  ? 220.074 211.598 229.538 1.00 282.34 ? 194 CYS A CA   1 
ATOM 7714  C C    . CYS C 1 99  ? 219.179 212.810 229.320 1.00 282.34 ? 194 CYS A C    1 
ATOM 7715  O O    . CYS C 1 99  ? 219.576 213.756 228.633 1.00 282.34 ? 194 CYS A O    1 
ATOM 7716  C CB   . CYS C 1 99  ? 221.222 211.970 230.476 1.00 282.34 ? 194 CYS A CB   1 
ATOM 7717  S SG   . CYS C 1 99  ? 220.688 212.595 232.087 1.00 282.34 ? 194 CYS A SG   1 
ATOM 7718  H H    . CYS C 1 99  ? 220.879 211.756 227.757 1.00 338.81 ? 194 CYS A H    1 
ATOM 7719  H HA   . CYS C 1 99  ? 219.548 210.908 229.970 1.00 338.81 ? 194 CYS A HA   1 
ATOM 7720  H HB2  . CYS C 1 99  ? 221.852 211.096 230.645 1.00 338.81 ? 194 CYS A HB2  1 
ATOM 7721  H HB3  . CYS C 1 99  ? 221.843 212.733 230.007 1.00 338.81 ? 194 CYS A HB3  1 
ATOM 7722  N N    . ALA C 1 100 ? 217.979 212.792 229.903 1.00 251.90 ? 195 ALA A N    1 
ATOM 7723  C CA   . ALA C 1 100 ? 217.122 213.973 229.862 1.00 251.90 ? 195 ALA A CA   1 
ATOM 7724  C C    . ALA C 1 100 ? 216.066 213.867 230.950 1.00 251.90 ? 195 ALA A C    1 
ATOM 7725  O O    . ALA C 1 100 ? 215.721 212.775 231.404 1.00 251.90 ? 195 ALA A O    1 
ATOM 7726  C CB   . ALA C 1 100 ? 216.463 214.139 228.488 1.00 251.90 ? 195 ALA A CB   1 
ATOM 7727  H H    . ALA C 1 100 ? 217.643 212.120 230.322 1.00 302.28 ? 195 ALA A H    1 
ATOM 7728  H HA   . ALA C 1 100 ? 217.660 214.761 230.037 1.00 302.28 ? 195 ALA A HA   1 
ATOM 7729  H HB1  . ALA C 1 100 ? 215.876 214.912 228.515 1.00 302.28 ? 195 ALA A HB1  1 
ATOM 7730  H HB2  . ALA C 1 100 ? 217.149 214.272 227.816 1.00 302.28 ? 195 ALA A HB2  1 
ATOM 7731  H HB3  . ALA C 1 100 ? 215.950 213.342 228.285 1.00 302.28 ? 195 ALA A HB3  1 
ATOM 7732  N N    . CYS C 1 101 ? 215.551 215.022 231.364 1.00 242.95 ? 196 CYS A N    1 
ATOM 7733  C CA   . CYS C 1 101 ? 214.491 215.093 232.361 1.00 242.95 ? 196 CYS A CA   1 
ATOM 7734  C C    . CYS C 1 101 ? 213.130 215.034 231.679 1.00 242.95 ? 196 CYS A C    1 
ATOM 7735  O O    . CYS C 1 101 ? 212.871 215.762 230.715 1.00 242.95 ? 196 CYS A O    1 
ATOM 7736  C CB   . CYS C 1 101 ? 214.597 216.379 233.181 1.00 242.95 ? 196 CYS A CB   1 
ATOM 7737  S SG   . CYS C 1 101 ? 216.018 216.425 234.300 1.00 242.95 ? 196 CYS A SG   1 
ATOM 7738  H H    . CYS C 1 101 ? 215.806 215.791 231.076 1.00 291.54 ? 196 CYS A H    1 
ATOM 7739  H HA   . CYS C 1 101 ? 214.547 214.339 232.965 1.00 291.54 ? 196 CYS A HA   1 
ATOM 7740  H HB2  . CYS C 1 101 ? 214.670 217.234 232.509 1.00 291.54 ? 196 CYS A HB2  1 
ATOM 7741  H HB3  . CYS C 1 101 ? 213.694 216.506 233.777 1.00 291.54 ? 196 CYS A HB3  1 
ATOM 7742  N N    . VAL C 1 102 ? 212.271 214.149 232.180 1.00 230.62 ? 197 VAL A N    1 
ATOM 7743  C CA   . VAL C 1 102 ? 210.919 213.967 231.662 1.00 230.62 ? 197 VAL A CA   1 
ATOM 7744  C C    . VAL C 1 102 ? 209.925 214.363 232.745 1.00 230.62 ? 197 VAL A C    1 
ATOM 7745  O O    . VAL C 1 102 ? 209.230 215.373 232.634 1.00 230.62 ? 197 VAL A O    1 
ATOM 7746  C CB   . VAL C 1 102 ? 210.681 212.505 231.239 1.00 230.62 ? 197 VAL A CB   1 
ATOM 7747  C CG1  . VAL C 1 102 ? 209.257 212.321 230.737 1.00 230.62 ? 197 VAL A CG1  1 
ATOM 7748  C CG2  . VAL C 1 102 ? 211.686 212.105 230.170 1.00 230.62 ? 197 VAL A CG2  1 
ATOM 7749  O OXT  . VAL C 1 102 ? 209.796 213.679 233.760 1.00 230.62 ? 197 VAL A OXT  1 
ATOM 7750  H H    . VAL C 1 102 ? 212.455 213.628 232.840 1.00 276.74 ? 197 VAL A H    1 
ATOM 7751  H HA   . VAL C 1 102 ? 210.768 214.546 230.900 1.00 276.74 ? 197 VAL A HA   1 
ATOM 7752  H HB   . VAL C 1 102 ? 210.800 211.861 232.110 1.00 276.74 ? 197 VAL A HB   1 
ATOM 7753  H HG11 . VAL C 1 102 ? 209.106 211.282 230.442 1.00 276.74 ? 197 VAL A HG11 1 
ATOM 7754  H HG12 . VAL C 1 102 ? 208.555 212.578 231.530 1.00 276.74 ? 197 VAL A HG12 1 
ATOM 7755  H HG13 . VAL C 1 102 ? 209.088 212.969 229.877 1.00 276.74 ? 197 VAL A HG13 1 
ATOM 7756  H HG21 . VAL C 1 102 ? 211.512 211.070 229.876 1.00 276.74 ? 197 VAL A HG21 1 
ATOM 7757  H HG22 . VAL C 1 102 ? 211.570 212.753 229.301 1.00 276.74 ? 197 VAL A HG22 1 
ATOM 7758  H HG23 . VAL C 1 102 ? 212.697 212.205 230.565 1.00 276.74 ? 197 VAL A HG23 1 
ATOM 7759  N N    . ASP D 2 18  ? 246.691 201.844 192.712 1.00 309.65 ? 39  ASP C N    1 
ATOM 7760  C CA   . ASP D 2 18  ? 246.363 200.483 193.121 1.00 309.65 ? 39  ASP C CA   1 
ATOM 7761  C C    . ASP D 2 18  ? 246.250 199.564 191.906 1.00 309.65 ? 39  ASP C C    1 
ATOM 7762  O O    . ASP D 2 18  ? 246.430 200.006 190.773 1.00 309.65 ? 39  ASP C O    1 
ATOM 7763  C CB   . ASP D 2 18  ? 245.055 200.460 193.915 1.00 309.65 ? 39  ASP C CB   1 
ATOM 7764  C CG   . ASP D 2 18  ? 243.854 200.904 193.090 1.00 309.65 ? 39  ASP C CG   1 
ATOM 7765  O OD1  . ASP D 2 18  ? 243.982 200.994 191.892 1.00 309.65 ? 39  ASP C OD1  1 
ATOM 7766  O OD2  . ASP D 2 18  ? 242.821 201.148 193.666 1.00 309.65 ? 39  ASP C OD2  1 
ATOM 7767  H H    . ASP D 2 18  ? 246.070 202.596 192.934 1.00 371.58 ? 39  ASP C H    1 
ATOM 7768  H HA   . ASP D 2 18  ? 247.077 200.146 193.686 1.00 371.58 ? 39  ASP C HA   1 
ATOM 7769  H HB2  . ASP D 2 18  ? 244.871 199.451 194.284 1.00 371.58 ? 39  ASP C HB2  1 
ATOM 7770  H HB3  . ASP D 2 18  ? 245.143 201.115 194.782 1.00 371.58 ? 39  ASP C HB3  1 
ATOM 7771  N N    . CYS D 2 19  ? 245.943 198.287 192.152 1.00 310.57 ? 40  CYS C N    1 
ATOM 7772  C CA   . CYS D 2 19  ? 245.829 197.320 191.062 1.00 310.57 ? 40  CYS C CA   1 
ATOM 7773  C C    . CYS D 2 19  ? 244.638 197.621 190.159 1.00 310.57 ? 40  CYS C C    1 
ATOM 7774  O O    . CYS D 2 19  ? 244.712 197.406 188.943 1.00 310.57 ? 40  CYS C O    1 
ATOM 7775  C CB   . CYS D 2 19  ? 245.726 195.905 191.631 1.00 310.57 ? 40  CYS C CB   1 
ATOM 7776  S SG   . CYS D 2 19  ? 247.264 195.299 192.365 1.00 310.57 ? 40  CYS C SG   1 
ATOM 7777  H H    . CYS D 2 19  ? 245.797 197.960 192.933 1.00 372.68 ? 40  CYS C H    1 
ATOM 7778  H HA   . CYS D 2 19  ? 246.633 197.362 190.523 1.00 372.68 ? 40  CYS C HA   1 
ATOM 7779  H HB2  . CYS D 2 19  ? 245.046 195.897 192.322 1.00 372.68 ? 40  CYS C HB2  1 
ATOM 7780  H HB3  . CYS D 2 19  ? 245.478 195.297 190.918 1.00 372.68 ? 40  CYS C HB3  1 
ATOM 7781  N N    . VAL D 2 20  ? 243.540 198.123 190.728 1.00 295.99 ? 41  VAL C N    1 
ATOM 7782  C CA   . VAL D 2 20  ? 242.340 198.390 189.936 1.00 295.99 ? 41  VAL C CA   1 
ATOM 7783  C C    . VAL D 2 20  ? 242.615 199.509 188.936 1.00 295.99 ? 41  VAL C C    1 
ATOM 7784  O O    . VAL D 2 20  ? 242.344 199.381 187.733 1.00 295.99 ? 41  VAL C O    1 
ATOM 7785  C CB   . VAL D 2 20  ? 241.164 198.787 190.847 1.00 295.99 ? 41  VAL C CB   1 
ATOM 7786  C CG1  . VAL D 2 20  ? 239.955 199.186 190.014 1.00 295.99 ? 41  VAL C CG1  1 
ATOM 7787  C CG2  . VAL D 2 20  ? 240.819 197.635 191.779 1.00 295.99 ? 41  VAL C CG2  1 
ATOM 7788  H H    . VAL D 2 20  ? 243.469 198.318 191.562 1.00 355.19 ? 41  VAL C H    1 
ATOM 7789  H HA   . VAL D 2 20  ? 242.108 197.592 189.438 1.00 355.19 ? 41  VAL C HA   1 
ATOM 7790  H HB   . VAL D 2 20  ? 241.450 199.658 191.436 1.00 355.19 ? 41  VAL C HB   1 
ATOM 7791  H HG11 . VAL D 2 20  ? 239.133 199.464 190.674 1.00 355.19 ? 41  VAL C HG11 1 
ATOM 7792  H HG12 . VAL D 2 20  ? 240.214 200.035 189.381 1.00 355.19 ? 41  VAL C HG12 1 
ATOM 7793  H HG13 . VAL D 2 20  ? 239.650 198.346 189.389 1.00 355.19 ? 41  VAL C HG13 1 
ATOM 7794  H HG21 . VAL D 2 20  ? 239.987 197.923 192.421 1.00 355.19 ? 41  VAL C HG21 1 
ATOM 7795  H HG22 . VAL D 2 20  ? 240.538 196.762 191.190 1.00 355.19 ? 41  VAL C HG22 1 
ATOM 7796  H HG23 . VAL D 2 20  ? 241.686 197.394 192.395 1.00 355.19 ? 41  VAL C HG23 1 
ATOM 7797  N N    . ARG D 2 21  ? 243.169 200.622 189.424 1.00 311.17 ? 42  ARG C N    1 
ATOM 7798  C CA   . ARG D 2 21  ? 243.508 201.733 188.545 1.00 311.17 ? 42  ARG C CA   1 
ATOM 7799  C C    . ARG D 2 21  ? 244.666 201.371 187.624 1.00 311.17 ? 42  ARG C C    1 
ATOM 7800  O O    . ARG D 2 21  ? 244.670 201.758 186.451 1.00 311.17 ? 42  ARG C O    1 
ATOM 7801  C CB   . ARG D 2 21  ? 243.876 202.966 189.358 1.00 311.17 ? 42  ARG C CB   1 
ATOM 7802  C CG   . ARG D 2 21  ? 244.212 204.199 188.534 1.00 311.17 ? 42  ARG C CG   1 
ATOM 7803  C CD   . ARG D 2 21  ? 243.078 204.603 187.663 1.00 311.17 ? 42  ARG C CD   1 
ATOM 7804  N NE   . ARG D 2 21  ? 243.370 205.820 186.923 1.00 311.17 ? 42  ARG C NE   1 
ATOM 7805  C CZ   . ARG D 2 21  ? 242.670 206.254 185.857 1.00 311.17 ? 42  ARG C CZ   1 
ATOM 7806  N NH1  . ARG D 2 21  ? 241.643 205.560 185.419 1.00 311.17 ? 42  ARG C NH1  1 
ATOM 7807  N NH2  . ARG D 2 21  ? 243.015 207.377 185.252 1.00 311.17 ? 42  ARG C NH2  1 
ATOM 7808  H H    . ARG D 2 21  ? 243.355 200.753 190.253 1.00 373.40 ? 42  ARG C H    1 
ATOM 7809  H HA   . ARG D 2 21  ? 242.737 201.939 187.995 1.00 373.40 ? 42  ARG C HA   1 
ATOM 7810  H HB2  . ARG D 2 21  ? 243.050 203.226 190.018 1.00 373.40 ? 42  ARG C HB2  1 
ATOM 7811  H HB3  . ARG D 2 21  ? 244.739 202.744 189.986 1.00 373.40 ? 42  ARG C HB3  1 
ATOM 7812  H HG2  . ARG D 2 21  ? 244.446 205.029 189.200 1.00 373.40 ? 42  ARG C HG2  1 
ATOM 7813  H HG3  . ARG D 2 21  ? 245.074 203.989 187.899 1.00 373.40 ? 42  ARG C HG3  1 
ATOM 7814  H HD2  . ARG D 2 21  ? 242.870 203.810 186.946 1.00 373.40 ? 42  ARG C HD2  1 
ATOM 7815  H HD3  . ARG D 2 21  ? 242.195 204.779 188.275 1.00 373.40 ? 42  ARG C HD3  1 
ATOM 7816  H HE   . ARG D 2 21  ? 244.153 206.381 187.231 1.00 373.40 ? 42  ARG C HE   1 
ATOM 7817  H HH11 . ARG D 2 21  ? 241.378 204.702 185.882 1.00 373.40 ? 42  ARG C HH11 1 
ATOM 7818  H HH12 . ARG D 2 21  ? 241.118 205.885 184.620 1.00 373.40 ? 42  ARG C HH12 1 
ATOM 7819  H HH21 . ARG D 2 21  ? 243.805 207.910 185.589 1.00 373.40 ? 42  ARG C HH21 1 
ATOM 7820  H HH22 . ARG D 2 21  ? 242.491 207.701 184.453 1.00 373.40 ? 42  ARG C HH22 1 
ATOM 7821  N N    . ALA D 2 22  ? 245.654 200.632 188.133 1.00 307.64 ? 43  ALA C N    1 
ATOM 7822  C CA   . ALA D 2 22  ? 246.800 200.273 187.304 1.00 307.64 ? 43  ALA C CA   1 
ATOM 7823  C C    . ALA D 2 22  ? 246.356 199.565 186.030 1.00 307.64 ? 43  ALA C C    1 
ATOM 7824  O O    . ALA D 2 22  ? 246.968 199.746 184.970 1.00 307.64 ? 43  ALA C O    1 
ATOM 7825  C CB   . ALA D 2 22  ? 247.776 199.403 188.093 1.00 307.64 ? 43  ALA C CB   1 
ATOM 7826  H H    . ALA D 2 22  ? 245.683 200.331 188.937 1.00 369.17 ? 43  ALA C H    1 
ATOM 7827  H HA   . ALA D 2 22  ? 247.266 201.084 187.046 1.00 369.17 ? 43  ALA C HA   1 
ATOM 7828  H HB1  . ALA D 2 22  ? 248.561 199.250 187.548 1.00 369.17 ? 43  ALA C HB1  1 
ATOM 7829  H HB2  . ALA D 2 22  ? 248.031 199.868 188.903 1.00 369.17 ? 43  ALA C HB2  1 
ATOM 7830  H HB3  . ALA D 2 22  ? 247.348 198.561 188.310 1.00 369.17 ? 43  ALA C HB3  1 
ATOM 7831  N N    . ASN D 2 23  ? 245.296 198.757 186.106 1.00 304.50 ? 44  ASN C N    1 
ATOM 7832  C CA   . ASN D 2 23  ? 244.766 198.148 184.890 1.00 304.50 ? 44  ASN C CA   1 
ATOM 7833  C C    . ASN D 2 23  ? 244.098 199.198 184.018 1.00 304.50 ? 44  ASN C C    1 
ATOM 7834  O O    . ASN D 2 23  ? 244.351 199.267 182.810 1.00 304.50 ? 44  ASN C O    1 
ATOM 7835  C CB   . ASN D 2 23  ? 243.795 197.030 185.222 1.00 304.50 ? 44  ASN C CB   1 
ATOM 7836  C CG   . ASN D 2 23  ? 243.315 196.299 183.999 1.00 304.50 ? 44  ASN C CG   1 
ATOM 7837  O OD1  . ASN D 2 23  ? 244.111 195.701 183.266 1.00 304.50 ? 44  ASN C OD1  1 
ATOM 7838  N ND2  . ASN D 2 23  ? 242.028 196.335 183.766 1.00 304.50 ? 44  ASN C ND2  1 
ATOM 7839  H H    . ASN D 2 23  ? 244.877 198.550 186.829 1.00 365.40 ? 44  ASN C H    1 
ATOM 7840  H HA   . ASN D 2 23  ? 245.498 197.759 184.386 1.00 365.40 ? 44  ASN C HA   1 
ATOM 7841  H HB2  . ASN D 2 23  ? 244.278 196.316 185.892 1.00 365.40 ? 44  ASN C HB2  1 
ATOM 7842  H HB3  . ASN D 2 23  ? 242.933 197.441 185.748 1.00 365.40 ? 44  ASN C HB3  1 
ATOM 7843  H HD21 . ASN D 2 23  ? 241.652 195.866 182.966 1.00 365.40 ? 44  ASN C HD21 1 
ATOM 7844  H HD22 . ASN D 2 23  ? 241.421 196.830 184.386 1.00 365.40 ? 44  ASN C HD22 1 
ATOM 7845  N N    . GLU D 2 24  ? 243.243 200.033 184.620 1.00 316.79 ? 45  GLU C N    1 
ATOM 7846  C CA   . GLU D 2 24  ? 242.535 201.062 183.858 1.00 316.79 ? 45  GLU C CA   1 
ATOM 7847  C C    . GLU D 2 24  ? 243.488 202.001 183.122 1.00 316.79 ? 45  GLU C C    1 
ATOM 7848  O O    . GLU D 2 24  ? 243.145 202.512 182.051 1.00 316.79 ? 45  GLU C O    1 
ATOM 7849  C CB   . GLU D 2 24  ? 241.631 201.876 184.786 1.00 316.79 ? 45  GLU C CB   1 
ATOM 7850  C CG   . GLU D 2 24  ? 240.457 201.097 185.363 1.00 316.79 ? 45  GLU C CG   1 
ATOM 7851  C CD   . GLU D 2 24  ? 239.656 201.894 186.354 1.00 316.79 ? 45  GLU C CD   1 
ATOM 7852  O OE1  . GLU D 2 24  ? 240.040 203.001 186.647 1.00 316.79 ? 45  GLU C OE1  1 
ATOM 7853  O OE2  . GLU D 2 24  ? 238.659 201.395 186.820 1.00 316.79 ? 45  GLU C OE2  1 
ATOM 7854  H H    . GLU D 2 24  ? 243.059 200.024 185.461 1.00 380.15 ? 45  GLU C H    1 
ATOM 7855  H HA   . GLU D 2 24  ? 241.975 200.629 183.194 1.00 380.15 ? 45  GLU C HA   1 
ATOM 7856  H HB2  . GLU D 2 24  ? 242.218 202.261 185.620 1.00 380.15 ? 45  GLU C HB2  1 
ATOM 7857  H HB3  . GLU D 2 24  ? 241.230 202.733 184.245 1.00 380.15 ? 45  GLU C HB3  1 
ATOM 7858  H HG2  . GLU D 2 24  ? 239.803 200.790 184.547 1.00 380.15 ? 45  GLU C HG2  1 
ATOM 7859  H HG3  . GLU D 2 24  ? 240.834 200.197 185.847 1.00 380.15 ? 45  GLU C HG3  1 
ATOM 7860  N N    . LEU D 2 25  ? 244.678 202.244 183.677 1.00 306.50 ? 46  LEU C N    1 
ATOM 7861  C CA   . LEU D 2 25  ? 245.610 203.167 183.030 1.00 306.50 ? 46  LEU C CA   1 
ATOM 7862  C C    . LEU D 2 25  ? 245.992 202.701 181.627 1.00 306.50 ? 46  LEU C C    1 
ATOM 7863  O O    . LEU D 2 25  ? 246.219 203.539 180.745 1.00 306.50 ? 46  LEU C O    1 
ATOM 7864  C CB   . LEU D 2 25  ? 246.877 203.318 183.882 1.00 306.50 ? 46  LEU C CB   1 
ATOM 7865  C CG   . LEU D 2 25  ? 246.699 204.062 185.212 1.00 306.50 ? 46  LEU C CG   1 
ATOM 7866  C CD1  . LEU D 2 25  ? 247.986 203.972 186.020 1.00 306.50 ? 46  LEU C CD1  1 
ATOM 7867  C CD2  . LEU D 2 25  ? 246.326 205.511 184.936 1.00 306.50 ? 46  LEU C CD2  1 
ATOM 7868  H H    . LEU D 2 25  ? 244.965 201.898 184.411 1.00 367.80 ? 46  LEU C H    1 
ATOM 7869  H HA   . LEU D 2 25  ? 245.180 204.030 182.940 1.00 367.80 ? 46  LEU C HA   1 
ATOM 7870  H HB2  . LEU D 2 25  ? 247.264 202.325 184.108 1.00 367.80 ? 46  LEU C HB2  1 
ATOM 7871  H HB3  . LEU D 2 25  ? 247.626 203.854 183.300 1.00 367.80 ? 46  LEU C HB3  1 
ATOM 7872  H HG   . LEU D 2 25  ? 245.907 203.588 185.792 1.00 367.80 ? 46  LEU C HG   1 
ATOM 7873  H HD11 . LEU D 2 25  ? 247.860 204.501 186.965 1.00 367.80 ? 46  LEU C HD11 1 
ATOM 7874  H HD12 . LEU D 2 25  ? 248.218 202.926 186.219 1.00 367.80 ? 46  LEU C HD12 1 
ATOM 7875  H HD13 . LEU D 2 25  ? 248.801 204.425 185.458 1.00 367.80 ? 46  LEU C HD13 1 
ATOM 7876  H HD21 . LEU D 2 25  ? 246.199 206.040 185.881 1.00 367.80 ? 46  LEU C HD21 1 
ATOM 7877  H HD22 . LEU D 2 25  ? 247.118 205.987 184.358 1.00 367.80 ? 46  LEU C HD22 1 
ATOM 7878  H HD23 . LEU D 2 25  ? 245.394 205.546 184.373 1.00 367.80 ? 46  LEU C HD23 1 
ATOM 7879  N N    . CYS D 2 26  ? 246.061 201.382 181.395 1.00 319.06 ? 47  CYS C N    1 
ATOM 7880  C CA   . CYS D 2 26  ? 246.380 200.827 180.083 1.00 319.06 ? 47  CYS C CA   1 
ATOM 7881  C C    . CYS D 2 26  ? 245.239 200.039 179.449 1.00 319.06 ? 47  CYS C C    1 
ATOM 7882  O O    . CYS D 2 26  ? 245.307 199.750 178.250 1.00 319.06 ? 47  CYS C O    1 
ATOM 7883  C CB   . CYS D 2 26  ? 247.602 199.915 180.188 1.00 319.06 ? 47  CYS C CB   1 
ATOM 7884  S SG   . CYS D 2 26  ? 248.192 199.284 178.599 1.00 319.06 ? 47  CYS C SG   1 
ATOM 7885  H H    . CYS D 2 26  ? 245.924 200.782 181.997 1.00 382.87 ? 47  CYS C H    1 
ATOM 7886  H HA   . CYS D 2 26  ? 246.605 201.542 179.468 1.00 382.87 ? 47  CYS C HA   1 
ATOM 7887  H HB2  . CYS D 2 26  ? 248.421 200.457 180.661 1.00 382.87 ? 47  CYS C HB2  1 
ATOM 7888  H HB3  . CYS D 2 26  ? 247.365 199.062 180.823 1.00 382.87 ? 47  CYS C HB3  1 
ATOM 7889  N N    . ALA D 2 27  ? 244.185 199.704 180.202 1.00 332.73 ? 48  ALA C N    1 
ATOM 7890  C CA   . ALA D 2 27  ? 243.087 198.916 179.645 1.00 332.73 ? 48  ALA C CA   1 
ATOM 7891  C C    . ALA D 2 27  ? 242.446 199.598 178.442 1.00 332.73 ? 48  ALA C C    1 
ATOM 7892  O O    . ALA D 2 27  ? 241.907 198.919 177.560 1.00 332.73 ? 48  ALA C O    1 
ATOM 7893  C CB   . ALA D 2 27  ? 242.038 198.648 180.723 1.00 332.73 ? 48  ALA C CB   1 
ATOM 7894  H H    . ALA D 2 27  ? 244.082 199.916 181.029 1.00 399.28 ? 48  ALA C H    1 
ATOM 7895  H HA   . ALA D 2 27  ? 243.436 198.060 179.350 1.00 399.28 ? 48  ALA C HA   1 
ATOM 7896  H HB1  . ALA D 2 27  ? 241.318 198.122 180.341 1.00 399.28 ? 48  ALA C HB1  1 
ATOM 7897  H HB2  . ALA D 2 27  ? 242.454 198.159 181.453 1.00 399.28 ? 48  ALA C HB2  1 
ATOM 7898  H HB3  . ALA D 2 27  ? 241.694 199.495 181.048 1.00 399.28 ? 48  ALA C HB3  1 
ATOM 7899  N N    . ALA D 2 28  ? 242.490 200.931 178.386 1.00 358.27 ? 49  ALA C N    1 
ATOM 7900  C CA   . ALA D 2 28  ? 241.967 201.643 177.227 1.00 358.27 ? 49  ALA C CA   1 
ATOM 7901  C C    . ALA D 2 28  ? 242.795 201.382 175.974 1.00 358.27 ? 49  ALA C C    1 
ATOM 7902  O O    . ALA D 2 28  ? 242.297 201.576 174.860 1.00 358.27 ? 49  ALA C O    1 
ATOM 7903  C CB   . ALA D 2 28  ? 241.915 203.143 177.517 1.00 358.27 ? 49  ALA C CB   1 
ATOM 7904  H H    . ALA D 2 28  ? 242.813 201.439 179.000 1.00 429.92 ? 49  ALA C H    1 
ATOM 7905  H HA   . ALA D 2 28  ? 241.062 201.341 177.055 1.00 429.92 ? 49  ALA C HA   1 
ATOM 7906  H HB1  . ALA D 2 28  ? 241.568 203.603 176.737 1.00 429.92 ? 49  ALA C HB1  1 
ATOM 7907  H HB2  . ALA D 2 28  ? 241.335 203.297 178.279 1.00 429.92 ? 49  ALA C HB2  1 
ATOM 7908  H HB3  . ALA D 2 28  ? 242.812 203.456 177.716 1.00 429.92 ? 49  ALA C HB3  1 
ATOM 7909  N N    . GLU D 2 29  ? 244.044 200.946 176.127 1.00 325.54 ? 50  GLU C N    1 
ATOM 7910  C CA   . GLU D 2 29  ? 244.909 200.740 174.974 1.00 325.54 ? 50  GLU C CA   1 
ATOM 7911  C C    . GLU D 2 29  ? 244.510 199.473 174.227 1.00 325.54 ? 50  GLU C C    1 
ATOM 7912  O O    . GLU D 2 29  ? 244.113 198.473 174.831 1.00 325.54 ? 50  GLU C O    1 
ATOM 7913  C CB   . GLU D 2 29  ? 246.374 200.653 175.409 1.00 325.54 ? 50  GLU C CB   1 
ATOM 7914  C CG   . GLU D 2 29  ? 246.910 201.916 176.068 1.00 325.54 ? 50  GLU C CG   1 
ATOM 7915  C CD   . GLU D 2 29  ? 247.008 203.076 175.117 1.00 325.54 ? 50  GLU C CD   1 
ATOM 7916  O OE1  . GLU D 2 29  ? 247.054 202.846 173.932 1.00 325.54 ? 50  GLU C OE1  1 
ATOM 7917  O OE2  . GLU D 2 29  ? 247.037 204.194 175.575 1.00 325.54 ? 50  GLU C OE2  1 
ATOM 7918  H H    . GLU D 2 29  ? 244.413 200.765 176.882 1.00 390.65 ? 50  GLU C H    1 
ATOM 7919  H HA   . GLU D 2 29  ? 244.816 201.489 174.366 1.00 390.65 ? 50  GLU C HA   1 
ATOM 7920  H HB2  . GLU D 2 29  ? 246.496 199.831 176.114 1.00 390.65 ? 50  GLU C HB2  1 
ATOM 7921  H HB3  . GLU D 2 29  ? 246.999 200.437 174.543 1.00 390.65 ? 50  GLU C HB3  1 
ATOM 7922  H HG2  . GLU D 2 29  ? 246.251 202.192 176.891 1.00 390.65 ? 50  GLU C HG2  1 
ATOM 7923  H HG3  . GLU D 2 29  ? 247.895 201.707 176.482 1.00 390.65 ? 50  GLU C HG3  1 
ATOM 7924  N N    . SER D 2 30  ? 244.620 199.522 172.898 1.00 297.66 ? 51  SER C N    1 
ATOM 7925  C CA   . SER D 2 30  ? 244.331 198.345 172.086 1.00 297.66 ? 51  SER C CA   1 
ATOM 7926  C C    . SER D 2 30  ? 245.261 197.190 172.428 1.00 297.66 ? 51  SER C C    1 
ATOM 7927  O O    . SER D 2 30  ? 244.872 196.023 172.297 1.00 297.66 ? 51  SER C O    1 
ATOM 7928  C CB   . SER D 2 30  ? 244.456 198.685 170.614 1.00 297.66 ? 51  SER C CB   1 
ATOM 7929  O OG   . SER D 2 30  ? 245.789 198.951 170.271 1.00 297.66 ? 51  SER C OG   1 
ATOM 7930  H H    . SER D 2 30  ? 244.856 200.217 172.449 1.00 357.19 ? 51  SER C H    1 
ATOM 7931  H HA   . SER D 2 30  ? 243.421 198.058 172.260 1.00 357.19 ? 51  SER C HA   1 
ATOM 7932  H HB2  . SER D 2 30  ? 244.083 197.854 170.016 1.00 357.19 ? 51  SER C HB2  1 
ATOM 7933  H HB3  . SER D 2 30  ? 243.840 199.554 170.387 1.00 357.19 ? 51  SER C HB3  1 
ATOM 7934  H HG   . SER D 2 30  ? 245.778 199.212 169.347 1.00 357.19 ? 51  SER C HG   1 
ATOM 7935  N N    . ASN D 2 31  ? 246.486 197.492 172.865 1.00 292.95 ? 52  ASN C N    1 
ATOM 7936  C CA   . ASN D 2 31  ? 247.444 196.447 173.215 1.00 292.95 ? 52  ASN C CA   1 
ATOM 7937  C C    . ASN D 2 31  ? 246.989 195.679 174.451 1.00 292.95 ? 52  ASN C C    1 
ATOM 7938  O O    . ASN D 2 31  ? 246.827 194.451 174.412 1.00 292.95 ? 52  ASN C O    1 
ATOM 7939  C CB   . ASN D 2 31  ? 248.825 197.036 173.431 1.00 292.95 ? 52  ASN C CB   1 
ATOM 7940  C CG   . ASN D 2 31  ? 249.479 197.461 172.145 1.00 292.95 ? 52  ASN C CG   1 
ATOM 7941  O OD1  . ASN D 2 31  ? 249.096 197.008 171.060 1.00 292.95 ? 52  ASN C OD1  1 
ATOM 7942  N ND2  . ASN D 2 31  ? 250.460 198.321 172.245 1.00 292.95 ? 52  ASN C ND2  1 
ATOM 7943  H H    . ASN D 2 31  ? 246.785 198.292 172.966 1.00 351.54 ? 52  ASN C H    1 
ATOM 7944  H HA   . ASN D 2 31  ? 247.514 195.818 172.480 1.00 351.54 ? 52  ASN C HA   1 
ATOM 7945  H HB2  . ASN D 2 31  ? 248.753 197.902 174.091 1.00 351.54 ? 52  ASN C HB2  1 
ATOM 7946  H HB3  . ASN D 2 31  ? 249.462 196.301 173.923 1.00 351.54 ? 52  ASN C HB3  1 
ATOM 7947  H HD21 . ASN D 2 31  ? 250.933 198.639 171.423 1.00 351.54 ? 52  ASN C HD21 1 
ATOM 7948  H HD22 . ASN D 2 31  ? 250.738 198.660 173.144 1.00 351.54 ? 52  ASN C HD22 1 
ATOM 7949  N N    . CYS D 2 32  ? 246.794 196.393 175.565 1.00 289.78 ? 53  CYS C N    1 
ATOM 7950  C CA   . CYS D 2 32  ? 246.359 195.746 176.798 1.00 289.78 ? 53  CYS C CA   1 
ATOM 7951  C C    . CYS D 2 32  ? 244.962 195.160 176.654 1.00 289.78 ? 53  CYS C C    1 
ATOM 7952  O O    . CYS D 2 32  ? 244.694 194.066 177.152 1.00 289.78 ? 53  CYS C O    1 
ATOM 7953  C CB   . CYS D 2 32  ? 246.370 196.740 177.960 1.00 289.78 ? 53  CYS C CB   1 
ATOM 7954  S SG   . CYS D 2 32  ? 248.026 197.214 178.511 1.00 289.78 ? 53  CYS C SG   1 
ATOM 7955  H H    . CYS D 2 32  ? 246.906 197.243 175.629 1.00 347.74 ? 53  CYS C H    1 
ATOM 7956  H HA   . CYS D 2 32  ? 246.969 195.020 176.992 1.00 347.74 ? 53  CYS C HA   1 
ATOM 7957  H HB2  . CYS D 2 32  ? 245.839 197.647 177.668 1.00 347.74 ? 53  CYS C HB2  1 
ATOM 7958  H HB3  . CYS D 2 32  ? 245.841 196.311 178.811 1.00 347.74 ? 53  CYS C HB3  1 
ATOM 7959  N N    . SER D 2 33  ? 244.070 195.853 175.944 1.00 302.91 ? 54  SER C N    1 
ATOM 7960  C CA   . SER D 2 33  ? 242.702 195.367 175.781 1.00 302.91 ? 54  SER C CA   1 
ATOM 7961  C C    . SER D 2 33  ? 242.676 194.006 175.091 1.00 302.91 ? 54  SER C C    1 
ATOM 7962  O O    . SER D 2 33  ? 242.056 193.050 175.584 1.00 302.91 ? 54  SER C O    1 
ATOM 7963  C CB   . SER D 2 33  ? 241.885 196.364 174.983 1.00 302.91 ? 54  SER C CB   1 
ATOM 7964  O OG   . SER D 2 33  ? 240.558 195.933 174.849 1.00 302.91 ? 54  SER C OG   1 
ATOM 7965  H H    . SER D 2 33  ? 244.232 196.600 175.549 1.00 363.49 ? 54  SER C H    1 
ATOM 7966  H HA   . SER D 2 33  ? 242.294 195.269 176.656 1.00 363.49 ? 54  SER C HA   1 
ATOM 7967  H HB2  . SER D 2 33  ? 241.908 197.333 175.479 1.00 363.49 ? 54  SER C HB2  1 
ATOM 7968  H HB3  . SER D 2 33  ? 242.330 196.491 173.997 1.00 363.49 ? 54  SER C HB3  1 
ATOM 7969  H HG   . SER D 2 33  ? 240.015 196.720 174.935 1.00 363.49 ? 54  SER C HG   1 
ATOM 7970  N N    . SER D 2 34  ? 243.340 193.904 173.934 1.00 305.43 ? 55  SER C N    1 
ATOM 7971  C CA   . SER D 2 34  ? 243.362 192.649 173.191 1.00 305.43 ? 55  SER C CA   1 
ATOM 7972  C C    . SER D 2 34  ? 244.119 191.569 173.949 1.00 305.43 ? 55  SER C C    1 
ATOM 7973  O O    . SER D 2 34  ? 243.665 190.422 174.020 1.00 305.43 ? 55  SER C O    1 
ATOM 7974  C CB   . SER D 2 34  ? 243.996 192.861 171.830 1.00 305.43 ? 55  SER C CB   1 
ATOM 7975  O OG   . SER D 2 34  ? 243.180 193.656 171.014 1.00 305.43 ? 55  SER C OG   1 
ATOM 7976  H H    . SER D 2 34  ? 243.781 194.543 173.566 1.00 366.52 ? 55  SER C H    1 
ATOM 7977  H HA   . SER D 2 34  ? 242.454 192.338 173.066 1.00 366.52 ? 55  SER C HA   1 
ATOM 7978  H HB2  . SER D 2 34  ? 244.968 193.338 171.952 1.00 366.52 ? 55  SER C HB2  1 
ATOM 7979  H HB3  . SER D 2 34  ? 244.162 191.896 171.353 1.00 366.52 ? 55  SER C HB3  1 
ATOM 7980  H HG   . SER D 2 34  ? 243.757 194.022 170.340 1.00 366.52 ? 55  SER C HG   1 
ATOM 7981  N N    . ARG D 2 35  ? 245.260 191.914 174.547 1.00 296.08 ? 56  ARG C N    1 
ATOM 7982  C CA   . ARG D 2 35  ? 246.066 190.892 175.202 1.00 296.08 ? 56  ARG C CA   1 
ATOM 7983  C C    . ARG D 2 35  ? 245.496 190.509 176.566 1.00 296.08 ? 56  ARG C C    1 
ATOM 7984  O O    . ARG D 2 35  ? 245.640 189.356 176.991 1.00 296.08 ? 56  ARG C O    1 
ATOM 7985  C CB   . ARG D 2 35  ? 247.498 191.377 175.373 1.00 296.08 ? 56  ARG C CB   1 
ATOM 7986  C CG   . ARG D 2 35  ? 248.234 191.670 174.075 1.00 296.08 ? 56  ARG C CG   1 
ATOM 7987  C CD   . ARG D 2 35  ? 248.358 190.456 173.229 1.00 296.08 ? 56  ARG C CD   1 
ATOM 7988  N NE   . ARG D 2 35  ? 249.163 190.702 172.043 1.00 296.08 ? 56  ARG C NE   1 
ATOM 7989  C CZ   . ARG D 2 35  ? 249.311 189.832 171.025 1.00 296.08 ? 56  ARG C CZ   1 
ATOM 7990  N NH1  . ARG D 2 35  ? 248.704 188.667 171.062 1.00 296.08 ? 56  ARG C NH1  1 
ATOM 7991  N NH2  . ARG D 2 35  ? 250.067 190.151 169.988 1.00 296.08 ? 56  ARG C NH2  1 
ATOM 7992  H H    . ARG D 2 35  ? 245.581 192.711 174.586 1.00 355.30 ? 56  ARG C H    1 
ATOM 7993  H HA   . ARG D 2 35  ? 246.052 190.089 174.663 1.00 355.30 ? 56  ARG C HA   1 
ATOM 7994  H HB2  . ARG D 2 35  ? 247.504 192.289 175.969 1.00 355.30 ? 56  ARG C HB2  1 
ATOM 7995  H HB3  . ARG D 2 35  ? 248.073 190.627 175.917 1.00 355.30 ? 56  ARG C HB3  1 
ATOM 7996  H HG2  . ARG D 2 35  ? 247.689 192.427 173.511 1.00 355.30 ? 56  ARG C HG2  1 
ATOM 7997  H HG3  . ARG D 2 35  ? 249.236 192.036 174.300 1.00 355.30 ? 56  ARG C HG3  1 
ATOM 7998  H HD2  . ARG D 2 35  ? 248.831 189.659 173.802 1.00 355.30 ? 56  ARG C HD2  1 
ATOM 7999  H HD3  . ARG D 2 35  ? 247.369 190.133 172.908 1.00 355.30 ? 56  ARG C HD3  1 
ATOM 8000  H HE   . ARG D 2 35  ? 249.646 191.589 171.978 1.00 355.30 ? 56  ARG C HE   1 
ATOM 8001  H HH11 . ARG D 2 35  ? 248.127 188.424 171.854 1.00 355.30 ? 56  ARG C HH11 1 
ATOM 8002  H HH12 . ARG D 2 35  ? 248.815 188.015 170.299 1.00 355.30 ? 56  ARG C HH12 1 
ATOM 8003  H HH21 . ARG D 2 35  ? 250.534 191.047 169.959 1.00 355.30 ? 56  ARG C HH21 1 
ATOM 8004  H HH22 . ARG D 2 35  ? 250.178 189.500 169.226 1.00 355.30 ? 56  ARG C HH22 1 
ATOM 8005  N N    . TYR D 2 36  ? 244.802 191.431 177.238 1.00 289.91 ? 57  TYR C N    1 
ATOM 8006  C CA   . TYR D 2 36  ? 244.077 191.089 178.456 1.00 289.91 ? 57  TYR C CA   1 
ATOM 8007  C C    . TYR D 2 36  ? 243.079 189.974 178.186 1.00 289.91 ? 57  TYR C C    1 
ATOM 8008  O O    . TYR D 2 36  ? 243.047 188.963 178.900 1.00 289.91 ? 57  TYR C O    1 
ATOM 8009  C CB   . TYR D 2 36  ? 243.364 192.318 179.024 1.00 289.91 ? 57  TYR C CB   1 
ATOM 8010  C CG   . TYR D 2 36  ? 242.536 192.028 180.257 1.00 289.91 ? 57  TYR C CG   1 
ATOM 8011  C CD1  . TYR D 2 36  ? 243.151 191.925 181.496 1.00 289.91 ? 57  TYR C CD1  1 
ATOM 8012  C CD2  . TYR D 2 36  ? 241.163 191.866 180.148 1.00 289.91 ? 57  TYR C CD2  1 
ATOM 8013  C CE1  . TYR D 2 36  ? 242.395 191.660 182.622 1.00 289.91 ? 57  TYR C CE1  1 
ATOM 8014  C CE2  . TYR D 2 36  ? 240.408 191.601 181.273 1.00 289.91 ? 57  TYR C CE2  1 
ATOM 8015  C CZ   . TYR D 2 36  ? 241.019 191.498 182.506 1.00 289.91 ? 57  TYR C CZ   1 
ATOM 8016  O OH   . TYR D 2 36  ? 240.266 191.234 183.628 1.00 289.91 ? 57  TYR C OH   1 
ATOM 8017  H H    . TYR D 2 36  ? 244.738 192.257 177.010 1.00 347.89 ? 57  TYR C H    1 
ATOM 8018  H HA   . TYR D 2 36  ? 244.704 190.782 179.129 1.00 347.89 ? 57  TYR C HA   1 
ATOM 8019  H HB2  . TYR D 2 36  ? 244.100 193.081 179.280 1.00 347.89 ? 57  TYR C HB2  1 
ATOM 8020  H HB3  . TYR D 2 36  ? 242.706 192.740 178.265 1.00 347.89 ? 57  TYR C HB3  1 
ATOM 8021  H HD1  . TYR D 2 36  ? 244.230 192.052 181.581 1.00 347.89 ? 57  TYR C HD1  1 
ATOM 8022  H HD2  . TYR D 2 36  ? 240.680 191.946 179.174 1.00 347.89 ? 57  TYR C HD2  1 
ATOM 8023  H HE1  . TYR D 2 36  ? 242.878 191.579 183.595 1.00 347.89 ? 57  TYR C HE1  1 
ATOM 8024  H HE2  . TYR D 2 36  ? 239.328 191.473 181.188 1.00 347.89 ? 57  TYR C HE2  1 
ATOM 8025  H HH   . TYR D 2 36  ? 240.841 191.195 184.396 1.00 347.89 ? 57  TYR C HH   1 
ATOM 8026  N N    . ARG D 2 37  ? 242.251 190.144 177.152 1.00 299.15 ? 58  ARG C N    1 
ATOM 8027  C CA   . ARG D 2 37  ? 241.277 189.108 176.818 1.00 299.15 ? 58  ARG C CA   1 
ATOM 8028  C C    . ARG D 2 37  ? 241.974 187.813 176.410 1.00 299.15 ? 58  ARG C C    1 
ATOM 8029  O O    . ARG D 2 37  ? 241.484 186.714 176.699 1.00 299.15 ? 58  ARG C O    1 
ATOM 8030  C CB   . ARG D 2 37  ? 240.352 189.595 175.704 1.00 299.15 ? 58  ARG C CB   1 
ATOM 8031  C CG   . ARG D 2 37  ? 239.405 190.706 176.130 1.00 299.15 ? 58  ARG C CG   1 
ATOM 8032  C CD   . ARG D 2 37  ? 238.365 190.994 175.059 1.00 299.15 ? 58  ARG C CD   1 
ATOM 8033  N NE   . ARG D 2 37  ? 238.970 191.423 173.798 1.00 299.15 ? 58  ARG C NE   1 
ATOM 8034  C CZ   . ARG D 2 37  ? 239.401 192.655 173.530 1.00 299.15 ? 58  ARG C CZ   1 
ATOM 8035  N NH1  . ARG D 2 37  ? 239.318 193.631 174.428 1.00 299.15 ? 58  ARG C NH1  1 
ATOM 8036  N NH2  . ARG D 2 37  ? 239.928 192.918 172.342 1.00 299.15 ? 58  ARG C NH2  1 
ATOM 8037  H H    . ARG D 2 37  ? 242.234 190.836 176.641 1.00 358.98 ? 58  ARG C H    1 
ATOM 8038  H HA   . ARG D 2 37  ? 240.734 188.922 177.599 1.00 358.98 ? 58  ARG C HA   1 
ATOM 8039  H HB2  . ARG D 2 37  ? 240.893 189.932 174.973 1.00 358.98 ? 58  ARG C HB2  1 
ATOM 8040  H HB3  . ARG D 2 37  ? 239.814 188.848 175.398 1.00 358.98 ? 58  ARG C HB3  1 
ATOM 8041  H HG2  . ARG D 2 37  ? 238.942 190.438 176.940 1.00 358.98 ? 58  ARG C HG2  1 
ATOM 8042  H HG3  . ARG D 2 37  ? 239.913 191.517 176.288 1.00 358.98 ? 58  ARG C HG3  1 
ATOM 8043  H HD2  . ARG D 2 37  ? 237.872 190.178 174.882 1.00 358.98 ? 58  ARG C HD2  1 
ATOM 8044  H HD3  . ARG D 2 37  ? 237.754 191.677 175.374 1.00 358.98 ? 58  ARG C HD3  1 
ATOM 8045  H HE   . ARG D 2 37  ? 239.188 190.805 173.241 1.00 358.98 ? 58  ARG C HE   1 
ATOM 8046  H HH11 . ARG D 2 37  ? 238.982 193.496 175.207 1.00 358.98 ? 58  ARG C HH11 1 
ATOM 8047  H HH12 . ARG D 2 37  ? 239.606 194.414 174.224 1.00 358.98 ? 58  ARG C HH12 1 
ATOM 8048  H HH21 . ARG D 2 37  ? 239.990 192.295 171.752 1.00 358.98 ? 58  ARG C HH21 1 
ATOM 8049  H HH22 . ARG D 2 37  ? 240.212 193.710 172.162 1.00 358.98 ? 58  ARG C HH22 1 
ATOM 8050  N N    . THR D 2 38  ? 243.128 187.930 175.749 1.00 301.97 ? 59  THR C N    1 
ATOM 8051  C CA   . THR D 2 38  ? 243.859 186.751 175.290 1.00 301.97 ? 59  THR C CA   1 
ATOM 8052  C C    . THR D 2 38  ? 244.197 185.828 176.455 1.00 301.97 ? 59  THR C C    1 
ATOM 8053  O O    . THR D 2 38  ? 243.967 184.616 176.388 1.00 301.97 ? 59  THR C O    1 
ATOM 8054  C CB   . THR D 2 38  ? 245.151 187.151 174.554 1.00 301.97 ? 59  THR C CB   1 
ATOM 8055  O OG1  . THR D 2 38  ? 244.823 187.925 173.392 1.00 301.97 ? 59  THR C OG1  1 
ATOM 8056  C CG2  . THR D 2 38  ? 245.928 185.913 174.131 1.00 301.97 ? 59  THR C CG2  1 
ATOM 8057  H H    . THR D 2 38  ? 243.505 188.677 175.552 1.00 362.36 ? 59  THR C H    1 
ATOM 8058  H HA   . THR D 2 38  ? 243.305 186.258 174.665 1.00 362.36 ? 59  THR C HA   1 
ATOM 8059  H HB   . THR D 2 38  ? 245.773 187.756 175.213 1.00 362.36 ? 59  THR C HB   1 
ATOM 8060  H HG1  . THR D 2 38  ? 244.353 188.718 173.660 1.00 362.36 ? 59  THR C HG1  1 
ATOM 8061  H HG21 . THR D 2 38  ? 246.839 186.215 173.613 1.00 362.36 ? 59  THR C HG21 1 
ATOM 8062  H HG22 . THR D 2 38  ? 246.189 185.329 175.013 1.00 362.36 ? 59  THR C HG22 1 
ATOM 8063  H HG23 . THR D 2 38  ? 245.315 185.309 173.464 1.00 362.36 ? 59  THR C HG23 1 
ATOM 8064  N N    . LEU D 2 39  ? 244.752 186.385 177.535 1.00 293.23 ? 60  LEU C N    1 
ATOM 8065  C CA   . LEU D 2 39  ? 245.092 185.556 178.688 1.00 293.23 ? 60  LEU C CA   1 
ATOM 8066  C C    . LEU D 2 39  ? 243.850 184.945 179.322 1.00 293.23 ? 60  LEU C C    1 
ATOM 8067  O O    . LEU D 2 39  ? 243.909 183.823 179.837 1.00 293.23 ? 60  LEU C O    1 
ATOM 8068  C CB   . LEU D 2 39  ? 245.847 186.387 179.733 1.00 293.23 ? 60  LEU C CB   1 
ATOM 8069  C CG   . LEU D 2 39  ? 247.262 186.827 179.336 1.00 293.23 ? 60  LEU C CG   1 
ATOM 8070  C CD1  . LEU D 2 39  ? 247.873 187.648 180.463 1.00 293.23 ? 60  LEU C CD1  1 
ATOM 8071  C CD2  . LEU D 2 39  ? 248.109 185.600 179.033 1.00 293.23 ? 60  LEU C CD2  1 
ATOM 8072  H H    . LEU D 2 39  ? 244.937 187.221 177.624 1.00 351.88 ? 60  LEU C H    1 
ATOM 8073  H HA   . LEU D 2 39  ? 245.649 184.822 178.390 1.00 351.88 ? 60  LEU C HA   1 
ATOM 8074  H HB2  . LEU D 2 39  ? 245.269 187.284 179.947 1.00 351.88 ? 60  LEU C HB2  1 
ATOM 8075  H HB3  . LEU D 2 39  ? 245.926 185.803 180.650 1.00 351.88 ? 60  LEU C HB3  1 
ATOM 8076  H HG   . LEU D 2 39  ? 247.212 187.461 178.451 1.00 351.88 ? 60  LEU C HG   1 
ATOM 8077  H HD11 . LEU D 2 39  ? 248.879 187.961 180.182 1.00 351.88 ? 60  LEU C HD11 1 
ATOM 8078  H HD12 . LEU D 2 39  ? 247.258 188.529 180.646 1.00 351.88 ? 60  LEU C HD12 1 
ATOM 8079  H HD13 . LEU D 2 39  ? 247.922 187.044 181.369 1.00 351.88 ? 60  LEU C HD13 1 
ATOM 8080  H HD21 . LEU D 2 39  ? 249.115 185.913 178.750 1.00 351.88 ? 60  LEU C HD21 1 
ATOM 8081  H HD22 . LEU D 2 39  ? 248.161 184.966 179.918 1.00 351.88 ? 60  LEU C HD22 1 
ATOM 8082  H HD23 . LEU D 2 39  ? 247.659 185.041 178.212 1.00 351.88 ? 60  LEU C HD23 1 
ATOM 8083  N N    . ARG D 2 40  ? 242.725 185.663 179.305 1.00 285.52 ? 61  ARG C N    1 
ATOM 8084  C CA   . ARG D 2 40  ? 241.487 185.080 179.808 1.00 285.52 ? 61  ARG C CA   1 
ATOM 8085  C C    . ARG D 2 40  ? 241.150 183.798 179.057 1.00 285.52 ? 61  ARG C C    1 
ATOM 8086  O O    . ARG D 2 40  ? 240.643 182.838 179.649 1.00 285.52 ? 61  ARG C O    1 
ATOM 8087  C CB   . ARG D 2 40  ? 240.334 186.064 179.675 1.00 285.52 ? 61  ARG C CB   1 
ATOM 8088  C CG   . ARG D 2 40  ? 240.385 187.243 180.633 1.00 285.52 ? 61  ARG C CG   1 
ATOM 8089  C CD   . ARG D 2 40  ? 239.271 188.196 180.392 1.00 285.52 ? 61  ARG C CD   1 
ATOM 8090  N NE   . ARG D 2 40  ? 237.973 187.583 180.625 1.00 285.52 ? 61  ARG C NE   1 
ATOM 8091  C CZ   . ARG D 2 40  ? 237.376 187.491 181.829 1.00 285.52 ? 61  ARG C CZ   1 
ATOM 8092  N NH1  . ARG D 2 40  ? 237.971 187.975 182.897 1.00 285.52 ? 61  ARG C NH1  1 
ATOM 8093  N NH2  . ARG D 2 40  ? 236.192 186.913 181.937 1.00 285.52 ? 61  ARG C NH2  1 
ATOM 8094  H H    . ARG D 2 40  ? 242.654 186.469 179.015 1.00 342.62 ? 61  ARG C H    1 
ATOM 8095  H HA   . ARG D 2 40  ? 241.601 184.856 180.746 1.00 342.62 ? 61  ARG C HA   1 
ATOM 8096  H HB2  . ARG D 2 40  ? 240.312 186.463 178.662 1.00 342.62 ? 61  ARG C HB2  1 
ATOM 8097  H HB3  . ARG D 2 40  ? 239.390 185.544 179.841 1.00 342.62 ? 61  ARG C HB3  1 
ATOM 8098  H HG2  . ARG D 2 40  ? 240.311 186.881 181.659 1.00 342.62 ? 61  ARG C HG2  1 
ATOM 8099  H HG3  . ARG D 2 40  ? 241.327 187.777 180.504 1.00 342.62 ? 61  ARG C HG3  1 
ATOM 8100  H HD2  . ARG D 2 40  ? 239.371 189.049 181.062 1.00 342.62 ? 61  ARG C HD2  1 
ATOM 8101  H HD3  . ARG D 2 40  ? 239.305 188.540 179.359 1.00 342.62 ? 61  ARG C HD3  1 
ATOM 8102  H HE   . ARG D 2 40  ? 237.485 187.199 179.827 1.00 342.62 ? 61  ARG C HE   1 
ATOM 8103  H HH11 . ARG D 2 40  ? 238.876 188.416 182.814 1.00 342.62 ? 61  ARG C HH11 1 
ATOM 8104  H HH12 . ARG D 2 40  ? 237.524 187.906 183.799 1.00 342.62 ? 61  ARG C HH12 1 
ATOM 8105  H HH21 . ARG D 2 40  ? 235.735 186.541 181.116 1.00 342.62 ? 61  ARG C HH21 1 
ATOM 8106  H HH22 . ARG D 2 40  ? 235.745 186.844 182.839 1.00 342.62 ? 61  ARG C HH22 1 
ATOM 8107  N N    . GLN D 2 41  ? 241.423 183.763 177.750 1.00 285.15 ? 62  GLN C N    1 
ATOM 8108  C CA   . GLN D 2 41  ? 241.283 182.510 177.014 1.00 285.15 ? 62  GLN C CA   1 
ATOM 8109  C C    . GLN D 2 41  ? 242.267 181.455 177.509 1.00 285.15 ? 62  GLN C C    1 
ATOM 8110  O O    . GLN D 2 41  ? 241.922 180.268 177.558 1.00 285.15 ? 62  GLN C O    1 
ATOM 8111  C CB   . GLN D 2 41  ? 241.486 182.747 175.515 1.00 285.15 ? 62  GLN C CB   1 
ATOM 8112  C CG   . GLN D 2 41  ? 240.395 183.579 174.863 1.00 285.15 ? 62  GLN C CG   1 
ATOM 8113  C CD   . GLN D 2 41  ? 240.675 183.857 173.399 1.00 285.15 ? 62  GLN C CD   1 
ATOM 8114  O OE1  . GLN D 2 41  ? 241.830 183.859 172.963 1.00 285.15 ? 62  GLN C OE1  1 
ATOM 8115  N NE2  . GLN D 2 41  ? 239.619 184.093 172.629 1.00 285.15 ? 62  GLN C NE2  1 
ATOM 8116  H H    . GLN D 2 41  ? 241.685 184.433 177.278 1.00 342.18 ? 62  GLN C H    1 
ATOM 8117  H HA   . GLN D 2 41  ? 240.387 182.165 177.154 1.00 342.18 ? 62  GLN C HA   1 
ATOM 8118  H HB2  . GLN D 2 41  ? 242.438 183.253 175.352 1.00 342.18 ? 62  GLN C HB2  1 
ATOM 8119  H HB3  . GLN D 2 41  ? 241.532 181.789 174.998 1.00 342.18 ? 62  GLN C HB3  1 
ATOM 8120  H HG2  . GLN D 2 41  ? 239.450 183.041 174.934 1.00 342.18 ? 62  GLN C HG2  1 
ATOM 8121  H HG3  . GLN D 2 41  ? 240.321 184.534 175.384 1.00 342.18 ? 62  GLN C HG3  1 
ATOM 8122  H HE21 . GLN D 2 41  ? 239.742 184.282 171.654 1.00 342.18 ? 62  GLN C HE21 1 
ATOM 8123  H HE22 . GLN D 2 41  ? 238.700 184.081 173.023 1.00 342.18 ? 62  GLN C HE22 1 
ATOM 8124  N N    . CYS D 2 42  ? 243.483 181.853 177.878 1.00 297.26 ? 63  CYS C N    1 
ATOM 8125  C CA   . CYS D 2 42  ? 244.432 180.911 178.472 1.00 297.26 ? 63  CYS C CA   1 
ATOM 8126  C C    . CYS D 2 42  ? 245.584 181.618 179.185 1.00 297.26 ? 63  CYS C C    1 
ATOM 8127  O O    . CYS D 2 42  ? 246.450 180.973 179.776 1.00 297.26 ? 63  CYS C O    1 
ATOM 8128  C CB   . CYS D 2 42  ? 244.975 179.939 177.410 1.00 297.26 ? 63  CYS C CB   1 
