data_6H5H
# 
_entry.id   6H5H 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.308 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6H5H         
WWPDB D_1200011074 
BMRB  34304        
# 
_pdbx_database_related.db_name        BMRB 
_pdbx_database_related.details        'A computationally designed dRP lyase domain reconstructed from two heterologous fragments' 
_pdbx_database_related.db_id          34304 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.entry_id                        6H5H 
_pdbx_database_status.recvd_initial_deposition_date   2018-07-24 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'ElGamacy, M.' 1 0000-0002-3446-8774 
'Coles, M.'    2 0000-0001-6716-6150 
'Lupas, A.N.'  3 0000-0002-1959-4836 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'J. Struct. Biol.' 
_citation.journal_id_ASTM           JSBIEM 
_citation.journal_id_CSD            0803 
_citation.journal_id_ISSN           1095-8657 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            204 
_citation.language                  ? 
_citation.page_first                380 
_citation.page_last                 387 
_citation.title                     'Asymmetric protein design from conserved supersecondary structures.' 
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.jsb.2018.10.010 
_citation.pdbx_database_id_PubMed   30558718 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'ElGamacy, M.' 1 ? 
primary 'Coles, M.'    2 ? 
primary 'Lupas, A.'    3 ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           polb4 
_entity.formula_weight             13443.259 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MKHHHHHHPMSDYDIPTTENLYFQGAMGGQETLNGALVNMLKEEGNKALSVGNIDDALQYYAAAITLDKYPHKIKSGAEA
KKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MKHHHHHHPMSDYDIPTTENLYFQGAMGGQETLNGALVNMLKEEGNKALSVGNIDDALQYYAAAITLDKYPHKIKSGAEA
KKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFL
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   LYS n 
1 3   HIS n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   PRO n 
1 10  MET n 
1 11  SER n 
1 12  ASP n 
1 13  TYR n 
1 14  ASP n 
1 15  ILE n 
1 16  PRO n 
1 17  THR n 
1 18  THR n 
1 19  GLU n 
1 20  ASN n 
1 21  LEU n 
1 22  TYR n 
1 23  PHE n 
1 24  GLN n 
1 25  GLY n 
1 26  ALA n 
1 27  MET n 
1 28  GLY n 
1 29  GLY n 
1 30  GLN n 
1 31  GLU n 
1 32  THR n 
1 33  LEU n 
1 34  ASN n 
1 35  GLY n 
1 36  ALA n 
1 37  LEU n 
1 38  VAL n 
1 39  ASN n 
1 40  MET n 
1 41  LEU n 
1 42  LYS n 
1 43  GLU n 
1 44  GLU n 
1 45  GLY n 
1 46  ASN n 
1 47  LYS n 
1 48  ALA n 
1 49  LEU n 
1 50  SER n 
1 51  VAL n 
1 52  GLY n 
1 53  ASN n 
1 54  ILE n 
1 55  ASP n 
1 56  ASP n 
1 57  ALA n 
1 58  LEU n 
1 59  GLN n 
1 60  TYR n 
1 61  TYR n 
1 62  ALA n 
1 63  ALA n 
1 64  ALA n 
1 65  ILE n 
1 66  THR n 
1 67  LEU n 
1 68  ASP n 
1 69  LYS n 
1 70  TYR n 
1 71  PRO n 
1 72  HIS n 
1 73  LYS n 
1 74  ILE n 
1 75  LYS n 
1 76  SER n 
1 77  GLY n 
1 78  ALA n 
1 79  GLU n 
1 80  ALA n 
1 81  LYS n 
1 82  LYS n 
1 83  LEU n 
1 84  PRO n 
1 85  GLY n 
1 86  VAL n 
1 87  GLY n 
1 88  THR n 
1 89  LYS n 
1 90  ILE n 
1 91  ALA n 
1 92  GLU n 
1 93  LYS n 
1 94  ILE n 
1 95  ASP n 
1 96  GLU n 
1 97  PHE n 
1 98  LEU n 
1 99  ALA n 
1 100 THR n 
1 101 GLY n 
1 102 LYS n 
1 103 LEU n 
1 104 ARG n 
1 105 LYS n 
1 106 LEU n 
1 107 GLU n 
1 108 LYS n 
1 109 ILE n 
1 110 ARG n 
1 111 GLN n 
1 112 ASP n 
1 113 ASP n 
1 114 THR n 
1 115 SER n 
1 116 SER n 
1 117 SER n 
1 118 ILE n 
1 119 ASN n 
1 120 PHE n 
1 121 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   121 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'synthetic construct' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     32630 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    PDB 
_struct_ref.db_code                    6H5H 
_struct_ref.pdbx_db_accession          6H5H 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           1 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              6H5H 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 121 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             6H5H 
_struct_ref_seq.db_align_beg                  -29 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  91 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       -29 
_struct_ref_seq.pdbx_auth_seq_align_end       91 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.spectrometer_id 
_pdbx_nmr_exptl.sample_state 
1  1 2 '3D HNCO'               1 isotropic 
2  1 2 '3D HNCA'               1 isotropic 
3  1 2 '3D C(CO)NH'            1 isotropic 
4  1 2 '3D H(CCO)NH'           1 isotropic 
9  1 2 '3D CCH-TOCSY'          1 isotropic 
5  1 1 '3D 15N-HSQC NOESY'     2 isotropic 
6  1 2 '3D 13C-HSQC NOESY'     2 isotropic 
7  1 2 '3D CNH-NOESY'          2 isotropic 
8  1 1 '3D NNH-NOESY'          2 isotropic 
10 1 1 '2D 15N-filtered NOESY' 2 isotropic 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id          1 
_pdbx_nmr_exptl_sample_conditions.temperature            313 
_pdbx_nmr_exptl_sample_conditions.pressure_units         atm 
_pdbx_nmr_exptl_sample_conditions.pressure               1 
_pdbx_nmr_exptl_sample_conditions.pH                     7.1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength         0.15 
_pdbx_nmr_exptl_sample_conditions.details                ? 
_pdbx_nmr_exptl_sample_conditions.ionic_strength_err     ? 
_pdbx_nmr_exptl_sample_conditions.ionic_strength_units   M 
_pdbx_nmr_exptl_sample_conditions.label                  conditions_1 
_pdbx_nmr_exptl_sample_conditions.pH_err                 ? 
_pdbx_nmr_exptl_sample_conditions.pH_units               pH 
_pdbx_nmr_exptl_sample_conditions.pressure_err           ? 
_pdbx_nmr_exptl_sample_conditions.temperature_err        ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units      K 
# 
loop_
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solvent_system 
_pdbx_nmr_sample_details.label 
_pdbx_nmr_sample_details.type 
_pdbx_nmr_sample_details.details 
1 '500 uM [U-15N] polb4, 150 mM potassium phosphate, 90% H2O/10% D2O'        '90% H2O/10% D2O' 15N_sample     solution ? 
2 '500 uM [U-13C; U-15N] polb4, 150 mM potassium phosphate, 90% H2O/10% D2O' '90% H2O/10% D2O' 13C,15N_sample solution ? 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.type 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.details 
1 AvanceIII ? Bruker 600 ? 
2 AvanceIII ? Bruker 800 ? 
# 
loop_
_pdbx_nmr_refine.entry_id 
_pdbx_nmr_refine.method 
_pdbx_nmr_refine.details 
_pdbx_nmr_refine.software_ordinal 
6H5H 'simulated annealing'    ?                                                      3 
6H5H 'NOESY back-calculation' 'Structures justified against the input NOESY spectra' 4 
# 
_pdbx_nmr_ensemble.entry_id                                      6H5H 
_pdbx_nmr_ensemble.conformers_calculated_total_number            50 
_pdbx_nmr_ensemble.conformers_submitted_total_number             22 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the least restraint violations' 
_pdbx_nmr_ensemble.representative_conformer                      ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             6H5H 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'minimized average structure' 
# 
loop_
_pdbx_nmr_software.ordinal 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
1 collection              TopSpin ? 'Bruker Biospin'         
2 'data analysis'         Sparky  ? Goddard                  
3 'structure calculation' X-PLOR  ? Brunger                  
4 refinement              Shine   ? 'Riss, M. and Coles, M.' 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6H5H 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                     6H5H 
_struct.title                        'A computationally designed dRP lyase domain reconstructed from two heterologous fragments' 
_struct.pdbx_descriptor              polb4 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6H5H 
_struct_keywords.text            'Protein design, dRP lyase domain, UNKNOWN FUNCTION' 
_struct_keywords.pdbx_keywords   'UNKNOWN FUNCTION' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 ASN A 34 ? VAL A 51  ? ASN A 4  VAL A 21 1 ? 18 
HELX_P HELX_P2 AA2 ASN A 53 ? TYR A 70  ? ASN A 23 TYR A 40 1 ? 18 
HELX_P HELX_P3 AA3 SER A 76 ? LYS A 81  ? SER A 46 LYS A 51 1 ? 6  
HELX_P HELX_P4 AA4 GLY A 87 ? GLY A 101 ? GLY A 57 GLY A 71 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_atom_sites.entry_id                    6H5H 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . GLU A 1 31  ? 45.811 41.489 18.767 1.00 1.19 ? 1  GLU A N    1  
ATOM 2     C CA   . GLU A 1 31  ? 46.716 42.277 17.940 1.00 0.34 ? 1  GLU A CA   1  
ATOM 3     C C    . GLU A 1 31  ? 46.439 42.037 16.460 1.00 0.30 ? 1  GLU A C    1  
ATOM 4     O O    . GLU A 1 31  ? 46.449 42.970 15.657 1.00 0.28 ? 1  GLU A O    1  
ATOM 5     C CB   . GLU A 1 31  ? 48.168 41.908 18.257 1.00 1.20 ? 1  GLU A CB   1  
ATOM 6     C CG   . GLU A 1 31  ? 48.476 42.250 19.719 1.00 1.76 ? 1  GLU A CG   1  
ATOM 7     C CD   . GLU A 1 31  ? 49.943 41.981 20.069 1.00 2.16 ? 1  GLU A CD   1  
ATOM 8     O OE1  . GLU A 1 31  ? 50.645 41.369 19.276 1.00 2.46 ? 1  GLU A OE1  1  
ATOM 9     O OE2  . GLU A 1 31  ? 50.350 42.398 21.142 1.00 2.83 ? 1  GLU A OE2  1  
ATOM 10    H H    . GLU A 1 31  ? 45.699 40.530 18.596 1.00 1.71 ? 1  GLU A H    1  
ATOM 11    H HA   . GLU A 1 31  ? 46.569 43.323 18.159 1.00 0.94 ? 1  GLU A HA   1  
ATOM 12    H HB2  . GLU A 1 31  ? 48.313 40.849 18.094 1.00 1.73 ? 1  GLU A HB2  1  
ATOM 13    H HB3  . GLU A 1 31  ? 48.830 42.466 17.613 1.00 1.83 ? 1  GLU A HB3  1  
ATOM 14    H HG2  . GLU A 1 31  ? 48.261 43.294 19.889 1.00 2.14 ? 1  GLU A HG2  1  
ATOM 15    H HG3  . GLU A 1 31  ? 47.844 41.652 20.360 1.00 2.26 ? 1  GLU A HG3  1  
ATOM 16    N N    . THR A 1 32  ? 46.193 40.780 16.103 1.00 0.29 ? 2  THR A N    1  
ATOM 17    C CA   . THR A 1 32  ? 45.911 40.430 14.716 1.00 0.26 ? 2  THR A CA   1  
ATOM 18    C C    . THR A 1 32  ? 44.693 41.197 14.211 1.00 0.20 ? 2  THR A C    1  
ATOM 19    O O    . THR A 1 32  ? 43.718 41.383 14.938 1.00 0.18 ? 2  THR A O    1  
ATOM 20    C CB   . THR A 1 32  ? 45.657 38.926 14.596 1.00 0.27 ? 2  THR A CB   1  
ATOM 21    O OG1  . THR A 1 32  ? 46.719 38.219 15.220 1.00 0.33 ? 2  THR A OG1  1  
ATOM 22    C CG2  . THR A 1 32  ? 45.583 38.537 13.119 1.00 0.26 ? 2  THR A CG2  1  
ATOM 23    H H    . THR A 1 32  ? 46.201 40.076 16.786 1.00 0.32 ? 2  THR A H    1  
ATOM 24    H HA   . THR A 1 32  ? 46.765 40.689 14.109 1.00 0.28 ? 2  THR A HA   1  
ATOM 25    H HB   . THR A 1 32  ? 44.723 38.677 15.078 1.00 0.26 ? 2  THR A HB   1  
ATOM 26    H HG1  . THR A 1 32  ? 47.487 38.460 14.820 1.00 0.94 ? 2  THR A HG1  1  
ATOM 27    H HG21 . THR A 1 32  ? 44.868 39.171 12.614 1.00 1.01 ? 2  THR A HG21 1  
ATOM 28    H HG22 . THR A 1 32  ? 45.271 37.508 13.034 1.00 1.05 ? 2  THR A HG22 1  
ATOM 29    H HG23 . THR A 1 32  ? 46.555 38.658 12.665 1.00 1.06 ? 2  THR A HG23 1  
ATOM 30    N N    . LEU A 1 33  ? 44.726 41.586 12.943 1.00 0.20 ? 3  LEU A N    1  
ATOM 31    C CA   . LEU A 1 33  ? 43.664 42.419 12.381 1.00 0.17 ? 3  LEU A CA   1  
ATOM 32    C C    . LEU A 1 33  ? 42.287 41.760 12.502 1.00 0.14 ? 3  LEU A C    1  
ATOM 33    O O    . LEU A 1 33  ? 41.274 42.452 12.598 1.00 0.14 ? 3  LEU A O    1  
ATOM 34    C CB   . LEU A 1 33  ? 43.954 42.686 10.905 1.00 0.21 ? 3  LEU A CB   1  
ATOM 35    C CG   . LEU A 1 33  ? 45.305 43.386 10.756 1.00 0.26 ? 3  LEU A CG   1  
ATOM 36    C CD1  . LEU A 1 33  ? 45.687 43.450 9.276  1.00 0.29 ? 3  LEU A CD1  1  
ATOM 37    C CD2  . LEU A 1 33  ? 45.203 44.808 11.309 1.00 0.27 ? 3  LEU A CD2  1  
ATOM 38    H H    . LEU A 1 33  ? 45.473 41.311 12.372 1.00 0.23 ? 3  LEU A H    1  
ATOM 39    H HA   . LEU A 1 33  ? 43.646 43.362 12.905 1.00 0.18 ? 3  LEU A HA   1  
ATOM 40    H HB2  . LEU A 1 33  ? 43.972 41.749 10.366 1.00 0.22 ? 3  LEU A HB2  1  
ATOM 41    H HB3  . LEU A 1 33  ? 43.179 43.317 10.501 1.00 0.22 ? 3  LEU A HB3  1  
ATOM 42    H HG   . LEU A 1 33  ? 46.060 42.838 11.301 1.00 0.27 ? 3  LEU A HG   1  
ATOM 43    H HD11 . LEU A 1 33  ? 46.651 43.926 9.172  1.00 1.07 ? 3  LEU A HD11 1  
ATOM 44    H HD12 . LEU A 1 33  ? 44.944 44.021 8.737  1.00 1.09 ? 3  LEU A HD12 1  
ATOM 45    H HD13 . LEU A 1 33  ? 45.733 42.449 8.872  1.00 1.01 ? 3  LEU A HD13 1  
ATOM 46    H HD21 . LEU A 1 33  ? 46.090 45.363 11.040 1.00 1.00 ? 3  LEU A HD21 1  
ATOM 47    H HD22 . LEU A 1 33  ? 45.113 44.772 12.384 1.00 1.11 ? 3  LEU A HD22 1  
ATOM 48    H HD23 . LEU A 1 33  ? 44.334 45.294 10.890 1.00 1.01 ? 3  LEU A HD23 1  
ATOM 49    N N    . ASN A 1 34  ? 42.246 40.431 12.498 1.00 0.12 ? 4  ASN A N    1  
ATOM 50    C CA   . ASN A 1 34  ? 40.974 39.712 12.591 1.00 0.11 ? 4  ASN A CA   1  
ATOM 51    C C    . ASN A 1 34  ? 40.638 39.274 14.027 1.00 0.12 ? 4  ASN A C    1  
ATOM 52    O O    . ASN A 1 34  ? 39.654 38.562 14.234 1.00 0.13 ? 4  ASN A O    1  
ATOM 53    C CB   . ASN A 1 34  ? 41.016 38.477 11.688 1.00 0.11 ? 4  ASN A CB   1  
ATOM 54    C CG   . ASN A 1 34  ? 41.351 38.878 10.253 1.00 0.12 ? 4  ASN A CG   1  
ATOM 55    O OD1  . ASN A 1 34  ? 40.744 39.797 9.699  1.00 0.14 ? 4  ASN A OD1  1  
ATOM 56    N ND2  . ASN A 1 34  ? 42.278 38.228 9.605  1.00 0.13 ? 4  ASN A ND2  1  
ATOM 57    H H    . ASN A 1 34  ? 43.082 39.923 12.431 1.00 0.14 ? 4  ASN A H    1  
ATOM 58    H HA   . ASN A 1 34  ? 40.188 40.362 12.239 1.00 0.12 ? 4  ASN A HA   1  
ATOM 59    H HB2  . ASN A 1 34  ? 41.770 37.793 12.053 1.00 0.12 ? 4  ASN A HB2  1  
ATOM 60    H HB3  . ASN A 1 34  ? 40.053 37.988 11.706 1.00 0.11 ? 4  ASN A HB3  1  
ATOM 61    H HD21 . ASN A 1 34  ? 42.748 37.481 10.034 1.00 0.14 ? 4  ASN A HD21 1  
ATOM 62    H HD22 . ASN A 1 34  ? 42.519 38.500 8.694  1.00 0.15 ? 4  ASN A HD22 1  
ATOM 63    N N    . GLY A 1 35  ? 41.425 39.694 15.020 1.00 0.14 ? 5  GLY A N    1  
ATOM 64    C CA   . GLY A 1 35  ? 41.255 39.197 16.380 1.00 0.16 ? 5  GLY A CA   1  
ATOM 65    C C    . GLY A 1 35  ? 39.825 39.380 16.875 1.00 0.17 ? 5  GLY A C    1  
ATOM 66    O O    . GLY A 1 35  ? 39.279 38.496 17.541 1.00 0.17 ? 5  GLY A O    1  
ATOM 67    H H    . GLY A 1 35  ? 42.123 40.355 14.837 1.00 0.14 ? 5  GLY A H    1  
ATOM 68    H HA2  . GLY A 1 35  ? 41.504 38.146 16.403 1.00 0.16 ? 5  GLY A HA2  1  
ATOM 69    H HA3  . GLY A 1 35  ? 41.923 39.732 17.037 1.00 0.19 ? 5  GLY A HA3  1  
ATOM 70    N N    . ALA A 1 36  ? 39.204 40.506 16.530 1.00 0.19 ? 6  ALA A N    1  
ATOM 71    C CA   . ALA A 1 36  ? 37.845 40.773 16.989 1.00 0.22 ? 6  ALA A CA   1  
ATOM 72    C C    . ALA A 1 36  ? 36.896 39.695 16.476 1.00 0.21 ? 6  ALA A C    1  
ATOM 73    O O    . ALA A 1 36  ? 36.118 39.118 17.241 1.00 0.22 ? 6  ALA A O    1  
ATOM 74    C CB   . ALA A 1 36  ? 37.383 42.143 16.490 1.00 0.25 ? 6  ALA A CB   1  
ATOM 75    H H    . ALA A 1 36  ? 39.665 41.161 15.964 1.00 0.19 ? 6  ALA A H    1  
ATOM 76    H HA   . ALA A 1 36  ? 37.831 40.770 18.069 1.00 0.24 ? 6  ALA A HA   1  
ATOM 77    H HB1  . ALA A 1 36  ? 38.202 42.845 16.557 1.00 1.04 ? 6  ALA A HB1  1  
ATOM 78    H HB2  . ALA A 1 36  ? 36.562 42.490 17.099 1.00 1.07 ? 6  ALA A HB2  1  
ATOM 79    H HB3  . ALA A 1 36  ? 37.060 42.063 15.463 1.00 0.95 ? 6  ALA A HB3  1  
ATOM 80    N N    . LEU A 1 37  ? 36.994 39.392 15.185 1.00 0.20 ? 7  LEU A N    1  
ATOM 81    C CA   . LEU A 1 37  ? 36.181 38.326 14.610 1.00 0.21 ? 7  LEU A CA   1  
ATOM 82    C C    . LEU A 1 37  ? 36.508 36.983 15.258 1.00 0.18 ? 7  LEU A C    1  
ATOM 83    O O    . LEU A 1 37  ? 35.611 36.181 15.512 1.00 0.21 ? 7  LEU A O    1  
ATOM 84    C CB   . LEU A 1 37  ? 36.419 38.243 13.100 1.00 0.21 ? 7  LEU A CB   1  
ATOM 85    C CG   . LEU A 1 37  ? 35.906 39.520 12.433 1.00 0.21 ? 7  LEU A CG   1  
ATOM 86    C CD1  . LEU A 1 37  ? 36.362 39.558 10.974 1.00 0.24 ? 7  LEU A CD1  1  
ATOM 87    C CD2  . LEU A 1 37  ? 34.376 39.536 12.481 1.00 0.21 ? 7  LEU A CD2  1  
ATOM 88    H H    . LEU A 1 37  ? 37.618 39.888 14.616 1.00 0.19 ? 7  LEU A H    1  
ATOM 89    H HA   . LEU A 1 37  ? 35.140 38.551 14.786 1.00 0.23 ? 7  LEU A HA   1  
ATOM 90    H HB2  . LEU A 1 37  ? 37.477 38.133 12.908 1.00 0.22 ? 7  LEU A HB2  1  
ATOM 91    H HB3  . LEU A 1 37  ? 35.889 37.392 12.699 1.00 0.20 ? 7  LEU A HB3  1  
ATOM 92    H HG   . LEU A 1 37  ? 36.294 40.382 12.955 1.00 0.25 ? 7  LEU A HG   1  
ATOM 93    H HD11 . LEU A 1 37  ? 36.215 38.587 10.525 1.00 1.05 ? 7  LEU A HD11 1  
ATOM 94    H HD12 . LEU A 1 37  ? 37.408 39.821 10.930 1.00 1.04 ? 7  LEU A HD12 1  
ATOM 95    H HD13 . LEU A 1 37  ? 35.782 40.295 10.436 1.00 1.04 ? 7  LEU A HD13 1  
ATOM 96    H HD21 . LEU A 1 37  ? 34.000 40.224 11.740 1.00 1.05 ? 7  LEU A HD21 1  
ATOM 97    H HD22 . LEU A 1 37  ? 34.051 39.849 13.462 1.00 0.99 ? 7  LEU A HD22 1  
ATOM 98    H HD23 . LEU A 1 37  ? 34.000 38.544 12.277 1.00 1.07 ? 7  LEU A HD23 1  
ATOM 99    N N    . VAL A 1 38  ? 37.781 36.762 15.579 1.00 0.16 ? 8  VAL A N    1  
ATOM 100   C CA   . VAL A 1 38  ? 38.187 35.510 16.206 1.00 0.15 ? 8  VAL A CA   1  
ATOM 101   C C    . VAL A 1 38  ? 37.462 35.337 17.541 1.00 0.16 ? 8  VAL A C    1  
ATOM 102   O O    . VAL A 1 38  ? 36.973 34.250 17.853 1.00 0.17 ? 8  VAL A O    1  
ATOM 103   C CB   . VAL A 1 38  ? 39.711 35.507 16.412 1.00 0.16 ? 8  VAL A CB   1  
ATOM 104   C CG1  . VAL A 1 38  ? 40.168 34.213 17.095 1.00 0.19 ? 8  VAL A CG1  1  
ATOM 105   C CG2  . VAL A 1 38  ? 40.413 35.615 15.055 1.00 0.16 ? 8  VAL A CG2  1  
ATOM 106   H H    . VAL A 1 38  ? 38.457 37.437 15.360 1.00 0.15 ? 8  VAL A H    1  
ATOM 107   H HA   . VAL A 1 38  ? 37.920 34.690 15.555 1.00 0.17 ? 8  VAL A HA   1  
ATOM 108   H HB   . VAL A 1 38  ? 39.989 36.351 17.026 1.00 0.16 ? 8  VAL A HB   1  
ATOM 109   H HG11 . VAL A 1 38  ? 41.217 34.288 17.343 1.00 1.01 ? 8  VAL A HG11 1  
ATOM 110   H HG12 . VAL A 1 38  ? 40.016 33.382 16.426 1.00 0.93 ? 8  VAL A HG12 1  
ATOM 111   H HG13 . VAL A 1 38  ? 39.596 34.058 17.998 1.00 0.99 ? 8  VAL A HG13 1  
ATOM 112   H HG21 . VAL A 1 38  ? 40.477 34.637 14.602 1.00 0.98 ? 8  VAL A HG21 1  
ATOM 113   H HG22 . VAL A 1 38  ? 41.408 36.010 15.196 1.00 1.01 ? 8  VAL A HG22 1  
ATOM 114   H HG23 . VAL A 1 38  ? 39.856 36.273 14.406 1.00 1.02 ? 8  VAL A HG23 1  
ATOM 115   N N    . ASN A 1 39  ? 37.360 36.421 18.308 1.00 0.18 ? 9  ASN A N    1  
ATOM 116   C CA   . ASN A 1 39  ? 36.656 36.360 19.584 1.00 0.22 ? 9  ASN A CA   1  
ATOM 117   C C    . ASN A 1 39  ? 35.190 35.999 19.373 1.00 0.23 ? 9  ASN A C    1  
ATOM 118   O O    . ASN A 1 39  ? 34.644 35.144 20.075 1.00 0.23 ? 9  ASN A O    1  
ATOM 119   C CB   . ASN A 1 39  ? 36.752 37.711 20.298 1.00 0.29 ? 9  ASN A CB   1  
ATOM 120   C CG   . ASN A 1 39  ? 38.203 38.023 20.651 1.00 1.21 ? 9  ASN A CG   1  
ATOM 121   O OD1  . ASN A 1 39  ? 39.033 37.118 20.748 1.00 1.96 ? 9  ASN A OD1  1  
ATOM 122   N ND2  . ASN A 1 39  ? 38.563 39.262 20.849 1.00 1.92 ? 9  ASN A ND2  1  
ATOM 123   H H    . ASN A 1 39  ? 37.791 37.255 18.029 1.00 0.18 ? 9  ASN A H    1  
ATOM 124   H HA   . ASN A 1 39  ? 37.117 35.606 20.205 1.00 0.24 ? 9  ASN A HA   1  
ATOM 125   H HB2  . ASN A 1 39  ? 36.367 38.484 19.650 1.00 0.80 ? 9  ASN A HB2  1  
ATOM 126   H HB3  . ASN A 1 39  ? 36.164 37.680 21.203 1.00 0.90 ? 9  ASN A HB3  1  
ATOM 127   H HD21 . ASN A 1 39  ? 37.902 39.981 20.771 1.00 2.14 ? 9  ASN A HD21 1  
ATOM 128   H HD22 . ASN A 1 39  ? 39.492 39.472 21.076 1.00 2.57 ? 9  ASN A HD22 1  
ATOM 129   N N    . MET A 1 40  ? 34.563 36.621 18.375 1.00 0.27 ? 10 MET A N    1  
ATOM 130   C CA   . MET A 1 40  ? 33.169 36.309 18.072 1.00 0.33 ? 10 MET A CA   1  
ATOM 131   C C    . MET A 1 40  ? 33.013 34.840 17.684 1.00 0.27 ? 10 MET A C    1  
ATOM 132   O O    . MET A 1 40  ? 32.046 34.185 18.079 1.00 0.27 ? 10 MET A O    1  
ATOM 133   C CB   . MET A 1 40  ? 32.671 37.199 16.933 1.00 0.47 ? 10 MET A CB   1  
ATOM 134   C CG   . MET A 1 40  ? 31.157 37.041 16.784 1.00 0.51 ? 10 MET A CG   1  
ATOM 135   S SD   . MET A 1 40  ? 30.586 38.000 15.359 1.00 0.86 ? 10 MET A SD   1  
ATOM 136   C CE   . MET A 1 40  ? 31.272 36.927 14.074 1.00 0.79 ? 10 MET A CE   1  
ATOM 137   H H    . MET A 1 40  ? 35.030 37.320 17.868 1.00 0.29 ? 10 MET A H    1  
ATOM 138   H HA   . MET A 1 40  ? 32.570 36.502 18.950 1.00 0.37 ? 10 MET A HA   1  
ATOM 139   H HB2  . MET A 1 40  ? 32.907 38.230 17.152 1.00 0.55 ? 10 MET A HB2  1  
ATOM 140   H HB3  . MET A 1 40  ? 33.152 36.907 16.010 1.00 0.51 ? 10 MET A HB3  1  
ATOM 141   H HG2  . MET A 1 40  ? 30.916 35.999 16.637 1.00 0.37 ? 10 MET A HG2  1  
ATOM 142   H HG3  . MET A 1 40  ? 30.668 37.400 17.678 1.00 0.57 ? 10 MET A HG3  1  
ATOM 143   H HE1  . MET A 1 40  ? 32.350 37.015 14.071 1.00 1.30 ? 10 MET A HE1  1  
ATOM 144   H HE2  . MET A 1 40  ? 30.887 37.225 13.111 1.00 1.44 ? 10 MET A HE2  1  
ATOM 145   H HE3  . MET A 1 40  ? 30.990 35.903 14.272 1.00 1.56 ? 10 MET A HE3  1  
ATOM 146   N N    . LEU A 1 41  ? 33.984 34.310 16.943 1.00 0.26 ? 11 LEU A N    1  
ATOM 147   C CA   . LEU A 1 41  ? 33.960 32.898 16.580 1.00 0.29 ? 11 LEU A CA   1  
ATOM 148   C C    . LEU A 1 41  ? 34.017 32.018 17.821 1.00 0.23 ? 11 LEU A C    1  
ATOM 149   O O    . LEU A 1 41  ? 33.308 31.017 17.911 1.00 0.26 ? 11 LEU A O    1  
ATOM 150   C CB   . LEU A 1 41  ? 35.138 32.570 15.661 1.00 0.34 ? 11 LEU A CB   1  
ATOM 151   C CG   . LEU A 1 41  ? 34.960 33.292 14.326 1.00 0.38 ? 11 LEU A CG   1  
ATOM 152   C CD1  . LEU A 1 41  ? 36.263 33.218 13.528 1.00 0.45 ? 11 LEU A CD1  1  
ATOM 153   C CD2  . LEU A 1 41  ? 33.841 32.623 13.528 1.00 0.42 ? 11 LEU A CD2  1  
ATOM 154   H H    . LEU A 1 41  ? 34.705 34.883 16.611 1.00 0.27 ? 11 LEU A H    1  
ATOM 155   H HA   . LEU A 1 41  ? 33.041 32.691 16.051 1.00 0.34 ? 11 LEU A HA   1  
ATOM 156   H HB2  . LEU A 1 41  ? 36.058 32.892 16.128 1.00 0.33 ? 11 LEU A HB2  1  
ATOM 157   H HB3  . LEU A 1 41  ? 35.174 31.505 15.489 1.00 0.37 ? 11 LEU A HB3  1  
ATOM 158   H HG   . LEU A 1 41  ? 34.705 34.325 14.505 1.00 0.37 ? 11 LEU A HG   1  
ATOM 159   H HD11 . LEU A 1 41  ? 36.292 34.024 12.809 1.00 1.05 ? 11 LEU A HD11 1  
ATOM 160   H HD12 . LEU A 1 41  ? 36.315 32.272 13.011 1.00 1.06 ? 11 LEU A HD12 1  
ATOM 161   H HD13 . LEU A 1 41  ? 37.103 33.307 14.202 1.00 1.21 ? 11 LEU A HD13 1  
ATOM 162   H HD21 . LEU A 1 41  ? 33.870 32.973 12.507 1.00 1.13 ? 11 LEU A HD21 1  
ATOM 163   H HD22 . LEU A 1 41  ? 32.886 32.872 13.966 1.00 1.01 ? 11 LEU A HD22 1  
ATOM 164   H HD23 . LEU A 1 41  ? 33.977 31.551 13.545 1.00 1.01 ? 11 LEU A HD23 1  
ATOM 165   N N    . LYS A 1 42  ? 34.846 32.405 18.789 1.00 0.19 ? 12 LYS A N    1  
ATOM 166   C CA   . LYS A 1 42  ? 34.927 31.654 20.037 1.00 0.21 ? 12 LYS A CA   1  
ATOM 167   C C    . LYS A 1 42  ? 33.568 31.616 20.729 1.00 0.19 ? 12 LYS A C    1  
ATOM 168   O O    . LYS A 1 42  ? 33.158 30.578 21.253 1.00 0.20 ? 12 LYS A O    1  
ATOM 169   C CB   . LYS A 1 42  ? 35.960 32.295 20.968 1.00 0.25 ? 12 LYS A CB   1  
ATOM 170   C CG   . LYS A 1 42  ? 36.147 31.419 22.209 1.00 1.17 ? 12 LYS A CG   1  
ATOM 171   C CD   . LYS A 1 42  ? 37.115 32.101 23.177 1.00 1.54 ? 12 LYS A CD   1  
ATOM 172   C CE   . LYS A 1 42  ? 37.420 31.158 24.343 1.00 2.35 ? 12 LYS A CE   1  
ATOM 173   N NZ   . LYS A 1 42  ? 38.208 31.886 25.378 1.00 2.85 ? 12 LYS A NZ   1  
ATOM 174   H H    . LYS A 1 42  ? 35.437 33.174 18.644 1.00 0.19 ? 12 LYS A H    1  
ATOM 175   H HA   . LYS A 1 42  ? 35.237 30.642 19.819 1.00 0.26 ? 12 LYS A HA   1  
ATOM 176   H HB2  . LYS A 1 42  ? 36.902 32.391 20.447 1.00 0.77 ? 12 LYS A HB2  1  
ATOM 177   H HB3  . LYS A 1 42  ? 35.614 33.273 21.270 1.00 0.92 ? 12 LYS A HB3  1  
ATOM 178   H HG2  . LYS A 1 42  ? 35.192 31.275 22.694 1.00 1.84 ? 12 LYS A HG2  1  
ATOM 179   H HG3  . LYS A 1 42  ? 36.550 30.461 21.916 1.00 1.86 ? 12 LYS A HG3  1  
ATOM 180   H HD2  . LYS A 1 42  ? 38.032 32.343 22.659 1.00 1.99 ? 12 LYS A HD2  1  
ATOM 181   H HD3  . LYS A 1 42  ? 36.667 33.007 23.558 1.00 1.85 ? 12 LYS A HD3  1  
ATOM 182   H HE2  . LYS A 1 42  ? 36.493 30.810 24.775 1.00 2.79 ? 12 LYS A HE2  1  
ATOM 183   H HE3  . LYS A 1 42  ? 37.989 30.314 23.983 1.00 2.85 ? 12 LYS A HE3  1  
ATOM 184   H HZ1  . LYS A 1 42  ? 38.371 31.261 26.193 1.00 3.06 ? 12 LYS A HZ1  1  
ATOM 185   H HZ2  . LYS A 1 42  ? 37.682 32.728 25.685 1.00 3.14 ? 12 LYS A HZ2  1  
ATOM 186   H HZ3  . LYS A 1 42  ? 39.124 32.174 24.977 1.00 3.31 ? 12 LYS A HZ3  1  
ATOM 187   N N    . GLU A 1 43  ? 32.851 32.738 20.692 1.00 0.19 ? 13 GLU A N    1  
ATOM 188   C CA   . GLU A 1 43  ? 31.508 32.780 21.263 1.00 0.24 ? 13 GLU A CA   1  
ATOM 189   C C    . GLU A 1 43  ? 30.585 31.801 20.543 1.00 0.25 ? 13 GLU A C    1  
ATOM 190   O O    . GLU A 1 43  ? 29.835 31.057 21.178 1.00 0.27 ? 13 GLU A O    1  
ATOM 191   C CB   . GLU A 1 43  ? 30.939 34.196 21.153 1.00 0.31 ? 13 GLU A CB   1  
ATOM 192   C CG   . GLU A 1 43  ? 29.613 34.278 21.918 1.00 1.15 ? 13 GLU A CG   1  
ATOM 193   C CD   . GLU A 1 43  ? 28.947 35.651 21.767 1.00 1.42 ? 13 GLU A CD   1  
ATOM 194   O OE1  . GLU A 1 43  ? 27.898 35.833 22.361 1.00 2.00 ? 13 GLU A OE1  1  
ATOM 195   O OE2  . GLU A 1 43  ? 29.479 36.502 21.068 1.00 1.77 ? 13 GLU A OE2  1  
ATOM 196   H H    . GLU A 1 43  ? 33.247 33.553 20.316 1.00 0.19 ? 13 GLU A H    1  
ATOM 197   H HA   . GLU A 1 43  ? 31.562 32.507 22.307 1.00 0.27 ? 13 GLU A HA   1  
ATOM 198   H HB2  . GLU A 1 43  ? 31.644 34.900 21.573 1.00 0.87 ? 13 GLU A HB2  1  
ATOM 199   H HB3  . GLU A 1 43  ? 30.767 34.436 20.115 1.00 0.82 ? 13 GLU A HB3  1  
ATOM 200   H HG2  . GLU A 1 43  ? 28.942 33.521 21.540 1.00 1.63 ? 13 GLU A HG2  1  
ATOM 201   H HG3  . GLU A 1 43  ? 29.800 34.090 22.965 1.00 1.65 ? 13 GLU A HG3  1  
ATOM 202   N N    . GLU A 1 44  ? 30.675 31.771 19.215 1.00 0.26 ? 14 GLU A N    1  
ATOM 203   C CA   . GLU A 1 44  ? 29.858 30.845 18.436 1.00 0.31 ? 14 GLU A CA   1  
ATOM 204   C C    . GLU A 1 44  ? 30.200 29.398 18.778 1.00 0.26 ? 14 GLU A C    1  
ATOM 205   O O    . GLU A 1 44  ? 29.312 28.551 18.890 1.00 0.29 ? 14 GLU A O    1  
ATOM 206   C CB   . GLU A 1 44  ? 30.082 31.083 16.942 1.00 0.37 ? 14 GLU A CB   1  
ATOM 207   C CG   . GLU A 1 44  ? 29.615 32.495 16.570 1.00 0.79 ? 14 GLU A CG   1  
ATOM 208   C CD   . GLU A 1 44  ? 28.118 32.675 16.831 1.00 0.92 ? 14 GLU A CD   1  
ATOM 209   O OE1  . GLU A 1 44  ? 27.692 33.817 16.903 1.00 1.44 ? 14 GLU A OE1  1  
ATOM 210   O OE2  . GLU A 1 44  ? 27.412 31.684 16.941 1.00 1.67 ? 14 GLU A OE2  1  
ATOM 211   H H    . GLU A 1 44  ? 31.267 32.404 18.756 1.00 0.25 ? 14 GLU A H    1  
ATOM 212   H HA   . GLU A 1 44  ? 28.817 31.022 18.663 1.00 0.36 ? 14 GLU A HA   1  
ATOM 213   H HB2  . GLU A 1 44  ? 31.133 30.978 16.714 1.00 0.57 ? 14 GLU A HB2  1  
ATOM 214   H HB3  . GLU A 1 44  ? 29.517 30.360 16.373 1.00 0.63 ? 14 GLU A HB3  1  
ATOM 215   H HG2  . GLU A 1 44  ? 30.165 33.215 17.160 1.00 1.31 ? 14 GLU A HG2  1  
ATOM 216   H HG3  . GLU A 1 44  ? 29.817 32.670 15.524 1.00 1.35 ? 14 GLU A HG3  1  
ATOM 217   N N    . GLY A 1 45  ? 31.487 29.122 18.977 1.00 0.22 ? 15 GLY A N    1  
ATOM 218   C CA   . GLY A 1 45  ? 31.913 27.780 19.355 1.00 0.23 ? 15 GLY A CA   1  
ATOM 219   C C    . GLY A 1 45  ? 31.276 27.361 20.673 1.00 0.23 ? 15 GLY A C    1  
ATOM 220   O O    . GLY A 1 45  ? 30.759 26.250 20.798 1.00 0.25 ? 15 GLY A O    1  
ATOM 221   H H    . GLY A 1 45  ? 32.157 29.822 18.840 1.00 0.21 ? 15 GLY A H    1  
ATOM 222   H HA2  . GLY A 1 45  ? 31.621 27.085 18.580 1.00 0.26 ? 15 GLY A HA2  1  
ATOM 223   H HA3  . GLY A 1 45  ? 32.987 27.764 19.461 1.00 0.23 ? 15 GLY A HA3  1  
ATOM 224   N N    . ASN A 1 46  ? 31.285 28.268 21.648 1.00 0.25 ? 16 ASN A N    1  
ATOM 225   C CA   . ASN A 1 46  ? 30.672 27.976 22.939 1.00 0.31 ? 16 ASN A CA   1  
ATOM 226   C C    . ASN A 1 46  ? 29.178 27.707 22.780 1.00 0.33 ? 16 ASN A C    1  
ATOM 227   O O    . ASN A 1 46  ? 28.634 26.809 23.423 1.00 0.36 ? 16 ASN A O    1  
ATOM 228   C CB   . ASN A 1 46  ? 30.880 29.153 23.894 1.00 0.35 ? 16 ASN A CB   1  
ATOM 229   C CG   . ASN A 1 46  ? 32.367 29.347 24.182 1.00 0.36 ? 16 ASN A CG   1  
ATOM 230   O OD1  . ASN A 1 46  ? 33.160 28.419 24.029 1.00 0.82 ? 16 ASN A OD1  1  
ATOM 231   N ND2  . ASN A 1 46  ? 32.793 30.509 24.593 1.00 0.86 ? 16 ASN A ND2  1  
ATOM 232   H H    . ASN A 1 46  ? 31.737 29.127 21.508 1.00 0.24 ? 16 ASN A H    1  
ATOM 233   H HA   . ASN A 1 46  ? 31.143 27.099 23.359 1.00 0.32 ? 16 ASN A HA   1  
ATOM 234   H HB2  . ASN A 1 46  ? 30.482 30.051 23.444 1.00 0.35 ? 16 ASN A HB2  1  
ATOM 235   H HB3  . ASN A 1 46  ? 30.361 28.957 24.821 1.00 0.41 ? 16 ASN A HB3  1  
ATOM 236   H HD21 . ASN A 1 46  ? 32.161 31.249 24.715 1.00 1.40 ? 16 ASN A HD21 1  
ATOM 237   H HD22 . ASN A 1 46  ? 33.745 30.645 24.781 1.00 0.86 ? 16 ASN A HD22 1  
ATOM 238   N N    . LYS A 1 47  ? 28.523 28.457 21.895 1.00 0.34 ? 17 LYS A N    1  
ATOM 239   C CA   . LYS A 1 47  ? 27.101 28.239 21.647 1.00 0.39 ? 17 LYS A CA   1  
ATOM 240   C C    . LYS A 1 47  ? 26.858 26.834 21.100 1.00 0.36 ? 17 LYS A C    1  
ATOM 241   O O    . LYS A 1 47  ? 25.961 26.123 21.566 1.00 0.40 ? 17 LYS A O    1  
ATOM 242   C CB   . LYS A 1 47  ? 26.585 29.277 20.646 1.00 0.42 ? 17 LYS A CB   1  
ATOM 243   C CG   . LYS A 1 47  ? 25.067 29.136 20.493 1.00 1.20 ? 17 LYS A CG   1  
ATOM 244   C CD   . LYS A 1 47  ? 24.525 30.241 19.578 1.00 1.67 ? 17 LYS A CD   1  
ATOM 245   C CE   . LYS A 1 47  ? 24.933 30.001 18.117 1.00 2.47 ? 17 LYS A CE   1  
ATOM 246   N NZ   . LYS A 1 47  ? 23.776 29.427 17.374 1.00 2.86 ? 17 LYS A NZ   1  
ATOM 247   H H    . LYS A 1 47  ? 28.989 29.190 21.441 1.00 0.32 ? 17 LYS A H    1  
ATOM 248   H HA   . LYS A 1 47  ? 26.562 28.352 22.574 1.00 0.44 ? 17 LYS A HA   1  
ATOM 249   H HB2  . LYS A 1 47  ? 26.821 30.268 21.006 1.00 0.96 ? 17 LYS A HB2  1  
ATOM 250   H HB3  . LYS A 1 47  ? 27.060 29.119 19.691 1.00 0.97 ? 17 LYS A HB3  1  
ATOM 251   H HG2  . LYS A 1 47  ? 24.840 28.171 20.063 1.00 1.86 ? 17 LYS A HG2  1  
ATOM 252   H HG3  . LYS A 1 47  ? 24.600 29.216 21.462 1.00 1.88 ? 17 LYS A HG3  1  
ATOM 253   H HD2  . LYS A 1 47  ? 23.448 30.261 19.647 1.00 2.13 ? 17 LYS A HD2  1  
ATOM 254   H HD3  . LYS A 1 47  ? 24.918 31.194 19.903 1.00 2.02 ? 17 LYS A HD3  1  
ATOM 255   H HE2  . LYS A 1 47  ? 25.213 30.942 17.666 1.00 2.86 ? 17 LYS A HE2  1  
ATOM 256   H HE3  . LYS A 1 47  ? 25.768 29.319 18.063 1.00 3.05 ? 17 LYS A HE3  1  
ATOM 257   H HZ1  . LYS A 1 47  ? 23.493 28.529 17.813 1.00 3.14 ? 17 LYS A HZ1  1  
ATOM 258   H HZ2  . LYS A 1 47  ? 24.051 29.258 16.385 1.00 3.25 ? 17 LYS A HZ2  1  
ATOM 259   H HZ3  . LYS A 1 47  ? 22.978 30.092 17.405 1.00 3.08 ? 17 LYS A HZ3  1  
ATOM 260   N N    . ALA A 1 48  ? 27.690 26.413 20.148 1.00 0.31 ? 18 ALA A N    1  
ATOM 261   C CA   . ALA A 1 48  ? 27.545 25.077 19.585 1.00 0.29 ? 18 ALA A CA   1  
ATOM 262   C C    . ALA A 1 48  ? 27.716 24.026 20.676 1.00 0.28 ? 18 ALA A C    1  
ATOM 263   O O    . ALA A 1 48  ? 26.983 23.039 20.713 1.00 0.29 ? 18 ALA A O    1  
ATOM 264   C CB   . ALA A 1 48  ? 28.571 24.850 18.472 1.00 0.24 ? 18 ALA A CB   1  
ATOM 265   H H    . ALA A 1 48  ? 28.387 27.013 19.806 1.00 0.29 ? 18 ALA A H    1  
ATOM 266   H HA   . ALA A 1 48  ? 26.554 24.984 19.165 1.00 0.33 ? 18 ALA A HA   1  
ATOM 267   H HB1  . ALA A 1 48  ? 29.462 24.400 18.885 1.00 1.07 ? 18 ALA A HB1  1  
ATOM 268   H HB2  . ALA A 1 48  ? 28.823 25.795 18.016 1.00 1.01 ? 18 ALA A HB2  1  
ATOM 269   H HB3  . ALA A 1 48  ? 28.149 24.191 17.724 1.00 0.97 ? 18 ALA A HB3  1  
ATOM 270   N N    . LEU A 1 49  ? 28.689 24.235 21.560 1.00 0.27 ? 19 LEU A N    1  
ATOM 271   C CA   . LEU A 1 49  ? 28.870 23.335 22.693 1.00 0.31 ? 19 LEU A CA   1  
ATOM 272   C C    . LEU A 1 49  ? 27.626 23.320 23.579 1.00 0.38 ? 19 LEU A C    1  
ATOM 273   O O    . LEU A 1 49  ? 27.178 22.259 24.012 1.00 0.40 ? 19 LEU A O    1  
ATOM 274   C CB   . LEU A 1 49  ? 30.083 23.777 23.516 1.00 0.34 ? 19 LEU A CB   1  
ATOM 275   C CG   . LEU A 1 49  ? 30.361 22.756 24.622 1.00 0.41 ? 19 LEU A CG   1  
ATOM 276   C CD1  . LEU A 1 49  ? 30.897 21.464 24.002 1.00 0.40 ? 19 LEU A CD1  1  
ATOM 277   C CD2  . LEU A 1 49  ? 31.401 23.325 25.589 1.00 0.47 ? 19 LEU A CD2  1  
ATOM 278   H H    . LEU A 1 49  ? 29.307 24.985 21.432 1.00 0.26 ? 19 LEU A H    1  
ATOM 279   H HA   . LEU A 1 49  ? 29.047 22.337 22.322 1.00 0.29 ? 19 LEU A HA   1  
ATOM 280   H HB2  . LEU A 1 49  ? 30.946 23.851 22.870 1.00 0.30 ? 19 LEU A HB2  1  
ATOM 281   H HB3  . LEU A 1 49  ? 29.883 24.739 23.962 1.00 0.38 ? 19 LEU A HB3  1  
ATOM 282   H HG   . LEU A 1 49  ? 29.447 22.546 25.157 1.00 0.45 ? 19 LEU A HG   1  
ATOM 283   H HD11 . LEU A 1 49  ? 31.432 20.900 24.751 1.00 1.04 ? 19 LEU A HD11 1  
ATOM 284   H HD12 . LEU A 1 49  ? 31.564 21.705 23.188 1.00 1.08 ? 19 LEU A HD12 1  
ATOM 285   H HD13 . LEU A 1 49  ? 30.072 20.874 23.630 1.00 1.07 ? 19 LEU A HD13 1  
ATOM 286   H HD21 . LEU A 1 49  ? 31.029 24.242 26.019 1.00 1.21 ? 19 LEU A HD21 1  
ATOM 287   H HD22 . LEU A 1 49  ? 32.318 23.526 25.053 1.00 1.07 ? 19 LEU A HD22 1  
ATOM 288   H HD23 . LEU A 1 49  ? 31.593 22.610 26.374 1.00 1.07 ? 19 LEU A HD23 1  
ATOM 289   N N    . SER A 1 50  ? 27.017 24.487 23.772 1.00 0.43 ? 20 SER A N    1  
ATOM 290   C CA   . SER A 1 50  ? 25.840 24.586 24.631 1.00 0.52 ? 20 SER A CA   1  
ATOM 291   C C    . SER A 1 50  ? 24.694 23.714 24.125 1.00 0.51 ? 20 SER A C    1  
ATOM 292   O O    . SER A 1 50  ? 23.935 23.157 24.919 1.00 0.56 ? 20 SER A O    1  
ATOM 293   C CB   . SER A 1 50  ? 25.374 26.041 24.702 1.00 0.58 ? 20 SER A CB   1  
ATOM 294   O OG   . SER A 1 50  ? 26.458 26.859 25.123 1.00 1.28 ? 20 SER A OG   1  
ATOM 295   H H    . SER A 1 50  ? 27.391 25.298 23.370 1.00 0.42 ? 20 SER A H    1  
ATOM 296   H HA   . SER A 1 50  ? 26.108 24.264 25.626 1.00 0.55 ? 20 SER A HA   1  
ATOM 297   H HB2  . SER A 1 50  ? 25.046 26.367 23.729 1.00 1.33 ? 20 SER A HB2  1  
ATOM 298   H HB3  . SER A 1 50  ? 24.551 26.120 25.399 1.00 1.08 ? 20 SER A HB3  1  
ATOM 299   H HG   . SER A 1 50  ? 26.733 26.563 25.927 1.00 1.68 ? 20 SER A HG   1  
ATOM 300   N N    . VAL A 1 51  ? 24.570 23.596 22.807 1.00 0.46 ? 21 VAL A N    1  
ATOM 301   C CA   . VAL A 1 51  ? 23.530 22.747 22.224 1.00 0.47 ? 21 VAL A CA   1  
ATOM 302   C C    . VAL A 1 51  ? 23.960 21.282 22.053 1.00 0.41 ? 21 VAL A C    1  
ATOM 303   O O    . VAL A 1 51  ? 23.182 20.476 21.542 1.00 0.42 ? 21 VAL A O    1  
ATOM 304   C CB   . VAL A 1 51  ? 23.094 23.311 20.870 1.00 0.49 ? 21 VAL A CB   1  
ATOM 305   C CG1  . VAL A 1 51  ? 22.568 24.735 21.057 1.00 0.56 ? 21 VAL A CG1  1  
ATOM 306   C CG2  . VAL A 1 51  ? 24.287 23.335 19.914 1.00 0.42 ? 21 VAL A CG2  1  
ATOM 307   H H    . VAL A 1 51  ? 25.145 24.136 22.221 1.00 0.44 ? 21 VAL A H    1  
ATOM 308   H HA   . VAL A 1 51  ? 22.674 22.768 22.881 1.00 0.53 ? 21 VAL A HA   1  
ATOM 309   H HB   . VAL A 1 51  ? 22.312 22.691 20.457 1.00 0.51 ? 21 VAL A HB   1  
ATOM 310   H HG11 . VAL A 1 51  ? 21.830 24.745 21.845 1.00 1.20 ? 21 VAL A HG11 1  
ATOM 311   H HG12 . VAL A 1 51  ? 22.117 25.076 20.137 1.00 1.06 ? 21 VAL A HG12 1  
ATOM 312   H HG13 . VAL A 1 51  ? 23.386 25.389 21.322 1.00 1.19 ? 21 VAL A HG13 1  
ATOM 313   H HG21 . VAL A 1 51  ? 24.988 24.092 20.235 1.00 1.06 ? 21 VAL A HG21 1  
ATOM 314   H HG22 . VAL A 1 51  ? 23.945 23.563 18.916 1.00 1.01 ? 21 VAL A HG22 1  
ATOM 315   H HG23 . VAL A 1 51  ? 24.773 22.370 19.917 1.00 1.12 ? 21 VAL A HG23 1  
ATOM 316   N N    . GLY A 1 52  ? 25.177 20.926 22.469 1.00 0.36 ? 22 GLY A N    1  
ATOM 317   C CA   . GLY A 1 52  ? 25.669 19.559 22.287 1.00 0.33 ? 22 GLY A CA   1  
ATOM 318   C C    . GLY A 1 52  ? 26.338 19.333 20.924 1.00 0.28 ? 22 GLY A C    1  
ATOM 319   O O    . GLY A 1 52  ? 26.613 18.190 20.554 1.00 0.28 ? 22 GLY A O    1  
ATOM 320   H H    . GLY A 1 52  ? 25.743 21.578 22.929 1.00 0.37 ? 22 GLY A H    1  
ATOM 321   H HA2  . GLY A 1 52  ? 26.387 19.342 23.064 1.00 0.33 ? 22 GLY A HA2  1  
ATOM 322   H HA3  . GLY A 1 52  ? 24.838 18.876 22.382 1.00 0.35 ? 22 GLY A HA3  1  
ATOM 323   N N    . ASN A 1 53  ? 26.602 20.404 20.176 1.00 0.26 ? 23 ASN A N    1  
ATOM 324   C CA   . ASN A 1 53  ? 27.211 20.286 18.856 1.00 0.24 ? 23 ASN A CA   1  
ATOM 325   C C    . ASN A 1 53  ? 28.724 20.491 18.944 1.00 0.20 ? 23 ASN A C    1  
ATOM 326   O O    . ASN A 1 53  ? 29.272 21.479 18.447 1.00 0.18 ? 23 ASN A O    1  
ATOM 327   C CB   . ASN A 1 53  ? 26.580 21.325 17.924 1.00 0.28 ? 23 ASN A CB   1  
ATOM 328   C CG   . ASN A 1 53  ? 26.919 21.007 16.475 1.00 0.31 ? 23 ASN A CG   1  
ATOM 329   O OD1  . ASN A 1 53  ? 27.962 20.418 16.194 1.00 0.29 ? 23 ASN A OD1  1  
ATOM 330   N ND2  . ASN A 1 53  ? 26.096 21.378 15.533 1.00 0.37 ? 23 ASN A ND2  1  
ATOM 331   H H    . ASN A 1 53  ? 26.395 21.294 20.526 1.00 0.28 ? 23 ASN A H    1  
ATOM 332   H HA   . ASN A 1 53  ? 27.012 19.300 18.465 1.00 0.27 ? 23 ASN A HA   1  
ATOM 333   H HB2  . ASN A 1 53  ? 25.508 21.314 18.052 1.00 0.32 ? 23 ASN A HB2  1  
ATOM 334   H HB3  . ASN A 1 53  ? 26.960 22.305 18.174 1.00 0.28 ? 23 ASN A HB3  1  
ATOM 335   H HD21 . ASN A 1 53  ? 25.274 21.857 15.764 1.00 0.39 ? 23 ASN A HD21 1  
ATOM 336   H HD22 . ASN A 1 53  ? 26.300 21.175 14.596 1.00 0.40 ? 23 ASN A HD22 1  
ATOM 337   N N    . ILE A 1 54  ? 29.405 19.528 19.558 1.00 0.22 ? 24 ILE A N    1  
ATOM 338   C CA   . ILE A 1 54  ? 30.842 19.660 19.787 1.00 0.23 ? 24 ILE A CA   1  
ATOM 339   C C    . ILE A 1 54  ? 31.596 19.739 18.458 1.00 0.24 ? 24 ILE A C    1  
ATOM 340   O O    . ILE A 1 54  ? 32.568 20.488 18.343 1.00 0.23 ? 24 ILE A O    1  
ATOM 341   C CB   . ILE A 1 54  ? 31.352 18.468 20.609 1.00 0.30 ? 24 ILE A CB   1  
ATOM 342   C CG1  . ILE A 1 54  ? 30.581 18.384 21.930 1.00 0.32 ? 24 ILE A CG1  1  
ATOM 343   C CG2  . ILE A 1 54  ? 32.843 18.643 20.920 1.00 0.35 ? 24 ILE A CG2  1  
ATOM 344   C CD1  . ILE A 1 54  ? 30.956 17.093 22.662 1.00 0.39 ? 24 ILE A CD1  1  
ATOM 345   H H    . ILE A 1 54  ? 28.939 18.721 19.860 1.00 0.25 ? 24 ILE A H    1  
ATOM 346   H HA   . ILE A 1 54  ? 31.023 20.567 20.343 1.00 0.22 ? 24 ILE A HA   1  
ATOM 347   H HB   . ILE A 1 54  ? 31.207 17.556 20.048 1.00 0.33 ? 24 ILE A HB   1  
ATOM 348   H HG12 . ILE A 1 54  ? 30.831 19.235 22.546 1.00 0.33 ? 24 ILE A HG12 1  
ATOM 349   H HG13 . ILE A 1 54  ? 29.520 18.385 21.728 1.00 0.29 ? 24 ILE A HG13 1  
ATOM 350   H HG21 . ILE A 1 54  ? 32.977 19.500 21.564 1.00 1.08 ? 24 ILE A HG21 1  
ATOM 351   H HG22 . ILE A 1 54  ? 33.387 18.793 20.000 1.00 0.95 ? 24 ILE A HG22 1  
ATOM 352   H HG23 . ILE A 1 54  ? 33.212 17.758 21.417 1.00 1.02 ? 24 ILE A HG23 1  
ATOM 353   H HD11 . ILE A 1 54  ? 31.986 17.147 22.981 1.00 1.14 ? 24 ILE A HD11 1  
ATOM 354   H HD12 . ILE A 1 54  ? 30.828 16.253 21.997 1.00 1.10 ? 24 ILE A HD12 1  
ATOM 355   H HD13 . ILE A 1 54  ? 30.317 16.969 23.524 1.00 1.03 ? 24 ILE A HD13 1  
ATOM 356   N N    . ASP A 1 55  ? 31.134 19.001 17.451 1.00 0.27 ? 25 ASP A N    1  
ATOM 357   C CA   . ASP A 1 55  ? 31.818 18.992 16.162 1.00 0.31 ? 25 ASP A CA   1  
ATOM 358   C C    . ASP A 1 55  ? 31.842 20.392 15.553 1.00 0.28 ? 25 ASP A C    1  
ATOM 359   O O    . ASP A 1 55  ? 32.890 20.875 15.121 1.00 0.28 ? 25 ASP A O    1  
ATOM 360   C CB   . ASP A 1 55  ? 31.114 18.028 15.204 1.00 0.38 ? 25 ASP A CB   1  
ATOM 361   C CG   . ASP A 1 55  ? 31.215 16.593 15.717 1.00 1.28 ? 25 ASP A CG   1  
ATOM 362   O OD1  . ASP A 1 55  ? 30.310 15.824 15.440 1.00 2.06 ? 25 ASP A OD1  1  
ATOM 363   O OD2  . ASP A 1 55  ? 32.197 16.278 16.372 1.00 2.06 ? 25 ASP A OD2  1  
ATOM 364   H H    . ASP A 1 55  ? 30.327 18.459 17.576 1.00 0.29 ? 25 ASP A H    1  
ATOM 365   H HA   . ASP A 1 55  ? 32.834 18.658 16.307 1.00 0.34 ? 25 ASP A HA   1  
ATOM 366   H HB2  . ASP A 1 55  ? 30.073 18.304 15.121 1.00 0.93 ? 25 ASP A HB2  1  
ATOM 367   H HB3  . ASP A 1 55  ? 31.578 18.090 14.230 1.00 0.77 ? 25 ASP A HB3  1  
ATOM 368   N N    . ASP A 1 56  ? 30.693 21.064 15.568 1.00 0.26 ? 26 ASP A N    1  
ATOM 369   C CA   . ASP A 1 56  ? 30.616 22.417 15.029 1.00 0.26 ? 26 ASP A CA   1  
ATOM 370   C C    . ASP A 1 56  ? 31.492 23.372 15.830 1.00 0.19 ? 26 ASP A C    1  
ATOM 371   O O    . ASP A 1 56  ? 32.171 24.224 15.254 1.00 0.18 ? 26 ASP A O    1  
ATOM 372   C CB   . ASP A 1 56  ? 29.166 22.915 15.033 1.00 0.29 ? 26 ASP A CB   1  
ATOM 373   C CG   . ASP A 1 56  ? 28.339 22.219 13.950 1.00 0.37 ? 26 ASP A CG   1  
ATOM 374   O OD1  . ASP A 1 56  ? 27.294 22.751 13.611 1.00 1.16 ? 26 ASP A OD1  1  
ATOM 375   O OD2  . ASP A 1 56  ? 28.739 21.164 13.481 1.00 1.01 ? 26 ASP A OD2  1  
ATOM 376   H H    . ASP A 1 56  ? 29.886 20.642 15.930 1.00 0.27 ? 26 ASP A H    1  
ATOM 377   H HA   . ASP A 1 56  ? 30.970 22.401 14.009 1.00 0.30 ? 26 ASP A HA   1  
ATOM 378   H HB2  . ASP A 1 56  ? 28.727 22.714 15.998 1.00 0.26 ? 26 ASP A HB2  1  
ATOM 379   H HB3  . ASP A 1 56  ? 29.159 23.980 14.856 1.00 0.29 ? 26 ASP A HB3  1  
ATOM 380   N N    . ALA A 1 57  ? 31.515 23.201 17.151 1.00 0.15 ? 27 ALA A N    1  
ATOM 381   C CA   . ALA A 1 57  ? 32.325 24.073 17.994 1.00 0.12 ? 27 ALA A CA   1  
ATOM 382   C C    . ALA A 1 57  ? 33.797 23.958 17.606 1.00 0.13 ? 27 ALA A C    1  
ATOM 383   O O    . ALA A 1 57  ? 34.481 24.968 17.428 1.00 0.12 ? 27 ALA A O    1  
ATOM 384   C CB   . ALA A 1 57  ? 32.152 23.686 19.464 1.00 0.14 ? 27 ALA A CB   1  
ATOM 385   H H    . ALA A 1 57  ? 30.948 22.512 17.563 1.00 0.17 ? 27 ALA A H    1  
ATOM 386   H HA   . ALA A 1 57  ? 31.999 25.095 17.860 1.00 0.13 ? 27 ALA A HA   1  
ATOM 387   H HB1  . ALA A 1 57  ? 33.039 23.957 20.018 1.00 0.93 ? 27 ALA A HB1  1  
ATOM 388   H HB2  . ALA A 1 57  ? 31.994 22.620 19.540 1.00 0.98 ? 27 ALA A HB2  1  
ATOM 389   H HB3  . ALA A 1 57  ? 31.299 24.205 19.876 1.00 0.95 ? 27 ALA A HB3  1  
ATOM 390   N N    . LEU A 1 58  ? 34.274 22.726 17.436 1.00 0.16 ? 28 LEU A N    1  
ATOM 391   C CA   . LEU A 1 58  ? 35.654 22.516 17.013 1.00 0.20 ? 28 LEU A CA   1  
ATOM 392   C C    . LEU A 1 58  ? 35.908 23.162 15.654 1.00 0.18 ? 28 LEU A C    1  
ATOM 393   O O    . LEU A 1 58  ? 36.958 23.768 15.436 1.00 0.18 ? 28 LEU A O    1  
ATOM 394   C CB   . LEU A 1 58  ? 35.956 21.017 16.931 1.00 0.26 ? 28 LEU A CB   1  
ATOM 395   C CG   . LEU A 1 58  ? 35.806 20.380 18.315 1.00 0.27 ? 28 LEU A CG   1  
ATOM 396   C CD1  . LEU A 1 58  ? 35.935 18.861 18.192 1.00 0.33 ? 28 LEU A CD1  1  
ATOM 397   C CD2  . LEU A 1 58  ? 36.903 20.905 19.242 1.00 0.32 ? 28 LEU A CD2  1  
ATOM 398   H H    . LEU A 1 58  ? 33.698 21.954 17.618 1.00 0.18 ? 28 LEU A H    1  
ATOM 399   H HA   . LEU A 1 58  ? 36.315 22.965 17.739 1.00 0.21 ? 28 LEU A HA   1  
ATOM 400   H HB2  . LEU A 1 58  ? 35.267 20.550 16.243 1.00 0.26 ? 28 LEU A HB2  1  
ATOM 401   H HB3  . LEU A 1 58  ? 36.967 20.873 16.580 1.00 0.30 ? 28 LEU A HB3  1  
ATOM 402   H HG   . LEU A 1 58  ? 34.837 20.627 18.723 1.00 0.24 ? 28 LEU A HG   1  
ATOM 403   H HD11 . LEU A 1 58  ? 36.863 18.617 17.695 1.00 0.99 ? 28 LEU A HD11 1  
ATOM 404   H HD12 . LEU A 1 58  ? 35.107 18.474 17.616 1.00 1.14 ? 28 LEU A HD12 1  
ATOM 405   H HD13 . LEU A 1 58  ? 35.928 18.418 19.177 1.00 1.06 ? 28 LEU A HD13 1  
ATOM 406   H HD21 . LEU A 1 58  ? 36.627 21.882 19.610 1.00 1.05 ? 28 LEU A HD21 1  
ATOM 407   H HD22 . LEU A 1 58  ? 37.833 20.974 18.697 1.00 1.09 ? 28 LEU A HD22 1  
ATOM 408   H HD23 . LEU A 1 58  ? 37.025 20.227 20.075 1.00 1.07 ? 28 LEU A HD23 1  
ATOM 409   N N    . GLN A 1 59  ? 34.930 23.066 14.754 1.00 0.18 ? 29 GLN A N    1  
ATOM 410   C CA   . GLN A 1 59  ? 35.080 23.665 13.432 1.00 0.19 ? 29 GLN A CA   1  
ATOM 411   C C    . GLN A 1 59  ? 35.272 25.175 13.533 1.00 0.15 ? 29 GLN A C    1  
ATOM 412   O O    . GLN A 1 59  ? 36.164 25.736 12.893 1.00 0.16 ? 29 GLN A O    1  
ATOM 413   C CB   . GLN A 1 59  ? 33.845 23.363 12.581 1.00 0.22 ? 29 GLN A CB   1  
ATOM 414   C CG   . GLN A 1 59  ? 34.080 23.845 11.146 1.00 1.12 ? 29 GLN A CG   1  
ATOM 415   C CD   . GLN A 1 59  ? 32.886 23.510 10.252 1.00 1.57 ? 29 GLN A CD   1  
ATOM 416   O OE1  . GLN A 1 59  ? 31.968 22.797 10.661 1.00 1.80 ? 29 GLN A OE1  1  
ATOM 417   N NE2  . GLN A 1 59  ? 32.844 23.990 9.039  1.00 2.44 ? 29 GLN A NE2  1  
ATOM 418   H H    . GLN A 1 59  ? 34.124 22.549 14.966 1.00 0.19 ? 29 GLN A H    1  
ATOM 419   H HA   . GLN A 1 59  ? 35.946 23.235 12.950 1.00 0.21 ? 29 GLN A HA   1  
ATOM 420   H HB2  . GLN A 1 59  ? 33.663 22.297 12.578 1.00 0.82 ? 29 GLN A HB2  1  
ATOM 421   H HB3  . GLN A 1 59  ? 32.988 23.874 12.994 1.00 0.83 ? 29 GLN A HB3  1  
ATOM 422   H HG2  . GLN A 1 59  ? 34.229 24.915 11.153 1.00 1.74 ? 29 GLN A HG2  1  
ATOM 423   H HG3  . GLN A 1 59  ? 34.965 23.368 10.752 1.00 1.81 ? 29 GLN A HG3  1  
ATOM 424   H HE21 . GLN A 1 59  ? 33.572 24.558 8.713  1.00 2.79 ? 29 GLN A HE21 1  
ATOM 425   H HE22 . GLN A 1 59  ? 32.085 23.782 8.456  1.00 2.94 ? 29 GLN A HE22 1  
ATOM 426   N N    . TYR A 1 60  ? 34.461 25.829 14.363 1.00 0.13 ? 30 TYR A N    1  
ATOM 427   C CA   . TYR A 1 60  ? 34.599 27.269 14.554 1.00 0.13 ? 30 TYR A CA   1  
ATOM 428   C C    . TYR A 1 60  ? 35.982 27.615 15.094 1.00 0.12 ? 30 TYR A C    1  
ATOM 429   O O    . TYR A 1 60  ? 36.614 28.563 14.625 1.00 0.13 ? 30 TYR A O    1  
ATOM 430   C CB   . TYR A 1 60  ? 33.540 27.781 15.532 1.00 0.14 ? 30 TYR A CB   1  
ATOM 431   C CG   . TYR A 1 60  ? 32.133 27.740 14.986 1.00 0.16 ? 30 TYR A CG   1  
ATOM 432   C CD1  . TYR A 1 60  ? 31.192 26.859 15.534 1.00 0.21 ? 30 TYR A CD1  1  
ATOM 433   C CD2  . TYR A 1 60  ? 31.766 28.586 13.933 1.00 0.20 ? 30 TYR A CD2  1  
ATOM 434   C CE1  . TYR A 1 60  ? 29.887 26.825 15.029 1.00 0.25 ? 30 TYR A CE1  1  
ATOM 435   C CE2  . TYR A 1 60  ? 30.462 28.552 13.427 1.00 0.24 ? 30 TYR A CE2  1  
ATOM 436   C CZ   . TYR A 1 60  ? 29.522 27.670 13.975 1.00 0.24 ? 30 TYR A CZ   1  
ATOM 437   O OH   . TYR A 1 60  ? 28.235 27.637 13.477 1.00 0.29 ? 30 TYR A OH   1  
ATOM 438   H H    . TYR A 1 60  ? 33.739 25.347 14.814 1.00 0.13 ? 30 TYR A H    1  
ATOM 439   H HA   . TYR A 1 60  ? 34.461 27.763 13.604 1.00 0.15 ? 30 TYR A HA   1  
ATOM 440   H HB2  . TYR A 1 60  ? 33.575 27.178 16.426 1.00 0.14 ? 30 TYR A HB2  1  
ATOM 441   H HB3  . TYR A 1 60  ? 33.784 28.801 15.798 1.00 0.14 ? 30 TYR A HB3  1  
ATOM 442   H HD1  . TYR A 1 60  ? 31.475 26.206 16.347 1.00 0.25 ? 30 TYR A HD1  1  
ATOM 443   H HD2  . TYR A 1 60  ? 32.492 29.266 13.511 1.00 0.24 ? 30 TYR A HD2  1  
ATOM 444   H HE1  . TYR A 1 60  ? 29.162 26.145 15.453 1.00 0.30 ? 30 TYR A HE1  1  
ATOM 445   H HE2  . TYR A 1 60  ? 30.181 29.205 12.614 1.00 0.29 ? 30 TYR A HE2  1  
ATOM 446   H HH   . TYR A 1 60  ? 27.680 27.430 14.155 1.00 0.89 ? 30 TYR A HH   1  
ATOM 447   N N    . TYR A 1 61  ? 36.469 26.826 16.052 1.00 0.13 ? 31 TYR A N    1  
ATOM 448   C CA   . TYR A 1 61  ? 37.789 27.084 16.619 1.00 0.15 ? 31 TYR A CA   1  
ATOM 449   C C    . TYR A 1 61  ? 38.877 26.965 15.555 1.00 0.16 ? 31 TYR A C    1  
ATOM 450   O O    . TYR A 1 61  ? 39.791 27.790 15.504 1.00 0.17 ? 31 TYR A O    1  
ATOM 451   C CB   . TYR A 1 61  ? 38.075 26.108 17.761 1.00 0.18 ? 31 TYR A CB   1  
ATOM 452   C CG   . TYR A 1 61  ? 37.132 26.253 18.935 1.00 0.20 ? 31 TYR A CG   1  
ATOM 453   C CD1  . TYR A 1 61  ? 36.789 27.526 19.407 1.00 0.22 ? 31 TYR A CD1  1  
ATOM 454   C CD2  . TYR A 1 61  ? 36.604 25.113 19.552 1.00 0.22 ? 31 TYR A CD2  1  
ATOM 455   C CE1  . TYR A 1 61  ? 35.917 27.658 20.495 1.00 0.25 ? 31 TYR A CE1  1  
ATOM 456   C CE2  . TYR A 1 61  ? 35.733 25.245 20.640 1.00 0.24 ? 31 TYR A CE2  1  
ATOM 457   C CZ   . TYR A 1 61  ? 35.389 26.518 21.110 1.00 0.26 ? 31 TYR A CZ   1  
ATOM 458   O OH   . TYR A 1 61  ? 34.530 26.647 22.183 1.00 0.30 ? 31 TYR A OH   1  
ATOM 459   H H    . TYR A 1 61  ? 35.922 26.092 16.403 1.00 0.13 ? 31 TYR A H    1  
ATOM 460   H HA   . TYR A 1 61  ? 37.804 28.089 17.014 1.00 0.16 ? 31 TYR A HA   1  
ATOM 461   H HB2  . TYR A 1 61  ? 37.995 25.101 17.383 1.00 0.18 ? 31 TYR A HB2  1  
ATOM 462   H HB3  . TYR A 1 61  ? 39.088 26.266 18.102 1.00 0.20 ? 31 TYR A HB3  1  
ATOM 463   H HD1  . TYR A 1 61  ? 37.196 28.406 18.933 1.00 0.23 ? 31 TYR A HD1  1  
ATOM 464   H HD2  . TYR A 1 61  ? 36.870 24.131 19.190 1.00 0.23 ? 31 TYR A HD2  1  
ATOM 465   H HE1  . TYR A 1 61  ? 35.653 28.639 20.860 1.00 0.29 ? 31 TYR A HE1  1  
ATOM 466   H HE2  . TYR A 1 61  ? 35.325 24.364 21.114 1.00 0.27 ? 31 TYR A HE2  1  
ATOM 467   H HH   . TYR A 1 61  ? 34.979 27.049 22.852 1.00 0.78 ? 31 TYR A HH   1  
ATOM 468   N N    . ALA A 1 62  ? 38.745 25.982 14.668 1.00 0.15 ? 32 ALA A N    1  
ATOM 469   C CA   . ALA A 1 62  ? 39.730 25.803 13.606 1.00 0.17 ? 32 ALA A CA   1  
ATOM 470   C C    . ALA A 1 62  ? 39.743 27.012 12.679 1.00 0.14 ? 32 ALA A C    1  
ATOM 471   O O    . ALA A 1 62  ? 40.806 27.533 12.332 1.00 0.15 ? 32 ALA A O    1  
ATOM 472   C CB   . ALA A 1 62  ? 39.406 24.543 12.799 1.00 0.19 ? 32 ALA A CB   1  
ATOM 473   H H    . ALA A 1 62  ? 38.002 25.348 14.753 1.00 0.15 ? 32 ALA A H    1  
ATOM 474   H HA   . ALA A 1 62  ? 40.708 25.690 14.050 1.00 0.19 ? 32 ALA A HA   1  
ATOM 475   H HB1  . ALA A 1 62  ? 38.345 24.509 12.596 1.00 1.02 ? 32 ALA A HB1  1  
ATOM 476   H HB2  . ALA A 1 62  ? 39.693 23.669 13.366 1.00 1.04 ? 32 ALA A HB2  1  
ATOM 477   H HB3  . ALA A 1 62  ? 39.951 24.562 11.867 1.00 1.03 ? 32 ALA A HB3  1  
ATOM 478   N N    . ALA A 1 63  ? 38.554 27.488 12.319 1.00 0.13 ? 33 ALA A N    1  
ATOM 479   C CA   . ALA A 1 63  ? 38.454 28.667 11.468 1.00 0.14 ? 33 ALA A CA   1  
ATOM 480   C C    . ALA A 1 63  ? 39.049 29.888 12.161 1.00 0.15 ? 33 ALA A C    1  
ATOM 481   O O    . ALA A 1 63  ? 39.730 30.695 11.530 1.00 0.15 ? 33 ALA A O    1  
ATOM 482   C CB   . ALA A 1 63  ? 36.988 28.938 11.123 1.00 0.16 ? 33 ALA A CB   1  
ATOM 483   H H    . ALA A 1 63  ? 37.738 27.024 12.605 1.00 0.13 ? 33 ALA A H    1  
ATOM 484   H HA   . ALA A 1 63  ? 38.997 28.485 10.553 1.00 0.15 ? 33 ALA A HA   1  
ATOM 485   H HB1  . ALA A 1 63  ? 36.867 29.979 10.861 1.00 1.01 ? 33 ALA A HB1  1  
ATOM 486   H HB2  . ALA A 1 63  ? 36.368 28.708 11.976 1.00 1.00 ? 33 ALA A HB2  1  
ATOM 487   H HB3  . ALA A 1 63  ? 36.695 28.320 10.287 1.00 0.98 ? 33 ALA A HB3  1  
ATOM 488   N N    . ALA A 1 64  ? 38.828 30.001 13.469 1.00 0.18 ? 34 ALA A N    1  
ATOM 489   C CA   . ALA A 1 64  ? 39.355 31.135 14.220 1.00 0.22 ? 34 ALA A CA   1  
ATOM 490   C C    . ALA A 1 64  ? 40.882 31.170 14.153 1.00 0.22 ? 34 ALA A C    1  
ATOM 491   O O    . ALA A 1 64  ? 41.470 32.221 13.887 1.00 0.24 ? 34 ALA A O    1  
ATOM 492   C CB   . ALA A 1 64  ? 38.881 31.045 15.679 1.00 0.27 ? 34 ALA A CB   1  
ATOM 493   H H    . ALA A 1 64  ? 38.273 29.336 13.925 1.00 0.17 ? 34 ALA A H    1  
ATOM 494   H HA   . ALA A 1 64  ? 38.969 32.047 13.788 1.00 0.24 ? 34 ALA A HA   1  
ATOM 495   H HB1  . ALA A 1 64  ? 38.050 31.721 15.825 1.00 1.04 ? 34 ALA A HB1  1  
ATOM 496   H HB2  . ALA A 1 64  ? 39.681 31.314 16.354 1.00 1.09 ? 34 ALA A HB2  1  
ATOM 497   H HB3  . ALA A 1 64  ? 38.560 30.036 15.891 1.00 1.02 ? 34 ALA A HB3  1  
ATOM 498   N N    . ILE A 1 65  ? 41.517 30.014 14.340 1.00 0.21 ? 35 ILE A N    1  
ATOM 499   C CA   . ILE A 1 65  ? 42.974 29.957 14.283 1.00 0.23 ? 35 ILE A CA   1  
ATOM 500   C C    . ILE A 1 65  ? 43.472 30.374 12.901 1.00 0.18 ? 35 ILE A C    1  
ATOM 501   O O    . ILE A 1 65  ? 44.397 31.181 12.791 1.00 0.19 ? 35 ILE A O    1  
ATOM 502   C CB   . ILE A 1 65  ? 43.456 28.539 14.625 1.00 0.26 ? 35 ILE A CB   1  
ATOM 503   C CG1  . ILE A 1 65  ? 42.976 28.172 16.030 1.00 0.31 ? 35 ILE A CG1  1  
ATOM 504   C CG2  . ILE A 1 65  ? 44.987 28.469 14.596 1.00 0.29 ? 35 ILE A CG2  1  
ATOM 505   C CD1  . ILE A 1 65  ? 43.212 26.682 16.279 1.00 0.35 ? 35 ILE A CD1  1  
ATOM 506   H H    . ILE A 1 65  ? 41.005 29.205 14.551 1.00 0.21 ? 35 ILE A H    1  
ATOM 507   H HA   . ILE A 1 65  ? 43.376 30.642 15.015 1.00 0.27 ? 35 ILE A HA   1  
ATOM 508   H HB   . ILE A 1 65  ? 43.049 27.838 13.910 1.00 0.24 ? 35 ILE A HB   1  
ATOM 509   H HG12 . ILE A 1 65  ? 43.527 28.750 16.758 1.00 0.34 ? 35 ILE A HG12 1  
ATOM 510   H HG13 . ILE A 1 65  ? 41.924 28.390 16.122 1.00 0.30 ? 35 ILE A HG13 1  
ATOM 511   H HG21 . ILE A 1 65  ? 45.341 28.738 13.612 1.00 0.99 ? 35 ILE A HG21 1  
ATOM 512   H HG22 . ILE A 1 65  ? 45.306 27.465 14.833 1.00 1.03 ? 35 ILE A HG22 1  
ATOM 513   H HG23 . ILE A 1 65  ? 45.392 29.157 15.325 1.00 1.03 ? 35 ILE A HG23 1  
ATOM 514   H HD11 . ILE A 1 65  ? 42.942 26.122 15.395 1.00 1.16 ? 35 ILE A HD11 1  
ATOM 515   H HD12 . ILE A 1 65  ? 42.605 26.355 17.111 1.00 0.98 ? 35 ILE A HD12 1  
ATOM 516   H HD13 . ILE A 1 65  ? 44.254 26.515 16.506 1.00 1.05 ? 35 ILE A HD13 1  
ATOM 517   N N    . THR A 1 66  ? 42.846 29.846 11.849 1.00 0.15 ? 36 THR A N    1  
ATOM 518   C CA   . THR A 1 66  ? 43.264 30.192 10.494 1.00 0.12 ? 36 THR A CA   1  
ATOM 519   C C    . THR A 1 66  ? 43.110 31.690 10.237 1.00 0.12 ? 36 THR A C    1  
ATOM 520   O O    . THR A 1 66  ? 44.008 32.332 9.690  1.00 0.12 ? 36 THR A O    1  
ATOM 521   C CB   . THR A 1 66  ? 42.433 29.414 9.472  1.00 0.12 ? 36 THR A CB   1  
ATOM 522   O OG1  . THR A 1 66  ? 42.388 28.042 9.840  1.00 0.13 ? 36 THR A OG1  1  
ATOM 523   C CG2  . THR A 1 66  ? 43.076 29.547 8.091  1.00 0.15 ? 36 THR A CG2  1  
ATOM 524   H H    . THR A 1 66  ? 42.119 29.200 11.986 1.00 0.15 ? 36 THR A H    1  
ATOM 525   H HA   . THR A 1 66  ? 44.302 29.923 10.370 1.00 0.13 ? 36 THR A HA   1  
ATOM 526   H HB   . THR A 1 66  ? 41.431 29.813 9.438  1.00 0.12 ? 36 THR A HB   1  
ATOM 527   H HG1  . THR A 1 66  ? 41.874 27.611 9.239  1.00 0.13 ? 36 THR A HG1  1  
ATOM 528   H HG21 . THR A 1 66  ? 42.952 30.558 7.733  1.00 1.02 ? 36 THR A HG21 1  
ATOM 529   H HG22 . THR A 1 66  ? 42.604 28.861 7.405  1.00 1.04 ? 36 THR A HG22 1  
ATOM 530   H HG23 . THR A 1 66  ? 44.130 29.317 8.162  1.00 1.02 ? 36 THR A HG23 1  
ATOM 531   N N    . LEU A 1 67  ? 41.989 32.256 10.677 1.00 0.14 ? 37 LEU A N    1  
ATOM 532   C CA   . LEU A 1 67  ? 41.744 33.682 10.486 1.00 0.16 ? 37 LEU A CA   1  
ATOM 533   C C    . LEU A 1 67  ? 42.800 34.531 11.188 1.00 0.17 ? 37 LEU A C    1  
ATOM 534   O O    . LEU A 1 67  ? 43.162 35.603 10.701 1.00 0.17 ? 37 LEU A O    1  
ATOM 535   C CB   . LEU A 1 67  ? 40.353 34.048 11.007 1.00 0.19 ? 37 LEU A CB   1  
ATOM 536   C CG   . LEU A 1 67  ? 39.291 33.405 10.112 1.00 0.19 ? 37 LEU A CG   1  
ATOM 537   C CD1  . LEU A 1 67  ? 37.920 33.512 10.785 1.00 0.24 ? 37 LEU A CD1  1  
ATOM 538   C CD2  . LEU A 1 67  ? 39.254 34.132 8.766  1.00 0.20 ? 37 LEU A CD2  1  
ATOM 539   H H    . LEU A 1 67  ? 41.308 31.705 11.114 1.00 0.15 ? 37 LEU A H    1  
ATOM 540   H HA   . LEU A 1 67  ? 41.780 33.898 9.429  1.00 0.15 ? 37 LEU A HA   1  
ATOM 541   H HB2  . LEU A 1 67  ? 40.242 33.686 12.019 1.00 0.20 ? 37 LEU A HB2  1  
ATOM 542   H HB3  . LEU A 1 67  ? 40.233 35.120 10.991 1.00 0.21 ? 37 LEU A HB3  1  
ATOM 543   H HG   . LEU A 1 67  ? 39.534 32.365 9.954  1.00 0.18 ? 37 LEU A HG   1  
ATOM 544   H HD11 . LEU A 1 67  ? 37.795 32.687 11.470 1.00 1.02 ? 37 LEU A HD11 1  
ATOM 545   H HD12 . LEU A 1 67  ? 37.145 33.475 10.034 1.00 1.08 ? 37 LEU A HD12 1  
ATOM 546   H HD13 . LEU A 1 67  ? 37.855 34.443 11.327 1.00 1.02 ? 37 LEU A HD13 1  
ATOM 547   H HD21 . LEU A 1 67  ? 39.427 35.187 8.922  1.00 0.93 ? 37 LEU A HD21 1  
ATOM 548   H HD22 . LEU A 1 67  ? 38.288 33.990 8.306  1.00 0.96 ? 37 LEU A HD22 1  
ATOM 549   H HD23 . LEU A 1 67  ? 40.023 33.734 8.121  1.00 0.96 ? 37 LEU A HD23 1  
ATOM 550   N N    . ASP A 1 68  ? 43.260 34.074 12.350 1.00 0.18 ? 38 ASP A N    1  
ATOM 551   C CA   . ASP A 1 68  ? 44.342 34.761 13.044 1.00 0.20 ? 38 ASP A CA   1  
ATOM 552   C C    . ASP A 1 68  ? 45.634 34.694 12.235 1.00 0.19 ? 38 ASP A C    1  
ATOM 553   O O    . ASP A 1 68  ? 46.304 35.707 12.031 1.00 0.19 ? 38 ASP A O    1  
ATOM 554   C CB   . ASP A 1 68  ? 44.565 34.126 14.418 1.00 0.22 ? 38 ASP A CB   1  
ATOM 555   C CG   . ASP A 1 68  ? 45.564 34.952 15.219 1.00 0.26 ? 38 ASP A CG   1  
ATOM 556   O OD1  . ASP A 1 68  ? 46.735 34.608 15.203 1.00 1.09 ? 38 ASP A OD1  1  
ATOM 557   O OD2  . ASP A 1 68  ? 45.145 35.917 15.838 1.00 1.08 ? 38 ASP A OD2  1  
ATOM 558   H H    . ASP A 1 68  ? 42.836 33.294 12.766 1.00 0.18 ? 38 ASP A H    1  
ATOM 559   H HA   . ASP A 1 68  ? 44.068 35.795 13.182 1.00 0.22 ? 38 ASP A HA   1  
ATOM 560   H HB2  . ASP A 1 68  ? 43.626 34.084 14.949 1.00 0.23 ? 38 ASP A HB2  1  
ATOM 561   H HB3  . ASP A 1 68  ? 44.950 33.125 14.291 1.00 0.21 ? 38 ASP A HB3  1  
ATOM 562   N N    . LYS A 1 69  ? 45.980 33.495 11.776 1.00 0.18 ? 39 LYS A N    1  
ATOM 563   C CA   . LYS A 1 69  ? 47.203 33.310 10.997 1.00 0.18 ? 39 LYS A CA   1  
ATOM 564   C C    . LYS A 1 69  ? 47.198 34.143 9.714  1.00 0.17 ? 39 LYS A C    1  
ATOM 565   O O    . LYS A 1 69  ? 48.256 34.563 9.244  1.00 0.17 ? 39 LYS A O    1  
ATOM 566   C CB   . LYS A 1 69  ? 47.367 31.829 10.645 1.00 0.20 ? 39 LYS A CB   1  
ATOM 567   C CG   . LYS A 1 69  ? 48.725 31.600 9.978  1.00 1.15 ? 39 LYS A CG   1  
ATOM 568   C CD   . LYS A 1 69  ? 48.847 30.136 9.553  1.00 1.55 ? 39 LYS A CD   1  
ATOM 569   C CE   . LYS A 1 69  ? 50.259 29.872 9.027  1.00 2.40 ? 39 LYS A CE   1  
ATOM 570   N NZ   . LYS A 1 69  ? 51.231 29.941 10.154 1.00 3.07 ? 39 LYS A NZ   1  
ATOM 571   H H    . LYS A 1 69  ? 45.418 32.719 11.984 1.00 0.18 ? 39 LYS A H    1  
ATOM 572   H HA   . LYS A 1 69  ? 48.046 33.612 11.602 1.00 0.20 ? 39 LYS A HA   1  
ATOM 573   H HB2  . LYS A 1 69  ? 47.304 31.237 11.547 1.00 0.75 ? 39 LYS A HB2  1  
ATOM 574   H HB3  . LYS A 1 69  ? 46.581 31.533 9.965  1.00 0.84 ? 39 LYS A HB3  1  
ATOM 575   H HG2  . LYS A 1 69  ? 48.810 32.237 9.110  1.00 1.76 ? 39 LYS A HG2  1  
ATOM 576   H HG3  . LYS A 1 69  ? 49.513 31.835 10.677 1.00 1.83 ? 39 LYS A HG3  1  
ATOM 577   H HD2  . LYS A 1 69  ? 48.651 29.497 10.402 1.00 2.01 ? 39 LYS A HD2  1  
ATOM 578   H HD3  . LYS A 1 69  ? 48.131 29.926 8.772  1.00 1.77 ? 39 LYS A HD3  1  
ATOM 579   H HE2  . LYS A 1 69  ? 50.298 28.891 8.578  1.00 2.76 ? 39 LYS A HE2  1  
ATOM 580   H HE3  . LYS A 1 69  ? 50.512 30.616 8.286  1.00 2.86 ? 39 LYS A HE3  1  
ATOM 581   H HZ1  . LYS A 1 69  ? 51.961 30.650 9.940  1.00 3.49 ? 39 LYS A HZ1  1  
ATOM 582   H HZ2  . LYS A 1 69  ? 51.678 29.011 10.284 1.00 3.39 ? 39 LYS A HZ2  1  
ATOM 583   H HZ3  . LYS A 1 69  ? 50.735 30.213 11.026 1.00 3.41 ? 39 LYS A HZ3  1  
ATOM 584   N N    . TYR A 1 70  ? 46.017 34.383 9.148  1.00 0.15 ? 40 TYR A N    1  
ATOM 585   C CA   . TYR A 1 70  ? 45.916 35.167 7.923  1.00 0.15 ? 40 TYR A CA   1  
ATOM 586   C C    . TYR A 1 70  ? 46.527 36.561 8.141  1.00 0.16 ? 40 TYR A C    1  
ATOM 587   O O    . TYR A 1 70  ? 46.209 37.211 9.138  1.00 0.17 ? 40 TYR A O    1  
ATOM 588   C CB   . TYR A 1 70  ? 44.437 35.260 7.542  1.00 0.18 ? 40 TYR A CB   1  
ATOM 589   C CG   . TYR A 1 70  ? 44.160 35.948 6.227  1.00 0.17 ? 40 TYR A CG   1  
ATOM 590   C CD1  . TYR A 1 70  ? 44.518 35.334 5.020  1.00 0.34 ? 40 TYR A CD1  1  
ATOM 591   C CD2  . TYR A 1 70  ? 43.508 37.184 6.219  1.00 0.26 ? 40 TYR A CD2  1  
ATOM 592   C CE1  . TYR A 1 70  ? 44.226 35.964 3.805  1.00 0.49 ? 40 TYR A CE1  1  
ATOM 593   C CE2  . TYR A 1 70  ? 43.218 37.815 5.005  1.00 0.39 ? 40 TYR A CE2  1  
ATOM 594   C CZ   . TYR A 1 70  ? 43.577 37.205 3.796  1.00 0.48 ? 40 TYR A CZ   1  
ATOM 595   O OH   . TYR A 1 70  ? 43.290 37.826 2.598  1.00 0.66 ? 40 TYR A OH   1  
ATOM 596   H H    . TYR A 1 70  ? 45.209 33.979 9.530  1.00 0.16 ? 40 TYR A H    1  
ATOM 597   H HA   . TYR A 1 70  ? 46.442 34.637 7.146  1.00 0.16 ? 40 TYR A HA   1  
ATOM 598   H HB2  . TYR A 1 70  ? 44.036 34.261 7.486  1.00 0.30 ? 40 TYR A HB2  1  
ATOM 599   H HB3  . TYR A 1 70  ? 43.918 35.789 8.330  1.00 0.28 ? 40 TYR A HB3  1  
ATOM 600   H HD1  . TYR A 1 70  ? 45.022 34.379 5.028  1.00 0.43 ? 40 TYR A HD1  1  
ATOM 601   H HD2  . TYR A 1 70  ? 43.229 37.650 7.151  1.00 0.34 ? 40 TYR A HD2  1  
ATOM 602   H HE1  . TYR A 1 70  ? 44.501 35.491 2.873  1.00 0.65 ? 40 TYR A HE1  1  
ATOM 603   H HE2  . TYR A 1 70  ? 42.712 38.769 5.001  1.00 0.49 ? 40 TYR A HE2  1  
ATOM 604   H HH   . TYR A 1 70  ? 43.278 38.714 2.740  1.00 1.07 ? 40 TYR A HH   1  
ATOM 605   N N    . PRO A 1 71  ? 47.382 37.045 7.260  1.00 0.18 ? 41 PRO A N    1  
ATOM 606   C CA   . PRO A 1 71  ? 48.151 38.300 7.521  1.00 0.20 ? 41 PRO A CA   1  
ATOM 607   C C    . PRO A 1 71  ? 47.420 39.600 7.180  1.00 0.19 ? 41 PRO A C    1  
ATOM 608   O O    . PRO A 1 71  ? 48.059 40.652 7.123  1.00 0.21 ? 41 PRO A O    1  
ATOM 609   C CB   . PRO A 1 71  ? 49.382 38.134 6.632  1.00 0.22 ? 41 PRO A CB   1  
ATOM 610   C CG   . PRO A 1 71  ? 48.910 37.350 5.455  1.00 0.22 ? 41 PRO A CG   1  
ATOM 611   C CD   . PRO A 1 71  ? 47.701 36.529 5.914  1.00 0.19 ? 41 PRO A CD   1  
ATOM 612   H HA   . PRO A 1 71  ? 48.471 38.324 8.551  1.00 0.20 ? 41 PRO A HA   1  
ATOM 613   H HB2  . PRO A 1 71  ? 49.750 39.103 6.322  1.00 0.23 ? 41 PRO A HB2  1  
ATOM 614   H HB3  . PRO A 1 71  ? 50.152 37.586 7.154  1.00 0.23 ? 41 PRO A HB3  1  
ATOM 615   H HG2  . PRO A 1 71  ? 48.626 38.022 4.657  1.00 0.22 ? 41 PRO A HG2  1  
ATOM 616   H HG3  . PRO A 1 71  ? 49.688 36.682 5.119  1.00 0.24 ? 41 PRO A HG3  1  
ATOM 617   H HD2  . PRO A 1 71  ? 46.869 36.680 5.240  1.00 0.19 ? 41 PRO A HD2  1  
ATOM 618   H HD3  . PRO A 1 71  ? 47.958 35.483 5.970  1.00 0.19 ? 41 PRO A HD3  1  
ATOM 619   N N    . HIS A 1 72  ? 46.107 39.547 6.957  1.00 0.18 ? 42 HIS A N    1  
ATOM 620   C CA   . HIS A 1 72  ? 45.380 40.748 6.539  1.00 0.19 ? 42 HIS A CA   1  
ATOM 621   C C    . HIS A 1 72  ? 43.977 40.807 7.132  1.00 0.18 ? 42 HIS A C    1  
ATOM 622   O O    . HIS A 1 72  ? 43.362 39.778 7.407  1.00 0.17 ? 42 HIS A O    1  
ATOM 623   C CB   . HIS A 1 72  ? 45.284 40.791 5.014  1.00 0.20 ? 42 HIS A CB   1  
ATOM 624   C CG   . HIS A 1 72  ? 46.612 40.986 4.335  1.00 0.96 ? 42 HIS A CG   1  
ATOM 625   N ND1  . HIS A 1 72  ? 47.344 39.927 3.826  1.00 1.89 ? 42 HIS A ND1  1  
ATOM 626   C CD2  . HIS A 1 72  ? 47.353 42.114 4.075  1.00 1.76 ? 42 HIS A CD2  1  
ATOM 627   C CE1  . HIS A 1 72  ? 48.471 40.432 3.291  1.00 2.42 ? 42 HIS A CE1  1  
ATOM 628   N NE2  . HIS A 1 72  ? 48.527 41.760 3.416  1.00 2.32 ? 42 HIS A NE2  1  
ATOM 629   H H    . HIS A 1 72  ? 45.627 38.701 7.073  1.00 0.17 ? 42 HIS A H    1  
ATOM 630   H HA   . HIS A 1 72  ? 45.927 41.618 6.870  1.00 0.20 ? 42 HIS A HA   1  
ATOM 631   H HB2  . HIS A 1 72  ? 44.856 39.863 4.668  1.00 0.72 ? 42 HIS A HB2  1  
ATOM 632   H HB3  . HIS A 1 72  ? 44.622 41.599 4.734  1.00 0.72 ? 42 HIS A HB3  1  
ATOM 633   H HD1  . HIS A 1 72  ? 47.089 38.981 3.851  1.00 2.45 ? 42 HIS A HD1  1  
ATOM 634   H HD2  . HIS A 1 72  ? 47.068 43.121 4.342  1.00 2.39 ? 42 HIS A HD2  1  
ATOM 635   H HE1  . HIS A 1 72  ? 49.236 39.834 2.817  1.00 3.22 ? 42 HIS A HE1  1  
ATOM 636   N N    . LYS A 1 73  ? 43.484 42.024 7.356  1.00 0.19 ? 43 LYS A N    1  
ATOM 637   C CA   . LYS A 1 73  ? 42.086 42.200 7.728  1.00 0.19 ? 43 LYS A CA   1  
ATOM 638   C C    . LYS A 1 73  ? 41.200 41.705 6.593  1.00 0.19 ? 43 LYS A C    1  
ATOM 639   O O    . LYS A 1 73  ? 41.424 42.055 5.433  1.00 0.21 ? 43 LYS A O    1  
ATOM 640   C CB   . LYS A 1 73  ? 41.792 43.680 7.982  1.00 0.21 ? 43 LYS A CB   1  
ATOM 641   C CG   . LYS A 1 73  ? 40.387 43.829 8.566  1.00 0.21 ? 43 LYS A CG   1  
ATOM 642   C CD   . LYS A 1 73  ? 40.060 45.314 8.744  1.00 0.57 ? 43 LYS A CD   1  
ATOM 643   C CE   . LYS A 1 73  ? 38.722 45.459 9.469  1.00 1.04 ? 43 LYS A CE   1  
ATOM 644   N NZ   . LYS A 1 73  ? 37.620 45.000 8.577  1.00 1.69 ? 43 LYS A NZ   1  
ATOM 645   H H    . LYS A 1 73  ? 44.069 42.807 7.281  1.00 0.21 ? 43 LYS A H    1  
ATOM 646   H HA   . LYS A 1 73  ? 41.877 41.635 8.625  1.00 0.18 ? 43 LYS A HA   1  
ATOM 647   H HB2  . LYS A 1 73  ? 42.518 44.083 8.672  1.00 0.22 ? 43 LYS A HB2  1  
ATOM 648   H HB3  . LYS A 1 73  ? 41.847 44.220 7.049  1.00 0.22 ? 43 LYS A HB3  1  
ATOM 649   H HG2  . LYS A 1 73  ? 39.670 43.379 7.896  1.00 0.47 ? 43 LYS A HG2  1  
ATOM 650   H HG3  . LYS A 1 73  ? 40.341 43.337 9.526  1.00 0.34 ? 43 LYS A HG3  1  
ATOM 651   H HD2  . LYS A 1 73  ? 40.840 45.786 9.323  1.00 0.95 ? 43 LYS A HD2  1  
ATOM 652   H HD3  . LYS A 1 73  ? 39.995 45.787 7.775  1.00 1.05 ? 43 LYS A HD3  1  
ATOM 653   H HE2  . LYS A 1 73  ? 38.732 44.860 10.367 1.00 1.62 ? 43 LYS A HE2  1  
ATOM 654   H HE3  . LYS A 1 73  ? 38.565 46.495 9.731  1.00 1.59 ? 43 LYS A HE3  1  
ATOM 655   H HZ1  . LYS A 1 73  ? 37.812 44.028 8.261  1.00 2.16 ? 43 LYS A HZ1  1  
ATOM 656   H HZ2  . LYS A 1 73  ? 37.559 45.628 7.751  1.00 2.15 ? 43 LYS A HZ2  1  
ATOM 657   H HZ3  . LYS A 1 73  ? 36.721 45.022 9.098  1.00 2.18 ? 43 LYS A HZ3  1  
ATOM 658   N N    . ILE A 1 74  ? 40.199 40.894 6.922  1.00 0.17 ? 44 ILE A N    1  
ATOM 659   C CA   . ILE A 1 74  ? 39.267 40.413 5.905  1.00 0.18 ? 44 ILE A CA   1  
ATOM 660   C C    . ILE A 1 74  ? 38.075 41.360 5.782  1.00 0.19 ? 44 ILE A C    1  
ATOM 661   O O    . ILE A 1 74  ? 37.455 41.728 6.782  1.00 0.19 ? 44 ILE A O    1  
ATOM 662   C CB   . ILE A 1 74  ? 38.823 38.984 6.241  1.00 0.17 ? 44 ILE A CB   1  
ATOM 663   C CG1  . ILE A 1 74  ? 40.064 38.086 6.284  1.00 0.19 ? 44 ILE A CG1  1  
ATOM 664   C CG2  . ILE A 1 74  ? 37.857 38.461 5.172  1.00 0.19 ? 44 ILE A CG2  1  
ATOM 665   C CD1  . ILE A 1 74  ? 39.690 36.693 6.790  1.00 0.22 ? 44 ILE A CD1  1  
ATOM 666   H H    . ILE A 1 74  ? 40.100 40.603 7.855  1.00 0.17 ? 44 ILE A H    1  
ATOM 667   H HA   . ILE A 1 74  ? 39.783 40.394 4.955  1.00 0.19 ? 44 ILE A HA   1  
ATOM 668   H HB   . ILE A 1 74  ? 38.337 38.973 7.205  1.00 0.17 ? 44 ILE A HB   1  
ATOM 669   H HG12 . ILE A 1 74  ? 40.481 38.006 5.291  1.00 0.21 ? 44 ILE A HG12 1  
ATOM 670   H HG13 . ILE A 1 74  ? 40.797 38.520 6.946  1.00 0.19 ? 44 ILE A HG13 1  
ATOM 671   H HG21 . ILE A 1 74  ? 36.955 39.054 5.186  1.00 1.02 ? 44 ILE A HG21 1  
ATOM 672   H HG22 . ILE A 1 74  ? 37.613 37.429 5.376  1.00 1.00 ? 44 ILE A HG22 1  
ATOM 673   H HG23 . ILE A 1 74  ? 38.322 38.535 4.200  1.00 1.03 ? 44 ILE A HG23 1  
ATOM 674   H HD11 . ILE A 1 74  ? 39.012 36.785 7.626  1.00 1.04 ? 44 ILE A HD11 1  
ATOM 675   H HD12 . ILE A 1 74  ? 40.585 36.176 7.104  1.00 0.98 ? 44 ILE A HD12 1  
ATOM 676   H HD13 . ILE A 1 74  ? 39.213 36.139 5.996  1.00 1.04 ? 44 ILE A HD13 1  
ATOM 677   N N    . LYS A 1 75  ? 37.760 41.748 4.550  1.00 0.22 ? 45 LYS A N    1  
ATOM 678   C CA   . LYS A 1 75  ? 36.665 42.685 4.302  1.00 0.25 ? 45 LYS A CA   1  
ATOM 679   C C    . LYS A 1 75  ? 35.294 42.004 4.247  1.00 0.24 ? 45 LYS A C    1  
ATOM 680   O O    . LYS A 1 75  ? 34.271 42.672 4.405  1.00 0.25 ? 45 LYS A O    1  
ATOM 681   C CB   . LYS A 1 75  ? 36.912 43.426 2.988  1.00 0.33 ? 45 LYS A CB   1  
ATOM 682   C CG   . LYS A 1 75  ? 38.180 44.274 3.109  1.00 1.29 ? 45 LYS A CG   1  
ATOM 683   C CD   . LYS A 1 75  ? 38.370 45.096 1.833  1.00 1.38 ? 45 LYS A CD   1  
ATOM 684   C CE   . LYS A 1 75  ? 39.699 45.850 1.903  1.00 2.40 ? 45 LYS A CE   1  
ATOM 685   N NZ   . LYS A 1 75  ? 40.808 44.939 1.504  1.00 2.89 ? 45 LYS A NZ   1  
ATOM 686   H H    . LYS A 1 75  ? 38.273 41.399 3.791  1.00 0.24 ? 45 LYS A H    1  
ATOM 687   H HA   . LYS A 1 75  ? 36.650 43.411 5.101  1.00 0.26 ? 45 LYS A HA   1  
ATOM 688   H HB2  . LYS A 1 75  ? 37.031 42.708 2.188  1.00 1.05 ? 45 LYS A HB2  1  
ATOM 689   H HB3  . LYS A 1 75  ? 36.072 44.069 2.772  1.00 1.18 ? 45 LYS A HB3  1  
ATOM 690   H HG2  . LYS A 1 75  ? 38.089 44.937 3.956  1.00 2.04 ? 45 LYS A HG2  1  
ATOM 691   H HG3  . LYS A 1 75  ? 39.034 43.627 3.247  1.00 1.92 ? 45 LYS A HG3  1  
ATOM 692   H HD2  . LYS A 1 75  ? 38.373 44.437 0.977  1.00 1.48 ? 45 LYS A HD2  1  
ATOM 693   H HD3  . LYS A 1 75  ? 37.562 45.806 1.737  1.00 1.68 ? 45 LYS A HD3  1  
ATOM 694   H HE2  . LYS A 1 75  ? 39.670 46.696 1.233  1.00 2.99 ? 45 LYS A HE2  1  
ATOM 695   H HE3  . LYS A 1 75  ? 39.863 46.197 2.913  1.00 2.87 ? 45 LYS A HE3  1  
ATOM 696   H HZ1  . LYS A 1 75  ? 41.717 45.351 1.796  1.00 3.13 ? 45 LYS A HZ1  1  
ATOM 697   H HZ2  . LYS A 1 75  ? 40.799 44.814 0.472  1.00 3.32 ? 45 LYS A HZ2  1  
ATOM 698   H HZ3  . LYS A 1 75  ? 40.684 44.016 1.967  1.00 3.21 ? 45 LYS A HZ3  1  
ATOM 699   N N    . SER A 1 76  ? 35.262 40.693 4.011  1.00 0.22 ? 46 SER A N    1  
ATOM 700   C CA   . SER A 1 76  ? 33.993 39.974 3.942  1.00 0.24 ? 46 SER A CA   1  
ATOM 701   C C    . SER A 1 76  ? 34.175 38.500 4.290  1.00 0.21 ? 46 SER A C    1  
ATOM 702   O O    . SER A 1 76  ? 35.253 37.934 4.104  1.00 0.19 ? 46 SER A O    1  
ATOM 703   C CB   . SER A 1 76  ? 33.405 40.095 2.535  1.00 0.31 ? 46 SER A CB   1  
ATOM 704   O OG   . SER A 1 76  ? 34.205 39.347 1.628  1.00 0.34 ? 46 SER A OG   1  
ATOM 705   H H    . SER A 1 76  ? 36.101 40.205 3.875  1.00 0.21 ? 46 SER A H    1  
ATOM 706   H HA   . SER A 1 76  ? 33.302 40.415 4.644  1.00 0.27 ? 46 SER A HA   1  
ATOM 707   H HB2  . SER A 1 76  ? 32.401 39.702 2.525  1.00 0.35 ? 46 SER A HB2  1  
ATOM 708   H HB3  . SER A 1 76  ? 33.383 41.137 2.246  1.00 0.33 ? 46 SER A HB3  1  
ATOM 709   H HG   . SER A 1 76  ? 33.892 39.492 0.797  1.00 0.85 ? 46 SER A HG   1  
ATOM 710   N N    . GLY A 1 77  ? 33.110 37.886 4.792  1.00 0.24 ? 47 GLY A N    1  
ATOM 711   C CA   . GLY A 1 77  ? 33.137 36.466 5.132  1.00 0.25 ? 47 GLY A CA   1  
ATOM 712   C C    . GLY A 1 77  ? 33.359 35.592 3.899  1.00 0.25 ? 47 GLY A C    1  
ATOM 713   O O    . GLY A 1 77  ? 34.004 34.544 3.978  1.00 0.25 ? 47 GLY A O    1  
ATOM 714   H H    . GLY A 1 77  ? 32.279 38.389 4.918  1.00 0.26 ? 47 GLY A H    1  
ATOM 715   H HA2  . GLY A 1 77  ? 33.935 36.290 5.839  1.00 0.24 ? 47 GLY A HA2  1  
ATOM 716   H HA3  . GLY A 1 77  ? 32.196 36.196 5.588  1.00 0.30 ? 47 GLY A HA3  1  
ATOM 717   N N    . ALA A 1 78  ? 32.846 36.031 2.749  1.00 0.26 ? 48 ALA A N    1  
ATOM 718   C CA   . ALA A 1 78  ? 32.940 35.228 1.536  1.00 0.29 ? 48 ALA A CA   1  