ATOM 8129  S SG   . CYS D 2 42  ? 246.023 180.540 176.019 1.00 297.26 ? 63  CYS C SG   1 
ATOM 8130  H H    . CYS D 2 42  ? 243.782 182.655 177.796 1.00 356.71 ? 63  CYS C H    1 
ATOM 8131  H HA   . CYS D 2 42  ? 243.963 180.383 179.137 1.00 356.71 ? 63  CYS C HA   1 
ATOM 8132  H HB2  . CYS D 2 42  ? 245.503 179.272 177.875 1.00 356.71 ? 63  CYS C HB2  1 
ATOM 8133  H HB3  . CYS D 2 42  ? 244.211 179.500 177.004 1.00 356.71 ? 63  CYS C HB3  1 
ATOM 8134  N N    . LEU D 2 52  ? 248.843 178.857 167.879 1.00 283.99 ? 73  LEU C N    1 
ATOM 8135  C CA   . LEU D 2 52  ? 247.867 178.362 168.842 1.00 283.99 ? 73  LEU C CA   1 
ATOM 8136  C C    . LEU D 2 52  ? 247.614 179.403 169.929 1.00 283.99 ? 73  LEU C C    1 
ATOM 8137  O O    . LEU D 2 52  ? 248.326 180.404 170.019 1.00 283.99 ? 73  LEU C O    1 
ATOM 8138  C CB   . LEU D 2 52  ? 248.359 177.054 169.474 1.00 283.99 ? 73  LEU C CB   1 
ATOM 8139  C CG   . LEU D 2 52  ? 248.641 175.906 168.496 1.00 283.99 ? 73  LEU C CG   1 
ATOM 8140  C CD1  . LEU D 2 52  ? 249.220 174.721 169.256 1.00 283.99 ? 73  LEU C CD1  1 
ATOM 8141  C CD2  . LEU D 2 52  ? 247.355 175.521 167.780 1.00 283.99 ? 73  LEU C CD2  1 
ATOM 8142  H H    . LEU D 2 52  ? 249.701 178.363 167.738 1.00 340.79 ? 73  LEU C H    1 
ATOM 8143  H HA   . LEU D 2 52  ? 247.027 178.201 168.388 1.00 340.79 ? 73  LEU C HA   1 
ATOM 8144  H HB2  . LEU D 2 52  ? 249.278 177.256 170.021 1.00 340.79 ? 73  LEU C HB2  1 
ATOM 8145  H HB3  . LEU D 2 52  ? 247.608 176.707 170.184 1.00 340.79 ? 73  LEU C HB3  1 
ATOM 8146  H HG   . LEU D 2 52  ? 249.382 176.227 167.763 1.00 340.79 ? 73  LEU C HG   1 
ATOM 8147  H HD11 . LEU D 2 52  ? 249.421 173.906 168.561 1.00 340.79 ? 73  LEU C HD11 1 
ATOM 8148  H HD12 . LEU D 2 52  ? 250.149 175.019 169.742 1.00 340.79 ? 73  LEU C HD12 1 
ATOM 8149  H HD13 . LEU D 2 52  ? 248.506 174.388 170.009 1.00 340.79 ? 73  LEU C HD13 1 
ATOM 8150  H HD21 . LEU D 2 52  ? 247.556 174.706 167.084 1.00 340.79 ? 73  LEU C HD21 1 
ATOM 8151  H HD22 . LEU D 2 52  ? 246.614 175.199 168.512 1.00 340.79 ? 73  LEU C HD22 1 
ATOM 8152  H HD23 . LEU D 2 52  ? 246.973 176.382 167.231 1.00 340.79 ? 73  LEU C HD23 1 
ATOM 8153  N N    . ALA D 2 53  ? 246.591 179.163 170.752 1.00 297.93 ? 74  ALA C N    1 
ATOM 8154  C CA   . ALA D 2 53  ? 246.267 180.097 171.825 1.00 297.93 ? 74  ALA C CA   1 
ATOM 8155  C C    . ALA D 2 53  ? 247.446 180.284 172.771 1.00 297.93 ? 74  ALA C C    1 
ATOM 8156  O O    . ALA D 2 53  ? 247.699 181.400 173.243 1.00 297.93 ? 74  ALA C O    1 
ATOM 8157  C CB   . ALA D 2 53  ? 245.039 179.606 172.590 1.00 297.93 ? 74  ALA C CB   1 
ATOM 8158  H H    . ALA D 2 53  ? 246.077 178.475 170.708 1.00 357.52 ? 74  ALA C H    1 
ATOM 8159  H HA   . ALA D 2 53  ? 246.054 180.959 171.437 1.00 357.52 ? 74  ALA C HA   1 
ATOM 8160  H HB1  . ALA D 2 53  ? 244.823 180.247 173.286 1.00 357.52 ? 74  ALA C HB1  1 
ATOM 8161  H HB2  . ALA D 2 53  ? 244.295 179.524 171.972 1.00 357.52 ? 74  ALA C HB2  1 
ATOM 8162  H HB3  . ALA D 2 53  ? 245.237 178.742 172.984 1.00 357.52 ? 74  ALA C HB3  1 
ATOM 8163  N N    . ASN D 2 54  ? 248.172 179.203 173.071 1.00 285.17 ? 75  ASN C N    1 
ATOM 8164  C CA   . ASN D 2 54  ? 249.298 179.294 173.997 1.00 285.17 ? 75  ASN C CA   1 
ATOM 8165  C C    . ASN D 2 54  ? 250.367 180.250 173.482 1.00 285.17 ? 75  ASN C C    1 
ATOM 8166  O O    . ASN D 2 54  ? 251.013 180.945 174.275 1.00 285.17 ? 75  ASN C O    1 
ATOM 8167  C CB   . ASN D 2 54  ? 249.892 177.921 174.251 1.00 285.17 ? 75  ASN C CB   1 
ATOM 8168  C CG   . ASN D 2 54  ? 249.014 177.064 175.120 1.00 285.17 ? 75  ASN C CG   1 
ATOM 8169  O OD1  . ASN D 2 54  ? 248.160 177.573 175.856 1.00 285.17 ? 75  ASN C OD1  1 
ATOM 8170  N ND2  . ASN D 2 54  ? 249.205 175.771 175.049 1.00 285.17 ? 75  ASN C ND2  1 
ATOM 8171  H H    . ASN D 2 54  ? 248.032 178.415 172.757 1.00 342.20 ? 75  ASN C H    1 
ATOM 8172  H HA   . ASN D 2 54  ? 248.983 179.632 174.848 1.00 342.20 ? 75  ASN C HA   1 
ATOM 8173  H HB2  . ASN D 2 54  ? 250.052 177.411 173.300 1.00 342.20 ? 75  ASN C HB2  1 
ATOM 8174  H HB3  . ASN D 2 54  ? 250.864 178.028 174.732 1.00 342.20 ? 75  ASN C HB3  1 
ATOM 8175  H HD21 . ASN D 2 54  ? 248.650 175.152 175.605 1.00 342.20 ? 75  ASN C HD21 1 
ATOM 8176  H HD22 . ASN D 2 54  ? 249.907 175.403 174.440 1.00 342.20 ? 75  ASN C HD22 1 
ATOM 8177  N N    . LYS D 2 55  ? 250.565 180.295 172.163 1.00 277.77 ? 76  LYS C N    1 
ATOM 8178  C CA   . LYS D 2 55  ? 251.515 181.234 171.571 1.00 277.77 ? 76  LYS C CA   1 
ATOM 8179  C C    . LYS D 2 55  ? 251.068 182.674 171.790 1.00 277.77 ? 76  LYS C C    1 
ATOM 8180  O O    . LYS D 2 55  ? 251.856 183.520 172.237 1.00 277.77 ? 76  LYS C O    1 
ATOM 8181  C CB   . LYS D 2 55  ? 251.684 180.956 170.077 1.00 277.77 ? 76  LYS C CB   1 
ATOM 8182  C CG   . LYS D 2 55  ? 252.667 181.883 169.373 1.00 277.77 ? 76  LYS C CG   1 
ATOM 8183  C CD   . LYS D 2 55  ? 252.816 181.516 167.904 1.00 277.77 ? 76  LYS C CD   1 
ATOM 8184  C CE   . LYS D 2 55  ? 253.752 182.477 167.185 1.00 277.77 ? 76  LYS C CE   1 
ATOM 8185  N NZ   . LYS D 2 55  ? 253.894 182.141 165.742 1.00 277.77 ? 76  LYS C NZ   1 
ATOM 8186  H H    . LYS D 2 55  ? 250.164 179.794 171.592 1.00 333.32 ? 76  LYS C H    1 
ATOM 8187  H HA   . LYS D 2 55  ? 252.381 181.118 171.991 1.00 333.32 ? 76  LYS C HA   1 
ATOM 8188  H HB2  . LYS D 2 55  ? 252.029 179.932 169.934 1.00 333.32 ? 76  LYS C HB2  1 
ATOM 8189  H HB3  . LYS D 2 55  ? 250.720 181.050 169.577 1.00 333.32 ? 76  LYS C HB3  1 
ATOM 8190  H HG2  . LYS D 2 55  ? 252.314 182.912 169.448 1.00 333.32 ? 76  LYS C HG2  1 
ATOM 8191  H HG3  . LYS D 2 55  ? 253.641 181.815 169.856 1.00 333.32 ? 76  LYS C HG3  1 
ATOM 8192  H HD2  . LYS D 2 55  ? 253.214 180.504 167.820 1.00 333.32 ? 76  LYS C HD2  1 
ATOM 8193  H HD3  . LYS D 2 55  ? 251.840 181.545 167.420 1.00 333.32 ? 76  LYS C HD3  1 
ATOM 8194  H HE2  . LYS D 2 55  ? 253.368 183.492 167.273 1.00 333.32 ? 76  LYS C HE2  1 
ATOM 8195  H HE3  . LYS D 2 55  ? 254.737 182.443 167.651 1.00 333.32 ? 76  LYS C HE3  1 
ATOM 8196  H HZ1  . LYS D 2 55  ? 254.521 182.800 165.303 1.00 333.32 ? 76  LYS C HZ1  1 
ATOM 8197  H HZ2  . LYS D 2 55  ? 254.268 181.207 165.649 1.00 333.32 ? 76  LYS C HZ2  1 
ATOM 8198  H HZ3  . LYS D 2 55  ? 252.990 182.188 165.295 1.00 333.32 ? 76  LYS C HZ3  1 
ATOM 8199  N N    . GLU D 2 56  ? 249.799 182.967 171.497 1.00 286.37 ? 77  GLU C N    1 
ATOM 8200  C CA   . GLU D 2 56  ? 249.290 184.319 171.689 1.00 286.37 ? 77  GLU C CA   1 
ATOM 8201  C C    . GLU D 2 56  ? 249.182 184.664 173.169 1.00 286.37 ? 77  GLU C C    1 
ATOM 8202  O O    . GLU D 2 56  ? 249.460 185.799 173.561 1.00 286.37 ? 77  GLU C O    1 
ATOM 8203  C CB   . GLU D 2 56  ? 247.923 184.474 171.019 1.00 286.37 ? 77  GLU C CB   1 
ATOM 8204  C CG   . GLU D 2 56  ? 247.946 184.334 169.503 1.00 286.37 ? 77  GLU C CG   1 
ATOM 8205  C CD   . GLU D 2 56  ? 248.902 185.288 168.843 1.00 286.37 ? 77  GLU C CD   1 
ATOM 8206  O OE1  . GLU D 2 56  ? 248.842 186.458 169.135 1.00 286.37 ? 77  GLU C OE1  1 
ATOM 8207  O OE2  . GLU D 2 56  ? 249.694 184.846 168.044 1.00 286.37 ? 77  GLU C OE2  1 
ATOM 8208  H H    . GLU D 2 56  ? 249.223 182.407 171.189 1.00 343.64 ? 77  GLU C H    1 
ATOM 8209  H HA   . GLU D 2 56  ? 249.913 184.946 171.290 1.00 343.64 ? 77  GLU C HA   1 
ATOM 8210  H HB2  . GLU D 2 56  ? 247.237 183.724 171.414 1.00 343.64 ? 77  GLU C HB2  1 
ATOM 8211  H HB3  . GLU D 2 56  ? 247.509 185.454 171.258 1.00 343.64 ? 77  GLU C HB3  1 
ATOM 8212  H HG2  . GLU D 2 56  ? 248.234 183.314 169.248 1.00 343.64 ? 77  GLU C HG2  1 
ATOM 8213  H HG3  . GLU D 2 56  ? 246.943 184.507 169.118 1.00 343.64 ? 77  GLU C HG3  1 
ATOM 8214  N N    . CYS D 2 57  ? 248.805 183.701 174.015 1.00 298.77 ? 78  CYS C N    1 
ATOM 8215  C CA   . CYS D 2 57  ? 248.763 183.966 175.452 1.00 298.77 ? 78  CYS C CA   1 
ATOM 8216  C C    . CYS D 2 57  ? 250.157 184.271 176.001 1.00 298.77 ? 78  CYS C C    1 
ATOM 8217  O O    . CYS D 2 57  ? 250.320 185.174 176.834 1.00 298.77 ? 78  CYS C O    1 
ATOM 8218  C CB   . CYS D 2 57  ? 248.128 182.785 176.187 1.00 298.77 ? 78  CYS C CB   1 
ATOM 8219  S SG   . CYS D 2 57  ? 246.341 182.576 175.885 1.00 298.77 ? 78  CYS C SG   1 
ATOM 8220  H H    . CYS D 2 57  ? 248.575 182.905 173.787 1.00 358.52 ? 78  CYS C H    1 
ATOM 8221  H HA   . CYS D 2 57  ? 248.211 184.746 175.612 1.00 358.52 ? 78  CYS C HA   1 
ATOM 8222  H HB2  . CYS D 2 57  ? 248.572 181.969 175.906 1.00 358.52 ? 78  CYS C HB2  1 
ATOM 8223  H HB3  . CYS D 2 57  ? 248.250 182.912 177.140 1.00 358.52 ? 78  CYS C HB3  1 
ATOM 8224  N N    . GLN D 2 58  ? 251.172 183.530 175.552 1.00 281.96 ? 79  GLN C N    1 
ATOM 8225  C CA   . GLN D 2 58  ? 252.546 183.857 175.929 1.00 281.96 ? 79  GLN C CA   1 
ATOM 8226  C C    . GLN D 2 58  ? 252.935 185.270 175.488 1.00 281.96 ? 79  GLN C C    1 
ATOM 8227  O O    . GLN D 2 58  ? 253.541 186.027 176.261 1.00 281.96 ? 79  GLN C O    1 
ATOM 8228  C CB   . GLN D 2 58  ? 253.518 182.838 175.328 1.00 281.96 ? 79  GLN C CB   1 
ATOM 8229  C CG   . GLN D 2 58  ? 254.970 183.062 175.712 1.00 281.96 ? 79  GLN C CG   1 
ATOM 8230  C CD   . GLN D 2 58  ? 255.221 182.831 177.190 1.00 281.96 ? 79  GLN C CD   1 
ATOM 8231  O OE1  . GLN D 2 58  ? 254.909 181.765 177.728 1.00 281.96 ? 79  GLN C OE1  1 
ATOM 8232  N NE2  . GLN D 2 58  ? 255.787 183.830 177.857 1.00 281.96 ? 79  GLN C NE2  1 
ATOM 8233  H H    . GLN D 2 58  ? 251.090 182.842 175.041 1.00 338.35 ? 79  GLN C H    1 
ATOM 8234  H HA   . GLN D 2 58  ? 252.624 183.818 177.015 1.00 338.35 ? 79  GLN C HA   1 
ATOM 8235  H HB2  . GLN D 2 58  ? 253.236 181.834 175.648 1.00 338.35 ? 79  GLN C HB2  1 
ATOM 8236  H HB3  . GLN D 2 58  ? 253.449 182.866 174.241 1.00 338.35 ? 79  GLN C HB3  1 
ATOM 8237  H HG2  . GLN D 2 58  ? 255.595 182.371 175.147 1.00 338.35 ? 79  GLN C HG2  1 
ATOM 8238  H HG3  . GLN D 2 58  ? 255.243 184.090 175.476 1.00 338.35 ? 79  GLN C HG3  1 
ATOM 8239  H HE21 . GLN D 2 58  ? 255.977 183.736 178.835 1.00 338.35 ? 79  GLN C HE21 1 
ATOM 8240  H HE22 . GLN D 2 58  ? 256.025 184.678 177.382 1.00 338.35 ? 79  GLN C HE22 1 
ATOM 8241  N N    . ALA D 2 59  ? 252.571 185.659 174.256 1.00 288.90 ? 80  ALA C N    1 
ATOM 8242  C CA   . ALA D 2 59  ? 252.801 187.034 173.826 1.00 288.90 ? 80  ALA C CA   1 
ATOM 8243  C C    . ALA D 2 59  ? 252.038 188.018 174.704 1.00 288.90 ? 80  ALA C C    1 
ATOM 8244  O O    . ALA D 2 59  ? 252.559 189.078 175.061 1.00 288.90 ? 80  ALA C O    1 
ATOM 8245  C CB   . ALA D 2 59  ? 252.398 187.199 172.362 1.00 288.90 ? 80  ALA C CB   1 
ATOM 8246  H H    . ALA D 2 59  ? 252.184 185.202 173.633 1.00 346.68 ? 80  ALA C H    1 
ATOM 8247  H HA   . ALA D 2 59  ? 253.747 187.233 173.901 1.00 346.68 ? 80  ALA C HA   1 
ATOM 8248  H HB1  . ALA D 2 59  ? 252.549 188.119 172.095 1.00 346.68 ? 80  ALA C HB1  1 
ATOM 8249  H HB2  . ALA D 2 59  ? 252.936 186.602 171.818 1.00 346.68 ? 80  ALA C HB2  1 
ATOM 8250  H HB3  . ALA D 2 59  ? 251.459 186.976 172.267 1.00 346.68 ? 80  ALA C HB3  1 
ATOM 8251  N N    . ALA D 2 60  ? 250.804 187.676 175.079 1.00 291.41 ? 81  ALA C N    1 
ATOM 8252  C CA   . ALA D 2 60  ? 250.010 188.560 175.919 1.00 291.41 ? 81  ALA C CA   1 
ATOM 8253  C C    . ALA D 2 60  ? 250.694 188.813 177.252 1.00 291.41 ? 81  ALA C C    1 
ATOM 8254  O O    . ALA D 2 60  ? 250.638 189.928 177.784 1.00 291.41 ? 81  ALA C O    1 
ATOM 8255  C CB   . ALA D 2 60  ? 248.620 187.961 176.131 1.00 291.41 ? 81  ALA C CB   1 
ATOM 8256  H H    . ALA D 2 60  ? 250.409 186.944 174.859 1.00 349.69 ? 81  ALA C H    1 
ATOM 8257  H HA   . ALA D 2 60  ? 249.925 189.420 175.489 1.00 349.69 ? 81  ALA C HA   1 
ATOM 8258  H HB1  . ALA D 2 60  ? 248.155 188.484 176.799 1.00 349.69 ? 81  ALA C HB1  1 
ATOM 8259  H HB2  . ALA D 2 60  ? 248.135 187.982 175.292 1.00 349.69 ? 81  ALA C HB2  1 
ATOM 8260  H HB3  . ALA D 2 60  ? 248.715 187.048 176.441 1.00 349.69 ? 81  ALA C HB3  1 
ATOM 8261  N N    . LEU D 2 61  ? 251.333 187.787 177.813 1.00 274.66 ? 82  LEU C N    1 
ATOM 8262  C CA   . LEU D 2 61  ? 252.064 187.987 179.061 1.00 274.66 ? 82  LEU C CA   1 
ATOM 8263  C C    . LEU D 2 61  ? 253.208 188.974 178.854 1.00 274.66 ? 82  LEU C C    1 
ATOM 8264  O O    . LEU D 2 61  ? 253.374 189.927 179.628 1.00 274.66 ? 82  LEU C O    1 
ATOM 8265  C CB   . LEU D 2 61  ? 252.614 186.653 179.581 1.00 274.66 ? 82  LEU C CB   1 
ATOM 8266  C CG   . LEU D 2 61  ? 253.421 186.728 180.883 1.00 274.66 ? 82  LEU C CG   1 
ATOM 8267  C CD1  . LEU D 2 61  ? 252.531 187.248 182.004 1.00 274.66 ? 82  LEU C CD1  1 
ATOM 8268  C CD2  . LEU D 2 61  ? 253.973 185.350 181.219 1.00 274.66 ? 82  LEU C CD2  1 
ATOM 8269  H H    . LEU D 2 61  ? 251.359 186.986 177.502 1.00 329.59 ? 82  LEU C H    1 
ATOM 8270  H HA   . LEU D 2 61  ? 251.457 188.364 179.716 1.00 329.59 ? 82  LEU C HA   1 
ATOM 8271  H HB2  . LEU D 2 61  ? 251.779 185.975 179.747 1.00 329.59 ? 82  LEU C HB2  1 
ATOM 8272  H HB3  . LEU D 2 61  ? 253.259 186.221 178.816 1.00 329.59 ? 82  LEU C HB3  1 
ATOM 8273  H HG   . LEU D 2 61  ? 254.246 187.429 180.760 1.00 329.59 ? 82  LEU C HG   1 
ATOM 8274  H HD11 . LEU D 2 61  ? 253.104 187.301 182.929 1.00 329.59 ? 82  LEU C HD11 1 
ATOM 8275  H HD12 . LEU D 2 61  ? 252.166 188.242 181.746 1.00 329.59 ? 82  LEU C HD12 1 
ATOM 8276  H HD13 . LEU D 2 61  ? 251.685 186.574 182.139 1.00 329.59 ? 82  LEU C HD13 1 
ATOM 8277  H HD21 . LEU D 2 61  ? 254.547 185.403 182.144 1.00 329.59 ? 82  LEU C HD21 1 
ATOM 8278  H HD22 . LEU D 2 61  ? 253.148 184.648 181.343 1.00 329.59 ? 82  LEU C HD22 1 
ATOM 8279  H HD23 . LEU D 2 61  ? 254.619 185.010 180.409 1.00 329.59 ? 82  LEU C HD23 1 
ATOM 8280  N N    . GLU D 2 62  ? 253.987 188.784 177.785 1.00 279.51 ? 83  GLU C N    1 
ATOM 8281  C CA   . GLU D 2 62  ? 255.117 189.676 177.535 1.00 279.51 ? 83  GLU C CA   1 
ATOM 8282  C C    . GLU D 2 62  ? 254.685 191.119 177.256 1.00 279.51 ? 83  GLU C C    1 
ATOM 8283  O O    . GLU D 2 62  ? 255.370 192.063 177.668 1.00 279.51 ? 83  GLU C O    1 
ATOM 8284  C CB   . GLU D 2 62  ? 256.044 189.120 176.444 1.00 279.51 ? 83  GLU C CB   1 
ATOM 8285  C CG   . GLU D 2 62  ? 256.819 187.887 176.881 1.00 279.51 ? 83  GLU C CG   1 
ATOM 8286  C CD   . GLU D 2 62  ? 257.715 187.340 175.787 1.00 279.51 ? 83  GLU C CD   1 
ATOM 8287  O OE1  . GLU D 2 62  ? 257.628 187.832 174.641 1.00 279.51 ? 83  GLU C OE1  1 
ATOM 8288  O OE2  . GLU D 2 62  ? 258.507 186.418 176.072 1.00 279.51 ? 83  GLU C OE2  1 
ATOM 8289  H H    . GLU D 2 62  ? 253.884 188.156 177.206 1.00 335.41 ? 83  GLU C H    1 
ATOM 8290  H HA   . GLU D 2 62  ? 254.598 189.641 176.735 1.00 335.41 ? 83  GLU C HA   1 
ATOM 8291  H HB2  . GLU D 2 62  ? 255.575 188.869 175.624 1.00 335.41 ? 83  GLU C HB2  1 
ATOM 8292  H HB3  . GLU D 2 62  ? 256.698 189.805 176.235 1.00 335.41 ? 83  GLU C HB3  1 
ATOM 8293  H HG2  . GLU D 2 62  ? 257.377 188.117 177.640 1.00 335.41 ? 83  GLU C HG2  1 
ATOM 8294  H HG3  . GLU D 2 62  ? 256.191 187.191 177.130 1.00 335.41 ? 83  GLU C HG3  1 
ATOM 8295  N N    . VAL D 2 63  ? 253.553 191.315 176.568 1.00 283.59 ? 84  VAL C N    1 
ATOM 8296  C CA   . VAL D 2 63  ? 253.072 192.670 176.299 1.00 283.59 ? 84  VAL C CA   1 
ATOM 8297  C C    . VAL D 2 63  ? 252.498 193.286 177.570 1.00 283.59 ? 84  VAL C C    1 
ATOM 8298  O O    . VAL D 2 63  ? 252.838 194.418 177.936 1.00 283.59 ? 84  VAL C O    1 
ATOM 8299  C CB   . VAL D 2 63  ? 251.993 192.655 175.201 1.00 283.59 ? 84  VAL C CB   1 
ATOM 8300  C CG1  . VAL D 2 63  ? 251.376 194.037 175.042 1.00 283.59 ? 84  VAL C CG1  1 
ATOM 8301  C CG2  . VAL D 2 63  ? 252.597 192.180 173.888 1.00 283.59 ? 84  VAL C CG2  1 
ATOM 8302  H H    . VAL D 2 63  ? 253.019 190.711 176.258 1.00 340.31 ? 84  VAL C H    1 
ATOM 8303  H HA   . VAL D 2 63  ? 253.818 193.222 176.016 1.00 340.31 ? 84  VAL C HA   1 
ATOM 8304  H HB   . VAL D 2 63  ? 251.193 191.978 175.499 1.00 340.31 ? 84  VAL C HB   1 
ATOM 8305  H HG11 . VAL D 2 63  ? 250.615 194.008 174.261 1.00 340.31 ? 84  VAL C HG11 1 
ATOM 8306  H HG12 . VAL D 2 63  ? 250.918 194.341 175.983 1.00 340.31 ? 84  VAL C HG12 1 
ATOM 8307  H HG13 . VAL D 2 63  ? 252.151 194.752 174.766 1.00 340.31 ? 84  VAL C HG13 1 
ATOM 8308  H HG21 . VAL D 2 63  ? 251.828 192.172 173.116 1.00 340.31 ? 84  VAL C HG21 1 
ATOM 8309  H HG22 . VAL D 2 63  ? 253.401 192.854 173.592 1.00 340.31 ? 84  VAL C HG22 1 
ATOM 8310  H HG23 . VAL D 2 63  ? 252.995 191.173 174.014 1.00 340.31 ? 84  VAL C HG23 1 
ATOM 8311  N N    . LEU D 2 64  ? 251.620 192.555 178.264 1.00 282.04 ? 85  LEU C N    1 
ATOM 8312  C CA   . LEU D 2 64  ? 251.036 193.074 179.496 1.00 282.04 ? 85  LEU C CA   1 
ATOM 8313  C C    . LEU D 2 64  ? 252.067 193.239 180.604 1.00 282.04 ? 85  LEU C C    1 
ATOM 8314  O O    . LEU D 2 64  ? 251.831 194.022 181.529 1.00 282.04 ? 85  LEU C O    1 
ATOM 8315  C CB   . LEU D 2 64  ? 249.918 192.140 179.977 1.00 282.04 ? 85  LEU C CB   1 
ATOM 8316  C CG   . LEU D 2 64  ? 248.669 192.085 179.088 1.00 282.04 ? 85  LEU C CG   1 
ATOM 8317  C CD1  . LEU D 2 64  ? 247.758 190.961 179.560 1.00 282.04 ? 85  LEU C CD1  1 
ATOM 8318  C CD2  . LEU D 2 64  ? 247.952 193.426 179.135 1.00 282.04 ? 85  LEU C CD2  1 
ATOM 8319  H H    . LEU D 2 64  ? 251.351 191.768 178.044 1.00 338.45 ? 85  LEU C H    1 
ATOM 8320  H HA   . LEU D 2 64  ? 250.659 193.949 179.319 1.00 338.45 ? 85  LEU C HA   1 
ATOM 8321  H HB2  . LEU D 2 64  ? 250.317 191.130 180.051 1.00 338.45 ? 85  LEU C HB2  1 
ATOM 8322  H HB3  . LEU D 2 64  ? 249.603 192.458 180.971 1.00 338.45 ? 85  LEU C HB3  1 
ATOM 8323  H HG   . LEU D 2 64  ? 248.963 191.867 178.061 1.00 338.45 ? 85  LEU C HG   1 
ATOM 8324  H HD11 . LEU D 2 64  ? 246.871 190.921 178.928 1.00 338.45 ? 85  LEU C HD11 1 
ATOM 8325  H HD12 . LEU D 2 64  ? 248.290 190.011 179.497 1.00 338.45 ? 85  LEU C HD12 1 
ATOM 8326  H HD13 . LEU D 2 64  ? 247.460 191.143 180.592 1.00 338.45 ? 85  LEU C HD13 1 
ATOM 8327  H HD21 . LEU D 2 64  ? 247.065 193.387 178.503 1.00 338.45 ? 85  LEU C HD21 1 
ATOM 8328  H HD22 . LEU D 2 64  ? 247.657 193.645 180.162 1.00 338.45 ? 85  LEU C HD22 1 
ATOM 8329  H HD23 . LEU D 2 64  ? 248.621 194.209 178.776 1.00 338.45 ? 85  LEU C HD23 1 
ATOM 8330  N N    . GLN D 2 65  ? 253.187 192.507 180.543 1.00 250.73 ? 86  GLN C N    1 
ATOM 8331  C CA   . GLN D 2 65  ? 254.261 192.675 181.519 1.00 250.73 ? 86  GLN C CA   1 
ATOM 8332  C C    . GLN D 2 65  ? 254.676 194.134 181.688 1.00 250.73 ? 86  GLN C C    1 
ATOM 8333  O O    . GLN D 2 65  ? 255.127 194.522 182.772 1.00 250.73 ? 86  GLN C O    1 
ATOM 8334  C CB   . GLN D 2 65  ? 255.477 191.838 181.114 1.00 250.73 ? 86  GLN C CB   1 
ATOM 8335  C CG   . GLN D 2 65  ? 256.624 191.885 182.109 1.00 250.73 ? 86  GLN C CG   1 
ATOM 8336  C CD   . GLN D 2 65  ? 257.764 190.962 181.721 1.00 250.73 ? 86  GLN C CD   1 
ATOM 8337  O OE1  . GLN D 2 65  ? 258.154 190.891 180.552 1.00 250.73 ? 86  GLN C OE1  1 
ATOM 8338  N NE2  . GLN D 2 65  ? 258.306 190.248 182.702 1.00 250.73 ? 86  GLN C NE2  1 
ATOM 8339  H H    . GLN D 2 65  ? 253.349 191.905 179.950 1.00 300.88 ? 86  GLN C H    1 
ATOM 8340  H HA   . GLN D 2 65  ? 253.955 192.349 182.380 1.00 300.88 ? 86  GLN C HA   1 
ATOM 8341  H HB2  . GLN D 2 65  ? 255.179 190.797 180.993 1.00 300.88 ? 86  GLN C HB2  1 
ATOM 8342  H HB3  . GLN D 2 65  ? 255.853 192.185 180.151 1.00 300.88 ? 86  GLN C HB3  1 
ATOM 8343  H HG2  . GLN D 2 65  ? 257.010 192.903 182.156 1.00 300.88 ? 86  GLN C HG2  1 
ATOM 8344  H HG3  . GLN D 2 65  ? 256.255 191.579 183.088 1.00 300.88 ? 86  GLN C HG3  1 
ATOM 8345  H HE21 . GLN D 2 65  ? 259.062 189.622 182.506 1.00 300.88 ? 86  GLN C HE21 1 
ATOM 8346  H HE22 . GLN D 2 65  ? 257.959 190.336 183.635 1.00 300.88 ? 86  GLN C HE22 1 
ATOM 8347  N N    . GLU D 2 66  ? 254.536 194.950 180.644 1.00 252.92 ? 87  GLU C N    1 
ATOM 8348  C CA   . GLU D 2 66  ? 254.904 196.358 180.694 1.00 252.92 ? 87  GLU C CA   1 
ATOM 8349  C C    . GLU D 2 66  ? 253.768 197.267 181.156 1.00 252.92 ? 87  GLU C C    1 
ATOM 8350  O O    . GLU D 2 66  ? 253.978 198.479 181.266 1.00 252.92 ? 87  GLU C O    1 
ATOM 8351  C CB   . GLU D 2 66  ? 255.390 196.813 179.316 1.00 252.92 ? 87  GLU C CB   1 
ATOM 8352  C CG   . GLU D 2 66  ? 256.636 196.094 178.820 1.00 252.92 ? 87  GLU C CG   1 
ATOM 8353  C CD   . GLU D 2 66  ? 257.831 196.314 179.705 1.00 252.92 ? 87  GLU C CD   1 
ATOM 8354  O OE1  . GLU D 2 66  ? 258.074 197.438 180.074 1.00 252.92 ? 87  GLU C OE1  1 
ATOM 8355  O OE2  . GLU D 2 66  ? 258.502 195.357 180.012 1.00 252.92 ? 87  GLU C OE2  1 
ATOM 8356  H H    . GLU D 2 66  ? 254.223 194.704 179.883 1.00 303.50 ? 87  GLU C H    1 
ATOM 8357  H HA   . GLU D 2 66  ? 255.642 196.471 181.316 1.00 303.50 ? 87  GLU C HA   1 
ATOM 8358  H HB2  . GLU D 2 66  ? 254.599 196.659 178.582 1.00 303.50 ? 87  GLU C HB2  1 
ATOM 8359  H HB3  . GLU D 2 66  ? 255.608 197.881 179.342 1.00 303.50 ? 87  GLU C HB3  1 
ATOM 8360  H HG2  . GLU D 2 66  ? 256.429 195.025 178.768 1.00 303.50 ? 87  GLU C HG2  1 
ATOM 8361  H HG3  . GLU D 2 66  ? 256.866 196.441 177.813 1.00 303.50 ? 87  GLU C HG3  1 
ATOM 8362  N N    . SER D 2 67  ? 252.576 196.722 181.430 1.00 278.39 ? 88  SER C N    1 
ATOM 8363  C CA   . SER D 2 67  ? 251.459 197.560 181.837 1.00 278.39 ? 88  SER C CA   1 
ATOM 8364  C C    . SER D 2 67  ? 251.590 197.961 183.309 1.00 278.39 ? 88  SER C C    1 
ATOM 8365  O O    . SER D 2 67  ? 252.226 197.253 184.094 1.00 278.39 ? 88  SER C O    1 
ATOM 8366  C CB   . SER D 2 67  ? 250.150 196.829 181.609 1.00 278.39 ? 88  SER C CB   1 
ATOM 8367  O OG   . SER D 2 67  ? 250.020 195.746 182.489 1.00 278.39 ? 88  SER C OG   1 
ATOM 8368  H H    . SER D 2 67  ? 252.392 195.883 181.390 1.00 334.07 ? 88  SER C H    1 
ATOM 8369  H HA   . SER D 2 67  ? 251.465 198.339 181.264 1.00 334.07 ? 88  SER C HA   1 
ATOM 8370  H HB2  . SER D 2 67  ? 249.319 197.519 181.752 1.00 334.07 ? 88  SER C HB2  1 
ATOM 8371  H HB3  . SER D 2 67  ? 250.107 196.472 180.581 1.00 334.07 ? 88  SER C HB3  1 
ATOM 8372  H HG   . SER D 2 67  ? 250.540 195.033 182.111 1.00 334.07 ? 88  SER C HG   1 
ATOM 8373  N N    . PRO D 2 68  ? 251.000 199.094 183.716 1.00 289.26 ? 89  PRO C N    1 
ATOM 8374  C CA   . PRO D 2 68  ? 251.052 199.457 185.143 1.00 289.26 ? 89  PRO C CA   1 
ATOM 8375  C C    . PRO D 2 68  ? 250.506 198.385 186.070 1.00 289.26 ? 89  PRO C C    1 
ATOM 8376  O O    . PRO D 2 68  ? 250.958 198.293 187.218 1.00 289.26 ? 89  PRO C O    1 
ATOM 8377  C CB   . PRO D 2 68  ? 250.187 200.720 185.197 1.00 289.26 ? 89  PRO C CB   1 
ATOM 8378  C CG   . PRO D 2 68  ? 250.286 201.291 183.824 1.00 289.26 ? 89  PRO C CG   1 
ATOM 8379  C CD   . PRO D 2 68  ? 250.282 200.089 182.918 1.00 289.26 ? 89  PRO C CD   1 
ATOM 8380  H HA   . PRO D 2 68  ? 251.964 199.665 185.401 1.00 347.11 ? 89  PRO C HA   1 
ATOM 8381  H HB2  . PRO D 2 68  ? 249.156 200.458 185.477 1.00 347.11 ? 89  PRO C HB2  1 
ATOM 8382  H HB3  . PRO D 2 68  ? 250.566 201.403 185.972 1.00 347.11 ? 89  PRO C HB3  1 
ATOM 8383  H HG2  . PRO D 2 68  ? 249.441 201.969 183.633 1.00 347.11 ? 89  PRO C HG2  1 
ATOM 8384  H HG3  . PRO D 2 68  ? 251.203 201.891 183.728 1.00 347.11 ? 89  PRO C HG3  1 
ATOM 8385  H HD2  . PRO D 2 68  ? 249.245 199.787 182.712 1.00 347.11 ? 89  PRO C HD2  1 
ATOM 8386  H HD3  . PRO D 2 68  ? 250.808 200.333 181.983 1.00 347.11 ? 89  PRO C HD3  1 
ATOM 8387  N N    . LEU D 2 69  ? 249.539 197.581 185.616 1.00 293.67 ? 90  LEU C N    1 
ATOM 8388  C CA   . LEU D 2 69  ? 249.021 196.497 186.448 1.00 293.67 ? 90  LEU C CA   1 
ATOM 8389  C C    . LEU D 2 69  ? 250.133 195.547 186.871 1.00 293.67 ? 90  LEU C C    1 
ATOM 8390  O O    . LEU D 2 69  ? 250.098 194.994 187.977 1.00 293.67 ? 90  LEU C O    1 
ATOM 8391  C CB   . LEU D 2 69  ? 247.922 195.743 185.696 1.00 293.67 ? 90  LEU C CB   1 
ATOM 8392  C CG   . LEU D 2 69  ? 247.213 194.604 186.438 1.00 293.67 ? 90  LEU C CG   1 
ATOM 8393  C CD1  . LEU D 2 69  ? 246.527 195.109 187.697 1.00 293.67 ? 90  LEU C CD1  1 
ATOM 8394  C CD2  . LEU D 2 69  ? 246.202 193.935 185.521 1.00 293.67 ? 90  LEU C CD2  1 
ATOM 8395  H H    . LEU D 2 69  ? 249.174 197.641 184.840 1.00 352.40 ? 90  LEU C H    1 
ATOM 8396  H HA   . LEU D 2 69  ? 248.636 196.873 187.251 1.00 352.40 ? 90  LEU C HA   1 
ATOM 8397  H HB2  . LEU D 2 69  ? 247.240 196.384 185.441 1.00 352.40 ? 90  LEU C HB2  1 
ATOM 8398  H HB3  . LEU D 2 69  ? 248.313 195.360 184.896 1.00 352.40 ? 90  LEU C HB3  1 
ATOM 8399  H HG   . LEU D 2 69  ? 247.862 193.933 186.700 1.00 352.40 ? 90  LEU C HG   1 
ATOM 8400  H HD11 . LEU D 2 69  ? 246.002 194.391 188.082 1.00 352.40 ? 90  LEU C HD11 1 
ATOM 8401  H HD12 . LEU D 2 69  ? 247.198 195.403 188.331 1.00 352.40 ? 90  LEU C HD12 1 
ATOM 8402  H HD13 . LEU D 2 69  ? 245.953 195.850 187.458 1.00 352.40 ? 90  LEU C HD13 1 
ATOM 8403  H HD21 . LEU D 2 69  ? 245.781 193.202 185.997 1.00 352.40 ? 90  LEU C HD21 1 
ATOM 8404  H HD22 . LEU D 2 69  ? 245.533 194.588 185.260 1.00 352.40 ? 90  LEU C HD22 1 
ATOM 8405  H HD23 . LEU D 2 69  ? 246.661 193.601 184.735 1.00 352.40 ? 90  LEU C HD23 1 
ATOM 8406  N N    . TYR D 2 70  ? 251.121 195.344 186.007 1.00 256.53 ? 91  TYR C N    1 
ATOM 8407  C CA   . TYR D 2 70  ? 252.183 194.389 186.287 1.00 256.53 ? 91  TYR C CA   1 
ATOM 8408  C C    . TYR D 2 70  ? 252.952 194.813 187.532 1.00 256.53 ? 91  TYR C C    1 
ATOM 8409  O O    . TYR D 2 70  ? 253.358 195.972 187.662 1.00 256.53 ? 91  TYR C O    1 
ATOM 8410  C CB   . TYR D 2 70  ? 253.126 194.260 185.089 1.00 256.53 ? 91  TYR C CB   1 
ATOM 8411  C CG   . TYR D 2 70  ? 254.220 193.233 185.281 1.00 256.53 ? 91  TYR C CG   1 
ATOM 8412  C CD1  . TYR D 2 70  ? 253.926 191.880 185.186 1.00 256.53 ? 91  TYR C CD1  1 
ATOM 8413  C CD2  . TYR D 2 70  ? 255.516 193.644 185.552 1.00 256.53 ? 91  TYR C CD2  1 
ATOM 8414  C CE1  . TYR D 2 70  ? 254.926 190.943 185.361 1.00 256.53 ? 91  TYR C CE1  1 
ATOM 8415  C CE2  . TYR D 2 70  ? 256.516 192.706 185.728 1.00 256.53 ? 91  TYR C CE2  1 
ATOM 8416  C CZ   . TYR D 2 70  ? 256.224 191.361 185.633 1.00 256.53 ? 91  TYR C CZ   1 
ATOM 8417  O OH   . TYR D 2 70  ? 257.219 190.427 185.808 1.00 256.53 ? 91  TYR C OH   1 
ATOM 8418  H H    . TYR D 2 70  ? 251.199 195.744 185.250 1.00 307.84 ? 91  TYR C H    1 
ATOM 8419  H HA   . TYR D 2 70  ? 251.797 193.514 186.448 1.00 307.84 ? 91  TYR C HA   1 
ATOM 8420  H HB2  . TYR D 2 70  ? 252.553 193.984 184.202 1.00 307.84 ? 91  TYR C HB2  1 
ATOM 8421  H HB3  . TYR D 2 70  ? 253.595 195.223 184.889 1.00 307.84 ? 91  TYR C HB3  1 
ATOM 8422  H HD1  . TYR D 2 70  ? 252.907 191.557 184.973 1.00 307.84 ? 91  TYR C HD1  1 
ATOM 8423  H HD2  . TYR D 2 70  ? 255.747 194.706 185.628 1.00 307.84 ? 91  TYR C HD2  1 
ATOM 8424  H HE1  . TYR D 2 70  ? 254.695 189.880 185.287 1.00 307.84 ? 91  TYR C HE1  1 
ATOM 8425  H HE2  . TYR D 2 70  ? 257.535 193.029 185.942 1.00 307.84 ? 91  TYR C HE2  1 
ATOM 8426  H HH   . TYR D 2 70  ? 258.049 190.875 185.989 1.00 307.84 ? 91  TYR C HH   1 
ATOM 8427  N N    . ASP D 2 71  ? 253.136 193.868 188.455 1.00 262.97 ? 92  ASP C N    1 
ATOM 8428  C CA   . ASP D 2 71  ? 253.816 194.115 189.729 1.00 262.97 ? 92  ASP C CA   1 
ATOM 8429  C C    . ASP D 2 71  ? 253.109 195.196 190.547 1.00 262.97 ? 92  ASP C C    1 
ATOM 8430  O O    . ASP D 2 71  ? 253.748 195.957 191.277 1.00 262.97 ? 92  ASP C O    1 
ATOM 8431  C CB   . ASP D 2 71  ? 255.270 194.524 189.488 1.00 262.97 ? 92  ASP C CB   1 
ATOM 8432  C CG   . ASP D 2 71  ? 256.115 193.398 188.909 1.00 262.97 ? 92  ASP C CG   1 
ATOM 8433  O OD1  . ASP D 2 71  ? 255.703 192.266 188.999 1.00 262.97 ? 92  ASP C OD1  1 
ATOM 8434  O OD2  . ASP D 2 71  ? 257.165 193.680 188.382 1.00 262.97 ? 92  ASP C OD2  1 
ATOM 8435  H H    . ASP D 2 71  ? 252.871 193.055 188.363 1.00 315.56 ? 92  ASP C H    1 
ATOM 8436  H HA   . ASP D 2 71  ? 253.786 193.300 190.254 1.00 315.56 ? 92  ASP C HA   1 
ATOM 8437  H HB2  . ASP D 2 71  ? 255.301 195.371 188.802 1.00 315.56 ? 92  ASP C HB2  1 
ATOM 8438  H HB3  . ASP D 2 71  ? 255.718 194.848 190.428 1.00 315.56 ? 92  ASP C HB3  1 
ATOM 8439  N N    . CYS D 2 72  ? 251.784 195.274 190.435 1.00 288.19 ? 93  CYS C N    1 
ATOM 8440  C CA   . CYS D 2 72  ? 251.005 196.126 191.319 1.00 288.19 ? 93  CYS C CA   1 
ATOM 8441  C C    . CYS D 2 72  ? 250.824 195.442 192.674 1.00 288.19 ? 93  CYS C C    1 
ATOM 8442  O O    . CYS D 2 72  ? 251.152 194.266 192.855 1.00 288.19 ? 93  CYS C O    1 
ATOM 8443  C CB   . CYS D 2 72  ? 249.637 196.436 190.710 1.00 288.19 ? 93  CYS C CB   1 
ATOM 8444  S SG   . CYS D 2 72  ? 248.480 195.046 190.747 1.00 288.19 ? 93  CYS C SG   1 
ATOM 8445  H H    . CYS D 2 72  ? 251.315 194.845 189.856 1.00 345.83 ? 93  CYS C H    1 
ATOM 8446  H HA   . CYS D 2 72  ? 251.476 196.963 191.461 1.00 345.83 ? 93  CYS C HA   1 
ATOM 8447  H HB2  . CYS D 2 72  ? 249.181 197.269 191.245 1.00 345.83 ? 93  CYS C HB2  1 
ATOM 8448  H HB3  . CYS D 2 72  ? 249.762 196.742 189.672 1.00 345.83 ? 93  CYS C HB3  1 
ATOM 8449  N N    . ARG D 2 73  ? 250.297 196.198 193.638 1.00 271.98 ? 94  ARG C N    1 
ATOM 8450  C CA   . ARG D 2 73  ? 250.013 195.670 194.964 1.00 271.98 ? 94  ARG C CA   1 
ATOM 8451  C C    . ARG D 2 73  ? 248.681 196.210 195.462 1.00 271.98 ? 94  ARG C C    1 
ATOM 8452  O O    . ARG D 2 73  ? 248.256 197.306 195.087 1.00 271.98 ? 94  ARG C O    1 
ATOM 8453  C CB   . ARG D 2 73  ? 251.116 196.042 195.945 1.00 271.98 ? 94  ARG C CB   1 
ATOM 8454  C CG   . ARG D 2 73  ? 252.473 195.425 195.646 1.00 271.98 ? 94  ARG C CG   1 
ATOM 8455  C CD   . ARG D 2 73  ? 252.480 193.962 195.905 1.00 271.98 ? 94  ARG C CD   1 
ATOM 8456  N NE   . ARG D 2 73  ? 253.799 193.383 195.706 1.00 271.98 ? 94  ARG C NE   1 
ATOM 8457  C CZ   . ARG D 2 73  ? 254.268 192.939 194.523 1.00 271.98 ? 94  ARG C CZ   1 
ATOM 8458  N NH1  . ARG D 2 73  ? 253.516 193.014 193.447 1.00 271.98 ? 94  ARG C NH1  1 
ATOM 8459  N NH2  . ARG D 2 73  ? 255.484 192.427 194.445 1.00 271.98 ? 94  ARG C NH2  1 
ATOM 8460  H H    . ARG D 2 73  ? 250.093 197.029 193.542 1.00 326.38 ? 94  ARG C H    1 
ATOM 8461  H HA   . ARG D 2 73  ? 249.937 194.707 194.921 1.00 326.38 ? 94  ARG C HA   1 
ATOM 8462  H HB2  . ARG D 2 73  ? 251.241 197.124 195.958 1.00 326.38 ? 94  ARG C HB2  1 
ATOM 8463  H HB3  . ARG D 2 73  ? 250.828 195.734 196.950 1.00 326.38 ? 94  ARG C HB3  1 
ATOM 8464  H HG2  . ARG D 2 73  ? 252.724 195.588 194.598 1.00 326.38 ? 94  ARG C HG2  1 
ATOM 8465  H HG3  . ARG D 2 73  ? 253.231 195.889 196.278 1.00 326.38 ? 94  ARG C HG3  1 
ATOM 8466  H HD2  . ARG D 2 73  ? 252.178 193.774 196.935 1.00 326.38 ? 94  ARG C HD2  1 
ATOM 8467  H HD3  . ARG D 2 73  ? 251.785 193.469 195.227 1.00 326.38 ? 94  ARG C HD3  1 
ATOM 8468  H HE   . ARG D 2 73  ? 254.406 193.308 196.511 1.00 326.38 ? 94  ARG C HE   1 
ATOM 8469  H HH11 . ARG D 2 73  ? 252.587 193.406 193.507 1.00 326.38 ? 94  ARG C HH11 1 
ATOM 8470  H HH12 . ARG D 2 73  ? 253.868 192.682 192.561 1.00 326.38 ? 94  ARG C HH12 1 
ATOM 8471  H HH21 . ARG D 2 73  ? 256.062 192.369 195.272 1.00 326.38 ? 94  ARG C HH21 1 
ATOM 8472  H HH22 . ARG D 2 73  ? 255.836 192.094 193.560 1.00 326.38 ? 94  ARG C HH22 1 
ATOM 8473  N N    . CYS D 2 74  ? 248.030 195.421 196.315 1.00 251.63 ? 95  CYS C N    1 
ATOM 8474  C CA   . CYS D 2 74  ? 246.838 195.821 197.044 1.00 251.63 ? 95  CYS C CA   1 
ATOM 8475  C C    . CYS D 2 74  ? 247.220 195.992 198.518 1.00 251.63 ? 95  CYS C C    1 
ATOM 8476  O O    . CYS D 2 74  ? 248.385 195.825 198.896 1.00 251.63 ? 95  CYS C O    1 
ATOM 8477  C CB   . CYS D 2 74  ? 245.729 194.785 196.826 1.00 251.63 ? 95  CYS C CB   1 
ATOM 8478  S SG   . CYS D 2 74  ? 244.097 195.207 197.493 1.00 251.63 ? 95  CYS C SG   1 
ATOM 8479  H H    . CYS D 2 74  ? 248.273 194.615 196.490 1.00 301.96 ? 95  CYS C H    1 
ATOM 8480  H HA   . CYS D 2 74  ? 246.518 196.675 196.715 1.00 301.96 ? 95  CYS C HA   1 
ATOM 8481  H HB2  . CYS D 2 74  ? 245.621 194.656 195.871 1.00 301.96 ? 95  CYS C HB2  1 
ATOM 8482  H HB3  . CYS D 2 74  ? 246.004 193.949 197.234 1.00 301.96 ? 95  CYS C HB3  1 
ATOM 8483  N N    . LYS D 2 75  ? 246.238 196.335 199.353 1.00 239.35 ? 96  LYS C N    1 
ATOM 8484  C CA   . LYS D 2 75  ? 246.483 196.637 200.761 1.00 239.35 ? 96  LYS C CA   1 
ATOM 8485  C C    . LYS D 2 75  ? 245.335 196.104 201.603 1.00 239.35 ? 96  LYS C C    1 
ATOM 8486  O O    . LYS D 2 75  ? 244.209 195.964 201.117 1.00 239.35 ? 96  LYS C O    1 
ATOM 8487  C CB   . LYS D 2 75  ? 246.652 198.141 200.979 1.00 239.35 ? 96  LYS C CB   1 
ATOM 8488  C CG   . LYS D 2 75  ? 247.831 198.756 200.236 1.00 239.35 ? 96  LYS C CG   1 
ATOM 8489  C CD   . LYS D 2 75  ? 247.972 200.237 200.554 1.00 239.35 ? 96  LYS C CD   1 
ATOM 8490  C CE   . LYS D 2 75  ? 249.160 200.849 199.826 1.00 239.35 ? 96  LYS C CE   1 
ATOM 8491  N NZ   . LYS D 2 75  ? 249.316 202.297 200.133 1.00 239.35 ? 96  LYS C NZ   1 
ATOM 8492  H H    . LYS D 2 75  ? 245.412 196.401 199.123 1.00 287.22 ? 96  LYS C H    1 
ATOM 8493  H HA   . LYS D 2 75  ? 247.293 196.204 201.070 1.00 287.22 ? 96  LYS C HA   1 
ATOM 8494  H HB2  . LYS D 2 75  ? 245.748 198.659 200.659 1.00 287.22 ? 96  LYS C HB2  1 
ATOM 8495  H HB3  . LYS D 2 75  ? 246.785 198.342 202.042 1.00 287.22 ? 96  LYS C HB3  1 
ATOM 8496  H HG2  . LYS D 2 75  ? 248.749 198.242 200.522 1.00 287.22 ? 96  LYS C HG2  1 
ATOM 8497  H HG3  . LYS D 2 75  ? 247.687 198.635 199.163 1.00 287.22 ? 96  LYS C HG3  1 
ATOM 8498  H HD2  . LYS D 2 75  ? 247.064 200.762 200.255 1.00 287.22 ? 96  LYS C HD2  1 
ATOM 8499  H HD3  . LYS D 2 75  ? 248.110 200.367 201.627 1.00 287.22 ? 96  LYS C HD3  1 
ATOM 8500  H HE2  . LYS D 2 75  ? 250.072 200.329 200.117 1.00 287.22 ? 96  LYS C HE2  1 
ATOM 8501  H HE3  . LYS D 2 75  ? 249.029 200.731 198.751 1.00 287.22 ? 96  LYS C HE3  1 
ATOM 8502  H HZ1  . LYS D 2 75  ? 250.112 202.664 199.632 1.00 287.22 ? 96  LYS C HZ1  1 
ATOM 8503  H HZ2  . LYS D 2 75  ? 248.482 202.793 199.850 1.00 287.22 ? 96  LYS C HZ2  1 
ATOM 8504  H HZ3  . LYS D 2 75  ? 249.458 202.417 201.126 1.00 287.22 ? 96  LYS C HZ3  1 
ATOM 8505  N N    . ARG D 2 76  ? 245.633 195.809 202.866 1.00 224.00 ? 97  ARG C N    1 
ATOM 8506  C CA   . ARG D 2 76  ? 244.588 195.511 203.834 1.00 224.00 ? 97  ARG C CA   1 
ATOM 8507  C C    . ARG D 2 76  ? 243.622 196.684 203.941 1.00 224.00 ? 97  ARG C C    1 
ATOM 8508  O O    . ARG D 2 76  ? 244.037 197.834 204.109 1.00 224.00 ? 97  ARG C O    1 
ATOM 8509  C CB   . ARG D 2 76  ? 245.186 195.214 205.202 1.00 224.00 ? 97  ARG C CB   1 
ATOM 8510  C CG   . ARG D 2 76  ? 245.896 193.875 205.312 1.00 224.00 ? 97  ARG C CG   1 
ATOM 8511  C CD   . ARG D 2 76  ? 244.949 192.775 205.628 1.00 224.00 ? 97  ARG C CD   1 
ATOM 8512  N NE   . ARG D 2 76  ? 244.399 192.901 206.968 1.00 224.00 ? 97  ARG C NE   1 
ATOM 8513  C CZ   . ARG D 2 76  ? 245.006 192.464 208.089 1.00 224.00 ? 97  ARG C CZ   1 
ATOM 8514  N NH1  . ARG D 2 76  ? 246.179 191.877 208.014 1.00 224.00 ? 97  ARG C NH1  1 
ATOM 8515  N NH2  . ARG D 2 76  ? 244.422 192.626 209.263 1.00 224.00 ? 97  ARG C NH2  1 
ATOM 8516  H H    . ARG D 2 76  ? 246.431 195.775 203.186 1.00 268.80 ? 97  ARG C H    1 
ATOM 8517  H HA   . ARG D 2 76  ? 244.089 194.742 203.540 1.00 268.80 ? 97  ARG C HA   1 
ATOM 8518  H HB2  . ARG D 2 76  ? 245.905 195.991 205.461 1.00 268.80 ? 97  ARG C HB2  1 
ATOM 8519  H HB3  . ARG D 2 76  ? 244.398 195.233 205.955 1.00 268.80 ? 97  ARG C HB3  1 
ATOM 8520  H HG2  . ARG D 2 76  ? 246.387 193.644 204.367 1.00 268.80 ? 97  ARG C HG2  1 
ATOM 8521  H HG3  . ARG D 2 76  ? 246.643 193.923 206.106 1.00 268.80 ? 97  ARG C HG3  1 
ATOM 8522  H HD2  . ARG D 2 76  ? 244.123 192.792 204.917 1.00 268.80 ? 97  ARG C HD2  1 
ATOM 8523  H HD3  . ARG D 2 76  ? 245.466 191.819 205.561 1.00 268.80 ? 97  ARG C HD3  1 
ATOM 8524  H HE   . ARG D 2 76  ? 243.497 193.348 207.066 1.00 268.80 ? 97  ARG C HE   1 
ATOM 8525  H HH11 . ARG D 2 76  ? 246.626 191.753 207.116 1.00 268.80 ? 97  ARG C HH11 1 
ATOM 8526  H HH12 . ARG D 2 76  ? 246.635 191.549 208.854 1.00 268.80 ? 97  ARG C HH12 1 
ATOM 8527  H HH21 . ARG D 2 76  ? 243.519 193.078 209.320 1.00 268.80 ? 97  ARG C HH21 1 
ATOM 8528  H HH22 . ARG D 2 76  ? 244.876 192.299 210.102 1.00 268.80 ? 97  ARG C HH22 1 
ATOM 8529  N N    . GLY D 2 77  ? 242.329 196.386 203.842 1.00 218.77 ? 98  GLY C N    1 
ATOM 8530  C CA   . GLY D 2 77  ? 241.305 197.401 203.956 1.00 218.77 ? 98  GLY C CA   1 
ATOM 8531  C C    . GLY D 2 77  ? 241.120 198.267 202.731 1.00 218.77 ? 98  GLY C C    1 
ATOM 8532  O O    . GLY D 2 77  ? 240.438 199.295 202.821 1.00 218.77 ? 98  GLY C O    1 
ATOM 8533  H H    . GLY D 2 77  ? 242.022 195.592 203.708 1.00 262.52 ? 98  GLY C H    1 
ATOM 8534  H HA2  . GLY D 2 77  ? 240.457 196.971 204.148 1.00 262.52 ? 98  GLY C HA2  1 
ATOM 8535  H HA3  . GLY D 2 77  ? 241.522 197.982 204.703 1.00 262.52 ? 98  GLY C HA3  1 
ATOM 8536  N N    . MET D 2 78  ? 241.698 197.892 201.593 1.00 252.61 ? 99  MET C N    1 
ATOM 8537  C CA   . MET D 2 78  ? 241.528 198.676 200.379 1.00 252.61 ? 99  MET C CA   1 
ATOM 8538  C C    . MET D 2 78  ? 240.100 198.550 199.862 1.00 252.61 ? 99  MET C C    1 
ATOM 8539  O O    . MET D 2 78  ? 239.490 197.476 199.899 1.00 252.61 ? 99  MET C O    1 
ATOM 8540  C CB   . MET D 2 78  ? 242.529 198.232 199.314 1.00 252.61 ? 99  MET C CB   1 
ATOM 8541  C CG   . MET D 2 78  ? 242.466 199.030 198.019 1.00 252.61 ? 99  MET C CG   1 
ATOM 8542  S SD   . MET D 2 78  ? 243.733 198.534 196.835 1.00 252.61 ? 99  MET C SD   1 
ATOM 8543  C CE   . MET D 2 78  ? 245.186 199.289 197.559 1.00 252.61 ? 99  MET C CE   1 
ATOM 8544  H H    . MET D 2 78  ? 242.189 197.193 201.497 1.00 303.13 ? 99  MET C H    1 
ATOM 8545  H HA   . MET D 2 78  ? 241.711 199.607 200.577 1.00 303.13 ? 99  MET C HA   1 
ATOM 8546  H HB2  . MET D 2 78  ? 243.541 198.316 199.708 1.00 303.13 ? 99  MET C HB2  1 
ATOM 8547  H HB3  . MET D 2 78  ? 242.359 197.183 199.069 1.00 303.13 ? 99  MET C HB3  1 
ATOM 8548  H HG2  . MET D 2 78  ? 241.489 198.894 197.556 1.00 303.13 ? 99  MET C HG2  1 
ATOM 8549  H HG3  . MET D 2 78  ? 242.594 200.090 198.237 1.00 303.13 ? 99  MET C HG3  1 
ATOM 8550  H HE1  . MET D 2 78  ? 246.056 199.072 196.939 1.00 303.13 ? 99  MET C HE1  1 
ATOM 8551  H HE2  . MET D 2 78  ? 245.043 200.369 197.620 1.00 303.13 ? 99  MET C HE2  1 
ATOM 8552  H HE3  . MET D 2 78  ? 245.344 198.887 198.560 1.00 303.13 ? 99  MET C HE3  1 
ATOM 8553  N N    . LYS D 2 79  ? 239.561 199.677 199.401 1.00 252.79 ? 100 LYS C N    1 
ATOM 8554  C CA   . LYS D 2 79  ? 238.300 199.678 198.673 1.00 252.79 ? 100 LYS C CA   1 
ATOM 8555  C C    . LYS D 2 79  ? 238.402 198.762 197.459 1.00 252.79 ? 100 LYS C C    1 
ATOM 8556  O O    . LYS D 2 79  ? 239.361 198.837 196.688 1.00 252.79 ? 100 LYS C O    1 
ATOM 8557  C CB   . LYS D 2 79  ? 237.921 201.096 198.242 1.00 252.79 ? 100 LYS C CB   1 
ATOM 8558  C CG   . LYS D 2 79  ? 236.568 201.203 197.550 1.00 252.79 ? 100 LYS C CG   1 
ATOM 8559  C CD   . LYS D 2 79  ? 236.227 202.649 197.225 1.00 252.79 ? 100 LYS C CD   1 
ATOM 8560  C CE   . LYS D 2 79  ? 234.876 202.758 196.534 1.00 252.79 ? 100 LYS C CE   1 
ATOM 8561  N NZ   . LYS D 2 79  ? 234.528 204.168 196.210 1.00 252.79 ? 100 LYS C NZ   1 
ATOM 8562  H H    . LYS D 2 79  ? 239.909 200.457 199.499 1.00 303.35 ? 100 LYS C H    1 
ATOM 8563  H HA   . LYS D 2 79  ? 237.590 199.353 199.248 1.00 303.35 ? 100 LYS C HA   1 
ATOM 8564  H HB2  . LYS D 2 79  ? 237.902 201.749 199.115 1.00 303.35 ? 100 LYS C HB2  1 
ATOM 8565  H HB3  . LYS D 2 79  ? 238.677 201.483 197.559 1.00 303.35 ? 100 LYS C HB3  1 
ATOM 8566  H HG2  . LYS D 2 79  ? 236.586 200.625 196.625 1.00 303.35 ? 100 LYS C HG2  1 
ATOM 8567  H HG3  . LYS D 2 79  ? 235.795 200.793 198.198 1.00 303.35 ? 100 LYS C HG3  1 
ATOM 8568  H HD2  . LYS D 2 79  ? 236.203 203.234 198.145 1.00 303.35 ? 100 LYS C HD2  1 
ATOM 8569  H HD3  . LYS D 2 79  ? 236.993 203.065 196.570 1.00 303.35 ? 100 LYS C HD3  1 
ATOM 8570  H HE2  . LYS D 2 79  ? 234.891 202.179 195.612 1.00 303.35 ? 100 LYS C HE2  1 
ATOM 8571  H HE3  . LYS D 2 79  ? 234.102 202.346 197.182 1.00 303.35 ? 100 LYS C HE3  1 
ATOM 8572  H HZ1  . LYS D 2 79  ? 233.627 204.197 195.754 1.00 303.35 ? 100 LYS C HZ1  1 
ATOM 8573  H HZ2  . LYS D 2 79  ? 234.492 204.711 197.061 1.00 303.35 ? 100 LYS C HZ2  1 
ATOM 8574  H HZ3  . LYS D 2 79  ? 235.229 204.555 195.594 1.00 303.35 ? 100 LYS C HZ3  1 
ATOM 8575  N N    . LYS D 2 80  ? 237.404 197.891 197.294 1.00 248.90 ? 101 LYS C N    1 
ATOM 8576  C CA   . LYS D 2 80  ? 237.436 196.851 196.264 1.00 248.90 ? 101 LYS C CA   1 
ATOM 8577  C C    . LYS D 2 80  ? 238.600 195.890 196.503 1.00 248.90 ? 101 LYS C C    1 
ATOM 8578  O O    . LYS D 2 80  ? 239.400 195.615 195.606 1.00 248.90 ? 101 LYS C O    1 
ATOM 8579  C CB   . LYS D 2 80  ? 237.543 197.475 194.871 1.00 248.90 ? 101 LYS C CB   1 
ATOM 8580  C CG   . LYS D 2 80  ? 236.359 198.350 194.481 1.00 248.90 ? 101 LYS C CG   1 
ATOM 8581  C CD   . LYS D 2 80  ? 236.513 198.890 193.067 1.00 248.90 ? 101 LYS C CD   1 
ATOM 8582  C CE   . LYS D 2 80  ? 235.346 199.790 192.687 1.00 248.90 ? 101 LYS C CE   1 
ATOM 8583  N NZ   . LYS D 2 80  ? 235.504 200.359 191.321 1.00 248.90 ? 101 LYS C NZ   1 
ATOM 8584  H H    . LYS D 2 80  ? 236.689 197.882 197.772 1.00 298.68 ? 101 LYS C H    1 
ATOM 8585  H HA   . LYS D 2 80  ? 236.615 196.337 196.317 1.00 298.68 ? 101 LYS C HA   1 
ATOM 8586  H HB2  . LYS D 2 80  ? 238.444 198.086 194.814 1.00 298.68 ? 101 LYS C HB2  1 
ATOM 8587  H HB3  . LYS D 2 80  ? 237.635 196.685 194.125 1.00 298.68 ? 101 LYS C HB3  1 
ATOM 8588  H HG2  . LYS D 2 80  ? 235.440 197.766 194.540 1.00 298.68 ? 101 LYS C HG2  1 
ATOM 8589  H HG3  . LYS D 2 80  ? 236.281 199.187 195.175 1.00 298.68 ? 101 LYS C HG3  1 
ATOM 8590  H HD2  . LYS D 2 80  ? 237.440 199.461 192.995 1.00 298.68 ? 101 LYS C HD2  1 
ATOM 8591  H HD3  . LYS D 2 80  ? 236.563 198.059 192.364 1.00 298.68 ? 101 LYS C HD3  1 
ATOM 8592  H HE2  . LYS D 2 80  ? 234.420 199.218 192.725 1.00 298.68 ? 101 LYS C HE2  1 
ATOM 8593  H HE3  . LYS D 2 80  ? 235.271 200.609 193.402 1.00 298.68 ? 101 LYS C HE3  1 
ATOM 8594  H HZ1  . LYS D 2 80  ? 234.711 200.948 191.108 1.00 298.68 ? 101 LYS C HZ1  1 
ATOM 8595  H HZ2  . LYS D 2 80  ? 236.352 200.907 191.280 1.00 298.68 ? 101 LYS C HZ2  1 
ATOM 8596  H HZ3  . LYS D 2 80  ? 235.555 199.608 190.648 1.00 298.68 ? 101 LYS C HZ3  1 
ATOM 8597  N N    . GLU D 2 81  ? 238.693 195.375 197.732 1.00 240.74 ? 102 GLU C N    1 
ATOM 8598  C CA   . GLU D 2 81  ? 239.780 194.463 198.082 1.00 240.74 ? 102 GLU C CA   1 
ATOM 8599  C C    . GLU D 2 81  ? 239.762 193.212 197.212 1.00 240.74 ? 102 GLU C C    1 
ATOM 8600  O O    . GLU D 2 81  ? 240.789 192.539 197.061 1.00 240.74 ? 102 GLU C O    1 
ATOM 8601  C CB   . GLU D 2 81  ? 239.687 194.067 199.558 1.00 240.74 ? 102 GLU C CB   1 
ATOM 8602  C CG   . GLU D 2 81  ? 238.477 193.212 199.905 1.00 240.74 ? 102 GLU C CG   1 
ATOM 8603  C CD   . GLU D 2 81  ? 238.392 192.885 201.370 1.00 240.74 ? 102 GLU C CD   1 
ATOM 8604  O OE1  . GLU D 2 81  ? 239.271 193.279 202.098 1.00 240.74 ? 102 GLU C OE1  1 
ATOM 8605  O OE2  . GLU D 2 81  ? 237.447 192.242 201.761 1.00 240.74 ? 102 GLU C OE2  1 
ATOM 8606  H H    . GLU D 2 81  ? 238.147 195.539 198.375 1.00 288.89 ? 102 GLU C H    1 
ATOM 8607  H HA   . GLU D 2 81  ? 240.627 194.914 197.942 1.00 288.89 ? 102 GLU C HA   1 
ATOM 8608  H HB2  . GLU D 2 81  ? 240.582 193.513 199.842 1.00 288.89 ? 102 GLU C HB2  1 
ATOM 8609  H HB3  . GLU D 2 81  ? 239.650 194.966 200.173 1.00 288.89 ? 102 GLU C HB3  1 
ATOM 8610  H HG2  . GLU D 2 81  ? 237.573 193.744 199.610 1.00 288.89 ? 102 GLU C HG2  1 
ATOM 8611  H HG3  . GLU D 2 81  ? 238.524 192.286 199.333 1.00 288.89 ? 102 GLU C HG3  1 
ATOM 8612  N N    . LEU D 2 82  ? 238.605 192.874 196.640 1.00 238.40 ? 103 LEU C N    1 
ATOM 8613  C CA   . LEU D 2 82  ? 238.521 191.708 195.766 1.00 238.40 ? 103 LEU C CA   1 
ATOM 8614  C C    . LEU D 2 82  ? 239.025 192.035 194.365 1.00 238.40 ? 103 LEU C C    1 
ATOM 8615  O O    . LEU D 2 82  ? 239.877 191.324 193.816 1.00 238.40 ? 103 LEU C O    1 
ATOM 8616  C CB   . LEU D 2 82  ? 237.074 191.204 195.692 1.00 238.40 ? 103 LEU C CB   1 
ATOM 8617  C CG   . LEU D 2 82  ? 236.835 190.002 194.769 1.00 238.40 ? 103 LEU C CG   1 
ATOM 8618  C CD1  . LEU D 2 82  ? 237.647 188.812 195.264 1.00 238.40 ? 103 LEU C CD1  1 
ATOM 8619  C CD2  . LEU D 2 82  ? 235.350 189.675 194.735 1.00 238.40 ? 103 LEU C CD2  1 
ATOM 8620  H H    . LEU D 2 82  ? 237.861 193.294 196.743 1.00 286.08 ? 103 LEU C H    1 
ATOM 8621  H HA   . LEU D 2 82  ? 239.074 190.999 196.127 1.00 286.08 ? 103 LEU C HA   1 
ATOM 8622  H HB2  . LEU D 2 82  ? 236.753 190.922 196.693 1.00 286.08 ? 103 LEU C HB2  1 
ATOM 8623  H HB3  . LEU D 2 82  ? 236.439 192.019 195.345 1.00 286.08 ? 103 LEU C HB3  1 
ATOM 8624  H HG   . LEU D 2 82  ? 237.177 190.243 193.762 1.00 286.08 ? 103 LEU C HG   1 
ATOM 8625  H HD11 . LEU D 2 82  ? 237.477 187.958 194.608 1.00 286.08 ? 103 LEU C HD11 1 
ATOM 8626  H HD12 . LEU D 2 82  ? 238.706 189.067 195.259 1.00 286.08 ? 103 LEU C HD12 1 
ATOM 8627  H HD13 . LEU D 2 82  ? 237.338 188.558 196.277 1.00 286.08 ? 103 LEU C HD13 1 
ATOM 8628  H HD21 . LEU D 2 82  ? 235.180 188.821 194.079 1.00 286.08 ? 103 LEU C HD21 1 
ATOM 8629  H HD22 . LEU D 2 82  ? 235.008 189.433 195.741 1.00 286.08 ? 103 LEU C HD22 1 
ATOM 8630  H HD23 . LEU D 2 82  ? 234.796 190.536 194.361 1.00 286.08 ? 103 LEU C HD23 1 
ATOM 8631  N N    . GLN D 2 83  ? 238.513 193.115 193.771 1.00 259.52 ? 104 GLN C N    1 
ATOM 8632  C CA   . GLN D 2 83  ? 238.884 193.446 192.399 1.00 259.52 ? 104 GLN C CA   1 
ATOM 8633  C C    . GLN D 2 83  ? 240.370 193.752 192.276 1.00 259.52 ? 104 GLN C C    1 
ATOM 8634  O O    . GLN D 2 83  ? 240.983 193.425 191.251 1.00 259.52 ? 104 GLN C O    1 
ATOM 8635  C CB   . GLN D 2 83  ? 238.065 194.640 191.900 1.00 259.52 ? 104 GLN C CB   1 
ATOM 8636  C CG   . GLN D 2 83  ? 236.578 194.362 191.765 1.00 259.52 ? 104 GLN C CG   1 
ATOM 8637  C CD   . GLN D 2 83  ? 235.842 194.498 193.085 1.00 259.52 ? 104 GLN C CD   1 
ATOM 8638  O OE1  . GLN D 2 83  ? 236.454 194.488 194.157 1.00 259.52 ? 104 GLN C OE1  1 
ATOM 8639  N NE2  . GLN D 2 83  ? 234.522 194.628 193.014 1.00 259.52 ? 104 GLN C NE2  1 
ATOM 8640  H H    . GLN D 2 83  ? 237.965 193.665 194.138 1.00 311.42 ? 104 GLN C H    1 
ATOM 8641  H HA   . GLN D 2 83  ? 238.689 192.684 191.832 1.00 311.42 ? 104 GLN C HA   1 
ATOM 8642  H HB2  . GLN D 2 83  ? 238.190 195.479 192.584 1.00 311.42 ? 104 GLN C HB2  1 
ATOM 8643  H HB3  . GLN D 2 83  ? 238.438 194.954 190.925 1.00 311.42 ? 104 GLN C HB3  1 
ATOM 8644  H HG2  . GLN D 2 83  ? 236.148 195.072 191.059 1.00 311.42 ? 104 GLN C HG2  1 
ATOM 8645  H HG3  . GLN D 2 83  ? 236.440 193.344 191.401 1.00 311.42 ? 104 GLN C HG3  1 
ATOM 8646  H HE21 . GLN D 2 83  ? 233.983 194.722 193.852 1.00 311.42 ? 104 GLN C HE21 1 
ATOM 8647  H HE22 . GLN D 2 83  ? 234.066 194.631 192.124 1.00 311.42 ? 104 GLN C HE22 1 
ATOM 8648  N N    . CYS D 2 84  ? 240.973 194.356 193.308 1.00 265.03 ? 105 CYS C N    1 
ATOM 8649  C CA   . CYS D 2 84  ? 242.400 194.666 193.255 1.00 265.03 ? 105 CYS C CA   1 
ATOM 8650  C C    . CYS D 2 84  ? 243.241 193.404 193.097 1.00 265.03 ? 105 CYS C C    1 
ATOM 8651  O O    . CYS D 2 84  ? 244.395 193.482 192.660 1.00 265.03 ? 105 CYS C O    1 
ATOM 8652  C CB   . CYS D 2 84  ? 242.835 195.404 194.521 1.00 265.03 ? 105 CYS C CB   1 
ATOM 8653  S SG   . CYS D 2 84  ? 242.798 194.389 196.018 1.00 265.03 ? 105 CYS C SG   1 
ATOM 8654  H H    . CYS D 2 84  ? 240.582 194.592 194.037 1.00 318.04 ? 105 CYS C H    1 
ATOM 8655  H HA   . CYS D 2 84  ? 242.568 195.232 192.487 1.00 318.04 ? 105 CYS C HA   1 
ATOM 8656  H HB2  . CYS D 2 84  ? 243.851 195.778 194.393 1.00 318.04 ? 105 CYS C HB2  1 
ATOM 8657  H HB3  . CYS D 2 84  ? 242.187 196.265 194.682 1.00 318.04 ? 105 CYS C HB3  1 
ATOM 8658  N N    . LEU D 2 85  ? 242.683 192.240 193.441 1.00 241.02 ? 106 LEU C N    1 
ATOM 8659  C CA   . LEU D 2 85  ? 243.362 190.964 193.255 1.00 241.02 ? 106 LEU C CA   1 
ATOM 8660  C C    . LEU D 2 85  ? 242.877 190.221 192.022 1.00 241.02 ? 106 LEU C C    1 
ATOM 8661  O O    . LEU D 2 85  ? 243.698 189.684 191.274 1.00 241.02 ? 106 LEU C O    1 
ATOM 8662  C CB   . LEU D 2 85  ? 243.161 190.081 194.493 1.00 241.02 ? 106 LEU C CB   1 
ATOM 8663  C CG   . LEU D 2 85  ? 243.667 190.665 195.818 1.00 241.02 ? 106 LEU C CG   1 
ATOM 8664  C CD1  . LEU D 2 85  ? 243.352 189.701 196.953 1.00 241.02 ? 106 LEU C CD1  1 
ATOM 8665  C CD2  . LEU D 2 85  ? 245.164 190.924 195.719 1.00 241.02 ? 106 LEU C CD2  1 
ATOM 8666  H H    . LEU D 2 85  ? 241.902 192.161 193.793 1.00 289.22 ? 106 LEU C H    1 
ATOM 8667  H HA   . LEU D 2 85  ? 244.309 191.112 193.126 1.00 289.22 ? 106 LEU C HA   1 
ATOM 8668  H HB2  . LEU D 2 85  ? 242.097 189.878 194.606 1.00 289.22 ? 106 LEU C HB2  1 
ATOM 8669  H HB3  . LEU D 2 85  ? 243.675 189.133 194.331 1.00 289.22 ? 106 LEU C HB3  1 
ATOM 8670  H HG   . LEU D 2 85  ? 243.150 191.603 196.023 1.00 289.22 ? 106 LEU C HG   1 
ATOM 8671  H HD11 . LEU D 2 85  ? 243.712 190.117 197.894 1.00 289.22 ? 106 LEU C HD11 1 
ATOM 8672  H HD12 . LEU D 2 85  ? 242.274 189.549 197.013 1.00 289.22 ? 106 LEU C HD12 1 
ATOM 8673  H HD13 . LEU D 2 85  ? 243.844 188.747 196.766 1.00 289.22 ? 106 LEU C HD13 1 
ATOM 8674  H HD21 . LEU D 2 85  ? 245.524 191.340 196.661 1.00 289.22 ? 106 LEU C HD21 1 
ATOM 8675  H HD22 . LEU D 2 85  ? 245.682 189.987 195.515 1.00 289.22 ? 106 LEU C HD22 1 
ATOM 8676  H HD23 . LEU D 2 85  ? 245.359 191.630 194.912 1.00 289.22 ? 106 LEU C HD23 1 
ATOM 8677  N N    . GLN D 2 86  ? 241.560 190.152 191.804 1.00 244.10 ? 107 GLN C N    1 
ATOM 8678  C CA   . GLN D 2 86  ? 241.046 189.440 190.635 1.00 244.10 ? 107 GLN C CA   1 
ATOM 8679  C C    . GLN D 2 86  ? 241.631 190.009 189.348 1.00 244.10 ? 107 GLN C C    1 
ATOM 8680  O O    . GLN D 2 86  ? 242.013 189.257 188.440 1.00 244.10 ? 107 GLN C O    1 
ATOM 8681  C CB   . GLN D 2 86  ? 239.518 189.510 190.591 1.00 244.10 ? 107 GLN C CB   1 
ATOM 8682  C CG   . GLN D 2 86  ? 238.892 188.737 189.443 1.00 244.10 ? 107 GLN C CG   1 
ATOM 8683  C CD   . GLN D 2 86  ? 237.377 188.805 189.457 1.00 244.10 ? 107 GLN C CD   1 
ATOM 8684  O OE1  . GLN D 2 86  ? 236.791 189.868 189.680 1.00 244.10 ? 107 GLN C OE1  1 
ATOM 8685  N NE2  . GLN D 2 86  ? 236.732 187.669 189.217 1.00 244.10 ? 107 GLN C NE2  1 
ATOM 8686  H H    . GLN D 2 86  ? 240.957 190.501 192.307 1.00 292.92 ? 107 GLN C H    1 
ATOM 8687  H HA   . GLN D 2 86  ? 241.303 188.506 190.695 1.00 292.92 ? 107 GLN C HA   1 
ATOM 8688  H HB2  . GLN D 2 86  ? 239.108 189.119 191.522 1.00 292.92 ? 107 GLN C HB2  1 
ATOM 8689  H HB3  . GLN D 2 86  ? 239.204 190.550 190.506 1.00 292.92 ? 107 GLN C HB3  1 
ATOM 8690  H HG2  . GLN D 2 86  ? 239.245 189.157 188.501 1.00 292.92 ? 107 GLN C HG2  1 
ATOM 8691  H HG3  . GLN D 2 86  ? 239.188 187.690 189.519 1.00 292.92 ? 107 GLN C HG3  1 
ATOM 8692  H HE21 . GLN D 2 86  ? 235.731 187.652 189.214 1.00 292.92 ? 107 GLN C HE21 1 
ATOM 8693  H HE22 . GLN D 2 86  ? 237.246 186.829 189.041 1.00 292.92 ? 107 GLN C HE22 1 
ATOM 8694  N N    . ILE D 2 87  ? 241.741 191.338 189.270 1.00 273.64 ? 108 ILE C N    1 
ATOM 8695  C CA   . ILE D 2 87  ? 242.307 191.982 188.089 1.00 273.64 ? 108 ILE C CA   1 
ATOM 8696  C C    . ILE D 2 87  ? 243.784 191.628 187.945 1.00 273.64 ? 108 ILE C C    1 
ATOM 8697  O O    . ILE D 2 87  ? 244.248 191.270 186.856 1.00 273.64 ? 108 ILE C O    1 
ATOM 8698  C CB   . ILE D 2 87  ? 242.143 193.511 188.160 1.00 273.64 ? 108 ILE C CB   1 
ATOM 8699  C CG1  . ILE D 2 87  ? 240.664 193.894 188.075 1.00 273.64 ? 108 ILE C CG1  1 
ATOM 8700  C CG2  . ILE D 2 87  ? 242.935 194.182 187.048 1.00 273.64 ? 108 ILE C CG2  1 
ATOM 8701  C CD1  . ILE D 2 87  ? 240.386 195.339 188.423 1.00 273.64 ? 108 ILE C CD1  1 
ATOM 8702  H H    . ILE D 2 87  ? 241.492 191.884 189.886 1.00 328.37 ? 108 ILE C H    1 
ATOM 8703  H HA   . ILE D 2 87  ? 241.845 191.653 187.301 1.00 328.37 ? 108 ILE C HA   1 
ATOM 8704  H HB   . ILE D 2 87  ? 242.507 193.871 189.121 1.00 328.37 ? 108 ILE C HB   1 
ATOM 8705  H HG12 . ILE D 2 87  ? 240.298 193.711 187.065 1.00 328.37 ? 108 ILE C HG12 1 
ATOM 8706  H HG13 . ILE D 2 87  ? 240.085 193.264 188.750 1.00 328.37 ? 108 ILE C HG13 1 
ATOM 8707  H HG21 . ILE D 2 87  ? 242.808 195.263 187.113 1.00 328.37 ? 108 ILE C HG21 1 
ATOM 8708  H HG22 . ILE D 2 87  ? 243.991 193.934 187.153 1.00 328.37 ? 108 ILE C HG22 1 
ATOM 8709  H HG23 . ILE D 2 87  ? 242.575 193.832 186.081 1.00 328.37 ? 108 ILE C HG23 1 
ATOM 8710  H HD11 . ILE D 2 87  ? 239.317 195.534 188.340 1.00 328.37 ? 108 ILE C HD11 1 
ATOM 8711  H HD12 . ILE D 2 87  ? 240.713 195.536 189.445 1.00 328.37 ? 108 ILE C HD12 1 
ATOM 8712  H HD13 . ILE D 2 87  ? 240.927 195.989 187.737 1.00 328.37 ? 108 ILE C HD13 1 
ATOM 8713  N N    . TYR D 2 88  ? 244.546 191.726 189.036 1.00 269.82 ? 109 TYR C N    1 
ATOM 8714  C CA   . TYR D 2 88  ? 245.970 191.412 188.965 1.00 269.82 ? 109 TYR C CA   1 
ATOM 8715  C C    . TYR D 2 88  ? 246.195 189.965 188.540 1.00 269.82 ? 109 TYR C C    1 
ATOM 8716  O O    . TYR D 2 88  ? 246.971 189.693 187.618 1.00 269.82 ? 109 TYR C O    1 
ATOM 8717  C CB   . TYR D 2 88  ? 246.645 191.681 190.311 1.00 269.82 ? 109 TYR C CB   1 
ATOM 8718  C CG   . TYR D 2 88  ? 248.081 191.209 190.379 1.00 269.82 ? 109 TYR C CG   1 
ATOM 8719  C CD1  . TYR D 2 88  ? 249.077 191.925 189.732 1.00 269.82 ? 109 TYR C CD1  1 
ATOM 8720  C CD2  . TYR D 2 88  ? 248.401 190.061 191.087 1.00 269.82 ? 109 TYR C CD2  1 
ATOM 8721  C CE1  . TYR D 2 88  ? 250.389 191.495 189.794 1.00 269.82 ? 109 TYR C CE1  1 
ATOM 8722  C CE2  . TYR D 2 88  ? 249.712 189.630 191.149 1.00 269.82 ? 109 TYR C CE2  1 
ATOM 8723  C CZ   . TYR D 2 88  ? 250.703 190.342 190.506 1.00 269.82 ? 109 TYR C CZ   1 
ATOM 8724  O OH   . TYR D 2 88  ? 252.009 189.914 190.567 1.00 269.82 ? 109 TYR C OH   1 
ATOM 8725  H H    . TYR D 2 88  ? 244.268 191.968 189.813 1.00 323.78 ? 109 TYR C H    1 
ATOM 8726  H HA   . TYR D 2 88  ? 246.384 191.984 188.302 1.00 323.78 ? 109 TYR C HA   1 
ATOM 8727  H HB2  . TYR D 2 88  ? 246.628 192.751 190.520 1.00 323.78 ? 109 TYR C HB2  1 
ATOM 8728  H HB3  . TYR D 2 88  ? 246.086 191.184 191.104 1.00 323.78 ? 109 TYR C HB3  1 
ATOM 8729  H HD1  . TYR D 2 88  ? 248.826 192.828 189.175 1.00 323.78 ? 109 TYR C HD1  1 
ATOM 8730  H HD2  . TYR D 2 88  ? 247.618 189.497 191.595 1.00 323.78 ? 109 TYR C HD2  1 
ATOM 8731  H HE1  . TYR D 2 88  ? 251.171 192.057 189.286 1.00 323.78 ? 109 TYR C HE1  1 
ATOM 8732  H HE2  . TYR D 2 88  ? 249.963 188.727 191.705 1.00 323.78 ? 109 TYR C HE2  1 
ATOM 8733  H HH   . TYR D 2 88  ? 252.057 189.113 191.095 1.00 323.78 ? 109 TYR C HH   1 
ATOM 8734  N N    . TRP D 2 89  ? 245.534 189.018 189.207 1.00 250.03 ? 110 TRP C N    1 
ATOM 8735  C CA   . TRP D 2 89  ? 245.749 187.609 188.915 1.00 250.03 ? 110 TRP C CA   1 
ATOM 8736  C C    . TRP D 2 89  ? 245.273 187.233 187.522 1.00 250.03 ? 110 TRP C C    1 
ATOM 8737  O O    . TRP D 2 89  ? 245.765 186.250 186.958 1.00 250.03 ? 110 TRP C O    1 
ATOM 8738  C CB   . TRP D 2 89  ? 245.030 186.741 189.949 1.00 250.03 ? 110 TRP C CB   1 
ATOM 8739  C CG   . TRP D 2 89  ? 245.698 186.730 191.290 1.00 250.03 ? 110 TRP C CG   1 
ATOM 8740  C CD1  . TRP D 2 89  ? 245.259 187.347 192.424 1.00 250.03 ? 110 TRP C CD1  1 
ATOM 8741  C CD2  . TRP D 2 89  ? 246.934 186.067 191.647 1.00 250.03 ? 110 TRP C CD2  1 
ATOM 8742  N NE1  . TRP D 2 89  ? 246.133 187.115 193.457 1.00 250.03 ? 110 TRP C NE1  1 
ATOM 8743  C CE2  . TRP D 2 89  ? 247.164 186.332 193.000 1.00 250.03 ? 110 TRP C CE2  1 
ATOM 8744  C CE3  . TRP D 2 89  ? 247.850 185.280 190.938 1.00 250.03 ? 110 TRP C CE3  1 
ATOM 8745  C CZ2  . TRP D 2 89  ? 248.276 185.841 193.666 1.00 250.03 ? 110 TRP C CZ2  1 
ATOM 8746  C CZ3  . TRP D 2 89  ? 248.965 184.787 191.606 1.00 250.03 ? 110 TRP C CZ3  1 
ATOM 8747  C CH2  . TRP D 2 89  ? 249.171 185.060 192.935 1.00 250.03 ? 110 TRP C CH2  1 
ATOM 8748  H H    . TRP D 2 89  ? 244.959 189.168 189.829 1.00 300.04 ? 110 TRP C H    1 
ATOM 8749  H HA   . TRP D 2 89  ? 246.699 187.418 188.968 1.00 300.04 ? 110 TRP C HA   1 
ATOM 8750  H HB2  . TRP D 2 89  ? 244.008 187.099 190.077 1.00 300.04 ? 110 TRP C HB2  1 
ATOM 8751  H HB3  . TRP D 2 89  ? 244.973 185.715 189.586 1.00 300.04 ? 110 TRP C HB3  1 
ATOM 8752  H HD1  . TRP D 2 89  ? 244.347 187.937 192.499 1.00 300.04 ? 110 TRP C HD1  1 
ATOM 8753  H HE1  . TRP D 2 89  ? 246.036 187.464 194.400 1.00 300.04 ? 110 TRP C HE1  1 
ATOM 8754  H HE3  . TRP D 2 89  ? 247.690 185.058 189.884 1.00 300.04 ? 110 TRP C HE3  1 
ATOM 8755  H HZ2  . TRP D 2 89  ? 248.457 186.048 194.721 1.00 300.04 ? 110 TRP C HZ2  1 
ATOM 8756  H HZ3  . TRP D 2 89  ? 249.674 184.176 191.047 1.00 300.04 ? 110 TRP C HZ3  1 
ATOM 8757  H HH2  . TRP D 2 89  ? 250.056 184.657 193.428 1.00 300.04 ? 110 TRP C HH2  1 
ATOM 8758  N N    . SER D 2 90  ? 244.333 187.991 186.951 1.00 266.38 ? 111 SER C N    1 
ATOM 8759  C CA   . SER D 2 90  ? 243.781 187.631 185.652 1.00 266.38 ? 111 SER C CA   1 
ATOM 8760  C C    . SER D 2 90  ? 244.812 187.670 184.528 1.00 266.38 ? 111 SER C C    1 
ATOM 8761  O O    . SER D 2 90  ? 244.572 187.052 183.485 1.00 266.38 ? 111 SER C O    1 
ATOM 8762  C CB   . SER D 2 90  ? 242.633 188.562 185.314 1.00 266.38 ? 111 SER C CB   1 
ATOM 8763  O OG   . SER D 2 90  ? 243.103 189.844 184.995 1.00 266.38 ? 111 SER C OG   1 
ATOM 8764  H H    . SER D 2 90  ? 244.002 188.708 187.293 1.00 319.66 ? 111 SER C H    1 
ATOM 8765  H HA   . SER D 2 90  ? 243.435 186.727 185.702 1.00 319.66 ? 111 SER C HA   1 
ATOM 8766  H HB2  . SER D 2 90  ? 242.072 188.158 184.471 1.00 319.66 ? 111 SER C HB2  1 
ATOM 8767  H HB3  . SER D 2 90  ? 241.951 188.622 186.161 1.00 319.66 ? 111 SER C HB3  1 
ATOM 8768  H HG   . SER D 2 90  ? 243.542 190.168 185.785 1.00 319.66 ? 111 SER C HG   1 
ATOM 8769  N N    . ILE D 2 91  ? 245.938 188.365 184.708 1.00 272.95 ? 112 ILE C N    1 
ATOM 8770  C CA   . ILE D 2 91  ? 246.974 188.476 183.683 1.00 272.95 ? 112 ILE C CA   1 
ATOM 8771  C C    . ILE D 2 91  ? 248.145 187.530 183.951 1.00 272.95 ? 112 ILE C C    1 
ATOM 8772  O O    . ILE D 2 91  ? 249.222 187.709 183.378 1.00 272.95 ? 112 ILE C O    1 
ATOM 8773  C CB   . ILE D 2 91  ? 247.497 189.921 183.593 1.00 272.95 ? 112 ILE C CB   1 
ATOM 8774  C CG1  . ILE D 2 91  ? 248.156 190.334 184.912 1.00 272.95 ? 112 ILE C CG1  1 
ATOM 8775  C CG2  . ILE D 2 91  ? 246.366 190.875 183.239 1.00 272.95 ? 112 ILE C CG2  1 
ATOM 8776  C CD1  . ILE D 2 91  ? 249.026 191.566 184.800 1.00 272.95 ? 112 ILE C CD1  1 
ATOM 8777  H H    . ILE D 2 91  ? 246.129 188.789 185.431 1.00 327.54 ? 112 ILE C H    1 
ATOM 8778  H HA   . ILE D 2 91  ? 246.604 188.224 182.826 1.00 327.54 ? 112 ILE C HA   1 
ATOM 8779  H HB   . ILE D 2 91  ? 248.266 189.983 182.823 1.00 327.54 ? 112 ILE C HB   1 
ATOM 8780  H HG12 . ILE D 2 91  ? 247.387 190.525 185.659 1.00 327.54 ? 112 ILE C HG12 1 
ATOM 8781  H HG13 . ILE D 2 91  ? 248.773 189.515 185.282 1.00 327.54 ? 112 ILE C HG13 1 
ATOM 8782  H HG21 . ILE D 2 91  ? 246.752 191.892 183.180 1.00 327.54 ? 112 ILE C HG21 1 
ATOM 8783  H HG22 . ILE D 2 91  ? 245.940 190.592 182.277 1.00 327.54 ? 112 ILE C HG22 1 
ATOM 8784  H HG23 . ILE D 2 91  ? 245.593 190.824 184.006 1.00 327.54 ? 112 ILE C HG23 1 
ATOM 8785  H HD11 . ILE D 2 91  ? 249.458 191.795 185.774 1.00 327.54 ? 112 ILE C HD11 1 
ATOM 8786  H HD12 . ILE D 2 91  ? 249.825 191.383 184.082 1.00 327.54 ? 112 ILE C HD12 1 
ATOM 8787  H HD13 . ILE D 2 91  ? 248.422 192.408 184.465 1.00 327.54 ? 112 ILE C HD13 1 
ATOM 8788  N N    . HIS D 2 92  ? 247.964 186.528 184.811 1.00 250.47 ? 113 HIS C N    1 
ATOM 8789  C CA   . HIS D 2 92  ? 248.963 185.479 184.961 1.00 250.47 ? 113 HIS C CA   1 
ATOM 8790  C C    . HIS D 2 92  ? 248.713 184.373 183.943 1.00 250.47 ? 113 HIS C C    1 
ATOM 8791  O O    . HIS D 2 92  ? 247.594 183.865 183.825 1.00 250.47 ? 113 HIS C O    1 
ATOM 8792  C CB   . HIS D 2 92  ? 248.942 184.901 186.380 1.00 250.47 ? 113 HIS C CB   1 
ATOM 8793  C CG   . HIS D 2 92  ? 249.404 185.864 187.429 1.00 250.47 ? 113 HIS C CG   1 
ATOM 8794  N ND1  . HIS D 2 92  ? 250.358 185.538 188.370 1.00 250.47 ? 113 HIS C ND1  1 
ATOM 8795  C CD2  . HIS D 2 92  ? 249.043 187.143 187.685 1.00 250.47 ? 113 HIS C CD2  1 
ATOM 8796  C CE1  . HIS D 2 92  ? 250.563 186.578 189.161 1.00 250.47 ? 113 HIS C CE1  1 
ATOM 8797  N NE2  . HIS D 2 92  ? 249.778 187.563 188.767 1.00 250.47 ? 113 HIS C NE2  1 
ATOM 8798  H H    . HIS D 2 92  ? 247.277 186.428 185.316 1.00 300.56 ? 113 HIS C H    1 
ATOM 8799  H HA   . HIS D 2 92  ? 249.849 185.842 184.807 1.00 300.56 ? 113 HIS C HA   1 
ATOM 8800  H HB2  . HIS D 2 92  ? 247.929 184.584 186.629 1.00 300.56 ? 113 HIS C HB2  1 
ATOM 8801  H HB3  . HIS D 2 92  ? 249.581 184.019 186.422 1.00 300.56 ? 113 HIS C HB3  1 
ATOM 8802  H HD2  . HIS D 2 92  ? 248.305 187.731 187.137 1.00 300.56 ? 113 HIS C HD2  1 
ATOM 8803  H HE1  . HIS D 2 92  ? 251.263 186.615 189.996 1.00 300.56 ? 113 HIS C HE1  1 
ATOM 8804  H HE2  . HIS D 2 92  ? 249.723 188.479 189.188 1.00 300.56 ? 113 HIS C HE2  1 
ATOM 8805  N N    . LEU D 2 93  ? 249.760 184.003 183.210 1.00 259.71 ? 114 LEU C N    1 
ATOM 8806  C CA   . LEU D 2 93  ? 249.656 183.029 182.131 1.00 259.71 ? 114 LEU C CA   1 
ATOM 8807  C C    . LEU D 2 93  ? 249.408 181.650 182.729 1.00 259.71 ? 114 LEU C C    1 
ATOM 8808  O O    . LEU D 2 93  ? 250.160 181.202 183.602 1.00 259.71 ? 114 LEU C O    1 
ATOM 8809  C CB   . LEU D 2 93  ? 250.933 183.018 181.281 1.00 259.71 ? 114 LEU C CB   1 
ATOM 8810  C CG   . LEU D 2 93  ? 250.939 182.036 180.102 1.00 259.71 ? 114 LEU C CG   1 
ATOM 8811  C CD1  . LEU D 2 93  ? 249.872 182.444 179.096 1.00 259.71 ? 114 LEU C CD1  1 
ATOM 8812  C CD2  . LEU D 2 93  ? 252.319 182.021 179.461 1.00 259.71 ? 114 LEU C CD2  1 
ATOM 8813  H H    . LEU D 2 93  ? 250.556 184.309 183.321 1.00 311.65 ? 114 LEU C H    1 
ATOM 8814  H HA   . LEU D 2 93  ? 248.903 183.259 181.566 1.00 311.65 ? 114 LEU C HA   1 
ATOM 8815  H HB2  . LEU D 2 93  ? 251.091 184.018 180.880 1.00 311.65 ? 114 LEU C HB2  1 
ATOM 8816  H HB3  . LEU D 2 93  ? 251.776 182.769 181.925 1.00 311.65 ? 114 LEU C HB3  1 
ATOM 8817  H HG   . LEU D 2 93  ? 250.694 181.036 180.461 1.00 311.65 ? 114 LEU C HG   1 
ATOM 8818  H HD11 . LEU D 2 93  ? 249.876 181.746 178.258 1.00 311.65 ? 114 LEU C HD11 1 
ATOM 8819  H HD12 . LEU D 2 93  ? 248.893 182.427 179.575 1.00 311.65 ? 114 LEU C HD12 1 
ATOM 8820  H HD13 . LEU D 2 93  ? 250.081 183.449 178.731 1.00 311.65 ? 114 LEU C HD13 1 
ATOM 8821  H HD21 . LEU D 2 93  ? 252.323 181.323 178.624 1.00 311.65 ? 114 LEU C HD21 1 
ATOM 8822  H HD22 . LEU D 2 93  ? 252.564 183.021 179.102 1.00 311.65 ? 114 LEU C HD22 1 
ATOM 8823  H HD23 . LEU D 2 93  ? 253.059 181.709 180.198 1.00 311.65 ? 114 LEU C HD23 1 
ATOM 8824  N N    . GLY D 2 94  ? 248.359 180.982 182.260 1.00 244.29 ? 115 GLY C N    1 
ATOM 8825  C CA   . GLY D 2 94  ? 248.009 179.663 182.752 1.00 244.29 ? 115 GLY C CA   1 
ATOM 8826  C C    . GLY D 2 94  ? 247.166 178.720 181.916 1.00 244.29 ? 115 GLY C C    1 
ATOM 8827  O O    . GLY D 2 94  ? 247.675 177.747 181.358 1.00 244.29 ? 115 GLY C O    1 
ATOM 8828  H H    . GLY D 2 94  ? 247.830 181.280 181.649 1.00 293.15 ? 115 GLY C H    1 
ATOM 8829  H HA2  . GLY D 2 94  ? 248.625 179.384 182.057 1.00 293.15 ? 115 GLY C HA2  1 
ATOM 8830  H HA3  . GLY D 2 94  ? 247.125 180.059 182.801 1.00 293.15 ? 115 GLY C HA3  1 
ATOM 8831  N N    . GLU D 2 100 ? 254.670 175.610 194.384 1.00 164.73 ? 121 GLU C N    1 
ATOM 8832  C CA   . GLU D 2 100 ? 253.390 176.239 194.694 1.00 164.73 ? 121 GLU C CA   1 
ATOM 8833  C C    . GLU D 2 100 ? 253.179 176.422 196.197 1.00 164.73 ? 121 GLU C C    1 
ATOM 8834  O O    . GLU D 2 100 ? 252.179 177.003 196.617 1.00 164.73 ? 121 GLU C O    1 
ATOM 8835  C CB   . GLU D 2 100 ? 252.245 175.408 194.111 1.00 164.73 ? 121 GLU C CB   1 
ATOM 8836  C CG   . GLU D 2 100 ? 252.231 175.335 192.591 1.00 164.73 ? 121 GLU C CG   1 
ATOM 8837  C CD   . GLU D 2 100 ? 251.113 174.483 192.057 1.00 164.73 ? 121 GLU C CD   1 
ATOM 8838  O OE1  . GLU D 2 100 ? 250.403 173.905 192.844 1.00 164.73 ? 121 GLU C OE1  1 
ATOM 8839  O OE2  . GLU D 2 100 ? 250.969 174.411 190.859 1.00 164.73 ? 121 GLU C OE2  1 
ATOM 8840  H H    . GLU D 2 100 ? 254.693 174.740 193.892 1.00 197.68 ? 121 GLU C H    1 
ATOM 8841  H HA   . GLU D 2 100 ? 253.369 177.120 194.288 1.00 197.68 ? 121 GLU C HA   1 
ATOM 8842  H HB2  . GLU D 2 100 ? 252.303 174.389 194.495 1.00 197.68 ? 121 GLU C HB2  1 
ATOM 8843  H HB3  . GLU D 2 100 ? 251.291 175.825 194.435 1.00 197.68 ? 121 GLU C HB3  1 
ATOM 8844  H HG2  . GLU D 2 100 ? 252.128 176.343 192.190 1.00 197.68 ? 121 GLU C HG2  1 
ATOM 8845  H HG3  . GLU D 2 100 ? 253.183 174.933 192.248 1.00 197.68 ? 121 GLU C HG3  1 
ATOM 8846  N N    . PHE D 2 101 ? 254.116 175.926 197.008 1.00 185.94 ? 122 PHE C N    1 
ATOM 8847  C CA   . PHE D 2 101 ? 254.026 176.119 198.452 1.00 185.94 ? 122 PHE C CA   1 
ATOM 8848  C C    . PHE D 2 101 ? 253.962 177.603 198.802 1.00 185.94 ? 122 PHE C C    1 
ATOM 8849  O O    . PHE D 2 101 ? 253.123 178.026 199.606 1.00 185.94 ? 122 PHE C O    1 
ATOM 8850  C CB   . PHE D 2 101 ? 255.223 175.475 199.154 1.00 185.94 ? 122 PHE C CB   1 
ATOM 8851  C CG   . PHE D 2 101 ? 255.077 175.391 200.646 1.00 185.94 ? 122 PHE C CG   1 
ATOM 8852  C CD1  . PHE D 2 101 ? 255.365 176.485 201.449 1.00 185.94 ? 122 PHE C CD1  1 
ATOM 8853  C CD2  . PHE D 2 101 ? 254.651 174.218 201.251 1.00 185.94 ? 122 PHE C CD2  1 
ATOM 8854  C CE1  . PHE D 2 101 ? 255.233 176.409 202.822 1.00 185.94 ? 122 PHE C CE1  1 
ATOM 8855  C CE2  . PHE D 2 101 ? 254.516 174.140 202.625 1.00 185.94 ? 122 PHE C CE2  1 
ATOM 8856  C CZ   . PHE D 2 101 ? 254.807 175.235 203.410 1.00 185.94 ? 122 PHE C CZ   1 
ATOM 8857  H H    . PHE D 2 101 ? 254.804 175.475 196.760 1.00 223.13 ? 122 PHE C H    1 
ATOM 8858  H HA   . PHE D 2 101 ? 253.213 175.702 198.774 1.00 223.13 ? 122 PHE C HA   1 
ATOM 8859  H HB2  . PHE D 2 101 ? 255.370 174.466 198.769 1.00 223.13 ? 122 PHE C HB2  1 
ATOM 8860  H HB3  . PHE D 2 101 ? 256.125 176.044 198.931 1.00 223.13 ? 122 PHE C HB3  1 
ATOM 8861  H HD1  . PHE D 2 101 ? 255.701 177.412 200.984 1.00 223.13 ? 122 PHE C HD1  1 
ATOM 8862  H HD2  . PHE D 2 101 ? 254.421 173.352 200.630 1.00 223.13 ? 122 PHE C HD2  1 
ATOM 8863  H HE1  . PHE D 2 101 ? 255.463 177.276 203.441 1.00 223.13 ? 122 PHE C HE1  1 
ATOM 8864  H HE2  . PHE D 2 101 ? 254.180 173.212 203.087 1.00 223.13 ? 122 PHE C HE2  1 
ATOM 8865  H HZ   . PHE D 2 101 ? 254.700 175.175 204.492 1.00 223.13 ? 122 PHE C HZ   1 
ATOM 8866  N N    . TYR D 2 102 ? 254.850 178.405 198.212 1.00 190.07 ? 123 TYR C N    1 
ATOM 8867  C CA   . TYR D 2 102 ? 254.900 179.842 198.456 1.00 190.07 ? 123 TYR C CA   1 
ATOM 8868  C C    . TYR D 2 102 ? 254.339 180.571 197.241 1.00 190.07 ? 123 TYR C C    1 
ATOM 8869  O O    . TYR D 2 102 ? 254.973 180.602 196.180 1.00 190.07 ? 123 TYR C O    1 
ATOM 8870  C CB   . TYR D 2 102 ? 256.329 180.301 198.754 1.00 190.07 ? 123 TYR C CB   1 
ATOM 8871  C CG   . TYR D 2 102 ? 256.895 179.738 200.039 1.00 190.07 ? 123 TYR C CG   1 
ATOM 8872  C CD1  . TYR D 2 102 ? 256.335 180.091 201.257 1.00 190.07 ? 123 TYR C CD1  1 
ATOM 8873  C CD2  . TYR D 2 102 ? 257.975 178.868 199.998 1.00 190.07 ? 123 TYR C CD2  1 
ATOM 8874  C CE1  . TYR D 2 102 ? 256.852 179.576 202.430 1.00 190.07 ? 123 TYR C CE1  1 
ATOM 8875  C CE2  . TYR D 2 102 ? 258.492 178.353 201.171 1.00 190.07 ? 123 TYR C CE2  1 
ATOM 8876  C CZ   . TYR D 2 102 ? 257.926 178.711 202.390 1.00 190.07 ? 123 TYR C CZ   1 
ATOM 8877  O OH   . TYR D 2 102 ? 258.441 178.198 203.558 1.00 190.07 ? 123 TYR C OH   1 
ATOM 8878  H H    . TYR D 2 102 ? 255.446 178.131 197.656 1.00 228.08 ? 123 TYR C H    1 
ATOM 8879  H HA   . TYR D 2 102 ? 254.335 180.090 199.202 1.00 228.08 ? 123 TYR C HA   1 
ATOM 8880  H HB2  . TYR D 2 102 ? 256.985 180.005 197.934 1.00 228.08 ? 123 TYR C HB2  1 
ATOM 8881  H HB3  . TYR D 2 102 ? 256.356 181.388 198.819 1.00 228.08 ? 123 TYR C HB3  1 
ATOM 8882  H HD1  . TYR D 2 102 ? 255.486 180.774 201.289 1.00 228.08 ? 123 TYR C HD1  1 
ATOM 8883  H HD2  . TYR D 2 102 ? 258.415 178.590 199.040 1.00 228.08 ? 123 TYR C HD2  1 
ATOM 8884  H HE1  . TYR D 2 102 ? 256.411 179.853 203.388 1.00 228.08 ? 123 TYR C HE1  1 
ATOM 8885  H HE2  . TYR D 2 102 ? 259.340 177.670 201.139 1.00 228.08 ? 123 TYR C HE2  1 
ATOM 8886  H HH   . TYR D 2 102 ? 257.933 178.529 204.303 1.00 228.08 ? 123 TYR C HH   1 
ATOM 8887  N N    . GLU D 2 103 ? 253.154 181.153 197.401 1.00 205.02 ? 124 GLU C N    1 
ATOM 8888  C CA   . GLU D 2 103 ? 252.501 181.929 196.358 1.00 205.02 ? 124 GLU C CA   1 
ATOM 8889  C C    . GLU D 2 103 ? 252.721 183.420 196.590 1.00 205.02 ? 124 GLU C C    1 
ATOM 8890  O O    . GLU D 2 103 ? 253.060 183.854 197.694 1.00 205.02 ? 124 GLU C O    1 
ATOM 8891  C CB   . GLU D 2 103 ? 251.003 181.618 196.315 1.00 205.02 ? 124 GLU C CB   1 
ATOM 8892  C CG   . GLU D 2 103 ? 250.670 180.181 195.940 1.00 205.02 ? 124 GLU C CG   1 
ATOM 8893  C CD   . GLU D 2 103 ? 249.190 179.926 195.858 1.00 205.02 ? 124 GLU C CD   1 
ATOM 8894  O OE1  . GLU D 2 103 ? 248.523 180.637 195.145 1.00 205.02 ? 124 GLU C OE1  1 
ATOM 8895  O OE2  . GLU D 2 103 ? 248.727 179.019 196.508 1.00 205.02 ? 124 GLU C OE2  1 
ATOM 8896  H H    . GLU D 2 103 ? 252.693 181.102 198.123 1.00 246.02 ? 124 GLU C H    1 
ATOM 8897  H HA   . GLU D 2 103 ? 252.883 181.697 195.498 1.00 246.02 ? 124 GLU C HA   1 
ATOM 8898  H HB2  . GLU D 2 103 ? 250.561 181.820 197.291 1.00 246.02 ? 124 GLU C HB2  1 
ATOM 8899  H HB3  . GLU D 2 103 ? 250.516 182.274 195.594 1.00 246.02 ? 124 GLU C HB3  1 
ATOM 8900  H HG2  . GLU D 2 103 ? 251.120 179.955 194.974 1.00 246.02 ? 124 GLU C HG2  1 
ATOM 8901  H HG3  . GLU D 2 103 ? 251.108 179.512 196.679 1.00 246.02 ? 124 GLU C HG3  1 
ATOM 8902  N N    . ALA D 2 104 ? 252.522 184.201 195.530 1.00 248.55 ? 125 ALA C N    1 
ATOM 8903  C CA   . ALA D 2 104 ? 252.759 185.636 195.592 1.00 248.55 ? 125 ALA C CA   1 
ATOM 8904  C C    . ALA D 2 104 ? 251.767 186.321 196.525 1.00 248.55 ? 125 ALA C C    1 
ATOM 8905  O O    . ALA D 2 104 ? 250.652 185.843 196.752 1.00 248.55 ? 125 ALA C O    1 
ATOM 8906  C CB   . ALA D 2 104 ? 252.676 186.251 194.196 1.00 248.55 ? 125 ALA C CB   1 
ATOM 8907  H H    . ALA D 2 104 ? 252.249 183.922 194.763 1.00 298.26 ? 125 ALA C H    1 
ATOM 8908  H HA   . ALA D 2 104 ? 253.651 185.794 195.939 1.00 298.26 ? 125 ALA C HA   1 
ATOM 8909  H HB1  . ALA D 2 104 ? 252.805 187.210 194.268 1.00 298.26 ? 125 ALA C HB1  1 
ATOM 8910  H HB2  . ALA D 2 104 ? 253.372 185.865 193.642 1.00 298.26 ? 125 ALA C HB2  1 
ATOM 8911  H HB3  . ALA D 2 104 ? 251.804 186.062 193.816 1.00 298.26 ? 125 ALA C HB3  1 
ATOM 8912  N N    . SER D 2 105 ? 252.196 187.463 197.068 1.00 251.92 ? 126 SER C N    1 
ATOM 8913  C CA   . SER D 2 105 ? 251.429 188.221 198.052 1.00 251.92 ? 126 SER C CA   1 
ATOM 8914  C C    . SER D 2 105 ? 251.099 189.606 197.508 1.00 251.92 ? 126 SER C C    1 
ATOM 8915  O O    . SER D 2 105 ? 251.411 190.618 198.149 1.00 251.92 ? 126 SER C O    1 
ATOM 8916  C CB   . SER D 2 105 ? 252.204 188.343 199.350 1.00 251.92 ? 126 SER C CB   1 
ATOM 8917  O OG   . SER D 2 105 ? 253.442 188.964 199.138 1.00 251.92 ? 126 SER C OG   1 
ATOM 8918  H H    . SER D 2 105 ? 252.951 187.827 196.875 1.00 302.30 ? 126 SER C H    1 
ATOM 8919  H HA   . SER D 2 105 ? 250.589 187.774 198.241 1.00 302.30 ? 126 SER C HA   1 
ATOM 8920  H HB2  . SER D 2 105 ? 251.623 188.920 200.068 1.00 302.30 ? 126 SER C HB2  1 
ATOM 8921  H HB3  . SER D 2 105 ? 252.360 187.352 199.775 1.00 302.30 ? 126 SER C HB3  1 
ATOM 8922  H HG   . SER D 2 105 ? 253.723 189.293 199.995 1.00 302.30 ? 126 SER C HG   1 
ATOM 8923  N N    . PRO D 2 106 ? 250.468 189.698 196.335 1.00 246.85 ? 127 PRO C N    1 
ATOM 8924  C CA   . PRO D 2 106 ? 250.137 191.026 195.795 1.00 246.85 ? 127 PRO C CA   1 
ATOM 8925  C C    . PRO D 2 106 ? 249.200 191.803 196.698 1.00 246.85 ? 127 PRO C C    1 
ATOM 8926  O O    . PRO D 2 106 ? 249.157 193.036 196.621 1.00 246.85 ? 127 PRO C O    1 
ATOM 8927  C CB   . PRO D 2 106 ? 249.481 190.704 194.447 1.00 246.85 ? 127 PRO C CB   1 
ATOM 8928  C CG   . PRO D 2 106 ? 249.033 189.290 194.587 1.00 246.85 ? 127 PRO C CG   1 
ATOM 8929  C CD   . PRO D 2 106 ? 250.064 188.612 195.443 1.00 246.85 ? 127 PRO C CD   1 
ATOM 8930  H HA   . PRO D 2 106 ? 250.944 191.543 195.645 1.00 296.22 ? 127 PRO C HA   1 
ATOM 8931  H HB2  . PRO D 2 106 ? 248.724 191.293 194.301 1.00 296.22 ? 127 PRO C HB2  1 
ATOM 8932  H HB3  . PRO D 2 106 ? 250.130 190.793 193.733 1.00 296.22 ? 127 PRO C HB3  1 
ATOM 8933  H HG2  . PRO D 2 106 ? 248.164 189.267 195.020 1.00 296.22 ? 127 PRO C HG2  1 
ATOM 8934  H HG3  . PRO D 2 106 ? 248.989 188.872 193.716 1.00 296.22 ? 127 PRO C HG3  1 
ATOM 8935  H HD2  . PRO D 2 106 ? 249.661 187.881 195.935 1.00 296.22 ? 127 PRO C HD2  1 
ATOM 8936  H HD3  . PRO D 2 106 ? 250.806 188.309 194.897 1.00 296.22 ? 127 PRO C HD3  1 
ATOM 8937  N N    . TYR D 2 107 ? 248.451 191.110 197.556 1.00 238.43 ? 128 TYR C N    1 
ATOM 8938  C CA   . TYR D 2 107 ? 247.554 191.767 198.499 1.00 238.43 ? 128 TYR C CA   1 
ATOM 8939  C C    . TYR D 2 107 ? 248.322 192.482 199.605 1.00 238.43 ? 128 TYR C C    1 
ATOM 8940  O O    . TYR D 2 107 ? 247.838 193.473 200.166 1.00 238.43 ? 128 TYR C O    1 
ATOM 8941  C CB   . TYR D 2 107 ? 246.583 190.751 199.103 1.00 238.43 ? 128 TYR C CB   1 
ATOM 8942  C CG   . TYR D 2 107 ? 245.521 191.370 199.985 1.00 238.43 ? 128 TYR C CG   1 
ATOM 8943  C CD1  . TYR D 2 107 ? 244.486 192.097 199.416 1.00 238.43 ? 128 TYR C CD1  1 
ATOM 8944  C CD2  . TYR D 2 107 ? 245.583 191.212 201.361 1.00 238.43 ? 128 TYR C CD2  1 
ATOM 8945  C CE1  . TYR D 2 107 ? 243.516 192.663 200.221 1.00 238.43 ? 128 TYR C CE1  1 
ATOM 8946  C CE2  . TYR D 2 107 ? 244.613 191.778 202.166 1.00 238.43 ? 128 TYR C CE2  1 
ATOM 8947  C CZ   . TYR D 2 107 ? 243.583 192.501 201.600 1.00 238.43 ? 128 TYR C CZ   1 
ATOM 8948  O OH   . TYR D 2 107 ? 242.617 193.065 202.402 1.00 238.43 ? 128 TYR C OH   1 
ATOM 8949  H H    . TYR D 2 107 ? 248.435 190.252 197.609 1.00 286.12 ? 128 TYR C H    1 
ATOM 8950  H HA   . TYR D 2 107 ? 247.016 192.422 198.027 1.00 286.12 ? 128 TYR C HA   1 
ATOM 8951  H HB2  . TYR D 2 107 ? 246.084 190.203 198.303 1.00 286.12 ? 128 TYR C HB2  1 
ATOM 8952  H HB3  . TYR D 2 107 ? 247.139 190.026 199.698 1.00 286.12 ? 128 TYR C HB3  1 
ATOM 8953  H HD1  . TYR D 2 107 ? 244.437 192.222 198.334 1.00 286.12 ? 128 TYR C HD1  1 
ATOM 8954  H HD2  . TYR D 2 107 ? 246.397 190.641 201.808 1.00 286.12 ? 128 TYR C HD2  1 
ATOM 8955  H HE1  . TYR D 2 107 ? 242.702 193.234 199.774 1.00 286.12 ? 128 TYR C HE1  1 
ATOM 8956  H HE2  . TYR D 2 107 ? 244.662 191.654 203.248 1.00 286.12 ? 128 TYR C HE2  1 
ATOM 8957  H HH   . TYR D 2 107 ? 241.975 193.522 201.854 1.00 286.12 ? 128 TYR C HH   1 
ATOM 8958  N N    . GLU D 2 108 ? 249.512 191.988 199.943 1.00 271.89 ? 129 GLU C N    1 