ATOM 719   C C    . ALA A 1 78  ? 34.399 34.941 1.209  1.00 0.26 ? 48 ALA A C    1  
ATOM 720   O O    . ALA A 1 78  ? 34.749 33.819 0.840  1.00 0.27 ? 48 ALA A O    1  
ATOM 721   C CB   . ALA A 1 78  ? 32.285 35.967 0.367  1.00 0.32 ? 48 ALA A CB   1  
ATOM 722   H H    . ALA A 1 78  ? 32.401 36.904 2.719  1.00 0.27 ? 48 ALA A H    1  
ATOM 723   H HA   . ALA A 1 78  ? 32.423 34.292 1.693  1.00 0.31 ? 48 ALA A HA   1  
ATOM 724   H HB1  . ALA A 1 78  ? 32.679 36.970 0.310  1.00 1.06 ? 48 ALA A HB1  1  
ATOM 725   H HB2  . ALA A 1 78  ? 31.217 36.007 0.520  1.00 1.04 ? 48 ALA A HB2  1  
ATOM 726   H HB3  . ALA A 1 78  ? 32.497 35.443 -0.553 1.00 1.06 ? 48 ALA A HB3  1  
ATOM 727   N N    . GLU A 1 79  ? 35.248 35.957 1.342  1.00 0.25 ? 49 GLU A N    1  
ATOM 728   C CA   . GLU A 1 79  ? 36.684 35.741 1.217  1.00 0.24 ? 49 GLU A CA   1  
ATOM 729   C C    . GLU A 1 79  ? 37.185 34.783 2.299  1.00 0.21 ? 49 GLU A C    1  
ATOM 730   O O    . GLU A 1 79  ? 37.990 33.895 2.024  1.00 0.21 ? 49 GLU A O    1  
ATOM 731   C CB   . GLU A 1 79  ? 37.425 37.075 1.334  1.00 0.26 ? 49 GLU A CB   1  
ATOM 732   C CG   . GLU A 1 79  ? 38.912 36.865 1.024  1.00 1.13 ? 49 GLU A CG   1  
ATOM 733   C CD   . GLU A 1 79  ? 39.724 38.152 1.214  1.00 1.66 ? 49 GLU A CD   1  
ATOM 734   O OE1  . GLU A 1 79  ? 40.918 38.101 0.965  1.00 2.24 ? 49 GLU A OE1  1  
ATOM 735   O OE2  . GLU A 1 79  ? 39.162 39.165 1.602  1.00 2.20 ? 49 GLU A OE2  1  
ATOM 736   H H    . GLU A 1 79  ? 34.905 36.856 1.525  1.00 0.26 ? 49 GLU A H    1  
ATOM 737   H HA   . GLU A 1 79  ? 36.891 35.313 0.248  1.00 0.26 ? 49 GLU A HA   1  
ATOM 738   H HB2  . GLU A 1 79  ? 37.005 37.782 0.633  1.00 0.87 ? 49 GLU A HB2  1  
ATOM 739   H HB3  . GLU A 1 79  ? 37.321 37.458 2.339  1.00 0.90 ? 49 GLU A HB3  1  
ATOM 740   H HG2  . GLU A 1 79  ? 39.304 36.104 1.681  1.00 1.68 ? 49 GLU A HG2  1  
ATOM 741   H HG3  . GLU A 1 79  ? 39.013 36.532 0.001  1.00 1.66 ? 49 GLU A HG3  1  
ATOM 742   N N    . ALA A 1 80  ? 36.615 34.883 3.499  1.00 0.20 ? 50 ALA A N    1  
ATOM 743   C CA   . ALA A 1 80  ? 37.060 34.052 4.615  1.00 0.19 ? 50 ALA A CA   1  
ATOM 744   C C    . ALA A 1 80  ? 36.878 32.565 4.313  1.00 0.20 ? 50 ALA A C    1  
ATOM 745   O O    . ALA A 1 80  ? 37.712 31.742 4.691  1.00 0.20 ? 50 ALA A O    1  
ATOM 746   C CB   . ALA A 1 80  ? 36.275 34.412 5.877  1.00 0.22 ? 50 ALA A CB   1  
ATOM 747   H H    . ALA A 1 80  ? 35.889 35.528 3.639  1.00 0.21 ? 50 ALA A H    1  
ATOM 748   H HA   . ALA A 1 80  ? 38.107 34.243 4.795  1.00 0.19 ? 50 ALA A HA   1  
ATOM 749   H HB1  . ALA A 1 80  ? 36.860 34.161 6.749  1.00 1.03 ? 50 ALA A HB1  1  
ATOM 750   H HB2  . ALA A 1 80  ? 35.347 33.859 5.894  1.00 1.04 ? 50 ALA A HB2  1  
ATOM 751   H HB3  . ALA A 1 80  ? 36.062 35.471 5.878  1.00 1.01 ? 50 ALA A HB3  1  
ATOM 752   N N    . LYS A 1 81  ? 35.833 32.231 3.565  1.00 0.23 ? 51 LYS A N    1  
ATOM 753   C CA   . LYS A 1 81  ? 35.561 30.837 3.224  1.00 0.26 ? 51 LYS A CA   1  
ATOM 754   C C    . LYS A 1 81  ? 36.746 30.188 2.503  1.00 0.25 ? 51 LYS A C    1  
ATOM 755   O O    . LYS A 1 81  ? 36.933 28.974 2.596  1.00 0.26 ? 51 LYS A O    1  
ATOM 756   C CB   . LYS A 1 81  ? 34.317 30.759 2.335  1.00 0.31 ? 51 LYS A CB   1  
ATOM 757   C CG   . LYS A 1 81  ? 33.932 29.295 2.113  1.00 0.98 ? 51 LYS A CG   1  
ATOM 758   C CD   . LYS A 1 81  ? 32.739 29.220 1.158  1.00 1.10 ? 51 LYS A CD   1  
ATOM 759   C CE   . LYS A 1 81  ? 32.251 27.773 1.059  1.00 1.94 ? 51 LYS A CE   1  
ATOM 760   N NZ   . LYS A 1 81  ? 33.144 27.010 0.143  1.00 2.20 ? 51 LYS A NZ   1  
ATOM 761   H H    . LYS A 1 81  ? 35.204 32.931 3.286  1.00 0.25 ? 51 LYS A H    1  
ATOM 762   H HA   . LYS A 1 81  ? 35.367 30.289 4.133  1.00 0.27 ? 51 LYS A HA   1  
ATOM 763   H HB2  . LYS A 1 81  ? 33.501 31.278 2.815  1.00 0.98 ? 51 LYS A HB2  1  
ATOM 764   H HB3  . LYS A 1 81  ? 34.527 31.221 1.382  1.00 0.79 ? 51 LYS A HB3  1  
ATOM 765   H HG2  . LYS A 1 81  ? 34.770 28.763 1.688  1.00 1.50 ? 51 LYS A HG2  1  
ATOM 766   H HG3  . LYS A 1 81  ? 33.660 28.846 3.057  1.00 1.67 ? 51 LYS A HG3  1  
ATOM 767   H HD2  . LYS A 1 81  ? 31.940 29.846 1.530  1.00 1.31 ? 51 LYS A HD2  1  
ATOM 768   H HD3  . LYS A 1 81  ? 33.039 29.562 0.179  1.00 1.58 ? 51 LYS A HD3  1  
ATOM 769   H HE2  . LYS A 1 81  ? 32.269 27.320 2.039  1.00 2.61 ? 51 LYS A HE2  1  
ATOM 770   H HE3  . LYS A 1 81  ? 31.242 27.759 0.673  1.00 2.44 ? 51 LYS A HE3  1  
ATOM 771   H HZ1  . LYS A 1 81  ? 32.922 25.996 0.207  1.00 2.58 ? 51 LYS A HZ1  1  
ATOM 772   H HZ2  . LYS A 1 81  ? 34.136 27.165 0.417  1.00 2.46 ? 51 LYS A HZ2  1  
ATOM 773   H HZ3  . LYS A 1 81  ? 32.998 27.333 -0.835 1.00 2.51 ? 51 LYS A HZ3  1  
ATOM 774   N N    . LYS A 1 82  ? 37.544 30.980 1.788  1.00 0.24 ? 52 LYS A N    1  
ATOM 775   C CA   . LYS A 1 82  ? 38.693 30.439 1.065  1.00 0.25 ? 52 LYS A CA   1  
ATOM 776   C C    . LYS A 1 82  ? 39.704 29.765 1.999  1.00 0.23 ? 52 LYS A C    1  
ATOM 777   O O    . LYS A 1 82  ? 40.470 28.906 1.561  1.00 0.25 ? 52 LYS A O    1  
ATOM 778   C CB   . LYS A 1 82  ? 39.390 31.560 0.292  1.00 0.27 ? 52 LYS A CB   1  
ATOM 779   C CG   . LYS A 1 82  ? 38.444 32.107 -0.779 1.00 1.13 ? 52 LYS A CG   1  
ATOM 780   C CD   . LYS A 1 82  ? 39.177 33.154 -1.620 1.00 1.39 ? 52 LYS A CD   1  
ATOM 781   C CE   . LYS A 1 82  ? 38.199 33.787 -2.613 1.00 2.40 ? 52 LYS A CE   1  
ATOM 782   N NZ   . LYS A 1 82  ? 38.788 35.044 -3.155 1.00 2.99 ? 52 LYS A NZ   1  
ATOM 783   H H    . LYS A 1 82  ? 37.389 31.948 1.779  1.00 0.23 ? 52 LYS A H    1  
ATOM 784   H HA   . LYS A 1 82  ? 38.339 29.707 0.356  1.00 0.28 ? 52 LYS A HA   1  
ATOM 785   H HB2  . LYS A 1 82  ? 39.660 32.353 0.976  1.00 0.88 ? 52 LYS A HB2  1  
ATOM 786   H HB3  . LYS A 1 82  ? 40.280 31.173 -0.181 1.00 0.91 ? 52 LYS A HB3  1  
ATOM 787   H HG2  . LYS A 1 82  ? 38.115 31.297 -1.414 1.00 1.69 ? 52 LYS A HG2  1  
ATOM 788   H HG3  . LYS A 1 82  ? 37.589 32.565 -0.305 1.00 1.87 ? 52 LYS A HG3  1  
ATOM 789   H HD2  . LYS A 1 82  ? 39.579 33.918 -0.973 1.00 1.98 ? 52 LYS A HD2  1  
ATOM 790   H HD3  . LYS A 1 82  ? 39.981 32.681 -2.164 1.00 1.32 ? 52 LYS A HD3  1  
ATOM 791   H HE2  . LYS A 1 82  ? 38.014 33.097 -3.424 1.00 2.73 ? 52 LYS A HE2  1  
ATOM 792   H HE3  . LYS A 1 82  ? 37.271 34.010 -2.111 1.00 3.02 ? 52 LYS A HE3  1  
ATOM 793   H HZ1  . LYS A 1 82  ? 39.096 35.650 -2.369 1.00 3.34 ? 52 LYS A HZ1  1  
ATOM 794   H HZ2  . LYS A 1 82  ? 38.072 35.545 -3.719 1.00 3.38 ? 52 LYS A HZ2  1  
ATOM 795   H HZ3  . LYS A 1 82  ? 39.605 34.815 -3.755 1.00 3.30 ? 52 LYS A HZ3  1  
ATOM 796   N N    . LEU A 1 83  ? 39.715 30.145 3.278  1.00 0.20 ? 53 LEU A N    1  
ATOM 797   C CA   . LEU A 1 83  ? 40.723 29.642 4.204  1.00 0.19 ? 53 LEU A CA   1  
ATOM 798   C C    . LEU A 1 83  ? 40.325 28.265 4.751  1.00 0.21 ? 53 LEU A C    1  
ATOM 799   O O    . LEU A 1 83  ? 39.150 28.057 5.069  1.00 0.22 ? 53 LEU A O    1  
ATOM 800   C CB   . LEU A 1 83  ? 40.879 30.624 5.367  1.00 0.17 ? 53 LEU A CB   1  
ATOM 801   C CG   . LEU A 1 83  ? 41.698 31.834 4.913  1.00 0.23 ? 53 LEU A CG   1  
ATOM 802   C CD1  . LEU A 1 83  ? 41.539 32.967 5.927  1.00 0.25 ? 53 LEU A CD1  1  
ATOM 803   C CD2  . LEU A 1 83  ? 43.173 31.442 4.815  1.00 0.38 ? 53 LEU A CD2  1  
ATOM 804   H H    . LEU A 1 83  ? 39.027 30.759 3.609  1.00 0.19 ? 53 LEU A H    1  
ATOM 805   H HA   . LEU A 1 83  ? 41.658 29.585 3.673  1.00 0.21 ? 53 LEU A HA   1  
ATOM 806   H HB2  . LEU A 1 83  ? 39.902 30.951 5.693  1.00 0.21 ? 53 LEU A HB2  1  
ATOM 807   H HB3  . LEU A 1 83  ? 41.385 30.136 6.183  1.00 0.25 ? 53 LEU A HB3  1  
ATOM 808   H HG   . LEU A 1 83  ? 41.345 32.163 3.947  1.00 0.31 ? 53 LEU A HG   1  
ATOM 809   H HD11 . LEU A 1 83  ? 42.120 33.820 5.609  1.00 1.08 ? 53 LEU A HD11 1  
ATOM 810   H HD12 . LEU A 1 83  ? 41.886 32.636 6.895  1.00 0.95 ? 53 LEU A HD12 1  
ATOM 811   H HD13 . LEU A 1 83  ? 40.497 33.247 5.995  1.00 1.08 ? 53 LEU A HD13 1  
ATOM 812   H HD21 . LEU A 1 83  ? 43.457 30.885 5.695  1.00 0.99 ? 53 LEU A HD21 1  
ATOM 813   H HD22 . LEU A 1 83  ? 43.778 32.335 4.743  1.00 1.11 ? 53 LEU A HD22 1  
ATOM 814   H HD23 . LEU A 1 83  ? 43.327 30.833 3.937  1.00 1.12 ? 53 LEU A HD23 1  
ATOM 815   N N    . PRO A 1 84  ? 41.252 27.342 4.926  1.00 0.23 ? 54 PRO A N    1  
ATOM 816   C CA   . PRO A 1 84  ? 40.898 25.979 5.431  1.00 0.26 ? 54 PRO A CA   1  
ATOM 817   C C    . PRO A 1 84  ? 40.207 26.045 6.791  1.00 0.24 ? 54 PRO A C    1  
ATOM 818   O O    . PRO A 1 84  ? 40.710 26.672 7.725  1.00 0.22 ? 54 PRO A O    1  
ATOM 819   C CB   . PRO A 1 84  ? 42.235 25.233 5.536  1.00 0.28 ? 54 PRO A CB   1  
ATOM 820   C CG   . PRO A 1 84  ? 43.196 26.003 4.698  1.00 0.57 ? 54 PRO A CG   1  
ATOM 821   C CD   . PRO A 1 84  ? 42.707 27.449 4.698  1.00 0.26 ? 54 PRO A CD   1  
ATOM 822   H HA   . PRO A 1 84  ? 40.261 25.476 4.720  1.00 0.29 ? 54 PRO A HA   1  
ATOM 823   H HB2  . PRO A 1 84  ? 42.574 25.204 6.562  1.00 0.44 ? 54 PRO A HB2  1  
ATOM 824   H HB3  . PRO A 1 84  ? 42.134 24.232 5.146  1.00 0.40 ? 54 PRO A HB3  1  
ATOM 825   H HG2  . PRO A 1 84  ? 44.187 25.940 5.124  1.00 0.97 ? 54 PRO A HG2  1  
ATOM 826   H HG3  . PRO A 1 84  ? 43.197 25.626 3.688  1.00 0.92 ? 54 PRO A HG3  1  
ATOM 827   H HD2  . PRO A 1 84  ? 43.182 28.007 5.494  1.00 0.30 ? 54 PRO A HD2  1  
ATOM 828   H HD3  . PRO A 1 84  ? 42.900 27.909 3.741  1.00 0.35 ? 54 PRO A HD3  1  
ATOM 829   N N    . GLY A 1 85  ? 39.060 25.384 6.894  1.00 0.27 ? 55 GLY A N    1  
ATOM 830   C CA   . GLY A 1 85  ? 38.322 25.340 8.155  1.00 0.27 ? 55 GLY A CA   1  
ATOM 831   C C    . GLY A 1 85  ? 37.146 26.323 8.203  1.00 0.26 ? 55 GLY A C    1  
ATOM 832   O O    . GLY A 1 85  ? 36.317 26.230 9.110  1.00 0.28 ? 55 GLY A O    1  
ATOM 833   H H    . GLY A 1 85  ? 38.701 24.917 6.111  1.00 0.29 ? 55 GLY A H    1  
ATOM 834   H HA2  . GLY A 1 85  ? 37.942 24.340 8.297  1.00 0.31 ? 55 GLY A HA2  1  
ATOM 835   H HA3  . GLY A 1 85  ? 39.001 25.570 8.963  1.00 0.26 ? 55 GLY A HA3  1  
ATOM 836   N N    . VAL A 1 86  ? 37.062 27.256 7.251  1.00 0.24 ? 56 VAL A N    1  
ATOM 837   C CA   . VAL A 1 86  ? 35.954 28.210 7.239  1.00 0.24 ? 56 VAL A CA   1  
ATOM 838   C C    . VAL A 1 86  ? 34.777 27.638 6.452  1.00 0.24 ? 56 VAL A C    1  
ATOM 839   O O    . VAL A 1 86  ? 34.954 27.090 5.363  1.00 0.26 ? 56 VAL A O    1  
ATOM 840   C CB   . VAL A 1 86  ? 36.395 29.542 6.619  1.00 0.26 ? 56 VAL A CB   1  
ATOM 841   C CG1  . VAL A 1 86  ? 35.258 30.561 6.736  1.00 0.27 ? 56 VAL A CG1  1  
ATOM 842   C CG2  . VAL A 1 86  ? 37.623 30.082 7.359  1.00 0.29 ? 56 VAL A CG2  1  
ATOM 843   H H    . VAL A 1 86  ? 37.754 27.314 6.557  1.00 0.24 ? 56 VAL A H    1  
ATOM 844   H HA   . VAL A 1 86  ? 35.637 28.388 8.256  1.00 0.26 ? 56 VAL A HA   1  
ATOM 845   H HB   . VAL A 1 86  ? 36.635 29.391 5.578  1.00 0.27 ? 56 VAL A HB   1  
ATOM 846   H HG11 . VAL A 1 86  ? 34.944 30.633 7.767  1.00 1.04 ? 56 VAL A HG11 1  
ATOM 847   H HG12 . VAL A 1 86  ? 34.426 30.244 6.126  1.00 0.98 ? 56 VAL A HG12 1  
ATOM 848   H HG13 . VAL A 1 86  ? 35.605 31.527 6.397  1.00 1.00 ? 56 VAL A HG13 1  
ATOM 849   H HG21 . VAL A 1 86  ? 37.833 31.086 7.022  1.00 1.04 ? 56 VAL A HG21 1  
ATOM 850   H HG22 . VAL A 1 86  ? 38.473 29.448 7.153  1.00 1.08 ? 56 VAL A HG22 1  
ATOM 851   H HG23 . VAL A 1 86  ? 37.429 30.091 8.420  1.00 1.05 ? 56 VAL A HG23 1  
ATOM 852   N N    . GLY A 1 87  ? 33.577 27.767 7.011  1.00 0.25 ? 57 GLY A N    1  
ATOM 853   C CA   . GLY A 1 87  ? 32.373 27.250 6.364  1.00 0.28 ? 57 GLY A CA   1  
ATOM 854   C C    . GLY A 1 87  ? 31.436 28.385 5.966  1.00 0.27 ? 57 GLY A C    1  
ATOM 855   O O    . GLY A 1 87  ? 31.640 29.537 6.353  1.00 0.25 ? 57 GLY A O    1  
ATOM 856   H H    . GLY A 1 87  ? 33.498 28.224 7.874  1.00 0.26 ? 57 GLY A H    1  
ATOM 857   H HA2  . GLY A 1 87  ? 32.650 26.691 5.481  1.00 0.29 ? 57 GLY A HA2  1  
ATOM 858   H HA3  . GLY A 1 87  ? 31.856 26.596 7.050  1.00 0.32 ? 57 GLY A HA3  1  
ATOM 859   N N    . THR A 1 88  ? 30.394 28.052 5.212  1.00 0.31 ? 58 THR A N    1  
ATOM 860   C CA   . THR A 1 88  ? 29.452 29.066 4.750  1.00 0.32 ? 58 THR A CA   1  
ATOM 861   C C    . THR A 1 88  ? 28.819 29.790 5.934  1.00 0.33 ? 58 THR A C    1  
ATOM 862   O O    . THR A 1 88  ? 28.727 31.018 5.943  1.00 0.32 ? 58 THR A O    1  
ATOM 863   C CB   . THR A 1 88  ? 28.356 28.418 3.901  1.00 0.37 ? 58 THR A CB   1  
ATOM 864   O OG1  . THR A 1 88  ? 27.627 27.494 4.697  1.00 1.43 ? 58 THR A OG1  1  
ATOM 865   C CG2  . THR A 1 88  ? 28.987 27.687 2.714  1.00 1.41 ? 58 THR A CG2  1  
ATOM 866   H H    . THR A 1 88  ? 30.255 27.115 4.964  1.00 0.34 ? 58 THR A H    1  
ATOM 867   H HA   . THR A 1 88  ? 29.983 29.785 4.142  1.00 0.30 ? 58 THR A HA   1  
ATOM 868   H HB   . THR A 1 88  ? 27.687 29.181 3.533  1.00 0.93 ? 58 THR A HB   1  
ATOM 869   H HG1  . THR A 1 88  ? 26.811 27.397 4.333  1.00 1.89 ? 58 THR A HG1  1  
ATOM 870   H HG21 . THR A 1 88  ? 28.212 27.391 2.021  1.00 1.97 ? 58 THR A HG21 1  
ATOM 871   H HG22 . THR A 1 88  ? 29.508 26.810 3.066  1.00 1.91 ? 58 THR A HG22 1  
ATOM 872   H HG23 . THR A 1 88  ? 29.683 28.344 2.215  1.00 2.06 ? 58 THR A HG23 1  
ATOM 873   N N    . LYS A 1 89  ? 28.432 29.032 6.956  1.00 0.36 ? 59 LYS A N    1  
ATOM 874   C CA   . LYS A 1 89  ? 27.807 29.630 8.131  1.00 0.40 ? 59 LYS A CA   1  
ATOM 875   C C    . LYS A 1 89  ? 28.760 30.617 8.799  1.00 0.37 ? 59 LYS A C    1  
ATOM 876   O O    . LYS A 1 89  ? 28.362 31.716 9.187  1.00 0.39 ? 59 LYS A O    1  
ATOM 877   C CB   . LYS A 1 89  ? 27.418 28.539 9.130  1.00 0.45 ? 59 LYS A CB   1  
ATOM 878   C CG   . LYS A 1 89  ? 26.354 27.632 8.511  1.00 1.20 ? 59 LYS A CG   1  
ATOM 879   C CD   . LYS A 1 89  ? 25.890 26.608 9.549  1.00 1.58 ? 59 LYS A CD   1  
ATOM 880   C CE   . LYS A 1 89  ? 24.915 25.625 8.898  1.00 2.35 ? 59 LYS A CE   1  
ATOM 881   N NZ   . LYS A 1 89  ? 23.630 26.321 8.604  1.00 2.91 ? 59 LYS A NZ   1  
ATOM 882   H H    . LYS A 1 89  ? 28.567 28.061 6.919  1.00 0.37 ? 59 LYS A H    1  
ATOM 883   H HA   . LYS A 1 89  ? 26.915 30.156 7.825  1.00 0.42 ? 59 LYS A HA   1  
ATOM 884   H HB2  . LYS A 1 89  ? 28.291 27.953 9.380  1.00 1.00 ? 59 LYS A HB2  1  
ATOM 885   H HB3  . LYS A 1 89  ? 27.023 28.994 10.026 1.00 1.01 ? 59 LYS A HB3  1  
ATOM 886   H HG2  . LYS A 1 89  ? 25.513 28.231 8.194  1.00 1.77 ? 59 LYS A HG2  1  
ATOM 887   H HG3  . LYS A 1 89  ? 26.770 27.115 7.661  1.00 1.93 ? 59 LYS A HG3  1  
ATOM 888   H HD2  . LYS A 1 89  ? 26.745 26.069 9.929  1.00 2.05 ? 59 LYS A HD2  1  
ATOM 889   H HD3  . LYS A 1 89  ? 25.394 27.117 10.362 1.00 1.83 ? 59 LYS A HD3  1  
ATOM 890   H HE2  . LYS A 1 89  ? 25.341 25.252 7.977  1.00 2.68 ? 59 LYS A HE2  1  
ATOM 891   H HE3  . LYS A 1 89  ? 24.732 24.800 9.571  1.00 2.88 ? 59 LYS A HE3  1  
ATOM 892   H HZ1  . LYS A 1 89  ? 22.897 25.617 8.385  1.00 3.10 ? 59 LYS A HZ1  1  
ATOM 893   H HZ2  . LYS A 1 89  ? 23.759 26.955 7.789  1.00 3.40 ? 59 LYS A HZ2  1  
ATOM 894   H HZ3  . LYS A 1 89  ? 23.339 26.875 9.433  1.00 3.22 ? 59 LYS A HZ3  1  
ATOM 895   N N    . ILE A 1 90  ? 30.037 30.251 8.866  1.00 0.34 ? 60 ILE A N    1  
ATOM 896   C CA   . ILE A 1 90  ? 31.032 31.117 9.489  1.00 0.33 ? 60 ILE A CA   1  
ATOM 897   C C    . ILE A 1 90  ? 31.172 32.409 8.684  1.00 0.28 ? 60 ILE A C    1  
ATOM 898   O O    . ILE A 1 90  ? 31.222 33.501 9.251  1.00 0.31 ? 60 ILE A O    1  
ATOM 899   C CB   . ILE A 1 90  ? 32.375 30.380 9.593  1.00 0.32 ? 60 ILE A CB   1  
ATOM 900   C CG1  . ILE A 1 90  ? 32.180 29.107 10.426 1.00 0.39 ? 60 ILE A CG1  1  
ATOM 901   C CG2  . ILE A 1 90  ? 33.408 31.277 10.282 1.00 0.35 ? 60 ILE A CG2  1  
ATOM 902   C CD1  . ILE A 1 90  ? 33.436 28.227 10.396 1.00 0.40 ? 60 ILE A CD1  1  
ATOM 903   H H    . ILE A 1 90  ? 30.314 29.389 8.492  1.00 0.33 ? 60 ILE A H    1  
ATOM 904   H HA   . ILE A 1 90  ? 30.696 31.366 10.485 1.00 0.38 ? 60 ILE A HA   1  
ATOM 905   H HB   . ILE A 1 90  ? 32.723 30.119 8.604  1.00 0.28 ? 60 ILE A HB   1  
ATOM 906   H HG12 . ILE A 1 90  ? 31.965 29.384 11.447 1.00 0.45 ? 60 ILE A HG12 1  
ATOM 907   H HG13 . ILE A 1 90  ? 31.345 28.547 10.028 1.00 0.40 ? 60 ILE A HG13 1  
ATOM 908   H HG21 . ILE A 1 90  ? 34.381 30.808 10.232 1.00 1.12 ? 60 ILE A HG21 1  
ATOM 909   H HG22 . ILE A 1 90  ? 33.128 31.414 11.315 1.00 1.05 ? 60 ILE A HG22 1  
ATOM 910   H HG23 . ILE A 1 90  ? 33.443 32.236 9.786  1.00 1.04 ? 60 ILE A HG23 1  
ATOM 911   H HD11 . ILE A 1 90  ? 33.575 27.770 11.366 1.00 1.07 ? 60 ILE A HD11 1  
ATOM 912   H HD12 . ILE A 1 90  ? 34.304 28.823 10.154 1.00 1.07 ? 60 ILE A HD12 1  
ATOM 913   H HD13 . ILE A 1 90  ? 33.313 27.453 9.653  1.00 1.14 ? 60 ILE A HD13 1  
ATOM 914   N N    . ALA A 1 91  ? 31.182 32.286 7.360  1.00 0.24 ? 61 ALA A N    1  
ATOM 915   C CA   . ALA A 1 91  ? 31.270 33.460 6.501  1.00 0.22 ? 61 ALA A CA   1  
ATOM 916   C C    . ALA A 1 91  ? 30.099 34.403 6.767  1.00 0.26 ? 61 ALA A C    1  
ATOM 917   O O    . ALA A 1 91  ? 30.278 35.620 6.837  1.00 0.25 ? 61 ALA A O    1  
ATOM 918   C CB   . ALA A 1 91  ? 31.262 33.035 5.031  1.00 0.23 ? 61 ALA A CB   1  
ATOM 919   H H    . ALA A 1 91  ? 31.160 31.393 6.959  1.00 0.24 ? 61 ALA A H    1  
ATOM 920   H HA   . ALA A 1 91  ? 32.193 33.980 6.710  1.00 0.21 ? 61 ALA A HA   1  
ATOM 921   H HB1  . ALA A 1 91  ? 30.268 32.717 4.754  1.00 1.01 ? 61 ALA A HB1  1  
ATOM 922   H HB2  . ALA A 1 91  ? 31.954 32.218 4.890  1.00 0.95 ? 61 ALA A HB2  1  
ATOM 923   H HB3  . ALA A 1 91  ? 31.559 33.869 4.413  1.00 1.01 ? 61 ALA A HB3  1  
ATOM 924   N N    . GLU A 1 92  ? 28.904 33.841 6.942  1.00 0.34 ? 62 GLU A N    1  
ATOM 925   C CA   . GLU A 1 92  ? 27.730 34.663 7.221  1.00 0.41 ? 62 GLU A CA   1  
ATOM 926   C C    . GLU A 1 92  ? 27.889 35.425 8.534  1.00 0.42 ? 62 GLU A C    1  
ATOM 927   O O    . GLU A 1 92  ? 27.534 36.603 8.611  1.00 0.43 ? 62 GLU A O    1  
ATOM 928   C CB   . GLU A 1 92  ? 26.476 33.788 7.286  1.00 0.50 ? 62 GLU A CB   1  
ATOM 929   C CG   . GLU A 1 92  ? 26.201 33.179 5.906  1.00 1.25 ? 62 GLU A CG   1  
ATOM 930   C CD   . GLU A 1 92  ? 24.911 32.352 5.896  1.00 1.45 ? 62 GLU A CD   1  
ATOM 931   O OE1  . GLU A 1 92  ? 24.488 31.985 4.812  1.00 1.97 ? 62 GLU A OE1  1  
ATOM 932   O OE2  . GLU A 1 92  ? 24.363 32.085 6.957  1.00 1.76 ? 62 GLU A OE2  1  
ATOM 933   H H    . GLU A 1 92  ? 28.808 32.870 6.845  1.00 0.35 ? 62 GLU A H    1  
ATOM 934   H HA   . GLU A 1 92  ? 27.609 35.376 6.418  1.00 0.40 ? 62 GLU A HA   1  
ATOM 935   H HB2  . GLU A 1 92  ? 26.628 32.997 8.007  1.00 0.88 ? 62 GLU A HB2  1  
ATOM 936   H HB3  . GLU A 1 92  ? 25.631 34.390 7.584  1.00 0.94 ? 62 GLU A HB3  1  
ATOM 937   H HG2  . GLU A 1 92  ? 26.113 33.974 5.181  1.00 1.74 ? 62 GLU A HG2  1  
ATOM 938   H HG3  . GLU A 1 92  ? 27.029 32.544 5.630  1.00 1.71 ? 62 GLU A HG3  1  
ATOM 939   N N    . LYS A 1 93  ? 28.451 34.776 9.554  1.00 0.44 ? 63 LYS A N    1  
ATOM 940   C CA   . LYS A 1 93  ? 28.706 35.465 10.819 1.00 0.49 ? 63 LYS A CA   1  
ATOM 941   C C    . LYS A 1 93  ? 29.659 36.639 10.610 1.00 0.42 ? 63 LYS A C    1  
ATOM 942   O O    . LYS A 1 93  ? 29.455 37.718 11.170 1.00 0.44 ? 63 LYS A O    1  
ATOM 943   C CB   . LYS A 1 93  ? 29.300 34.503 11.851 1.00 0.57 ? 63 LYS A CB   1  
ATOM 944   C CG   . LYS A 1 93  ? 28.342 33.335 12.105 1.00 1.09 ? 63 LYS A CG   1  
ATOM 945   C CD   . LYS A 1 93  ? 27.048 33.845 12.745 1.00 1.33 ? 63 LYS A CD   1  
ATOM 946   C CE   . LYS A 1 93  ? 26.201 32.653 13.196 1.00 2.00 ? 63 LYS A CE   1  
ATOM 947   N NZ   . LYS A 1 93  ? 25.166 33.117 14.163 1.00 2.64 ? 63 LYS A NZ   1  
ATOM 948   H H    . LYS A 1 93  ? 28.652 33.819 9.468  1.00 0.44 ? 63 LYS A H    1  
ATOM 949   H HA   . LYS A 1 93  ? 27.772 35.850 11.199 1.00 0.55 ? 63 LYS A HA   1  
ATOM 950   H HB2  . LYS A 1 93  ? 30.241 34.120 11.482 1.00 1.01 ? 63 LYS A HB2  1  
ATOM 951   H HB3  . LYS A 1 93  ? 29.469 35.032 12.777 1.00 1.08 ? 63 LYS A HB3  1  
ATOM 952   H HG2  . LYS A 1 93  ? 28.110 32.853 11.169 1.00 1.77 ? 63 LYS A HG2  1  
ATOM 953   H HG3  . LYS A 1 93  ? 28.811 32.624 12.769 1.00 1.84 ? 63 LYS A HG3  1  
ATOM 954   H HD2  . LYS A 1 93  ? 27.286 34.463 13.599 1.00 1.79 ? 63 LYS A HD2  1  
ATOM 955   H HD3  . LYS A 1 93  ? 26.490 34.422 12.024 1.00 1.85 ? 63 LYS A HD3  1  
ATOM 956   H HE2  . LYS A 1 93  ? 25.718 32.210 12.337 1.00 2.47 ? 63 LYS A HE2  1  
ATOM 957   H HE3  . LYS A 1 93  ? 26.835 31.919 13.671 1.00 2.45 ? 63 LYS A HE3  1  
ATOM 958   H HZ1  . LYS A 1 93  ? 25.535 33.926 14.703 1.00 3.00 ? 63 LYS A HZ1  1  
ATOM 959   H HZ2  . LYS A 1 93  ? 24.928 32.342 14.814 1.00 3.00 ? 63 LYS A HZ2  1  
ATOM 960   H HZ3  . LYS A 1 93  ? 24.313 33.410 13.645 1.00 3.05 ? 63 LYS A HZ3  1  
ATOM 961   N N    . ILE A 1 94  ? 30.678 36.443 9.777  1.00 0.34 ? 64 ILE A N    1  
ATOM 962   C CA   . ILE A 1 94  ? 31.609 37.525 9.467  1.00 0.29 ? 64 ILE A CA   1  
ATOM 963   C C    . ILE A 1 94  ? 30.863 38.689 8.811  1.00 0.27 ? 64 ILE A C    1  
ATOM 964   O O    . ILE A 1 94  ? 31.052 39.847 9.187  1.00 0.28 ? 64 ILE A O    1  
ATOM 965   C CB   . ILE A 1 94  ? 32.723 37.002 8.551  1.00 0.23 ? 64 ILE A CB   1  
ATOM 966   C CG1  . ILE A 1 94  ? 33.479 35.887 9.276  1.00 0.29 ? 64 ILE A CG1  1  
ATOM 967   C CG2  . ILE A 1 94  ? 33.710 38.120 8.198  1.00 0.22 ? 64 ILE A CG2  1  
ATOM 968   C CD1  . ILE A 1 94  ? 34.461 35.219 8.313  1.00 0.30 ? 64 ILE A CD1  1  
ATOM 969   H H    . ILE A 1 94  ? 30.826 35.551 9.397  1.00 0.32 ? 64 ILE A H    1  
ATOM 970   H HA   . ILE A 1 94  ? 32.053 37.875 10.388 1.00 0.34 ? 64 ILE A HA   1  
ATOM 971   H HB   . ILE A 1 94  ? 32.286 36.609 7.644  1.00 0.21 ? 64 ILE A HB   1  
ATOM 972   H HG12 . ILE A 1 94  ? 34.023 36.307 10.110 1.00 0.32 ? 64 ILE A HG12 1  
ATOM 973   H HG13 . ILE A 1 94  ? 32.778 35.152 9.639  1.00 0.33 ? 64 ILE A HG13 1  
ATOM 974   H HG21 . ILE A 1 94  ? 33.170 38.969 7.806  1.00 0.97 ? 64 ILE A HG21 1  
ATOM 975   H HG22 . ILE A 1 94  ? 34.406 37.762 7.451  1.00 1.04 ? 64 ILE A HG22 1  
ATOM 976   H HG23 . ILE A 1 94  ? 34.253 38.415 9.084  1.00 1.10 ? 64 ILE A HG23 1  
ATOM 977   H HD11 . ILE A 1 94  ? 34.902 34.355 8.789  1.00 1.05 ? 64 ILE A HD11 1  
ATOM 978   H HD12 . ILE A 1 94  ? 35.238 35.919 8.047  1.00 0.98 ? 64 ILE A HD12 1  
ATOM 979   H HD13 . ILE A 1 94  ? 33.936 34.909 7.421  1.00 1.09 ? 64 ILE A HD13 1  
ATOM 980   N N    . ASP A 1 95  ? 29.985 38.375 7.861  1.00 0.26 ? 65 ASP A N    1  
ATOM 981   C CA   . ASP A 1 95  ? 29.217 39.414 7.183  1.00 0.29 ? 65 ASP A CA   1  
ATOM 982   C C    . ASP A 1 95  ? 28.371 40.194 8.183  1.00 0.36 ? 65 ASP A C    1  
ATOM 983   O O    . ASP A 1 95  ? 28.316 41.424 8.136  1.00 0.38 ? 65 ASP A O    1  
ATOM 984   C CB   . ASP A 1 95  ? 28.303 38.789 6.124  1.00 0.32 ? 65 ASP A CB   1  
ATOM 985   C CG   . ASP A 1 95  ? 29.114 38.137 5.001  1.00 0.29 ? 65 ASP A CG   1  
ATOM 986   O OD1  . ASP A 1 95  ? 30.276 38.475 4.840  1.00 0.26 ? 65 ASP A OD1  1  
ATOM 987   O OD2  . ASP A 1 95  ? 28.553 37.299 4.313  1.00 0.30 ? 65 ASP A OD2  1  
ATOM 988   H H    . ASP A 1 95  ? 29.878 37.438 7.593  1.00 0.26 ? 65 ASP A H    1  
ATOM 989   H HA   . ASP A 1 95  ? 29.901 40.093 6.696  1.00 0.26 ? 65 ASP A HA   1  
ATOM 990   H HB2  . ASP A 1 95  ? 27.681 38.039 6.590  1.00 0.35 ? 65 ASP A HB2  1  
ATOM 991   H HB3  . ASP A 1 95  ? 27.672 39.559 5.703  1.00 0.36 ? 65 ASP A HB3  1  
ATOM 992   N N    . GLU A 1 96  ? 27.746 39.481 9.115  1.00 0.41 ? 66 GLU A N    1  
ATOM 993   C CA   . GLU A 1 96  ? 26.908 40.131 10.114 1.00 0.49 ? 66 GLU A CA   1  
ATOM 994   C C    . GLU A 1 96  ? 27.735 41.072 10.985 1.00 0.48 ? 66 GLU A C    1  
ATOM 995   O O    . GLU A 1 96  ? 27.336 42.214 11.226 1.00 0.51 ? 66 GLU A O    1  
ATOM 996   C CB   . GLU A 1 96  ? 26.236 39.076 10.996 1.00 0.55 ? 66 GLU A CB   1  
ATOM 997   C CG   . GLU A 1 96  ? 25.215 39.753 11.919 1.00 1.26 ? 66 GLU A CG   1  
ATOM 998   C CD   . GLU A 1 96  ? 24.575 38.757 12.893 1.00 1.56 ? 66 GLU A CD   1  
ATOM 999   O OE1  . GLU A 1 96  ? 23.724 39.187 13.655 1.00 2.13 ? 66 GLU A OE1  1  
ATOM 1000  O OE2  . GLU A 1 96  ? 24.931 37.588 12.876 1.00 2.02 ? 66 GLU A OE2  1  
ATOM 1001  H H    . GLU A 1 96  ? 27.824 38.505 9.108  1.00 0.41 ? 66 GLU A H    1  
ATOM 1002  H HA   . GLU A 1 96  ? 26.142 40.702 9.611  1.00 0.51 ? 66 GLU A HA   1  
ATOM 1003  H HB2  . GLU A 1 96  ? 25.733 38.352 10.371 1.00 1.04 ? 66 GLU A HB2  1  
ATOM 1004  H HB3  . GLU A 1 96  ? 26.984 38.579 11.595 1.00 0.96 ? 66 GLU A HB3  1  
ATOM 1005  H HG2  . GLU A 1 96  ? 25.713 40.526 12.486 1.00 1.74 ? 66 GLU A HG2  1  
ATOM 1006  H HG3  . GLU A 1 96  ? 24.441 40.204 11.315 1.00 1.93 ? 66 GLU A HG3  1  
ATOM 1007  N N    . PHE A 1 97  ? 28.902 40.610 11.430 1.00 0.45 ? 67 PHE A N    1  
ATOM 1008  C CA   . PHE A 1 97  ? 29.752 41.439 12.277 1.00 0.46 ? 67 PHE A CA   1  
ATOM 1009  C C    . PHE A 1 97  ? 30.148 42.724 11.555 1.00 0.41 ? 67 PHE A C    1  
ATOM 1010  O O    . PHE A 1 97  ? 30.167 43.796 12.159 1.00 0.44 ? 67 PHE A O    1  
ATOM 1011  C CB   . PHE A 1 97  ? 31.014 40.670 12.668 1.00 0.44 ? 67 PHE A CB   1  
ATOM 1012  C CG   . PHE A 1 97  ? 31.891 41.417 13.645 1.00 0.47 ? 67 PHE A CG   1  
ATOM 1013  C CD1  . PHE A 1 97  ? 32.927 42.233 13.176 1.00 0.36 ? 67 PHE A CD1  1  
ATOM 1014  C CD2  . PHE A 1 97  ? 31.665 41.295 15.022 1.00 0.70 ? 67 PHE A CD2  1  
ATOM 1015  C CE1  . PHE A 1 97  ? 33.737 42.927 14.082 1.00 0.41 ? 67 PHE A CE1  1  
ATOM 1016  C CE2  . PHE A 1 97  ? 32.475 41.988 15.928 1.00 0.73 ? 67 PHE A CE2  1  
ATOM 1017  C CZ   . PHE A 1 97  ? 33.512 42.804 15.459 1.00 0.57 ? 67 PHE A CZ   1  
ATOM 1018  H H    . PHE A 1 97  ? 29.178 39.696 11.209 1.00 0.43 ? 67 PHE A H    1  
ATOM 1019  H HA   . PHE A 1 97  ? 29.209 41.695 13.174 1.00 0.52 ? 67 PHE A HA   1  
ATOM 1020  H HB2  . PHE A 1 97  ? 30.725 39.732 13.117 1.00 0.50 ? 67 PHE A HB2  1  
ATOM 1021  H HB3  . PHE A 1 97  ? 31.583 40.462 11.772 1.00 0.38 ? 67 PHE A HB3  1  
ATOM 1022  H HD1  . PHE A 1 97  ? 33.103 42.325 12.114 1.00 0.33 ? 67 PHE A HD1  1  
ATOM 1023  H HD2  . PHE A 1 97  ? 30.865 40.665 15.384 1.00 0.86 ? 67 PHE A HD2  1  
ATOM 1024  H HE1  . PHE A 1 97  ? 34.537 43.556 13.720 1.00 0.42 ? 67 PHE A HE1  1  
ATOM 1025  H HE2  . PHE A 1 97  ? 32.301 41.894 16.990 1.00 0.91 ? 67 PHE A HE2  1  
ATOM 1026  H HZ   . PHE A 1 97  ? 34.137 43.340 16.158 1.00 0.62 ? 67 PHE A HZ   1  
ATOM 1027  N N    . LEU A 1 98  ? 30.465 42.616 10.266 1.00 0.35 ? 68 LEU A N    1  
ATOM 1028  C CA   . LEU A 1 98  ? 30.772 43.802 9.472  1.00 0.34 ? 68 LEU A CA   1  
ATOM 1029  C C    . LEU A 1 98  ? 29.561 44.728 9.379  1.00 0.41 ? 68 LEU A C    1  
ATOM 1030  O O    . LEU A 1 98  ? 29.699 45.950 9.441  1.00 0.43 ? 68 LEU A O    1  
ATOM 1031  C CB   . LEU A 1 98  ? 31.218 43.396 8.065  1.00 0.31 ? 68 LEU A CB   1  
ATOM 1032  C CG   . LEU A 1 98  ? 32.494 42.553 8.145  1.00 0.28 ? 68 LEU A CG   1  
ATOM 1033  C CD1  . LEU A 1 98  ? 32.838 42.019 6.751  1.00 0.29 ? 68 LEU A CD1  1  
ATOM 1034  C CD2  . LEU A 1 98  ? 33.651 43.418 8.651  1.00 0.34 ? 68 LEU A CD2  1  
ATOM 1035  H H    . LEU A 1 98  ? 30.520 41.728 9.852  1.00 0.32 ? 68 LEU A H    1  
ATOM 1036  H HA   . LEU A 1 98  ? 31.577 44.339 9.951  1.00 0.34 ? 68 LEU A HA   1  
ATOM 1037  H HB2  . LEU A 1 98  ? 30.436 42.819 7.594  1.00 0.32 ? 68 LEU A HB2  1  
ATOM 1038  H HB3  . LEU A 1 98  ? 31.413 44.282 7.480  1.00 0.35 ? 68 LEU A HB3  1  
ATOM 1039  H HG   . LEU A 1 98  ? 32.338 41.725 8.819  1.00 0.26 ? 68 LEU A HG   1  
ATOM 1040  H HD11 . LEU A 1 98  ? 32.590 42.763 6.009  1.00 1.02 ? 68 LEU A HD11 1  
ATOM 1041  H HD12 . LEU A 1 98  ? 32.274 41.118 6.562  1.00 1.10 ? 68 LEU A HD12 1  
ATOM 1042  H HD13 . LEU A 1 98  ? 33.895 41.799 6.699  1.00 1.06 ? 68 LEU A HD13 1  
ATOM 1043  H HD21 . LEU A 1 98  ? 34.589 42.982 8.340  1.00 1.05 ? 68 LEU A HD21 1  
ATOM 1044  H HD22 . LEU A 1 98  ? 33.618 43.469 9.729  1.00 1.04 ? 68 LEU A HD22 1  
ATOM 1045  H HD23 . LEU A 1 98  ? 33.563 44.414 8.241  1.00 1.10 ? 68 LEU A HD23 1  
ATOM 1046  N N    . ALA A 1 99  ? 28.375 44.144 9.228  1.00 0.45 ? 69 ALA A N    1  
ATOM 1047  C CA   . ALA A 1 99  ? 27.147 44.935 9.180  1.00 0.54 ? 69 ALA A CA   1  
ATOM 1048  C C    . ALA A 1 99  ? 26.920 45.703 10.481 1.00 0.58 ? 69 ALA A C    1  
ATOM 1049  O O    . ALA A 1 99  ? 26.384 46.812 10.468 1.00 0.64 ? 69 ALA A O    1  
ATOM 1050  C CB   . ALA A 1 99  ? 25.952 44.019 8.915  1.00 0.59 ? 69 ALA A CB   1  
ATOM 1051  H H    . ALA A 1 99  ? 28.328 43.172 9.109  1.00 0.43 ? 69 ALA A H    1  
ATOM 1052  H HA   . ALA A 1 99  ? 27.224 45.643 8.367  1.00 0.55 ? 69 ALA A HA   1  
ATOM 1053  H HB1  . ALA A 1 99  ? 25.143 44.596 8.490  1.00 1.13 ? 69 ALA A HB1  1  
ATOM 1054  H HB2  . ALA A 1 99  ? 25.627 43.573 9.843  1.00 1.19 ? 69 ALA A HB2  1  
ATOM 1055  H HB3  . ALA A 1 99  ? 26.240 43.241 8.224  1.00 1.21 ? 69 ALA A HB3  1  
ATOM 1056  N N    . THR A 1 100 ? 27.327 45.114 11.603 1.00 0.58 ? 70 THR A N    1  
ATOM 1057  C CA   . THR A 1 100 ? 27.222 45.791 12.895 1.00 0.64 ? 70 THR A CA   1  
ATOM 1058  C C    . THR A 1 100 ? 28.284 46.883 13.066 1.00 0.61 ? 70 THR A C    1  
ATOM 1059  O O    . THR A 1 100 ? 28.088 47.818 13.843 1.00 0.65 ? 70 THR A O    1  
ATOM 1060  C CB   . THR A 1 100 ? 27.361 44.765 14.022 1.00 0.67 ? 70 THR A CB   1  
ATOM 1061  O OG1  . THR A 1 100 ? 26.442 43.704 13.810 1.00 1.16 ? 70 THR A OG1  1  
ATOM 1062  C CG2  . THR A 1 100 ? 27.067 45.433 15.366 1.00 1.48 ? 70 THR A CG2  1  
ATOM 1063  H H    . THR A 1 100 ? 27.658 44.193 11.566 1.00 0.54 ? 70 THR A H    1  
ATOM 1064  H HA   . THR A 1 100 ? 26.245 46.245 12.967 1.00 0.70 ? 70 THR A HA   1  
ATOM 1065  H HB   . THR A 1 100 ? 28.368 44.374 14.031 1.00 1.15 ? 70 THR A HB   1  
ATOM 1066  H HG1  . THR A 1 100 ? 26.901 42.930 13.825 1.00 1.63 ? 70 THR A HG1  1  
ATOM 1067  H HG21 . THR A 1 100 ? 26.223 46.099 15.260 1.00 1.95 ? 70 THR A HG21 1  
ATOM 1068  H HG22 . THR A 1 100 ? 27.932 45.996 15.686 1.00 2.08 ? 70 THR A HG22 1  
ATOM 1069  H HG23 . THR A 1 100 ? 26.839 44.676 16.102 1.00 1.98 ? 70 THR A HG23 1  
ATOM 1070  N N    . GLY A 1 101 ? 29.402 46.772 12.349 1.00 0.54 ? 71 GLY A N    1  
ATOM 1071  C CA   . GLY A 1 101 ? 30.465 47.767 12.449 1.00 0.53 ? 71 GLY A CA   1  
ATOM 1072  C C    . GLY A 1 101 ? 31.837 47.101 12.439 1.00 1.30 ? 71 GLY A C    1  
ATOM 1073  O O    . GLY A 1 101 ? 32.362 46.726 13.486 1.00 2.07 ? 71 GLY A O    1  
ATOM 1074  H H    . GLY A 1 101 ? 29.512 46.010 11.744 1.00 0.51 ? 71 GLY A H    1  
ATOM 1075  H HA2  . GLY A 1 101 ? 30.393 48.447 11.613 1.00 1.11 ? 71 GLY A HA2  1  
ATOM 1076  H HA3  . GLY A 1 101 ? 30.349 48.319 13.369 1.00 1.18 ? 71 GLY A HA3  1  
ATOM 1077  N N    . GLU A 1 31  ? 47.533 43.183 18.393 1.00 0.00 ? 1  GLU A N    2  
ATOM 1078  C CA   . GLU A 1 31  ? 46.443 42.235 18.193 1.00 0.00 ? 1  GLU A CA   2  
ATOM 1079  C C    . GLU A 1 31  ? 46.222 41.979 16.705 1.00 0.00 ? 1  GLU A C    2  
ATOM 1080  O O    . GLU A 1 31  ? 46.250 42.906 15.895 1.00 0.00 ? 1  GLU A O    2  
ATOM 1081  C CB   . GLU A 1 31  ? 45.155 42.780 18.815 1.00 0.00 ? 1  GLU A CB   2  
ATOM 1082  C CG   . GLU A 1 31  ? 45.343 42.936 20.328 1.00 0.00 ? 1  GLU A CG   2  
ATOM 1083  C CD   . GLU A 1 31  ? 44.054 43.398 21.017 1.00 0.00 ? 1  GLU A CD   2  
ATOM 1084  O OE1  . GLU A 1 31  ? 44.027 43.365 22.236 1.00 0.00 ? 1  GLU A OE1  2  
ATOM 1085  O OE2  . GLU A 1 31  ? 43.119 43.788 20.333 1.00 0.00 ? 1  GLU A OE2  2  
ATOM 1086  H H    . GLU A 1 31  ? 47.346 44.144 18.433 1.00 0.00 ? 1  GLU A H    2  
ATOM 1087  H HA   . GLU A 1 31  ? 46.695 41.303 18.675 1.00 0.00 ? 1  GLU A HA   2  
ATOM 1088  H HB2  . GLU A 1 31  ? 44.924 43.741 18.378 1.00 0.00 ? 1  GLU A HB2  2  
ATOM 1089  H HB3  . GLU A 1 31  ? 44.344 42.093 18.625 1.00 0.00 ? 1  GLU A HB3  2  
ATOM 1090  H HG2  . GLU A 1 31  ? 45.642 41.986 20.746 1.00 0.00 ? 1  GLU A HG2  2  
ATOM 1091  H HG3  . GLU A 1 31  ? 46.122 43.661 20.513 1.00 0.00 ? 1  GLU A HG3  2  
ATOM 1092  N N    . THR A 1 32  ? 46.002 40.717 16.354 1.00 0.00 ? 2  THR A N    2  
ATOM 1093  C CA   . THR A 1 32  ? 45.775 40.350 14.961 1.00 0.00 ? 2  THR A CA   2  
ATOM 1094  C C    . THR A 1 32  ? 44.565 41.096 14.406 1.00 0.00 ? 2  THR A C    2  
ATOM 1095  O O    . THR A 1 32  ? 43.558 41.262 15.092 1.00 0.00 ? 2  THR A O    2  
ATOM 1096  C CB   . THR A 1 32  ? 45.548 38.841 14.851 1.00 0.00 ? 2  THR A CB   2  
ATOM 1097  O OG1  . THR A 1 32  ? 46.617 38.159 15.492 1.00 0.00 ? 2  THR A OG1  2  
ATOM 1098  C CG2  . THR A 1 32  ? 45.492 38.433 13.377 1.00 0.00 ? 2  THR A CG2  2  
ATOM 1099  H H    . THR A 1 32  ? 45.993 40.020 17.043 1.00 0.00 ? 2  THR A H    2  
ATOM 1100  H HA   . THR A 1 32  ? 46.646 40.615 14.382 1.00 0.00 ? 2  THR A HA   2  
ATOM 1101  H HB   . THR A 1 32  ? 44.615 38.580 15.328 1.00 0.00 ? 2  THR A HB   2  
ATOM 1102  H HG1  . THR A 1 32  ? 46.401 38.058 16.360 1.00 0.00 ? 2  THR A HG1  2  
ATOM 1103  H HG21 . THR A 1 32  ? 44.487 38.562 13.006 1.00 0.00 ? 2  THR A HG21 2  
ATOM 1104  H HG22 . THR A 1 32  ? 45.781 37.397 13.280 1.00 0.00 ? 2  THR A HG22 2  
ATOM 1105  H HG23 . THR A 1 32  ? 46.170 39.050 12.805 1.00 0.00 ? 2  THR A HG23 2  
ATOM 1106  N N    . LEU A 1 33  ? 44.645 41.491 13.141 1.00 0.00 ? 3  LEU A N    2  
ATOM 1107  C CA   . LEU A 1 33  ? 43.592 42.307 12.541 1.00 0.00 ? 3  LEU A CA   2  
ATOM 1108  C C    . LEU A 1 33  ? 42.225 41.622 12.600 1.00 0.00 ? 3  LEU A C    2  
ATOM 1109  O O    . LEU A 1 33  ? 41.195 42.294 12.660 1.00 0.00 ? 3  LEU A O    2  
ATOM 1110  C CB   . LEU A 1 33  ? 43.937 42.588 11.079 1.00 0.00 ? 3  LEU A CB   2  
ATOM 1111  C CG   . LEU A 1 33  ? 45.281 43.314 10.990 1.00 0.00 ? 3  LEU A CG   2  
ATOM 1112  C CD1  . LEU A 1 33  ? 45.723 43.390 9.527  1.00 0.00 ? 3  LEU A CD1  2  
ATOM 1113  C CD2  . LEU A 1 33  ? 45.130 44.732 11.542 1.00 0.00 ? 3  LEU A CD2  2  
ATOM 1114  H H    . LEU A 1 33  ? 45.421 41.232 12.602 1.00 0.00 ? 3  LEU A H    2  
ATOM 1115  H HA   . LEU A 1 33  ? 43.535 43.247 13.068 1.00 0.00 ? 3  LEU A HA   2  
ATOM 1116  H HB2  . LEU A 1 33  ? 43.994 41.656 10.537 1.00 0.00 ? 3  LEU A HB2  2  
ATOM 1117  H HB3  . LEU A 1 33  ? 43.168 43.209 10.648 1.00 0.00 ? 3  LEU A HB3  2  
ATOM 1118  H HG   . LEU A 1 33  ? 46.021 42.776 11.564 1.00 0.00 ? 3  LEU A HG   2  
ATOM 1119  H HD11 . LEU A 1 33  ? 45.758 42.394 9.109  1.00 0.00 ? 3  LEU A HD11 2  
ATOM 1120  H HD12 . LEU A 1 33  ? 46.703 43.839 9.470  1.00 0.00 ? 3  LEU A HD12 2  
ATOM 1121  H HD13 . LEU A 1 33  ? 45.019 43.989 8.969  1.00 0.00 ? 3  LEU A HD13 2  
ATOM 1122  H HD21 . LEU A 1 33  ? 46.017 45.303 11.314 1.00 0.00 ? 3  LEU A HD21 2  
ATOM 1123  H HD22 . LEU A 1 33  ? 44.994 44.689 12.613 1.00 0.00 ? 3  LEU A HD22 2  
ATOM 1124  H HD23 . LEU A 1 33  ? 44.271 45.204 11.088 1.00 0.00 ? 3  LEU A HD23 2  
ATOM 1125  N N    . ASN A 1 34  ? 42.211 40.292 12.584 1.00 0.00 ? 4  ASN A N    2  
ATOM 1126  C CA   . ASN A 1 34  ? 40.952 39.546 12.621 1.00 0.00 ? 4  ASN A CA   2  
ATOM 1127  C C    . ASN A 1 34  ? 40.570 39.089 14.039 1.00 0.00 ? 4  ASN A C    2  
ATOM 1128  O O    . ASN A 1 34  ? 39.611 38.335 14.207 1.00 0.00 ? 4  ASN A O    2  
ATOM 1129  C CB   . ASN A 1 34  ? 41.056 38.320 11.707 1.00 0.00 ? 4  ASN A CB   2  
ATOM 1130  C CG   . ASN A 1 34  ? 41.458 38.737 10.293 1.00 0.00 ? 4  ASN A CG   2  
ATOM 1131  O OD1  . ASN A 1 34  ? 40.847 39.630 9.701  1.00 0.00 ? 4  ASN A OD1  2  
ATOM 1132  N ND2  . ASN A 1 34  ? 42.455 38.132 9.706  1.00 0.00 ? 4  ASN A ND2  2  
ATOM 1133  H H    . ASN A 1 34  ? 43.059 39.803 12.546 1.00 0.00 ? 4  ASN A H    2  
ATOM 1134  H HA   . ASN A 1 34  ? 40.165 40.182 12.243 1.00 0.00 ? 4  ASN A HA   2  
ATOM 1135  H HB2  . ASN A 1 34  ? 41.799 37.643 12.104 1.00 0.00 ? 4  ASN A HB2  2  
ATOM 1136  H HB3  . ASN A 1 34  ? 40.100 37.819 11.672 1.00 0.00 ? 4  ASN A HB3  2  
ATOM 1137  H HD21 . ASN A 1 34  ? 42.933 37.410 10.167 1.00 0.00 ? 4  ASN A HD21 2  
ATOM 1138  H HD22 . ASN A 1 34  ? 42.738 38.413 8.810  1.00 0.00 ? 4  ASN A HD22 2  
ATOM 1139  N N    . GLY A 1 35  ? 41.289 39.550 15.065 1.00 0.00 ? 5  GLY A N    2  
ATOM 1140  C CA   . GLY A 1 35  ? 41.094 39.044 16.419 1.00 0.00 ? 5  GLY A CA   2  
ATOM 1141  C C    . GLY A 1 35  ? 39.636 39.137 16.855 1.00 0.00 ? 5  GLY A C    2  
ATOM 1142  O O    . GLY A 1 35  ? 39.125 38.227 17.511 1.00 0.00 ? 5  GLY A O    2  
ATOM 1143  H H    . GLY A 1 35  ? 41.960 40.247 14.910 1.00 0.00 ? 5  GLY A H    2  
ATOM 1144  H HA2  . GLY A 1 35  ? 41.407 38.010 16.455 1.00 0.00 ? 5  GLY A HA2  2  
ATOM 1145  H HA3  . GLY A 1 35  ? 41.701 39.620 17.101 1.00 0.00 ? 5  GLY A HA3  2  
ATOM 1146  N N    . ALA A 1 36  ? 38.961 40.220 16.480 1.00 0.00 ? 6  ALA A N    2  
ATOM 1147  C CA   . ALA A 1 36  ? 37.572 40.402 16.888 1.00 0.00 ? 6  ALA A CA   2  
ATOM 1148  C C    . ALA A 1 36  ? 36.718 39.253 16.361 1.00 0.00 ? 6  ALA A C    2  
ATOM 1149  O O    . ALA A 1 36  ? 35.947 38.644 17.107 1.00 0.00 ? 6  ALA A O    2  
ATOM 1150  C CB   . ALA A 1 36  ? 37.036 41.730 16.351 1.00 0.00 ? 6  ALA A CB   2  
ATOM 1151  H H    . ALA A 1 36  ? 39.398 40.899 15.925 1.00 0.00 ? 6  ALA A H    2  
ATOM 1152  H HA   . ALA A 1 36  ? 37.521 40.413 17.967 1.00 0.00 ? 6  ALA A HA   2  
ATOM 1153  H HB1  . ALA A 1 36  ? 37.376 42.537 16.983 1.00 0.00 ? 6  ALA A HB1  2  
ATOM 1154  H HB2  . ALA A 1 36  ? 35.957 41.707 16.345 1.00 0.00 ? 6  ALA A HB2  2  
ATOM 1155  H HB3  . ALA A 1 36  ? 37.398 41.884 15.345 1.00 0.00 ? 6  ALA A HB3  2  
ATOM 1156  N N    . LEU A 1 37  ? 36.880 38.934 15.080 1.00 0.00 ? 7  LEU A N    2  
ATOM 1157  C CA   . LEU A 1 37  ? 36.148 37.816 14.495 1.00 0.00 ? 7  LEU A CA   2  
ATOM 1158  C C    . LEU A 1 37  ? 36.521 36.499 15.176 1.00 0.00 ? 7  LEU A C    2  
ATOM 1159  O O    . LEU A 1 37  ? 35.663 35.636 15.364 1.00 0.00 ? 7  LEU A O    2  
ATOM 1160  C CB   . LEU A 1 37  ? 36.426 37.737 12.991 1.00 0.00 ? 7  LEU A CB   2  
ATOM 1161  C CG   . LEU A 1 37  ? 36.022 39.055 12.321 1.00 0.00 ? 7  LEU A CG   2  
ATOM 1162  C CD1  . LEU A 1 37  ? 36.398 39.017 10.839 1.00 0.00 ? 7  LEU A CD1  2  
ATOM 1163  C CD2  . LEU A 1 37  ? 34.509 39.259 12.440 1.00 0.00 ? 7  LEU A CD2  2  
ATOM 1164  H H    . LEU A 1 37  ? 37.497 39.455 14.524 1.00 0.00 ? 7  LEU A H    2  
ATOM 1165  H HA   . LEU A 1 37  ? 35.092 37.984 14.644 1.00 0.00 ? 7  LEU A HA   2  
ATOM 1166  H HB2  . LEU A 1 37  ? 37.479 37.557 12.830 1.00 0.00 ? 7  LEU A HB2  2  
ATOM 1167  H HB3  . LEU A 1 37  ? 35.853 36.928 12.562 1.00 0.00 ? 7  LEU A HB3  2  
ATOM 1168  H HG   . LEU A 1 37  ? 36.537 39.874 12.801 1.00 0.00 ? 7  LEU A HG   2  
ATOM 1169  H HD11 . LEU A 1 37  ? 37.448 39.243 10.728 1.00 0.00 ? 7  LEU A HD11 2  
ATOM 1170  H HD12 . LEU A 1 37  ? 35.812 39.749 10.303 1.00 0.00 ? 7  LEU A HD12 2  
ATOM 1171  H HD13 . LEU A 1 37  ? 36.197 38.033 10.441 1.00 0.00 ? 7  LEU A HD13 2  
ATOM 1172  H HD21 . LEU A 1 37  ? 34.185 39.984 11.707 1.00 0.00 ? 7  LEU A HD21 2  
ATOM 1173  H HD22 . LEU A 1 37  ? 34.271 39.618 13.431 1.00 0.00 ? 7  LEU A HD22 2  
ATOM 1174  H HD23 . LEU A 1 37  ? 34.004 38.321 12.266 1.00 0.00 ? 7  LEU A HD23 2  
ATOM 1175  N N    . VAL A 1 38  ? 37.784 36.357 15.584 1.00 0.00 ? 8  VAL A N    2  
ATOM 1176  C CA   . VAL A 1 38  ? 38.197 35.159 16.315 1.00 0.00 ? 8  VAL A CA   2  
ATOM 1177  C C    . VAL A 1 38  ? 37.396 35.042 17.612 1.00 0.00 ? 8  VAL A C    2  
ATOM 1178  O O    . VAL A 1 38  ? 36.939 33.957 17.974 1.00 0.00 ? 8  VAL A O    2  
ATOM 1179  C CB   . VAL A 1 38  ? 39.700 35.219 16.624 1.00 0.00 ? 8  VAL A CB   2  
ATOM 1180  C CG1  . VAL A 1 38  ? 40.158 33.947 17.351 1.00 0.00 ? 8  VAL A CG1  2  
ATOM 1181  C CG2  . VAL A 1 38  ? 40.482 35.356 15.313 1.00 0.00 ? 8  VAL A CG2  2  
ATOM 1182  H H    . VAL A 1 38  ? 38.445 37.047 15.360 1.00 0.00 ? 8  VAL A H    2  
ATOM 1183  H HA   . VAL A 1 38  ? 37.999 34.291 15.704 1.00 0.00 ? 8  VAL A HA   2  
ATOM 1184  H HB   . VAL A 1 38  ? 39.901 36.075 17.250 1.00 0.00 ? 8  VAL A HB   2  
ATOM 1185  H HG11 . VAL A 1 38  ? 41.120 34.126 17.807 1.00 0.00 ? 8  VAL A HG11 2  
ATOM 1186  H HG12 . VAL A 1 38  ? 40.247 33.140 16.640 1.00 0.00 ? 8  VAL A HG12 2  
ATOM 1187  H HG13 . VAL A 1 38  ? 39.446 33.675 18.115 1.00 0.00 ? 8  VAL A HG13 2  
ATOM 1188  H HG21 . VAL A 1 38  ? 39.984 34.796 14.535 1.00 0.00 ? 8  VAL A HG21 2  
ATOM 1189  H HG22 . VAL A 1 38  ? 41.485 34.976 15.443 1.00 0.00 ? 8  VAL A HG22 2  
ATOM 1190  H HG23 . VAL A 1 38  ? 40.530 36.396 15.032 1.00 0.00 ? 8  VAL A HG23 2  
ATOM 1191  N N    . ASN A 1 39  ? 37.190 36.169 18.290 1.00 0.00 ? 9  ASN A N    2  
ATOM 1192  C CA   . ASN A 1 39  ? 36.370 36.176 19.498 1.00 0.00 ? 9  ASN A CA   2  
ATOM 1193  C C    . ASN A 1 39  ? 34.940 35.748 19.178 1.00 0.00 ? 9  ASN A C    2  
ATOM 1194  O O    . ASN A 1 39  ? 34.326 34.987 19.929 1.00 0.00 ? 9  ASN A O    2  
ATOM 1195  C CB   . ASN A 1 39  ? 36.361 37.576 20.115 1.00 0.00 ? 9  ASN A CB   2  
ATOM 1196  C CG   . ASN A 1 39  ? 35.783 37.525 21.526 1.00 0.00 ? 9  ASN A CG   2  
ATOM 1197  O OD1  . ASN A 1 39  ? 35.822 36.482 22.180 1.00 0.00 ? 9  ASN A OD1  2  
ATOM 1198  N ND2  . ASN A 1 39  ? 35.243 38.597 22.038 1.00 0.00 ? 9  ASN A ND2  2  
ATOM 1199  H H    . ASN A 1 39  ? 37.624 36.996 17.994 1.00 0.00 ? 9  ASN A H    2  
ATOM 1200  H HA   . ASN A 1 39  ? 36.791 35.483 20.211 1.00 0.00 ? 9  ASN A HA   2  
ATOM 1201  H HB2  . ASN A 1 39  ? 37.371 37.955 20.156 1.00 0.00 ? 9  ASN A HB2  2  
ATOM 1202  H HB3  . ASN A 1 39  ? 35.757 38.231 19.506 1.00 0.00 ? 9  ASN A HB3  2  
ATOM 1203  H HD21 . ASN A 1 39  ? 35.212 39.427 21.517 1.00 0.00 ? 9  ASN A HD21 2  
ATOM 1204  H HD22 . ASN A 1 39  ? 34.870 38.573 22.944 1.00 0.00 ? 9  ASN A HD22 2  
ATOM 1205  N N    . MET A 1 40  ? 34.426 36.205 18.038 1.00 0.00 ? 10 MET A N    2  
ATOM 1206  C CA   . MET A 1 40  ? 33.078 35.826 17.626 1.00 0.00 ? 10 MET A CA   2  
ATOM 1207  C C    . MET A 1 40  ? 32.980 34.314 17.451 1.00 0.00 ? 10 MET A C    2  
ATOM 1208  O O    . MET A 1 40  ? 32.014 33.687 17.888 1.00 0.00 ? 10 MET A O    2  
ATOM 1209  C CB   . MET A 1 40  ? 32.766 36.478 16.279 1.00 0.00 ? 10 MET A CB   2  
ATOM 1210  C CG   . MET A 1 40  ? 31.268 36.386 15.986 1.00 0.00 ? 10 MET A CG   2  
ATOM 1211  S SD   . MET A 1 40  ? 30.966 36.767 14.240 1.00 0.00 ? 10 MET A SD   2  
ATOM 1212  C CE   . MET A 1 40  ? 31.624 38.453 14.214 1.00 0.00 ? 10 MET A CE   2  
ATOM 1213  H H    . MET A 1 40  ? 34.941 36.840 17.496 1.00 0.00 ? 10 MET A H    2  
ATOM 1214  H HA   . MET A 1 40  ? 32.361 36.158 18.361 1.00 0.00 ? 10 MET A HA   2  
ATOM 1215  H HB2  . MET A 1 40  ? 33.063 37.515 16.315 1.00 0.00 ? 10 MET A HB2  2  
ATOM 1216  H HB3  . MET A 1 40  ? 33.316 35.973 15.498 1.00 0.00 ? 10 MET A HB3  2  
ATOM 1217  H HG2  . MET A 1 40  ? 30.920 35.386 16.201 1.00 0.00 ? 10 MET A HG2  2  
ATOM 1218  H HG3  . MET A 1 40  ? 30.736 37.093 16.605 1.00 0.00 ? 10 MET A HG3  2  
ATOM 1219  H HE1  . MET A 1 40  ? 31.525 38.855 13.217 1.00 0.00 ? 10 MET A HE1  2  
ATOM 1220  H HE2  . MET A 1 40  ? 32.667 38.442 14.487 1.00 0.00 ? 10 MET A HE2  2  
ATOM 1221  H HE3  . MET A 1 40  ? 31.074 39.066 14.914 1.00 0.00 ? 10 MET A HE3  2  
ATOM 1222  N N    . LEU A 1 41  ? 34.008 33.727 16.846 1.00 0.00 ? 11 LEU A N    2  
ATOM 1223  C CA   . LEU A 1 41  ? 34.041 32.281 16.668 1.00 0.00 ? 11 LEU A CA   2  
ATOM 1224  C C    . LEU A 1 41  ? 34.055 31.566 18.013 1.00 0.00 ? 11 LEU A C    2  
ATOM 1225  O O    . LEU A 1 41  ? 33.370 30.560 18.188 1.00 0.00 ? 11 LEU A O    2  
ATOM 1226  C CB   . LEU A 1 41  ? 35.271 31.882 15.850 1.00 0.00 ? 11 LEU A CB   2  
ATOM 1227  C CG   . LEU A 1 41  ? 35.184 32.519 14.462 1.00 0.00 ? 11 LEU A CG   2  
ATOM 1228  C CD1  . LEU A 1 41  ? 36.494 32.290 13.709 1.00 0.00 ? 11 LEU A CD1  2  
ATOM 1229  C CD2  . LEU A 1 41  ? 34.041 31.879 13.674 1.00 0.00 ? 11 LEU A CD2  2  
ATOM 1230  H H    . LEU A 1 41  ? 34.734 34.277 16.485 1.00 0.00 ? 11 LEU A H    2  
ATOM 1231  H HA   . LEU A 1 41  ? 33.155 31.980 16.132 1.00 0.00 ? 11 LEU A HA   2  
ATOM 1232  H HB2  . LEU A 1 41  ? 36.164 32.226 16.352 1.00 0.00 ? 11 LEU A HB2  2  
ATOM 1233  H HB3  . LEU A 1 41  ? 35.304 30.808 15.749 1.00 0.00 ? 11 LEU A HB3  2  
ATOM 1234  H HG   . LEU A 1 41  ? 35.005 33.579 14.561 1.00 0.00 ? 11 LEU A HG   2  
ATOM 1235  H HD11 . LEU A 1 41  ? 37.233 33.000 14.049 1.00 0.00 ? 11 LEU A HD11 2  
ATOM 1236  H HD12 . LEU A 1 41  ? 36.328 32.421 12.650 1.00 0.00 ? 11 LEU A HD12 2  
ATOM 1237  H HD13 . LEU A 1 41  ? 36.845 31.286 13.897 1.00 0.00 ? 11 LEU A HD13 2  
ATOM 1238  H HD21 . LEU A 1 41  ? 33.101 32.309 13.987 1.00 0.00 ? 11 LEU A HD21 2  
ATOM 1239  H HD22 . LEU A 1 41  ? 34.029 30.814 13.855 1.00 0.00 ? 11 LEU A HD22 2  
ATOM 1240  H HD23 . LEU A 1 41  ? 34.189 32.063 12.622 1.00 0.00 ? 11 LEU A HD23 2  
ATOM 1241  N N    . LYS A 1 42  ? 34.818 32.098 18.966 1.00 0.00 ? 12 LYS A N    2  
ATOM 1242  C CA   . LYS A 1 42  ? 34.873 31.491 20.291 1.00 0.00 ? 12 LYS A CA   2  
ATOM 1243  C C    . LYS A 1 42  ? 33.484 31.457 20.924 1.00 0.00 ? 12 LYS A C    2  
ATOM 1244  O O    . LYS A 1 42  ? 33.093 30.453 21.524 1.00 0.00 ? 12 LYS A O    2  
ATOM 1245  C CB   . LYS A 1 42  ? 35.827 32.282 21.189 1.00 0.00 ? 12 LYS A CB   2  
ATOM 1246  C CG   . LYS A 1 42  ? 35.996 31.556 22.525 1.00 0.00 ? 12 LYS A CG   2  
ATOM 1247  C CD   . LYS A 1 42  ? 36.884 32.390 23.451 1.00 0.00 ? 12 LYS A CD   2  
ATOM 1248  C CE   . LYS A 1 42  ? 37.183 31.597 24.725 1.00 0.00 ? 12 LYS A CE   2  
ATOM 1249  N NZ   . LYS A 1 42  ? 36.046 31.741 25.678 1.00 0.00 ? 12 LYS A NZ   2  
ATOM 1250  H H    . LYS A 1 42  ? 35.378 32.876 18.763 1.00 0.00 ? 12 LYS A H    2  
ATOM 1251  H HA   . LYS A 1 42  ? 35.240 30.480 20.198 1.00 0.00 ? 12 LYS A HA   2  
ATOM 1252  H HB2  . LYS A 1 42  ? 36.788 32.369 20.702 1.00 0.00 ? 12 LYS A HB2  2  
ATOM 1253  H HB3  . LYS A 1 42  ? 35.422 33.267 21.366 1.00 0.00 ? 12 LYS A HB3  2  
ATOM 1254  H HG2  . LYS A 1 42  ? 35.028 31.416 22.983 1.00 0.00 ? 12 LYS A HG2  2  
ATOM 1255  H HG3  . LYS A 1 42  ? 36.459 30.595 22.358 1.00 0.00 ? 12 LYS A HG3  2  
ATOM 1256  H HD2  . LYS A 1 42  ? 37.810 32.625 22.946 1.00 0.00 ? 12 LYS A HD2  2  
ATOM 1257  H HD3  . LYS A 1 42  ? 36.374 33.305 23.712 1.00 0.00 ? 12 LYS A HD3  2  
ATOM 1258  H HE2  . LYS A 1 42  ? 37.314 30.554 24.476 1.00 0.00 ? 12 LYS A HE2  2  
ATOM 1259  H HE3  . LYS A 1 42  ? 38.086 31.975 25.181 1.00 0.00 ? 12 LYS A HE3  2  
ATOM 1260  H HZ1  . LYS A 1 42  ? 36.065 32.691 26.099 1.00 0.00 ? 12 LYS A HZ1  2  
ATOM 1261  H HZ2  . LYS A 1 42  ? 36.132 31.026 26.428 1.00 0.00 ? 12 LYS A HZ2  2  
ATOM 1262  H HZ3  . LYS A 1 42  ? 35.149 31.607 25.170 1.00 0.00 ? 12 LYS A HZ3  2  
ATOM 1263  N N    . GLU A 1 43  ? 32.721 32.534 20.745 1.00 0.00 ? 13 GLU A N    2  
ATOM 1264  C CA   . GLU A 1 43  ? 31.360 32.572 21.272 1.00 0.00 ? 13 GLU A CA   2  
ATOM 1265  C C    . GLU A 1 43  ? 30.488 31.518 20.597 1.00 0.00 ? 13 GLU A C    2  
ATOM 1266  O O    . GLU A 1 43  ? 29.751 30.789 21.265 1.00 0.00 ? 13 GLU A O    2  
ATOM 1267  C CB   . GLU A 1 43  ? 30.753 33.958 21.048 1.00 0.00 ? 13 GLU A CB   2  
ATOM 1268  C CG   . GLU A 1 43  ? 31.550 35.002 21.839 1.00 0.00 ? 13 GLU A CG   2  
ATOM 1269  C CD   . GLU A 1 43  ? 30.934 36.400 21.718 1.00 0.00 ? 13 GLU A CD   2  
ATOM 1270  O OE1  . GLU A 1 43  ? 31.365 37.269 22.457 1.00 0.00 ? 13 GLU A OE1  2  
ATOM 1271  O OE2  . GLU A 1 43  ? 30.053 36.595 20.892 1.00 0.00 ? 13 GLU A OE2  2  
ATOM 1272  H H    . GLU A 1 43  ? 33.092 33.321 20.293 1.00 0.00 ? 13 GLU A H    2  
ATOM 1273  H HA   . GLU A 1 43  ? 31.391 32.374 22.333 1.00 0.00 ? 13 GLU A HA   2  
ATOM 1274  H HB2  . GLU A 1 43  ? 30.786 34.199 19.996 1.00 0.00 ? 13 GLU A HB2  2  
ATOM 1275  H HB3  . GLU A 1 43  ? 29.727 33.961 21.387 1.00 0.00 ? 13 GLU A HB3  2  
ATOM 1276  H HG2  . GLU A 1 43  ? 31.568 34.716 22.880 1.00 0.00 ? 13 GLU A HG2  2  
ATOM 1277  H HG3  . GLU A 1 43  ? 32.563 35.029 21.464 1.00 0.00 ? 13 GLU A HG3  2  
ATOM 1278  N N    . GLU A 1 44  ? 30.616 31.398 19.277 1.00 0.00 ? 14 GLU A N    2  
ATOM 1279  C CA   . GLU A 1 44  ? 29.851 30.392 18.546 1.00 0.00 ? 14 GLU A CA   2  
ATOM 1280  C C    . GLU A 1 44  ? 30.230 28.985 18.998 1.00 0.00 ? 14 GLU A C    2  
ATOM 1281  O O    . GLU A 1 44  ? 29.369 28.117 19.143 1.00 0.00 ? 14 GLU A O    2  
ATOM 1282  C CB   . GLU A 1 44  ? 30.104 30.532 17.043 1.00 0.00 ? 14 GLU A CB   2  
ATOM 1283  C CG   . GLU A 1 44  ? 29.590 31.893 16.561 1.00 0.00 ? 14 GLU A CG   2  
ATOM 1284  C CD   . GLU A 1 44  ? 28.079 32.028 16.773 1.00 0.00 ? 14 GLU A CD   2  
ATOM 1285  O OE1  . GLU A 1 44  ? 27.413 31.019 16.952 1.00 0.00 ? 14 GLU A OE1  2  
ATOM 1286  O OE2  . GLU A 1 44  ? 27.607 33.153 16.754 1.00 0.00 ? 14 GLU A OE2  2  
ATOM 1287  H H    . GLU A 1 44  ? 31.203 32.013 18.789 1.00 0.00 ? 14 GLU A H    2  
ATOM 1288  H HA   . GLU A 1 44  ? 28.799 30.548 18.736 1.00 0.00 ? 14 GLU A HA   2  
ATOM 1289  H HB2  . GLU A 1 44  ? 31.165 30.457 16.849 1.00 0.00 ? 14 GLU A HB2  2  
ATOM 1290  H HB3  . GLU A 1 44  ? 29.585 29.747 16.515 1.00 0.00 ? 14 GLU A HB3  2  
ATOM 1291  H HG2  . GLU A 1 44  ? 30.093 32.675 17.109 1.00 0.00 ? 14 GLU A HG2  2  
ATOM 1292  H HG3  . GLU A 1 44  ? 29.810 32.001 15.509 1.00 0.00 ? 14 GLU A HG3  2  
ATOM 1293  N N    . GLY A 1 45  ? 31.518 28.770 19.253 1.00 0.00 ? 15 GLY A N    2  
ATOM 1294  C CA   . GLY A 1 45  ? 31.981 27.471 19.721 1.00 0.00 ? 15 GLY A CA   2  
ATOM 1295  C C    . GLY A 1 45  ? 31.328 27.106 21.047 1.00 0.00 ? 15 GLY A C    2  
ATOM 1296  O O    . GLY A 1 45  ? 30.855 25.983 21.224 1.00 0.00 ? 15 GLY A O    2  
ATOM 1297  H H    . GLY A 1 45  ? 32.166 29.486 19.099 1.00 0.00 ? 15 GLY A H    2  
ATOM 1298  H HA2  . GLY A 1 45  ? 31.734 26.722 18.983 1.00 0.00 ? 15 GLY A HA2  2  
ATOM 1299  H HA3  . GLY A 1 45  ? 33.052 27.502 19.853 1.00 0.00 ? 15 GLY A HA3  2  
ATOM 1300  N N    . ASN A 1 46  ? 31.274 28.068 21.966 1.00 0.00 ? 16 ASN A N    2  
ATOM 1301  C CA   . ASN A 1 46  ? 30.657 27.817 23.263 1.00 0.00 ? 16 ASN A CA   2  
ATOM 1302  C C    . ASN A 1 46  ? 29.182 27.460 23.102 1.00 0.00 ? 16 ASN A C    2  
ATOM 1303  O O    . ASN A 1 46  ? 28.689 26.544 23.762 1.00 0.00 ? 16 ASN A O    2  
ATOM 1304  C CB   . ASN A 1 46  ? 30.789 29.055 24.152 1.00 0.00 ? 16 ASN A CB   2  
ATOM 1305  C CG   . ASN A 1 46  ? 32.259 29.340 24.450 1.00 0.00 ? 16 ASN A CG   2  
ATOM 1306  O OD1  . ASN A 1 46  ? 33.100 28.445 24.365 1.00 0.00 ? 16 ASN A OD1  2  
ATOM 1307  N ND2  . ASN A 1 46  ? 32.621 30.545 24.797 1.00 0.00 ? 16 ASN A ND2  2  
ATOM 1308  H H    . ASN A 1 46  ? 31.689 28.938 21.784 1.00 0.00 ? 16 ASN A H    2  
ATOM 1309  H HA   . ASN A 1 46  ? 31.166 26.992 23.739 1.00 0.00 ? 16 ASN A HA   2  
ATOM 1310  H HB2  . ASN A 1 46  ? 30.356 29.906 23.647 1.00 0.00 ? 16 ASN A HB2  2  
ATOM 1311  H HB3  . ASN A 1 46  ? 30.264 28.886 25.081 1.00 0.00 ? 16 ASN A HB3  2  
ATOM 1312  H HD21 . ASN A 1 46  ? 31.951 31.257 24.865 1.00 0.00 ? 16 ASN A HD21 2  
ATOM 1313  H HD22 . ASN A 1 46  ? 33.562 30.738 24.990 1.00 0.00 ? 16 ASN A HD22 2  
ATOM 1314  N N    . LYS A 1 47  ? 28.489 28.149 22.196 1.00 0.00 ? 17 LYS A N    2  
ATOM 1315  C CA   . LYS A 1 47  ? 27.083 27.839 21.949 1.00 0.00 ? 17 LYS A CA   2  
ATOM 1316  C C    . LYS A 1 47  ? 26.918 26.414 21.428 1.00 0.00 ? 17 LYS A C    2  
ATOM 1317  O O    . LYS A 1 47  ? 26.062 25.663 21.909 1.00 0.00 ? 17 LYS A O    2  
ATOM 1318  C CB   . LYS A 1 47  ? 26.496 28.825 20.937 1.00 0.00 ? 17 LYS A CB   2  
ATOM 1319  C CG   . LYS A 1 47  ? 26.488 30.232 21.538 1.00 0.00 ? 17 LYS A CG   2  
ATOM 1320  C CD   . LYS A 1 47  ? 25.804 31.199 20.568 1.00 0.00 ? 17 LYS A CD   2  
ATOM 1321  C CE   . LYS A 1 47  ? 25.903 32.624 21.114 1.00 0.00 ? 17 LYS A CE   2  
ATOM 1322  N NZ   . LYS A 1 47  ? 25.503 33.591 20.053 1.00 0.00 ? 17 LYS A NZ   2  
ATOM 1323  H H    . LYS A 1 47  ? 28.916 28.894 21.721 1.00 0.00 ? 17 LYS A H    2  
ATOM 1324  H HA   . LYS A 1 47  ? 26.540 27.934 22.877 1.00 0.00 ? 17 LYS A HA   2  
ATOM 1325  H HB2  . LYS A 1 47  ? 27.097 28.819 20.039 1.00 0.00 ? 17 LYS A HB2  2  
ATOM 1326  H HB3  . LYS A 1 47  ? 25.485 28.534 20.696 1.00 0.00 ? 17 LYS A HB3  2  
ATOM 1327  H HG2  . LYS A 1 47  ? 25.949 30.219 22.474 1.00 0.00 ? 17 LYS A HG2  2  
ATOM 1328  H HG3  . LYS A 1 47  ? 27.502 30.557 21.710 1.00 0.00 ? 17 LYS A HG3  2  
ATOM 1329  H HD2  . LYS A 1 47  ? 26.291 31.145 19.605 1.00 0.00 ? 17 LYS A HD2  2  
ATOM 1330  H HD3  . LYS A 1 47  ? 24.764 30.928 20.463 1.00 0.00 ? 17 LYS A HD3  2  
ATOM 1331  H HE2  . LYS A 1 47  ? 25.246 32.731 21.964 1.00 0.00 ? 17 LYS A HE2  2  
ATOM 1332  H HE3  . LYS A 1 47  ? 26.920 32.824 21.418 1.00 0.00 ? 17 LYS A HE3  2  
ATOM 1333  H HZ1  . LYS A 1 47  ? 26.006 33.367 19.171 1.00 0.00 ? 17 LYS A HZ1  2  
ATOM 1334  H HZ2  . LYS A 1 47  ? 25.746 34.557 20.355 1.00 0.00 ? 17 LYS A HZ2  2  
ATOM 1335  H HZ3  . LYS A 1 47  ? 24.478 33.526 19.891 1.00 0.00 ? 17 LYS A HZ3  2  
ATOM 1336  N N    . ALA A 1 48  ? 27.773 26.020 20.483 1.00 0.00 ? 18 ALA A N    2  
ATOM 1337  C CA   . ALA A 1 48  ? 27.692 24.672 19.936 1.00 0.00 ? 18 ALA A CA   2  
ATOM 1338  C C    . ALA A 1 48  ? 27.923 23.643 21.036 1.00 0.00 ? 18 ALA A C    2  
ATOM 1339  O O    . ALA A 1 48  ? 27.238 22.623 21.090 1.00 0.00 ? 18 ALA A O    2  
ATOM 1340  C CB   . ALA A 1 48  ? 28.723 24.484 18.821 1.00 0.00 ? 18 ALA A CB   2  
ATOM 1341  H H    . ALA A 1 48  ? 28.443 26.646 20.136 1.00 0.00 ? 18 ALA A H    2  
ATOM 1342  H HA   . ALA A 1 48  ? 26.705 24.524 19.523 1.00 0.00 ? 18 ALA A HA   2  
ATOM 1343  H HB1  . ALA A 1 48  ? 28.481 23.596 18.255 1.00 0.00 ? 18 ALA A HB1  2  
ATOM 1344  H HB2  . ALA A 1 48  ? 29.706 24.381 19.254 1.00 0.00 ? 18 ALA A HB2  2  
ATOM 1345  H HB3  . ALA A 1 48  ? 28.705 25.343 18.167 1.00 0.00 ? 18 ALA A HB3  2  
ATOM 1346  N N    . LEU A 1 49  ? 28.892 23.909 21.910 1.00 0.00 ? 19 LEU A N    2  
ATOM 1347  C CA   . LEU A 1 49  ? 29.133 23.025 23.044 1.00 0.00 ? 19 LEU A CA   2  
ATOM 1348  C C    . LEU A 1 49  ? 27.902 22.948 23.944 1.00 0.00 ? 19 LEU A C    2  
ATOM 1349  O O    . LEU A 1 49  ? 27.515 21.866 24.384 1.00 0.00 ? 19 LEU A O    2  
ATOM 1350  C CB   . LEU A 1 49  ? 30.329 23.533 23.853 1.00 0.00 ? 19 LEU A CB   2  
ATOM 1351  C CG   . LEU A 1 49  ? 30.675 22.528 24.954 1.00 0.00 ? 19 LEU A CG   2  
ATOM 1352  C CD1  . LEU A 1 49  ? 31.289 21.275 24.328 1.00 0.00 ? 19 LEU A CD1  2  
ATOM 1353  C CD2  . LEU A 1 49  ? 31.681 23.160 25.919 1.00 0.00 ? 19 LEU A CD2  2  
ATOM 1354  H H    . LEU A 1 49  ? 29.465 24.692 21.775 1.00 0.00 ? 19 LEU A H    2  
ATOM 1355  H HA   . LEU A 1 49  ? 29.358 22.035 22.675 1.00 0.00 ? 19 LEU A HA   2  
ATOM 1356  H HB2  . LEU A 1 49  ? 31.179 23.656 23.197 1.00 0.00 ? 19 LEU A HB2  2  
ATOM 1357  H HB3  . LEU A 1 49  ? 30.081 24.483 24.302 1.00 0.00 ? 19 LEU A HB3  2  
ATOM 1358  H HG   . LEU A 1 49  ? 29.778 22.259 25.493 1.00 0.00 ? 19 LEU A HG   2  
ATOM 1359  H HD11 . LEU A 1 49  ? 31.918 21.559 23.497 1.00 0.00 ? 19 LEU A HD11 2  
ATOM 1360  H HD12 . LEU A 1 49  ? 30.501 20.624 23.978 1.00 0.00 ? 19 LEU A HD12 2  
ATOM 1361  H HD13 . LEU A 1 49  ? 31.882 20.757 25.068 1.00 0.00 ? 19 LEU A HD13 2  
ATOM 1362  H HD21 . LEU A 1 49  ? 31.179 23.889 26.537 1.00 0.00 ? 19 LEU A HD21 2  
ATOM 1363  H HD22 . LEU A 1 49  ? 32.465 23.644 25.355 1.00 0.00 ? 19 LEU A HD22 2  
ATOM 1364  H HD23 . LEU A 1 49  ? 32.111 22.391 26.545 1.00 0.00 ? 19 LEU A HD23 2  
ATOM 1365  N N    . SER A 1 50  ? 27.235 24.083 24.142 1.00 0.00 ? 20 SER A N    2  
ATOM 1366  C CA   . SER A 1 50  ? 26.063 24.121 25.012 1.00 0.00 ? 20 SER A CA   2  
ATOM 1367  C C    . SER A 1 50  ? 24.960 23.189 24.517 1.00 0.00 ? 20 SER A C    2  
ATOM 1368  O O    . SER A 1 50  ? 24.240 22.593 25.318 1.00 0.00 ? 20 SER A O    2  
ATOM 1369  C CB   . SER A 1 50  ? 25.523 25.550 25.088 1.00 0.00 ? 20 SER A CB   2  
ATOM 1370  O OG   . SER A 1 50  ? 26.567 26.422 25.500 1.00 0.00 ? 20 SER A OG   2  
ATOM 1371  H H    . SER A 1 50  ? 27.563 24.912 23.736 1.00 0.00 ? 20 SER A H    2  
ATOM 1372  H HA   . SER A 1 50  ? 26.358 23.813 26.004 1.00 0.00 ? 20 SER A HA   2  
ATOM 1373  H HB2  . SER A 1 50  ? 25.170 25.858 24.118 1.00 0.00 ? 20 SER A HB2  2  
ATOM 1374  H HB3  . SER A 1 50  ? 24.704 25.585 25.793 1.00 0.00 ? 20 SER A HB3  2  
ATOM 1375  H HG   . SER A 1 50  ? 26.991 26.039 26.197 1.00 0.00 ? 20 SER A HG   2  
ATOM 1376  N N    . VAL A 1 51  ? 24.829 23.065 23.199 1.00 0.00 ? 21 VAL A N    2  
ATOM 1377  C CA   . VAL A 1 51  ? 23.832 22.157 22.628 1.00 0.00 ? 21 VAL A CA   2  
ATOM 1378  C C    . VAL A 1 51  ? 24.342 20.719 22.451 1.00 0.00 ? 21 VAL A C    2  
ATOM 1379  O O    . VAL A 1 51  ? 23.604 19.870 21.950 1.00 0.00 ? 21 VAL A O    2  
ATOM 1380  C CB   . VAL A 1 51  ? 23.349 22.695 21.279 1.00 0.00 ? 21 VAL A CB   2  
ATOM 1381  C CG1  . VAL A 1 51  ? 22.748 24.089 21.472 1.00 0.00 ? 21 VAL A CG1  2  
ATOM 1382  C CG2  . VAL A 1 51  ? 24.526 22.784 20.308 1.00 0.00 ? 21 VAL A CG2  2  
ATOM 1383  H H    . VAL A 1 51  ? 25.365 23.637 22.607 1.00 0.00 ? 21 VAL A H    2  
ATOM 1384  H HA   . VAL A 1 51  ? 22.984 22.130 23.296 1.00 0.00 ? 21 VAL A HA   2  
ATOM 1385  H HB   . VAL A 1 51  ? 22.596 22.033 20.877 1.00 0.00 ? 21 VAL A HB   2  
ATOM 1386  H HG11 . VAL A 1 51  ? 23.502 24.754 21.868 1.00 0.00 ? 21 VAL A HG11 2  
ATOM 1387  H HG12 . VAL A 1 51  ? 21.920 24.032 22.162 1.00 0.00 ? 21 VAL A HG12 2  
ATOM 1388  H HG13 . VAL A 1 51  ? 22.400 24.466 20.522 1.00 0.00 ? 21 VAL A HG13 2  
ATOM 1389  H HG21 . VAL A 1 51  ? 24.159 22.994 19.314 1.00 0.00 ? 21 VAL A HG21 2  
ATOM 1390  H HG22 . VAL A 1 51  ? 25.062 21.846 20.302 1.00 0.00 ? 21 VAL A HG22 2  
ATOM 1391  H HG23 . VAL A 1 51  ? 25.190 23.575 20.621 1.00 0.00 ? 21 VAL A HG23 2  
ATOM 1392  N N    . GLY A 1 52  ? 25.583 20.433 22.850 1.00 0.00 ? 22 GLY A N    2  
ATOM 1393  C CA   . GLY A 1 52  ? 26.149 19.095 22.659 1.00 0.00 ? 22 GLY A CA   2  
ATOM 1394  C C    . GLY A 1 52  ? 26.811 18.909 21.286 1.00 0.00 ? 22 GLY A C    2  
ATOM 1395  O O    . GLY A 1 52  ? 27.160 17.787 20.917 1.00 0.00 ? 22 GLY A O    2  
ATOM 1396  H H    . GLY A 1 52  ? 26.117 21.115 23.305 1.00 0.00 ? 22 GLY A H    2  
ATOM 1397  H HA2  . GLY A 1 52  ? 26.889 18.919 23.426 1.00 0.00 ? 22 GLY A HA2  2  
ATOM 1398  H HA3  . GLY A 1 52  ? 25.359 18.367 22.765 1.00 0.00 ? 22 GLY A HA3  2  
ATOM 1399  N N    . ASN A 1 53  ? 26.988 19.992 20.529 1.00 0.00 ? 23 ASN A N    2  
ATOM 1400  C CA   . ASN A 1 53  ? 27.562 19.908 19.191 1.00 0.00 ? 23 ASN A CA   2  
ATOM 1401  C C    . ASN A 1 53  ? 29.063 20.201 19.228 1.00 0.00 ? 23 ASN A C    2  
ATOM 1402  O O    . ASN A 1 53  ? 29.539 21.205 18.686 1.00 0.00 ? 23 ASN A O    2  
ATOM 1403  C CB   . ASN A 1 53  ? 26.841 20.904 18.279 1.00 0.00 ? 23 ASN A CB   2  
ATOM 1404  C CG   . ASN A 1 53  ? 27.168 20.615 16.820 1.00 0.00 ? 23 ASN A CG   2  
ATOM 1405  O OD1  . ASN A 1 53  ? 28.216 20.046 16.516 1.00 0.00 ? 23 ASN A OD1  2  
ATOM 1406  N ND2  . ASN A 1 53  ? 26.329 20.991 15.895 1.00 0.00 ? 23 ASN A ND2  2  
ATOM 1407  H H    . ASN A 1 53  ? 26.738 20.869 20.884 1.00 0.00 ? 23 ASN A H    2  
ATOM 1408  H HA   . ASN A 1 53  ? 27.409 18.911 18.806 1.00 0.00 ? 23 ASN A HA   2  
ATOM 1409  H HB2  . ASN A 1 53  ? 25.775 20.821 18.431 1.00 0.00 ? 23 ASN A HB2  2  
ATOM 1410  H HB3  . ASN A 1 53  ? 27.160 21.907 18.523 1.00 0.00 ? 23 ASN A HB3  2  
ATOM 1411  H HD21 . ASN A 1 53  ? 25.505 21.458 16.145 1.00 0.00 ? 23 ASN A HD21 2  
ATOM 1412  H HD22 . ASN A 1 53  ? 26.520 20.803 14.953 1.00 0.00 ? 23 ASN A HD22 2  
ATOM 1413  N N    . ILE A 1 54  ? 29.817 19.297 19.843 1.00 0.00 ? 24 ILE A N    2  
ATOM 1414  C CA   . ILE A 1 54  ? 31.250 19.512 20.017 1.00 0.00 ? 24 ILE A CA   2  
ATOM 1415  C C    . ILE A 1 54  ? 31.953 19.593 18.660 1.00 0.00 ? 24 ILE A C    2  
ATOM 1416  O O    . ILE A 1 54  ? 32.883 20.383 18.492 1.00 0.00 ? 24 ILE A O    2  
ATOM 1417  C CB   . ILE A 1 54  ? 31.854 18.377 20.858 1.00 0.00 ? 24 ILE A CB   2  
ATOM 1418  C CG1  . ILE A 1 54  ? 31.135 18.293 22.210 1.00 0.00 ? 24 ILE A CG1  2  
ATOM 1419  C CG2  . ILE A 1 54  ? 33.342 18.649 21.108 1.00 0.00 ? 24 ILE A CG2  2  
ATOM 1420  C CD1  . ILE A 1 54  ? 31.514 16.991 22.923 1.00 0.00 ? 24 ILE A CD1  2  
ATOM 1421  H H    . ILE A 1 54  ? 29.406 18.475 20.185 1.00 0.00 ? 24 ILE A H    2  
ATOM 1422  H HA   . ILE A 1 54  ? 31.399 20.445 20.540 1.00 0.00 ? 24 ILE A HA   2  
ATOM 1423  H HB   . ILE A 1 54  ? 31.744 17.440 20.330 1.00 0.00 ? 24 ILE A HB   2  
ATOM 1424  H HG12 . ILE A 1 54  ? 31.426 19.134 22.822 1.00 0.00 ? 24 ILE A HG12 2  
ATOM 1425  H HG13 . ILE A 1 54  ? 30.067 18.314 22.056 1.00 0.00 ? 24 ILE A HG13 2  
ATOM 1426  H HG21 . ILE A 1 54  ? 33.448 19.535 21.717 1.00 0.00 ? 24 ILE A HG21 2  
ATOM 1427  H HG22 . ILE A 1 54  ? 33.844 18.799 20.163 1.00 0.00 ? 24 ILE A HG22 2  
ATOM 1428  H HG23 . ILE A 1 54  ? 33.781 17.806 21.619 1.00 0.00 ? 24 ILE A HG23 2  
ATOM 1429  H HD11 . ILE A 1 54  ? 32.542 16.742 22.708 1.00 0.00 ? 24 ILE A HD11 2  
ATOM 1430  H HD12 . ILE A 1 54  ? 30.872 16.194 22.579 1.00 0.00 ? 24 ILE A HD12 2  
ATOM 1431  H HD13 . ILE A 1 54  ? 31.390 17.117 23.988 1.00 0.00 ? 24 ILE A HD13 2  
ATOM 1432  N N    . ASP A 1 55  ? 31.491 18.811 17.684 1.00 0.00 ? 25 ASP A N    2  
ATOM 1433  C CA   . ASP A 1 55  ? 32.133 18.799 16.373 1.00 0.00 ? 25 ASP A CA   2  
ATOM 1434  C C    . ASP A 1 55  ? 32.085 20.183 15.731 1.00 0.00 ? 25 ASP A C    2  
ATOM 1435  O O    . ASP A 1 55  ? 33.110 20.710 15.291 1.00 0.00 ? 25 ASP A O    2  
ATOM 1436  C CB   . ASP A 1 55  ? 31.436 17.788 15.461 1.00 0.00 ? 25 ASP A CB   2  
ATOM 1437  C CG   . ASP A 1 55  ? 32.218 17.633 14.161 1.00 0.00 ? 25 ASP A CG   2  
ATOM 1438  O OD1  . ASP A 1 55  ? 31.860 18.289 13.196 1.00 0.00 ? 25 ASP A OD1  2  
ATOM 1439  O OD2  . ASP A 1 55  ? 33.162 16.861 14.149 1.00 0.00 ? 25 ASP A OD2  2  
ATOM 1440  H H    . ASP A 1 55  ? 30.713 18.238 17.849 1.00 0.00 ? 25 ASP A H    2  
ATOM 1441  H HA   . ASP A 1 55  ? 33.165 18.505 16.493 1.00 0.00 ? 25 ASP A HA   2  
ATOM 1442  H HB2  . ASP A 1 55  ? 31.381 16.833 15.963 1.00 0.00 ? 25 ASP A HB2  2  
ATOM 1443  H HB3  . ASP A 1 55  ? 30.438 18.134 15.239 1.00 0.00 ? 25 ASP A HB3  2  
ATOM 1444  N N    . ASP A 1 56  ? 30.903 20.795 15.723 1.00 0.00 ? 26 ASP A N    2  
ATOM 1445  C CA   . ASP A 1 56  ? 30.758 22.125 15.142 1.00 0.00 ? 26 ASP A CA   2  
ATOM 1446  C C    . ASP A 1 56  ? 31.583 23.148 15.915 1.00 0.00 ? 26 ASP A C    2  
ATOM 1447  O O    . ASP A 1 56  ? 32.210 24.023 15.315 1.00 0.00 ? 26 ASP A O    2  
ATOM 1448  C CB   . ASP A 1 56  ? 29.286 22.551 15.125 1.00 0.00 ? 26 ASP A CB   2  
ATOM 1449  C CG   . ASP A 1 56  ? 28.491 21.787 14.062 1.00 0.00 ? 26 ASP A CG   2  
ATOM 1450  O OD1  . ASP A 1 56  ? 27.377 22.202 13.788 1.00 0.00 ? 26 ASP A OD1  2  
ATOM 1451  O OD2  . ASP A 1 56  ? 28.986 20.797 13.542 1.00 0.00 ? 26 ASP A OD2  2  
ATOM 1452  H H    . ASP A 1 56  ? 30.118 20.344 16.101 1.00 0.00 ? 26 ASP A H    2  
ATOM 1453  H HA   . ASP A 1 56  ? 31.117 22.095 14.124 1.00 0.00 ? 26 ASP A HA   2  
ATOM 1454  H HB2  . ASP A 1 56  ? 28.852 22.359 16.095 1.00 0.00 ? 26 ASP A HB2  2  
ATOM 1455  H HB3  . ASP A 1 56  ? 29.228 23.609 14.917 1.00 0.00 ? 26 ASP A HB3  2  
ATOM 1456  N N    . ALA A 1 57  ? 31.619 23.012 17.240 1.00 0.00 ? 27 ALA A N    2  
ATOM 1457  C CA   . ALA A 1 57  ? 32.382 23.948 18.057 1.00 0.00 ? 27 ALA A CA   2  
ATOM 1458  C C    . ALA A 1 57  ? 33.857 23.903 17.663 1.00 0.00 ? 27 ALA A C    2  
ATOM 1459  O O    . ALA A 1 57  ? 34.490 24.943 17.466 1.00 0.00 ? 27 ALA A O    2  
ATOM 1460  C CB   . ALA A 1 57  ? 32.227 23.591 19.539 1.00 0.00 ? 27 ALA A CB   2  
ATOM 1461  H H    . ALA A 1 57  ? 31.096 22.302 17.672 1.00 0.00 ? 27 ALA A H    2  
ATOM 1462  H HA   . ALA A 1 57  ? 32.001 24.946 17.897 1.00 0.00 ? 27 ALA A HA   2  
ATOM 1463  H HB1  . ALA A 1 57  ? 31.290 23.077 19.688 1.00 0.00 ? 27 ALA A HB1  2  
ATOM 1464  H HB2  . ALA A 1 57  ? 32.239 24.495 20.129 1.00 0.00 ? 27 ALA A HB2  2  
ATOM 1465  H HB3  . ALA A 1 57  ? 33.039 22.949 19.849 1.00 0.00 ? 27 ALA A HB3  2  
ATOM 1466  N N    . LEU A 1 58  ? 34.392 22.694 17.506 1.00 0.00 ? 28 LEU A N    2  
ATOM 1467  C CA   . LEU A 1 58  ? 35.776 22.544 17.072 1.00 0.00 ? 28 LEU A CA   2  
ATOM 1468  C C    . LEU A 1 58  ? 35.989 23.178 15.701 1.00 0.00 ? 28 LEU A C    2  
ATOM 1469  O O    . LEU A 1 58  ? 37.018 23.810 15.461 1.00 0.00 ? 28 LEU A O    2  
ATOM 1470  C CB   . LEU A 1 58  ? 36.153 21.062 17.014 1.00 0.00 ? 28 LEU A CB   2  
ATOM 1471  C CG   . LEU A 1 58  ? 36.092 20.454 18.417 1.00 0.00 ? 28 LEU A CG   2  
ATOM 1472  C CD1  . LEU A 1 58  ? 36.271 18.937 18.324 1.00 0.00 ? 28 LEU A CD1  2  
ATOM 1473  C CD2  . LEU A 1 58  ? 37.215 21.039 19.277 1.00 0.00 ? 28 LEU A CD2  2  
ATOM 1474  H H    . LEU A 1 58  ? 33.858 21.898 17.706 1.00 0.00 ? 28 LEU A H    2  
ATOM 1475  H HA   . LEU A 1 58  ? 36.420 23.038 17.783 1.00 0.00 ? 28 LEU A HA   2  
ATOM 1476  H HB2  . LEU A 1 58  ? 35.462 20.542 16.366 1.00 0.00 ? 28 LEU A HB2  2  
ATOM 1477  H HB3  . LEU A 1 58  ? 37.155 20.961 16.625 1.00 0.00 ? 28 LEU A HB3  2  
ATOM 1478  H HG   . LEU A 1 58  ? 35.137 20.678 18.867 1.00 0.00 ? 28 LEU A HG   2  
ATOM 1479  H HD11 . LEU A 1 58  ? 35.510 18.524 17.678 1.00 0.00 ? 28 LEU A HD11 2  
ATOM 1480  H HD12 . LEU A 1 58  ? 36.182 18.503 19.308 1.00 0.00 ? 28 LEU A HD12 2  
ATOM 1481  H HD13 . LEU A 1 58  ? 37.247 18.714 17.919 1.00 0.00 ? 28 LEU A HD13 2  
ATOM 1482  H HD21 . LEU A 1 58  ? 38.103 21.163 18.675 1.00 0.00 ? 28 LEU A HD21 2  
ATOM 1483  H HD22 . LEU A 1 58  ? 37.427 20.370 20.097 1.00 0.00 ? 28 LEU A HD22 2  
ATOM 1484  H HD23 . LEU A 1 58  ? 36.907 21.999 19.666 1.00 0.00 ? 28 LEU A HD23 2  
ATOM 1485  N N    . GLN A 1 59  ? 35.004 23.038 14.813 1.00 0.00 ? 29 GLN A N    2  
ATOM 1486  C CA   . GLN A 1 59  ? 35.126 23.616 13.478 1.00 0.00 ? 29 GLN A CA   2  
ATOM 1487  C C    . GLN A 1 59  ? 35.279 25.134 13.543 1.00 0.00 ? 29 GLN A C    2  
ATOM 1488  O O    . GLN A 1 59  ? 36.156 25.701 12.886 1.00 0.00 ? 29 GLN A O    2  
ATOM 1489  C CB   . GLN A 1 59  ? 33.893 23.262 12.644 1.00 0.00 ? 29 GLN A CB   2  
ATOM 1490  C CG   . GLN A 1 59  ? 34.102 23.721 11.198 1.00 0.00 ? 29 GLN A CG   2  
ATOM 1491  C CD   . GLN A 1 59  ? 32.910 23.333 10.323 1.00 0.00 ? 29 GLN A CD   2  
ATOM 1492  O OE1  . GLN A 1 59  ? 32.015 22.603 10.755 1.00 0.00 ? 29 GLN A OE1  2  
ATOM 1493  N NE2  . GLN A 1 59  ? 32.844 23.784 9.100  1.00 0.00 ? 29 GLN A NE2  2  
ATOM 1494  H H    . GLN A 1 59  ? 34.218 22.497 15.041 1.00 0.00 ? 29 GLN A H    2  
ATOM 1495  H HA   . GLN A 1 59  ? 35.999 23.199 12.997 1.00 0.00 ? 29 GLN A HA   2  
ATOM 1496  H HB2  . GLN A 1 59  ? 33.739 22.193 12.666 1.00 0.00 ? 29 GLN A HB2  2  
ATOM 1497  H HB3  . GLN A 1 59  ? 33.027 23.759 13.055 1.00 0.00 ? 29 GLN A HB3  2  
ATOM 1498  H HG2  . GLN A 1 59  ? 34.220 24.795 11.180 1.00 0.00 ? 29 GLN A HG2  2  
ATOM 1499  H HG3  . GLN A 1 59  ? 34.995 23.260 10.805 1.00 0.00 ? 29 GLN A HG3  2  
ATOM 1500  H HE21 . GLN A 1 59  ? 33.554 24.364 8.753  1.00 0.00 ? 29 GLN A HE21 2  
ATOM 1501  H HE22 . GLN A 1 59  ? 32.085 23.543 8.529  1.00 0.00 ? 29 GLN A HE22 2  
ATOM 1502  N N    . TYR A 1 60  ? 34.457 25.789 14.363 1.00 0.00 ? 30 TYR A N    2  
ATOM 1503  C CA   . TYR A 1 60  ? 34.584 27.232 14.539 1.00 0.00 ? 30 TYR A CA   2  
ATOM 1504  C C    . TYR A 1 60  ? 35.960 27.594 15.087 1.00 0.00 ? 30 TYR A C    2  
ATOM 1505  O O    . TYR A 1 60  ? 36.591 28.541 14.612 1.00 0.00 ? 30 TYR A O    2  
ATOM 1506  C CB   . TYR A 1 60  ? 33.511 27.749 15.501 1.00 0.00 ? 30 TYR A CB   2  
ATOM 1507  C CG   . TYR A 1 60  ? 32.100 27.615 14.976 1.00 0.00 ? 30 TYR A CG   2  
ATOM 1508  C CD1  . TYR A 1 60  ? 31.235 26.665 15.532 1.00 0.00 ? 30 TYR A CD1  2  
ATOM 1509  C CD2  . TYR A 1 60  ? 31.656 28.443 13.939 1.00 0.00 ? 30 TYR A CD2  2  
ATOM 1510  C CE1  . TYR A 1 60  ? 29.926 26.543 15.050 1.00 0.00 ? 30 TYR A CE1  2  
ATOM 1511  C CE2  . TYR A 1 60  ? 30.347 28.320 13.457 1.00 0.00 ? 30 TYR A CE2  2  
ATOM 1512  C CZ   . TYR A 1 60  ? 29.482 27.370 14.013 1.00 0.00 ? 30 TYR A CZ   2  
ATOM 1513  O OH   . TYR A 1 60  ? 28.192 27.250 13.538 1.00 0.00 ? 30 TYR A OH   2  
ATOM 1514  H H    . TYR A 1 60  ? 33.730 25.306 14.808 1.00 0.00 ? 30 TYR A H    2  
ATOM 1515  H HA   . TYR A 1 60  ? 34.451 27.713 13.581 1.00 0.00 ? 30 TYR A HA   2  
ATOM 1516  H HB2  . TYR A 1 60  ? 33.582 27.199 16.425 1.00 0.00 ? 30 TYR A HB2  2  
ATOM 1517  H HB3  . TYR A 1 60  ? 33.711 28.791 15.707 1.00 0.00 ? 30 TYR A HB3  2  
ATOM 1518  H HD1  . TYR A 1 60  ? 31.577 26.026 16.332 1.00 0.00 ? 30 TYR A HD1  2  
ATOM 1519  H HD2  . TYR A 1 60  ? 32.324 29.176 13.510 1.00 0.00 ? 30 TYR A HD2  2  
ATOM 1520  H HE1  . TYR A 1 60  ? 29.259 25.810 15.479 1.00 0.00 ? 30 TYR A HE1  2  
ATOM 1521  H HE2  . TYR A 1 60  ? 30.004 28.959 12.656 1.00 0.00 ? 30 TYR A HE2  2  
ATOM 1522  H HH   . TYR A 1 60  ? 28.226 26.826 12.745 1.00 0.00 ? 30 TYR A HH   2  
ATOM 1523  N N    . TYR A 1 61  ? 36.445 26.820 16.058 1.00 0.00 ? 31 TYR A N    2  
ATOM 1524  C CA   . TYR A 1 61  ? 37.762 27.090 16.629 1.00 0.00 ? 31 TYR A CA   2  
ATOM 1525  C C    . TYR A 1 61  ? 38.855 26.962 15.572 1.00 0.00 ? 31 TYR A C    2  
ATOM 1526  O O    . TYR A 1 61  ? 39.784 27.770 15.531 1.00 0.00 ? 31 TYR A O    2  
ATOM 1527  C CB   . TYR A 1 61  ? 38.050 26.127 17.784 1.00 0.00 ? 31 TYR A CB   2  
ATOM 1528  C CG   . TYR A 1 61  ? 37.112 26.280 18.961 1.00 0.00 ? 31 TYR A CG   2  
ATOM 1529  C CD1  . TYR A 1 61  ? 36.728 27.554 19.400 1.00 0.00 ? 31 TYR A CD1  2  
ATOM 1530  C CD2  . TYR A 1 61  ? 36.630 25.142 19.620 1.00 0.00 ? 31 TYR A CD2  2  
ATOM 1531  C CE1  . TYR A 1 61  ? 35.863 27.688 20.494 1.00 0.00 ? 31 TYR A CE1  2  
ATOM 1532  C CE2  . TYR A 1 61  ? 35.765 25.276 20.712 1.00 0.00 ? 31 TYR A CE2  2  
ATOM 1533  C CZ   . TYR A 1 61  ? 35.381 26.549 21.149 1.00 0.00 ? 31 TYR A CZ   2  
ATOM 1534  O OH   . TYR A 1 61  ? 34.530 26.681 22.226 1.00 0.00 ? 31 TYR A OH   2  
ATOM 1535  H H    . TYR A 1 61  ? 35.899 26.087 16.416 1.00 0.00 ? 31 TYR A H    2  
ATOM 1536  H HA   . TYR A 1 61  ? 37.771 28.099 17.013 1.00 0.00 ? 31 TYR A HA   2  
ATOM 1537  H HB2  . TYR A 1 61  ? 37.972 25.116 17.418 1.00 0.00 ? 31 TYR A HB2  2  
ATOM 1538  H HB3  . TYR A 1 61  ? 39.064 26.291 18.120 1.00 0.00 ? 31 TYR A HB3  2  
ATOM 1539  H HD1  . TYR A 1 61  ? 37.098 28.433 18.894 1.00 0.00 ? 31 TYR A HD1  2  
ATOM 1540  H HD2  . TYR A 1 61  ? 36.927 24.159 19.285 1.00 0.00 ? 31 TYR A HD2  2  
ATOM 1541  H HE1  . TYR A 1 61  ? 35.568 28.670 20.832 1.00 0.00 ? 31 TYR A HE1  2  
ATOM 1542  H HE2  . TYR A 1 61  ? 35.394 24.397 21.218 1.00 0.00 ? 31 TYR A HE2  2  
ATOM 1543  H HH   . TYR A 1 61  ? 35.030 26.832 22.959 1.00 0.00 ? 31 TYR A HH   2  
ATOM 1544  N N    . ALA A 1 62  ? 38.714 25.982 14.681 1.00 0.00 ? 32 ALA A N    2  
ATOM 1545  C CA   . ALA A 1 62  ? 39.699 25.793 13.621 1.00 0.00 ? 32 ALA A CA   2  
ATOM 1546  C C    . ALA A 1 62  ? 39.736 27.010 12.706 1.00 0.00 ? 32 ALA A C    2  
ATOM 1547  O O    . ALA A 1 62  ? 40.810 27.514 12.367 1.00 0.00 ? 32 ALA A O    2  
ATOM 1548  C CB   . ALA A 1 62  ? 39.354 24.547 12.803 1.00 0.00 ? 32 ALA A CB   2  
ATOM 1549  H H    . ALA A 1 62  ? 37.963 25.359 14.761 1.00 0.00 ? 32 ALA A H    2  
ATOM 1550  H HA   . ALA A 1 62  ? 40.673 25.658 14.067 1.00 0.00 ? 32 ALA A HA   2  
ATOM 1551  H HB1  . ALA A 1 62  ? 40.203 24.266 12.198 1.00 0.00 ? 32 ALA A HB1  2  
ATOM 1552  H HB2  . ALA A 1 62  ? 38.510 24.759 12.163 1.00 0.00 ? 32 ALA A HB2  2  
ATOM 1553  H HB3  . ALA A 1 62  ? 39.103 23.736 13.471 1.00 0.00 ? 32 ALA A HB3  2  
ATOM 1554  N N    . ALA A 1 63  ? 38.557 27.511 12.348 1.00 0.00 ? 33 ALA A N    2  
ATOM 1555  C CA   . ALA A 1 63  ? 38.482 28.701 11.510 1.00 0.00 ? 33 ALA A CA   2  
ATOM 1556  C C    . ALA A 1 63  ? 39.102 29.901 12.221 1.00 0.00 ? 33 ALA A C    2  
ATOM 1557  O O    . ALA A 1 63  ? 39.795 30.705 11.599 1.00 0.00 ? 33 ALA A O    2  
ATOM 1558  C CB   . ALA A 1 63  ? 37.023 29.007 11.167 1.00 0.00 ? 33 ALA A CB   2  
ATOM 1559  H H    . ALA A 1 63  ? 37.732 27.057 12.625 1.00 0.00 ? 33 ALA A H    2  
ATOM 1560  H HA   . ALA A 1 63  ? 39.024 28.518 10.594 1.00 0.00 ? 33 ALA A HA   2  
ATOM 1561  H HB1  . ALA A 1 63  ? 36.727 28.427 10.306 1.00 0.00 ? 33 ALA A HB1  2  
ATOM 1562  H HB2  . ALA A 1 63  ? 36.919 30.059 10.945 1.00 0.00 ? 33 ALA A HB2  2  
ATOM 1563  H HB3  . ALA A 1 63  ? 36.394 28.752 12.007 1.00 0.00 ? 33 ALA A HB3  2  
ATOM 1564  N N    . ALA A 1 64  ? 38.887 30.000 13.531 1.00 0.00 ? 34 ALA A N    2  
ATOM 1565  C CA   . ALA A 1 64  ? 39.445 31.109 14.299 1.00 0.00 ? 34 ALA A CA   2  
ATOM 1566  C C    . ALA A 1 64  ? 40.971 31.108 14.231 1.00 0.00 ? 34 ALA A C    2  
ATOM 1567  O O    . ALA A 1 64  ? 41.584 32.151 13.988 1.00 0.00 ? 34 ALA A O    2  
ATOM 1568  C CB   . ALA A 1 64  ? 38.963 31.030 15.756 1.00 0.00 ? 34 ALA A CB   2  
ATOM 1569  H H    . ALA A 1 64  ? 38.313 29.344 13.977 1.00 0.00 ? 34 ALA A H    2  
ATOM 1570  H HA   . ALA A 1 64  ? 39.091 32.034 13.871 1.00 0.00 ? 34 ALA A HA   2  
ATOM 1571  H HB1  . ALA A 1 64  ? 38.590 31.996 16.060 1.00 0.00 ? 34 ALA A HB1  2  
ATOM 1572  H HB2  . ALA A 1 64  ? 39.774 30.737 16.407 1.00 0.00 ? 34 ALA A HB2  2  
ATOM 1573  H HB3  . ALA A 1 64  ? 38.166 30.304 15.835 1.00 0.00 ? 34 ALA A HB3  2  
ATOM 1574  N N    . ILE A 1 65  ? 41.580 29.935 14.398 1.00 0.00 ? 35 ILE A N    2  
ATOM 1575  C CA   . ILE A 1 65  ? 43.034 29.844 14.321 1.00 0.00 ? 35 ILE A CA   2  
ATOM 1576  C C    . ILE A 1 65  ? 43.514 30.269 12.935 1.00 0.00 ? 35 ILE A C    2  
ATOM 1577  O O    . ILE A 1 65  ? 44.490 31.011 12.814 1.00 0.00 ? 35 ILE A O    2  
ATOM 1578  C CB   . ILE A 1 65  ? 43.488 28.411 14.630 1.00 0.00 ? 35 ILE A CB   2  
ATOM 1579  C CG1  . ILE A 1 65  ? 43.012 28.023 16.031 1.00 0.00 ? 35 ILE A CG1  2  
ATOM 1580  C CG2  . ILE A 1 65  ? 45.017 28.314 14.586 1.00 0.00 ? 35 ILE A CG2  2  
ATOM 1581  C CD1  . ILE A 1 65  ? 43.256 26.530 16.260 1.00 0.00 ? 35 ILE A CD1  2  
ATOM 1582  H H    . ILE A 1 65  ? 41.050 29.137 14.606 1.00 0.00 ? 35 ILE A H    2  
ATOM 1583  H HA   . ILE A 1 65  ? 43.463 30.510 15.055 1.00 0.00 ? 35 ILE A HA   2  
ATOM 1584  H HB   . ILE A 1 65  ? 43.063 27.734 13.904 1.00 0.00 ? 35 ILE A HB   2  
ATOM 1585  H HG12 . ILE A 1 65  ? 43.560 28.595 16.766 1.00 0.00 ? 35 ILE A HG12 2  
ATOM 1586  H HG13 . ILE A 1 65  ? 41.958 28.232 16.126 1.00 0.00 ? 35 ILE A HG13 2  
ATOM 1587  H HG21 . ILE A 1 65  ? 45.374 28.687 13.638 1.00 0.00 ? 35 ILE A HG21 2  
ATOM 1588  H HG22 . ILE A 1 65  ? 45.316 27.283 14.703 1.00 0.00 ? 35 ILE A HG22 2  
ATOM 1589  H HG23 . ILE A 1 65  ? 45.438 28.904 15.387 1.00 0.00 ? 35 ILE A HG23 2  
ATOM 1590  H HD11 . ILE A 1 65  ? 42.665 26.193 17.099 1.00 0.00 ? 35 ILE A HD11 2  
ATOM 1591  H HD12 . ILE A 1 65  ? 44.303 26.364 16.467 1.00 0.00 ? 35 ILE A HD12 2  
ATOM 1592  H HD13 . ILE A 1 65  ? 42.972 25.979 15.375 1.00 0.00 ? 35 ILE A HD13 2  
ATOM 1593  N N    . THR A 1 66  ? 42.814 29.821 11.893 1.00 0.00 ? 36 THR A N    2  
ATOM 1594  C CA   . THR A 1 66  ? 43.186 30.203 10.534 1.00 0.00 ? 36 THR A CA   2  
ATOM 1595  C C    . THR A 1 66  ? 43.101 31.718 10.346 1.00 0.00 ? 36 THR A C    2  
ATOM 1596  O O    . THR A 1 66  ? 44.005 32.333 9.777  1.00 0.00 ? 36 THR A O    2  
ATOM 1597  C CB   . THR A 1 66  ? 42.267 29.512 9.526  1.00 0.00 ? 36 THR A CB   2  
ATOM 1598  O OG1  . THR A 1 66  ? 42.172 28.129 9.838  1.00 0.00 ? 36 THR A OG1  2  
ATOM 1599  C CG2  . THR A 1 66  ? 42.846 29.675 8.121  1.00 0.00 ? 36 THR A CG2  2  
ATOM 1600  H H    . THR A 1 66  ? 42.065 29.203 12.038 1.00 0.00 ? 36 THR A H    2  
ATOM 1601  H HA   . THR A 1 66  ? 44.202 29.886 10.350 1.00 0.00 ? 36 THR A HA   2  
ATOM 1602  H HB   . THR A 1 66  ? 41.286 29.960 9.562  1.00 0.00 ? 36 THR A HB   2  
ATOM 1603  H HG1  . THR A 1 66  ? 41.622 27.745 9.237  1.00 0.00 ? 36 THR A HG1  2  
ATOM 1604  H HG21 . THR A 1 66  ? 43.918 29.548 8.156  1.00 0.00 ? 36 THR A HG21 2  
ATOM 1605  H HG22 . THR A 1 66  ? 42.613 30.661 7.747  1.00 0.00 ? 36 THR A HG22 2  
ATOM 1606  H HG23 . THR A 1 66  ? 42.417 28.931 7.466  1.00 0.00 ? 36 THR A HG23 2  
ATOM 1607  N N    . LEU A 1 67  ? 42.036 32.326 10.864 1.00 0.00 ? 37 LEU A N    2  
ATOM 1608  C CA   . LEU A 1 67  ? 41.871 33.773 10.752 1.00 0.00 ? 37 LEU A CA   2  
ATOM 1609  C C    . LEU A 1 67  ? 43.015 34.519 11.433 1.00 0.00 ? 37 LEU A C    2  
ATOM 1610  O O    . LEU A 1 67  ? 43.424 35.585 10.971 1.00 0.00 ? 37 LEU A O    2  
ATOM 1611  C CB   . LEU A 1 67  ? 40.539 34.202 11.371 1.00 0.00 ? 37 LEU A CB   2  
ATOM 1612  C CG   . LEU A 1 67  ? 39.381 33.664 10.527 1.00 0.00 ? 37 LEU A CG   2  
ATOM 1613  C CD1  . LEU A 1 67  ? 38.064 33.865 11.280 1.00 0.00 ? 37 LEU A CD1  2  
ATOM 1614  C CD2  . LEU A 1 67  ? 39.323 34.423 9.199  1.00 0.00 ? 37 LEU A CD2  2  
ATOM 1615  H H    . LEU A 1 67  ? 41.341 31.793 11.302 1.00 0.00 ? 37 LEU A H    2  
ATOM 1616  H HA   . LEU A 1 67  ? 41.864 34.038 9.706  1.00 0.00 ? 37 LEU A HA   2  
ATOM 1617  H HB2  . LEU A 1 67  ? 40.466 33.810 12.375 1.00 0.00 ? 37 LEU A HB2  2  
ATOM 1618  H HB3  . LEU A 1 67  ? 40.487 35.280 11.401 1.00 0.00 ? 37 LEU A HB3  2  
ATOM 1619  H HG   . LEU A 1 67  ? 39.531 32.613 10.337 1.00 0.00 ? 37 LEU A HG   2  
ATOM 1620  H HD11 . LEU A 1 67  ? 38.224 33.703 12.335 1.00 0.00 ? 37 LEU A HD11 2  
ATOM 1621  H HD12 . LEU A 1 67  ? 37.330 33.162 10.915 1.00 0.00 ? 37 LEU A HD12 2  
ATOM 1622  H HD13 . LEU A 1 67  ? 37.707 34.872 11.120 1.00 0.00 ? 37 LEU A HD13 2  
ATOM 1623  H HD21 . LEU A 1 67  ? 40.032 33.991 8.507  1.00 0.00 ? 37 LEU A HD21 2  
ATOM 1624  H HD22 . LEU A 1 67  ? 39.570 35.461 9.366  1.00 0.00 ? 37 LEU A HD22 2  
ATOM 1625  H HD23 . LEU A 1 67  ? 38.328 34.351 8.786  1.00 0.00 ? 37 LEU A HD23 2  
ATOM 1626  N N    . ASP A 1 68  ? 43.497 33.981 12.549 1.00 0.00 ? 38 ASP A N    2  
ATOM 1627  C CA   . ASP A 1 68  ? 44.657 34.558 13.217 1.00 0.00 ? 38 ASP A CA   2  
ATOM 1628  C C    . ASP A 1 68  ? 45.903 34.446 12.342 1.00 0.00 ? 38 ASP A C    2  
ATOM 1629  O O    . ASP A 1 68  ? 46.634 35.420 12.160 1.00 0.00 ? 38 ASP A O    2  
ATOM 1630  C CB   . ASP A 1 68  ? 44.902 33.838 14.545 1.00 0.00 ? 38 ASP A CB   2  
ATOM 1631  C CG   . ASP A 1 68  ? 46.029 34.513 15.324 1.00 0.00 ? 38 ASP A CG   2  
ATOM 1632  O OD1  . ASP A 1 68  ? 46.705 33.818 16.064 1.00 0.00 ? 38 ASP A OD1  2  
ATOM 1633  O OD2  . ASP A 1 68  ? 46.197 35.713 15.179 1.00 0.00 ? 38 ASP A OD2  2  
ATOM 1634  H H    . ASP A 1 68  ? 43.040 33.212 12.951 1.00 0.00 ? 38 ASP A H    2  
ATOM 1635  H HA   . ASP A 1 68  ? 44.463 35.601 13.418 1.00 0.00 ? 38 ASP A HA   2  
ATOM 1636  H HB2  . ASP A 1 68  ? 43.998 33.861 15.135 1.00 0.00 ? 38 ASP A HB2  2  
ATOM 1637  H HB3  . ASP A 1 68  ? 45.172 32.811 14.349 1.00 0.00 ? 38 ASP A HB3  2  
ATOM 1638  N N    . LYS A 1 69  ? 46.138 33.253 11.803 1.00 0.00 ? 39 LYS A N    2  
ATOM 1639  C CA   . LYS A 1 69  ? 47.309 33.024 10.961 1.00 0.00 ? 39 LYS A CA   2  
ATOM 1640  C C    . LYS A 1 69  ? 47.312 33.929 9.727  1.00 0.00 ? 39 LYS A C    2  
ATOM 1641  O O    . LYS A 1 69  ? 48.377 34.302 9.235  1.00 0.00 ? 39 LYS A O    2  
ATOM 1642  C CB   . LYS A 1 69  ? 47.342 31.557 10.520 1.00 0.00 ? 39 LYS A CB   2  
ATOM 1643  C CG   . LYS A 1 69  ? 48.643 31.267 9.767  1.00 0.00 ? 39 LYS A CG   2  
ATOM 1644  C CD   . LYS A 1 69  ? 48.709 29.780 9.415  1.00 0.00 ? 39 LYS A CD   2  
ATOM 1645  C CE   . LYS A 1 69  ? 47.637 29.454 8.374  1.00 0.00 ? 39 LYS A CE   2  
ATOM 1646  N NZ   . LYS A 1 69  ? 47.872 28.087 7.829  1.00 0.00 ? 39 LYS A NZ   2  
ATOM 1647  H H    . LYS A 1 69  ? 45.530 32.509 11.996 1.00 0.00 ? 39 LYS A H    2  
ATOM 1648  H HA   . LYS A 1 69  ? 48.197 33.226 11.540 1.00 0.00 ? 39 LYS A HA   2  
ATOM 1649  H HB2  . LYS A 1 69  ? 47.280 30.921 11.390 1.00 0.00 ? 39 LYS A HB2  2  
ATOM 1650  H HB3  . LYS A 1 69  ? 46.502 31.359 9.870  1.00 0.00 ? 39 LYS A HB3  2  
ATOM 1651  H HG2  . LYS A 1 69  ? 48.673 31.855 8.862  1.00 0.00 ? 39 LYS A HG2  2  
ATOM 1652  H HG3  . LYS A 1 69  ? 49.485 31.524 10.392 1.00 0.00 ? 39 LYS A HG3  2  
ATOM 1653  H HD2  . LYS A 1 69  ? 49.685 29.549 9.013  1.00 0.00 ? 39 LYS A HD2  2  
ATOM 1654  H HD3  . LYS A 1 69  ? 48.536 29.191 10.303 1.00 0.00 ? 39 LYS A HD3  2  
ATOM 1655  H HE2  . LYS A 1 69  ? 46.662 29.494 8.836  1.00 0.00 ? 39 LYS A HE2  2  
ATOM 1656  H HE3  . LYS A 1 69  ? 47.684 30.174 7.571  1.00 0.00 ? 39 LYS A HE3  2  
ATOM 1657  H HZ1  . LYS A 1 69  ? 46.993 27.725 7.408  1.00 0.00 ? 39 LYS A HZ1  2  
ATOM 1658  H HZ2  . LYS A 1 69  ? 48.175 27.455 8.598  1.00 0.00 ? 39 LYS A HZ2  2  
ATOM 1659  H HZ3  . LYS A 1 69  ? 48.612 28.126 7.099  1.00 0.00 ? 39 LYS A HZ3  2  
ATOM 1660  N N    . TYR A 1 70  ? 46.128 34.281 9.228  1.00 0.00 ? 40 TYR A N    2  
ATOM 1661  C CA   . TYR A 1 70  ? 46.036 35.160 8.067  1.00 0.00 ? 40 TYR A CA   2  
ATOM 1662  C C    . TYR A 1 70  ? 46.729 36.498 8.373  1.00 0.00 ? 40 TYR A C    2  
ATOM 1663  O O    . TYR A 1 70  ? 46.424 37.108 9.399  1.00 0.00 ? 40 TYR A O    2  
ATOM 1664  C CB   . TYR A 1 70  ? 44.552 35.377 7.756  1.00 0.00 ? 40 TYR A CB   2  
ATOM 1665  C CG   . TYR A 1 70  ? 44.250 35.672 6.307  1.00 0.00 ? 40 TYR A CG   2  
ATOM 1666  C CD1  . TYR A 1 70  ? 44.400 34.670 5.341  1.00 0.00 ? 40 TYR A CD1  2  
ATOM 1667  C CD2  . TYR A 1 70  ? 43.777 36.935 5.937  1.00 0.00 ? 40 TYR A CD2  2  
ATOM 1668  C CE1  . TYR A 1 70  ? 44.083 34.934 4.003  1.00 0.00 ? 40 TYR A CE1  2  
ATOM 1669  C CE2  . TYR A 1 70  ? 43.463 37.201 4.600  1.00 0.00 ? 40 TYR A CE2  2  
ATOM 1670  C CZ   . TYR A 1 70  ? 43.615 36.201 3.633  1.00 0.00 ? 40 TYR A CZ   2  
ATOM 1671  O OH   . TYR A 1 70  ? 43.303 36.462 2.314  1.00 0.00 ? 40 TYR A OH   2  
ATOM 1672  H H    . TYR A 1 70  ? 45.311 33.901 9.613  1.00 0.00 ? 40 TYR A H    2  
ATOM 1673  H HA   . TYR A 1 70  ? 46.498 34.663 7.230  1.00 0.00 ? 40 TYR A HA   2  
ATOM 1674  H HB2  . TYR A 1 70  ? 44.009 34.487 8.035  1.00 0.00 ? 40 TYR A HB2  2  
ATOM 1675  H HB3  . TYR A 1 70  ? 44.194 36.197 8.363  1.00 0.00 ? 40 TYR A HB3  2  
ATOM 1676  H HD1  . TYR A 1 70  ? 44.766 33.696 5.628  1.00 0.00 ? 40 TYR A HD1  2  
ATOM 1677  H HD2  . TYR A 1 70  ? 43.658 37.705 6.683  1.00 0.00 ? 40 TYR A HD2  2  
ATOM 1678  H HE1  . TYR A 1 70  ? 44.199 34.161 3.258  1.00 0.00 ? 40 TYR A HE1  2  
ATOM 1679  H HE2  . TYR A 1 70  ? 43.096 38.175 4.317  1.00 0.00 ? 40 TYR A HE2  2  
ATOM 1680  H HH   . TYR A 1 70  ? 42.597 37.020 2.301  1.00 0.00 ? 40 TYR A HH   2  
ATOM 1681  N N    . PRO A 1 71  ? 47.635 36.979 7.540  1.00 0.00 ? 41 PRO A N    2  
ATOM 1682  C CA   . PRO A 1 71  ? 48.413 38.214 7.861  1.00 0.00 ? 41 PRO A CA   2  
ATOM 1683  C C    . PRO A 1 71  ? 47.708 39.520 7.499  1.00 0.00 ? 41 PRO A C    2  
ATOM 1684  O O    . PRO A 1 71  ? 48.348 40.573 7.486  1.00 0.00 ? 41 PRO A O    2  
ATOM 1685  C CB   . PRO A 1 71  ? 49.684 38.043 7.032  1.00 0.00 ? 41 PRO A CB   2  
ATOM 1686  C CG   . PRO A 1 71  ? 49.263 37.278 5.822  1.00 0.00 ? 41 PRO A CG   2  
ATOM 1687  C CD   . PRO A 1 71  ? 48.015 36.477 6.205  1.00 0.00 ? 41 PRO A CD   2  
ATOM 1688  H HA   . PRO A 1 71  ? 48.678 38.219 8.906  1.00 0.00 ? 41 PRO A HA   2  
ATOM 1689  H HB2  . PRO A 1 71  ? 50.079 39.010 6.752  1.00 0.00 ? 41 PRO A HB2  2  
ATOM 1690  H HB3  . PRO A 1 71  ? 50.421 37.479 7.583  1.00 0.00 ? 41 PRO A HB3  2  
ATOM 1691  H HG2  . PRO A 1 71  ? 49.035 37.963 5.017  1.00 0.00 ? 41 PRO A HG2  2  
ATOM 1692  H HG3  . PRO A 1 71  ? 50.046 36.600 5.522  1.00 0.00 ? 41 PRO A HG3  2  
ATOM 1693  H HD2  . PRO A 1 71  ? 47.223 36.655 5.492  1.00 0.00 ? 41 PRO A HD2  2  
ATOM 1694  H HD3  . PRO A 1 71  ? 48.245 35.424 6.260  1.00 0.00 ? 41 PRO A HD3  2  
ATOM 1695  N N    . HIS A 1 72  ? 46.408 39.467 7.212  1.00 0.00 ? 42 HIS A N    2  
ATOM 1696  C CA   . HIS A 1 72  ? 45.703 40.663 6.753  1.00 0.00 ? 42 HIS A CA   2  
ATOM 1697  C C    . HIS A 1 72  ? 44.272 40.720 7.276  1.00 0.00 ? 42 HIS A C    2  
ATOM 1698  O O    . HIS A 1 72  ? 43.643 39.689 7.516  1.00 0.00 ? 42 HIS A O    2  
ATOM 1699  C CB   . HIS A 1 72  ? 45.689 40.693 5.224  1.00 0.00 ? 42 HIS A CB   2  
ATOM 1700  C CG   . HIS A 1 72  ? 45.159 41.980 4.652  1.00 0.00 ? 42 HIS A CG   2  
ATOM 1701  N ND1  . HIS A 1 72  ? 45.751 43.204 4.916  1.00 0.00 ? 42 HIS A ND1  2  
ATOM 1702  C CD2  . HIS A 1 72  ? 44.097 42.248 3.823  1.00 0.00 ? 42 HIS A CD2  2  
ATOM 1703  C CE1  . HIS A 1 72  ? 45.051 44.145 4.258  1.00 0.00 ? 42 HIS A CE1  2  
ATOM 1704  N NE2  . HIS A 1 72  ? 44.031 43.617 3.576  1.00 0.00 ? 42 HIS A NE2  2  
ATOM 1705  H H    . HIS A 1 72  ? 45.922 38.621 7.309  1.00 0.00 ? 42 HIS A H    2  
ATOM 1706  H HA   . HIS A 1 72  ? 46.232 41.536 7.106  1.00 0.00 ? 42 HIS A HA   2  
ATOM 1707  H HB2  . HIS A 1 72  ? 46.696 40.551 4.866  1.00 0.00 ? 42 HIS A HB2  2  
ATOM 1708  H HB3  . HIS A 1 72  ? 45.080 39.873 4.870  1.00 0.00 ? 42 HIS A HB3  2  
ATOM 1709  H HD1  . HIS A 1 72  ? 46.538 43.357 5.480  1.00 0.00 ? 42 HIS A HD1  2  
ATOM 1710  H HD2  . HIS A 1 72  ? 43.417 41.510 3.424  1.00 0.00 ? 42 HIS A HD2  2  
ATOM 1711  H HE1  . HIS A 1 72  ? 45.284 45.199 4.279  1.00 0.00 ? 42 HIS A HE1  2  
ATOM 1712  N N    . LYS A 1 73  ? 43.773 41.935 7.490  1.00 0.00 ? 43 LYS A N    2  
ATOM 1713  C CA   . LYS A 1 73  ? 42.359 42.114 7.797  1.00 0.00 ? 43 LYS A CA   2  
ATOM 1714  C C    . LYS A 1 73  ? 41.524 41.630 6.617  1.00 0.00 ? 43 LYS A C    2  
ATOM 1715  O O    . LYS A 1 73  ? 41.816 41.975 5.472  1.00 0.00 ? 43 LYS A O    2  
ATOM 1716  C CB   . LYS A 1 73  ? 42.059 43.595 8.039  1.00 0.00 ? 43 LYS A CB   2  
ATOM 1717  C CG   . LYS A 1 73  ? 40.629 43.747 8.562  1.00 0.00 ? 43 LYS A CG   2  
ATOM 1718  C CD   . LYS A 1 73  ? 40.300 45.232 8.726  1.00 0.00 ? 43 LYS A CD   2  
ATOM 1719  C CE   . LYS A 1 73  ? 38.931 45.382 9.393  1.00 0.00 ? 43 LYS A CE   2  
ATOM 1720  N NZ   . LYS A 1 73  ? 38.534 46.818 9.396  1.00 0.00 ? 43 LYS A NZ   2  
ATOM 1721  H H    . LYS A 1 73  ? 44.363 42.717 7.451  1.00 0.00 ? 43 LYS A H    2  
ATOM 1722  H HA   . LYS A 1 73  ? 42.105 41.546 8.679  1.00 0.00 ? 43 LYS A HA   2  
ATOM 1723  H HB2  . LYS A 1 73  ? 42.756 43.995 8.759  1.00 0.00 ? 43 LYS A HB2  2  
ATOM 1724  H HB3  . LYS A 1 73  ? 42.155 44.135 7.110  1.00 0.00 ? 43 LYS A HB3  2  
ATOM 1725  H HG2  . LYS A 1 73  ? 39.940 43.300 7.861  1.00 0.00 ? 43 LYS A HG2  2  
ATOM 1726  H HG3  . LYS A 1 73  ? 40.541 43.254 9.519  1.00 0.00 ? 43 LYS A HG3  2  
ATOM 1727  H HD2  . LYS A 1 73  ? 41.055 45.702 9.341  1.00 0.00 ? 43 LYS A HD2  2  
ATOM 1728  H HD3  . LYS A 1 73  ? 40.278 45.706 7.756  1.00 0.00 ? 43 LYS A HD3  2  
ATOM 1729  H HE2  . LYS A 1 73  ? 38.199 44.807 8.846  1.00 0.00 ? 43 LYS A HE2  2  
ATOM 1730  H HE3  . LYS A 1 73  ? 38.985 45.021 10.410 1.00 0.00 ? 43 LYS A HE3  2  
ATOM 1731  H HZ1  . LYS A 1 73  ? 37.695 46.945 9.997  1.00 0.00 ? 43 LYS A HZ1  2  
ATOM 1732  H HZ2  . LYS A 1 73  ? 38.314 47.118 8.424  1.00 0.00 ? 43 LYS A HZ2  2  
ATOM 1733  H HZ3  . LYS A 1 73  ? 39.315 47.394 9.768  1.00 0.00 ? 43 LYS A HZ3  2  
ATOM 1734  N N    . ILE A 1 74  ? 40.491 40.839 6.891  1.00 0.00 ? 44 ILE A N    2  
ATOM 1735  C CA   . ILE A 1 74  ? 39.598 40.391 5.823  1.00 0.00 ? 44 ILE A CA   2  
ATOM 1736  C C    . ILE A 1 74  ? 38.435 41.369 5.659  1.00 0.00 ? 44 ILE A C    2  
ATOM 1737  O O    . ILE A 1 74  ? 37.812 41.782 6.637  1.00 0.00 ? 44 ILE A O    2  
ATOM 1738  C CB   . ILE A 1 74  ? 39.114 38.963 6.111  1.00 0.00 ? 44 ILE A CB   2  
ATOM 1739  C CG1  . ILE A 1 74  ? 40.341 38.047 6.177  1.00 0.00 ? 44 ILE A CG1  2  
ATOM 1740  C CG2  . ILE A 1 74  ? 38.180 38.486 4.993  1.00 0.00 ? 44 ILE A CG2  2  
ATOM 1741  C CD1  . ILE A 1 74  ? 39.942 36.642 6.627  1.00 0.00 ? 44 ILE A CD1  2  
ATOM 1742  H H    . ILE A 1 74  ? 40.344 40.535 7.813  1.00 0.00 ? 44 ILE A H    2  
ATOM 1743  H HA   . ILE A 1 74  ? 40.157 40.378 4.898  1.00 0.00 ? 44 ILE A HA   2  
ATOM 1744  H HB   . ILE A 1 74  ? 38.592 38.940 7.057  1.00 0.00 ? 44 ILE A HB   2  
ATOM 1745  H HG12 . ILE A 1 74  ? 40.797 37.992 5.200  1.00 0.00 ? 44 ILE A HG12 2  
ATOM 1746  H HG13 . ILE A 1 74  ? 41.053 38.456 6.879  1.00 0.00 ? 44 ILE A HG13 2  
ATOM 1747  H HG21 . ILE A 1 74  ? 38.666 38.617 4.038  1.00 0.00 ? 44 ILE A HG21 2  
ATOM 1748  H HG22 . ILE A 1 74  ? 37.270 39.065 5.016  1.00 0.00 ? 44 ILE A HG22 2  
ATOM 1749  H HG23 . ILE A 1 74  ? 37.944 37.442 5.137  1.00 0.00 ? 44 ILE A HG23 2  
ATOM 1750  H HD11 . ILE A 1 74  ? 39.153 36.268 5.992  1.00 0.00 ? 44 ILE A HD11 2  
ATOM 1751  H HD12 . ILE A 1 74  ? 39.598 36.674 7.650  1.00 0.00 ? 44 ILE A HD12 2  
ATOM 1752  H HD13 . ILE A 1 74  ? 40.800 35.990 6.555  1.00 0.00 ? 44 ILE A HD13 2  
ATOM 1753  N N    . LYS A 1 75  ? 38.154 41.731 4.410  1.00 0.00 ? 45 LYS A N    2  
ATOM 1754  C CA   . LYS A 1 75  ? 37.133 42.736 4.116  1.00 0.00 ? 45 LYS A CA   2  
ATOM 1755  C C    . LYS A 1 75  ? 35.716 42.155 4.077  1.00 0.00 ? 45 LYS A C    2  
ATOM 1756  O O    . LYS A 1 75  ? 34.744 42.896 4.232  1.00 0.00 ? 45 LYS A O    2  
ATOM 1757  C CB   . LYS A 1 75  ? 37.461 43.392 2.771  1.00 0.00 ? 45 LYS A CB   2  
ATOM 1758  C CG   . LYS A 1 75  ? 36.525 44.575 2.511  1.00 0.00 ? 45 LYS A CG   2  
ATOM 1759  C CD   . LYS A 1 75  ? 36.834 45.175 1.137  1.00 0.00 ? 45 LYS A CD   2  
ATOM 1760  C CE   . LYS A 1 75  ? 36.011 46.449 0.938  1.00 0.00 ? 45 LYS A CE   2  
ATOM 1761  N NZ   . LYS A 1 75  ? 36.520 47.187 -0.252 1.00 0.00 ? 45 LYS A NZ   2  
ATOM 1762  H H    . LYS A 1 75  ? 38.643 41.315 3.670  1.00 0.00 ? 45 LYS A H    2  
ATOM 1763  H HA   . LYS A 1 75  ? 37.168 43.497 4.881  1.00 0.00 ? 45 LYS A HA   2  
ATOM 1764  H HB2  . LYS A 1 75  ? 38.483 43.741 2.784  1.00 0.00 ? 45 LYS A HB2  2  
ATOM 1765  H HB3  . LYS A 1 75  ? 37.342 42.665 1.981  1.00 0.00 ? 45 LYS A HB3  2  
ATOM 1766  H HG2  . LYS A 1 75  ? 35.500 44.237 2.529  1.00 0.00 ? 45 LYS A HG2  2  
ATOM 1767  H HG3  . LYS A 1 75  ? 36.673 45.328 3.270  1.00 0.00 ? 45 LYS A HG3  2  
ATOM 1768  H HD2  . LYS A 1 75  ? 37.886 45.411 1.077  1.00 0.00 ? 45 LYS A HD2  2  
ATOM 1769  H HD3  . LYS A 1 75  ? 36.580 44.462 0.367  1.00 0.00 ? 45 LYS A HD3  2  
ATOM 1770  H HE2  . LYS A 1 75  ? 34.975 46.188 0.784  1.00 0.00 ? 45 LYS A HE2  2  
ATOM 1771  H HE3  . LYS A 1 75  ? 36.098 47.075 1.814  1.00 0.00 ? 45 LYS A HE3  2  
ATOM 1772  H HZ1  . LYS A 1 75  ? 35.873 47.043 -1.053 1.00 0.00 ? 45 LYS A HZ1  2  
ATOM 1773  H HZ2  . LYS A 1 75  ? 37.466 46.833 -0.501 1.00 0.00 ? 45 LYS A HZ2  2  
ATOM 1774  H HZ3  . LYS A 1 75  ? 36.575 48.202 -0.034 1.00 0.00 ? 45 LYS A HZ3  2  
ATOM 1775  N N    . SER A 1 76  ? 35.588 40.840 3.894  1.00 0.00 ? 46 SER A N    2  
ATOM 1776  C CA   . SER A 1 76  ? 34.269 40.216 3.840  1.00 0.00 ? 46 SER A CA   2  
ATOM 1777  C C    . SER A 1 76  ? 34.334 38.749 4.247  1.00 0.00 ? 46 SER A C    2  
ATOM 1778  O O    . SER A 1 76  ? 35.373 38.101 4.123  1.00 0.00 ? 46 SER A O    2  
ATOM 1779  C CB   . SER A 1 76  ? 33.701 40.327 2.425  1.00 0.00 ? 46 SER A CB   2  
ATOM 1780  O OG   . SER A 1 76  ? 34.446 39.486 1.555  1.00 0.00 ? 46 SER A OG   2  
ATOM 1781  H H    . SER A 1 76  ? 36.389 40.287 3.788  1.00 0.00 ? 46 SER A H    2  
ATOM 1782  H HA   . SER A 1 76  ? 33.610 40.737 4.518  1.00 0.00 ? 46 SER A HA   2  
ATOM 1783  H HB2  . SER A 1 76  ? 32.670 40.013 2.420  1.00 0.00 ? 46 SER A HB2  2  
ATOM 1784  H HB3  . SER A 1 76  ? 33.760 41.356 2.095  1.00 0.00 ? 46 SER A HB3  2  
ATOM 1785  H HG   . SER A 1 76  ? 34.737 39.986 0.866  1.00 0.00 ? 46 SER A HG   2  
ATOM 1786  N N    . GLY A 1 77  ? 33.209 38.233 4.734  1.00 0.00 ? 47 GLY A N    2  
ATOM 1787  C CA   . GLY A 1 77  ? 33.115 36.827 5.110  1.00 0.00 ? 47 GLY A CA   2  
ATOM 1788  C C    . GLY A 1 77  ? 33.296 35.912 3.901  1.00 0.00 ? 47 GLY A C    2  
ATOM 1789  O O    . GLY A 1 77  ? 33.889 34.836 4.007  1.00 0.00 ? 47 GLY A O    2  
ATOM 1790  H H    . GLY A 1 77  ? 32.417 38.801 4.817  1.00 0.00 ? 47 GLY A H    2  
ATOM 1791  H HA2  . GLY A 1 77  ? 33.879 36.604 5.841  1.00 0.00 ? 47 GLY A HA2  2  
ATOM 1792  H HA3  . GLY A 1 77  ? 32.145 36.642 5.545  1.00 0.00 ? 47 GLY A HA3  2  
ATOM 1793  N N    . ALA A 1 78  ? 32.806 36.350 2.741  1.00 0.00 ? 48 ALA A N    2  
ATOM 1794  C CA   . ALA A 1 78  ? 32.896 35.531 1.537  1.00 0.00 ? 48 ALA A CA   2  
ATOM 1795  C C    . ALA A 1 78  ? 34.354 35.210 1.232  1.00 0.00 ? 48 ALA A C    2  
ATOM 1796  O O    . ALA A 1 78  ? 34.683 34.080 0.869  1.00 0.00 ? 48 ALA A O    2  
ATOM 1797  C CB   . ALA A 1 78  ? 32.272 36.270 0.352  1.00 0.00 ? 48 ALA A CB   2  
ATOM 1798  H H    . ALA A 1 78  ? 32.381 37.231 2.696  1.00 0.00 ? 48 ALA A H    2  
ATOM 1799  H HA   . ALA A 1 78  ? 32.358 34.608 1.698  1.00 0.00 ? 48 ALA A HA   2  
ATOM 1800  H HB1  . ALA A 1 78  ? 32.664 37.275 0.308  1.00 0.00 ? 48 ALA A HB1  2  
ATOM 1801  H HB2  . ALA A 1 78  ? 31.200 36.306 0.473  1.00 0.00 ? 48 ALA A HB2  2  
ATOM 1802  H HB3  . ALA A 1 78  ? 32.513 35.750 -0.564 1.00 0.00 ? 48 ALA A HB3  2  
ATOM 1803  N N    . GLU A 1 79  ? 35.225 36.206 1.379  1.00 0.00 ? 49 GLU A N    2  
ATOM 1804  C CA   . GLU A 1 79  ? 36.658 35.953 1.291  1.00 0.00 ? 49 GLU A CA   2  
ATOM 1805  C C    . GLU A 1 79  ? 37.105 34.991 2.392  1.00 0.00 ? 49 GLU A C    2  
ATOM 1806  O O    . GLU A 1 79  ? 37.902 34.087 2.144  1.00 0.00 ? 49 GLU A O    2  
ATOM 1807  C CB   . GLU A 1 79  ? 37.429 37.268 1.417  1.00 0.00 ? 49 GLU A CB   2  
ATOM 1808  C CG   . GLU A 1 79  ? 37.082 38.182 0.236  1.00 0.00 ? 49 GLU A CG   2  
ATOM 1809  C CD   . GLU A 1 79  ? 37.892 39.483 0.267  1.00 0.00 ? 49 GLU A CD   2  
ATOM 1810  O OE1  . GLU A 1 79  ? 38.548 39.756 1.262  1.00 0.00 ? 49 GLU A OE1  2  
ATOM 1811  O OE2  . GLU A 1 79  ? 37.843 40.197 -0.721 1.00 0.00 ? 49 GLU A OE2  2  
ATOM 1812  H H    . GLU A 1 79  ? 34.900 37.115 1.547  1.00 0.00 ? 49 GLU A H    2  
ATOM 1813  H HA   . GLU A 1 79  ? 36.877 35.511 0.330  1.00 0.00 ? 49 GLU A HA   2  
ATOM 1814  H HB2  . GLU A 1 79  ? 37.159 37.755 2.343  1.00 0.00 ? 49 GLU A HB2  2  
ATOM 1815  H HB3  . GLU A 1 79  ? 38.490 37.066 1.411  1.00 0.00 ? 49 GLU A HB3  2  
ATOM 1816  H HG2  . GLU A 1 79  ? 37.291 37.661 -0.686 1.00 0.00 ? 49 GLU A HG2  2  
ATOM 1817  H HG3  . GLU A 1 79  ? 36.029 38.421 0.274  1.00 0.00 ? 49 GLU A HG3  2  
ATOM 1818  N N    . ALA A 1 80  ? 36.503 35.107 3.577  1.00 0.00 ? 50 ALA A N    2  
ATOM 1819  C CA   . ALA A 1 80  ? 36.892 34.260 4.703  1.00 0.00 ? 50 ALA A CA   2  
ATOM 1820  C C    . ALA A 1 80  ? 36.675 32.781 4.387  1.00 0.00 ? 50 ALA A C    2  
ATOM 1821  O O    . ALA A 1 80  ? 37.482 31.933 4.768  1.00 0.00 ? 50 ALA A O    2  
ATOM 1822  C CB   . ALA A 1 80  ? 36.080 34.640 5.942  1.00 0.00 ? 50 ALA A CB   2  
ATOM 1823  H H    . ALA A 1 80  ? 35.793 35.773 3.697  1.00 0.00 ? 50 ALA A H    2  
ATOM 1824  H HA   . ALA A 1 80  ? 37.939 34.421 4.914  1.00 0.00 ? 50 ALA A HA   2  
ATOM 1825  H HB1  . ALA A 1 80  ? 35.122 34.141 5.911  1.00 0.00 ? 50 ALA A HB1  2  
ATOM 1826  H HB2  . ALA A 1 80  ? 35.929 35.709 5.960  1.00 0.00 ? 50 ALA A HB2  2  
ATOM 1827  H HB3  . ALA A 1 80  ? 36.615 34.337 6.830  1.00 0.00 ? 50 ALA A HB3  2  
ATOM 1828  N N    . LYS A 1 81  ? 35.633 32.482 3.619  1.00 0.00 ? 51 LYS A N    2  
ATOM 1829  C CA   . LYS A 1 81  ? 35.336 31.100 3.252  1.00 0.00 ? 51 LYS A CA   2  
ATOM 1830  C C    . LYS A 1 81  ? 36.517 30.438 2.534  1.00 0.00 ? 51 LYS A C    2  
ATOM 1831  O O    . LYS A 1 81  ? 36.680 29.220 2.611  1.00 0.00 ? 51 LYS A O    2  
ATOM 1832  C CB   . LYS A 1 81  ? 34.102 31.066 2.346  1.00 0.00 ? 51 LYS A CB   2  
ATOM 1833  C CG   . LYS A 1 81  ? 33.688 29.615 2.092  1.00 0.00 ? 51 LYS A CG   2  
ATOM 1834  C CD   . LYS A 1 81  ? 32.504 29.585 1.123  1.00 0.00 ? 51 LYS A CD   2  
ATOM 1835  C CE   . LYS A 1 81  ? 31.987 28.151 0.990  1.00 0.00 ? 51 LYS A CE   2  
ATOM 1836  N NZ   . LYS A 1 81  ? 32.823 27.412 0.002  1.00 0.00 ? 51 LYS A NZ   2  
ATOM 1837  H H    . LYS A 1 81  ? 35.025 33.200 3.341  1.00 0.00 ? 51 LYS A H    2  
ATOM 1838  H HA   . LYS A 1 81  ? 35.119 30.541 4.148  1.00 0.00 ? 51 LYS A HA   2  
ATOM 1839  H HB2  . LYS A 1 81  ? 33.291 31.594 2.826  1.00 0.00 ? 51 LYS A HB2  2  
ATOM 1840  H HB3  . LYS A 1 81  ? 34.334 31.541 1.405  1.00 0.00 ? 51 LYS A HB3  2  
ATOM 1841  H HG2  . LYS A 1 81  ? 34.519 29.073 1.664  1.00 0.00 ? 51 LYS A HG2  2  
ATOM 1842  H HG3  . LYS A 1 81  ? 33.398 29.154 3.024  1.00 0.00 ? 51 LYS A HG3  2  
ATOM 1843  H HD2  . LYS A 1 81  ? 31.715 30.219 1.500  1.00 0.00 ? 51 LYS A HD2  2  
ATOM 1844  H HD3  . LYS A 1 81  ? 32.822 29.940 0.154  1.00 0.00 ? 51 LYS A HD3  2  
ATOM 1845  H HE2  . LYS A 1 81  ? 32.044 27.658 1.950  1.00 0.00 ? 51 LYS A HE2  2  
ATOM 1846  H HE3  . LYS A 1 81  ? 30.961 28.167 0.654  1.00 0.00 ? 51 LYS A HE3  2  
ATOM 1847  H HZ1  . LYS A 1 81  ? 33.568 26.886 0.502  1.00 0.00 ? 51 LYS A HZ1  2  
ATOM 1848  H HZ2  . LYS A 1 81  ? 33.257 28.089 -0.658 1.00 0.00 ? 51 LYS A HZ2  2  
ATOM 1849  H HZ3  . LYS A 1 81  ? 32.226 26.745 -0.527 1.00 0.00 ? 51 LYS A HZ3  2  
ATOM 1850  N N    . LYS A 1 82  ? 37.338 31.226 1.842  1.00 0.00 ? 52 LYS A N    2  
ATOM 1851  C CA   . LYS A 1 82  ? 38.481 30.676 1.118  1.00 0.00 ? 52 LYS A CA   2  
ATOM 1852  C C    . LYS A 1 82  ? 39.470 29.964 2.047  1.00 0.00 ? 52 LYS A C    2  
ATOM 1853  O O    . LYS A 1 82  ? 40.221 29.098 1.597  1.00 0.00 ? 52 LYS A O    2  
ATOM 1854  C CB   . LYS A 1 82  ? 39.206 31.800 0.374  1.00 0.00 ? 52 LYS A CB   2  
ATOM 1855  C CG   . LYS A 1 82  ? 38.276 32.394 -0.686 1.00 0.00 ? 52 LYS A CG   2  
ATOM 1856  C CD   . LYS A 1 82  ? 39.034 33.444 -1.500 1.00 0.00 ? 52 LYS A CD   2  
ATOM 1857  C CE   . LYS A 1 82  ? 38.074 34.124 -2.478 1.00 0.00 ? 52 LYS A CE   2  
ATOM 1858  N NZ   . LYS A 1 82  ? 38.853 34.766 -3.574 1.00 0.00 ? 52 LYS A NZ   2  
ATOM 1859  H H    . LYS A 1 82  ? 37.204 32.197 1.851  1.00 0.00 ? 52 LYS A H    2  
ATOM 1860  H HA   . LYS A 1 82  ? 38.118 29.966 0.390  1.00 0.00 ? 52 LYS A HA   2  
ATOM 1861  H HB2  . LYS A 1 82  ? 39.492 32.569 1.077  1.00 0.00 ? 52 LYS A HB2  2  
ATOM 1862  H HB3  . LYS A 1 82  ? 40.088 31.403 -0.106 1.00 0.00 ? 52 LYS A HB3  2  
ATOM 1863  H HG2  . LYS A 1 82  ? 37.931 31.608 -1.342 1.00 0.00 ? 52 LYS A HG2  2  
ATOM 1864  H HG3  . LYS A 1 82  ? 37.430 32.859 -0.203 1.00 0.00 ? 52 LYS A HG3  2  
ATOM 1865  H HD2  . LYS A 1 82  ? 39.454 34.182 -0.833 1.00 0.00 ? 52 LYS A HD2  2  
ATOM 1866  H HD3  . LYS A 1 82  ? 39.828 32.966 -2.055 1.00 0.00 ? 52 LYS A HD3  2  
ATOM 1867  H HE2  . LYS A 1 82  ? 37.404 33.388 -2.896 1.00 0.00 ? 52 LYS A HE2  2  
ATOM 1868  H HE3  . LYS A 1 82  ? 37.501 34.876 -1.955 1.00 0.00 ? 52 LYS A HE3  2  
ATOM 1869  H HZ1  . LYS A 1 82  ? 39.323 35.620 -3.212 1.00 0.00 ? 52 LYS A HZ1  2  
ATOM 1870  H HZ2  . LYS A 1 82  ? 38.210 35.025 -4.350 1.00 0.00 ? 52 LYS A HZ2  2  
ATOM 1871  H HZ3  . LYS A 1 82  ? 39.571 34.101 -3.925 1.00 0.00 ? 52 LYS A HZ3  2  
ATOM 1872  N N    . LEU A 1 83  ? 39.478 30.318 3.333  1.00 0.00 ? 53 LEU A N    2  
ATOM 1873  C CA   . LEU A 1 83  ? 40.471 29.778 4.255  1.00 0.00 ? 53 LEU A CA   2  
ATOM 1874  C C    . LEU A 1 83  ? 40.023 28.418 4.804  1.00 0.00 ? 53 LEU A C    2  
ATOM 1875  O O    . LEU A 1 83  ? 38.843 28.257 5.137  1.00 0.00 ? 53 LEU A O    2  
ATOM 1876  C CB   . LEU A 1 83  ? 40.668 30.753 5.418  1.00 0.00 ? 53 LEU A CB   2  
ATOM 1877  C CG   . LEU A 1 83  ? 41.616 31.878 4.996  1.00 0.00 ? 53 LEU A CG   2  
ATOM 1878  C CD1  . LEU A 1 83  ? 41.556 33.009 6.025  1.00 0.00 ? 53 LEU A CD1  2  
ATOM 1879  C CD2  . LEU A 1 83  ? 43.045 31.337 4.916  1.00 0.00 ? 53 LEU A CD2  2  
ATOM 1880  H H    . LEU A 1 83  ? 38.798 30.937 3.672  1.00 0.00 ? 53 LEU A H    2  
ATOM 1881  H HA   . LEU A 1 83  ? 41.399 29.685 3.718  1.00 0.00 ? 53 LEU A HA   2  
ATOM 1882  H HB2  . LEU A 1 83  ? 39.713 31.172 5.700  1.00 0.00 ? 53 LEU A HB2  2  
ATOM 1883  H HB3  . LEU A 1 83  ? 41.091 30.226 6.259  1.00 0.00 ? 53 LEU A HB3  2  
ATOM 1884  H HG   . LEU A 1 83  ? 41.317 32.255 4.030  1.00 0.00 ? 53 LEU A HG   2  
ATOM 1885  H HD11 . LEU A 1 83  ? 40.540 33.131 6.368  1.00 0.00 ? 53 LEU A HD11 2  
ATOM 1886  H HD12 . LEU A 1 83  ? 41.895 33.929 5.570  1.00 0.00 ? 53 LEU A HD12 2  
ATOM 1887  H HD13 . LEU A 1 83  ? 42.193 32.768 6.863  1.00 0.00 ? 53 LEU A HD13 2  
ATOM 1888  H HD21 . LEU A 1 83  ? 43.199 30.608 5.697  1.00 0.00 ? 53 LEU A HD21 2  
ATOM 1889  H HD22 . LEU A 1 83  ? 43.745 32.149 5.039  1.00 0.00 ? 53 LEU A HD22 2  
ATOM 1890  H HD23 . LEU A 1 83  ? 43.200 30.871 3.954  1.00 0.00 ? 53 LEU A HD23 2  
ATOM 1891  N N    . PRO A 1 84  ? 40.912 27.455 4.965  1.00 0.00 ? 54 PRO A N    2  
ATOM 1892  C CA   . PRO A 1 84  ? 40.508 26.109 5.477  1.00 0.00 ? 54 PRO A CA   2  
ATOM 1893  C C    . PRO A 1 84  ? 39.842 26.208 6.846  1.00 0.00 ? 54 PRO A C    2  
ATOM 1894  O O    . PRO A 1 84  ? 40.377 26.832 7.764  1.00 0.00 ? 54 PRO A O    2  
ATOM 1895  C CB   . PRO A 1 84  ? 41.813 25.308 5.561  1.00 0.00 ? 54 PRO A CB   2  
ATOM 1896  C CG   . PRO A 1 84  ? 42.790 26.034 4.703  1.00 0.00 ? 54 PRO A CG   2  
ATOM 1897  C CD   . PRO A 1 84  ? 42.366 27.500 4.712  1.00 0.00 ? 54 PRO A CD   2  
ATOM 1898  H HA   . PRO A 1 84  ? 39.840 25.634 4.776  1.00 0.00 ? 54 PRO A HA   2  
ATOM 1899  H HB2  . PRO A 1 84  ? 42.169 25.269 6.582  1.00 0.00 ? 54 PRO A HB2  2  
ATOM 1900  H HB3  . PRO A 1 84  ? 41.664 24.310 5.178  1.00 0.00 ? 54 PRO A HB3  2  
ATOM 1901  H HG2  . PRO A 1 84  ? 43.787 25.926 5.108  1.00 0.00 ? 54 PRO A HG2  2  
ATOM 1902  H HG3  . PRO A 1 84  ? 42.754 25.655 3.693  1.00 0.00 ? 54 PRO A HG3  2  
ATOM 1903  H HD2  . PRO A 1 84  ? 42.878 28.035 5.500  1.00 0.00 ? 54 PRO A HD2  2  
ATOM 1904  H HD3  . PRO A 1 84  ? 42.562 27.951 3.752  1.00 0.00 ? 54 PRO A HD3  2  
ATOM 1905  N N    . GLY A 1 85  ? 38.681 25.577 6.976  1.00 0.00 ? 55 GLY A N    2  
ATOM 1906  C CA   . GLY A 1 85  ? 37.960 25.568 8.247  1.00 0.00 ? 55 GLY A CA   2  
ATOM 1907  C C    . GLY A 1 85  ? 36.800 26.569 8.291  1.00 0.00 ? 55 GLY A C    2  
ATOM 1908  O O    . GLY A 1 85  ? 35.982 26.506 9.210  1.00 0.00 ? 55 GLY A O    2  
ATOM 1909  H H    . GLY A 1 85  ? 38.300 25.107 6.205  1.00 0.00 ? 55 GLY A H    2  
ATOM 1910  H HA2  . GLY A 1 85  ? 37.566 24.577 8.414  1.00 0.00 ? 55 GLY A HA2  2  
ATOM 1911  H HA3  . GLY A 1 85  ? 38.652 25.804 9.042  1.00 0.00 ? 55 GLY A HA3  2  
ATOM 1912  N N    . VAL A 1 86  ? 36.715 27.486 7.322  1.00 0.00 ? 56 VAL A N    2  
ATOM 1913  C CA   . VAL A 1 86  ? 35.615 28.448 7.300  1.00 0.00 ? 56 VAL A CA   2  
ATOM 1914  C C    . VAL A 1 86  ? 34.425 27.869 6.539  1.00 0.00 ? 56 VAL A C    2  
ATOM 1915  O O    . VAL A 1 86  ? 34.585 27.296 5.462  1.00 0.00 ? 56 VAL A O    2  
ATOM 1916  C CB   . VAL A 1 86  ? 36.060 29.762 6.647  1.00 0.00 ? 56 VAL A CB   2  
ATOM 1917  C CG1  . VAL A 1 86  ? 34.934 30.794 6.749  1.00 0.00 ? 56 VAL A CG1  2  
ATOM 1918  C CG2  . VAL A 1 86  ? 37.300 30.308 7.361  1.00 0.00 ? 56 VAL A CG2  2  
ATOM 1919  H H    . VAL A 1 86  ? 37.405 27.527 6.623  1.00 0.00 ? 56 VAL A H    2  
ATOM 1920  H HA   . VAL A 1 86  ? 35.312 28.651 8.317  1.00 0.00 ? 56 VAL A HA   2  
ATOM 1921  H HB   . VAL A 1 86  ? 36.291 29.585 5.606  1.00 0.00 ? 56 VAL A HB   2  
ATOM 1922  H HG11 . VAL A 1 86  ? 34.039 30.396 6.294  1.00 0.00 ? 56 VAL A HG11 2  
ATOM 1923  H HG12 . VAL A 1 86  ? 35.226 31.699 6.237  1.00 0.00 ? 56 VAL A HG12 2  
ATOM 1924  H HG13 . VAL A 1 86  ? 34.742 31.015 7.789  1.00 0.00 ? 56 VAL A HG13 2  
ATOM 1925  H HG21 . VAL A 1 86  ? 37.437 31.348 7.101  1.00 0.00 ? 56 VAL A HG21 2  
ATOM 1926  H HG22 . VAL A 1 86  ? 38.169 29.744 7.057  1.00 0.00 ? 56 VAL A HG22 2  
ATOM 1927  H HG23 . VAL A 1 86  ? 37.169 30.219 8.430  1.00 0.00 ? 56 VAL A HG23 2  
ATOM 1928  N N    . GLY A 1 87  ? 33.232 28.022 7.109  1.00 0.00 ? 57 GLY A N    2  
ATOM 1929  C CA   . GLY A 1 87  ? 32.016 27.508 6.482  1.00 0.00 ? 57 GLY A CA   2  
ATOM 1930  C C    . GLY A 1 87  ? 31.115 28.650 6.024  1.00 0.00 ? 57 GLY A C    2  
ATOM 1931  O O    . GLY A 1 87  ? 31.347 29.811 6.360  1.00 0.00 ? 57 GLY A O    2  
ATOM 1932  H H    . GLY A 1 87  ? 33.167 28.492 7.965  1.00 0.00 ? 57 GLY A H    2  
ATOM 1933  H HA2  . GLY A 1 87  ? 32.280 26.899 5.628  1.00 0.00 ? 57 GLY A HA2  2  
ATOM 1934  H HA3  . GLY A 1 87  ? 31.478 26.904 7.196  1.00 0.00 ? 57 GLY A HA3  2  
ATOM 1935  N N    . THR A 1 88  ? 30.066 28.311 5.280  1.00 0.00 ? 58 THR A N    2  
ATOM 1936  C CA   . THR A 1 88  ? 29.161 29.328 4.756  1.00 0.00 ? 58 THR A CA   2  
ATOM 1937  C C    . THR A 1 88  ? 28.503 30.107 5.891  1.00 0.00 ? 58 THR A C    2  
ATOM 1938  O O    . THR A 1 88  ? 28.426 31.335 5.847  1.00 0.00 ? 58 THR A O    2  
ATOM 1939  C CB   . THR A 1 88  ? 28.080 28.674 3.892  1.00 0.00 ? 58 THR A CB   2  
ATOM 1940  O OG1  . THR A 1 88  ? 27.310 27.788 4.692  1.00 0.00 ? 58 THR A OG1  2  
ATOM 1941  C CG2  . THR A 1 88  ? 28.735 27.895 2.749  1.00 0.00 ? 58 THR A CG2  2  
ATOM 1942  H H    . THR A 1 88  ? 29.898 27.366 5.082  1.00 0.00 ? 58 THR A H    2  
ATOM 1943  H HA   . THR A 1 88  ? 29.726 30.015 4.144  1.00 0.00 ? 58 THR A HA   2  
ATOM 1944  H HB   . THR A 1 88  ? 27.438 29.437 3.479  1.00 0.00 ? 58 THR A HB   2  
ATOM 1945  H HG1  . THR A 1 88  ? 26.830 28.283 5.271  1.00 0.00 ? 58 THR A HG1  2  
ATOM 1946  H HG21 . THR A 1 88  ? 29.389 27.139 3.157  1.00 0.00 ? 58 THR A HG21 2  
ATOM 1947  H HG22 . THR A 1 88  ? 29.309 28.573 2.134  1.00 0.00 ? 58 THR A HG22 2  
ATOM 1948  H HG23 . THR A 1 88  ? 27.970 27.425 2.149  1.00 0.00 ? 58 THR A HG23 2  
ATOM 1949  N N    . LYS A 1 89  ? 28.059 29.394 6.924  1.00 0.00 ? 59 LYS A N    2  
ATOM 1950  C CA   . LYS A 1 89  ? 27.397 30.046 8.049  1.00 0.00 ? 59 LYS A CA   2  
ATOM 1951  C C    . LYS A 1 89  ? 28.339 31.039 8.721  1.00 0.00 ? 59 LYS A C    2  
ATOM 1952  O O    . LYS A 1 89  ? 27.949 32.163 9.043  1.00 0.00 ? 59 LYS A O    2  
ATOM 1953  C CB   . LYS A 1 89  ? 26.940 29.000 9.067  1.00 0.00 ? 59 LYS A CB   2  
ATOM 1954  C CG   . LYS A 1 89  ? 25.883 28.096 8.430  1.00 0.00 ? 59 LYS A CG   2  
ATOM 1955  C CD   . LYS A 1 89  ? 25.346 27.118 9.476  1.00 0.00 ? 59 LYS A CD   2  
ATOM 1956  C CE   . LYS A 1 89  ? 24.378 26.138 8.811  1.00 0.00 ? 59 LYS A CE   2  
ATOM 1957  N NZ   . LYS A 1 89  ? 24.035 25.050 9.770  1.00 0.00 ? 59 LYS A NZ   2  
ATOM 1958  H H    . LYS A 1 89  ? 28.178 28.422 6.929  1.00 0.00 ? 59 LYS A H    2  
ATOM 1959  H HA   . LYS A 1 89  ? 26.531 30.578 7.684  1.00 0.00 ? 59 LYS A HA   2  
ATOM 1960  H HB2  . LYS A 1 89  ? 27.788 28.404 9.375  1.00 0.00 ? 59 LYS A HB2  2  
ATOM 1961  H HB3  . LYS A 1 89  ? 26.515 29.495 9.927  1.00 0.00 ? 59 LYS A HB3  2  
ATOM 1962  H HG2  . LYS A 1 89  ? 25.072 28.703 8.052  1.00 0.00 ? 59 LYS A HG2  2  
ATOM 1963  H HG3  . LYS A 1 89  ? 26.326 27.541 7.617  1.00 0.00 ? 59 LYS A HG3  2  
ATOM 1964  H HD2  . LYS A 1 89  ? 26.169 26.573 9.915  1.00 0.00 ? 59 LYS A HD2  2  
ATOM 1965  H HD3  . LYS A 1 89  ? 24.825 27.666 10.247 1.00 0.00 ? 59 LYS A HD3  2  
ATOM 1966  H HE2  . LYS A 1 89  ? 23.478 26.660 8.522  1.00 0.00 ? 59 LYS A HE2  2  
ATOM 1967  H HE3  . LYS A 1 89  ? 24.844 25.712 7.934  1.00 0.00 ? 59 LYS A HE3  2  
ATOM 1968  H HZ1  . LYS A 1 89  ? 24.607 24.208 9.558  1.00 0.00 ? 59 LYS A HZ1  2  
ATOM 1969  H HZ2  . LYS A 1 89  ? 23.025 24.817 9.681  1.00 0.00 ? 59 LYS A HZ2  2  
ATOM 1970  H HZ3  . LYS A 1 89  ? 24.235 25.367 10.740 1.00 0.00 ? 59 LYS A HZ3  2  
ATOM 1971  N N    . ILE A 1 90  ? 29.600 30.644 8.874  1.00 0.00 ? 60 ILE A N    2  
ATOM 1972  C CA   . ILE A 1 90  ? 30.583 31.515 9.504  1.00 0.00 ? 60 ILE A CA   2  
ATOM 1973  C C    . ILE A 1 90  ? 30.801 32.757 8.640  1.00 0.00 ? 60 ILE A C    2  
ATOM 1974  O O    . ILE A 1 90  ? 30.827 33.878 9.150  1.00 0.00 ? 60 ILE A O    2  
ATOM 1975  C CB   . ILE A 1 90  ? 31.892 30.742 9.731  1.00 0.00 ? 60 ILE A CB   2  
ATOM 1976  C CG1  . ILE A 1 90  ? 31.609 29.572 10.683 1.00 0.00 ? 60 ILE A CG1  2  
ATOM 1977  C CG2  . ILE A 1 90  ? 32.951 31.657 10.355 1.00 0.00 ? 60 ILE A CG2  2  
ATOM 1978  C CD1  . ILE A 1 90  ? 32.849 28.683 10.836 1.00 0.00 ? 60 ILE A CD1  2  
ATOM 1979  H H    . ILE A 1 90  ? 29.870 29.756 8.560  1.00 0.00 ? 60 ILE A H    2  
ATOM 1980  H HA   . ILE A 1 90  ? 30.198 31.830 10.463 1.00 0.00 ? 60 ILE A HA   2  
ATOM 1981  H HB   . ILE A 1 90  ? 32.254 30.360 8.788  1.00 0.00 ? 60 ILE A HB   2  
ATOM 1982  H HG12 . ILE A 1 90  ? 31.332 29.963 11.651 1.00 0.00 ? 60 ILE A HG12 2  
ATOM 1983  H HG13 . ILE A 1 90  ? 30.795 28.982 10.290 1.00 0.00 ? 60 ILE A HG13 2  
ATOM 1984  H HG21 . ILE A 1 90  ? 33.849 31.089 10.552 1.00 0.00 ? 60 ILE A HG21 2  
ATOM 1985  H HG22 . ILE A 1 90  ? 32.573 32.066 11.280 1.00 0.00 ? 60 ILE A HG22 2  
ATOM 1986  H HG23 . ILE A 1 90  ? 33.178 32.463 9.672  1.00 0.00 ? 60 ILE A HG23 2  
ATOM 1987  H HD11 . ILE A 1 90  ? 33.689 29.280 11.159 1.00 0.00 ? 60 ILE A HD11 2  
ATOM 1988  H HD12 . ILE A 1 90  ? 33.081 28.221 9.889  1.00 0.00 ? 60 ILE A HD12 2  
ATOM 1989  H HD13 . ILE A 1 90  ? 32.654 27.915 11.572 1.00 0.00 ? 60 ILE A HD13 2  
ATOM 1990  N N    . ALA A 1 91  ? 30.897 32.563 7.329  1.00 0.00 ? 61 ALA A N    2  
ATOM 1991  C CA   . ALA A 1 91  ? 31.088 33.687 6.419  1.00 0.00 ? 61 ALA A CA   2  
ATOM 1992  C C    . ALA A 1 91  ? 29.938 34.683 6.552  1.00 0.00 ? 61 ALA A C    2  
ATOM 1993  O O    . ALA A 1 91  ? 30.160 35.894 6.605  1.00 0.00 ? 61 ALA A O    2  
ATOM 1994  C CB   . ALA A 1 91  ? 31.167 33.185 4.976  1.00 0.00 ? 61 ALA A CB   2  
ATOM 1995  H H    . ALA A 1 91  ? 30.868 31.651 6.971  1.00 0.00 ? 61 ALA A H    2  
ATOM 1996  H HA   . ALA A 1 91  ? 32.013 34.185 6.667  1.00 0.00 ? 61 ALA A HA   2  
ATOM 1997  H HB1  . ALA A 1 91  ? 31.924 32.418 4.903  1.00 0.00 ? 61 ALA A HB1  2  
ATOM 1998  H HB2  . ALA A 1 91  ? 31.422 34.007 4.323  1.00 0.00 ? 61 ALA A HB2  2  
ATOM 1999  H HB3  . ALA A 1 91  ? 30.211 32.777 4.684  1.00 0.00 ? 61 ALA A HB3  2  
ATOM 2000  N N    . GLU A 1 92  ? 28.712 34.172 6.636  1.00 0.00 ? 62 GLU A N    2  
ATOM 2001  C CA   . GLU A 1 92  ? 27.549 35.044 6.761  1.00 0.00 ? 62 GLU A CA   2  
ATOM 2002  C C    . GLU A 1 92  ? 27.614 35.863 8.048  1.00 0.00 ? 62 GLU A C    2  
ATOM 2003  O O    . GLU A 1 92  ? 27.323 37.060 8.040  1.00 0.00 ? 62 GLU A O    2  
ATOM 2004  C CB   . GLU A 1 92  ? 26.268 34.207 6.752  1.00 0.00 ? 62 GLU A CB   2  
ATOM 2005  C CG   . GLU A 1 92  ? 25.049 35.136 6.694  1.00 0.00 ? 62 GLU A CG   2  
ATOM 2006  C CD   . GLU A 1 92  ? 23.731 34.358 6.776  1.00 0.00 ? 62 GLU A CD   2  
ATOM 2007  O OE1  . GLU A 1 92  ? 23.758 33.142 6.902  1.00 0.00 ? 62 GLU A OE1  2  
ATOM 2008  O OE2  . GLU A 1 92  ? 22.696 35.001 6.708  1.00 0.00 ? 62 GLU A OE2  2  
ATOM 2009  H H    . GLU A 1 92  ? 28.588 33.202 6.580  1.00 0.00 ? 62 GLU A H    2  
ATOM 2010  H HA   . GLU A 1 92  ? 27.527 35.719 5.919  1.00 0.00 ? 62 GLU A HA   2  
ATOM 2011  H HB2  . GLU A 1 92  ? 26.269 33.558 5.889  1.00 0.00 ? 62 GLU A HB2  2  
ATOM 2012  H HB3  . GLU A 1 92  ? 26.220 33.612 7.651  1.00 0.00 ? 62 GLU A HB3  2  
ATOM 2013  H HG2  . GLU A 1 92  ? 25.097 35.830 7.520  1.00 0.00 ? 62 GLU A HG2  2  
ATOM 2014  H HG3  . GLU A 1 92  ? 25.075 35.691 5.768  1.00 0.00 ? 62 GLU A HG3  2  
ATOM 2015  N N    . LYS A 1 93  ? 28.031 35.232 9.146  1.00 0.00 ? 63 LYS A N    2  
ATOM 2016  C CA   . LYS A 1 93  ? 28.172 35.954 10.408 1.00 0.00 ? 63 LYS A CA   2  
ATOM 2017  C C    . LYS A 1 93  ? 29.188 37.085 10.273 1.00 0.00 ? 63 LYS A C    2  
ATOM 2018  O O    . LYS A 1 93  ? 28.964 38.193 10.764 1.00 0.00 ? 63 LYS A O    2  
ATOM 2019  C CB   . LYS A 1 93  ? 28.609 34.997 11.520 1.00 0.00 ? 63 LYS A CB   2  
ATOM 2020  C CG   . LYS A 1 93  ? 27.497 33.981 11.787 1.00 0.00 ? 63 LYS A CG   2  
ATOM 2021  C CD   . LYS A 1 93  ? 27.891 33.088 12.965 1.00 0.00 ? 63 LYS A CD   2  
ATOM 2022  C CE   . LYS A 1 93  ? 26.833 31.999 13.157 1.00 0.00 ? 63 LYS A CE   2  
ATOM 2023  N NZ   . LYS A 1 93  ? 27.087 30.885 12.200 1.00 0.00 ? 63 LYS A NZ   2  
ATOM 2024  H H    . LYS A 1 93  ? 28.205 34.267 9.114  1.00 0.00 ? 63 LYS A H    2  
ATOM 2025  H HA   . LYS A 1 93  ? 27.215 36.378 10.674 1.00 0.00 ? 63 LYS A HA   2  
ATOM 2026  H HB2  . LYS A 1 93  ? 29.507 34.480 11.216 1.00 0.00 ? 63 LYS A HB2  2  
ATOM 2027  H HB3  . LYS A 1 93  ? 28.803 35.558 12.422 1.00 0.00 ? 63 LYS A HB3  2  
ATOM 2028  H HG2  . LYS A 1 93  ? 26.581 34.504 12.021 1.00 0.00 ? 63 LYS A HG2  2  
ATOM 2029  H HG3  . LYS A 1 93  ? 27.348 33.370 10.910 1.00 0.00 ? 63 LYS A HG3  2  
ATOM 2030  H HD2  . LYS A 1 93  ? 28.848 32.630 12.764 1.00 0.00 ? 63 LYS A HD2  2  
ATOM 2031  H HD3  . LYS A 1 93  ? 27.957 33.684 13.863 1.00 0.00 ? 63 LYS A HD3  2  
ATOM 2032  H HE2  . LYS A 1 93  ? 26.883 31.623 14.168 1.00 0.00 ? 63 LYS A HE2  2  
ATOM 2033  H HE3  . LYS A 1 93  ? 25.853 32.414 12.974 1.00 0.00 ? 63 LYS A HE3  2  
ATOM 2034  H HZ1  . LYS A 1 93  ? 26.642 30.015 12.554 1.00 0.00 ? 63 LYS A HZ1  2  
ATOM 2035  H HZ2  . LYS A 1 93  ? 28.112 30.738 12.105 1.00 0.00 ? 63 LYS A HZ2  2  
ATOM 2036  H HZ3  . LYS A 1 93  ? 26.683 31.125 11.272 1.00 0.00 ? 63 LYS A HZ3  2  
ATOM 2037  N N    . ILE A 1 94  ? 30.284 36.818 9.569  1.00 0.00 ? 64 ILE A N    2  
ATOM 2038  C CA   . ILE A 1 94  ? 31.289 37.850 9.329  1.00 0.00 ? 64 ILE A CA   2  
ATOM 2039  C C    . ILE A 1 94  ? 30.671 39.013 8.552  1.00 0.00 ? 64 ILE A C    2  
ATOM 2040  O O    . ILE A 1 94  ? 30.875 40.176 8.905  1.00 0.00 ? 64 ILE A O    2  
ATOM 2041  C CB   . ILE A 1 94  ? 32.472 37.243 8.560  1.00 0.00 ? 64 ILE A CB   2  
ATOM 2042  C CG1  . ILE A 1 94  ? 33.112 36.145 9.412  1.00 0.00 ? 64 ILE A CG1  2  
ATOM 2043  C CG2  . ILE A 1 94  ? 33.535 38.304 8.250  1.00 0.00 ? 64 ILE A CG2  2  
ATOM 2044  C CD1  . ILE A 1 94  ? 34.104 35.349 8.562  1.00 0.00 ? 64 ILE A CD1  2  
ATOM 2045  H H    . ILE A 1 94  ? 30.435 35.908 9.236  1.00 0.00 ? 64 ILE A H    2  
ATOM 2046  H HA   . ILE A 1 94  ? 31.644 38.217 10.282 1.00 0.00 ? 64 ILE A HA   2  
ATOM 2047  H HB   . ILE A 1 94  ? 32.115 36.814 7.636  1.00 0.00 ? 64 ILE A HB   2  
ATOM 2048  H HG12 . ILE A 1 94  ? 33.633 36.598 10.244 1.00 0.00 ? 64 ILE A HG12 2  
ATOM 2049  H HG13 . ILE A 1 94  ? 32.347 35.483 9.785  1.00 0.00 ? 64 ILE A HG13 2  
ATOM 2050  H HG21 . ILE A 1 94  ? 33.071 39.149 7.763  1.00 0.00 ? 64 ILE A HG21 2  
ATOM 2051  H HG22 . ILE A 1 94  ? 34.285 37.881 7.597  1.00 0.00 ? 64 ILE A HG22 2  
ATOM 2052  H HG23 . ILE A 1 94  ? 33.999 38.628 9.170  1.00 0.00 ? 64 ILE A HG23 2  
ATOM 2053  H HD11 . ILE A 1 94  ? 35.003 35.930 8.420  1.00 0.00 ? 64 ILE A HD11 2  
ATOM 2054  H HD12 . ILE A 1 94  ? 33.661 35.131 7.602  1.00 0.00 ? 64 ILE A HD12 2  
ATOM 2055  H HD13 . ILE A 1 94  ? 34.347 34.425 9.064  1.00 0.00 ? 64 ILE A HD13 2  
ATOM 2056  N N    . ASP A 1 95  ? 29.886 38.700 7.524  1.00 0.00 ? 65 ASP A N    2  
ATOM 2057  C CA   . ASP A 1 95  ? 29.269 39.746 6.713  1.00 0.00 ? 65 ASP A CA   2  
ATOM 2058  C C    . ASP A 1 95  ? 28.369 40.635 7.565  1.00 0.00 ? 65 ASP A C    2  
ATOM 2059  O O    . ASP A 1 95  ? 28.418 41.861 7.457  1.00 0.00 ? 65 ASP A O    2  
ATOM 2060  C CB   . ASP A 1 95  ? 28.439 39.121 5.587  1.00 0.00 ? 65 ASP A CB   2  
ATOM 2061  C CG   . ASP A 1 95  ? 29.331 38.384 4.590  1.00 0.00 ? 65 ASP A CG   2  
ATOM 2062  O OD1  . ASP A 1 95  ? 30.496 38.731 4.482  1.00 0.00 ? 65 ASP A OD1  2  
ATOM 2063  O OD2  . ASP A 1 95  ? 28.832 37.476 3.945  1.00 0.00 ? 65 ASP A OD2  2  
ATOM 2064  H H    . ASP A 1 95  ? 29.752 37.758 7.287  1.00 0.00 ? 65 ASP A H    2  
ATOM 2065  H HA   . ASP A 1 95  ? 30.047 40.353 6.275  1.00 0.00 ? 65 ASP A HA   2  
ATOM 2066  H HB2  . ASP A 1 95  ? 27.732 38.424 6.013  1.00 0.00 ? 65 ASP A HB2  2  
ATOM 2067  H HB3  . ASP A 1 95  ? 27.899 39.901 5.071  1.00 0.00 ? 65 ASP A HB3  2  
ATOM 2068  N N    . GLU A 1 96  ? 27.582 40.020 8.444  1.00 0.00 ? 66 GLU A N    2  
ATOM 2069  C CA   . GLU A 1 96  ? 26.689 40.788 9.305  1.00 0.00 ? 66 GLU A CA   2  
ATOM 2070  C C    . GLU A 1 96  ? 27.485 41.705 10.230 1.00 0.00 ? 66 GLU A C    2  
ATOM 2071  O O    . GLU A 1 96  ? 27.168 42.887 10.368 1.00 0.00 ? 66 GLU A O    2  
ATOM 2072  C CB   . GLU A 1 96  ? 25.827 39.840 10.141 1.00 0.00 ? 66 GLU A CB   2  
ATOM 2073  C CG   . GLU A 1 96  ? 24.919 39.022 9.216  1.00 0.00 ? 66 GLU A CG   2  
ATOM 2074  C CD   . GLU A 1 96  ? 23.974 38.111 10.007 1.00 0.00 ? 66 GLU A CD   2  
ATOM 2075  O OE1  . GLU A 1 96  ? 24.150 37.966 11.208 1.00 0.00 ? 66 GLU A OE1  2  
ATOM 2076  O OE2  . GLU A 1 96  ? 23.076 37.563 9.389  1.00 0.00 ? 66 GLU A OE2  2  
ATOM 2077  H H    . GLU A 1 96  ? 27.580 39.041 8.490  1.00 0.00 ? 66 GLU A H    2  
ATOM 2078  H HA   . GLU A 1 96  ? 26.042 41.392 8.687  1.00 0.00 ? 66 GLU A HA   2  
ATOM 2079  H HB2  . GLU A 1 96  ? 26.467 39.174 10.702 1.00 0.00 ? 66 GLU A HB2  2  
ATOM 2080  H HB3  . GLU A 1 96  ? 25.218 40.414 10.823 1.00 0.00 ? 66 GLU A HB3  2  
ATOM 2081  H HG2  . GLU A 1 96  ? 24.330 39.697 8.613  1.00 0.00 ? 66 GLU A HG2  2  
ATOM 2082  H HG3  . GLU A 1 96  ? 25.533 38.416 8.566  1.00 0.00 ? 66 GLU A HG3  2  
ATOM 2083  N N    . PHE A 1 97  ? 28.543 41.169 10.832 1.00 0.00 ? 67 PHE A N    2  
ATOM 2084  C CA   . PHE A 1 97  ? 29.353 41.958 11.754 1.00 0.00 ? 67 PHE A CA   2  
ATOM 2085  C C    . PHE A 1 97  ? 29.955 43.178 11.063 1.00 0.00 ? 67 PHE A C    2  
ATOM 2086  O O    . PHE A 1 97  ? 29.973 44.269 11.636 1.00 0.00 ? 67 PHE A O    2  
ATOM 2087  C CB   . PHE A 1 97  ? 30.467 41.081 12.328 1.00 0.00 ? 67 PHE A CB   2  
ATOM 2088  C CG   . PHE A 1 97  ? 31.383 41.803 13.287 1.00 0.00 ? 67 PHE A CG   2  
ATOM 2089  C CD1  . PHE A 1 97  ? 32.710 42.069 12.922 1.00 0.00 ? 67 PHE A CD1  2  
ATOM 2090  C CD2  . PHE A 1 97  ? 30.907 42.211 14.539 1.00 0.00 ? 67 PHE A CD2  2  
ATOM 2091  C CE1  . PHE A 1 97  ? 33.558 42.741 13.809 1.00 0.00 ? 67 PHE A CE1  2  
ATOM 2092  C CE2  . PHE A 1 97  ? 31.757 42.882 15.427 1.00 0.00 ? 67 PHE A CE2  2  
ATOM 2093  C CZ   . PHE A 1 97  ? 33.082 43.147 15.062 1.00 0.00 ? 67 PHE A CZ   2  
ATOM 2094  H H    . PHE A 1 97  ? 28.765 40.227 10.678 1.00 0.00 ? 67 PHE A H    2  
ATOM 2095  H HA   . PHE A 1 97  ? 28.726 42.293 12.567 1.00 0.00 ? 67 PHE A HA   2  
ATOM 2096  H HB2  . PHE A 1 97  ? 30.013 40.255 12.851 1.00 0.00 ? 67 PHE A HB2  2  
ATOM 2097  H HB3  . PHE A 1 97  ? 31.052 40.689 11.508 1.00 0.00 ? 67 PHE A HB3  2  
ATOM 2098  H HD1  . PHE A 1 97  ? 33.079 41.753 11.956 1.00 0.00 ? 67 PHE A HD1  2  
ATOM 2099  H HD2  . PHE A 1 97  ? 29.885 42.006 14.821 1.00 0.00 ? 67 PHE A HD2  2  
ATOM 2100  H HE1  . PHE A 1 97  ? 34.581 42.945 13.528 1.00 0.00 ? 67 PHE A HE1  2  
ATOM 2101  H HE2  . PHE A 1 97  ? 31.390 43.195 16.393 1.00 0.00 ? 67 PHE A HE2  2  
ATOM 2102  H HZ   . PHE A 1 97  ? 33.738 43.665 15.746 1.00 0.00 ? 67 PHE A HZ   2  
ATOM 2103  N N    . LEU A 1 98  ? 30.450 42.999 9.840  1.00 0.00 ? 68 LEU A N    2  
ATOM 2104  C CA   . LEU A 1 98  ? 30.972 44.128 9.077  1.00 0.00 ? 68 LEU A CA   2  
ATOM 2105  C C    . LEU A 1 98  ? 29.864 45.121 8.732  1.00 0.00 ? 68 LEU A C    2  
ATOM 2106  O O    . LEU A 1 98  ? 30.081 46.332 8.756  1.00 0.00 ? 68 LEU A O    2  
ATOM 2107  C CB   . LEU A 1 98  ? 31.647 43.634 7.793  1.00 0.00 ? 68 LEU A CB   2  
ATOM 2108  C CG   . LEU A 1 98  ? 32.798 42.682 8.138  1.00 0.00 ? 68 LEU A CG   2  
ATOM 2109  C CD1  . LEU A 1 98  ? 33.391 42.110 6.849  1.00 0.00 ? 68 LEU A CD1  2  
ATOM 2110  C CD2  . LEU A 1 98  ? 33.890 43.438 8.900  1.00 0.00 ? 68 LEU A CD2  2  
ATOM 2111  H H    . LEU A 1 98  ? 30.486 42.096 9.459  1.00 0.00 ? 68 LEU A H    2  
ATOM 2112  H HA   . LEU A 1 98  ? 31.706 44.640 9.680  1.00 0.00 ? 68 LEU A HA   2  
ATOM 2113  H HB2  . LEU A 1 98  ? 30.922 43.114 7.185  1.00 0.00 ? 68 LEU A HB2  2  
ATOM 2114  H HB3  . LEU A 1 98  ? 32.037 44.479 7.245  1.00 0.00 ? 68 LEU A HB3  2  
ATOM 2115  H HG   . LEU A 1 98  ? 32.424 41.874 8.750  1.00 0.00 ? 68 LEU A HG   2  
ATOM 2116  H HD11 . LEU A 1 98  ? 32.602 41.955 6.127  1.00 0.00 ? 68 LEU A HD11 2  
ATOM 2117  H HD12 . LEU A 1 98  ? 33.874 41.168 7.062  1.00 0.00 ? 68 LEU A HD12 2  
ATOM 2118  H HD13 . LEU A 1 98  ? 34.116 42.802 6.446  1.00 0.00 ? 68 LEU A HD13 2  
ATOM 2119  H HD21 . LEU A 1 98  ? 33.624 43.500 9.945  1.00 0.00 ? 68 LEU A HD21 2  
ATOM 2120  H HD22 . LEU A 1 98  ? 33.988 44.435 8.495  1.00 0.00 ? 68 LEU A HD22 2  
ATOM 2121  H HD23 . LEU A 1 98  ? 34.829 42.915 8.798  1.00 0.00 ? 68 LEU A HD23 2  
ATOM 2122  N N    . ALA A 1 99  ? 28.677 44.608 8.413  1.00 0.00 ? 69 ALA A N    2  
ATOM 2123  C CA   . ALA A 1 99  ? 27.546 45.475 8.092  1.00 0.00 ? 69 ALA A CA   2  
ATOM 2124  C C    . ALA A 1 99  ? 27.158 46.360 9.277  1.00 0.00 ? 69 ALA A C    2  
ATOM 2125  O O    . ALA A 1 99  ? 26.726 47.497 9.091  1.00 0.00 ? 69 ALA A O    2  
ATOM 2126  C CB   . ALA A 1 99  ? 26.343 44.625 7.680  1.00 0.00 ? 69 ALA A CB   2  
ATOM 2127  H H    . ALA A 1 99  ? 28.571 43.636 8.352  1.00 0.00 ? 69 ALA A H    2  
ATOM 2128  H HA   . ALA A 1 99  ? 27.819 46.109 7.262  1.00 0.00 ? 69 ALA A HA   2  
ATOM 2129  H HB1  . ALA A 1 99  ? 26.274 43.762 8.325  1.00 0.00 ? 69 ALA A HB1  2  
ATOM 2130  H HB2  . ALA A 1 99  ? 26.465 44.301 6.657  1.00 0.00 ? 69 ALA A HB2  2  
ATOM 2131  H HB3  . ALA A 1 99  ? 25.441 45.212 7.766  1.00 0.00 ? 69 ALA A HB3  2  
ATOM 2132  N N    . THR A 1 100 ? 27.312 45.839 10.491 1.00 0.00 ? 70 THR A N    2  
ATOM 2133  C CA   . THR A 1 100 ? 27.045 46.631 11.691 1.00 0.00 ? 70 THR A CA   2  
ATOM 2134  C C    . THR A 1 100 ? 28.153 47.651 11.978 1.00 0.00 ? 70 THR A C    2  
ATOM 2135  O O    . THR A 1 100 ? 27.916 48.637 12.677 1.00 0.00 ? 70 THR A O    2  
ATOM 2136  C CB   . THR A 1 100 ? 26.882 45.707 12.900 1.00 0.00 ? 70 THR A CB   2  
ATOM 2137  O OG1  . THR A 1 100 ? 28.091 44.994 13.117 1.00 0.00 ? 70 THR A OG1  2  
ATOM 2138  C CG2  . THR A 1 100 ? 25.741 44.721 12.646 1.00 0.00 ? 70 THR A CG2  2  
ATOM 2139  H H    . THR A 1 100 ? 27.562 44.895 10.580 1.00 0.00 ? 70 THR A H    2  
ATOM 2140  H HA   . THR A 1 100 ? 26.118 47.165 11.547 1.00 0.00 ? 70 THR A HA   2  
ATOM 2141  H HB   . THR A 1 100 ? 26.652 46.297 13.774 1.00 0.00 ? 70 THR A HB   2  
ATOM 2142  H HG1  . THR A 1 100 ? 28.768 45.587 13.110 1.00 0.00 ? 70 THR A HG1  2  
ATOM 2143  H HG21 . THR A 1 100 ? 25.756 43.950 13.402 1.00 0.00 ? 70 THR A HG21 2  
ATOM 2144  H HG22 . THR A 1 100 ? 25.862 44.270 11.672 1.00 0.00 ? 70 THR A HG22 2  
ATOM 2145  H HG23 . THR A 1 100 ? 24.797 45.244 12.685 1.00 0.00 ? 70 THR A HG23 2  
ATOM 2146  N N    . GLY A 1 101 ? 29.354 47.426 11.447 1.00 0.00 ? 71 GLY A N    2  
ATOM 2147  C CA   . GLY A 1 101 ? 30.464 48.345 11.670 1.00 0.00 ? 71 GLY A CA   2  
ATOM 2148  C C    . GLY A 1 101 ? 30.744 48.511 13.159 1.00 0.00 ? 71 GLY A C    2  
ATOM 2149  O O    . GLY A 1 101 ? 30.404 47.644 13.965 1.00 0.00 ? 71 GLY A O    2  
ATOM 2150  H H    . GLY A 1 101 ? 29.494 46.627 10.896 1.00 0.00 ? 71 GLY A H    2  
ATOM 2151  H HA2  . GLY A 1 101 ? 31.348 47.958 11.182 1.00 0.00 ? 71 GLY A HA2  2  
ATOM 2152  H HA3  . GLY A 1 101 ? 30.218 49.308 11.249 1.00 0.00 ? 71 GLY A HA3  2  
ATOM 2153  N N    . GLU A 1 31  ? 47.443 43.552 18.356 1.00 0.00 ? 1  GLU A N    3  
ATOM 2154  C CA   . GLU A 1 31  ? 46.457 42.491 18.184 1.00 0.00 ? 1  GLU A CA   3  
ATOM 2155  C C    . GLU A 1 31  ? 46.284 42.158 16.706 1.00 0.00 ? 1  GLU A C    3  
ATOM 2156  O O    . GLU A 1 31  ? 46.375 43.036 15.848 1.00 0.00 ? 1  GLU A O    3  
ATOM 2157  C CB   . GLU A 1 31  ? 45.109 42.921 18.770 1.00 0.00 ? 1  GLU A CB   3  
ATOM 2158  C CG   . GLU A 1 31  ? 45.240 43.131 20.284 1.00 0.00 ? 1  GLU A CG   3  
ATOM 2159  C CD   . GLU A 1 31  ? 45.917 44.465 20.607 1.00 0.00 ? 1  GLU A CD   3  
ATOM 2160  O OE1  . GLU A 1 31  ? 46.406 44.595 21.717 1.00 0.00 ? 1  GLU A OE1  3  
ATOM 2161  O OE2  . GLU A 1 31  ? 45.927 45.343 19.757 1.00 0.00 ? 1  GLU A OE2  3  
ATOM 2162  H H    . GLU A 1 31  ? 48.383 43.326 18.515 1.00 0.00 ? 1  GLU A H    3  
ATOM 2163  H HA   . GLU A 1 31  ? 46.798 41.609 18.705 1.00 0.00 ? 1  GLU A HA   3  
ATOM 2164  H HB2  . GLU A 1 31  ? 44.794 43.843 18.304 1.00 0.00 ? 1  GLU A HB2  3  
ATOM 2165  H HB3  . GLU A 1 31  ? 44.374 42.153 18.580 1.00 0.00 ? 1  GLU A HB3  3  
ATOM 2166  H HG2  . GLU A 1 31  ? 44.256 43.118 20.728 1.00 0.00 ? 1  GLU A HG2  3  
ATOM 2167  H HG3  . GLU A 1 31  ? 45.826 42.326 20.702 1.00 0.00 ? 1  GLU A HG3  3  
ATOM 2168  N N    . THR A 1 32  ? 46.034 40.885 16.414 1.00 0.00 ? 2  THR A N    3  
ATOM 2169  C CA   . THR A 1 32  ? 45.837 40.455 15.034 1.00 0.00 ? 2  THR A CA   3  
ATOM 2170  C C    . THR A 1 32  ? 44.673 41.213 14.406 1.00 0.00 ? 2  THR A C    3  
ATOM 2171  O O    . THR A 1 32  ? 43.659 41.460 15.058 1.00 0.00 ? 2  THR A O    3  
ATOM 2172  C CB   . THR A 1 32  ? 45.558 38.951 14.989 1.00 0.00 ? 2  THR A CB   3  
ATOM 2173  O OG1  . THR A 1 32  ? 46.554 38.264 15.732 1.00 0.00 ? 2  THR A OG1  3  
ATOM 2174  C CG2  . THR A 1 32  ? 45.581 38.471 13.536 1.00 0.00 ? 2  THR A CG2  3  
ATOM 2175  H H    . THR A 1 32  ? 45.981 40.226 17.137 1.00 0.00 ? 2  THR A H    3  
ATOM 2176  H HA   . THR A 1 32  ? 46.735 40.660 14.471 1.00 0.00 ? 2  THR A HA   3  
ATOM 2177  H HB   . THR A 1 32  ? 44.586 38.752 15.414 1.00 0.00 ? 2  THR A HB   3  
ATOM 2178  H HG1  . THR A 1 32  ? 46.414 38.428 16.605 1.00 0.00 ? 2  THR A HG1  3  
ATOM 2179  H HG21 . THR A 1 32  ? 45.399 37.408 13.506 1.00 0.00 ? 2  THR A HG21 3  
ATOM 2180  H HG22 . THR A 1 32  ? 46.547 38.684 13.102 1.00 0.00 ? 2  THR A HG22 3  
ATOM 2181  H HG23 . THR A 1 32  ? 44.814 38.984 12.975 1.00 0.00 ? 2  THR A HG23 3  
ATOM 2182  N N    . LEU A 1 33  ? 44.798 41.535 13.124 1.00 0.00 ? 3  LEU A N    3  
ATOM 2183  C CA   . LEU A 1 33  ? 43.795 42.363 12.457 1.00 0.00 ? 3  LEU A CA   3  
ATOM 2184  C C    . LEU A 1 33  ? 42.399 41.741 12.523 1.00 0.00 ? 3  LEU A C    3  
ATOM 2185  O O    . LEU A 1 33  ? 41.399 42.460 12.544 1.00 0.00 ? 3  LEU A O    3  
ATOM 2186  C CB   . LEU A 1 33  ? 44.189 42.556 10.992 1.00 0.00 ? 3  LEU A CB   3  
ATOM 2187  C CG   . LEU A 1 33  ? 45.566 43.218 10.904 1.00 0.00 ? 3  LEU A CG   3  
ATOM 2188  C CD1  . LEU A 1 33  ? 46.015 43.266 9.443  1.00 0.00 ? 3  LEU A CD1  3  
ATOM 2189  C CD2  . LEU A 1 33  ? 45.480 44.645 11.449 1.00 0.00 ? 3  LEU A CD2  3  
ATOM 2190  H H    . LEU A 1 33  ? 45.571 41.213 12.619 1.00 0.00 ? 3  LEU A H    3  
ATOM 2191  H HA   . LEU A 1 33  ? 43.768 43.330 12.936 1.00 0.00 ? 3  LEU A HA   3  
ATOM 2192  H HB2  . LEU A 1 33  ? 44.218 41.596 10.498 1.00 0.00 ? 3  LEU A HB2  3  
ATOM 2193  H HB3  . LEU A 1 33  ? 43.461 43.186 10.510 1.00 0.00 ? 3  LEU A HB3  3  
ATOM 2194  H HG   . LEU A 1 33  ? 46.279 42.650 11.484 1.00 0.00 ? 3  LEU A HG   3  
ATOM 2195  H HD11 . LEU A 1 33  ? 46.045 42.264 9.042  1.00 0.00 ? 3  LEU A HD11 3  
ATOM 2196  H HD12 . LEU A 1 33  ? 46.999 43.708 9.382  1.00 0.00 ? 3  LEU A HD12 3  
ATOM 2197  H HD13 . LEU A 1 33  ? 45.318 43.862 8.871  1.00 0.00 ? 3  LEU A HD13 3  
ATOM 2198  H HD21 . LEU A 1 33  ? 46.377 45.185 11.187 1.00 0.00 ? 3  LEU A HD21 3  
ATOM 2199  H HD22 . LEU A 1 33  ? 45.379 44.615 12.525 1.00 0.00 ? 3  LEU A HD22 3  
ATOM 2200  H HD23 . LEU A 1 33  ? 44.623 45.142 11.020 1.00 0.00 ? 3  LEU A HD23 3  
ATOM 2201  N N    . ASN A 1 34  ? 42.326 40.413 12.553 1.00 0.00 ? 4  ASN A N    3  
ATOM 2202  C CA   . ASN A 1 34  ? 41.034 39.727 12.637 1.00 0.00 ? 4  ASN A CA   3  
ATOM 2203  C C    . ASN A 1 34  ? 40.656 39.332 14.074 1.00 0.00 ? 4  ASN A C    3  
ATOM 2204  O O    . ASN A 1 34  ? 39.641 38.668 14.282 1.00 0.00 ? 4  ASN A O    3  
ATOM 2205  C CB   . ASN A 1 34  ? 41.066 38.466 11.768 1.00 0.00 ? 4  ASN A CB   3  
ATOM 2206  C CG   . ASN A 1 34  ? 41.423 38.820 10.326 1.00 0.00 ? 4  ASN A CG   3  
ATOM 2207  O OD1  . ASN A 1 34  ? 40.802 39.696 9.720  1.00 0.00 ? 4  ASN A OD1  3  
ATOM 2208  N ND2  . ASN A 1 34  ? 42.384 38.172 9.726  1.00 0.00 ? 4  ASN A ND2  3  
ATOM 2209  H H    . ASN A 1 34  ? 43.150 39.885 12.519 1.00 0.00 ? 4  ASN A H    3  
ATOM 2210  H HA   . ASN A 1 34  ? 40.271 40.384 12.250 1.00 0.00 ? 4  ASN A HA   3  
ATOM 2211  H HB2  . ASN A 1 34  ? 41.804 37.781 12.160 1.00 0.00 ? 4  ASN A HB2  3  
ATOM 2212  H HB3  . ASN A 1 34  ? 40.095 37.994 11.789 1.00 0.00 ? 4  ASN A HB3  3  
ATOM 2213  H HD21 . ASN A 1 34  ? 42.864 37.457 10.196 1.00 0.00 ? 4  ASN A HD21 3  
ATOM 2214  H HD22 . ASN A 1 34  ? 42.638 38.414 8.810  1.00 0.00 ? 4  ASN A HD22 3  
ATOM 2215  N N    . GLY A 1 35  ? 41.436 39.753 15.072 1.00 0.00 ? 5  GLY A N    3  
ATOM 2216  C CA   . GLY A 1 35  ? 41.270 39.241 16.428 1.00 0.00 ? 5  GLY A CA   3  
ATOM 2217  C C    . GLY A 1 35  ? 39.837 39.393 16.925 1.00 0.00 ? 5  GLY A C    3  
ATOM 2218  O O    . GLY A 1 35  ? 39.310 38.493 17.583 1.00 0.00 ? 5  GLY A O    3  
ATOM 2219  H H    . GLY A 1 35  ? 42.125 40.425 14.897 1.00 0.00 ? 5  GLY A H    3  
ATOM 2220  H HA2  . GLY A 1 35  ? 41.538 38.195 16.442 1.00 0.00 ? 5  GLY A HA2  3  
ATOM 2221  H HA3  . GLY A 1 35  ? 41.929 39.782 17.090 1.00 0.00 ? 5  GLY A HA3  3  
ATOM 2222  N N    . ALA A 1 36  ? 39.195 40.510 16.589 1.00 0.00 ? 6  ALA A N    3  
ATOM 2223  C CA   . ALA A 1 36  ? 37.832 40.745 17.053 1.00 0.00 ? 6  ALA A CA   3  
ATOM 2224  C C    . ALA A 1 36  ? 36.909 39.642 16.543 1.00 0.00 ? 6  ALA A C    3  
ATOM 2225  O O    . ALA A 1 36  ? 36.144 39.051 17.310 1.00 0.00 ? 6  ALA A O    3  
ATOM 2226  C CB   . ALA A 1 36  ? 37.335 42.104 16.557 1.00 0.00 ? 6  ALA A CB   3  
ATOM 2227  H H    . ALA A 1 36  ? 39.641 41.178 16.027 1.00 0.00 ? 6  ALA A H    3  
ATOM 2228  H HA   . ALA A 1 36  ? 37.822 40.740 18.133 1.00 0.00 ? 6  ALA A HA   3  
ATOM 2229  H HB1  . ALA A 1 36  ? 37.764 42.887 17.163 1.00 0.00 ? 6  ALA A HB1  3  
ATOM 2230  H HB2  . ALA A 1 36  ? 36.258 42.141 16.630 1.00 0.00 ? 6  ALA A HB2  3  
ATOM 2231  H HB3  . ALA A 1 36  ? 37.631 42.241 15.527 1.00 0.00 ? 6  ALA A HB3  3  
ATOM 2232  N N    . LEU A 1 37  ? 37.011 39.340 15.251 1.00 0.00 ? 7  LEU A N    3  
ATOM 2233  C CA   . LEU A 1 37  ? 36.216 38.262 14.676 1.00 0.00 ? 7  LEU A CA   3  
ATOM 2234  C C    . LEU A 1 37  ? 36.564 36.924 15.323 1.00 0.00 ? 7  LEU A C    3  
ATOM 2235  O O    . LEU A 1 37  ? 35.679 36.104 15.570 1.00 0.00 ? 7  LEU A O    3  
ATOM 2236  C CB   . LEU A 1 37  ? 36.449 38.187 13.166 1.00 0.00 ? 7  LEU A CB   3  
ATOM 2237  C CG   . LEU A 1 37  ? 35.954 39.477 12.506 1.00 0.00 ? 7  LEU A CG   3  
ATOM 2238  C CD1  . LEU A 1 37  ? 36.375 39.500 11.035 1.00 0.00 ? 7  LEU A CD1  3  
ATOM 2239  C CD2  . LEU A 1 37  ? 34.428 39.538 12.588 1.00 0.00 ? 7  LEU A CD2  3  
ATOM 2240  H H    . LEU A 1 37  ? 37.627 39.848 14.681 1.00 0.00 ? 7  LEU A H    3  
ATOM 2241  H HA   . LEU A 1 37  ? 35.172 38.469 14.858 1.00 0.00 ? 7  LEU A HA   3  
ATOM 2242  H HB2  . LEU A 1 37  ? 37.504 38.063 12.970 1.00 0.00 ? 7  LEU A HB2  3  
ATOM 2243  H HB3  . LEU A 1 37  ? 35.906 37.348 12.759 1.00 0.00 ? 7  LEU A HB3  3  
ATOM 2244  H HG   . LEU A 1 37  ? 36.378 40.329 13.015 1.00 0.00 ? 7  LEU A HG   3  
ATOM 2245  H HD11 . LEU A 1 37  ? 35.750 40.196 10.495 1.00 0.00 ? 7  LEU A HD11 3  
ATOM 2246  H HD12 . LEU A 1 37  ? 36.262 38.512 10.613 1.00 0.00 ? 7  LEU A HD12 3  
ATOM 2247  H HD13 . LEU A 1 37  ? 37.407 39.807 10.960 1.00 0.00 ? 7  LEU A HD13 3  
ATOM 2248  H HD21 . LEU A 1 37  ? 34.133 39.888 13.566 1.00 0.00 ? 7  LEU A HD21 3  
ATOM 2249  H HD22 . LEU A 1 37  ? 34.019 38.552 12.419 1.00 0.00 ? 7  LEU A HD22 3  
ATOM 2250  H HD23 . LEU A 1 37  ? 34.054 40.215 11.834 1.00 0.00 ? 7  LEU A HD23 3  
ATOM 2251  N N    . VAL A 1 38  ? 37.841 36.722 15.649 1.00 0.00 ? 8  VAL A N    3  
ATOM 2252  C CA   . VAL A 1 38  ? 38.254 35.478 16.292 1.00 0.00 ? 8  VAL A CA   3  
ATOM 2253  C C    . VAL A 1 38  ? 37.526 35.318 17.626 1.00 0.00 ? 8  VAL A C    3  
ATOM 2254  O O    . VAL A 1 38  ? 37.012 34.241 17.932 1.00 0.00 ? 8  VAL A O    3  
ATOM 2255  C CB   . VAL A 1 38  ? 39.776 35.477 16.506 1.00 0.00 ? 8  VAL A CB   3  
ATOM 2256  C CG1  . VAL A 1 38  ? 40.226 34.174 17.181 1.00 0.00 ? 8  VAL A CG1  3  
ATOM 2257  C CG2  . VAL A 1 38  ? 40.479 35.607 15.151 1.00 0.00 ? 8  VAL A CG2  3  
ATOM 2258  H H    . VAL A 1 38  ? 38.510 37.402 15.422 1.00 0.00 ? 8  VAL A H    3  
ATOM 2259  H HA   . VAL A 1 38  ? 37.991 34.650 15.651 1.00 0.00 ? 8  VAL A HA   3  
ATOM 2260  H HB   . VAL A 1 38  ? 40.049 36.314 17.132 1.00 0.00 ? 8  VAL A HB   3  
ATOM 2261  H HG11 . VAL A 1 38  ? 40.088 33.352 16.496 1.00 0.00 ? 8  VAL A HG11 3  
ATOM 2262  H HG12 . VAL A 1 38  ? 39.641 34.005 18.072 1.00 0.00 ? 8  VAL A HG12 3  
ATOM 2263  H HG13 . VAL A 1 38  ? 41.271 34.249 17.446 1.00 0.00 ? 8  VAL A HG13 3  
ATOM 2264  H HG21 . VAL A 1 38  ? 41.472 35.183 15.209 1.00 0.00 ? 8  VAL A HG21 3  
ATOM 2265  H HG22 . VAL A 1 38  ? 40.554 36.649 14.884 1.00 0.00 ? 8  VAL A HG22 3  
ATOM 2266  H HG23 . VAL A 1 38  ? 39.910 35.084 14.396 1.00 0.00 ? 8  VAL A HG23 3  
ATOM 2267  N N    . ASN A 1 39  ? 37.430 36.404 18.389 1.00 0.00 ? 9  ASN A N    3  
ATOM 2268  C CA   . ASN A 1 39  ? 36.752 36.346 19.680 1.00 0.00 ? 9  ASN A CA   3  
ATOM 2269  C C    . ASN A 1 39  ? 35.287 35.967 19.495 1.00 0.00 ? 9  ASN A C    3  
ATOM 2270  O O    . ASN A 1 39  ? 34.758 35.116 20.216 1.00 0.00 ? 9  ASN A O    3  
ATOM 2271  C CB   . ASN A 1 39  ? 36.846 37.702 20.382 1.00 0.00 ? 9  ASN A CB   3  
ATOM 2272  C CG   . ASN A 1 39  ? 38.308 38.060 20.631 1.00 0.00 ? 9  ASN A CG   3  
ATOM 2273  O OD1  . ASN A 1 39  ? 38.727 39.185 20.357 1.00 0.00 ? 9  ASN A OD1  3  
ATOM 2274  N ND2  . ASN A 1 39  ? 39.112 37.166 21.136 1.00 0.00 ? 9  ASN A ND2  3  
ATOM 2275  H H    . ASN A 1 39  ? 37.848 37.240 18.096 1.00 0.00 ? 9  ASN A H    3  
ATOM 2276  H HA   . ASN A 1 39  ? 37.232 35.600 20.295 1.00 0.00 ? 9  ASN A HA   3  
ATOM 2277  H HB2  . ASN A 1 39  ? 36.391 38.459 19.760 1.00 0.00 ? 9  ASN A HB2  3  
ATOM 2278  H HB3  . ASN A 1 39  ? 36.326 37.654 21.326 1.00 0.00 ? 9  ASN A HB3  3  
ATOM 2279  H HD21 . ASN A 1 39  ? 38.776 36.272 21.353 1.00 0.00 ? 9  ASN A HD21 3  
ATOM 2280  H HD22 . ASN A 1 39  ? 40.053 37.388 21.298 1.00 0.00 ? 9  ASN A HD22 3  
ATOM 2281  N N    . MET A 1 40  ? 34.643 36.569 18.497 1.00 0.00 ? 10 MET A N    3  
ATOM 2282  C CA   . MET A 1 40  ? 33.251 36.239 18.213 1.00 0.00 ? 10 MET A CA   3  
ATOM 2283  C C    . MET A 1 40  ? 33.106 34.762 17.847 1.00 0.00 ? 10 MET A C    3  
ATOM 2284  O O    . MET A 1 40  ? 32.141 34.110 18.249 1.00 0.00 ? 10 MET A O    3  
ATOM 2285  C CB   . MET A 1 40  ? 32.741 37.113 17.063 1.00 0.00 ? 10 MET A CB   3  
ATOM 2286  C CG   . MET A 1 40  ? 31.246 36.869 16.850 1.00 0.00 ? 10 MET A CG   3  
ATOM 2287  S SD   . MET A 1 40  ? 30.668 37.853 15.444 1.00 0.00 ? 10 MET A SD   3  
ATOM 2288  C CE   . MET A 1 40  ? 31.467 36.892 14.134 1.00 0.00 ? 10 MET A CE   3  
ATOM 2289  H H    . MET A 1 40  ? 35.098 37.266 17.975 1.00 0.00 ? 10 MET A H    3  
ATOM 2290  H HA   . MET A 1 40  ? 32.656 36.442 19.091 1.00 0.00 ? 10 MET A HA   3  
ATOM 2291  H HB2  . MET A 1 40  ? 32.905 38.153 17.303 1.00 0.00 ? 10 MET A HB2  3  
ATOM 2292  H HB3  . MET A 1 40  ? 33.276 36.863 16.159 1.00 0.00 ? 10 MET A HB3  3  
ATOM 2293  H HG2  . MET A 1 40  ? 31.078 35.821 16.648 1.00 0.00 ? 10 MET A HG2  3  
ATOM 2294  H HG3  . MET A 1 40  ? 30.703 37.156 17.737 1.00 0.00 ? 10 MET A HG3  3  
ATOM 2295  H HE1  . MET A 1 40  ? 31.215 35.848 14.250 1.00 0.00 ? 10 MET A HE1  3  
ATOM 2296  H HE2  . MET A 1 40  ? 32.537 37.012 14.198 1.00 0.00 ? 10 MET A HE2  3  
ATOM 2297  H HE3  . MET A 1 40  ? 31.126 37.246 13.171 1.00 0.00 ? 10 MET A HE3  3  
ATOM 2298  N N    . LEU A 1 41  ? 34.084 34.224 17.121 1.00 0.00 ? 11 LEU A N    3  
ATOM 2299  C CA   . LEU A 1 41  ? 34.067 32.804 16.782 1.00 0.00 ? 11 LEU A CA   3  
ATOM 2300  C C    . LEU A 1 41  ? 34.128 31.932 18.032 1.00 0.00 ? 11 LEU A C    3  
ATOM 2301  O O    . LEU A 1 41  ? 33.402 30.943 18.132 1.00 0.00 ? 11 LEU A O    3  
ATOM 2302  C CB   . LEU A 1 41  ? 35.242 32.471 15.864 1.00 0.00 ? 11 LEU A CB   3  
ATOM 2303  C CG   . LEU A 1 41  ? 35.039 33.157 14.513 1.00 0.00 ? 11 LEU A CG   3  
ATOM 2304  C CD1  . LEU A 1 41  ? 36.333 33.086 13.703 1.00 0.00 ? 11 LEU A CD1  3  
ATOM 2305  C CD2  . LEU A 1 41  ? 33.920 32.450 13.744 1.00 0.00 ? 11 LEU A CD2  3  
ATOM 2306  H H    . LEU A 1 41  ? 34.802 34.794 16.777 1.00 0.00 ? 11 LEU A H    3  
ATOM 2307  H HA   . LEU A 1 41  ? 33.149 32.587 16.257 1.00 0.00 ? 11 LEU A HA   3  
ATOM 2308  H HB2  . LEU A 1 41  ? 36.160 32.821 16.314 1.00 0.00 ? 11 LEU A HB2  3  
ATOM 2309  H HB3  . LEU A 1 41  ? 35.296 31.403 15.718 1.00 0.00 ? 11 LEU A HB3  3  
ATOM 2310  H HG   . LEU A 1 41  ? 34.769 34.190 14.671 1.00 0.00 ? 11 LEU A HG   3  
ATOM 2311  H HD11 . LEU A 1 41  ? 36.349 33.889 12.982 1.00 0.00 ? 11 LEU A HD11 3  
ATOM 2312  H HD12 . LEU A 1 41  ? 36.387 32.137 13.188 1.00 0.00 ? 11 LEU A HD12 3  
ATOM 2313  H HD13 . LEU A 1 41  ? 37.180 33.183 14.367 1.00 0.00 ? 11 LEU A HD13 3  
ATOM 2314  H HD21 . LEU A 1 41  ? 33.950 32.753 12.709 1.00 0.00 ? 11 LEU A HD21 3  
ATOM 2315  H HD22 . LEU A 1 41  ? 32.964 32.719 14.170 1.00 0.00 ? 11 LEU A HD22 3  
ATOM 2316  H HD23 . LEU A 1 41  ? 34.055 31.380 13.811 1.00 0.00 ? 11 LEU A HD23 3  
ATOM 2317  N N    . LYS A 1 42  ? 34.974 32.305 18.993 1.00 0.00 ? 12 LYS A N    3  
ATOM 2318  C CA   . LYS A 1 42  ? 35.051 31.549 20.242 1.00 0.00 ? 12 LYS A CA   3  
ATOM 2319  C C    . LYS A 1 42  ? 33.698 31.533 20.946 1.00 0.00 ? 12 LYS A C    3  
ATOM 2320  O O    . LYS A 1 42  ? 33.284 30.501 21.479 1.00 0.00 ? 12 LYS A O    3  
ATOM 2321  C CB   . LYS A 1 42  ? 36.103 32.152 21.177 1.00 0.00 ? 12 LYS A CB   3  
ATOM 2322  C CG   . LYS A 1 42  ? 37.479 32.155 20.505 1.00 0.00 ? 12 LYS A CG   3  
ATOM 2323  C CD   . LYS A 1 42  ? 37.950 30.719 20.266 1.00 0.00 ? 12 LYS A CD   3  
ATOM 2324  C CE   . LYS A 1 42  ? 39.407 30.735 19.798 1.00 0.00 ? 12 LYS A CE   3  
ATOM 2325  N NZ   . LYS A 1 42  ? 39.858 29.341 19.524 1.00 0.00 ? 12 LYS A NZ   3  
ATOM 2326  H H    . LYS A 1 42  ? 35.572 33.067 18.844 1.00 0.00 ? 12 LYS A H    3  
ATOM 2327  H HA   . LYS A 1 42  ? 35.330 30.531 20.014 1.00 0.00 ? 12 LYS A HA   3  
ATOM 2328  H HB2  . LYS A 1 42  ? 35.822 33.168 21.421 1.00 0.00 ? 12 LYS A HB2  3  
ATOM 2329  H HB3  . LYS A 1 42  ? 36.150 31.568 22.084 1.00 0.00 ? 12 LYS A HB3  3  
ATOM 2330  H HG2  . LYS A 1 42  ? 37.413 32.671 19.560 1.00 0.00 ? 12 LYS A HG2  3  
ATOM 2331  H HG3  . LYS A 1 42  ? 38.188 32.661 21.142 1.00 0.00 ? 12 LYS A HG3  3  
ATOM 2332  H HD2  . LYS A 1 42  ? 37.871 30.154 21.183 1.00 0.00 ? 12 LYS A HD2  3  
ATOM 2333  H HD3  . LYS A 1 42  ? 37.340 30.258 19.504 1.00 0.00 ? 12 LYS A HD3  3  
ATOM 2334  H HE2  . LYS A 1 42  ? 39.488 31.323 18.895 1.00 0.00 ? 12 LYS A HE2  3  
ATOM 2335  H HE3  . LYS A 1 42  ? 40.028 31.170 20.568 1.00 0.00 ? 12 LYS A HE3  3  
ATOM 2336  H HZ1  . LYS A 1 42  ? 39.445 28.699 20.230 1.00 0.00 ? 12 LYS A HZ1  3  
ATOM 2337  H HZ2  . LYS A 1 42  ? 40.896 29.296 19.577 1.00 0.00 ? 12 LYS A HZ2  3  
ATOM 2338  H HZ3  . LYS A 1 42  ? 39.545 29.055 18.574 1.00 0.00 ? 12 LYS A HZ3  3  
ATOM 2339  N N    . GLU A 1 43  ? 32.991 32.662 20.909 1.00 0.00 ? 13 GLU A N    3  
ATOM 2340  C CA   . GLU A 1 43  ? 31.665 32.721 21.516 1.00 0.00 ? 13 GLU A CA   3  
ATOM 2341  C C    . GLU A 1 43  ? 30.710 31.759 20.816 1.00 0.00 ? 13 GLU A C    3  
ATOM 2342  O O    . GLU A 1 43  ? 29.979 31.013 21.469 1.00 0.00 ? 13 GLU A O    3  
ATOM 2343  C CB   . GLU A 1 43  ? 31.114 34.146 21.427 1.00 0.00 ? 13 GLU A CB   3  
ATOM 2344  C CG   . GLU A 1 43  ? 32.005 35.092 22.240 1.00 0.00 ? 13 GLU A CG   3  
ATOM 2345  C CD   . GLU A 1 43  ? 31.451 36.521 22.256 1.00 0.00 ? 13 GLU A CD   3  
ATOM 2346  O OE1  . GLU A 1 43  ? 31.965 37.312 23.030 1.00 0.00 ? 13 GLU A OE1  3  
ATOM 2347  O OE2  . GLU A 1 43  ? 30.537 36.816 21.500 1.00 0.00 ? 13 GLU A OE2  3  
ATOM 2348  H H    . GLU A 1 43  ? 33.386 33.469 20.512 1.00 0.00 ? 13 GLU A H    3  
ATOM 2349  H HA   . GLU A 1 43  ? 31.744 32.442 22.555 1.00 0.00 ? 13 GLU A HA   3  
ATOM 2350  H HB2  . GLU A 1 43  ? 31.099 34.462 20.393 1.00 0.00 ? 13 GLU A HB2  3  
ATOM 2351  H HB3  . GLU A 1 43  ? 30.110 34.170 21.825 1.00 0.00 ? 13 GLU A HB3  3  
ATOM 2352  H HG2  . GLU A 1 43  ? 32.070 34.728 23.255 1.00 0.00 ? 13 GLU A HG2  3  
ATOM 2353  H HG3  . GLU A 1 43  ? 32.995 35.101 21.808 1.00 0.00 ? 13 GLU A HG3  3  
ATOM 2354  N N    . GLU A 1 44  ? 30.761 31.732 19.485 1.00 0.00 ? 14 GLU A N    3  
ATOM 2355  C CA   . GLU A 1 44  ? 29.913 30.818 18.726 1.00 0.00 ? 14 GLU A CA   3  
ATOM 2356  C C    . GLU A 1 44  ? 30.250 29.366 19.053 1.00 0.00 ? 14 GLU A C    3  