ATOM 8959  C CA   . GLU D 2 108 ? 250.269 192.496 201.082 1.00 271.89 ? 129 GLU C CA   1 
ATOM 8960  C C    . GLU D 2 108 ? 250.550 193.996 200.949 1.00 271.89 ? 129 GLU C C    1 
ATOM 8961  O O    . GLU D 2 108 ? 251.033 194.433 199.895 1.00 271.89 ? 129 GLU C O    1 
ATOM 8962  C CB   . GLU D 2 108 ? 251.586 191.731 201.224 1.00 271.89 ? 129 GLU C CB   1 
ATOM 8963  C CG   . GLU D 2 108 ? 252.432 192.152 202.417 1.00 271.89 ? 129 GLU C CG   1 
ATOM 8964  C CD   . GLU D 2 108 ? 253.746 191.424 202.489 1.00 271.89 ? 129 GLU C CD   1 
ATOM 8965  O OE1  . GLU D 2 108 ? 254.014 190.635 201.615 1.00 271.89 ? 129 GLU C OE1  1 
ATOM 8966  O OE2  . GLU D 2 108 ? 254.482 191.658 203.418 1.00 271.89 ? 129 GLU C OE2  1 
ATOM 8967  H H    . GLU D 2 108 ? 249.906 191.347 199.527 1.00 326.27 ? 129 GLU C H    1 
ATOM 8968  H HA   . GLU D 2 108 ? 249.762 192.295 201.879 1.00 326.27 ? 129 GLU C HA   1 
ATOM 8969  H HB2  . GLU D 2 108 ? 251.379 190.665 201.320 1.00 326.27 ? 129 GLU C HB2  1 
ATOM 8970  H HB3  . GLU D 2 108 ? 252.186 191.869 200.324 1.00 326.27 ? 129 GLU C HB3  1 
ATOM 8971  H HG2  . GLU D 2 108 ? 252.626 193.222 202.353 1.00 326.27 ? 129 GLU C HG2  1 
ATOM 8972  H HG3  . GLU D 2 108 ? 251.869 191.966 203.331 1.00 326.27 ? 129 GLU C HG3  1 
ATOM 8973  N N    . PRO D 2 109 ? 250.264 194.824 201.982 1.00 278.28 ? 130 PRO C N    1 
ATOM 8974  C CA   . PRO D 2 109 ? 250.601 196.254 201.892 1.00 278.28 ? 130 PRO C CA   1 
ATOM 8975  C C    . PRO D 2 109 ? 252.100 196.517 201.994 1.00 278.28 ? 130 PRO C C    1 
ATOM 8976  O O    . PRO D 2 109 ? 252.562 196.992 203.037 1.00 278.28 ? 130 PRO C O    1 
ATOM 8977  C CB   . PRO D 2 109 ? 249.852 196.855 203.085 1.00 278.28 ? 130 PRO C CB   1 
ATOM 8978  C CG   . PRO D 2 109 ? 249.835 195.759 204.096 1.00 278.28 ? 130 PRO C CG   1 
ATOM 8979  C CD   . PRO D 2 109 ? 249.622 194.507 203.287 1.00 278.28 ? 130 PRO C CD   1 
ATOM 8980  H HA   . PRO D 2 109 ? 250.261 196.627 201.063 1.00 333.94 ? 130 PRO C HA   1 
ATOM 8981  H HB2  . PRO D 2 109 ? 250.372 197.756 203.441 1.00 333.94 ? 130 PRO C HB2  1 
ATOM 8982  H HB3  . PRO D 2 109 ? 248.843 197.167 202.777 1.00 333.94 ? 130 PRO C HB3  1 
ATOM 8983  H HG2  . PRO D 2 109 ? 250.782 195.745 204.656 1.00 333.94 ? 130 PRO C HG2  1 
ATOM 8984  H HG3  . PRO D 2 109 ? 249.034 195.931 204.829 1.00 333.94 ? 130 PRO C HG3  1 
ATOM 8985  H HD2  . PRO D 2 109 ? 250.120 193.661 203.783 1.00 333.94 ? 130 PRO C HD2  1 
ATOM 8986  H HD3  . PRO D 2 109 ? 248.544 194.316 203.183 1.00 333.94 ? 130 PRO C HD3  1 
ATOM 8987  N N    . VAL D 2 110 ? 252.854 196.107 200.959 1.00 303.14 ? 131 VAL C N    1 
ATOM 8988  C CA   . VAL D 2 110 ? 254.330 196.066 200.994 1.00 303.14 ? 131 VAL C CA   1 
ATOM 8989  C C    . VAL D 2 110 ? 254.916 197.320 201.630 1.00 303.14 ? 131 VAL C C    1 
ATOM 8990  O O    . VAL D 2 110 ? 255.849 197.239 202.439 1.00 303.14 ? 131 VAL C O    1 
ATOM 8991  C CB   . VAL D 2 110 ? 254.896 195.918 199.569 1.00 303.14 ? 131 VAL C CB   1 
ATOM 8992  C CG1  . VAL D 2 110 ? 256.405 196.114 199.573 1.00 303.14 ? 131 VAL C CG1  1 
ATOM 8993  C CG2  . VAL D 2 110 ? 254.531 194.553 199.006 1.00 303.14 ? 131 VAL C CG2  1 
ATOM 8994  H H    . VAL D 2 110 ? 252.494 195.785 200.251 1.00 363.77 ? 131 VAL C H    1 
ATOM 8995  H HA   . VAL D 2 110 ? 254.584 195.332 201.568 1.00 363.77 ? 131 VAL C HA   1 
ATOM 8996  H HB   . VAL D 2 110 ? 254.472 196.698 198.936 1.00 363.77 ? 131 VAL C HB   1 
ATOM 8997  H HG11 . VAL D 2 110 ? 256.789 196.006 198.558 1.00 363.77 ? 131 VAL C HG11 1 
ATOM 8998  H HG12 . VAL D 2 110 ? 256.641 197.111 199.945 1.00 363.77 ? 131 VAL C HG12 1 
ATOM 8999  H HG13 . VAL D 2 110 ? 256.868 195.366 200.216 1.00 363.77 ? 131 VAL C HG13 1 
ATOM 9000  H HG21 . VAL D 2 110 ? 254.935 194.455 197.999 1.00 363.77 ? 131 VAL C HG21 1 
ATOM 9001  H HG22 . VAL D 2 110 ? 254.951 193.773 199.643 1.00 363.77 ? 131 VAL C HG22 1 
ATOM 9002  H HG23 . VAL D 2 110 ? 253.447 194.450 198.974 1.00 363.77 ? 131 VAL C HG23 1 
ATOM 9003  N N    . THR D 2 111 ? 254.402 198.495 201.261 1.00 341.52 ? 132 THR C N    1 
ATOM 9004  C CA   . THR D 2 111 ? 254.962 199.748 201.752 1.00 341.52 ? 132 THR C CA   1 
ATOM 9005  C C    . THR D 2 111 ? 254.829 199.885 203.262 1.00 341.52 ? 132 THR C C    1 
ATOM 9006  O O    . THR D 2 111 ? 255.635 200.596 203.878 1.00 341.52 ? 132 THR C O    1 
ATOM 9007  C CB   . THR D 2 111 ? 254.289 200.953 201.069 1.00 341.52 ? 132 THR C CB   1 
ATOM 9008  O OG1  . THR D 2 111 ? 252.886 200.950 201.364 1.00 341.52 ? 132 THR C OG1  1 
ATOM 9009  C CG2  . THR D 2 111 ? 254.487 200.891 199.562 1.00 341.52 ? 132 THR C CG2  1 
ATOM 9010  H H    . THR D 2 111 ? 253.730 198.580 200.737 1.00 409.82 ? 132 THR C H    1 
ATOM 9011  H HA   . THR D 2 111 ? 255.907 199.765 201.533 1.00 409.82 ? 132 THR C HA   1 
ATOM 9012  H HB   . THR D 2 111 ? 254.725 201.877 201.449 1.00 409.82 ? 132 THR C HB   1 
ATOM 9013  H HG1  . THR D 2 111 ? 252.742 201.330 202.234 1.00 409.82 ? 132 THR C HG1  1 
ATOM 9014  H HG21 . THR D 2 111 ? 254.005 201.750 199.096 1.00 409.82 ? 132 THR C HG21 1 
ATOM 9015  H HG22 . THR D 2 111 ? 255.553 200.904 199.334 1.00 409.82 ? 132 THR C HG22 1 
ATOM 9016  H HG23 . THR D 2 111 ? 254.045 199.974 199.175 1.00 409.82 ? 132 THR C HG23 1 
ATOM 9017  N N    . SER D 2 112 ? 253.864 199.187 203.873 1.00 328.06 ? 133 SER C N    1 
ATOM 9018  C CA   . SER D 2 112 ? 253.683 199.238 205.317 1.00 328.06 ? 133 SER C CA   1 
ATOM 9019  C C    . SER D 2 112 ? 254.766 198.476 206.068 1.00 328.06 ? 133 SER C C    1 
ATOM 9020  O O    . SER D 2 112 ? 254.870 198.642 207.288 1.00 328.06 ? 133 SER C O    1 
ATOM 9021  C CB   . SER D 2 112 ? 252.323 198.677 205.684 1.00 328.06 ? 133 SER C CB   1 
ATOM 9022  O OG   . SER D 2 112 ? 251.295 199.501 205.206 1.00 328.06 ? 133 SER C OG   1 
ATOM 9023  H H    . SER D 2 112 ? 253.304 198.674 203.468 1.00 393.67 ? 133 SER C H    1 
ATOM 9024  H HA   . SER D 2 112 ? 253.719 200.163 205.603 1.00 393.67 ? 133 SER C HA   1 
ATOM 9025  H HB2  . SER D 2 112 ? 252.217 197.677 205.264 1.00 393.67 ? 133 SER C HB2  1 
ATOM 9026  H HB3  . SER D 2 112 ? 252.247 198.587 206.767 1.00 393.67 ? 133 SER C HB3  1 
ATOM 9027  H HG   . SER D 2 112 ? 250.474 199.088 205.485 1.00 393.67 ? 133 SER C HG   1 
ATOM 9028  N N    . ARG D 2 113 ? 255.566 197.657 205.364 1.00 308.89 ? 134 ARG C N    1 
ATOM 9029  C CA   . ARG D 2 113 ? 256.597 196.849 206.013 1.00 308.89 ? 134 ARG C CA   1 
ATOM 9030  C C    . ARG D 2 113 ? 257.494 197.707 206.890 1.00 308.89 ? 134 ARG C C    1 
ATOM 9031  O O    . ARG D 2 113 ? 257.812 197.324 208.024 1.00 308.89 ? 134 ARG C O    1 
ATOM 9032  C CB   . ARG D 2 113 ? 257.449 196.128 204.978 1.00 308.89 ? 134 ARG C CB   1 
ATOM 9033  C CG   . ARG D 2 113 ? 256.765 194.958 204.289 1.00 308.89 ? 134 ARG C CG   1 
ATOM 9034  C CD   . ARG D 2 113 ? 257.594 194.409 203.186 1.00 308.89 ? 134 ARG C CD   1 
ATOM 9035  N NE   . ARG D 2 113 ? 256.948 193.283 202.531 1.00 308.89 ? 134 ARG C NE   1 
ATOM 9036  C CZ   . ARG D 2 113 ? 257.360 192.733 201.372 1.00 308.89 ? 134 ARG C CZ   1 
ATOM 9037  N NH1  . ARG D 2 113 ? 258.417 193.214 200.755 1.00 308.89 ? 134 ARG C NH1  1 
ATOM 9038  N NH2  . ARG D 2 113 ? 256.703 191.709 200.856 1.00 308.89 ? 134 ARG C NH2  1 
ATOM 9039  H H    . ARG D 2 113 ? 255.526 197.557 204.511 1.00 370.67 ? 134 ARG C H    1 
ATOM 9040  H HA   . ARG D 2 113 ? 256.180 196.202 206.597 1.00 370.67 ? 134 ARG C HA   1 
ATOM 9041  H HB2  . ARG D 2 113 ? 257.754 196.833 204.205 1.00 370.67 ? 134 ARG C HB2  1 
ATOM 9042  H HB3  . ARG D 2 113 ? 258.354 195.749 205.451 1.00 370.67 ? 134 ARG C HB3  1 
ATOM 9043  H HG2  . ARG D 2 113 ? 256.587 194.163 205.014 1.00 370.67 ? 134 ARG C HG2  1 
ATOM 9044  H HG3  . ARG D 2 113 ? 255.813 195.288 203.871 1.00 370.67 ? 134 ARG C HG3  1 
ATOM 9045  H HD2  . ARG D 2 113 ? 257.767 195.184 202.441 1.00 370.67 ? 134 ARG C HD2  1 
ATOM 9046  H HD3  . ARG D 2 113 ? 258.549 194.068 203.585 1.00 370.67 ? 134 ARG C HD3  1 
ATOM 9047  H HE   . ARG D 2 113 ? 256.131 192.885 202.976 1.00 370.67 ? 134 ARG C HE   1 
ATOM 9048  H HH11 . ARG D 2 113 ? 258.919 193.997 201.150 1.00 370.67 ? 134 ARG C HH11 1 
ATOM 9049  H HH12 . ARG D 2 113 ? 258.726 192.802 199.887 1.00 370.67 ? 134 ARG C HH12 1 
ATOM 9050  H HH21 . ARG D 2 113 ? 255.890 191.339 201.330 1.00 370.67 ? 134 ARG C HH21 1 
ATOM 9051  H HH22 . ARG D 2 113 ? 257.012 191.297 199.988 1.00 370.67 ? 134 ARG C HH22 1 
ATOM 9052  N N    . LEU D 2 114 ? 257.889 198.881 206.382 1.00 354.58 ? 135 LEU C N    1 
ATOM 9053  C CA   . LEU D 2 114 ? 258.698 199.811 207.164 1.00 354.58 ? 135 LEU C CA   1 
ATOM 9054  C C    . LEU D 2 114 ? 257.932 200.289 208.389 1.00 354.58 ? 135 LEU C C    1 
ATOM 9055  O O    . LEU D 2 114 ? 258.428 200.183 209.522 1.00 354.58 ? 135 LEU C O    1 
ATOM 9056  C CB   . LEU D 2 114 ? 259.108 201.014 206.305 1.00 354.58 ? 135 LEU C CB   1 
ATOM 9057  C CG   . LEU D 2 114 ? 259.907 202.106 207.029 1.00 354.58 ? 135 LEU C CG   1 
ATOM 9058  C CD1  . LEU D 2 114 ? 261.210 201.518 207.555 1.00 354.58 ? 135 LEU C CD1  1 
ATOM 9059  C CD2  . LEU D 2 114 ? 260.175 203.258 206.072 1.00 354.58 ? 135 LEU C CD2  1 
ATOM 9060  H H    . LEU D 2 114 ? 257.702 199.157 205.588 1.00 425.50 ? 135 LEU C H    1 
ATOM 9061  H HA   . LEU D 2 114 ? 259.501 199.359 207.465 1.00 425.50 ? 135 LEU C HA   1 
ATOM 9062  H HB2  . LEU D 2 114 ? 259.714 200.657 205.474 1.00 425.50 ? 135 LEU C HB2  1 
ATOM 9063  H HB3  . LEU D 2 114 ? 258.208 201.476 205.900 1.00 425.50 ? 135 LEU C HB3  1 
ATOM 9064  H HG   . LEU D 2 114 ? 259.336 202.469 207.883 1.00 425.50 ? 135 LEU C HG   1 
ATOM 9065  H HD11 . LEU D 2 114 ? 261.777 202.294 208.069 1.00 425.50 ? 135 LEU C HD11 1 
ATOM 9066  H HD12 . LEU D 2 114 ? 260.989 200.709 208.252 1.00 425.50 ? 135 LEU C HD12 1 
ATOM 9067  H HD13 . LEU D 2 114 ? 261.796 201.131 206.723 1.00 425.50 ? 135 LEU C HD13 1 
ATOM 9068  H HD21 . LEU D 2 114 ? 260.742 204.034 206.586 1.00 425.50 ? 135 LEU C HD21 1 
ATOM 9069  H HD22 . LEU D 2 114 ? 260.747 202.896 205.217 1.00 425.50 ? 135 LEU C HD22 1 
ATOM 9070  H HD23 . LEU D 2 114 ? 259.227 203.670 205.725 1.00 425.50 ? 135 LEU C HD23 1 
ATOM 9071  N N    . SER D 2 115 ? 256.683 200.724 208.182 1.00 352.54 ? 136 SER C N    1 
ATOM 9072  C CA   . SER D 2 115 ? 255.830 201.141 209.289 1.00 352.54 ? 136 SER C CA   1 
ATOM 9073  C C    . SER D 2 115 ? 255.641 200.010 210.288 1.00 352.54 ? 136 SER C C    1 
ATOM 9074  O O    . SER D 2 115 ? 255.693 200.235 211.504 1.00 352.54 ? 136 SER C O    1 
ATOM 9075  C CB   . SER D 2 115 ? 254.481 201.598 208.768 1.00 352.54 ? 136 SER C CB   1 
ATOM 9076  O OG   . SER D 2 115 ? 254.612 202.749 207.980 1.00 352.54 ? 136 SER C OG   1 
ATOM 9077  H H    . SER D 2 115 ? 256.310 200.784 207.409 1.00 423.05 ? 136 SER C H    1 
ATOM 9078  H HA   . SER D 2 115 ? 256.249 201.883 209.751 1.00 423.05 ? 136 SER C HA   1 
ATOM 9079  H HB2  . SER D 2 115 ? 254.029 200.800 208.180 1.00 423.05 ? 136 SER C HB2  1 
ATOM 9080  H HB3  . SER D 2 115 ? 253.818 201.802 209.608 1.00 423.05 ? 136 SER C HB3  1 
ATOM 9081  H HG   . SER D 2 115 ? 253.727 202.961 207.673 1.00 423.05 ? 136 SER C HG   1 
ATOM 9082  N N    . ASP D 2 116 ? 255.492 198.776 209.791 1.00 338.63 ? 137 ASP C N    1 
ATOM 9083  C CA   . ASP D 2 116 ? 255.295 197.641 210.684 1.00 338.63 ? 137 ASP C CA   1 
ATOM 9084  C C    . ASP D 2 116 ? 256.459 197.515 211.653 1.00 338.63 ? 137 ASP C C    1 
ATOM 9085  O O    . ASP D 2 116 ? 256.257 197.223 212.839 1.00 338.63 ? 137 ASP C O    1 
ATOM 9086  C CB   . ASP D 2 116 ? 255.141 196.344 209.887 1.00 338.63 ? 137 ASP C CB   1 
ATOM 9087  C CG   . ASP D 2 116 ? 253.804 196.248 209.165 1.00 338.63 ? 137 ASP C CG   1 
ATOM 9088  O OD1  . ASP D 2 116 ? 252.919 197.003 209.491 1.00 338.63 ? 137 ASP C OD1  1 
ATOM 9089  O OD2  . ASP D 2 116 ? 253.680 195.420 208.294 1.00 338.63 ? 137 ASP C OD2  1 
ATOM 9090  H H    . ASP D 2 116 ? 255.515 198.574 208.959 1.00 406.36 ? 137 ASP C H    1 
ATOM 9091  H HA   . ASP D 2 116 ? 254.492 197.786 211.209 1.00 406.36 ? 137 ASP C HA   1 
ATOM 9092  H HB2  . ASP D 2 116 ? 255.941 196.273 209.150 1.00 406.36 ? 137 ASP C HB2  1 
ATOM 9093  H HB3  . ASP D 2 116 ? 255.237 195.490 210.558 1.00 406.36 ? 137 ASP C HB3  1 
ATOM 9094  N N    . ILE D 2 117 ? 257.678 197.799 211.186 1.00 332.22 ? 138 ILE C N    1 
ATOM 9095  C CA   . ILE D 2 117 ? 258.822 197.769 212.090 1.00 332.22 ? 138 ILE C CA   1 
ATOM 9096  C C    . ILE D 2 117 ? 258.645 198.832 213.165 1.00 332.22 ? 138 ILE C C    1 
ATOM 9097  O O    . ILE D 2 117 ? 258.779 198.553 214.365 1.00 332.22 ? 138 ILE C O    1 
ATOM 9098  C CB   . ILE D 2 117 ? 260.143 198.002 211.334 1.00 332.22 ? 138 ILE C CB   1 
ATOM 9099  C CG1  . ILE D 2 117 ? 260.432 196.831 210.392 1.00 332.22 ? 138 ILE C CG1  1 
ATOM 9100  C CG2  . ILE D 2 117 ? 261.289 198.198 212.314 1.00 332.22 ? 138 ILE C CG2  1 
ATOM 9101  C CD1  . ILE D 2 117 ? 261.528 197.110 209.389 1.00 332.22 ? 138 ILE C CD1  1 
ATOM 9102  H H    . ILE D 2 117 ? 257.862 198.006 210.371 1.00 398.66 ? 138 ILE C H    1 
ATOM 9103  H HA   . ILE D 2 117 ? 258.848 196.905 212.529 1.00 398.66 ? 138 ILE C HA   1 
ATOM 9104  H HB   . ILE D 2 117 ? 260.054 198.892 210.711 1.00 398.66 ? 138 ILE C HB   1 
ATOM 9105  H HG12 . ILE D 2 117 ? 260.720 195.957 210.976 1.00 398.66 ? 138 ILE C HG12 1 
ATOM 9106  H HG13 . ILE D 2 117 ? 259.527 196.572 209.843 1.00 398.66 ? 138 ILE C HG13 1 
ATOM 9107  H HG21 . ILE D 2 117 ? 262.215 198.360 211.763 1.00 398.66 ? 138 ILE C HG21 1 
ATOM 9108  H HG22 . ILE D 2 117 ? 261.086 199.063 212.944 1.00 398.66 ? 138 ILE C HG22 1 
ATOM 9109  H HG23 . ILE D 2 117 ? 261.390 197.310 212.938 1.00 398.66 ? 138 ILE C HG23 1 
ATOM 9110  H HD11 . ILE D 2 117 ? 261.675 196.234 208.757 1.00 398.66 ? 138 ILE C HD11 1 
ATOM 9111  H HD12 . ILE D 2 117 ? 261.245 197.961 208.768 1.00 398.66 ? 138 ILE C HD12 1 
ATOM 9112  H HD13 . ILE D 2 117 ? 262.454 197.337 209.915 1.00 398.66 ? 138 ILE C HD13 1 
ATOM 9113  N N    . PHE D 2 118 ? 258.252 200.043 212.755 1.00 351.11 ? 139 PHE C N    1 
ATOM 9114  C CA   . PHE D 2 118 ? 258.067 201.124 213.715 1.00 351.11 ? 139 PHE C CA   1 
ATOM 9115  C C    . PHE D 2 118 ? 256.898 200.838 214.646 1.00 351.11 ? 139 PHE C C    1 
ATOM 9116  O O    . PHE D 2 118 ? 256.922 201.258 215.811 1.00 351.11 ? 139 PHE C O    1 
ATOM 9117  C CB   . PHE D 2 118 ? 257.833 202.451 212.990 1.00 351.11 ? 139 PHE C CB   1 
ATOM 9118  C CG   . PHE D 2 118 ? 259.069 203.018 212.351 1.00 351.11 ? 139 PHE C CG   1 
ATOM 9119  C CD1  . PHE D 2 118 ? 260.177 203.343 213.119 1.00 351.11 ? 139 PHE C CD1  1 
ATOM 9120  C CD2  . PHE D 2 118 ? 259.126 203.227 210.981 1.00 351.11 ? 139 PHE C CD2  1 
ATOM 9121  C CE1  . PHE D 2 118 ? 261.314 203.866 212.534 1.00 351.11 ? 139 PHE C CE1  1 
ATOM 9122  C CE2  . PHE D 2 118 ? 260.263 203.749 210.393 1.00 351.11 ? 139 PHE C CE2  1 
ATOM 9123  C CZ   . PHE D 2 118 ? 261.357 204.069 211.169 1.00 351.11 ? 139 PHE C CZ   1 
ATOM 9124  H H    . PHE D 2 118 ? 258.088 200.257 211.938 1.00 421.33 ? 139 PHE C H    1 
ATOM 9125  H HA   . PHE D 2 118 ? 258.840 201.182 214.296 1.00 421.33 ? 139 PHE C HA   1 
ATOM 9126  H HB2  . PHE D 2 118 ? 257.082 202.313 212.213 1.00 421.33 ? 139 PHE C HB2  1 
ATOM 9127  H HB3  . PHE D 2 118 ? 257.445 203.186 213.693 1.00 421.33 ? 139 PHE C HB3  1 
ATOM 9128  H HD1  . PHE D 2 118 ? 260.144 203.183 214.197 1.00 421.33 ? 139 PHE C HD1  1 
ATOM 9129  H HD2  . PHE D 2 118 ? 258.261 202.975 210.368 1.00 421.33 ? 139 PHE C HD2  1 
ATOM 9130  H HE1  . PHE D 2 118 ? 262.178 204.118 213.149 1.00 421.33 ? 139 PHE C HE1  1 
ATOM 9131  H HE2  . PHE D 2 118 ? 260.294 203.908 209.316 1.00 421.33 ? 139 PHE C HE2  1 
ATOM 9132  H HZ   . PHE D 2 118 ? 262.253 204.479 210.706 1.00 421.33 ? 139 PHE C HZ   1 
ATOM 9133  N N    . ARG D 2 119 ? 255.888 200.094 214.170 1.00 329.83 ? 140 ARG C N    1 
ATOM 9134  C CA   . ARG D 2 119 ? 254.751 199.796 215.033 1.00 329.83 ? 140 ARG C CA   1 
ATOM 9135  C C    . ARG D 2 119 ? 255.201 199.071 216.290 1.00 329.83 ? 140 ARG C C    1 
ATOM 9136  O O    . ARG D 2 119 ? 254.560 199.206 217.340 1.00 329.83 ? 140 ARG C O    1 
ATOM 9137  C CB   . ARG D 2 119 ? 253.725 198.944 214.300 1.00 329.83 ? 140 ARG C CB   1 
ATOM 9138  C CG   . ARG D 2 119 ? 252.959 199.668 213.204 1.00 329.83 ? 140 ARG C CG   1 
ATOM 9139  C CD   . ARG D 2 119 ? 251.972 198.776 212.543 1.00 329.83 ? 140 ARG C CD   1 
ATOM 9140  N NE   . ARG D 2 119 ? 251.338 199.419 211.403 1.00 329.83 ? 140 ARG C NE   1 
ATOM 9141  C CZ   . ARG D 2 119 ? 250.280 200.248 211.483 1.00 329.83 ? 140 ARG C CZ   1 
ATOM 9142  N NH1  . ARG D 2 119 ? 249.748 200.525 212.653 1.00 329.83 ? 140 ARG C NH1  1 
ATOM 9143  N NH2  . ARG D 2 119 ? 249.775 200.784 210.385 1.00 329.83 ? 140 ARG C NH2  1 
ATOM 9144  H H    . ARG D 2 119 ? 255.842 199.762 213.379 1.00 395.80 ? 140 ARG C H    1 
ATOM 9145  H HA   . ARG D 2 119 ? 254.333 200.629 215.303 1.00 395.80 ? 140 ARG C HA   1 
ATOM 9146  H HB2  . ARG D 2 119 ? 254.222 198.089 213.844 1.00 395.80 ? 140 ARG C HB2  1 
ATOM 9147  H HB3  . ARG D 2 119 ? 252.996 198.558 215.012 1.00 395.80 ? 140 ARG C HB3  1 
ATOM 9148  H HG2  . ARG D 2 119 ? 252.422 200.515 213.634 1.00 395.80 ? 140 ARG C HG2  1 
ATOM 9149  H HG3  . ARG D 2 119 ? 253.657 200.028 212.448 1.00 395.80 ? 140 ARG C HG3  1 
ATOM 9150  H HD2  . ARG D 2 119 ? 252.474 197.876 212.191 1.00 395.80 ? 140 ARG C HD2  1 
ATOM 9151  H HD3  . ARG D 2 119 ? 251.195 198.503 213.255 1.00 395.80 ? 140 ARG C HD3  1 
ATOM 9152  H HE   . ARG D 2 119 ? 251.719 199.231 210.485 1.00 395.80 ? 140 ARG C HE   1 
ATOM 9153  H HH11 . ARG D 2 119 ? 250.134 200.115 213.493 1.00 395.80 ? 140 ARG C HH11 1 
ATOM 9154  H HH12 . ARG D 2 119 ? 248.955 201.146 212.714 1.00 395.80 ? 140 ARG C HH12 1 
ATOM 9155  H HH21 . ARG D 2 119 ? 250.183 200.571 209.485 1.00 395.80 ? 140 ARG C HH21 1 
ATOM 9156  H HH22 . ARG D 2 119 ? 248.982 201.405 210.445 1.00 395.80 ? 140 ARG C HH22 1 
ATOM 9157  N N    . LEU D 2 120 ? 256.337 198.361 216.219 1.00 320.30 ? 141 LEU C N    1 
ATOM 9158  C CA   . LEU D 2 120 ? 256.853 197.673 217.399 1.00 320.30 ? 141 LEU C CA   1 
ATOM 9159  C C    . LEU D 2 120 ? 257.185 198.663 218.506 1.00 320.30 ? 141 LEU C C    1 
ATOM 9160  O O    . LEU D 2 120 ? 256.918 198.391 219.684 1.00 320.30 ? 141 LEU C O    1 
ATOM 9161  C CB   . LEU D 2 120 ? 258.104 196.863 217.038 1.00 320.30 ? 141 LEU C CB   1 
ATOM 9162  C CG   . LEU D 2 120 ? 257.878 195.675 216.094 1.00 320.30 ? 141 LEU C CG   1 
ATOM 9163  C CD1  . LEU D 2 120 ? 259.221 195.083 215.690 1.00 320.30 ? 141 LEU C CD1  1 
ATOM 9164  C CD2  . LEU D 2 120 ? 257.009 194.635 216.786 1.00 320.30 ? 141 LEU C CD2  1 
ATOM 9165  H H    . LEU D 2 120 ? 256.814 198.266 215.510 1.00 384.36 ? 141 LEU C H    1 
ATOM 9166  H HA   . LEU D 2 120 ? 256.172 197.074 217.737 1.00 384.36 ? 141 LEU C HA   1 
ATOM 9167  H HB2  . LEU D 2 120 ? 258.825 197.528 216.565 1.00 384.36 ? 141 LEU C HB2  1 
ATOM 9168  H HB3  . LEU D 2 120 ? 258.545 196.477 217.957 1.00 384.36 ? 141 LEU C HB3  1 
ATOM 9169  H HG   . LEU D 2 120 ? 257.379 196.020 215.188 1.00 384.36 ? 141 LEU C HG   1 
ATOM 9170  H HD11 . LEU D 2 120 ? 259.060 194.239 215.019 1.00 384.36 ? 141 LEU C HD11 1 
ATOM 9171  H HD12 . LEU D 2 120 ? 259.815 195.843 215.180 1.00 384.36 ? 141 LEU C HD12 1 
ATOM 9172  H HD13 . LEU D 2 120 ? 259.752 194.744 216.579 1.00 384.36 ? 141 LEU C HD13 1 
ATOM 9173  H HD21 . LEU D 2 120 ? 256.847 193.791 216.115 1.00 384.36 ? 141 LEU C HD21 1 
ATOM 9174  H HD22 . LEU D 2 120 ? 257.507 194.289 217.692 1.00 384.36 ? 141 LEU C HD22 1 
ATOM 9175  H HD23 . LEU D 2 120 ? 256.048 195.080 217.048 1.00 384.36 ? 141 LEU C HD23 1 
ATOM 9176  N N    . ALA D 2 121 ? 257.716 199.836 218.140 1.00 347.10 ? 142 ALA C N    1 
ATOM 9177  C CA   . ALA D 2 121 ? 258.005 200.858 219.140 1.00 347.10 ? 142 ALA C CA   1 
ATOM 9178  C C    . ALA D 2 121 ? 256.725 201.347 219.801 1.00 347.10 ? 142 ALA C C    1 
ATOM 9179  O O    . ALA D 2 121 ? 256.681 201.534 221.024 1.00 347.10 ? 142 ALA C O    1 
ATOM 9180  C CB   . ALA D 2 121 ? 258.763 202.023 218.503 1.00 347.10 ? 142 ALA C CB   1 
ATOM 9181  H H    . ALA D 2 121 ? 257.913 200.059 217.332 1.00 416.52 ? 142 ALA C H    1 
ATOM 9182  H HA   . ALA D 2 121 ? 258.570 200.473 219.829 1.00 416.52 ? 142 ALA C HA   1 
ATOM 9183  H HB1  . ALA D 2 121 ? 258.999 202.660 219.195 1.00 416.52 ? 142 ALA C HB1  1 
ATOM 9184  H HB2  . ALA D 2 121 ? 259.565 201.682 218.079 1.00 416.52 ? 142 ALA C HB2  1 
ATOM 9185  H HB3  . ALA D 2 121 ? 258.194 202.448 217.843 1.00 416.52 ? 142 ALA C HB3  1 
ATOM 9186  N N    . SER D 2 122 ? 255.659 201.516 219.012 1.00 342.57 ? 143 SER C N    1 
ATOM 9187  C CA   . SER D 2 122 ? 254.381 201.930 219.579 1.00 342.57 ? 143 SER C CA   1 
ATOM 9188  C C    . SER D 2 122 ? 253.826 200.855 220.504 1.00 342.57 ? 143 SER C C    1 
ATOM 9189  O O    . SER D 2 122 ? 253.391 201.154 221.623 1.00 342.57 ? 143 SER C O    1 
ATOM 9190  C CB   . SER D 2 122 ? 253.386 202.224 218.473 1.00 342.57 ? 143 SER C CB   1 
ATOM 9191  O OG   . SER D 2 122 ? 253.781 203.342 217.727 1.00 342.57 ? 143 SER C OG   1 
ATOM 9192  H H    . SER D 2 122 ? 255.652 201.400 218.160 1.00 411.08 ? 143 SER C H    1 
ATOM 9193  H HA   . SER D 2 122 ? 254.511 202.738 220.099 1.00 411.08 ? 143 SER C HA   1 
ATOM 9194  H HB2  . SER D 2 122 ? 253.303 201.356 217.819 1.00 411.08 ? 143 SER C HB2  1 
ATOM 9195  H HB3  . SER D 2 122 ? 252.403 202.402 218.907 1.00 411.08 ? 143 SER C HB3  1 
ATOM 9196  H HG   . SER D 2 122 ? 253.101 203.469 217.061 1.00 411.08 ? 143 SER C HG   1 
ATOM 9197  N N    . ILE D 2 123 ? 253.879 199.594 220.070 1.00 311.36 ? 144 ILE C N    1 
ATOM 9198  C CA   . ILE D 2 123 ? 253.370 198.508 220.899 1.00 311.36 ? 144 ILE C CA   1 
ATOM 9199  C C    . ILE D 2 123 ? 254.166 198.419 222.194 1.00 311.36 ? 144 ILE C C    1 
ATOM 9200  O O    . ILE D 2 123 ? 253.615 198.111 223.257 1.00 311.36 ? 144 ILE C O    1 
ATOM 9201  C CB   . ILE D 2 123 ? 253.434 197.162 220.155 1.00 311.36 ? 144 ILE C CB   1 
ATOM 9202  C CG1  . ILE D 2 123 ? 252.446 197.151 218.985 1.00 311.36 ? 144 ILE C CG1  1 
ATOM 9203  C CG2  . ILE D 2 123 ? 253.148 196.013 221.108 1.00 311.36 ? 144 ILE C CG2  1 
ATOM 9204  C CD1  . ILE D 2 123 ? 252.637 195.991 218.035 1.00 311.36 ? 144 ILE C CD1  1 
ATOM 9205  H H    . ILE D 2 123 ? 254.203 199.348 219.313 1.00 373.63 ? 144 ILE C H    1 
ATOM 9206  H HA   . ILE D 2 123 ? 252.451 198.701 221.142 1.00 373.63 ? 144 ILE C HA   1 
ATOM 9207  H HB   . ILE D 2 123 ? 254.428 197.029 219.728 1.00 373.63 ? 144 ILE C HB   1 
ATOM 9208  H HG12 . ILE D 2 123 ? 251.427 197.113 219.371 1.00 373.63 ? 144 ILE C HG12 1 
ATOM 9209  H HG13 . ILE D 2 123 ? 252.544 198.076 218.417 1.00 373.63 ? 144 ILE C HG13 1 
ATOM 9210  H HG21 . ILE D 2 123 ? 253.197 195.069 220.566 1.00 373.63 ? 144 ILE C HG21 1 
ATOM 9211  H HG22 . ILE D 2 123 ? 253.888 196.010 221.907 1.00 373.63 ? 144 ILE C HG22 1 
ATOM 9212  H HG23 . ILE D 2 123 ? 252.153 196.134 221.536 1.00 373.63 ? 144 ILE C HG23 1 
ATOM 9213  H HD11 . ILE D 2 123 ? 251.900 196.052 217.234 1.00 373.63 ? 144 ILE C HD11 1 
ATOM 9214  H HD12 . ILE D 2 123 ? 253.640 196.030 217.610 1.00 373.63 ? 144 ILE C HD12 1 
ATOM 9215  H HD13 . ILE D 2 123 ? 252.507 195.054 218.575 1.00 373.63 ? 144 ILE C HD13 1 
ATOM 9216  N N    . PHE D 2 124 ? 255.474 198.686 222.130 1.00 319.53 ? 145 PHE C N    1 
ATOM 9217  C CA   . PHE D 2 124 ? 256.282 198.653 223.342 1.00 319.53 ? 145 PHE C CA   1 
ATOM 9218  C C    . PHE D 2 124 ? 255.727 199.613 224.387 1.00 319.53 ? 145 PHE C C    1 
ATOM 9219  O O    . PHE D 2 124 ? 255.818 199.356 225.594 1.00 319.53 ? 145 PHE C O    1 
ATOM 9220  C CB   . PHE D 2 124 ? 257.736 199.014 223.028 1.00 319.53 ? 145 PHE C CB   1 
ATOM 9221  C CG   . PHE D 2 124 ? 258.659 198.890 224.207 1.00 319.53 ? 145 PHE C CG   1 
ATOM 9222  C CD1  . PHE D 2 124 ? 259.102 197.647 224.632 1.00 319.53 ? 145 PHE C CD1  1 
ATOM 9223  C CD2  . PHE D 2 124 ? 259.085 200.017 224.894 1.00 319.53 ? 145 PHE C CD2  1 
ATOM 9224  C CE1  . PHE D 2 124 ? 259.951 197.532 225.717 1.00 319.53 ? 145 PHE C CE1  1 
ATOM 9225  C CE2  . PHE D 2 124 ? 259.934 199.906 225.978 1.00 319.53 ? 145 PHE C CE2  1 
ATOM 9226  C CZ   . PHE D 2 124 ? 260.367 198.661 226.389 1.00 319.53 ? 145 PHE C CZ   1 
ATOM 9227  H H    . PHE D 2 124 ? 255.911 198.877 221.414 1.00 383.44 ? 145 PHE C H    1 
ATOM 9228  H HA   . PHE D 2 124 ? 256.258 197.757 223.714 1.00 383.44 ? 145 PHE C HA   1 
ATOM 9229  H HB2  . PHE D 2 124 ? 258.108 198.366 222.236 1.00 383.44 ? 145 PHE C HB2  1 
ATOM 9230  H HB3  . PHE D 2 124 ? 257.785 200.039 222.663 1.00 383.44 ? 145 PHE C HB3  1 
ATOM 9231  H HD1  . PHE D 2 124 ? 258.773 196.754 224.099 1.00 383.44 ? 145 PHE C HD1  1 
ATOM 9232  H HD2  . PHE D 2 124 ? 258.742 201.000 224.569 1.00 383.44 ? 145 PHE C HD2  1 
ATOM 9233  H HE1  . PHE D 2 124 ? 260.291 196.549 226.040 1.00 383.44 ? 145 PHE C HE1  1 
ATOM 9234  H HE2  . PHE D 2 124 ? 260.262 200.799 226.508 1.00 383.44 ? 145 PHE C HE2  1 
ATOM 9235  H HZ   . PHE D 2 124 ? 261.036 198.572 227.244 1.00 383.44 ? 145 PHE C HZ   1 
ATOM 9236  N N    . SER D 2 125 ? 255.137 200.727 223.937 1.00 355.33 ? 146 SER C N    1 
ATOM 9237  C CA   . SER D 2 125 ? 254.576 201.715 224.855 1.00 355.33 ? 146 SER C CA   1 
ATOM 9238  C C    . SER D 2 125 ? 253.134 201.376 225.214 1.00 355.33 ? 146 SER C C    1 
ATOM 9239  O O    . SER D 2 125 ? 252.746 201.441 226.385 1.00 355.33 ? 146 SER C O    1 
ATOM 9240  C CB   . SER D 2 125 ? 254.640 203.098 224.237 1.00 355.33 ? 146 SER C CB   1 
ATOM 9241  O OG   . SER D 2 125 ? 254.085 204.057 225.095 1.00 355.33 ? 146 SER C OG   1 
ATOM 9242  H H    . SER D 2 125 ? 255.052 200.938 223.108 1.00 426.40 ? 146 SER C H    1 
ATOM 9243  H HA   . SER D 2 125 ? 255.089 201.738 225.676 1.00 426.40 ? 146 SER C HA   1 
ATOM 9244  H HB2  . SER D 2 125 ? 255.678 203.353 224.024 1.00 426.40 ? 146 SER C HB2  1 
ATOM 9245  H HB3  . SER D 2 125 ? 254.102 203.099 223.290 1.00 426.40 ? 146 SER C HB3  1 
ATOM 9246  H HG   . SER D 2 125 ? 254.162 204.897 224.637 1.00 426.40 ? 146 SER C HG   1 
ATOM 9247  N N    . GLY D 2 126 ? 252.330 201.011 224.220 1.00 314.74 ? 147 GLY C N    1 
ATOM 9248  C CA   . GLY D 2 126 ? 250.937 200.674 224.444 1.00 314.74 ? 147 GLY C CA   1 
ATOM 9249  C C    . GLY D 2 126 ? 250.108 200.746 223.178 1.00 314.74 ? 147 GLY C C    1 
ATOM 9250  O O    . GLY D 2 126 ? 250.507 201.379 222.200 1.00 314.74 ? 147 GLY C O    1 
ATOM 9251  H H    . GLY D 2 126 ? 252.574 200.952 223.398 1.00 377.69 ? 147 GLY C H    1 
ATOM 9252  H HA2  . GLY D 2 126 ? 250.877 199.772 224.798 1.00 377.69 ? 147 GLY C HA2  1 
ATOM 9253  H HA3  . GLY D 2 126 ? 250.556 201.285 225.095 1.00 377.69 ? 147 GLY C HA3  1 
ATOM 9254  N N    . SER D 2 137 ? 247.784 188.711 238.395 1.00 231.09 ? 158 SER C N    1 
ATOM 9255  C CA   . SER D 2 137 ? 247.131 189.613 237.453 1.00 231.09 ? 158 SER C CA   1 
ATOM 9256  C C    . SER D 2 137 ? 246.737 188.877 236.179 1.00 231.09 ? 158 SER C C    1 
ATOM 9257  O O    . SER D 2 137 ? 247.579 188.272 235.513 1.00 231.09 ? 158 SER C O    1 
ATOM 9258  C CB   . SER D 2 137 ? 248.048 190.773 237.117 1.00 231.09 ? 158 SER C CB   1 
ATOM 9259  O OG   . SER D 2 137 ? 248.312 191.550 238.253 1.00 231.09 ? 158 SER C OG   1 
ATOM 9260  H H    . SER D 2 137 ? 248.720 188.895 238.696 1.00 277.31 ? 158 SER C H    1 
ATOM 9261  H HA   . SER D 2 137 ? 246.323 189.966 237.859 1.00 277.31 ? 158 SER C HA   1 
ATOM 9262  H HB2  . SER D 2 137 ? 248.984 190.391 236.710 1.00 277.31 ? 158 SER C HB2  1 
ATOM 9263  H HB3  . SER D 2 137 ? 247.586 191.392 236.350 1.00 277.31 ? 158 SER C HB3  1 
ATOM 9264  H HG   . SER D 2 137 ? 248.865 192.276 237.954 1.00 277.31 ? 158 SER C HG   1 
ATOM 9265  N N    . ASN D 2 138 ? 245.452 188.932 235.844 1.00 233.39 ? 159 ASN C N    1 
ATOM 9266  C CA   . ASN D 2 138 ? 244.939 188.322 234.618 1.00 233.39 ? 159 ASN C CA   1 
ATOM 9267  C C    . ASN D 2 138 ? 245.173 189.304 233.475 1.00 233.39 ? 159 ASN C C    1 
ATOM 9268  O O    . ASN D 2 138 ? 244.401 190.240 233.263 1.00 233.39 ? 159 ASN C O    1 
ATOM 9269  C CB   . ASN D 2 138 ? 243.470 187.961 234.746 1.00 233.39 ? 159 ASN C CB   1 
ATOM 9270  C CG   . ASN D 2 138 ? 242.941 187.255 233.528 1.00 233.39 ? 159 ASN C CG   1 
ATOM 9271  O OD1  . ASN D 2 138 ? 243.392 187.506 232.405 1.00 233.39 ? 159 ASN C OD1  1 
ATOM 9272  N ND2  . ASN D 2 138 ? 241.991 186.377 233.729 1.00 233.39 ? 159 ASN C ND2  1 
ATOM 9273  H H    . ASN D 2 138 ? 244.847 189.321 236.316 1.00 280.07 ? 159 ASN C H    1 
ATOM 9274  H HA   . ASN D 2 138 ? 245.430 187.508 234.431 1.00 280.07 ? 159 ASN C HA   1 
ATOM 9275  H HB2  . ASN D 2 138 ? 243.328 187.317 235.615 1.00 280.07 ? 159 ASN C HB2  1 
ATOM 9276  H HB3  . ASN D 2 138 ? 242.885 188.866 234.910 1.00 280.07 ? 159 ASN C HB3  1 
ATOM 9277  H HD21 . ASN D 2 138 ? 241.601 185.877 232.955 1.00 280.07 ? 159 ASN C HD21 1 
ATOM 9278  H HD22 . ASN D 2 138 ? 241.656 186.206 234.655 1.00 280.07 ? 159 ASN C HD22 1 
ATOM 9279  N N    . HIS D 2 139 ? 246.263 189.087 232.731 1.00 231.04 ? 160 HIS C N    1 
ATOM 9280  C CA   . HIS D 2 139 ? 246.686 190.054 231.721 1.00 231.04 ? 160 HIS C CA   1 
ATOM 9281  C C    . HIS D 2 139 ? 245.673 190.154 230.586 1.00 231.04 ? 160 HIS C C    1 
ATOM 9282  O O    . HIS D 2 139 ? 245.418 191.250 230.068 1.00 231.04 ? 160 HIS C O    1 
ATOM 9283  C CB   . HIS D 2 139 ? 248.058 189.678 231.154 1.00 231.04 ? 160 HIS C CB   1 
ATOM 9284  C CG   . HIS D 2 139 ? 249.178 189.834 232.135 1.00 231.04 ? 160 HIS C CG   1 
ATOM 9285  N ND1  . HIS D 2 139 ? 250.436 189.314 231.917 1.00 231.04 ? 160 HIS C ND1  1 
ATOM 9286  C CD2  . HIS D 2 139 ? 249.229 190.449 233.340 1.00 231.04 ? 160 HIS C CD2  1 
ATOM 9287  C CE1  . HIS D 2 139 ? 251.214 189.604 232.945 1.00 231.04 ? 160 HIS C CE1  1 
ATOM 9288  N NE2  . HIS D 2 139 ? 250.505 190.292 233.822 1.00 231.04 ? 160 HIS C NE2  1 
ATOM 9289  H H    . HIS D 2 139 ? 246.768 188.394 232.794 1.00 277.25 ? 160 HIS C H    1 
ATOM 9290  H HA   . HIS D 2 139 ? 246.752 190.931 232.131 1.00 277.25 ? 160 HIS C HA   1 
ATOM 9291  H HB2  . HIS D 2 139 ? 248.041 188.641 230.817 1.00 277.25 ? 160 HIS C HB2  1 
ATOM 9292  H HB3  . HIS D 2 139 ? 248.276 190.300 230.286 1.00 277.25 ? 160 HIS C HB3  1 
ATOM 9293  H HD1  . HIS D 2 139 ? 250.752 188.861 231.082 1.00 277.25 ? 160 HIS C HD1  1 
ATOM 9294  H HD2  . HIS D 2 139 ? 248.487 190.994 233.925 1.00 277.25 ? 160 HIS C HD2  1 
ATOM 9295  H HE1  . HIS D 2 139 ? 252.254 189.280 232.964 1.00 277.25 ? 160 HIS C HE1  1 
ATOM 9296  N N    . CYS D 2 140 ? 245.102 189.020 230.172 1.00 234.35 ? 161 CYS C N    1 
ATOM 9297  C CA   . CYS D 2 140 ? 244.088 189.043 229.123 1.00 234.35 ? 161 CYS C CA   1 
ATOM 9298  C C    . CYS D 2 140 ? 242.838 189.772 229.586 1.00 234.35 ? 161 CYS C C    1 
ATOM 9299  O O    . CYS D 2 140 ? 242.167 190.429 228.782 1.00 234.35 ? 161 CYS C O    1 
ATOM 9300  C CB   . CYS D 2 140 ? 243.715 187.621 228.701 1.00 234.35 ? 161 CYS C CB   1 
ATOM 9301  S SG   . CYS D 2 140 ? 245.035 186.738 227.834 1.00 234.35 ? 161 CYS C SG   1 
ATOM 9302  H H    . CYS D 2 140 ? 245.282 188.237 230.479 1.00 281.22 ? 161 CYS C H    1 
ATOM 9303  H HA   . CYS D 2 140 ? 244.442 189.509 228.349 1.00 281.22 ? 161 CYS C HA   1 
ATOM 9304  H HB2  . CYS D 2 140 ? 243.443 187.040 229.582 1.00 281.22 ? 161 CYS C HB2  1 
ATOM 9305  H HB3  . CYS D 2 140 ? 242.844 187.652 228.047 1.00 281.22 ? 161 CYS C HB3  1 
ATOM 9306  N N    . LEU D 2 141 ? 242.522 189.687 230.878 1.00 233.07 ? 162 LEU C N    1 
ATOM 9307  C CA   . LEU D 2 141 ? 241.411 190.455 231.424 1.00 233.07 ? 162 LEU C CA   1 
ATOM 9308  C C    . LEU D 2 141 ? 241.661 191.950 231.281 1.00 233.07 ? 162 LEU C C    1 
ATOM 9309  O O    . LEU D 2 141 ? 240.791 192.692 230.819 1.00 233.07 ? 162 LEU C O    1 
ATOM 9310  C CB   . LEU D 2 141 ? 241.192 190.076 232.888 1.00 233.07 ? 162 LEU C CB   1 
ATOM 9311  C CG   . LEU D 2 141 ? 240.123 190.824 233.684 1.00 233.07 ? 162 LEU C CG   1 
ATOM 9312  C CD1  . LEU D 2 141 ? 238.761 190.612 233.070 1.00 233.07 ? 162 LEU C CD1  1 
ATOM 9313  C CD2  . LEU D 2 141 ? 240.132 190.356 235.127 1.00 233.07 ? 162 LEU C CD2  1 
ATOM 9314  H H    . LEU D 2 141 ? 242.933 189.195 231.452 1.00 279.68 ? 162 LEU C H    1 
ATOM 9315  H HA   . LEU D 2 141 ? 240.606 190.236 230.927 1.00 279.68 ? 162 LEU C HA   1 
ATOM 9316  H HB2  . LEU D 2 141 ? 240.941 189.143 232.906 1.00 279.68 ? 162 LEU C HB2  1 
ATOM 9317  H HB3  . LEU D 2 141 ? 242.031 190.193 233.357 1.00 279.68 ? 162 LEU C HB3  1 
ATOM 9318  H HG   . LEU D 2 141 ? 240.316 191.774 233.674 1.00 279.68 ? 162 LEU C HG   1 
ATOM 9319  H HD11 . LEU D 2 141 ? 238.097 191.030 233.635 1.00 279.68 ? 162 LEU C HD11 1 
ATOM 9320  H HD12 . LEU D 2 141 ? 238.744 191.008 232.185 1.00 279.68 ? 162 LEU C HD12 1 
ATOM 9321  H HD13 . LEU D 2 141 ? 238.588 189.660 233.013 1.00 279.68 ? 162 LEU C HD13 1 
ATOM 9322  H HD21 . LEU D 2 141 ? 239.444 190.833 235.617 1.00 279.68 ? 162 LEU C HD21 1 
ATOM 9323  H HD22 . LEU D 2 141 ? 239.951 189.403 235.147 1.00 279.68 ? 162 LEU C HD22 1 
ATOM 9324  H HD23 . LEU D 2 141 ? 241.002 190.537 235.513 1.00 279.68 ? 162 LEU C HD23 1 
ATOM 9325  N N    . ASP D 2 142 ? 242.855 192.412 231.660 1.00 231.90 ? 163 ASP C N    1 
ATOM 9326  C CA   . ASP D 2 142 ? 243.182 193.824 231.490 1.00 231.90 ? 163 ASP C CA   1 
ATOM 9327  C C    . ASP D 2 142 ? 243.043 194.247 230.032 1.00 231.90 ? 163 ASP C C    1 
ATOM 9328  O O    . ASP D 2 142 ? 242.578 195.356 229.739 1.00 231.90 ? 163 ASP C O    1 
ATOM 9329  C CB   . ASP D 2 142 ? 244.604 194.109 231.978 1.00 231.90 ? 163 ASP C CB   1 
ATOM 9330  C CG   . ASP D 2 142 ? 244.732 194.060 233.494 1.00 231.90 ? 163 ASP C CG   1 
ATOM 9331  O OD1  . ASP D 2 142 ? 243.722 194.084 234.157 1.00 231.90 ? 163 ASP C OD1  1 
ATOM 9332  O OD2  . ASP D 2 142 ? 245.838 193.998 233.975 1.00 231.90 ? 163 ASP C OD2  1 
ATOM 9333  H H    . ASP D 2 142 ? 243.479 191.937 232.014 1.00 278.28 ? 163 ASP C H    1 
ATOM 9334  H HA   . ASP D 2 142 ? 242.562 194.358 232.011 1.00 278.28 ? 163 ASP C HA   1 
ATOM 9335  H HB2  . ASP D 2 142 ? 245.290 193.379 231.546 1.00 278.28 ? 163 ASP C HB2  1 
ATOM 9336  H HB3  . ASP D 2 142 ? 244.917 195.095 231.633 1.00 278.28 ? 163 ASP C HB3  1 
ATOM 9337  N N    . ALA D 2 143 ? 243.439 193.374 229.102 1.00 236.91 ? 164 ALA C N    1 
ATOM 9338  C CA   . ALA D 2 143 ? 243.217 193.657 227.687 1.00 236.91 ? 164 ALA C CA   1 
ATOM 9339  C C    . ALA D 2 143 ? 241.727 193.795 227.387 1.00 236.91 ? 164 ALA C C    1 
ATOM 9340  O O    . ALA D 2 143 ? 241.303 194.728 226.690 1.00 236.91 ? 164 ALA C O    1 
ATOM 9341  C CB   . ALA D 2 143 ? 243.841 192.555 226.830 1.00 236.91 ? 164 ALA C CB   1 
ATOM 9342  H H    . ALA D 2 143 ? 243.829 192.625 229.263 1.00 284.29 ? 164 ALA C H    1 
ATOM 9343  H HA   . ALA D 2 143 ? 243.648 194.494 227.459 1.00 284.29 ? 164 ALA C HA   1 
ATOM 9344  H HB1  . ALA D 2 143 ? 243.695 192.762 225.893 1.00 284.29 ? 164 ALA C HB1  1 
ATOM 9345  H HB2  . ALA D 2 143 ? 244.791 192.512 227.016 1.00 284.29 ? 164 ALA C HB2  1 
ATOM 9346  H HB3  . ALA D 2 143 ? 243.422 191.708 227.051 1.00 284.29 ? 164 ALA C HB3  1 
ATOM 9347  N N    . ALA D 2 144 ? 240.918 192.872 227.912 1.00 235.97 ? 165 ALA C N    1 
ATOM 9348  C CA   . ALA D 2 144 ? 239.476 192.942 227.705 1.00 235.97 ? 165 ALA C CA   1 
ATOM 9349  C C    . ALA D 2 144 ? 238.893 194.204 228.333 1.00 235.97 ? 165 ALA C C    1 
ATOM 9350  O O    . ALA D 2 144 ? 238.041 194.864 227.730 1.00 235.97 ? 165 ALA C O    1 
ATOM 9351  C CB   . ALA D 2 144 ? 238.802 191.694 228.275 1.00 235.97 ? 165 ALA C CB   1 
ATOM 9352  H H    . ALA D 2 144 ? 241.179 192.199 228.381 1.00 283.16 ? 165 ALA C H    1 
ATOM 9353  H HA   . ALA D 2 144 ? 239.297 192.972 226.752 1.00 283.16 ? 165 ALA C HA   1 
ATOM 9354  H HB1  . ALA D 2 144 ? 237.848 191.757 228.124 1.00 283.16 ? 165 ALA C HB1  1 
ATOM 9355  H HB2  . ALA D 2 144 ? 239.160 190.914 227.826 1.00 283.16 ? 165 ALA C HB2  1 
ATOM 9356  H HB3  . ALA D 2 144 ? 238.985 191.643 229.226 1.00 283.16 ? 165 ALA C HB3  1 
ATOM 9357  N N    . LYS D 2 145 ? 239.346 194.559 229.539 1.00 235.10 ? 166 LYS C N    1 
ATOM 9358  C CA   . LYS D 2 145 ? 238.838 195.759 230.200 1.00 235.10 ? 166 LYS C CA   1 
ATOM 9359  C C    . LYS D 2 145 ? 239.150 197.003 229.383 1.00 235.10 ? 166 LYS C C    1 
ATOM 9360  O O    . LYS D 2 145 ? 238.325 197.918 229.286 1.00 235.10 ? 166 LYS C O    1 
ATOM 9361  C CB   . LYS D 2 145 ? 239.429 195.891 231.605 1.00 235.10 ? 166 LYS C CB   1 
ATOM 9362  C CG   . LYS D 2 145 ? 238.904 194.870 232.607 1.00 235.10 ? 166 LYS C CG   1 
ATOM 9363  C CD   . LYS D 2 145 ? 239.352 195.204 234.022 1.00 235.10 ? 166 LYS C CD   1 
ATOM 9364  C CE   . LYS D 2 145 ? 240.838 194.938 234.210 1.00 235.10 ? 166 LYS C CE   1 
ATOM 9365  N NZ   . LYS D 2 145 ? 241.263 195.132 235.623 1.00 235.10 ? 166 LYS C NZ   1 
ATOM 9366  H H    . LYS D 2 145 ? 239.937 194.128 229.991 1.00 282.12 ? 166 LYS C H    1 
ATOM 9367  H HA   . LYS D 2 145 ? 237.874 195.691 230.290 1.00 282.12 ? 166 LYS C HA   1 
ATOM 9368  H HB2  . LYS D 2 145 ? 240.513 195.784 231.556 1.00 282.12 ? 166 LYS C HB2  1 
ATOM 9369  H HB3  . LYS D 2 145 ? 239.215 196.885 231.998 1.00 282.12 ? 166 LYS C HB3  1 
ATOM 9370  H HG2  . LYS D 2 145 ? 237.814 194.855 232.573 1.00 282.12 ? 166 LYS C HG2  1 
ATOM 9371  H HG3  . LYS D 2 145 ? 239.271 193.879 232.343 1.00 282.12 ? 166 LYS C HG3  1 
ATOM 9372  H HD2  . LYS D 2 145 ? 239.150 196.256 234.229 1.00 282.12 ? 166 LYS C HD2  1 
ATOM 9373  H HD3  . LYS D 2 145 ? 238.791 194.598 234.733 1.00 282.12 ? 166 LYS C HD3  1 
ATOM 9374  H HE2  . LYS D 2 145 ? 241.065 193.916 233.912 1.00 282.12 ? 166 LYS C HE2  1 