ATOM 2357  O O    . GLU A 1 44  ? 29.357 28.529 19.192 1.00 0.00 ? 14 GLU A O    3  
ATOM 2358  C CB   . GLU A 1 44  ? 30.094 31.060 17.227 1.00 0.00 ? 14 GLU A CB   3  
ATOM 2359  C CG   . GLU A 1 44  ? 29.616 32.474 16.875 1.00 0.00 ? 14 GLU A CG   3  
ATOM 2360  C CD   . GLU A 1 44  ? 28.127 32.654 17.179 1.00 0.00 ? 14 GLU A CD   3  
ATOM 2361  O OE1  . GLU A 1 44  ? 27.704 33.795 17.266 1.00 0.00 ? 14 GLU A OE1  3  
ATOM 2362  O OE2  . GLU A 1 44  ? 27.424 31.662 17.306 1.00 0.00 ? 14 GLU A OE2  3  
ATOM 2363  H H    . GLU A 1 44  ? 31.347 32.360 19.011 1.00 0.00 ? 14 GLU A H    3  
ATOM 2364  H HA   . GLU A 1 44  ? 28.882 31.004 18.986 1.00 0.00 ? 14 GLU A HA   3  
ATOM 2365  H HB2  . GLU A 1 44  ? 31.138 30.956 16.969 1.00 0.00 ? 14 GLU A HB2  3  
ATOM 2366  H HB3  . GLU A 1 44  ? 29.511 30.339 16.673 1.00 0.00 ? 14 GLU A HB3  3  
ATOM 2367  H HG2  . GLU A 1 44  ? 30.182 33.191 17.450 1.00 0.00 ? 14 GLU A HG2  3  
ATOM 2368  H HG3  . GLU A 1 44  ? 29.788 32.652 15.823 1.00 0.00 ? 14 GLU A HG3  3  
ATOM 2369  N N    . GLY A 1 45  ? 31.539 29.077 19.209 1.00 0.00 ? 15 GLY A N    3  
ATOM 2370  C CA   . GLY A 1 45  ? 31.965 27.726 19.552 1.00 0.00 ? 15 GLY A CA   3  
ATOM 2371  C C    . GLY A 1 45  ? 31.372 27.289 20.886 1.00 0.00 ? 15 GLY A C    3  
ATOM 2372  O O    . GLY A 1 45  ? 30.854 26.177 21.008 1.00 0.00 ? 15 GLY A O    3  
ATOM 2373  H H    . GLY A 1 45  ? 32.210 29.773 19.061 1.00 0.00 ? 15 GLY A H    3  
ATOM 2374  H HA2  . GLY A 1 45  ? 31.641 27.046 18.778 1.00 0.00 ? 15 GLY A HA2  3  
ATOM 2375  H HA3  . GLY A 1 45  ? 33.042 27.700 19.622 1.00 0.00 ? 15 GLY A HA3  3  
ATOM 2376  N N    . ASN A 1 46  ? 31.421 28.177 21.877 1.00 0.00 ? 16 ASN A N    3  
ATOM 2377  C CA   . ASN A 1 46  ? 30.871 27.854 23.188 1.00 0.00 ? 16 ASN A CA   3  
ATOM 2378  C C    . ASN A 1 46  ? 29.374 27.577 23.095 1.00 0.00 ? 16 ASN A C    3  
ATOM 2379  O O    . ASN A 1 46  ? 28.874 26.642 23.722 1.00 0.00 ? 16 ASN A O    3  
ATOM 2380  C CB   . ASN A 1 46  ? 31.119 29.011 24.157 1.00 0.00 ? 16 ASN A CB   3  
ATOM 2381  C CG   . ASN A 1 46  ? 32.616 29.236 24.331 1.00 0.00 ? 16 ASN A CG   3  
ATOM 2382  O OD1  . ASN A 1 46  ? 33.086 30.372 24.270 1.00 0.00 ? 16 ASN A OD1  3  
ATOM 2383  N ND2  . ASN A 1 46  ? 33.399 28.214 24.546 1.00 0.00 ? 16 ASN A ND2  3  
ATOM 2384  H H    . ASN A 1 46  ? 31.862 29.041 21.734 1.00 0.00 ? 16 ASN A H    3  
ATOM 2385  H HA   . ASN A 1 46  ? 31.367 26.972 23.567 1.00 0.00 ? 16 ASN A HA   3  
ATOM 2386  H HB2  . ASN A 1 46  ? 30.664 29.909 23.765 1.00 0.00 ? 16 ASN A HB2  3  
ATOM 2387  H HB3  . ASN A 1 46  ? 30.680 28.777 25.115 1.00 0.00 ? 16 ASN A HB3  3  
ATOM 2388  H HD21 . ASN A 1 46  ? 33.024 27.311 24.595 1.00 0.00 ? 16 ASN A HD21 3  
ATOM 2389  H HD22 . ASN A 1 46  ? 34.363 28.351 24.659 1.00 0.00 ? 16 ASN A HD22 3  
ATOM 2390  N N    . LYS A 1 47  ? 28.665 28.359 22.281 1.00 0.00 ? 17 LYS A N    3  
ATOM 2391  C CA   . LYS A 1 47  ? 27.236 28.128 22.093 1.00 0.00 ? 17 LYS A CA   3  
ATOM 2392  C C    . LYS A 1 47  ? 26.977 26.750 21.490 1.00 0.00 ? 17 LYS A C    3  
ATOM 2393  O O    . LYS A 1 47  ? 26.110 26.011 21.964 1.00 0.00 ? 17 LYS A O    3  
ATOM 2394  C CB   . LYS A 1 47  ? 26.640 29.206 21.184 1.00 0.00 ? 17 LYS A CB   3  
ATOM 2395  C CG   . LYS A 1 47  ? 26.717 30.565 21.883 1.00 0.00 ? 17 LYS A CG   3  
ATOM 2396  C CD   . LYS A 1 47  ? 26.029 31.625 21.020 1.00 0.00 ? 17 LYS A CD   3  
ATOM 2397  C CE   . LYS A 1 47  ? 26.208 33.002 21.661 1.00 0.00 ? 17 LYS A CE   3  
ATOM 2398  N NZ   . LYS A 1 47  ? 25.206 33.948 21.095 1.00 0.00 ? 17 LYS A NZ   3  
ATOM 2399  H H    . LYS A 1 47  ? 29.100 29.119 21.837 1.00 0.00 ? 17 LYS A H    3  
ATOM 2400  H HA   . LYS A 1 47  ? 26.748 28.182 23.054 1.00 0.00 ? 17 LYS A HA   3  
ATOM 2401  H HB2  . LYS A 1 47  ? 27.197 29.244 20.259 1.00 0.00 ? 17 LYS A HB2  3  
ATOM 2402  H HB3  . LYS A 1 47  ? 25.608 28.971 20.975 1.00 0.00 ? 17 LYS A HB3  3  
ATOM 2403  H HG2  . LYS A 1 47  ? 26.225 30.504 22.843 1.00 0.00 ? 17 LYS A HG2  3  
ATOM 2404  H HG3  . LYS A 1 47  ? 27.751 30.839 22.027 1.00 0.00 ? 17 LYS A HG3  3  
ATOM 2405  H HD2  . LYS A 1 47  ? 26.467 31.624 20.032 1.00 0.00 ? 17 LYS A HD2  3  
ATOM 2406  H HD3  . LYS A 1 47  ? 24.975 31.400 20.948 1.00 0.00 ? 17 LYS A HD3  3  
ATOM 2407  H HE2  . LYS A 1 47  ? 26.068 32.925 22.729 1.00 0.00 ? 17 LYS A HE2  3  
ATOM 2408  H HE3  . LYS A 1 47  ? 27.204 33.366 21.455 1.00 0.00 ? 17 LYS A HE3  3  
ATOM 2409  H HZ1  . LYS A 1 47  ? 25.476 34.198 20.122 1.00 0.00 ? 17 LYS A HZ1  3  
ATOM 2410  H HZ2  . LYS A 1 47  ? 25.174 34.808 21.679 1.00 0.00 ? 17 LYS A HZ2  3  
ATOM 2411  H HZ3  . LYS A 1 47  ? 24.269 33.497 21.087 1.00 0.00 ? 17 LYS A HZ3  3  
ATOM 2412  N N    . ALA A 1 48  ? 27.763 26.383 20.476 1.00 0.00 ? 18 ALA A N    3  
ATOM 2413  C CA   . ALA A 1 48  ? 27.588 25.081 19.847 1.00 0.00 ? 18 ALA A CA   3  
ATOM 2414  C C    . ALA A 1 48  ? 27.802 23.971 20.868 1.00 0.00 ? 18 ALA A C    3  
ATOM 2415  O O    . ALA A 1 48  ? 27.056 22.992 20.890 1.00 0.00 ? 18 ALA A O    3  
ATOM 2416  C CB   . ALA A 1 48  ? 28.567 24.914 18.684 1.00 0.00 ? 18 ALA A CB   3  
ATOM 2417  H H    . ALA A 1 48  ? 28.445 27.001 20.136 1.00 0.00 ? 18 ALA A H    3  
ATOM 2418  H HA   . ALA A 1 48  ? 26.580 25.013 19.464 1.00 0.00 ? 18 ALA A HA   3  
ATOM 2419  H HB1  . ALA A 1 48  ? 28.143 24.241 17.952 1.00 0.00 ? 18 ALA A HB1  3  
ATOM 2420  H HB2  . ALA A 1 48  ? 29.497 24.507 19.052 1.00 0.00 ? 18 ALA A HB2  3  
ATOM 2421  H HB3  . ALA A 1 48  ? 28.750 25.875 18.226 1.00 0.00 ? 18 ALA A HB3  3  
ATOM 2422  N N    . LEU A 1 49  ? 28.823 24.119 21.709 1.00 0.00 ? 19 LEU A N    3  
ATOM 2423  C CA   . LEU A 1 49  ? 29.052 23.153 22.777 1.00 0.00 ? 19 LEU A CA   3  
ATOM 2424  C C    . LEU A 1 49  ? 27.860 23.103 23.730 1.00 0.00 ? 19 LEU A C    3  
ATOM 2425  O O    . LEU A 1 49  ? 27.415 22.025 24.121 1.00 0.00 ? 19 LEU A O    3  
ATOM 2426  C CB   . LEU A 1 49  ? 30.317 23.527 23.554 1.00 0.00 ? 19 LEU A CB   3  
ATOM 2427  C CG   . LEU A 1 49  ? 30.641 22.432 24.573 1.00 0.00 ? 19 LEU A CG   3  
ATOM 2428  C CD1  . LEU A 1 49  ? 31.129 21.181 23.840 1.00 0.00 ? 19 LEU A CD1  3  
ATOM 2429  C CD2  . LEU A 1 49  ? 31.738 22.927 25.519 1.00 0.00 ? 19 LEU A CD2  3  
ATOM 2430  H H    . LEU A 1 49  ? 29.440 24.872 21.594 1.00 0.00 ? 19 LEU A H    3  
ATOM 2431  H HA   . LEU A 1 49  ? 29.190 22.176 22.339 1.00 0.00 ? 19 LEU A HA   3  
ATOM 2432  H HB2  . LEU A 1 49  ? 31.142 23.635 22.865 1.00 0.00 ? 19 LEU A HB2  3  
ATOM 2433  H HB3  . LEU A 1 49  ? 30.158 24.461 24.072 1.00 0.00 ? 19 LEU A HB3  3  
ATOM 2434  H HG   . LEU A 1 49  ? 29.754 22.193 25.140 1.00 0.00 ? 19 LEU A HG   3  
ATOM 2435  H HD11 . LEU A 1 49  ? 31.824 21.468 23.064 1.00 0.00 ? 19 LEU A HD11 3  
ATOM 2436  H HD12 . LEU A 1 49  ? 30.287 20.671 23.398 1.00 0.00 ? 19 LEU A HD12 3  
ATOM 2437  H HD13 . LEU A 1 49  ? 31.623 20.524 24.541 1.00 0.00 ? 19 LEU A HD13 3  
ATOM 2438  H HD21 . LEU A 1 49  ? 32.594 23.244 24.943 1.00 0.00 ? 19 LEU A HD21 3  
ATOM 2439  H HD22 . LEU A 1 49  ? 32.026 22.127 26.185 1.00 0.00 ? 19 LEU A HD22 3  
ATOM 2440  H HD23 . LEU A 1 49  ? 31.364 23.760 26.098 1.00 0.00 ? 19 LEU A HD23 3  
ATOM 2441  N N    . SER A 1 50  ? 27.287 24.266 24.026 1.00 0.00 ? 20 SER A N    3  
ATOM 2442  C CA   . SER A 1 50  ? 26.162 24.333 24.957 1.00 0.00 ? 20 SER A CA   3  
ATOM 2443  C C    . SER A 1 50  ? 24.973 23.510 24.469 1.00 0.00 ? 20 SER A C    3  
ATOM 2444  O O    . SER A 1 50  ? 24.250 22.920 25.271 1.00 0.00 ? 20 SER A O    3  
ATOM 2445  C CB   . SER A 1 50  ? 25.731 25.788 25.142 1.00 0.00 ? 20 SER A CB   3  
ATOM 2446  O OG   . SER A 1 50  ? 24.750 25.857 26.167 1.00 0.00 ? 20 SER A OG   3  
ATOM 2447  H H    . SER A 1 50  ? 27.651 25.094 23.652 1.00 0.00 ? 20 SER A H    3  
ATOM 2448  H HA   . SER A 1 50  ? 26.482 23.946 25.913 1.00 0.00 ? 20 SER A HA   3  
ATOM 2449  H HB2  . SER A 1 50  ? 26.580 26.386 25.427 1.00 0.00 ? 20 SER A HB2  3  
ATOM 2450  H HB3  . SER A 1 50  ? 25.329 26.162 24.210 1.00 0.00 ? 20 SER A HB3  3  
ATOM 2451  H HG   . SER A 1 50  ? 25.141 25.624 26.943 1.00 0.00 ? 20 SER A HG   3  
ATOM 2452  N N    . VAL A 1 51  ? 24.770 23.471 23.155 1.00 0.00 ? 21 VAL A N    3  
ATOM 2453  C CA   . VAL A 1 51  ? 23.677 22.681 22.587 1.00 0.00 ? 21 VAL A CA   3  
ATOM 2454  C C    . VAL A 1 51  ? 24.058 21.220 22.308 1.00 0.00 ? 21 VAL A C    3  
ATOM 2455  O O    . VAL A 1 51  ? 23.230 20.462 21.801 1.00 0.00 ? 21 VAL A O    3  
ATOM 2456  C CB   . VAL A 1 51  ? 23.184 23.332 21.292 1.00 0.00 ? 21 VAL A CB   3  
ATOM 2457  C CG1  . VAL A 1 51  ? 22.704 24.754 21.586 1.00 0.00 ? 21 VAL A CG1  3  
ATOM 2458  C CG2  . VAL A 1 51  ? 24.326 23.385 20.274 1.00 0.00 ? 21 VAL A CG2  3  
ATOM 2459  H H    . VAL A 1 51  ? 25.324 24.031 22.567 1.00 0.00 ? 21 VAL A H    3  
ATOM 2460  H HA   . VAL A 1 51  ? 22.859 22.685 23.291 1.00 0.00 ? 21 VAL A HA   3  
ATOM 2461  H HB   . VAL A 1 51  ? 22.366 22.753 20.888 1.00 0.00 ? 21 VAL A HB   3  
ATOM 2462  H HG11 . VAL A 1 51  ? 22.013 24.736 22.416 1.00 0.00 ? 21 VAL A HG11 3  
ATOM 2463  H HG12 . VAL A 1 51  ? 22.208 25.154 20.714 1.00 0.00 ? 21 VAL A HG12 3  
ATOM 2464  H HG13 . VAL A 1 51  ? 23.551 25.376 21.835 1.00 0.00 ? 21 VAL A HG13 3  
ATOM 2465  H HG21 . VAL A 1 51  ? 24.789 22.413 20.199 1.00 0.00 ? 21 VAL A HG21 3  
ATOM 2466  H HG22 . VAL A 1 51  ? 25.059 24.109 20.596 1.00 0.00 ? 21 VAL A HG22 3  
ATOM 2467  H HG23 . VAL A 1 51  ? 23.935 23.674 19.309 1.00 0.00 ? 21 VAL A HG23 3  
ATOM 2468  N N    . GLY A 1 52  ? 25.287 20.812 22.630 1.00 0.00 ? 22 GLY A N    3  
ATOM 2469  C CA   . GLY A 1 52  ? 25.730 19.446 22.345 1.00 0.00 ? 22 GLY A CA   3  
ATOM 2470  C C    . GLY A 1 52  ? 26.311 19.282 20.933 1.00 0.00 ? 22 GLY A C    3  
ATOM 2471  O O    . GLY A 1 52  ? 26.528 18.157 20.483 1.00 0.00 ? 22 GLY A O    3  
ATOM 2472  H H    . GLY A 1 52  ? 25.897 21.424 23.091 1.00 0.00 ? 22 GLY A H    3  
ATOM 2473  H HA2  . GLY A 1 52  ? 26.486 19.168 23.065 1.00 0.00 ? 22 GLY A HA2  3  
ATOM 2474  H HA3  . GLY A 1 52  ? 24.887 18.779 22.453 1.00 0.00 ? 22 GLY A HA3  3  
ATOM 2475  N N    . ASN A 1 53  ? 26.566 20.388 20.234 1.00 0.00 ? 23 ASN A N    3  
ATOM 2476  C CA   . ASN A 1 53  ? 27.088 20.330 18.873 1.00 0.00 ? 23 ASN A CA   3  
ATOM 2477  C C    . ASN A 1 53  ? 28.610 20.481 18.879 1.00 0.00 ? 23 ASN A C    3  
ATOM 2478  O O    . ASN A 1 53  ? 29.161 21.484 18.418 1.00 0.00 ? 23 ASN A O    3  
ATOM 2479  C CB   . ASN A 1 53  ? 26.441 21.442 18.043 1.00 0.00 ? 23 ASN A CB   3  
ATOM 2480  C CG   . ASN A 1 53  ? 26.696 21.208 16.560 1.00 0.00 ? 23 ASN A CG   3  
ATOM 2481  O OD1  . ASN A 1 53  ? 27.697 20.592 16.190 1.00 0.00 ? 23 ASN A OD1  3  
ATOM 2482  N ND2  . ASN A 1 53  ? 25.851 21.678 15.685 1.00 0.00 ? 23 ASN A ND2  3  
ATOM 2483  H H    . ASN A 1 53  ? 26.412 21.262 20.646 1.00 0.00 ? 23 ASN A H    3  
ATOM 2484  H HA   . ASN A 1 53  ? 26.832 19.375 18.440 1.00 0.00 ? 23 ASN A HA   3  
ATOM 2485  H HB2  . ASN A 1 53  ? 25.377 21.450 18.225 1.00 0.00 ? 23 ASN A HB2  3  
ATOM 2486  H HB3  . ASN A 1 53  ? 26.861 22.393 18.331 1.00 0.00 ? 23 ASN A HB3  3  
ATOM 2487  H HD21 . ASN A 1 53  ? 25.065 22.179 15.988 1.00 0.00 ? 23 ASN A HD21 3  
ATOM 2488  H HD22 . ASN A 1 53  ? 25.999 21.528 14.729 1.00 0.00 ? 23 ASN A HD22 3  
ATOM 2489  N N    . ILE A 1 54  ? 29.293 19.456 19.381 1.00 0.00 ? 24 ILE A N    3  
ATOM 2490  C CA   . ILE A 1 54  ? 30.743 19.527 19.531 1.00 0.00 ? 24 ILE A CA   3  
ATOM 2491  C C    . ILE A 1 54  ? 31.420 19.680 18.168 1.00 0.00 ? 24 ILE A C    3  
ATOM 2492  O O    . ILE A 1 54  ? 32.406 20.407 18.047 1.00 0.00 ? 24 ILE A O    3  
ATOM 2493  C CB   . ILE A 1 54  ? 31.261 18.267 20.240 1.00 0.00 ? 24 ILE A CB   3  
ATOM 2494  C CG1  . ILE A 1 54  ? 30.568 18.116 21.600 1.00 0.00 ? 24 ILE A CG1  3  
ATOM 2495  C CG2  . ILE A 1 54  ? 32.774 18.381 20.468 1.00 0.00 ? 24 ILE A CG2  3  
ATOM 2496  C CD1  . ILE A 1 54  ? 30.848 16.725 22.180 1.00 0.00 ? 24 ILE A CD1  3  
ATOM 2497  H H    . ILE A 1 54  ? 28.817 18.644 19.654 1.00 0.00 ? 24 ILE A H    3  
ATOM 2498  H HA   . ILE A 1 54  ? 30.986 20.388 20.136 1.00 0.00 ? 24 ILE A HA   3  
ATOM 2499  H HB   . ILE A 1 54  ? 31.054 17.399 19.630 1.00 0.00 ? 24 ILE A HB   3  
ATOM 2500  H HG12 . ILE A 1 54  ? 30.942 18.868 22.278 1.00 0.00 ? 24 ILE A HG12 3  
ATOM 2501  H HG13 . ILE A 1 54  ? 29.503 18.240 21.480 1.00 0.00 ? 24 ILE A HG13 3  
ATOM 2502  H HG21 . ILE A 1 54  ? 32.972 19.183 21.163 1.00 0.00 ? 24 ILE A HG21 3  
ATOM 2503  H HG22 . ILE A 1 54  ? 33.264 18.589 19.528 1.00 0.00 ? 24 ILE A HG22 3  
ATOM 2504  H HG23 . ILE A 1 54  ? 33.148 17.452 20.872 1.00 0.00 ? 24 ILE A HG23 3  
ATOM 2505  H HD11 . ILE A 1 54  ? 31.826 16.389 21.871 1.00 0.00 ? 24 ILE A HD11 3  
ATOM 2506  H HD12 . ILE A 1 54  ? 30.101 16.031 21.823 1.00 0.00 ? 24 ILE A HD12 3  
ATOM 2507  H HD13 . ILE A 1 54  ? 30.807 16.772 23.258 1.00 0.00 ? 24 ILE A HD13 3  
ATOM 2508  N N    . ASP A 1 55  ? 30.874 19.032 17.138 1.00 0.00 ? 25 ASP A N    3  
ATOM 2509  C CA   . ASP A 1 55  ? 31.483 19.097 15.814 1.00 0.00 ? 25 ASP A CA   3  
ATOM 2510  C C    . ASP A 1 55  ? 31.524 20.535 15.308 1.00 0.00 ? 25 ASP A C    3  
ATOM 2511  O O    . ASP A 1 55  ? 32.570 21.020 14.870 1.00 0.00 ? 25 ASP A O    3  
ATOM 2512  C CB   . ASP A 1 55  ? 30.690 18.231 14.830 1.00 0.00 ? 25 ASP A CB   3  
ATOM 2513  C CG   . ASP A 1 55  ? 30.771 16.758 15.224 1.00 0.00 ? 25 ASP A CG   3  
ATOM 2514  O OD1  . ASP A 1 55  ? 31.774 16.363 15.797 1.00 0.00 ? 25 ASP A OD1  3  
ATOM 2515  O OD2  . ASP A 1 55  ? 29.823 16.042 14.943 1.00 0.00 ? 25 ASP A OD2  3  
ATOM 2516  H H    . ASP A 1 55  ? 30.056 18.509 17.272 1.00 0.00 ? 25 ASP A H    3  
ATOM 2517  H HA   . ASP A 1 55  ? 32.492 18.719 15.874 1.00 0.00 ? 25 ASP A HA   3  
ATOM 2518  H HB2  . ASP A 1 55  ? 29.657 18.545 14.833 1.00 0.00 ? 25 ASP A HB2  3  
ATOM 2519  H HB3  . ASP A 1 55  ? 31.097 18.357 13.838 1.00 0.00 ? 25 ASP A HB3  3  
ATOM 2520  N N    . ASP A 1 56  ? 30.398 21.236 15.418 1.00 0.00 ? 26 ASP A N    3  
ATOM 2521  C CA   . ASP A 1 56  ? 30.337 22.623 14.970 1.00 0.00 ? 26 ASP A CA   3  
ATOM 2522  C C    . ASP A 1 56  ? 31.277 23.499 15.788 1.00 0.00 ? 26 ASP A C    3  
ATOM 2523  O O    . ASP A 1 56  ? 31.968 24.356 15.235 1.00 0.00 ? 26 ASP A O    3  
ATOM 2524  C CB   . ASP A 1 56  ? 28.906 23.160 15.077 1.00 0.00 ? 26 ASP A CB   3  
ATOM 2525  C CG   . ASP A 1 56  ? 28.004 22.567 13.990 1.00 0.00 ? 26 ASP A CG   3  
ATOM 2526  O OD1  . ASP A 1 56  ? 26.948 23.134 13.765 1.00 0.00 ? 26 ASP A OD1  3  
ATOM 2527  O OD2  . ASP A 1 56  ? 28.363 21.554 13.405 1.00 0.00 ? 26 ASP A OD2  3  
ATOM 2528  H H    . ASP A 1 56  ? 29.597 20.813 15.791 1.00 0.00 ? 26 ASP A H    3  
ATOM 2529  H HA   . ASP A 1 56  ? 30.642 22.663 13.935 1.00 0.00 ? 26 ASP A HA   3  
ATOM 2530  H HB2  . ASP A 1 56  ? 28.504 22.904 16.046 1.00 0.00 ? 26 ASP A HB2  3  
ATOM 2531  H HB3  . ASP A 1 56  ? 28.923 24.235 14.973 1.00 0.00 ? 26 ASP A HB3  3  
ATOM 2532  N N    . ALA A 1 57  ? 31.337 23.256 17.096 1.00 0.00 ? 27 ALA A N    3  
ATOM 2533  C CA   . ALA A 1 57  ? 32.196 24.059 17.957 1.00 0.00 ? 27 ALA A CA   3  
ATOM 2534  C C    . ALA A 1 57  ? 33.654 23.932 17.521 1.00 0.00 ? 27 ALA A C    3  
ATOM 2535  O O    . ALA A 1 57  ? 34.353 24.934 17.357 1.00 0.00 ? 27 ALA A O    3  
ATOM 2536  C CB   . ALA A 1 57  ? 32.053 23.597 19.410 1.00 0.00 ? 27 ALA A CB   3  
ATOM 2537  H H    . ALA A 1 57  ? 30.769 22.556 17.487 1.00 0.00 ? 27 ALA A H    3  
ATOM 2538  H HA   . ALA A 1 57  ? 31.893 25.094 17.890 1.00 0.00 ? 27 ALA A HA   3  
ATOM 2539  H HB1  . ALA A 1 57  ? 32.780 22.826 19.620 1.00 0.00 ? 27 ALA A HB1  3  
ATOM 2540  H HB2  . ALA A 1 57  ? 31.060 23.204 19.567 1.00 0.00 ? 27 ALA A HB2  3  
ATOM 2541  H HB3  . ALA A 1 57  ? 32.216 24.434 20.071 1.00 0.00 ? 27 ALA A HB3  3  
ATOM 2542  N N    . LEU A 1 58  ? 34.103 22.698 17.293 1.00 0.00 ? 28 LEU A N    3  
ATOM 2543  C CA   . LEU A 1 58  ? 35.470 22.476 16.836 1.00 0.00 ? 28 LEU A CA   3  
ATOM 2544  C C    . LEU A 1 58  ? 35.715 23.168 15.498 1.00 0.00 ? 28 LEU A C    3  
ATOM 2545  O O    . LEU A 1 58  ? 36.776 23.758 15.285 1.00 0.00 ? 28 LEU A O    3  
ATOM 2546  C CB   . LEU A 1 58  ? 35.739 20.976 16.689 1.00 0.00 ? 28 LEU A CB   3  
ATOM 2547  C CG   . LEU A 1 58  ? 35.611 20.288 18.051 1.00 0.00 ? 28 LEU A CG   3  
ATOM 2548  C CD1  . LEU A 1 58  ? 35.700 18.773 17.863 1.00 0.00 ? 28 LEU A CD1  3  
ATOM 2549  C CD2  . LEU A 1 58  ? 36.748 20.750 18.965 1.00 0.00 ? 28 LEU A CD2  3  
ATOM 2550  H H    . LEU A 1 58  ? 33.514 21.931 17.451 1.00 0.00 ? 28 LEU A H    3  
ATOM 2551  H HA   . LEU A 1 58  ? 36.153 22.882 17.566 1.00 0.00 ? 28 LEU A HA   3  
ATOM 2552  H HB2  . LEU A 1 58  ? 35.023 20.549 16.002 1.00 0.00 ? 28 LEU A HB2  3  
ATOM 2553  H HB3  . LEU A 1 58  ? 36.737 20.827 16.306 1.00 0.00 ? 28 LEU A HB3  3  
ATOM 2554  H HG   . LEU A 1 58  ? 34.662 20.542 18.496 1.00 0.00 ? 28 LEU A HG   3  
ATOM 2555  H HD11 . LEU A 1 58  ? 35.685 18.290 18.828 1.00 0.00 ? 28 LEU A HD11 3  
ATOM 2556  H HD12 . LEU A 1 58  ? 36.619 18.526 17.352 1.00 0.00 ? 28 LEU A HD12 3  
ATOM 2557  H HD13 . LEU A 1 58  ? 34.860 18.432 17.277 1.00 0.00 ? 28 LEU A HD13 3  
ATOM 2558  H HD21 . LEU A 1 58  ? 36.525 21.735 19.348 1.00 0.00 ? 28 LEU A HD21 3  
ATOM 2559  H HD22 . LEU A 1 58  ? 37.671 20.783 18.403 1.00 0.00 ? 28 LEU A HD22 3  
ATOM 2560  H HD23 . LEU A 1 58  ? 36.851 20.058 19.788 1.00 0.00 ? 28 LEU A HD23 3  
ATOM 2561  N N    . GLN A 1 59  ? 34.721 23.127 14.613 1.00 0.00 ? 29 GLN A N    3  
ATOM 2562  C CA   . GLN A 1 59  ? 34.865 23.766 13.309 1.00 0.00 ? 29 GLN A CA   3  
ATOM 2563  C C    . GLN A 1 59  ? 35.100 25.266 13.459 1.00 0.00 ? 29 GLN A C    3  
ATOM 2564  O O    . GLN A 1 59  ? 35.998 25.825 12.825 1.00 0.00 ? 29 GLN A O    3  
ATOM 2565  C CB   . GLN A 1 59  ? 33.607 23.527 12.472 1.00 0.00 ? 29 GLN A CB   3  
ATOM 2566  C CG   . GLN A 1 59  ? 33.830 24.053 11.050 1.00 0.00 ? 29 GLN A CG   3  
ATOM 2567  C CD   . GLN A 1 59  ? 32.609 23.787 10.170 1.00 0.00 ? 29 GLN A CD   3  
ATOM 2568  O OE1  . GLN A 1 59  ? 31.673 23.093 10.575 1.00 0.00 ? 29 GLN A OE1  3  
ATOM 2569  N NE2  . GLN A 1 59  ? 32.562 24.304 8.973  1.00 0.00 ? 29 GLN A NE2  3  
ATOM 2570  H H    . GLN A 1 59  ? 33.903 22.626 14.821 1.00 0.00 ? 29 GLN A H    3  
ATOM 2571  H HA   . GLN A 1 59  ? 35.710 23.329 12.798 1.00 0.00 ? 29 GLN A HA   3  
ATOM 2572  H HB2  . GLN A 1 59  ? 33.394 22.469 12.436 1.00 0.00 ? 29 GLN A HB2  3  
ATOM 2573  H HB3  . GLN A 1 59  ? 32.774 24.049 12.917 1.00 0.00 ? 29 GLN A HB3  3  
ATOM 2574  H HG2  . GLN A 1 59  ? 34.013 25.116 11.090 1.00 0.00 ? 29 GLN A HG2  3  
ATOM 2575  H HG3  . GLN A 1 59  ? 34.691 23.562 10.621 1.00 0.00 ? 29 GLN A HG3  3  
ATOM 2576  H HE21 . GLN A 1 59  ? 33.305 24.855 8.649  1.00 0.00 ? 29 GLN A HE21 3  
ATOM 2577  H HE22 . GLN A 1 59  ? 31.785 24.141 8.399  1.00 0.00 ? 29 GLN A HE22 3  
ATOM 2578  N N    . TYR A 1 60  ? 34.319 25.910 14.325 1.00 0.00 ? 30 TYR A N    3  
ATOM 2579  C CA   . TYR A 1 60  ? 34.496 27.338 14.559 1.00 0.00 ? 30 TYR A CA   3  
ATOM 2580  C C    . TYR A 1 60  ? 35.892 27.635 15.094 1.00 0.00 ? 30 TYR A C    3  
ATOM 2581  O O    . TYR A 1 60  ? 36.539 28.586 14.652 1.00 0.00 ? 30 TYR A O    3  
ATOM 2582  C CB   . TYR A 1 60  ? 33.455 27.847 15.559 1.00 0.00 ? 30 TYR A CB   3  
ATOM 2583  C CG   . TYR A 1 60  ? 32.042 27.834 15.026 1.00 0.00 ? 30 TYR A CG   3  
ATOM 2584  C CD1  . TYR A 1 60  ? 31.076 27.011 15.615 1.00 0.00 ? 30 TYR A CD1  3  
ATOM 2585  C CD2  . TYR A 1 60  ? 31.699 28.650 13.941 1.00 0.00 ? 30 TYR A CD2  3  
ATOM 2586  C CE1  . TYR A 1 60  ? 29.767 27.003 15.120 1.00 0.00 ? 30 TYR A CE1  3  
ATOM 2587  C CE2  . TYR A 1 60  ? 30.390 28.641 13.446 1.00 0.00 ? 30 TYR A CE2  3  
ATOM 2588  C CZ   . TYR A 1 60  ? 29.423 27.817 14.035 1.00 0.00 ? 30 TYR A CZ   3  
ATOM 2589  O OH   . TYR A 1 60  ? 28.133 27.809 13.547 1.00 0.00 ? 30 TYR A OH   3  
ATOM 2590  H H    . TYR A 1 60  ? 33.598 25.428 14.780 1.00 0.00 ? 30 TYR A H    3  
ATOM 2591  H HA   . TYR A 1 60  ? 34.363 27.863 13.625 1.00 0.00 ? 30 TYR A HA   3  
ATOM 2592  H HB2  . TYR A 1 60  ? 33.491 27.226 16.441 1.00 0.00 ? 30 TYR A HB2  3  
ATOM 2593  H HB3  . TYR A 1 60  ? 33.715 28.857 15.841 1.00 0.00 ? 30 TYR A HB3  3  
ATOM 2594  H HD1  . TYR A 1 60  ? 31.341 26.382 16.452 1.00 0.00 ? 30 TYR A HD1  3  
ATOM 2595  H HD2  . TYR A 1 60  ? 32.444 29.285 13.486 1.00 0.00 ? 30 TYR A HD2  3  
ATOM 2596  H HE1  . TYR A 1 60  ? 29.021 26.367 15.575 1.00 0.00 ? 30 TYR A HE1  3  
ATOM 2597  H HE2  . TYR A 1 60  ? 30.125 29.271 12.609 1.00 0.00 ? 30 TYR A HE2  3  
ATOM 2598  H HH   . TYR A 1 60  ? 28.163 27.557 12.684 1.00 0.00 ? 30 TYR A HH   3  
ATOM 2599  N N    . TYR A 1 61  ? 36.373 26.802 16.017 1.00 0.00 ? 31 TYR A N    3  
ATOM 2600  C CA   . TYR A 1 61  ? 37.705 27.010 16.574 1.00 0.00 ? 31 TYR A CA   3  
ATOM 2601  C C    . TYR A 1 61  ? 38.777 26.906 15.493 1.00 0.00 ? 31 TYR A C    3  
ATOM 2602  O O    . TYR A 1 61  ? 39.709 27.710 15.458 1.00 0.00 ? 31 TYR A O    3  
ATOM 2603  C CB   . TYR A 1 61  ? 37.986 25.985 17.675 1.00 0.00 ? 31 TYR A CB   3  
ATOM 2604  C CG   . TYR A 1 61  ? 37.068 26.111 18.870 1.00 0.00 ? 31 TYR A CG   3  
ATOM 2605  C CD1  . TYR A 1 61  ? 36.768 27.374 19.397 1.00 0.00 ? 31 TYR A CD1  3  
ATOM 2606  C CD2  . TYR A 1 61  ? 36.519 24.963 19.454 1.00 0.00 ? 31 TYR A CD2  3  
ATOM 2607  C CE1  . TYR A 1 61  ? 35.920 27.488 20.505 1.00 0.00 ? 31 TYR A CE1  3  
ATOM 2608  C CE2  . TYR A 1 61  ? 35.670 25.077 20.561 1.00 0.00 ? 31 TYR A CE2  3  
ATOM 2609  C CZ   . TYR A 1 61  ? 35.370 26.339 21.087 1.00 0.00 ? 31 TYR A CZ   3  
ATOM 2610  O OH   . TYR A 1 61  ? 34.535 26.451 22.180 1.00 0.00 ? 31 TYR A OH   3  
ATOM 2611  H H    . TYR A 1 61  ? 35.814 26.067 16.349 1.00 0.00 ? 31 TYR A H    3  
ATOM 2612  H HA   . TYR A 1 61  ? 37.748 27.998 17.007 1.00 0.00 ? 31 TYR A HA   3  
ATOM 2613  H HB2  . TYR A 1 61  ? 37.873 24.995 17.263 1.00 0.00 ? 31 TYR A HB2  3  
ATOM 2614  H HB3  . TYR A 1 61  ? 39.009 26.105 18.004 1.00 0.00 ? 31 TYR A HB3  3  
ATOM 2615  H HD1  . TYR A 1 61  ? 37.190 28.261 18.947 1.00 0.00 ? 31 TYR A HD1  3  
ATOM 2616  H HD2  . TYR A 1 61  ? 36.751 23.989 19.050 1.00 0.00 ? 31 TYR A HD2  3  
ATOM 2617  H HE1  . TYR A 1 61  ? 35.689 28.462 20.911 1.00 0.00 ? 31 TYR A HE1  3  
ATOM 2618  H HE2  . TYR A 1 61  ? 35.247 24.191 21.011 1.00 0.00 ? 31 TYR A HE2  3  
ATOM 2619  H HH   . TYR A 1 61  ? 34.833 25.889 22.817 1.00 0.00 ? 31 TYR A HH   3  
ATOM 2620  N N    . ALA A 1 62  ? 38.610 25.959 14.572 1.00 0.00 ? 32 ALA A N    3  
ATOM 2621  C CA   . ALA A 1 62  ? 39.576 25.796 13.490 1.00 0.00 ? 32 ALA A CA   3  
ATOM 2622  C C    . ALA A 1 62  ? 39.608 27.040 12.611 1.00 0.00 ? 32 ALA A C    3  
ATOM 2623  O O    . ALA A 1 62  ? 40.680 27.548 12.270 1.00 0.00 ? 32 ALA A O    3  
ATOM 2624  C CB   . ALA A 1 62  ? 39.209 24.578 12.639 1.00 0.00 ? 32 ALA A CB   3  
ATOM 2625  H H    . ALA A 1 62  ? 37.853 25.340 14.644 1.00 0.00 ? 32 ALA A H    3  
ATOM 2626  H HA   . ALA A 1 62  ? 40.557 25.642 13.915 1.00 0.00 ? 32 ALA A HA   3  
ATOM 2627  H HB1  . ALA A 1 62  ? 39.103 23.713 13.277 1.00 0.00 ? 32 ALA A HB1  3  
ATOM 2628  H HB2  . ALA A 1 62  ? 39.989 24.397 11.914 1.00 0.00 ? 32 ALA A HB2  3  
ATOM 2629  H HB3  . ALA A 1 62  ? 38.277 24.764 12.127 1.00 0.00 ? 32 ALA A HB3  3  
ATOM 2630  N N    . ALA A 1 63  ? 38.426 27.559 12.286 1.00 0.00 ? 33 ALA A N    3  
ATOM 2631  C CA   . ALA A 1 63  ? 38.345 28.768 11.476 1.00 0.00 ? 33 ALA A CA   3  
ATOM 2632  C C    . ALA A 1 63  ? 38.984 29.950 12.198 1.00 0.00 ? 33 ALA A C    3  
ATOM 2633  O O    . ALA A 1 63  ? 39.679 30.758 11.582 1.00 0.00 ? 33 ALA A O    3  
ATOM 2634  C CB   . ALA A 1 63  ? 36.882 29.088 11.165 1.00 0.00 ? 33 ALA A CB   3  
ATOM 2635  H H    . ALA A 1 63  ? 37.603 27.107 12.570 1.00 0.00 ? 33 ALA A H    3  
ATOM 2636  H HA   . ALA A 1 63  ? 38.868 28.602 10.546 1.00 0.00 ? 33 ALA A HA   3  
ATOM 2637  H HB1  . ALA A 1 63  ? 36.458 29.658 11.980 1.00 0.00 ? 33 ALA A HB1  3  
ATOM 2638  H HB2  . ALA A 1 63  ? 36.330 28.168 11.045 1.00 0.00 ? 33 ALA A HB2  3  
ATOM 2639  H HB3  . ALA A 1 63  ? 36.825 29.666 10.254 1.00 0.00 ? 33 ALA A HB3  3  
ATOM 2640  N N    . ALA A 1 64  ? 38.784 30.028 13.512 1.00 0.00 ? 34 ALA A N    3  
ATOM 2641  C CA   . ALA A 1 64  ? 39.350 31.123 14.290 1.00 0.00 ? 34 ALA A CA   3  
ATOM 2642  C C    . ALA A 1 64  ? 40.877 31.119 14.211 1.00 0.00 ? 34 ALA A C    3  
ATOM 2643  O O    . ALA A 1 64  ? 41.491 32.161 13.972 1.00 0.00 ? 34 ALA A O    3  
ATOM 2644  C CB   . ALA A 1 64  ? 38.889 30.999 15.747 1.00 0.00 ? 34 ALA A CB   3  
ATOM 2645  H H    . ALA A 1 64  ? 38.218 29.363 13.956 1.00 0.00 ? 34 ALA A H    3  
ATOM 2646  H HA   . ALA A 1 64  ? 38.984 32.058 13.891 1.00 0.00 ? 34 ALA A HA   3  
ATOM 2647  H HB1  . ALA A 1 64  ? 38.617 29.973 15.948 1.00 0.00 ? 34 ALA A HB1  3  
ATOM 2648  H HB2  . ALA A 1 64  ? 38.029 31.633 15.905 1.00 0.00 ? 34 ALA A HB2  3  
ATOM 2649  H HB3  . ALA A 1 64  ? 39.681 31.297 16.419 1.00 0.00 ? 34 ALA A HB3  3  
ATOM 2650  N N    . ILE A 1 65  ? 41.483 29.942 14.362 1.00 0.00 ? 35 ILE A N    3  
ATOM 2651  C CA   . ILE A 1 65  ? 42.938 29.849 14.296 1.00 0.00 ? 35 ILE A CA   3  
ATOM 2652  C C    . ILE A 1 65  ? 43.442 30.294 12.925 1.00 0.00 ? 35 ILE A C    3  
ATOM 2653  O O    . ILE A 1 65  ? 44.388 31.080 12.835 1.00 0.00 ? 35 ILE A O    3  
ATOM 2654  C CB   . ILE A 1 65  ? 43.385 28.411 14.595 1.00 0.00 ? 35 ILE A CB   3  
ATOM 2655  C CG1  . ILE A 1 65  ? 42.901 28.015 15.991 1.00 0.00 ? 35 ILE A CG1  3  
ATOM 2656  C CG2  . ILE A 1 65  ? 44.913 28.305 14.558 1.00 0.00 ? 35 ILE A CG2  3  
ATOM 2657  C CD1  . ILE A 1 65  ? 43.107 26.514 16.199 1.00 0.00 ? 35 ILE A CD1  3  
ATOM 2658  H H    . ILE A 1 65  ? 40.950 29.141 14.552 1.00 0.00 ? 35 ILE A H    3  
ATOM 2659  H HA   . ILE A 1 65  ? 43.359 30.503 15.046 1.00 0.00 ? 35 ILE A HA   3  
ATOM 2660  H HB   . ILE A 1 65  ? 42.958 27.741 13.861 1.00 0.00 ? 35 ILE A HB   3  
ATOM 2661  H HG12 . ILE A 1 65  ? 43.464 28.563 16.733 1.00 0.00 ? 35 ILE A HG12 3  
ATOM 2662  H HG13 . ILE A 1 65  ? 41.853 28.250 16.091 1.00 0.00 ? 35 ILE A HG13 3  
ATOM 2663  H HG21 . ILE A 1 65  ? 45.335 28.897 15.357 1.00 0.00 ? 35 ILE A HG21 3  
ATOM 2664  H HG22 . ILE A 1 65  ? 45.277 28.670 13.609 1.00 0.00 ? 35 ILE A HG22 3  
ATOM 2665  H HG23 . ILE A 1 65  ? 45.205 27.272 14.683 1.00 0.00 ? 35 ILE A HG23 3  
ATOM 2666  H HD11 . ILE A 1 65  ? 44.163 26.289 16.173 1.00 0.00 ? 35 ILE A HD11 3  
ATOM 2667  H HD12 . ILE A 1 65  ? 42.603 25.969 15.414 1.00 0.00 ? 35 ILE A HD12 3  
ATOM 2668  H HD13 . ILE A 1 65  ? 42.701 26.224 17.156 1.00 0.00 ? 35 ILE A HD13 3  
ATOM 2669  N N    . THR A 1 66  ? 42.797 29.817 11.861 1.00 0.00 ? 36 THR A N    3  
ATOM 2670  C CA   . THR A 1 66  ? 43.220 30.191 10.515 1.00 0.00 ? 36 THR A CA   3  
ATOM 2671  C C    . THR A 1 66  ? 43.108 31.699 10.307 1.00 0.00 ? 36 THR A C    3  
ATOM 2672  O O    . THR A 1 66  ? 44.018 32.333 9.768  1.00 0.00 ? 36 THR A O    3  
ATOM 2673  C CB   . THR A 1 66  ? 42.361 29.467 9.477  1.00 0.00 ? 36 THR A CB   3  
ATOM 2674  O OG1  . THR A 1 66  ? 42.293 28.084 9.793  1.00 0.00 ? 36 THR A OG1  3  
ATOM 2675  C CG2  . THR A 1 66  ? 42.990 29.641 8.094  1.00 0.00 ? 36 THR A CG2  3  
ATOM 2676  H H    . THR A 1 66  ? 42.052 29.188 11.983 1.00 0.00 ? 36 THR A H    3  
ATOM 2677  H HA   . THR A 1 66  ? 44.250 29.895 10.378 1.00 0.00 ? 36 THR A HA   3  
ATOM 2678  H HB   . THR A 1 66  ? 41.366 29.888 9.471  1.00 0.00 ? 36 THR A HB   3  
ATOM 2679  H HG1  . THR A 1 66  ? 41.774 27.682 9.177  1.00 0.00 ? 36 THR A HG1  3  
ATOM 2680  H HG21 . THR A 1 66  ? 44.065 29.573 8.176  1.00 0.00 ? 36 THR A HG21 3  
ATOM 2681  H HG22 . THR A 1 66  ? 42.719 30.606 7.695  1.00 0.00 ? 36 THR A HG22 3  
ATOM 2682  H HG23 . THR A 1 66  ? 42.630 28.864 7.434  1.00 0.00 ? 36 THR A HG23 3  
ATOM 2683  N N    . LEU A 1 67  ? 42.008 32.282 10.775 1.00 0.00 ? 37 LEU A N    3  
ATOM 2684  C CA   . LEU A 1 67  ? 41.802 33.720 10.632 1.00 0.00 ? 37 LEU A CA   3  
ATOM 2685  C C    . LEU A 1 67  ? 42.887 34.516 11.350 1.00 0.00 ? 37 LEU A C    3  
ATOM 2686  O O    . LEU A 1 67  ? 43.275 35.592 10.892 1.00 0.00 ? 37 LEU A O    3  
ATOM 2687  C CB   . LEU A 1 67  ? 40.425 34.102 11.176 1.00 0.00 ? 37 LEU A CB   3  
ATOM 2688  C CG   . LEU A 1 67  ? 39.347 33.513 10.264 1.00 0.00 ? 37 LEU A CG   3  
ATOM 2689  C CD1  . LEU A 1 67  ? 37.986 33.595 10.957 1.00 0.00 ? 37 LEU A CD1  3  
ATOM 2690  C CD2  . LEU A 1 67  ? 39.303 34.308 8.958  1.00 0.00 ? 37 LEU A CD2  3  
ATOM 2691  H H    . LEU A 1 67  ? 41.315 31.737 11.199 1.00 0.00 ? 37 LEU A H    3  
ATOM 2692  H HA   . LEU A 1 67  ? 41.834 33.967 9.582  1.00 0.00 ? 37 LEU A HA   3  
ATOM 2693  H HB2  . LEU A 1 67  ? 40.311 33.710 12.176 1.00 0.00 ? 37 LEU A HB2  3  
ATOM 2694  H HB3  . LEU A 1 67  ? 40.329 35.177 11.194 1.00 0.00 ? 37 LEU A HB3  3  
ATOM 2695  H HG   . LEU A 1 67  ? 39.580 32.480 10.052 1.00 0.00 ? 37 LEU A HG   3  
ATOM 2696  H HD11 . LEU A 1 67  ? 37.860 32.738 11.602 1.00 0.00 ? 37 LEU A HD11 3  
ATOM 2697  H HD12 . LEU A 1 67  ? 37.201 33.604 10.214 1.00 0.00 ? 37 LEU A HD12 3  
ATOM 2698  H HD13 . LEU A 1 67  ? 37.933 34.500 11.545 1.00 0.00 ? 37 LEU A HD13 3  
ATOM 2699  H HD21 . LEU A 1 67  ? 39.421 35.359 9.175  1.00 0.00 ? 37 LEU A HD21 3  
ATOM 2700  H HD22 . LEU A 1 67  ? 38.355 34.144 8.469  1.00 0.00 ? 37 LEU A HD22 3  
ATOM 2701  H HD23 . LEU A 1 67  ? 40.104 33.982 8.311  1.00 0.00 ? 37 LEU A HD23 3  
ATOM 2702  N N    . ASP A 1 68  ? 43.343 34.011 12.493 1.00 0.00 ? 38 ASP A N    3  
ATOM 2703  C CA   . ASP A 1 68  ? 44.459 34.640 13.192 1.00 0.00 ? 38 ASP A CA   3  
ATOM 2704  C C    . ASP A 1 68  ? 45.733 34.562 12.357 1.00 0.00 ? 38 ASP A C    3  
ATOM 2705  O O    . ASP A 1 68  ? 46.444 35.554 12.197 1.00 0.00 ? 38 ASP A O    3  
ATOM 2706  C CB   . ASP A 1 68  ? 44.687 33.946 14.537 1.00 0.00 ? 38 ASP A CB   3  
ATOM 2707  C CG   . ASP A 1 68  ? 45.713 34.714 15.368 1.00 0.00 ? 38 ASP A CG   3  
ATOM 2708  O OD1  . ASP A 1 68  ? 46.413 34.077 16.137 1.00 0.00 ? 38 ASP A OD1  3  
ATOM 2709  O OD2  . ASP A 1 68  ? 45.779 35.925 15.233 1.00 0.00 ? 38 ASP A OD2  3  
ATOM 2710  H H    . ASP A 1 68  ? 42.897 33.235 12.893 1.00 0.00 ? 38 ASP A H    3  
ATOM 2711  H HA   . ASP A 1 68  ? 44.219 35.677 13.371 1.00 0.00 ? 38 ASP A HA   3  
ATOM 2712  H HB2  . ASP A 1 68  ? 43.752 33.901 15.078 1.00 0.00 ? 38 ASP A HB2  3  
ATOM 2713  H HB3  . ASP A 1 68  ? 45.048 32.943 14.364 1.00 0.00 ? 38 ASP A HB3  3  
ATOM 2714  N N    . LYS A 1 69  ? 46.015 33.375 11.823 1.00 0.00 ? 39 LYS A N    3  
ATOM 2715  C CA   . LYS A 1 69  ? 47.208 33.179 11.004 1.00 0.00 ? 39 LYS A CA   3  
ATOM 2716  C C    . LYS A 1 69  ? 47.210 34.080 9.767  1.00 0.00 ? 39 LYS A C    3  
ATOM 2717  O O    . LYS A 1 69  ? 48.275 34.475 9.291  1.00 0.00 ? 39 LYS A O    3  
ATOM 2718  C CB   . LYS A 1 69  ? 47.293 31.713 10.566 1.00 0.00 ? 39 LYS A CB   3  
ATOM 2719  C CG   . LYS A 1 69  ? 48.620 31.460 9.848  1.00 0.00 ? 39 LYS A CG   3  
ATOM 2720  C CD   . LYS A 1 69  ? 48.659 30.018 9.339  1.00 0.00 ? 39 LYS A CD   3  
ATOM 2721  C CE   . LYS A 1 69  ? 50.041 29.718 8.755  1.00 0.00 ? 39 LYS A CE   3  
ATOM 2722  N NZ   . LYS A 1 69  ? 51.026 29.569 9.864  1.00 0.00 ? 39 LYS A NZ   3  
ATOM 2723  H H    . LYS A 1 69  ? 45.425 32.614 12.008 1.00 0.00 ? 39 LYS A H    3  
ATOM 2724  H HA   . LYS A 1 69  ? 48.077 33.408 11.600 1.00 0.00 ? 39 LYS A HA   3  
ATOM 2725  H HB2  . LYS A 1 69  ? 47.227 31.076 11.436 1.00 0.00 ? 39 LYS A HB2  3  
ATOM 2726  H HB3  . LYS A 1 69  ? 46.476 31.492 9.896  1.00 0.00 ? 39 LYS A HB3  3  
ATOM 2727  H HG2  . LYS A 1 69  ? 48.713 32.141 9.014  1.00 0.00 ? 39 LYS A HG2  3  
ATOM 2728  H HG3  . LYS A 1 69  ? 49.439 31.619 10.535 1.00 0.00 ? 39 LYS A HG3  3  
ATOM 2729  H HD2  . LYS A 1 69  ? 48.459 29.343 10.158 1.00 0.00 ? 39 LYS A HD2  3  
ATOM 2730  H HD3  . LYS A 1 69  ? 47.912 29.887 8.571  1.00 0.00 ? 39 LYS A HD3  3  
ATOM 2731  H HE2  . LYS A 1 69  ? 50.000 28.802 8.185  1.00 0.00 ? 39 LYS A HE2  3  
ATOM 2732  H HE3  . LYS A 1 69  ? 50.344 30.531 8.112  1.00 0.00 ? 39 LYS A HE3  3  
ATOM 2733  H HZ1  . LYS A 1 69  ? 51.263 30.506 10.246 1.00 0.00 ? 39 LYS A HZ1  3  
ATOM 2734  H HZ2  . LYS A 1 69  ? 51.889 29.113 9.501  1.00 0.00 ? 39 LYS A HZ2  3  
ATOM 2735  H HZ3  . LYS A 1 69  ? 50.614 28.984 10.618 1.00 0.00 ? 39 LYS A HZ3  3  
ATOM 2736  N N    . TYR A 1 70  ? 46.027 34.406 9.248  1.00 0.00 ? 40 TYR A N    3  
ATOM 2737  C CA   . TYR A 1 70  ? 45.935 35.264 8.071  1.00 0.00 ? 40 TYR A CA   3  
ATOM 2738  C C    . TYR A 1 70  ? 46.626 36.610 8.347  1.00 0.00 ? 40 TYR A C    3  
ATOM 2739  O O    . TYR A 1 70  ? 46.343 37.226 9.377  1.00 0.00 ? 40 TYR A O    3  
ATOM 2740  C CB   . TYR A 1 70  ? 44.454 35.484 7.751  1.00 0.00 ? 40 TYR A CB   3  
ATOM 2741  C CG   . TYR A 1 70  ? 44.157 35.697 6.285  1.00 0.00 ? 40 TYR A CG   3  
ATOM 2742  C CD1  . TYR A 1 70  ? 44.291 34.636 5.381  1.00 0.00 ? 40 TYR A CD1  3  
ATOM 2743  C CD2  . TYR A 1 70  ? 43.720 36.947 5.836  1.00 0.00 ? 40 TYR A CD2  3  
ATOM 2744  C CE1  . TYR A 1 70  ? 43.991 34.828 4.027  1.00 0.00 ? 40 TYR A CE1  3  
ATOM 2745  C CE2  . TYR A 1 70  ? 43.421 37.140 4.483  1.00 0.00 ? 40 TYR A CE2  3  
ATOM 2746  C CZ   . TYR A 1 70  ? 43.555 36.081 3.578  1.00 0.00 ? 40 TYR A CZ   3  
ATOM 2747  O OH   . TYR A 1 70  ? 43.258 36.272 2.244  1.00 0.00 ? 40 TYR A OH   3  
ATOM 2748  H H    . TYR A 1 70  ? 45.212 34.016 9.628  1.00 0.00 ? 40 TYR A H    3  
ATOM 2749  H HA   . TYR A 1 70  ? 46.398 34.751 7.243  1.00 0.00 ? 40 TYR A HA   3  
ATOM 2750  H HB2  . TYR A 1 70  ? 43.896 34.622 8.082  1.00 0.00 ? 40 TYR A HB2  3  
ATOM 2751  H HB3  . TYR A 1 70  ? 44.109 36.345 8.305  1.00 0.00 ? 40 TYR A HB3  3  
ATOM 2752  H HD1  . TYR A 1 70  ? 44.629 33.670 5.727  1.00 0.00 ? 40 TYR A HD1  3  
ATOM 2753  H HD2  . TYR A 1 70  ? 43.616 37.765 6.534  1.00 0.00 ? 40 TYR A HD2  3  
ATOM 2754  H HE1  . TYR A 1 70  ? 44.093 34.011 3.330  1.00 0.00 ? 40 TYR A HE1  3  
ATOM 2755  H HE2  . TYR A 1 70  ? 43.080 38.104 4.140  1.00 0.00 ? 40 TYR A HE2  3  
ATOM 2756  H HH   . TYR A 1 70  ? 42.681 35.629 1.992  1.00 0.00 ? 40 TYR A HH   3  
ATOM 2757  N N    . PRO A 1 71  ? 47.505 37.091 7.486  1.00 0.00 ? 41 PRO A N    3  
ATOM 2758  C CA   . PRO A 1 71  ? 48.265 38.347 7.766  1.00 0.00 ? 41 PRO A CA   3  
ATOM 2759  C C    . PRO A 1 71  ? 47.526 39.630 7.393  1.00 0.00 ? 41 PRO A C    3  
ATOM 2760  O O    . PRO A 1 71  ? 48.142 40.697 7.346  1.00 0.00 ? 41 PRO A O    3  
ATOM 2761  C CB   . PRO A 1 71  ? 49.524 38.182 6.916  1.00 0.00 ? 41 PRO A CB   3  
ATOM 2762  C CG   . PRO A 1 71  ? 49.103 37.372 5.736  1.00 0.00 ? 41 PRO A CG   3  
ATOM 2763  C CD   . PRO A 1 71  ? 47.868 36.568 6.154  1.00 0.00 ? 41 PRO A CD   3  
ATOM 2764  H HA   . PRO A 1 71  ? 48.549 38.378 8.806  1.00 0.00 ? 41 PRO A HA   3  
ATOM 2765  H HB2  . PRO A 1 71  ? 49.889 39.150 6.601  1.00 0.00 ? 41 PRO A HB2  3  
ATOM 2766  H HB3  . PRO A 1 71  ? 50.285 37.654 7.470  1.00 0.00 ? 41 PRO A HB3  3  
ATOM 2767  H HG2  . PRO A 1 71  ? 48.860 38.027 4.910  1.00 0.00 ? 41 PRO A HG2  3  
ATOM 2768  H HG3  . PRO A 1 71  ? 49.892 36.694 5.452  1.00 0.00 ? 41 PRO A HG3  3  
ATOM 2769  H HD2  . PRO A 1 71  ? 47.063 36.727 5.451  1.00 0.00 ? 41 PRO A HD2  3  
ATOM 2770  H HD3  . PRO A 1 71  ? 48.107 35.518 6.223  1.00 0.00 ? 41 PRO A HD3  3  
ATOM 2771  N N    . HIS A 1 72  ? 46.222 39.544 7.135  1.00 0.00 ? 42 HIS A N    3  
ATOM 2772  C CA   . HIS A 1 72  ? 45.472 40.721 6.701  1.00 0.00 ? 42 HIS A CA   3  
ATOM 2773  C C    . HIS A 1 72  ? 44.052 40.731 7.257  1.00 0.00 ? 42 HIS A C    3  
ATOM 2774  O O    . HIS A 1 72  ? 43.465 39.679 7.507  1.00 0.00 ? 42 HIS A O    3  
ATOM 2775  C CB   . HIS A 1 72  ? 45.414 40.765 5.173  1.00 0.00 ? 42 HIS A CB   3  
ATOM 2776  C CG   . HIS A 1 72  ? 46.758 40.969 4.528  1.00 0.00 ? 42 HIS A CG   3  
ATOM 2777  N ND1  . HIS A 1 72  ? 47.537 39.909 4.093  1.00 0.00 ? 42 HIS A ND1  3  
ATOM 2778  C CD2  . HIS A 1 72  ? 47.474 42.104 4.238  1.00 0.00 ? 42 HIS A CD2  3  
ATOM 2779  C CE1  . HIS A 1 72  ? 48.665 40.421 3.572  1.00 0.00 ? 42 HIS A CE1  3  
ATOM 2780  N NE2  . HIS A 1 72  ? 48.680 41.755 3.634  1.00 0.00 ? 42 HIS A NE2  3  
ATOM 2781  H H    . HIS A 1 72  ? 45.763 38.685 7.237  1.00 0.00 ? 42 HIS A H    3  
ATOM 2782  H HA   . HIS A 1 72  ? 45.983 41.606 7.047  1.00 0.00 ? 42 HIS A HA   3  
ATOM 2783  H HB2  . HIS A 1 72  ? 45.002 39.834 4.814  1.00 0.00 ? 42 HIS A HB2  3  
ATOM 2784  H HB3  . HIS A 1 72  ? 44.755 41.569 4.876  1.00 0.00 ? 42 HIS A HB3  3  
ATOM 2785  H HD1  . HIS A 1 72  ? 47.308 38.958 4.155  1.00 0.00 ? 42 HIS A HD1  3  
ATOM 2786  H HD2  . HIS A 1 72  ? 47.152 43.114 4.447  1.00 0.00 ? 42 HIS A HD2  3  
ATOM 2787  H HE1  . HIS A 1 72  ? 49.463 39.827 3.152  1.00 0.00 ? 42 HIS A HE1  3  
ATOM 2788  N N    . LYS A 1 73  ? 43.515 41.928 7.482  1.00 0.00 ? 43 LYS A N    3  
ATOM 2789  C CA   . LYS A 1 73  ? 42.100 42.054 7.808  1.00 0.00 ? 43 LYS A CA   3  
ATOM 2790  C C    . LYS A 1 73  ? 41.269 41.578 6.622  1.00 0.00 ? 43 LYS A C    3  
ATOM 2791  O O    . LYS A 1 73  ? 41.529 41.973 5.485  1.00 0.00 ? 43 LYS A O    3  
ATOM 2792  C CB   . LYS A 1 73  ? 41.751 43.515 8.102  1.00 0.00 ? 43 LYS A CB   3  
ATOM 2793  C CG   . LYS A 1 73  ? 40.314 43.601 8.622  1.00 0.00 ? 43 LYS A CG   3  
ATOM 2794  C CD   . LYS A 1 73  ? 39.936 45.067 8.837  1.00 0.00 ? 43 LYS A CD   3  
ATOM 2795  C CE   . LYS A 1 73  ? 38.560 45.148 9.501  1.00 0.00 ? 43 LYS A CE   3  
ATOM 2796  N NZ   . LYS A 1 73  ? 37.500 44.954 8.471  1.00 0.00 ? 43 LYS A NZ   3  
ATOM 2797  H H    . LYS A 1 73  ? 44.076 42.731 7.437  1.00 0.00 ? 43 LYS A H    3  
ATOM 2798  H HA   . LYS A 1 73  ? 41.874 41.449 8.673  1.00 0.00 ? 43 LYS A HA   3  
ATOM 2799  H HB2  . LYS A 1 73  ? 42.428 43.908 8.844  1.00 0.00 ? 43 LYS A HB2  3  
ATOM 2800  H HB3  . LYS A 1 73  ? 41.835 44.094 7.196  1.00 0.00 ? 43 LYS A HB3  3  
ATOM 2801  H HG2  . LYS A 1 73  ? 39.644 43.157 7.899  1.00 0.00 ? 43 LYS A HG2  3  
ATOM 2802  H HG3  . LYS A 1 73  ? 40.237 43.072 9.559  1.00 0.00 ? 43 LYS A HG3  3  
ATOM 2803  H HD2  . LYS A 1 73  ? 40.672 45.539 9.473  1.00 0.00 ? 43 LYS A HD2  3  
ATOM 2804  H HD3  . LYS A 1 73  ? 39.903 45.575 7.885  1.00 0.00 ? 43 LYS A HD3  3  
ATOM 2805  H HE2  . LYS A 1 73  ? 38.477 44.379 10.253 1.00 0.00 ? 43 LYS A HE2  3  
ATOM 2806  H HE3  . LYS A 1 73  ? 38.439 46.118 9.962  1.00 0.00 ? 43 LYS A HE3  3  
ATOM 2807  H HZ1  . LYS A 1 73  ? 37.836 44.285 7.749  1.00 0.00 ? 43 LYS A HZ1  3  
ATOM 2808  H HZ2  . LYS A 1 73  ? 37.280 45.867 8.024  1.00 0.00 ? 43 LYS A HZ2  3  
ATOM 2809  H HZ3  . LYS A 1 73  ? 36.644 44.572 8.922  1.00 0.00 ? 43 LYS A HZ3  3  
ATOM 2810  N N    . ILE A 1 74  ? 40.276 40.734 6.883  1.00 0.00 ? 44 ILE A N    3  
ATOM 2811  C CA   . ILE A 1 74  ? 39.382 40.288 5.817  1.00 0.00 ? 44 ILE A CA   3  
ATOM 2812  C C    . ILE A 1 74  ? 38.175 41.219 5.714  1.00 0.00 ? 44 ILE A C    3  
ATOM 2813  O O    . ILE A 1 74  ? 37.541 41.547 6.718  1.00 0.00 ? 44 ILE A O    3  
ATOM 2814  C CB   . ILE A 1 74  ? 38.966 38.831 6.061  1.00 0.00 ? 44 ILE A CB   3  
ATOM 2815  C CG1  . ILE A 1 74  ? 40.232 37.968 6.062  1.00 0.00 ? 44 ILE A CG1  3  
ATOM 2816  C CG2  . ILE A 1 74  ? 38.024 38.354 4.951  1.00 0.00 ? 44 ILE A CG2  3  
ATOM 2817  C CD1  . ILE A 1 74  ? 39.892 36.519 6.415  1.00 0.00 ? 44 ILE A CD1  3  
ATOM 2818  H H    . ILE A 1 74  ? 40.157 40.397 7.799  1.00 0.00 ? 44 ILE A H    3  
ATOM 2819  H HA   . ILE A 1 74  ? 39.921 40.333 4.882  1.00 0.00 ? 44 ILE A HA   3  
ATOM 2820  H HB   . ILE A 1 74  ? 38.471 38.750 7.018  1.00 0.00 ? 44 ILE A HB   3  
ATOM 2821  H HG12 . ILE A 1 74  ? 40.685 37.998 5.081  1.00 0.00 ? 44 ILE A HG12 3  
ATOM 2822  H HG13 . ILE A 1 74  ? 40.929 38.357 6.788  1.00 0.00 ? 44 ILE A HG13 3  
ATOM 2823  H HG21 . ILE A 1 74  ? 37.767 37.317 5.112  1.00 0.00 ? 44 ILE A HG21 3  
ATOM 2824  H HG22 . ILE A 1 74  ? 38.512 38.458 3.993  1.00 0.00 ? 44 ILE A HG22 3  
ATOM 2825  H HG23 . ILE A 1 74  ? 37.125 38.950 4.964  1.00 0.00 ? 44 ILE A HG23 3  
ATOM 2826  H HD11 . ILE A 1 74  ? 39.189 36.128 5.695  1.00 0.00 ? 44 ILE A HD11 3  
ATOM 2827  H HD12 . ILE A 1 74  ? 39.458 36.482 7.403  1.00 0.00 ? 44 ILE A HD12 3  
ATOM 2828  H HD13 . ILE A 1 74  ? 40.796 35.927 6.394  1.00 0.00 ? 44 ILE A HD13 3  
ATOM 2829  N N    . LYS A 1 75  ? 37.867 41.642 4.491  1.00 0.00 ? 45 LYS A N    3  
ATOM 2830  C CA   . LYS A 1 75  ? 36.794 42.609 4.265  1.00 0.00 ? 45 LYS A CA   3  
ATOM 2831  C C    . LYS A 1 75  ? 35.407 41.967 4.196  1.00 0.00 ? 45 LYS A C    3  
ATOM 2832  O O    . LYS A 1 75  ? 34.404 42.661 4.363  1.00 0.00 ? 45 LYS A O    3  
ATOM 2833  C CB   . LYS A 1 75  ? 37.058 43.371 2.965  1.00 0.00 ? 45 LYS A CB   3  
ATOM 2834  C CG   . LYS A 1 75  ? 38.347 44.185 3.100  1.00 0.00 ? 45 LYS A CG   3  
ATOM 2835  C CD   . LYS A 1 75  ? 38.554 45.025 1.838  1.00 0.00 ? 45 LYS A CD   3  
ATOM 2836  C CE   . LYS A 1 75  ? 39.902 45.745 1.915  1.00 0.00 ? 45 LYS A CE   3  
ATOM 2837  N NZ   . LYS A 1 75  ? 40.383 46.046 0.536  1.00 0.00 ? 45 LYS A NZ   3  
ATOM 2838  H H    . LYS A 1 75  ? 38.370 41.298 3.724  1.00 0.00 ? 45 LYS A H    3  
ATOM 2839  H HA   . LYS A 1 75  ? 36.797 43.319 5.078  1.00 0.00 ? 45 LYS A HA   3  
ATOM 2840  H HB2  . LYS A 1 75  ? 37.159 42.667 2.151  1.00 0.00 ? 45 LYS A HB2  3  
ATOM 2841  H HB3  . LYS A 1 75  ? 36.233 44.039 2.764  1.00 0.00 ? 45 LYS A HB3  3  
ATOM 2842  H HG2  . LYS A 1 75  ? 38.273 44.835 3.960  1.00 0.00 ? 45 LYS A HG2  3  
ATOM 2843  H HG3  . LYS A 1 75  ? 39.184 43.516 3.225  1.00 0.00 ? 45 LYS A HG3  3  
ATOM 2844  H HD2  . LYS A 1 75  ? 38.538 44.381 0.970  1.00 0.00 ? 45 LYS A HD2  3  
ATOM 2845  H HD3  . LYS A 1 75  ? 37.763 45.755 1.758  1.00 0.00 ? 45 LYS A HD3  3  
ATOM 2846  H HE2  . LYS A 1 75  ? 39.787 46.668 2.465  1.00 0.00 ? 45 LYS A HE2  3  
ATOM 2847  H HE3  . LYS A 1 75  ? 40.620 45.115 2.417  1.00 0.00 ? 45 LYS A HE3  3  
ATOM 2848  H HZ1  . LYS A 1 75  ? 41.089 45.337 0.254  1.00 0.00 ? 45 LYS A HZ1  3  
ATOM 2849  H HZ2  . LYS A 1 75  ? 40.812 46.993 0.519  1.00 0.00 ? 45 LYS A HZ2  3  
ATOM 2850  H HZ3  . LYS A 1 75  ? 39.580 46.015 -0.125 1.00 0.00 ? 45 LYS A HZ3  3  
ATOM 2851  N N    . SER A 1 76  ? 35.339 40.662 3.934  1.00 0.00 ? 46 SER A N    3  
ATOM 2852  C CA   . SER A 1 76  ? 34.049 39.982 3.851  1.00 0.00 ? 46 SER A CA   3  
ATOM 2853  C C    . SER A 1 76  ? 34.189 38.494 4.155  1.00 0.00 ? 46 SER A C    3  
ATOM 2854  O O    . SER A 1 76  ? 35.262 37.913 3.997  1.00 0.00 ? 46 SER A O    3  
ATOM 2855  C CB   . SER A 1 76  ? 33.456 40.161 2.454  1.00 0.00 ? 46 SER A CB   3  
ATOM 2856  O OG   . SER A 1 76  ? 34.222 39.411 1.521  1.00 0.00 ? 46 SER A OG   3  
ATOM 2857  H H    . SER A 1 76  ? 36.164 40.155 3.784  1.00 0.00 ? 46 SER A H    3  
ATOM 2858  H HA   . SER A 1 76  ? 33.376 40.423 4.571  1.00 0.00 ? 46 SER A HA   3  
ATOM 2859  H HB2  . SER A 1 76  ? 32.439 39.804 2.441  1.00 0.00 ? 46 SER A HB2  3  
ATOM 2860  H HB3  . SER A 1 76  ? 33.468 41.211 2.192  1.00 0.00 ? 46 SER A HB3  3  
ATOM 2861  H HG   . SER A 1 76  ? 35.035 39.792 1.460  1.00 0.00 ? 46 SER A HG   3  
ATOM 2862  N N    . GLY A 1 77  ? 33.091 37.887 4.594  1.00 0.00 ? 47 GLY A N    3  
ATOM 2863  C CA   . GLY A 1 77  ? 33.073 36.454 4.872  1.00 0.00 ? 47 GLY A CA   3  
ATOM 2864  C C    . GLY A 1 77  ? 33.342 35.631 3.612  1.00 0.00 ? 47 GLY A C    3  
ATOM 2865  O O    . GLY A 1 77  ? 33.966 34.570 3.676  1.00 0.00 ? 47 GLY A O    3  
ATOM 2866  H H    . GLY A 1 77  ? 32.270 38.405 4.716  1.00 0.00 ? 47 GLY A H    3  
ATOM 2867  H HA2  . GLY A 1 77  ? 33.830 36.229 5.610  1.00 0.00 ? 47 GLY A HA2  3  
ATOM 2868  H HA3  . GLY A 1 77  ? 32.104 36.184 5.266  1.00 0.00 ? 47 GLY A HA3  3  
ATOM 2869  N N    . ALA A 1 78  ? 32.894 36.130 2.459  1.00 0.00 ? 48 ALA A N    3  
ATOM 2870  C CA   . ALA A 1 78  ? 33.062 35.393 1.213  1.00 0.00 ? 48 ALA A CA   3  
ATOM 2871  C C    . ALA A 1 78  ? 34.542 35.131 0.959  1.00 0.00 ? 48 ALA A C    3  
ATOM 2872  O O    . ALA A 1 78  ? 34.923 34.032 0.555  1.00 0.00 ? 48 ALA A O    3  
ATOM 2873  C CB   . ALA A 1 78  ? 32.473 36.190 0.046  1.00 0.00 ? 48 ALA A CB   3  
ATOM 2874  H H    . ALA A 1 78  ? 32.446 37.002 2.449  1.00 0.00 ? 48 ALA A H    3  
ATOM 2875  H HA   . ALA A 1 78  ? 32.545 34.449 1.288  1.00 0.00 ? 48 ALA A HA   3  
ATOM 2876  H HB1  . ALA A 1 78  ? 32.879 37.191 0.053  1.00 0.00 ? 48 ALA A HB1  3  
ATOM 2877  H HB2  . ALA A 1 78  ? 31.399 36.238 0.149  1.00 0.00 ? 48 ALA A HB2  3  
ATOM 2878  H HB3  . ALA A 1 78  ? 32.726 35.707 -0.885 1.00 0.00 ? 48 ALA A HB3  3  
ATOM 2879  N N    . GLU A 1 79  ? 35.372 36.143 1.197  1.00 0.00 ? 49 GLU A N    3  
ATOM 2880  C CA   . GLU A 1 79  ? 36.815 35.937 1.173  1.00 0.00 ? 49 GLU A CA   3  
ATOM 2881  C C    . GLU A 1 79  ? 37.237 34.936 2.252  1.00 0.00 ? 49 GLU A C    3  
ATOM 2882  O O    . GLU A 1 79  ? 38.073 34.068 2.006  1.00 0.00 ? 49 GLU A O    3  
ATOM 2883  C CB   . GLU A 1 79  ? 37.535 37.267 1.401  1.00 0.00 ? 49 GLU A CB   3  
ATOM 2884  C CG   . GLU A 1 79  ? 39.043 37.078 1.193  1.00 0.00 ? 49 GLU A CG   3  
ATOM 2885  C CD   . GLU A 1 79  ? 39.829 38.358 1.499  1.00 0.00 ? 49 GLU A CD   3  
ATOM 2886  O OE1  . GLU A 1 79  ? 41.038 38.324 1.337  1.00 0.00 ? 49 GLU A OE1  3  
ATOM 2887  O OE2  . GLU A 1 79  ? 39.233 39.350 1.890  1.00 0.00 ? 49 GLU A OE2  3  
ATOM 2888  H H    . GLU A 1 79  ? 35.010 37.034 1.388  1.00 0.00 ? 49 GLU A H    3  
ATOM 2889  H HA   . GLU A 1 79  ? 37.098 35.549 0.206  1.00 0.00 ? 49 GLU A HA   3  
ATOM 2890  H HB2  . GLU A 1 79  ? 37.163 38.002 0.701  1.00 0.00 ? 49 GLU A HB2  3  
ATOM 2891  H HB3  . GLU A 1 79  ? 37.356 37.607 2.411  1.00 0.00 ? 49 GLU A HB3  3  
ATOM 2892  H HG2  . GLU A 1 79  ? 39.391 36.289 1.845  1.00 0.00 ? 49 GLU A HG2  3  
ATOM 2893  H HG3  . GLU A 1 79  ? 39.221 36.789 0.168  1.00 0.00 ? 49 GLU A HG3  3  
ATOM 2894  N N    . ALA A 1 80  ? 36.569 34.978 3.405  1.00 0.00 ? 50 ALA A N    3  
ATOM 2895  C CA   . ALA A 1 80  ? 36.931 34.103 4.518  1.00 0.00 ? 50 ALA A CA   3  
ATOM 2896  C C    . ALA A 1 80  ? 36.797 32.630 4.136  1.00 0.00 ? 50 ALA A C    3  
ATOM 2897  O O    . ALA A 1 80  ? 37.612 31.801 4.542  1.00 0.00 ? 50 ALA A O    3  
ATOM 2898  C CB   . ALA A 1 80  ? 36.035 34.399 5.722  1.00 0.00 ? 50 ALA A CB   3  
ATOM 2899  H H    . ALA A 1 80  ? 35.826 35.609 3.511  1.00 0.00 ? 50 ALA A H    3  
ATOM 2900  H HA   . ALA A 1 80  ? 37.955 34.299 4.794  1.00 0.00 ? 50 ALA A HA   3  
ATOM 2901  H HB1  . ALA A 1 80  ? 36.535 34.088 6.628  1.00 0.00 ? 50 ALA A HB1  3  
ATOM 2902  H HB2  . ALA A 1 80  ? 35.105 33.860 5.621  1.00 0.00 ? 50 ALA A HB2  3  
ATOM 2903  H HB3  . ALA A 1 80  ? 35.834 35.459 5.769  1.00 0.00 ? 50 ALA A HB3  3  
ATOM 2904  N N    . LYS A 1 81  ? 35.826 32.316 3.285  1.00 0.00 ? 51 LYS A N    3  
ATOM 2905  C CA   . LYS A 1 81  ? 35.600 30.934 2.873  1.00 0.00 ? 51 LYS A CA   3  
ATOM 2906  C C    . LYS A 1 81  ? 36.854 30.322 2.241  1.00 0.00 ? 51 LYS A C    3  
ATOM 2907  O O    . LYS A 1 81  ? 37.059 29.112 2.324  1.00 0.00 ? 51 LYS A O    3  
ATOM 2908  C CB   . LYS A 1 81  ? 34.461 30.881 1.851  1.00 0.00 ? 51 LYS A CB   3  
ATOM 2909  C CG   . LYS A 1 81  ? 33.160 31.364 2.495  1.00 0.00 ? 51 LYS A CG   3  
ATOM 2910  C CD   . LYS A 1 81  ? 32.013 31.211 1.493  1.00 0.00 ? 51 LYS A CD   3  
ATOM 2911  C CE   . LYS A 1 81  ? 30.735 31.816 2.077  1.00 0.00 ? 51 LYS A CE   3  
ATOM 2912  N NZ   . LYS A 1 81  ? 29.653 31.775 1.053  1.00 0.00 ? 51 LYS A NZ   3  
ATOM 2913  H H    . LYS A 1 81  ? 35.216 33.022 2.978  1.00 0.00 ? 51 LYS A H    3  
ATOM 2914  H HA   . LYS A 1 81  ? 35.320 30.349 3.736  1.00 0.00 ? 51 LYS A HA   3  
ATOM 2915  H HB2  . LYS A 1 81  ? 34.704 31.516 1.012  1.00 0.00 ? 51 LYS A HB2  3  
ATOM 2916  H HB3  . LYS A 1 81  ? 34.333 29.865 1.508  1.00 0.00 ? 51 LYS A HB3  3  
ATOM 2917  H HG2  . LYS A 1 81  ? 32.953 30.773 3.376  1.00 0.00 ? 51 LYS A HG2  3  
ATOM 2918  H HG3  . LYS A 1 81  ? 33.256 32.404 2.771  1.00 0.00 ? 51 LYS A HG3  3  
ATOM 2919  H HD2  . LYS A 1 81  ? 32.267 31.722 0.576  1.00 0.00 ? 51 LYS A HD2  3  
ATOM 2920  H HD3  . LYS A 1 81  ? 31.850 30.163 1.289  1.00 0.00 ? 51 LYS A HD3  3  
ATOM 2921  H HE2  . LYS A 1 81  ? 30.432 31.250 2.944  1.00 0.00 ? 51 LYS A HE2  3  
ATOM 2922  H HE3  . LYS A 1 81  ? 30.920 32.841 2.363  1.00 0.00 ? 51 LYS A HE3  3  
ATOM 2923  H HZ1  . LYS A 1 81  ? 29.825 30.988 0.397  1.00 0.00 ? 51 LYS A HZ1  3  
ATOM 2924  H HZ2  . LYS A 1 81  ? 29.642 32.672 0.524  1.00 0.00 ? 51 LYS A HZ2  3  
ATOM 2925  H HZ3  . LYS A 1 81  ? 28.736 31.639 1.522  1.00 0.00 ? 51 LYS A HZ3  3  
ATOM 2926  N N    . LYS A 1 82  ? 37.691 31.147 1.613  1.00 0.00 ? 52 LYS A N    3  
ATOM 2927  C CA   . LYS A 1 82  ? 38.896 30.646 0.960  1.00 0.00 ? 52 LYS A CA   3  
ATOM 2928  C C    . LYS A 1 82  ? 39.849 29.955 1.940  1.00 0.00 ? 52 LYS A C    3  
ATOM 2929  O O    . LYS A 1 82  ? 40.657 29.121 1.529  1.00 0.00 ? 52 LYS A O    3  
ATOM 2930  C CB   . LYS A 1 82  ? 39.627 31.802 0.274  1.00 0.00 ? 52 LYS A CB   3  
ATOM 2931  C CG   . LYS A 1 82  ? 38.748 32.371 -0.842 1.00 0.00 ? 52 LYS A CG   3  
ATOM 2932  C CD   . LYS A 1 82  ? 39.519 33.455 -1.599 1.00 0.00 ? 52 LYS A CD   3  
ATOM 2933  C CE   . LYS A 1 82  ? 38.600 34.107 -2.635 1.00 0.00 ? 52 LYS A CE   3  
ATOM 2934  N NZ   . LYS A 1 82  ? 38.436 33.190 -3.799 1.00 0.00 ? 52 LYS A NZ   3  
ATOM 2935  H H    . LYS A 1 82  ? 37.522 32.113 1.625  1.00 0.00 ? 52 LYS A H    3  
ATOM 2936  H HA   . LYS A 1 82  ? 38.606 29.933 0.202  1.00 0.00 ? 52 LYS A HA   3  
ATOM 2937  H HB2  . LYS A 1 82  ? 39.837 32.575 0.999  1.00 0.00 ? 52 LYS A HB2  3  
ATOM 2938  H HB3  . LYS A 1 82  ? 40.553 31.443 -0.148 1.00 0.00 ? 52 LYS A HB3  3  
ATOM 2939  H HG2  . LYS A 1 82  ? 38.476 31.578 -1.524 1.00 0.00 ? 52 LYS A HG2  3  
ATOM 2940  H HG3  . LYS A 1 82  ? 37.855 32.801 -0.414 1.00 0.00 ? 52 LYS A HG3  3  
ATOM 2941  H HD2  . LYS A 1 82  ? 39.864 34.204 -0.901 1.00 0.00 ? 52 LYS A HD2  3  
ATOM 2942  H HD3  . LYS A 1 82  ? 40.365 33.012 -2.101 1.00 0.00 ? 52 LYS A HD3  3  
ATOM 2943  H HE2  . LYS A 1 82  ? 37.635 34.300 -2.190 1.00 0.00 ? 52 LYS A HE2  3  
ATOM 2944  H HE3  . LYS A 1 82  ? 39.037 35.037 -2.968 1.00 0.00 ? 52 LYS A HE3  3  
ATOM 2945  H HZ1  . LYS A 1 82  ? 39.094 32.391 -3.707 1.00 0.00 ? 52 LYS A HZ1  3  
ATOM 2946  H HZ2  . LYS A 1 82  ? 38.638 33.708 -4.678 1.00 0.00 ? 52 LYS A HZ2  3  
ATOM 2947  H HZ3  . LYS A 1 82  ? 37.460 32.832 -3.823 1.00 0.00 ? 52 LYS A HZ3  3  
ATOM 2948  N N    . LEU A 1 83  ? 39.764 30.291 3.228  1.00 0.00 ? 53 LEU A N    3  
ATOM 2949  C CA   . LEU A 1 83  ? 40.727 29.786 4.201  1.00 0.00 ? 53 LEU A CA   3  
ATOM 2950  C C    . LEU A 1 83  ? 40.320 28.396 4.709  1.00 0.00 ? 53 LEU A C    3  
ATOM 2951  O O    . LEU A 1 83  ? 39.135 28.177 4.985  1.00 0.00 ? 53 LEU A O    3  
ATOM 2952  C CB   . LEU A 1 83  ? 40.808 30.755 5.382  1.00 0.00 ? 53 LEU A CB   3  
ATOM 2953  C CG   . LEU A 1 83  ? 41.653 31.968 4.989  1.00 0.00 ? 53 LEU A CG   3  
ATOM 2954  C CD1  . LEU A 1 83  ? 41.340 33.134 5.929  1.00 0.00 ? 53 LEU A CD1  3  
ATOM 2955  C CD2  . LEU A 1 83  ? 43.139 31.613 5.092  1.00 0.00 ? 53 LEU A CD2  3  
ATOM 2956  H H    . LEU A 1 83  ? 39.037 30.871 3.533  1.00 0.00 ? 53 LEU A H    3  
ATOM 2957  H HA   . LEU A 1 83  ? 41.689 29.749 3.720  1.00 0.00 ? 53 LEU A HA   3  
ATOM 2958  H HB2  . LEU A 1 83  ? 39.813 31.077 5.650  1.00 0.00 ? 53 LEU A HB2  3  
ATOM 2959  H HB3  . LEU A 1 83  ? 41.264 30.257 6.224  1.00 0.00 ? 53 LEU A HB3  3  
ATOM 2960  H HG   . LEU A 1 83  ? 41.419 32.254 3.974  1.00 0.00 ? 53 LEU A HG   3  
ATOM 2961  H HD11 . LEU A 1 83  ? 40.271 33.228 6.043  1.00 0.00 ? 53 LEU A HD11 3  
ATOM 2962  H HD12 . LEU A 1 83  ? 41.739 34.048 5.514  1.00 0.00 ? 53 LEU A HD12 3  
ATOM 2963  H HD13 . LEU A 1 83  ? 41.791 32.950 6.894  1.00 0.00 ? 53 LEU A HD13 3  
ATOM 2964  H HD21 . LEU A 1 83  ? 43.285 30.582 4.802  1.00 0.00 ? 53 LEU A HD21 3  
ATOM 2965  H HD22 . LEU A 1 83  ? 43.476 31.753 6.108  1.00 0.00 ? 53 LEU A HD22 3  
ATOM 2966  H HD23 . LEU A 1 83  ? 43.707 32.254 4.433  1.00 0.00 ? 53 LEU A HD23 3  
ATOM 2967  N N    . PRO A 1 84  ? 41.244 27.472 4.896  1.00 0.00 ? 54 PRO A N    3  
ATOM 2968  C CA   . PRO A 1 84  ? 40.879 26.099 5.362  1.00 0.00 ? 54 PRO A CA   3  
ATOM 2969  C C    . PRO A 1 84  ? 40.143 26.133 6.699  1.00 0.00 ? 54 PRO A C    3  
ATOM 2970  O O    . PRO A 1 84  ? 40.606 26.749 7.660  1.00 0.00 ? 54 PRO A O    3  
ATOM 2971  C CB   . PRO A 1 84  ? 42.215 25.356 5.496  1.00 0.00 ? 54 PRO A CB   3  
ATOM 2972  C CG   . PRO A 1 84  ? 43.199 26.145 4.703  1.00 0.00 ? 54 PRO A CG   3  
ATOM 2973  C CD   . PRO A 1 84  ? 42.705 27.589 4.715  1.00 0.00 ? 54 PRO A CD   3  
ATOM 2974  H HA   . PRO A 1 84  ? 40.270 25.608 4.620  1.00 0.00 ? 54 PRO A HA   3  
ATOM 2975  H HB2  . PRO A 1 84  ? 42.521 25.309 6.532  1.00 0.00 ? 54 PRO A HB2  3  
ATOM 2976  H HB3  . PRO A 1 84  ? 42.132 24.362 5.085  1.00 0.00 ? 54 PRO A HB3  3  
ATOM 2977  H HG2  . PRO A 1 84  ? 44.177 26.078 5.160  1.00 0.00 ? 54 PRO A HG2  3  
ATOM 2978  H HG3  . PRO A 1 84  ? 43.233 25.786 3.688  1.00 0.00 ? 54 PRO A HG3  3  
ATOM 2979  H HD2  . PRO A 1 84  ? 43.152 28.134 5.536  1.00 0.00 ? 54 PRO A HD2  3  
ATOM 2980  H HD3  . PRO A 1 84  ? 42.925 28.067 3.773  1.00 0.00 ? 54 PRO A HD3  3  
ATOM 2981  N N    . GLY A 1 85  ? 39.000 25.458 6.751  1.00 0.00 ? 55 GLY A N    3  
ATOM 2982  C CA   . GLY A 1 85  ? 38.217 25.385 7.982  1.00 0.00 ? 55 GLY A CA   3  
ATOM 2983  C C    . GLY A 1 85  ? 37.040 26.367 8.010  1.00 0.00 ? 55 GLY A C    3  
ATOM 2984  O O    . GLY A 1 85  ? 36.176 26.255 8.882  1.00 0.00 ? 55 GLY A O    3  
ATOM 2985  H H    . GLY A 1 85  ? 38.675 25.000 5.948  1.00 0.00 ? 55 GLY A H    3  
ATOM 2986  H HA2  . GLY A 1 85  ? 37.831 24.382 8.088  1.00 0.00 ? 55 GLY A HA2  3  
ATOM 2987  H HA3  . GLY A 1 85  ? 38.866 25.597 8.819  1.00 0.00 ? 55 GLY A HA3  3  
ATOM 2988  N N    . VAL A 1 86  ? 36.991 27.322 7.078  1.00 0.00 ? 56 VAL A N    3  
ATOM 2989  C CA   . VAL A 1 86  ? 35.878 28.268 7.033  1.00 0.00 ? 56 VAL A CA   3  
ATOM 2990  C C    . VAL A 1 86  ? 34.680 27.632 6.331  1.00 0.00 ? 56 VAL A C    3  
ATOM 2991  O O    . VAL A 1 86  ? 34.825 27.006 5.281  1.00 0.00 ? 56 VAL A O    3  
ATOM 2992  C CB   . VAL A 1 86  ? 36.298 29.551 6.303  1.00 0.00 ? 56 VAL A CB   3  
ATOM 2993  C CG1  . VAL A 1 86  ? 35.154 30.568 6.342  1.00 0.00 ? 56 VAL A CG1  3  
ATOM 2994  C CG2  . VAL A 1 86  ? 37.528 30.155 6.988  1.00 0.00 ? 56 VAL A CG2  3  
ATOM 2995  H H    . VAL A 1 86  ? 37.714 27.400 6.417  1.00 0.00 ? 56 VAL A H    3  
ATOM 2996  H HA   . VAL A 1 86  ? 35.595 28.520 8.044  1.00 0.00 ? 56 VAL A HA   3  
ATOM 2997  H HB   . VAL A 1 86  ? 36.535 29.318 5.274  1.00 0.00 ? 56 VAL A HB   3  
ATOM 2998  H HG11 . VAL A 1 86  ? 34.377 30.264 5.656  1.00 0.00 ? 56 VAL A HG11 3  
ATOM 2999  H HG12 . VAL A 1 86  ? 35.527 31.541 6.055  1.00 0.00 ? 56 VAL A HG12 3  
ATOM 3000  H HG13 . VAL A 1 86  ? 34.752 30.619 7.344  1.00 0.00 ? 56 VAL A HG13 3  
ATOM 3001  H HG21 . VAL A 1 86  ? 37.452 30.009 8.055  1.00 0.00 ? 56 VAL A HG21 3  
ATOM 3002  H HG22 . VAL A 1 86  ? 37.581 31.212 6.772  1.00 0.00 ? 56 VAL A HG22 3  
ATOM 3003  H HG23 . VAL A 1 86  ? 38.420 29.668 6.620  1.00 0.00 ? 56 VAL A HG23 3  
ATOM 3004  N N    . GLY A 1 87  ? 33.496 27.797 6.917  1.00 0.00 ? 57 GLY A N    3  
ATOM 3005  C CA   . GLY A 1 87  ? 32.276 27.241 6.337  1.00 0.00 ? 57 GLY A CA   3  
ATOM 3006  C C    . GLY A 1 87  ? 31.302 28.350 5.953  1.00 0.00 ? 57 GLY A C    3  
ATOM 3007  O O    . GLY A 1 87  ? 31.503 29.514 6.301  1.00 0.00 ? 57 GLY A O    3  
ATOM 3008  H H    . GLY A 1 87  ? 33.442 28.303 7.755  1.00 0.00 ? 57 GLY A H    3  
ATOM 3009  H HA2  . GLY A 1 87  ? 32.521 26.663 5.458  1.00 0.00 ? 57 GLY A HA2  3  
ATOM 3010  H HA3  . GLY A 1 87  ? 31.801 26.598 7.063  1.00 0.00 ? 57 GLY A HA3  3  
ATOM 3011  N N    . THR A 1 88  ? 30.233 27.982 5.252  1.00 0.00 ? 58 THR A N    3  
ATOM 3012  C CA   . THR A 1 88  ? 29.258 28.968 4.802  1.00 0.00 ? 58 THR A CA   3  
ATOM 3013  C C    . THR A 1 88  ? 28.670 29.724 5.989  1.00 0.00 ? 58 THR A C    3  
ATOM 3014  O O    . THR A 1 88  ? 28.567 30.952 5.966  1.00 0.00 ? 58 THR A O    3  
ATOM 3015  C CB   . THR A 1 88  ? 28.136 28.276 4.027  1.00 0.00 ? 58 THR A CB   3  
ATOM 3016  O OG1  . THR A 1 88  ? 28.696 27.488 2.987  1.00 0.00 ? 58 THR A OG1  3  
ATOM 3017  C CG2  . THR A 1 88  ? 27.202 29.329 3.425  1.00 0.00 ? 58 THR A CG2  3  
ATOM 3018  H H    . THR A 1 88  ? 30.101 27.036 5.035  1.00 0.00 ? 58 THR A H    3  
ATOM 3019  H HA   . THR A 1 88  ? 29.750 29.672 4.148  1.00 0.00 ? 58 THR A HA   3  
ATOM 3020  H HB   . THR A 1 88  ? 27.572 27.642 4.695  1.00 0.00 ? 58 THR A HB   3  
ATOM 3021  H HG1  . THR A 1 88  ? 28.566 26.622 3.193  1.00 0.00 ? 58 THR A HG1  3  
ATOM 3022  H HG21 . THR A 1 88  ? 27.744 29.916 2.698  1.00 0.00 ? 58 THR A HG21 3  
ATOM 3023  H HG22 . THR A 1 88  ? 26.835 29.974 4.208  1.00 0.00 ? 58 THR A HG22 3  
ATOM 3024  H HG23 . THR A 1 88  ? 26.369 28.839 2.942  1.00 0.00 ? 58 THR A HG23 3  
ATOM 3025  N N    . LYS A 1 89  ? 28.317 28.992 7.042  1.00 0.00 ? 59 LYS A N    3  
ATOM 3026  C CA   . LYS A 1 89  ? 27.720 29.616 8.217  1.00 0.00 ? 59 LYS A CA   3  
ATOM 3027  C C    . LYS A 1 89  ? 28.682 30.626 8.833  1.00 0.00 ? 59 LYS A C    3  
ATOM 3028  O O    . LYS A 1 89  ? 28.286 31.734 9.197  1.00 0.00 ? 59 LYS A O    3  
ATOM 3029  C CB   . LYS A 1 89  ? 27.366 28.546 9.252  1.00 0.00 ? 59 LYS A CB   3  
ATOM 3030  C CG   . LYS A 1 89  ? 26.291 27.618 8.681  1.00 0.00 ? 59 LYS A CG   3  
ATOM 3031  C CD   . LYS A 1 89  ? 25.859 26.614 9.752  1.00 0.00 ? 59 LYS A CD   3  
ATOM 3032  C CE   . LYS A 1 89  ? 24.875 25.612 9.146  1.00 0.00 ? 59 LYS A CE   3  
ATOM 3033  N NZ   . LYS A 1 89  ? 24.703 24.460 10.075 1.00 0.00 ? 59 LYS A NZ   3  
ATOM 3034  H H    . LYS A 1 89  ? 28.460 28.022 7.027  1.00 0.00 ? 59 LYS A H    3  
ATOM 3035  H HA   . LYS A 1 89  ? 26.816 30.127 7.922  1.00 0.00 ? 59 LYS A HA   3  
ATOM 3036  H HB2  . LYS A 1 89  ? 28.249 27.972 9.492  1.00 0.00 ? 59 LYS A HB2  3  
ATOM 3037  H HB3  . LYS A 1 89  ? 26.989 29.021 10.147 1.00 0.00 ? 59 LYS A HB3  3  
ATOM 3038  H HG2  . LYS A 1 89  ? 25.439 28.204 8.370  1.00 0.00 ? 59 LYS A HG2  3  
ATOM 3039  H HG3  . LYS A 1 89  ? 26.692 27.084 7.832  1.00 0.00 ? 59 LYS A HG3  3  
ATOM 3040  H HD2  . LYS A 1 89  ? 26.727 26.089 10.123 1.00 0.00 ? 59 LYS A HD2  3  
ATOM 3041  H HD3  . LYS A 1 89  ? 25.379 27.138 10.564 1.00 0.00 ? 59 LYS A HD3  3  
ATOM 3042  H HE2  . LYS A 1 89  ? 23.921 26.093 8.989  1.00 0.00 ? 59 LYS A HE2  3  
ATOM 3043  H HE3  . LYS A 1 89  ? 25.259 25.257 8.201  1.00 0.00 ? 59 LYS A HE3  3  
ATOM 3044  H HZ1  . LYS A 1 89  ? 24.653 24.808 11.054 1.00 0.00 ? 59 LYS A HZ1  3  
ATOM 3045  H HZ2  . LYS A 1 89  ? 25.512 23.813 9.978  1.00 0.00 ? 59 LYS A HZ2  3  
ATOM 3046  H HZ3  . LYS A 1 89  ? 23.824 23.956 9.843  1.00 0.00 ? 59 LYS A HZ3  3  
ATOM 3047  N N    . ILE A 1 90  ? 29.960 30.263 8.891  1.00 0.00 ? 60 ILE A N    3  
ATOM 3048  C CA   . ILE A 1 90  ? 30.960 31.147 9.480  1.00 0.00 ? 60 ILE A CA   3  
ATOM 3049  C C    . ILE A 1 90  ? 31.086 32.416 8.642  1.00 0.00 ? 60 ILE A C    3  
ATOM 3050  O O    . ILE A 1 90  ? 31.115 33.524 9.179  1.00 0.00 ? 60 ILE A O    3  
ATOM 3051  C CB   . ILE A 1 90  ? 32.310 30.422 9.581  1.00 0.00 ? 60 ILE A CB   3  
ATOM 3052  C CG1  . ILE A 1 90  ? 32.141 29.156 10.429 1.00 0.00 ? 60 ILE A CG1  3  
ATOM 3053  C CG2  . ILE A 1 90  ? 33.339 31.339 10.250 1.00 0.00 ? 60 ILE A CG2  3  
ATOM 3054  C CD1  . ILE A 1 90  ? 33.396 28.281 10.350 1.00 0.00 ? 60 ILE A CD1  3  
ATOM 3055  H H    . ILE A 1 90  ? 30.234 29.393 8.534  1.00 0.00 ? 60 ILE A H    3  
ATOM 3056  H HA   . ILE A 1 90  ? 30.638 31.419 10.475 1.00 0.00 ? 60 ILE A HA   3  
ATOM 3057  H HB   . ILE A 1 90  ? 32.652 30.155 8.592  1.00 0.00 ? 60 ILE A HB   3  
ATOM 3058  H HG12 . ILE A 1 90  ? 31.967 29.439 11.457 1.00 0.00 ? 60 ILE A HG12 3  
ATOM 3059  H HG13 . ILE A 1 90  ? 31.293 28.594 10.067 1.00 0.00 ? 60 ILE A HG13 3  
ATOM 3060  H HG21 . ILE A 1 90  ? 34.314 30.876 10.212 1.00 0.00 ? 60 ILE A HG21 3  
ATOM 3061  H HG22 . ILE A 1 90  ? 33.059 31.502 11.280 1.00 0.00 ? 60 ILE A HG22 3  
ATOM 3062  H HG23 . ILE A 1 90  ? 33.370 32.286 9.731  1.00 0.00 ? 60 ILE A HG23 3  
ATOM 3063  H HD11 . ILE A 1 90  ? 33.525 27.755 11.285 1.00 0.00 ? 60 ILE A HD11 3  
ATOM 3064  H HD12 . ILE A 1 90  ? 34.265 28.896 10.162 1.00 0.00 ? 60 ILE A HD12 3  
ATOM 3065  H HD13 . ILE A 1 90  ? 33.284 27.565 9.550  1.00 0.00 ? 60 ILE A HD13 3  
ATOM 3066  N N    . ALA A 1 91  ? 31.103 32.256 7.322  1.00 0.00 ? 61 ALA A N    3  
ATOM 3067  C CA   . ALA A 1 91  ? 31.197 33.406 6.430  1.00 0.00 ? 61 ALA A CA   3  
ATOM 3068  C C    . ALA A 1 91  ? 30.027 34.357 6.663  1.00 0.00 ? 61 ALA A C    3  
ATOM 3069  O O    . ALA A 1 91  ? 30.208 35.574 6.721  1.00 0.00 ? 61 ALA A O    3  
ATOM 3070  C CB   . ALA A 1 91  ? 31.199 32.940 4.974  1.00 0.00 ? 61 ALA A CB   3  
ATOM 3071  H H    . ALA A 1 91  ? 31.077 31.352 6.945  1.00 0.00 ? 61 ALA A H    3  
ATOM 3072  H HA   . ALA A 1 91  ? 32.120 33.930 6.631  1.00 0.00 ? 61 ALA A HA   3  
ATOM 3073  H HB1  . ALA A 1 91  ? 30.550 32.083 4.869  1.00 0.00 ? 61 ALA A HB1  3  
ATOM 3074  H HB2  . ALA A 1 91  ? 32.204 32.668 4.685  1.00 0.00 ? 61 ALA A HB2  3  
ATOM 3075  H HB3  . ALA A 1 91  ? 30.847 33.739 4.339  1.00 0.00 ? 61 ALA A HB3  3  
ATOM 3076  N N    . GLU A 1 92  ? 28.830 33.798 6.825  1.00 0.00 ? 62 GLU A N    3  
ATOM 3077  C CA   . GLU A 1 92  ? 27.650 34.624 7.062  1.00 0.00 ? 62 GLU A CA   3  
ATOM 3078  C C    . GLU A 1 92  ? 27.792 35.411 8.363  1.00 0.00 ? 62 GLU A C    3  
ATOM 3079  O O    . GLU A 1 92  ? 27.447 36.592 8.418  1.00 0.00 ? 62 GLU A O    3  
ATOM 3080  C CB   . GLU A 1 92  ? 26.401 33.743 7.131  1.00 0.00 ? 62 GLU A CB   3  
ATOM 3081  C CG   . GLU A 1 92  ? 25.151 34.631 7.189  1.00 0.00 ? 62 GLU A CG   3  
ATOM 3082  C CD   . GLU A 1 92  ? 23.869 33.807 7.351  1.00 0.00 ? 62 GLU A CD   3  
ATOM 3083  O OE1  . GLU A 1 92  ? 23.945 32.590 7.448  1.00 0.00 ? 62 GLU A OE1  3  
ATOM 3084  O OE2  . GLU A 1 92  ? 22.812 34.416 7.377  1.00 0.00 ? 62 GLU A OE2  3  
ATOM 3085  H H    . GLU A 1 92  ? 28.734 32.825 6.751  1.00 0.00 ? 62 GLU A H    3  
ATOM 3086  H HA   . GLU A 1 92  ? 27.540 35.318 6.243  1.00 0.00 ? 62 GLU A HA   3  
ATOM 3087  H HB2  . GLU A 1 92  ? 26.357 33.112 6.255  1.00 0.00 ? 62 GLU A HB2  3  
ATOM 3088  H HB3  . GLU A 1 92  ? 26.442 33.128 8.017  1.00 0.00 ? 62 GLU A HB3  3  
ATOM 3089  H HG2  . GLU A 1 92  ? 25.239 35.309 8.024  1.00 0.00 ? 62 GLU A HG2  3  
ATOM 3090  H HG3  . GLU A 1 92  ? 25.089 35.206 6.276  1.00 0.00 ? 62 GLU A HG3  3  
ATOM 3091  N N    . LYS A 1 93  ? 28.330 34.770 9.400  1.00 0.00 ? 63 LYS A N    3  
ATOM 3092  C CA   . LYS A 1 93  ? 28.564 35.466 10.663 1.00 0.00 ? 63 LYS A CA   3  
ATOM 3093  C C    . LYS A 1 93  ? 29.524 36.638 10.468 1.00 0.00 ? 63 LYS A C    3  
ATOM 3094  O O    . LYS A 1 93  ? 29.309 37.721 11.013 1.00 0.00 ? 63 LYS A O    3  
ATOM 3095  C CB   . LYS A 1 93  ? 29.131 34.501 11.705 1.00 0.00 ? 63 LYS A CB   3  
ATOM 3096  C CG   . LYS A 1 93  ? 28.082 33.441 12.046 1.00 0.00 ? 63 LYS A CG   3  
ATOM 3097  C CD   . LYS A 1 93  ? 28.611 32.536 13.161 1.00 0.00 ? 63 LYS A CD   3  
ATOM 3098  C CE   . LYS A 1 93  ? 27.611 31.407 13.419 1.00 0.00 ? 63 LYS A CE   3  
ATOM 3099  N NZ   . LYS A 1 93  ? 27.613 30.469 12.261 1.00 0.00 ? 63 LYS A NZ   3  
ATOM 3100  H H    . LYS A 1 93  ? 28.534 33.813 9.327  1.00 0.00 ? 63 LYS A H    3  
ATOM 3101  H HA   . LYS A 1 93  ? 27.621 35.849 11.025 1.00 0.00 ? 63 LYS A HA   3  
ATOM 3102  H HB2  . LYS A 1 93  ? 30.014 34.021 11.307 1.00 0.00 ? 63 LYS A HB2  3  
ATOM 3103  H HB3  . LYS A 1 93  ? 29.390 35.048 12.600 1.00 0.00 ? 63 LYS A HB3  3  
ATOM 3104  H HG2  . LYS A 1 93  ? 27.175 33.928 12.375 1.00 0.00 ? 63 LYS A HG2  3  
ATOM 3105  H HG3  . LYS A 1 93  ? 27.873 32.845 11.171 1.00 0.00 ? 63 LYS A HG3  3  
ATOM 3106  H HD2  . LYS A 1 93  ? 29.561 32.118 12.865 1.00 0.00 ? 63 LYS A HD2  3  
ATOM 3107  H HD3  . LYS A 1 93  ? 28.736 33.114 14.065 1.00 0.00 ? 63 LYS A HD3  3  
ATOM 3108  H HE2  . LYS A 1 93  ? 27.895 30.874 14.314 1.00 0.00 ? 63 LYS A HE2  3  
ATOM 3109  H HE3  . LYS A 1 93  ? 26.623 31.823 13.544 1.00 0.00 ? 63 LYS A HE3  3  
ATOM 3110  H HZ1  . LYS A 1 93  ? 27.021 30.856 11.499 1.00 0.00 ? 63 LYS A HZ1  3  
ATOM 3111  H HZ2  . LYS A 1 93  ? 27.234 29.548 12.561 1.00 0.00 ? 63 LYS A HZ2  3  
ATOM 3112  H HZ3  . LYS A 1 93  ? 28.585 30.348 11.914 1.00 0.00 ? 63 LYS A HZ3  3  
ATOM 3113  N N    . ILE A 1 94  ? 30.563 36.432 9.662  1.00 0.00 ? 64 ILE A N    3  
ATOM 3114  C CA   . ILE A 1 94  ? 31.505 37.508 9.366  1.00 0.00 ? 64 ILE A CA   3  
ATOM 3115  C C    . ILE A 1 94  ? 30.779 38.667 8.682  1.00 0.00 ? 64 ILE A C    3  
ATOM 3116  O O    . ILE A 1 94  ? 30.966 39.828 9.049  1.00 0.00 ? 64 ILE A O    3  
ATOM 3117  C CB   . ILE A 1 94  ? 32.638 36.974 8.478  1.00 0.00 ? 64 ILE A CB   3  
ATOM 3118  C CG1  . ILE A 1 94  ? 33.382 35.868 9.228  1.00 0.00 ? 64 ILE A CG1  3  
ATOM 3119  C CG2  . ILE A 1 94  ? 33.635 38.086 8.131  1.00 0.00 ? 64 ILE A CG2  3  
ATOM 3120  C CD1  . ILE A 1 94  ? 34.344 35.158 8.274  1.00 0.00 ? 64 ILE A CD1  3  
ATOM 3121  H H    . ILE A 1 94  ? 30.716 35.537 9.292  1.00 0.00 ? 64 ILE A H    3  
ATOM 3122  H HA   . ILE A 1 94  ? 31.927 37.863 10.295 1.00 0.00 ? 64 ILE A HA   3  
ATOM 3123  H HB   . ILE A 1 94  ? 32.219 36.570 7.567  1.00 0.00 ? 64 ILE A HB   3  
ATOM 3124  H HG12 . ILE A 1 94  ? 33.941 36.303 10.044 1.00 0.00 ? 64 ILE A HG12 3  
ATOM 3125  H HG13 . ILE A 1 94  ? 32.673 35.156 9.619  1.00 0.00 ? 64 ILE A HG13 3  
ATOM 3126  H HG21 . ILE A 1 94  ? 34.159 38.391 9.024  1.00 0.00 ? 64 ILE A HG21 3  
ATOM 3127  H HG22 . ILE A 1 94  ? 33.103 38.931 7.718  1.00 0.00 ? 64 ILE A HG22 3  
ATOM 3128  H HG23 . ILE A 1 94  ? 34.344 37.718 7.403  1.00 0.00 ? 64 ILE A HG23 3  
ATOM 3129  H HD11 . ILE A 1 94  ? 35.180 35.807 8.057  1.00 0.00 ? 64 ILE A HD11 3  
ATOM 3130  H HD12 . ILE A 1 94  ? 33.827 34.916 7.356  1.00 0.00 ? 64 ILE A HD12 3  
ATOM 3131  H HD13 . ILE A 1 94  ? 34.703 34.250 8.735  1.00 0.00 ? 64 ILE A HD13 3  
ATOM 3132  N N    . ASP A 1 95  ? 29.921 38.346 7.717  1.00 0.00 ? 65 ASP A N    3  
ATOM 3133  C CA   . ASP A 1 95  ? 29.177 39.381 7.005  1.00 0.00 ? 65 ASP A CA   3  
ATOM 3134  C C    . ASP A 1 95  ? 28.313 40.184 7.972  1.00 0.00 ? 65 ASP A C    3  
ATOM 3135  O O    . ASP A 1 95  ? 28.277 41.413 7.910  1.00 0.00 ? 65 ASP A O    3  
ATOM 3136  C CB   . ASP A 1 95  ? 28.285 38.747 5.933  1.00 0.00 ? 65 ASP A CB   3  
ATOM 3137  C CG   . ASP A 1 95  ? 29.120 38.078 4.841  1.00 0.00 ? 65 ASP A CG   3  
ATOM 3138  O OD1  . ASP A 1 95  ? 30.273 38.443 4.674  1.00 0.00 ? 65 ASP A OD1  3  
ATOM 3139  O OD2  . ASP A 1 95  ? 28.589 37.199 4.181  1.00 0.00 ? 65 ASP A OD2  3  
ATOM 3140  H H    . ASP A 1 95  ? 29.813 37.406 7.459  1.00 0.00 ? 65 ASP A H    3  
ATOM 3141  H HA   . ASP A 1 95  ? 29.878 40.047 6.525  1.00 0.00 ? 65 ASP A HA   3  
ATOM 3142  H HB2  . ASP A 1 95  ? 27.648 38.007 6.395  1.00 0.00 ? 65 ASP A HB2  3  
ATOM 3143  H HB3  . ASP A 1 95  ? 27.669 39.515 5.487  1.00 0.00 ? 65 ASP A HB3  3  
ATOM 3144  N N    . GLU A 1 96  ? 27.652 39.489 8.893  1.00 0.00 ? 66 GLU A N    3  
ATOM 3145  C CA   . GLU A 1 96  ? 26.797 40.163 9.863  1.00 0.00 ? 66 GLU A CA   3  
ATOM 3146  C C    . GLU A 1 96  ? 27.617 41.100 10.745 1.00 0.00 ? 66 GLU A C    3  
ATOM 3147  O O    . GLU A 1 96  ? 27.231 42.250 10.966 1.00 0.00 ? 66 GLU A O    3  
ATOM 3148  C CB   . GLU A 1 96  ? 26.085 39.129 10.737 1.00 0.00 ? 66 GLU A CB   3  
ATOM 3149  C CG   . GLU A 1 96  ? 25.051 39.832 11.625 1.00 0.00 ? 66 GLU A CG   3  
ATOM 3150  C CD   . GLU A 1 96  ? 24.368 38.856 12.592 1.00 0.00 ? 66 GLU A CD   3  
ATOM 3151  O OE1  . GLU A 1 96  ? 23.506 39.308 13.326 1.00 0.00 ? 66 GLU A OE1  3  
ATOM 3152  O OE2  . GLU A 1 96  ? 24.706 37.681 12.596 1.00 0.00 ? 66 GLU A OE2  3  
ATOM 3153  H H    . GLU A 1 96  ? 27.716 38.512 8.900  1.00 0.00 ? 66 GLU A H    3  
ATOM 3154  H HA   . GLU A 1 96  ? 26.054 40.742 9.332  1.00 0.00 ? 66 GLU A HA   3  
ATOM 3155  H HB2  . GLU A 1 96  ? 25.588 38.406 10.105 1.00 0.00 ? 66 GLU A HB2  3  
ATOM 3156  H HB3  . GLU A 1 96  ? 26.808 38.625 11.361 1.00 0.00 ? 66 GLU A HB3  3  
ATOM 3157  H HG2  . GLU A 1 96  ? 25.545 40.602 12.197 1.00 0.00 ? 66 GLU A HG2  3  
ATOM 3158  H HG3  . GLU A 1 96  ? 24.301 40.289 10.996 1.00 0.00 ? 66 GLU A HG3  3  
ATOM 3159  N N    . PHE A 1 97  ? 28.765 40.623 11.221 1.00 0.00 ? 67 PHE A N    3  
ATOM 3160  C CA   . PHE A 1 97  ? 29.606 41.443 12.085 1.00 0.00 ? 67 PHE A CA   3  
ATOM 3161  C C    . PHE A 1 97  ? 30.041 42.717 11.366 1.00 0.00 ? 67 PHE A C    3  
ATOM 3162  O O    . PHE A 1 97  ? 30.049 43.795 11.963 1.00 0.00 ? 67 PHE A O    3  
ATOM 3163  C CB   . PHE A 1 97  ? 30.845 40.653 12.510 1.00 0.00 ? 67 PHE A CB   3  
ATOM 3164  C CG   . PHE A 1 97  ? 31.707 41.383 13.512 1.00 0.00 ? 67 PHE A CG   3  
ATOM 3165  C CD1  . PHE A 1 97  ? 32.781 42.167 13.074 1.00 0.00 ? 67 PHE A CD1  3  
ATOM 3166  C CD2  . PHE A 1 97  ? 31.427 41.278 14.879 1.00 0.00 ? 67 PHE A CD2  3  
ATOM 3167  C CE1  . PHE A 1 97  ? 33.576 42.846 14.005 1.00 0.00 ? 67 PHE A CE1  3  
ATOM 3168  C CE2  . PHE A 1 97  ? 32.223 41.956 15.810 1.00 0.00 ? 67 PHE A CE2  3  
ATOM 3169  C CZ   . PHE A 1 97  ? 33.298 42.740 15.374 1.00 0.00 ? 67 PHE A CZ   3  
ATOM 3170  H H    . PHE A 1 97  ? 29.032 39.704 11.013 1.00 0.00 ? 67 PHE A H    3  
ATOM 3171  H HA   . PHE A 1 97  ? 29.046 41.712 12.968 1.00 0.00 ? 67 PHE A HA   3  
ATOM 3172  H HB2  . PHE A 1 97  ? 30.527 39.719 12.947 1.00 0.00 ? 67 PHE A HB2  3  
ATOM 3173  H HB3  . PHE A 1 97  ? 31.434 40.437 11.629 1.00 0.00 ? 67 PHE A HB3  3  
ATOM 3174  H HD1  . PHE A 1 97  ? 32.998 42.246 12.018 1.00 0.00 ? 67 PHE A HD1  3  
ATOM 3175  H HD2  . PHE A 1 97  ? 30.599 40.672 15.217 1.00 0.00 ? 67 PHE A HD2  3  
ATOM 3176  H HE1  . PHE A 1 97  ? 34.406 43.450 13.668 1.00 0.00 ? 67 PHE A HE1  3  
ATOM 3177  H HE2  . PHE A 1 97  ? 32.008 41.875 16.866 1.00 0.00 ? 67 PHE A HE2  3  
ATOM 3178  H HZ   . PHE A 1 97  ? 33.911 43.264 16.091 1.00 0.00 ? 67 PHE A HZ   3  
ATOM 3179  N N    . LEU A 1 98  ? 30.400 42.596 10.090 1.00 0.00 ? 68 LEU A N    3  
ATOM 3180  C CA   . LEU A 1 98  ? 30.746 43.772 9.298  1.00 0.00 ? 68 LEU A CA   3  
ATOM 3181  C C    . LEU A 1 98  ? 29.545 44.702 9.141  1.00 0.00 ? 68 LEU A C    3  
ATOM 3182  O O    . LEU A 1 98  ? 29.691 45.924 9.175  1.00 0.00 ? 68 LEU A O    3  
ATOM 3183  C CB   . LEU A 1 98  ? 31.253 43.350 7.917  1.00 0.00 ? 68 LEU A CB   3  
ATOM 3184  C CG   . LEU A 1 98  ? 32.519 42.498 8.054  1.00 0.00 ? 68 LEU A CG   3  
ATOM 3185  C CD1  . LEU A 1 98  ? 32.933 41.971 6.677  1.00 0.00 ? 68 LEU A CD1  3  
ATOM 3186  C CD2  . LEU A 1 98  ? 33.655 43.348 8.630  1.00 0.00 ? 68 LEU A CD2  3  
ATOM 3187  H H    . LEU A 1 98  ? 30.459 41.704 9.686  1.00 0.00 ? 68 LEU A H    3  
ATOM 3188  H HA   . LEU A 1 98  ? 31.530 44.312 9.807  1.00 0.00 ? 68 LEU A HA   3  
ATOM 3189  H HB2  . LEU A 1 98  ? 30.488 42.776 7.415  1.00 0.00 ? 68 LEU A HB2  3  
ATOM 3190  H HB3  . LEU A 1 98  ? 31.481 44.231 7.334  1.00 0.00 ? 68 LEU A HB3  3  
ATOM 3191  H HG   . LEU A 1 98  ? 32.321 41.664 8.712  1.00 0.00 ? 68 LEU A HG   3  
ATOM 3192  H HD11 . LEU A 1 98  ? 32.711 42.715 5.925  1.00 0.00 ? 68 LEU A HD11 3  
ATOM 3193  H HD12 . LEU A 1 98  ? 32.386 41.066 6.458  1.00 0.00 ? 68 LEU A HD12 3  
ATOM 3194  H HD13 . LEU A 1 98  ? 33.993 41.760 6.669  1.00 0.00 ? 68 LEU A HD13 3  
ATOM 3195  H HD21 . LEU A 1 98  ? 34.597 42.844 8.475  1.00 0.00 ? 68 LEU A HD21 3  
ATOM 3196  H HD22 . LEU A 1 98  ? 33.494 43.494 9.688  1.00 0.00 ? 68 LEU A HD22 3  
ATOM 3197  H HD23 . LEU A 1 98  ? 33.674 44.307 8.132  1.00 0.00 ? 68 LEU A HD23 3  
ATOM 3198  N N    . ALA A 1 99  ? 28.360 44.122 8.968  1.00 0.00 ? 69 ALA A N    3  
ATOM 3199  C CA   . ALA A 1 99  ? 27.142 44.922 8.849  1.00 0.00 ? 69 ALA A CA   3  
ATOM 3200  C C    . ALA A 1 99  ? 26.877 45.734 10.116 1.00 0.00 ? 69 ALA A C    3  
ATOM 3201  O O    . ALA A 1 99  ? 26.351 46.845 10.047 1.00 0.00 ? 69 ALA A O    3  
ATOM 3202  C CB   . ALA A 1 99  ? 25.948 44.007 8.573  1.00 0.00 ? 69 ALA A CB   3  
ATOM 3203  H H    . ALA A 1 99  ? 28.309 43.148 8.877  1.00 0.00 ? 69 ALA A H    3  
ATOM 3204  H HA   . ALA A 1 99  ? 27.254 45.601 8.018  1.00 0.00 ? 69 ALA A HA   3  
ATOM 3205  H HB1  . ALA A 1 99  ? 25.116 44.597 8.219  1.00 0.00 ? 69 ALA A HB1  3  
ATOM 3206  H HB2  . ALA A 1 99  ? 25.667 43.497 9.483  1.00 0.00 ? 69 ALA A HB2  3  
ATOM 3207  H HB3  . ALA A 1 99  ? 26.217 43.279 7.821  1.00 0.00 ? 69 ALA A HB3  3  
ATOM 3208  N N    . THR A 1 100 ? 27.240 45.181 11.270 1.00 0.00 ? 70 THR A N    3  
ATOM 3209  C CA   . THR A 1 100 ? 27.109 45.906 12.532 1.00 0.00 ? 70 THR A CA   3  
ATOM 3210  C C    . THR A 1 100 ? 28.186 46.986 12.693 1.00 0.00 ? 70 THR A C    3  
ATOM 3211  O O    . THR A 1 100 ? 27.985 47.954 13.429 1.00 0.00 ? 70 THR A O    3  
ATOM 3212  C CB   . THR A 1 100 ? 27.198 44.922 13.701 1.00 0.00 ? 70 THR A CB   3  
ATOM 3213  O OG1  . THR A 1 100 ? 26.263 43.872 13.502 1.00 0.00 ? 70 THR A OG1  3  
ATOM 3214  C CG2  . THR A 1 100 ? 26.879 45.646 15.011 1.00 0.00 ? 70 THR A CG2  3  
ATOM 3215  H H    . THR A 1 100 ? 27.554 44.252 11.276 1.00 0.00 ? 70 THR A H    3  
ATOM 3216  H HA   . THR A 1 100 ? 26.139 46.380 12.558 1.00 0.00 ? 70 THR A HA   3  
ATOM 3217  H HB   . THR A 1 100 ? 28.196 44.513 13.754 1.00 0.00 ? 70 THR A HB   3  
ATOM 3218  H HG1  . THR A 1 100 ? 26.366 43.277 14.171 1.00 0.00 ? 70 THR A HG1  3  
ATOM 3219  H HG21 . THR A 1 100 ? 27.756 46.178 15.350 1.00 0.00 ? 70 THR A HG21 3  
ATOM 3220  H HG22 . THR A 1 100 ? 26.584 44.925 15.759 1.00 0.00 ? 70 THR A HG22 3  
ATOM 3221  H HG23 . THR A 1 100 ? 26.075 46.347 14.848 1.00 0.00 ? 70 THR A HG23 3  
ATOM 3222  N N    . GLY A 1 101 ? 29.322 46.830 12.014 1.00 0.00 ? 71 GLY A N    3  
ATOM 3223  C CA   . GLY A 1 101 ? 30.399 47.810 12.107 1.00 0.00 ? 71 GLY A CA   3  
ATOM 3224  C C    . GLY A 1 101 ? 29.972 49.147 11.511 1.00 0.00 ? 71 GLY A C    3  
ATOM 3225  O O    . GLY A 1 101 ? 30.714 49.761 10.745 1.00 0.00 ? 71 GLY A O    3  
ATOM 3226  H H    . GLY A 1 101 ? 29.436 46.043 11.441 1.00 0.00 ? 71 GLY A H    3  
ATOM 3227  H HA2  . GLY A 1 101 ? 30.662 47.949 13.146 1.00 0.00 ? 71 GLY A HA2  3  
ATOM 3228  H HA3  . GLY A 1 101 ? 31.259 47.444 11.568 1.00 0.00 ? 71 GLY A HA3  3  
ATOM 3229  N N    . GLU A 1 31  ? 47.704 43.493 18.001 1.00 0.00 ? 1  GLU A N    4  
ATOM 3230  C CA   . GLU A 1 31  ? 46.841 42.328 17.853 1.00 0.00 ? 1  GLU A CA   4  
ATOM 3231  C C    . GLU A 1 31  ? 46.523 42.079 16.383 1.00 0.00 ? 1  GLU A C    4  
ATOM 3232  O O    . GLU A 1 31  ? 46.485 43.011 15.580 1.00 0.00 ? 1  GLU A O    4  
ATOM 3233  C CB   . GLU A 1 31  ? 45.539 42.539 18.629 1.00 0.00 ? 1  GLU A CB   4  
ATOM 3234  C CG   . GLU A 1 31  ? 45.850 42.688 20.124 1.00 0.00 ? 1  GLU A CG   4  
ATOM 3235  C CD   . GLU A 1 31  ? 44.572 42.817 20.960 1.00 0.00 ? 1  GLU A CD   4  
ATOM 3236  O OE1  . GLU A 1 31  ? 43.501 42.987 20.394 1.00 0.00 ? 1  GLU A OE1  4  
ATOM 3237  O OE2  . GLU A 1 31  ? 44.686 42.743 22.172 1.00 0.00 ? 1  GLU A OE2  4  
ATOM 3238  H H    . GLU A 1 31  ? 47.369 44.296 18.452 1.00 0.00 ? 1  GLU A H    4  
ATOM 3239  H HA   . GLU A 1 31  ? 47.348 41.462 18.254 1.00 0.00 ? 1  GLU A HA   4  
ATOM 3240  H HB2  . GLU A 1 31  ? 45.049 43.434 18.271 1.00 0.00 ? 1  GLU A HB2  4  
ATOM 3241  H HB3  . GLU A 1 31  ? 44.889 41.690 18.482 1.00 0.00 ? 1  GLU A HB3  4  
ATOM 3242  H HG2  . GLU A 1 31  ? 46.400 41.819 20.455 1.00 0.00 ? 1  GLU A HG2  4  
ATOM 3243  H HG3  . GLU A 1 31  ? 46.458 43.567 20.270 1.00 0.00 ? 1  GLU A HG3  4  
ATOM 3244  N N    . THR A 1 32  ? 46.294 40.816 16.037 1.00 0.00 ? 2  THR A N    4  
ATOM 3245  C CA   . THR A 1 32  ? 45.974 40.458 14.661 1.00 0.00 ? 2  THR A CA   4  
ATOM 3246  C C    . THR A 1 32  ? 44.722 41.195 14.198 1.00 0.00 ? 2  THR A C    4  
ATOM 3247  O O    . THR A 1 32  ? 43.758 41.337 14.951 1.00 0.00 ? 2  THR A O    4  
ATOM 3248  C CB   . THR A 1 32  ? 45.753 38.948 14.552 1.00 0.00 ? 2  THR A CB   4  
ATOM 3249  O OG1  . THR A 1 32  ? 46.856 38.269 15.133 1.00 0.00 ? 2  THR A OG1  4  
ATOM 3250  C CG2  . THR A 1 32  ? 45.629 38.552 13.080 1.00 0.00 ? 2  THR A CG2  4  
ATOM 3251  H H    . THR A 1 32  ? 46.341 40.115 16.719 1.00 0.00 ? 2  THR A H    4  
ATOM 3252  H HA   . THR A 1 32  ? 46.800 40.737 14.025 1.00 0.00 ? 2  THR A HA   4  
ATOM 3253  H HB   . THR A 1 32  ? 44.847 38.677 15.071 1.00 0.00 ? 2  THR A HB   4  
ATOM 3254  H HG1  . THR A 1 32  ? 47.612 38.638 14.812 1.00 0.00 ? 2  THR A HG1  4  
ATOM 3255  H HG21 . THR A 1 32  ? 45.294 37.528 13.011 1.00 0.00 ? 2  THR A HG21 4  
ATOM 3256  H HG22 . THR A 1 32  ? 46.590 38.649 12.597 1.00 0.00 ? 2  THR A HG22 4  
ATOM 3257  H HG23 . THR A 1 32  ? 44.914 39.196 12.591 1.00 0.00 ? 2  THR A HG23 4  
ATOM 3258  N N    . LEU A 1 33  ? 44.710 41.603 12.935 1.00 0.00 ? 3  LEU A N    4  
ATOM 3259  C CA   . LEU A 1 33  ? 43.611 42.414 12.415 1.00 0.00 ? 3  LEU A CA   4  
ATOM 3260  C C    . LEU A 1 33  ? 42.259 41.715 12.561 1.00 0.00 ? 3  LEU A C    4  
ATOM 3261  O O    . LEU A 1 33  ? 41.230 42.377 12.698 1.00 0.00 ? 3  LEU A O    4  
ATOM 3262  C CB   . LEU A 1 33  ? 43.852 42.707 10.933 1.00 0.00 ? 3  LEU A CB   4  
ATOM 3263  C CG   . LEU A 1 33  ? 45.186 43.434 10.750 1.00 0.00 ? 3  LEU A CG   4  
ATOM 3264  C CD1  . LEU A 1 33  ? 45.529 43.499 9.261  1.00 0.00 ? 3  LEU A CD1  4  
ATOM 3265  C CD2  . LEU A 1 33  ? 45.069 44.854 11.304 1.00 0.00 ? 3  LEU A CD2  4  
ATOM 3266  H H    . LEU A 1 33  ? 45.449 41.353 12.342 1.00 0.00 ? 3  LEU A H    4  
ATOM 3267  H HA   . LEU A 1 33  ? 43.582 43.351 12.951 1.00 0.00 ? 3  LEU A HA   4  
ATOM 3268  H HB2  . LEU A 1 33  ? 43.869 41.778 10.381 1.00 0.00 ? 3  LEU A HB2  4  
ATOM 3269  H HB3  . LEU A 1 33  ? 43.054 43.330 10.562 1.00 0.00 ? 3  LEU A HB3  4  
ATOM 3270  H HG   . LEU A 1 33  ? 45.964 42.901 11.276 1.00 0.00 ? 3  LEU A HG   4  
ATOM 3271  H HD11 . LEU A 1 33  ? 45.581 42.498 8.858  1.00 0.00 ? 3  LEU A HD11 4  
ATOM 3272  H HD12 . LEU A 1 33  ? 46.483 43.989 9.132  1.00 0.00 ? 3  LEU A HD12 4  
ATOM 3273  H HD13 . LEU A 1 33  ? 44.765 44.057 8.740  1.00 0.00 ? 3  LEU A HD13 4  
ATOM 3274  H HD21 . LEU A 1 33  ? 44.977 44.815 12.380 1.00 0.00 ? 3  LEU A HD21 4  
ATOM 3275  H HD22 . LEU A 1 33  ? 44.197 45.333 10.885 1.00 0.00 ? 3  LEU A HD22 4  
ATOM 3276  H HD23 . LEU A 1 33  ? 45.951 45.417 11.038 1.00 0.00 ? 3  LEU A HD23 4  
ATOM 3277  N N    . ASN A 1 34  ? 42.255 40.385 12.532 1.00 0.00 ? 4  ASN A N    4  
ATOM 3278  C CA   . ASN A 1 34  ? 41.005 39.630 12.627 1.00 0.00 ? 4  ASN A CA   4  
ATOM 3279  C C    . ASN A 1 34  ? 40.701 39.155 14.058 1.00 0.00 ? 4  ASN A C    4  
ATOM 3280  O O    . ASN A 1 34  ? 39.740 38.414 14.266 1.00 0.00 ? 4  ASN A O    4  
ATOM 3281  C CB   . ASN A 1 34  ? 41.068 38.411 11.701 1.00 0.00 ? 4  ASN A CB   4  
ATOM 3282  C CG   . ASN A 1 34  ? 41.401 38.837 10.271 1.00 0.00 ? 4  ASN A CG   4  
ATOM 3283  O OD1  . ASN A 1 34  ? 40.781 39.751 9.723  1.00 0.00 ? 4  ASN A OD1  4  
ATOM 3284  N ND2  . ASN A 1 34  ? 42.347 38.213 9.623  1.00 0.00 ? 4  ASN A ND2  4  
ATOM 3285  H H    . ASN A 1 34  ? 43.104 39.904 12.443 1.00 0.00 ? 4  ASN A H    4  
ATOM 3286  H HA   . ASN A 1 34  ? 40.195 40.263 12.297 1.00 0.00 ? 4  ASN A HA   4  
ATOM 3287  H HB2  . ASN A 1 34  ? 41.830 37.732 12.056 1.00 0.00 ? 4  ASN A HB2  4  
ATOM 3288  H HB3  . ASN A 1 34  ? 40.112 37.908 11.708 1.00 0.00 ? 4  ASN A HB3  4  
ATOM 3289  H HD21 . ASN A 1 34  ? 42.829 37.473 10.049 1.00 0.00 ? 4  ASN A HD21 4  
ATOM 3290  H HD22 . ASN A 1 34  ? 42.588 38.499 8.716  1.00 0.00 ? 4  ASN A HD22 4  
ATOM 3291  N N    . GLY A 1 35  ? 41.495 39.573 15.047 1.00 0.00 ? 5  GLY A N    4  
ATOM 3292  C CA   . GLY A 1 35  ? 41.357 39.045 16.400 1.00 0.00 ? 5  GLY A CA   4  
ATOM 3293  C C    . GLY A 1 35  ? 39.931 39.191 16.923 1.00 0.00 ? 5  GLY A C    4  
ATOM 3294  O O    . GLY A 1 35  ? 39.415 38.285 17.579 1.00 0.00 ? 5  GLY A O    4  
ATOM 3295  H H    . GLY A 1 35  ? 42.177 40.253 14.868 1.00 0.00 ? 5  GLY A H    4  
ATOM 3296  H HA2  . GLY A 1 35  ? 41.627 37.999 16.398 1.00 0.00 ? 5  GLY A HA2  4  
ATOM 3297  H HA3  . GLY A 1 35  ? 42.027 39.580 17.057 1.00 0.00 ? 5  GLY A HA3  4  
ATOM 3298  N N    . ALA A 1 36  ? 39.286 40.312 16.611 1.00 0.00 ? 6  ALA A N    4  
ATOM 3299  C CA   . ALA A 1 36  ? 37.930 40.545 17.099 1.00 0.00 ? 6  ALA A CA   4  
ATOM 3300  C C    . ALA A 1 36  ? 36.992 39.457 16.585 1.00 0.00 ? 6  ALA A C    4  
ATOM 3301  O O    . ALA A 1 36  ? 36.234 38.859 17.355 1.00 0.00 ? 6  ALA A O    4  
ATOM 3302  C CB   . ALA A 1 36  ? 37.433 41.915 16.634 1.00 0.00 ? 6  ALA A CB   4  
ATOM 3303  H H    . ALA A 1 36  ? 39.723 40.986 16.051 1.00 0.00 ? 6  ALA A H    4  
ATOM 3304  H HA   . ALA A 1 36  ? 37.936 40.523 18.179 1.00 0.00 ? 6  ALA A HA   4  
ATOM 3305  H HB1  . ALA A 1 36  ? 37.820 42.122 15.648 1.00 0.00 ? 6  ALA A HB1  4  
ATOM 3306  H HB2  . ALA A 1 36  ? 37.774 42.674 17.323 1.00 0.00 ? 6  ALA A HB2  4  
ATOM 3307  H HB3  . ALA A 1 36  ? 36.354 41.915 16.605 1.00 0.00 ? 6  ALA A HB3  4  
ATOM 3308  N N    . LEU A 1 37  ? 37.069 39.177 15.287 1.00 0.00 ? 7  LEU A N    4  
ATOM 3309  C CA   . LEU A 1 37  ? 36.254 38.115 14.708 1.00 0.00 ? 7  LEU A CA   4  
ATOM 3310  C C    . LEU A 1 37  ? 36.599 36.762 15.325 1.00 0.00 ? 7  LEU A C    4  
ATOM 3311  O O    . LEU A 1 37  ? 35.714 35.942 15.565 1.00 0.00 ? 7  LEU A O    4  
ATOM 3312  C CB   . LEU A 1 37  ? 36.464 38.065 13.192 1.00 0.00 ? 7  LEU A CB   4  
ATOM 3313  C CG   . LEU A 1 37  ? 36.006 39.385 12.565 1.00 0.00 ? 7  LEU A CG   4  
ATOM 3314  C CD1  . LEU A 1 37  ? 36.390 39.412 11.084 1.00 0.00 ? 7  LEU A CD1  4  
ATOM 3315  C CD2  . LEU A 1 37  ? 34.486 39.509 12.690 1.00 0.00 ? 7  LEU A CD2  4  
ATOM 3316  H H    . LEU A 1 37  ? 37.681 39.688 14.716 1.00 0.00 ? 7  LEU A H    4  
ATOM 3317  H HA   . LEU A 1 37  ? 35.215 38.329 14.908 1.00 0.00 ? 7  LEU A HA   4  
ATOM 3318  H HB2  . LEU A 1 37  ? 37.511 37.907 12.980 1.00 0.00 ? 7  LEU A HB2  4  
ATOM 3319  H HB3  . LEU A 1 37  ? 35.886 37.253 12.775 1.00 0.00 ? 7  LEU A HB3  4  
ATOM 3320  H HG   . LEU A 1 37  ? 36.481 40.210 13.075 1.00 0.00 ? 7  LEU A HG   4  
ATOM 3321  H HD11 . LEU A 1 37  ? 37.423 39.712 10.984 1.00 0.00 ? 7  LEU A HD11 4  
ATOM 3322  H HD12 . LEU A 1 37  ? 35.758 40.118 10.565 1.00 0.00 ? 7  LEU A HD12 4  
ATOM 3323  H HD13 . LEU A 1 37  ? 36.256 38.428 10.660 1.00 0.00 ? 7  LEU A HD13 4  
ATOM 3324  H HD21 . LEU A 1 37  ? 34.034 38.536 12.562 1.00 0.00 ? 7  LEU A HD21 4  
ATOM 3325  H HD22 . LEU A 1 37  ? 34.114 40.182 11.932 1.00 0.00 ? 7  LEU A HD22 4  
ATOM 3326  H HD23 . LEU A 1 37  ? 34.236 39.895 13.668 1.00 0.00 ? 7  LEU A HD23 4  
ATOM 3327  N N    . VAL A 1 38  ? 37.879 36.546 15.627 1.00 0.00 ? 8  VAL A N    4  
ATOM 3328  C CA   . VAL A 1 38  ? 38.299 35.291 16.243 1.00 0.00 ? 8  VAL A CA   4  
ATOM 3329  C C    . VAL A 1 38  ? 37.594 35.112 17.586 1.00 0.00 ? 8  VAL A C    4  
ATOM 3330  O O    . VAL A 1 38  ? 37.095 34.028 17.896 1.00 0.00 ? 8  VAL A O    4  
ATOM 3331  C CB   . VAL A 1 38  ? 39.825 35.293 16.432 1.00 0.00 ? 8  VAL A CB   4  
ATOM 3332  C CG1  . VAL A 1 38  ? 40.297 33.989 17.087 1.00 0.00 ? 8  VAL A CG1  4  
ATOM 3333  C CG2  . VAL A 1 38  ? 40.514 35.430 15.071 1.00 0.00 ? 8  VAL A CG2  4  
ATOM 3334  H H    . VAL A 1 38  ? 38.549 37.224 15.401 1.00 0.00 ? 8  VAL A H    4  
ATOM 3335  H HA   . VAL A 1 38  ? 38.028 34.473 15.592 1.00 0.00 ? 8  VAL A HA   4  
ATOM 3336  H HB   . VAL A 1 38  ? 40.104 36.128 17.059 1.00 0.00 ? 8  VAL A HB   4  
ATOM 3337  H HG11 . VAL A 1 38  ? 41.340 34.078 17.351 1.00 0.00 ? 8  VAL A HG11 4  
ATOM 3338  H HG12 . VAL A 1 38  ? 40.173 33.172 16.393 1.00 0.00 ? 8  VAL A HG12 4  
ATOM 3339  H HG13 . VAL A 1 38  ? 39.717 33.798 17.977 1.00 0.00 ? 8  VAL A HG13 4  
ATOM 3340  H HG21 . VAL A 1 38  ? 41.522 35.790 15.214 1.00 0.00 ? 8  VAL A HG21 4  
ATOM 3341  H HG22 . VAL A 1 38  ? 39.969 36.127 14.453 1.00 0.00 ? 8  VAL A HG22 4  
ATOM 3342  H HG23 . VAL A 1 38  ? 40.544 34.467 14.586 1.00 0.00 ? 8  VAL A HG23 4  
ATOM 3343  N N    . ASN A 1 39  ? 37.516 36.188 18.365 1.00 0.00 ? 9  ASN A N    4  
ATOM 3344  C CA   . ASN A 1 39  ? 36.840 36.124 19.656 1.00 0.00 ? 9  ASN A CA   4  
ATOM 3345  C C    . ASN A 1 39  ? 35.366 35.777 19.478 1.00 0.00 ? 9  ASN A C    4  
ATOM 3346  O O    . ASN A 1 39  ? 34.828 34.926 20.191 1.00 0.00 ? 9  ASN A O    4  
ATOM 3347  C CB   . ASN A 1 39  ? 36.965 37.469 20.378 1.00 0.00 ? 9  ASN A CB   4  
ATOM 3348  C CG   . ASN A 1 39  ? 38.427 37.756 20.708 1.00 0.00 ? 9  ASN A CG   4  
ATOM 3349  O OD1  . ASN A 1 39  ? 39.241 36.838 20.799 1.00 0.00 ? 9  ASN A OD1  4  
ATOM 3350  N ND2  . ASN A 1 39  ? 38.810 38.990 20.896 1.00 0.00 ? 9  ASN A ND2  4  
ATOM 3351  H H    . ASN A 1 39  ? 37.946 37.022 18.082 1.00 0.00 ? 9  ASN A H    4  
ATOM 3352  H HA   . ASN A 1 39  ? 37.309 35.362 20.259 1.00 0.00 ? 9  ASN A HA   4  
ATOM 3353  H HB2  . ASN A 1 39  ? 36.581 38.253 19.742 1.00 0.00 ? 9  ASN A HB2  4  
ATOM 3354  H HB3  . ASN A 1 39  ? 36.392 37.437 21.293 1.00 0.00 ? 9  ASN A HB3  4  
ATOM 3355  H HD21 . ASN A 1 39  ? 38.162 39.721 20.825 1.00 0.00 ? 9  ASN A HD21 4  
ATOM 3356  H HD22 . ASN A 1 39  ? 39.747 39.184 21.109 1.00 0.00 ? 9  ASN A HD22 4  
ATOM 3357  N N    . MET A 1 40  ? 34.721 36.411 18.499 1.00 0.00 ? 10 MET A N    4  
ATOM 3358  C CA   . MET A 1 40  ? 33.315 36.127 18.238 1.00 0.00 ? 10 MET A CA   4  
ATOM 3359  C C    . MET A 1 40  ? 33.120 34.660 17.859 1.00 0.00 ? 10 MET A C    4  
ATOM 3360  O O    . MET A 1 40  ? 32.166 34.020 18.303 1.00 0.00 ? 10 MET A O    4  
ATOM 3361  C CB   . MET A 1 40  ? 32.806 37.027 17.111 1.00 0.00 ? 10 MET A CB   4  
ATOM 3362  C CG   . MET A 1 40  ? 31.289 36.877 16.977 1.00 0.00 ? 10 MET A CG   4  
ATOM 3363  S SD   . MET A 1 40  ? 30.698 37.888 15.594 1.00 0.00 ? 10 MET A SD   4  
ATOM 3364  C CE   . MET A 1 40  ? 31.344 36.861 14.252 1.00 0.00 ? 10 MET A CE   4  
ATOM 3365  H H    . MET A 1 40  ? 35.188 37.099 17.976 1.00 0.00 ? 10 MET A H    4  
ATOM 3366  H HA   . MET A 1 40  ? 32.745 36.334 19.132 1.00 0.00 ? 10 MET A HA   4  
ATOM 3367  H HB2  . MET A 1 40  ? 33.048 38.056 17.335 1.00 0.00 ? 10 MET A HB2  4  
ATOM 3368  H HB3  . MET A 1 40  ? 33.276 36.742 16.182 1.00 0.00 ? 10 MET A HB3  4  
ATOM 3369  H HG2  . MET A 1 40  ? 31.045 35.841 16.795 1.00 0.00 ? 10 MET A HG2  4  
ATOM 3370  H HG3  . MET A 1 40  ? 30.813 37.204 17.890 1.00 0.00 ? 10 MET A HG3  4  
ATOM 3371  H HE1  . MET A 1 40  ? 30.985 37.241 13.306 1.00 0.00 ? 10 MET A HE1  4  
ATOM 3372  H HE2  . MET A 1 40  ? 31.007 35.844 14.380 1.00 0.00 ? 10 MET A HE2  4  
ATOM 3373  H HE3  . MET A 1 40  ? 32.425 36.885 14.268 1.00 0.00 ? 10 MET A HE3  4  
ATOM 3374  N N    . LEU A 1 41  ? 34.053 34.114 17.082 1.00 0.00 ? 11 LEU A N    4  
ATOM 3375  C CA   . LEU A 1 41  ? 33.998 32.697 16.736 1.00 0.00 ? 11 LEU A CA   4  
ATOM 3376  C C    . LEU A 1 41  ? 34.091 31.830 17.986 1.00 0.00 ? 11 LEU A C    4  
ATOM 3377  O O    . LEU A 1 41  ? 33.376 30.837 18.112 1.00 0.00 ? 11 LEU A O    4  
ATOM 3378  C CB   . LEU A 1 41  ? 35.136 32.342 15.778 1.00 0.00 ? 11 LEU A CB   4  
ATOM 3379  C CG   . LEU A 1 41  ? 34.918 33.050 14.441 1.00 0.00 ? 11 LEU A CG   4  
ATOM 3380  C CD1  . LEU A 1 41  ? 36.173 32.903 13.580 1.00 0.00 ? 11 LEU A CD1  4  
ATOM 3381  C CD2  . LEU A 1 41  ? 33.731 32.416 13.714 1.00 0.00 ? 11 LEU A CD2  4  
ATOM 3382  H H    . LEU A 1 41  ? 34.766 34.674 16.714 1.00 0.00 ? 11 LEU A H    4  
ATOM 3383  H HA   . LEU A 1 41  ? 33.058 32.496 16.246 1.00 0.00 ? 11 LEU A HA   4  
ATOM 3384  H HB2  . LEU A 1 41  ? 36.077 32.657 16.206 1.00 0.00 ? 11 LEU A HB2  4  
ATOM 3385  H HB3  . LEU A 1 41  ? 35.152 31.274 15.619 1.00 0.00 ? 11 LEU A HB3  4  
ATOM 3386  H HG   . LEU A 1 41  ? 34.720 34.096 14.615 1.00 0.00 ? 11 LEU A HG   4  
ATOM 3387  H HD11 . LEU A 1 41  ? 36.454 31.861 13.527 1.00 0.00 ? 11 LEU A HD11 4  
ATOM 3388  H HD12 . LEU A 1 41  ? 36.979 33.472 14.017 1.00 0.00 ? 11 LEU A HD12 4  
ATOM 3389  H HD13 . LEU A 1 41  ? 35.971 33.272 12.585 1.00 0.00 ? 11 LEU A HD13 4  
ATOM 3390  H HD21 . LEU A 1 41  ? 32.810 32.744 14.175 1.00 0.00 ? 11 LEU A HD21 4  
ATOM 3391  H HD22 . LEU A 1 41  ? 33.801 31.340 13.775 1.00 0.00 ? 11 LEU A HD22 4  
ATOM 3392  H HD23 . LEU A 1 41  ? 33.741 32.720 12.678 1.00 0.00 ? 11 LEU A HD23 4  
ATOM 3393  N N    . LYS A 1 42  ? 34.958 32.219 18.919 1.00 0.00 ? 12 LYS A N    4  
ATOM 3394  C CA   . LYS A 1 42  ? 35.099 31.466 20.160 1.00 0.00 ? 12 LYS A CA   4  
ATOM 3395  C C    . LYS A 1 42  ? 33.769 31.414 20.909 1.00 0.00 ? 12 LYS A C    4  
ATOM 3396  O O    . LYS A 1 42  ? 33.379 30.367 21.430 1.00 0.00 ? 12 LYS A O    4  
ATOM 3397  C CB   . LYS A 1 42  ? 36.158 32.130 21.046 1.00 0.00 ? 12 LYS A CB   4  
ATOM 3398  C CG   . LYS A 1 42  ? 36.433 31.265 22.276 1.00 0.00 ? 12 LYS A CG   4  
ATOM 3399  C CD   . LYS A 1 42  ? 37.300 30.068 21.880 1.00 0.00 ? 12 LYS A CD   4  
ATOM 3400  C CE   . LYS A 1 42  ? 37.642 29.248 23.125 1.00 0.00 ? 12 LYS A CE   4  
ATOM 3401  N NZ   . LYS A 1 42  ? 38.740 29.919 23.876 1.00 0.00 ? 12 LYS A NZ   4  
ATOM 3402  H H    . LYS A 1 42  ? 35.538 32.990 18.748 1.00 0.00 ? 12 LYS A H    4  
ATOM 3403  H HA   . LYS A 1 42  ? 35.413 30.460 19.930 1.00 0.00 ? 12 LYS A HA   4  
ATOM 3404  H HB2  . LYS A 1 42  ? 37.070 32.252 20.480 1.00 0.00 ? 12 LYS A HB2  4  
ATOM 3405  H HB3  . LYS A 1 42  ? 35.802 33.099 21.364 1.00 0.00 ? 12 LYS A HB3  4  
ATOM 3406  H HG2  . LYS A 1 42  ? 36.949 31.852 23.021 1.00 0.00 ? 12 LYS A HG2  4  
ATOM 3407  H HG3  . LYS A 1 42  ? 35.499 30.907 22.684 1.00 0.00 ? 12 LYS A HG3  4  
ATOM 3408  H HD2  . LYS A 1 42  ? 36.762 29.449 21.178 1.00 0.00 ? 12 LYS A HD2  4  
ATOM 3409  H HD3  . LYS A 1 42  ? 38.213 30.420 21.424 1.00 0.00 ? 12 LYS A HD3  4  
ATOM 3410  H HE2  . LYS A 1 42  ? 36.769 29.171 23.757 1.00 0.00 ? 12 LYS A HE2  4  
ATOM 3411  H HE3  . LYS A 1 42  ? 37.959 28.259 22.830 1.00 0.00 ? 12 LYS A HE3  4  
ATOM 3412  H HZ1  . LYS A 1 42  ? 38.392 30.813 24.275 1.00 0.00 ? 12 LYS A HZ1  4  
ATOM 3413  H HZ2  . LYS A 1 42  ? 39.532 30.113 23.229 1.00 0.00 ? 12 LYS A HZ2  4  
ATOM 3414  H HZ3  . LYS A 1 42  ? 39.064 29.301 24.646 1.00 0.00 ? 12 LYS A HZ3  4  
ATOM 3415  N N    . GLU A 1 43  ? 33.049 32.534 20.916 1.00 0.00 ? 13 GLU A N    4  
ATOM 3416  C CA   . GLU A 1 43  ? 31.735 32.570 21.551 1.00 0.00 ? 13 GLU A CA   4  
ATOM 3417  C C    . GLU A 1 43  ? 30.774 31.615 20.850 1.00 0.00 ? 13 GLU A C    4  
ATOM 3418  O O    . GLU A 1 43  ? 30.045 30.861 21.498 1.00 0.00 ? 13 GLU A O    4  
ATOM 3419  C CB   . GLU A 1 43  ? 31.171 33.991 21.503 1.00 0.00 ? 13 GLU A CB   4  
ATOM 3420  C CG   . GLU A 1 43  ? 32.073 34.929 22.314 1.00 0.00 ? 13 GLU A CG   4  
ATOM 3421  C CD   . GLU A 1 43  ? 31.508 36.353 22.371 1.00 0.00 ? 13 GLU A CD   4  
ATOM 3422  O OE1  . GLU A 1 43  ? 32.035 37.134 23.146 1.00 0.00 ? 13 GLU A OE1  4  
ATOM 3423  O OE2  . GLU A 1 43  ? 30.571 36.654 21.646 1.00 0.00 ? 13 GLU A OE2  4  
ATOM 3424  H H    . GLU A 1 43  ? 33.427 33.353 20.528 1.00 0.00 ? 13 GLU A H    4  
ATOM 3425  H HA   . GLU A 1 43  ? 31.836 32.270 22.584 1.00 0.00 ? 13 GLU A HA   4  
ATOM 3426  H HB2  . GLU A 1 43  ? 31.129 34.327 20.477 1.00 0.00 ? 13 GLU A HB2  4  
ATOM 3427  H HB3  . GLU A 1 43  ? 30.177 33.999 21.926 1.00 0.00 ? 13 GLU A HB3  4  
ATOM 3428  H HG2  . GLU A 1 43  ? 32.164 34.547 23.320 1.00 0.00 ? 13 GLU A HG2  4  
ATOM 3429  H HG3  . GLU A 1 43  ? 33.052 34.956 21.857 1.00 0.00 ? 13 GLU A HG3  4  
ATOM 3430  N N    . GLU A 1 44  ? 30.807 31.615 19.520 1.00 0.00 ? 14 GLU A N    4  
ATOM 3431  C CA   . GLU A 1 44  ? 29.947 30.722 18.752 1.00 0.00 ? 14 GLU A CA   4  
ATOM 3432  C C    . GLU A 1 44  ? 30.278 29.261 19.042 1.00 0.00 ? 14 GLU A C    4  
ATOM 3433  O O    . GLU A 1 44  ? 29.380 28.425 19.154 1.00 0.00 ? 14 GLU A O    4  
ATOM 3434  C CB   . GLU A 1 44  ? 30.127 31.002 17.259 1.00 0.00 ? 14 GLU A CB   4  
ATOM 3435  C CG   . GLU A 1 44  ? 29.622 32.413 16.937 1.00 0.00 ? 14 GLU A CG   4  
ATOM 3436  C CD   . GLU A 1 44  ? 29.740 32.728 15.443 1.00 0.00 ? 14 GLU A CD   4  
ATOM 3437  O OE1  . GLU A 1 44  ? 29.160 33.719 15.031 1.00 0.00 ? 14 GLU A OE1  4  
ATOM 3438  O OE2  . GLU A 1 44  ? 30.419 32.000 14.733 1.00 0.00 ? 14 GLU A OE2  4  
ATOM 3439  H H    . GLU A 1 44  ? 31.390 32.251 19.052 1.00 0.00 ? 14 GLU A H    4  
ATOM 3440  H HA   . GLU A 1 44  ? 28.918 30.909 19.019 1.00 0.00 ? 14 GLU A HA   4  
ATOM 3441  H HB2  . GLU A 1 44  ? 31.174 30.925 17.002 1.00 0.00 ? 14 GLU A HB2  4  
ATOM 3442  H HB3  . GLU A 1 44  ? 29.561 30.281 16.687 1.00 0.00 ? 14 GLU A HB3  4  
ATOM 3443  H HG2  . GLU A 1 44  ? 28.586 32.490 17.231 1.00 0.00 ? 14 GLU A HG2  4  
ATOM 3444  H HG3  . GLU A 1 44  ? 30.201 33.131 17.497 1.00 0.00 ? 14 GLU A HG3  4  
ATOM 3445  N N    . GLY A 1 45  ? 31.565 28.959 19.192 1.00 0.00 ? 15 GLY A N    4  
ATOM 3446  C CA   . GLY A 1 45  ? 31.980 27.601 19.520 1.00 0.00 ? 15 GLY A CA   4  
ATOM 3447  C C    . GLY A 1 45  ? 31.376 27.157 20.847 1.00 0.00 ? 15 GLY A C    4  
ATOM 3448  O O    . GLY A 1 45  ? 30.837 26.055 20.956 1.00 0.00 ? 15 GLY A O    4  
ATOM 3449  H H    . GLY A 1 45  ? 32.243 29.652 19.052 1.00 0.00 ? 15 GLY A H    4  
ATOM 3450  H HA2  . GLY A 1 45  ? 31.652 26.933 18.737 1.00 0.00 ? 15 GLY A HA2  4  
ATOM 3451  H HA3  . GLY A 1 45  ? 33.055 27.565 19.593 1.00 0.00 ? 15 GLY A HA3  4  
ATOM 3452  N N    . ASN A 1 46  ? 31.437 28.034 21.847 1.00 0.00 ? 16 ASN A N    4  
ATOM 3453  C CA   . ASN A 1 46  ? 30.854 27.717 23.147 1.00 0.00 ? 16 ASN A CA   4  
ATOM 3454  C C    . ASN A 1 46  ? 29.348 27.490 23.026 1.00 0.00 ? 16 ASN A C    4  
ATOM 3455  O O    . ASN A 1 46  ? 28.799 26.596 23.671 1.00 0.00 ? 16 ASN A O    4  
ATOM 3456  C CB   . ASN A 1 46  ? 31.123 28.857 24.133 1.00 0.00 ? 16 ASN A CB   4  
ATOM 3457  C CG   . ASN A 1 46  ? 32.620 28.978 24.409 1.00 0.00 ? 16 ASN A CG   4  
ATOM 3458  O OD1  . ASN A 1 46  ? 33.372 28.022 24.214 1.00 0.00 ? 16 ASN A OD1  4  
ATOM 3459  N ND2  . ASN A 1 46  ? 33.101 30.107 24.854 1.00 0.00 ? 16 ASN A ND2  4  
ATOM 3460  H H    . ASN A 1 46  ? 31.909 28.886 21.719 1.00 0.00 ? 16 ASN A H    4  
ATOM 3461  H HA   . ASN A 1 46  ? 31.312 26.816 23.524 1.00 0.00 ? 16 ASN A HA   4  
ATOM 3462  H HB2  . ASN A 1 46  ? 30.760 29.783 23.714 1.00 0.00 ? 16 ASN A HB2  4  
ATOM 3463  H HB3  . ASN A 1 46  ? 30.606 28.656 25.059 1.00 0.00 ? 16 ASN A HB3  4  
ATOM 3464  H HD21 . ASN A 1 46  ? 32.501 30.867 25.009 1.00 0.00 ? 16 ASN A HD21 4  
ATOM 3465  H HD22 . ASN A 1 46  ? 34.060 30.194 25.034 1.00 0.00 ? 16 ASN A HD22 4  
ATOM 3466  N N    . LYS A 1 47  ? 28.688 28.272 22.174 1.00 0.00 ? 17 LYS A N    4  
ATOM 3467  C CA   . LYS A 1 47  ? 27.257 28.087 21.953 1.00 0.00 ? 17 LYS A CA   4  
ATOM 3468  C C    . LYS A 1 47  ? 26.976 26.699 21.382 1.00 0.00 ? 17 LYS A C    4  
ATOM 3469  O O    . LYS A 1 47  ? 26.077 25.994 21.850 1.00 0.00 ? 17 LYS A O    4  
ATOM 3470  C CB   . LYS A 1 47  ? 26.740 29.156 20.987 1.00 0.00 ? 17 LYS A CB   4  
ATOM 3471  C CG   . LYS A 1 47  ? 25.219 29.046 20.858 1.00 0.00 ? 17 LYS A CG   4  
ATOM 3472  C CD   . LYS A 1 47  ? 24.689 30.185 19.977 1.00 0.00 ? 17 LYS A CD   4  
ATOM 3473  C CE   . LYS A 1 47  ? 25.110 29.998 18.510 1.00 0.00 ? 17 LYS A CE   4  
ATOM 3474  N NZ   . LYS A 1 47  ? 25.669 31.276 17.984 1.00 0.00 ? 17 LYS A NZ   4  
ATOM 3475  H H    . LYS A 1 47  ? 29.158 29.006 21.725 1.00 0.00 ? 17 LYS A H    4  
ATOM 3476  H HA   . LYS A 1 47  ? 26.740 28.189 22.896 1.00 0.00 ? 17 LYS A HA   4  
ATOM 3477  H HB2  . LYS A 1 47  ? 27.000 30.135 21.365 1.00 0.00 ? 17 LYS A HB2  4  
ATOM 3478  H HB3  . LYS A 1 47  ? 27.193 29.012 20.018 1.00 0.00 ? 17 LYS A HB3  4  
ATOM 3479  H HG2  . LYS A 1 47  ? 24.965 28.096 20.410 1.00 0.00 ? 17 LYS A HG2  4  
ATOM 3480  H HG3  . LYS A 1 47  ? 24.769 29.114 21.837 1.00 0.00 ? 17 LYS A HG3  4  
ATOM 3481  H HD2  . LYS A 1 47  ? 23.611 30.205 20.036 1.00 0.00 ? 17 LYS A HD2  4  
ATOM 3482  H HD3  . LYS A 1 47  ? 25.081 31.123 20.344 1.00 0.00 ? 17 LYS A HD3  4  
ATOM 3483  H HE2  . LYS A 1 47  ? 25.856 29.222 18.420 1.00 0.00 ? 17 LYS A HE2  4  
ATOM 3484  H HE3  . LYS A 1 47  ? 24.243 29.726 17.926 1.00 0.00 ? 17 LYS A HE3  4  
ATOM 3485  H HZ1  . LYS A 1 47  ? 26.649 31.388 18.313 1.00 0.00 ? 17 LYS A HZ1  4  
ATOM 3486  H HZ2  . LYS A 1 47  ? 25.094 32.073 18.328 1.00 0.00 ? 17 LYS A HZ2  4  
ATOM 3487  H HZ3  . LYS A 1 47  ? 25.654 31.260 16.945 1.00 0.00 ? 17 LYS A HZ3  4  
ATOM 3488  N N    . ALA A 1 48  ? 27.779 26.284 20.403 1.00 0.00 ? 18 ALA A N    4  
ATOM 3489  C CA   . ALA A 1 48  ? 27.609 24.955 19.829 1.00 0.00 ? 18 ALA A CA   4  
ATOM 3490  C C    . ALA A 1 48  ? 27.793 23.890 20.904 1.00 0.00 ? 18 ALA A C    4  
ATOM 3491  O O    . ALA A 1 48  ? 27.061 22.902 20.935 1.00 0.00 ? 18 ALA A O    4  
ATOM 3492  C CB   . ALA A 1 48  ? 28.610 24.730 18.694 1.00 0.00 ? 18 ALA A CB   4  
ATOM 3493  H H    . ALA A 1 48  ? 28.470 26.883 20.050 1.00 0.00 ? 18 ALA A H    4  
ATOM 3494  H HA   . ALA A 1 48  ? 26.610 24.876 19.427 1.00 0.00 ? 18 ALA A HA   4  
ATOM 3495  H HB1  . ALA A 1 48  ? 28.208 24.004 17.999 1.00 0.00 ? 18 ALA A HB1  4  
ATOM 3496  H HB2  . ALA A 1 48  ? 29.539 24.363 19.101 1.00 0.00 ? 18 ALA A HB2  4  
ATOM 3497  H HB3  . ALA A 1 48  ? 28.786 25.662 18.178 1.00 0.00 ? 18 ALA A HB3  4  
ATOM 3498  N N    . LEU A 1 49  ? 28.774 24.089 21.783 1.00 0.00 ? 19 LEU A N    4  
ATOM 3499  C CA   . LEU A 1 49  ? 28.977 23.166 22.895 1.00 0.00 ? 19 LEU A CA   4  
ATOM 3500  C C    . LEU A 1 49  ? 27.747 23.115 23.801 1.00 0.00 ? 19 LEU A C    4  
ATOM 3501  O O    . LEU A 1 49  ? 27.309 22.034 24.192 1.00 0.00 ? 19 LEU A O    4  
ATOM 3502  C CB   . LEU A 1 49  ? 30.198 23.602 23.709 1.00 0.00 ? 19 LEU A CB   4  
ATOM 3503  C CG   . LEU A 1 49  ? 30.501 22.566 24.794 1.00 0.00 ? 19 LEU A CG   4  
ATOM 3504  C CD1  . LEU A 1 49  ? 31.037 21.289 24.146 1.00 0.00 ? 19 LEU A CD1  4  
ATOM 3505  C CD2  . LEU A 1 49  ? 31.551 23.128 25.754 1.00 0.00 ? 19 LEU A CD2  4  
ATOM 3506  H H    . LEU A 1 49  ? 29.387 24.844 21.662 1.00 0.00 ? 19 LEU A H    4  
ATOM 3507  H HA   . LEU A 1 49  ? 29.161 22.178 22.500 1.00 0.00 ? 19 LEU A HA   4  
ATOM 3508  H HB2  . LEU A 1 49  ? 31.051 23.695 23.053 1.00 0.00 ? 19 LEU A HB2  4  
ATOM 3509  H HB3  . LEU A 1 49  ? 29.996 24.556 24.175 1.00 0.00 ? 19 LEU A HB3  4  
ATOM 3510  H HG   . LEU A 1 49  ? 29.597 22.339 25.340 1.00 0.00 ? 19 LEU A HG   4  
ATOM 3511  H HD11 . LEU A 1 49  ? 30.209 20.679 23.814 1.00 0.00 ? 19 LEU A HD11 4  
ATOM 3512  H HD12 . LEU A 1 49  ? 31.623 20.738 24.867 1.00 0.00 ? 19 LEU A HD12 4  
ATOM 3513  H HD13 . LEU A 1 49  ? 31.656 21.547 23.300 1.00 0.00 ? 19 LEU A HD13 4  
ATOM 3514  H HD21 . LEU A 1 49  ? 31.935 22.330 26.375 1.00 0.00 ? 19 LEU A HD21 4  
ATOM 3515  H HD22 . LEU A 1 49  ? 31.100 23.885 26.379 1.00 0.00 ? 19 LEU A HD22 4  
ATOM 3516  H HD23 . LEU A 1 49  ? 32.360 23.564 25.187 1.00 0.00 ? 19 LEU A HD23 4  
ATOM 3517  N N    . SER A 1 50  ? 27.139 24.271 24.059 1.00 0.00 ? 20 SER A N    4  
ATOM 3518  C CA   . SER A 1 50  ? 25.980 24.323 24.948 1.00 0.00 ? 20 SER A CA   4  
ATOM 3519  C C    . SER A 1 50  ? 24.825 23.474 24.418 1.00 0.00 ? 20 SER A C    4  
ATOM 3520  O O    . SER A 1 50  ? 24.076 22.885 25.196 1.00 0.00 ? 20 SER A O    4  
ATOM 3521  C CB   . SER A 1 50  ? 25.513 25.769 25.128 1.00 0.00 ? 20 SER A CB   4  
ATOM 3522  O OG   . SER A 1 50  ? 24.785 26.177 23.979 1.00 0.00 ? 20 SER A OG   4  
ATOM 3523  H H    . SER A 1 50  ? 27.500 25.101 23.686 1.00 0.00 ? 20 SER A H    4  
ATOM 3524  H HA   . SER A 1 50  ? 26.272 23.938 25.914 1.00 0.00 ? 20 SER A HA   4  
ATOM 3525  H HB2  . SER A 1 50  ? 24.874 25.840 25.993 1.00 0.00 ? 20 SER A HB2  4  
ATOM 3526  H HB3  . SER A 1 50  ? 26.376 26.406 25.272 1.00 0.00 ? 20 SER A HB3  4  
ATOM 3527  H HG   . SER A 1 50  ? 24.508 27.022 24.111 1.00 0.00 ? 20 SER A HG   4  
ATOM 3528  N N    . VAL A 1 51  ? 24.681 23.416 23.097 1.00 0.00 ? 21 VAL A N    4  
ATOM 3529  C CA   . VAL A 1 51  ? 23.636 22.588 22.492 1.00 0.00 ? 21 VAL A CA   4  
ATOM 3530  C C    . VAL A 1 51  ? 24.070 21.135 22.250 1.00 0.00 ? 21 VAL A C    4  
ATOM 3531  O O    . VAL A 1 51  ? 23.288 20.347 21.716 1.00 0.00 ? 21 VAL A O    4  
ATOM 3532  C CB   . VAL A 1 51  ? 23.178 23.210 21.171 1.00 0.00 ? 21 VAL A CB   4  
ATOM 3533  C CG1  . VAL A 1 51  ? 22.650 24.622 21.428 1.00 0.00 ? 21 VAL A CG1  4  
ATOM 3534  C CG2  . VAL A 1 51  ? 24.358 23.280 20.201 1.00 0.00 ? 21 VAL A CG2  4  
ATOM 3535  H H    . VAL A 1 51  ? 25.243 23.986 22.526 1.00 0.00 ? 21 VAL A H    4  
ATOM 3536  H HA   . VAL A 1 51  ? 22.789 22.576 23.162 1.00 0.00 ? 21 VAL A HA   4  
ATOM 3537  H HB   . VAL A 1 51  ? 22.392 22.605 20.742 1.00 0.00 ? 21 VAL A HB   4  
ATOM 3538  H HG11 . VAL A 1 51  ? 23.477 25.281 21.650 1.00 0.00 ? 21 VAL A HG11 4  
ATOM 3539  H HG12 . VAL A 1 51  ? 21.969 24.605 22.265 1.00 0.00 ? 21 VAL A HG12 4  
ATOM 3540  H HG13 . VAL A 1 51  ? 22.132 24.979 20.550 1.00 0.00 ? 21 VAL A HG13 4  
ATOM 3541  H HG21 . VAL A 1 51  ? 24.831 22.312 20.137 1.00 0.00 ? 21 VAL A HG21 4  
ATOM 3542  H HG22 . VAL A 1 51  ? 25.072 24.007 20.559 1.00 0.00 ? 21 VAL A HG22 4  
ATOM 3543  H HG23 . VAL A 1 51  ? 24.004 23.574 19.223 1.00 0.00 ? 21 VAL A HG23 4  
ATOM 3544  N N    . GLY A 1 52  ? 25.295 20.767 22.631 1.00 0.00 ? 22 GLY A N    4  
ATOM 3545  C CA   . GLY A 1 52  ? 25.783 19.405 22.402 1.00 0.00 ? 22 GLY A CA   4  
ATOM 3546  C C    . GLY A 1 52  ? 26.425 19.214 21.020 1.00 0.00 ? 22 GLY A C    4  
ATOM 3547  O O    . GLY A 1 52  ? 26.702 18.082 20.621 1.00 0.00 ? 22 GLY A O    4  
ATOM 3548  H H    . GLY A 1 52  ? 25.871 21.405 23.098 1.00 0.00 ? 22 GLY A H    4  
ATOM 3549  H HA2  . GLY A 1 52  ? 26.515 19.168 23.159 1.00 0.00 ? 22 GLY A HA2  4  
ATOM 3550  H HA3  . GLY A 1 52  ? 24.953 18.720 22.496 1.00 0.00 ? 22 GLY A HA3  4  
ATOM 3551  N N    . ASN A 1 53  ? 26.666 20.303 20.290 1.00 0.00 ? 23 ASN A N    4  
ATOM 3552  C CA   . ASN A 1 53  ? 27.247 20.213 18.956 1.00 0.00 ? 23 ASN A CA   4  
ATOM 3553  C C    . ASN A 1 53  ? 28.761 20.425 19.012 1.00 0.00 ? 23 ASN A C    4  
ATOM 3554  O O    . ASN A 1 53  ? 29.294 21.417 18.504 1.00 0.00 ? 23 ASN A O    4  
ATOM 3555  C CB   . ASN A 1 53  ? 26.591 21.261 18.054 1.00 0.00 ? 23 ASN A CB   4  
ATOM 3556  C CG   . ASN A 1 53  ? 26.878 20.948 16.591 1.00 0.00 ? 23 ASN A CG   4  
ATOM 3557  O OD1  . ASN A 1 53  ? 27.896 20.333 16.274 1.00 0.00 ? 23 ASN A OD1  4  
ATOM 3558  N ND2  . ASN A 1 53  ? 26.039 21.352 15.679 1.00 0.00 ? 23 ASN A ND2  4  
ATOM 3559  H H    . ASN A 1 53  ? 26.460 21.184 20.662 1.00 0.00 ? 23 ASN A H    4  
ATOM 3560  H HA   . ASN A 1 53  ? 27.047 19.232 18.552 1.00 0.00 ? 23 ASN A HA   4  
ATOM 3561  H HB2  . ASN A 1 53  ? 25.524 21.257 18.218 1.00 0.00 ? 23 ASN A HB2  4  
ATOM 3562  H HB3  . ASN A 1 53  ? 26.988 22.237 18.293 1.00 0.00 ? 23 ASN A HB3  4  
ATOM 3563  H HD21 . ASN A 1 53  ? 25.240 21.855 15.940 1.00 0.00 ? 23 ASN A HD21 4  
ATOM 3564  H HD22 . ASN A 1 53  ? 26.204 21.150 14.735 1.00 0.00 ? 23 ASN A HD22 4  
ATOM 3565  N N    . ILE A 1 54  ? 29.462 19.466 19.608 1.00 0.00 ? 24 ILE A N    4  
ATOM 3566  C CA   . ILE A 1 54  ? 30.905 19.599 19.789 1.00 0.00 ? 24 ILE A CA   4  
ATOM 3567  C C    . ILE A 1 54  ? 31.618 19.674 18.437 1.00 0.00 ? 24 ILE A C    4  
ATOM 3568  O O    . ILE A 1 54  ? 32.589 20.417 18.289 1.00 0.00 ? 24 ILE A O    4  
ATOM 3569  C CB   . ILE A 1 54  ? 31.443 18.411 20.601 1.00 0.00 ? 24 ILE A CB   4  
ATOM 3570  C CG1  . ILE A 1 54  ? 30.716 18.338 21.948 1.00 0.00 ? 24 ILE A CG1  4  
ATOM 3571  C CG2  . ILE A 1 54  ? 32.943 18.588 20.862 1.00 0.00 ? 24 ILE A CG2  4  
ATOM 3572  C CD1  . ILE A 1 54  ? 31.115 17.053 22.677 1.00 0.00 ? 24 ILE A CD1  4  
ATOM 3573  H H    . ILE A 1 54  ? 29.007 18.659 19.927 1.00 0.00 ? 24 ILE A H    4  
ATOM 3574  H HA   . ILE A 1 54  ? 31.104 20.509 20.336 1.00 0.00 ? 24 ILE A HA   4  
ATOM 3575  H HB   . ILE A 1 54  ? 31.280 17.496 20.052 1.00 0.00 ? 24 ILE A HB   4  
ATOM 3576  H HG12 . ILE A 1 54  ? 30.987 19.193 22.550 1.00 0.00 ? 24 ILE A HG12 4  
ATOM 3577  H HG13 . ILE A 1 54  ? 29.649 18.337 21.782 1.00 0.00 ? 24 ILE A HG13 4  
ATOM 3578  H HG21 . ILE A 1 54  ? 33.455 18.744 19.924 1.00 0.00 ? 24 ILE A HG21 4  
ATOM 3579  H HG22 . ILE A 1 54  ? 33.332 17.702 21.343 1.00 0.00 ? 24 ILE A HG22 4  
ATOM 3580  H HG23 . ILE A 1 54  ? 33.099 19.443 21.503 1.00 0.00 ? 24 ILE A HG23 4  
ATOM 3581  H HD11 . ILE A 1 54  ? 32.160 17.103 22.949 1.00 0.00 ? 24 ILE A HD11 4  
ATOM 3582  H HD12 . ILE A 1 54  ? 30.952 16.206 22.027 1.00 0.00 ? 24 ILE A HD12 4  
ATOM 3583  H HD13 . ILE A 1 54  ? 30.515 16.944 23.568 1.00 0.00 ? 24 ILE A HD13 4  
ATOM 3584  N N    . ASP A 1 55  ? 31.120 18.939 17.444 1.00 0.00 ? 25 ASP A N    4  
ATOM 3585  C CA   . ASP A 1 55  ? 31.760 18.927 16.133 1.00 0.00 ? 25 ASP A CA   4  
ATOM 3586  C C    . ASP A 1 55  ? 31.771 20.326 15.525 1.00 0.00 ? 25 ASP A C    4  
ATOM 3587  O O    . ASP A 1 55  ? 32.810 20.810 15.073 1.00 0.00 ? 25 ASP A O    4  
ATOM 3588  C CB   . ASP A 1 55  ? 31.018 17.967 15.198 1.00 0.00 ? 25 ASP A CB   4  
ATOM 3589  C CG   . ASP A 1 55  ? 31.106 16.532 15.716 1.00 0.00 ? 25 ASP A CG   4  
ATOM 3590  O OD1  . ASP A 1 55  ? 30.192 15.773 15.442 1.00 0.00 ? 25 ASP A OD1  4  
ATOM 3591  O OD2  . ASP A 1 55  ? 32.086 16.208 16.370 1.00 0.00 ? 25 ASP A OD2  4  
ATOM 3592  H H    . ASP A 1 55  ? 30.313 18.402 17.595 1.00 0.00 ? 25 ASP A H    4  
ATOM 3593  H HA   . ASP A 1 55  ? 32.780 18.585 16.245 1.00 0.00 ? 25 ASP A HA   4  
ATOM 3594  H HB2  . ASP A 1 55  ? 29.981 18.262 15.139 1.00 0.00 ? 25 ASP A HB2  4  
ATOM 3595  H HB3  . ASP A 1 55  ? 31.459 18.017 14.214 1.00 0.00 ? 25 ASP A HB3  4  
ATOM 3596  N N    . ASP A 1 56  ? 30.622 20.997 15.565 1.00 0.00 ? 26 ASP A N    4  
ATOM 3597  C CA   . ASP A 1 56  ? 30.534 22.352 15.031 1.00 0.00 ? 26 ASP A CA   4  
ATOM 3598  C C    . ASP A 1 56  ? 31.427 23.303 15.817 1.00 0.00 ? 26 ASP A C    4  
ATOM 3599  O O    . ASP A 1 56  ? 32.096 24.156 15.232 1.00 0.00 ? 26 ASP A O    4  
ATOM 3600  C CB   . ASP A 1 56  ? 29.086 22.850 15.068 1.00 0.00 ? 26 ASP A CB   4  
ATOM 3601  C CG   . ASP A 1 56  ? 28.231 22.154 14.006 1.00 0.00 ? 26 ASP A CG   4  
ATOM 3602  O OD1  . ASP A 1 56  ? 27.178 22.685 13.693 1.00 0.00 ? 26 ASP A OD1  4  
ATOM 3603  O OD2  . ASP A 1 56  ? 28.621 21.099 13.527 1.00 0.00 ? 26 ASP A OD2  4  
ATOM 3604  H H    . ASP A 1 56  ? 29.823 20.573 15.942 1.00 0.00 ? 26 ASP A H    4  
ATOM 3605  H HA   . ASP A 1 56  ? 30.865 22.338 14.004 1.00 0.00 ? 26 ASP A HA   4  
ATOM 3606  H HB2  . ASP A 1 56  ? 28.668 22.653 16.043 1.00 0.00 ? 26 ASP A HB2  4  
ATOM 3607  H HB3  . ASP A 1 56  ? 29.075 23.915 14.887 1.00 0.00 ? 26 ASP A HB3  4  
ATOM 3608  N N    . ALA A 1 57  ? 31.478 23.125 17.136 1.00 0.00 ? 27 ALA A N    4  
ATOM 3609  C CA   . ALA A 1 57  ? 32.297 23.999 17.968 1.00 0.00 ? 27 ALA A CA   4  
ATOM 3610  C C    . ALA A 1 57  ? 33.762 23.900 17.551 1.00 0.00 ? 27 ALA A C    4  
ATOM 3611  O O    . ALA A 1 57  ? 34.435 24.918 17.371 1.00 0.00 ? 27 ALA A O    4  
ATOM 3612  C CB   . ALA A 1 57  ? 32.154 23.597 19.439 1.00 0.00 ? 27 ALA A CB   4  
ATOM 3613  H H    . ALA A 1 57  ? 30.926 22.431 17.555 1.00 0.00 ? 27 ALA A H    4  
ATOM 3614  H HA   . ALA A 1 57  ? 31.961 25.019 17.851 1.00 0.00 ? 27 ALA A HA   4  
ATOM 3615  H HB1  . ALA A 1 57  ? 32.259 24.473 20.063 1.00 0.00 ? 27 ALA A HB1  4  
ATOM 3616  H HB2  . ALA A 1 57  ? 32.917 22.879 19.698 1.00 0.00 ? 27 ALA A HB2  4  
ATOM 3617  H HB3  . ALA A 1 57  ? 31.180 23.158 19.599 1.00 0.00 ? 27 ALA A HB3  4  
ATOM 3618  N N    . LEU A 1 58  ? 34.243 22.675 17.354 1.00 0.00 ? 28 LEU A N    4  
ATOM 3619  C CA   . LEU A 1 58  ? 35.616 22.479 16.904 1.00 0.00 ? 28 LEU A CA   4  
ATOM 3620  C C    . LEU A 1 58  ? 35.845 23.145 15.551 1.00 0.00 ? 28 LEU A C    4  
ATOM 3621  O O    . LEU A 1 58  ? 36.886 23.765 15.329 1.00 0.00 ? 28 LEU A O    4  
ATOM 3622  C CB   . LEU A 1 58  ? 35.927 20.983 16.799 1.00 0.00 ? 28 LEU A CB   4  
ATOM 3623  C CG   . LEU A 1 58  ? 35.820 20.331 18.180 1.00 0.00 ? 28 LEU A CG   4  
ATOM 3624  C CD1  . LEU A 1 58  ? 35.950 18.814 18.037 1.00 0.00 ? 28 LEU A CD1  4  
ATOM 3625  C CD2  . LEU A 1 58  ? 36.945 20.848 19.079 1.00 0.00 ? 28 LEU A CD2  4  
ATOM 3626  H H    . LEU A 1 58  ? 33.676 21.896 17.534 1.00 0.00 ? 28 LEU A H    4  
ATOM 3627  H HA   . LEU A 1 58  ? 36.285 22.923 17.624 1.00 0.00 ? 28 LEU A HA   4  
ATOM 3628  H HB2  . LEU A 1 58  ? 35.224 20.518 16.125 1.00 0.00 ? 28 LEU A HB2  4  
ATOM 3629  H HB3  . LEU A 1 58  ? 36.930 20.852 16.419 1.00 0.00 ? 28 LEU A HB3  4  
ATOM 3630  H HG   . LEU A 1 58  ? 34.864 20.573 18.619 1.00 0.00 ? 28 LEU A HG   4  
ATOM 3631  H HD11 . LEU A 1 58  ? 35.024 18.409 17.654 1.00 0.00 ? 28 LEU A HD11 4  
ATOM 3632  H HD12 . LEU A 1 58  ? 36.161 18.378 19.002 1.00 0.00 ? 28 LEU A HD12 4  
ATOM 3633  H HD13 . LEU A 1 58  ? 36.753 18.583 17.353 1.00 0.00 ? 28 LEU A HD13 4  
ATOM 3634  H HD21 . LEU A 1 58  ? 37.862 20.907 18.513 1.00 0.00 ? 28 LEU A HD21 4  
ATOM 3635  H HD22 . LEU A 1 58  ? 37.078 20.174 19.912 1.00 0.00 ? 28 LEU A HD22 4  
ATOM 3636  H HD23 . LEU A 1 58  ? 36.688 21.831 19.448 1.00 0.00 ? 28 LEU A HD23 4  
ATOM 3637  N N    . GLN A 1 59  ? 34.857 23.052 14.660 1.00 0.00 ? 29 GLN A N    4  
ATOM 3638  C CA   . GLN A 1 59  ? 34.990 23.665 13.343 1.00 0.00 ? 29 GLN A CA   4  
ATOM 3639  C C    . GLN A 1 59  ? 35.174 25.178 13.455 1.00 0.00 ? 29 GLN A C    4  
ATOM 3640  O O    . GLN A 1 59  ? 36.061 25.749 12.817 1.00 0.00 ? 29 GLN A O    4  
ATOM 3641  C CB   . GLN A 1 59  ? 33.749 23.359 12.501 1.00 0.00 ? 29 GLN A CB   4  
ATOM 3642  C CG   . GLN A 1 59  ? 33.964 23.857 11.071 1.00 0.00 ? 29 GLN A CG   4  
ATOM 3643  C CD   . GLN A 1 59  ? 32.676 23.709 10.266 1.00 0.00 ? 29 GLN A CD   4  
ATOM 3644  O OE1  . GLN A 1 59  ? 31.641 24.256 10.645 1.00 0.00 ? 29 GLN A OE1  4  
ATOM 3645  N NE2  . GLN A 1 59  ? 32.680 22.995 9.174  1.00 0.00 ? 29 GLN A NE2  4  
ATOM 3646  H H    . GLN A 1 59  ? 34.057 22.526 14.875 1.00 0.00 ? 29 GLN A H    4  
ATOM 3647  H HA   . GLN A 1 59  ? 35.853 23.246 12.849 1.00 0.00 ? 29 GLN A HA   4  
ATOM 3648  H HB2  . GLN A 1 59  ? 33.577 22.293 12.489 1.00 0.00 ? 29 GLN A HB2  4  
ATOM 3649  H HB3  . GLN A 1 59  ? 32.892 23.859 12.927 1.00 0.00 ? 29 GLN A HB3  4  
ATOM 3650  H HG2  . GLN A 1 59  ? 34.255 24.897 11.094 1.00 0.00 ? 29 GLN A HG2  4  
ATOM 3651  H HG3  . GLN A 1 59  ? 34.745 23.276 10.603 1.00 0.00 ? 29 GLN A HG3  4  
ATOM 3652  H HE21 . GLN A 1 59  ? 33.506 22.560 8.875  1.00 0.00 ? 29 GLN A HE21 4  
ATOM 3653  H HE22 . GLN A 1 59  ? 31.857 22.894 8.651  1.00 0.00 ? 29 GLN A HE22 4  
ATOM 3654  N N    . TYR A 1 60  ? 34.364 25.820 14.296 1.00 0.00 ? 30 TYR A N    4  
ATOM 3655  C CA   . TYR A 1 60  ? 34.507 27.257 14.510 1.00 0.00 ? 30 TYR A CA   4  
ATOM 3656  C C    . TYR A 1 60  ? 35.889 27.594 15.057 1.00 0.00 ? 30 TYR A C    4  
ATOM 3657  O O    . TYR A 1 60  ? 36.521 28.550 14.602 1.00 0.00 ? 30 TYR A O    4  
ATOM 3658  C CB   . TYR A 1 60  ? 33.450 27.759 15.498 1.00 0.00 ? 30 TYR A CB   4  
ATOM 3659  C CG   . TYR A 1 60  ? 32.034 27.687 14.976 1.00 0.00 ? 30 TYR A CG   4  
ATOM 3660  C CD1  . TYR A 1 60  ? 31.125 26.788 15.546 1.00 0.00 ? 30 TYR A CD1  4  
ATOM 3661  C CD2  . TYR A 1 60  ? 31.628 28.524 13.932 1.00 0.00 ? 30 TYR A CD2  4  
ATOM 3662  C CE1  . TYR A 1 60  ? 29.810 26.724 15.069 1.00 0.00 ? 30 TYR A CE1  4  
ATOM 3663  C CE2  . TYR A 1 60  ? 30.314 28.461 13.455 1.00 0.00 ? 30 TYR A CE2  4  
ATOM 3664  C CZ   . TYR A 1 60  ? 29.404 27.561 14.024 1.00 0.00 ? 30 TYR A CZ   4  
ATOM 3665  O OH   . TYR A 1 60  ? 28.108 27.500 13.554 1.00 0.00 ? 30 TYR A OH   4  
ATOM 3666  H H    . TYR A 1 60  ? 33.636 25.335 14.734 1.00 0.00 ? 30 TYR A H    4  
ATOM 3667  H HA   . TYR A 1 60  ? 34.370 27.767 13.567 1.00 0.00 ? 30 TYR A HA   4  
ATOM 3668  H HB2  . TYR A 1 60  ? 33.510 27.165 16.396 1.00 0.00 ? 30 TYR A HB2  4  
ATOM 3669  H HB3  . TYR A 1 60  ? 33.680 28.784 15.752 1.00 0.00 ? 30 TYR A HB3  4  
ATOM 3670  H HD1  . TYR A 1 60  ? 31.438 26.142 16.352 1.00 0.00 ? 30 TYR A HD1  4  
ATOM 3671  H HD2  . TYR A 1 60  ? 32.329 29.219 13.492 1.00 0.00 ? 30 TYR A HD2  4  
ATOM 3672  H HE1  . TYR A 1 60  ? 29.109 26.030 15.509 1.00 0.00 ? 30 TYR A HE1  4  
ATOM 3673  H HE2  . TYR A 1 60  ? 30.000 29.108 12.650 1.00 0.00 ? 30 TYR A HE2  4  
ATOM 3674  H HH   . TYR A 1 60  ? 28.086 27.897 12.746 1.00 0.00 ? 30 TYR A HH   4  
ATOM 3675  N N    . TYR A 1 61  ? 36.376 26.791 16.003 1.00 0.00 ? 31 TYR A N    4  
ATOM 3676  C CA   . TYR A 1 61  ? 37.686 27.058 16.591 1.00 0.00 ? 31 TYR A CA   4  
ATOM 3677  C C    . TYR A 1 61  ? 38.782 26.982 15.535 1.00 0.00 ? 31 TYR A C    4  
ATOM 3678  O O    . TYR A 1 61  ? 39.677 27.828 15.498 1.00 0.00 ? 31 TYR A O    4  
ATOM 3679  C CB   . TYR A 1 61  ? 37.988 26.052 17.706 1.00 0.00 ? 31 TYR A CB   4  
ATOM 3680  C CG   . TYR A 1 61  ? 36.995 26.067 18.848 1.00 0.00 ? 31 TYR A CG   4  
ATOM 3681  C CD1  . TYR A 1 61  ? 36.456 27.276 19.309 1.00 0.00 ? 31 TYR A CD1  4  
ATOM 3682  C CD2  . TYR A 1 61  ? 36.619 24.862 19.454 1.00 0.00 ? 31 TYR A CD2  4  
ATOM 3683  C CE1  . TYR A 1 61  ? 35.541 27.277 20.369 1.00 0.00 ? 31 TYR A CE1  4  
ATOM 3684  C CE2  . TYR A 1 61  ? 35.704 24.863 20.514 1.00 0.00 ? 31 TYR A CE2  4  
ATOM 3685  C CZ   . TYR A 1 61  ? 35.165 26.071 20.971 1.00 0.00 ? 31 TYR A CZ   4  
ATOM 3686  O OH   . TYR A 1 61  ? 34.263 26.072 22.016 1.00 0.00 ? 31 TYR A OH   4  
ATOM 3687  H H    . TYR A 1 61  ? 35.837 26.040 16.331 1.00 0.00 ? 31 TYR A H    4  
ATOM 3688  H HA   . TYR A 1 61  ? 37.679 28.051 17.015 1.00 0.00 ? 31 TYR A HA   4  
ATOM 3689  H HB2  . TYR A 1 61  ? 37.998 25.060 17.281 1.00 0.00 ? 31 TYR A HB2  4  
ATOM 3690  H HB3  . TYR A 1 61  ? 38.974 26.264 18.097 1.00 0.00 ? 31 TYR A HB3  4  
ATOM 3691  H HD1  . TYR A 1 61  ? 36.744 28.207 18.844 1.00 0.00 ? 31 TYR A HD1  4  
ATOM 3692  H HD2  . TYR A 1 61  ? 37.036 23.930 19.104 1.00 0.00 ? 31 TYR A HD2  4  
ATOM 3693  H HE1  . TYR A 1 61  ? 35.127 28.209 20.723 1.00 0.00 ? 31 TYR A HE1  4  
ATOM 3694  H HE2  . TYR A 1 61  ? 35.414 23.932 20.979 1.00 0.00 ? 31 TYR A HE2  4  
ATOM 3695  H HH   . TYR A 1 61  ? 34.710 26.289 22.768 1.00 0.00 ? 31 TYR A HH   4  
ATOM 3696  N N    . ALA A 1 62  ? 38.676 26.007 14.634 1.00 0.00 ? 32 ALA A N    4  
ATOM 3697  C CA   . ALA A 1 62  ? 39.679 25.852 13.587 1.00 0.00 ? 32 ALA A CA   4  
ATOM 3698  C C    . ALA A 1 62  ? 39.690 27.066 12.665 1.00 0.00 ? 32 ALA A C    4  
ATOM 3699  O O    . ALA A 1 62  ? 40.753 27.603 12.342 1.00 0.00 ? 32 ALA A O    4  
ATOM 3700  C CB   . ALA A 1 62  ? 39.389 24.591 12.772 1.00 0.00 ? 32 ALA A CB   4  
ATOM 3701  H H    . ALA A 1 62  ? 37.937 25.366 14.698 1.00 0.00 ? 32 ALA A H    4  
ATOM 3702  H HA   . ALA A 1 62  ? 40.651 25.753 14.046 1.00 0.00 ? 32 ALA A HA   4  
ATOM 3703  H HB1  . ALA A 1 62  ? 39.875 24.664 11.810 1.00 0.00 ? 32 ALA A HB1  4  
ATOM 3704  H HB2  . ALA A 1 62  ? 38.324 24.491 12.629 1.00 0.00 ? 32 ALA A HB2  4  
ATOM 3705  H HB3  . ALA A 1 62  ? 39.764 23.726 13.300 1.00 0.00 ? 32 ALA A HB3  4  
ATOM 3706  N N    . ALA A 1 63  ? 38.501 27.528 12.284 1.00 0.00 ? 33 ALA A N    4  
ATOM 3707  C CA   . ALA A 1 63  ? 38.405 28.696 11.416 1.00 0.00 ? 33 ALA A CA   4  
ATOM 3708  C C    . ALA A 1 63  ? 38.984 29.928 12.104 1.00 0.00 ? 33 ALA A C    4  
ATOM 3709  O O    . ALA A 1 63  ? 39.690 30.718 11.480 1.00 0.00 ? 33 ALA A O    4  
ATOM 3710  C CB   . ALA A 1 63  ? 36.942 28.954 11.049 1.00 0.00 ? 33 ALA A CB   4  
ATOM 3711  H H    . ALA A 1 63  ? 37.685 27.060 12.562 1.00 0.00 ? 33 ALA A H    4  
ATOM 3712  H HA   . ALA A 1 63  ? 38.962 28.507 10.512 1.00 0.00 ? 33 ALA A HA   4  
ATOM 3713  H HB1  . ALA A 1 63  ? 36.677 28.358 10.189 1.00 0.00 ? 33 ALA A HB1  4  
ATOM 3714  H HB2  . ALA A 1 63  ? 36.808 30.001 10.815 1.00 0.00 ? 33 ALA A HB2  4  
ATOM 3715  H HB3  . ALA A 1 63  ? 36.309 28.687 11.882 1.00 0.00 ? 33 ALA A HB3  4  
ATOM 3716  N N    . ALA A 1 64  ? 38.718 30.067 13.402 1.00 0.00 ? 34 ALA A N    4  
ATOM 3717  C CA   . ALA A 1 64  ? 39.208 31.225 14.140 1.00 0.00 ? 34 ALA A CA   4  
ATOM 3718  C C    . ALA A 1 64  ? 40.735 31.271 14.147 1.00 0.00 ? 34 ALA A C    4  
ATOM 3719  O O    . ALA A 1 64  ? 41.330 32.319 13.880 1.00 0.00 ? 34 ALA A O    4  
ATOM 3720  C CB   . ALA A 1 64  ? 38.669 31.183 15.575 1.00 0.00 ? 34 ALA A CB   4  
ATOM 3721  H H    . ALA A 1 64  ? 38.158 29.404 13.856 1.00 0.00 ? 34 ALA A H    4  
ATOM 3722  H HA   . ALA A 1 64  ? 38.838 32.120 13.662 1.00 0.00 ? 34 ALA A HA   4  
ATOM 3723  H HB1  . ALA A 1 64  ? 38.396 32.180 15.885 1.00 0.00 ? 34 ALA A HB1  4  
ATOM 3724  H HB2  . ALA A 1 64  ? 39.422 30.791 16.244 1.00 0.00 ? 34 ALA A HB2  4  
ATOM 3725  H HB3  . ALA A 1 64  ? 37.796 30.547 15.610 1.00 0.00 ? 34 ALA A HB3  4  
ATOM 3726  N N    . ILE A 1 65  ? 41.370 30.127 14.401 1.00 0.00 ? 35 ILE A N    4  
ATOM 3727  C CA   . ILE A 1 65  ? 42.831 30.079 14.408 1.00 0.00 ? 35 ILE A CA   4  
ATOM 3728  C C    . ILE A 1 65  ? 43.381 30.452 13.034 1.00 0.00 ? 35 ILE A C    4  
ATOM 3729  O O    . ILE A 1 65  ? 44.332 31.232 12.934 1.00 0.00 ? 35 ILE A O    4  
ATOM 3730  C CB   . ILE A 1 65  ? 43.306 28.679 14.819 1.00 0.00 ? 35 ILE A CB   4  
ATOM 3731  C CG1  . ILE A 1 65  ? 42.775 28.357 16.217 1.00 0.00 ? 35 ILE A CG1  4  
ATOM 3732  C CG2  . ILE A 1 65  ? 44.838 28.621 14.853 1.00 0.00 ? 35 ILE A CG2  4  
ATOM 3733  C CD1  . ILE A 1 65  ? 43.017 26.879 16.529 1.00 0.00 ? 35 ILE A CD1  4  
ATOM 3734  H H    . ILE A 1 65  ? 40.855 29.321 14.616 1.00 0.00 ? 35 ILE A H    4  
ATOM 3735  H HA   . ILE A 1 65  ? 43.195 30.794 15.132 1.00 0.00 ? 35 ILE A HA   4  
ATOM 3736  H HB   . ILE A 1 65  ? 42.934 27.950 14.115 1.00 0.00 ? 35 ILE A HB   4  
ATOM 3737  H HG12 . ILE A 1 65  ? 43.290 28.967 16.945 1.00 0.00 ? 35 ILE A HG12 4  
ATOM 3738  H HG13 . ILE A 1 65  ? 41.718 28.564 16.260 1.00 0.00 ? 35 ILE A HG13 4  
ATOM 3739  H HG21 . ILE A 1 65  ? 45.228 28.835 13.870 1.00 0.00 ? 35 ILE A HG21 4  
ATOM 3740  H HG22 . ILE A 1 65  ? 45.154 27.634 15.158 1.00 0.00 ? 35 ILE A HG22 4  
ATOM 3741  H HG23 . ILE A 1 65  ? 45.211 29.351 15.556 1.00 0.00 ? 35 ILE A HG23 4  
ATOM 3742  H HD11 . ILE A 1 65  ? 42.383 26.576 17.350 1.00 0.00 ? 35 ILE A HD11 4  
ATOM 3743  H HD12 . ILE A 1 65  ? 44.052 26.734 16.801 1.00 0.00 ? 35 ILE A HD12 4  
ATOM 3744  H HD13 . ILE A 1 65  ? 42.787 26.285 15.657 1.00 0.00 ? 35 ILE A HD13 4  
ATOM 3745  N N    . THR A 1 66  ? 42.773 29.918 11.974 1.00 0.00 ? 36 THR A N    4  
ATOM 3746  C CA   . THR A 1 66  ? 43.231 30.232 10.625 1.00 0.00 ? 36 THR A CA   4  
ATOM 3747  C C    . THR A 1 66  ? 43.107 31.729 10.346 1.00 0.00 ? 36 THR A C    4  
ATOM 3748  O O    . THR A 1 66  ? 44.021 32.350 9.800  1.00 0.00 ? 36 THR A O    4  
ATOM 3749  C CB   . THR A 1 66  ? 42.411 29.454 9.595  1.00 0.00 ? 36 THR A CB   4  
ATOM 3750  O OG1  . THR A 1 66  ? 42.301 28.097 9.998  1.00 0.00 ? 36 THR A OG1  4  
ATOM 3751  C CG2  . THR A 1 66  ? 43.113 29.525 8.239  1.00 0.00 ? 36 THR A CG2  4  
ATOM 3752  H H    . THR A 1 66  ? 42.034 29.283 12.103 1.00 0.00 ? 36 THR A H    4  
ATOM 3753  H HA   . THR A 1 66  ? 44.268 29.945 10.532 1.00 0.00 ? 36 THR A HA   4  
ATOM 3754  H HB   . THR A 1 66  ? 41.427 29.890 9.510  1.00 0.00 ? 36 THR A HB   4  
ATOM 3755  H HG1  . THR A 1 66  ? 41.761 27.675 9.412  1.00 0.00 ? 36 THR A HG1  4  
ATOM 3756  H HG21 . THR A 1 66  ? 42.617 28.865 7.543  1.00 0.00 ? 36 THR A HG21 4  
ATOM 3757  H HG22 . THR A 1 66  ? 44.143 29.221 8.350  1.00 0.00 ? 36 THR A HG22 4  
ATOM 3758  H HG23 . THR A 1 66  ? 43.075 30.537 7.864  1.00 0.00 ? 36 THR A HG23 4  
ATOM 3759  N N    . LEU A 1 67  ? 41.991 32.318 10.767 1.00 0.00 ? 37 LEU A N    4  
ATOM 3760  C CA   . LEU A 1 67  ? 41.780 33.749 10.574 1.00 0.00 ? 37 LEU A CA   4  
ATOM 3761  C C    . LEU A 1 67  ? 42.854 34.572 11.281 1.00 0.00 ? 37 LEU A C    4  
ATOM 3762  O O    . LEU A 1 67  ? 43.245 35.634 10.795 1.00 0.00 ? 37 LEU A O    4  
ATOM 3763  C CB   . LEU A 1 67  ? 40.397 34.148 11.092 1.00 0.00 ? 37 LEU A CB   4  
ATOM 3764  C CG   . LEU A 1 67  ? 39.323 33.539 10.189 1.00 0.00 ? 37 LEU A CG   4  
ATOM 3765  C CD1  . LEU A 1 67  ? 37.954 33.671 10.858 1.00 0.00 ? 37 LEU A CD1  4  
ATOM 3766  C CD2  . LEU A 1 67  ? 39.308 34.281 8.851  1.00 0.00 ? 37 LEU A CD2  4  
ATOM 3767  H H    . LEU A 1 67  ? 41.288 31.779 11.187 1.00 0.00 ? 37 LEU A H    4  
ATOM 3768  H HA   . LEU A 1 67  ? 41.824 33.964 9.518  1.00 0.00 ? 37 LEU A HA   4  
ATOM 3769  H HB2  . LEU A 1 67  ? 40.272 33.782 12.101 1.00 0.00 ? 37 LEU A HB2  4  
ATOM 3770  H HB3  . LEU A 1 67  ? 40.304 35.224 11.083 1.00 0.00 ? 37 LEU A HB3  4  
ATOM 3771  H HG   . LEU A 1 67  ? 39.543 32.495 10.020 1.00 0.00 ? 37 LEU A HG   4  
ATOM 3772  H HD11 . LEU A 1 67  ? 37.907 34.600 11.406 1.00 0.00 ? 37 LEU A HD11 4  
ATOM 3773  H HD12 . LEU A 1 67  ? 37.808 32.844 11.535 1.00 0.00 ? 37 LEU A HD12 4  
ATOM 3774  H HD13 . LEU A 1 67  ? 37.180 33.658 10.103 1.00 0.00 ? 37 LEU A HD13 4  
ATOM 3775  H HD21 . LEU A 1 67  ? 38.343 34.162 8.382  1.00 0.00 ? 37 LEU A HD21 4  
ATOM 3776  H HD22 . LEU A 1 67  ? 40.075 33.876 8.206  1.00 0.00 ? 37 LEU A HD22 4  
ATOM 3777  H HD23 . LEU A 1 67  ? 39.499 35.331 9.020  1.00 0.00 ? 37 LEU A HD23 4  
ATOM 3778  N N    . ASP A 1 68  ? 43.298 34.102 12.445 1.00 0.00 ? 38 ASP A N    4  
ATOM 3779  C CA   . ASP A 1 68  ? 44.396 34.761 13.143 1.00 0.00 ? 38 ASP A CA   4  
ATOM 3780  C C    . ASP A 1 68  ? 45.686 34.681 12.331 1.00 0.00 ? 38 ASP A C    4  
ATOM 3781  O O    . ASP A 1 68  ? 46.365 35.688 12.128 1.00 0.00 ? 38 ASP A O    4  
ATOM 3782  C CB   . ASP A 1 68  ? 44.611 34.106 14.508 1.00 0.00 ? 38 ASP A CB   4  
ATOM 3783  C CG   . ASP A 1 68  ? 45.646 34.893 15.306 1.00 0.00 ? 38 ASP A CG   4  
ATOM 3784  O OD1  . ASP A 1 68  ? 46.805 34.512 15.272 1.00 0.00 ? 38 ASP A OD1  4  
ATOM 3785  O OD2  . ASP A 1 68  ? 45.265 35.863 15.939 1.00 0.00 ? 38 ASP A OD2  4  
ATOM 3786  H H    . ASP A 1 68  ? 42.852 33.334 12.858 1.00 0.00 ? 38 ASP A H    4  
ATOM 3787  H HA   . ASP A 1 68  ? 44.140 35.799 13.292 1.00 0.00 ? 38 ASP A HA   4  
ATOM 3788  H HB2  . ASP A 1 68  ? 43.676 34.091 15.049 1.00 0.00 ? 38 ASP A HB2  4  
ATOM 3789  H HB3  . ASP A 1 68  ? 44.961 33.095 14.370 1.00 0.00 ? 38 ASP A HB3  4  
ATOM 3790  N N    . LYS A 1 69  ? 46.024 33.479 11.871 1.00 0.00 ? 39 LYS A N    4  
ATOM 3791  C CA   . LYS A 1 69  ? 47.245 33.291 11.091 1.00 0.00 ? 39 LYS A CA   4  
ATOM 3792  C C    . LYS A 1 69  ? 47.249 34.124 9.809  1.00 0.00 ? 39 LYS A C    4  
ATOM 3793  O O    . LYS A 1 69  ? 48.311 34.536 9.341  1.00 0.00 ? 39 LYS A O    4  
ATOM 3794  C CB   . LYS A 1 69  ? 47.409 31.813 10.730 1.00 0.00 ? 39 LYS A CB   4  
ATOM 3795  C CG   . LYS A 1 69  ? 47.621 30.992 12.003 1.00 0.00 ? 39 LYS A CG   4  
ATOM 3796  C CD   . LYS A 1 69  ? 47.891 29.532 11.628 1.00 0.00 ? 39 LYS A CD   4  
ATOM 3797  C CE   . LYS A 1 69  ? 47.996 28.688 12.898 1.00 0.00 ? 39 LYS A CE   4  
ATOM 3798  N NZ   . LYS A 1 69  ? 47.665 27.270 12.580 1.00 0.00 ? 39 LYS A NZ   4  
ATOM 3799  H H    . LYS A 1 69  ? 45.457 32.707 12.078 1.00 0.00 ? 39 LYS A H    4  
ATOM 3800  H HA   . LYS A 1 69  ? 48.089 33.587 11.696 1.00 0.00 ? 39 LYS A HA   4  
ATOM 3801  H HB2  . LYS A 1 69  ? 46.520 31.468 10.222 1.00 0.00 ? 39 LYS A HB2  4  
ATOM 3802  H HB3  . LYS A 1 69  ? 48.264 31.694 10.081 1.00 0.00 ? 39 LYS A HB3  4  
ATOM 3803  H HG2  . LYS A 1 69  ? 48.466 31.387 12.548 1.00 0.00 ? 39 LYS A HG2  4  
ATOM 3804  H HG3  . LYS A 1 69  ? 46.736 31.044 12.618 1.00 0.00 ? 39 LYS A HG3  4  
ATOM 3805  H HD2  . LYS A 1 69  ? 47.081 29.164 11.015 1.00 0.00 ? 39 LYS A HD2  4  
ATOM 3806  H HD3  . LYS A 1 69  ? 48.817 29.467 11.077 1.00 0.00 ? 39 LYS A HD3  4  
ATOM 3807  H HE2  . LYS A 1 69  ? 49.002 28.743 13.286 1.00 0.00 ? 39 LYS A HE2  4  
ATOM 3808  H HE3  . LYS A 1 69  ? 47.304 29.060 13.638 1.00 0.00 ? 39 LYS A HE3  4  
ATOM 3809  H HZ1  . LYS A 1 69  ? 47.145 26.846 13.374 1.00 0.00 ? 39 LYS A HZ1  4  
ATOM 3810  H HZ2  . LYS A 1 69  ? 48.545 26.737 12.419 1.00 0.00 ? 39 LYS A HZ2  4  
ATOM 3811  H HZ3  . LYS A 1 69  ? 47.076 27.234 11.724 1.00 0.00 ? 39 LYS A HZ3  4  
ATOM 3812  N N    . TYR A 1 70  ? 46.070 34.374 9.244  1.00 0.00 ? 40 TYR A N    4  
ATOM 3813  C CA   . TYR A 1 70  ? 45.979 35.153 8.014  1.00 0.00 ? 40 TYR A CA   4  
ATOM 3814  C C    . TYR A 1 70  ? 46.602 36.543 8.224  1.00 0.00 ? 40 TYR A C    4  
ATOM 3815  O O    . TYR A 1 70  ? 46.288 37.201 9.217  1.00 0.00 ? 40 TYR A O    4  
ATOM 3816  C CB   . TYR A 1 70  ? 44.500 35.255 7.630  1.00 0.00 ? 40 TYR A CB   4  
ATOM 3817  C CG   . TYR A 1 70  ? 44.232 35.902 6.293  1.00 0.00 ? 40 TYR A CG   4  
ATOM 3818  C CD1  . TYR A 1 70  ? 44.578 35.244 5.108  1.00 0.00 ? 40 TYR A CD1  4  
ATOM 3819  C CD2  . TYR A 1 70  ? 43.593 37.144 6.244  1.00 0.00 ? 40 TYR A CD2  4  
ATOM 3820  C CE1  . TYR A 1 70  ? 44.291 35.835 3.871  1.00 0.00 ? 40 TYR A CE1  4  
ATOM 3821  C CE2  . TYR A 1 70  ? 43.306 37.737 5.010  1.00 0.00 ? 40 TYR A CE2  4  
ATOM 3822  C CZ   . TYR A 1 70  ? 43.657 37.083 3.822  1.00 0.00 ? 40 TYR A CZ   4  
ATOM 3823  O OH   . TYR A 1 70  ? 43.372 37.665 2.604  1.00 0.00 ? 40 TYR A OH   4  
ATOM 3824  H H    . TYR A 1 70  ? 45.258 33.981 9.628  1.00 0.00 ? 40 TYR A H    4  
ATOM 3825  H HA   . TYR A 1 70  ? 46.501 34.614 7.241  1.00 0.00 ? 40 TYR A HA   4  
ATOM 3826  H HB2  . TYR A 1 70  ? 44.084 34.261 7.608  1.00 0.00 ? 40 TYR A HB2  4  
ATOM 3827  H HB3  . TYR A 1 70  ? 43.991 35.817 8.400  1.00 0.00 ? 40 TYR A HB3  4  
ATOM 3828  H HD1  . TYR A 1 70  ? 45.073 34.284 5.146  1.00 0.00 ? 40 TYR A HD1  4  
ATOM 3829  H HD2  . TYR A 1 70  ? 43.321 37.646 7.160  1.00 0.00 ? 40 TYR A HD2  4  
ATOM 3830  H HE1  . TYR A 1 70  ? 44.558 35.328 2.956  1.00 0.00 ? 40 TYR A HE1  4  
ATOM 3831  H HE2  . TYR A 1 70  ? 42.812 38.696 4.974  1.00 0.00 ? 40 TYR A HE2  4  
ATOM 3832  H HH   . TYR A 1 70  ? 44.089 38.148 2.353  1.00 0.00 ? 40 TYR A HH   4  
ATOM 3833  N N    . PRO A 1 71  ? 47.464 37.013 7.343  1.00 0.00 ? 41 PRO A N    4  
ATOM 3834  C CA   . PRO A 1 71  ? 48.240 38.266 7.597  1.00 0.00 ? 41 PRO A CA   4  
ATOM 3835  C C    . PRO A 1 71  ? 47.519 39.566 7.242  1.00 0.00 ? 41 PRO A C    4  
ATOM 3836  O O    . PRO A 1 71  ? 48.164 40.615 7.178  1.00 0.00 ? 41 PRO A O    4  
ATOM 3837  C CB   . PRO A 1 71  ? 49.476 38.083 6.717  1.00 0.00 ? 41 PRO A CB   4  
ATOM 3838  C CG   . PRO A 1 71  ? 49.008 37.288 5.546  1.00 0.00 ? 41 PRO A CG   4  
ATOM 3839  C CD   . PRO A 1 71  ? 47.787 36.483 6.003  1.00 0.00 ? 41 PRO A CD   4  
ATOM 3840  H HA   . PRO A 1 71  ? 48.555 38.296 8.629  1.00 0.00 ? 41 PRO A HA   4  
ATOM 3841  H HB2  . PRO A 1 71  ? 49.851 39.046 6.398  1.00 0.00 ? 41 PRO A HB2  4  
ATOM 3842  H HB3  . PRO A 1 71  ? 50.240 37.537 7.249  1.00 0.00 ? 41 PRO A HB3  4  
ATOM 3843  H HG2  . PRO A 1 71  ? 48.737 37.951 4.737  1.00 0.00 ? 41 PRO A HG2  4  
ATOM 3844  H HG3  . PRO A 1 71  ? 49.783 36.609 5.225  1.00 0.00 ? 41 PRO A HG3  4  
ATOM 3845  H HD2  . PRO A 1 71  ? 46.962 36.636 5.323  1.00 0.00 ? 41 PRO A HD2  4  
ATOM 3846  H HD3  . PRO A 1 71  ? 48.034 35.434 6.071  1.00 0.00 ? 41 PRO A HD3  4  
ATOM 3847  N N    . HIS A 1 72  ? 46.207 39.519 7.012  1.00 0.00 ? 42 HIS A N    4  
ATOM 3848  C CA   . HIS A 1 72  ? 45.488 40.718 6.580  1.00 0.00 ? 42 HIS A CA   4  
ATOM 3849  C C    . HIS A 1 72  ? 44.083 40.791 7.165  1.00 0.00 ? 42 HIS A C    4  
ATOM 3850  O O    . HIS A 1 72  ? 43.464 39.767 7.451  1.00 0.00 ? 42 HIS A O    4  
ATOM 3851  C CB   . HIS A 1 72  ? 45.399 40.745 5.053  1.00 0.00 ? 42 HIS A CB   4  
ATOM 3852  C CG   . HIS A 1 72  ? 46.731 40.934 4.380  1.00 0.00 ? 42 HIS A CG   4  
ATOM 3853  N ND1  . HIS A 1 72  ? 47.475 39.868 3.902  1.00 0.00 ? 42 HIS A ND1  4  
ATOM 3854  C CD2  . HIS A 1 72  ? 47.466 42.060 4.098  1.00 0.00 ? 42 HIS A CD2  4  
ATOM 3855  C CE1  . HIS A 1 72  ? 48.602 40.367 3.364  1.00 0.00 ? 42 HIS A CE1  4  
ATOM 3856  N NE2  . HIS A 1 72  ? 48.648 41.699 3.456  1.00 0.00 ? 42 HIS A NE2  4  
ATOM 3857  H H    . HIS A 1 72  ? 45.721 38.678 7.140  1.00 0.00 ? 42 HIS A H    4  
ATOM 3858  H HA   . HIS A 1 72  ? 46.039 41.589 6.902  1.00 0.00 ? 42 HIS A HA   4  
ATOM 3859  H HB2  . HIS A 1 72  ? 44.975 39.814 4.713  1.00 0.00 ? 42 HIS A HB2  4  
ATOM 3860  H HB3  . HIS A 1 72  ? 44.739 41.550 4.761  1.00 0.00 ? 42 HIS A HB3  4  
ATOM 3861  H HD1  . HIS A 1 72  ? 47.226 38.921 3.946  1.00 0.00 ? 42 HIS A HD1  4  
ATOM 3862  H HD2  . HIS A 1 72  ? 47.173 43.071 4.339  1.00 0.00 ? 42 HIS A HD2  4  
ATOM 3863  H HE1  . HIS A 1 72  ? 49.375 39.765 2.910  1.00 0.00 ? 42 HIS A HE1  4  
ATOM 3864  N N    . LYS A 1 73  ? 43.594 42.012 7.368  1.00 0.00 ? 43 LYS A N    4  
ATOM 3865  C CA   . LYS A 1 73  ? 42.195 42.198 7.730  1.00 0.00 ? 43 LYS A CA   4  
ATOM 3866  C C    . LYS A 1 73  ? 41.315 41.696 6.590  1.00 0.00 ? 43 LYS A C    4  
ATOM 3867  O O    . LYS A 1 73  ? 41.557 42.030 5.430  1.00 0.00 ? 43 LYS A O    4  
ATOM 3868  C CB   . LYS A 1 73  ? 41.905 43.681 7.966  1.00 0.00 ? 43 LYS A CB   4  
ATOM 3869  C CG   . LYS A 1 73  ? 40.492 43.842 8.533  1.00 0.00 ? 43 LYS A CG   4  
ATOM 3870  C CD   . LYS A 1 73  ? 40.169 45.329 8.690  1.00 0.00 ? 43 LYS A CD   4  
ATOM 3871  C CE   . LYS A 1 73  ? 38.821 45.488 9.396  1.00 0.00 ? 43 LYS A CE   4  
ATOM 3872  N NZ   . LYS A 1 73  ? 38.633 46.912 9.790  1.00 0.00 ? 43 LYS A NZ   4  
ATOM 3873  H H    . LYS A 1 73  ? 44.181 42.792 7.281  1.00 0.00 ? 43 LYS A H    4  
ATOM 3874  H HA   . LYS A 1 73  ? 41.976 41.641 8.629  1.00 0.00 ? 43 LYS A HA   4  
ATOM 3875  H HB2  . LYS A 1 73  ? 42.625 44.086 8.661  1.00 0.00 ? 43 LYS A HB2  4  
ATOM 3876  H HB3  . LYS A 1 73  ? 41.973 44.214 7.029  1.00 0.00 ? 43 LYS A HB3  4  
ATOM 3877  H HG2  . LYS A 1 73  ? 39.781 43.386 7.859  1.00 0.00 ? 43 LYS A HG2  4  
ATOM 3878  H HG3  . LYS A 1 73  ? 40.434 43.360 9.498  1.00 0.00 ? 43 LYS A HG3  4  
ATOM 3879  H HD2  . LYS A 1 73  ? 40.942 45.805 9.275  1.00 0.00 ? 43 LYS A HD2  4  
ATOM 3880  H HD3  . LYS A 1 73  ? 40.119 45.792 7.715  1.00 0.00 ? 43 LYS A HD3  4  
ATOM 3881  H HE2  . LYS A 1 73  ? 38.028 45.191 8.727  1.00 0.00 ? 43 LYS A HE2  4  
ATOM 3882  H HE3  . LYS A 1 73  ? 38.802 44.865 10.277 1.00 0.00 ? 43 LYS A HE3  4  
ATOM 3883  H HZ1  . LYS A 1 73  ? 39.444 47.225 10.361 1.00 0.00 ? 43 LYS A HZ1  4  
ATOM 3884  H HZ2  . LYS A 1 73  ? 37.758 47.005 10.348 1.00 0.00 ? 43 LYS A HZ2  4  
ATOM 3885  H HZ3  . LYS A 1 73  ? 38.564 47.503 8.936  1.00 0.00 ? 43 LYS A HZ3  4  
ATOM 3886  N N    . ILE A 1 74  ? 40.303 40.898 6.917  1.00 0.00 ? 44 ILE A N    4  
ATOM 3887  C CA   . ILE A 1 74  ? 39.379 40.417 5.893  1.00 0.00 ? 44 ILE A CA   4  
ATOM 3888  C C    . ILE A 1 74  ? 38.195 41.375 5.751  1.00 0.00 ? 44 ILE A C    4  
ATOM 3889  O O    . ILE A 1 74  ? 37.577 41.766 6.741  1.00 0.00 ? 44 ILE A O    4  
ATOM 3890  C CB   . ILE A 1 74  ? 38.919 38.994 6.235  1.00 0.00 ? 44 ILE A CB   4  
ATOM 3891  C CG1  . ILE A 1 74  ? 40.153 38.087 6.293  1.00 0.00 ? 44 ILE A CG1  4  
ATOM 3892  C CG2  . ILE A 1 74  ? 37.959 38.473 5.160  1.00 0.00 ? 44 ILE A CG2  4  
ATOM 3893  C CD1  . ILE A 1 74  ? 39.762 36.700 6.801  1.00 0.00 ? 44 ILE A CD1  4  
ATOM 3894  H H    . ILE A 1 74  ? 40.194 40.612 7.851  1.00 0.00 ? 44 ILE A H    4  
ATOM 3895  H HA   . ILE A 1 74  ? 39.904 40.387 4.948  1.00 0.00 ? 44 ILE A HA   4  
ATOM 3896  H HB   . ILE A 1 74  ? 38.424 38.993 7.194  1.00 0.00 ? 44 ILE A HB   4  
ATOM 3897  H HG12 . ILE A 1 74  ? 40.578 37.998 5.304  1.00 0.00 ? 44 ILE A HG12 4  
ATOM 3898  H HG13 . ILE A 1 74  ? 40.883 38.518 6.960  1.00 0.00 ? 44 ILE A HG13 4  
ATOM 3899  H HG21 . ILE A 1 74  ? 38.433 38.538 4.193  1.00 0.00 ? 44 ILE A HG21 4  
ATOM 3900  H HG22 . ILE A 1 74  ? 37.064 39.074 5.164  1.00 0.00 ? 44 ILE A HG22 4  
ATOM 3901  H HG23 . ILE A 1 74  ? 37.702 37.445 5.369  1.00 0.00 ? 44 ILE A HG23 4  
ATOM 3902  H HD11 . ILE A 1 74  ? 39.342 36.124 5.989  1.00 0.00 ? 44 ILE A HD11 4  
ATOM 3903  H HD12 . ILE A 1 74  ? 39.031 36.797 7.591  1.00 0.00 ? 44 ILE A HD12 4  
ATOM 3904  H HD13 . ILE A 1 74  ? 40.640 36.198 7.181  1.00 0.00 ? 44 ILE A HD13 4  
ATOM 3905  N N    . LYS A 1 75  ? 37.889 41.744 4.510  1.00 0.00 ? 45 LYS A N    4  
ATOM 3906  C CA   . LYS A 1 75  ? 36.811 42.696 4.242  1.00 0.00 ? 45 LYS A CA   4  
ATOM 3907  C C    . LYS A 1 75  ? 35.429 42.037 4.199  1.00 0.00 ? 45 LYS A C    4  
ATOM 3908  O O    . LYS A 1 75  ? 34.419 42.726 4.340  1.00 0.00 ? 45 LYS A O    4  
ATOM 3909  C CB   . LYS A 1 75  ? 37.070 43.399 2.908  1.00 0.00 ? 45 LYS A CB   4  
ATOM 3910  C CG   . LYS A 1 75  ? 38.363 44.212 2.999  1.00 0.00 ? 45 LYS A CG   4  
ATOM 3911  C CD   . LYS A 1 75  ? 38.565 44.995 1.699  1.00 0.00 ? 45 LYS A CD   4  
ATOM 3912  C CE   . LYS A 1 75  ? 39.919 45.706 1.735  1.00 0.00 ? 45 LYS A CE   4  
ATOM 3913  N NZ   . LYS A 1 75  ? 39.803 46.954 2.539  1.00 0.00 ? 45 LYS A NZ   4  
ATOM 3914  H H    . LYS A 1 75  ? 38.396 41.369 3.759  1.00 0.00 ? 45 LYS A H    4  
ATOM 3915  H HA   . LYS A 1 75  ? 36.807 43.439 5.024  1.00 0.00 ? 45 LYS A HA   4  
ATOM 3916  H HB2  . LYS A 1 75  ? 37.161 42.661 2.125  1.00 0.00 ? 45 LYS A HB2  4  
ATOM 3917  H HB3  . LYS A 1 75  ? 36.247 44.062 2.686  1.00 0.00 ? 45 LYS A HB3  4  
ATOM 3918  H HG2  . LYS A 1 75  ? 38.298 44.900 3.829  1.00 0.00 ? 45 LYS A HG2  4  
ATOM 3919  H HG3  . LYS A 1 75  ? 39.198 43.545 3.147  1.00 0.00 ? 45 LYS A HG3  4  
ATOM 3920  H HD2  . LYS A 1 75  ? 38.535 44.314 0.861  1.00 0.00 ? 45 LYS A HD2  4  
ATOM 3921  H HD3  . LYS A 1 75  ? 37.780 45.729 1.595  1.00 0.00 ? 45 LYS A HD3  4  
ATOM 3922  H HE2  . LYS A 1 75  ? 40.655 45.055 2.182  1.00 0.00 ? 45 LYS A HE2  4  
ATOM 3923  H HE3  . LYS A 1 75  ? 40.222 45.953 0.728  1.00 0.00 ? 45 LYS A HE3  4  
ATOM 3924  H HZ1  . LYS A 1 75  ? 38.817 47.285 2.529  1.00 0.00 ? 45 LYS A HZ1  4  
ATOM 3925  H HZ2  . LYS A 1 75  ? 40.420 47.686 2.132  1.00 0.00 ? 45 LYS A HZ2  4  
ATOM 3926  H HZ3  . LYS A 1 75  ? 40.091 46.764 3.521  1.00 0.00 ? 45 LYS A HZ3  4  
ATOM 3927  N N    . SER A 1 76  ? 35.373 40.721 3.990  1.00 0.00 ? 46 SER A N    4  
ATOM 3928  C CA   . SER A 1 76  ? 34.094 40.023 3.944  1.00 0.00 ? 46 SER A CA   4  
ATOM 3929  C C    . SER A 1 76  ? 34.256 38.554 4.320  1.00 0.00 ? 46 SER A C    4  
ATOM 3930  O O    . SER A 1 76  ? 35.322 37.966 4.136  1.00 0.00 ? 46 SER A O    4  
ATOM 3931  C CB   . SER A 1 76  ? 33.497 40.125 2.540  1.00 0.00 ? 46 SER A CB   4  
ATOM 3932  O OG   . SER A 1 76  ? 34.278 39.348 1.643  1.00 0.00 ? 46 SER A OG   4  
ATOM 3933  H H    . SER A 1 76  ? 36.204 40.221 3.854  1.00 0.00 ? 46 SER A H    4  
ATOM 3934  H HA   . SER A 1 76  ? 33.416 40.489 4.643  1.00 0.00 ? 46 SER A HA   4  
ATOM 3935  H HB2  . SER A 1 76  ? 32.487 39.747 2.545  1.00 0.00 ? 46 SER A HB2  4  
ATOM 3936  H HB3  . SER A 1 76  ? 33.487 41.161 2.229  1.00 0.00 ? 46 SER A HB3  4  
ATOM 3937  H HG   . SER A 1 76  ? 33.772 38.659 1.359  1.00 0.00 ? 46 SER A HG   4  
ATOM 3938  N N    . GLY A 1 77  ? 33.183 37.966 4.838  1.00 0.00 ? 47 GLY A N    4  
ATOM 3939  C CA   . GLY A 1 77  ? 33.189 36.553 5.201  1.00 0.00 ? 47 GLY A CA   4  
ATOM 3940  C C    . GLY A 1 77  ? 33.428 35.657 3.987  1.00 0.00 ? 47 GLY A C    4  
ATOM 3941  O O    . GLY A 1 77  ? 34.043 34.595 4.103  1.00 0.00 ? 47 GLY A O    4  
ATOM 3942  H H    . GLY A 1 77  ? 32.362 38.486 4.954  1.00 0.00 ? 47 GLY A H    4  
ATOM 3943  H HA2  . GLY A 1 77  ? 33.970 36.379 5.927  1.00 0.00 ? 47 GLY A HA2  4  
ATOM 3944  H HA3  . GLY A 1 77  ? 32.237 36.300 5.639  1.00 0.00 ? 47 GLY A HA3  4  
ATOM 3945  N N    . ALA A 1 78  ? 32.960 36.090 2.816  1.00 0.00 ? 48 ALA A N    4  
ATOM 3946  C CA   . ALA A 1 78  ? 33.110 35.284 1.609  1.00 0.00 ? 48 ALA A CA   4  
ATOM 3947  C C    . ALA A 1 78  ? 34.586 35.007 1.346  1.00 0.00 ? 48 ALA A C    4  
ATOM 3948  O O    . ALA A 1 78  ? 34.954 33.895 0.967  1.00 0.00 ? 48 ALA A O    4  
ATOM 3949  C CB   . ALA A 1 78  ? 32.502 36.016 0.411  1.00 0.00 ? 48 ALA A CB   4  
ATOM 3950  H H    . ALA A 1 78  ? 32.511 36.959 2.765  1.00 0.00 ? 48 ALA A H    4  
ATOM 3951  H HA   . ALA A 1 78  ? 32.594 34.345 1.746  1.00 0.00 ? 48 ALA A HA   4  
ATOM 3952  H HB1  . ALA A 1 78  ? 31.424 35.988 0.481  1.00 0.00 ? 48 ALA A HB1  4  
ATOM 3953  H HB2  . ALA A 1 78  ? 32.816 35.533 -0.502 1.00 0.00 ? 48 ALA A HB2  4  
ATOM 3954  H HB3  . ALA A 1 78  ? 32.836 37.043 0.409  1.00 0.00 ? 48 ALA A HB3  4  
ATOM 3955  N N    . GLU A 1 79  ? 35.427 36.020 1.545  1.00 0.00 ? 49 GLU A N    4  
ATOM 3956  C CA   . GLU A 1 79  ? 36.868 35.802 1.498  1.00 0.00 ? 49 GLU A CA   4  
ATOM 3957  C C    . GLU A 1 79  ? 37.302 34.826 2.591  1.00 0.00 ? 49 GLU A C    4  
ATOM 3958  O O    . GLU A 1 79  ? 38.118 33.938 2.344  1.00 0.00 ? 49 GLU A O    4  
ATOM 3959  C CB   . GLU A 1 79  ? 37.602 37.133 1.682  1.00 0.00 ? 49 GLU A CB   4  
ATOM 3960  C CG   . GLU A 1 79  ? 37.260 38.070 0.517  1.00 0.00 ? 49 GLU A CG   4  
ATOM 3961  C CD   . GLU A 1 79  ? 37.717 37.486 -0.822 1.00 0.00 ? 49 GLU A CD   4  
ATOM 3962  O OE1  . GLU A 1 79  ? 37.221 37.947 -1.837 1.00 0.00 ? 49 GLU A OE1  4  
ATOM 3963  O OE2  . GLU A 1 79  ? 38.562 36.602 -0.826 1.00 0.00 ? 49 GLU A OE2  4  
ATOM 3964  H H    . GLU A 1 79  ? 35.076 36.917 1.724  1.00 0.00 ? 49 GLU A H    4  
ATOM 3965  H HA   . GLU A 1 79  ? 37.129 35.390 0.535  1.00 0.00 ? 49 GLU A HA   4  
ATOM 3966  H HB2  . GLU A 1 79  ? 37.294 37.587 2.613  1.00 0.00 ? 49 GLU A HB2  4  
ATOM 3967  H HB3  . GLU A 1 79  ? 38.666 36.958 1.698  1.00 0.00 ? 49 GLU A HB3  4  
ATOM 3968  H HG2  . GLU A 1 79  ? 36.192 38.222 0.488  1.00 0.00 ? 49 GLU A HG2  4  
ATOM 3969  H HG3  . GLU A 1 79  ? 37.748 39.020 0.675  1.00 0.00 ? 49 GLU A HG3  4  
ATOM 3970  N N    . ALA A 1 80  ? 36.666 34.907 3.762  1.00 0.00 ? 50 ALA A N    4  
ATOM 3971  C CA   . ALA A 1 80  ? 37.038 34.038 4.877  1.00 0.00 ? 50 ALA A CA   4  
ATOM 3972  C C    . ALA A 1 80  ? 36.847 32.564 4.520  1.00 0.00 ? 50 ALA A C    4  
ATOM 3973  O O    . ALA A 1 80  ? 37.656 31.717 4.899  1.00 0.00 ? 50 ALA A O    4  
ATOM 3974  C CB   . ALA A 1 80  ? 36.190 34.378 6.104  1.00 0.00 ? 50 ALA A CB   4  
ATOM 3975  H H    . ALA A 1 80  ? 35.946 35.562 3.879  1.00 0.00 ? 50 ALA A H    4  
ATOM 3976  H HA   . ALA A 1 80  ? 38.076 34.206 5.118  1.00 0.00 ? 50 ALA A HA   4  
ATOM 3977  H HB1  . ALA A 1 80  ? 36.002 35.440 6.129  1.00 0.00 ? 50 ALA A HB1  4  
ATOM 3978  H HB2  . ALA A 1 80  ? 36.718 34.085 6.999  1.00 0.00 ? 50 ALA A HB2  4  
ATOM 3979  H HB3  . ALA A 1 80  ? 35.250 33.847 6.051  1.00 0.00 ? 50 ALA A HB3  4  
ATOM 3980  N N    . LYS A 1 81  ? 35.828 32.272 3.720  1.00 0.00 ? 51 LYS A N    4  
ATOM 3981  C CA   . LYS A 1 81  ? 35.556 30.897 3.313  1.00 0.00 ? 51 LYS A CA   4  
ATOM 3982  C C    . LYS A 1 81  ? 36.762 30.265 2.610  1.00 0.00 ? 51 LYS A C    4  
ATOM 3983  O O    . LYS A 1 81  ? 36.941 29.049 2.669  1.00 0.00 ? 51 LYS A O    4  
ATOM 3984  C CB   . LYS A 1 81  ? 34.347 30.872 2.374  1.00 0.00 ? 51 LYS A CB   4  
ATOM 3985  C CG   . LYS A 1 81  ? 33.955 29.424 2.069  1.00 0.00 ? 51 LYS A CG   4  
ATOM 3986  C CD   . LYS A 1 81  ? 32.803 29.409 1.063  1.00 0.00 ? 51 LYS A CD   4  
ATOM 3987  C CE   . LYS A 1 81  ? 32.305 27.974 0.876  1.00 0.00 ? 51 LYS A CE   4  
ATOM 3988  N NZ   . LYS A 1 81  ? 31.545 27.876 -0.402 1.00 0.00 ? 51 LYS A NZ   4  
ATOM 3989  H H    . LYS A 1 81  ? 35.220 32.990 3.443  1.00 0.00 ? 51 LYS A H    4  
ATOM 3990  H HA   . LYS A 1 81  ? 35.321 30.313 4.190  1.00 0.00 ? 51 LYS A HA   4  
ATOM 3991  H HB2  . LYS A 1 81  ? 33.517 31.377 2.847  1.00 0.00 ? 51 LYS A HB2  4  
ATOM 3992  H HB3  . LYS A 1 81  ? 34.597 31.376 1.452  1.00 0.00 ? 51 LYS A HB3  4  
ATOM 3993  H HG2  . LYS A 1 81  ? 34.805 28.902 1.653  1.00 0.00 ? 51 LYS A HG2  4  