ATOM 9375  H HE3  . LYS D 2 145 ? 241.412 195.614 233.576 1.00 282.12 ? 166 LYS C HE3  1 
ATOM 9376  H HZ1  . LYS D 2 145 ? 242.253 194.947 235.705 1.00 282.12 ? 166 LYS C HZ1  1 
ATOM 9377  H HZ2  . LYS D 2 145 ? 241.074 196.084 235.905 1.00 282.12 ? 166 LYS C HZ2  1 
ATOM 9378  H HZ3  . LYS D 2 145 ? 240.752 194.497 236.219 1.00 282.12 ? 166 LYS C HZ3  1 
ATOM 9379  N N    . ALA D 2 146 ? 240.352 197.056 228.797 1.00 232.76 ? 167 ALA C N    1 
ATOM 9380  C CA   . ALA D 2 146 ? 240.712 198.164 227.915 1.00 232.76 ? 167 ALA C CA   1 
ATOM 9381  C C    . ALA D 2 146 ? 239.727 198.295 226.759 1.00 232.76 ? 167 ALA C C    1 
ATOM 9382  O O    . ALA D 2 146 ? 239.356 199.410 226.372 1.00 232.76 ? 167 ALA C O    1 
ATOM 9383  C CB   . ALA D 2 146 ? 242.133 197.971 227.387 1.00 232.76 ? 167 ALA C CB   1 
ATOM 9384  H H    . ALA D 2 146 ? 240.965 196.462 228.893 1.00 279.31 ? 167 ALA C H    1 
ATOM 9385  H HA   . ALA D 2 146 ? 240.686 198.988 228.423 1.00 279.31 ? 167 ALA C HA   1 
ATOM 9386  H HB1  . ALA D 2 146 ? 242.353 198.719 226.814 1.00 279.31 ? 167 ALA C HB1  1 
ATOM 9387  H HB2  . ALA D 2 146 ? 242.744 197.936 228.139 1.00 279.31 ? 167 ALA C HB2  1 
ATOM 9388  H HB3  . ALA D 2 146 ? 242.174 197.143 226.887 1.00 279.31 ? 167 ALA C HB3  1 
ATOM 9389  N N    . CYS D 2 147 ? 239.292 197.166 226.195 1.00 242.72 ? 168 CYS C N    1 
ATOM 9390  C CA   . CYS D 2 147 ? 238.285 197.216 225.138 1.00 242.72 ? 168 CYS C CA   1 
ATOM 9391  C C    . CYS D 2 147 ? 236.927 197.642 225.691 1.00 242.72 ? 168 CYS C C    1 
ATOM 9392  O O    . CYS D 2 147 ? 236.243 198.486 225.101 1.00 242.72 ? 168 CYS C O    1 
ATOM 9393  C CB   . CYS D 2 147 ? 238.149 195.853 224.460 1.00 242.72 ? 168 CYS C CB   1 
ATOM 9394  S SG   . CYS D 2 147 ? 236.989 195.831 223.072 1.00 242.72 ? 168 CYS C SG   1 
ATOM 9395  H H    . CYS D 2 147 ? 239.558 196.375 226.401 1.00 291.26 ? 168 CYS C H    1 
ATOM 9396  H HA   . CYS D 2 147 ? 238.554 197.869 224.474 1.00 291.26 ? 168 CYS C HA   1 
ATOM 9397  H HB2  . CYS D 2 147 ? 239.123 195.532 224.090 1.00 291.26 ? 168 CYS C HB2  1 
ATOM 9398  H HB3  . CYS D 2 147 ? 237.816 195.115 225.189 1.00 291.26 ? 168 CYS C HB3  1 
ATOM 9399  N N    . ASN D 2 148 ? 236.520 197.066 226.826 1.00 235.56 ? 169 ASN C N    1 
ATOM 9400  C CA   . ASN D 2 148 ? 235.214 197.385 227.397 1.00 235.56 ? 169 ASN C CA   1 
ATOM 9401  C C    . ASN D 2 148 ? 235.065 198.874 227.675 1.00 235.56 ? 169 ASN C C    1 
ATOM 9402  O O    . ASN D 2 148 ? 233.949 199.405 227.620 1.00 235.56 ? 169 ASN C O    1 
ATOM 9403  C CB   . ASN D 2 148 ? 234.980 196.585 228.666 1.00 235.56 ? 169 ASN C CB   1 
ATOM 9404  C CG   . ASN D 2 148 ? 234.694 195.135 228.390 1.00 235.56 ? 169 ASN C CG   1 
ATOM 9405  O OD1  . ASN D 2 148 ? 234.331 194.764 227.268 1.00 235.56 ? 169 ASN C OD1  1 
ATOM 9406  N ND2  . ASN D 2 148 ? 234.850 194.308 229.392 1.00 235.56 ? 169 ASN C ND2  1 
ATOM 9407  H H    . ASN D 2 148 ? 236.976 196.494 227.279 1.00 282.67 ? 169 ASN C H    1 
ATOM 9408  H HA   . ASN D 2 148 ? 234.523 197.128 226.767 1.00 282.67 ? 169 ASN C HA   1 
ATOM 9409  H HB2  . ASN D 2 148 ? 235.860 196.654 229.307 1.00 282.67 ? 169 ASN C HB2  1 
ATOM 9410  H HB3  . ASN D 2 148 ? 234.141 197.011 229.215 1.00 282.67 ? 169 ASN C HB3  1 
ATOM 9411  H HD21 . ASN D 2 148 ? 234.674 193.331 229.266 1.00 282.67 ? 169 ASN C HD21 1 
ATOM 9412  H HD22 . ASN D 2 148 ? 235.146 194.652 230.283 1.00 282.67 ? 169 ASN C HD22 1 
ATOM 9413  N N    . LEU D 2 149 ? 236.165 199.561 227.976 1.00 241.32 ? 170 LEU C N    1 
ATOM 9414  C CA   . LEU D 2 149 ? 236.125 201.003 228.184 1.00 241.32 ? 170 LEU C CA   1 
ATOM 9415  C C    . LEU D 2 149 ? 236.211 201.801 226.889 1.00 241.32 ? 170 LEU C C    1 
ATOM 9416  O O    . LEU D 2 149 ? 236.032 203.024 226.931 1.00 241.32 ? 170 LEU C O    1 
ATOM 9417  C CB   . LEU D 2 149 ? 237.272 201.421 229.112 1.00 241.32 ? 170 LEU C CB   1 
ATOM 9418  C CG   . LEU D 2 149 ? 237.227 200.836 230.530 1.00 241.32 ? 170 LEU C CG   1 
ATOM 9419  C CD1  . LEU D 2 149 ? 238.489 201.234 231.284 1.00 241.32 ? 170 LEU C CD1  1 
ATOM 9420  C CD2  . LEU D 2 149 ? 235.982 201.337 231.246 1.00 241.32 ? 170 LEU C CD2  1 
ATOM 9421  H H    . LEU D 2 149 ? 236.947 199.213 228.064 1.00 289.58 ? 170 LEU C H    1 
ATOM 9422  H HA   . LEU D 2 149 ? 235.280 201.231 228.598 1.00 289.58 ? 170 LEU C HA   1 
ATOM 9423  H HB2  . LEU D 2 149 ? 238.214 201.117 228.658 1.00 289.58 ? 170 LEU C HB2  1 
ATOM 9424  H HB3  . LEU D 2 149 ? 237.269 202.507 229.201 1.00 289.58 ? 170 LEU C HB3  1 
ATOM 9425  H HG   . LEU D 2 149 ? 237.201 199.748 230.474 1.00 289.58 ? 170 LEU C HG   1 
ATOM 9426  H HD11 . LEU D 2 149 ? 238.457 200.819 232.291 1.00 289.58 ? 170 LEU C HD11 1 
ATOM 9427  H HD12 . LEU D 2 149 ? 239.363 200.847 230.760 1.00 289.58 ? 170 LEU C HD12 1 
ATOM 9428  H HD13 . LEU D 2 149 ? 238.551 202.320 231.341 1.00 289.58 ? 170 LEU C HD13 1 
ATOM 9429  H HD21 . LEU D 2 149 ? 235.949 200.921 232.254 1.00 289.58 ? 170 LEU C HD21 1 
ATOM 9430  H HD22 . LEU D 2 149 ? 236.008 202.425 231.303 1.00 289.58 ? 170 LEU C HD22 1 
ATOM 9431  H HD23 . LEU D 2 149 ? 235.095 201.023 230.696 1.00 289.58 ? 170 LEU C HD23 1 
ATOM 9432  N N    . ASN D 2 150 ? 236.475 201.157 225.750 1.00 236.78 ? 171 ASN C N    1 
ATOM 9433  C CA   . ASN D 2 150 ? 236.596 201.842 224.467 1.00 236.78 ? 171 ASN C CA   1 
ATOM 9434  C C    . ASN D 2 150 ? 235.290 201.643 223.709 1.00 236.78 ? 171 ASN C C    1 
ATOM 9435  O O    . ASN D 2 150 ? 234.957 200.520 223.318 1.00 236.78 ? 171 ASN C O    1 
ATOM 9436  C CB   . ASN D 2 150 ? 237.783 201.333 223.671 1.00 236.78 ? 171 ASN C CB   1 
ATOM 9437  C CG   . ASN D 2 150 ? 237.980 202.084 222.383 1.00 236.78 ? 171 ASN C CG   1 
ATOM 9438  O OD1  . ASN D 2 150 ? 237.303 201.815 221.384 1.00 236.78 ? 171 ASN C OD1  1 
ATOM 9439  N ND2  . ASN D 2 150 ? 238.895 203.020 222.387 1.00 236.78 ? 171 ASN C ND2  1 
ATOM 9440  H H    . ASN D 2 150 ? 236.594 200.306 225.694 1.00 284.14 ? 171 ASN C H    1 
ATOM 9441  H HA   . ASN D 2 150 ? 236.727 202.793 224.605 1.00 284.14 ? 171 ASN C HA   1 
ATOM 9442  H HB2  . ASN D 2 150 ? 238.689 201.421 224.272 1.00 284.14 ? 171 ASN C HB2  1 
ATOM 9443  H HB3  . ASN D 2 150 ? 237.643 200.276 223.444 1.00 284.14 ? 171 ASN C HB3  1 
ATOM 9444  H HD21 . ASN D 2 150 ? 239.069 203.552 221.559 1.00 284.14 ? 171 ASN C HD21 1 
ATOM 9445  H HD22 . ASN D 2 150 ? 239.418 203.203 223.219 1.00 284.14 ? 171 ASN C HD22 1 
ATOM 9446  N N    . ASP D 2 151 ? 234.553 202.736 223.500 1.00 245.14 ? 172 ASP C N    1 
ATOM 9447  C CA   . ASP D 2 151 ? 233.226 202.627 222.908 1.00 245.14 ? 172 ASP C CA   1 
ATOM 9448  C C    . ASP D 2 151 ? 233.278 201.951 221.542 1.00 245.14 ? 172 ASP C C    1 
ATOM 9449  O O    . ASP D 2 151 ? 232.411 201.137 221.216 1.00 245.14 ? 172 ASP C O    1 
ATOM 9450  C CB   . ASP D 2 151 ? 232.585 204.011 222.774 1.00 245.14 ? 172 ASP C CB   1 
ATOM 9451  C CG   . ASP D 2 151 ? 232.151 204.595 224.111 1.00 245.14 ? 172 ASP C CG   1 
ATOM 9452  O OD1  . ASP D 2 151 ? 232.090 203.859 225.067 1.00 245.14 ? 172 ASP C OD1  1 
ATOM 9453  O OD2  . ASP D 2 151 ? 231.885 205.772 224.164 1.00 245.14 ? 172 ASP C OD2  1 
ATOM 9454  H H    . ASP D 2 151 ? 234.796 203.538 223.693 1.00 294.17 ? 172 ASP C H    1 
ATOM 9455  H HA   . ASP D 2 151 ? 232.668 202.079 223.483 1.00 294.17 ? 172 ASP C HA   1 
ATOM 9456  H HB2  . ASP D 2 151 ? 233.294 204.696 222.307 1.00 294.17 ? 172 ASP C HB2  1 
ATOM 9457  H HB3  . ASP D 2 151 ? 231.714 203.947 222.122 1.00 294.17 ? 172 ASP C HB3  1 
ATOM 9458  N N    . ASN D 2 152 ? 234.296 202.259 220.739 1.00 235.10 ? 173 ASN C N    1 
ATOM 9459  C CA   . ASN D 2 152 ? 234.392 201.674 219.403 1.00 235.10 ? 173 ASN C CA   1 
ATOM 9460  C C    . ASN D 2 152 ? 234.721 200.186 219.466 1.00 235.10 ? 173 ASN C C    1 
ATOM 9461  O O    . ASN D 2 152 ? 234.067 199.362 218.805 1.00 235.10 ? 173 ASN C O    1 
ATOM 9462  C CB   . ASN D 2 152 ? 235.425 202.412 218.571 1.00 235.10 ? 173 ASN C CB   1 
ATOM 9463  C CG   . ASN D 2 152 ? 234.957 203.777 218.146 1.00 235.10 ? 173 ASN C CG   1 
ATOM 9464  O OD1  . ASN D 2 152 ? 233.752 204.055 218.125 1.00 235.10 ? 173 ASN C OD1  1 
ATOM 9465  N ND2  . ASN D 2 152 ? 235.886 204.633 217.807 1.00 235.10 ? 173 ASN C ND2  1 
ATOM 9466  H H    . ASN D 2 152 ? 234.938 202.796 220.940 1.00 282.12 ? 173 ASN C H    1 
ATOM 9467  H HA   . ASN D 2 152 ? 233.539 201.774 218.952 1.00 282.12 ? 173 ASN C HA   1 
ATOM 9468  H HB2  . ASN D 2 152 ? 236.346 202.520 219.146 1.00 282.12 ? 173 ASN C HB2  1 
ATOM 9469  H HB3  . ASN D 2 152 ? 235.660 201.828 217.681 1.00 282.12 ? 173 ASN C HB3  1 
ATOM 9470  H HD21 . ASN D 2 152 ? 235.633 205.556 217.515 1.00 282.12 ? 173 ASN C HD21 1 
ATOM 9471  H HD22 . ASN D 2 152 ? 236.849 204.365 217.839 1.00 282.12 ? 173 ASN C HD22 1 
ATOM 9472  N N    . CYS D 2 153 ? 235.753 199.827 220.236 1.00 243.81 ? 174 CYS C N    1 
ATOM 9473  C CA   . CYS D 2 153 ? 236.136 198.426 220.385 1.00 243.81 ? 174 CYS C CA   1 
ATOM 9474  C C    . CYS D 2 153 ? 235.015 197.627 221.034 1.00 243.81 ? 174 CYS C C    1 
ATOM 9475  O O    . CYS D 2 153 ? 234.660 196.542 220.560 1.00 243.81 ? 174 CYS C O    1 
ATOM 9476  C CB   . CYS D 2 153 ? 237.404 198.297 221.228 1.00 243.81 ? 174 CYS C CB   1 
ATOM 9477  S SG   . CYS D 2 153 ? 238.006 196.600 221.402 1.00 243.81 ? 174 CYS C SG   1 
ATOM 9478  H H    . CYS D 2 153 ? 236.245 200.376 220.681 1.00 292.57 ? 174 CYS C H    1 
ATOM 9479  H HA   . CYS D 2 153 ? 236.306 198.050 219.507 1.00 292.57 ? 174 CYS C HA   1 
ATOM 9480  H HB2  . CYS D 2 153 ? 238.201 198.893 220.781 1.00 292.57 ? 174 CYS C HB2  1 
ATOM 9481  H HB3  . CYS D 2 153 ? 237.220 198.694 222.226 1.00 292.57 ? 174 CYS C HB3  1 
ATOM 9482  N N    . LYS D 2 154 ? 234.455 198.154 222.127 1.00 227.85 ? 175 LYS C N    1 
ATOM 9483  C CA   . LYS D 2 154 ? 233.365 197.486 222.830 1.00 227.85 ? 175 LYS C CA   1 
ATOM 9484  C C    . LYS D 2 154 ? 232.228 197.139 221.879 1.00 227.85 ? 175 LYS C C    1 
ATOM 9485  O O    . LYS D 2 154 ? 231.748 195.998 221.850 1.00 227.85 ? 175 LYS C O    1 
ATOM 9486  C CB   . LYS D 2 154 ? 232.845 198.362 223.971 1.00 227.85 ? 175 LYS C CB   1 
ATOM 9487  C CG   . LYS D 2 154 ? 231.697 197.749 224.762 1.00 227.85 ? 175 LYS C CG   1 
ATOM 9488  C CD   . LYS D 2 154 ? 231.222 198.685 225.863 1.00 227.85 ? 175 LYS C CD   1 
ATOM 9489  C CE   . LYS D 2 154 ? 230.409 199.840 225.295 1.00 227.85 ? 175 LYS C CE   1 
ATOM 9490  N NZ   . LYS D 2 154 ? 229.872 200.722 226.367 1.00 227.85 ? 175 LYS C NZ   1 
ATOM 9491  H H    . LYS D 2 154 ? 234.693 198.901 222.482 1.00 273.42 ? 175 LYS C H    1 
ATOM 9492  H HA   . LYS D 2 154 ? 233.694 196.663 223.224 1.00 273.42 ? 175 LYS C HA   1 
ATOM 9493  H HB2  . LYS D 2 154 ? 233.657 198.571 224.668 1.00 273.42 ? 175 LYS C HB2  1 
ATOM 9494  H HB3  . LYS D 2 154 ? 232.503 199.316 223.571 1.00 273.42 ? 175 LYS C HB3  1 
ATOM 9495  H HG2  . LYS D 2 154 ? 230.864 197.538 224.091 1.00 273.42 ? 175 LYS C HG2  1 
ATOM 9496  H HG3  . LYS D 2 154 ? 232.025 196.811 225.211 1.00 273.42 ? 175 LYS C HG3  1 
ATOM 9497  H HD2  . LYS D 2 154 ? 230.605 198.131 226.571 1.00 273.42 ? 175 LYS C HD2  1 
ATOM 9498  H HD3  . LYS D 2 154 ? 232.083 199.088 226.396 1.00 273.42 ? 175 LYS C HD3  1 
ATOM 9499  H HE2  . LYS D 2 154 ? 231.037 200.435 224.633 1.00 273.42 ? 175 LYS C HE2  1 
ATOM 9500  H HE3  . LYS D 2 154 ? 229.576 199.447 224.713 1.00 273.42 ? 175 LYS C HE3  1 
ATOM 9501  H HZ1  . LYS D 2 154 ? 229.340 201.473 225.950 1.00 273.42 ? 175 LYS C HZ1  1 
ATOM 9502  H HZ2  . LYS D 2 154 ? 229.272 200.184 226.977 1.00 273.42 ? 175 LYS C HZ2  1 
ATOM 9503  H HZ3  . LYS D 2 154 ? 230.636 201.108 226.901 1.00 273.42 ? 175 LYS C HZ3  1 
ATOM 9504  N N    . LYS D 2 155 ? 231.774 198.123 221.101 1.00 215.51 ? 176 LYS C N    1 
ATOM 9505  C CA   . LYS D 2 155 ? 230.660 197.904 220.188 1.00 215.51 ? 176 LYS C CA   1 
ATOM 9506  C C    . LYS D 2 155 ? 231.025 196.890 219.115 1.00 215.51 ? 176 LYS C C    1 
ATOM 9507  O O    . LYS D 2 155 ? 230.273 195.943 218.870 1.00 215.51 ? 176 LYS C O    1 
ATOM 9508  C CB   . LYS D 2 155 ? 230.227 199.221 219.542 1.00 215.51 ? 176 LYS C CB   1 
ATOM 9509  C CG   . LYS D 2 155 ? 229.011 199.105 218.632 1.00 215.51 ? 176 LYS C CG   1 
ATOM 9510  C CD   . LYS D 2 155 ? 228.607 200.462 218.074 1.00 215.51 ? 176 LYS C CD   1 
ATOM 9511  C CE   . LYS D 2 155 ? 227.450 200.336 217.094 1.00 215.51 ? 176 LYS C CE   1 
ATOM 9512  N NZ   . LYS D 2 155 ? 226.200 199.886 217.762 1.00 215.51 ? 176 LYS C NZ   1 
ATOM 9513  H H    . LYS D 2 155 ? 232.094 198.921 221.084 1.00 258.61 ? 176 LYS C H    1 
ATOM 9514  H HA   . LYS D 2 155 ? 229.908 197.552 220.688 1.00 258.61 ? 176 LYS C HA   1 
ATOM 9515  H HB2  . LYS D 2 155 ? 229.995 199.949 220.319 1.00 258.61 ? 176 LYS C HB2  1 
ATOM 9516  H HB3  . LYS D 2 155 ? 231.049 199.624 218.951 1.00 258.61 ? 176 LYS C HB3  1 
ATOM 9517  H HG2  . LYS D 2 155 ? 229.239 198.435 217.803 1.00 258.61 ? 176 LYS C HG2  1 
ATOM 9518  H HG3  . LYS D 2 155 ? 228.175 198.689 219.193 1.00 258.61 ? 176 LYS C HG3  1 
ATOM 9519  H HD2  . LYS D 2 155 ? 228.308 201.118 218.893 1.00 258.61 ? 176 LYS C HD2  1 
ATOM 9520  H HD3  . LYS D 2 155 ? 229.457 200.913 217.563 1.00 258.61 ? 176 LYS C HD3  1 
ATOM 9521  H HE2  . LYS D 2 155 ? 227.268 201.300 216.621 1.00 258.61 ? 176 LYS C HE2  1 
ATOM 9522  H HE3  . LYS D 2 155 ? 227.710 199.619 216.315 1.00 258.61 ? 176 LYS C HE3  1 
ATOM 9523  H HZ1  . LYS D 2 155 ? 225.459 199.814 217.079 1.00 258.61 ? 176 LYS C HZ1  1 
ATOM 9524  H HZ2  . LYS D 2 155 ? 226.352 198.982 218.189 1.00 258.61 ? 176 LYS C HZ2  1 
ATOM 9525  H HZ3  . LYS D 2 155 ? 225.938 200.553 218.474 1.00 258.61 ? 176 LYS C HZ3  1 
ATOM 9526  N N    . LEU D 2 156 ? 232.175 197.069 218.462 1.00 206.57 ? 177 LEU C N    1 
ATOM 9527  C CA   . LEU D 2 156 ? 232.590 196.097 217.451 1.00 206.57 ? 177 LEU C CA   1 
ATOM 9528  C C    . LEU D 2 156 ? 232.809 194.721 218.073 1.00 206.57 ? 177 LEU C C    1 
ATOM 9529  O O    . LEU D 2 156 ? 232.473 193.689 217.467 1.00 206.57 ? 177 LEU C O    1 
ATOM 9530  C CB   . LEU D 2 156 ? 233.877 196.564 216.759 1.00 206.57 ? 177 LEU C CB   1 
ATOM 9531  C CG   . LEU D 2 156 ? 233.734 197.785 215.842 1.00 206.57 ? 177 LEU C CG   1 
ATOM 9532  C CD1  . LEU D 2 156 ? 235.115 198.264 215.414 1.00 206.57 ? 177 LEU C CD1  1 
ATOM 9533  C CD2  . LEU D 2 156 ? 232.884 197.417 214.635 1.00 206.57 ? 177 LEU C CD2  1 
ATOM 9534  H H    . LEU D 2 156 ? 232.719 197.725 218.580 1.00 247.88 ? 177 LEU C H    1 
ATOM 9535  H HA   . LEU D 2 156 ? 231.884 196.008 216.792 1.00 247.88 ? 177 LEU C HA   1 
ATOM 9536  H HB2  . LEU D 2 156 ? 234.613 196.808 217.524 1.00 247.88 ? 177 LEU C HB2  1 
ATOM 9537  H HB3  . LEU D 2 156 ? 234.266 195.742 216.159 1.00 247.88 ? 177 LEU C HB3  1 
ATOM 9538  H HG   . LEU D 2 156 ? 233.255 198.597 216.389 1.00 247.88 ? 177 LEU C HG   1 
ATOM 9539  H HD11 . LEU D 2 156 ? 235.013 199.132 214.763 1.00 247.88 ? 177 LEU C HD11 1 
ATOM 9540  H HD12 . LEU D 2 156 ? 235.694 198.539 216.296 1.00 247.88 ? 177 LEU C HD12 1 
ATOM 9541  H HD13 . LEU D 2 156 ? 235.626 197.465 214.878 1.00 247.88 ? 177 LEU C HD13 1 
ATOM 9542  H HD21 . LEU D 2 156 ? 232.782 198.286 213.983 1.00 247.88 ? 177 LEU C HD21 1 
ATOM 9543  H HD22 . LEU D 2 156 ? 233.364 196.606 214.086 1.00 247.88 ? 177 LEU C HD22 1 
ATOM 9544  H HD23 . LEU D 2 156 ? 231.898 197.096 214.969 1.00 247.88 ? 177 LEU C HD23 1 
ATOM 9545  N N    . ARG D 2 157 ? 233.349 194.691 219.294 1.00 210.18 ? 178 ARG C N    1 
ATOM 9546  C CA   . ARG D 2 157 ? 233.545 193.443 220.019 1.00 210.18 ? 178 ARG C CA   1 
ATOM 9547  C C    . ARG D 2 157 ? 232.220 192.747 220.287 1.00 210.18 ? 178 ARG C C    1 
ATOM 9548  O O    . ARG D 2 157 ? 232.078 191.547 220.040 1.00 210.18 ? 178 ARG C O    1 
ATOM 9549  C CB   . ARG D 2 157 ? 234.257 193.698 221.339 1.00 210.18 ? 178 ARG C CB   1 
ATOM 9550  C CG   . ARG D 2 157 ? 234.506 192.456 222.181 1.00 210.18 ? 178 ARG C CG   1 
ATOM 9551  C CD   . ARG D 2 157 ? 235.429 192.735 223.311 1.00 210.18 ? 178 ARG C CD   1 
ATOM 9552  N NE   . ARG D 2 157 ? 235.621 191.566 224.155 1.00 210.18 ? 178 ARG C NE   1 
ATOM 9553  C CZ   . ARG D 2 157 ? 234.898 191.292 225.258 1.00 210.18 ? 178 ARG C CZ   1 
ATOM 9554  N NH1  . ARG D 2 157 ? 233.941 192.109 225.636 1.00 210.18 ? 178 ARG C NH1  1 
ATOM 9555  N NH2  . ARG D 2 157 ? 235.152 190.200 225.959 1.00 210.18 ? 178 ARG C NH2  1 
ATOM 9556  H H    . ARG D 2 157 ? 233.611 195.388 219.724 1.00 252.22 ? 178 ARG C H    1 
ATOM 9557  H HA   . ARG D 2 157 ? 234.072 192.834 219.486 1.00 252.22 ? 178 ARG C HA   1 
ATOM 9558  H HB2  . ARG D 2 157 ? 235.222 194.165 221.148 1.00 252.22 ? 178 ARG C HB2  1 
ATOM 9559  H HB3  . ARG D 2 157 ? 233.670 194.392 221.941 1.00 252.22 ? 178 ARG C HB3  1 
ATOM 9560  H HG2  . ARG D 2 157 ? 233.561 192.099 222.591 1.00 252.22 ? 178 ARG C HG2  1 
ATOM 9561  H HG3  . ARG D 2 157 ? 234.949 191.678 221.559 1.00 252.22 ? 178 ARG C HG3  1 
ATOM 9562  H HD2  . ARG D 2 157 ? 236.400 193.037 222.921 1.00 252.22 ? 178 ARG C HD2  1 
ATOM 9563  H HD3  . ARG D 2 157 ? 235.020 193.535 223.926 1.00 252.22 ? 178 ARG C HD3  1 
ATOM 9564  H HE   . ARG D 2 157 ? 236.349 190.914 223.895 1.00 252.22 ? 178 ARG C HE   1 
ATOM 9565  H HH11 . ARG D 2 157 ? 233.747 192.943 225.100 1.00 252.22 ? 178 ARG C HH11 1 
ATOM 9566  H HH12 . ARG D 2 157 ? 233.399 191.903 226.463 1.00 252.22 ? 178 ARG C HH12 1 
ATOM 9567  H HH21 . ARG D 2 157 ? 235.888 189.572 225.668 1.00 252.22 ? 178 ARG C HH21 1 
ATOM 9568  H HH22 . ARG D 2 157 ? 234.610 189.995 226.785 1.00 252.22 ? 178 ARG C HH22 1 
ATOM 9569  N N    . SER D 2 158 ? 231.240 193.482 220.807 1.00 215.45 ? 179 SER C N    1 
ATOM 9570  C CA   . SER D 2 158 ? 229.917 192.898 220.979 1.00 215.45 ? 179 SER C CA   1 
ATOM 9571  C C    . SER D 2 158 ? 229.316 192.488 219.643 1.00 215.45 ? 179 SER C C    1 
ATOM 9572  O O    . SER D 2 158 ? 228.657 191.443 219.553 1.00 215.45 ? 179 SER C O    1 
ATOM 9573  C CB   . SER D 2 158 ? 228.998 193.884 221.674 1.00 215.45 ? 179 SER C CB   1 
ATOM 9574  O OG   . SER D 2 158 ? 229.401 194.097 222.999 1.00 215.45 ? 179 SER C OG   1 
ATOM 9575  H H    . SER D 2 158 ? 231.314 194.299 221.062 1.00 258.54 ? 179 SER C H    1 
ATOM 9576  H HA   . SER D 2 158 ? 229.991 192.106 221.534 1.00 258.54 ? 179 SER C HA   1 
ATOM 9577  H HB2  . SER D 2 158 ? 229.003 194.829 221.133 1.00 258.54 ? 179 SER C HB2  1 
ATOM 9578  H HB3  . SER D 2 158 ? 227.978 193.503 221.659 1.00 258.54 ? 179 SER C HB3  1 
ATOM 9579  H HG   . SER D 2 158 ? 229.019 194.938 223.260 1.00 258.54 ? 179 SER C HG   1 
ATOM 9580  N N    . SER D 2 159 ? 229.563 193.276 218.593 1.00 221.11 ? 180 SER C N    1 
ATOM 9581  C CA   . SER D 2 159 ? 228.935 193.069 217.296 1.00 221.11 ? 180 SER C CA   1 
ATOM 9582  C C    . SER D 2 159 ? 229.274 191.722 216.685 1.00 221.11 ? 180 SER C C    1 
ATOM 9583  O O    . SER D 2 159 ? 228.521 191.252 215.830 1.00 221.11 ? 180 SER C O    1 
ATOM 9584  C CB   . SER D 2 159 ? 229.352 194.173 216.343 1.00 221.11 ? 180 SER C CB   1 
ATOM 9585  O OG   . SER D 2 159 ? 228.807 195.404 216.732 1.00 221.11 ? 180 SER C OG   1 
ATOM 9586  H H    . SER D 2 159 ? 230.101 193.947 218.612 1.00 265.33 ? 180 SER C H    1 
ATOM 9587  H HA   . SER D 2 159 ? 227.973 193.114 217.400 1.00 265.33 ? 180 SER C HA   1 
ATOM 9588  H HB2  . SER D 2 159 ? 230.439 194.244 216.322 1.00 265.33 ? 180 SER C HB2  1 
ATOM 9589  H HB3  . SER D 2 159 ? 229.020 193.928 215.335 1.00 265.33 ? 180 SER C HB3  1 
ATOM 9590  H HG   . SER D 2 159 ? 229.147 195.577 217.614 1.00 265.33 ? 180 SER C HG   1 
ATOM 9591  N N    . TYR D 2 160 ? 230.410 191.122 217.058 1.00 199.74 ? 181 TYR C N    1 
ATOM 9592  C CA   . TYR D 2 160 ? 230.766 189.787 216.586 1.00 199.74 ? 181 TYR C CA   1 
ATOM 9593  C C    . TYR D 2 160 ? 230.542 188.675 217.608 1.00 199.74 ? 181 TYR C C    1 
ATOM 9594  O O    . TYR D 2 160 ? 230.195 187.555 217.208 1.00 199.74 ? 181 TYR C O    1 
ATOM 9595  C CB   . TYR D 2 160 ? 232.228 189.778 216.133 1.00 199.74 ? 181 TYR C CB   1 
ATOM 9596  C CG   . TYR D 2 160 ? 233.209 189.478 217.245 1.00 199.74 ? 181 TYR C CG   1 
ATOM 9597  C CD1  . TYR D 2 160 ? 233.467 188.164 217.606 1.00 199.74 ? 181 TYR C CD1  1 
ATOM 9598  C CD2  . TYR D 2 160 ? 233.851 190.517 217.903 1.00 199.74 ? 181 TYR C CD2  1 
ATOM 9599  C CE1  . TYR D 2 160 ? 234.363 187.889 218.621 1.00 199.74 ? 181 TYR C CE1  1 
ATOM 9600  C CE2  . TYR D 2 160 ? 234.747 190.242 218.917 1.00 199.74 ? 181 TYR C CE2  1 
ATOM 9601  C CZ   . TYR D 2 160 ? 235.003 188.935 219.277 1.00 199.74 ? 181 TYR C CZ   1 
ATOM 9602  O OH   . TYR D 2 160 ? 235.896 188.662 220.287 1.00 199.74 ? 181 TYR C OH   1 
ATOM 9603  H H    . TYR D 2 160 ? 230.995 191.467 217.585 1.00 239.69 ? 181 TYR C H    1 
ATOM 9604  H HA   . TYR D 2 160 ? 230.201 189.517 215.850 1.00 239.69 ? 181 TYR C HA   1 
ATOM 9605  H HB2  . TYR D 2 160 ? 232.362 189.031 215.350 1.00 239.69 ? 181 TYR C HB2  1 
ATOM 9606  H HB3  . TYR D 2 160 ? 232.482 190.749 215.708 1.00 239.69 ? 181 TYR C HB3  1 
ATOM 9607  H HD1  . TYR D 2 160 ? 232.962 187.347 217.089 1.00 239.69 ? 181 TYR C HD1  1 
ATOM 9608  H HD2  . TYR D 2 160 ? 233.647 191.549 217.619 1.00 239.69 ? 181 TYR C HD2  1 
ATOM 9609  H HE1  . TYR D 2 160 ? 234.566 186.857 218.904 1.00 239.69 ? 181 TYR C HE1  1 
ATOM 9610  H HE2  . TYR D 2 160 ? 235.251 191.059 219.435 1.00 239.69 ? 181 TYR C HE2  1 
ATOM 9611  H HH   . TYR D 2 160 ? 235.964 187.711 220.405 1.00 239.69 ? 181 TYR C HH   1 
ATOM 9612  N N    . ILE D 2 161 ? 230.696 188.944 218.910 1.00 190.45 ? 182 ILE C N    1 
ATOM 9613  C CA   . ILE D 2 161 ? 230.392 187.921 219.906 1.00 190.45 ? 182 ILE C CA   1 
ATOM 9614  C C    . ILE D 2 161 ? 228.904 187.607 219.891 1.00 190.45 ? 182 ILE C C    1 
ATOM 9615  O O    . ILE D 2 161 ? 228.509 186.438 219.946 1.00 190.45 ? 182 ILE C O    1 
ATOM 9616  C CB   . ILE D 2 161 ? 230.865 188.349 221.310 1.00 190.45 ? 182 ILE C CB   1 
ATOM 9617  C CG1  . ILE D 2 161 ? 232.394 188.370 221.378 1.00 190.45 ? 182 ILE C CG1  1 
ATOM 9618  C CG2  . ILE D 2 161 ? 230.331 187.384 222.395 1.00 190.45 ? 182 ILE C CG2  1 
ATOM 9619  C CD1  . ILE D 2 161 ? 232.946 189.059 222.606 1.00 190.45 ? 182 ILE C CD1  1 
ATOM 9620  H H    . ILE D 2 161 ? 230.966 189.694 219.232 1.00 228.54 ? 182 ILE C H    1 
ATOM 9621  H HA   . ILE D 2 161 ? 230.867 187.109 219.671 1.00 228.54 ? 182 ILE C HA   1 
ATOM 9622  H HB   . ILE D 2 161 ? 230.531 189.241 221.494 1.00 228.54 ? 182 ILE C HB   1 
ATOM 9623  H HG12 . ILE D 2 161 ? 232.710 187.454 221.397 1.00 228.54 ? 182 ILE C HG12 1 
ATOM 9624  H HG13 . ILE D 2 161 ? 232.753 188.817 220.598 1.00 228.54 ? 182 ILE C HG13 1 
ATOM 9625  H HG21 . ILE D 2 161 ? 230.725 187.607 223.251 1.00 228.54 ? 182 ILE C HG21 1 
ATOM 9626  H HG22 . ILE D 2 161 ? 229.370 187.447 222.495 1.00 228.54 ? 182 ILE C HG22 1 
ATOM 9627  H HG23 . ILE D 2 161 ? 230.584 186.479 222.155 1.00 228.54 ? 182 ILE C HG23 1 
ATOM 9628  H HD11 . ILE D 2 161 ? 233.883 189.255 222.463 1.00 228.54 ? 182 ILE C HD11 1 
ATOM 9629  H HD12 . ILE D 2 161 ? 232.447 189.878 222.752 1.00 228.54 ? 182 ILE C HD12 1 
ATOM 9630  H HD13 . ILE D 2 161 ? 232.848 188.476 223.375 1.00 228.54 ? 182 ILE C HD13 1 
ATOM 9631  N N    . SER D 2 162 ? 228.054 188.639 219.801 1.00 190.61 ? 183 SER C N    1 
ATOM 9632  C CA   . SER D 2 162 ? 226.610 188.434 219.756 1.00 190.61 ? 183 SER C CA   1 
ATOM 9633  C C    . SER D 2 162 ? 226.172 187.626 218.543 1.00 190.61 ? 183 SER C C    1 
ATOM 9634  O O    . SER D 2 162 ? 225.062 187.084 218.539 1.00 190.61 ? 183 SER C O    1 
ATOM 9635  C CB   . SER D 2 162 ? 225.900 189.773 219.752 1.00 190.61 ? 183 SER C CB   1 
ATOM 9636  O OG   . SER D 2 162 ? 226.069 190.428 218.525 1.00 190.61 ? 183 SER C OG   1 
ATOM 9637  H H    . SER D 2 162 ? 228.295 189.465 219.766 1.00 228.73 ? 183 SER C H    1 
ATOM 9638  H HA   . SER D 2 162 ? 226.334 187.960 220.555 1.00 228.73 ? 183 SER C HA   1 
ATOM 9639  H HB2  . SER D 2 162 ? 224.837 189.623 219.943 1.00 228.73 ? 183 SER C HB2  1 
ATOM 9640  H HB3  . SER D 2 162 ? 226.291 190.395 220.556 1.00 228.73 ? 183 SER C HB3  1 
ATOM 9641  H HG   . SER D 2 162 ? 225.930 191.362 218.702 1.00 228.73 ? 183 SER C HG   1 
ATOM 9642  N N    . ILE D 2 163 ? 227.020 187.534 217.525 1.00 174.01 ? 184 ILE C N    1 
ATOM 9643  C CA   . ILE D 2 163 ? 226.771 186.686 216.370 1.00 174.01 ? 184 ILE C CA   1 
ATOM 9644  C C    . ILE D 2 163 ? 227.396 185.316 216.568 1.00 174.01 ? 184 ILE C C    1 
ATOM 9645  O O    . ILE D 2 163 ? 226.750 184.286 216.354 1.00 174.01 ? 184 ILE C O    1 
ATOM 9646  C CB   . ILE D 2 163 ? 227.324 187.326 215.083 1.00 174.01 ? 184 ILE C CB   1 
ATOM 9647  C CG1  . ILE D 2 163 ? 226.587 188.633 214.778 1.00 174.01 ? 184 ILE C CG1  1 
ATOM 9648  C CG2  . ILE D 2 163 ? 227.207 186.359 213.915 1.00 174.01 ? 184 ILE C CG2  1 
ATOM 9649  C CD1  . ILE D 2 163 ? 227.219 189.446 213.671 1.00 174.01 ? 184 ILE C CD1  1 
ATOM 9650  H H    . ILE D 2 163 ? 227.768 187.951 217.476 1.00 208.81 ? 184 ILE C H    1 
ATOM 9651  H HA   . ILE D 2 163 ? 225.819 186.566 216.251 1.00 208.81 ? 184 ILE C HA   1 
ATOM 9652  H HB   . ILE D 2 163 ? 228.373 187.582 215.227 1.00 208.81 ? 184 ILE C HB   1 
ATOM 9653  H HG12 . ILE D 2 163 ? 225.559 188.412 214.495 1.00 208.81 ? 184 ILE C HG12 1 
ATOM 9654  H HG13 . ILE D 2 163 ? 226.553 189.250 215.676 1.00 208.81 ? 184 ILE C HG13 1 
ATOM 9655  H HG21 . ILE D 2 163 ? 227.601 186.828 213.014 1.00 208.81 ? 184 ILE C HG21 1 
ATOM 9656  H HG22 . ILE D 2 163 ? 227.774 185.456 214.133 1.00 208.81 ? 184 ILE C HG22 1 
ATOM 9657  H HG23 . ILE D 2 163 ? 226.159 186.101 213.761 1.00 208.81 ? 184 ILE C HG23 1 
ATOM 9658  H HD11 . ILE D 2 163 ? 226.641 190.357 213.513 1.00 208.81 ? 184 ILE C HD11 1 
ATOM 9659  H HD12 . ILE D 2 163 ? 228.241 189.708 213.950 1.00 208.81 ? 184 ILE C HD12 1 
ATOM 9660  H HD13 . ILE D 2 163 ? 227.233 188.861 212.753 1.00 208.81 ? 184 ILE C HD13 1 
ATOM 9661  N N    . CYS D 2 164 ? 228.666 185.283 216.989 1.00 199.16 ? 185 CYS C N    1 
ATOM 9662  C CA   . CYS D 2 164 ? 229.362 184.005 217.089 1.00 199.16 ? 185 CYS C CA   1 
ATOM 9663  C C    . CYS D 2 164 ? 228.801 183.110 218.193 1.00 199.16 ? 185 CYS C C    1 
ATOM 9664  O O    . CYS D 2 164 ? 228.962 181.887 218.116 1.00 199.16 ? 185 CYS C O    1 
ATOM 9665  C CB   . CYS D 2 164 ? 230.851 184.237 217.346 1.00 199.16 ? 185 CYS C CB   1 
ATOM 9666  S SG   . CYS D 2 164 ? 231.723 185.028 215.974 1.00 199.16 ? 185 CYS C SG   1 
ATOM 9667  H H    . CYS D 2 164 ? 229.138 185.967 217.211 1.00 238.99 ? 185 CYS C H    1 
ATOM 9668  H HA   . CYS D 2 164 ? 229.265 183.527 216.252 1.00 238.99 ? 185 CYS C HA   1 
ATOM 9669  H HB2  . CYS D 2 164 ? 230.974 184.862 218.230 1.00 238.99 ? 185 CYS C HB2  1 
ATOM 9670  H HB3  . CYS D 2 164 ? 231.338 183.283 217.550 1.00 238.99 ? 185 CYS C HB3  1 
ATOM 9671  N N    . ASN D 2 165 ? 228.156 183.679 219.215 1.00 181.35 ? 186 ASN C N    1 
ATOM 9672  C CA   . ASN D 2 165 ? 227.525 182.894 220.275 1.00 181.35 ? 186 ASN C CA   1 
ATOM 9673  C C    . ASN D 2 165 ? 226.043 182.630 220.016 1.00 181.35 ? 186 ASN C C    1 
ATOM 9674  O O    . ASN D 2 165 ? 225.350 182.120 220.902 1.00 181.35 ? 186 ASN C O    1 
ATOM 9675  C CB   . ASN D 2 165 ? 227.708 183.584 221.614 1.00 181.35 ? 186 ASN C CB   1 
ATOM 9676  C CG   . ASN D 2 165 ? 226.927 184.865 221.716 1.00 181.35 ? 186 ASN C CG   1 
ATOM 9677  O OD1  . ASN D 2 165 ? 226.093 185.168 220.855 1.00 181.35 ? 186 ASN C OD1  1 
ATOM 9678  N ND2  . ASN D 2 165 ? 227.180 185.623 222.753 1.00 181.35 ? 186 ASN C ND2  1 
ATOM 9679  H H    . ASN D 2 165 ? 228.070 184.528 219.318 1.00 217.62 ? 186 ASN C H    1 
ATOM 9680  H HA   . ASN D 2 165 ? 227.960 182.032 220.347 1.00 217.62 ? 186 ASN C HA   1 
ATOM 9681  H HB2  . ASN D 2 165 ? 227.392 182.915 222.415 1.00 217.62 ? 186 ASN C HB2  1 
ATOM 9682  H HB3  . ASN D 2 165 ? 228.765 183.804 221.769 1.00 217.62 ? 186 ASN C HB3  1 
ATOM 9683  H HD21 . ASN D 2 165 ? 226.690 186.487 222.872 1.00 217.62 ? 186 ASN C HD21 1 
ATOM 9684  H HD22 . ASN D 2 165 ? 227.863 185.338 223.425 1.00 217.62 ? 186 ASN C HD22 1 
ATOM 9685  N N    . ARG D 2 166 ? 225.544 182.967 218.829 1.00 188.52 ? 187 ARG C N    1 
ATOM 9686  C CA   . ARG D 2 166 ? 224.130 182.823 218.513 1.00 188.52 ? 187 ARG C CA   1 
ATOM 9687  C C    . ARG D 2 166 ? 223.825 181.367 218.186 1.00 188.52 ? 187 ARG C C    1 
ATOM 9688  O O    . ARG D 2 166 ? 224.484 180.768 217.329 1.00 188.52 ? 187 ARG C O    1 
ATOM 9689  C CB   . ARG D 2 166 ? 223.740 183.708 217.338 1.00 188.52 ? 187 ARG C CB   1 
ATOM 9690  C CG   . ARG D 2 166 ? 222.261 183.685 216.983 1.00 188.52 ? 187 ARG C CG   1 
ATOM 9691  C CD   . ARG D 2 166 ? 221.957 184.585 215.842 1.00 188.52 ? 187 ARG C CD   1 
ATOM 9692  N NE   . ARG D 2 166 ? 222.197 185.981 216.172 1.00 188.52 ? 187 ARG C NE   1 
ATOM 9693  C CZ   . ARG D 2 166 ? 221.330 186.771 216.834 1.00 188.52 ? 187 ARG C CZ   1 
ATOM 9694  N NH1  . ARG D 2 166 ? 220.172 186.289 217.229 1.00 188.52 ? 187 ARG C NH1  1 
ATOM 9695  N NH2  . ARG D 2 166 ? 221.643 188.029 217.087 1.00 188.52 ? 187 ARG C NH2  1 
ATOM 9696  H H    . ARG D 2 166 ? 226.008 183.280 218.176 1.00 226.22 ? 187 ARG C H    1 
ATOM 9697  H HA   . ARG D 2 166 ? 223.600 183.082 219.285 1.00 226.22 ? 187 ARG C HA   1 
ATOM 9698  H HB2  . ARG D 2 166 ? 224.010 184.741 217.555 1.00 226.22 ? 187 ARG C HB2  1 
ATOM 9699  H HB3  . ARG D 2 166 ? 224.297 183.403 216.453 1.00 226.22 ? 187 ARG C HB3  1 
ATOM 9700  H HG2  . ARG D 2 166 ? 221.969 182.671 216.708 1.00 226.22 ? 187 ARG C HG2  1 
ATOM 9701  H HG3  . ARG D 2 166 ? 221.675 184.011 217.843 1.00 226.22 ? 187 ARG C HG3  1 
ATOM 9702  H HD2  . ARG D 2 166 ? 222.587 184.322 214.993 1.00 226.22 ? 187 ARG C HD2  1 
ATOM 9703  H HD3  . ARG D 2 166 ? 220.909 184.477 215.562 1.00 226.22 ? 187 ARG C HD3  1 
ATOM 9704  H HE   . ARG D 2 166 ? 223.078 186.387 215.885 1.00 226.22 ? 187 ARG C HE   1 
ATOM 9705  H HH11 . ARG D 2 166 ? 219.933 185.327 217.036 1.00 226.22 ? 187 ARG C HH11 1 
ATOM 9706  H HH12 . ARG D 2 166 ? 219.522 186.881 217.725 1.00 226.22 ? 187 ARG C HH12 1 
ATOM 9707  H HH21 . ARG D 2 166 ? 222.533 188.400 216.783 1.00 226.22 ? 187 ARG C HH21 1 
ATOM 9708  H HH22 . ARG D 2 166 ? 220.993 188.621 217.583 1.00 226.22 ? 187 ARG C HH22 1 
ATOM 9709  N N    . GLU D 2 167 ? 222.829 180.802 218.865 1.00 177.82 ? 188 GLU C N    1 
ATOM 9710  C CA   . GLU D 2 167 ? 222.388 179.441 218.587 1.00 177.82 ? 188 GLU C CA   1 
ATOM 9711  C C    . GLU D 2 167 ? 221.471 179.438 217.368 1.00 177.82 ? 188 GLU C C    1 
ATOM 9712  O O    . GLU D 2 167 ? 220.575 180.280 217.255 1.00 177.82 ? 188 GLU C O    1 
ATOM 9713  C CB   . GLU D 2 167 ? 221.663 178.846 219.797 1.00 177.82 ? 188 GLU C CB   1 
ATOM 9714  C CG   . GLU D 2 167 ? 221.279 177.382 219.643 1.00 177.82 ? 188 GLU C CG   1 
ATOM 9715  C CD   . GLU D 2 167 ? 220.552 176.838 220.841 1.00 177.82 ? 188 GLU C CD   1 
ATOM 9716  O OE1  . GLU D 2 167 ? 220.272 177.598 221.737 1.00 177.82 ? 188 GLU C OE1  1 
ATOM 9717  O OE2  . GLU D 2 167 ? 220.275 175.662 220.860 1.00 177.82 ? 188 GLU C OE2  1 
ATOM 9718  H H    . GLU D 2 167 ? 222.392 181.189 219.496 1.00 213.38 ? 188 GLU C H    1 
ATOM 9719  H HA   . GLU D 2 167 ? 223.157 178.883 218.393 1.00 213.38 ? 188 GLU C HA   1 
ATOM 9720  H HB2  . GLU D 2 167 ? 222.296 178.935 220.680 1.00 213.38 ? 188 GLU C HB2  1 
ATOM 9721  H HB3  . GLU D 2 167 ? 220.752 179.412 219.989 1.00 213.38 ? 188 GLU C HB3  1 
ATOM 9722  H HG2  . GLU D 2 167 ? 220.642 177.274 218.766 1.00 213.38 ? 188 GLU C HG2  1 
ATOM 9723  H HG3  . GLU D 2 167 ? 222.182 176.796 219.476 1.00 213.38 ? 188 GLU C HG3  1 
ATOM 9724  N N    . ILE D 2 168 ? 221.697 178.489 216.464 1.00 165.66 ? 189 ILE C N    1 
ATOM 9725  C CA   . ILE D 2 168 ? 220.893 178.363 215.250 1.00 165.66 ? 189 ILE C CA   1 
ATOM 9726  C C    . ILE D 2 168 ? 219.839 177.274 215.401 1.00 165.66 ? 189 ILE C C    1 
ATOM 9727  O O    . ILE D 2 168 ? 218.669 177.476 215.064 1.00 165.66 ? 189 ILE C O    1 
ATOM 9728  C CB   . ILE D 2 168 ? 221.780 178.053 214.031 1.00 165.66 ? 189 ILE C CB   1 
ATOM 9729  C CG1  . ILE D 2 168 ? 222.858 179.128 213.867 1.00 165.66 ? 189 ILE C CG1  1 
ATOM 9730  C CG2  . ILE D 2 168 ? 220.934 177.947 212.771 1.00 165.66 ? 189 ILE C CG2  1 
ATOM 9731  C CD1  . ILE D 2 168 ? 222.306 180.525 213.700 1.00 165.66 ? 189 ILE C CD1  1 
ATOM 9732  H H    . ILE D 2 168 ? 222.319 177.898 216.530 1.00 198.79 ? 189 ILE C H    1 
ATOM 9733  H HA   . ILE D 2 168 ? 220.417 179.192 215.090 1.00 198.79 ? 189 ILE C HA   1 
ATOM 9734  H HB   . ILE D 2 168 ? 222.299 177.108 214.189 1.00 198.79 ? 189 ILE C HB   1 
ATOM 9735  H HG12 . ILE D 2 168 ? 223.512 179.121 214.738 1.00 198.79 ? 189 ILE C HG12 1 
ATOM 9736  H HG13 . ILE D 2 168 ? 223.472 178.898 212.996 1.00 198.79 ? 189 ILE C HG13 1 
ATOM 9737  H HG21 . ILE D 2 168 ? 221.577 177.728 211.919 1.00 198.79 ? 189 ILE C HG21 1 
ATOM 9738  H HG22 . ILE D 2 168 ? 220.204 177.147 212.889 1.00 198.79 ? 189 ILE C HG22 1 
ATOM 9739  H HG23 . ILE D 2 168 ? 220.415 178.890 212.601 1.00 198.79 ? 189 ILE C HG23 1 
ATOM 9740  H HD11 . ILE D 2 168 ? 223.130 181.231 213.590 1.00 198.79 ? 189 ILE C HD11 1 
ATOM 9741  H HD12 . ILE D 2 168 ? 221.674 180.563 212.812 1.00 198.79 ? 189 ILE C HD12 1 
ATOM 9742  H HD13 . ILE D 2 168 ? 221.717 180.791 214.576 1.00 198.79 ? 189 ILE C HD13 1 
ATOM 9743  N N    . SER D 2 169 ? 220.236 176.110 215.905 1.00 159.50 ? 190 SER C N    1 
ATOM 9744  C CA   . SER D 2 169 ? 219.334 174.975 216.045 1.00 159.50 ? 190 SER C CA   1 
ATOM 9745  C C    . SER D 2 169 ? 219.862 174.093 217.168 1.00 159.50 ? 190 SER C C    1 
ATOM 9746  O O    . SER D 2 169 ? 221.000 174.277 217.626 1.00 159.50 ? 190 SER C O    1 
ATOM 9747  C CB   . SER D 2 169 ? 219.239 174.192 214.750 1.00 159.50 ? 190 SER C CB   1 
ATOM 9748  O OG   . SER D 2 169 ? 220.420 173.478 214.507 1.00 159.50 ? 190 SER C OG   1 
ATOM 9749  H H    . SER D 2 169 ? 221.036 175.952 216.177 1.00 191.40 ? 190 SER C H    1 
ATOM 9750  H HA   . SER D 2 169 ? 218.454 175.298 216.288 1.00 191.40 ? 190 SER C HA   1 
ATOM 9751  H HB2  . SER D 2 169 ? 218.398 173.501 214.803 1.00 191.40 ? 190 SER C HB2  1 
ATOM 9752  H HB3  . SER D 2 169 ? 219.048 174.876 213.924 1.00 191.40 ? 190 SER C HB3  1 
ATOM 9753  H HG   . SER D 2 169 ? 220.715 173.744 213.632 1.00 191.40 ? 190 SER C HG   1 
ATOM 9754  N N    . PRO D 2 170 ? 219.063 173.132 217.646 1.00 149.37 ? 191 PRO C N    1 
ATOM 9755  C CA   . PRO D 2 170 ? 219.551 172.256 218.727 1.00 149.37 ? 191 PRO C CA   1 
ATOM 9756  C C    . PRO D 2 170 ? 220.871 171.566 218.423 1.00 149.37 ? 191 PRO C C    1 
ATOM 9757  O O    . PRO D 2 170 ? 221.589 171.209 219.367 1.00 149.37 ? 191 PRO C O    1 
ATOM 9758  C CB   . PRO D 2 170 ? 218.420 171.232 218.860 1.00 149.37 ? 191 PRO C CB   1 
ATOM 9759  C CG   . PRO D 2 170 ? 217.201 171.976 218.433 1.00 149.37 ? 191 PRO C CG   1 
ATOM 9760  C CD   . PRO D 2 170 ? 217.666 172.825 217.279 1.00 149.37 ? 191 PRO C CD   1 
ATOM 9761  H HA   . PRO D 2 170 ? 219.643 172.764 219.549 1.00 179.24 ? 191 PRO C HA   1 
ATOM 9762  H HB2  . PRO D 2 170 ? 218.628 170.356 218.228 1.00 179.24 ? 191 PRO C HB2  1 
ATOM 9763  H HB3  . PRO D 2 170 ? 218.358 170.872 219.898 1.00 179.24 ? 191 PRO C HB3  1 
ATOM 9764  H HG2  . PRO D 2 170 ? 216.406 171.272 218.148 1.00 179.24 ? 191 PRO C HG2  1 
ATOM 9765  H HG3  . PRO D 2 170 ? 216.809 172.576 219.268 1.00 179.24 ? 191 PRO C HG3  1 
ATOM 9766  H HD2  . PRO D 2 170 ? 217.604 172.243 216.348 1.00 179.24 ? 191 PRO C HD2  1 
ATOM 9767  H HD3  . PRO D 2 170 ? 217.043 173.729 217.214 1.00 179.24 ? 191 PRO C HD3  1 
ATOM 9768  N N    . THR D 2 171 ? 221.211 171.362 217.151 1.00 153.04 ? 192 THR C N    1 
ATOM 9769  C CA   . THR D 2 171 ? 222.460 170.725 216.739 1.00 153.04 ? 192 THR C CA   1 
ATOM 9770  C C    . THR D 2 171 ? 223.218 171.611 215.759 1.00 153.04 ? 192 THR C C    1 
ATOM 9771  O O    . THR D 2 171 ? 223.799 171.132 214.780 1.00 153.04 ? 192 THR C O    1 
ATOM 9772  C CB   . THR D 2 171 ? 222.201 169.348 216.102 1.00 153.04 ? 192 THR C CB   1 
ATOM 9773  O OG1  . THR D 2 171 ? 221.337 169.498 214.968 1.00 153.04 ? 192 THR C OG1  1 
ATOM 9774  C CG2  . THR D 2 171 ? 221.554 168.407 217.107 1.00 153.04 ? 192 THR C CG2  1 
ATOM 9775  H H    . THR D 2 171 ? 220.718 171.594 216.485 1.00 183.65 ? 192 THR C H    1 
ATOM 9776  H HA   . THR D 2 171 ? 223.035 170.594 217.507 1.00 183.65 ? 192 THR C HA   1 
ATOM 9777  H HB   . THR D 2 171 ? 223.146 168.918 215.767 1.00 183.65 ? 192 THR C HB   1 
ATOM 9778  H HG1  . THR D 2 171 ? 221.838 169.851 214.229 1.00 183.65 ? 192 THR C HG1  1 
ATOM 9779  H HG21 . THR D 2 171 ? 221.379 167.439 216.639 1.00 183.65 ? 192 THR C HG21 1 
ATOM 9780  H HG22 . THR D 2 171 ? 222.214 168.282 217.965 1.00 183.65 ? 192 THR C HG22 1 
ATOM 9781  H HG23 . THR D 2 171 ? 220.605 168.827 217.438 1.00 183.65 ? 192 THR C HG23 1 
ATOM 9782  N N    . GLU D 2 172 ? 223.218 172.919 216.009 1.00 165.78 ? 193 GLU C N    1 
ATOM 9783  C CA   . GLU D 2 172 ? 224.033 173.858 215.240 1.00 165.78 ? 193 GLU C CA   1 
ATOM 9784  C C    . GLU D 2 172 ? 224.383 175.013 216.166 1.00 165.78 ? 193 GLU C C    1 
ATOM 9785  O O    . GLU D 2 172 ? 223.516 175.829 216.496 1.00 165.78 ? 193 GLU C O    1 
ATOM 9786  C CB   . GLU D 2 172 ? 223.298 174.348 213.994 1.00 165.78 ? 193 GLU C CB   1 
ATOM 9787  C CG   . GLU D 2 172 ? 224.141 175.226 213.078 1.00 165.78 ? 193 GLU C CG   1 
ATOM 9788  C CD   . GLU D 2 172 ? 223.434 175.565 211.780 1.00 165.78 ? 193 GLU C CD   1 
ATOM 9789  O OE1  . GLU D 2 172 ? 222.263 175.161 211.618 1.00 165.78 ? 193 GLU C OE1  1 