ATOM 3994  H HG3  . LYS A 1 81  ? 33.641 28.936 2.979  1.00 0.00 ? 51 LYS A HG3  4  
ATOM 3995  H HD2  . LYS A 1 81  ? 31.996 30.026 1.432  1.00 0.00 ? 51 LYS A HD2  4  
ATOM 3996  H HD3  . LYS A 1 81  ? 33.147 29.794 0.115  1.00 0.00 ? 51 LYS A HD3  4  
ATOM 3997  H HE2  . LYS A 1 81  ? 33.149 27.302 0.845  1.00 0.00 ? 51 LYS A HE2  4  
ATOM 3998  H HE3  . LYS A 1 81  ? 31.660 27.705 1.699  1.00 0.00 ? 51 LYS A HE3  4  
ATOM 3999  H HZ1  . LYS A 1 81  ? 30.694 28.471 -0.347 1.00 0.00 ? 51 LYS A HZ1  4  
ATOM 4000  H HZ2  . LYS A 1 81  ? 31.268 26.887 -0.565 1.00 0.00 ? 51 LYS A HZ2  4  
ATOM 4001  H HZ3  . LYS A 1 81  ? 32.143 28.205 -1.187 1.00 0.00 ? 51 LYS A HZ3  4  
ATOM 4002  N N    . LYS A 1 82  ? 37.586 31.077 1.949  1.00 0.00 ? 52 LYS A N    4  
ATOM 4003  C CA   . LYS A 1 82  ? 38.747 30.555 1.234  1.00 0.00 ? 52 LYS A CA   4  
ATOM 4004  C C    . LYS A 1 82  ? 39.726 29.834 2.170  1.00 0.00 ? 52 LYS A C    4  
ATOM 4005  O O    . LYS A 1 82  ? 40.488 28.976 1.721  1.00 0.00 ? 52 LYS A O    4  
ATOM 4006  C CB   . LYS A 1 82  ? 39.469 31.705 0.527  1.00 0.00 ? 52 LYS A CB   4  
ATOM 4007  C CG   . LYS A 1 82  ? 40.585 31.151 -0.362 1.00 0.00 ? 52 LYS A CG   4  
ATOM 4008  C CD   . LYS A 1 82  ? 41.349 32.311 -1.005 1.00 0.00 ? 52 LYS A CD   4  
ATOM 4009  C CE   . LYS A 1 82  ? 42.361 31.761 -2.012 1.00 0.00 ? 52 LYS A CE   4  
ATOM 4010  N NZ   . LYS A 1 82  ? 41.647 30.970 -3.054 1.00 0.00 ? 52 LYS A NZ   4  
ATOM 4011  H H    . LYS A 1 82  ? 37.440 32.047 1.978  1.00 0.00 ? 52 LYS A H    4  
ATOM 4012  H HA   . LYS A 1 82  ? 38.406 29.855 0.487  1.00 0.00 ? 52 LYS A HA   4  
ATOM 4013  H HB2  . LYS A 1 82  ? 38.762 32.250 -0.083 1.00 0.00 ? 52 LYS A HB2  4  
ATOM 4014  H HB3  . LYS A 1 82  ? 39.895 32.369 1.264  1.00 0.00 ? 52 LYS A HB3  4  
ATOM 4015  H HG2  . LYS A 1 82  ? 41.263 30.562 0.238  1.00 0.00 ? 52 LYS A HG2  4  
ATOM 4016  H HG3  . LYS A 1 82  ? 40.158 30.532 -1.136 1.00 0.00 ? 52 LYS A HG3  4  
ATOM 4017  H HD2  . LYS A 1 82  ? 40.652 32.961 -1.512 1.00 0.00 ? 52 LYS A HD2  4  
ATOM 4018  H HD3  . LYS A 1 82  ? 41.871 32.866 -0.241 1.00 0.00 ? 52 LYS A HD3  4  
ATOM 4019  H HE2  . LYS A 1 82  ? 42.886 32.580 -2.479 1.00 0.00 ? 52 LYS A HE2  4  
ATOM 4020  H HE3  . LYS A 1 82  ? 43.069 31.126 -1.500 1.00 0.00 ? 52 LYS A HE3  4  
ATOM 4021  H HZ1  . LYS A 1 82  ? 42.284 30.800 -3.858 1.00 0.00 ? 52 LYS A HZ1  4  
ATOM 4022  H HZ2  . LYS A 1 82  ? 40.812 31.499 -3.377 1.00 0.00 ? 52 LYS A HZ2  4  
ATOM 4023  H HZ3  . LYS A 1 82  ? 41.348 30.058 -2.653 1.00 0.00 ? 52 LYS A HZ3  4  
ATOM 4024  N N    . LEU A 1 83  ? 39.705 30.162 3.462  1.00 0.00 ? 53 LEU A N    4  
ATOM 4025  C CA   . LEU A 1 83  ? 40.690 29.622 4.391  1.00 0.00 ? 53 LEU A CA   4  
ATOM 4026  C C    . LEU A 1 83  ? 40.244 28.259 4.935  1.00 0.00 ? 53 LEU A C    4  
ATOM 4027  O O    . LEU A 1 83  ? 39.055 28.079 5.218  1.00 0.00 ? 53 LEU A O    4  
ATOM 4028  C CB   . LEU A 1 83  ? 40.875 30.595 5.556  1.00 0.00 ? 53 LEU A CB   4  
ATOM 4029  C CG   . LEU A 1 83  ? 41.720 31.787 5.101  1.00 0.00 ? 53 LEU A CG   4  
ATOM 4030  C CD1  . LEU A 1 83  ? 41.624 32.905 6.140  1.00 0.00 ? 53 LEU A CD1  4  
ATOM 4031  C CD2  . LEU A 1 83  ? 43.180 31.353 4.955  1.00 0.00 ? 53 LEU A CD2  4  
ATOM 4032  H H    . LEU A 1 83  ? 39.008 30.762 3.801  1.00 0.00 ? 53 LEU A H    4  
ATOM 4033  H HA   . LEU A 1 83  ? 41.625 29.531 3.865  1.00 0.00 ? 53 LEU A HA   4  
ATOM 4034  H HB2  . LEU A 1 83  ? 39.909 30.943 5.889  1.00 0.00 ? 53 LEU A HB2  4  
ATOM 4035  H HB3  . LEU A 1 83  ? 41.376 30.092 6.367  1.00 0.00 ? 53 LEU A HB3  4  
ATOM 4036  H HG   . LEU A 1 83  ? 41.351 32.146 4.151  1.00 0.00 ? 53 LEU A HG   4  
ATOM 4037  H HD11 . LEU A 1 83  ? 40.589 33.192 6.266  1.00 0.00 ? 53 LEU A HD11 4  
ATOM 4038  H HD12 . LEU A 1 83  ? 42.195 33.759 5.805  1.00 0.00 ? 53 LEU A HD12 4  
ATOM 4039  H HD13 . LEU A 1 83  ? 42.018 32.556 7.083  1.00 0.00 ? 53 LEU A HD13 4  
ATOM 4040  H HD21 . LEU A 1 83  ? 43.454 30.727 5.791  1.00 0.00 ? 53 LEU A HD21 4  
ATOM 4041  H HD22 . LEU A 1 83  ? 43.814 32.226 4.936  1.00 0.00 ? 53 LEU A HD22 4  
ATOM 4042  H HD23 . LEU A 1 83  ? 43.301 30.800 4.036  1.00 0.00 ? 53 LEU A HD23 4  
ATOM 4043  N N    . PRO A 1 84  ? 41.144 27.316 5.141  1.00 0.00 ? 54 PRO A N    4  
ATOM 4044  C CA   . PRO A 1 84  ? 40.747 25.969 5.658  1.00 0.00 ? 54 PRO A CA   4  
ATOM 4045  C C    . PRO A 1 84  ? 40.031 26.072 7.002  1.00 0.00 ? 54 PRO A C    4  
ATOM 4046  O O    . PRO A 1 84  ? 40.530 26.699 7.938  1.00 0.00 ? 54 PRO A O    4  
ATOM 4047  C CB   . PRO A 1 84  ? 42.063 25.195 5.800  1.00 0.00 ? 54 PRO A CB   4  
ATOM 4048  C CG   . PRO A 1 84  ? 43.053 25.923 4.959  1.00 0.00 ? 54 PRO A CG   4  
ATOM 4049  C CD   . PRO A 1 84  ? 42.604 27.381 4.928  1.00 0.00 ? 54 PRO A CD   4  
ATOM 4050  H HA   . PRO A 1 84  ? 40.114 25.471 4.941  1.00 0.00 ? 54 PRO A HA   4  
ATOM 4051  H HB2  . PRO A 1 84  ? 42.386 25.184 6.833  1.00 0.00 ? 54 PRO A HB2  4  
ATOM 4052  H HB3  . PRO A 1 84  ? 41.946 24.187 5.434  1.00 0.00 ? 54 PRO A HB3  4  
ATOM 4053  H HG2  . PRO A 1 84  ? 44.039 25.840 5.395  1.00 0.00 ? 54 PRO A HG2  4  
ATOM 4054  H HG3  . PRO A 1 84  ? 43.053 25.525 3.956  1.00 0.00 ? 54 PRO A HG3  4  
ATOM 4055  H HD2  . PRO A 1 84  ? 43.084 27.939 5.720  1.00 0.00 ? 54 PRO A HD2  4  
ATOM 4056  H HD3  . PRO A 1 84  ? 42.818 27.818 3.966  1.00 0.00 ? 54 PRO A HD3  4  
ATOM 4057  N N    . GLY A 1 85  ? 38.866 25.438 7.089  1.00 0.00 ? 55 GLY A N    4  
ATOM 4058  C CA   . GLY A 1 85  ? 38.092 25.436 8.327  1.00 0.00 ? 55 GLY A CA   4  
ATOM 4059  C C    . GLY A 1 85  ? 36.929 26.434 8.315  1.00 0.00 ? 55 GLY A C    4  
ATOM 4060  O O    . GLY A 1 85  ? 36.066 26.370 9.193  1.00 0.00 ? 55 GLY A O    4  
ATOM 4061  H H    . GLY A 1 85  ? 38.519 24.963 6.305  1.00 0.00 ? 55 GLY A H    4  
ATOM 4062  H HA2  . GLY A 1 85  ? 37.695 24.445 8.486  1.00 0.00 ? 55 GLY A HA2  4  
ATOM 4063  H HA3  . GLY A 1 85  ? 38.750 25.681 9.149  1.00 0.00 ? 55 GLY A HA3  4  
ATOM 4064  N N    . VAL A 1 86  ? 36.883 27.344 7.337  1.00 0.00 ? 56 VAL A N    4  
ATOM 4065  C CA   . VAL A 1 86  ? 35.792 28.314 7.268  1.00 0.00 ? 56 VAL A CA   4  
ATOM 4066  C C    . VAL A 1 86  ? 34.674 27.784 6.374  1.00 0.00 ? 56 VAL A C    4  
ATOM 4067  O O    . VAL A 1 86  ? 34.928 27.267 5.286  1.00 0.00 ? 56 VAL A O    4  
ATOM 4068  C CB   . VAL A 1 86  ? 36.299 29.656 6.727  1.00 0.00 ? 56 VAL A CB   4  
ATOM 4069  C CG1  . VAL A 1 86  ? 35.171 30.690 6.778  1.00 0.00 ? 56 VAL A CG1  4  
ATOM 4070  C CG2  . VAL A 1 86  ? 37.469 30.155 7.581  1.00 0.00 ? 56 VAL A CG2  4  
ATOM 4071  H H    . VAL A 1 86  ? 37.596 27.372 6.662  1.00 0.00 ? 56 VAL A H    4  
ATOM 4072  H HA   . VAL A 1 86  ? 35.400 28.465 8.262  1.00 0.00 ? 56 VAL A HA   4  
ATOM 4073  H HB   . VAL A 1 86  ? 36.625 29.532 5.704  1.00 0.00 ? 56 VAL A HB   4  
ATOM 4074  H HG11 . VAL A 1 86  ? 34.762 30.727 7.777  1.00 0.00 ? 56 VAL A HG11 4  
ATOM 4075  H HG12 . VAL A 1 86  ? 34.395 30.411 6.082  1.00 0.00 ? 56 VAL A HG12 4  
ATOM 4076  H HG13 . VAL A 1 86  ? 35.561 31.662 6.513  1.00 0.00 ? 56 VAL A HG13 4  
ATOM 4077  H HG21 . VAL A 1 86  ? 38.304 29.478 7.479  1.00 0.00 ? 56 VAL A HG21 4  
ATOM 4078  H HG22 . VAL A 1 86  ? 37.166 30.199 8.616  1.00 0.00 ? 56 VAL A HG22 4  
ATOM 4079  H HG23 . VAL A 1 86  ? 37.762 31.141 7.250  1.00 0.00 ? 56 VAL A HG23 4  
ATOM 4080  N N    . GLY A 1 87  ? 33.434 27.916 6.840  1.00 0.00 ? 57 GLY A N    4  
ATOM 4081  C CA   . GLY A 1 87  ? 32.279 27.435 6.086  1.00 0.00 ? 57 GLY A CA   4  
ATOM 4082  C C    . GLY A 1 87  ? 31.360 28.587 5.695  1.00 0.00 ? 57 GLY A C    4  
ATOM 4083  O O    . GLY A 1 87  ? 31.526 29.716 6.159  1.00 0.00 ? 57 GLY A O    4  
ATOM 4084  H H    . GLY A 1 87  ? 33.293 28.347 7.709  1.00 0.00 ? 57 GLY A H    4  
ATOM 4085  H HA2  . GLY A 1 87  ? 32.616 26.931 5.190  1.00 0.00 ? 57 GLY A HA2  4  
ATOM 4086  H HA3  . GLY A 1 87  ? 31.724 26.739 6.696  1.00 0.00 ? 57 GLY A HA3  4  
ATOM 4087  N N    . THR A 1 88  ? 30.374 28.292 4.854  1.00 0.00 ? 58 THR A N    4  
ATOM 4088  C CA   . THR A 1 88  ? 29.458 29.323 4.381  1.00 0.00 ? 58 THR A CA   4  
ATOM 4089  C C    . THR A 1 88  ? 28.751 30.001 5.551  1.00 0.00 ? 58 THR A C    4  
ATOM 4090  O O    . THR A 1 88  ? 28.622 31.225 5.581  1.00 0.00 ? 58 THR A O    4  
ATOM 4091  C CB   . THR A 1 88  ? 28.420 28.706 3.441  1.00 0.00 ? 58 THR A CB   4  
ATOM 4092  O OG1  . THR A 1 88  ? 29.086 27.993 2.408  1.00 0.00 ? 58 THR A OG1  4  
ATOM 4093  C CG2  . THR A 1 88  ? 27.560 29.812 2.825  1.00 0.00 ? 58 THR A CG2  4  
ATOM 4094  H H    . THR A 1 88  ? 30.260 27.368 4.548  1.00 0.00 ? 58 THR A H    4  
ATOM 4095  H HA   . THR A 1 88  ? 30.020 30.066 3.836  1.00 0.00 ? 58 THR A HA   4  
ATOM 4096  H HB   . THR A 1 88  ? 27.787 28.030 3.996  1.00 0.00 ? 58 THR A HB   4  
ATOM 4097  H HG1  . THR A 1 88  ? 28.953 27.114 2.547  1.00 0.00 ? 58 THR A HG1  4  
ATOM 4098  H HG21 . THR A 1 88  ? 26.902 30.217 3.580  1.00 0.00 ? 58 THR A HG21 4  
ATOM 4099  H HG22 . THR A 1 88  ? 26.973 29.403 2.017  1.00 0.00 ? 58 THR A HG22 4  
ATOM 4100  H HG23 . THR A 1 88  ? 28.199 30.595 2.446  1.00 0.00 ? 58 THR A HG23 4  
ATOM 4101  N N    . LYS A 1 89  ? 28.324 29.208 6.531  1.00 0.00 ? 59 LYS A N    4  
ATOM 4102  C CA   . LYS A 1 89  ? 27.595 29.758 7.670  1.00 0.00 ? 59 LYS A CA   4  
ATOM 4103  C C    . LYS A 1 89  ? 28.464 30.765 8.417  1.00 0.00 ? 59 LYS A C    4  
ATOM 4104  O O    . LYS A 1 89  ? 28.011 31.860 8.760  1.00 0.00 ? 59 LYS A O    4  
ATOM 4105  C CB   . LYS A 1 89  ? 27.181 28.628 8.617  1.00 0.00 ? 59 LYS A CB   4  
ATOM 4106  C CG   . LYS A 1 89  ? 26.295 29.178 9.738  1.00 0.00 ? 59 LYS A CG   4  
ATOM 4107  C CD   . LYS A 1 89  ? 24.895 29.471 9.196  1.00 0.00 ? 59 LYS A CD   4  
ATOM 4108  C CE   . LYS A 1 89  ? 23.990 29.933 10.341 1.00 0.00 ? 59 LYS A CE   4  
ATOM 4109  N NZ   . LYS A 1 89  ? 22.623 30.206 9.814  1.00 0.00 ? 59 LYS A NZ   4  
ATOM 4110  H H    . LYS A 1 89  ? 28.499 28.245 6.486  1.00 0.00 ? 59 LYS A H    4  
ATOM 4111  H HA   . LYS A 1 89  ? 26.709 30.258 7.310  1.00 0.00 ? 59 LYS A HA   4  
ATOM 4112  H HB2  . LYS A 1 89  ? 26.634 27.879 8.062  1.00 0.00 ? 59 LYS A HB2  4  
ATOM 4113  H HB3  . LYS A 1 89  ? 28.064 28.180 9.047  1.00 0.00 ? 59 LYS A HB3  4  
ATOM 4114  H HG2  . LYS A 1 89  ? 26.229 28.448 10.532 1.00 0.00 ? 59 LYS A HG2  4  
ATOM 4115  H HG3  . LYS A 1 89  ? 26.726 30.090 10.125 1.00 0.00 ? 59 LYS A HG3  4  
ATOM 4116  H HD2  . LYS A 1 89  ? 24.951 30.248 8.448  1.00 0.00 ? 59 LYS A HD2  4  
ATOM 4117  H HD3  . LYS A 1 89  ? 24.484 28.575 8.757  1.00 0.00 ? 59 LYS A HD3  4  
ATOM 4118  H HE2  . LYS A 1 89  ? 23.939 29.160 11.094 1.00 0.00 ? 59 LYS A HE2  4  
ATOM 4119  H HE3  . LYS A 1 89  ? 24.395 30.834 10.778 1.00 0.00 ? 59 LYS A HE3  4  
ATOM 4120  H HZ1  . LYS A 1 89  ? 21.923 30.037 10.564 1.00 0.00 ? 59 LYS A HZ1  4  
ATOM 4121  H HZ2  . LYS A 1 89  ? 22.430 29.576 9.009  1.00 0.00 ? 59 LYS A HZ2  4  
ATOM 4122  H HZ3  . LYS A 1 89  ? 22.563 31.196 9.503  1.00 0.00 ? 59 LYS A HZ3  4  
ATOM 4123  N N    . ILE A 1 90  ? 29.734 30.419 8.608  1.00 0.00 ? 60 ILE A N    4  
ATOM 4124  C CA   . ILE A 1 90  ? 30.652 31.312 9.302  1.00 0.00 ? 60 ILE A CA   4  
ATOM 4125  C C    . ILE A 1 90  ? 30.849 32.589 8.486  1.00 0.00 ? 60 ILE A C    4  
ATOM 4126  O O    . ILE A 1 90  ? 30.827 33.691 9.035  1.00 0.00 ? 60 ILE A O    4  
ATOM 4127  C CB   . ILE A 1 90  ? 31.990 30.602 9.556  1.00 0.00 ? 60 ILE A CB   4  
ATOM 4128  C CG1  . ILE A 1 90  ? 31.729 29.359 10.416 1.00 0.00 ? 60 ILE A CG1  4  
ATOM 4129  C CG2  . ILE A 1 90  ? 32.947 31.538 10.302 1.00 0.00 ? 60 ILE A CG2  4  
ATOM 4130  C CD1  . ILE A 1 90  ? 33.018 28.550 10.605 1.00 0.00 ? 60 ILE A CD1  4  
ATOM 4131  H H    . ILE A 1 90  ? 30.055 29.554 8.279  1.00 0.00 ? 60 ILE A H    4  
ATOM 4132  H HA   . ILE A 1 90  ? 30.217 31.579 10.254 1.00 0.00 ? 60 ILE A HA   4  
ATOM 4133  H HB   . ILE A 1 90  ? 32.429 30.308 8.615  1.00 0.00 ? 60 ILE A HB   4  
ATOM 4134  H HG12 . ILE A 1 90  ? 31.360 29.669 11.381 1.00 0.00 ? 60 ILE A HG12 4  
ATOM 4135  H HG13 . ILE A 1 90  ? 30.989 28.740 9.932  1.00 0.00 ? 60 ILE A HG13 4  
ATOM 4136  H HG21 . ILE A 1 90  ? 33.136 32.414 9.701  1.00 0.00 ? 60 ILE A HG21 4  
ATOM 4137  H HG22 . ILE A 1 90  ? 33.878 31.025 10.494 1.00 0.00 ? 60 ILE A HG22 4  
ATOM 4138  H HG23 . ILE A 1 90  ? 32.500 31.834 11.239 1.00 0.00 ? 60 ILE A HG23 4  
ATOM 4139  H HD11 . ILE A 1 90  ? 33.365 28.195 9.648  1.00 0.00 ? 60 ILE A HD11 4  
ATOM 4140  H HD12 . ILE A 1 90  ? 32.821 27.707 11.253 1.00 0.00 ? 60 ILE A HD12 4  
ATOM 4141  H HD13 . ILE A 1 90  ? 33.777 29.174 11.055 1.00 0.00 ? 60 ILE A HD13 4  
ATOM 4142  N N    . ALA A 1 91  ? 30.980 32.446 7.170  1.00 0.00 ? 61 ALA A N    4  
ATOM 4143  C CA   . ALA A 1 91  ? 31.169 33.605 6.307  1.00 0.00 ? 61 ALA A CA   4  
ATOM 4144  C C    . ALA A 1 91  ? 30.001 34.579 6.443  1.00 0.00 ? 61 ALA A C    4  
ATOM 4145  O O    . ALA A 1 91  ? 30.208 35.785 6.593  1.00 0.00 ? 61 ALA A O    4  
ATOM 4146  C CB   . ALA A 1 91  ? 31.291 33.155 4.850  1.00 0.00 ? 61 ALA A CB   4  
ATOM 4147  H H    . ALA A 1 91  ? 30.979 31.547 6.781  1.00 0.00 ? 61 ALA A H    4  
ATOM 4148  H HA   . ALA A 1 91  ? 32.080 34.109 6.592  1.00 0.00 ? 61 ALA A HA   4  
ATOM 4149  H HB1  . ALA A 1 91  ? 30.487 32.474 4.615  1.00 0.00 ? 61 ALA A HB1  4  
ATOM 4150  H HB2  . ALA A 1 91  ? 32.239 32.658 4.705  1.00 0.00 ? 61 ALA A HB2  4  
ATOM 4151  H HB3  . ALA A 1 91  ? 31.234 34.017 4.201  1.00 0.00 ? 61 ALA A HB3  4  
ATOM 4152  N N    . GLU A 1 92  ? 28.775 34.058 6.435  1.00 0.00 ? 62 GLU A N    4  
ATOM 4153  C CA   . GLU A 1 92  ? 27.602 34.920 6.537  1.00 0.00 ? 62 GLU A CA   4  
ATOM 4154  C C    . GLU A 1 92  ? 27.598 35.675 7.863  1.00 0.00 ? 62 GLU A C    4  
ATOM 4155  O O    . GLU A 1 92  ? 27.316 36.875 7.898  1.00 0.00 ? 62 GLU A O    4  
ATOM 4156  C CB   . GLU A 1 92  ? 26.325 34.087 6.417  1.00 0.00 ? 62 GLU A CB   4  
ATOM 4157  C CG   . GLU A 1 92  ? 26.258 33.452 5.024  1.00 0.00 ? 62 GLU A CG   4  
ATOM 4158  C CD   . GLU A 1 92  ? 26.202 34.518 3.926  1.00 0.00 ? 62 GLU A CD   4  
ATOM 4159  O OE1  . GLU A 1 92  ? 26.485 34.172 2.790  1.00 0.00 ? 62 GLU A OE1  4  
ATOM 4160  O OE2  . GLU A 1 92  ? 25.867 35.655 4.221  1.00 0.00 ? 62 GLU A OE2  4  
ATOM 4161  H H    . GLU A 1 92  ? 28.660 33.090 6.332  1.00 0.00 ? 62 GLU A H    4  
ATOM 4162  H HA   . GLU A 1 92  ? 27.626 35.637 5.729  1.00 0.00 ? 62 GLU A HA   4  
ATOM 4163  H HB2  . GLU A 1 92  ? 26.331 33.311 7.168  1.00 0.00 ? 62 GLU A HB2  4  
ATOM 4164  H HB3  . GLU A 1 92  ? 25.464 34.722 6.561  1.00 0.00 ? 62 GLU A HB3  4  
ATOM 4165  H HG2  . GLU A 1 92  ? 27.132 32.837 4.873  1.00 0.00 ? 62 GLU A HG2  4  
ATOM 4166  H HG3  . GLU A 1 92  ? 25.375 32.832 4.960  1.00 0.00 ? 62 GLU A HG3  4  
ATOM 4167  N N    . LYS A 1 93  ? 27.941 34.987 8.950  1.00 0.00 ? 63 LYS A N    4  
ATOM 4168  C CA   . LYS A 1 93  ? 28.030 35.648 10.250 1.00 0.00 ? 63 LYS A CA   4  
ATOM 4169  C C    . LYS A 1 93  ? 29.085 36.756 10.237 1.00 0.00 ? 63 LYS A C    4  
ATOM 4170  O O    . LYS A 1 93  ? 28.874 37.826 10.808 1.00 0.00 ? 63 LYS A O    4  
ATOM 4171  C CB   . LYS A 1 93  ? 28.332 34.621 11.340 1.00 0.00 ? 63 LYS A CB   4  
ATOM 4172  C CG   . LYS A 1 93  ? 27.157 33.644 11.432 1.00 0.00 ? 63 LYS A CG   4  
ATOM 4173  C CD   . LYS A 1 93  ? 27.300 32.769 12.676 1.00 0.00 ? 63 LYS A CD   4  
ATOM 4174  C CE   . LYS A 1 93  ? 28.521 31.861 12.524 1.00 0.00 ? 63 LYS A CE   4  
ATOM 4175  N NZ   . LYS A 1 93  ? 28.433 30.747 13.510 1.00 0.00 ? 63 LYS A NZ   4  
ATOM 4176  H H    . LYS A 1 93  ? 28.103 34.021 8.884  1.00 0.00 ? 63 LYS A H    4  
ATOM 4177  H HA   . LYS A 1 93  ? 27.072 36.098 10.464 1.00 0.00 ? 63 LYS A HA   4  
ATOM 4178  H HB2  . LYS A 1 93  ? 29.237 34.084 11.093 1.00 0.00 ? 63 LYS A HB2  4  
ATOM 4179  H HB3  . LYS A 1 93  ? 28.455 35.122 12.289 1.00 0.00 ? 63 LYS A HB3  4  
ATOM 4180  H HG2  . LYS A 1 93  ? 26.232 34.200 11.489 1.00 0.00 ? 63 LYS A HG2  4  
ATOM 4181  H HG3  . LYS A 1 93  ? 27.143 33.015 10.554 1.00 0.00 ? 63 LYS A HG3  4  
ATOM 4182  H HD2  . LYS A 1 93  ? 27.424 33.398 13.546 1.00 0.00 ? 63 LYS A HD2  4  
ATOM 4183  H HD3  . LYS A 1 93  ? 26.416 32.161 12.793 1.00 0.00 ? 63 LYS A HD3  4  
ATOM 4184  H HE2  . LYS A 1 93  ? 28.544 31.455 11.523 1.00 0.00 ? 63 LYS A HE2  4  
ATOM 4185  H HE3  . LYS A 1 93  ? 29.419 32.432 12.703 1.00 0.00 ? 63 LYS A HE3  4  
ATOM 4186  H HZ1  . LYS A 1 93  ? 27.655 30.931 14.174 1.00 0.00 ? 63 LYS A HZ1  4  
ATOM 4187  H HZ2  . LYS A 1 93  ? 29.330 30.679 14.036 1.00 0.00 ? 63 LYS A HZ2  4  
ATOM 4188  H HZ3  . LYS A 1 93  ? 28.255 29.853 13.010 1.00 0.00 ? 63 LYS A HZ3  4  
ATOM 4189  N N    . ILE A 1 94  ? 30.203 36.516 9.556  1.00 0.00 ? 64 ILE A N    4  
ATOM 4190  C CA   . ILE A 1 94  ? 31.225 37.549 9.406  1.00 0.00 ? 64 ILE A CA   4  
ATOM 4191  C C    . ILE A 1 94  ? 30.640 38.756 8.670  1.00 0.00 ? 64 ILE A C    4  
ATOM 4192  O O    . ILE A 1 94  ? 30.880 39.903 9.057  1.00 0.00 ? 64 ILE A O    4  
ATOM 4193  C CB   . ILE A 1 94  ? 32.435 36.966 8.654  1.00 0.00 ? 64 ILE A CB   4  
ATOM 4194  C CG1  . ILE A 1 94  ? 33.066 35.864 9.508  1.00 0.00 ? 64 ILE A CG1  4  
ATOM 4195  C CG2  . ILE A 1 94  ? 33.498 38.038 8.380  1.00 0.00 ? 64 ILE A CG2  4  
ATOM 4196  C CD1  . ILE A 1 94  ? 34.022 35.027 8.654  1.00 0.00 ? 64 ILE A CD1  4  
ATOM 4197  H H    . ILE A 1 94  ? 30.358 35.624 9.180  1.00 0.00 ? 64 ILE A H    4  
ATOM 4198  H HA   . ILE A 1 94  ? 31.546 37.864 10.389 1.00 0.00 ? 64 ILE A HA   4  
ATOM 4199  H HB   . ILE A 1 94  ? 32.102 36.544 7.718  1.00 0.00 ? 64 ILE A HB   4  
ATOM 4200  H HG12 . ILE A 1 94  ? 33.615 36.316 10.322 1.00 0.00 ? 64 ILE A HG12 4  
ATOM 4201  H HG13 . ILE A 1 94  ? 32.293 35.229 9.910  1.00 0.00 ? 64 ILE A HG13 4  
ATOM 4202  H HG21 . ILE A 1 94  ? 33.939 38.357 9.313  1.00 0.00 ? 64 ILE A HG21 4  
ATOM 4203  H HG22 . ILE A 1 94  ? 33.042 38.884 7.888  1.00 0.00 ? 64 ILE A HG22 4  
ATOM 4204  H HG23 . ILE A 1 94  ? 34.267 37.625 7.741  1.00 0.00 ? 64 ILE A HG23 4  
ATOM 4205  H HD11 . ILE A 1 94  ? 34.780 34.590 9.286  1.00 0.00 ? 64 ILE A HD11 4  
ATOM 4206  H HD12 . ILE A 1 94  ? 34.491 35.657 7.912  1.00 0.00 ? 64 ILE A HD12 4  
ATOM 4207  H HD13 . ILE A 1 94  ? 33.469 34.241 8.161  1.00 0.00 ? 64 ILE A HD13 4  
ATOM 4208  N N    . ASP A 1 95  ? 29.843 38.499 7.637  1.00 0.00 ? 65 ASP A N    4  
ATOM 4209  C CA   . ASP A 1 95  ? 29.210 39.585 6.893  1.00 0.00 ? 65 ASP A CA   4  
ATOM 4210  C C    . ASP A 1 95  ? 28.321 40.411 7.815  1.00 0.00 ? 65 ASP A C    4  
ATOM 4211  O O    . ASP A 1 95  ? 28.347 41.642 7.778  1.00 0.00 ? 65 ASP A O    4  
ATOM 4212  C CB   . ASP A 1 95  ? 28.365 39.024 5.743  1.00 0.00 ? 65 ASP A CB   4  
ATOM 4213  C CG   . ASP A 1 95  ? 29.237 38.300 4.717  1.00 0.00 ? 65 ASP A CG   4  
ATOM 4214  O OD1  . ASP A 1 95  ? 30.422 38.584 4.649  1.00 0.00 ? 65 ASP A OD1  4  
ATOM 4215  O OD2  . ASP A 1 95  ? 28.702 37.464 4.008  1.00 0.00 ? 65 ASP A OD2  4  
ATOM 4216  H H    . ASP A 1 95  ? 29.710 37.572 7.349  1.00 0.00 ? 65 ASP A H    4  
ATOM 4217  H HA   . ASP A 1 95  ? 29.980 40.222 6.482  1.00 0.00 ? 65 ASP A HA   4  
ATOM 4218  H HB2  . ASP A 1 95  ? 27.639 38.331 6.142  1.00 0.00 ? 65 ASP A HB2  4  
ATOM 4219  H HB3  . ASP A 1 95  ? 27.847 39.837 5.257  1.00 0.00 ? 65 ASP A HB3  4  
ATOM 4220  N N    . GLU A 1 96  ? 27.566 39.731 8.673  1.00 0.00 ? 66 GLU A N    4  
ATOM 4221  C CA   . GLU A 1 96  ? 26.689 40.429 9.607  1.00 0.00 ? 66 GLU A CA   4  
ATOM 4222  C C    . GLU A 1 96  ? 27.503 41.294 10.565 1.00 0.00 ? 66 GLU A C    4  
ATOM 4223  O O    . GLU A 1 96  ? 27.147 42.445 10.825 1.00 0.00 ? 66 GLU A O    4  
ATOM 4224  C CB   . GLU A 1 96  ? 25.867 39.416 10.406 1.00 0.00 ? 66 GLU A CB   4  
ATOM 4225  C CG   . GLU A 1 96  ? 24.946 38.638 9.460  1.00 0.00 ? 66 GLU A CG   4  
ATOM 4226  C CD   . GLU A 1 96  ? 24.042 37.662 10.221 1.00 0.00 ? 66 GLU A CD   4  
ATOM 4227  O OE1  . GLU A 1 96  ? 23.137 37.134 9.598  1.00 0.00 ? 66 GLU A OE1  4  
ATOM 4228  O OE2  . GLU A 1 96  ? 24.262 37.442 11.404 1.00 0.00 ? 66 GLU A OE2  4  
ATOM 4229  H H    . GLU A 1 96  ? 27.570 38.752 8.649  1.00 0.00 ? 66 GLU A H    4  
ATOM 4230  H HA   . GLU A 1 96  ? 26.015 41.062 9.049  1.00 0.00 ? 66 GLU A HA   4  
ATOM 4231  H HB2  . GLU A 1 96  ? 26.532 38.731 10.909 1.00 0.00 ? 66 GLU A HB2  4  
ATOM 4232  H HB3  . GLU A 1 96  ? 25.267 39.938 11.138 1.00 0.00 ? 66 GLU A HB3  4  
ATOM 4233  H HG2  . GLU A 1 96  ? 24.327 39.336 8.916  1.00 0.00 ? 66 GLU A HG2  4  
ATOM 4234  H HG3  . GLU A 1 96  ? 25.551 38.084 8.757  1.00 0.00 ? 66 GLU A HG3  4  
ATOM 4235  N N    . PHE A 1 97  ? 28.616 40.756 11.058 1.00 0.00 ? 67 PHE A N    4  
ATOM 4236  C CA   . PHE A 1 97  ? 29.457 41.511 11.981 1.00 0.00 ? 67 PHE A CA   4  
ATOM 4237  C C    . PHE A 1 97  ? 29.960 42.794 11.327 1.00 0.00 ? 67 PHE A C    4  
ATOM 4238  O O    . PHE A 1 97  ? 29.999 43.845 11.966 1.00 0.00 ? 67 PHE A O    4  
ATOM 4239  C CB   . PHE A 1 97  ? 30.652 40.659 12.415 1.00 0.00 ? 67 PHE A CB   4  
ATOM 4240  C CG   . PHE A 1 97  ? 31.516 41.321 13.462 1.00 0.00 ? 67 PHE A CG   4  
ATOM 4241  C CD1  . PHE A 1 97  ? 32.660 42.033 13.083 1.00 0.00 ? 67 PHE A CD1  4  
ATOM 4242  C CD2  . PHE A 1 97  ? 31.170 41.224 14.815 1.00 0.00 ? 67 PHE A CD2  4  
ATOM 4243  C CE1  . PHE A 1 97  ? 33.457 42.648 14.054 1.00 0.00 ? 67 PHE A CE1  4  
ATOM 4244  C CE2  . PHE A 1 97  ? 31.968 41.838 15.789 1.00 0.00 ? 67 PHE A CE2  4  
ATOM 4245  C CZ   . PHE A 1 97  ? 33.112 42.551 15.408 1.00 0.00 ? 67 PHE A CZ   4  
ATOM 4246  H H    . PHE A 1 97  ? 28.853 39.832 10.830 1.00 0.00 ? 67 PHE A H    4  
ATOM 4247  H HA   . PHE A 1 97  ? 28.878 41.767 12.855 1.00 0.00 ? 67 PHE A HA   4  
ATOM 4248  H HB2  . PHE A 1 97  ? 30.285 39.726 12.814 1.00 0.00 ? 67 PHE A HB2  4  
ATOM 4249  H HB3  . PHE A 1 97  ? 31.256 40.445 11.544 1.00 0.00 ? 67 PHE A HB3  4  
ATOM 4250  H HD1  . PHE A 1 97  ? 32.929 42.105 12.038 1.00 0.00 ? 67 PHE A HD1  4  
ATOM 4251  H HD2  . PHE A 1 97  ? 30.288 40.673 15.109 1.00 0.00 ? 67 PHE A HD2  4  
ATOM 4252  H HE1  . PHE A 1 97  ? 34.339 43.197 13.761 1.00 0.00 ? 67 PHE A HE1  4  
ATOM 4253  H HE2  . PHE A 1 97  ? 31.702 41.763 16.832 1.00 0.00 ? 67 PHE A HE2  4  
ATOM 4254  H HZ   . PHE A 1 97  ? 33.727 43.025 16.158 1.00 0.00 ? 67 PHE A HZ   4  
ATOM 4255  N N    . LEU A 1 98  ? 30.347 42.708 10.056 1.00 0.00 ? 68 LEU A N    4  
ATOM 4256  C CA   . LEU A 1 98  ? 30.730 43.904 9.312  1.00 0.00 ? 68 LEU A CA   4  
ATOM 4257  C C    . LEU A 1 98  ? 29.545 44.855 9.150  1.00 0.00 ? 68 LEU A C    4  
ATOM 4258  O O    . LEU A 1 98  ? 29.706 46.074 9.216  1.00 0.00 ? 68 LEU A O    4  
ATOM 4259  C CB   . LEU A 1 98  ? 31.273 43.521 7.932  1.00 0.00 ? 68 LEU A CB   4  
ATOM 4260  C CG   . LEU A 1 98  ? 32.510 42.628 8.080  1.00 0.00 ? 68 LEU A CG   4  
ATOM 4261  C CD1  . LEU A 1 98  ? 32.965 42.159 6.697  1.00 0.00 ? 68 LEU A CD1  4  
ATOM 4262  C CD2  . LEU A 1 98  ? 33.643 43.420 8.739  1.00 0.00 ? 68 LEU A CD2  4  
ATOM 4263  H H    . LEU A 1 98  ? 30.405 41.829 9.625  1.00 0.00 ? 68 LEU A H    4  
ATOM 4264  H HA   . LEU A 1 98  ? 31.505 44.419 9.860  1.00 0.00 ? 68 LEU A HA   4  
ATOM 4265  H HB2  . LEU A 1 98  ? 30.510 42.988 7.384  1.00 0.00 ? 68 LEU A HB2  4  
ATOM 4266  H HB3  . LEU A 1 98  ? 31.543 44.416 7.392  1.00 0.00 ? 68 LEU A HB3  4  
ATOM 4267  H HG   . LEU A 1 98  ? 32.264 41.771 8.689  1.00 0.00 ? 68 LEU A HG   4  
ATOM 4268  H HD11 . LEU A 1 98  ? 32.811 42.952 5.980  1.00 0.00 ? 68 LEU A HD11 4  
ATOM 4269  H HD12 . LEU A 1 98  ? 32.391 41.293 6.402  1.00 0.00 ? 68 LEU A HD12 4  
ATOM 4270  H HD13 . LEU A 1 98  ? 34.014 41.903 6.727  1.00 0.00 ? 68 LEU A HD13 4  
ATOM 4271  H HD21 . LEU A 1 98  ? 34.590 42.957 8.502  1.00 0.00 ? 68 LEU A HD21 4  
ATOM 4272  H HD22 . LEU A 1 98  ? 33.503 43.425 9.810  1.00 0.00 ? 68 LEU A HD22 4  
ATOM 4273  H HD23 . LEU A 1 98  ? 33.635 44.434 8.370  1.00 0.00 ? 68 LEU A HD23 4  
ATOM 4274  N N    . ALA A 1 99  ? 28.356 44.296 8.937  1.00 0.00 ? 69 ALA A N    4  
ATOM 4275  C CA   . ALA A 1 99  ? 27.155 45.115 8.785  1.00 0.00 ? 69 ALA A CA   4  
ATOM 4276  C C    . ALA A 1 99  ? 26.860 45.925 10.047 1.00 0.00 ? 69 ALA A C    4  
ATOM 4277  O O    . ALA A 1 99  ? 26.353 47.044 9.966  1.00 0.00 ? 69 ALA A O    4  
ATOM 4278  C CB   . ALA A 1 99  ? 25.956 44.218 8.468  1.00 0.00 ? 69 ALA A CB   4  
ATOM 4279  H H    . ALA A 1 99  ? 28.293 43.324 8.834  1.00 0.00 ? 69 ALA A H    4  
ATOM 4280  H HA   . ALA A 1 99  ? 27.301 45.796 7.960  1.00 0.00 ? 69 ALA A HA   4  
ATOM 4281  H HB1  . ALA A 1 99  ? 26.287 43.362 7.900  1.00 0.00 ? 69 ALA A HB1  4  
ATOM 4282  H HB2  . ALA A 1 99  ? 25.233 44.775 7.891  1.00 0.00 ? 69 ALA A HB2  4  
ATOM 4283  H HB3  . ALA A 1 99  ? 25.503 43.885 9.390  1.00 0.00 ? 69 ALA A HB3  4  
ATOM 4284  N N    . THR A 1 100 ? 27.177 45.363 11.209 1.00 0.00 ? 70 THR A N    4  
ATOM 4285  C CA   . THR A 1 100 ? 27.010 46.090 12.468 1.00 0.00 ? 70 THR A CA   4  
ATOM 4286  C C    . THR A 1 100 ? 28.093 47.155 12.677 1.00 0.00 ? 70 THR A C    4  
ATOM 4287  O O    . THR A 1 100 ? 27.897 48.090 13.453 1.00 0.00 ? 70 THR A O    4  
ATOM 4288  C CB   . THR A 1 100 ? 27.032 45.110 13.644 1.00 0.00 ? 70 THR A CB   4  
ATOM 4289  O OG1  . THR A 1 100 ? 28.291 44.455 13.691 1.00 0.00 ? 70 THR A OG1  4  
ATOM 4290  C CG2  . THR A 1 100 ? 25.920 44.075 13.472 1.00 0.00 ? 70 THR A CG2  4  
ATOM 4291  H H    . THR A 1 100 ? 27.481 44.430 11.225 1.00 0.00 ? 70 THR A H    4  
ATOM 4292  H HA   . THR A 1 100 ? 26.048 46.580 12.454 1.00 0.00 ? 70 THR A HA   4  
ATOM 4293  H HB   . THR A 1 100 ? 26.874 45.651 14.564 1.00 0.00 ? 70 THR A HB   4  
ATOM 4294  H HG1  . THR A 1 100 ? 28.537 44.386 14.554 1.00 0.00 ? 70 THR A HG1  4  
ATOM 4295  H HG21 . THR A 1 100 ? 25.945 43.380 14.299 1.00 0.00 ? 70 THR A HG21 4  
ATOM 4296  H HG22 . THR A 1 100 ? 26.066 43.539 12.546 1.00 0.00 ? 70 THR A HG22 4  
ATOM 4297  H HG23 . THR A 1 100 ? 24.962 44.576 13.452 1.00 0.00 ? 70 THR A HG23 4  
ATOM 4298  N N    . GLY A 1 101 ? 29.230 47.024 11.994 1.00 0.00 ? 71 GLY A N    4  
ATOM 4299  C CA   . GLY A 1 101 ? 30.310 47.995 12.128 1.00 0.00 ? 71 GLY A CA   4  
ATOM 4300  C C    . GLY A 1 101 ? 31.342 47.821 11.020 1.00 0.00 ? 71 GLY A C    4  
ATOM 4301  O O    . GLY A 1 101 ? 32.277 47.029 11.146 1.00 0.00 ? 71 GLY A O    4  
ATOM 4302  H H    . GLY A 1 101 ? 29.343 46.261 11.389 1.00 0.00 ? 71 GLY A H    4  
ATOM 4303  H HA2  . GLY A 1 101 ? 29.898 48.992 12.078 1.00 0.00 ? 71 GLY A HA2  4  
ATOM 4304  H HA3  . GLY A 1 101 ? 30.795 47.857 13.083 1.00 0.00 ? 71 GLY A HA3  4  
ATOM 4305  N N    . GLU A 1 31  ? 46.887 43.557 18.286 1.00 0.00 ? 1  GLU A N    5  
ATOM 4306  C CA   . GLU A 1 31  ? 46.546 42.165 18.017 1.00 0.00 ? 1  GLU A CA   5  
ATOM 4307  C C    . GLU A 1 31  ? 46.292 41.952 16.529 1.00 0.00 ? 1  GLU A C    5  
ATOM 4308  O O    . GLU A 1 31  ? 46.298 42.902 15.746 1.00 0.00 ? 1  GLU A O    5  
ATOM 4309  C CB   . GLU A 1 31  ? 45.299 41.770 18.810 1.00 0.00 ? 1  GLU A CB   5  
ATOM 4310  C CG   . GLU A 1 31  ? 45.588 41.879 20.312 1.00 0.00 ? 1  GLU A CG   5  
ATOM 4311  C CD   . GLU A 1 31  ? 44.399 41.412 21.156 1.00 0.00 ? 1  GLU A CD   5  
ATOM 4312  O OE1  . GLU A 1 31  ? 43.324 41.203 20.611 1.00 0.00 ? 1  GLU A OE1  5  
ATOM 4313  O OE2  . GLU A 1 31  ? 44.583 41.270 22.354 1.00 0.00 ? 1  GLU A OE2  5  
ATOM 4314  H H    . GLU A 1 31  ? 46.231 44.265 18.115 1.00 0.00 ? 1  GLU A H    5  
ATOM 4315  H HA   . GLU A 1 31  ? 47.368 41.536 18.326 1.00 0.00 ? 1  GLU A HA   5  
ATOM 4316  H HB2  . GLU A 1 31  ? 44.484 42.431 18.550 1.00 0.00 ? 1  GLU A HB2  5  
ATOM 4317  H HB3  . GLU A 1 31  ? 45.027 40.752 18.572 1.00 0.00 ? 1  GLU A HB3  5  
ATOM 4318  H HG2  . GLU A 1 31  ? 46.447 41.269 20.549 1.00 0.00 ? 1  GLU A HG2  5  
ATOM 4319  H HG3  . GLU A 1 31  ? 45.812 42.909 20.552 1.00 0.00 ? 1  GLU A HG3  5  
ATOM 4320  N N    . THR A 1 32  ? 46.069 40.700 16.145 1.00 0.00 ? 2  THR A N    5  
ATOM 4321  C CA   . THR A 1 32  ? 45.807 40.374 14.748 1.00 0.00 ? 2  THR A CA   5  
ATOM 4322  C C    . THR A 1 32  ? 44.581 41.129 14.246 1.00 0.00 ? 2  THR A C    5  
ATOM 4323  O O    . THR A 1 32  ? 43.597 41.286 14.967 1.00 0.00 ? 2  THR A O    5  
ATOM 4324  C CB   . THR A 1 32  ? 45.582 38.868 14.595 1.00 0.00 ? 2  THR A CB   5  
ATOM 4325  O OG1  . THR A 1 32  ? 46.643 38.167 15.229 1.00 0.00 ? 2  THR A OG1  5  
ATOM 4326  C CG2  . THR A 1 32  ? 45.546 38.504 13.110 1.00 0.00 ? 2  THR A CG2  5  
ATOM 4327  H H    . THR A 1 32  ? 46.080 39.983 16.813 1.00 0.00 ? 2  THR A H    5  
ATOM 4328  H HA   . THR A 1 32  ? 46.663 40.660 14.155 1.00 0.00 ? 2  THR A HA   5  
ATOM 4329  H HB   . THR A 1 32  ? 44.644 38.594 15.052 1.00 0.00 ? 2  THR A HB   5  
ATOM 4330  H HG1  . THR A 1 32  ? 46.326 37.814 15.994 1.00 0.00 ? 2  THR A HG1  5  
ATOM 4331  H HG21 . THR A 1 32  ? 44.835 39.137 12.600 1.00 0.00 ? 2  THR A HG21 5  
ATOM 4332  H HG22 . THR A 1 32  ? 45.252 37.473 12.999 1.00 0.00 ? 2  THR A HG22 5  
ATOM 4333  H HG23 . THR A 1 32  ? 46.527 38.647 12.680 1.00 0.00 ? 2  THR A HG23 5  
ATOM 4334  N N    . LEU A 1 33  ? 44.618 41.537 12.983 1.00 0.00 ? 3  LEU A N    5  
ATOM 4335  C CA   . LEU A 1 33  ? 43.541 42.351 12.423 1.00 0.00 ? 3  LEU A CA   5  
ATOM 4336  C C    . LEU A 1 33  ? 42.181 41.655 12.520 1.00 0.00 ? 3  LEU A C    5  
ATOM 4337  O O    . LEU A 1 33  ? 41.147 42.319 12.605 1.00 0.00 ? 3  LEU A O    5  
ATOM 4338  C CB   . LEU A 1 33  ? 43.835 42.644 10.952 1.00 0.00 ? 3  LEU A CB   5  
ATOM 4339  C CG   . LEU A 1 33  ? 45.176 43.368 10.817 1.00 0.00 ? 3  LEU A CG   5  
ATOM 4340  C CD1  . LEU A 1 33  ? 45.580 43.418 9.343  1.00 0.00 ? 3  LEU A CD1  5  
ATOM 4341  C CD2  . LEU A 1 33  ? 45.039 44.795 11.351 1.00 0.00 ? 3  LEU A CD2  5  
ATOM 4342  H H    . LEU A 1 33  ? 45.377 41.287 12.417 1.00 0.00 ? 3  LEU A H    5  
ATOM 4343  H HA   . LEU A 1 33  ? 43.494 43.287 12.959 1.00 0.00 ? 3  LEU A HA   5  
ATOM 4344  H HB2  . LEU A 1 33  ? 43.869 41.716 10.401 1.00 0.00 ? 3  LEU A HB2  5  
ATOM 4345  H HB3  . LEU A 1 33  ? 43.051 43.270 10.553 1.00 0.00 ? 3  LEU A HB3  5  
ATOM 4346  H HG   . LEU A 1 33  ? 45.930 42.840 11.381 1.00 0.00 ? 3  LEU A HG   5  
ATOM 4347  H HD11 . LEU A 1 33  ? 46.576 43.826 9.256  1.00 0.00 ? 3  LEU A HD11 5  
ATOM 4348  H HD12 . LEU A 1 33  ? 44.886 44.042 8.800  1.00 0.00 ? 3  LEU A HD12 5  
ATOM 4349  H HD13 . LEU A 1 33  ? 45.564 42.420 8.931  1.00 0.00 ? 3  LEU A HD13 5  
ATOM 4350  H HD21 . LEU A 1 33  ? 44.886 44.767 12.420 1.00 0.00 ? 3  LEU A HD21 5  
ATOM 4351  H HD22 . LEU A 1 33  ? 44.194 45.274 10.879 1.00 0.00 ? 3  LEU A HD22 5  
ATOM 4352  H HD23 . LEU A 1 33  ? 45.938 45.350 11.131 1.00 0.00 ? 3  LEU A HD23 5  
ATOM 4353  N N    . ASN A 1 34  ? 42.176 40.326 12.507 1.00 0.00 ? 4  ASN A N    5  
ATOM 4354  C CA   . ASN A 1 34  ? 40.924 39.568 12.569 1.00 0.00 ? 4  ASN A CA   5  
ATOM 4355  C C    . ASN A 1 34  ? 40.574 39.112 13.995 1.00 0.00 ? 4  ASN A C    5  
ATOM 4356  O O    . ASN A 1 34  ? 39.640 38.331 14.178 1.00 0.00 ? 4  ASN A O    5  
ATOM 4357  C CB   . ASN A 1 34  ? 41.022 38.335 11.665 1.00 0.00 ? 4  ASN A CB   5  
ATOM 4358  C CG   . ASN A 1 34  ? 41.412 38.739 10.245 1.00 0.00 ? 4  ASN A CG   5  
ATOM 4359  O OD1  . ASN A 1 34  ? 40.807 39.638 9.655  1.00 0.00 ? 4  ASN A OD1  5  
ATOM 4360  N ND2  . ASN A 1 34  ? 42.393 38.117 9.650  1.00 0.00 ? 4  ASN A ND2  5  
ATOM 4361  H H    . ASN A 1 34  ? 43.027 39.842 12.455 1.00 0.00 ? 4  ASN A H    5  
ATOM 4362  H HA   . ASN A 1 34  ? 40.125 40.195 12.202 1.00 0.00 ? 4  ASN A HA   5  
ATOM 4363  H HB2  . ASN A 1 34  ? 41.768 37.662 12.060 1.00 0.00 ? 4  ASN A HB2  5  
ATOM 4364  H HB3  . ASN A 1 34  ? 40.067 37.833 11.643 1.00 0.00 ? 4  ASN A HB3  5  
ATOM 4365  H HD21 . ASN A 1 34  ? 42.866 37.392 10.113 1.00 0.00 ? 4  ASN A HD21 5  
ATOM 4366  H HD22 . ASN A 1 34  ? 42.670 38.388 8.751  1.00 0.00 ? 4  ASN A HD22 5  
ATOM 4367  N N    . GLY A 1 35  ? 41.298 39.594 15.008 1.00 0.00 ? 5  GLY A N    5  
ATOM 4368  C CA   . GLY A 1 35  ? 41.120 39.098 16.368 1.00 0.00 ? 5  GLY A CA   5  
ATOM 4369  C C    . GLY A 1 35  ? 39.665 39.183 16.814 1.00 0.00 ? 5  GLY A C    5  
ATOM 4370  O O    . GLY A 1 35  ? 39.166 38.274 17.478 1.00 0.00 ? 5  GLY A O    5  
ATOM 4371  H H    . GLY A 1 35  ? 41.963 40.293 14.839 1.00 0.00 ? 5  GLY A H    5  
ATOM 4372  H HA2  . GLY A 1 35  ? 41.443 38.068 16.412 1.00 0.00 ? 5  GLY A HA2  5  
ATOM 4373  H HA3  . GLY A 1 35  ? 41.726 39.687 17.039 1.00 0.00 ? 5  GLY A HA3  5  
ATOM 4374  N N    . ALA A 1 36  ? 38.976 40.258 16.434 1.00 0.00 ? 6  ALA A N    5  
ATOM 4375  C CA   . ALA A 1 36  ? 37.588 40.429 16.852 1.00 0.00 ? 6  ALA A CA   5  
ATOM 4376  C C    . ALA A 1 36  ? 36.729 39.282 16.328 1.00 0.00 ? 6  ALA A C    5  
ATOM 4377  O O    . ALA A 1 36  ? 35.972 38.666 17.080 1.00 0.00 ? 6  ALA A O    5  
ATOM 4378  C CB   . ALA A 1 36  ? 37.044 41.759 16.326 1.00 0.00 ? 6  ALA A CB   5  
ATOM 4379  H H    . ALA A 1 36  ? 39.404 40.937 15.870 1.00 0.00 ? 6  ALA A H    5  
ATOM 4380  H HA   . ALA A 1 36  ? 37.544 40.436 17.931 1.00 0.00 ? 6  ALA A HA   5  
ATOM 4381  H HB1  . ALA A 1 36  ? 37.563 42.576 16.807 1.00 0.00 ? 6  ALA A HB1  5  
ATOM 4382  H HB2  . ALA A 1 36  ? 35.988 41.826 16.542 1.00 0.00 ? 6  ALA A HB2  5  
ATOM 4383  H HB3  . ALA A 1 36  ? 37.198 41.814 15.259 1.00 0.00 ? 6  ALA A HB3  5  
ATOM 4384  N N    . LEU A 1 37  ? 36.876 38.969 15.042 1.00 0.00 ? 7  LEU A N    5  
ATOM 4385  C CA   . LEU A 1 37  ? 36.141 37.849 14.462 1.00 0.00 ? 7  LEU A CA   5  
ATOM 4386  C C    . LEU A 1 37  ? 36.530 36.531 15.133 1.00 0.00 ? 7  LEU A C    5  
ATOM 4387  O O    . LEU A 1 37  ? 35.682 35.664 15.346 1.00 0.00 ? 7  LEU A O    5  
ATOM 4388  C CB   . LEU A 1 37  ? 36.404 37.773 12.955 1.00 0.00 ? 7  LEU A CB   5  
ATOM 4389  C CG   . LEU A 1 37  ? 35.991 39.090 12.290 1.00 0.00 ? 7  LEU A CG   5  
ATOM 4390  C CD1  . LEU A 1 37  ? 36.354 39.052 10.805 1.00 0.00 ? 7  LEU A CD1  5  
ATOM 4391  C CD2  . LEU A 1 37  ? 34.478 39.291 12.425 1.00 0.00 ? 7  LEU A CD2  5  
ATOM 4392  H H    . LEU A 1 37  ? 37.483 39.494 14.480 1.00 0.00 ? 7  LEU A H    5  
ATOM 4393  H HA   . LEU A 1 37  ? 35.086 38.011 14.623 1.00 0.00 ? 7  LEU A HA   5  
ATOM 4394  H HB2  . LEU A 1 37  ? 37.456 37.596 12.784 1.00 0.00 ? 7  LEU A HB2  5  
ATOM 4395  H HB3  . LEU A 1 37  ? 35.830 36.963 12.530 1.00 0.00 ? 7  LEU A HB3  5  
ATOM 4396  H HG   . LEU A 1 37  ? 36.508 39.910 12.766 1.00 0.00 ? 7  LEU A HG   5  
ATOM 4397  H HD11 . LEU A 1 37  ? 36.160 38.066 10.412 1.00 0.00 ? 7  LEU A HD11 5  
ATOM 4398  H HD12 . LEU A 1 37  ? 37.401 39.290 10.684 1.00 0.00 ? 7  LEU A HD12 5  
ATOM 4399  H HD13 . LEU A 1 37  ? 35.756 39.777 10.272 1.00 0.00 ? 7  LEU A HD13 5  
ATOM 4400  H HD21 . LEU A 1 37  ? 34.147 40.020 11.703 1.00 0.00 ? 7  LEU A HD21 5  
ATOM 4401  H HD22 . LEU A 1 37  ? 34.249 39.639 13.421 1.00 0.00 ? 7  LEU A HD22 5  
ATOM 4402  H HD23 . LEU A 1 37  ? 33.975 38.353 12.248 1.00 0.00 ? 7  LEU A HD23 5  
ATOM 4403  N N    . VAL A 1 38  ? 37.804 36.395 15.500 1.00 0.00 ? 8  VAL A N    5  
ATOM 4404  C CA   . VAL A 1 38  ? 38.252 35.200 16.211 1.00 0.00 ? 8  VAL A CA   5  
ATOM 4405  C C    . VAL A 1 38  ? 37.497 35.070 17.534 1.00 0.00 ? 8  VAL A C    5  
ATOM 4406  O O    . VAL A 1 38  ? 37.053 33.981 17.902 1.00 0.00 ? 8  VAL A O    5  
ATOM 4407  C CB   . VAL A 1 38  ? 39.767 35.283 16.458 1.00 0.00 ? 8  VAL A CB   5  
ATOM 4408  C CG1  . VAL A 1 38  ? 40.267 34.041 17.203 1.00 0.00 ? 8  VAL A CG1  5  
ATOM 4409  C CG2  . VAL A 1 38  ? 40.499 35.376 15.117 1.00 0.00 ? 8  VAL A CG2  5  
ATOM 4410  H H    . VAL A 1 38  ? 38.452 37.091 15.262 1.00 0.00 ? 8  VAL A H    5  
ATOM 4411  H HA   . VAL A 1 38  ? 38.044 34.332 15.603 1.00 0.00 ? 8  VAL A HA   5  
ATOM 4412  H HB   . VAL A 1 38  ? 39.984 36.163 17.045 1.00 0.00 ? 8  VAL A HB   5  
ATOM 4413  H HG11 . VAL A 1 38  ? 41.283 34.205 17.529 1.00 0.00 ? 8  VAL A HG11 5  
ATOM 4414  H HG12 . VAL A 1 38  ? 40.237 33.189 16.543 1.00 0.00 ? 8  VAL A HG12 5  
ATOM 4415  H HG13 . VAL A 1 38  ? 39.642 33.854 18.063 1.00 0.00 ? 8  VAL A HG13 5  
ATOM 4416  H HG21 . VAL A 1 38  ? 41.510 35.718 15.283 1.00 0.00 ? 8  VAL A HG21 5  
ATOM 4417  H HG22 . VAL A 1 38  ? 39.987 36.070 14.468 1.00 0.00 ? 8  VAL A HG22 5  
ATOM 4418  H HG23 . VAL A 1 38  ? 40.522 34.401 14.653 1.00 0.00 ? 8  VAL A HG23 5  
ATOM 4419  N N    . ASN A 1 39  ? 37.310 36.192 18.226 1.00 0.00 ? 9  ASN A N    5  
ATOM 4420  C CA   . ASN A 1 39  ? 36.532 36.190 19.460 1.00 0.00 ? 9  ASN A CA   5  
ATOM 4421  C C    . ASN A 1 39  ? 35.092 35.761 19.190 1.00 0.00 ? 9  ASN A C    5  
ATOM 4422  O O    . ASN A 1 39  ? 34.504 35.006 19.967 1.00 0.00 ? 9  ASN A O    5  
ATOM 4423  C CB   . ASN A 1 39  ? 36.543 37.587 20.086 1.00 0.00 ? 9  ASN A CB   5  
ATOM 4424  C CG   . ASN A 1 39  ? 37.961 37.973 20.498 1.00 0.00 ? 9  ASN A CG   5  
ATOM 4425  O OD1  . ASN A 1 39  ? 38.810 37.106 20.703 1.00 0.00 ? 9  ASN A OD1  5  
ATOM 4426  N ND2  . ASN A 1 39  ? 38.268 39.235 20.633 1.00 0.00 ? 9  ASN A ND2  5  
ATOM 4427  H H    . ASN A 1 39  ? 37.729 37.022 17.920 1.00 0.00 ? 9  ASN A H    5  
ATOM 4428  H HA   . ASN A 1 39  ? 36.980 35.494 20.155 1.00 0.00 ? 9  ASN A HA   5  
ATOM 4429  H HB2  . ASN A 1 39  ? 36.172 38.302 19.367 1.00 0.00 ? 9  ASN A HB2  5  
ATOM 4430  H HB3  . ASN A 1 39  ? 35.905 37.593 20.957 1.00 0.00 ? 9  ASN A HB3  5  
ATOM 4431  H HD21 . ASN A 1 39  ? 37.592 39.923 20.470 1.00 0.00 ? 9  ASN A HD21 5  
ATOM 4432  H HD22 . ASN A 1 39  ? 39.176 39.491 20.897 1.00 0.00 ? 9  ASN A HD22 5  
ATOM 4433  N N    . MET A 1 40  ? 34.541 36.205 18.062 1.00 0.00 ? 10 MET A N    5  
ATOM 4434  C CA   . MET A 1 40  ? 33.181 35.822 17.700 1.00 0.00 ? 10 MET A CA   5  
ATOM 4435  C C    . MET A 1 40  ? 33.083 34.309 17.550 1.00 0.00 ? 10 MET A C    5  
ATOM 4436  O O    . MET A 1 40  ? 32.150 33.681 18.052 1.00 0.00 ? 10 MET A O    5  
ATOM 4437  C CB   . MET A 1 40  ? 32.824 36.451 16.351 1.00 0.00 ? 10 MET A CB   5  
ATOM 4438  C CG   . MET A 1 40  ? 31.325 36.295 16.082 1.00 0.00 ? 10 MET A CG   5  
ATOM 4439  S SD   . MET A 1 40  ? 30.980 36.603 14.329 1.00 0.00 ? 10 MET A SD   5  
ATOM 4440  C CE   . MET A 1 40  ? 31.509 38.332 14.236 1.00 0.00 ? 10 MET A CE   5  
ATOM 4441  H H    . MET A 1 40  ? 35.038 36.835 17.496 1.00 0.00 ? 10 MET A H    5  
ATOM 4442  H HA   . MET A 1 40  ? 32.488 36.165 18.453 1.00 0.00 ? 10 MET A HA   5  
ATOM 4443  H HB2  . MET A 1 40  ? 33.079 37.500 16.375 1.00 0.00 ? 10 MET A HB2  5  
ATOM 4444  H HB3  . MET A 1 40  ? 33.381 35.963 15.567 1.00 0.00 ? 10 MET A HB3  5  
ATOM 4445  H HG2  . MET A 1 40  ? 31.018 35.292 16.338 1.00 0.00 ? 10 MET A HG2  5  
ATOM 4446  H HG3  . MET A 1 40  ? 30.777 37.003 16.687 1.00 0.00 ? 10 MET A HG3  5  
ATOM 4447  H HE1  . MET A 1 40  ? 32.529 38.418 14.579 1.00 0.00 ? 10 MET A HE1  5  
ATOM 4448  H HE2  . MET A 1 40  ? 30.870 38.942 14.855 1.00 0.00 ? 10 MET A HE2  5  
ATOM 4449  H HE3  . MET A 1 40  ? 31.443 38.666 13.210 1.00 0.00 ? 10 MET A HE3  5  
ATOM 4450  N N    . LEU A 1 41  ? 34.079 33.720 16.896 1.00 0.00 ? 11 LEU A N    5  
ATOM 4451  C CA   . LEU A 1 41  ? 34.095 32.276 16.707 1.00 0.00 ? 11 LEU A CA   5  
ATOM 4452  C C    . LEU A 1 41  ? 34.187 31.540 18.038 1.00 0.00 ? 11 LEU A C    5  
ATOM 4453  O O    . LEU A 1 41  ? 33.503 30.537 18.237 1.00 0.00 ? 11 LEU A O    5  
ATOM 4454  C CB   . LEU A 1 41  ? 35.268 31.886 15.806 1.00 0.00 ? 11 LEU A CB   5  
ATOM 4455  C CG   . LEU A 1 41  ? 35.101 32.561 14.443 1.00 0.00 ? 11 LEU A CG   5  
ATOM 4456  C CD1  . LEU A 1 41  ? 36.363 32.349 13.609 1.00 0.00 ? 11 LEU A CD1  5  
ATOM 4457  C CD2  . LEU A 1 41  ? 33.907 31.948 13.709 1.00 0.00 ? 11 LEU A CD2  5  
ATOM 4458  H H    . LEU A 1 41  ? 34.791 34.269 16.507 1.00 0.00 ? 11 LEU A H    5  
ATOM 4459  H HA   . LEU A 1 41  ? 33.177 31.984 16.221 1.00 0.00 ? 11 LEU A HA   5  
ATOM 4460  H HB2  . LEU A 1 41  ? 36.194 32.208 16.261 1.00 0.00 ? 11 LEU A HB2  5  
ATOM 4461  H HB3  . LEU A 1 41  ? 35.283 30.814 15.675 1.00 0.00 ? 11 LEU A HB3  5  
ATOM 4462  H HG   . LEU A 1 41  ? 34.936 33.619 14.584 1.00 0.00 ? 11 LEU A HG   5  
ATOM 4463  H HD11 . LEU A 1 41  ? 37.111 33.071 13.902 1.00 0.00 ? 11 LEU A HD11 5  
ATOM 4464  H HD12 . LEU A 1 41  ? 36.129 32.477 12.562 1.00 0.00 ? 11 LEU A HD12 5  
ATOM 4465  H HD13 . LEU A 1 41  ? 36.740 31.351 13.774 1.00 0.00 ? 11 LEU A HD13 5  
ATOM 4466  H HD21 . LEU A 1 41  ? 33.938 32.238 12.671 1.00 0.00 ? 11 LEU A HD21 5  
ATOM 4467  H HD22 . LEU A 1 41  ? 32.989 32.302 14.154 1.00 0.00 ? 11 LEU A HD22 5  
ATOM 4468  H HD23 . LEU A 1 41  ? 33.950 30.871 13.785 1.00 0.00 ? 11 LEU A HD23 5  
ATOM 4469  N N    . LYS A 1 42  ? 35.009 32.047 18.958 1.00 0.00 ? 12 LYS A N    5  
ATOM 4470  C CA   . LYS A 1 42  ? 35.119 31.421 20.272 1.00 0.00 ? 12 LYS A CA   5  
ATOM 4471  C C    . LYS A 1 42  ? 33.770 31.401 20.983 1.00 0.00 ? 12 LYS A C    5  
ATOM 4472  O O    . LYS A 1 42  ? 33.397 30.393 21.588 1.00 0.00 ? 12 LYS A O    5  
ATOM 4473  C CB   . LYS A 1 42  ? 36.141 32.166 21.135 1.00 0.00 ? 12 LYS A CB   5  
ATOM 4474  C CG   . LYS A 1 42  ? 37.539 32.001 20.537 1.00 0.00 ? 12 LYS A CG   5  
ATOM 4475  C CD   . LYS A 1 42  ? 38.569 32.657 21.461 1.00 0.00 ? 12 LYS A CD   5  
ATOM 4476  C CE   . LYS A 1 42  ? 39.961 32.584 20.827 1.00 0.00 ? 12 LYS A CE   5  
ATOM 4477  N NZ   . LYS A 1 42  ? 40.785 33.727 21.312 1.00 0.00 ? 12 LYS A NZ   5  
ATOM 4478  H H    . LYS A 1 42  ? 35.569 32.820 18.737 1.00 0.00 ? 12 LYS A H    5  
ATOM 4479  H HA   . LYS A 1 42  ? 35.457 30.403 20.143 1.00 0.00 ? 12 LYS A HA   5  
ATOM 4480  H HB2  . LYS A 1 42  ? 35.884 33.215 21.168 1.00 0.00 ? 12 LYS A HB2  5  
ATOM 4481  H HB3  . LYS A 1 42  ? 36.130 31.761 22.135 1.00 0.00 ? 12 LYS A HB3  5  
ATOM 4482  H HG2  . LYS A 1 42  ? 37.764 30.949 20.434 1.00 0.00 ? 12 LYS A HG2  5  
ATOM 4483  H HG3  . LYS A 1 42  ? 37.576 32.475 19.568 1.00 0.00 ? 12 LYS A HG3  5  
ATOM 4484  H HD2  . LYS A 1 42  ? 38.300 33.691 21.620 1.00 0.00 ? 12 LYS A HD2  5  
ATOM 4485  H HD3  . LYS A 1 42  ? 38.581 32.139 22.409 1.00 0.00 ? 12 LYS A HD3  5  
ATOM 4486  H HE2  . LYS A 1 42  ? 40.434 31.655 21.108 1.00 0.00 ? 12 LYS A HE2  5  
ATOM 4487  H HE3  . LYS A 1 42  ? 39.875 32.633 19.753 1.00 0.00 ? 12 LYS A HE3  5  
ATOM 4488  H HZ1  . LYS A 1 42  ? 40.522 34.589 20.793 1.00 0.00 ? 12 LYS A HZ1  5  
ATOM 4489  H HZ2  . LYS A 1 42  ? 41.791 33.519 21.152 1.00 0.00 ? 12 LYS A HZ2  5  
ATOM 4490  H HZ3  . LYS A 1 42  ? 40.617 33.871 22.328 1.00 0.00 ? 12 LYS A HZ3  5  
ATOM 4491  N N    . GLU A 1 43  ? 33.017 32.495 20.869 1.00 0.00 ? 13 GLU A N    5  
ATOM 4492  C CA   . GLU A 1 43  ? 31.695 32.548 21.485 1.00 0.00 ? 13 GLU A CA   5  
ATOM 4493  C C    . GLU A 1 43  ? 30.767 31.513 20.854 1.00 0.00 ? 13 GLU A C    5  
ATOM 4494  O O    . GLU A 1 43  ? 30.071 30.779 21.559 1.00 0.00 ? 13 GLU A O    5  
ATOM 4495  C CB   . GLU A 1 43  ? 31.096 33.946 21.316 1.00 0.00 ? 13 GLU A CB   5  
ATOM 4496  C CG   . GLU A 1 43  ? 29.797 34.047 22.125 1.00 0.00 ? 13 GLU A CG   5  
ATOM 4497  C CD   . GLU A 1 43  ? 29.100 35.398 21.924 1.00 0.00 ? 13 GLU A CD   5  
ATOM 4498  O OE1  . GLU A 1 43  ? 29.591 36.218 21.162 1.00 0.00 ? 13 GLU A OE1  5  
ATOM 4499  O OE2  . GLU A 1 43  ? 28.070 35.595 22.548 1.00 0.00 ? 13 GLU A OE2  5  
ATOM 4500  H H    . GLU A 1 43  ? 33.371 33.282 20.403 1.00 0.00 ? 13 GLU A H    5  
ATOM 4501  H HA   . GLU A 1 43  ? 31.791 32.336 22.538 1.00 0.00 ? 13 GLU A HA   5  
ATOM 4502  H HB2  . GLU A 1 43  ? 31.801 34.684 21.670 1.00 0.00 ? 13 GLU A HB2  5  
ATOM 4503  H HB3  . GLU A 1 43  ? 30.881 34.122 20.273 1.00 0.00 ? 13 GLU A HB3  5  
ATOM 4504  H HG2  . GLU A 1 43  ? 29.127 33.259 21.815 1.00 0.00 ? 13 GLU A HG2  5  
ATOM 4505  H HG3  . GLU A 1 43  ? 30.025 33.920 23.173 1.00 0.00 ? 13 GLU A HG3  5  
ATOM 4506  N N    . GLU A 1 44  ? 30.810 31.410 19.528 1.00 0.00 ? 14 GLU A N    5  
ATOM 4507  C CA   . GLU A 1 44  ? 29.987 30.426 18.833 1.00 0.00 ? 14 GLU A CA   5  
ATOM 4508  C C    . GLU A 1 44  ? 30.373 29.007 19.241 1.00 0.00 ? 14 GLU A C    5  
ATOM 4509  O O    . GLU A 1 44  ? 29.510 28.151 19.429 1.00 0.00 ? 14 GLU A O    5  
ATOM 4510  C CB   . GLU A 1 44  ? 30.152 30.581 17.320 1.00 0.00 ? 14 GLU A CB   5  
ATOM 4511  C CG   . GLU A 1 44  ? 29.621 31.950 16.884 1.00 0.00 ? 14 GLU A CG   5  
ATOM 4512  C CD   . GLU A 1 44  ? 28.124 32.088 17.172 1.00 0.00 ? 14 GLU A CD   5  
ATOM 4513  O OE1  . GLU A 1 44  ? 27.655 33.214 17.190 1.00 0.00 ? 14 GLU A OE1  5  
ATOM 4514  O OE2  . GLU A 1 44  ? 27.460 31.079 17.357 1.00 0.00 ? 14 GLU A OE2  5  
ATOM 4515  H H    . GLU A 1 44  ? 31.374 32.024 19.012 1.00 0.00 ? 14 GLU A H    5  
ATOM 4516  H HA   . GLU A 1 44  ? 28.951 30.592 19.088 1.00 0.00 ? 14 GLU A HA   5  
ATOM 4517  H HB2  . GLU A 1 44  ? 31.199 30.499 17.063 1.00 0.00 ? 14 GLU A HB2  5  
ATOM 4518  H HB3  . GLU A 1 44  ? 29.595 29.806 16.816 1.00 0.00 ? 14 GLU A HB3  5  
ATOM 4519  H HG2  . GLU A 1 44  ? 30.154 32.722 17.418 1.00 0.00 ? 14 GLU A HG2  5  
ATOM 4520  H HG3  . GLU A 1 44  ? 29.791 32.073 15.824 1.00 0.00 ? 14 GLU A HG3  5  
ATOM 4521  N N    . GLY A 1 45  ? 31.672 28.772 19.411 1.00 0.00 ? 15 GLY A N    5  
ATOM 4522  C CA   . GLY A 1 45  ? 32.146 27.455 19.815 1.00 0.00 ? 15 GLY A CA   5  
ATOM 4523  C C    . GLY A 1 45  ? 31.574 27.056 21.168 1.00 0.00 ? 15 GLY A C    5  
ATOM 4524  O O    . GLY A 1 45  ? 31.075 25.942 21.331 1.00 0.00 ? 15 GLY A O    5  
ATOM 4525  H H    . GLY A 1 45  ? 32.318 29.484 19.235 1.00 0.00 ? 15 GLY A H    5  
ATOM 4526  H HA2  . GLY A 1 45  ? 31.845 26.730 19.074 1.00 0.00 ? 15 GLY A HA2  5  
ATOM 4527  H HA3  . GLY A 1 45  ? 33.223 27.471 19.879 1.00 0.00 ? 15 GLY A HA3  5  
ATOM 4528  N N    . ASN A 1 46  ? 31.618 27.977 22.130 1.00 0.00 ? 16 ASN A N    5  
ATOM 4529  C CA   . ASN A 1 46  ? 31.105 27.679 23.462 1.00 0.00 ? 16 ASN A CA   5  
ATOM 4530  C C    . ASN A 1 46  ? 29.614 27.357 23.415 1.00 0.00 ? 16 ASN A C    5  
ATOM 4531  O O    . ASN A 1 46  ? 29.163 26.405 24.054 1.00 0.00 ? 16 ASN A O    5  
ATOM 4532  C CB   . ASN A 1 46  ? 31.340 28.872 24.390 1.00 0.00 ? 16 ASN A CB   5  
ATOM 4533  C CG   . ASN A 1 46  ? 32.835 29.150 24.515 1.00 0.00 ? 16 ASN A CG   5  
ATOM 4534  O OD1  . ASN A 1 46  ? 33.263 30.300 24.415 1.00 0.00 ? 16 ASN A OD1  5  
ATOM 4535  N ND2  . ASN A 1 46  ? 33.658 28.161 24.730 1.00 0.00 ? 16 ASN A ND2  5  
ATOM 4536  H H    . ASN A 1 46  ? 32.032 28.849 21.950 1.00 0.00 ? 16 ASN A H    5  
ATOM 4537  H HA   . ASN A 1 46  ? 31.633 26.824 23.856 1.00 0.00 ? 16 ASN A HA   5  
ATOM 4538  H HB2  . ASN A 1 46  ? 30.846 29.743 23.985 1.00 0.00 ? 16 ASN A HB2  5  
ATOM 4539  H HB3  . ASN A 1 46  ? 30.935 28.652 25.366 1.00 0.00 ? 16 ASN A HB3  5  
ATOM 4540  H HD21 . ASN A 1 46  ? 33.314 27.247 24.811 1.00 0.00 ? 16 ASN A HD21 5  
ATOM 4541  H HD22 . ASN A 1 46  ? 34.619 28.333 24.812 1.00 0.00 ? 16 ASN A HD22 5  
ATOM 4542  N N    . LYS A 1 47  ? 28.856 28.116 22.621 1.00 0.00 ? 17 LYS A N    5  
ATOM 4543  C CA   . LYS A 1 47  ? 27.427 27.846 22.486 1.00 0.00 ? 17 LYS A CA   5  
ATOM 4544  C C    . LYS A 1 47  ? 27.182 26.470 21.872 1.00 0.00 ? 17 LYS A C    5  
ATOM 4545  O O    . LYS A 1 47  ? 26.354 25.699 22.368 1.00 0.00 ? 17 LYS A O    5  
ATOM 4546  C CB   . LYS A 1 47  ? 26.761 28.922 21.626 1.00 0.00 ? 17 LYS A CB   5  
ATOM 4547  C CG   . LYS A 1 47  ? 26.875 30.278 22.327 1.00 0.00 ? 17 LYS A CG   5  
ATOM 4548  C CD   . LYS A 1 47  ? 25.993 31.303 21.610 1.00 0.00 ? 17 LYS A CD   5  
ATOM 4549  C CE   . LYS A 1 47  ? 26.532 31.549 20.200 1.00 0.00 ? 17 LYS A CE   5  
ATOM 4550  N NZ   . LYS A 1 47  ? 25.829 32.716 19.596 1.00 0.00 ? 17 LYS A NZ   5  
ATOM 4551  H H    . LYS A 1 47  ? 29.256 28.881 22.153 1.00 0.00 ? 17 LYS A H    5  
ATOM 4552  H HA   . LYS A 1 47  ? 26.980 27.867 23.469 1.00 0.00 ? 17 LYS A HA   5  
ATOM 4553  H HB2  . LYS A 1 47  ? 27.252 28.969 20.665 1.00 0.00 ? 17 LYS A HB2  5  
ATOM 4554  H HB3  . LYS A 1 47  ? 25.718 28.678 21.488 1.00 0.00 ? 17 LYS A HB3  5  
ATOM 4555  H HG2  . LYS A 1 47  ? 26.551 30.180 23.353 1.00 0.00 ? 17 LYS A HG2  5  
ATOM 4556  H HG3  . LYS A 1 47  ? 27.900 30.612 22.305 1.00 0.00 ? 17 LYS A HG3  5  
ATOM 4557  H HD2  . LYS A 1 47  ? 24.982 30.928 21.550 1.00 0.00 ? 17 LYS A HD2  5  
ATOM 4558  H HD3  . LYS A 1 47  ? 26.000 32.232 22.162 1.00 0.00 ? 17 LYS A HD3  5  
ATOM 4559  H HE2  . LYS A 1 47  ? 27.591 31.754 20.250 1.00 0.00 ? 17 LYS A HE2  5  
ATOM 4560  H HE3  . LYS A 1 47  ? 26.363 30.672 19.592 1.00 0.00 ? 17 LYS A HE3  5  
ATOM 4561  H HZ1  . LYS A 1 47  ? 25.204 32.388 18.833 1.00 0.00 ? 17 LYS A HZ1  5  
ATOM 4562  H HZ2  . LYS A 1 47  ? 26.530 33.380 19.209 1.00 0.00 ? 17 LYS A HZ2  5  
ATOM 4563  H HZ3  . LYS A 1 47  ? 25.262 33.194 20.323 1.00 0.00 ? 17 LYS A HZ3  5  
ATOM 4564  N N    . ALA A 1 48  ? 27.933 26.139 20.823 1.00 0.00 ? 18 ALA A N    5  
ATOM 4565  C CA   . ALA A 1 48  ? 27.756 24.849 20.168 1.00 0.00 ? 18 ALA A CA   5  
ATOM 4566  C C    . ALA A 1 48  ? 28.033 23.716 21.149 1.00 0.00 ? 18 ALA A C    5  
ATOM 4567  O O    . ALA A 1 48  ? 27.298 22.729 21.184 1.00 0.00 ? 18 ALA A O    5  
ATOM 4568  C CB   . ALA A 1 48  ? 28.688 24.734 18.962 1.00 0.00 ? 18 ALA A CB   5  
ATOM 4569  H H    . ALA A 1 48  ? 28.596 26.772 20.474 1.00 0.00 ? 18 ALA A H    5  
ATOM 4570  H HA   . ALA A 1 48  ? 26.735 24.771 19.826 1.00 0.00 ? 18 ALA A HA   5  
ATOM 4571  H HB1  . ALA A 1 48  ? 28.430 23.854 18.390 1.00 0.00 ? 18 ALA A HB1  5  
ATOM 4572  H HB2  . ALA A 1 48  ? 29.710 24.657 19.301 1.00 0.00 ? 18 ALA A HB2  5  
ATOM 4573  H HB3  . ALA A 1 48  ? 28.581 25.611 18.340 1.00 0.00 ? 18 ALA A HB3  5  
ATOM 4574  N N    . LEU A 1 49  ? 29.094 23.856 21.941 1.00 0.00 ? 19 LEU A N    5  
ATOM 4575  C CA   . LEU A 1 49  ? 29.407 22.847 22.948 1.00 0.00 ? 19 LEU A CA   5  
ATOM 4576  C C    . LEU A 1 49  ? 28.280 22.720 23.970 1.00 0.00 ? 19 LEU A C    5  
ATOM 4577  O O    . LEU A 1 49  ? 27.862 21.611 24.303 1.00 0.00 ? 19 LEU A O    5  
ATOM 4578  C CB   . LEU A 1 49  ? 30.710 23.214 23.662 1.00 0.00 ? 19 LEU A CB   5  
ATOM 4579  C CG   . LEU A 1 49  ? 31.121 22.080 24.603 1.00 0.00 ? 19 LEU A CG   5  
ATOM 4580  C CD1  . LEU A 1 49  ? 31.581 20.874 23.780 1.00 0.00 ? 19 LEU A CD1  5  
ATOM 4581  C CD2  . LEU A 1 49  ? 32.270 22.551 25.496 1.00 0.00 ? 19 LEU A CD2  5  
ATOM 4582  H H    . LEU A 1 49  ? 29.683 24.630 21.833 1.00 0.00 ? 19 LEU A H    5  
ATOM 4583  H HA   . LEU A 1 49  ? 29.539 21.895 22.456 1.00 0.00 ? 19 LEU A HA   5  
ATOM 4584  H HB2  . LEU A 1 49  ? 31.488 23.374 22.929 1.00 0.00 ? 19 LEU A HB2  5  
ATOM 4585  H HB3  . LEU A 1 49  ? 30.564 24.117 24.236 1.00 0.00 ? 19 LEU A HB3  5  
ATOM 4586  H HG   . LEU A 1 49  ? 30.279 21.795 25.216 1.00 0.00 ? 19 LEU A HG   5  
ATOM 4587  H HD11 . LEU A 1 49  ? 30.718 20.338 23.414 1.00 0.00 ? 19 LEU A HD11 5  
ATOM 4588  H HD12 . LEU A 1 49  ? 32.176 20.221 24.399 1.00 0.00 ? 19 LEU A HD12 5  
ATOM 4589  H HD13 . LEU A 1 49  ? 32.174 21.215 22.943 1.00 0.00 ? 19 LEU A HD13 5  
ATOM 4590  H HD21 . LEU A 1 49  ? 33.112 22.832 24.881 1.00 0.00 ? 19 LEU A HD21 5  
ATOM 4591  H HD22 . LEU A 1 49  ? 32.561 21.752 26.161 1.00 0.00 ? 19 LEU A HD22 5  
ATOM 4592  H HD23 . LEU A 1 49  ? 31.948 23.403 26.077 1.00 0.00 ? 19 LEU A HD23 5  
ATOM 4593  N N    . SER A 1 50  ? 27.720 23.853 24.391 1.00 0.00 ? 20 SER A N    5  
ATOM 4594  C CA   . SER A 1 50  ? 26.662 23.834 25.399 1.00 0.00 ? 20 SER A CA   5  
ATOM 4595  C C    . SER A 1 50  ? 25.440 23.051 24.922 1.00 0.00 ? 20 SER A C    5  
ATOM 4596  O O    . SER A 1 50  ? 24.765 22.402 25.721 1.00 0.00 ? 20 SER A O    5  
ATOM 4597  C CB   . SER A 1 50  ? 26.246 25.263 25.753 1.00 0.00 ? 20 SER A CB   5  
ATOM 4598  O OG   . SER A 1 50  ? 25.457 25.797 24.699 1.00 0.00 ? 20 SER A OG   5  
ATOM 4599  H H    . SER A 1 50  ? 28.052 24.711 24.054 1.00 0.00 ? 20 SER A H    5  
ATOM 4600  H HA   . SER A 1 50  ? 27.047 23.360 26.291 1.00 0.00 ? 20 SER A HA   5  
ATOM 4601  H HB2  . SER A 1 50  ? 25.663 25.257 26.660 1.00 0.00 ? 20 SER A HB2  5  
ATOM 4602  H HB3  . SER A 1 50  ? 27.131 25.865 25.903 1.00 0.00 ? 20 SER A HB3  5  
ATOM 4603  H HG   . SER A 1 50  ? 25.716 26.648 24.562 1.00 0.00 ? 20 SER A HG   5  
ATOM 4604  N N    . VAL A 1 51  ? 25.159 23.110 23.623 1.00 0.00 ? 21 VAL A N    5  
ATOM 4605  C CA   . VAL A 1 51  ? 24.023 22.373 23.067 1.00 0.00 ? 21 VAL A CA   5  
ATOM 4606  C C    . VAL A 1 51  ? 24.369 20.932 22.661 1.00 0.00 ? 21 VAL A C    5  
ATOM 4607  O O    . VAL A 1 51  ? 23.503 20.222 22.149 1.00 0.00 ? 21 VAL A O    5  
ATOM 4608  C CB   . VAL A 1 51  ? 23.465 23.122 21.855 1.00 0.00 ? 21 VAL A CB   5  
ATOM 4609  C CG1  . VAL A 1 51  ? 23.025 24.524 22.279 1.00 0.00 ? 21 VAL A CG1  5  
ATOM 4610  C CG2  . VAL A 1 51  ? 24.547 23.236 20.779 1.00 0.00 ? 21 VAL A CG2  5  
ATOM 4611  H H    . VAL A 1 51  ? 25.684 23.705 23.044 1.00 0.00 ? 21 VAL A H    5  
ATOM 4612  H HA   . VAL A 1 51  ? 23.249 22.333 23.817 1.00 0.00 ? 21 VAL A HA   5  
ATOM 4613  H HB   . VAL A 1 51  ? 22.616 22.583 21.459 1.00 0.00 ? 21 VAL A HB   5  
ATOM 4614  H HG11 . VAL A 1 51  ? 23.896 25.144 22.432 1.00 0.00 ? 21 VAL A HG11 5  
ATOM 4615  H HG12 . VAL A 1 51  ? 22.461 24.462 23.199 1.00 0.00 ? 21 VAL A HG12 5  
ATOM 4616  H HG13 . VAL A 1 51  ? 22.406 24.956 21.507 1.00 0.00 ? 21 VAL A HG13 5  
ATOM 4617  H HG21 . VAL A 1 51  ? 25.319 23.911 21.116 1.00 0.00 ? 21 VAL A HG21 5  
ATOM 4618  H HG22 . VAL A 1 51  ? 24.110 23.616 19.867 1.00 0.00 ? 21 VAL A HG22 5  
ATOM 4619  H HG23 . VAL A 1 51  ? 24.975 22.263 20.593 1.00 0.00 ? 21 VAL A HG23 5  
ATOM 4620  N N    . GLY A 1 52  ? 25.609 20.491 22.878 1.00 0.00 ? 22 GLY A N    5  
ATOM 4621  C CA   . GLY A 1 52  ? 26.011 19.139 22.484 1.00 0.00 ? 22 GLY A CA   5  
ATOM 4622  C C    . GLY A 1 52  ? 26.499 19.051 21.030 1.00 0.00 ? 22 GLY A C    5  
ATOM 4623  O O    . GLY A 1 52  ? 26.674 17.951 20.506 1.00 0.00 ? 22 GLY A O    5  
ATOM 4624  H H    . GLY A 1 52  ? 26.258 21.067 23.333 1.00 0.00 ? 22 GLY A H    5  
ATOM 4625  H HA2  . GLY A 1 52  ? 26.807 18.811 23.135 1.00 0.00 ? 22 GLY A HA2  5  
ATOM 4626  H HA3  . GLY A 1 52  ? 25.166 18.478 22.608 1.00 0.00 ? 22 GLY A HA3  5  
ATOM 4627  N N    . ASN A 1 53  ? 26.718 20.192 20.378 1.00 0.00 ? 23 ASN A N    5  
ATOM 4628  C CA   . ASN A 1 53  ? 27.164 20.204 18.989 1.00 0.00 ? 23 ASN A CA   5  
ATOM 4629  C C    . ASN A 1 53  ? 28.683 20.352 18.920 1.00 0.00 ? 23 ASN A C    5  
ATOM 4630  O O    . ASN A 1 53  ? 29.215 21.362 18.448 1.00 0.00 ? 23 ASN A O    5  
ATOM 4631  C CB   . ASN A 1 53  ? 26.476 21.357 18.253 1.00 0.00 ? 23 ASN A CB   5  
ATOM 4632  C CG   . ASN A 1 53  ? 26.712 21.239 16.752 1.00 0.00 ? 23 ASN A CG   5  
ATOM 4633  O OD1  . ASN A 1 53  ? 27.695 20.640 16.320 1.00 0.00 ? 23 ASN A OD1  5  
ATOM 4634  N ND2  . ASN A 1 53  ? 25.865 21.793 15.930 1.00 0.00 ? 23 ASN A ND2  5  
ATOM 4635  H H    . ASN A 1 53  ? 26.593 21.042 20.844 1.00 0.00 ? 23 ASN A H    5  
ATOM 4636  H HA   . ASN A 1 53  ? 26.881 19.273 18.521 1.00 0.00 ? 23 ASN A HA   5  
ATOM 4637  H HB2  . ASN A 1 53  ? 25.415 21.325 18.451 1.00 0.00 ? 23 ASN A HB2  5  
ATOM 4638  H HB3  . ASN A 1 53  ? 26.878 22.295 18.604 1.00 0.00 ? 23 ASN A HB3  5  
ATOM 4639  H HD21 . ASN A 1 53  ? 25.090 22.280 16.281 1.00 0.00 ? 23 ASN A HD21 5  
ATOM 4640  H HD22 . ASN A 1 53  ? 26.001 21.720 14.962 1.00 0.00 ? 23 ASN A HD22 5  
ATOM 4641  N N    . ILE A 1 54  ? 29.387 19.316 19.365 1.00 0.00 ? 24 ILE A N    5  
ATOM 4642  C CA   . ILE A 1 54  ? 30.842 19.384 19.457 1.00 0.00 ? 24 ILE A CA   5  
ATOM 4643  C C    . ILE A 1 54  ? 31.467 19.572 18.074 1.00 0.00 ? 24 ILE A C    5  
ATOM 4644  O O    . ILE A 1 54  ? 32.455 20.294 17.937 1.00 0.00 ? 24 ILE A O    5  
ATOM 4645  C CB   . ILE A 1 54  ? 31.384 18.103 20.107 1.00 0.00 ? 24 ILE A CB   5  
ATOM 4646  C CG1  . ILE A 1 54  ? 30.745 17.913 21.486 1.00 0.00 ? 24 ILE A CG1  5  
ATOM 4647  C CG2  . ILE A 1 54  ? 32.904 18.200 20.279 1.00 0.00 ? 24 ILE A CG2  5  
ATOM 4648  C CD1  . ILE A 1 54  ? 31.137 16.545 22.049 1.00 0.00 ? 24 ILE A CD1  5  
ATOM 4649  H H    . ILE A 1 54  ? 28.923 18.497 19.635 1.00 0.00 ? 24 ILE A H    5  
ATOM 4650  H HA   . ILE A 1 54  ? 31.112 20.226 20.077 1.00 0.00 ? 24 ILE A HA   5  
ATOM 4651  H HB   . ILE A 1 54  ? 31.148 17.255 19.481 1.00 0.00 ? 24 ILE A HB   5  
ATOM 4652  H HG12 . ILE A 1 54  ? 31.091 18.690 22.152 1.00 0.00 ? 24 ILE A HG12 5  
ATOM 4653  H HG13 . ILE A 1 54  ? 29.671 17.967 21.396 1.00 0.00 ? 24 ILE A HG13 5  
ATOM 4654  H HG21 . ILE A 1 54  ? 33.137 18.989 20.979 1.00 0.00 ? 24 ILE A HG21 5  
ATOM 4655  H HG22 . ILE A 1 54  ? 33.361 18.418 19.325 1.00 0.00 ? 24 ILE A HG22 5  
ATOM 4656  H HG23 . ILE A 1 54  ? 33.285 17.261 20.655 1.00 0.00 ? 24 ILE A HG23 5  
ATOM 4657  H HD11 . ILE A 1 54  ? 30.844 15.772 21.355 1.00 0.00 ? 24 ILE A HD11 5  
ATOM 4658  H HD12 . ILE A 1 54  ? 30.637 16.389 22.994 1.00 0.00 ? 24 ILE A HD12 5  
ATOM 4659  H HD13 . ILE A 1 54  ? 32.207 16.510 22.197 1.00 0.00 ? 24 ILE A HD13 5  
ATOM 4660  N N    . ASP A 1 55  ? 30.874 18.963 17.048 1.00 0.00 ? 25 ASP A N    5  
ATOM 4661  C CA   . ASP A 1 55  ? 31.441 19.050 15.705 1.00 0.00 ? 25 ASP A CA   5  
ATOM 4662  C C    . ASP A 1 55  ? 31.489 20.497 15.226 1.00 0.00 ? 25 ASP A C    5  
ATOM 4663  O O    . ASP A 1 55  ? 32.539 20.987 14.804 1.00 0.00 ? 25 ASP A O    5  
ATOM 4664  C CB   . ASP A 1 55  ? 30.605 18.216 14.731 1.00 0.00 ? 25 ASP A CB   5  
ATOM 4665  C CG   . ASP A 1 55  ? 30.671 16.734 15.097 1.00 0.00 ? 25 ASP A CG   5  
ATOM 4666  O OD1  . ASP A 1 55  ? 31.686 16.313 15.629 1.00 0.00 ? 25 ASP A OD1  5  
ATOM 4667  O OD2  . ASP A 1 55  ? 29.702 16.041 14.839 1.00 0.00 ? 25 ASP A OD2  5  
ATOM 4668  H H    . ASP A 1 55  ? 30.050 18.454 17.196 1.00 0.00 ? 25 ASP A H    5  
ATOM 4669  H HA   . ASP A 1 55  ? 32.446 18.655 15.725 1.00 0.00 ? 25 ASP A HA   5  
ATOM 4670  H HB2  . ASP A 1 55  ? 29.578 18.547 14.770 1.00 0.00 ? 25 ASP A HB2  5  
ATOM 4671  H HB3  . ASP A 1 55  ? 30.985 18.352 13.729 1.00 0.00 ? 25 ASP A HB3  5  
ATOM 4672  N N    . ASP A 1 56  ? 30.365 21.201 15.345 1.00 0.00 ? 26 ASP A N    5  
ATOM 4673  C CA   . ASP A 1 56  ? 30.312 22.594 14.918 1.00 0.00 ? 26 ASP A CA   5  
ATOM 4674  C C    . ASP A 1 56  ? 31.252 23.454 15.754 1.00 0.00 ? 26 ASP A C    5  
ATOM 4675  O O    . ASP A 1 56  ? 31.933 24.332 15.221 1.00 0.00 ? 26 ASP A O    5  
ATOM 4676  C CB   . ASP A 1 56  ? 28.882 23.137 15.018 1.00 0.00 ? 26 ASP A CB   5  
ATOM 4677  C CG   . ASP A 1 56  ? 27.975 22.553 13.929 1.00 0.00 ? 26 ASP A CG   5  
ATOM 4678  O OD1  . ASP A 1 56  ? 26.858 23.030 13.813 1.00 0.00 ? 26 ASP A OD1  5  
ATOM 4679  O OD2  . ASP A 1 56  ? 28.390 21.640 13.230 1.00 0.00 ? 26 ASP A OD2  5  
ATOM 4680  H H    . ASP A 1 56  ? 29.563 20.779 15.717 1.00 0.00 ? 26 ASP A H    5  
ATOM 4681  H HA   . ASP A 1 56  ? 30.626 22.648 13.885 1.00 0.00 ? 26 ASP A HA   5  
ATOM 4682  H HB2  . ASP A 1 56  ? 28.476 22.884 15.986 1.00 0.00 ? 26 ASP A HB2  5  
ATOM 4683  H HB3  . ASP A 1 56  ? 28.906 24.212 14.918 1.00 0.00 ? 26 ASP A HB3  5  
ATOM 4684  N N    . ALA A 1 57  ? 31.319 23.177 17.055 1.00 0.00 ? 27 ALA A N    5  
ATOM 4685  C CA   . ALA A 1 57  ? 32.178 23.962 17.933 1.00 0.00 ? 27 ALA A CA   5  
ATOM 4686  C C    . ALA A 1 57  ? 33.635 23.853 17.489 1.00 0.00 ? 27 ALA A C    5  
ATOM 4687  O O    . ALA A 1 57  ? 34.324 24.865 17.337 1.00 0.00 ? 27 ALA A O    5  
ATOM 4688  C CB   . ALA A 1 57  ? 32.043 23.462 19.374 1.00 0.00 ? 27 ALA A CB   5  
ATOM 4689  H H    . ALA A 1 57  ? 30.758 22.465 17.432 1.00 0.00 ? 27 ALA A H    5  
ATOM 4690  H HA   . ALA A 1 57  ? 31.871 24.997 17.892 1.00 0.00 ? 27 ALA A HA   5  
ATOM 4691  H HB1  . ALA A 1 57  ? 32.203 24.285 20.056 1.00 0.00 ? 27 ALA A HB1  5  
ATOM 4692  H HB2  . ALA A 1 57  ? 32.776 22.692 19.563 1.00 0.00 ? 27 ALA A HB2  5  
ATOM 4693  H HB3  . ALA A 1 57  ? 31.052 23.060 19.524 1.00 0.00 ? 27 ALA A HB3  5  
ATOM 4694  N N    . LEU A 1 58  ? 34.093 22.628 17.244 1.00 0.00 ? 28 LEU A N    5  
ATOM 4695  C CA   . LEU A 1 58  ? 35.463 22.423 16.786 1.00 0.00 ? 28 LEU A CA   5  
ATOM 4696  C C    . LEU A 1 58  ? 35.707 23.138 15.461 1.00 0.00 ? 28 LEU A C    5  
ATOM 4697  O O    . LEU A 1 58  ? 36.764 23.738 15.264 1.00 0.00 ? 28 LEU A O    5  
ATOM 4698  C CB   . LEU A 1 58  ? 35.742 20.927 16.618 1.00 0.00 ? 28 LEU A CB   5  
ATOM 4699  C CG   . LEU A 1 58  ? 35.639 20.222 17.972 1.00 0.00 ? 28 LEU A CG   5  
ATOM 4700  C CD1  . LEU A 1 58  ? 35.723 18.709 17.766 1.00 0.00 ? 28 LEU A CD1  5  
ATOM 4701  C CD2  . LEU A 1 58  ? 36.792 20.671 18.872 1.00 0.00 ? 28 LEU A CD2  5  
ATOM 4702  H H    . LEU A 1 58  ? 33.509 21.854 17.387 1.00 0.00 ? 28 LEU A H    5  
ATOM 4703  H HA   . LEU A 1 58  ? 36.140 22.822 17.526 1.00 0.00 ? 28 LEU A HA   5  
ATOM 4704  H HB2  . LEU A 1 58  ? 35.020 20.503 15.935 1.00 0.00 ? 28 LEU A HB2  5  
ATOM 4705  H HB3  . LEU A 1 58  ? 36.736 20.791 16.220 1.00 0.00 ? 28 LEU A HB3  5  
ATOM 4706  H HG   . LEU A 1 58  ? 34.697 20.471 18.438 1.00 0.00 ? 28 LEU A HG   5  
ATOM 4707  H HD11 . LEU A 1 58  ? 34.807 18.355 17.318 1.00 0.00 ? 28 LEU A HD11 5  
ATOM 4708  H HD12 . LEU A 1 58  ? 35.869 18.223 18.719 1.00 0.00 ? 28 LEU A HD12 5  
ATOM 4709  H HD13 . LEU A 1 58  ? 36.554 18.480 17.114 1.00 0.00 ? 28 LEU A HD13 5  
ATOM 4710  H HD21 . LEU A 1 58  ? 36.561 21.636 19.298 1.00 0.00 ? 28 LEU A HD21 5  
ATOM 4711  H HD22 . LEU A 1 58  ? 37.698 20.744 18.286 1.00 0.00 ? 28 LEU A HD22 5  
ATOM 4712  H HD23 . LEU A 1 58  ? 36.932 19.951 19.664 1.00 0.00 ? 28 LEU A HD23 5  
ATOM 4713  N N    . GLN A 1 59  ? 34.717 23.105 14.570 1.00 0.00 ? 29 GLN A N    5  
ATOM 4714  C CA   . GLN A 1 59  ? 34.867 23.760 13.275 1.00 0.00 ? 29 GLN A CA   5  
ATOM 4715  C C    . GLN A 1 59  ? 35.093 25.260 13.443 1.00 0.00 ? 29 GLN A C    5  
ATOM 4716  O O    . GLN A 1 59  ? 35.996 25.829 12.825 1.00 0.00 ? 29 GLN A O    5  
ATOM 4717  C CB   . GLN A 1 59  ? 33.616 23.522 12.426 1.00 0.00 ? 29 GLN A CB   5  
ATOM 4718  C CG   . GLN A 1 59  ? 33.848 24.046 11.007 1.00 0.00 ? 29 GLN A CG   5  
ATOM 4719  C CD   . GLN A 1 59  ? 34.778 23.105 10.249 1.00 0.00 ? 29 GLN A CD   5  
ATOM 4720  O OE1  . GLN A 1 59  ? 34.430 21.950 10.005 1.00 0.00 ? 29 GLN A OE1  5  
ATOM 4721  N NE2  . GLN A 1 59  ? 35.948 23.532 9.860  1.00 0.00 ? 29 GLN A NE2  5  
ATOM 4722  H H    . GLN A 1 59  ? 33.901 22.596 14.767 1.00 0.00 ? 29 GLN A H    5  
ATOM 4723  H HA   . GLN A 1 59  ? 35.718 23.334 12.765 1.00 0.00 ? 29 GLN A HA   5  
ATOM 4724  H HB2  . GLN A 1 59  ? 33.404 22.463 12.390 1.00 0.00 ? 29 GLN A HB2  5  
ATOM 4725  H HB3  . GLN A 1 59  ? 32.779 24.042 12.866 1.00 0.00 ? 29 GLN A HB3  5  
ATOM 4726  H HG2  . GLN A 1 59  ? 32.902 24.107 10.490 1.00 0.00 ? 29 GLN A HG2  5  
ATOM 4727  H HG3  . GLN A 1 59  ? 34.294 25.027 11.053 1.00 0.00 ? 29 GLN A HG3  5  
ATOM 4728  H HE21 . GLN A 1 59  ? 36.223 24.453 10.055 1.00 0.00 ? 29 GLN A HE21 5  
ATOM 4729  H HE22 . GLN A 1 59  ? 36.551 22.934 9.372  1.00 0.00 ? 29 GLN A HE22 5  
ATOM 4730  N N    . TYR A 1 60  ? 34.302 25.894 14.308 1.00 0.00 ? 30 TYR A N    5  
ATOM 4731  C CA   . TYR A 1 60  ? 34.478 27.319 14.565 1.00 0.00 ? 30 TYR A CA   5  
ATOM 4732  C C    . TYR A 1 60  ? 35.865 27.608 15.131 1.00 0.00 ? 30 TYR A C    5  
ATOM 4733  O O    . TYR A 1 60  ? 36.524 28.558 14.708 1.00 0.00 ? 30 TYR A O    5  
ATOM 4734  C CB   . TYR A 1 60  ? 33.420 27.812 15.555 1.00 0.00 ? 30 TYR A CB   5  
ATOM 4735  C CG   . TYR A 1 60  ? 32.006 27.726 15.028 1.00 0.00 ? 30 TYR A CG   5  
ATOM 4736  C CD1  . TYR A 1 60  ? 31.049 26.971 15.717 1.00 0.00 ? 30 TYR A CD1  5  
ATOM 4737  C CD2  . TYR A 1 60  ? 31.654 28.403 13.856 1.00 0.00 ? 30 TYR A CD2  5  
ATOM 4738  C CE1  . TYR A 1 60  ? 29.738 26.894 15.232 1.00 0.00 ? 30 TYR A CE1  5  
ATOM 4739  C CE2  . TYR A 1 60  ? 30.343 28.326 13.370 1.00 0.00 ? 30 TYR A CE2  5  
ATOM 4740  C CZ   . TYR A 1 60  ? 29.386 27.571 14.058 1.00 0.00 ? 30 TYR A CZ   5  
ATOM 4741  O OH   . TYR A 1 60  ? 28.093 27.496 13.579 1.00 0.00 ? 30 TYR A OH   5  
ATOM 4742  H H    . TYR A 1 60  ? 33.570 25.409 14.739 1.00 0.00 ? 30 TYR A H    5  
ATOM 4743  H HA   . TYR A 1 60  ? 34.361 27.858 13.637 1.00 0.00 ? 30 TYR A HA   5  
ATOM 4744  H HB2  . TYR A 1 60  ? 33.484 27.218 16.453 1.00 0.00 ? 30 TYR A HB2  5  
ATOM 4745  H HB3  . TYR A 1 60  ? 33.639 28.839 15.807 1.00 0.00 ? 30 TYR A HB3  5  
ATOM 4746  H HD1  . TYR A 1 60  ? 31.322 26.449 16.621 1.00 0.00 ? 30 TYR A HD1  5  
ATOM 4747  H HD2  . TYR A 1 60  ? 32.393 28.985 13.325 1.00 0.00 ? 30 TYR A HD2  5  
ATOM 4748  H HE1  . TYR A 1 60  ? 28.999 26.313 15.762 1.00 0.00 ? 30 TYR A HE1  5  
ATOM 4749  H HE2  . TYR A 1 60  ? 30.071 28.848 12.466 1.00 0.00 ? 30 TYR A HE2  5  
ATOM 4750  H HH   . TYR A 1 60  ? 27.858 28.312 13.283 1.00 0.00 ? 30 TYR A HH   5  
ATOM 4751  N N    . TYR A 1 61  ? 36.324 26.767 16.058 1.00 0.00 ? 31 TYR A N    5  
ATOM 4752  C CA   . TYR A 1 61  ? 37.642 26.972 16.652 1.00 0.00 ? 31 TYR A CA   5  
ATOM 4753  C C    . TYR A 1 61  ? 38.742 26.879 15.600 1.00 0.00 ? 31 TYR A C    5  
ATOM 4754  O O    . TYR A 1 61  ? 39.671 27.689 15.594 1.00 0.00 ? 31 TYR A O    5  
ATOM 4755  C CB   . TYR A 1 61  ? 37.892 25.936 17.749 1.00 0.00 ? 31 TYR A CB   5  
ATOM 4756  C CG   . TYR A 1 61  ? 36.955 26.068 18.928 1.00 0.00 ? 31 TYR A CG   5  
ATOM 4757  C CD1  . TYR A 1 61  ? 36.695 27.329 19.476 1.00 0.00 ? 31 TYR A CD1  5  
ATOM 4758  C CD2  . TYR A 1 61  ? 36.352 24.928 19.474 1.00 0.00 ? 31 TYR A CD2  5  
ATOM 4759  C CE1  . TYR A 1 61  ? 35.829 27.451 20.570 1.00 0.00 ? 31 TYR A CE1  5  
ATOM 4760  C CE2  . TYR A 1 61  ? 35.486 25.051 20.568 1.00 0.00 ? 31 TYR A CE2  5  
ATOM 4761  C CZ   . TYR A 1 61  ? 35.225 26.312 21.115 1.00 0.00 ? 31 TYR A CZ   5  
ATOM 4762  O OH   . TYR A 1 61  ? 34.372 26.433 22.194 1.00 0.00 ? 31 TYR A OH   5  
ATOM 4763  H H    . TYR A 1 61  ? 35.758 26.028 16.369 1.00 0.00 ? 31 TYR A H    5  
ATOM 4764  H HA   . TYR A 1 61  ? 37.671 27.956 17.097 1.00 0.00 ? 31 TYR A HA   5  
ATOM 4765  H HB2  . TYR A 1 61  ? 37.772 24.949 17.328 1.00 0.00 ? 31 TYR A HB2  5  
ATOM 4766  H HB3  . TYR A 1 61  ? 38.911 26.040 18.096 1.00 0.00 ? 31 TYR A HB3  5  
ATOM 4767  H HD1  . TYR A 1 61  ? 37.160 28.207 19.055 1.00 0.00 ? 31 TYR A HD1  5  
ATOM 4768  H HD2  . TYR A 1 61  ? 36.554 23.955 19.053 1.00 0.00 ? 31 TYR A HD2  5  
ATOM 4769  H HE1  . TYR A 1 61  ? 35.628 28.424 20.992 1.00 0.00 ? 31 TYR A HE1  5  
ATOM 4770  H HE2  . TYR A 1 61  ? 35.020 24.172 20.989 1.00 0.00 ? 31 TYR A HE2  5  
ATOM 4771  H HH   . TYR A 1 61  ? 34.642 27.138 22.684 1.00 0.00 ? 31 TYR A HH   5  
ATOM 4772  N N    . ALA A 1 62  ? 38.603 25.936 14.671 1.00 0.00 ? 32 ALA A N    5  
ATOM 4773  C CA   . ALA A 1 62  ? 39.599 25.780 13.617 1.00 0.00 ? 32 ALA A CA   5  
ATOM 4774  C C    . ALA A 1 62  ? 39.642 27.024 12.738 1.00 0.00 ? 32 ALA A C    5  
ATOM 4775  O O    . ALA A 1 62  ? 40.716 27.542 12.427 1.00 0.00 ? 32 ALA A O    5  
ATOM 4776  C CB   . ALA A 1 62  ? 39.265 24.558 12.759 1.00 0.00 ? 32 ALA A CB   5  
ATOM 4777  H H    . ALA A 1 62  ? 37.845 25.316 14.718 1.00 0.00 ? 32 ALA A H    5  
ATOM 4778  H HA   . ALA A 1 62  ? 40.569 25.635 14.068 1.00 0.00 ? 32 ALA A HA   5  
ATOM 4779  H HB1  . ALA A 1 62  ? 39.940 24.514 11.917 1.00 0.00 ? 32 ALA A HB1  5  
ATOM 4780  H HB2  . ALA A 1 62  ? 38.249 24.634 12.403 1.00 0.00 ? 32 ALA A HB2  5  
ATOM 4781  H HB3  . ALA A 1 62  ? 39.371 23.661 13.353 1.00 0.00 ? 32 ALA A HB3  5  
ATOM 4782  N N    . ALA A 1 63  ? 38.464 27.531 12.384 1.00 0.00 ? 33 ALA A N    5  
ATOM 4783  C CA   . ALA A 1 63  ? 38.392 28.733 11.565 1.00 0.00 ? 33 ALA A CA   5  
ATOM 4784  C C    . ALA A 1 63  ? 39.005 29.923 12.294 1.00 0.00 ? 33 ALA A C    5  
ATOM 4785  O O    . ALA A 1 63  ? 39.711 30.729 11.689 1.00 0.00 ? 33 ALA A O    5  
ATOM 4786  C CB   . ALA A 1 63  ? 36.933 29.041 11.221 1.00 0.00 ? 33 ALA A CB   5  
ATOM 4787  H H    . ALA A 1 63  ? 37.638 27.073 12.650 1.00 0.00 ? 33 ALA A H    5  
ATOM 4788  H HA   . ALA A 1 63  ? 38.936 28.566 10.647 1.00 0.00 ? 33 ALA A HA   5  
ATOM 4789  H HB1  . ALA A 1 63  ? 36.896 29.794 10.448 1.00 0.00 ? 33 ALA A HB1  5  
ATOM 4790  H HB2  . ALA A 1 63  ? 36.424 29.405 12.101 1.00 0.00 ? 33 ALA A HB2  5  
ATOM 4791  H HB3  . ALA A 1 63  ? 36.448 28.142 10.871 1.00 0.00 ? 33 ALA A HB3  5  
ATOM 4792  N N    . ALA A 1 64  ? 38.772 30.010 13.601 1.00 0.00 ? 34 ALA A N    5  
ATOM 4793  C CA   . ALA A 1 64  ? 39.301 31.124 14.380 1.00 0.00 ? 34 ALA A CA   5  
ATOM 4794  C C    . ALA A 1 64  ? 40.827 31.140 14.350 1.00 0.00 ? 34 ALA A C    5  
ATOM 4795  O O    . ALA A 1 64  ? 41.436 32.186 14.113 1.00 0.00 ? 34 ALA A O    5  
ATOM 4796  C CB   . ALA A 1 64  ? 38.794 31.028 15.825 1.00 0.00 ? 34 ALA A CB   5  
ATOM 4797  H H    . ALA A 1 64  ? 38.205 29.341 14.038 1.00 0.00 ? 34 ALA A H    5  
ATOM 4798  H HA   . ALA A 1 64  ? 38.942 32.048 13.951 1.00 0.00 ? 34 ALA A HA   5  
ATOM 4799  H HB1  . ALA A 1 64  ? 37.916 30.400 15.854 1.00 0.00 ? 34 ALA A HB1  5  
ATOM 4800  H HB2  . ALA A 1 64  ? 38.538 32.014 16.181 1.00 0.00 ? 34 ALA A HB2  5  
ATOM 4801  H HB3  . ALA A 1 64  ? 39.558 30.602 16.459 1.00 0.00 ? 34 ALA A HB3  5  
ATOM 4802  N N    . ILE A 1 65  ? 41.442 29.973 14.537 1.00 0.00 ? 35 ILE A N    5  
ATOM 4803  C CA   . ILE A 1 65  ? 42.898 29.895 14.501 1.00 0.00 ? 35 ILE A CA   5  
ATOM 4804  C C    . ILE A 1 65  ? 43.416 30.319 13.128 1.00 0.00 ? 35 ILE A C    5  
ATOM 4805  O O    . ILE A 1 65  ? 44.375 31.086 13.033 1.00 0.00 ? 35 ILE A O    5  
ATOM 4806  C CB   . ILE A 1 65  ? 43.354 28.467 14.830 1.00 0.00 ? 35 ILE A CB   5  
ATOM 4807  C CG1  . ILE A 1 65  ? 42.839 28.081 16.218 1.00 0.00 ? 35 ILE A CG1  5  
ATOM 4808  C CG2  . ILE A 1 65  ? 44.884 28.383 14.833 1.00 0.00 ? 35 ILE A CG2  5  
ATOM 4809  C CD1  . ILE A 1 65  ? 43.074 26.589 16.456 1.00 0.00 ? 35 ILE A CD1  5  
ATOM 4810  H H    . ILE A 1 65  ? 40.914 29.169 14.731 1.00 0.00 ? 35 ILE A H    5  
ATOM 4811  H HA   . ILE A 1 65  ? 43.300 30.567 15.246 1.00 0.00 ? 35 ILE A HA   5  
ATOM 4812  H HB   . ILE A 1 65  ? 42.957 27.783 14.095 1.00 0.00 ? 35 ILE A HB   5  
ATOM 4813  H HG12 . ILE A 1 65  ? 43.367 28.652 16.968 1.00 0.00 ? 35 ILE A HG12 5  
ATOM 4814  H HG13 . ILE A 1 65  ? 41.783 28.293 16.284 1.00 0.00 ? 35 ILE A HG13 5  
ATOM 4815  H HG21 . ILE A 1 65  ? 45.267 28.741 13.888 1.00 0.00 ? 35 ILE A HG21 5  
ATOM 4816  H HG22 . ILE A 1 65  ? 45.189 27.358 14.980 1.00 0.00 ? 35 ILE A HG22 5  
ATOM 4817  H HG23 . ILE A 1 65  ? 45.276 28.992 15.634 1.00 0.00 ? 35 ILE A HG23 5  
ATOM 4818  H HD11 . ILE A 1 65  ? 42.529 26.273 17.334 1.00 0.00 ? 35 ILE A HD11 5  
ATOM 4819  H HD12 . ILE A 1 65  ? 44.129 26.409 16.603 1.00 0.00 ? 35 ILE A HD12 5  
ATOM 4820  H HD13 . ILE A 1 65  ? 42.730 26.029 15.598 1.00 0.00 ? 35 ILE A HD13 5  
ATOM 4821  N N    . THR A 1 66  ? 42.765 29.841 12.068 1.00 0.00 ? 36 THR A N    5  
ATOM 4822  C CA   . THR A 1 66  ? 43.189 30.200 10.719 1.00 0.00 ? 36 THR A CA   5  
ATOM 4823  C C    . THR A 1 66  ? 43.091 31.708 10.490 1.00 0.00 ? 36 THR A C    5  
ATOM 4824  O O    . THR A 1 66  ? 44.017 32.324 9.958  1.00 0.00 ? 36 THR A O    5  
ATOM 4825  C CB   . THR A 1 66  ? 42.323 29.474 9.688  1.00 0.00 ? 36 THR A CB   5  
ATOM 4826  O OG1  . THR A 1 66  ? 42.227 28.099 10.030 1.00 0.00 ? 36 THR A OG1  5  
ATOM 4827  C CG2  . THR A 1 66  ? 42.963 29.609 8.306  1.00 0.00 ? 36 THR A CG2  5  
ATOM 4828  H H    . THR A 1 66  ? 42.017 29.218 12.195 1.00 0.00 ? 36 THR A H    5  
ATOM 4829  H HA   . THR A 1 66  ? 44.215 29.893 10.583 1.00 0.00 ? 36 THR A HA   5  
ATOM 4830  H HB   . THR A 1 66  ? 41.337 29.912 9.669  1.00 0.00 ? 36 THR A HB   5  
ATOM 4831  H HG1  . THR A 1 66  ? 41.680 27.702 9.436  1.00 0.00 ? 36 THR A HG1  5  
ATOM 4832  H HG21 . THR A 1 66  ? 42.486 28.925 7.620  1.00 0.00 ? 36 THR A HG21 5  
ATOM 4833  H HG22 . THR A 1 66  ? 44.015 29.377 8.373  1.00 0.00 ? 36 THR A HG22 5  
ATOM 4834  H HG23 . THR A 1 66  ? 42.839 30.621 7.950  1.00 0.00 ? 36 THR A HG23 5  
ATOM 4835  N N    . LEU A 1 67  ? 41.989 32.310 10.932 1.00 0.00 ? 37 LEU A N    5  
ATOM 4836  C CA   . LEU A 1 67  ? 41.802 33.748 10.761 1.00 0.00 ? 37 LEU A CA   5  
ATOM 4837  C C    . LEU A 1 67  ? 42.891 34.543 11.475 1.00 0.00 ? 37 LEU A C    5  
ATOM 4838  O O    . LEU A 1 67  ? 43.304 35.600 10.996 1.00 0.00 ? 37 LEU A O    5  
ATOM 4839  C CB   . LEU A 1 67  ? 40.430 34.171 11.288 1.00 0.00 ? 37 LEU A CB   5  
ATOM 4840  C CG   . LEU A 1 67  ? 39.329 33.581 10.404 1.00 0.00 ? 37 LEU A CG   5  
ATOM 4841  C CD1  . LEU A 1 67  ? 37.969 33.789 11.073 1.00 0.00 ? 37 LEU A CD1  5  
ATOM 4842  C CD2  . LEU A 1 67  ? 39.336 34.285 9.044  1.00 0.00 ? 37 LEU A CD2  5  
ATOM 4843  H H    . LEU A 1 67  ? 41.284 31.779 11.356 1.00 0.00 ? 37 LEU A H    5  
ATOM 4844  H HA   . LEU A 1 67  ? 41.850 33.975 9.706  1.00 0.00 ? 37 LEU A HA   5  
ATOM 4845  H HB2  . LEU A 1 67  ? 40.309 33.812 12.301 1.00 0.00 ? 37 LEU A HB2  5  
ATOM 4846  H HB3  . LEU A 1 67  ? 40.356 35.248 11.278 1.00 0.00 ? 37 LEU A HB3  5  
ATOM 4847  H HG   . LEU A 1 67  ? 39.505 32.525 10.264 1.00 0.00 ? 37 LEU A HG   5  
ATOM 4848  H HD11 . LEU A 1 67  ? 37.272 33.049 10.710 1.00 0.00 ? 37 LEU A HD11 5  
ATOM 4849  H HD12 . LEU A 1 67  ? 37.599 34.778 10.843 1.00 0.00 ? 37 LEU A HD12 5  
ATOM 4850  H HD13 . LEU A 1 67  ? 38.077 33.687 12.143 1.00 0.00 ? 37 LEU A HD13 5  
ATOM 4851  H HD21 . LEU A 1 67  ? 40.074 33.826 8.404  1.00 0.00 ? 37 LEU A HD21 5  
ATOM 4852  H HD22 . LEU A 1 67  ? 39.578 35.329 9.181  1.00 0.00 ? 37 LEU A HD22 5  
ATOM 4853  H HD23 . LEU A 1 67  ? 38.361 34.199 8.588  1.00 0.00 ? 37 LEU A HD23 5  
ATOM 4854  N N    . ASP A 1 68  ? 43.326 34.053 12.633 1.00 0.00 ? 38 ASP A N    5  
ATOM 4855  C CA   . ASP A 1 68  ? 44.425 34.693 13.345 1.00 0.00 ? 38 ASP A CA   5  
ATOM 4856  C C    . ASP A 1 68  ? 45.724 34.595 12.549 1.00 0.00 ? 38 ASP A C    5  
ATOM 4857  O O    . ASP A 1 68  ? 46.415 35.592 12.345 1.00 0.00 ? 38 ASP A O    5  
ATOM 4858  C CB   . ASP A 1 68  ? 44.613 34.033 14.712 1.00 0.00 ? 38 ASP A CB   5  
ATOM 4859  C CG   . ASP A 1 68  ? 45.640 34.810 15.529 1.00 0.00 ? 38 ASP A CG   5  
ATOM 4860  O OD1  . ASP A 1 68  ? 45.255 35.784 16.155 1.00 0.00 ? 38 ASP A OD1  5  
ATOM 4861  O OD2  . ASP A 1 68  ? 46.795 34.420 15.517 1.00 0.00 ? 38 ASP A OD2  5  
ATOM 4862  H H    . ASP A 1 68  ? 42.873 33.281 13.034 1.00 0.00 ? 38 ASP A H    5  
ATOM 4863  H HA   . ASP A 1 68  ? 44.184 35.734 13.495 1.00 0.00 ? 38 ASP A HA   5  
ATOM 4864  H HB2  . ASP A 1 68  ? 43.670 34.022 15.237 1.00 0.00 ? 38 ASP A HB2  5  
ATOM 4865  H HB3  . ASP A 1 68  ? 44.959 33.019 14.576 1.00 0.00 ? 38 ASP A HB3  5  
ATOM 4866  N N    . LYS A 1 69  ? 46.050 33.385 12.102 1.00 0.00 ? 39 LYS A N    5  
ATOM 4867  C CA   . LYS A 1 69  ? 47.280 33.171 11.342 1.00 0.00 ? 39 LYS A CA   5  
ATOM 4868  C C    . LYS A 1 69  ? 47.310 33.998 10.055 1.00 0.00 ? 39 LYS A C    5  
ATOM 4869  O O    . LYS A 1 69  ? 48.381 34.401 9.602  1.00 0.00 ? 39 LYS A O    5  
ATOM 4870  C CB   . LYS A 1 69  ? 47.413 31.684 10.999 1.00 0.00 ? 39 LYS A CB   5  
ATOM 4871  C CG   . LYS A 1 69  ? 48.769 31.407 10.340 1.00 0.00 ? 39 LYS A CG   5  
ATOM 4872  C CD   . LYS A 1 69  ? 49.877 31.444 11.395 1.00 0.00 ? 39 LYS A CD   5  
ATOM 4873  C CE   . LYS A 1 69  ? 51.212 31.075 10.747 1.00 0.00 ? 39 LYS A CE   5  
ATOM 4874  N NZ   . LYS A 1 69  ? 51.799 32.281 10.096 1.00 0.00 ? 39 LYS A NZ   5  
ATOM 4875  H H    . LYS A 1 69  ? 45.468 32.622 12.302 1.00 0.00 ? 39 LYS A H    5  
ATOM 4876  H HA   . LYS A 1 69  ? 48.118 33.459 11.957 1.00 0.00 ? 39 LYS A HA   5  
ATOM 4877  H HB2  . LYS A 1 69  ? 47.330 31.101 11.904 1.00 0.00 ? 39 LYS A HB2  5  
ATOM 4878  H HB3  . LYS A 1 69  ? 46.624 31.402 10.319 1.00 0.00 ? 39 LYS A HB3  5  
ATOM 4879  H HG2  . LYS A 1 69  ? 48.747 30.431 9.878  1.00 0.00 ? 39 LYS A HG2  5  
ATOM 4880  H HG3  . LYS A 1 69  ? 48.969 32.154 9.587  1.00 0.00 ? 39 LYS A HG3  5  
ATOM 4881  H HD2  . LYS A 1 69  ? 49.943 32.437 11.815 1.00 0.00 ? 39 LYS A HD2  5  
ATOM 4882  H HD3  . LYS A 1 69  ? 49.653 30.735 12.178 1.00 0.00 ? 39 LYS A HD3  5  
ATOM 4883  H HE2  . LYS A 1 69  ? 51.890 30.708 11.502 1.00 0.00 ? 39 LYS A HE2  5  
ATOM 4884  H HE3  . LYS A 1 69  ? 51.051 30.307 10.005 1.00 0.00 ? 39 LYS A HE3  5  
ATOM 4885  H HZ1  . LYS A 1 69  ? 52.312 32.842 10.805 1.00 0.00 ? 39 LYS A HZ1  5  
ATOM 4886  H HZ2  . LYS A 1 69  ? 51.036 32.854 9.682  1.00 0.00 ? 39 LYS A HZ2  5  
ATOM 4887  H HZ3  . LYS A 1 69  ? 52.457 31.985 9.347  1.00 0.00 ? 39 LYS A HZ3  5  
ATOM 4888  N N    . TYR A 1 70  ? 46.141 34.253 9.469  1.00 0.00 ? 40 TYR A N    5  
ATOM 4889  C CA   . TYR A 1 70  ? 46.076 35.033 8.237  1.00 0.00 ? 40 TYR A CA   5  
ATOM 4890  C C    . TYR A 1 70  ? 46.687 36.425 8.467  1.00 0.00 ? 40 TYR A C    5  
ATOM 4891  O O    . TYR A 1 70  ? 46.325 37.089 9.440  1.00 0.00 ? 40 TYR A O    5  
ATOM 4892  C CB   . TYR A 1 70  ? 44.606 35.126 7.819  1.00 0.00 ? 40 TYR A CB   5  
ATOM 4893  C CG   . TYR A 1 70  ? 44.362 35.798 6.490  1.00 0.00 ? 40 TYR A CG   5  
ATOM 4894  C CD1  . TYR A 1 70  ? 44.743 35.169 5.299  1.00 0.00 ? 40 TYR A CD1  5  
ATOM 4895  C CD2  . TYR A 1 70  ? 43.709 37.034 6.452  1.00 0.00 ? 40 TYR A CD2  5  
ATOM 4896  C CE1  . TYR A 1 70  ? 44.479 35.783 4.069  1.00 0.00 ? 40 TYR A CE1  5  
ATOM 4897  C CE2  . TYR A 1 70  ? 43.445 37.649 5.223  1.00 0.00 ? 40 TYR A CE2  5  
ATOM 4898  C CZ   . TYR A 1 70  ? 43.830 37.024 4.031  1.00 0.00 ? 40 TYR A CZ   5  
ATOM 4899  O OH   . TYR A 1 70  ? 43.567 37.629 2.818  1.00 0.00 ? 40 TYR A OH   5  
ATOM 4900  H H    . TYR A 1 70  ? 45.320 33.867 9.840  1.00 0.00 ? 40 TYR A H    5  
ATOM 4901  H HA   . TYR A 1 70  ? 46.619 34.496 7.476  1.00 0.00 ? 40 TYR A HA   5  
ATOM 4902  H HB2  . TYR A 1 70  ? 44.202 34.128 7.767  1.00 0.00 ? 40 TYR A HB2  5  
ATOM 4903  H HB3  . TYR A 1 70  ? 44.071 35.667 8.588  1.00 0.00 ? 40 TYR A HB3  5  
ATOM 4904  H HD1  . TYR A 1 70  ? 45.248 34.215 5.329  1.00 0.00 ? 40 TYR A HD1  5  
ATOM 4905  H HD2  . TYR A 1 70  ? 43.412 37.513 7.371  1.00 0.00 ? 40 TYR A HD2  5  
ATOM 4906  H HE1  . TYR A 1 70  ? 44.773 35.299 3.149  1.00 0.00 ? 40 TYR A HE1  5  
ATOM 4907  H HE2  . TYR A 1 70  ? 42.939 38.602 5.197  1.00 0.00 ? 40 TYR A HE2  5  
ATOM 4908  H HH   . TYR A 1 70  ? 43.945 38.446 2.827  1.00 0.00 ? 40 TYR A HH   5  
ATOM 4909  N N    . PRO A 1 71  ? 47.585 36.893 7.623  1.00 0.00 ? 41 PRO A N    5  
ATOM 4910  C CA   . PRO A 1 71  ? 48.345 38.151 7.902  1.00 0.00 ? 41 PRO A CA   5  
ATOM 4911  C C    . PRO A 1 71  ? 47.637 39.446 7.503  1.00 0.00 ? 41 PRO A C    5  
ATOM 4912  O O    . PRO A 1 71  ? 48.280 40.496 7.461  1.00 0.00 ? 41 PRO A O    5  
ATOM 4913  C CB   . PRO A 1 71  ? 49.620 37.966 7.081  1.00 0.00 ? 41 PRO A CB   5  
ATOM 4914  C CG   . PRO A 1 71  ? 49.206 37.164 5.894  1.00 0.00 ? 41 PRO A CG   5  
ATOM 4915  C CD   . PRO A 1 71  ? 47.970 36.358 6.301  1.00 0.00 ? 41 PRO A CD   5  
ATOM 4916  H HA   . PRO A 1 71  ? 48.611 38.190 8.946  1.00 0.00 ? 41 PRO A HA   5  
ATOM 4917  H HB2  . PRO A 1 71  ? 50.007 38.928 6.773  1.00 0.00 ? 41 PRO A HB2  5  
ATOM 4918  H HB3  . PRO A 1 71  ? 50.359 37.425 7.649  1.00 0.00 ? 41 PRO A HB3  5  
ATOM 4919  H HG2  . PRO A 1 71  ? 48.969 37.823 5.070  1.00 0.00 ? 41 PRO A HG2  5  
ATOM 4920  H HG3  . PRO A 1 71  ? 49.998 36.486 5.611  1.00 0.00 ? 41 PRO A HG3  5  
ATOM 4921  H HD2  . PRO A 1 71  ? 47.174 36.505 5.584  1.00 0.00 ? 41 PRO A HD2  5  
ATOM 4922  H HD3  . PRO A 1 71  ? 48.215 35.310 6.384  1.00 0.00 ? 41 PRO A HD3  5  
ATOM 4923  N N    . HIS A 1 72  ? 46.337 39.392 7.215  1.00 0.00 ? 42 HIS A N    5  
ATOM 4924  C CA   . HIS A 1 72  ? 45.639 40.581 6.721  1.00 0.00 ? 42 HIS A CA   5  
ATOM 4925  C C    . HIS A 1 72  ? 44.208 40.668 7.238  1.00 0.00 ? 42 HIS A C    5  
ATOM 4926  O O    . HIS A 1 72  ? 43.567 39.653 7.505  1.00 0.00 ? 42 HIS A O    5  
ATOM 4927  C CB   . HIS A 1 72  ? 45.625 40.572 5.191  1.00 0.00 ? 42 HIS A CB   5  
ATOM 4928  C CG   . HIS A 1 72  ? 46.997 40.670 4.581  1.00 0.00 ? 42 HIS A CG   5  
ATOM 4929  N ND1  . HIS A 1 72  ? 47.780 41.806 4.704  1.00 0.00 ? 42 HIS A ND1  5  
ATOM 4930  C CD2  . HIS A 1 72  ? 47.738 39.783 3.840  1.00 0.00 ? 42 HIS A CD2  5  
ATOM 4931  C CE1  . HIS A 1 72  ? 48.934 41.576 4.055  1.00 0.00 ? 42 HIS A CE1  5  
ATOM 4932  N NE2  . HIS A 1 72  ? 48.962 40.358 3.509  1.00 0.00 ? 42 HIS A NE2  5  
ATOM 4933  H H    . HIS A 1 72  ? 45.844 38.554 7.339  1.00 0.00 ? 42 HIS A H    5  
ATOM 4934  H HA   . HIS A 1 72  ? 46.176 41.458 7.050  1.00 0.00 ? 42 HIS A HA   5  
ATOM 4935  H HB2  . HIS A 1 72  ? 45.166 39.656 4.854  1.00 0.00 ? 42 HIS A HB2  5  
ATOM 4936  H HB3  . HIS A 1 72  ? 45.025 41.403 4.848  1.00 0.00 ? 42 HIS A HB3  5  
ATOM 4937  H HD1  . HIS A 1 72  ? 47.538 42.628 5.180  1.00 0.00 ? 42 HIS A HD1  5  
ATOM 4938  H HD2  . HIS A 1 72  ? 47.420 38.790 3.557  1.00 0.00 ? 42 HIS A HD2  5  
ATOM 4939  H HE1  . HIS A 1 72  ? 49.742 42.290 3.982  1.00 0.00 ? 42 HIS A HE1  5  
ATOM 4940  N N    . LYS A 1 73  ? 43.719 41.895 7.406  1.00 0.00 ? 43 LYS A N    5  
ATOM 4941  C CA   . LYS A 1 73  ? 42.311 42.097 7.718  1.00 0.00 ? 43 LYS A CA   5  
ATOM 4942  C C    . LYS A 1 73  ? 41.456 41.580 6.567  1.00 0.00 ? 43 LYS A C    5  
ATOM 4943  O O    . LYS A 1 73  ? 41.740 41.871 5.404  1.00 0.00 ? 43 LYS A O    5  
ATOM 4944  C CB   . LYS A 1 73  ? 42.027 43.589 7.915  1.00 0.00 ? 43 LYS A CB   5  
ATOM 4945  C CG   . LYS A 1 73  ? 40.600 43.774 8.435  1.00 0.00 ? 43 LYS A CG   5  
ATOM 4946  C CD   . LYS A 1 73  ? 40.288 45.267 8.552  1.00 0.00 ? 43 LYS A CD   5  
ATOM 4947  C CE   . LYS A 1 73  ? 38.921 45.454 9.213  1.00 0.00 ? 43 LYS A CE   5  
ATOM 4948  N NZ   . LYS A 1 73  ? 39.064 45.340 10.692 1.00 0.00 ? 43 LYS A NZ   5  
ATOM 4949  H H    . LYS A 1 73  ? 44.314 42.669 7.326  1.00 0.00 ? 43 LYS A H    5  
ATOM 4950  H HA   . LYS A 1 73  ? 42.061 41.563 8.622  1.00 0.00 ? 43 LYS A HA   5  
ATOM 4951  H HB2  . LYS A 1 73  ? 42.729 44.002 8.623  1.00 0.00 ? 43 LYS A HB2  5  
ATOM 4952  H HB3  . LYS A 1 73  ? 42.129 44.100 6.970  1.00 0.00 ? 43 LYS A HB3  5  
ATOM 4953  H HG2  . LYS A 1 73  ? 39.905 43.313 7.748  1.00 0.00 ? 43 LYS A HG2  5  
ATOM 4954  H HG3  . LYS A 1 73  ? 40.507 43.313 9.406  1.00 0.00 ? 43 LYS A HG3  5  
ATOM 4955  H HD2  . LYS A 1 73  ? 41.048 45.746 9.151  1.00 0.00 ? 43 LYS A HD2  5  
ATOM 4956  H HD3  . LYS A 1 73  ? 40.272 45.710 7.568  1.00 0.00 ? 43 LYS A HD3  5  
ATOM 4957  H HE2  . LYS A 1 73  ? 38.530 46.429 8.962  1.00 0.00 ? 43 LYS A HE2  5  
ATOM 4958  H HE3  . LYS A 1 73  ? 38.242 44.693 8.858  1.00 0.00 ? 43 LYS A HE3  5  
ATOM 4959  H HZ1  . LYS A 1 73  ? 38.257 44.811 11.079 1.00 0.00 ? 43 LYS A HZ1  5  
ATOM 4960  H HZ2  . LYS A 1 73  ? 39.088 46.292 11.111 1.00 0.00 ? 43 LYS A HZ2  5  
ATOM 4961  H HZ3  . LYS A 1 73  ? 39.946 44.839 10.918 1.00 0.00 ? 43 LYS A HZ3  5  
ATOM 4962  N N    . ILE A 1 74  ? 40.417 40.814 6.885  1.00 0.00 ? 44 ILE A N    5  
ATOM 4963  C CA   . ILE A 1 74  ? 39.501 40.338 5.851  1.00 0.00 ? 44 ILE A CA   5  
ATOM 4964  C C    . ILE A 1 74  ? 38.349 41.325 5.668  1.00 0.00 ? 44 ILE A C    5  
ATOM 4965  O O    . ILE A 1 74  ? 37.717 41.745 6.637  1.00 0.00 ? 44 ILE A O    5  
ATOM 4966  C CB   . ILE A 1 74  ? 38.993 38.936 6.211  1.00 0.00 ? 44 ILE A CB   5  
ATOM 4967  C CG1  . ILE A 1 74  ? 40.197 37.995 6.320  1.00 0.00 ? 44 ILE A CG1  5  
ATOM 4968  C CG2  . ILE A 1 74  ? 38.047 38.420 5.122  1.00 0.00 ? 44 ILE A CG2  5  
ATOM 4969  C CD1  . ILE A 1 74  ? 39.754 36.628 6.840  1.00 0.00 ? 44 ILE A CD1  5  
ATOM 4970  H H    . ILE A 1 74  ? 40.280 40.547 7.821  1.00 0.00 ? 44 ILE A H    5  
ATOM 4971  H HA   . ILE A 1 74  ? 40.044 40.276 4.919  1.00 0.00 ? 44 ILE A HA   5  
ATOM 4972  H HB   . ILE A 1 74  ? 38.472 38.970 7.157  1.00 0.00 ? 44 ILE A HB   5  
ATOM 4973  H HG12 . ILE A 1 74  ? 40.649 37.879 5.346  1.00 0.00 ? 44 ILE A HG12 5  
ATOM 4974  H HG13 . ILE A 1 74  ? 40.920 38.418 7.002  1.00 0.00 ? 44 ILE A HG13 5  
ATOM 4975  H HG21 . ILE A 1 74  ? 38.553 38.435 4.168  1.00 0.00 ? 44 ILE A HG21 5  
ATOM 4976  H HG22 . ILE A 1 74  ? 37.174 39.055 5.076  1.00 0.00 ? 44 ILE A HG22 5  
ATOM 4977  H HG23 . ILE A 1 74  ? 37.744 37.410 5.354  1.00 0.00 ? 44 ILE A HG23 5  
ATOM 4978  H HD11 . ILE A 1 74  ? 40.625 36.048 7.103  1.00 0.00 ? 44 ILE A HD11 5  
ATOM 4979  H HD12 . ILE A 1 74  ? 39.196 36.115 6.070  1.00 0.00 ? 44 ILE A HD12 5  
ATOM 4980  H HD13 . ILE A 1 74  ? 39.130 36.759 7.711  1.00 0.00 ? 44 ILE A HD13 5  
ATOM 4981  N N    . LYS A 1 75  ? 38.086 41.687 4.415  1.00 0.00 ? 45 LYS A N    5  
ATOM 4982  C CA   . LYS A 1 75  ? 37.054 42.678 4.108  1.00 0.00 ? 45 LYS A CA   5  
ATOM 4983  C C    . LYS A 1 75  ? 35.648 42.072 4.040  1.00 0.00 ? 45 LYS A C    5  
ATOM 4984  O O    . LYS A 1 75  ? 34.663 42.795 4.181  1.00 0.00 ? 45 LYS A O    5  
ATOM 4985  C CB   . LYS A 1 75  ? 37.396 43.350 2.773  1.00 0.00 ? 45 LYS A CB   5  
ATOM 4986  C CG   . LYS A 1 75  ? 36.447 44.522 2.507  1.00 0.00 ? 45 LYS A CG   5  
ATOM 4987  C CD   . LYS A 1 75  ? 36.769 45.136 1.144  1.00 0.00 ? 45 LYS A CD   5  
ATOM 4988  C CE   . LYS A 1 75  ? 35.935 46.402 0.941  1.00 0.00 ? 45 LYS A CE   5  
ATOM 4989  N NZ   . LYS A 1 75  ? 36.283 47.021 -0.368 1.00 0.00 ? 45 LYS A NZ   5  
ATOM 4990  H H    . LYS A 1 75  ? 38.595 41.283 3.683  1.00 0.00 ? 45 LYS A H    5  
ATOM 4991  H HA   . LYS A 1 75  ? 37.059 43.431 4.880  1.00 0.00 ? 45 LYS A HA   5  
ATOM 4992  H HB2  . LYS A 1 75  ? 38.412 43.713 2.807  1.00 0.00 ? 45 LYS A HB2  5  
ATOM 4993  H HB3  . LYS A 1 75  ? 37.300 42.627 1.977  1.00 0.00 ? 45 LYS A HB3  5  
ATOM 4994  H HG2  . LYS A 1 75  ? 35.427 44.170 2.508  1.00 0.00 ? 45 LYS A HG2  5  
ATOM 4995  H HG3  . LYS A 1 75  ? 36.573 45.271 3.275  1.00 0.00 ? 45 LYS A HG3  5  
ATOM 4996  H HD2  . LYS A 1 75  ? 37.820 45.384 1.102  1.00 0.00 ? 45 LYS A HD2  5  
ATOM 4997  H HD3  . LYS A 1 75  ? 36.535 44.426 0.365  1.00 0.00 ? 45 LYS A HD3  5  
ATOM 4998  H HE2  . LYS A 1 75  ? 34.885 46.147 0.952  1.00 0.00 ? 45 LYS A HE2  5  
ATOM 4999  H HE3  . LYS A 1 75  ? 36.143 47.102 1.737  1.00 0.00 ? 45 LYS A HE3  5  
ATOM 5000  H HZ1  . LYS A 1 75  ? 37.185 47.530 -0.283 1.00 0.00 ? 45 LYS A HZ1  5  
ATOM 5001  H HZ2  . LYS A 1 75  ? 35.533 47.688 -0.646 1.00 0.00 ? 45 LYS A HZ2  5  
ATOM 5002  H HZ3  . LYS A 1 75  ? 36.373 46.279 -1.091 1.00 0.00 ? 45 LYS A HZ3  5  
ATOM 5003  N N    . SER A 1 76  ? 35.547 40.756 3.849  1.00 0.00 ? 46 SER A N    5  
ATOM 5004  C CA   . SER A 1 76  ? 34.240 40.109 3.774  1.00 0.00 ? 46 SER A CA   5  
ATOM 5005  C C    . SER A 1 76  ? 34.325 38.647 4.197  1.00 0.00 ? 46 SER A C    5  
ATOM 5006  O O    . SER A 1 76  ? 35.373 38.013 4.080  1.00 0.00 ? 46 SER A O    5  
ATOM 5007  C CB   . SER A 1 76  ? 33.699 40.196 2.347  1.00 0.00 ? 46 SER A CB   5  
ATOM 5008  O OG   . SER A 1 76  ? 34.475 39.359 1.502  1.00 0.00 ? 46 SER A OG   5  
ATOM 5009  H H    . SER A 1 76  ? 36.359 40.218 3.750  1.00 0.00 ? 46 SER A H    5  
ATOM 5010  H HA   . SER A 1 76  ? 33.558 40.624 4.434  1.00 0.00 ? 46 SER A HA   5  
ATOM 5011  H HB2  . SER A 1 76  ? 32.674 39.864 2.326  1.00 0.00 ? 46 SER A HB2  5  
ATOM 5012  H HB3  . SER A 1 76  ? 33.747 41.223 2.008  1.00 0.00 ? 46 SER A HB3  5  
ATOM 5013  H HG   . SER A 1 76  ? 33.931 38.733 1.153  1.00 0.00 ? 46 SER A HG   5  
ATOM 5014  N N    . GLY A 1 77  ? 33.208 38.120 4.687  1.00 0.00 ? 47 GLY A N    5  
ATOM 5015  C CA   . GLY A 1 77  ? 33.138 36.715 5.073  1.00 0.00 ? 47 GLY A CA   5  
ATOM 5016  C C    . GLY A 1 77  ? 33.355 35.798 3.871  1.00 0.00 ? 47 GLY A C    5  
ATOM 5017  O O    . GLY A 1 77  ? 33.973 34.738 3.991  1.00 0.00 ? 47 GLY A O    5  
ATOM 5018  H H    . GLY A 1 77  ? 32.406 38.677 4.767  1.00 0.00 ? 47 GLY A H    5  
ATOM 5019  H HA2  . GLY A 1 77  ? 33.897 36.514 5.815  1.00 0.00 ? 47 GLY A HA2  5  
ATOM 5020  H HA3  . GLY A 1 77  ? 32.166 36.513 5.497  1.00 0.00 ? 47 GLY A HA3  5  
ATOM 5021  N N    . ALA A 1 78  ? 32.871 36.218 2.701  1.00 0.00 ? 48 ALA A N    5  
ATOM 5022  C CA   . ALA A 1 78  ? 33.015 35.404 1.499  1.00 0.00 ? 48 ALA A CA   5  
ATOM 5023  C C    . ALA A 1 78  ? 34.492 35.139 1.222  1.00 0.00 ? 48 ALA A C    5  
ATOM 5024  O O    . ALA A 1 78  ? 34.869 34.026 0.858  1.00 0.00 ? 48 ALA A O    5  
ATOM 5025  C CB   . ALA A 1 78  ? 32.388 36.120 0.303  1.00 0.00 ? 48 ALA A CB   5  
ATOM 5026  H H    . ALA A 1 78  ? 32.414 37.083 2.649  1.00 0.00 ? 48 ALA A H    5  
ATOM 5027  H HA   . ALA A 1 78  ? 32.510 34.461 1.650  1.00 0.00 ? 48 ALA A HA   5  
ATOM 5028  H HB1  . ALA A 1 78  ? 31.436 36.542 0.594  1.00 0.00 ? 48 ALA A HB1  5  
ATOM 5029  H HB2  . ALA A 1 78  ? 32.237 35.415 -0.501 1.00 0.00 ? 48 ALA A HB2  5  
ATOM 5030  H HB3  . ALA A 1 78  ? 33.044 36.911 -0.029 1.00 0.00 ? 48 ALA A HB3  5  
ATOM 5031  N N    . GLU A 1 79  ? 35.323 36.165 1.396  1.00 0.00 ? 49 GLU A N    5  
ATOM 5032  C CA   . GLU A 1 79  ? 36.765 35.965 1.342  1.00 0.00 ? 49 GLU A CA   5  
ATOM 5033  C C    . GLU A 1 79  ? 37.219 35.013 2.449  1.00 0.00 ? 49 GLU A C    5  
ATOM 5034  O O    . GLU A 1 79  ? 38.055 34.140 2.216  1.00 0.00 ? 49 GLU A O    5  
ATOM 5035  C CB   . GLU A 1 79  ? 37.485 37.307 1.493  1.00 0.00 ? 49 GLU A CB   5  
ATOM 5036  C CG   . GLU A 1 79  ? 38.987 37.113 1.252  1.00 0.00 ? 49 GLU A CG   5  
ATOM 5037  C CD   . GLU A 1 79  ? 39.776 38.408 1.478  1.00 0.00 ? 49 GLU A CD   5  
ATOM 5038  O OE1  . GLU A 1 79  ? 39.184 39.416 1.838  1.00 0.00 ? 49 GLU A OE1  5  
ATOM 5039  O OE2  . GLU A 1 79  ? 40.979 38.371 1.284  1.00 0.00 ? 49 GLU A OE2  5  
ATOM 5040  H H    . GLU A 1 79  ? 34.961 37.061 1.560  1.00 0.00 ? 49 GLU A H    5  
ATOM 5041  H HA   . GLU A 1 79  ? 37.023 35.538 0.385  1.00 0.00 ? 49 GLU A HA   5  
ATOM 5042  H HB2  . GLU A 1 79  ? 37.090 38.009 0.773  1.00 0.00 ? 49 GLU A HB2  5  
ATOM 5043  H HB3  . GLU A 1 79  ? 37.330 37.689 2.491  1.00 0.00 ? 49 GLU A HB3  5  
ATOM 5044  H HG2  . GLU A 1 79  ? 39.356 36.356 1.928  1.00 0.00 ? 49 GLU A HG2  5  
ATOM 5045  H HG3  . GLU A 1 79  ? 39.139 36.780 0.235  1.00 0.00 ? 49 GLU A HG3  5  
ATOM 5046  N N    . ALA A 1 80  ? 36.584 35.100 3.619  1.00 0.00 ? 50 ALA A N    5  
ATOM 5047  C CA   . ALA A 1 80  ? 36.967 34.250 4.745  1.00 0.00 ? 50 ALA A CA   5  
ATOM 5048  C C    . ALA A 1 80  ? 36.796 32.768 4.408  1.00 0.00 ? 50 ALA A C    5  
ATOM 5049  O O    . ALA A 1 80  ? 37.609 31.937 4.812  1.00 0.00 ? 50 ALA A O    5  
ATOM 5050  C CB   . ALA A 1 80  ? 36.114 34.594 5.968  1.00 0.00 ? 50 ALA A CB   5  
ATOM 5051  H H    . ALA A 1 80  ? 35.856 35.748 3.730  1.00 0.00 ? 50 ALA A H    5  
ATOM 5052  H HA   . ALA A 1 80  ? 38.003 34.435 4.985  1.00 0.00 ? 50 ALA A HA   5  
ATOM 5053  H HB1  . ALA A 1 80  ? 35.189 34.038 5.931  1.00 0.00 ? 50 ALA A HB1  5  
ATOM 5054  H HB2  . ALA A 1 80  ? 35.898 35.652 5.970  1.00 0.00 ? 50 ALA A HB2  5  
ATOM 5055  H HB3  . ALA A 1 80  ? 36.654 34.335 6.868  1.00 0.00 ? 50 ALA A HB3  5  
ATOM 5056  N N    . LYS A 1 81  ? 35.792 32.452 3.599  1.00 0.00 ? 51 LYS A N    5  
ATOM 5057  C CA   . LYS A 1 81  ? 35.543 31.067 3.206  1.00 0.00 ? 51 LYS A CA   5  
ATOM 5058  C C    . LYS A 1 81  ? 36.767 30.442 2.528  1.00 0.00 ? 51 LYS A C    5  
ATOM 5059  O O    . LYS A 1 81  ? 36.952 29.226 2.592  1.00 0.00 ? 51 LYS A O    5  
ATOM 5060  C CB   . LYS A 1 81  ? 34.346 31.011 2.253  1.00 0.00 ? 51 LYS A CB   5  
ATOM 5061  C CG   . LYS A 1 81  ? 33.978 29.553 1.969  1.00 0.00 ? 51 LYS A CG   5  
ATOM 5062  C CD   . LYS A 1 81  ? 32.837 29.502 0.950  1.00 0.00 ? 51 LYS A CD   5  
ATOM 5063  C CE   . LYS A 1 81  ? 32.364 28.056 0.783  1.00 0.00 ? 51 LYS A CE   5  
ATOM 5064  N NZ   . LYS A 1 81  ? 31.873 27.540 2.091  1.00 0.00 ? 51 LYS A NZ   5  
ATOM 5065  H H    . LYS A 1 81  ? 35.174 33.157 3.307  1.00 0.00 ? 51 LYS A H    5  
ATOM 5066  H HA   . LYS A 1 81  ? 35.305 30.493 4.088  1.00 0.00 ? 51 LYS A HA   5  
ATOM 5067  H HB2  . LYS A 1 81  ? 33.504 31.513 2.705  1.00 0.00 ? 51 LYS A HB2  5  
ATOM 5068  H HB3  . LYS A 1 81  ? 34.601 31.502 1.326  1.00 0.00 ? 51 LYS A HB3  5  
ATOM 5069  H HG2  . LYS A 1 81  ? 34.840 29.036 1.572  1.00 0.00 ? 51 LYS A HG2  5  
ATOM 5070  H HG3  . LYS A 1 81  ? 33.662 29.076 2.884  1.00 0.00 ? 51 LYS A HG3  5  
ATOM 5071  H HD2  . LYS A 1 81  ? 32.016 30.112 1.299  1.00 0.00 ? 51 LYS A HD2  5  
ATOM 5072  H HD3  . LYS A 1 81  ? 33.185 29.876 -0.001 1.00 0.00 ? 51 LYS A HD3  5  
ATOM 5073  H HE2  . LYS A 1 81  ? 31.564 28.022 0.059  1.00 0.00 ? 51 LYS A HE2  5  
ATOM 5074  H HE3  . LYS A 1 81  ? 33.187 27.446 0.440  1.00 0.00 ? 51 LYS A HE3  5  
ATOM 5075  H HZ1  . LYS A 1 81  ? 31.447 28.316 2.634  1.00 0.00 ? 51 LYS A HZ1  5  
ATOM 5076  H HZ2  . LYS A 1 81  ? 32.671 27.139 2.626  1.00 0.00 ? 51 LYS A HZ2  5  
ATOM 5077  H HZ3  . LYS A 1 81  ? 31.159 26.801 1.926  1.00 0.00 ? 51 LYS A HZ3  5  
ATOM 5078  N N    . LYS A 1 82  ? 37.598 31.258 1.880  1.00 0.00 ? 52 LYS A N    5  
ATOM 5079  C CA   . LYS A 1 82  ? 38.778 30.743 1.194  1.00 0.00 ? 52 LYS A CA   5  
ATOM 5080  C C    . LYS A 1 82  ? 39.745 30.035 2.151  1.00 0.00 ? 52 LYS A C    5  
ATOM 5081  O O    . LYS A 1 82  ? 40.529 29.190 1.717  1.00 0.00 ? 52 LYS A O    5  
ATOM 5082  C CB   . LYS A 1 82  ? 39.510 31.892 0.498  1.00 0.00 ? 52 LYS A CB   5  
ATOM 5083  C CG   . LYS A 1 82  ? 38.616 32.483 -0.592 1.00 0.00 ? 52 LYS A CG   5  
ATOM 5084  C CD   . LYS A 1 82  ? 39.388 33.560 -1.357 1.00 0.00 ? 52 LYS A CD   5  
ATOM 5085  C CE   . LYS A 1 82  ? 38.459 34.237 -2.367 1.00 0.00 ? 52 LYS A CE   5  
ATOM 5086  N NZ   . LYS A 1 82  ? 39.105 35.475 -2.885 1.00 0.00 ? 52 LYS A NZ   5  
ATOM 5087  H H    . LYS A 1 82  ? 37.443 32.226 1.898  1.00 0.00 ? 52 LYS A H    5  
ATOM 5088  H HA   . LYS A 1 82  ? 38.460 30.037 0.441  1.00 0.00 ? 52 LYS A HA   5  
ATOM 5089  H HB2  . LYS A 1 82  ? 39.752 32.655 1.224  1.00 0.00 ? 52 LYS A HB2  5  
ATOM 5090  H HB3  . LYS A 1 82  ? 40.420 31.520 0.051  1.00 0.00 ? 52 LYS A HB3  5  
ATOM 5091  H HG2  . LYS A 1 82  ? 38.315 31.702 -1.274 1.00 0.00 ? 52 LYS A HG2  5  
ATOM 5092  H HG3  . LYS A 1 82  ? 37.742 32.925 -0.140 1.00 0.00 ? 52 LYS A HG3  5  
ATOM 5093  H HD2  . LYS A 1 82  ? 39.764 34.297 -0.662 1.00 0.00 ? 52 LYS A HD2  5  
ATOM 5094  H HD3  . LYS A 1 82  ? 40.215 33.106 -1.882 1.00 0.00 ? 52 LYS A HD3  5  
ATOM 5095  H HE2  . LYS A 1 82  ? 38.265 33.562 -3.187 1.00 0.00 ? 52 LYS A HE2  5  
ATOM 5096  H HE3  . LYS A 1 82  ? 37.527 34.492 -1.883 1.00 0.00 ? 52 LYS A HE3  5  
ATOM 5097  H HZ1  . LYS A 1 82  ? 39.182 36.175 -2.119 1.00 0.00 ? 52 LYS A HZ1  5  
ATOM 5098  H HZ2  . LYS A 1 82  ? 38.530 35.868 -3.658 1.00 0.00 ? 52 LYS A HZ2  5  
ATOM 5099  H HZ3  . LYS A 1 82  ? 40.057 35.248 -3.240 1.00 0.00 ? 52 LYS A HZ3  5  
ATOM 5100  N N    . LEU A 1 83  ? 39.695 30.367 3.442  1.00 0.00 ? 53 LEU A N    5  
ATOM 5101  C CA   . LEU A 1 83  ? 40.663 29.833 4.392  1.00 0.00 ? 53 LEU A CA   5  
ATOM 5102  C C    . LEU A 1 83  ? 40.198 28.482 4.950  1.00 0.00 ? 53 LEU A C    5  
ATOM 5103  O O    . LEU A 1 83  ? 39.008 28.313 5.231  1.00 0.00 ? 53 LEU A O    5  
ATOM 5104  C CB   . LEU A 1 83  ? 40.853 30.824 5.542  1.00 0.00 ? 53 LEU A CB   5  
ATOM 5105  C CG   . LEU A 1 83  ? 41.403 32.143 4.997  1.00 0.00 ? 53 LEU A CG   5  
ATOM 5106  C CD1  . LEU A 1 83  ? 41.194 33.251 6.032  1.00 0.00 ? 53 LEU A CD1  5  
ATOM 5107  C CD2  . LEU A 1 83  ? 42.899 31.991 4.710  1.00 0.00 ? 53 LEU A CD2  5  
ATOM 5108  H H    . LEU A 1 83  ? 38.990 30.968 3.763  1.00 0.00 ? 53 LEU A H    5  
ATOM 5109  H HA   . LEU A 1 83  ? 41.604 29.716 3.877  1.00 0.00 ? 53 LEU A HA   5  
ATOM 5110  H HB2  . LEU A 1 83  ? 39.903 31.000 6.026  1.00 0.00 ? 53 LEU A HB2  5  
ATOM 5111  H HB3  . LEU A 1 83  ? 41.550 30.415 6.256  1.00 0.00 ? 53 LEU A HB3  5  
ATOM 5112  H HG   . LEU A 1 83  ? 40.884 32.401 4.085  1.00 0.00 ? 53 LEU A HG   5  
ATOM 5113  H HD11 . LEU A 1 83  ? 41.680 34.155 5.695  1.00 0.00 ? 53 LEU A HD11 5  
ATOM 5114  H HD12 . LEU A 1 83  ? 41.618 32.944 6.977  1.00 0.00 ? 53 LEU A HD12 5  
ATOM 5115  H HD13 . LEU A 1 83  ? 40.137 33.435 6.153  1.00 0.00 ? 53 LEU A HD13 5  
ATOM 5116  H HD21 . LEU A 1 83  ? 43.398 31.616 5.592  1.00 0.00 ? 53 LEU A HD21 5  
ATOM 5117  H HD22 . LEU A 1 83  ? 43.314 32.952 4.444  1.00 0.00 ? 53 LEU A HD22 5  
ATOM 5118  H HD23 . LEU A 1 83  ? 43.040 31.299 3.894  1.00 0.00 ? 53 LEU A HD23 5  
ATOM 5119  N N    . PRO A 1 84  ? 41.092 27.538 5.177  1.00 0.00 ? 54 PRO A N    5  
ATOM 5120  C CA   . PRO A 1 84  ? 40.679 26.179 5.642  1.00 0.00 ? 54 PRO A CA   5  
ATOM 5121  C C    . PRO A 1 84  ? 39.959 26.237 6.984  1.00 0.00 ? 54 PRO A C    5  
ATOM 5122  O O    . PRO A 1 84  ? 40.457 26.830 7.942  1.00 0.00 ? 54 PRO A O    5  
ATOM 5123  C CB   . PRO A 1 84  ? 41.988 25.388 5.750  1.00 0.00 ? 54 PRO A CB   5  
ATOM 5124  C CG   . PRO A 1 84  ? 43.063 26.414 5.858  1.00 0.00 ? 54 PRO A CG   5  
ATOM 5125  C CD   . PRO A 1 84  ? 42.564 27.634 5.089  1.00 0.00 ? 54 PRO A CD   5  
ATOM 5126  H HA   . PRO A 1 84  ? 40.042 25.715 4.903  1.00 0.00 ? 54 PRO A HA   5  
ATOM 5127  H HB2  . PRO A 1 84  ? 41.976 24.759 6.630  1.00 0.00 ? 54 PRO A HB2  5  
ATOM 5128  H HB3  . PRO A 1 84  ? 42.140 24.792 4.864  1.00 0.00 ? 54 PRO A HB3  5  
ATOM 5129  H HG2  . PRO A 1 84  ? 43.233 26.663 6.897  1.00 0.00 ? 54 PRO A HG2  5  
ATOM 5130  H HG3  . PRO A 1 84  ? 43.972 26.051 5.404  1.00 0.00 ? 54 PRO A HG3  5  
ATOM 5131  H HD2  . PRO A 1 84  ? 42.918 28.543 5.556  1.00 0.00 ? 54 PRO A HD2  5  
ATOM 5132  H HD3  . PRO A 1 84  ? 42.875 27.588 4.057  1.00 0.00 ? 54 PRO A HD3  5  
ATOM 5133  N N    . GLY A 1 85  ? 38.792 25.605 7.047  1.00 0.00 ? 55 GLY A N    5  
ATOM 5134  C CA   . GLY A 1 85  ? 38.015 25.566 8.283  1.00 0.00 ? 55 GLY A CA   5  
ATOM 5135  C C    . GLY A 1 85  ? 36.853 26.565 8.299  1.00 0.00 ? 55 GLY A C    5  
ATOM 5136  O O    . GLY A 1 85  ? 35.994 26.481 9.178  1.00 0.00 ? 55 GLY A O    5  
ATOM 5137  H H    . GLY A 1 85  ? 38.446 25.155 6.248  1.00 0.00 ? 55 GLY A H    5  
ATOM 5138  H HA2  . GLY A 1 85  ? 37.616 24.571 8.409  1.00 0.00 ? 55 GLY A HA2  5  
ATOM 5139  H HA3  . GLY A 1 85  ? 38.671 25.784 9.114  1.00 0.00 ? 55 GLY A HA3  5  
ATOM 5140  N N    . VAL A 1 86  ? 36.811 27.504 7.348  1.00 0.00 ? 56 VAL A N    5  
ATOM 5141  C CA   . VAL A 1 86  ? 35.711 28.465 7.296  1.00 0.00 ? 56 VAL A CA   5  
ATOM 5142  C C    . VAL A 1 86  ? 34.534 27.871 6.526  1.00 0.00 ? 56 VAL A C    5  
ATOM 5143  O O    . VAL A 1 86  ? 34.712 27.281 5.461  1.00 0.00 ? 56 VAL A O    5  
ATOM 5144  C CB   . VAL A 1 86  ? 36.169 29.766 6.626  1.00 0.00 ? 56 VAL A CB   5  
ATOM 5145  C CG1  . VAL A 1 86  ? 35.041 30.799 6.676  1.00 0.00 ? 56 VAL A CG1  5  
ATOM 5146  C CG2  . VAL A 1 86  ? 37.389 30.329 7.363  1.00 0.00 ? 56 VAL A CG2  5  
ATOM 5147  H H    . VAL A 1 86  ? 37.532 27.561 6.682  1.00 0.00 ? 56 VAL A H    5  
ATOM 5148  H HA   . VAL A 1 86  ? 35.393 28.685 8.304  1.00 0.00 ? 56 VAL A HA   5  
ATOM 5149  H HB   . VAL A 1 86  ? 36.430 29.567 5.598  1.00 0.00 ? 56 VAL A HB   5  
ATOM 5150  H HG11 . VAL A 1 86  ? 34.595 30.799 7.660  1.00 0.00 ? 56 VAL A HG11 5  
ATOM 5151  H HG12 . VAL A 1 86  ? 34.290 30.548 5.941  1.00 0.00 ? 56 VAL A HG12 5  
ATOM 5152  H HG13 . VAL A 1 86  ? 35.439 31.779 6.463  1.00 0.00 ? 56 VAL A HG13 5  
ATOM 5153  H HG21 . VAL A 1 86  ? 37.228 30.267 8.428  1.00 0.00 ? 56 VAL A HG21 5  
ATOM 5154  H HG22 . VAL A 1 86  ? 37.535 31.361 7.079  1.00 0.00 ? 56 VAL A HG22 5  
ATOM 5155  H HG23 . VAL A 1 86  ? 38.265 29.755 7.098  1.00 0.00 ? 56 VAL A HG23 5  
ATOM 5156  N N    . GLY A 1 87  ? 33.329 28.028 7.073  1.00 0.00 ? 57 GLY A N    5  
ATOM 5157  C CA   . GLY A 1 87  ? 32.127 27.500 6.430  1.00 0.00 ? 57 GLY A CA   5  
ATOM 5158  C C    . GLY A 1 87  ? 31.219 28.628 5.953  1.00 0.00 ? 57 GLY A C    5  
ATOM 5159  O O    . GLY A 1 87  ? 31.433 29.796 6.284  1.00 0.00 ? 57 GLY A O    5  
ATOM 5160  H H    . GLY A 1 87  ? 33.247 28.509 7.923  1.00 0.00 ? 57 GLY A H    5  
ATOM 5161  H HA2  . GLY A 1 87  ? 32.409 26.888 5.585  1.00 0.00 ? 57 GLY A HA2  5  
ATOM 5162  H HA3  . GLY A 1 87  ? 31.585 26.894 7.140  1.00 0.00 ? 57 GLY A HA3  5  
ATOM 5163  N N    . THR A 1 88  ? 30.186 28.274 5.195  1.00 0.00 ? 58 THR A N    5  
ATOM 5164  C CA   . THR A 1 88  ? 29.274 29.276 4.655  1.00 0.00 ? 58 THR A CA   5  
ATOM 5165  C C    . THR A 1 88  ? 28.598 30.062 5.777  1.00 0.00 ? 58 THR A C    5  
ATOM 5166  O O    . THR A 1 88  ? 28.527 31.291 5.724  1.00 0.00 ? 58 THR A O    5  
ATOM 5167  C CB   . THR A 1 88  ? 28.215 28.610 3.770  1.00 0.00 ? 58 THR A CB   5  
ATOM 5168  O OG1  . THR A 1 88  ? 27.309 29.597 3.300  1.00 0.00 ? 58 THR A OG1  5  
ATOM 5169  C CG2  . THR A 1 88  ? 27.446 27.552 4.566  1.00 0.00 ? 58 THR A CG2  5  
ATOM 5170  H H    . THR A 1 88  ? 30.040 27.326 4.992  1.00 0.00 ? 58 THR A H    5  
ATOM 5171  H HA   . THR A 1 88  ? 29.842 29.965 4.048  1.00 0.00 ? 58 THR A HA   5  
ATOM 5172  H HB   . THR A 1 88  ? 28.698 28.137 2.928  1.00 0.00 ? 58 THR A HB   5  
ATOM 5173  H HG1  . THR A 1 88  ? 27.107 29.405 2.444  1.00 0.00 ? 58 THR A HG1  5  
ATOM 5174  H HG21 . THR A 1 88  ? 26.777 28.040 5.259  1.00 0.00 ? 58 THR A HG21 5  
ATOM 5175  H HG22 . THR A 1 88  ? 28.142 26.933 5.113  1.00 0.00 ? 58 THR A HG22 5  
ATOM 5176  H HG23 . THR A 1 88  ? 26.874 26.936 3.888  1.00 0.00 ? 58 THR A HG23 5  
ATOM 5177  N N    . LYS A 1 89  ? 28.131 29.360 6.805  1.00 0.00 ? 59 LYS A N    5  
ATOM 5178  C CA   . LYS A 1 89  ? 27.449 30.022 7.913  1.00 0.00 ? 59 LYS A CA   5  
ATOM 5179  C C    . LYS A 1 89  ? 28.380 31.017 8.600  1.00 0.00 ? 59 LYS A C    5  
ATOM 5180  O O    . LYS A 1 89  ? 27.979 32.135 8.925  1.00 0.00 ? 59 LYS A O    5  
ATOM 5181  C CB   . LYS A 1 89  ? 26.969 28.982 8.928  1.00 0.00 ? 59 LYS A CB   5  
ATOM 5182  C CG   . LYS A 1 89  ? 25.921 28.079 8.275  1.00 0.00 ? 59 LYS A CG   5  
ATOM 5183  C CD   . LYS A 1 89  ? 25.361 27.107 9.315  1.00 0.00 ? 59 LYS A CD   5  
ATOM 5184  C CE   . LYS A 1 89  ? 24.403 26.128 8.635  1.00 0.00 ? 59 LYS A CE   5  
ATOM 5185  N NZ   . LYS A 1 89  ? 23.506 25.520 9.658  1.00 0.00 ? 59 LYS A NZ   5  
ATOM 5186  H H    . LYS A 1 89  ? 28.246 28.387 6.819  1.00 0.00 ? 59 LYS A H    5  
ATOM 5187  H HA   . LYS A 1 89  ? 26.592 30.554 7.529  1.00 0.00 ? 59 LYS A HA   5  
ATOM 5188  H HB2  . LYS A 1 89  ? 27.808 28.385 9.255  1.00 0.00 ? 59 LYS A HB2  5  
ATOM 5189  H HB3  . LYS A 1 89  ? 26.529 29.483 9.776  1.00 0.00 ? 59 LYS A HB3  5  
ATOM 5190  H HG2  . LYS A 1 89  ? 25.120 28.686 7.878  1.00 0.00 ? 59 LYS A HG2  5  
ATOM 5191  H HG3  . LYS A 1 89  ? 26.378 27.519 7.473  1.00 0.00 ? 59 LYS A HG3  5  
ATOM 5192  H HD2  . LYS A 1 89  ? 26.174 26.561 9.771  1.00 0.00 ? 59 LYS A HD2  5  
ATOM 5193  H HD3  . LYS A 1 89  ? 24.827 27.660 10.073 1.00 0.00 ? 59 LYS A HD3  5  
ATOM 5194  H HE2  . LYS A 1 89  ? 23.809 26.655 7.903  1.00 0.00 ? 59 LYS A HE2  5  
ATOM 5195  H HE3  . LYS A 1 89  ? 24.971 25.350 8.146  1.00 0.00 ? 59 LYS A HE3  5  
ATOM 5196  H HZ1  . LYS A 1 89  ? 23.995 25.490 10.575 1.00 0.00 ? 59 LYS A HZ1  5  
ATOM 5197  H HZ2  . LYS A 1 89  ? 23.254 24.554 9.367  1.00 0.00 ? 59 LYS A HZ2  5  
ATOM 5198  H HZ3  . LYS A 1 89  ? 22.643 26.093 9.747  1.00 0.00 ? 59 LYS A HZ3  5  
ATOM 5199  N N    . ILE A 1 90  ? 29.641 30.628 8.765  1.00 0.00 ? 60 ILE A N    5  
ATOM 5200  C CA   . ILE A 1 90  ? 30.613 31.504 9.407  1.00 0.00 ? 60 ILE A CA   5  
ATOM 5201  C C    . ILE A 1 90  ? 30.833 32.747 8.546  1.00 0.00 ? 60 ILE A C    5  
ATOM 5202  O O    . ILE A 1 90  ? 30.844 33.868 9.055  1.00 0.00 ? 60 ILE A O    5  
ATOM 5203  C CB   . ILE A 1 90  ? 31.928 30.744 9.632  1.00 0.00 ? 60 ILE A CB   5  
ATOM 5204  C CG1  . ILE A 1 90  ? 31.654 29.532 10.531 1.00 0.00 ? 60 ILE A CG1  5  
ATOM 5205  C CG2  . ILE A 1 90  ? 32.951 31.657 10.316 1.00 0.00 ? 60 ILE A CG2  5  
ATOM 5206  C CD1  . ILE A 1 90  ? 32.872 28.604 10.573 1.00 0.00 ? 60 ILE A CD1  5  
ATOM 5207  H H    . ILE A 1 90  ? 29.920 29.742 8.453  1.00 0.00 ? 60 ILE A H    5  
ATOM 5208  H HA   . ILE A 1 90  ? 30.222 31.812 10.365 1.00 0.00 ? 60 ILE A HA   5  
ATOM 5209  H HB   . ILE A 1 90  ? 32.320 30.410 8.683  1.00 0.00 ? 60 ILE A HB   5  
ATOM 5210  H HG12 . ILE A 1 90  ? 31.434 29.876 11.531 1.00 0.00 ? 60 ILE A HG12 5  
ATOM 5211  H HG13 . ILE A 1 90  ? 30.805 28.987 10.147 1.00 0.00 ? 60 ILE A HG13 5  
ATOM 5212  H HG21 . ILE A 1 90  ? 32.480 32.169 11.142 1.00 0.00 ? 60 ILE A HG21 5  
ATOM 5213  H HG22 . ILE A 1 90  ? 33.318 32.383 9.605  1.00 0.00 ? 60 ILE A HG22 5  
ATOM 5214  H HG23 . ILE A 1 90  ? 33.775 31.064 10.682 1.00 0.00 ? 60 ILE A HG23 5  
ATOM 5215  H HD11 . ILE A 1 90  ? 33.779 29.186 10.520 1.00 0.00 ? 60 ILE A HD11 5  
ATOM 5216  H HD12 . ILE A 1 90  ? 32.834 27.924 9.734  1.00 0.00 ? 60 ILE A HD12 5  
ATOM 5217  H HD13 . ILE A 1 90  ? 32.862 28.037 11.493 1.00 0.00 ? 60 ILE A HD13 5  
ATOM 5218  N N    . ALA A 1 91  ? 30.945 32.551 7.236  1.00 0.00 ? 61 ALA A N    5  
ATOM 5219  C CA   . ALA A 1 91  ? 31.140 33.675 6.326  1.00 0.00 ? 61 ALA A CA   5  
ATOM 5220  C C    . ALA A 1 91  ? 29.985 34.665 6.443  1.00 0.00 ? 61 ALA A C    5  
ATOM 5221  O O    . ALA A 1 91  ? 30.200 35.876 6.520  1.00 0.00 ? 61 ALA A O    5  
ATOM 5222  C CB   . ALA A 1 91  ? 31.240 33.169 4.886  1.00 0.00 ? 61 ALA A CB   5  
ATOM 5223  H H    . ALA A 1 91  ? 30.927 31.638 6.881  1.00 0.00 ? 61 ALA A H    5  
ATOM 5224  H HA   . ALA A 1 91  ? 32.060 34.178 6.584  1.00 0.00 ? 61 ALA A HA   5  
ATOM 5225  H HB1  . ALA A 1 91  ? 32.252 32.852 4.685  1.00 0.00 ? 61 ALA A HB1  5  
ATOM 5226  H HB2  . ALA A 1 91  ? 30.970 33.964 4.206  1.00 0.00 ? 61 ALA A HB2  5  
ATOM 5227  H HB3  . ALA A 1 91  ? 30.566 32.335 4.750  1.00 0.00 ? 61 ALA A HB3  5  
ATOM 5228  N N    . GLU A 1 92  ? 28.758 34.149 6.491  1.00 0.00 ? 62 GLU A N    5  
ATOM 5229  C CA   . GLU A 1 92  ? 27.590 35.018 6.588  1.00 0.00 ? 62 GLU A CA   5  
ATOM 5230  C C    . GLU A 1 92  ? 27.622 35.829 7.881  1.00 0.00 ? 62 GLU A C    5  
ATOM 5231  O O    . GLU A 1 92  ? 27.326 37.025 7.875  1.00 0.00 ? 62 GLU A O    5  
ATOM 5232  C CB   . GLU A 1 92  ? 26.312 34.178 6.543  1.00 0.00 ? 62 GLU A CB   5  
ATOM 5233  C CG   . GLU A 1 92  ? 25.093 35.106 6.460  1.00 0.00 ? 62 GLU A CG   5  
ATOM 5234  C CD   . GLU A 1 92  ? 23.774 34.324 6.504  1.00 0.00 ? 62 GLU A CD   5  
ATOM 5235  O OE1  . GLU A 1 92  ? 22.740 34.966 6.414  1.00 0.00 ? 62 GLU A OE1  5  
ATOM 5236  O OE2  . GLU A 1 92  ? 23.801 33.108 6.626  1.00 0.00 ? 62 GLU A OE2  5  
ATOM 5237  H H    . GLU A 1 92  ? 28.639 33.179 6.428  1.00 0.00 ? 62 GLU A H    5  
ATOM 5238  H HA   . GLU A 1 92  ? 27.589 35.698 5.749  1.00 0.00 ? 62 GLU A HA   5  
ATOM 5239  H HB2  . GLU A 1 92  ? 26.335 33.534 5.676  1.00 0.00 ? 62 GLU A HB2  5  
ATOM 5240  H HB3  . GLU A 1 92  ? 26.242 33.578 7.437  1.00 0.00 ? 62 GLU A HB3  5  
ATOM 5241  H HG2  . GLU A 1 92  ? 25.118 35.795 7.291  1.00 0.00 ? 62 GLU A HG2  5  
ATOM 5242  H HG3  . GLU A 1 92  ? 25.141 35.666 5.538  1.00 0.00 ? 62 GLU A HG3  5  
ATOM 5243  N N    . LYS A 1 93  ? 28.011 35.191 8.983  1.00 0.00 ? 63 LYS A N    5  
ATOM 5244  C CA   . LYS A 1 93  ? 28.119 35.901 10.255 1.00 0.00 ? 63 LYS A CA   5  
ATOM 5245  C C    . LYS A 1 93  ? 29.137 37.036 10.160 1.00 0.00 ? 63 LYS A C    5  
ATOM 5246  O O    . LYS A 1 93  ? 28.901 38.135 10.663 1.00 0.00 ? 63 LYS A O    5  
ATOM 5247  C CB   . LYS A 1 93  ? 28.516 34.932 11.370 1.00 0.00 ? 63 LYS A CB   5  
ATOM 5248  C CG   . LYS A 1 93  ? 27.385 33.924 11.584 1.00 0.00 ? 63 LYS A CG   5  
ATOM 5249  C CD   . LYS A 1 93  ? 27.811 32.878 12.617 1.00 0.00 ? 63 LYS A CD   5  
ATOM 5250  C CE   . LYS A 1 93  ? 27.891 33.519 14.004 1.00 0.00 ? 63 LYS A CE   5  
ATOM 5251  N NZ   . LYS A 1 93  ? 26.575 34.130 14.352 1.00 0.00 ? 63 LYS A NZ   5  
ATOM 5252  H H    . LYS A 1 93  ? 28.191 34.226 8.949  1.00 0.00 ? 63 LYS A H    5  
ATOM 5253  H HA   . LYS A 1 93  ? 27.154 36.325 10.495 1.00 0.00 ? 63 LYS A HA   5  
ATOM 5254  H HB2  . LYS A 1 93  ? 29.421 34.411 11.088 1.00 0.00 ? 63 LYS A HB2  5  
ATOM 5255  H HB3  . LYS A 1 93  ? 28.684 35.481 12.283 1.00 0.00 ? 63 LYS A HB3  5  
ATOM 5256  H HG2  . LYS A 1 93  ? 26.505 34.442 11.934 1.00 0.00 ? 63 LYS A HG2  5  
ATOM 5257  H HG3  . LYS A 1 93  ? 27.163 33.431 10.649 1.00 0.00 ? 63 LYS A HG3  5  
ATOM 5258  H HD2  . LYS A 1 93  ? 27.088 32.075 12.633 1.00 0.00 ? 63 LYS A HD2  5  
ATOM 5259  H HD3  . LYS A 1 93  ? 28.780 32.483 12.351 1.00 0.00 ? 63 LYS A HD3  5  
ATOM 5260  H HE2  . LYS A 1 93  ? 28.138 32.763 14.733 1.00 0.00 ? 63 LYS A HE2  5  
ATOM 5261  H HE3  . LYS A 1 93  ? 28.655 34.283 14.005 1.00 0.00 ? 63 LYS A HE3  5  
ATOM 5262  H HZ1  . LYS A 1 93  ? 25.808 33.499 14.045 1.00 0.00 ? 63 LYS A HZ1  5  
ATOM 5263  H HZ2  . LYS A 1 93  ? 26.483 35.048 13.873 1.00 0.00 ? 63 LYS A HZ2  5  
ATOM 5264  H HZ3  . LYS A 1 93  ? 26.518 34.267 15.381 1.00 0.00 ? 63 LYS A HZ3  5  
ATOM 5265  N N    . ILE A 1 94  ? 30.253 36.783 9.482  1.00 0.00 ? 64 ILE A N    5  
ATOM 5266  C CA   . ILE A 1 94  ? 31.256 37.824 9.272  1.00 0.00 ? 64 ILE A CA   5  
ATOM 5267  C C    . ILE A 1 94  ? 30.647 38.985 8.484  1.00 0.00 ? 64 ILE A C    5  
ATOM 5268  O O    . ILE A 1 94  ? 30.858 40.150 8.822  1.00 0.00 ? 64 ILE A O    5  
ATOM 5269  C CB   . ILE A 1 94  ? 32.464 37.229 8.529  1.00 0.00 ? 64 ILE A CB   5  
ATOM 5270  C CG1  . ILE A 1 94  ? 33.098 36.141 9.398  1.00 0.00 ? 64 ILE A CG1  5  
ATOM 5271  C CG2  . ILE A 1 94  ? 33.521 38.301 8.236  1.00 0.00 ? 64 ILE A CG2  5  
ATOM 5272  C CD1  . ILE A 1 94  ? 34.117 35.354 8.572  1.00 0.00 ? 64 ILE A CD1  5  
ATOM 5273  H H    . ILE A 1 94  ? 30.420 35.875 9.149  1.00 0.00 ? 64 ILE A H    5  
ATOM 5274  H HA   . ILE A 1 94  ? 31.584 38.189 10.235 1.00 0.00 ? 64 ILE A HA   5  
ATOM 5275  H HB   . ILE A 1 94  ? 32.131 36.792 7.598  1.00 0.00 ? 64 ILE A HB   5  
ATOM 5276  H HG12 . ILE A 1 94  ? 33.595 36.603 10.240 1.00 0.00 ? 64 ILE A HG12 5  
ATOM 5277  H HG13 . ILE A 1 94  ? 32.333 35.472 9.757  1.00 0.00 ? 64 ILE A HG13 5  
ATOM 5278  H HG21 . ILE A 1 94  ? 34.286 37.882 7.597  1.00 0.00 ? 64 ILE A HG21 5  
ATOM 5279  H HG22 . ILE A 1 94  ? 33.967 38.629 9.164  1.00 0.00 ? 64 ILE A HG22 5  
ATOM 5280  H HG23 . ILE A 1 94  ? 33.059 39.141 7.741  1.00 0.00 ? 64 ILE A HG23 5  
ATOM 5281  H HD11 . ILE A 1 94  ? 33.659 35.027 7.651  1.00 0.00 ? 64 ILE A HD11 5  
ATOM 5282  H HD12 . ILE A 1 94  ? 34.449 34.495 9.135  1.00 0.00 ? 64 ILE A HD12 5  
ATOM 5283  H HD13 . ILE A 1 94  ? 34.964 35.987 8.348  1.00 0.00 ? 64 ILE A HD13 5  
ATOM 5284  N N    . ASP A 1 95  ? 29.862 38.665 7.458  1.00 0.00 ? 65 ASP A N    5  
ATOM 5285  C CA   . ASP A 1 95  ? 29.228 39.704 6.650  1.00 0.00 ? 65 ASP A CA   5  
ATOM 5286  C C    . ASP A 1 95  ? 28.319 40.573 7.512  1.00 0.00 ? 65 ASP A C    5  
ATOM 5287  O O    . ASP A 1 95  ? 28.343 41.800 7.411  1.00 0.00 ? 65 ASP A O    5  
ATOM 5288  C CB   . ASP A 1 95  ? 28.401 39.070 5.527  1.00 0.00 ? 65 ASP A CB   5  
ATOM 5289  C CG   . ASP A 1 95  ? 29.297 38.337 4.528  1.00 0.00 ? 65 ASP A CG   5  
ATOM 5290  O OD1  . ASP A 1 95  ? 30.467 38.673 4.434  1.00 0.00 ? 65 ASP A OD1  5  
ATOM 5291  O OD2  . ASP A 1 95  ? 28.794 37.444 3.866  1.00 0.00 ? 65 ASP A OD2  5  
ATOM 5292  H H    . ASP A 1 95  ? 29.742 37.722 7.217  1.00 0.00 ? 65 ASP A H    5  
ATOM 5293  H HA   . ASP A 1 95  ? 29.995 40.325 6.212  1.00 0.00 ? 65 ASP A HA   5  
ATOM 5294  H HB2  . ASP A 1 95  ? 27.701 38.368 5.956  1.00 0.00 ? 65 ASP A HB2  5  
ATOM 5295  H HB3  . ASP A 1 95  ? 27.854 39.845 5.010  1.00 0.00 ? 65 ASP A HB3  5  
ATOM 5296  N N    . GLU A 1 96  ? 27.551 39.938 8.391  1.00 0.00 ? 66 GLU A N    5  
ATOM 5297  C CA   . GLU A 1 96  ? 26.653 40.678 9.269  1.00 0.00 ? 66 GLU A CA   5  
ATOM 5298  C C    . GLU A 1 96  ? 27.445 41.599 10.192 1.00 0.00 ? 66 GLU A C    5  
ATOM 5299  O O    . GLU A 1 96  ? 27.101 42.771 10.358 1.00 0.00 ? 66 GLU A O    5  
ATOM 5300  C CB   . GLU A 1 96  ? 25.819 39.706 10.107 1.00 0.00 ? 66 GLU A CB   5  
ATOM 5301  C CG   . GLU A 1 96  ? 24.751 40.484 10.885 1.00 0.00 ? 66 GLU A CG   5  
ATOM 5302  C CD   . GLU A 1 96  ? 23.941 39.573 11.815 1.00 0.00 ? 66 GLU A CD   5  
ATOM 5303  O OE1  . GLU A 1 96  ? 24.217 38.383 11.878 1.00 0.00 ? 66 GLU A OE1  5  
ATOM 5304  O OE2  . GLU A 1 96  ? 23.043 40.088 12.460 1.00 0.00 ? 66 GLU A OE2  5  
ATOM 5305  H H    . GLU A 1 96  ? 27.564 38.958 8.426  1.00 0.00 ? 66 GLU A H    5  
ATOM 5306  H HA   . GLU A 1 96  ? 25.986 41.276 8.665  1.00 0.00 ? 66 GLU A HA   5  
ATOM 5307  H HB2  . GLU A 1 96  ? 25.342 38.988 9.456  1.00 0.00 ? 66 GLU A HB2  5  
ATOM 5308  H HB3  . GLU A 1 96  ? 26.461 39.189 10.804 1.00 0.00 ? 66 GLU A HB3  5  
ATOM 5309  H HG2  . GLU A 1 96  ? 25.233 41.248 11.476 1.00 0.00 ? 66 GLU A HG2  5  
ATOM 5310  H HG3  . GLU A 1 96  ? 24.080 40.956 10.182 1.00 0.00 ? 66 GLU A HG3  5  
ATOM 5311  N N    . PHE A 1 97  ? 28.525 41.078 10.766 1.00 0.00 ? 67 PHE A N    5  
ATOM 5312  C CA   . PHE A 1 97  ? 29.343 41.875 11.674 1.00 0.00 ? 67 PHE A CA   5  
ATOM 5313  C C    . PHE A 1 97  ? 29.905 43.109 10.974 1.00 0.00 ? 67 PHE A C    5  
ATOM 5314  O O    . PHE A 1 97  ? 29.935 44.193 11.559 1.00 0.00 ? 67 PHE A O    5  
ATOM 5315  C CB   . PHE A 1 97  ? 30.489 41.019 12.216 1.00 0.00 ? 67 PHE A CB   5  
ATOM 5316  C CG   . PHE A 1 97  ? 31.395 41.753 13.176 1.00 0.00 ? 67 PHE A CG   5  
ATOM 5317  C CD1  . PHE A 1 97  ? 32.684 42.124 12.776 1.00 0.00 ? 67 PHE A CD1  5  
ATOM 5318  C CD2  . PHE A 1 97  ? 30.944 42.066 14.463 1.00 0.00 ? 67 PHE A CD2  5  
ATOM 5319  C CE1  . PHE A 1 97  ? 33.523 42.808 13.664 1.00 0.00 ? 67 PHE A CE1  5  
ATOM 5320  C CE2  . PHE A 1 97  ? 31.783 42.749 15.352 1.00 0.00 ? 67 PHE A CE2  5  
ATOM 5321  C CZ   . PHE A 1 97  ? 33.073 43.120 14.952 1.00 0.00 ? 67 PHE A CZ   5  
ATOM 5322  H H    . PHE A 1 97  ? 28.759 40.141 10.602 1.00 0.00 ? 67 PHE A H    5  
ATOM 5323  H HA   . PHE A 1 97  ? 28.730 42.196 12.504 1.00 0.00 ? 67 PHE A HA   5  
ATOM 5324  H HB2  . PHE A 1 97  ? 30.066 40.170 12.728 1.00 0.00 ? 67 PHE A HB2  5  
ATOM 5325  H HB3  . PHE A 1 97  ? 31.075 40.661 11.381 1.00 0.00 ? 67 PHE A HB3  5  
ATOM 5326  H HD1  . PHE A 1 97  ? 33.034 41.881 11.782 1.00 0.00 ? 67 PHE A HD1  5  
ATOM 5327  H HD2  . PHE A 1 97  ? 29.949 41.780 14.773 1.00 0.00 ? 67 PHE A HD2  5  
ATOM 5328  H HE1  . PHE A 1 97  ? 34.518 43.093 13.356 1.00 0.00 ? 67 PHE A HE1  5  
ATOM 5329  H HE2  . PHE A 1 97  ? 31.435 42.990 16.346 1.00 0.00 ? 67 PHE A HE2  5  
ATOM 5330  H HZ   . PHE A 1 97  ? 33.720 43.647 15.638 1.00 0.00 ? 67 PHE A HZ   5  
ATOM 5331  N N    . LEU A 1 98  ? 30.351 42.951 9.728  1.00 0.00 ? 68 LEU A N    5  
ATOM 5332  C CA   . LEU A 1 98  ? 30.811 44.100 8.952  1.00 0.00 ? 68 LEU A CA   5  
ATOM 5333  C C    . LEU A 1 98  ? 29.668 45.079 8.693  1.00 0.00 ? 68 LEU A C    5  
ATOM 5334  O O    . LEU A 1 98  ? 29.862 46.294 8.738  1.00 0.00 ? 68 LEU A O    5  
ATOM 5335  C CB   . LEU A 1 98  ? 31.404 43.644 7.615  1.00 0.00 ? 68 LEU A CB   5  
ATOM 5336  C CG   . LEU A 1 98  ? 32.637 42.760 7.843  1.00 0.00 ? 68 LEU A CG   5  
ATOM 5337  C CD1  . LEU A 1 98  ? 33.139 42.229 6.496  1.00 0.00 ? 68 LEU A CD1  5  
ATOM 5338  C CD2  . LEU A 1 98  ? 33.748 43.583 8.504  1.00 0.00 ? 68 LEU A CD2  5  
ATOM 5339  H H    . LEU A 1 98  ? 30.396 42.052 9.339  1.00 0.00 ? 68 LEU A H    5  
ATOM 5340  H HA   . LEU A 1 98  ? 31.574 44.613 9.517  1.00 0.00 ? 68 LEU A HA   5  
ATOM 5341  H HB2  . LEU A 1 98  ? 30.659 43.081 7.070  1.00 0.00 ? 68 LEU A HB2  5  
ATOM 5342  H HB3  . LEU A 1 98  ? 31.688 44.510 7.038  1.00 0.00 ? 68 LEU A HB3  5  
ATOM 5343  H HG   . LEU A 1 98  ? 32.372 41.931 8.481  1.00 0.00 ? 68 LEU A HG   5  
ATOM 5344  H HD11 . LEU A 1 98  ? 32.970 42.971 5.729  1.00 0.00 ? 68 LEU A HD11 5  
ATOM 5345  H HD12 . LEU A 1 98  ? 32.602 41.326 6.244  1.00 0.00 ? 68 LEU A HD12 5  
ATOM 5346  H HD13 . LEU A 1 98  ? 34.197 42.012 6.556  1.00 0.00 ? 68 LEU A HD13 5  
ATOM 5347  H HD21 . LEU A 1 98  ? 34.696 43.086 8.364  1.00 0.00 ? 68 LEU A HD21 5  
ATOM 5348  H HD22 . LEU A 1 98  ? 33.545 43.680 9.560  1.00 0.00 ? 68 LEU A HD22 5  
ATOM 5349  H HD23 . LEU A 1 98  ? 33.786 44.564 8.054  1.00 0.00 ? 68 LEU A HD23 5  
ATOM 5350  N N    . ALA A 1 99  ? 28.478 44.549 8.422  1.00 0.00 ? 69 ALA A N    5  
ATOM 5351  C CA   . ALA A 1 99  ? 27.313 45.400 8.191  1.00 0.00 ? 69 ALA A CA   5  
ATOM 5352  C C    . ALA A 1 99  ? 26.974 46.239 9.423  1.00 0.00 ? 69 ALA A C    5  
ATOM 5353  O O    . ALA A 1 99  ? 26.506 47.371 9.299  1.00 0.00 ? 69 ALA A O    5  
ATOM 5354  C CB   . ALA A 1 99  ? 26.107 44.535 7.817  1.00 0.00 ? 69 ALA A CB   5  
ATOM 5355  H H    . ALA A 1 99  ? 28.390 43.577 8.335  1.00 0.00 ? 69 ALA A H    5  
ATOM 5356  H HA   . ALA A 1 99  ? 27.526 46.064 7.368  1.00 0.00 ? 69 ALA A HA   5  
ATOM 5357  H HB1  . ALA A 1 99  ? 26.414 43.772 7.117  1.00 0.00 ? 69 ALA A HB1  5  
ATOM 5358  H HB2  . ALA A 1 99  ? 25.346 45.155 7.364  1.00 0.00 ? 69 ALA A HB2  5  
ATOM 5359  H HB3  . ALA A 1 99  ? 25.708 44.069 8.707  1.00 0.00 ? 69 ALA A HB3  5  
ATOM 5360  N N    . THR A 1 100 ? 27.208 45.683 10.608 1.00 0.00 ? 70 THR A N    5  
ATOM 5361  C CA   . THR A 1 100 ? 26.994 46.427 11.848 1.00 0.00 ? 70 THR A CA   5  
ATOM 5362  C C    . THR A 1 100 ? 28.096 47.463 12.100 1.00 0.00 ? 70 THR A C    5  
ATOM 5363  O O    . THR A 1 100 ? 27.870 48.446 12.808 1.00 0.00 ? 70 THR A O    5  
ATOM 5364  C CB   . THR A 1 100 ? 26.934 45.454 13.028 1.00 0.00 ? 70 THR A CB   5  
ATOM 5365  O OG1  . THR A 1 100 ? 25.978 44.439 12.752 1.00 0.00 ? 70 THR A OG1  5  
ATOM 5366  C CG2  . THR A 1 100 ? 26.526 46.205 14.297 1.00 0.00 ? 70 THR A CG2  5  
ATOM 5367  H H    . THR A 1 100 ? 27.484 44.744 10.651 1.00 0.00 ? 70 THR A H    5  
ATOM 5368  H HA   . THR A 1 100 ? 26.047 46.941 11.783 1.00 0.00 ? 70 THR A HA   5  
ATOM 5369  H HB   . THR A 1 100 ? 27.904 45.005 13.177 1.00 0.00 ? 70 THR A HB   5  
ATOM 5370  H HG1  . THR A 1 100 ? 26.142 43.746 13.301 1.00 0.00 ? 70 THR A HG1  5  
ATOM 5371  H HG21 . THR A 1 100 ? 25.550 46.646 14.156 1.00 0.00 ? 70 THR A HG21 5  
ATOM 5372  H HG22 . THR A 1 100 ? 27.247 46.982 14.502 1.00 0.00 ? 70 THR A HG22 5  
ATOM 5373  H HG23 . THR A 1 100 ? 26.493 45.516 15.128 1.00 0.00 ? 70 THR A HG23 5  
ATOM 5374  N N    . GLY A 1 101 ? 29.281 47.254 11.528 1.00 0.00 ? 71 GLY A N    5  
ATOM 5375  C CA   . GLY A 1 101 ? 30.385 48.189 11.710 1.00 0.00 ? 71 GLY A CA   5  
ATOM 5376  C C    . GLY A 1 101 ? 30.456 49.180 10.554 1.00 0.00 ? 71 GLY A C    5  
ATOM 5377  O O    . GLY A 1 101 ? 30.732 48.801 9.416  1.00 0.00 ? 71 GLY A O    5  
ATOM 5378  H H    . GLY A 1 101 ? 29.414 46.455 10.974 1.00 0.00 ? 71 GLY A H    5  
ATOM 5379  H HA2  . GLY A 1 101 ? 30.241 48.729 12.636 1.00 0.00 ? 71 GLY A HA2  5  
ATOM 5380  H HA3  . GLY A 1 101 ? 31.312 47.640 11.759 1.00 0.00 ? 71 GLY A HA3  5  
ATOM 5381  N N    . GLU A 1 31  ? 47.990 42.292 18.511 1.00 0.00 ? 1  GLU A N    6  
ATOM 5382  C CA   . GLU A 1 31  ? 46.562 42.221 18.221 1.00 0.00 ? 1  GLU A CA   6  
ATOM 5383  C C    . GLU A 1 31  ? 46.330 41.955 16.738 1.00 0.00 ? 1  GLU A C    6  
ATOM 5384  O O    . GLU A 1 31  ? 46.385 42.870 15.917 1.00 0.00 ? 1  GLU A O    6  
ATOM 5385  C CB   . GLU A 1 31  ? 45.884 43.534 18.617 1.00 0.00 ? 1  GLU A CB   6  
ATOM 5386  C CG   . GLU A 1 31  ? 46.030 43.753 20.126 1.00 0.00 ? 1  GLU A CG   6  
ATOM 5387  C CD   . GLU A 1 31  ? 45.294 45.015 20.592 1.00 0.00 ? 1  GLU A CD   6  
ATOM 5388  O OE1  . GLU A 1 31  ? 45.172 45.181 21.794 1.00 0.00 ? 1  GLU A OE1  6  
ATOM 5389  O OE2  . GLU A 1 31  ? 44.871 45.802 19.758 1.00 0.00 ? 1  GLU A OE2  6  
ATOM 5390  H H    . GLU A 1 31  ? 48.424 43.163 18.631 1.00 0.00 ? 1  GLU A H    6  
ATOM 5391  H HA   . GLU A 1 31  ? 46.127 41.418 18.795 1.00 0.00 ? 1  GLU A HA   6  
ATOM 5392  H HB2  . GLU A 1 31  ? 46.350 44.354 18.086 1.00 0.00 ? 1  GLU A HB2  6  
ATOM 5393  H HB3  . GLU A 1 31  ? 44.836 43.490 18.362 1.00 0.00 ? 1  GLU A HB3  6  
ATOM 5394  H HG2  . GLU A 1 31  ? 45.623 42.899 20.647 1.00 0.00 ? 1  GLU A HG2  6  
ATOM 5395  H HG3  . GLU A 1 31  ? 47.078 43.846 20.369 1.00 0.00 ? 1  GLU A HG3  6  
ATOM 5396  N N    . THR A 1 32  ? 46.070 40.695 16.401 1.00 0.00 ? 2  THR A N    6  
ATOM 5397  C CA   . THR A 1 32  ? 45.822 40.323 15.013 1.00 0.00 ? 2  THR A CA   6  
ATOM 5398  C C    . THR A 1 32  ? 44.634 41.102 14.460 1.00 0.00 ? 2  THR A C    6  
ATOM 5399  O O    . THR A 1 32  ? 43.637 41.303 15.149 1.00 0.00 ? 2  THR A O    6  
ATOM 5400  C CB   . THR A 1 32  ? 45.545 38.822 14.917 1.00 0.00 ? 2  THR A CB   6  
ATOM 5401  O OG1  . THR A 1 32  ? 46.596 38.107 15.550 1.00 0.00 ? 2  THR A OG1  6  
ATOM 5402  C CG2  . THR A 1 32  ? 45.459 38.406 13.446 1.00 0.00 ? 2  THR A CG2  6  
ATOM 5403  H H    . THR A 1 32  ? 46.043 40.006 17.097 1.00 0.00 ? 2  THR A H    6  
ATOM 5404  H HA   . THR A 1 32  ? 46.699 40.555 14.426 1.00 0.00 ? 2  THR A HA   6  
ATOM 5405  H HB   . THR A 1 32  ? 44.609 38.596 15.406 1.00 0.00 ? 2  THR A HB   6  
ATOM 5406  H HG1  . THR A 1 32  ? 46.385 38.015 16.420 1.00 0.00 ? 2  THR A HG1  6  
ATOM 5407  H HG21 . THR A 1 32  ? 44.454 38.562 13.087 1.00 0.00 ? 2  THR A HG21 6  
ATOM 5408  H HG22 . THR A 1 32  ? 45.716 37.362 13.354 1.00 0.00 ? 2  THR A HG22 6  
ATOM 5409  H HG23 . THR A 1 32  ? 46.148 38.999 12.861 1.00 0.00 ? 2  THR A HG23 6  
ATOM 5410  N N    . LEU A 1 33  ? 44.721 41.492 13.194 1.00 0.00 ? 3  LEU A N    6  
ATOM 5411  C CA   . LEU A 1 33  ? 43.689 42.334 12.593 1.00 0.00 ? 3  LEU A CA   6  
ATOM 5412  C C    . LEU A 1 33  ? 42.305 41.684 12.658 1.00 0.00 ? 3  LEU A C    6  
ATOM 5413  O O    . LEU A 1 33  ? 41.294 42.382 12.735 1.00 0.00 ? 3  LEU A O    6  
ATOM 5414  C CB   . LEU A 1 33  ? 44.044 42.610 11.132 1.00 0.00 ? 3  LEU A CB   6  
ATOM 5415  C CG   . LEU A 1 33  ? 45.404 43.307 11.051 1.00 0.00 ? 3  LEU A CG   6  
ATOM 5416  C CD1  . LEU A 1 33  ? 45.830 43.423 9.586  1.00 0.00 ? 3  LEU A CD1  6  
ATOM 5417  C CD2  . LEU A 1 33  ? 45.294 44.707 11.654 1.00 0.00 ? 3  LEU A CD2  6  
ATOM 5418  H H    . LEU A 1 33  ? 45.488 41.210 12.653 1.00 0.00 ? 3  LEU A H    6  
ATOM 5419  H HA   . LEU A 1 33  ? 43.657 43.275 13.122 1.00 0.00 ? 3  LEU A HA   6  
ATOM 5420  H HB2  . LEU A 1 33  ? 44.083 41.677 10.589 1.00 0.00 ? 3  LEU A HB2  6  
ATOM 5421  H HB3  . LEU A 1 33  ? 43.292 43.249 10.699 1.00 0.00 ? 3  LEU A HB3  6  
ATOM 5422  H HG   . LEU A 1 33  ? 46.138 42.731 11.595 1.00 0.00 ? 3  LEU A HG   6  
ATOM 5423  H HD11 . LEU A 1 33  ? 45.781 42.452 9.119  1.00 0.00 ? 3  LEU A HD11 6  
ATOM 5424  H HD12 . LEU A 1 33  ? 46.842 43.797 9.533  1.00 0.00 ? 3  LEU A HD12 6  
ATOM 5425  H HD13 . LEU A 1 33  ? 45.168 44.105 9.071  1.00 0.00 ? 3  LEU A HD13 6  
ATOM 5426  H HD21 . LEU A 1 33  ? 46.175 45.279 11.401 1.00 0.00 ? 3  LEU A HD21 6  
ATOM 5427  H HD22 . LEU A 1 33  ? 45.213 44.631 12.729 1.00 0.00 ? 3  LEU A HD22 6  
ATOM 5428  H HD23 . LEU A 1 33  ? 44.419 45.199 11.260 1.00 0.00 ? 3  LEU A HD23 6  
ATOM 5429  N N    . ASN A 1 34  ? 42.255 40.356 12.628 1.00 0.00 ? 4  ASN A N    6  
ATOM 5430  C CA   . ASN A 1 34  ? 40.979 39.641 12.700 1.00 0.00 ? 4  ASN A CA   6  
ATOM 5431  C C    . ASN A 1 34  ? 40.635 39.175 14.125 1.00 0.00 ? 4  ASN A C    6  
ATOM 5432  O O    . ASN A 1 34  ? 39.671 38.431 14.313 1.00 0.00 ? 4  ASN A O    6  
ATOM 5433  C CB   . ASN A 1 34  ? 41.016 38.426 11.768 1.00 0.00 ? 4  ASN A CB   6  
ATOM 5434  C CG   . ASN A 1 34  ? 41.359 38.855 10.342 1.00 0.00 ? 4  ASN A CG   6  
ATOM 5435  O OD1  . ASN A 1 34  ? 40.712 39.737 9.772  1.00 0.00 ? 4  ASN A OD1  6  
ATOM 5436  N ND2  . ASN A 1 34  ? 42.341 38.264 9.716  1.00 0.00 ? 4  ASN A ND2  6  
ATOM 5437  H H    . ASN A 1 34  ? 43.088 39.845 12.554 1.00 0.00 ? 4  ASN A H    6  
ATOM 5438  H HA   . ASN A 1 34  ? 40.198 40.304 12.358 1.00 0.00 ? 4  ASN A HA   6  
ATOM 5439  H HB2  . ASN A 1 34  ? 41.763 37.730 12.119 1.00 0.00 ? 4  ASN A HB2  6  
ATOM 5440  H HB3  . ASN A 1 34  ? 40.050 37.945 11.771 1.00 0.00 ? 4  ASN A HB3  6  
ATOM 5441  H HD21 . ASN A 1 34  ? 42.844 37.548 10.157 1.00 0.00 ? 4  ASN A HD21 6  
ATOM 5442  H HD22 . ASN A 1 34  ? 42.585 38.549 8.810  1.00 0.00 ? 4  ASN A HD22 6  
ATOM 5443  N N    . GLY A 1 35  ? 41.398 39.604 15.132 1.00 0.00 ? 5  GLY A N    6  
ATOM 5444  C CA   . GLY A 1 35  ? 41.228 39.088 16.486 1.00 0.00 ? 5  GLY A CA   6  
ATOM 5445  C C    . GLY A 1 35  ? 39.788 39.222 16.967 1.00 0.00 ? 5  GLY A C    6  
ATOM 5446  O O    . GLY A 1 35  ? 39.263 38.318 17.621 1.00 0.00 ? 5  GLY A O    6  
ATOM 5447  H H    . GLY A 1 35  ? 42.080 40.286 14.965 1.00 0.00 ? 5  GLY A H    6  
ATOM 5448  H HA2  . GLY A 1 35  ? 41.510 38.045 16.502 1.00 0.00 ? 5  GLY A HA2  6  
ATOM 5449  H HA3  . GLY A 1 35  ? 41.873 39.637 17.155 1.00 0.00 ? 5  GLY A HA3  6  
ATOM 5450  N N    . ALA A 1 36  ? 39.139 40.333 16.623 1.00 0.00 ? 6  ALA A N    6  
ATOM 5451  C CA   . ALA A 1 36  ? 37.768 40.556 17.069 1.00 0.00 ? 6  ALA A CA   6  
ATOM 5452  C C    . ALA A 1 36  ? 36.863 39.445 16.548 1.00 0.00 ? 6  ALA A C    6  
ATOM 5453  O O    . ALA A 1 36  ? 36.093 38.847 17.306 1.00 0.00 ? 6  ALA A O    6  
ATOM 5454  C CB   . ALA A 1 36  ? 37.265 41.909 16.563 1.00 0.00 ? 6  ALA A CB   6  
ATOM 5455  H H    . ALA A 1 36  ? 39.585 41.004 16.066 1.00 0.00 ? 6  ALA A H    6  
ATOM 5456  H HA   . ALA A 1 36  ? 37.744 40.553 18.149 1.00 0.00 ? 6  ALA A HA   6  
ATOM 5457  H HB1  . ALA A 1 36  ? 38.065 42.633 16.613 1.00 0.00 ? 6  ALA A HB1  6  
ATOM 5458  H HB2  . ALA A 1 36  ? 36.441 42.239 17.178 1.00 0.00 ? 6  ALA A HB2  6  
ATOM 5459  H HB3  . ALA A 1 36  ? 36.932 41.810 15.540 1.00 0.00 ? 6  ALA A HB3  6  
ATOM 5460  N N    . LEU A 1 37  ? 36.989 39.138 15.260 1.00 0.00 ? 7  LEU A N    6  
ATOM 5461  C CA   . LEU A 1 37  ? 36.211 38.050 14.677 1.00 0.00 ? 7  LEU A CA   6  
ATOM 5462  C C    . LEU A 1 37  ? 36.559 36.719 15.339 1.00 0.00 ? 7  LEU A C    6  
ATOM 5463  O O    . LEU A 1 37  ? 35.678 35.897 15.583 1.00 0.00 ? 7  LEU A O    6  
ATOM 5464  C CB   . LEU A 1 37  ? 36.479 37.964 13.173 1.00 0.00 ? 7  LEU A CB   6  
ATOM 5465  C CG   . LEU A 1 37  ? 36.026 39.258 12.494 1.00 0.00 ? 7  LEU A CG   6  
ATOM 5466  C CD1  . LEU A 1 37  ? 36.469 39.251 11.029 1.00 0.00 ? 7  LEU A CD1  6  
ATOM 5467  C CD2  . LEU A 1 37  ? 34.500 39.356 12.556 1.00 0.00 ? 7  LEU A CD2  6  
ATOM 5468  H H    . LEU A 1 37  ? 37.609 39.646 14.697 1.00 0.00 ? 7  LEU A H    6  
ATOM 5469  H HA   . LEU A 1 37  ? 35.161 38.251 14.834 1.00 0.00 ? 7  LEU A HA   6  
ATOM 5470  H HB2  . LEU A 1 37  ? 37.537 37.819 13.006 1.00 0.00 ? 7  LEU A HB2  6  
ATOM 5471  H HB3  . LEU A 1 37  ? 35.931 37.131 12.758 1.00 0.00 ? 7  LEU A HB3  6  
ATOM 5472  H HG   . LEU A 1 37  ? 36.464 40.105 13.000 1.00 0.00 ? 7  LEU A HG   6  
ATOM 5473  H HD11 . LEU A 1 37  ? 35.885 39.972 10.475 1.00 0.00 ? 7  LEU A HD11 6  
ATOM 5474  H HD12 . LEU A 1 37  ? 36.318 38.267 10.611 1.00 0.00 ? 7  LEU A HD12 6  
ATOM 5475  H HD13 . LEU A 1 37  ? 37.515 39.513 10.968 1.00 0.00 ? 7  LEU A HD13 6  
ATOM 5476  H HD21 . LEU A 1 37  ? 34.148 40.003 11.766 1.00 0.00 ? 7  LEU A HD21 6  
ATOM 5477  H HD22 . LEU A 1 37  ? 34.203 39.762 13.512 1.00 0.00 ? 7  LEU A HD22 6  
ATOM 5478  H HD23 . LEU A 1 37  ? 34.071 38.373 12.434 1.00 0.00 ? 7  LEU A HD23 6  
ATOM 5479  N N    . VAL A 1 38  ? 37.831 36.533 15.689 1.00 0.00 ? 8  VAL A N    6  
ATOM 5480  C CA   . VAL A 1 38  ? 38.252 35.291 16.330 1.00 0.00 ? 8  VAL A CA   6  
ATOM 5481  C C    . VAL A 1 38  ? 37.499 35.109 17.647 1.00 0.00 ? 8  VAL A C    6  
ATOM 5482  O O    . VAL A 1 38  ? 36.992 34.023 17.937 1.00 0.00 ? 8  VAL A O    6  
ATOM 5483  C CB   . VAL A 1 38  ? 39.769 35.328 16.577 1.00 0.00 ? 8  VAL A CB   6  
ATOM 5484  C CG1  . VAL A 1 38  ? 40.248 34.043 17.266 1.00 0.00 ? 8  VAL A CG1  6  
ATOM 5485  C CG2  . VAL A 1 38  ? 40.504 35.465 15.240 1.00 0.00 ? 8  VAL A CG2  6  
ATOM 5486  H H    . VAL A 1 38  ? 38.495 37.222 15.478 1.00 0.00 ? 8  VAL A H    6  
ATOM 5487  H HA   . VAL A 1 38  ? 38.023 34.462 15.677 1.00 0.00 ? 8  VAL A HA   6  
ATOM 5488  H HB   . VAL A 1 38  ? 40.007 36.176 17.203 1.00 0.00 ? 8  VAL A HB   6  
ATOM 5489  H HG11 . VAL A 1 38  ? 40.191 33.220 16.570 1.00 0.00 ? 8  VAL A HG11 6  
ATOM 5490  H HG12 . VAL A 1 38  ? 39.625 33.834 18.124 1.00 0.00 ? 8  VAL A HG12 6  
ATOM 5491  H HG13 . VAL A 1 38  ? 41.269 34.170 17.587 1.00 0.00 ? 8  VAL A HG13 6  
ATOM 5492  H HG21 . VAL A 1 38  ? 41.508 35.819 15.416 1.00 0.00 ? 8  VAL A HG21 6  
ATOM 5493  H HG22 . VAL A 1 38  ? 39.982 36.167 14.607 1.00 0.00 ? 8  VAL A HG22 6  
ATOM 5494  H HG23 . VAL A 1 38  ? 40.544 34.502 14.752 1.00 0.00 ? 8  VAL A HG23 6  
ATOM 5495  N N    . ASN A 1 39  ? 37.377 36.187 18.416 1.00 0.00 ? 9  ASN A N    6  
ATOM 5496  C CA   . ASN A 1 39  ? 36.648 36.121 19.679 1.00 0.00 ? 9  ASN A CA   6  
ATOM 5497  C C    . ASN A 1 39  ? 35.187 35.754 19.438 1.00 0.00 ? 9  ASN A C    6  
ATOM 5498  O O    . ASN A 1 39  ? 34.621 34.916 20.143 1.00 0.00 ? 9  ASN A O    6  
ATOM 5499  C CB   . ASN A 1 39  ? 36.724 37.470 20.398 1.00 0.00 ? 9  ASN A CB   6  
ATOM 5500  C CG   . ASN A 1 39  ? 38.168 37.785 20.780 1.00 0.00 ? 9  ASN A CG   6  
ATOM 5501  O OD1  . ASN A 1 39  ? 38.995 36.881 20.904 1.00 0.00 ? 9  ASN A OD1  6  
ATOM 5502  N ND2  . ASN A 1 39  ? 38.523 39.025 20.974 1.00 0.00 ? 9  ASN A ND2  6  
ATOM 5503  H H    . ASN A 1 39  ? 37.808 37.025 18.147 1.00 0.00 ? 9  ASN A H    6  
ATOM 5504  H HA   . ASN A 1 39  ? 37.100 35.368 20.305 1.00 0.00 ? 9  ASN A HA   6  
ATOM 5505  H HB2  . ASN A 1 39  ? 36.350 38.245 19.745 1.00 0.00 ? 9  ASN A HB2  6  
ATOM 5506  H HB3  . ASN A 1 39  ? 36.120 37.433 21.292 1.00 0.00 ? 9  ASN A HB3  6  
ATOM 5507  H HD21 . ASN A 1 39  ? 37.865 39.745 20.875 1.00 0.00 ? 9  ASN A HD21 6  
ATOM 5508  H HD22 . ASN A 1 39  ? 39.449 39.238 21.221 1.00 0.00 ? 9  ASN A HD22 6  
ATOM 5509  N N    . MET A 1 40  ? 34.589 36.356 18.412 1.00 0.00 ? 10 MET A N    6  
ATOM 5510  C CA   . MET A 1 40  ? 33.197 36.063 18.090 1.00 0.00 ? 10 MET A CA   6  
ATOM 5511  C C    . MET A 1 40  ? 33.017 34.585 17.745 1.00 0.00 ? 10 MET A C    6  
ATOM 5512  O O    . MET A 1 40  ? 32.033 33.961 18.152 1.00 0.00 ? 10 MET A O    6  
ATOM 5513  C CB   . MET A 1 40  ? 32.758 36.936 16.913 1.00 0.00 ? 10 MET A CB   6  
ATOM 5514  C CG   . MET A 1 40  ? 31.271 36.718 16.618 1.00 0.00 ? 10 MET A CG   6  
ATOM 5515  S SD   . MET A 1 40  ? 30.796 37.711 15.180 1.00 0.00 ? 10 MET A SD   6  
ATOM 5516  C CE   . MET A 1 40  ? 31.686 36.756 13.926 1.00 0.00 ? 10 MET A CE   6  
ATOM 5517  H H    . MET A 1 40  ? 35.077 37.034 17.895 1.00 0.00 ? 10 MET A H    6  
ATOM 5518  H HA   . MET A 1 40  ? 32.582 36.299 18.946 1.00 0.00 ? 10 MET A HA   6  
ATOM 5519  H HB2  . MET A 1 40  ? 32.927 37.975 17.156 1.00 0.00 ? 10 MET A HB2  6  
ATOM 5520  H HB3  . MET A 1 40  ? 33.336 36.675 16.039 1.00 0.00 ? 10 MET A HB3  6  
ATOM 5521  H HG2  . MET A 1 40  ? 31.094 35.674 16.409 1.00 0.00 ? 10 MET A HG2  6  
ATOM 5522  H HG3  . MET A 1 40  ? 30.687 37.021 17.474 1.00 0.00 ? 10 MET A HG3  6  
ATOM 5523  H HE1  . MET A 1 40  ? 32.749 36.917 14.038 1.00 0.00 ? 10 MET A HE1  6  
ATOM 5524  H HE2  . MET A 1 40  ? 31.379 37.076 12.942 1.00 0.00 ? 10 MET A HE2  6  
ATOM 5525  H HE3  . MET A 1 40  ? 31.460 35.706 14.047 1.00 0.00 ? 10 MET A HE3  6  
ATOM 5526  N N    . LEU A 1 41  ? 33.989 34.012 17.036 1.00 0.00 ? 11 LEU A N    6  
ATOM 5527  C CA   . LEU A 1 41  ? 33.942 32.585 16.730 1.00 0.00 ? 11 LEU A CA   6  
ATOM 5528  C C    . LEU A 1 41  ? 33.988 31.755 18.007 1.00 0.00 ? 11 LEU A C    6  
ATOM 5529  O O    . LEU A 1 41  ? 33.255 30.773 18.136 1.00 0.00 ? 11 LEU A O    6  
ATOM 5530  C CB   . LEU A 1 41  ? 35.111 32.195 15.824 1.00 0.00 ? 11 LEU A CB   6  
ATOM 5531  C CG   . LEU A 1 41  ? 34.985 32.913 14.479 1.00 0.00 ? 11 LEU A CG   6  
ATOM 5532  C CD1  . LEU A 1 41  ? 36.252 32.679 13.657 1.00 0.00 ? 11 LEU A CD1  6  
ATOM 5533  C CD2  . LEU A 1 41  ? 33.783 32.364 13.709 1.00 0.00 ? 11 LEU A CD2  6  
ATOM 5534  H H    . LEU A 1 41  ? 34.723 34.560 16.688 1.00 0.00 ? 11 LEU A H    6  
ATOM 5535  H HA   . LEU A 1 41  ? 33.018 32.373 16.215 1.00 0.00 ? 11 LEU A HA   6  
ATOM 5536  H HB2  . LEU A 1 41  ? 36.041 32.477 16.297 1.00 0.00 ? 11 LEU A HB2  6  
ATOM 5537  H HB3  . LEU A 1 41  ? 35.099 31.128 15.662 1.00 0.00 ? 11 LEU A HB3  6  
ATOM 5538  H HG   . LEU A 1 41  ? 34.854 33.970 14.645 1.00 0.00 ? 11 LEU A HG   6  
ATOM 5539  H HD11 . LEU A 1 41  ? 37.026 33.354 13.989 1.00 0.00 ? 11 LEU A HD11 6  
ATOM 5540  H HD12 . LEU A 1 41  ? 36.042 32.857 12.612 1.00 0.00 ? 11 LEU A HD12 6  
ATOM 5541  H HD13 . LEU A 1 41  ? 36.583 31.659 13.788 1.00 0.00 ? 11 LEU A HD13 6  
ATOM 5542  H HD21 . LEU A 1 41  ? 32.870 32.733 14.153 1.00 0.00 ? 11 LEU A HD21 6  
ATOM 5543  H HD22 . LEU A 1 41  ? 33.792 31.285 13.745 1.00 0.00 ? 11 LEU A HD22 6  
ATOM 5544  H HD23 . LEU A 1 41  ? 33.842 32.693 12.684 1.00 0.00 ? 11 LEU A HD23 6  
ATOM 5545  N N    . LYS A 1 42  ? 34.825 32.160 18.958 1.00 0.00 ? 12 LYS A N    6  
ATOM 5546  C CA   . LYS A 1 42  ? 34.908 31.441 20.226 1.00 0.00 ? 12 LYS A CA   6  
ATOM 5547  C C    . LYS A 1 42  ? 33.557 31.430 20.933 1.00 0.00 ? 12 LYS A C    6  
ATOM 5548  O O    . LYS A 1 42  ? 33.156 30.410 21.498 1.00 0.00 ? 12 LYS A O    6  
ATOM 5549  C CB   . LYS A 1 42  ? 35.954 32.089 21.136 1.00 0.00 ? 12 LYS A CB   6  
ATOM 5550  C CG   . LYS A 1 42  ? 37.345 31.928 20.519 1.00 0.00 ? 12 LYS A CG   6  
ATOM 5551  C CD   . LYS A 1 42  ? 38.396 32.488 21.479 1.00 0.00 ? 12 LYS A CD   6  
ATOM 5552  C CE   . LYS A 1 42  ? 39.774 32.439 20.815 1.00 0.00 ? 12 LYS A CE   6  
ATOM 5553  N NZ   . LYS A 1 42  ? 40.832 32.525 21.861 1.00 0.00 ? 12 LYS A NZ   6  
ATOM 5554  H H    . LYS A 1 42  ? 35.423 32.920 18.787 1.00 0.00 ? 12 LYS A H    6  
ATOM 5555  H HA   . LYS A 1 42  ? 35.206 30.423 20.028 1.00 0.00 ? 12 LYS A HA   6  
ATOM 5556  H HB2  . LYS A 1 42  ? 35.730 33.140 21.249 1.00 0.00 ? 12 LYS A HB2  6  
ATOM 5557  H HB3  . LYS A 1 42  ? 35.936 31.610 22.103 1.00 0.00 ? 12 LYS A HB3  6  
ATOM 5558  H HG2  . LYS A 1 42  ? 37.540 30.880 20.342 1.00 0.00 ? 12 LYS A HG2  6  
ATOM 5559  H HG3  . LYS A 1 42  ? 37.391 32.466 19.585 1.00 0.00 ? 12 LYS A HG3  6  
ATOM 5560  H HD2  . LYS A 1 42  ? 38.149 33.512 21.723 1.00 0.00 ? 12 LYS A HD2  6  
ATOM 5561  H HD3  . LYS A 1 42  ? 38.413 31.896 22.381 1.00 0.00 ? 12 LYS A HD3  6  
ATOM 5562  H HE2  . LYS A 1 42  ? 39.878 31.512 20.273 1.00 0.00 ? 12 LYS A HE2  6  
ATOM 5563  H HE3  . LYS A 1 42  ? 39.875 33.270 20.132 1.00 0.00 ? 12 LYS A HE3  6  
ATOM 5564  H HZ1  . LYS A 1 42  ? 40.450 32.192 22.770 1.00 0.00 ? 12 LYS A HZ1  6  
ATOM 5565  H HZ2  . LYS A 1 42  ? 41.144 33.513 21.958 1.00 0.00 ? 12 LYS A HZ2  6  
ATOM 5566  H HZ3  . LYS A 1 42  ? 41.639 31.931 21.589 1.00 0.00 ? 12 LYS A HZ3  6  
ATOM 5567  N N    . GLU A 1 43  ? 32.838 32.549 20.868 1.00 0.00 ? 13 GLU A N    6  
ATOM 5568  C CA   . GLU A 1 43  ? 31.517 32.616 21.486 1.00 0.00 ? 13 GLU A CA   6  
ATOM 5569  C C    . GLU A 1 43  ? 30.560 31.629 20.826 1.00 0.00 ? 13 GLU A C    6  
ATOM 5570  O O    . GLU A 1 43  ? 29.837 30.899 21.510 1.00 0.00 ? 13 GLU A O    6  
ATOM 5571  C CB   . GLU A 1 43  ? 30.954 34.034 21.363 1.00 0.00 ? 13 GLU A CB   6  
ATOM 5572  C CG   . GLU A 1 43  ? 29.654 34.139 22.170 1.00 0.00 ? 13 GLU A CG   6  
ATOM 5573  C CD   . GLU A 1 43  ? 28.992 35.513 22.012 1.00 0.00 ? 13 GLU A CD   6  
ATOM 5574  O OE1  . GLU A 1 43  ? 27.963 35.713 22.637 1.00 0.00 ? 13 GLU A OE1  6  
ATOM 5575  O OE2  . GLU A 1 43  ? 29.503 36.344 21.276 1.00 0.00 ? 13 GLU A OE2  6  
ATOM 5576  H H    . GLU A 1 43  ? 33.221 33.347 20.441 1.00 0.00 ? 13 GLU A H    6  
ATOM 5577  H HA   . GLU A 1 43  ? 31.609 32.367 22.533 1.00 0.00 ? 13 GLU A HA   6  
ATOM 5578  H HB2  . GLU A 1 43  ? 31.675 34.740 21.745 1.00 0.00 ? 13 GLU A HB2  6  
ATOM 5579  H HB3  . GLU A 1 43  ? 30.748 34.252 20.326 1.00 0.00 ? 13 GLU A HB3  6  
ATOM 5580  H HG2  . GLU A 1 43  ? 28.967 33.378 21.830 1.00 0.00 ? 13 GLU A HG2  6  
ATOM 5581  H HG3  . GLU A 1 43  ? 29.875 33.971 23.214 1.00 0.00 ? 13 GLU A HG3  6  
ATOM 5582  N N    . GLU A 1 44  ? 30.593 31.566 19.496 1.00 0.00 ? 14 GLU A N    6  
ATOM 5583  C CA   . GLU A 1 44  ? 29.765 30.599 18.779 1.00 0.00 ? 14 GLU A CA   6  
ATOM 5584  C C    . GLU A 1 44  ? 30.152 29.171 19.139 1.00 0.00 ? 14 GLU A C    6  
ATOM 5585  O O    . GLU A 1 44  ? 29.289 28.304 19.290 1.00 0.00 ? 14 GLU A O    6  
ATOM 5586  C CB   . GLU A 1 44  ? 29.891 30.804 17.269 1.00 0.00 ? 14 GLU A CB   6  
ATOM 5587  C CG   . GLU A 1 44  ? 29.305 32.169 16.890 1.00 0.00 ? 14 GLU A CG   6  
ATOM 5588  C CD   . GLU A 1 44  ? 29.316 32.390 15.375 1.00 0.00 ? 14 GLU A CD   6  
ATOM 5589  O OE1  . GLU A 1 44  ? 28.671 33.328 14.941 1.00 0.00 ? 14 GLU A OE1  6  
ATOM 5590  O OE2  . GLU A 1 44  ? 29.969 31.637 14.666 1.00 0.00 ? 14 GLU A OE2  6  
ATOM 5591  H H    . GLU A 1 44  ? 31.153 32.198 18.993 1.00 0.00 ? 14 GLU A H    6  
ATOM 5592  H HA   . GLU A 1 44  ? 28.734 30.757 19.061 1.00 0.00 ? 14 GLU A HA   6  
ATOM 5593  H HB2  . GLU A 1 44  ? 30.933 30.766 16.986 1.00 0.00 ? 14 GLU A HB2  6  
ATOM 5594  H HB3  . GLU A 1 44  ? 29.348 30.027 16.752 1.00 0.00 ? 14 GLU A HB3  6  
ATOM 5595  H HG2  . GLU A 1 44  ? 28.287 32.225 17.245 1.00 0.00 ? 14 GLU A HG2  6  
ATOM 5596  H HG3  . GLU A 1 44  ? 29.886 32.945 17.365 1.00 0.00 ? 14 GLU A HG3  6  
ATOM 5597  N N    . GLY A 1 45  ? 31.450 28.929 19.304 1.00 0.00 ? 15 GLY A N    6  
ATOM 5598  C CA   . GLY A 1 45  ? 31.920 27.601 19.677 1.00 0.00 ? 15 GLY A CA   6  
ATOM 5599  C C    . GLY A 1 45  ? 31.324 27.169 21.010 1.00 0.00 ? 15 GLY A C    6  
ATOM 5600  O O    . GLY A 1 45  ? 30.828 26.048 21.143 1.00 0.00 ? 15 GLY A O    6  
ATOM 5601  H H    . GLY A 1 45  ? 32.099 29.643 19.143 1.00 0.00 ? 15 GLY A H    6  
ATOM 5602  H HA2  . GLY A 1 45  ? 31.631 26.898 18.911 1.00 0.00 ? 15 GLY A HA2  6  
ATOM 5603  H HA3  . GLY A 1 45  ? 32.996 27.615 19.761 1.00 0.00 ? 15 GLY A HA3  6  
ATOM 5604  N N    . ASN A 1 46  ? 31.341 28.072 21.987 1.00 0.00 ? 16 ASN A N    6  
ATOM 5605  C CA   . ASN A 1 46  ? 30.767 27.764 23.291 1.00 0.00 ? 16 ASN A CA   6  
ATOM 5606  C C    . ASN A 1 46  ? 29.275 27.467 23.170 1.00 0.00 ? 16 ASN A C    6  
ATOM 5607  O O    . ASN A 1 46  ? 28.766 26.549 23.816 1.00 0.00 ? 16 ASN A O    6  
ATOM 5608  C CB   . ASN A 1 46  ? 30.979 28.939 24.247 1.00 0.00 ? 16 ASN A CB   6  
ATOM 5609  C CG   . ASN A 1 46  ? 32.469 29.149 24.508 1.00 0.00 ? 16 ASN A CG   6  
ATOM 5610  O OD1  . ASN A 1 46  ? 33.272 28.231 24.330 1.00 0.00 ? 16 ASN A OD1  6  
ATOM 5611  N ND2  . ASN A 1 46  ? 32.889 30.312 24.925 1.00 0.00 ? 16 ASN A ND2  6  
ATOM 5612  H H    . ASN A 1 46  ? 31.770 28.940 21.837 1.00 0.00 ? 16 ASN A H    6  
ATOM 5613  H HA   . ASN A 1 46  ? 31.264 26.894 23.695 1.00 0.00 ? 16 ASN A HA   6  
ATOM 5614  H HB2  . ASN A 1 46  ? 30.564 29.835 23.808 1.00 0.00 ? 16 ASN A HB2  6  
ATOM 5615  H HB3  . ASN A 1 46  ? 30.479 28.735 25.182 1.00 0.00 ? 16 ASN A HB3  6  
ATOM 5616  H HD21 . ASN A 1 46  ? 32.251 31.042 25.067 1.00 0.00 ? 16 ASN A HD21 6  
ATOM 5617  H HD22 . ASN A 1 46  ? 33.844 30.456 25.095 1.00 0.00 ? 16 ASN A HD22 6  
ATOM 5618  N N    . LYS A 1 47  ? 28.581 28.214 22.313 1.00 0.00 ? 17 LYS A N    6  
ATOM 5619  C CA   . LYS A 1 47  ? 27.157 27.972 22.103 1.00 0.00 ? 17 LYS A CA   6  
ATOM 5620  C C    . LYS A 1 47  ? 26.924 26.568 21.549 1.00 0.00 ? 17 LYS A C    6  
ATOM 5621  O O    . LYS A 1 47  ? 26.055 25.836 22.033 1.00 0.00 ? 17 LYS A O    6  
ATOM 5622  C CB   . LYS A 1 47  ? 26.593 29.013 21.132 1.00 0.00 ? 17 LYS A CB   6  
ATOM 5623  C CG   . LYS A 1 47  ? 25.072 28.859 21.017 1.00 0.00 ? 17 LYS A CG   6  
ATOM 5624  C CD   . LYS A 1 47  ? 24.398 29.413 22.274 1.00 0.00 ? 17 LYS A CD   6  
ATOM 5625  C CE   . LYS A 1 47  ? 22.878 29.342 22.111 1.00 0.00 ? 17 LYS A CE   6  
ATOM 5626  N NZ   . LYS A 1 47  ? 22.224 30.126 23.197 1.00 0.00 ? 17 LYS A NZ   6  
ATOM 5627  H H    . LYS A 1 47  ? 29.020 28.962 21.855 1.00 0.00 ? 17 LYS A H    6  
ATOM 5628  H HA   . LYS A 1 47  ? 26.644 28.063 23.049 1.00 0.00 ? 17 LYS A HA   6  
ATOM 5629  H HB2  . LYS A 1 47  ? 26.825 30.002 21.494 1.00 0.00 ? 17 LYS A HB2  6  
ATOM 5630  H HB3  . LYS A 1 47  ? 27.039 28.871 20.159 1.00 0.00 ? 17 LYS A HB3  6  
ATOM 5631  H HG2  . LYS A 1 47  ? 24.724 29.403 20.153 1.00 0.00 ? 17 LYS A HG2  6  