ATOM 9790  O OE2  . GLU D 2 172 ? 224.048 176.234 210.924 1.00 165.78 ? 193 GLU C OE2  1 
ATOM 9791  H H    . GLU D 2 172 ? 222.751 173.297 216.624 1.00 198.94 ? 193 GLU C H    1 
ATOM 9792  H HA   . GLU D 2 172 ? 224.858 173.432 214.963 1.00 198.94 ? 193 GLU C HA   1 
ATOM 9793  H HB2  . GLU D 2 172 ? 223.006 173.579 213.481 1.00 198.94 ? 193 GLU C HB2  1 
ATOM 9794  H HB3  . GLU D 2 172 ? 222.530 174.870 214.272 1.00 198.94 ? 193 GLU C HB3  1 
ATOM 9795  H HG2  . GLU D 2 172 ? 224.342 176.060 213.530 1.00 198.94 ? 193 GLU C HG2  1 
ATOM 9796  H HG3  . GLU D 2 172 ? 224.963 174.761 212.861 1.00 198.94 ? 193 GLU C HG3  1 
ATOM 9797  N N    . ARG D 2 173 ? 225.648 175.076 216.584 1.00 171.80 ? 194 ARG C N    1 
ATOM 9798  C CA   . ARG D 2 173 ? 226.041 176.020 217.624 1.00 171.80 ? 194 ARG C CA   1 
ATOM 9799  C C    . ARG D 2 173 ? 225.914 177.461 217.146 1.00 171.80 ? 194 ARG C C    1 
ATOM 9800  O O    . ARG D 2 173 ? 225.551 178.346 217.930 1.00 171.80 ? 194 ARG C O    1 
ATOM 9801  C CB   . ARG D 2 173 ? 227.474 175.761 218.066 1.00 171.80 ? 194 ARG C CB   1 
ATOM 9802  C CG   . ARG D 2 173 ? 228.006 176.731 219.110 1.00 171.80 ? 194 ARG C CG   1 
ATOM 9803  C CD   . ARG D 2 173 ? 227.287 176.594 220.403 1.00 171.80 ? 194 ARG C CD   1 
ATOM 9804  N NE   . ARG D 2 173 ? 227.728 177.581 221.375 1.00 171.80 ? 194 ARG C NE   1 
ATOM 9805  C CZ   . ARG D 2 173 ? 227.197 178.812 221.510 1.00 171.80 ? 194 ARG C CZ   1 
ATOM 9806  N NH1  . ARG D 2 173 ? 226.209 179.192 220.730 1.00 171.80 ? 194 ARG C NH1  1 
ATOM 9807  N NH2  . ARG D 2 173 ? 227.670 179.639 222.427 1.00 171.80 ? 194 ARG C NH2  1 
ATOM 9808  H H    . ARG D 2 173 ? 226.290 174.589 216.284 1.00 206.16 ? 194 ARG C H    1 
ATOM 9809  H HA   . ARG D 2 173 ? 225.454 175.904 218.386 1.00 206.16 ? 194 ARG C HA   1 
ATOM 9810  H HB2  . ARG D 2 173 ? 227.551 174.757 218.480 1.00 206.16 ? 194 ARG C HB2  1 
ATOM 9811  H HB3  . ARG D 2 173 ? 228.136 175.812 217.202 1.00 206.16 ? 194 ARG C HB3  1 
ATOM 9812  H HG2  . ARG D 2 173 ? 229.064 176.534 219.284 1.00 206.16 ? 194 ARG C HG2  1 
ATOM 9813  H HG3  . ARG D 2 173 ? 227.881 177.754 218.754 1.00 206.16 ? 194 ARG C HG3  1 
ATOM 9814  H HD2  . ARG D 2 173 ? 226.218 176.730 220.241 1.00 206.16 ? 194 ARG C HD2  1 
ATOM 9815  H HD3  . ARG D 2 173 ? 227.468 175.603 220.817 1.00 206.16 ? 194 ARG C HD3  1 
ATOM 9816  H HE   . ARG D 2 173 ? 228.487 177.326 221.993 1.00 206.16 ? 194 ARG C HE   1 
ATOM 9817  H HH11 . ARG D 2 173 ? 225.848 178.560 220.030 1.00 206.16 ? 194 ARG C HH11 1 
ATOM 9818  H HH12 . ARG D 2 173 ? 225.812 180.114 220.832 1.00 206.16 ? 194 ARG C HH12 1 
ATOM 9819  H HH21 . ARG D 2 173 ? 228.430 179.347 223.027 1.00 206.16 ? 194 ARG C HH21 1 
ATOM 9820  H HH22 . ARG D 2 173 ? 227.272 180.561 222.529 1.00 206.16 ? 194 ARG C HH22 1 
ATOM 9821  N N    . CYS D 2 174 ? 226.204 177.717 215.874 1.00 175.70 ? 195 CYS C N    1 
ATOM 9822  C CA   . CYS D 2 174 ? 226.229 179.078 215.356 1.00 175.70 ? 195 CYS C CA   1 
ATOM 9823  C C    . CYS D 2 174 ? 226.259 179.023 213.838 1.00 175.70 ? 195 CYS C C    1 
ATOM 9824  O O    . CYS D 2 174 ? 226.467 177.965 213.237 1.00 175.70 ? 195 CYS C O    1 
ATOM 9825  C CB   . CYS D 2 174 ? 227.447 179.843 215.879 1.00 175.70 ? 195 CYS C CB   1 
ATOM 9826  S SG   . CYS D 2 174 ? 228.996 179.182 215.220 1.00 175.70 ? 195 CYS C SG   1 
ATOM 9827  H H    . CYS D 2 174 ? 226.390 177.115 215.288 1.00 210.84 ? 195 CYS C H    1 
ATOM 9828  H HA   . CYS D 2 174 ? 225.426 179.545 215.630 1.00 210.84 ? 195 CYS C HA   1 
ATOM 9829  H HB2  . CYS D 2 174 ? 227.377 180.771 215.607 1.00 210.84 ? 195 CYS C HB2  1 
ATOM 9830  H HB3  . CYS D 2 174 ? 227.478 179.783 216.846 1.00 210.84 ? 195 CYS C HB3  1 
ATOM 9831  N N    . ASN D 2 175 ? 226.047 180.186 213.223 1.00 166.15 ? 196 ASN C N    1 
ATOM 9832  C CA   . ASN D 2 175 ? 226.307 180.373 211.797 1.00 166.15 ? 196 ASN C CA   1 
ATOM 9833  C C    . ASN D 2 175 ? 227.768 180.783 211.668 1.00 166.15 ? 196 ASN C C    1 
ATOM 9834  O O    . ASN D 2 175 ? 228.112 181.961 211.799 1.00 166.15 ? 196 ASN C O    1 
ATOM 9835  C CB   . ASN D 2 175 ? 225.379 181.403 211.181 1.00 166.15 ? 196 ASN C CB   1 
ATOM 9836  C CG   . ASN D 2 175 ? 225.553 181.521 209.693 1.00 166.15 ? 196 ASN C CG   1 
ATOM 9837  O OD1  . ASN D 2 175 ? 226.680 181.500 209.184 1.00 166.15 ? 196 ASN C OD1  1 
ATOM 9838  N ND2  . ASN D 2 175 ? 224.460 181.645 208.984 1.00 166.15 ? 196 ASN C ND2  1 
ATOM 9839  H H    . ASN D 2 175 ? 225.749 180.891 213.616 1.00 199.38 ? 196 ASN C H    1 
ATOM 9840  H HA   . ASN D 2 175 ? 226.180 179.535 211.327 1.00 199.38 ? 196 ASN C HA   1 
ATOM 9841  H HB2  . ASN D 2 175 ? 224.343 181.133 211.394 1.00 199.38 ? 196 ASN C HB2  1 
ATOM 9842  H HB3  . ASN D 2 175 ? 225.563 182.376 211.635 1.00 199.38 ? 196 ASN C HB3  1 
ATOM 9843  H HD21 . ASN D 2 175 ? 224.515 181.727 207.989 1.00 199.38 ? 196 ASN C HD21 1 
ATOM 9844  H HD22 . ASN D 2 175 ? 223.569 181.657 209.438 1.00 199.38 ? 196 ASN C HD22 1 
ATOM 9845  N N    . ARG D 2 176 ? 228.630 179.799 211.415 1.00 170.10 ? 197 ARG C N    1 
ATOM 9846  C CA   . ARG D 2 176 ? 230.070 180.037 211.422 1.00 170.10 ? 197 ARG C CA   1 
ATOM 9847  C C    . ARG D 2 176 ? 230.480 181.040 210.346 1.00 170.10 ? 197 ARG C C    1 
ATOM 9848  O O    . ARG D 2 176 ? 231.396 181.846 210.555 1.00 170.10 ? 197 ARG C O    1 
ATOM 9849  C CB   . ARG D 2 176 ? 230.825 178.734 211.209 1.00 170.10 ? 197 ARG C CB   1 
ATOM 9850  C CG   . ARG D 2 176 ? 232.331 178.830 211.394 1.00 170.10 ? 197 ARG C CG   1 
ATOM 9851  C CD   . ARG D 2 176 ? 232.982 177.498 211.306 1.00 170.10 ? 197 ARG C CD   1 
ATOM 9852  N NE   . ARG D 2 176 ? 234.417 177.579 211.525 1.00 170.10 ? 197 ARG C NE   1 
ATOM 9853  C CZ   . ARG D 2 176 ? 235.267 176.539 211.423 1.00 170.10 ? 197 ARG C CZ   1 
ATOM 9854  N NH1  . ARG D 2 176 ? 234.812 175.347 211.105 1.00 170.10 ? 197 ARG C NH1  1 
ATOM 9855  N NH2  . ARG D 2 176 ? 236.558 176.716 211.642 1.00 170.10 ? 197 ARG C NH2  1 
ATOM 9856  H H    . ARG D 2 176 ? 228.406 178.987 211.238 1.00 204.12 ? 197 ARG C H    1 
ATOM 9857  H HA   . ARG D 2 176 ? 230.323 180.402 212.285 1.00 204.12 ? 197 ARG C HA   1 
ATOM 9858  H HB2  . ARG D 2 176 ? 230.455 177.981 211.903 1.00 204.12 ? 197 ARG C HB2  1 
ATOM 9859  H HB3  . ARG D 2 176 ? 230.640 178.367 210.199 1.00 204.12 ? 197 ARG C HB3  1 
ATOM 9860  H HG2  . ARG D 2 176 ? 232.754 179.470 210.619 1.00 204.12 ? 197 ARG C HG2  1 
ATOM 9861  H HG3  . ARG D 2 176 ? 232.551 179.255 212.374 1.00 204.12 ? 197 ARG C HG3  1 
ATOM 9862  H HD2  . ARG D 2 176 ? 232.559 176.836 212.061 1.00 204.12 ? 197 ARG C HD2  1 
ATOM 9863  H HD3  . ARG D 2 176 ? 232.812 177.075 210.316 1.00 204.12 ? 197 ARG C HD3  1 
ATOM 9864  H HE   . ARG D 2 176 ? 234.805 178.480 211.771 1.00 204.12 ? 197 ARG C HE   1 
ATOM 9865  H HH11 . ARG D 2 176 ? 233.825 175.211 210.938 1.00 204.12 ? 197 ARG C HH11 1 
ATOM 9866  H HH12 . ARG D 2 176 ? 235.448 174.567 211.029 1.00 204.12 ? 197 ARG C HH12 1 
ATOM 9867  H HH21 . ARG D 2 176 ? 236.908 177.632 211.886 1.00 204.12 ? 197 ARG C HH21 1 
ATOM 9868  H HH22 . ARG D 2 176 ? 237.194 175.937 211.565 1.00 204.12 ? 197 ARG C HH22 1 
ATOM 9869  N N    . ARG D 2 177 ? 229.807 181.015 209.194 1.00 166.65 ? 198 ARG C N    1 
ATOM 9870  C CA   . ARG D 2 177 ? 230.113 181.961 208.123 1.00 166.65 ? 198 ARG C CA   1 
ATOM 9871  C C    . ARG D 2 177 ? 229.869 183.399 208.573 1.00 166.65 ? 198 ARG C C    1 
ATOM 9872  O O    . ARG D 2 177 ? 230.718 184.282 208.374 1.00 166.65 ? 198 ARG C O    1 
ATOM 9873  C CB   . ARG D 2 177 ? 229.269 181.668 206.892 1.00 166.65 ? 198 ARG C CB   1 
ATOM 9874  C CG   . ARG D 2 177 ? 229.590 182.525 205.678 1.00 166.65 ? 198 ARG C CG   1 
ATOM 9875  C CD   . ARG D 2 177 ? 228.634 182.284 204.567 1.00 166.65 ? 198 ARG C CD   1 
ATOM 9876  N NE   . ARG D 2 177 ? 227.304 182.783 204.878 1.00 166.65 ? 198 ARG C NE   1 
ATOM 9877  C CZ   . ARG D 2 177 ? 226.926 184.072 204.770 1.00 166.65 ? 198 ARG C CZ   1 
ATOM 9878  N NH1  . ARG D 2 177 ? 227.785 184.977 204.358 1.00 166.65 ? 198 ARG C NH1  1 
ATOM 9879  N NH2  . ARG D 2 177 ? 225.690 184.426 205.078 1.00 166.65 ? 198 ARG C NH2  1 
ATOM 9880  H H    . ARG D 2 177 ? 229.175 180.462 209.008 1.00 199.98 ? 198 ARG C H    1 
ATOM 9881  H HA   . ARG D 2 177 ? 231.048 181.875 207.880 1.00 199.98 ? 198 ARG C HA   1 
ATOM 9882  H HB2  . ARG D 2 177 ? 229.397 180.626 206.603 1.00 199.98 ? 198 ARG C HB2  1 
ATOM 9883  H HB3  . ARG D 2 177 ? 228.215 181.815 207.129 1.00 199.98 ? 198 ARG C HB3  1 
ATOM 9884  H HG2  . ARG D 2 177 ? 229.538 183.579 205.952 1.00 199.98 ? 198 ARG C HG2  1 
ATOM 9885  H HG3  . ARG D 2 177 ? 230.594 182.292 205.322 1.00 199.98 ? 198 ARG C HG3  1 
ATOM 9886  H HD2  . ARG D 2 177 ? 228.986 182.790 203.668 1.00 199.98 ? 198 ARG C HD2  1 
ATOM 9887  H HD3  . ARG D 2 177 ? 228.560 181.214 204.376 1.00 199.98 ? 198 ARG C HD3  1 
ATOM 9888  H HE   . ARG D 2 177 ? 226.614 182.116 205.198 1.00 199.98 ? 198 ARG C HE   1 
ATOM 9889  H HH11 . ARG D 2 177 ? 228.730 184.706 204.122 1.00 199.98 ? 198 ARG C HH11 1 
ATOM 9890  H HH12 . ARG D 2 177 ? 227.502 185.943 204.277 1.00 199.98 ? 198 ARG C HH12 1 
ATOM 9891  H HH21 . ARG D 2 177 ? 225.029 183.730 205.395 1.00 199.98 ? 198 ARG C HH21 1 
ATOM 9892  H HH22 . ARG D 2 177 ? 225.407 185.391 204.997 1.00 199.98 ? 198 ARG C HH22 1 
ATOM 9893  N N    . LYS D 2 178 ? 228.697 183.660 209.155 1.00 162.27 ? 199 LYS C N    1 
ATOM 9894  C CA   . LYS D 2 178 ? 228.414 184.992 209.676 1.00 162.27 ? 199 LYS C CA   1 
ATOM 9895  C C    . LYS D 2 178 ? 229.375 185.349 210.800 1.00 162.27 ? 199 LYS C C    1 
ATOM 9896  O O    . LYS D 2 178 ? 229.821 186.497 210.903 1.00 162.27 ? 199 LYS C O    1 
ATOM 9897  C CB   . LYS D 2 178 ? 226.969 185.081 210.170 1.00 162.27 ? 199 LYS C CB   1 
ATOM 9898  C CG   . LYS D 2 178 ? 225.925 185.093 209.061 1.00 162.27 ? 199 LYS C CG   1 
ATOM 9899  C CD   . LYS D 2 178 ? 224.516 185.158 209.630 1.00 162.27 ? 199 LYS C CD   1 
ATOM 9900  C CE   . LYS D 2 178 ? 223.472 185.196 208.523 1.00 162.27 ? 199 LYS C CE   1 
ATOM 9901  N NZ   . LYS D 2 178 ? 222.086 185.178 209.064 1.00 162.27 ? 199 LYS C NZ   1 
ATOM 9902  H H    . LYS D 2 178 ? 228.060 183.091 209.258 1.00 194.72 ? 199 LYS C H    1 
ATOM 9903  H HA   . LYS D 2 178 ? 228.532 185.641 208.964 1.00 194.72 ? 199 LYS C HA   1 
ATOM 9904  H HB2  . LYS D 2 178 ? 226.755 184.235 210.823 1.00 194.72 ? 199 LYS C HB2  1 
ATOM 9905  H HB3  . LYS D 2 178 ? 226.841 185.990 210.759 1.00 194.72 ? 199 LYS C HB3  1 
ATOM 9906  H HG2  . LYS D 2 178 ? 226.088 185.957 208.417 1.00 194.72 ? 199 LYS C HG2  1 
ATOM 9907  H HG3  . LYS D 2 178 ? 226.024 184.190 208.460 1.00 194.72 ? 199 LYS C HG3  1 
ATOM 9908  H HD2  . LYS D 2 178 ? 224.336 184.284 210.258 1.00 194.72 ? 199 LYS C HD2  1 
ATOM 9909  H HD3  . LYS D 2 178 ? 224.412 186.052 210.244 1.00 194.72 ? 199 LYS C HD3  1 
ATOM 9910  H HE2  . LYS D 2 178 ? 223.606 186.099 207.929 1.00 194.72 ? 199 LYS C HE2  1 
ATOM 9911  H HE3  . LYS D 2 178 ? 223.604 184.334 207.869 1.00 194.72 ? 199 LYS C HE3  1 
ATOM 9912  H HZ1  . LYS D 2 178 ? 221.426 185.204 208.300 1.00 194.72 ? 199 LYS C HZ1  1 
ATOM 9913  H HZ2  . LYS D 2 178 ? 221.945 184.335 209.603 1.00 194.72 ? 199 LYS C HZ2  1 
ATOM 9914  H HZ3  . LYS D 2 178 ? 221.945 185.983 209.657 1.00 194.72 ? 199 LYS C HZ3  1 
ATOM 9915  N N    . CYS D 2 179 ? 229.729 184.375 211.638 1.00 180.50 ? 200 CYS C N    1 
ATOM 9916  C CA   . CYS D 2 179 ? 230.763 184.609 212.642 1.00 180.50 ? 200 CYS C CA   1 
ATOM 9917  C C    . CYS D 2 179 ? 232.072 185.037 211.998 1.00 180.50 ? 200 CYS C C    1 
ATOM 9918  O O    . CYS D 2 179 ? 232.713 186.001 212.442 1.00 180.50 ? 200 CYS C O    1 
ATOM 9919  C CB   . CYS D 2 179 ? 231.001 183.349 213.474 1.00 180.50 ? 200 CYS C CB   1 
ATOM 9920  S SG   . CYS D 2 179 ? 232.277 183.532 214.743 1.00 180.50 ? 200 CYS C SG   1 
ATOM 9921  H H    . CYS D 2 179 ? 229.393 183.584 211.647 1.00 216.60 ? 200 CYS C H    1 
ATOM 9922  H HA   . CYS D 2 179 ? 230.464 185.325 213.223 1.00 216.60 ? 200 CYS C HA   1 
ATOM 9923  H HB2  . CYS D 2 179 ? 230.073 183.058 213.968 1.00 216.60 ? 200 CYS C HB2  1 
ATOM 9924  H HB3  . CYS D 2 179 ? 231.293 182.529 212.818 1.00 216.60 ? 200 CYS C HB3  1 
ATOM 9925  N N    . HIS D 2 180 ? 232.517 184.290 210.982 1.00 185.02 ? 201 HIS C N    1 
ATOM 9926  C CA   . HIS D 2 180 ? 233.764 184.634 210.314 1.00 185.02 ? 201 HIS C CA   1 
ATOM 9927  C C    . HIS D 2 180 ? 233.685 186.028 209.719 1.00 185.02 ? 201 HIS C C    1 
ATOM 9928  O O    . HIS D 2 180 ? 234.634 186.806 209.835 1.00 185.02 ? 201 HIS C O    1 
ATOM 9929  C CB   . HIS D 2 180 ? 234.094 183.619 209.215 1.00 185.02 ? 201 HIS C CB   1 
ATOM 9930  C CG   . HIS D 2 180 ? 234.662 182.335 209.733 1.00 185.02 ? 201 HIS C CG   1 
ATOM 9931  N ND1  . HIS D 2 180 ? 234.815 181.216 208.941 1.00 185.02 ? 201 HIS C ND1  1 
ATOM 9932  C CD2  . HIS D 2 180 ? 235.113 181.991 210.962 1.00 185.02 ? 201 HIS C CD2  1 
ATOM 9933  C CE1  . HIS D 2 180 ? 235.338 180.239 209.661 1.00 185.02 ? 201 HIS C CE1  1 
ATOM 9934  N NE2  . HIS D 2 180 ? 235.527 180.683 210.890 1.00 185.02 ? 201 HIS C NE2  1 
ATOM 9935  H H    . HIS D 2 180 ? 232.119 183.595 210.668 1.00 222.02 ? 201 HIS C H    1 
ATOM 9936  H HA   . HIS D 2 180 ? 234.483 184.639 210.964 1.00 222.02 ? 201 HIS C HA   1 
ATOM 9937  H HB2  . HIS D 2 180 ? 233.190 183.389 208.649 1.00 222.02 ? 201 HIS C HB2  1 
ATOM 9938  H HB3  . HIS D 2 180 ? 234.812 184.055 208.521 1.00 222.02 ? 201 HIS C HB3  1 
ATOM 9939  H HD2  . HIS D 2 180 ? 235.142 182.631 211.844 1.00 222.02 ? 201 HIS C HD2  1 
ATOM 9940  H HE1  . HIS D 2 180 ? 235.572 179.237 209.302 1.00 222.02 ? 201 HIS C HE1  1 
ATOM 9941  H HE2  . HIS D 2 180 ? 235.914 180.152 211.657 1.00 222.02 ? 201 HIS C HE2  1 
ATOM 9942  N N    . LYS D 2 181 ? 232.551 186.362 209.096 1.00 169.66 ? 202 LYS C N    1 
ATOM 9943  C CA   . LYS D 2 181 ? 232.354 187.706 208.556 1.00 169.66 ? 202 LYS C CA   1 
ATOM 9944  C C    . LYS D 2 181 ? 232.496 188.769 209.643 1.00 169.66 ? 202 LYS C C    1 
ATOM 9945  O O    . LYS D 2 181 ? 233.228 189.756 209.476 1.00 169.66 ? 202 LYS C O    1 
ATOM 9946  C CB   . LYS D 2 181 ? 230.983 187.819 207.888 1.00 169.66 ? 202 LYS C CB   1 
ATOM 9947  C CG   . LYS D 2 181 ? 230.710 189.169 207.237 1.00 169.66 ? 202 LYS C CG   1 
ATOM 9948  C CD   . LYS D 2 181 ? 229.345 189.192 206.566 1.00 169.66 ? 202 LYS C CD   1 
ATOM 9949  C CE   . LYS D 2 181 ? 229.062 190.546 205.931 1.00 169.66 ? 202 LYS C CE   1 
ATOM 9950  N NZ   . LYS D 2 181 ? 227.716 190.594 205.299 1.00 169.66 ? 202 LYS C NZ   1 
ATOM 9951  H H    . LYS D 2 181 ? 231.886 185.831 208.975 1.00 203.59 ? 202 LYS C H    1 
ATOM 9952  H HA   . LYS D 2 181 ? 233.026 187.879 207.878 1.00 203.59 ? 202 LYS C HA   1 
ATOM 9953  H HB2  . LYS D 2 181 ? 230.889 187.052 207.118 1.00 203.59 ? 202 LYS C HB2  1 
ATOM 9954  H HB3  . LYS D 2 181 ? 230.202 187.639 208.626 1.00 203.59 ? 202 LYS C HB3  1 
ATOM 9955  H HG2  . LYS D 2 181 ? 230.746 189.952 207.995 1.00 203.59 ? 202 LYS C HG2  1 
ATOM 9956  H HG3  . LYS D 2 181 ? 231.476 189.375 206.491 1.00 203.59 ? 202 LYS C HG3  1 
ATOM 9957  H HD2  . LYS D 2 181 ? 229.305 188.423 205.794 1.00 203.59 ? 202 LYS C HD2  1 
ATOM 9958  H HD3  . LYS D 2 181 ? 228.572 188.980 207.305 1.00 203.59 ? 202 LYS C HD3  1 
ATOM 9959  H HE2  . LYS D 2 181 ? 229.121 191.323 206.691 1.00 203.59 ? 202 LYS C HE2  1 
ATOM 9960  H HE3  . LYS D 2 181 ? 229.814 190.755 205.170 1.00 203.59 ? 202 LYS C HE3  1 
ATOM 9961  H HZ1  . LYS D 2 181 ? 227.568 191.506 204.890 1.00 203.59 ? 202 LYS C HZ1  1 
ATOM 9962  H HZ2  . LYS D 2 181 ? 227.656 189.888 204.579 1.00 203.59 ? 202 LYS C HZ2  1 
ATOM 9963  H HZ3  . LYS D 2 181 ? 227.009 190.421 205.999 1.00 203.59 ? 202 LYS C HZ3  1 
ATOM 9964  N N    . ALA D 2 182 ? 231.831 188.557 210.780 1.00 176.83 ? 203 ALA C N    1 
ATOM 9965  C CA   . ALA D 2 182 ? 231.938 189.475 211.909 1.00 176.83 ? 203 ALA C CA   1 
ATOM 9966  C C    . ALA D 2 182 ? 233.369 189.549 212.430 1.00 176.83 ? 203 ALA C C    1 
ATOM 9967  O O    . ALA D 2 182 ? 233.884 190.634 212.718 1.00 176.83 ? 203 ALA C O    1 
ATOM 9968  C CB   . ALA D 2 182 ? 230.974 189.032 213.011 1.00 176.83 ? 203 ALA C CB   1 
ATOM 9969  H H    . ALA D 2 182 ? 231.311 187.888 210.922 1.00 212.20 ? 203 ALA C H    1 
ATOM 9970  H HA   . ALA D 2 182 ? 231.677 190.363 211.621 1.00 212.20 ? 203 ALA C HA   1 
ATOM 9971  H HB1  . ALA D 2 182 ? 230.881 189.742 213.659 1.00 212.20 ? 203 ALA C HB1  1 
ATOM 9972  H HB2  . ALA D 2 182 ? 230.113 188.842 212.610 1.00 212.20 ? 203 ALA C HB2  1 
ATOM 9973  H HB3  . ALA D 2 182 ? 231.320 188.231 213.434 1.00 212.20 ? 203 ALA C HB3  1 
ATOM 9974  N N    . LEU D 2 183 ? 234.035 188.399 212.557 1.00 180.12 ? 204 LEU C N    1 
ATOM 9975  C CA   . LEU D 2 183 ? 235.432 188.424 212.989 1.00 180.12 ? 204 LEU C CA   1 
ATOM 9976  C C    . LEU D 2 183 ? 236.329 189.114 211.962 1.00 180.12 ? 204 LEU C C    1 
ATOM 9977  O O    . LEU D 2 183 ? 237.217 189.897 212.336 1.00 180.12 ? 204 LEU C O    1 
ATOM 9978  C CB   . LEU D 2 183 ? 235.922 187.002 213.273 1.00 180.12 ? 204 LEU C CB   1 
ATOM 9979  C CG   . LEU D 2 183 ? 235.365 186.331 214.538 1.00 180.12 ? 204 LEU C CG   1 
ATOM 9980  C CD1  . LEU D 2 183 ? 235.696 184.847 214.532 1.00 180.12 ? 204 LEU C CD1  1 
ATOM 9981  C CD2  . LEU D 2 183 ? 235.884 186.977 215.823 1.00 180.12 ? 204 LEU C CD2  1 
ATOM 9982  H H    . LEU D 2 183 ? 233.713 187.617 212.406 1.00 216.14 ? 204 LEU C H    1 
ATOM 9983  H HA   . LEU D 2 183 ? 235.487 188.934 213.807 1.00 216.14 ? 204 LEU C HA   1 
ATOM 9984  H HB2  . LEU D 2 183 ? 235.682 186.441 212.520 1.00 216.14 ? 204 LEU C HB2  1 
ATOM 9985  H HB3  . LEU D 2 183 ? 236.887 187.026 213.363 1.00 216.14 ? 204 LEU C HB3  1 
ATOM 9986  H HG   . LEU D 2 183 ? 234.399 186.418 214.536 1.00 216.14 ? 204 LEU C HG   1 
ATOM 9987  H HD11 . LEU D 2 183 ? 235.340 184.443 215.339 1.00 216.14 ? 204 LEU C HD11 1 
ATOM 9988  H HD12 . LEU D 2 183 ? 235.295 184.437 213.751 1.00 216.14 ? 204 LEU C HD12 1 
ATOM 9989  H HD13 . LEU D 2 183 ? 236.660 184.740 214.506 1.00 216.14 ? 204 LEU C HD13 1 
ATOM 9990  H HD21 . LEU D 2 183 ? 235.546 186.477 216.582 1.00 216.14 ? 204 LEU C HD21 1 
ATOM 9991  H HD22 . LEU D 2 183 ? 236.854 186.955 215.821 1.00 216.14 ? 204 LEU C HD22 1 
ATOM 9992  H HD23 . LEU D 2 183 ? 235.573 187.893 215.875 1.00 216.14 ? 204 LEU C HD23 1 
ATOM 9993  N N    . ARG D 2 184 ? 236.097 188.851 210.672 1.00 183.09 ? 205 ARG C N    1 
ATOM 9994  C CA   . ARG D 2 184 ? 236.889 189.443 209.603 1.00 183.09 ? 205 ARG C CA   1 
ATOM 9995  C C    . ARG D 2 184 ? 236.837 190.963 209.656 1.00 183.09 ? 205 ARG C C    1 
ATOM 9996  O O    . ARG D 2 184 ? 237.867 191.629 209.498 1.00 183.09 ? 205 ARG C O    1 
ATOM 9997  C CB   . ARG D 2 184 ? 236.394 188.969 208.245 1.00 183.09 ? 205 ARG C CB   1 
ATOM 9998  C CG   . ARG D 2 184 ? 237.260 189.387 207.067 1.00 183.09 ? 205 ARG C CG   1 
ATOM 9999  C CD   . ARG D 2 184 ? 236.704 188.905 205.777 1.00 183.09 ? 205 ARG C CD   1 
ATOM 10000 N NE   . ARG D 2 184 ? 236.618 187.454 205.732 1.00 183.09 ? 205 ARG C NE   1 
ATOM 10001 C CZ   . ARG D 2 184 ? 235.861 186.759 204.861 1.00 183.09 ? 205 ARG C CZ   1 
ATOM 10002 N NH1  . ARG D 2 184 ? 235.131 187.395 203.971 1.00 183.09 ? 205 ARG C NH1  1 
ATOM 10003 N NH2  . ARG D 2 184 ? 235.852 185.438 204.901 1.00 183.09 ? 205 ARG C NH2  1 
ATOM 10004 H H    . ARG D 2 184 ? 235.477 188.325 210.390 1.00 219.71 ? 205 ARG C H    1 
ATOM 10005 H HA   . ARG D 2 184 ? 237.814 189.166 209.699 1.00 219.71 ? 205 ARG C HA   1 
ATOM 10006 H HB2  . ARG D 2 184 ? 236.333 187.881 208.239 1.00 219.71 ? 205 ARG C HB2  1 
ATOM 10007 H HB3  . ARG D 2 184 ? 235.390 189.354 208.069 1.00 219.71 ? 205 ARG C HB3  1 
ATOM 10008 H HG2  . ARG D 2 184 ? 237.322 190.475 207.029 1.00 219.71 ? 205 ARG C HG2  1 
ATOM 10009 H HG3  . ARG D 2 184 ? 238.262 188.971 207.186 1.00 219.71 ? 205 ARG C HG3  1 
ATOM 10010 H HD2  . ARG D 2 184 ? 235.701 189.309 205.640 1.00 219.71 ? 205 ARG C HD2  1 
ATOM 10011 H HD3  . ARG D 2 184 ? 237.343 189.234 204.959 1.00 219.71 ? 205 ARG C HD3  1 
ATOM 10012 H HE   . ARG D 2 184 ? 237.166 186.930 206.402 1.00 219.71 ? 205 ARG C HE   1 
ATOM 10013 H HH11 . ARG D 2 184 ? 235.138 188.404 203.941 1.00 219.71 ? 205 ARG C HH11 1 
ATOM 10014 H HH12 . ARG D 2 184 ? 234.564 186.874 203.319 1.00 219.71 ? 205 ARG C HH12 1 
ATOM 10015 H HH21 . ARG D 2 184 ? 236.413 184.949 205.585 1.00 219.71 ? 205 ARG C HH21 1 
ATOM 10016 H HH22 . ARG D 2 184 ? 235.285 184.917 204.249 1.00 219.71 ? 205 ARG C HH22 1 
ATOM 10017 N N    . GLN D 2 185 ? 235.649 191.528 209.880 1.00 188.81 ? 206 GLN C N    1 
ATOM 10018 C CA   . GLN D 2 185 ? 235.534 192.975 210.036 1.00 188.81 ? 206 GLN C CA   1 
ATOM 10019 C C    . GLN D 2 185 ? 236.055 193.450 211.390 1.00 188.81 ? 206 GLN C C    1 
ATOM 10020 O O    . GLN D 2 185 ? 236.704 194.500 211.464 1.00 188.81 ? 206 GLN C O    1 
ATOM 10021 C CB   . GLN D 2 185 ? 234.077 193.411 209.860 1.00 188.81 ? 206 GLN C CB   1 
ATOM 10022 C CG   . GLN D 2 185 ? 233.517 193.167 208.469 1.00 188.81 ? 206 GLN C CG   1 
ATOM 10023 C CD   . GLN D 2 185 ? 234.278 193.924 207.398 1.00 188.81 ? 206 GLN C CD   1 
ATOM 10024 O OE1  . GLN D 2 185 ? 234.493 195.134 207.508 1.00 188.81 ? 206 GLN C OE1  1 
ATOM 10025 N NE2  . GLN D 2 185 ? 234.691 193.215 206.353 1.00 188.81 ? 206 GLN C NE2  1 
ATOM 10026 H H    . GLN D 2 185 ? 234.906 191.101 209.944 1.00 226.57 ? 206 GLN C H    1 
ATOM 10027 H HA   . GLN D 2 185 ? 236.061 193.413 209.351 1.00 226.57 ? 206 GLN C HA   1 
ATOM 10028 H HB2  . GLN D 2 185 ? 233.449 192.878 210.574 1.00 226.57 ? 206 GLN C HB2  1 
ATOM 10029 H HB3  . GLN D 2 185 ? 233.987 194.476 210.077 1.00 226.57 ? 206 GLN C HB3  1 
ATOM 10030 H HG2  . GLN D 2 185 ? 233.580 192.102 208.246 1.00 226.57 ? 206 GLN C HG2  1 
ATOM 10031 H HG3  . GLN D 2 185 ? 232.477 193.492 208.445 1.00 226.57 ? 206 GLN C HG3  1 
ATOM 10032 H HE21 . GLN D 2 185 ? 235.198 193.661 205.614 1.00 226.57 ? 206 GLN C HE21 1 
ATOM 10033 H HE22 . GLN D 2 185 ? 234.494 192.236 206.304 1.00 226.57 ? 206 GLN C HE22 1 
ATOM 10034 N N    . PHE D 2 186 ? 235.769 192.704 212.461 1.00 190.19 ? 207 PHE C N    1 
ATOM 10035 C CA   . PHE D 2 186 ? 236.226 193.090 213.796 1.00 190.19 ? 207 PHE C CA   1 
ATOM 10036 C C    . PHE D 2 186 ? 237.723 193.375 213.808 1.00 190.19 ? 207 PHE C C    1 
ATOM 10037 O O    . PHE D 2 186 ? 238.161 194.435 214.269 1.00 190.19 ? 207 PHE C O    1 
ATOM 10038 C CB   . PHE D 2 186 ? 235.906 191.990 214.810 1.00 190.19 ? 207 PHE C CB   1 
ATOM 10039 C CG   . PHE D 2 186 ? 236.476 192.242 216.177 1.00 190.19 ? 207 PHE C CG   1 
ATOM 10040 C CD1  . PHE D 2 186 ? 235.854 193.121 217.052 1.00 190.19 ? 207 PHE C CD1  1 
ATOM 10041 C CD2  . PHE D 2 186 ? 237.634 191.602 216.591 1.00 190.19 ? 207 PHE C CD2  1 
ATOM 10042 C CE1  . PHE D 2 186 ? 236.378 193.354 218.310 1.00 190.19 ? 207 PHE C CE1  1 
ATOM 10043 C CE2  . PHE D 2 186 ? 238.158 191.831 217.848 1.00 190.19 ? 207 PHE C CE2  1 
ATOM 10044 C CZ   . PHE D 2 186 ? 237.529 192.709 218.708 1.00 190.19 ? 207 PHE C CZ   1 
ATOM 10045 H H    . PHE D 2 186 ? 235.311 191.977 212.444 1.00 228.23 ? 207 PHE C H    1 
ATOM 10046 H HA   . PHE D 2 186 ? 235.764 193.899 214.067 1.00 228.23 ? 207 PHE C HA   1 
ATOM 10047 H HB2  . PHE D 2 186 ? 234.826 191.887 214.906 1.00 228.23 ? 207 PHE C HB2  1 
ATOM 10048 H HB3  . PHE D 2 186 ? 236.295 191.039 214.450 1.00 228.23 ? 207 PHE C HB3  1 
ATOM 10049 H HD1  . PHE D 2 186 ? 234.943 193.630 216.737 1.00 228.23 ? 207 PHE C HD1  1 
ATOM 10050 H HD2  . PHE D 2 186 ? 238.131 190.909 215.912 1.00 228.23 ? 207 PHE C HD2  1 
ATOM 10051 H HE1  . PHE D 2 186 ? 235.879 194.047 218.987 1.00 228.23 ? 207 PHE C HE1  1 
ATOM 10052 H HE2  . PHE D 2 186 ? 239.069 191.321 218.162 1.00 228.23 ? 207 PHE C HE2  1 
ATOM 10053 H HZ   . PHE D 2 186 ? 237.943 192.892 219.699 1.00 228.23 ? 207 PHE C HZ   1 
ATOM 10054 N N    . PHE D 2 187 ? 238.526 192.437 213.301 1.00 204.01 ? 208 PHE C N    1 
ATOM 10055 C CA   . PHE D 2 187 ? 239.978 192.570 213.406 1.00 204.01 ? 208 PHE C CA   1 
ATOM 10056 C C    . PHE D 2 187 ? 240.584 193.510 212.367 1.00 204.01 ? 208 PHE C C    1 
ATOM 10057 O O    . PHE D 2 187 ? 241.805 193.703 212.385 1.00 204.01 ? 208 PHE C O    1 
ATOM 10058 C CB   . PHE D 2 187 ? 240.635 191.195 213.276 1.00 204.01 ? 208 PHE C CB   1 
ATOM 10059 C CG   . PHE D 2 187 ? 240.479 190.331 214.495 1.00 204.01 ? 208 PHE C CG   1 
ATOM 10060 C CD1  . PHE D 2 187 ? 241.057 190.698 215.701 1.00 204.01 ? 208 PHE C CD1  1 
ATOM 10061 C CD2  . PHE D 2 187 ? 239.753 189.151 214.439 1.00 204.01 ? 208 PHE C CD2  1 
ATOM 10062 C CE1  . PHE D 2 187 ? 240.916 189.905 216.824 1.00 204.01 ? 208 PHE C CE1  1 
ATOM 10063 C CE2  . PHE D 2 187 ? 239.609 188.356 215.560 1.00 204.01 ? 208 PHE C CE2  1 
ATOM 10064 C CZ   . PHE D 2 187 ? 240.191 188.732 216.752 1.00 204.01 ? 208 PHE C CZ   1 
ATOM 10065 H H    . PHE D 2 187 ? 238.259 191.726 212.898 1.00 244.81 ? 208 PHE C H    1 
ATOM 10066 H HA   . PHE D 2 187 ? 240.203 192.989 214.249 1.00 244.81 ? 208 PHE C HA   1 
ATOM 10067 H HB2  . PHE D 2 187 ? 240.204 190.665 212.427 1.00 244.81 ? 208 PHE C HB2  1 
ATOM 10068 H HB3  . PHE D 2 187 ? 241.699 191.317 213.079 1.00 244.81 ? 208 PHE C HB3  1 
ATOM 10069 H HD1  . PHE D 2 187 ? 241.630 191.624 215.758 1.00 244.81 ? 208 PHE C HD1  1 
ATOM 10070 H HD2  . PHE D 2 187 ? 239.295 188.852 213.496 1.00 244.81 ? 208 PHE C HD2  1 
ATOM 10071 H HE1  . PHE D 2 187 ? 241.376 190.204 217.765 1.00 244.81 ? 208 PHE C HE1  1 
ATOM 10072 H HE2  . PHE D 2 187 ? 239.036 187.431 215.502 1.00 244.81 ? 208 PHE C HE2  1 
ATOM 10073 H HZ   . PHE D 2 187 ? 240.077 188.107 217.637 1.00 244.81 ? 208 PHE C HZ   1 
ATOM 10074 N N    . ASP D 2 188 ? 239.779 194.104 211.482 1.00 210.11 ? 209 ASP C N    1 
ATOM 10075 C CA   . ASP D 2 188 ? 240.240 195.147 210.572 1.00 210.11 ? 209 ASP C CA   1 
ATOM 10076 C C    . ASP D 2 188 ? 239.764 196.540 210.962 1.00 210.11 ? 209 ASP C C    1 
ATOM 10077 O O    . ASP D 2 188 ? 240.430 197.522 210.620 1.00 210.11 ? 209 ASP C O    1 
ATOM 10078 C CB   . ASP D 2 188 ? 239.776 194.839 209.147 1.00 210.11 ? 209 ASP C CB   1 
ATOM 10079 C CG   . ASP D 2 188 ? 240.486 193.637 208.540 1.00 210.11 ? 209 ASP C CG   1 
ATOM 10080 O OD1  . ASP D 2 188 ? 241.511 193.255 209.053 1.00 210.11 ? 209 ASP C OD1  1 
ATOM 10081 O OD2  . ASP D 2 188 ? 239.996 193.111 207.569 1.00 210.11 ? 209 ASP C OD2  1 
ATOM 10082 H H    . ASP D 2 188 ? 238.947 193.915 211.379 1.00 252.13 ? 209 ASP C H    1 
ATOM 10083 H HA   . ASP D 2 188 ? 241.207 195.181 210.556 1.00 252.13 ? 209 ASP C HA   1 
ATOM 10084 H HB2  . ASP D 2 188 ? 238.703 194.648 209.146 1.00 252.13 ? 209 ASP C HB2  1 
ATOM 10085 H HB3  . ASP D 2 188 ? 239.954 195.707 208.511 1.00 252.13 ? 209 ASP C HB3  1 
ATOM 10086 N N    . ARG D 2 189 ? 238.638 196.649 211.671 1.00 193.85 ? 210 ARG C N    1 
ATOM 10087 C CA   . ARG D 2 189 ? 238.079 197.944 212.042 1.00 193.85 ? 210 ARG C CA   1 
ATOM 10088 C C    . ARG D 2 189 ? 238.468 198.396 213.442 1.00 193.85 ? 210 ARG C C    1 
ATOM 10089 O O    . ARG D 2 189 ? 238.416 199.598 213.723 1.00 193.85 ? 210 ARG C O    1 
ATOM 10090 C CB   . ARG D 2 189 ? 236.549 197.900 211.938 1.00 193.85 ? 210 ARG C CB   1 
ATOM 10091 C CG   . ARG D 2 189 ? 236.046 197.733 210.515 1.00 193.85 ? 210 ARG C CG   1 
ATOM 10092 C CD   . ARG D 2 189 ? 234.534 197.619 210.461 1.00 193.85 ? 210 ARG C CD   1 
ATOM 10093 N NE   . ARG D 2 189 ? 234.053 197.419 209.093 1.00 193.85 ? 210 ARG C NE   1 
ATOM 10094 C CZ   . ARG D 2 189 ? 233.769 198.390 208.225 1.00 193.85 ? 210 ARG C CZ   1 
ATOM 10095 N NH1  . ARG D 2 189 ? 233.910 199.673 208.545 1.00 193.85 ? 210 ARG C NH1  1 
ATOM 10096 N NH2  . ARG D 2 189 ? 233.340 198.072 207.011 1.00 193.85 ? 210 ARG C NH2  1 
ATOM 10097 H H    . ARG D 2 189 ? 238.179 195.979 211.953 1.00 232.62 ? 210 ARG C H    1 
ATOM 10098 H HA   . ARG D 2 189 ? 238.388 198.618 211.419 1.00 232.62 ? 210 ARG C HA   1 
ATOM 10099 H HB2  . ARG D 2 189 ? 236.221 197.151 212.460 1.00 232.62 ? 210 ARG C HB2  1 
ATOM 10100 H HB3  . ARG D 2 189 ? 236.187 198.729 212.287 1.00 232.62 ? 210 ARG C HB3  1 
ATOM 10101 H HG2  . ARG D 2 189 ? 236.312 198.505 209.991 1.00 232.62 ? 210 ARG C HG2  1 
ATOM 10102 H HG3  . ARG D 2 189 ? 236.425 196.925 210.137 1.00 232.62 ? 210 ARG C HG3  1 
ATOM 10103 H HD2  . ARG D 2 189 ? 234.263 196.847 210.981 1.00 232.62 ? 210 ARG C HD2  1 
ATOM 10104 H HD3  . ARG D 2 189 ? 234.131 198.418 210.834 1.00 232.62 ? 210 ARG C HD3  1 
ATOM 10105 H HE   . ARG D 2 189 ? 234.060 196.614 208.791 1.00 232.62 ? 210 ARG C HE   1 
ATOM 10106 H HH11 . ARG D 2 189 ? 234.187 199.911 209.323 1.00 232.62 ? 210 ARG C HH11 1 
ATOM 10107 H HH12 . ARG D 2 189 ? 233.719 200.277 207.963 1.00 232.62 ? 210 ARG C HH12 1 
ATOM 10108 H HH21 . ARG D 2 189 ? 233.245 197.246 206.793 1.00 232.62 ? 210 ARG C HH21 1 
ATOM 10109 H HH22 . ARG D 2 189 ? 233.155 198.692 206.444 1.00 232.62 ? 210 ARG C HH22 1 
ATOM 10110 N N    . VAL D 2 190 ? 238.853 197.476 214.320 1.00 208.39 ? 211 VAL C N    1 
ATOM 10111 C CA   . VAL D 2 190 ? 239.183 197.806 215.703 1.00 208.39 ? 211 VAL C CA   1 
ATOM 10112 C C    . VAL D 2 190 ? 240.643 198.249 215.725 1.00 208.39 ? 211 VAL C C    1 
ATOM 10113 O O    . VAL D 2 190 ? 241.470 197.639 215.032 1.00 208.39 ? 211 VAL C O    1 
ATOM 10114 C CB   . VAL D 2 190 ? 238.977 196.596 216.634 1.00 208.39 ? 211 VAL C CB   1 
ATOM 10115 C CG1  . VAL D 2 190 ? 239.525 196.892 218.022 1.00 208.39 ? 211 VAL C CG1  1 
ATOM 10116 C CG2  . VAL D 2 190 ? 237.500 196.240 216.701 1.00 208.39 ? 211 VAL C CG2  1 
ATOM 10117 H H    . VAL D 2 190 ? 238.931 196.638 214.137 1.00 250.07 ? 211 VAL C H    1 
ATOM 10118 H HA   . VAL D 2 190 ? 238.603 198.527 215.982 1.00 250.07 ? 211 VAL C HA   1 
ATOM 10119 H HB   . VAL D 2 190 ? 239.538 195.748 216.242 1.00 250.07 ? 211 VAL C HB   1 
ATOM 10120 H HG11 . VAL D 2 190 ? 239.371 196.027 218.667 1.00 250.07 ? 211 VAL C HG11 1 
ATOM 10121 H HG12 . VAL D 2 190 ? 240.591 197.109 217.954 1.00 250.07 ? 211 VAL C HG12 1 
ATOM 10122 H HG13 . VAL D 2 190 ? 239.004 197.753 218.442 1.00 250.07 ? 211 VAL C HG13 1 
ATOM 10123 H HG21 . VAL D 2 190 ? 237.361 195.384 217.360 1.00 250.07 ? 211 VAL C HG21 1 
ATOM 10124 H HG22 . VAL D 2 190 ? 236.938 197.091 217.088 1.00 250.07 ? 211 VAL C HG22 1 
ATOM 10125 H HG23 . VAL D 2 190 ? 237.139 195.992 215.703 1.00 250.07 ? 211 VAL C HG23 1 
ATOM 10126 N N    . PRO D 2 191 ? 241.017 199.292 216.473 1.00 201.79 ? 212 PRO C N    1 
ATOM 10127 C CA   . PRO D 2 191 ? 242.425 199.702 216.479 1.00 201.79 ? 212 PRO C CA   1 
ATOM 10128 C C    . PRO D 2 191 ? 243.333 198.553 216.890 1.00 201.79 ? 212 PRO C C    1 
ATOM 10129 O O    . PRO D 2 191 ? 242.946 197.673 217.662 1.00 201.79 ? 212 PRO C O    1 
ATOM 10130 C CB   . PRO D 2 191 ? 242.453 200.835 217.509 1.00 201.79 ? 212 PRO C CB   1 
ATOM 10131 C CG   . PRO D 2 191 ? 241.072 201.395 217.475 1.00 201.79 ? 212 PRO C CG   1 
ATOM 10132 C CD   . PRO D 2 191 ? 240.185 200.192 217.288 1.00 201.79 ? 212 PRO C CD   1 
ATOM 10133 H HA   . PRO D 2 191 ? 242.690 200.034 215.607 1.00 242.15 ? 212 PRO C HA   1 
ATOM 10134 H HB2  . PRO D 2 191 ? 242.729 200.439 218.497 1.00 242.15 ? 212 PRO C HB2  1 
ATOM 10135 H HB3  . PRO D 2 191 ? 243.220 201.575 217.234 1.00 242.15 ? 212 PRO C HB3  1 
ATOM 10136 H HG2  . PRO D 2 191 ? 240.858 201.937 218.408 1.00 242.15 ? 212 PRO C HG2  1 
ATOM 10137 H HG3  . PRO D 2 191 ? 240.977 202.122 216.656 1.00 242.15 ? 212 PRO C HG3  1 
ATOM 10138 H HD2  . PRO D 2 191 ? 239.949 199.754 218.268 1.00 242.15 ? 212 PRO C HD2  1 
ATOM 10139 H HD3  . PRO D 2 191 ? 239.265 200.492 216.765 1.00 242.15 ? 212 PRO C HD3  1 
ATOM 10140 N N    . SER D 2 192 ? 244.550 198.566 216.343 1.00 232.40 ? 213 SER C N    1 
ATOM 10141 C CA   . SER D 2 192 ? 245.501 197.488 216.592 1.00 232.40 ? 213 SER C CA   1 
ATOM 10142 C C    . SER D 2 192 ? 245.766 197.301 218.079 1.00 232.40 ? 213 SER C C    1 
ATOM 10143 O O    . SER D 2 192 ? 245.829 196.163 218.565 1.00 232.40 ? 213 SER C O    1 
ATOM 10144 C CB   . SER D 2 192 ? 246.806 197.770 215.873 1.00 232.40 ? 213 SER C CB   1 
ATOM 10145 O OG   . SER D 2 192 ? 246.628 197.752 214.484 1.00 232.40 ? 213 SER C OG   1 
ATOM 10146 H H    . SER D 2 192 ? 244.847 199.185 215.825 1.00 278.88 ? 213 SER C H    1 
ATOM 10147 H HA   . SER D 2 192 ? 245.140 196.657 216.243 1.00 278.88 ? 213 SER C HA   1 
ATOM 10148 H HB2  . SER D 2 192 ? 247.188 198.743 216.181 1.00 278.88 ? 213 SER C HB2  1 
ATOM 10149 H HB3  . SER D 2 192 ? 247.547 197.024 216.158 1.00 278.88 ? 213 SER C HB3  1 
ATOM 10150 H HG   . SER D 2 192 ? 247.491 197.935 214.104 1.00 278.88 ? 213 SER C HG   1 
ATOM 10151 N N    . GLU D 2 193 ? 245.879 198.407 218.821 1.00 239.90 ? 214 GLU C N    1 
ATOM 10152 C CA   . GLU D 2 193 ? 246.171 198.351 220.248 1.00 239.90 ? 214 GLU C CA   1 
ATOM 10153 C C    . GLU D 2 193 ? 245.076 197.685 221.071 1.00 239.90 ? 214 GLU C C    1 
ATOM 10154 O O    . GLU D 2 193 ? 245.262 197.542 222.280 1.00 239.90 ? 214 GLU C O    1 
ATOM 10155 C CB   . GLU D 2 193 ? 246.412 199.765 220.781 1.00 239.90 ? 214 GLU C CB   1 
ATOM 10156 C CG   . GLU D 2 193 ? 245.196 200.678 220.712 1.00 239.90 ? 214 GLU C CG   1 
ATOM 10157 C CD   . GLU D 2 193 ? 245.085 201.408 219.403 1.00 239.90 ? 214 GLU C CD   1 
ATOM 10158 O OE1  . GLU D 2 193 ? 245.685 200.973 218.449 1.00 239.90 ? 214 GLU C OE1  1 
ATOM 10159 O OE2  . GLU D 2 193 ? 244.400 202.402 219.355 1.00 239.90 ? 214 GLU C OE2  1 
ATOM 10160 H H    . GLU D 2 193 ? 245.794 199.202 218.511 1.00 287.88 ? 214 GLU C H    1 
ATOM 10161 H HA   . GLU D 2 193 ? 246.980 197.829 220.372 1.00 287.88 ? 214 GLU C HA   1 
ATOM 10162 H HB2  . GLU D 2 193 ? 246.733 199.713 221.821 1.00 287.88 ? 214 GLU C HB2  1 
ATOM 10163 H HB3  . GLU D 2 193 ? 247.216 200.235 220.214 1.00 287.88 ? 214 GLU C HB3  1 
ATOM 10164 H HG2  . GLU D 2 193 ? 244.297 200.081 220.859 1.00 287.88 ? 214 GLU C HG2  1 
ATOM 10165 H HG3  . GLU D 2 193 ? 245.254 201.403 221.523 1.00 287.88 ? 214 GLU C HG3  1 
ATOM 10166 N N    . TYR D 2 194 ? 243.944 197.313 220.472 1.00 229.66 ? 215 TYR C N    1 
ATOM 10167 C CA   . TYR D 2 194 ? 242.919 196.494 221.118 1.00 229.66 ? 215 TYR C CA   1 
ATOM 10168 C C    . TYR D 2 194 ? 242.854 195.089 220.547 1.00 229.66 ? 215 TYR C C    1 
ATOM 10169 O O    . TYR D 2 194 ? 242.683 194.123 221.303 1.00 229.66 ? 215 TYR C O    1 
ATOM 10170 C CB   . TYR D 2 194 ? 241.549 197.166 220.998 1.00 229.66 ? 215 TYR C CB   1 
ATOM 10171 C CG   . TYR D 2 194 ? 241.449 198.484 221.733 1.00 229.66 ? 215 TYR C CG   1 
ATOM 10172 C CD1  . TYR D 2 194 ? 241.464 198.507 223.120 1.00 229.66 ? 215 TYR C CD1  1 
ATOM 10173 C CD2  . TYR D 2 194 ? 241.342 199.670 221.021 1.00 229.66 ? 215 TYR C CD2  1 
ATOM 10174 C CE1  . TYR D 2 194 ? 241.373 199.711 223.792 1.00 229.66 ? 215 TYR C CE1  1 
ATOM 10175 C CE2  . TYR D 2 194 ? 241.251 200.873 221.693 1.00 229.66 ? 215 TYR C CE2  1 
ATOM 10176 C CZ   . TYR D 2 194 ? 241.267 200.890 223.083 1.00 229.66 ? 215 TYR C CZ   1 
ATOM 10177 O OH   . TYR D 2 194 ? 241.176 202.089 223.752 1.00 229.66 ? 215 TYR C OH   1 
ATOM 10178 H H    . TYR D 2 194 ? 243.735 197.532 219.668 1.00 275.59 ? 215 TYR C H    1 
ATOM 10179 H HA   . TYR D 2 194 ? 243.124 196.383 222.058 1.00 275.59 ? 215 TYR C HA   1 
ATOM 10180 H HB2  . TYR D 2 194 ? 241.323 197.345 219.946 1.00 275.59 ? 215 TYR C HB2  1 
ATOM 10181 H HB3  . TYR D 2 194 ? 240.781 196.499 221.389 1.00 275.59 ? 215 TYR C HB3  1 
ATOM 10182 H HD1  . TYR D 2 194 ? 241.549 197.576 223.680 1.00 275.59 ? 215 TYR C HD1  1 
ATOM 10183 H HD2  . TYR D 2 194 ? 241.331 199.651 219.931 1.00 275.59 ? 215 TYR C HD2  1 
ATOM 10184 H HE1  . TYR D 2 194 ? 241.386 199.729 224.882 1.00 275.59 ? 215 TYR C HE1  1 
ATOM 10185 H HE2  . TYR D 2 194 ? 241.167 201.805 221.134 1.00 275.59 ? 215 TYR C HE2  1 
ATOM 10186 H HH   . TYR D 2 194 ? 241.199 201.928 224.699 1.00 275.59 ? 215 TYR C HH   1 
ATOM 10187 N N    . THR D 2 195 ? 242.977 194.970 219.222 1.00 223.99 ? 216 THR C N    1 
ATOM 10188 C CA   . THR D 2 195 ? 242.992 193.668 218.564 1.00 223.99 ? 216 THR C CA   1 
ATOM 10189 C C    . THR D 2 195 ? 244.175 192.834 219.036 1.00 223.99 ? 216 THR C C    1 
ATOM 10190 O O    . THR D 2 195 ? 244.004 191.713 219.533 1.00 223.99 ? 216 THR C O    1 
ATOM 10191 C CB   . THR D 2 195 ? 243.042 193.818 217.032 1.00 223.99 ? 216 THR C CB   1 
ATOM 10192 O OG1  . THR D 2 195 ? 244.198 194.581 216.662 1.00 223.99 ? 216 THR C OG1  1 
ATOM 10193 C CG2  . THR D 2 195 ? 241.793 194.520 216.523 1.00 223.99 ? 216 THR C CG2  1 
ATOM 10194 H H    . THR D 2 195 ? 243.052 195.635 218.681 1.00 268.79 ? 216 THR C H    1 
ATOM 10195 H HA   . THR D 2 195 ? 242.177 193.190 218.781 1.00 268.79 ? 216 THR C HA   1 
ATOM 10196 H HB   . THR D 2 195 ? 243.112 192.833 216.572 1.00 268.79 ? 216 THR C HB   1 
ATOM 10197 H HG1  . THR D 2 195 ? 244.400 194.426 215.736 1.00 268.79 ? 216 THR C HG1  1 
ATOM 10198 H HG21 . THR D 2 195 ? 241.846 194.617 215.439 1.00 268.79 ? 216 THR C HG21 1 
ATOM 10199 H HG22 . THR D 2 195 ? 240.912 193.936 216.793 1.00 268.79 ? 216 THR C HG22 1 
ATOM 10200 H HG23 . THR D 2 195 ? 241.723 195.510 216.972 1.00 268.79 ? 216 THR C HG23 1 
ATOM 10201 N N    . TYR D 2 196 ? 245.388 193.374 218.904 1.00 227.56 ? 217 TYR C N    1 
ATOM 10202 C CA   . TYR D 2 196 ? 246.560 192.592 219.274 1.00 227.56 ? 217 TYR C CA   1 
ATOM 10203 C C    . TYR D 2 196 ? 246.689 192.443 220.784 1.00 227.56 ? 217 TYR C C    1 
ATOM 10204 O O    . TYR D 2 196 ? 247.055 191.363 221.261 1.00 227.56 ? 217 TYR C O    1 
ATOM 10205 C CB   . TYR D 2 196 ? 247.826 193.231 218.698 1.00 227.56 ? 217 TYR C CB   1 
ATOM 10206 C CG   . TYR D 2 196 ? 247.869 193.244 217.186 1.00 227.56 ? 217 TYR C CG   1 
ATOM 10207 C CD1  . TYR D 2 196 ? 247.260 192.227 216.466 1.00 227.56 ? 217 TYR C CD1  1 
ATOM 10208 C CD2  . TYR D 2 196 ? 248.517 194.274 216.519 1.00 227.56 ? 217 TYR C CD2  1 
ATOM 10209 C CE1  . TYR D 2 196 ? 247.300 192.239 215.085 1.00 227.56 ? 217 TYR C CE1  1 
ATOM 10210 C CE2  . TYR D 2 196 ? 248.556 194.286 215.139 1.00 227.56 ? 217 TYR C CE2  1 
ATOM 10211 C CZ   . TYR D 2 196 ? 247.944 193.264 214.422 1.00 227.56 ? 217 TYR C CZ   1 
ATOM 10212 O OH   . TYR D 2 196 ? 247.983 193.276 213.047 1.00 227.56 ? 217 TYR C OH   1 
ATOM 10213 H H    . TYR D 2 196 ? 245.552 194.165 218.611 1.00 273.07 ? 217 TYR C H    1 
ATOM 10214 H HA   . TYR D 2 196 ? 246.471 191.703 218.898 1.00 273.07 ? 217 TYR C HA   1 
ATOM 10215 H HB2  . TYR D 2 196 ? 247.907 194.260 219.050 1.00 273.07 ? 217 TYR C HB2  1 
ATOM 10216 H HB3  . TYR D 2 196 ? 248.701 192.691 219.058 1.00 273.07 ? 217 TYR C HB3  1 
ATOM 10217 H HD1  . TYR D 2 196 ? 246.750 191.418 216.989 1.00 273.07 ? 217 TYR C HD1  1 
ATOM 10218 H HD2  . TYR D 2 196 ? 248.995 195.074 217.086 1.00 273.07 ? 217 TYR C HD2  1 
ATOM 10219 H HE1  . TYR D 2 196 ? 246.821 191.440 214.519 1.00 273.07 ? 217 TYR C HE1  1 
ATOM 10220 H HE2  . TYR D 2 196 ? 249.065 195.095 214.615 1.00 273.07 ? 217 TYR C HE2  1 
ATOM 10221 H HH   . TYR D 2 196 ? 247.524 192.504 212.708 1.00 273.07 ? 217 TYR C HH   1 
ATOM 10222 N N    . ARG D 2 197 ? 246.385 193.500 221.549 1.00 241.92 ? 218 ARG C N    1 
ATOM 10223 C CA   . ARG D 2 197 ? 246.463 193.410 223.005 1.00 241.92 ? 218 ARG C CA   1 
ATOM 10224 C C    . ARG D 2 197 ? 245.564 192.314 223.551 1.00 241.92 ? 218 ARG C C    1 
ATOM 10225 O O    . ARG D 2 197 ? 245.976 191.567 224.443 1.00 241.92 ? 218 ARG C O    1 
ATOM 10226 C CB   . ARG D 2 197 ? 246.075 194.736 223.643 1.00 241.92 ? 218 ARG C CB   1 
ATOM 10227 C CG   . ARG D 2 197 ? 246.185 194.772 225.159 1.00 241.92 ? 218 ARG C CG   1 
ATOM 10228 C CD   . ARG D 2 197 ? 245.873 196.119 225.701 1.00 241.92 ? 218 ARG C CD   1 
ATOM 10229 N NE   . ARG D 2 197 ? 245.912 196.143 227.154 1.00 241.92 ? 218 ARG C NE   1 
ATOM 10230 C CZ   . ARG D 2 197 ? 245.654 197.228 227.909 1.00 241.92 ? 218 ARG C CZ   1 
ATOM 10231 N NH1  . ARG D 2 197 ? 245.341 198.369 227.335 1.00 241.92 ? 218 ARG C NH1  1 
ATOM 10232 N NH2  . ARG D 2 197 ? 245.716 197.147 229.227 1.00 241.92 ? 218 ARG C NH2  1 
ATOM 10233 H H    . ARG D 2 197 ? 246.133 194.265 221.251 1.00 290.30 ? 218 ARG C H    1 
ATOM 10234 H HA   . ARG D 2 197 ? 247.376 193.205 223.261 1.00 290.30 ? 218 ARG C HA   1 
ATOM 10235 H HB2  . ARG D 2 197 ? 246.708 195.528 223.248 1.00 290.30 ? 218 ARG C HB2  1 
ATOM 10236 H HB3  . ARG D 2 197 ? 245.045 194.978 223.382 1.00 290.30 ? 218 ARG C HB3  1 
ATOM 10237 H HG2  . ARG D 2 197 ? 245.485 194.058 225.592 1.00 290.30 ? 218 ARG C HG2  1 
ATOM 10238 H HG3  . ARG D 2 197 ? 247.202 194.510 225.457 1.00 290.30 ? 218 ARG C HG3  1 
ATOM 10239 H HD2  . ARG D 2 197 ? 246.602 196.839 225.329 1.00 290.30 ? 218 ARG C HD2  1 
ATOM 10240 H HD3  . ARG D 2 197 ? 244.875 196.417 225.382 1.00 290.30 ? 218 ARG C HD3  1 
ATOM 10241 H HE   . ARG D 2 197 ? 246.149 195.283 227.632 1.00 290.30 ? 218 ARG C HE   1 
ATOM 10242 H HH11 . ARG D 2 197 ? 245.294 198.431 226.328 1.00 290.30 ? 218 ARG C HH11 1 
ATOM 10243 H HH12 . ARG D 2 197 ? 245.148 199.182 227.901 1.00 290.30 ? 218 ARG C HH12 1 
ATOM 10244 H HH21 . ARG D 2 197 ? 245.957 196.269 229.668 1.00 290.30 ? 218 ARG C HH21 1 
ATOM 10245 H HH22 . ARG D 2 197 ? 245.523 197.960 229.792 1.00 290.30 ? 218 ARG C HH22 1 
ATOM 10246 N N    . MET D 2 198 ? 244.343 192.200 223.030 1.00 234.30 ? 219 MET C N    1 
ATOM 10247 C CA   . MET D 2 198 ? 243.453 191.132 223.465 1.00 234.30 ? 219 MET C CA   1 
ATOM 10248 C C    . MET D 2 198 ? 243.815 189.791 222.841 1.00 234.30 ? 219 MET C C    1 
ATOM 10249 O O    . MET D 2 198 ? 243.901 188.781 223.549 1.00 234.30 ? 219 MET C O    1 
ATOM 10250 C CB   . MET D 2 198 ? 242.006 191.493 223.133 1.00 234.30 ? 219 MET C CB   1 
ATOM 10251 C CG   . MET D 2 198 ? 241.429 192.621 223.977 1.00 234.30 ? 219 MET C CG   1 
ATOM 10252 S SD   . MET D 2 198 ? 239.654 192.833 223.734 1.00 234.30 ? 219 MET C SD   1 
ATOM 10253 C CE   . MET D 2 198 ? 239.621 193.564 222.100 1.00 234.30 ? 219 MET C CE   1 
ATOM 10254 H H    . MET D 2 198 ? 244.013 192.721 222.431 1.00 281.16 ? 219 MET C H    1 
ATOM 10255 H HA   . MET D 2 198 ? 243.509 191.051 224.430 1.00 281.16 ? 219 MET C HA   1 
ATOM 10256 H HB2  . MET D 2 198 ? 241.936 191.789 222.087 1.00 281.16 ? 219 MET C HB2  1 
ATOM 10257 H HB3  . MET D 2 198 ? 241.372 190.616 223.268 1.00 281.16 ? 219 MET C HB3  1 
ATOM 10258 H HG2  . MET D 2 198 ? 241.611 192.415 225.031 1.00 281.16 ? 219 MET C HG2  1 
ATOM 10259 H HG3  . MET D 2 198 ? 241.925 193.557 223.722 1.00 281.16 ? 219 MET C HG3  1 
ATOM 10260 H HE1  . MET D 2 198 ? 238.588 193.755 221.808 1.00 281.16 ? 219 MET C HE1  1 
ATOM 10261 H HE2  . MET D 2 198 ? 240.176 194.503 222.110 1.00 281.16 ? 219 MET C HE2  1 
ATOM 10262 H HE3  . MET D 2 198 ? 240.080 192.880 221.386 1.00 281.16 ? 219 MET C HE3  1 
ATOM 10263 N N    . LEU D 2 199 ? 244.032 189.758 221.525 1.00 227.43 ? 220 LEU C N    1 
ATOM 10264 C CA   . LEU D 2 199 ? 244.189 188.477 220.842 1.00 227.43 ? 220 LEU C CA   1 
ATOM 10265 C C    . LEU D 2 199 ? 245.484 187.777 221.244 1.00 227.43 ? 220 LEU C C    1 
ATOM 10266 O O    . LEU D 2 199 ? 245.515 186.546 221.364 1.00 227.43 ? 220 LEU C O    1 
ATOM 10267 C CB   . LEU D 2 199 ? 244.168 188.686 219.323 1.00 227.43 ? 220 LEU C CB   1 
ATOM 10268 C CG   . LEU D 2 199 ? 244.218 187.408 218.475 1.00 227.43 ? 220 LEU C CG   1 
ATOM 10269 C CD1  . LEU D 2 199 ? 243.076 186.485 218.879 1.00 227.43 ? 220 LEU C CD1  1 
ATOM 10270 C CD2  . LEU D 2 199 ? 244.130 187.773 217.001 1.00 227.43 ? 220 LEU C CD2  1 
ATOM 10271 H H    . LEU D 2 199 ? 244.092 190.448 221.016 1.00 272.92 ? 220 LEU C H    1 
ATOM 10272 H HA   . LEU D 2 199 ? 243.449 187.902 221.091 1.00 272.92 ? 220 LEU C HA   1 
ATOM 10273 H HB2  . LEU D 2 199 ? 243.258 189.223 219.059 1.00 272.92 ? 220 LEU C HB2  1 
ATOM 10274 H HB3  . LEU D 2 199 ? 245.022 189.302 219.044 1.00 272.92 ? 220 LEU C HB3  1 
ATOM 10275 H HG   . LEU D 2 199 ? 245.154 186.883 218.664 1.00 272.92 ? 220 LEU C HG   1 
ATOM 10276 H HD11 . LEU D 2 199 ? 243.112 185.577 218.277 1.00 272.92 ? 220 LEU C HD11 1 
ATOM 10277 H HD12 . LEU D 2 199 ? 243.175 186.225 219.933 1.00 272.92 ? 220 LEU C HD12 1 
ATOM 10278 H HD13 . LEU D 2 199 ? 242.125 186.991 218.717 1.00 272.92 ? 220 LEU C HD13 1 
ATOM 10279 H HD21 . LEU D 2 199 ? 244.167 186.865 216.398 1.00 272.92 ? 220 LEU C HD21 1 
ATOM 10280 H HD22 . LEU D 2 199 ? 243.194 188.297 216.811 1.00 272.92 ? 220 LEU C HD22 1 
ATOM 10281 H HD23 . LEU D 2 199 ? 244.968 188.419 216.736 1.00 272.92 ? 220 LEU C HD23 1 
ATOM 10282 N N    . PHE D 2 200 ? 246.561 188.540 221.460 1.00 226.91 ? 221 PHE C N    1 
ATOM 10283 C CA   . PHE D 2 200 ? 247.888 187.999 221.742 1.00 226.91 ? 221 PHE C CA   1 
ATOM 10284 C C    . PHE D 2 200 ? 248.388 188.414 223.124 1.00 226.91 ? 221 PHE C C    1 
ATOM 10285 O O    . PHE D 2 200 ? 249.564 188.743 223.298 1.00 226.91 ? 221 PHE C O    1 
ATOM 10286 C CB   . PHE D 2 200 ? 248.885 188.462 220.677 1.00 226.91 ? 221 PHE C CB   1 
ATOM 10287 C CG   . PHE D 2 200 ? 248.482 188.105 219.275 1.00 226.91 ? 221 PHE C CG   1 
ATOM 10288 C CD1  . PHE D 2 200 ? 248.765 186.851 218.754 1.00 226.91 ? 221 PHE C CD1  1 
ATOM 10289 C CD2  . PHE D 2 200 ? 247.820 189.023 218.473 1.00 226.91 ? 221 PHE C CD2  1 
ATOM 10290 C CE1  . PHE D 2 200 ? 248.397 186.522 217.464 1.00 226.91 ? 221 PHE C CE1  1 
ATOM 10291 C CE2  . PHE D 2 200 ? 247.449 188.696 217.182 1.00 226.91 ? 221 PHE C CE2  1 
ATOM 10292 C CZ   . PHE D 2 200 ? 247.738 187.446 216.678 1.00 226.91 ? 221 PHE C CZ   1 
ATOM 10293 H H    . PHE D 2 200 ? 246.545 189.400 221.445 1.00 272.29 ? 221 PHE C H    1 
ATOM 10294 H HA   . PHE D 2 200 ? 247.863 187.033 221.777 1.00 272.29 ? 221 PHE C HA   1 
ATOM 10295 H HB2  . PHE D 2 200 ? 249.001 189.543 220.733 1.00 272.29 ? 221 PHE C HB2  1 
ATOM 10296 H HB3  . PHE D 2 200 ? 249.860 188.018 220.875 1.00 272.29 ? 221 PHE C HB3  1 
ATOM 10297 H HD1  . PHE D 2 200 ? 249.285 186.121 219.375 1.00 272.29 ? 221 PHE C HD1  1 
ATOM 10298 H HD2  . PHE D 2 200 ? 247.593 190.012 218.872 1.00 272.29 ? 221 PHE C HD2  1 
ATOM 10299 H HE1  . PHE D 2 200 ? 248.625 185.533 217.066 1.00 272.29 ? 221 PHE C HE1  1 
ATOM 10300 H HE2  . PHE D 2 200 ? 246.929 189.426 216.564 1.00 272.29 ? 221 PHE C HE2  1 
ATOM 10301 H HZ   . PHE D 2 200 ? 247.445 187.187 215.661 1.00 272.29 ? 221 PHE C HZ   1 
ATOM 10302 N N    . CYS D 2 201 ? 247.502 188.401 224.113 1.00 216.70 ? 222 CYS C N    1 
ATOM 10303 C CA   . CYS D 2 201 ? 247.888 188.680 225.488 1.00 216.70 ? 222 CYS C CA   1 
ATOM 10304 C C    . CYS D 2 201 ? 248.690 187.527 226.086 1.00 216.70 ? 222 CYS C C    1 
ATOM 10305 O O    . CYS D 2 201 ? 248.552 186.369 225.685 1.00 216.70 ? 222 CYS C O    1 
ATOM 10306 C CB   . CYS D 2 201 ? 246.635 188.951 226.319 1.00 216.70 ? 222 CYS C CB   1 
ATOM 10307 S SG   . CYS D 2 201 ? 245.344 187.716 226.065 1.00 216.70 ? 222 CYS C SG   1 
ATOM 10308 H H    . CYS D 2 201 ? 246.665 188.230 224.009 1.00 260.04 ? 222 CYS C H    1 
ATOM 10309 H HA   . CYS D 2 201 ? 248.440 189.477 225.511 1.00 260.04 ? 222 CYS C HA   1 
ATOM 10310 H HB2  . CYS D 2 201 ? 246.875 188.939 227.259 1.00 260.04 ? 222 CYS C HB2  1 
ATOM 10311 H HB3  . CYS D 2 201 ? 246.274 189.816 226.084 1.00 260.04 ? 222 CYS C HB3  1 
ATOM 10312 N N    . SER D 2 202 ? 249.544 187.859 227.054 1.00 227.04 ? 223 SER C N    1 
ATOM 10313 C CA   . SER D 2 202 ? 250.245 186.864 227.851 1.00 227.04 ? 223 SER C CA   1 
ATOM 10314 C C    . SER D 2 202 ? 249.369 186.405 229.014 1.00 227.04 ? 223 SER C C    1 
ATOM 10315 O O    . SER D 2 202 ? 248.332 186.999 229.315 1.00 227.04 ? 223 SER C O    1 
ATOM 10316 C CB   . SER D 2 202 ? 251.551 187.431 228.373 1.00 227.04 ? 223 SER C CB   1 
ATOM 10317 O OG   . SER D 2 202 ? 251.319 188.498 229.251 1.00 227.04 ? 223 SER C OG   1 
ATOM 10318 H H    . SER D 2 202 ? 249.737 188.670 227.267 1.00 272.45 ? 223 SER C H    1 
ATOM 10319 H HA   . SER D 2 202 ? 250.444 186.092 227.299 1.00 272.45 ? 223 SER C HA   1 
ATOM 10320 H HB2  . SER D 2 202 ? 252.108 186.648 228.887 1.00 272.45 ? 223 SER C HB2  1 
ATOM 10321 H HB3  . SER D 2 202 ? 252.160 187.771 227.537 1.00 272.45 ? 223 SER C HB3  1 
ATOM 10322 H HG   . SER D 2 202 ? 252.153 188.969 229.321 1.00 272.45 ? 223 SER C HG   1 
ATOM 10323 N N    . CYS D 2 203 ? 249.807 185.335 229.679 1.00 228.61 ? 224 CYS C N    1 
ATOM 10324 C CA   . CYS D 2 203 ? 249.091 184.815 230.834 1.00 228.61 ? 224 CYS C CA   1 
ATOM 10325 C C    . CYS D 2 203 ? 250.059 184.234 231.853 1.00 228.61 ? 224 CYS C C    1 
ATOM 10326 O O    . CYS D 2 203 ? 251.237 184.001 231.568 1.00 228.61 ? 224 CYS C O    1 
ATOM 10327 C CB   . CYS D 2 203 ? 248.073 183.747 230.421 1.00 228.61 ? 224 CYS C CB   1 
ATOM 10328 S SG   . CYS D 2 203 ? 246.676 184.408 229.518 1.00 228.61 ? 224 CYS C SG   1 
ATOM 10329 H H    . CYS D 2 203 ? 250.518 184.895 229.478 1.00 274.33 ? 224 CYS C H    1 
ATOM 10330 H HA   . CYS D 2 203 ? 248.618 185.538 231.272 1.00 274.33 ? 224 CYS C HA   1 
ATOM 10331 H HB2  . CYS D 2 203 ? 248.518 183.102 229.849 1.00 274.33 ? 224 CYS C HB2  1 
ATOM 10332 H HB3  . CYS D 2 203 ? 247.734 183.301 231.212 1.00 274.33 ? 224 CYS C HB3  1 
ATOM 10333 N N    . GLN D 2 204 ? 249.526 184.009 233.058 1.00 224.90 ? 225 GLN C N    1 
ATOM 10334 C CA   . GLN D 2 204 ? 250.246 183.376 234.153 1.00 224.90 ? 225 GLN C CA   1 
ATOM 10335 C C    . GLN D 2 204 ? 249.632 182.056 234.604 1.00 224.90 ? 225 GLN C C    1 
ATOM 10336 O O    . GLN D 2 204 ? 250.295 181.308 235.328 1.00 224.90 ? 225 GLN C O    1 
ATOM 10337 C CB   . GLN D 2 204 ? 250.323 184.334 235.345 1.00 224.90 ? 225 GLN C CB   1 
ATOM 10338 C CG   . GLN D 2 204 ? 251.053 185.633 235.053 1.00 224.90 ? 225 GLN C CG   1 
ATOM 10339 C CD   . GLN D 2 204 ? 251.198 186.506 236.286 1.00 224.90 ? 225 GLN C CD   1 
ATOM 10340 O OE1  . GLN D 2 204 ? 252.159 186.371 237.048 1.00 224.90 ? 225 GLN C OE1  1 
ATOM 10341 N NE2  . GLN D 2 204 ? 250.243 187.406 236.488 1.00 224.90 ? 225 GLN C NE2  1 
ATOM 10342 H H    . GLN D 2 204 ? 248.722 184.227 233.267 1.00 269.88 ? 225 GLN C H    1 
ATOM 10343 H HA   . GLN D 2 204 ? 251.154 183.186 233.874 1.00 269.88 ? 225 GLN C HA   1 
ATOM 10344 H HB2  . GLN D 2 204 ? 249.315 184.581 235.679 1.00 269.88 ? 225 GLN C HB2  1 
ATOM 10345 H HB3  . GLN D 2 204 ? 250.831 183.842 236.175 1.00 269.88 ? 225 GLN C HB3  1 
ATOM 10346 H HG2  . GLN D 2 204 ? 252.050 185.402 234.678 1.00 269.88 ? 225 GLN C HG2  1 
ATOM 10347 H HG3  . GLN D 2 204 ? 250.492 186.192 234.303 1.00 269.88 ? 225 GLN C HG3  1 
ATOM 10348 H HE21 . GLN D 2 204 ? 250.285 188.010 237.285 1.00 269.88 ? 225 GLN C HE21 1 
ATOM 10349 H HE22 . GLN D 2 204 ? 249.481 187.482 235.844 1.00 269.88 ? 225 GLN C HE22 1 
ATOM 10350 N N    . ASP D 2 205 ? 248.394 181.755 234.203 1.00 218.92 ? 226 ASP C N    1 
ATOM 10351 C CA   . ASP D 2 205 ? 247.691 180.557 234.644 1.00 218.92 ? 226 ASP C CA   1 
ATOM 10352 C C    . ASP D 2 205 ? 246.779 180.073 233.521 1.00 218.92 ? 226 ASP C C    1 
ATOM 10353 O O    . ASP D 2 205 ? 246.745 180.651 232.429 1.00 218.92 ? 226 ASP C O    1 
ATOM 10354 C CB   . ASP D 2 205 ? 246.874 180.832 235.910 1.00 218.92 ? 226 ASP C CB   1 
ATOM 10355 C CG   . ASP D 2 205 ? 245.826 181.919 235.714 1.00 218.92 ? 226 ASP C CG   1 
ATOM 10356 O OD1  . ASP D 2 205 ? 245.461 182.169 234.590 1.00 218.92 ? 226 ASP C OD1  1 
ATOM 10357 O OD2  . ASP D 2 205 ? 245.401 182.489 236.690 1.00 218.92 ? 226 ASP C OD2  1 
ATOM 10358 H H    . ASP D 2 205 ? 247.928 182.239 233.665 1.00 262.70 ? 226 ASP C H    1 
ATOM 10359 H HA   . ASP D 2 205 ? 248.332 179.851 234.822 1.00 262.70 ? 226 ASP C HA   1 
ATOM 10360 H HB2  . ASP D 2 205 ? 246.373 179.916 236.225 1.00 262.70 ? 226 ASP C HB2  1 
ATOM 10361 H HB3  . ASP D 2 205 ? 247.543 181.133 236.716 1.00 262.70 ? 226 ASP C HB3  1 
ATOM 10362 N N    . GLN D 2 206 ? 246.032 179.001 233.797 1.00 213.61 ? 227 GLN C N    1 
ATOM 10363 C CA   . GLN D 2 206 ? 245.146 178.427 232.788 1.00 213.61 ? 227 GLN C CA   1 
ATOM 10364 C C    . GLN D 2 206 ? 243.832 179.192 232.691 1.00 213.61 ? 227 GLN C C    1 
ATOM 10365 O O    . GLN D 2 206 ? 243.170 179.159 231.650 1.00 213.61 ? 227 GLN C O    1 
ATOM 10366 C CB   . GLN D 2 206 ? 244.867 176.954 233.099 1.00 213.61 ? 227 GLN C CB   1 
ATOM 10367 C CG   . GLN D 2 206 ? 246.094 176.061 233.033 1.00 213.61 ? 227 GLN C CG   1 
ATOM 10368 C CD   . GLN D 2 206 ? 246.921 176.118 234.303 1.00 213.61 ? 227 GLN C CD   1 
ATOM 10369 O OE1  . GLN D 2 206 ? 246.723 176.994 235.150 1.00 213.61 ? 227 GLN C OE1  1 
ATOM 10370 N NE2  . GLN D 2 206 ? 247.854 175.184 234.444 1.00 213.61 ? 227 GLN C NE2  1 
ATOM 10371 H H    . GLN D 2 206 ? 246.020 178.591 234.553 1.00 256.33 ? 227 GLN C H    1 
ATOM 10372 H HA   . GLN D 2 206 ? 245.579 178.472 231.922 1.00 256.33 ? 227 GLN C HA   1 
ATOM 10373 H HB2  . GLN D 2 206 ? 244.441 176.868 234.099 1.00 256.33 ? 227 GLN C HB2  1 
ATOM 10374 H HB3  . GLN D 2 206 ? 244.130 176.567 232.396 1.00 256.33 ? 227 GLN C HB3  1 
ATOM 10375 H HG2  . GLN D 2 206 ? 245.772 175.030 232.881 1.00 256.33 ? 227 GLN C HG2  1 
ATOM 10376 H HG3  . GLN D 2 206 ? 246.721 176.383 232.202 1.00 256.33 ? 227 GLN C HG3  1 
ATOM 10377 H HE21 . GLN D 2 206 ? 248.431 175.171 235.262 1.00 256.33 ? 227 GLN C HE21 1 
ATOM 10378 H HE22 . GLN D 2 206 ? 247.980 174.492 233.733 1.00 256.33 ? 227 GLN C HE22 1 
ATOM 10379 N N    . ALA D 2 207 ? 243.427 179.880 233.763 1.00 210.06 ? 228 ALA C N    1 
ATOM 10380 C CA   . ALA D 2 207 ? 242.221 180.702 233.696 1.00 210.06 ? 228 ALA C CA   1 
ATOM 10381 C C    . ALA D 2 207 ? 242.393 181.844 232.703 1.00 210.06 ? 228 ALA C C    1 
ATOM 10382 O O    . ALA D 2 207 ? 241.513 182.097 231.868 1.00 210.06 ? 228 ALA C O    1 
ATOM 10383 C CB   . ALA D 2 207 ? 241.880 181.244 235.084 1.00 210.06 ? 228 ALA C CB   1 
ATOM 10384 H H    . ALA D 2 207 ? 243.823 179.885 234.526 1.00 252.07 ? 228 ALA C H    1 
ATOM 10385 H HA   . ALA D 2 207 ? 241.480 180.153 233.398 1.00 252.07 ? 228 ALA C HA   1 
ATOM 10386 H HB1  . ALA D 2 207 ? 241.075 181.782 235.023 1.00 252.07 ? 228 ALA C HB1  1 
ATOM 10387 H HB2  . ALA D 2 207 ? 241.735 180.498 235.687 1.00 252.07 ? 228 ALA C HB2  1 
ATOM 10388 H HB3  . ALA D 2 207 ? 242.619 181.787 235.401 1.00 252.07 ? 228 ALA C HB3  1 
ATOM 10389 N N    . CYS D 2 208 ? 243.521 182.551 232.785 1.00 226.69 ? 229 CYS C N    1 
ATOM 10390 C CA   . CYS D 2 208 ? 243.866 183.540 231.770 1.00 226.69 ? 229 CYS C CA   1 
ATOM 10391 C C    . CYS D 2 208 ? 244.090 182.881 230.417 1.00 226.69 ? 229 CYS C C    1 
ATOM 10392 O O    . CYS D 2 208 ? 243.590 183.356 229.391 1.00 226.69 ? 229 CYS C O    1 
ATOM 10393 C CB   . CYS D 2 208 ? 245.115 184.308 232.201 1.00 226.69 ? 229 CYS C CB   1 
ATOM 10394 S SG   . CYS D 2 208 ? 245.695 185.522 230.996 1.00 226.69 ? 229 CYS C SG   1 
ATOM 10395 H H    . CYS D 2 208 ? 244.100 182.475 233.416 1.00 272.03 ? 229 CYS C H    1 
ATOM 10396 H HA   . CYS D 2 208 ? 243.136 184.174 231.681 1.00 272.03 ? 229 CYS C HA   1 
ATOM 10397 H HB2  . CYS D 2 208 ? 244.917 184.781 233.025 1.00 272.03 ? 229 CYS C HB2  1 
ATOM 10398 H HB3  . CYS D 2 208 ? 245.830 183.674 232.352 1.00 272.03 ? 229 CYS C HB3  1 
ATOM 10399 N N    . ALA D 2 209 ? 244.882 181.806 230.391 1.00 203.62 ? 230 ALA C N    1 
ATOM 10400 C CA   . ALA D 2 209 ? 245.230 181.173 229.125 1.00 203.62 ? 230 ALA C CA   1 
ATOM 10401 C C    . ALA D 2 209 ? 243.988 180.721 228.373 1.00 203.62 ? 230 ALA C C    1 
ATOM 10402 O O    . ALA D 2 209 ? 243.931 180.829 227.144 1.00 203.62 ? 230 ALA C O    1 
ATOM 10403 C CB   . ALA D 2 209 ? 246.165 179.992 229.372 1.00 203.62 ? 230 ALA C CB   1 
ATOM 10404 H H    . ALA D 2 209 ? 245.223 181.430 231.084 1.00 244.34 ? 230 ALA C H    1 
ATOM 10405 H HA   . ALA D 2 209 ? 245.699 181.817 228.570 1.00 244.34 ? 230 ALA C HA   1 
ATOM 10406 H HB1  . ALA D 2 209 ? 246.354 179.557 228.526 1.00 244.34 ? 230 ALA C HB1  1 
ATOM 10407 H HB2  . ALA D 2 209 ? 246.987 180.318 229.770 1.00 244.34 ? 230 ALA C HB2  1 
ATOM 10408 H HB3  . ALA D 2 209 ? 245.726 179.374 229.975 1.00 244.34 ? 230 ALA C HB3  1 
ATOM 10409 N N    . GLU D 2 210 ? 242.979 180.226 229.091 1.00 186.07 ? 231 GLU C N    1 
ATOM 10410 C CA   . GLU D 2 210 ? 241.720 179.871 228.452 1.00 186.07 ? 231 GLU C CA   1 
ATOM 10411 C C    . GLU D 2 210 ? 241.019 181.114 227.922 1.00 186.07 ? 231 GLU C C    1 
ATOM 10412 O O    . GLU D 2 210 ? 240.488 181.106 226.810 1.00 186.07 ? 231 GLU C O    1 
ATOM 10413 C CB   . GLU D 2 210 ? 240.807 179.134 229.434 1.00 186.07 ? 231 GLU C CB   1 
ATOM 10414 C CG   . GLU D 2 210 ? 239.480 178.682 228.841 1.00 186.07 ? 231 GLU C CG   1 
ATOM 10415 C CD   . GLU D 2 210 ? 239.645 177.662 227.749 1.00 186.07 ? 231 GLU C CD   1 
ATOM 10416 O OE1  . GLU D 2 210 ? 240.687 177.056 227.680 1.00 186.07 ? 231 GLU C OE1  1 
ATOM 10417 O OE2  . GLU D 2 210 ? 238.727 177.490 226.982 1.00 186.07 ? 231 GLU C OE2  1 
ATOM 10418 H H    . GLU D 2 210 ? 243.001 180.088 229.940 1.00 223.28 ? 231 GLU C H    1 
ATOM 10419 H HA   . GLU D 2 210 ? 241.906 179.288 227.699 1.00 223.28 ? 231 GLU C HA   1 
ATOM 10420 H HB2  . GLU D 2 210 ? 241.320 178.252 229.817 1.00 223.28 ? 231 GLU C HB2  1 
ATOM 10421 H HB3  . GLU D 2 210 ? 240.590 179.781 230.284 1.00 223.28 ? 231 GLU C HB3  1 
ATOM 10422 H HG2  . GLU D 2 210 ? 238.867 178.252 229.634 1.00 223.28 ? 231 GLU C HG2  1 
ATOM 10423 H HG3  . GLU D 2 210 ? 238.956 179.551 228.445 1.00 223.28 ? 231 GLU C HG3  1 
ATOM 10424 N N    . ARG D 2 211 ? 241.000 182.191 228.709 1.00 205.69 ? 232 ARG C N    1 
ATOM 10425 C CA   . ARG D 2 211 ? 240.478 183.464 228.209 1.00 205.69 ? 232 ARG C CA   1 
ATOM 10426 C C    . ARG D 2 211 ? 241.148 183.849 226.893 1.00 205.69 ? 232 ARG C C    1 
ATOM 10427 O O    . ARG D 2 211 ? 240.486 184.298 225.943 1.00 205.69 ? 232 ARG C O    1 
ATOM 10428 C CB   . ARG D 2 211 ? 240.694 184.572 229.229 1.00 205.69 ? 232 ARG C CB   1 
ATOM 10429 C CG   . ARG D 2 211 ? 240.223 185.949 228.787 1.00 205.69 ? 232 ARG C CG   1 
ATOM 10430 C CD   . ARG D 2 211 ? 240.429 186.967 229.849 1.00 205.69 ? 232 ARG C CD   1 
ATOM 10431 N NE   . ARG D 2 211 ? 239.536 186.760 230.978 1.00 205.69 ? 232 ARG C NE   1 
ATOM 10432 C CZ   . ARG D 2 211 ? 238.265 187.203 231.039 1.00 205.69 ? 232 ARG C CZ   1 
ATOM 10433 N NH1  . ARG D 2 211 ? 237.753 187.874 230.030 1.00 205.69 ? 232 ARG C NH1  1 
ATOM 10434 N NH2  . ARG D 2 211 ? 237.532 186.963 232.112 1.00 205.69 ? 232 ARG C NH2  1 
ATOM 10435 H H    . ARG D 2 211 ? 241.279 182.213 229.522 1.00 246.83 ? 232 ARG C H    1 
ATOM 10436 H HA   . ARG D 2 211 ? 239.526 183.377 228.049 1.00 246.83 ? 232 ARG C HA   1 
ATOM 10437 H HB2  . ARG D 2 211 ? 240.169 184.325 230.150 1.00 246.83 ? 232 ARG C HB2  1 
ATOM 10438 H HB3  . ARG D 2 211 ? 241.755 184.647 229.466 1.00 246.83 ? 232 ARG C HB3  1 
ATOM 10439 H HG2  . ARG D 2 211 ? 240.782 186.258 227.903 1.00 246.83 ? 232 ARG C HG2  1 
ATOM 10440 H HG3  . ARG D 2 211 ? 239.160 185.911 228.549 1.00 246.83 ? 232 ARG C HG3  1 
ATOM 10441 H HD2  . ARG D 2 211 ? 241.455 186.912 230.211 1.00 246.83 ? 232 ARG C HD2  1 
ATOM 10442 H HD3  . ARG D 2 211 ? 240.240 187.959 229.442 1.00 246.83 ? 232 ARG C HD3  1 
ATOM 10443 H HE   . ARG D 2 211 ? 239.894 186.248 231.773 1.00 246.83 ? 232 ARG C HE   1 
ATOM 10444 H HH11 . ARG D 2 211 ? 238.313 188.057 229.210 1.00 246.83 ? 232 ARG C HH11 1 
ATOM 10445 H HH12 . ARG D 2 211 ? 236.801 188.206 230.076 1.00 246.83 ? 232 ARG C HH12 1 
ATOM 10446 H HH21 . ARG D 2 211 ? 237.926 186.448 232.888 1.00 246.83 ? 232 ARG C HH21 1 
ATOM 10447 H HH22 . ARG D 2 211 ? 236.580 187.295 232.158 1.00 246.83 ? 232 ARG C HH22 1 
ATOM 10448 N N    . ARG D 2 212 ? 242.467 183.667 226.822 1.00 197.72 ? 233 ARG C N    1 
ATOM 10449 C CA   . ARG D 2 212 ? 243.216 183.947 225.600 1.00 197.72 ? 233 ARG C CA   1 
ATOM 10450 C C    . ARG D 2 212 ? 242.709 183.098 224.441 1.00 197.72 ? 233 ARG C C    1 
ATOM 10451 O O    . ARG D 2 212 ? 242.396 183.617 223.363 1.00 197.72 ? 233 ARG C O    1 
ATOM 10452 C CB   . ARG D 2 212 ? 244.700 183.684 225.808 1.00 197.72 ? 233 ARG C CB   1 
ATOM 10453 C CG   . ARG D 2 212 ? 245.589 184.076 224.639 1.00 197.72 ? 233 ARG C CG   1 
ATOM 10454 C CD   . ARG D 2 212 ? 247.025 183.844 224.939 1.00 197.72 ? 233 ARG C CD   1 
ATOM 10455 N NE   . ARG D 2 212 ? 247.339 182.427 225.029 1.00 197.72 ? 233 ARG C NE   1 
ATOM 10456 C CZ   . ARG D 2 212 ? 247.719 181.798 226.157 1.00 197.72 ? 233 ARG C CZ   1 
ATOM 10457 N NH1  . ARG D 2 212 ? 247.827 182.471 227.281 1.00 197.72 ? 233 ARG C NH1  1 
ATOM 10458 N NH2  . ARG D 2 212 ? 247.983 180.503 226.135 1.00 197.72 ? 233 ARG C NH2  1 
ATOM 10459 H H    . ARG D 2 212 ? 242.953 183.382 227.472 1.00 237.26 ? 233 ARG C H    1 
ATOM 10460 H HA   . ARG D 2 212 ? 243.105 184.881 225.365 1.00 237.26 ? 233 ARG C HA   1 
ATOM 10461 H HB2  . ARG D 2 212 ? 245.047 184.230 226.684 1.00 237.26 ? 233 ARG C HB2  1 
ATOM 10462 H HB3  . ARG D 2 212 ? 244.858 182.623 226.001 1.00 237.26 ? 233 ARG C HB3  1 
ATOM 10463 H HG2  . ARG D 2 212 ? 245.322 183.483 223.764 1.00 237.26 ? 233 ARG C HG2  1 
ATOM 10464 H HG3  . ARG D 2 212 ? 245.451 185.134 224.416 1.00 237.26 ? 233 ARG C HG3  1 
ATOM 10465 H HD2  . ARG D 2 212 ? 247.637 184.280 224.149 1.00 237.26 ? 233 ARG C HD2  1 
ATOM 10466 H HD3  . ARG D 2 212 ? 247.277 184.310 225.891 1.00 237.26 ? 233 ARG C HD3  1 
ATOM 10467 H HE   . ARG D 2 212 ? 247.267 181.876 224.184 1.00 237.26 ? 233 ARG C HE   1 
ATOM 10468 H HH11 . ARG D 2 212 ? 247.625 183.461 227.298 1.00 237.26 ? 233 ARG C HH11 1 
ATOM 10469 H HH12 . ARG D 2 212 ? 248.112 181.999 228.127 1.00 237.26 ? 233 ARG C HH12 1 
ATOM 10470 H HH21 . ARG D 2 212 ? 247.900 179.985 225.271 1.00 237.26 ? 233 ARG C HH21 1 
ATOM 10471 H HH22 . ARG D 2 212 ? 248.267 180.031 226.981 1.00 237.26 ? 233 ARG C HH22 1 
ATOM 10472 N N    . ARG D 2 213 ? 242.625 181.782 224.648 1.00 179.40 ? 234 ARG C N    1 
ATOM 10473 C CA   . ARG D 2 213 ? 242.170 180.885 223.593 1.00 179.40 ? 234 ARG C CA   1 
ATOM 10474 C C    . ARG D 2 213 ? 240.748 181.212 223.155 1.00 179.40 ? 234 ARG C C    1 
ATOM 10475 O O    . ARG D 2 213 ? 240.408 181.043 221.979 1.00 179.40 ? 234 ARG C O    1 
ATOM 10476 C CB   . ARG D 2 213 ? 242.231 179.439 224.060 1.00 179.40 ? 234 ARG C CB   1 
ATOM 10477 C CG   . ARG D 2 213 ? 241.908 178.407 222.991 1.00 179.40 ? 234 ARG C CG   1 
ATOM 10478 C CD   . ARG D 2 213 ? 242.223 177.028 223.444 1.00 179.40 ? 234 ARG C CD   1 
ATOM 10479 N NE   . ARG D 2 213 ? 242.043 176.053 222.381 1.00 179.40 ? 234 ARG C NE   1 
ATOM 10480 C CZ   . ARG D 2 213 ? 240.878 175.438 222.097 1.00 179.40 ? 234 ARG C CZ   1 
ATOM 10481 N NH1  . ARG D 2 213 ? 239.803 175.707 222.804 1.00 179.40 ? 234 ARG C NH1  1 
ATOM 10482 N NH2  . ARG D 2 213 ? 240.817 174.564 221.107 1.00 179.40 ? 234 ARG C NH2  1 
ATOM 10483 H H    . ARG D 2 213 ? 242.825 181.390 225.387 1.00 215.28 ? 234 ARG C H    1 
ATOM 10484 H HA   . ARG D 2 213 ? 242.752 180.983 222.823 1.00 215.28 ? 234 ARG C HA   1 
ATOM 10485 H HB2  . ARG D 2 213 ? 243.229 179.220 224.437 1.00 215.28 ? 234 ARG C HB2  1 
ATOM 10486 H HB3  . ARG D 2 213 ? 241.531 179.292 224.882 1.00 215.28 ? 234 ARG C HB3  1 
ATOM 10487 H HG2  . ARG D 2 213 ? 240.846 178.454 222.749 1.00 215.28 ? 234 ARG C HG2  1 
ATOM 10488 H HG3  . ARG D 2 213 ? 242.494 178.616 222.095 1.00 215.28 ? 234 ARG C HG3  1 
ATOM 10489 H HD2  . ARG D 2 213 ? 243.260 176.983 223.776 1.00 215.28 ? 234 ARG C HD2  1 
ATOM 10490 H HD3  . ARG D 2 213 ? 241.566 176.758 224.270 1.00 215.28 ? 234 ARG C HD3  1 
ATOM 10491 H HE   . ARG D 2 213 ? 242.848 175.820 221.815 1.00 215.28 ? 234 ARG C HE   1 
ATOM 10492 H HH11 . ARG D 2 213 ? 239.850 176.375 223.560 1.00 215.28 ? 234 ARG C HH11 1 
ATOM 10493 H HH12 . ARG D 2 213 ? 238.931 175.246 222.591 1.00 215.28 ? 234 ARG C HH12 1 
ATOM 10494 H HH21 . ARG D 2 213 ? 241.644 174.357 220.564 1.00 215.28 ? 234 ARG C HH21 1 
ATOM 10495 H HH22 . ARG D 2 213 ? 239.945 174.103 220.894 1.00 215.28 ? 234 ARG C HH22 1 
ATOM 10496 N N    . GLN D 2 214 ? 239.910 181.684 224.076 1.00 177.58 ? 235 GLN C N    1 
ATOM 10497 C CA   . GLN D 2 214 ? 238.501 181.920 223.799 1.00 177.58 ? 235 GLN C CA   1 
ATOM 10498 C C    . GLN D 2 214 ? 238.238 183.263 223.130 1.00 177.58 ? 235 GLN C C    1 
ATOM 10499 O O    . GLN D 2 214 ? 237.069 183.590 222.911 1.00 177.58 ? 235 GLN C O    1 
ATOM 10500 C CB   . GLN D 2 214 ? 237.694 181.828 225.097 1.00 177.58 ? 235 GLN C CB   1 
ATOM 10501 C CG   . GLN D 2 214 ? 237.592 180.425 225.669 1.00 177.58 ? 235 GLN C CG   1 
ATOM 10502 C CD   . GLN D 2 214 ? 236.878 179.468 224.733 1.00 177.58 ? 235 GLN C CD   1 
ATOM 10503 O OE1  . GLN D 2 214 ? 235.805 179.777 224.208 1.00 177.58 ? 235 GLN C OE1  1 
ATOM 10504 N NE2  . GLN D 2 214 ? 237.471 178.299 224.519 1.00 177.58 ? 235 GLN C NE2  1 
ATOM 10505 H H    . GLN D 2 214 ? 240.141 181.881 224.881 1.00 213.10 ? 235 GLN C H    1 
ATOM 10506 H HA   . GLN D 2 214 ? 238.200 181.228 223.216 1.00 213.10 ? 235 GLN C HA   1 
ATOM 10507 H HB2  . GLN D 2 214 ? 238.147 182.468 225.854 1.00 213.10 ? 235 GLN C HB2  1 
ATOM 10508 H HB3  . GLN D 2 214 ? 236.682 182.194 224.922 1.00 213.10 ? 235 GLN C HB3  1 
ATOM 10509 H HG2  . GLN D 2 214 ? 238.597 180.043 225.848 1.00 213.10 ? 235 GLN C HG2  1 
ATOM 10510 H HG3  . GLN D 2 214 ? 237.036 180.465 226.606 1.00 213.10 ? 235 GLN C HG3  1 
ATOM 10511 H HE21 . GLN D 2 214 ? 237.047 177.627 223.911 1.00 213.10 ? 235 GLN C HE21 1 
ATOM 10512 H HE22 . GLN D 2 214 ? 238.341 178.090 224.966 1.00 213.10 ? 235 GLN C HE22 1 
ATOM 10513 N N    . THR D 2 215 ? 239.294 184.044 222.864 1.00 190.41 ? 236 THR C N    1 
ATOM 10514 C CA   . THR D 2 215 ? 239.158 185.380 222.277 1.00 190.41 ? 236 THR C CA   1 
ATOM 10515 C C    . THR D 2 215 ? 238.138 185.438 221.137 1.00 190.41 ? 236 THR C C    1 
ATOM 10516 O O    . THR D 2 215 ? 237.314 186.359 221.086 1.00 190.41 ? 236 THR C O    1 
ATOM 10517 C CB   . THR D 2 215 ? 240.519 185.884 221.761 1.00 190.41 ? 236 THR C CB   1 
ATOM 10518 O OG1  . THR D 2 215 ? 241.438 185.991 222.856 1.00 190.41 ? 236 THR C OG1  1 
ATOM 10519 C CG2  . THR D 2 215 ? 240.367 187.244 221.097 1.00 190.41 ? 236 THR C CG2  1 
ATOM 10520 H H    . THR D 2 215 ? 240.112 183.833 223.021 1.00 228.49 ? 236 THR C H    1 
ATOM 10521 H HA   . THR D 2 215 ? 238.868 185.998 222.964 1.00 228.49 ? 236 THR C HA   1 
ATOM 10522 H HB   . THR D 2 215 ? 240.919 185.174 221.037 1.00 228.49 ? 236 THR C HB   1 
ATOM 10523 H HG1  . THR D 2 215 ? 241.753 185.115 223.096 1.00 228.49 ? 236 THR C HG1  1 
ATOM 10524 H HG21 . THR D 2 215 ? 241.339 187.584 220.738 1.00 228.49 ? 236 THR C HG21 1 
ATOM 10525 H HG22 . THR D 2 215 ? 239.678 187.163 220.257 1.00 228.49 ? 236 THR C HG22 1 
ATOM 10526 H HG23 . THR D 2 215 ? 239.977 187.959 221.819 1.00 228.49 ? 236 THR C HG23 1 
ATOM 10527 N N    . ILE D 2 216 ? 238.163 184.462 220.225 1.00 194.10 ? 237 ILE C N    1 
ATOM 10528 C CA   . ILE D 2 216 ? 237.276 184.460 219.059 1.00 194.10 ? 237 ILE C CA   1 
ATOM 10529 C C    . ILE D 2 216 ? 236.223 183.349 219.126 1.00 194.10 ? 237 ILE C C    1 
ATOM 10530 O O    . ILE D 2 216 ? 235.679 182.960 218.090 1.00 194.10 ? 237 ILE C O    1 
ATOM 10531 C CB   . ILE D 2 216 ? 238.091 184.308 217.761 1.00 194.10 ? 237 ILE C CB   1 
ATOM 10532 C CG1  . ILE D 2 216 ? 238.859 182.984 217.765 1.00 194.10 ? 237 ILE C CG1  1 
ATOM 10533 C CG2  . ILE D 2 216 ? 239.045 185.480 217.592 1.00 194.10 ? 237 ILE C CG2  1 
ATOM 10534 C CD1  . ILE D 2 216 ? 239.458 182.622 216.425 1.00 194.10 ? 237 ILE C CD1  1 
ATOM 10535 H H    . ILE D 2 216 ? 238.691 183.784 220.261 1.00 232.92 ? 237 ILE C H    1 
ATOM 10536 H HA   . ILE D 2 216 ? 236.794 185.300 219.023 1.00 232.92 ? 237 ILE C HA   1 
ATOM 10537 H HB   . ILE D 2 216 ? 237.413 184.278 216.908 1.00 232.92 ? 237 ILE C HB   1 
ATOM 10538 H HG12 . ILE D 2 216 ? 239.664 183.032 218.497 1.00 232.92 ? 237 ILE C HG12 1 
ATOM 10539 H HG13 . ILE D 2 216 ? 238.191 182.177 218.067 1.00 232.92 ? 237 ILE C HG13 1 
ATOM 10540 H HG21 . ILE D 2 216 ? 239.613 185.357 216.671 1.00 232.92 ? 237 ILE C HG21 1 
ATOM 10541 H HG22 . ILE D 2 216 ? 238.477 186.408 217.546 1.00 232.92 ? 237 ILE C HG22 1 
ATOM 10542 H HG23 . ILE D 2 216 ? 239.731 185.516 218.439 1.00 232.92 ? 237 ILE C HG23 1 
ATOM 10543 H HD11 . ILE D 2 216 ? 239.986 181.672 216.507 1.00 232.92 ? 237 ILE C HD11 1 
ATOM 10544 H HD12 . ILE D 2 216 ? 238.664 182.534 215.683 1.00 232.92 ? 237 ILE C HD12 1 
ATOM 10545 H HD13 . ILE D 2 216 ? 240.157 183.399 216.118 1.00 232.92 ? 237 ILE C HD13 1 
ATOM 10546 N N    . LEU D 2 217 ? 235.903 182.851 220.325 1.00 185.69 ? 238 LEU C N    1 
ATOM 10547 C CA   . LEU D 2 217 ? 234.892 181.809 220.518 1.00 185.69 ? 238 LEU C CA   1 
ATOM 10548 C C    . LEU D 2 217 ? 235.191 180.577 219.676 1.00 185.69 ? 238 LEU C C    1 
ATOM 10549 O O    . LEU D 2 217 ? 234.455 180.279 218.726 1.00 185.69 ? 238 LEU C O    1 
ATOM 10550 C CB   . LEU D 2 217 ? 233.500 182.347 220.162 1.00 185.69 ? 238 LEU C CB   1 
ATOM 10551 C CG   . LEU D 2 217 ? 232.830 183.219 221.232 1.00 185.69 ? 238 LEU C CG   1 
ATOM 10552 C CD1  . LEU D 2 217 ? 233.524 184.574 221.291 1.00 185.69 ? 238 LEU C CD1  1 
ATOM 10553 C CD2  . LEU D 2 217 ? 231.352 183.376 220.908 1.00 185.69 ? 238 LEU C CD2  1 
ATOM 10554 H H    . LEU D 2 217 ? 236.267 183.109 221.059 1.00 222.83 ? 238 LEU C H    1 
ATOM 10555 H HA   . LEU D 2 217 ? 234.916 181.530 221.442 1.00 222.83 ? 238 LEU C HA   1 
ATOM 10556 H HB2  . LEU D 2 217 ? 233.580 182.941 219.253 1.00 222.83 ? 238 LEU C HB2  1 
ATOM 10557 H HB3  . LEU D 2 217 ? 232.841 181.503 219.963 1.00 222.83 ? 238 LEU C HB3  1 
ATOM 10558 H HG   . LEU D 2 217 ? 232.940 182.746 222.208 1.00 222.83 ? 238 LEU C HG   1 
ATOM 10559 H HD11 . LEU D 2 217 ? 233.048 185.193 222.052 1.00 222.83 ? 238 LEU C HD11 1 
ATOM 10560 H HD12 . LEU D 2 217 ? 234.575 184.433 221.544 1.00 222.83 ? 238 LEU C HD12 1 
ATOM 10561 H HD13 . LEU D 2 217 ? 233.446 185.065 220.322 1.00 222.83 ? 238 LEU C HD13 1 
ATOM 10562 H HD21 . LEU D 2 217 ? 230.876 183.995 221.669 1.00 222.83 ? 238 LEU C HD21 1 
ATOM 10563 H HD22 . LEU D 2 217 ? 231.242 183.850 219.932 1.00 222.83 ? 238 LEU C HD22 1 
ATOM 10564 H HD23 . LEU D 2 217 ? 230.878 182.394 220.889 1.00 222.83 ? 238 LEU C HD23 1 
ATOM 10565 N N    . PRO D 2 218 ? 236.278 179.866 219.950 1.00 172.45 ? 239 PRO C N    1 
ATOM 10566 C CA   . PRO D 2 218 ? 236.585 178.698 219.122 1.00 172.45 ? 239 PRO C CA   1 
ATOM 10567 C C    . PRO D 2 218 ? 235.395 177.776 218.936 1.00 172.45 ? 239 PRO C C    1 
ATOM 10568 O O    . PRO D 2 218 ? 235.229 177.193 217.861 1.00 172.45 ? 239 PRO C O    1 
ATOM 10569 C CB   . PRO D 2 218 ? 237.701 178.008 219.913 1.00 172.45 ? 239 PRO C CB   1 
ATOM 10570 C CG   . PRO D 2 218 ? 238.417 179.128 220.588 1.00 172.45 ? 239 PRO C CG   1 
ATOM 10571 C CD   . PRO D 2 218 ? 237.325 180.087 220.983 1.00 172.45 ? 239 PRO C CD   1 
ATOM 10572 H HA   . PRO D 2 218 ? 236.889 179.038 218.279 1.00 206.94 ? 239 PRO C HA   1 
ATOM 10573 H HB2  . PRO D 2 218 ? 237.269 177.288 220.624 1.00 206.94 ? 239 PRO C HB2  1 
ATOM 10574 H HB3  . PRO D 2 218 ? 238.348 177.437 219.231 1.00 206.94 ? 239 PRO C HB3  1 
ATOM 10575 H HG2  . PRO D 2 218 ? 238.982 178.750 221.453 1.00 206.94 ? 239 PRO C HG2  1 
ATOM 10576 H HG3  . PRO D 2 218 ? 239.149 179.579 219.902 1.00 206.94 ? 239 PRO C HG3  1 
ATOM 10577 H HD2  . PRO D 2 218 ? 236.954 179.828 221.985 1.00 206.94 ? 239 PRO C HD2  1 
ATOM 10578 H HD3  . PRO D 2 218 ? 237.716 181.115 220.966 1.00 206.94 ? 239 PRO C HD3  1 
ATOM 10579 N N    . SER D 2 219 ? 234.548 177.640 219.958 1.00 154.22 ? 240 SER C N    1 
ATOM 10580 C CA   . SER D 2 219 ? 233.362 176.802 219.845 1.00 154.22 ? 240 SER C CA   1 
ATOM 10581 C C    . SER D 2 219 ? 232.484 177.173 218.654 1.00 154.22 ? 240 SER C C    1 
ATOM 10582 O O    . SER D 2 219 ? 231.580 176.400 218.318 1.00 154.22 ? 240 SER C O    1 
ATOM 10583 C CB   . SER D 2 219 ? 232.549 176.898 221.122 1.00 154.22 ? 240 SER C CB   1 
ATOM 10584 O OG   . SER D 2 219 ? 232.054 178.196 221.305 1.00 154.22 ? 240 SER C OG   1 
ATOM 10585 H H    . SER D 2 219 ? 234.641 178.023 220.722 1.00 185.06 ? 240 SER C H    1 
ATOM 10586 H HA   . SER D 2 219 ? 233.639 175.880 219.733 1.00 185.06 ? 240 SER C HA   1 
ATOM 10587 H HB2  . SER D 2 219 ? 231.719 176.192 221.078 1.00 185.06 ? 240 SER C HB2  1 
ATOM 10588 H HB3  . SER D 2 219 ? 233.171 176.619 221.971 1.00 185.06 ? 240 SER C HB3  1 
ATOM 10589 H HG   . SER D 2 219 ? 231.518 178.165 222.102 1.00 185.06 ? 240 SER C HG   1 
ATOM 10590 N N    . CYS D 2 220 ? 232.726 178.320 218.016 1.00 166.04 ? 241 CYS C N    1 
ATOM 10591 C CA   . CYS D 2 220 ? 232.007 178.737 216.816 1.00 166.04 ? 241 CYS C CA   1 
ATOM 10592 C C    . CYS D 2 220 ? 232.929 178.968 215.630 1.00 166.04 ? 241 CYS C C    1 
ATOM 10593 O O    . CYS D 2 220 ? 232.706 178.395 214.558 1.00 166.04 ? 241 CYS C O    1 
ATOM 10594 C CB   . CYS D 2 220 ? 231.221 180.020 217.088 1.00 166.04 ? 241 CYS C CB   1 
ATOM 10595 S SG   . CYS D 2 220 ? 230.321 180.653 215.653 1.00 166.04 ? 241 CYS C SG   1 
ATOM 10596 H H    . CYS D 2 220 ? 233.317 178.892 218.267 1.00 199.25 ? 241 CYS C H    1 
ATOM 10597 H HA   . CYS D 2 220 ? 231.371 178.054 216.557 1.00 199.25 ? 241 CYS C HA   1 
ATOM 10598 H HB2  . CYS D 2 220 ? 230.501 179.843 217.887 1.00 199.25 ? 241 CYS C HB2  1 
ATOM 10599 H HB3  . CYS D 2 220 ? 231.904 180.799 217.429 1.00 199.25 ? 241 CYS C HB3  1 
ATOM 10600 N N    . SER D 2 221 ? 233.965 179.793 215.793 1.00 171.47 ? 242 SER C N    1 
ATOM 10601 C CA   . SER D 2 221 ? 234.784 180.235 214.671 1.00 171.47 ? 242 SER C CA   1 
ATOM 10602 C C    . SER D 2 221 ? 235.891 179.257 214.297 1.00 171.47 ? 242 SER C C    1 
ATOM 10603 O O    . SER D 2 221 ? 236.315 179.243 213.136 1.00 171.47 ? 242 SER C O    1 
ATOM 10604 C CB   . SER D 2 221 ? 235.398 181.583 214.996 1.00 171.47 ? 242 SER C CB   1 
ATOM 10605 O OG   . SER D 2 221 ? 236.303 181.480 216.061 1.00 171.47 ? 242 SER C OG   1 
ATOM 10606 H H    . SER D 2 221 ? 234.214 180.112 216.553 1.00 205.76 ? 242 SER C H    1 
ATOM 10607 H HA   . SER D 2 221 ? 234.215 180.349 213.894 1.00 205.76 ? 242 SER C HA   1 
ATOM 10608 H HB2  . SER D 2 221 ? 235.910 181.971 214.116 1.00 205.76 ? 242 SER C HB2  1 
ATOM 10609 H HB3  . SER D 2 221 ? 234.609 182.289 215.252 1.00 205.76 ? 242 SER C HB3  1 
ATOM 10610 H HG   . SER D 2 221 ? 236.166 182.262 216.600 1.00 205.76 ? 242 SER C HG   1 
ATOM 10611 N N    . TYR D 2 222 ? 236.361 178.440 215.242 1.00 171.71 ? 243 TYR C N    1 
ATOM 10612 C CA   . TYR D 2 222 ? 237.533 177.592 215.054 1.00 171.71 ? 243 TYR C CA   1 
ATOM 10613 C C    . TYR D 2 222 ? 237.199 176.110 215.119 1.00 171.71 ? 243 TYR C C    1 
ATOM 10614 O O    . TYR D 2 222 ? 237.511 175.361 214.191 1.00 171.71 ? 243 TYR C O    1 
ATOM 10615 C CB   . TYR D 2 222 ? 238.600 177.932 216.096 1.00 171.71 ? 243 TYR C CB   1 
ATOM 10616 C CG   . TYR D 2 222 ? 239.865 177.113 215.963 1.00 171.71 ? 243 TYR C CG   1 
ATOM 10617 C CD1  . TYR D 2 222 ? 240.768 177.391 214.947 1.00 171.71 ? 243 TYR C CD1  1 
ATOM 10618 C CD2  . TYR D 2 222 ? 240.123 176.085 216.857 1.00 171.71 ? 243 TYR C CD2  1 
ATOM 10619 C CE1  . TYR D 2 222 ? 241.923 176.644 214.826 1.00 171.71 ? 243 TYR C CE1  1 
ATOM 10620 C CE2  . TYR D 2 222 ? 241.278 175.337 216.736 1.00 171.71 ? 243 TYR C CE2  1 
ATOM 10621 C CZ   . TYR D 2 222 ? 242.176 175.614 215.725 1.00 171.71 ? 243 TYR C CZ   1 
ATOM 10622 O OH   . TYR D 2 222 ? 243.327 174.869 215.604 1.00 171.71 ? 243 TYR C OH   1 
ATOM 10623 H H    . TYR D 2 222 ? 236.007 178.361 216.023 1.00 206.05 ? 243 TYR C H    1 
ATOM 10624 H HA   . TYR D 2 222 ? 237.940 177.770 214.193 1.00 206.05 ? 243 TYR C HA   1 
ATOM 10625 H HB2  . TYR D 2 222 ? 238.867 178.987 216.013 1.00 206.05 ? 243 TYR C HB2  1 
ATOM 10626 H HB3  . TYR D 2 222 ? 238.197 177.774 217.095 1.00 206.05 ? 243 TYR C HB3  1 
ATOM 10627 H HD1  . TYR D 2 222 ? 240.566 178.200 214.244 1.00 206.05 ? 243 TYR C HD1  1 
ATOM 10628 H HD2  . TYR D 2 222 ? 239.413 175.866 217.655 1.00 206.05 ? 243 TYR C HD2  1 
ATOM 10629 H HE1  . TYR D 2 222 ? 242.633 176.862 214.028 1.00 206.05 ? 243 TYR C HE1  1 
ATOM 10630 H HE2  . TYR D 2 222 ? 241.480 174.528 217.438 1.00 206.05 ? 243 TYR C HE2  1 
ATOM 10631 H HH   . TYR D 2 222 ? 243.842 175.196 214.863 1.00 206.05 ? 243 TYR C HH   1 
ATOM 10632 N N    . GLU D 2 223 ? 236.543 175.674 216.187 1.00 183.40 ? 244 GLU C N    1 
ATOM 10633 C CA   . GLU D 2 223 ? 236.240 174.266 216.371 1.00 183.40 ? 244 GLU C CA   1 
ATOM 10634 C C    . GLU D 2 223 ? 235.039 173.859 215.528 1.00 183.40 ? 244 GLU C C    1 
ATOM 10635 O O    . GLU D 2 223 ? 234.201 174.685 215.152 1.00 183.40 ? 244 GLU C O    1 
ATOM 10636 C CB   . GLU D 2 223 ? 235.973 173.963 217.846 1.00 183.40 ? 244 GLU C CB   1 
ATOM 10637 C CG   . GLU D 2 223 ? 237.169 174.226 218.751 1.00 183.40 ? 244 GLU C CG   1 
ATOM 10638 C CD   . GLU D 2 223 ? 236.832 174.091 220.223 1.00 183.40 ? 244 GLU C CD   1 
ATOM 10639 O OE1  . GLU D 2 223 ? 235.629 174.057 220.559 1.00 183.40 ? 244 GLU C OE1  1 
ATOM 10640 O OE2  . GLU D 2 223 ? 237.770 174.020 221.043 1.00 183.40 ? 244 GLU C OE2  1 
ATOM 10641 H H    . GLU D 2 223 ? 236.265 176.177 216.821 1.00 220.08 ? 244 GLU C H    1 
ATOM 10642 H HA   . GLU D 2 223 ? 237.001 173.737 216.087 1.00 220.08 ? 244 GLU C HA   1 
ATOM 10643 H HB2  . GLU D 2 223 ? 235.237 174.513 218.156 1.00 220.08 ? 244 GLU C HB2  1 
ATOM 10644 H HB3  . GLU D 2 223 ? 235.739 173.025 217.934 1.00 220.08 ? 244 GLU C HB3  1 
ATOM 10645 H HG2  . GLU D 2 223 ? 237.869 173.587 218.543 1.00 220.08 ? 244 GLU C HG2  1 
ATOM 10646 H HG3  . GLU D 2 223 ? 237.489 175.129 218.598 1.00 220.08 ? 244 GLU C HG3  1 
ATOM 10647 N N    . ASP D 2 224 ? 234.966 172.566 215.236 1.00 176.97 ? 245 ASP C N    1 
ATOM 10648 C CA   . ASP D 2 224 ? 233.887 172.004 214.436 1.00 176.97 ? 245 ASP C CA   1 
ATOM 10649 C C    . ASP D 2 224 ? 233.851 170.508 214.718 1.00 176.97 ? 245 ASP C C    1 
ATOM 10650 O O    . ASP D 2 224 ? 234.665 169.982 215.479 1.00 176.97 ? 245 ASP C O    1 
ATOM 10651 C CB   . ASP D 2 224 ? 234.095 172.270 212.943 1.00 176.97 ? 245 ASP C CB   1 
ATOM 10652 C CG   . ASP D 2 224 ? 232.790 172.300 212.160 1.00 176.97 ? 245 ASP C CG   1 
ATOM 10653 O OD1  . ASP D 2 224 ? 231.903 171.550 212.492 1.00 176.97 ? 245 ASP C OD1  1 
ATOM 10654 O OD2  . ASP D 2 224 ? 232.693 173.073 211.236 1.00 176.97 ? 245 ASP C OD2  1 
ATOM 10655 H H    . ASP D 2 224 ? 235.541 171.983 215.497 1.00 212.36 ? 245 ASP C H    1 
ATOM 10656 H HA   . ASP D 2 224 ? 233.044 172.392 214.716 1.00 212.36 ? 245 ASP C HA   1 
ATOM 10657 H HB2  . ASP D 2 224 ? 234.603 173.226 212.812 1.00 212.36 ? 245 ASP C HB2  1 
ATOM 10658 H HB3  . ASP D 2 224 ? 234.738 171.497 212.522 1.00 212.36 ? 245 ASP C HB3  1 
ATOM 10659 N N    . LYS D 2 225 ? 232.882 169.824 214.111 1.00 165.86 ? 246 LYS C N    1 
ATOM 10660 C CA   . LYS D 2 225 ? 232.773 168.382 214.309 1.00 165.86 ? 246 LYS C CA   1 
ATOM 10661 C C    . LYS D 2 225 ? 233.990 167.649 213.754 1.00 165.86 ? 246 LYS C C    1 
ATOM 10662 O O    . LYS D 2 225 ? 234.427 166.644 214.326 1.00 165.86 ? 246 LYS C O    1 
ATOM 10663 C CB   . LYS D 2 225 ? 231.496 167.849 213.657 1.00 165.86 ? 246 LYS C CB   1 
ATOM 10664 C CG   . LYS D 2 225 ? 230.210 168.264 214.359 1.00 165.86 ? 246 LYS C CG   1 
ATOM 10665 C CD   . LYS D 2 225 ? 228.987 167.712 213.642 1.00 165.86 ? 246 LYS C CD   1 
ATOM 10666 C CE   . LYS D 2 225 ? 227.700 168.129 214.340 1.00 165.86 ? 246 LYS C CE   1 
ATOM 10667 N NZ   . LYS D 2 225 ? 226.493 167.629 213.628 1.00 165.86 ? 246 LYS C NZ   1 
ATOM 10668 H H    . LYS D 2 225 ? 232.284 170.163 213.596 1.00 199.03 ? 246 LYS C H    1 
ATOM 10669 H HA   . LYS D 2 225 ? 232.720 168.199 215.261 1.00 199.03 ? 246 LYS C HA   1 
ATOM 10670 H HB2  . LYS D 2 225 ? 231.442 168.198 212.625 1.00 199.03 ? 246 LYS C HB2  1 
ATOM 10671 H HB3  . LYS D 2 225 ? 231.528 166.759 213.632 1.00 199.03 ? 246 LYS C HB3  1 
ATOM 10672 H HG2  . LYS D 2 225 ? 230.219 167.892 215.384 1.00 199.03 ? 246 LYS C HG2  1 
ATOM 10673 H HG3  . LYS D 2 225 ? 230.145 169.351 214.386 1.00 199.03 ? 246 LYS C HG3  1 
ATOM 10674 H HD2  . LYS D 2 225 ? 228.969 168.080 212.616 1.00 199.03 ? 246 LYS C HD2  1 
ATOM 10675 H HD3  . LYS D 2 225 ? 229.039 166.624 213.618 1.00 199.03 ? 246 LYS C HD3  1 
ATOM 10676 H HE2  . LYS D 2 225 ? 227.695 167.737 215.357 1.00 199.03 ? 246 LYS C HE2  1 
ATOM 10677 H HE3  . LYS D 2 225 ? 227.651 169.216 214.393 1.00 199.03 ? 246 LYS C HE3  1 
ATOM 10678 H HZ1  . LYS D 2 225 ? 225.663 167.926 214.121 1.00 199.03 ? 246 LYS C HZ1  1 
ATOM 10679 H HZ2  . LYS D 2 225 ? 226.478 168.001 212.689 1.00 199.03 ? 246 LYS C HZ2  1 
ATOM 10680 H HZ3  . LYS D 2 225 ? 226.518 166.620 213.590 1.00 199.03 ? 246 LYS C HZ3  1 
ATOM 10681 N N    . GLU D 2 226 ? 234.554 168.142 212.652 1.00 159.69 ? 247 GLU C N    1 
ATOM 10682 C CA   . GLU D 2 226 ? 235.666 167.499 211.965 1.00 159.69 ? 247 GLU C CA   1 
ATOM 10683 C C    . GLU D 2 226 ? 236.833 168.461 211.787 1.00 159.69 ? 247 GLU C C    1 
ATOM 10684 O O    . GLU D 2 226 ? 236.666 169.683 211.841 1.00 159.69 ? 247 GLU C O    1 
ATOM 10685 C CB   . GLU D 2 226 ? 235.216 166.970 210.601 1.00 159.69 ? 247 GLU C CB   1 
ATOM 10686 C CG   . GLU D 2 226 ? 234.764 168.048 209.626 1.00 159.69 ? 247 GLU C CG   1 
ATOM 10687 C CD   . GLU D 2 226 ? 234.357 167.494 208.289 1.00 159.69 ? 247 GLU C CD   1 
ATOM 10688 O OE1  . GLU D 2 226 ? 234.419 166.301 208.118 1.00 159.69 ? 247 GLU C OE1  1 
ATOM 10689 O OE2  . GLU D 2 226 ? 233.983 168.267 207.438 1.00 159.69 ? 247 GLU C OE2  1 
ATOM 10690 H H    . GLU D 2 226 ? 234.298 168.871 212.271 1.00 191.63 ? 247 GLU C H    1 
ATOM 10691 H HA   . GLU D 2 226 ? 235.984 166.742 212.477 1.00 191.63 ? 247 GLU C HA   1 
ATOM 10692 H HB2  . GLU D 2 226 ? 236.035 166.420 210.136 1.00 191.63 ? 247 GLU C HB2  1 
ATOM 10693 H HB3  . GLU D 2 226 ? 234.389 166.273 210.736 1.00 191.63 ? 247 GLU C HB3  1 
ATOM 10694 H HG2  . GLU D 2 226 ? 233.918 168.582 210.058 1.00 191.63 ? 247 GLU C HG2  1 
ATOM 10695 H HG3  . GLU D 2 226 ? 235.576 168.761 209.487 1.00 191.63 ? 247 GLU C HG3  1 
ATOM 10696 N N    . LYS D 2 227 ? 238.020 167.889 211.561 1.00 142.93 ? 248 LYS C N    1 
ATOM 10697 C CA   . LYS D 2 227 ? 239.232 168.619 211.192 1.00 142.93 ? 248 LYS C CA   1 
ATOM 10698 C C    . LYS D 2 227 ? 239.608 168.219 209.769 1.00 142.93 ? 248 LYS C C    1 
ATOM 10699 O O    . LYS D 2 227 ? 240.308 167.213 209.573 1.00 142.93 ? 248 LYS C O    1 
ATOM 10700 C CB   . LYS D 2 227 ? 240.378 168.327 212.162 1.00 142.93 ? 248 LYS C CB   1 
ATOM 10701 C CG   . LYS D 2 227 ? 240.158 168.856 213.573 1.00 142.93 ? 248 LYS C CG   1 
ATOM 10702 C CD   . LYS D 2 227 ? 241.286 168.435 214.503 1.00 142.93 ? 248 LYS C CD   1 
ATOM 10703 C CE   . LYS D 2 227 ? 242.588 169.140 214.151 1.00 142.93 ? 248 LYS C CE   1 
ATOM 10704 N NZ   . LYS D 2 227 ? 243.663 168.850 215.138 1.00 142.93 ? 248 LYS C NZ   1 
ATOM 10705 H H    . LYS D 2 227 ? 238.147 167.042 211.617 1.00 171.52 ? 248 LYS C H    1 
ATOM 10706 H HA   . LYS D 2 227 ? 239.071 169.575 211.217 1.00 171.52 ? 248 LYS C HA   1 
ATOM 10707 H HB2  . LYS D 2 227 ? 240.532 167.249 212.229 1.00 171.52 ? 248 LYS C HB2  1 
ATOM 10708 H HB3  . LYS D 2 227 ? 241.299 168.766 211.779 1.00 171.52 ? 248 LYS C HB3  1 
ATOM 10709 H HG2  . LYS D 2 227 ? 240.106 169.946 213.549 1.00 171.52 ? 248 LYS C HG2  1 
ATOM 10710 H HG3  . LYS D 2 227 ? 239.215 168.474 213.962 1.00 171.52 ? 248 LYS C HG3  1 
ATOM 10711 H HD2  . LYS D 2 227 ? 241.019 168.677 215.533 1.00 171.52 ? 248 LYS C HD2  1 
ATOM 10712 H HD3  . LYS D 2 227 ? 241.436 167.358 214.429 1.00 171.52 ? 248 LYS C HD3  1 
ATOM 10713 H HE2  . LYS D 2 227 ? 242.920 168.817 213.165 1.00 171.52 ? 248 LYS C HE2  1 
ATOM 10714 H HE3  . LYS D 2 227 ? 242.422 170.216 214.119 1.00 171.52 ? 248 LYS C HE3  1 
ATOM 10715 H HZ1  . LYS D 2 227 ? 244.507 169.335 214.870 1.00 171.52 ? 248 LYS C HZ1  1 
ATOM 10716 H HZ2  . LYS D 2 227 ? 243.372 169.162 216.054 1.00 171.52 ? 248 LYS C HZ2  1 
ATOM 10717 H HZ3  . LYS D 2 227 ? 243.839 167.856 215.163 1.00 171.52 ? 248 LYS C HZ3  1 
ATOM 10718 N N    . PRO D 2 228 ? 239.172 168.945 208.737 1.00 131.28 ? 249 PRO C N    1 
ATOM 10719 C CA   . PRO D 2 228 ? 239.526 168.542 207.369 1.00 131.28 ? 249 PRO C CA   1 
ATOM 10720 C C    . PRO D 2 228 ? 241.034 168.539 207.154 1.00 131.28 ? 249 PRO C C    1 
ATOM 10721 O O    . PRO D 2 228 ? 241.812 169.094 207.933 1.00 131.28 ? 249 PRO C O    1 
ATOM 10722 C CB   . PRO D 2 228 ? 238.841 169.606 206.506 1.00 131.28 ? 249 PRO C CB   1 
ATOM 10723 C CG   . PRO D 2 228 ? 237.726 170.106 207.359 1.00 131.28 ? 249 PRO C CG   1 
ATOM 10724 C CD   . PRO D 2 228 ? 238.292 170.107 208.754 1.00 131.28 ? 249 PRO C CD   1 
ATOM 10725 H HA   . PRO D 2 228 ? 239.170 167.661 207.174 1.00 157.54 ? 249 PRO C HA   1 
ATOM 10726 H HB2  . PRO D 2 228 ? 239.561 170.394 206.239 1.00 157.54 ? 249 PRO C HB2  1 
ATOM 10727 H HB3  . PRO D 2 228 ? 238.491 169.159 205.564 1.00 157.54 ? 249 PRO C HB3  1 
ATOM 10728 H HG2  . PRO D 2 228 ? 237.414 171.107 207.028 1.00 157.54 ? 249 PRO C HG2  1 
ATOM 10729 H HG3  . PRO D 2 228 ? 236.848 169.450 207.259 1.00 157.54 ? 249 PRO C HG3  1 
ATOM 10730 H HD2  . PRO D 2 228 ? 238.845 171.042 208.925 1.00 157.54 ? 249 PRO C HD2  1 
ATOM 10731 H HD3  . PRO D 2 228 ? 237.475 169.999 209.482 1.00 157.54 ? 249 PRO C HD3  1 
ATOM 10732 N N    . ASN D 2 229 ? 241.447 167.894 206.066 1.00 133.93 ? 250 ASN C N    1 
ATOM 10733 C CA   . ASN D 2 229 ? 242.854 167.876 205.678 1.00 133.93 ? 250 ASN C CA   1 
ATOM 10734 C C    . ASN D 2 229 ? 243.334 169.278 205.318 1.00 133.93 ? 250 ASN C C    1 
ATOM 10735 O O    . ASN D 2 229 ? 242.774 169.922 204.428 1.00 133.93 ? 250 ASN C O    1 
ATOM 10736 C CB   . ASN D 2 229 ? 243.080 166.918 204.522 1.00 133.93 ? 250 ASN C CB   1 
ATOM 10737 C CG   . ASN D 2 229 ? 244.539 166.673 204.252 1.00 133.93 ? 250 ASN C CG   1 
ATOM 10738 O OD1  . ASN D 2 229 ? 245.319 167.617 204.083 1.00 133.93 ? 250 ASN C OD1  1 
ATOM 10739 N ND2  . ASN D 2 229 ? 244.921 165.422 204.207 1.00 133.93 ? 250 ASN C ND2  1 
ATOM 10740 H H    . ASN D 2 229 ? 240.932 167.458 205.534 1.00 160.72 ? 250 ASN C H    1 
ATOM 10741 H HA   . ASN D 2 229 ? 243.385 167.548 206.418 1.00 160.72 ? 250 ASN C HA   1 
ATOM 10742 H HB2  . ASN D 2 229 ? 242.597 165.965 204.739 1.00 160.72 ? 250 ASN C HB2  1 
ATOM 10743 H HB3  . ASN D 2 229 ? 242.618 167.321 203.620 1.00 160.72 ? 250 ASN C HB3  1 
ATOM 10744 H HD21 . ASN D 2 229 ? 245.881 165.199 204.031 1.00 160.72 ? 250 ASN C HD21 1 
ATOM 10745 H HD22 . ASN D 2 229 ? 244.256 164.690 204.349 1.00 160.72 ? 250 ASN C HD22 1 
ATOM 10746 N N    . CYS D 2 230 ? 244.395 169.733 205.999 1.00 148.88 ? 251 CYS C N    1 
ATOM 10747 C CA   . CYS D 2 230 ? 244.906 171.087 205.787 1.00 148.88 ? 251 CYS C CA   1 
ATOM 10748 C C    . CYS D 2 230 ? 245.210 171.348 204.316 1.00 148.88 ? 251 CYS C C    1 
ATOM 10749 O O    . CYS D 2 230 ? 245.007 172.463 203.823 1.00 148.88 ? 251 CYS C O    1 
ATOM 10750 C CB   . CYS D 2 230 ? 246.168 171.322 206.619 1.00 148.88 ? 251 CYS C CB   1 
ATOM 10751 S SG   . CYS D 2 230 ? 245.976 171.168 208.408 1.00 148.88 ? 251 CYS C SG   1 
ATOM 10752 H H    . CYS D 2 230 ? 244.830 169.281 206.587 1.00 178.66 ? 251 CYS C H    1 
ATOM 10753 H HA   . CYS D 2 230 ? 244.236 171.727 206.072 1.00 178.66 ? 251 CYS C HA   1 
ATOM 10754 H HB2  . CYS D 2 230 ? 246.839 170.686 206.344 1.00 178.66 ? 251 CYS C HB2  1 
ATOM 10755 H HB3  . CYS D 2 230 ? 246.486 172.220 206.441 1.00 178.66 ? 251 CYS C HB3  1 
ATOM 10756 N N    . LEU D 2 231 ? 245.712 170.339 203.601 1.00 158.02 ? 252 LEU C N    1 
ATOM 10757 C CA   . LEU D 2 231 ? 246.092 170.548 202.208 1.00 158.02 ? 252 LEU C CA   1 
ATOM 10758 C C    . LEU D 2 231 ? 244.858 170.737 201.332 1.00 158.02 ? 252 LEU C C    1 
ATOM 10759 O O    . LEU D 2 231 ? 244.826 171.624 200.470 1.00 158.02 ? 252 LEU C O    1 
ATOM 10760 C CB   . LEU D 2 231 ? 246.916 169.359 201.696 1.00 158.02 ? 252 LEU C CB   1 
ATOM 10761 C CG   . LEU D 2 231 ? 247.429 169.476 200.255 1.00 158.02 ? 252 LEU C CG   1 
ATOM 10762 C CD1  . LEU D 2 231 ? 248.324 170.702 200.132 1.00 158.02 ? 252 LEU C CD1  1 
ATOM 10763 C CD2  . LEU D 2 231 ? 248.183 168.209 199.880 1.00 158.02 ? 252 LEU C CD2  1 
ATOM 10764 H H    . LEU D 2 231 ? 245.839 169.540 203.894 1.00 189.62 ? 252 LEU C H    1 
ATOM 10765 H HA   . LEU D 2 231 ? 246.625 171.356 202.152 1.00 189.62 ? 252 LEU C HA   1 
ATOM 10766 H HB2  . LEU D 2 231 ? 247.780 169.230 202.346 1.00 189.62 ? 252 LEU C HB2  1 
ATOM 10767 H HB3  . LEU D 2 231 ? 246.303 168.460 201.758 1.00 189.62 ? 252 LEU C HB3  1 
ATOM 10768 H HG   . LEU D 2 231 ? 246.585 169.610 199.578 1.00 189.62 ? 252 LEU C HG   1 
ATOM 10769 H HD11 . LEU D 2 231 ? 248.688 170.785 199.108 1.00 189.62 ? 252 LEU C HD11 1 
ATOM 10770 H HD12 . LEU D 2 231 ? 247.754 171.595 200.387 1.00 189.62 ? 252 LEU C HD12 1 
ATOM 10771 H HD13 . LEU D 2 231 ? 249.170 170.604 200.811 1.00 189.62 ? 252 LEU C HD13 1 
ATOM 10772 H HD21 . LEU D 2 231 ? 248.547 168.291 198.856 1.00 189.62 ? 252 LEU C HD21 1 
ATOM 10773 H HD22 . LEU D 2 231 ? 249.027 168.074 200.556 1.00 189.62 ? 252 LEU C HD22 1 
ATOM 10774 H HD23 . LEU D 2 231 ? 247.514 167.351 199.960 1.00 189.62 ? 252 LEU C HD23 1 
ATOM 10775 N N    . ASP D 2 232 ? 243.823 169.923 201.547 1.00 151.16 ? 253 ASP C N    1 
ATOM 10776 C CA   . ASP D 2 232 ? 242.582 170.112 200.804 1.00 151.16 ? 253 ASP C CA   1 
ATOM 10777 C C    . ASP D 2 232 ? 241.997 171.494 201.064 1.00 151.16 ? 253 ASP C C    1 
ATOM 10778 O O    . ASP D 2 232 ? 241.455 172.130 200.150 1.00 151.16 ? 253 ASP C O    1 
ATOM 10779 C CB   . ASP D 2 232 ? 241.559 169.038 201.181 1.00 151.16 ? 253 ASP C CB   1 
ATOM 10780 C CG   . ASP D 2 232 ? 241.918 167.661 200.640 1.00 151.16 ? 253 ASP C CG   1 
ATOM 10781 O OD1  . ASP D 2 232 ? 242.759 167.585 199.776 1.00 151.16 ? 253 ASP C OD1  1 
ATOM 10782 O OD2  . ASP D 2 232 ? 241.349 166.699 201.097 1.00 151.16 ? 253 ASP C OD2  1 
ATOM 10783 H H    . ASP D 2 232 ? 243.815 169.270 202.105 1.00 181.39 ? 253 ASP C H    1 
ATOM 10784 H HA   . ASP D 2 232 ? 242.771 170.048 199.854 1.00 181.39 ? 253 ASP C HA   1 
ATOM 10785 H HB2  . ASP D 2 232 ? 241.479 168.977 202.267 1.00 181.39 ? 253 ASP C HB2  1 
ATOM 10786 H HB3  . ASP D 2 232 ? 240.578 169.319 200.796 1.00 181.39 ? 253 ASP C HB3  1 
ATOM 10787 N N    . LEU D 2 233 ? 242.099 171.982 202.304 1.00 153.91 ? 254 LEU C N    1 
ATOM 10788 C CA   . LEU D 2 233 ? 241.602 173.320 202.606 1.00 153.91 ? 254 LEU C CA   1 
ATOM 10789 C C    . LEU D 2 233 ? 242.379 174.375 201.827 1.00 153.91 ? 254 LEU C C    1 
ATOM 10790 O O    . LEU D 2 233 ? 241.796 175.345 201.333 1.00 153.91 ? 254 LEU C O    1 
ATOM 10791 C CB   . LEU D 2 233 ? 241.708 173.601 204.110 1.00 153.91 ? 254 LEU C CB   1 
ATOM 10792 C CG   . LEU D 2 233 ? 240.771 172.782 205.007 1.00 153.91 ? 254 LEU C CG   1 
ATOM 10793 C CD1  . LEU D 2 233 ? 241.114 173.038 206.469 1.00 153.91 ? 254 LEU C CD1  1 
ATOM 10794 C CD2  . LEU D 2 233 ? 239.327 173.158 204.711 1.00 153.91 ? 254 LEU C CD2  1 
ATOM 10795 H H    . LEU D 2 233 ? 242.446 171.566 202.972 1.00 184.69 ? 254 LEU C H    1 
ATOM 10796 H HA   . LEU D 2 233 ? 240.671 173.379 202.341 1.00 184.69 ? 254 LEU C HA   1 
ATOM 10797 H HB2  . LEU D 2 233 ? 242.730 173.402 204.430 1.00 184.69 ? 254 LEU C HB2  1 
ATOM 10798 H HB3  . LEU D 2 233 ? 241.494 174.655 204.283 1.00 184.69 ? 254 LEU C HB3  1 
ATOM 10799 H HG   . LEU D 2 233 ? 240.917 171.719 204.812 1.00 184.69 ? 254 LEU C HG   1 
ATOM 10800 H HD11 . LEU D 2 233 ? 240.449 172.455 207.106 1.00 184.69 ? 254 LEU C HD11 1 
ATOM 10801 H HD12 . LEU D 2 233 ? 242.147 172.742 206.657 1.00 184.69 ? 254 LEU C HD12 1 
ATOM 10802 H HD13 . LEU D 2 233 ? 240.994 174.097 206.690 1.00 184.69 ? 254 LEU C HD13 1 
ATOM 10803 H HD21 . LEU D 2 233 ? 238.661 172.575 205.348 1.00 184.69 ? 254 LEU C HD21 1 
ATOM 10804 H HD22 . LEU D 2 233 ? 239.180 174.220 204.908 1.00 184.69 ? 254 LEU C HD22 1 
ATOM 10805 H HD23 . LEU D 2 233 ? 239.104 172.948 203.665 1.00 184.69 ? 254 LEU C HD23 1 
ATOM 10806 N N    . ARG D 2 234 ? 243.697 174.199 201.703 1.00 160.57 ? 255 ARG C N    1 
ATOM 10807 C CA   . ARG D 2 234 ? 244.493 175.083 200.856 1.00 160.57 ? 255 ARG C CA   1 
ATOM 10808 C C    . ARG D 2 234 ? 243.977 175.075 199.423 1.00 160.57 ? 255 ARG C C    1 
ATOM 10809 O O    . ARG D 2 234 ? 243.873 176.129 198.784 1.00 160.57 ? 255 ARG C O    1 
ATOM 10810 C CB   . ARG D 2 234 ? 245.956 174.667 200.868 1.00 160.57 ? 255 ARG C CB   1 
ATOM 10811 C CG   . ARG D 2 234 ? 246.882 175.558 200.055 1.00 160.57 ? 255 ARG C CG   1 
ATOM 10812 C CD   . ARG D 2 234 ? 248.296 175.115 200.152 1.00 160.57 ? 255 ARG C CD   1 
ATOM 10813 N NE   . ARG D 2 234 ? 249.182 175.947 199.353 1.00 160.57 ? 255 ARG C NE   1 
ATOM 10814 C CZ   . ARG D 2 234 ? 249.721 177.109 199.769 1.00 160.57 ? 255 ARG C CZ   1 
ATOM 10815 N NH1  . ARG D 2 234 ? 249.458 177.562 200.974 1.00 160.57 ? 255 ARG C NH1  1 
ATOM 10816 N NH2  . ARG D 2 234 ? 250.516 177.793 198.965 1.00 160.57 ? 255 ARG C NH2  1 
ATOM 10817 H H    . ARG D 2 234 ? 244.148 173.580 202.093 1.00 192.68 ? 255 ARG C H    1 
ATOM 10818 H HA   . ARG D 2 234 ? 244.429 175.991 201.194 1.00 192.68 ? 255 ARG C HA   1 
ATOM 10819 H HB2  . ARG D 2 234 ? 246.324 174.658 201.893 1.00 192.68 ? 255 ARG C HB2  1 
ATOM 10820 H HB3  . ARG D 2 234 ? 246.049 173.653 200.478 1.00 192.68 ? 255 ARG C HB3  1 
ATOM 10821 H HG2  . ARG D 2 234 ? 246.585 175.530 199.006 1.00 192.68 ? 255 ARG C HG2  1 
ATOM 10822 H HG3  . ARG D 2 234 ? 246.817 176.582 200.424 1.00 192.68 ? 255 ARG C HG3  1 
ATOM 10823 H HD2  . ARG D 2 234 ? 248.624 175.168 201.190 1.00 192.68 ? 255 ARG C HD2  1 
ATOM 10824 H HD3  . ARG D 2 234 ? 248.381 174.088 199.797 1.00 192.68 ? 255 ARG C HD3  1 
ATOM 10825 H HE   . ARG D 2 234 ? 249.408 175.630 198.419 1.00 192.68 ? 255 ARG C HE   1 
ATOM 10826 H HH11 . ARG D 2 234 ? 248.850 177.039 201.589 1.00 192.68 ? 255 ARG C HH11 1 
ATOM 10827 H HH12 . ARG D 2 234 ? 249.862 178.433 201.286 1.00 192.68 ? 255 ARG C HH12 1 
ATOM 10828 H HH21 . ARG D 2 234 ? 250.719 177.445 198.038 1.00 192.68 ? 255 ARG C HH21 1 
ATOM 10829 H HH22 . ARG D 2 234 ? 250.921 178.664 199.276 1.00 192.68 ? 255 ARG C HH22 1 
ATOM 10830 N N    . GLY D 2 235 ? 243.667 173.891 198.897 1.00 148.99 ? 256 GLY C N    1 
ATOM 10831 C CA   . GLY D 2 235 ? 243.077 173.807 197.571 1.00 148.99 ? 256 GLY C CA   1 
ATOM 10832 C C    . GLY D 2 235 ? 241.790 174.602 197.452 1.00 148.99 ? 256 GLY C C    1 
ATOM 10833 O O    . GLY D 2 235 ? 241.535 175.234 196.424 1.00 148.99 ? 256 GLY C O    1 
ATOM 10834 H H    . GLY D 2 235 ? 243.788 173.132 199.284 1.00 178.79 ? 256 GLY C H    1 
ATOM 10835 H HA2  . GLY D 2 235 ? 243.708 174.146 196.917 1.00 178.79 ? 256 GLY C HA2  1 
ATOM 10836 H HA3  . GLY D 2 235 ? 242.886 172.880 197.361 1.00 178.79 ? 256 GLY C HA3  1 
ATOM 10837 N N    . VAL D 2 236 ? 240.964 174.581 198.498 1.00 141.71 ? 257 VAL C N    1 
ATOM 10838 C CA   . VAL D 2 236 ? 239.732 175.369 198.490 1.00 141.71 ? 257 VAL C CA   1 
ATOM 10839 C C    . VAL D 2 236 ? 240.057 176.855 198.619 1.00 141.71 ? 257 VAL C C    1 
ATOM 10840 O O    . VAL D 2 236 ? 239.603 177.679 197.817 1.00 141.71 ? 257 VAL C O    1 
ATOM 10841 C CB   . VAL D 2 236 ? 238.807 174.941 199.644 1.00 141.71 ? 257 VAL C CB   1 
ATOM 10842 C CG1  . VAL D 2 236 ? 237.600 175.863 199.729 1.00 141.71 ? 257 VAL C CG1  1 
ATOM 10843 C CG2  . VAL D 2 236 ? 238.370 173.497 199.448 1.00 141.71 ? 257 VAL C CG2  1 
ATOM 10844 H H    . VAL D 2 236 ? 241.091 174.125 199.217 1.00 170.05 ? 257 VAL C H    1 
ATOM 10845 H HA   . VAL D 2 236 ? 239.283 175.238 197.640 1.00 170.05 ? 257 VAL C HA   1 
ATOM 10846 H HB   . VAL D 2 236 ? 239.349 175.033 200.585 1.00 170.05 ? 257 VAL C HB   1 
ATOM 10847 H HG11 . VAL D 2 236 ? 236.957 175.546 200.551 1.00 170.05 ? 257 VAL C HG11 1 
ATOM 10848 H HG12 . VAL D 2 236 ? 237.935 176.885 199.905 1.00 170.05 ? 257 VAL C HG12 1 
ATOM 10849 H HG13 . VAL D 2 236 ? 237.041 175.819 198.794 1.00 170.05 ? 257 VAL C HG13 1 
ATOM 10850 H HG21 . VAL D 2 236 ? 237.716 173.200 200.268 1.00 170.05 ? 257 VAL C HG21 1 
ATOM 10851 H HG22 . VAL D 2 236 ? 237.833 173.404 198.504 1.00 170.05 ? 257 VAL C HG22 1 
ATOM 10852 H HG23 . VAL D 2 236 ? 239.247 172.850 199.432 1.00 170.05 ? 257 VAL C HG23 1 
ATOM 10853 N N    . CYS D 2 237 ? 240.842 177.216 199.636 1.00 172.10 ? 258 CYS C N    1 
ATOM 10854 C CA   . CYS D 2 237 ? 241.244 178.606 199.833 1.00 172.10 ? 258 CYS C CA   1 
ATOM 10855 C C    . CYS D 2 237 ? 241.956 179.161 198.608 1.00 172.10 ? 258 CYS C C    1 
ATOM 10856 O O    . CYS D 2 237 ? 241.793 180.338 198.265 1.00 172.10 ? 258 CYS C O    1 
ATOM 10857 C CB   . CYS D 2 237 ? 242.144 178.704 201.065 1.00 172.10 ? 258 CYS C CB   1 
ATOM 10858 S SG   . CYS D 2 237 ? 242.743 180.361 201.437 1.00 172.10 ? 258 CYS C SG   1 
ATOM 10859 H H    . CYS D 2 237 ? 241.156 176.673 200.225 1.00 206.52 ? 258 CYS C H    1 
ATOM 10860 H HA   . CYS D 2 237 ? 240.454 179.146 199.995 1.00 206.52 ? 258 CYS C HA   1 
ATOM 10861 H HB2  . CYS D 2 237 ? 241.646 178.389 201.837 1.00 206.52 ? 258 CYS C HB2  1 
ATOM 10862 H HB3  . CYS D 2 237 ? 242.920 178.139 200.927 1.00 206.52 ? 258 CYS C HB3  1 
ATOM 10863 N N    . ARG D 2 238 ? 242.759 178.330 197.943 1.00 175.59 ? 259 ARG C N    1 
ATOM 10864 C CA   . ARG D 2 238 ? 243.517 178.788 196.783 1.00 175.59 ? 259 ARG C CA   1 
ATOM 10865 C C    . ARG D 2 238 ? 242.607 179.385 195.716 1.00 175.59 ? 259 ARG C C    1 
ATOM 10866 O O    . ARG D 2 238 ? 243.049 180.221 194.920 1.00 175.59 ? 259 ARG C O    1 
ATOM 10867 C CB   . ARG D 2 238 ? 244.311 177.640 196.178 1.00 175.59 ? 259 ARG C CB   1 
ATOM 10868 C CG   . ARG D 2 238 ? 245.241 178.035 195.041 1.00 175.59 ? 259 ARG C CG   1 
ATOM 10869 C CD   . ARG D 2 238 ? 246.088 176.896 194.603 1.00 175.59 ? 259 ARG C CD   1 
ATOM 10870 N NE   . ARG D 2 238 ? 246.951 177.258 193.490 1.00 175.59 ? 259 ARG C NE   1 
ATOM 10871 C CZ   . ARG D 2 238 ? 247.815 176.418 192.888 1.00 175.59 ? 259 ARG C CZ   1 
ATOM 10872 N NH1  . ARG D 2 238 ? 247.920 175.175 193.302 1.00 175.59 ? 259 ARG C NH1  1 
ATOM 10873 N NH2  . ARG D 2 238 ? 248.558 176.845 191.881 1.00 175.59 ? 259 ARG C NH2  1 
ATOM 10874 H H    . ARG D 2 238 ? 242.885 177.502 198.142 1.00 210.71 ? 259 ARG C H    1 
ATOM 10875 H HA   . ARG D 2 238 ? 244.140 179.476 197.064 1.00 210.71 ? 259 ARG C HA   1 
ATOM 10876 H HB2  . ARG D 2 238 ? 244.917 177.170 196.951 1.00 210.71 ? 259 ARG C HB2  1 
ATOM 10877 H HB3  . ARG D 2 238 ? 243.625 176.885 195.795 1.00 210.71 ? 259 ARG C HB3  1 
ATOM 10878 H HG2  . ARG D 2 238 ? 244.651 178.371 194.188 1.00 210.71 ? 259 ARG C HG2  1 
ATOM 10879 H HG3  . ARG D 2 238 ? 245.896 178.843 195.370 1.00 210.71 ? 259 ARG C HG3  1 
ATOM 10880 H HD2  . ARG D 2 238 ? 246.717 176.571 195.431 1.00 210.71 ? 259 ARG C HD2  1 
ATOM 10881 H HD3  . ARG D 2 238 ? 245.451 176.071 194.286 1.00 210.71 ? 259 ARG C HD3  1 
ATOM 10882 H HE   . ARG D 2 238 ? 246.898 178.207 193.144 1.00 210.71 ? 259 ARG C HE   1 
ATOM 10883 H HH11 . ARG D 2 238 ? 247.352 174.849 194.071 1.00 210.71 ? 259 ARG C HH11 1 
ATOM 10884 H HH12 . ARG D 2 238 ? 248.568 174.546 192.850 1.00 210.71 ? 259 ARG C HH12 1 
ATOM 10885 H HH21 . ARG D 2 238 ? 248.477 177.801 191.563 1.00 210.71 ? 259 ARG C HH21 1 
ATOM 10886 H HH22 . ARG D 2 238 ? 249.205 176.216 191.430 1.00 210.71 ? 259 ARG C HH22 1 
ATOM 10887 N N    . THR D 2 239 ? 241.339 178.972 195.681 1.00 166.89 ? 260 THR C N    1 
ATOM 10888 C CA   . THR D 2 239 ? 240.422 179.444 194.652 1.00 166.89 ? 260 THR C CA   1 
ATOM 10889 C C    . THR D 2 239 ? 239.859 180.826 194.954 1.00 166.89 ? 260 THR C C    1 
ATOM 10890 O O    . THR D 2 239 ? 239.383 181.498 194.033 1.00 166.89 ? 260 THR C O    1 
ATOM 10891 C CB   . THR D 2 239 ? 239.260 178.452 194.464 1.00 166.89 ? 260 THR C CB   1 
ATOM 10892 O OG1  . THR D 2 239 ? 238.457 178.422 195.651 1.00 166.89 ? 260 THR C OG1  1 
ATOM 10893 C CG2  . THR D 2 239 ? 239.791 177.055 194.180 1.00 166.89 ? 260 THR C CG2  1 
ATOM 10894 H H    . THR D 2 239 ? 240.988 178.423 196.242 1.00 200.27 ? 260 THR C H    1 
ATOM 10895 H HA   . THR D 2 239 ? 240.901 179.497 193.809 1.00 200.27 ? 260 THR C HA   1 
ATOM 10896 H HB   . THR D 2 239 ? 238.637 178.774 193.629 1.00 200.27 ? 260 THR C HB   1 
ATOM 10897 H HG1  . THR D 2 239 ? 238.994 178.133 196.393 1.00 200.27 ? 260 THR C HG1  1 
ATOM 10898 H HG21 . THR D 2 239 ? 238.955 176.368 194.050 1.00 200.27 ? 260 THR C HG21 1 
ATOM 10899 H HG22 . THR D 2 239 ? 240.392 177.072 193.272 1.00 200.27 ? 260 THR C HG22 1 
ATOM 10900 H HG23 . THR D 2 239 ? 240.406 176.723 195.016 1.00 200.27 ? 260 THR C HG23 1 
ATOM 10901 N N    . ASP D 2 240 ? 239.902 181.264 196.211 1.00 202.91 ? 261 ASP C N    1 
ATOM 10902 C CA   . ASP D 2 240 ? 239.381 182.565 196.612 1.00 202.91 ? 261 ASP C CA   1 
ATOM 10903 C C    . ASP D 2 240 ? 240.526 183.569 196.608 1.00 202.91 ? 261 ASP C C    1 
ATOM 10904 O O    . ASP D 2 240 ? 241.570 183.329 197.224 1.00 202.91 ? 261 ASP C O    1 
ATOM 10905 C CB   . ASP D 2 240 ? 238.734 182.500 197.998 1.00 202.91 ? 261 ASP C CB   1 
ATOM 10906 C CG   . ASP D 2 240 ? 238.081 183.813 198.409 1.00 202.91 ? 261 ASP C CG   1 
ATOM 10907 O OD1  . ASP D 2 240 ? 236.969 184.055 198.002 1.00 202.91 ? 261 ASP C OD1  1 
ATOM 10908 O OD2  . ASP D 2 240 ? 238.700 184.562 199.126 1.00 202.91 ? 261 ASP C OD2  1 
ATOM 10909 H H    . ASP D 2 240 ? 240.236 180.814 196.863 1.00 243.49 ? 261 ASP C H    1 
ATOM 10910 H HA   . ASP D 2 240 ? 238.711 182.859 195.975 1.00 243.49 ? 261 ASP C HA   1 
ATOM 10911 H HB2  . ASP D 2 240 ? 237.977 181.716 198.009 1.00 243.49 ? 261 ASP C HB2  1 
ATOM 10912 H HB3  . ASP D 2 240 ? 239.488 182.238 198.740 1.00 243.49 ? 261 ASP C HB3  1 
ATOM 10913 N N    . HIS D 2 241 ? 240.328 184.693 195.915 1.00 217.66 ? 262 HIS C N    1 
ATOM 10914 C CA   . HIS D 2 241 ? 241.400 185.671 195.767 1.00 217.66 ? 262 HIS C CA   1 
ATOM 10915 C C    . HIS D 2 241 ? 241.830 186.245 197.112 1.00 217.66 ? 262 HIS C C    1 
ATOM 10916 O O    . HIS D 2 241 ? 243.028 186.381 197.380 1.00 217.66 ? 262 HIS C O    1 
ATOM 10917 C CB   . HIS D 2 241 ? 240.964 186.810 194.839 1.00 217.66 ? 262 HIS C CB   1 
ATOM 10918 C CG   . HIS D 2 241 ? 240.857 186.408 193.401 1.00 217.66 ? 262 HIS C CG   1 
ATOM 10919 N ND1  . HIS D 2 241 ? 241.960 186.105 192.630 1.00 217.66 ? 262 HIS C ND1  1 
ATOM 10920 C CD2  . HIS D 2 241 ? 239.781 186.259 192.594 1.00 217.66 ? 262 HIS C CD2  1 
ATOM 10921 C CE1  . HIS D 2 241 ? 241.564 185.786 191.409 1.00 217.66 ? 262 HIS C CE1  1 
ATOM 10922 N NE2  . HIS D 2 241 ? 240.248 185.872 191.362 1.00 217.66 ? 262 HIS C NE2  1 
ATOM 10923 H H    . HIS D 2 241 ? 239.592 184.907 195.525 1.00 261.19 ? 262 HIS C H    1 
ATOM 10924 H HA   . HIS D 2 241 ? 242.170 185.234 195.371 1.00 261.19 ? 262 HIS C HA   1 
ATOM 10925 H HB2  . HIS D 2 241 ? 239.994 187.190 195.160 1.00 261.19 ? 262 HIS C HB2  1 
ATOM 10926 H HB3  . HIS D 2 241 ? 241.677 187.631 194.911 1.00 261.19 ? 262 HIS C HB3  1 
ATOM 10927 H HD2  . HIS D 2 241 ? 238.738 186.417 192.870 1.00 261.19 ? 262 HIS C HD2  1 
ATOM 10928 H HE1  . HIS D 2 241 ? 242.215 185.500 190.583 1.00 261.19 ? 262 HIS C HE1  1 
ATOM 10929 H HE2  . HIS D 2 241 ? 239.672 185.685 190.554 1.00 261.19 ? 262 HIS C HE2  1 
ATOM 10930 N N    . LEU D 2 242 ? 240.868 186.585 197.974 1.00 212.53 ? 263 LEU C N    1 
ATOM 10931 C CA   . LEU D 2 242 ? 241.188 187.196 199.262 1.00 212.53 ? 263 LEU C CA   1 
ATOM 10932 C C    . LEU D 2 242 ? 241.820 186.192 200.222 1.00 212.53 ? 263 LEU C C    1 
ATOM 10933 O O    . LEU D 2 242 ? 242.853 186.479 200.850 1.00 212.53 ? 263 LEU C O    1 
ATOM 10934 C CB   . LEU D 2 242 ? 239.921 187.785 199.895 1.00 212.53 ? 263 LEU C CB   1 
ATOM 10935 C CG   . LEU D 2 242 ? 240.113 188.471 201.254 1.00 212.53 ? 263 LEU C CG   1 
ATOM 10936 C CD1  . LEU D 2 242 ? 241.070 189.645 201.100 1.00 212.53 ? 263 LEU C CD1  1 
ATOM 10937 C CD2  . LEU D 2 242 ? 238.764 188.931 201.786 1.00 212.53 ? 263 LEU C CD2  1 
ATOM 10938 H H    . LEU D 2 242 ? 240.027 186.472 197.835 1.00 255.04 ? 263 LEU C H    1 
ATOM 10939 H HA   . LEU D 2 242 ? 241.823 187.912 199.118 1.00 255.04 ? 263 LEU C HA   1 
ATOM 10940 H HB2  . LEU D 2 242 ? 239.500 188.519 199.210 1.00 255.04 ? 263 LEU C HB2  1 
ATOM 10941 H HB3  . LEU D 2 242 ? 239.194 186.984 200.029 1.00 255.04 ? 263 LEU C HB3  1 
ATOM 10942 H HG   . LEU D 2 242 ? 240.559 187.768 201.957 1.00 255.04 ? 263 LEU C HG   1 
ATOM 10943 H HD11 . LEU D 2 242 ? 241.207 190.133 202.065 1.00 255.04 ? 263 LEU C HD11 1 
ATOM 10944 H HD12 . LEU D 2 242 ? 242.033 189.285 200.737 1.00 255.04 ? 263 LEU C HD12 1 
ATOM 10945 H HD13 . LEU D 2 242 ? 240.657 190.360 200.388 1.00 255.04 ? 263 LEU C HD13 1 
ATOM 10946 H HD21 . LEU D 2 242 ? 238.900 189.418 202.752 1.00 255.04 ? 263 LEU C HD21 1 
ATOM 10947 H HD22 . LEU D 2 242 ? 238.317 189.636 201.084 1.00 255.04 ? 263 LEU C HD22 1 
ATOM 10948 H HD23 . LEU D 2 242 ? 238.106 188.070 201.903 1.00 255.04 ? 263 LEU C HD23 1 
ATOM 10949 N N    . CYS D 2 243 ? 241.200 185.016 200.357 1.00 210.00 ? 264 CYS C N    1 
ATOM 10950 C CA   . CYS D 2 243 ? 241.738 183.977 201.228 1.00 210.00 ? 264 CYS C CA   1 
ATOM 10951 C C    . CYS D 2 243 ? 243.123 183.554 200.766 1.00 210.00 ? 264 CYS C C    1 
ATOM 10952 O O    . CYS D 2 243 ? 244.085 183.566 201.546 1.00 210.00 ? 264 CYS C O    1 
ATOM 10953 C CB   . CYS D 2 243 ? 240.784 182.780 201.258 1.00 210.00 ? 264 CYS C CB   1 
ATOM 10954 S SG   . CYS D 2 243 ? 241.255 181.448 202.396 1.00 210.00 ? 264 CYS C SG   1 
ATOM 10955 H H    . CYS D 2 243 ? 240.470 184.800 199.956 1.00 252.00 ? 264 CYS C H    1 
ATOM 10956 H HA   . CYS D 2 243 ? 241.816 184.323 202.121 1.00 252.00 ? 264 CYS C HA   1 
ATOM 10957 H HB2  . CYS D 2 243 ? 239.904 183.090 201.521 1.00 252.00 ? 264 CYS C HB2  1 
ATOM 10958 H HB3  . CYS D 2 243 ? 240.741 182.399 200.367 1.00 252.00 ? 264 CYS C HB3  1 
ATOM 10959 N N    . ARG D 2 244 ? 243.235 183.172 199.491 1.00 211.08 ? 265 ARG C N    1 
ATOM 10960 C CA   . ARG D 2 244 ? 244.506 182.718 198.941 1.00 211.08 ? 265 ARG C CA   1 
ATOM 10961 C C    . ARG D 2 244 ? 245.596 183.763 199.140 1.00 211.08 ? 265 ARG C C    1 
ATOM 10962 O O    . ARG D 2 244 ? 246.697 183.439 199.590 1.00 211.08 ? 265 ARG C O    1 
ATOM 10963 C CB   . ARG D 2 244 ? 244.367 182.411 197.457 1.00 211.08 ? 265 ARG C CB   1 
ATOM 10964 C CG   . ARG D 2 244 ? 245.629 181.885 196.792 1.00 211.08 ? 265 ARG C CG   1 
ATOM 10965 C CD   . ARG D 2 244 ? 246.403 182.975 196.144 1.00 211.08 ? 265 ARG C CD   1 
ATOM 10966 N NE   . ARG D 2 244 ? 245.619 183.672 195.137 1.00 211.08 ? 265 ARG C NE   1 
ATOM 10967 C CZ   . ARG D 2 244 ? 245.437 183.240 193.874 1.00 211.08 ? 265 ARG C CZ   1 
ATOM 10968 N NH1  . ARG D 2 244 ? 245.989 182.114 193.479 1.00 211.08 ? 265 ARG C NH1  1 
ATOM 10969 N NH2  . ARG D 2 244 ? 244.705 183.948 193.032 1.00 211.08 ? 265 ARG C NH2  1 
ATOM 10970 H H    . ARG D 2 244 ? 242.586 183.168 198.926 1.00 253.30 ? 265 ARG C H    1 
ATOM 10971 H HA   . ARG D 2 244 ? 244.778 181.906 199.395 1.00 253.30 ? 265 ARG C HA   1 
ATOM 10972 H HB2  . ARG D 2 244 ? 243.584 181.668 197.311 1.00 253.30 ? 265 ARG C HB2  1 
ATOM 10973 H HB3  . ARG D 2 244 ? 244.065 183.313 196.925 1.00 253.30 ? 265 ARG C HB3  1 
ATOM 10974 H HG2  . ARG D 2 244 ? 246.265 181.412 197.541 1.00 253.30 ? 265 ARG C HG2  1 
ATOM 10975 H HG3  . ARG D 2 244 ? 245.361 181.154 196.029 1.00 253.30 ? 265 ARG C HG3  1 
ATOM 10976 H HD2  . ARG D 2 244 ? 246.712 183.699 196.897 1.00 253.30 ? 265 ARG C HD2  1 
ATOM 10977 H HD3  . ARG D 2 244 ? 247.285 182.557 195.659 1.00 253.30 ? 265 ARG C HD3  1 
ATOM 10978 H HE   . ARG D 2 244 ? 245.178 184.543 195.404 1.00 253.30 ? 265 ARG C HE   1 
ATOM 10979 H HH11 . ARG D 2 244 ? 246.549 181.573 194.122 1.00 253.30 ? 265 ARG C HH11 1 
ATOM 10980 H HH12 . ARG D 2 244 ? 245.853 181.790 192.532 1.00 253.30 ? 265 ARG C HH12 1 
ATOM 10981 H HH21 . ARG D 2 244 ? 244.280 184.814 193.336 1.00 253.30 ? 265 ARG C HH21 1 
ATOM 10982 H HH22 . ARG D 2 244 ? 244.569 183.624 192.086 1.00 253.30 ? 265 ARG C HH22 1 
ATOM 10983 N N    . SER D 2 245 ? 245.297 185.030 198.845 1.00 222.38 ? 266 SER C N    1 
ATOM 10984 C CA   . SER D 2 245 ? 246.300 186.079 198.986 1.00 222.38 ? 266 SER C CA   1 
ATOM 10985 C C    . SER D 2 245 ? 246.694 186.283 200.445 1.00 222.38 ? 266 SER C C    1 
ATOM 10986 O O    . SER D 2 245 ? 247.884 186.413 200.761 1.00 222.38 ? 266 SER C O    1 
ATOM 10987 C CB   . SER D 2 245 ? 245.774 187.380 198.410 1.00 222.38 ? 266 SER C CB   1 
ATOM 10988 O OG   . SER D 2 245 ? 245.601 187.281 197.023 1.00 222.38 ? 266 SER C OG   1 
ATOM 10989 H H    . SER D 2 245 ? 244.531 185.303 198.564 1.00 266.86 ? 266 SER C H    1 
ATOM 10990 H HA   . SER D 2 245 ? 247.094 185.824 198.493 1.00 266.86 ? 266 SER C HA   1 
ATOM 10991 H HB2  . SER D 2 245 ? 244.824 187.629 198.881 1.00 266.86 ? 266 SER C HB2  1 
ATOM 10992 H HB3  . SER D 2 245 ? 246.472 188.185 198.635 1.00 266.86 ? 266 SER C HB3  1 
ATOM 10993 H HG   . SER D 2 245 ? 244.771 186.816 196.892 1.00 266.86 ? 266 SER C HG   1 
ATOM 10994 N N    . ARG D 2 246 ? 245.716 186.331 201.352 1.00 214.51 ? 267 ARG C N    1 
ATOM 10995 C CA   . ARG D 2 246 ? 246.079 186.450 202.764 1.00 214.51 ? 267 ARG C CA   1 
ATOM 10996 C C    . ARG D 2 246 ? 246.775 185.187 203.255 1.00 214.51 ? 267 ARG C C    1 
ATOM 10997 O O    . ARG D 2 246 ? 247.636 185.251 204.138 1.00 214.51 ? 267 ARG C O    1 
ATOM 10998 C CB   . ARG D 2 246 ? 244.846 186.711 203.618 1.00 214.51 ? 267 ARG C CB   1 
ATOM 10999 C CG   . ARG D 2 246 ? 244.258 188.106 203.483 1.00 214.51 ? 267 ARG C CG   1 
ATOM 11000 C CD   . ARG D 2 246 ? 243.262 188.388 204.548 1.00 214.51 ? 267 ARG C CD   1 
ATOM 11001 N NE   . ARG D 2 246 ? 242.671 189.708 204.403 1.00 214.51 ? 267 ARG C NE   1 
ATOM 11002 C CZ   . ARG D 2 246 ? 241.910 190.313 205.336 1.00 214.51 ? 267 ARG C CZ   1 
ATOM 11003 N NH1  . ARG D 2 246 ? 241.658 189.704 206.474 1.00 214.51 ? 267 ARG C NH1  1 
ATOM 11004 N NH2  . ARG D 2 246 ? 241.418 191.518 205.108 1.00 214.51 ? 267 ARG C NH2  1 
ATOM 11005 H H    . ARG D 2 246 ? 244.872 186.293 201.190 1.00 257.41 ? 267 ARG C H    1 
ATOM 11006 H HA   . ARG D 2 246 ? 246.701 187.188 202.867 1.00 257.41 ? 267 ARG C HA   1 
ATOM 11007 H HB2  . ARG D 2 246 ? 244.066 185.998 203.356 1.00 257.41 ? 267 ARG C HB2  1 
ATOM 11008 H HB3  . ARG D 2 246 ? 245.092 186.556 204.668 1.00 257.41 ? 267 ARG C HB3  1 
ATOM 11009 H HG2  . ARG D 2 246 ? 245.056 188.846 203.556 1.00 257.41 ? 267 ARG C HG2  1 
ATOM 11010 H HG3  . ARG D 2 246 ? 243.763 188.201 202.516 1.00 257.41 ? 267 ARG C HG3  1 
ATOM 11011 H HD2  . ARG D 2 246 ? 242.462 187.649 204.502 1.00 257.41 ? 267 ARG C HD2  1 
ATOM 11012 H HD3  . ARG D 2 246 ? 243.747 188.337 205.522 1.00 257.41 ? 267 ARG C HD3  1 
ATOM 11013 H HE   . ARG D 2 246 ? 242.843 190.208 203.541 1.00 257.41 ? 267 ARG C HE   1 
ATOM 11014 H HH11 . ARG D 2 246 ? 242.034 188.783 206.648 1.00 257.41 ? 267 ARG C HH11 1 
ATOM 11015 H HH12 . ARG D 2 246 ? 241.088 190.157 207.173 1.00 257.41 ? 267 ARG C HH12 1 
ATOM 11016 H HH21 . ARG D 2 246 ? 241.612 191.986 204.233 1.00 257.41 ? 267 ARG C HH21 1 
ATOM 11017 H HH22 . ARG D 2 246 ? 240.848 191.971 205.807 1.00 257.41 ? 267 ARG C HH22 1 
ATOM 11018 N N    . LEU D 2 247 ? 246.427 184.024 202.694 1.00 196.00 ? 268 LEU C N    1 
ATOM 11019 C CA   . LEU D 2 247 ? 247.183 182.817 203.011 1.00 196.00 ? 268 LEU C CA   1 
ATOM 11020 C C    . LEU D 2 247 ? 248.625 182.951 202.539 1.00 196.00 ? 268 LEU C C    1 
ATOM 11021 O O    . LEU D 2 247 ? 249.565 182.572 203.249 1.00 196.00 ? 268 LEU C O    1 
ATOM 11022 C CB   . LEU D 2 247 ? 246.533 181.591 202.358 1.00 196.00 ? 268 LEU C CB   1 
ATOM 11023 C CG   . LEU D 2 247 ? 247.238 180.252 202.606 1.00 196.00 ? 268 LEU C CG   1 
ATOM 11024 C CD1  . LEU D 2 247 ? 247.284 179.971 204.102 1.00 196.00 ? 268 LEU C CD1  1 
ATOM 11025 C CD2  . LEU D 2 247 ? 246.504 179.145 201.864 1.00 196.00 ? 268 LEU C CD2  1 
ATOM 11026 H H    . LEU D 2 247 ? 245.772 183.912 202.148 1.00 235.20 ? 268 LEU C H    1 
ATOM 11027 H HA   . LEU D 2 247 ? 247.189 182.691 203.972 1.00 235.20 ? 268 LEU C HA   1 
ATOM 11028 H HB2  . LEU D 2 247 ? 245.512 181.501 202.727 1.00 235.20 ? 268 LEU C HB2  1 
ATOM 11029 H HB3  . LEU D 2 247 ? 246.494 181.751 201.280 1.00 235.20 ? 268 LEU C HB3  1 
ATOM 11030 H HG   . LEU D 2 247 ? 248.266 180.310 202.247 1.00 235.20 ? 268 LEU C HG   1 
ATOM 11031 H HD11 . LEU D 2 247 ? 247.785 179.020 204.279 1.00 235.20 ? 268 LEU C HD11 1 
ATOM 11032 H HD12 . LEU D 2 247 ? 247.831 180.768 204.605 1.00 235.20 ? 268 LEU C HD12 1 
ATOM 11033 H HD13 . LEU D 2 247 ? 246.268 179.924 204.494 1.00 235.20 ? 268 LEU C HD13 1 
ATOM 11034 H HD21 . LEU D 2 247 ? 247.006 178.194 202.040 1.00 235.20 ? 268 LEU C HD21 1 
ATOM 11035 H HD22 . LEU D 2 247 ? 245.476 179.086 202.224 1.00 235.20 ? 268 LE