ATOM 5632  H HG3  . LYS A 1 47  ? 24.820 27.815 20.908 1.00 0.00 ? 17 LYS A HG3  6  
ATOM 5633  H HD2  . LYS A 1 47  ? 24.696 28.829 23.132 1.00 0.00 ? 17 LYS A HD2  6  
ATOM 5634  H HD3  . LYS A 1 47  ? 24.693 30.442 22.417 1.00 0.00 ? 17 LYS A HD3  6  
ATOM 5635  H HE2  . LYS A 1 47  ? 22.599 29.754 21.152 1.00 0.00 ? 17 LYS A HE2  6  
ATOM 5636  H HE3  . LYS A 1 47  ? 22.558 28.312 22.168 1.00 0.00 ? 17 LYS A HE3  6  
ATOM 5637  H HZ1  . LYS A 1 47  ? 22.569 29.794 24.120 1.00 0.00 ? 17 LYS A HZ1  6  
ATOM 5638  H HZ2  . LYS A 1 47  ? 21.193 29.998 23.143 1.00 0.00 ? 17 LYS A HZ2  6  
ATOM 5639  H HZ3  . LYS A 1 47  ? 22.456 31.133 23.086 1.00 0.00 ? 17 LYS A HZ3  6  
ATOM 5640  N N    . ALA A 1 48  ? 27.734 26.171 20.567 1.00 0.00 ? 18 ALA A N    6  
ATOM 5641  C CA   . ALA A 1 48  ? 27.593 24.839 19.993 1.00 0.00 ? 18 ALA A CA   6  
ATOM 5642  C C    . ALA A 1 48  ? 27.824 23.778 21.064 1.00 0.00 ? 18 ALA A C    6  
ATOM 5643  O O    . ALA A 1 48  ? 27.114 22.775 21.111 1.00 0.00 ? 18 ALA A O    6  
ATOM 5644  C CB   . ALA A 1 48  ? 28.578 24.647 18.837 1.00 0.00 ? 18 ALA A CB   6  
ATOM 5645  H H    . ALA A 1 48  ? 28.412 26.786 20.214 1.00 0.00 ? 18 ALA A H    6  
ATOM 5646  H HA   . ALA A 1 48  ? 26.589 24.732 19.610 1.00 0.00 ? 18 ALA A HA   6  
ATOM 5647  H HB1  . ALA A 1 48  ? 28.129 24.012 18.086 1.00 0.00 ? 18 ALA A HB1  6  
ATOM 5648  H HB2  . ALA A 1 48  ? 29.484 24.187 19.203 1.00 0.00 ? 18 ALA A HB2  6  
ATOM 5649  H HB3  . ALA A 1 48  ? 28.812 25.607 18.402 1.00 0.00 ? 18 ALA A HB3  6  
ATOM 5650  N N    . LEU A 1 49  ? 28.821 23.997 21.920 1.00 0.00 ? 19 LEU A N    6  
ATOM 5651  C CA   . LEU A 1 49  ? 29.075 23.072 23.018 1.00 0.00 ? 19 LEU A CA   6  
ATOM 5652  C C    . LEU A 1 49  ? 27.871 22.984 23.954 1.00 0.00 ? 19 LEU A C    6  
ATOM 5653  O O    . LEU A 1 49  ? 27.468 21.890 24.348 1.00 0.00 ? 19 LEU A O    6  
ATOM 5654  C CB   . LEU A 1 49  ? 30.305 23.532 23.807 1.00 0.00 ? 19 LEU A CB   6  
ATOM 5655  C CG   . LEU A 1 49  ? 30.665 22.483 24.862 1.00 0.00 ? 19 LEU A CG   6  
ATOM 5656  C CD1  . LEU A 1 49  ? 31.221 21.235 24.174 1.00 0.00 ? 19 LEU A CD1  6  
ATOM 5657  C CD2  . LEU A 1 49  ? 31.723 23.056 25.807 1.00 0.00 ? 19 LEU A CD2  6  
ATOM 5658  H H    . LEU A 1 49  ? 29.409 24.771 21.791 1.00 0.00 ? 19 LEU A H    6  
ATOM 5659  H HA   . LEU A 1 49  ? 29.272 22.092 22.610 1.00 0.00 ? 19 LEU A HA   6  
ATOM 5660  H HB2  . LEU A 1 49  ? 31.136 23.662 23.130 1.00 0.00 ? 19 LEU A HB2  6  
ATOM 5661  H HB3  . LEU A 1 49  ? 30.087 24.469 24.295 1.00 0.00 ? 19 LEU A HB3  6  
ATOM 5662  H HG   . LEU A 1 49  ? 29.781 22.220 25.426 1.00 0.00 ? 19 LEU A HG   6  
ATOM 5663  H HD11 . LEU A 1 49  ? 31.834 21.530 23.336 1.00 0.00 ? 19 LEU A HD11 6  
ATOM 5664  H HD12 . LEU A 1 49  ? 30.403 20.622 23.823 1.00 0.00 ? 19 LEU A HD12 6  
ATOM 5665  H HD13 . LEU A 1 49  ? 31.817 20.672 24.876 1.00 0.00 ? 19 LEU A HD13 6  
ATOM 5666  H HD21 . LEU A 1 49  ? 32.694 22.997 25.337 1.00 0.00 ? 19 LEU A HD21 6  
ATOM 5667  H HD22 . LEU A 1 49  ? 31.732 22.488 26.725 1.00 0.00 ? 19 LEU A HD22 6  
ATOM 5668  H HD23 . LEU A 1 49  ? 31.489 24.088 26.024 1.00 0.00 ? 19 LEU A HD23 6  
ATOM 5669  N N    . SER A 1 50  ? 27.241 24.123 24.232 1.00 0.00 ? 20 SER A N    6  
ATOM 5670  C CA   . SER A 1 50  ? 26.103 24.143 25.149 1.00 0.00 ? 20 SER A CA   6  
ATOM 5671  C C    . SER A 1 50  ? 24.957 23.268 24.643 1.00 0.00 ? 20 SER A C    6  
ATOM 5672  O O    . SER A 1 50  ? 24.245 22.652 25.437 1.00 0.00 ? 20 SER A O    6  
ATOM 5673  C CB   . SER A 1 50  ? 25.603 25.576 25.346 1.00 0.00 ? 20 SER A CB   6  
ATOM 5674  O OG   . SER A 1 50  ? 24.842 25.969 24.213 1.00 0.00 ? 20 SER A OG   6  
ATOM 5675  H H    . SER A 1 50  ? 27.571 24.964 23.853 1.00 0.00 ? 20 SER A H    6  
ATOM 5676  H HA   . SER A 1 50  ? 26.427 23.761 26.106 1.00 0.00 ? 20 SER A HA   6  
ATOM 5677  H HB2  . SER A 1 50  ? 24.979 25.626 26.223 1.00 0.00 ? 20 SER A HB2  6  
ATOM 5678  H HB3  . SER A 1 50  ? 26.452 26.233 25.475 1.00 0.00 ? 20 SER A HB3  6  
ATOM 5679  H HG   . SER A 1 50  ? 24.041 25.565 24.262 1.00 0.00 ? 20 SER A HG   6  
ATOM 5680  N N    . VAL A 1 51  ? 24.780 23.215 23.326 1.00 0.00 ? 21 VAL A N    6  
ATOM 5681  C CA   . VAL A 1 51  ? 23.735 22.371 22.744 1.00 0.00 ? 21 VAL A CA   6  
ATOM 5682  C C    . VAL A 1 51  ? 24.189 20.928 22.482 1.00 0.00 ? 21 VAL A C    6  
ATOM 5683  O O    . VAL A 1 51  ? 23.408 20.129 21.963 1.00 0.00 ? 21 VAL A O    6  
ATOM 5684  C CB   . VAL A 1 51  ? 23.233 22.990 21.438 1.00 0.00 ? 21 VAL A CB   6  
ATOM 5685  C CG1  . VAL A 1 51  ? 22.687 24.393 21.715 1.00 0.00 ? 21 VAL A CG1  6  
ATOM 5686  C CG2  . VAL A 1 51  ? 24.386 23.087 20.437 1.00 0.00 ? 21 VAL A CG2  6  
ATOM 5687  H H    . VAL A 1 51  ? 25.317 23.799 22.745 1.00 0.00 ? 21 VAL A H    6  
ATOM 5688  H HA   . VAL A 1 51  ? 22.906 22.340 23.435 1.00 0.00 ? 21 VAL A HA   6  
ATOM 5689  H HB   . VAL A 1 51  ? 22.448 22.374 21.027 1.00 0.00 ? 21 VAL A HB   6  
ATOM 5690  H HG11 . VAL A 1 51  ? 22.448 24.878 20.780 1.00 0.00 ? 21 VAL A HG11 6  
ATOM 5691  H HG12 . VAL A 1 51  ? 23.432 24.971 22.241 1.00 0.00 ? 21 VAL A HG12 6  
ATOM 5692  H HG13 . VAL A 1 51  ? 21.796 24.319 22.322 1.00 0.00 ? 21 VAL A HG13 6  
ATOM 5693  H HG21 . VAL A 1 51  ? 25.091 23.832 20.774 1.00 0.00 ? 21 VAL A HG21 6  
ATOM 5694  H HG22 . VAL A 1 51  ? 23.999 23.368 19.469 1.00 0.00 ? 21 VAL A HG22 6  
ATOM 5695  H HG23 . VAL A 1 51  ? 24.882 22.130 20.364 1.00 0.00 ? 21 VAL A HG23 6  
ATOM 5696  N N    . GLY A 1 52  ? 25.430 20.579 22.829 1.00 0.00 ? 22 GLY A N    6  
ATOM 5697  C CA   . GLY A 1 52  ? 25.936 19.228 22.578 1.00 0.00 ? 22 GLY A CA   6  
ATOM 5698  C C    . GLY A 1 52  ? 26.546 19.060 21.178 1.00 0.00 ? 22 GLY A C    6  
ATOM 5699  O O    . GLY A 1 52  ? 26.821 17.935 20.758 1.00 0.00 ? 22 GLY A O    6  
ATOM 5700  H H    . GLY A 1 52  ? 26.006 21.225 23.287 1.00 0.00 ? 22 GLY A H    6  
ATOM 5701  H HA2  . GLY A 1 52  ? 26.693 18.999 23.313 1.00 0.00 ? 22 GLY A HA2  6  
ATOM 5702  H HA3  . GLY A 1 52  ? 25.121 18.528 22.688 1.00 0.00 ? 22 GLY A HA3  6  
ATOM 5703  N N    . ASN A 1 53  ? 26.758 20.159 20.456 1.00 0.00 ? 23 ASN A N    6  
ATOM 5704  C CA   . ASN A 1 53  ? 27.303 20.092 19.105 1.00 0.00 ? 23 ASN A CA   6  
ATOM 5705  C C    . ASN A 1 53  ? 28.816 20.314 19.124 1.00 0.00 ? 23 ASN A C    6  
ATOM 5706  O O    . ASN A 1 53  ? 29.325 21.332 18.645 1.00 0.00 ? 23 ASN A O    6  
ATOM 5707  C CB   . ASN A 1 53  ? 26.614 21.150 18.238 1.00 0.00 ? 23 ASN A CB   6  
ATOM 5708  C CG   . ASN A 1 53  ? 26.906 20.894 16.766 1.00 0.00 ? 23 ASN A CG   6  
ATOM 5709  O OD1  . ASN A 1 53  ? 27.953 20.344 16.425 1.00 0.00 ? 23 ASN A OD1  6  
ATOM 5710  N ND2  . ASN A 1 53  ? 26.038 21.272 15.868 1.00 0.00 ? 23 ASN A ND2  6  
ATOM 5711  H H    . ASN A 1 53  ? 26.558 21.033 20.846 1.00 0.00 ? 23 ASN A H    6  
ATOM 5712  H HA   . ASN A 1 53  ? 27.097 19.117 18.692 1.00 0.00 ? 23 ASN A HA   6  
ATOM 5713  H HB2  . ASN A 1 53  ? 25.548 21.110 18.405 1.00 0.00 ? 23 ASN A HB2  6  
ATOM 5714  H HB3  . ASN A 1 53  ? 26.982 22.128 18.510 1.00 0.00 ? 23 ASN A HB3  6  
ATOM 5715  H HD21 . ASN A 1 53  ? 25.211 21.718 16.147 1.00 0.00 ? 23 ASN A HD21 6  
ATOM 5716  H HD22 . ASN A 1 53  ? 26.212 21.109 14.917 1.00 0.00 ? 23 ASN A HD22 6  
ATOM 5717  N N    . ILE A 1 54  ? 29.541 19.335 19.655 1.00 0.00 ? 24 ILE A N    6  
ATOM 5718  C CA   . ILE A 1 54  ? 30.985 19.474 19.810 1.00 0.00 ? 24 ILE A CA   6  
ATOM 5719  C C    . ILE A 1 54  ? 31.665 19.622 18.449 1.00 0.00 ? 24 ILE A C    6  
ATOM 5720  O O    . ILE A 1 54  ? 32.621 20.389 18.315 1.00 0.00 ? 24 ILE A O    6  
ATOM 5721  C CB   . ILE A 1 54  ? 31.552 18.253 20.551 1.00 0.00 ? 24 ILE A CB   6  
ATOM 5722  C CG1  . ILE A 1 54  ? 30.857 18.105 21.908 1.00 0.00 ? 24 ILE A CG1  6  
ATOM 5723  C CG2  . ILE A 1 54  ? 33.057 18.429 20.786 1.00 0.00 ? 24 ILE A CG2  6  
ATOM 5724  C CD1  . ILE A 1 54  ? 31.286 16.792 22.566 1.00 0.00 ? 24 ILE A CD1  6  
ATOM 5725  H H    . ILE A 1 54  ? 29.099 18.509 19.946 1.00 0.00 ? 24 ILE A H    6  
ATOM 5726  H HA   . ILE A 1 54  ? 31.187 20.358 20.398 1.00 0.00 ? 24 ILE A HA   6  
ATOM 5727  H HB   . ILE A 1 54  ? 31.383 17.365 19.960 1.00 0.00 ? 24 ILE A HB   6  
ATOM 5728  H HG12 . ILE A 1 54  ? 31.132 18.934 22.544 1.00 0.00 ? 24 ILE A HG12 6  
ATOM 5729  H HG13 . ILE A 1 54  ? 29.786 18.099 21.765 1.00 0.00 ? 24 ILE A HG13 6  
ATOM 5730  H HG21 . ILE A 1 54  ? 33.221 19.249 21.468 1.00 0.00 ? 24 ILE A HG21 6  
ATOM 5731  H HG22 . ILE A 1 54  ? 33.546 18.640 19.846 1.00 0.00 ? 24 ILE A HG22 6  
ATOM 5732  H HG23 . ILE A 1 54  ? 33.464 17.522 21.207 1.00 0.00 ? 24 ILE A HG23 6  
ATOM 5733  H HD11 . ILE A 1 54  ? 30.644 16.584 23.410 1.00 0.00 ? 24 ILE A HD11 6  
ATOM 5734  H HD12 . ILE A 1 54  ? 32.309 16.874 22.904 1.00 0.00 ? 24 ILE A HD12 6  
ATOM 5735  H HD13 . ILE A 1 54  ? 31.208 15.987 21.849 1.00 0.00 ? 24 ILE A HD13 6  
ATOM 5736  N N    . ASP A 1 55  ? 31.157 18.925 17.433 1.00 0.00 ? 25 ASP A N    6  
ATOM 5737  C CA   . ASP A 1 55  ? 31.774 18.981 16.112 1.00 0.00 ? 25 ASP A CA   6  
ATOM 5738  C C    . ASP A 1 55  ? 31.763 20.407 15.569 1.00 0.00 ? 25 ASP A C    6  
ATOM 5739  O O    . ASP A 1 55  ? 32.790 20.919 15.118 1.00 0.00 ? 25 ASP A O    6  
ATOM 5740  C CB   . ASP A 1 55  ? 31.023 18.062 15.145 1.00 0.00 ? 25 ASP A CB   6  
ATOM 5741  C CG   . ASP A 1 55  ? 31.149 16.602 15.578 1.00 0.00 ? 25 ASP A CG   6  
ATOM 5742  O OD1  . ASP A 1 55  ? 32.146 16.261 16.194 1.00 0.00 ? 25 ASP A OD1  6  
ATOM 5743  O OD2  . ASP A 1 55  ? 30.239 15.842 15.285 1.00 0.00 ? 25 ASP A OD2  6  
ATOM 5744  H H    . ASP A 1 55  ? 30.363 18.370 17.576 1.00 0.00 ? 25 ASP A H    6  
ATOM 5745  H HA   . ASP A 1 55  ? 32.798 18.643 16.189 1.00 0.00 ? 25 ASP A HA   6  
ATOM 5746  H HB2  . ASP A 1 55  ? 29.979 18.340 15.129 1.00 0.00 ? 25 ASP A HB2  6  
ATOM 5747  H HB3  . ASP A 1 55  ? 31.436 18.175 14.153 1.00 0.00 ? 25 ASP A HB3  6  
ATOM 5748  N N    . ASP A 1 56  ? 30.612 21.067 15.665 1.00 0.00 ? 26 ASP A N    6  
ATOM 5749  C CA   . ASP A 1 56  ? 30.498 22.439 15.187 1.00 0.00 ? 26 ASP A CA   6  
ATOM 5750  C C    . ASP A 1 56  ? 31.404 23.369 15.983 1.00 0.00 ? 26 ASP A C    6  
ATOM 5751  O O    . ASP A 1 56  ? 32.054 24.245 15.412 1.00 0.00 ? 26 ASP A O    6  
ATOM 5752  C CB   . ASP A 1 56  ? 29.046 22.921 15.282 1.00 0.00 ? 26 ASP A CB   6  
ATOM 5753  C CG   . ASP A 1 56  ? 28.168 22.266 14.214 1.00 0.00 ? 26 ASP A CG   6  
ATOM 5754  O OD1  . ASP A 1 56  ? 28.571 21.263 13.645 1.00 0.00 ? 26 ASP A OD1  6  
ATOM 5755  O OD2  . ASP A 1 56  ? 27.092 22.789 13.972 1.00 0.00 ? 26 ASP A OD2  6  
ATOM 5756  H H    . ASP A 1 56  ? 29.827 20.623 16.048 1.00 0.00 ? 26 ASP A H    6  
ATOM 5757  H HA   . ASP A 1 56  ? 30.802 22.468 14.150 1.00 0.00 ? 26 ASP A HA   6  
ATOM 5758  H HB2  . ASP A 1 56  ? 28.656 22.675 16.259 1.00 0.00 ? 26 ASP A HB2  6  
ATOM 5759  H HB3  . ASP A 1 56  ? 29.020 23.993 15.153 1.00 0.00 ? 26 ASP A HB3  6  
ATOM 5760  N N    . ALA A 1 57  ? 31.484 23.147 17.294 1.00 0.00 ? 27 ALA A N    6  
ATOM 5761  C CA   . ALA A 1 57  ? 32.321 23.996 18.135 1.00 0.00 ? 27 ALA A CA   6  
ATOM 5762  C C    . ALA A 1 57  ? 33.778 23.916 17.686 1.00 0.00 ? 27 ALA A C    6  
ATOM 5763  O O    . ALA A 1 57  ? 34.436 24.943 17.500 1.00 0.00 ? 27 ALA A O    6  
ATOM 5764  C CB   . ALA A 1 57  ? 32.207 23.555 19.597 1.00 0.00 ? 27 ALA A CB   6  
ATOM 5765  H H    . ALA A 1 57  ? 30.943 22.436 17.703 1.00 0.00 ? 27 ALA A H    6  
ATOM 5766  H HA   . ALA A 1 57  ? 31.979 25.017 18.052 1.00 0.00 ? 27 ALA A HA   6  
ATOM 5767  H HB1  . ALA A 1 57  ? 31.390 24.078 20.069 1.00 0.00 ? 27 ALA A HB1  6  
ATOM 5768  H HB2  . ALA A 1 57  ? 33.125 23.780 20.121 1.00 0.00 ? 27 ALA A HB2  6  
ATOM 5769  H HB3  . ALA A 1 57  ? 32.023 22.491 19.638 1.00 0.00 ? 27 ALA A HB3  6  
ATOM 5770  N N    . LEU A 1 58  ? 34.270 22.697 17.471 1.00 0.00 ? 28 LEU A N    6  
ATOM 5771  C CA   . LEU A 1 58  ? 35.642 22.521 17.008 1.00 0.00 ? 28 LEU A CA   6  
ATOM 5772  C C    . LEU A 1 58  ? 35.851 23.205 15.660 1.00 0.00 ? 28 LEU A C    6  
ATOM 5773  O O    . LEU A 1 58  ? 36.886 23.835 15.434 1.00 0.00 ? 28 LEU A O    6  
ATOM 5774  C CB   . LEU A 1 58  ? 35.967 21.031 16.878 1.00 0.00 ? 28 LEU A CB   6  
ATOM 5775  C CG   . LEU A 1 58  ? 35.855 20.352 18.246 1.00 0.00 ? 28 LEU A CG   6  
ATOM 5776  C CD1  . LEU A 1 58  ? 36.016 18.840 18.079 1.00 0.00 ? 28 LEU A CD1  6  
ATOM 5777  C CD2  . LEU A 1 58  ? 36.957 20.875 19.171 1.00 0.00 ? 28 LEU A CD2  6  
ATOM 5778  H H    . LEU A 1 58  ? 33.711 21.911 17.643 1.00 0.00 ? 28 LEU A H    6  
ATOM 5779  H HA   . LEU A 1 58  ? 36.313 22.963 17.728 1.00 0.00 ? 28 LEU A HA   6  
ATOM 5780  H HB2  . LEU A 1 58  ? 35.273 20.570 16.191 1.00 0.00 ? 28 LEU A HB2  6  
ATOM 5781  H HB3  . LEU A 1 58  ? 36.973 20.914 16.506 1.00 0.00 ? 28 LEU A HB3  6  
ATOM 5782  H HG   . LEU A 1 58  ? 34.889 20.567 18.676 1.00 0.00 ? 28 LEU A HG   6  
ATOM 5783  H HD11 . LEU A 1 58  ? 36.970 18.628 17.620 1.00 0.00 ? 28 LEU A HD11 6  
ATOM 5784  H HD12 . LEU A 1 58  ? 35.224 18.461 17.452 1.00 0.00 ? 28 LEU A HD12 6  
ATOM 5785  H HD13 . LEU A 1 58  ? 35.969 18.363 19.047 1.00 0.00 ? 28 LEU A HD13 6  
ATOM 5786  H HD21 . LEU A 1 58  ? 37.133 20.161 19.962 1.00 0.00 ? 28 LEU A HD21 6  
ATOM 5787  H HD22 . LEU A 1 58  ? 36.651 21.818 19.598 1.00 0.00 ? 28 LEU A HD22 6  
ATOM 5788  H HD23 . LEU A 1 58  ? 37.866 21.015 18.604 1.00 0.00 ? 28 LEU A HD23 6  
ATOM 5789  N N    . GLN A 1 59  ? 34.854 23.116 14.781 1.00 0.00 ? 29 GLN A N    6  
ATOM 5790  C CA   . GLN A 1 59  ? 34.969 23.740 13.466 1.00 0.00 ? 29 GLN A CA   6  
ATOM 5791  C C    . GLN A 1 59  ? 35.147 25.251 13.588 1.00 0.00 ? 29 GLN A C    6  
ATOM 5792  O O    . GLN A 1 59  ? 36.023 25.831 12.941 1.00 0.00 ? 29 GLN A O    6  
ATOM 5793  C CB   . GLN A 1 59  ? 33.720 23.437 12.638 1.00 0.00 ? 29 GLN A CB   6  
ATOM 5794  C CG   . GLN A 1 59  ? 33.915 23.946 11.208 1.00 0.00 ? 29 GLN A CG   6  
ATOM 5795  C CD   . GLN A 1 59  ? 32.617 23.805 10.421 1.00 0.00 ? 29 GLN A CD   6  
ATOM 5796  O OE1  . GLN A 1 59  ? 31.584 24.340 10.824 1.00 0.00 ? 29 GLN A OE1  6  
ATOM 5797  N NE2  . GLN A 1 59  ? 32.608 23.110 9.316  1.00 0.00 ? 29 GLN A NE2  6  
ATOM 5798  H H    . GLN A 1 59  ? 34.057 22.588 15.000 1.00 0.00 ? 29 GLN A H    6  
ATOM 5799  H HA   . GLN A 1 59  ? 35.829 23.328 12.959 1.00 0.00 ? 29 GLN A HA   6  
ATOM 5800  H HB2  . GLN A 1 59  ? 33.549 22.371 12.621 1.00 0.00 ? 29 GLN A HB2  6  
ATOM 5801  H HB3  . GLN A 1 59  ? 32.866 23.931 13.078 1.00 0.00 ? 29 GLN A HB3  6  
ATOM 5802  H HG2  . GLN A 1 59  ? 34.208 24.986 11.235 1.00 0.00 ? 29 GLN A HG2  6  
ATOM 5803  H HG3  . GLN A 1 59  ? 34.689 23.369 10.725 1.00 0.00 ? 29 GLN A HG3  6  
ATOM 5804  H HE21 . GLN A 1 59  ? 33.430 22.685 8.997  1.00 0.00 ? 29 GLN A HE21 6  
ATOM 5805  H HE22 . GLN A 1 59  ? 31.777 23.014 8.805  1.00 0.00 ? 29 GLN A HE22 6  
ATOM 5806  N N    . TYR A 1 60  ? 34.345 25.885 14.443 1.00 0.00 ? 30 TYR A N    6  
ATOM 5807  C CA   . TYR A 1 60  ? 34.474 27.323 14.652 1.00 0.00 ? 30 TYR A CA   6  
ATOM 5808  C C    . TYR A 1 60  ? 35.859 27.676 15.181 1.00 0.00 ? 30 TYR A C    6  
ATOM 5809  O O    . TYR A 1 60  ? 36.479 28.633 14.715 1.00 0.00 ? 30 TYR A O    6  
ATOM 5810  C CB   . TYR A 1 60  ? 33.419 27.812 15.645 1.00 0.00 ? 30 TYR A CB   6  
ATOM 5811  C CG   . TYR A 1 60  ? 32.003 27.738 15.121 1.00 0.00 ? 30 TYR A CG   6  
ATOM 5812  C CD1  . TYR A 1 60  ? 31.078 26.878 15.723 1.00 0.00 ? 30 TYR A CD1  6  
ATOM 5813  C CD2  . TYR A 1 60  ? 31.619 28.532 14.035 1.00 0.00 ? 30 TYR A CD2  6  
ATOM 5814  C CE1  . TYR A 1 60  ? 29.766 26.813 15.238 1.00 0.00 ? 30 TYR A CE1  6  
ATOM 5815  C CE2  . TYR A 1 60  ? 30.307 28.466 13.549 1.00 0.00 ? 30 TYR A CE2  6  
ATOM 5816  C CZ   . TYR A 1 60  ? 29.381 27.606 14.152 1.00 0.00 ? 30 TYR A CZ   6  
ATOM 5817  O OH   . TYR A 1 60  ? 28.088 27.541 13.673 1.00 0.00 ? 30 TYR A OH   6  
ATOM 5818  H H    . TYR A 1 60  ? 33.637 25.387 14.902 1.00 0.00 ? 30 TYR A H    6  
ATOM 5819  H HA   . TYR A 1 60  ? 34.321 27.826 13.710 1.00 0.00 ? 30 TYR A HA   6  
ATOM 5820  H HB2  . TYR A 1 60  ? 33.481 27.211 16.540 1.00 0.00 ? 30 TYR A HB2  6  
ATOM 5821  H HB3  . TYR A 1 60  ? 33.644 28.838 15.906 1.00 0.00 ? 30 TYR A HB3  6  
ATOM 5822  H HD1  . TYR A 1 60  ? 31.375 26.266 16.561 1.00 0.00 ? 30 TYR A HD1  6  
ATOM 5823  H HD2  . TYR A 1 60  ? 32.334 29.195 13.570 1.00 0.00 ? 30 TYR A HD2  6  
ATOM 5824  H HE1  . TYR A 1 60  ? 29.051 26.150 15.702 1.00 0.00 ? 30 TYR A HE1  6  
ATOM 5825  H HE2  . TYR A 1 60  ? 30.010 29.079 12.711 1.00 0.00 ? 30 TYR A HE2  6  
ATOM 5826  H HH   . TYR A 1 60  ? 27.656 28.284 13.938 1.00 0.00 ? 30 TYR A HH   6  
ATOM 5827  N N    . TYR A 1 61  ? 36.360 26.882 16.127 1.00 0.00 ? 31 TYR A N    6  
ATOM 5828  C CA   . TYR A 1 61  ? 37.678 27.149 16.691 1.00 0.00 ? 31 TYR A CA   6  
ATOM 5829  C C    . TYR A 1 61  ? 38.763 27.060 15.622 1.00 0.00 ? 31 TYR A C    6  
ATOM 5830  O O    . TYR A 1 61  ? 39.666 27.897 15.576 1.00 0.00 ? 31 TYR A O    6  
ATOM 5831  C CB   . TYR A 1 61  ? 37.980 26.157 17.815 1.00 0.00 ? 31 TYR A CB   6  
ATOM 5832  C CG   . TYR A 1 61  ? 37.046 26.283 18.998 1.00 0.00 ? 31 TYR A CG   6  
ATOM 5833  C CD1  . TYR A 1 61  ? 36.724 27.547 19.505 1.00 0.00 ? 31 TYR A CD1  6  
ATOM 5834  C CD2  . TYR A 1 61  ? 36.505 25.134 19.587 1.00 0.00 ? 31 TYR A CD2  6  
ATOM 5835  C CE1  . TYR A 1 61  ? 35.861 27.663 20.601 1.00 0.00 ? 31 TYR A CE1  6  
ATOM 5836  C CE2  . TYR A 1 61  ? 35.642 25.251 20.684 1.00 0.00 ? 31 TYR A CE2  6  
ATOM 5837  C CZ   . TYR A 1 61  ? 35.320 26.515 21.190 1.00 0.00 ? 31 TYR A CZ   6  
ATOM 5838  O OH   . TYR A 1 61  ? 34.468 26.630 22.270 1.00 0.00 ? 31 TYR A OH   6  
ATOM 5839  H H    . TYR A 1 61  ? 35.824 26.135 16.470 1.00 0.00 ? 31 TYR A H    6  
ATOM 5840  H HA   . TYR A 1 61  ? 37.682 28.147 17.104 1.00 0.00 ? 31 TYR A HA   6  
ATOM 5841  H HB2  . TYR A 1 61  ? 37.901 25.155 17.424 1.00 0.00 ? 31 TYR A HB2  6  
ATOM 5842  H HB3  . TYR A 1 61  ? 38.995 26.315 18.150 1.00 0.00 ? 31 TYR A HB3  6  
ATOM 5843  H HD1  . TYR A 1 61  ? 37.141 28.434 19.050 1.00 0.00 ? 31 TYR A HD1  6  
ATOM 5844  H HD2  . TYR A 1 61  ? 36.754 24.159 19.198 1.00 0.00 ? 31 TYR A HD2  6  
ATOM 5845  H HE1  . TYR A 1 61  ? 35.613 28.639 20.992 1.00 0.00 ? 31 TYR A HE1  6  
ATOM 5846  H HE2  . TYR A 1 61  ? 35.224 24.364 21.138 1.00 0.00 ? 31 TYR A HE2  6  
ATOM 5847  H HH   . TYR A 1 61  ? 33.838 25.991 22.197 1.00 0.00 ? 31 TYR A HH   6  
ATOM 5848  N N    . ALA A 1 62  ? 38.637 26.086 14.723 1.00 0.00 ? 32 ALA A N    6  
ATOM 5849  C CA   . ALA A 1 62  ? 39.621 25.929 13.656 1.00 0.00 ? 32 ALA A CA   6  
ATOM 5850  C C    . ALA A 1 62  ? 39.619 27.148 12.741 1.00 0.00 ? 32 ALA A C    6  
ATOM 5851  O O    . ALA A 1 62  ? 40.676 27.684 12.400 1.00 0.00 ? 32 ALA A O    6  
ATOM 5852  C CB   . ALA A 1 62  ? 39.310 24.673 12.839 1.00 0.00 ? 32 ALA A CB   6  
ATOM 5853  H H    . ALA A 1 62  ? 37.899 25.445 14.800 1.00 0.00 ? 32 ALA A H    6  
ATOM 5854  H HA   . ALA A 1 62  ? 40.602 25.825 14.097 1.00 0.00 ? 32 ALA A HA   6  
ATOM 5855  H HB1  . ALA A 1 62  ? 38.587 24.911 12.075 1.00 0.00 ? 32 ALA A HB1  6  
ATOM 5856  H HB2  . ALA A 1 62  ? 38.908 23.910 13.490 1.00 0.00 ? 32 ALA A HB2  6  
ATOM 5857  H HB3  . ALA A 1 62  ? 40.218 24.311 12.377 1.00 0.00 ? 32 ALA A HB3  6  
ATOM 5858  N N    . ALA A 1 63  ? 38.425 27.614 12.387 1.00 0.00 ? 33 ALA A N    6  
ATOM 5859  C CA   . ALA A 1 63  ? 38.312 28.786 11.527 1.00 0.00 ? 33 ALA A CA   6  
ATOM 5860  C C    . ALA A 1 63  ? 38.909 30.014 12.206 1.00 0.00 ? 33 ALA A C    6  
ATOM 5861  O O    . ALA A 1 63  ? 39.599 30.810 11.566 1.00 0.00 ? 33 ALA A O    6  
ATOM 5862  C CB   . ALA A 1 63  ? 36.843 29.048 11.194 1.00 0.00 ? 33 ALA A CB   6  
ATOM 5863  H H    . ALA A 1 63  ? 37.613 27.148 12.681 1.00 0.00 ? 33 ALA A H    6  
ATOM 5864  H HA   . ALA A 1 63  ? 38.848 28.598 10.609 1.00 0.00 ? 33 ALA A HA   6  
ATOM 5865  H HB1  . ALA A 1 63  ? 36.398 29.647 11.974 1.00 0.00 ? 33 ALA A HB1  6  
ATOM 5866  H HB2  . ALA A 1 63  ? 36.317 28.108 11.117 1.00 0.00 ? 33 ALA A HB2  6  
ATOM 5867  H HB3  . ALA A 1 63  ? 36.775 29.576 10.254 1.00 0.00 ? 33 ALA A HB3  6  
ATOM 5868  N N    . ALA A 1 64  ? 38.681 30.146 13.510 1.00 0.00 ? 34 ALA A N    6  
ATOM 5869  C CA   . ALA A 1 64  ? 39.200 31.295 14.243 1.00 0.00 ? 34 ALA A CA   6  
ATOM 5870  C C    . ALA A 1 64  ? 40.727 31.335 14.200 1.00 0.00 ? 34 ALA A C    6  
ATOM 5871  O O    . ALA A 1 64  ? 41.318 32.383 13.926 1.00 0.00 ? 34 ALA A O    6  
ATOM 5872  C CB   . ALA A 1 64  ? 38.706 31.244 15.694 1.00 0.00 ? 34 ALA A CB   6  
ATOM 5873  H H    . ALA A 1 64  ? 38.128 29.484 13.975 1.00 0.00 ? 34 ALA A H    6  
ATOM 5874  H HA   . ALA A 1 64  ? 38.823 32.197 13.784 1.00 0.00 ? 34 ALA A HA   6  
ATOM 5875  H HB1  . ALA A 1 64  ? 39.486 30.867 16.342 1.00 0.00 ? 34 ALA A HB1  6  
ATOM 5876  H HB2  . ALA A 1 64  ? 37.846 30.594 15.757 1.00 0.00 ? 34 ALA A HB2  6  
ATOM 5877  H HB3  . ALA A 1 64  ? 38.424 32.237 16.013 1.00 0.00 ? 34 ALA A HB3  6  
ATOM 5878  N N    . ILE A 1 65  ? 41.363 30.185 14.421 1.00 0.00 ? 35 ILE A N    6  
ATOM 5879  C CA   . ILE A 1 65  ? 42.820 30.128 14.371 1.00 0.00 ? 35 ILE A CA   6  
ATOM 5880  C C    . ILE A 1 65  ? 43.318 30.512 12.979 1.00 0.00 ? 35 ILE A C    6  
ATOM 5881  O O    . ILE A 1 65  ? 44.286 31.262 12.848 1.00 0.00 ? 35 ILE A O    6  
ATOM 5882  C CB   . ILE A 1 65  ? 43.303 28.721 14.748 1.00 0.00 ? 35 ILE A CB   6  
ATOM 5883  C CG1  . ILE A 1 65  ? 42.819 28.386 16.159 1.00 0.00 ? 35 ILE A CG1  6  
ATOM 5884  C CG2  . ILE A 1 65  ? 44.835 28.657 14.727 1.00 0.00 ? 35 ILE A CG2  6  
ATOM 5885  C CD1  . ILE A 1 65  ? 43.087 26.909 16.455 1.00 0.00 ? 35 ILE A CD1  6  
ATOM 5886  H H    . ILE A 1 65  ? 40.850 29.380 14.648 1.00 0.00 ? 35 ILE A H    6  
ATOM 5887  H HA   . ILE A 1 65  ? 43.218 30.834 15.086 1.00 0.00 ? 35 ILE A HA   6  
ATOM 5888  H HB   . ILE A 1 65  ? 42.902 28.003 14.049 1.00 0.00 ? 35 ILE A HB   6  
ATOM 5889  H HG12 . ILE A 1 65  ? 43.349 28.998 16.875 1.00 0.00 ? 35 ILE A HG12 6  
ATOM 5890  H HG13 . ILE A 1 65  ? 41.761 28.580 16.236 1.00 0.00 ? 35 ILE A HG13 6  
ATOM 5891  H HG21 . ILE A 1 65  ? 45.157 27.660 14.988 1.00 0.00 ? 35 ILE A HG21 6  
ATOM 5892  H HG22 . ILE A 1 65  ? 45.234 29.362 15.440 1.00 0.00 ? 35 ILE A HG22 6  
ATOM 5893  H HG23 . ILE A 1 65  ? 45.192 28.904 13.738 1.00 0.00 ? 35 ILE A HG23 6  
ATOM 5894  H HD11 . ILE A 1 65  ? 44.152 26.742 16.518 1.00 0.00 ? 35 ILE A HD11 6  
ATOM 5895  H HD12 . ILE A 1 65  ? 42.672 26.302 15.664 1.00 0.00 ? 35 ILE A HD12 6  
ATOM 5896  H HD13 . ILE A 1 65  ? 42.625 26.641 17.394 1.00 0.00 ? 35 ILE A HD13 6  
ATOM 5897  N N    . THR A 1 66  ? 42.641 30.020 11.941 1.00 0.00 ? 36 THR A N    6  
ATOM 5898  C CA   . THR A 1 66  ? 43.038 30.354 10.576 1.00 0.00 ? 36 THR A CA   6  
ATOM 5899  C C    . THR A 1 66  ? 42.947 31.860 10.334 1.00 0.00 ? 36 THR A C    6  
ATOM 5900  O O    . THR A 1 66  ? 43.852 32.460 9.749  1.00 0.00 ? 36 THR A O    6  
ATOM 5901  C CB   . THR A 1 66  ? 42.145 29.623 9.573  1.00 0.00 ? 36 THR A CB   6  
ATOM 5902  O OG1  . THR A 1 66  ? 42.069 28.246 9.918  1.00 0.00 ? 36 THR A OG1  6  
ATOM 5903  C CG2  . THR A 1 66  ? 42.743 29.764 8.174  1.00 0.00 ? 36 THR A CG2  6  
ATOM 5904  H H    . THR A 1 66  ? 41.894 29.400 12.093 1.00 0.00 ? 36 THR A H    6  
ATOM 5905  H HA   . THR A 1 66  ? 44.059 30.038 10.425 1.00 0.00 ? 36 THR A HA   6  
ATOM 5906  H HB   . THR A 1 66  ? 41.156 30.054 9.584  1.00 0.00 ? 36 THR A HB   6  
ATOM 5907  H HG1  . THR A 1 66  ? 41.567 27.831 9.295  1.00 0.00 ? 36 THR A HG1  6  
ATOM 5908  H HG21 . THR A 1 66  ? 42.250 29.079 7.500  1.00 0.00 ? 36 THR A HG21 6  
ATOM 5909  H HG22 . THR A 1 66  ? 43.799 29.538 8.208  1.00 0.00 ? 36 THR A HG22 6  
ATOM 5910  H HG23 . THR A 1 66  ? 42.602 30.776 7.824  1.00 0.00 ? 36 THR A HG23 6  
ATOM 5911  N N    . LEU A 1 67  ? 41.875 32.480 10.827 1.00 0.00 ? 37 LEU A N    6  
ATOM 5912  C CA   . LEU A 1 67  ? 41.714 33.923 10.674 1.00 0.00 ? 37 LEU A CA   6  
ATOM 5913  C C    . LEU A 1 67  ? 42.858 34.681 11.338 1.00 0.00 ? 37 LEU A C    6  
ATOM 5914  O O    . LEU A 1 67  ? 43.279 35.729 10.846 1.00 0.00 ? 37 LEU A O    6  
ATOM 5915  C CB   . LEU A 1 67  ? 40.383 34.375 11.279 1.00 0.00 ? 37 LEU A CB   6  
ATOM 5916  C CG   . LEU A 1 67  ? 39.220 33.801 10.464 1.00 0.00 ? 37 LEU A CG   6  
ATOM 5917  C CD1  . LEU A 1 67  ? 37.906 34.053 11.206 1.00 0.00 ? 37 LEU A CD1  6  
ATOM 5918  C CD2  . LEU A 1 67  ? 39.168 34.487 9.097  1.00 0.00 ? 37 LEU A CD2  6  
ATOM 5919  H H    . LEU A 1 67  ? 41.175 31.958 11.267 1.00 0.00 ? 37 LEU A H    6  
ATOM 5920  H HA   . LEU A 1 67  ? 41.711 34.160 9.620  1.00 0.00 ? 37 LEU A HA   6  
ATOM 5921  H HB2  . LEU A 1 67  ? 40.315 34.024 12.299 1.00 0.00 ? 37 LEU A HB2  6  
ATOM 5922  H HB3  . LEU A 1 67  ? 40.329 35.453 11.265 1.00 0.00 ? 37 LEU A HB3  6  
ATOM 5923  H HG   . LEU A 1 67  ? 39.362 32.740 10.331 1.00 0.00 ? 37 LEU A HG   6  
ATOM 5924  H HD11 . LEU A 1 67  ? 37.549 35.048 10.984 1.00 0.00 ? 37 LEU A HD11 6  
ATOM 5925  H HD12 . LEU A 1 67  ? 38.070 33.960 12.270 1.00 0.00 ? 37 LEU A HD12 6  
ATOM 5926  H HD13 . LEU A 1 67  ? 37.170 33.328 10.891 1.00 0.00 ? 37 LEU A HD13 6  
ATOM 5927  H HD21 . LEU A 1 67  ? 38.172 34.397 8.687  1.00 0.00 ? 37 LEU A HD21 6  
ATOM 5928  H HD22 . LEU A 1 67  ? 39.874 34.016 8.431  1.00 0.00 ? 37 LEU A HD22 6  
ATOM 5929  H HD23 . LEU A 1 67  ? 39.417 35.532 9.209  1.00 0.00 ? 37 LEU A HD23 6  
ATOM 5930  N N    . ASP A 1 68  ? 43.332 34.177 12.475 1.00 0.00 ? 38 ASP A N    6  
ATOM 5931  C CA   . ASP A 1 68  ? 44.490 34.771 13.128 1.00 0.00 ? 38 ASP A CA   6  
ATOM 5932  C C    . ASP A 1 68  ? 45.738 34.641 12.259 1.00 0.00 ? 38 ASP A C    6  
ATOM 5933  O O    . ASP A 1 68  ? 46.476 35.607 12.069 1.00 0.00 ? 38 ASP A O    6  
ATOM 5934  C CB   . ASP A 1 68  ? 44.735 34.089 14.476 1.00 0.00 ? 38 ASP A CB   6  
ATOM 5935  C CG   . ASP A 1 68  ? 45.835 34.819 15.239 1.00 0.00 ? 38 ASP A CG   6  
ATOM 5936  O OD1  . ASP A 1 68  ? 46.974 34.388 15.156 1.00 0.00 ? 38 ASP A OD1  6  
ATOM 5937  O OD2  . ASP A 1 68  ? 45.522 35.799 15.894 1.00 0.00 ? 38 ASP A OD2  6  
ATOM 5938  H H    . ASP A 1 68  ? 42.864 33.425 12.900 1.00 0.00 ? 38 ASP A H    6  
ATOM 5939  H HA   . ASP A 1 68  ? 44.293 35.819 13.302 1.00 0.00 ? 38 ASP A HA   6  
ATOM 5940  H HB2  . ASP A 1 68  ? 43.824 34.104 15.056 1.00 0.00 ? 38 ASP A HB2  6  
ATOM 5941  H HB3  . ASP A 1 68  ? 45.037 33.065 14.310 1.00 0.00 ? 38 ASP A HB3  6  
ATOM 5942  N N    . LYS A 1 69  ? 45.966 33.443 11.729 1.00 0.00 ? 39 LYS A N    6  
ATOM 5943  C CA   . LYS A 1 69  ? 47.144 33.203 10.897 1.00 0.00 ? 39 LYS A CA   6  
ATOM 5944  C C    . LYS A 1 69  ? 47.162 34.100 9.659  1.00 0.00 ? 39 LYS A C    6  
ATOM 5945  O O    . LYS A 1 69  ? 48.233 34.473 9.180  1.00 0.00 ? 39 LYS A O    6  
ATOM 5946  C CB   . LYS A 1 69  ? 47.171 31.735 10.463 1.00 0.00 ? 39 LYS A CB   6  
ATOM 5947  C CG   . LYS A 1 69  ? 48.479 31.434 9.726  1.00 0.00 ? 39 LYS A CG   6  
ATOM 5948  C CD   . LYS A 1 69  ? 48.460 29.989 9.217  1.00 0.00 ? 39 LYS A CD   6  
ATOM 5949  C CE   . LYS A 1 69  ? 49.819 29.644 8.609  1.00 0.00 ? 39 LYS A CE   6  
ATOM 5950  N NZ   . LYS A 1 69  ? 49.875 30.139 7.203  1.00 0.00 ? 39 LYS A NZ   6  
ATOM 5951  H H    . LYS A 1 69  ? 45.353 32.704 11.925 1.00 0.00 ? 39 LYS A H    6  
ATOM 5952  H HA   . LYS A 1 69  ? 48.028 33.402 11.483 1.00 0.00 ? 39 LYS A HA   6  
ATOM 5953  H HB2  . LYS A 1 69  ? 47.096 31.102 11.334 1.00 0.00 ? 39 LYS A HB2  6  
ATOM 5954  H HB3  . LYS A 1 69  ? 46.338 31.538 9.804  1.00 0.00 ? 39 LYS A HB3  6  
ATOM 5955  H HG2  . LYS A 1 69  ? 48.583 32.109 8.890  1.00 0.00 ? 39 LYS A HG2  6  
ATOM 5956  H HG3  . LYS A 1 69  ? 49.311 31.563 10.400 1.00 0.00 ? 39 LYS A HG3  6  
ATOM 5957  H HD2  . LYS A 1 69  ? 48.252 29.323 10.041 1.00 0.00 ? 39 LYS A HD2  6  
ATOM 5958  H HD3  . LYS A 1 69  ? 47.693 29.883 8.465  1.00 0.00 ? 39 LYS A HD3  6  
ATOM 5959  H HE2  . LYS A 1 69  ? 50.603 30.113 9.187  1.00 0.00 ? 39 LYS A HE2  6  
ATOM 5960  H HE3  . LYS A 1 69  ? 49.956 28.573 8.618  1.00 0.00 ? 39 LYS A HE3  6  
ATOM 5961  H HZ1  . LYS A 1 69  ? 49.022 30.696 6.996  1.00 0.00 ? 39 LYS A HZ1  6  
ATOM 5962  H HZ2  . LYS A 1 69  ? 49.927 29.329 6.553  1.00 0.00 ? 39 LYS A HZ2  6  
ATOM 5963  H HZ3  . LYS A 1 69  ? 50.716 30.739 7.079  1.00 0.00 ? 39 LYS A HZ3  6  
ATOM 5964  N N    . TYR A 1 70  ? 45.985 34.446 9.142  1.00 0.00 ? 40 TYR A N    6  
ATOM 5965  C CA   . TYR A 1 70  ? 45.908 35.320 7.975  1.00 0.00 ? 40 TYR A CA   6  
ATOM 5966  C C    . TYR A 1 70  ? 46.576 36.668 8.285  1.00 0.00 ? 40 TYR A C    6  
ATOM 5967  O O    . TYR A 1 70  ? 46.271 37.263 9.322  1.00 0.00 ? 40 TYR A O    6  
ATOM 5968  C CB   . TYR A 1 70  ? 44.430 35.506 7.620  1.00 0.00 ? 40 TYR A CB   6  
ATOM 5969  C CG   . TYR A 1 70  ? 44.171 35.859 6.175  1.00 0.00 ? 40 TYR A CG   6  
ATOM 5970  C CD1  . TYR A 1 70  ? 44.388 34.908 5.170  1.00 0.00 ? 40 TYR A CD1  6  
ATOM 5971  C CD2  . TYR A 1 70  ? 43.667 37.121 5.846  1.00 0.00 ? 40 TYR A CD2  6  
ATOM 5972  C CE1  . TYR A 1 70  ? 44.107 35.224 3.836  1.00 0.00 ? 40 TYR A CE1  6  
ATOM 5973  C CE2  . TYR A 1 70  ? 43.390 37.439 4.512  1.00 0.00 ? 40 TYR A CE2  6  
ATOM 5974  C CZ   . TYR A 1 70  ? 43.610 36.490 3.506  1.00 0.00 ? 40 TYR A CZ   6  
ATOM 5975  O OH   . TYR A 1 70  ? 43.334 36.802 2.191  1.00 0.00 ? 40 TYR A OH   6  
ATOM 5976  H H    . TYR A 1 70  ? 45.162 34.063 9.517  1.00 0.00 ? 40 TYR A H    6  
ATOM 5977  H HA   . TYR A 1 70  ? 46.401 34.825 7.155  1.00 0.00 ? 40 TYR A HA   6  
ATOM 5978  H HB2  . TYR A 1 70  ? 43.907 34.590 7.840  1.00 0.00 ? 40 TYR A HB2  6  
ATOM 5979  H HB3  . TYR A 1 70  ? 44.027 36.287 8.249  1.00 0.00 ? 40 TYR A HB3  6  
ATOM 5980  H HD1  . TYR A 1 70  ? 44.779 33.935 5.426  1.00 0.00 ? 40 TYR A HD1  6  
ATOM 5981  H HD2  . TYR A 1 70  ? 43.496 37.851 6.621  1.00 0.00 ? 40 TYR A HD2  6  
ATOM 5982  H HE1  . TYR A 1 70  ? 44.276 34.490 3.060  1.00 0.00 ? 40 TYR A HE1  6  
ATOM 5983  H HE2  . TYR A 1 70  ? 42.999 38.413 4.261  1.00 0.00 ? 40 TYR A HE2  6  
ATOM 5984  H HH   . TYR A 1 70  ? 43.240 36.031 1.736  1.00 0.00 ? 40 TYR A HH   6  
ATOM 5985  N N    . PRO A 1 71  ? 47.460 37.175 7.446  1.00 0.00 ? 41 PRO A N    6  
ATOM 5986  C CA   . PRO A 1 71  ? 48.225 38.416 7.772  1.00 0.00 ? 41 PRO A CA   6  
ATOM 5987  C C    . PRO A 1 71  ? 47.497 39.718 7.441  1.00 0.00 ? 41 PRO A C    6  
ATOM 5988  O O    . PRO A 1 71  ? 48.121 40.781 7.433  1.00 0.00 ? 41 PRO A O    6  
ATOM 5989  C CB   . PRO A 1 71  ? 49.485 38.276 6.919  1.00 0.00 ? 41 PRO A CB   6  
ATOM 5990  C CG   . PRO A 1 71  ? 49.061 37.512 5.711  1.00 0.00 ? 41 PRO A CG   6  
ATOM 5991  C CD   . PRO A 1 71  ? 47.820 36.701 6.096  1.00 0.00 ? 41 PRO A CD   6  
ATOM 5992  H HA   . PRO A 1 71  ? 48.508 38.410 8.813  1.00 0.00 ? 41 PRO A HA   6  
ATOM 5993  H HB2  . PRO A 1 71  ? 49.857 39.252 6.640  1.00 0.00 ? 41 PRO A HB2  6  
ATOM 5994  H HB3  . PRO A 1 71  ? 50.243 37.724 7.455  1.00 0.00 ? 41 PRO A HB3  6  
ATOM 5995  H HG2  . PRO A 1 71  ? 48.825 38.198 4.908  1.00 0.00 ? 41 PRO A HG2  6  
ATOM 5996  H HG3  . PRO A 1 71  ? 49.847 36.840 5.404  1.00 0.00 ? 41 PRO A HG3  6  
ATOM 5997  H HD2  . PRO A 1 71  ? 47.017 36.894 5.397  1.00 0.00 ? 41 PRO A HD2  6  
ATOM 5998  H HD3  . PRO A 1 71  ? 48.051 35.648 6.125  1.00 0.00 ? 41 PRO A HD3  6  
ATOM 5999  N N    . HIS A 1 72  ? 46.193 39.650 7.174  1.00 0.00 ? 42 HIS A N    6  
ATOM 6000  C CA   . HIS A 1 72  ? 45.453 40.850 6.779  1.00 0.00 ? 42 HIS A CA   6  
ATOM 6001  C C    . HIS A 1 72  ? 44.032 40.850 7.330  1.00 0.00 ? 42 HIS A C    6  
ATOM 6002  O O    . HIS A 1 72  ? 43.439 39.794 7.544  1.00 0.00 ? 42 HIS A O    6  
ATOM 6003  C CB   . HIS A 1 72  ? 45.405 40.949 5.255  1.00 0.00 ? 42 HIS A CB   6  
ATOM 6004  C CG   . HIS A 1 72  ? 46.754 41.173 4.626  1.00 0.00 ? 42 HIS A CG   6  
ATOM 6005  N ND1  . HIS A 1 72  ? 47.532 40.128 4.155  1.00 0.00 ? 42 HIS A ND1  6  
ATOM 6006  C CD2  . HIS A 1 72  ? 47.477 42.316 4.387  1.00 0.00 ? 42 HIS A CD2  6  
ATOM 6007  C CE1  . HIS A 1 72  ? 48.666 40.656 3.661  1.00 0.00 ? 42 HIS A CE1  6  
ATOM 6008  N NE2  . HIS A 1 72  ? 48.684 41.987 3.777  1.00 0.00 ? 42 HIS A NE2  6  
ATOM 6009  H H    . HIS A 1 72  ? 45.727 38.791 7.242  1.00 0.00 ? 42 HIS A H    6  
ATOM 6010  H HA   . HIS A 1 72  ? 45.971 41.717 7.161  1.00 0.00 ? 42 HIS A HA   6  
ATOM 6011  H HB2  . HIS A 1 72  ? 44.993 40.034 4.860  1.00 0.00 ? 42 HIS A HB2  6  
ATOM 6012  H HB3  . HIS A 1 72  ? 44.751 41.766 4.984  1.00 0.00 ? 42 HIS A HB3  6  
ATOM 6013  H HD1  . HIS A 1 72  ? 47.299 39.176 4.178  1.00 0.00 ? 42 HIS A HD1  6  
ATOM 6014  H HD2  . HIS A 1 72  ? 47.158 43.318 4.633  1.00 0.00 ? 42 HIS A HD2  6  
ATOM 6015  H HE1  . HIS A 1 72  ? 49.464 40.075 3.225  1.00 0.00 ? 42 HIS A HE1  6  
ATOM 6016  N N    . LYS A 1 73  ? 43.500 42.041 7.589  1.00 0.00 ? 43 LYS A N    6  
ATOM 6017  C CA   . LYS A 1 73  ? 42.080 42.165 7.893  1.00 0.00 ? 43 LYS A CA   6  
ATOM 6018  C C    . LYS A 1 73  ? 41.271 41.716 6.683  1.00 0.00 ? 43 LYS A C    6  
ATOM 6019  O O    . LYS A 1 73  ? 41.562 42.126 5.559  1.00 0.00 ? 43 LYS A O    6  
ATOM 6020  C CB   . LYS A 1 73  ? 41.733 43.622 8.207  1.00 0.00 ? 43 LYS A CB   6  
ATOM 6021  C CG   . LYS A 1 73  ? 40.289 43.709 8.704  1.00 0.00 ? 43 LYS A CG   6  
ATOM 6022  C CD   . LYS A 1 73  ? 39.914 45.174 8.937  1.00 0.00 ? 43 LYS A CD   6  
ATOM 6023  C CE   . LYS A 1 73  ? 38.528 45.252 9.578  1.00 0.00 ? 43 LYS A CE   6  
ATOM 6024  N NZ   . LYS A 1 73  ? 37.484 45.085 8.528  1.00 0.00 ? 43 LYS A NZ   6  
ATOM 6025  H H    . LYS A 1 73  ? 44.069 42.840 7.585  1.00 0.00 ? 43 LYS A H    6  
ATOM 6026  H HA   . LYS A 1 73  ? 41.837 41.546 8.743  1.00 0.00 ? 43 LYS A HA   6  
ATOM 6027  H HB2  . LYS A 1 73  ? 42.402 44.001 8.966  1.00 0.00 ? 43 LYS A HB2  6  
ATOM 6028  H HB3  . LYS A 1 73  ? 41.836 44.217 7.311  1.00 0.00 ? 43 LYS A HB3  6  
ATOM 6029  H HG2  . LYS A 1 73  ? 39.629 43.280 7.965  1.00 0.00 ? 43 LYS A HG2  6  
ATOM 6030  H HG3  . LYS A 1 73  ? 40.194 43.165 9.632  1.00 0.00 ? 43 LYS A HG3  6  
ATOM 6031  H HD2  . LYS A 1 73  ? 40.642 45.631 9.591  1.00 0.00 ? 43 LYS A HD2  6  
ATOM 6032  H HD3  . LYS A 1 73  ? 39.900 45.696 7.993  1.00 0.00 ? 43 LYS A HD3  6  
ATOM 6033  H HE2  . LYS A 1 73  ? 38.426 44.467 10.313 1.00 0.00 ? 43 LYS A HE2  6  
ATOM 6034  H HE3  . LYS A 1 73  ? 38.406 46.212 10.057 1.00 0.00 ? 43 LYS A HE3  6  
ATOM 6035  H HZ1  . LYS A 1 73  ? 36.548 45.286 8.933  1.00 0.00 ? 43 LYS A HZ1  6  
ATOM 6036  H HZ2  . LYS A 1 73  ? 37.507 44.107 8.171  1.00 0.00 ? 43 LYS A HZ2  6  
ATOM 6037  H HZ3  . LYS A 1 73  ? 37.670 45.744 7.745  1.00 0.00 ? 43 LYS A HZ3  6  
ATOM 6038  N N    . ILE A 1 74  ? 40.262 40.879 6.907  1.00 0.00 ? 44 ILE A N    6  
ATOM 6039  C CA   . ILE A 1 74  ? 39.392 40.457 5.810  1.00 0.00 ? 44 ILE A CA   6  
ATOM 6040  C C    . ILE A 1 74  ? 38.197 41.403 5.688  1.00 0.00 ? 44 ILE A C    6  
ATOM 6041  O O    . ILE A 1 74  ? 37.515 41.690 6.672  1.00 0.00 ? 44 ILE A O    6  
ATOM 6042  C CB   . ILE A 1 74  ? 38.948 39.004 6.019  1.00 0.00 ? 44 ILE A CB   6  
ATOM 6043  C CG1  . ILE A 1 74  ? 40.200 38.121 6.059  1.00 0.00 ? 44 ILE A CG1  6  
ATOM 6044  C CG2  . ILE A 1 74  ? 38.046 38.554 4.865  1.00 0.00 ? 44 ILE A CG2  6  
ATOM 6045  C CD1  . ILE A 1 74  ? 39.825 36.674 6.377  1.00 0.00 ? 44 ILE A CD1  6  
ATOM 6046  H H    . ILE A 1 74  ? 40.118 40.527 7.814  1.00 0.00 ? 44 ILE A H    6  
ATOM 6047  H HA   . ILE A 1 74  ? 39.956 40.510 4.890  1.00 0.00 ? 44 ILE A HA   6  
ATOM 6048  H HB   . ILE A 1 74  ? 38.412 38.917 6.952  1.00 0.00 ? 44 ILE A HB   6  
ATOM 6049  H HG12 . ILE A 1 74  ? 40.693 38.158 5.099  1.00 0.00 ? 44 ILE A HG12 6  
ATOM 6050  H HG13 . ILE A 1 74  ? 40.871 38.489 6.820  1.00 0.00 ? 44 ILE A HG13 6  
ATOM 6051  H HG21 . ILE A 1 74  ? 37.160 39.172 4.839  1.00 0.00 ? 44 ILE A HG21 6  
ATOM 6052  H HG22 . ILE A 1 74  ? 37.759 37.523 5.007  1.00 0.00 ? 44 ILE A HG22 6  
ATOM 6053  H HG23 . ILE A 1 74  ? 38.579 38.654 3.931  1.00 0.00 ? 44 ILE A HG23 6  
ATOM 6054  H HD11 . ILE A 1 74  ? 39.145 36.301 5.624  1.00 0.00 ? 44 ILE A HD11 6  
ATOM 6055  H HD12 . ILE A 1 74  ? 39.352 36.627 7.346  1.00 0.00 ? 44 ILE A HD12 6  
ATOM 6056  H HD13 . ILE A 1 74  ? 40.720 36.068 6.381  1.00 0.00 ? 44 ILE A HD13 6  
ATOM 6057  N N    . LYS A 1 75  ? 37.957 41.883 4.471  1.00 0.00 ? 45 LYS A N    6  
ATOM 6058  C CA   . LYS A 1 75  ? 36.887 42.849 4.230  1.00 0.00 ? 45 LYS A CA   6  
ATOM 6059  C C    . LYS A 1 75  ? 35.511 42.197 4.045  1.00 0.00 ? 45 LYS A C    6  
ATOM 6060  O O    . LYS A 1 75  ? 34.492 42.872 4.184  1.00 0.00 ? 45 LYS A O    6  
ATOM 6061  C CB   . LYS A 1 75  ? 37.241 43.722 3.018  1.00 0.00 ? 45 LYS A CB   6  
ATOM 6062  C CG   . LYS A 1 75  ? 37.214 42.899 1.723  1.00 0.00 ? 45 LYS A CG   6  
ATOM 6063  C CD   . LYS A 1 75  ? 37.689 43.769 0.557  1.00 0.00 ? 45 LYS A CD   6  
ATOM 6064  C CE   . LYS A 1 75  ? 37.369 43.075 -0.769 1.00 0.00 ? 45 LYS A CE   6  
ATOM 6065  N NZ   . LYS A 1 75  ? 37.236 44.096 -1.845 1.00 0.00 ? 45 LYS A NZ   6  
ATOM 6066  H H    . LYS A 1 75  ? 38.509 41.582 3.719  1.00 0.00 ? 45 LYS A H    6  
ATOM 6067  H HA   . LYS A 1 75  ? 36.828 43.495 5.093  1.00 0.00 ? 45 LYS A HA   6  
ATOM 6068  H HB2  . LYS A 1 75  ? 36.527 44.528 2.940  1.00 0.00 ? 45 LYS A HB2  6  
ATOM 6069  H HB3  . LYS A 1 75  ? 38.230 44.134 3.155  1.00 0.00 ? 45 LYS A HB3  6  
ATOM 6070  H HG2  . LYS A 1 75  ? 37.866 42.044 1.826  1.00 0.00 ? 45 LYS A HG2  6  
ATOM 6071  H HG3  . LYS A 1 75  ? 36.206 42.564 1.530  1.00 0.00 ? 45 LYS A HG3  6  
ATOM 6072  H HD2  . LYS A 1 75  ? 37.187 44.725 0.594  1.00 0.00 ? 45 LYS A HD2  6  
ATOM 6073  H HD3  . LYS A 1 75  ? 38.756 43.920 0.632  1.00 0.00 ? 45 LYS A HD3  6  
ATOM 6074  H HE2  . LYS A 1 75  ? 38.168 42.393 -1.020 1.00 0.00 ? 45 LYS A HE2  6  
ATOM 6075  H HE3  . LYS A 1 75  ? 36.443 42.526 -0.677 1.00 0.00 ? 45 LYS A HE3  6  
ATOM 6076  H HZ1  . LYS A 1 75  ? 36.657 43.713 -2.618 1.00 0.00 ? 45 LYS A HZ1  6  
ATOM 6077  H HZ2  . LYS A 1 75  ? 38.179 44.343 -2.207 1.00 0.00 ? 45 LYS A HZ2  6  
ATOM 6078  H HZ3  . LYS A 1 75  ? 36.777 44.946 -1.461 1.00 0.00 ? 45 LYS A HZ3  6  
ATOM 6079  N N    . SER A 1 76  ? 35.478 40.906 3.716  1.00 0.00 ? 46 SER A N    6  
ATOM 6080  C CA   . SER A 1 76  ? 34.205 40.219 3.513  1.00 0.00 ? 46 SER A CA   6  
ATOM 6081  C C    . SER A 1 76  ? 34.317 38.737 3.852  1.00 0.00 ? 46 SER A C    6  
ATOM 6082  O O    . SER A 1 76  ? 35.387 38.139 3.739  1.00 0.00 ? 46 SER A O    6  
ATOM 6083  C CB   . SER A 1 76  ? 33.756 40.377 2.061  1.00 0.00 ? 46 SER A CB   6  
ATOM 6084  O OG   . SER A 1 76  ? 34.623 39.628 1.220  1.00 0.00 ? 46 SER A OG   6  
ATOM 6085  H H    . SER A 1 76  ? 36.316 40.414 3.602  1.00 0.00 ? 46 SER A H    6  
ATOM 6086  H HA   . SER A 1 76  ? 33.461 40.668 4.155  1.00 0.00 ? 46 SER A HA   6  
ATOM 6087  H HB2  . SER A 1 76  ? 32.750 40.007 1.948  1.00 0.00 ? 46 SER A HB2  6  
ATOM 6088  H HB3  . SER A 1 76  ? 33.783 41.424 1.790  1.00 0.00 ? 46 SER A HB3  6  
ATOM 6089  H HG   . SER A 1 76  ? 35.266 40.181 0.919  1.00 0.00 ? 46 SER A HG   6  
ATOM 6090  N N    . GLY A 1 77  ? 33.197 38.150 4.266  1.00 0.00 ? 47 GLY A N    6  
ATOM 6091  C CA   . GLY A 1 77  ? 33.149 36.724 4.572  1.00 0.00 ? 47 GLY A CA   6  
ATOM 6092  C C    . GLY A 1 77  ? 33.421 35.865 3.337  1.00 0.00 ? 47 GLY A C    6  
ATOM 6093  O O    . GLY A 1 77  ? 33.992 34.776 3.444  1.00 0.00 ? 47 GLY A O    6  
ATOM 6094  H H    . GLY A 1 77  ? 32.379 38.682 4.353  1.00 0.00 ? 47 GLY A H    6  
ATOM 6095  H HA2  . GLY A 1 77  ? 33.890 36.502 5.325  1.00 0.00 ? 47 GLY A HA2  6  
ATOM 6096  H HA3  . GLY A 1 77  ? 32.171 36.481 4.958  1.00 0.00 ? 47 GLY A HA3  6  
ATOM 6097  N N    . ALA A 1 78  ? 33.034 36.358 2.159  1.00 0.00 ? 48 ALA A N    6  
ATOM 6098  C CA   . ALA A 1 78  ? 33.191 35.577 0.937  1.00 0.00 ? 48 ALA A CA   6  
ATOM 6099  C C    . ALA A 1 78  ? 34.658 35.221 0.731  1.00 0.00 ? 48 ALA A C    6  
ATOM 6100  O O    . ALA A 1 78  ? 34.982 34.088 0.374  1.00 0.00 ? 48 ALA A O    6  
ATOM 6101  C CB   . ALA A 1 78  ? 32.682 36.376 -0.264 1.00 0.00 ? 48 ALA A CB   6  
ATOM 6102  H H    . ALA A 1 78  ? 32.639 37.254 2.115  1.00 0.00 ? 48 ALA A H    6  
ATOM 6103  H HA   . ALA A 1 78  ? 32.616 34.668 1.023  1.00 0.00 ? 48 ALA A HA   6  
ATOM 6104  H HB1  . ALA A 1 78  ? 33.409 37.130 -0.530 1.00 0.00 ? 48 ALA A HB1  6  
ATOM 6105  H HB2  . ALA A 1 78  ? 31.747 36.853 -0.010 1.00 0.00 ? 48 ALA A HB2  6  
ATOM 6106  H HB3  . ALA A 1 78  ? 32.532 35.711 -1.102 1.00 0.00 ? 48 ALA A HB3  6  
ATOM 6107  N N    . GLU A 1 79  ? 35.541 36.190 0.954  1.00 0.00 ? 49 GLU A N    6  
ATOM 6108  C CA   . GLU A 1 79  ? 36.970 35.899 0.970  1.00 0.00 ? 49 GLU A CA   6  
ATOM 6109  C C    . GLU A 1 79  ? 37.312 34.915 2.090  1.00 0.00 ? 49 GLU A C    6  
ATOM 6110  O O    . GLU A 1 79  ? 38.109 33.998 1.893  1.00 0.00 ? 49 GLU A O    6  
ATOM 6111  C CB   . GLU A 1 79  ? 37.767 37.189 1.164  1.00 0.00 ? 49 GLU A CB   6  
ATOM 6112  C CG   . GLU A 1 79  ? 37.540 38.117 -0.034 1.00 0.00 ? 49 GLU A CG   6  
ATOM 6113  C CD   . GLU A 1 79  ? 38.384 39.392 0.064  1.00 0.00 ? 49 GLU A CD   6  
ATOM 6114  O OE1  . GLU A 1 79  ? 38.960 39.646 1.112  1.00 0.00 ? 49 GLU A OE1  6  
ATOM 6115  O OE2  . GLU A 1 79  ? 38.442 40.104 -0.924 1.00 0.00 ? 49 GLU A OE2  6  
ATOM 6116  H H    . GLU A 1 79  ? 35.229 37.107 1.109  1.00 0.00 ? 49 GLU A H    6  
ATOM 6117  H HA   . GLU A 1 79  ? 37.246 35.459 0.023  1.00 0.00 ? 49 GLU A HA   6  
ATOM 6118  H HB2  . GLU A 1 79  ? 37.439 37.681 2.069  1.00 0.00 ? 49 GLU A HB2  6  
ATOM 6119  H HB3  . GLU A 1 79  ? 38.818 36.955 1.240  1.00 0.00 ? 49 GLU A HB3  6  
ATOM 6120  H HG2  . GLU A 1 79  ? 37.804 37.593 -0.941 1.00 0.00 ? 49 GLU A HG2  6  
ATOM 6121  H HG3  . GLU A 1 79  ? 36.495 38.388 -0.078 1.00 0.00 ? 49 GLU A HG3  6  
ATOM 6122  N N    . ALA A 1 80  ? 36.618 35.024 3.223  1.00 0.00 ? 50 ALA A N    6  
ATOM 6123  C CA   . ALA A 1 80  ? 36.917 34.174 4.372  1.00 0.00 ? 50 ALA A CA   6  
ATOM 6124  C C    . ALA A 1 80  ? 36.729 32.695 4.037  1.00 0.00 ? 50 ALA A C    6  
ATOM 6125  O O    . ALA A 1 80  ? 37.502 31.850 4.486  1.00 0.00 ? 50 ALA A O    6  
ATOM 6126  C CB   . ALA A 1 80  ? 36.008 34.549 5.545  1.00 0.00 ? 50 ALA A CB   6  
ATOM 6127  H H    . ALA A 1 80  ? 35.902 35.691 3.290  1.00 0.00 ? 50 ALA A H    6  
ATOM 6128  H HA   . ALA A 1 80  ? 37.943 34.335 4.667  1.00 0.00 ? 50 ALA A HA   6  
ATOM 6129  H HB1  . ALA A 1 80  ? 35.039 34.092 5.410  1.00 0.00 ? 50 ALA A HB1  6  
ATOM 6130  H HB2  . ALA A 1 80  ? 35.898 35.622 5.585  1.00 0.00 ? 50 ALA A HB2  6  
ATOM 6131  H HB3  . ALA A 1 80  ? 36.448 34.197 6.467  1.00 0.00 ? 50 ALA A HB3  6  
ATOM 6132  N N    . LYS A 1 81  ? 35.761 32.395 3.176  1.00 0.00 ? 51 LYS A N    6  
ATOM 6133  C CA   . LYS A 1 81  ? 35.497 31.009 2.798  1.00 0.00 ? 51 LYS A CA   6  
ATOM 6134  C C    . LYS A 1 81  ? 36.741 30.340 2.205  1.00 0.00 ? 51 LYS A C    6  
ATOM 6135  O O    . LYS A 1 81  ? 36.912 29.129 2.338  1.00 0.00 ? 51 LYS A O    6  
ATOM 6136  C CB   . LYS A 1 81  ? 34.371 30.957 1.764  1.00 0.00 ? 51 LYS A CB   6  
ATOM 6137  C CG   . LYS A 1 81  ? 33.068 31.471 2.382  1.00 0.00 ? 51 LYS A CG   6  
ATOM 6138  C CD   . LYS A 1 81  ? 31.933 31.310 1.369  1.00 0.00 ? 51 LYS A CD   6  
ATOM 6139  C CE   . LYS A 1 81  ? 30.653 31.934 1.928  1.00 0.00 ? 51 LYS A CE   6  
ATOM 6140  N NZ   . LYS A 1 81  ? 29.557 31.799 0.926  1.00 0.00 ? 51 LYS A NZ   6  
ATOM 6141  H H    . LYS A 1 81  ? 35.182 33.111 2.839  1.00 0.00 ? 51 LYS A H    6  
ATOM 6142  H HA   . LYS A 1 81  ? 35.188 30.459 3.674  1.00 0.00 ? 51 LYS A HA   6  
ATOM 6143  H HB2  . LYS A 1 81  ? 34.634 31.573 0.917  1.00 0.00 ? 51 LYS A HB2  6  
ATOM 6144  H HB3  . LYS A 1 81  ? 34.230 29.938 1.436  1.00 0.00 ? 51 LYS A HB3  6  
ATOM 6145  H HG2  . LYS A 1 81  ? 32.844 30.902 3.272  1.00 0.00 ? 51 LYS A HG2  6  
ATOM 6146  H HG3  . LYS A 1 81  ? 33.177 32.514 2.636  1.00 0.00 ? 51 LYS A HG3  6  
ATOM 6147  H HD2  . LYS A 1 81  ? 32.202 31.805 0.447  1.00 0.00 ? 51 LYS A HD2  6  
ATOM 6148  H HD3  . LYS A 1 81  ? 31.765 30.261 1.179  1.00 0.00 ? 51 LYS A HD3  6  
ATOM 6149  H HE2  . LYS A 1 81  ? 30.372 31.427 2.838  1.00 0.00 ? 51 LYS A HE2  6  
ATOM 6150  H HE3  . LYS A 1 81  ? 30.823 32.979 2.136  1.00 0.00 ? 51 LYS A HE3  6  
ATOM 6151  H HZ1  . LYS A 1 81  ? 29.069 30.891 1.066  1.00 0.00 ? 51 LYS A HZ1  6  
ATOM 6152  H HZ2  . LYS A 1 81  ? 29.959 31.833 -0.033 1.00 0.00 ? 51 LYS A HZ2  6  
ATOM 6153  H HZ3  . LYS A 1 81  ? 28.878 32.577 1.046  1.00 0.00 ? 51 LYS A HZ3  6  
ATOM 6154  N N    . LYS A 1 82  ? 37.605 31.118 1.555  1.00 0.00 ? 52 LYS A N    6  
ATOM 6155  C CA   . LYS A 1 82  ? 38.804 30.562 0.936  1.00 0.00 ? 52 LYS A CA   6  
ATOM 6156  C C    . LYS A 1 82  ? 39.728 29.887 1.954  1.00 0.00 ? 52 LYS A C    6  
ATOM 6157  O O    . LYS A 1 82  ? 40.519 29.017 1.586  1.00 0.00 ? 52 LYS A O    6  
ATOM 6158  C CB   . LYS A 1 82  ? 39.572 31.671 0.216  1.00 0.00 ? 52 LYS A CB   6  
ATOM 6159  C CG   . LYS A 1 82  ? 38.682 32.295 -0.862 1.00 0.00 ? 52 LYS A CG   6  
ATOM 6160  C CD   . LYS A 1 82  ? 39.516 33.220 -1.753 1.00 0.00 ? 52 LYS A CD   6  
ATOM 6161  C CE   . LYS A 1 82  ? 40.037 34.401 -0.931 1.00 0.00 ? 52 LYS A CE   6  
ATOM 6162  N NZ   . LYS A 1 82  ? 40.644 35.412 -1.842 1.00 0.00 ? 52 LYS A NZ   6  
ATOM 6163  H H    . LYS A 1 82  ? 37.462 32.088 1.530  1.00 0.00 ? 52 LYS A H    6  
ATOM 6164  H HA   . LYS A 1 82  ? 38.503 29.828 0.204  1.00 0.00 ? 52 LYS A HA   6  
ATOM 6165  H HB2  . LYS A 1 82  ? 39.861 32.429 0.930  1.00 0.00 ? 52 LYS A HB2  6  
ATOM 6166  H HB3  . LYS A 1 82  ? 40.455 31.256 -0.247 1.00 0.00 ? 52 LYS A HB3  6  
ATOM 6167  H HG2  . LYS A 1 82  ? 38.245 31.512 -1.464 1.00 0.00 ? 52 LYS A HG2  6  
ATOM 6168  H HG3  . LYS A 1 82  ? 37.896 32.867 -0.391 1.00 0.00 ? 52 LYS A HG3  6  
ATOM 6169  H HD2  . LYS A 1 82  ? 40.350 32.668 -2.161 1.00 0.00 ? 52 LYS A HD2  6  
ATOM 6170  H HD3  . LYS A 1 82  ? 38.902 33.590 -2.559 1.00 0.00 ? 52 LYS A HD3  6  
ATOM 6171  H HE2  . LYS A 1 82  ? 39.220 34.851 -0.387 1.00 0.00 ? 52 LYS A HE2  6  
ATOM 6172  H HE3  . LYS A 1 82  ? 40.784 34.051 -0.233 1.00 0.00 ? 52 LYS A HE3  6  
ATOM 6173  H HZ1  . LYS A 1 82  ? 41.576 35.079 -2.159 1.00 0.00 ? 52 LYS A HZ1  6  
ATOM 6174  H HZ2  . LYS A 1 82  ? 40.751 36.314 -1.336 1.00 0.00 ? 52 LYS A HZ2  6  
ATOM 6175  H HZ3  . LYS A 1 82  ? 40.027 35.547 -2.668 1.00 0.00 ? 52 LYS A HZ3  6  
ATOM 6176  N N    . LEU A 1 83  ? 39.637 30.275 3.228  1.00 0.00 ? 53 LEU A N    6  
ATOM 6177  C CA   . LEU A 1 83  ? 40.586 29.800 4.226  1.00 0.00 ? 53 LEU A CA   6  
ATOM 6178  C C    . LEU A 1 83  ? 40.174 28.424 4.769  1.00 0.00 ? 53 LEU A C    6  
ATOM 6179  O O    . LEU A 1 83  ? 38.988 28.214 5.044  1.00 0.00 ? 53 LEU A O    6  
ATOM 6180  C CB   . LEU A 1 83  ? 40.654 30.803 5.380  1.00 0.00 ? 53 LEU A CB   6  
ATOM 6181  C CG   . LEU A 1 83  ? 41.562 31.974 4.997  1.00 0.00 ? 53 LEU A CG   6  
ATOM 6182  C CD1  . LEU A 1 83  ? 41.376 33.115 5.999  1.00 0.00 ? 53 LEU A CD1  6  
ATOM 6183  C CD2  . LEU A 1 83  ? 43.022 31.515 5.008  1.00 0.00 ? 53 LEU A CD2  6  
ATOM 6184  H H    . LEU A 1 83  ? 38.913 30.874 3.503  1.00 0.00 ? 53 LEU A H    6  
ATOM 6185  H HA   . LEU A 1 83  ? 41.552 29.747 3.755  1.00 0.00 ? 53 LEU A HA   6  
ATOM 6186  H HB2  . LEU A 1 83  ? 39.661 31.171 5.592  1.00 0.00 ? 53 LEU A HB2  6  
ATOM 6187  H HB3  . LEU A 1 83  ? 41.051 30.315 6.256  1.00 0.00 ? 53 LEU A HB3  6  
ATOM 6188  H HG   . LEU A 1 83  ? 41.300 32.321 4.007  1.00 0.00 ? 53 LEU A HG   6  
ATOM 6189  H HD11 . LEU A 1 83  ? 42.016 33.942 5.729  1.00 0.00 ? 53 LEU A HD11 6  
ATOM 6190  H HD12 . LEU A 1 83  ? 41.635 32.769 6.989  1.00 0.00 ? 53 LEU A HD12 6  
ATOM 6191  H HD13 . LEU A 1 83  ? 40.346 33.439 5.990  1.00 0.00 ? 53 LEU A HD13 6  
ATOM 6192  H HD21 . LEU A 1 83  ? 43.168 30.798 5.802  1.00 0.00 ? 53 LEU A HD21 6  
ATOM 6193  H HD22 . LEU A 1 83  ? 43.667 32.365 5.168  1.00 0.00 ? 53 LEU A HD22 6  
ATOM 6194  H HD23 . LEU A 1 83  ? 43.262 31.056 4.061  1.00 0.00 ? 53 LEU A HD23 6  
ATOM 6195  N N    . PRO A 1 84  ? 41.097 27.504 4.987  1.00 0.00 ? 54 PRO A N    6  
ATOM 6196  C CA   . PRO A 1 84  ? 40.727 26.145 5.485  1.00 0.00 ? 54 PRO A CA   6  
ATOM 6197  C C    . PRO A 1 84  ? 39.981 26.212 6.814  1.00 0.00 ? 54 PRO A C    6  
ATOM 6198  O O    . PRO A 1 84  ? 40.437 26.851 7.764  1.00 0.00 ? 54 PRO A O    6  
ATOM 6199  C CB   . PRO A 1 84  ? 42.060 25.404 5.646  1.00 0.00 ? 54 PRO A CB   6  
ATOM 6200  C CG   . PRO A 1 84  ? 43.050 26.171 4.840  1.00 0.00 ? 54 PRO A CG   6  
ATOM 6201  C CD   . PRO A 1 84  ? 42.560 27.616 4.817  1.00 0.00 ? 54 PRO A CD   6  
ATOM 6202  H HA   . PRO A 1 84  ? 40.122 25.635 4.750  1.00 0.00 ? 54 PRO A HA   6  
ATOM 6203  H HB2  . PRO A 1 84  ? 42.360 25.384 6.686  1.00 0.00 ? 54 PRO A HB2  6  
ATOM 6204  H HB3  . PRO A 1 84  ? 41.979 24.399 5.263  1.00 0.00 ? 54 PRO A HB3  6  
ATOM 6205  H HG2  . PRO A 1 84  ? 44.027 26.111 5.301  1.00 0.00 ? 54 PRO A HG2  6  
ATOM 6206  H HG3  . PRO A 1 84  ? 43.086 25.788 3.832  1.00 0.00 ? 54 PRO A HG3  6  
ATOM 6207  H HD2  . PRO A 1 84  ? 43.001 28.176 5.630  1.00 0.00 ? 54 PRO A HD2  6  
ATOM 6208  H HD3  . PRO A 1 84  ? 42.789 28.071 3.867  1.00 0.00 ? 54 PRO A HD3  6  
ATOM 6209  N N    . GLY A 1 85  ? 38.839 25.537 6.873  1.00 0.00 ? 55 GLY A N    6  
ATOM 6210  C CA   . GLY A 1 85  ? 38.047 25.488 8.100  1.00 0.00 ? 55 GLY A CA   6  
ATOM 6211  C C    . GLY A 1 85  ? 36.870 26.470 8.099  1.00 0.00 ? 55 GLY A C    6  
ATOM 6212  O O    . GLY A 1 85  ? 36.000 26.374 8.967  1.00 0.00 ? 55 GLY A O    6  
ATOM 6213  H H    . GLY A 1 85  ? 38.520 25.060 6.077  1.00 0.00 ? 55 GLY A H    6  
ATOM 6214  H HA2  . GLY A 1 85  ? 37.662 24.487 8.224  1.00 0.00 ? 55 GLY A HA2  6  
ATOM 6215  H HA3  . GLY A 1 85  ? 38.690 25.719 8.936  1.00 0.00 ? 55 GLY A HA3  6  
ATOM 6216  N N    . VAL A 1 86  ? 36.827 27.405 7.147  1.00 0.00 ? 56 VAL A N    6  
ATOM 6217  C CA   . VAL A 1 86  ? 35.713 28.345 7.073  1.00 0.00 ? 56 VAL A CA   6  
ATOM 6218  C C    . VAL A 1 86  ? 34.511 27.682 6.404  1.00 0.00 ? 56 VAL A C    6  
ATOM 6219  O O    . VAL A 1 86  ? 34.650 27.017 5.377  1.00 0.00 ? 56 VAL A O    6  
ATOM 6220  C CB   . VAL A 1 86  ? 36.126 29.602 6.295  1.00 0.00 ? 56 VAL A CB   6  
ATOM 6221  C CG1  . VAL A 1 86  ? 34.978 30.616 6.294  1.00 0.00 ? 56 VAL A CG1  6  
ATOM 6222  C CG2  . VAL A 1 86  ? 37.353 30.234 6.960  1.00 0.00 ? 56 VAL A CG2  6  
ATOM 6223  H H    . VAL A 1 86  ? 37.556 27.470 6.491  1.00 0.00 ? 56 VAL A H    6  
ATOM 6224  H HA   . VAL A 1 86  ? 35.434 28.633 8.076  1.00 0.00 ? 56 VAL A HA   6  
ATOM 6225  H HB   . VAL A 1 86  ? 36.367 29.332 5.278  1.00 0.00 ? 56 VAL A HB   6  
ATOM 6226  H HG11 . VAL A 1 86  ? 34.180 30.256 5.661  1.00 0.00 ? 56 VAL A HG11 6  
ATOM 6227  H HG12 . VAL A 1 86  ? 35.335 31.565 5.921  1.00 0.00 ? 56 VAL A HG12 6  
ATOM 6228  H HG13 . VAL A 1 86  ? 34.608 30.742 7.301  1.00 0.00 ? 56 VAL A HG13 6  
ATOM 6229  H HG21 . VAL A 1 86  ? 38.247 29.746 6.603  1.00 0.00 ? 56 VAL A HG21 6  
ATOM 6230  H HG22 . VAL A 1 86  ? 37.282 30.116 8.031  1.00 0.00 ? 56 VAL A HG22 6  
ATOM 6231  H HG23 . VAL A 1 86  ? 37.398 31.286 6.719  1.00 0.00 ? 56 VAL A HG23 6  
ATOM 6232  N N    . GLY A 1 87  ? 33.332 27.867 6.991  1.00 0.00 ? 57 GLY A N    6  
ATOM 6233  C CA   . GLY A 1 87  ? 32.106 27.293 6.441  1.00 0.00 ? 57 GLY A CA   6  
ATOM 6234  C C    . GLY A 1 87  ? 31.160 28.391 5.968  1.00 0.00 ? 57 GLY A C    6  
ATOM 6235  O O    . GLY A 1 87  ? 31.381 29.570 6.243  1.00 0.00 ? 57 GLY A O    6  
ATOM 6236  H H    . GLY A 1 87  ? 33.284 28.404 7.809  1.00 0.00 ? 57 GLY A H    6  
ATOM 6237  H HA2  . GLY A 1 87  ? 32.351 26.648 5.608  1.00 0.00 ? 57 GLY A HA2  6  
ATOM 6238  H HA3  . GLY A 1 87  ? 31.613 26.711 7.205  1.00 0.00 ? 57 GLY A HA3  6  
ATOM 6239  N N    . THR A 1 88  ? 30.091 27.997 5.285  1.00 0.00 ? 58 THR A N    6  
ATOM 6240  C CA   . THR A 1 88  ? 29.145 28.973 4.752  1.00 0.00 ? 58 THR A CA   6  
ATOM 6241  C C    . THR A 1 88  ? 28.526 29.794 5.878  1.00 0.00 ? 58 THR A C    6  
ATOM 6242  O O    . THR A 1 88  ? 28.465 31.021 5.802  1.00 0.00 ? 58 THR A O    6  
ATOM 6243  C CB   . THR A 1 88  ? 28.039 28.259 3.970  1.00 0.00 ? 58 THR A CB   6  
ATOM 6244  O OG1  . THR A 1 88  ? 27.317 27.407 4.848  1.00 0.00 ? 58 THR A OG1  6  
ATOM 6245  C CG2  . THR A 1 88  ? 28.656 27.428 2.842  1.00 0.00 ? 58 THR A CG2  6  
ATOM 6246  H H    . THR A 1 88  ? 29.934 27.041 5.138  1.00 0.00 ? 58 THR A H    6  
ATOM 6247  H HA   . THR A 1 88  ? 29.670 29.638 4.083  1.00 0.00 ? 58 THR A HA   6  
ATOM 6248  H HB   . THR A 1 88  ? 27.369 28.990 3.547  1.00 0.00 ? 58 THR A HB   6  
ATOM 6249  H HG1  . THR A 1 88  ? 26.531 27.805 5.037  1.00 0.00 ? 58 THR A HG1  6  
ATOM 6250  H HG21 . THR A 1 88  ? 29.458 27.985 2.382  1.00 0.00 ? 58 THR A HG21 6  
ATOM 6251  H HG22 . THR A 1 88  ? 27.901 27.208 2.103  1.00 0.00 ? 58 THR A HG22 6  
ATOM 6252  H HG23 . THR A 1 88  ? 29.045 26.505 3.245  1.00 0.00 ? 58 THR A HG23 6  
ATOM 6253  N N    . LYS A 1 89  ? 28.103 29.116 6.942  1.00 0.00 ? 59 LYS A N    6  
ATOM 6254  C CA   . LYS A 1 89  ? 27.475 29.806 8.064  1.00 0.00 ? 59 LYS A CA   6  
ATOM 6255  C C    . LYS A 1 89  ? 28.441 30.809 8.683  1.00 0.00 ? 59 LYS A C    6  
ATOM 6256  O O    . LYS A 1 89  ? 28.067 31.943 8.989  1.00 0.00 ? 59 LYS A O    6  
ATOM 6257  C CB   . LYS A 1 89  ? 27.044 28.791 9.125  1.00 0.00 ? 59 LYS A CB   6  
ATOM 6258  C CG   . LYS A 1 89  ? 25.953 27.883 8.551  1.00 0.00 ? 59 LYS A CG   6  
ATOM 6259  C CD   . LYS A 1 89  ? 25.627 26.764 9.545  1.00 0.00 ? 59 LYS A CD   6  
ATOM 6260  C CE   . LYS A 1 89  ? 24.802 27.310 10.716 1.00 0.00 ? 59 LYS A CE   6  
ATOM 6261  N NZ   . LYS A 1 89  ? 23.351 27.165 10.406 1.00 0.00 ? 59 LYS A NZ   6  
ATOM 6262  H H    . LYS A 1 89  ? 28.215 28.143 6.973  1.00 0.00 ? 59 LYS A H    6  
ATOM 6263  H HA   . LYS A 1 89  ? 26.602 30.332 7.709  1.00 0.00 ? 59 LYS A HA   6  
ATOM 6264  H HB2  . LYS A 1 89  ? 27.897 28.194 9.417  1.00 0.00 ? 59 LYS A HB2  6  
ATOM 6265  H HB3  . LYS A 1 89  ? 26.659 29.316 9.986  1.00 0.00 ? 59 LYS A HB3  6  
ATOM 6266  H HG2  . LYS A 1 89  ? 25.065 28.467 8.362  1.00 0.00 ? 59 LYS A HG2  6  
ATOM 6267  H HG3  . LYS A 1 89  ? 26.300 27.448 7.626  1.00 0.00 ? 59 LYS A HG3  6  
ATOM 6268  H HD2  . LYS A 1 89  ? 25.065 25.992 9.041  1.00 0.00 ? 59 LYS A HD2  6  
ATOM 6269  H HD3  . LYS A 1 89  ? 26.548 26.344 9.924  1.00 0.00 ? 59 LYS A HD3  6  
ATOM 6270  H HE2  . LYS A 1 89  ? 25.034 26.750 11.609 1.00 0.00 ? 59 LYS A HE2  6  
ATOM 6271  H HE3  . LYS A 1 89  ? 25.032 28.352 10.876 1.00 0.00 ? 59 LYS A HE3  6  
ATOM 6272  H HZ1  . LYS A 1 89  ? 22.799 27.241 11.285 1.00 0.00 ? 59 LYS A HZ1  6  
ATOM 6273  H HZ2  . LYS A 1 89  ? 23.183 26.236 9.969  1.00 0.00 ? 59 LYS A HZ2  6  
ATOM 6274  H HZ3  . LYS A 1 89  ? 23.059 27.916 9.750  1.00 0.00 ? 59 LYS A HZ3  6  
ATOM 6275  N N    . ILE A 1 90  ? 29.701 30.407 8.817  1.00 0.00 ? 60 ILE A N    6  
ATOM 6276  C CA   . ILE A 1 90  ? 30.702 31.280 9.416  1.00 0.00 ? 60 ILE A CA   6  
ATOM 6277  C C    . ILE A 1 90  ? 30.918 32.509 8.534  1.00 0.00 ? 60 ILE A C    6  
ATOM 6278  O O    . ILE A 1 90  ? 30.964 33.635 9.029  1.00 0.00 ? 60 ILE A O    6  
ATOM 6279  C CB   . ILE A 1 90  ? 32.014 30.511 9.629  1.00 0.00 ? 60 ILE A CB   6  
ATOM 6280  C CG1  . ILE A 1 90  ? 31.740 29.313 10.545 1.00 0.00 ? 60 ILE A CG1  6  
ATOM 6281  C CG2  . ILE A 1 90  ? 33.049 31.427 10.291 1.00 0.00 ? 60 ILE A CG2  6  
ATOM 6282  C CD1  . ILE A 1 90  ? 32.994 28.442 10.680 1.00 0.00 ? 60 ILE A CD1  6  
ATOM 6283  H H    . ILE A 1 90  ? 29.960 29.513 8.510  1.00 0.00 ? 60 ILE A H    6  
ATOM 6284  H HA   . ILE A 1 90  ? 30.337 31.610 10.378 1.00 0.00 ? 60 ILE A HA   6  
ATOM 6285  H HB   . ILE A 1 90  ? 32.391 30.164 8.678  1.00 0.00 ? 60 ILE A HB   6  
ATOM 6286  H HG12 . ILE A 1 90  ? 31.449 29.672 11.521 1.00 0.00 ? 60 ILE A HG12 6  
ATOM 6287  H HG13 . ILE A 1 90  ? 30.939 28.720 10.130 1.00 0.00 ? 60 ILE A HG13 6  
ATOM 6288  H HG21 . ILE A 1 90  ? 32.647 31.801 11.220 1.00 0.00 ? 60 ILE A HG21 6  
ATOM 6289  H HG22 . ILE A 1 90  ? 33.270 32.255 9.635  1.00 0.00 ? 60 ILE A HG22 6  
ATOM 6290  H HG23 . ILE A 1 90  ? 33.954 30.871 10.486 1.00 0.00 ? 60 ILE A HG23 6  
ATOM 6291  H HD11 . ILE A 1 90  ? 32.799 27.637 11.375 1.00 0.00 ? 60 ILE A HD11 6  
ATOM 6292  H HD12 . ILE A 1 90  ? 33.815 29.040 11.047 1.00 0.00 ? 60 ILE A HD12 6  
ATOM 6293  H HD13 . ILE A 1 90  ? 33.252 28.029 9.717  1.00 0.00 ? 60 ILE A HD13 6  
ATOM 6294  N N    . ALA A 1 91  ? 30.993 32.299 7.223  1.00 0.00 ? 61 ALA A N    6  
ATOM 6295  C CA   . ALA A 1 91  ? 31.192 33.410 6.297  1.00 0.00 ? 61 ALA A CA   6  
ATOM 6296  C C    . ALA A 1 91  ? 30.062 34.427 6.433  1.00 0.00 ? 61 ALA A C    6  
ATOM 6297  O O    . ALA A 1 91  ? 30.306 35.634 6.493  1.00 0.00 ? 61 ALA A O    6  
ATOM 6298  C CB   . ALA A 1 91  ? 31.246 32.890 4.860  1.00 0.00 ? 61 ALA A CB   6  
ATOM 6299  H H    . ALA A 1 91  ? 30.942 31.384 6.876  1.00 0.00 ? 61 ALA A H    6  
ATOM 6300  H HA   . ALA A 1 91  ? 32.128 33.894 6.528  1.00 0.00 ? 61 ALA A HA   6  
ATOM 6301  H HB1  . ALA A 1 91  ? 31.814 33.578 4.250  1.00 0.00 ? 61 ALA A HB1  6  
ATOM 6302  H HB2  . ALA A 1 91  ? 30.242 32.808 4.470  1.00 0.00 ? 61 ALA A HB2  6  
ATOM 6303  H HB3  . ALA A 1 91  ? 31.720 31.921 4.846  1.00 0.00 ? 61 ALA A HB3  6  
ATOM 6304  N N    . GLU A 1 92  ? 28.827 33.937 6.516  1.00 0.00 ? 62 GLU A N    6  
ATOM 6305  C CA   . GLU A 1 92  ? 27.685 34.831 6.677  1.00 0.00 ? 62 GLU A CA   6  
ATOM 6306  C C    . GLU A 1 92  ? 27.790 35.607 7.988  1.00 0.00 ? 62 GLU A C    6  
ATOM 6307  O O    . GLU A 1 92  ? 27.477 36.798 8.034  1.00 0.00 ? 62 GLU A O    6  
ATOM 6308  C CB   . GLU A 1 92  ? 26.382 34.028 6.659  1.00 0.00 ? 62 GLU A CB   6  
ATOM 6309  C CG   . GLU A 1 92  ? 26.203 33.372 5.285  1.00 0.00 ? 62 GLU A CG   6  
ATOM 6310  C CD   . GLU A 1 92  ? 24.873 32.619 5.182  1.00 0.00 ? 62 GLU A CD   6  
ATOM 6311  O OE1  . GLU A 1 92  ? 24.536 32.224 4.079  1.00 0.00 ? 62 GLU A OE1  6  
ATOM 6312  O OE2  . GLU A 1 92  ? 24.209 32.436 6.194  1.00 0.00 ? 62 GLU A OE2  6  
ATOM 6313  H H    . GLU A 1 92  ? 28.681 32.971 6.438  1.00 0.00 ? 62 GLU A H    6  
ATOM 6314  H HA   . GLU A 1 92  ? 27.671 35.532 5.856  1.00 0.00 ? 62 GLU A HA   6  
ATOM 6315  H HB2  . GLU A 1 92  ? 26.420 33.264 7.423  1.00 0.00 ? 62 GLU A HB2  6  
ATOM 6316  H HB3  . GLU A 1 92  ? 25.549 34.688 6.851  1.00 0.00 ? 62 GLU A HB3  6  
ATOM 6317  H HG2  . GLU A 1 92  ? 26.233 34.137 4.524  1.00 0.00 ? 62 GLU A HG2  6  
ATOM 6318  H HG3  . GLU A 1 92  ? 27.015 32.680 5.118  1.00 0.00 ? 62 GLU A HG3  6  
ATOM 6319  N N    . LYS A 1 93  ? 28.267 34.948 9.042  1.00 0.00 ? 63 LYS A N    6  
ATOM 6320  C CA   . LYS A 1 93  ? 28.467 35.630 10.318 1.00 0.00 ? 63 LYS A CA   6  
ATOM 6321  C C    . LYS A 1 93  ? 29.466 36.773 10.159 1.00 0.00 ? 63 LYS A C    6  
ATOM 6322  O O    . LYS A 1 93  ? 29.269 37.860 10.703 1.00 0.00 ? 63 LYS A O    6  
ATOM 6323  C CB   . LYS A 1 93  ? 28.982 34.642 11.368 1.00 0.00 ? 63 LYS A CB   6  
ATOM 6324  C CG   . LYS A 1 93  ? 29.031 35.320 12.741 1.00 0.00 ? 63 LYS A CG   6  
ATOM 6325  C CD   . LYS A 1 93  ? 27.616 35.423 13.317 1.00 0.00 ? 63 LYS A CD   6  
ATOM 6326  C CE   . LYS A 1 93  ? 27.679 36.024 14.722 1.00 0.00 ? 63 LYS A CE   6  
ATOM 6327  N NZ   . LYS A 1 93  ? 26.422 35.702 15.456 1.00 0.00 ? 63 LYS A NZ   6  
ATOM 6328  H H    . LYS A 1 93  ? 28.441 33.986 8.974  1.00 0.00 ? 63 LYS A H    6  
ATOM 6329  H HA   . LYS A 1 93  ? 27.522 36.034 10.649 1.00 0.00 ? 63 LYS A HA   6  
ATOM 6330  H HB2  . LYS A 1 93  ? 28.322 33.789 11.411 1.00 0.00 ? 63 LYS A HB2  6  
ATOM 6331  H HB3  . LYS A 1 93  ? 29.975 34.317 11.096 1.00 0.00 ? 63 LYS A HB3  6  
ATOM 6332  H HG2  . LYS A 1 93  ? 29.651 34.738 13.405 1.00 0.00 ? 63 LYS A HG2  6  
ATOM 6333  H HG3  . LYS A 1 93  ? 29.447 36.311 12.641 1.00 0.00 ? 63 LYS A HG3  6  
ATOM 6334  H HD2  . LYS A 1 93  ? 27.013 36.055 12.682 1.00 0.00 ? 63 LYS A HD2  6  
ATOM 6335  H HD3  . LYS A 1 93  ? 27.176 34.439 13.370 1.00 0.00 ? 63 LYS A HD3  6  
ATOM 6336  H HE2  . LYS A 1 93  ? 28.522 35.610 15.255 1.00 0.00 ? 63 LYS A HE2  6  
ATOM 6337  H HE3  . LYS A 1 93  ? 27.790 37.096 14.651 1.00 0.00 ? 63 LYS A HE3  6  
ATOM 6338  H HZ1  . LYS A 1 93  ? 26.410 36.207 16.364 1.00 0.00 ? 63 LYS A HZ1  6  
ATOM 6339  H HZ2  . LYS A 1 93  ? 26.373 34.677 15.627 1.00 0.00 ? 63 LYS A HZ2  6  
ATOM 6340  H HZ3  . LYS A 1 93  ? 25.603 35.999 14.888 1.00 0.00 ? 63 LYS A HZ3  6  
ATOM 6341  N N    . ILE A 1 94  ? 30.524 36.538 9.386  1.00 0.00 ? 64 ILE A N    6  
ATOM 6342  C CA   . ILE A 1 94  ? 31.513 37.581 9.133  1.00 0.00 ? 64 ILE A CA   6  
ATOM 6343  C C    . ILE A 1 94  ? 30.849 38.769 8.437  1.00 0.00 ? 64 ILE A C    6  
ATOM 6344  O O    . ILE A 1 94  ? 31.081 39.921 8.809  1.00 0.00 ? 64 ILE A O    6  
ATOM 6345  C CB   . ILE A 1 94  ? 32.654 37.012 8.274  1.00 0.00 ? 64 ILE A CB   6  
ATOM 6346  C CG1  . ILE A 1 94  ? 33.341 35.883 9.044  1.00 0.00 ? 64 ILE A CG1  6  
ATOM 6347  C CG2  . ILE A 1 94  ? 33.696 38.091 7.953  1.00 0.00 ? 64 ILE A CG2  6  
ATOM 6348  C CD1  . ILE A 1 94  ? 34.292 35.131 8.112  1.00 0.00 ? 64 ILE A CD1  6  
ATOM 6349  H H    . ILE A 1 94  ? 30.659 35.641 9.015  1.00 0.00 ? 64 ILE A H    6  
ATOM 6350  H HA   . ILE A 1 94  ? 31.919 37.913 10.078 1.00 0.00 ? 64 ILE A HA   6  
ATOM 6351  H HB   . ILE A 1 94  ? 32.247 36.621 7.353  1.00 0.00 ? 64 ILE A HB   6  
ATOM 6352  H HG12 . ILE A 1 94  ? 33.902 36.303 9.868  1.00 0.00 ? 64 ILE A HG12 6  
ATOM 6353  H HG13 . ILE A 1 94  ? 32.600 35.201 9.425  1.00 0.00 ? 64 ILE A HG13 6  
ATOM 6354  H HG21 . ILE A 1 94  ? 34.211 38.376 8.859  1.00 0.00 ? 64 ILE A HG21 6  
ATOM 6355  H HG22 . ILE A 1 94  ? 33.204 38.955 7.532  1.00 0.00 ? 64 ILE A HG22 6  
ATOM 6356  H HG23 . ILE A 1 94  ? 34.408 37.700 7.240  1.00 0.00 ? 64 ILE A HG23 6  
ATOM 6357  H HD11 . ILE A 1 94  ? 34.504 34.156 8.524  1.00 0.00 ? 64 ILE A HD11 6  
ATOM 6358  H HD12 . ILE A 1 94  ? 35.212 35.687 8.012  1.00 0.00 ? 64 ILE A HD12 6  
ATOM 6359  H HD13 . ILE A 1 94  ? 33.831 35.020 7.141  1.00 0.00 ? 64 ILE A HD13 6  
ATOM 6360  N N    . ASP A 1 95  ? 29.992 38.488 7.459  1.00 0.00 ? 65 ASP A N    6  
ATOM 6361  C CA   . ASP A 1 95  ? 29.293 39.556 6.751  1.00 0.00 ? 65 ASP A CA   6  
ATOM 6362  C C    . ASP A 1 95  ? 28.447 40.378 7.719  1.00 0.00 ? 65 ASP A C    6  
ATOM 6363  O O    . ASP A 1 95  ? 28.456 41.608 7.672  1.00 0.00 ? 65 ASP A O    6  
ATOM 6364  C CB   . ASP A 1 95  ? 28.392 38.968 5.661  1.00 0.00 ? 65 ASP A CB   6  
ATOM 6365  C CG   . ASP A 1 95  ? 29.221 38.296 4.567  1.00 0.00 ? 65 ASP A CG   6  
ATOM 6366  O OD1  . ASP A 1 95  ? 30.370 38.672 4.389  1.00 0.00 ? 65 ASP A OD1  6  
ATOM 6367  O OD2  . ASP A 1 95  ? 28.692 37.408 3.920  1.00 0.00 ? 65 ASP A OD2  6  
ATOM 6368  H H    . ASP A 1 95  ? 29.861 37.554 7.186  1.00 0.00 ? 65 ASP A H    6  
ATOM 6369  H HA   . ASP A 1 95  ? 30.022 40.203 6.288  1.00 0.00 ? 65 ASP A HA   6  
ATOM 6370  H HB2  . ASP A 1 95  ? 27.731 38.238 6.103  1.00 0.00 ? 65 ASP A HB2  6  
ATOM 6371  H HB3  . ASP A 1 95  ? 27.804 39.760 5.222  1.00 0.00 ? 65 ASP A HB3  6  
ATOM 6372  N N    . GLU A 1 96  ? 27.749 39.699 8.625  1.00 0.00 ? 66 GLU A N    6  
ATOM 6373  C CA   . GLU A 1 96  ? 26.923 40.396 9.605  1.00 0.00 ? 66 GLU A CA   6  
ATOM 6374  C C    . GLU A 1 96  ? 27.783 41.274 10.511 1.00 0.00 ? 66 GLU A C    6  
ATOM 6375  O O    . GLU A 1 96  ? 27.439 42.428 10.772 1.00 0.00 ? 66 GLU A O    6  
ATOM 6376  C CB   . GLU A 1 96  ? 26.150 39.386 10.455 1.00 0.00 ? 66 GLU A CB   6  
ATOM 6377  C CG   . GLU A 1 96  ? 25.164 38.615 9.569  1.00 0.00 ? 66 GLU A CG   6  
ATOM 6378  C CD   . GLU A 1 96  ? 24.306 37.644 10.387 1.00 0.00 ? 66 GLU A CD   6  
ATOM 6379  O OE1  . GLU A 1 96  ? 24.594 37.429 11.555 1.00 0.00 ? 66 GLU A OE1  6  
ATOM 6380  O OE2  . GLU A 1 96  ? 23.358 37.123 9.822  1.00 0.00 ? 66 GLU A OE2  6  
ATOM 6381  H H    . GLU A 1 96  ? 27.764 38.718 8.612  1.00 0.00 ? 66 GLU A H    6  
ATOM 6382  H HA   . GLU A 1 96  ? 26.216 41.022 9.083  1.00 0.00 ? 66 GLU A HA   6  
ATOM 6383  H HB2  . GLU A 1 96  ? 26.845 38.694 10.912 1.00 0.00 ? 66 GLU A HB2  6  
ATOM 6384  H HB3  . GLU A 1 96  ? 25.604 39.908 11.227 1.00 0.00 ? 66 GLU A HB3  6  
ATOM 6385  H HG2  . GLU A 1 96  ? 24.517 39.319 9.070  1.00 0.00 ? 66 GLU A HG2  6  
ATOM 6386  H HG3  . GLU A 1 96  ? 25.719 38.059 8.829  1.00 0.00 ? 66 GLU A HG3  6  
ATOM 6387  N N    . PHE A 1 97  ? 28.917 40.741 10.962 1.00 0.00 ? 67 PHE A N    6  
ATOM 6388  C CA   . PHE A 1 97  ? 29.796 41.504 11.840 1.00 0.00 ? 67 PHE A CA   6  
ATOM 6389  C C    . PHE A 1 97  ? 30.269 42.780 11.149 1.00 0.00 ? 67 PHE A C    6  
ATOM 6390  O O    . PHE A 1 97  ? 30.362 43.833 11.780 1.00 0.00 ? 67 PHE A O    6  
ATOM 6391  C CB   . PHE A 1 97  ? 31.009 40.656 12.228 1.00 0.00 ? 67 PHE A CB   6  
ATOM 6392  C CG   . PHE A 1 97  ? 31.900 41.317 13.254 1.00 0.00 ? 67 PHE A CG   6  
ATOM 6393  C CD1  . PHE A 1 97  ? 32.988 42.095 12.839 1.00 0.00 ? 67 PHE A CD1  6  
ATOM 6394  C CD2  . PHE A 1 97  ? 31.636 41.152 14.618 1.00 0.00 ? 67 PHE A CD2  6  
ATOM 6395  C CE1  . PHE A 1 97  ? 33.812 42.708 13.790 1.00 0.00 ? 67 PHE A CE1  6  
ATOM 6396  C CE2  . PHE A 1 97  ? 32.461 41.765 15.569 1.00 0.00 ? 67 PHE A CE2  6  
ATOM 6397  C CZ   . PHE A 1 97  ? 33.549 42.543 15.155 1.00 0.00 ? 67 PHE A CZ   6  
ATOM 6398  H H    . PHE A 1 97  ? 29.146 39.818 10.726 1.00 0.00 ? 67 PHE A H    6  
ATOM 6399  H HA   . PHE A 1 97  ? 29.255 41.769 12.735 1.00 0.00 ? 67 PHE A HA   6  
ATOM 6400  H HB2  . PHE A 1 97  ? 30.661 39.718 12.634 1.00 0.00 ? 67 PHE A HB2  6  
ATOM 6401  H HB3  . PHE A 1 97  ? 31.587 40.453 11.338 1.00 0.00 ? 67 PHE A HB3  6  
ATOM 6402  H HD1  . PHE A 1 97  ? 33.192 42.221 11.786 1.00 0.00 ? 67 PHE A HD1  6  
ATOM 6403  H HD2  . PHE A 1 97  ? 30.798 40.551 14.938 1.00 0.00 ? 67 PHE A HD2  6  
ATOM 6404  H HE1  . PHE A 1 97  ? 34.651 43.308 13.471 1.00 0.00 ? 67 PHE A HE1  6  
ATOM 6405  H HE2  . PHE A 1 97  ? 32.257 41.638 16.623 1.00 0.00 ? 67 PHE A HE2  6  
ATOM 6406  H HZ   . PHE A 1 97  ? 34.184 43.017 15.889 1.00 0.00 ? 67 PHE A HZ   6  
ATOM 6407  N N    . LEU A 1 98  ? 30.579 42.682 9.859  1.00 0.00 ? 68 LEU A N    6  
ATOM 6408  C CA   . LEU A 1 98  ? 30.936 43.866 9.086  1.00 0.00 ? 68 LEU A CA   6  
ATOM 6409  C C    . LEU A 1 98  ? 29.763 44.841 9.002  1.00 0.00 ? 68 LEU A C    6  
ATOM 6410  O O    . LEU A 1 98  ? 29.950 46.055 9.080  1.00 0.00 ? 68 LEU A O    6  
ATOM 6411  C CB   . LEU A 1 98  ? 31.369 43.459 7.676  1.00 0.00 ? 68 LEU A CB   6  
ATOM 6412  C CG   . LEU A 1 98  ? 32.612 42.569 7.756  1.00 0.00 ? 68 LEU A CG   6  
ATOM 6413  C CD1  . LEU A 1 98  ? 32.925 42.004 6.369  1.00 0.00 ? 68 LEU A CD1  6  
ATOM 6414  C CD2  . LEU A 1 98  ? 33.803 43.397 8.246  1.00 0.00 ? 68 LEU A CD2  6  
ATOM 6415  H H    . LEU A 1 98  ? 30.597 41.799 9.431  1.00 0.00 ? 68 LEU A H    6  
ATOM 6416  H HA   . LEU A 1 98  ? 31.762 44.362 9.573  1.00 0.00 ? 68 LEU A HA   6  
ATOM 6417  H HB2  . LEU A 1 98  ? 30.567 42.917 7.197  1.00 0.00 ? 68 LEU A HB2  6  
ATOM 6418  H HB3  . LEU A 1 98  ? 31.600 44.343 7.101  1.00 0.00 ? 68 LEU A HB3  6  
ATOM 6419  H HG   . LEU A 1 98  ? 32.430 41.756 8.444  1.00 0.00 ? 68 LEU A HG   6  
ATOM 6420  H HD11 . LEU A 1 98  ? 33.974 41.753 6.308  1.00 0.00 ? 68 LEU A HD11 6  
ATOM 6421  H HD12 . LEU A 1 98  ? 32.690 42.743 5.618  1.00 0.00 ? 68 LEU A HD12 6  
ATOM 6422  H HD13 . LEU A 1 98  ? 32.333 41.117 6.200  1.00 0.00 ? 68 LEU A HD13 6  
ATOM 6423  H HD21 . LEU A 1 98  ? 33.745 44.391 7.828  1.00 0.00 ? 68 LEU A HD21 6  
ATOM 6424  H HD22 . LEU A 1 98  ? 34.723 42.927 7.931  1.00 0.00 ? 68 LEU A HD22 6  
ATOM 6425  H HD23 . LEU A 1 98  ? 33.781 43.458 9.325  1.00 0.00 ? 68 LEU A HD23 6  
ATOM 6426  N N    . ALA A 1 99  ? 28.556 44.306 8.842  1.00 0.00 ? 69 ALA A N    6  
ATOM 6427  C CA   . ALA A 1 99  ? 27.362 45.147 8.776  1.00 0.00 ? 69 ALA A CA   6  
ATOM 6428  C C    . ALA A 1 99  ? 27.151 45.932 10.071 1.00 0.00 ? 69 ALA A C    6  
ATOM 6429  O O    . ALA A 1 99  ? 26.661 47.060 10.045 1.00 0.00 ? 69 ALA A O    6  
ATOM 6430  C CB   . ALA A 1 99  ? 26.133 44.281 8.502  1.00 0.00 ? 69 ALA A CB   6  
ATOM 6431  H H    . ALA A 1 99  ? 28.470 43.337 8.720  1.00 0.00 ? 69 ALA A H    6  
ATOM 6432  H HA   . ALA A 1 99  ? 27.476 45.848 7.962  1.00 0.00 ? 69 ALA A HA   6  
ATOM 6433  H HB1  . ALA A 1 99  ? 25.335 44.899 8.118  1.00 0.00 ? 69 ALA A HB1  6  
ATOM 6434  H HB2  . ALA A 1 99  ? 25.813 43.809 9.420  1.00 0.00 ? 69 ALA A HB2  6  
ATOM 6435  H HB3  . ALA A 1 99  ? 26.383 43.521 7.775  1.00 0.00 ? 69 ALA A HB3  6  
ATOM 6436  N N    . THR A 1 100 ? 27.519 45.335 11.202 1.00 0.00 ? 70 THR A N    6  
ATOM 6437  C CA   . THR A 1 100 ? 27.430 46.032 12.485 1.00 0.00 ? 70 THR A CA   6  
ATOM 6438  C C    . THR A 1 100 ? 28.540 47.075 12.664 1.00 0.00 ? 70 THR A C    6  
ATOM 6439  O O    . THR A 1 100 ? 28.401 47.990 13.475 1.00 0.00 ? 70 THR A O    6  
ATOM 6440  C CB   . THR A 1 100 ? 27.493 45.024 13.636 1.00 0.00 ? 70 THR A CB   6  
ATOM 6441  O OG1  . THR A 1 100 ? 28.746 44.357 13.613 1.00 0.00 ? 70 THR A OG1  6  
ATOM 6442  C CG2  . THR A 1 100 ? 26.363 44.003 13.491 1.00 0.00 ? 70 THR A CG2  6  
ATOM 6443  H H    . THR A 1 100 ? 27.808 44.398 11.176 1.00 0.00 ? 70 THR A H    6  
ATOM 6444  H HA   . THR A 1 100 ? 26.478 46.537 12.532 1.00 0.00 ? 70 THR A HA   6  
ATOM 6445  H HB   . THR A 1 100 ? 27.381 45.545 14.575 1.00 0.00 ? 70 THR A HB   6  
ATOM 6446  H HG1  . THR A 1 100 ? 28.809 43.860 14.362 1.00 0.00 ? 70 THR A HG1  6  
ATOM 6447  H HG21 . THR A 1 100 ? 26.460 43.247 14.256 1.00 0.00 ? 70 THR A HG21 6  
ATOM 6448  H HG22 . THR A 1 100 ? 26.419 43.538 12.517 1.00 0.00 ? 70 THR A HG22 6  
ATOM 6449  H HG23 . THR A 1 100 ? 25.411 44.502 13.597 1.00 0.00 ? 70 THR A HG23 6  
ATOM 6450  N N    . GLY A 1 101 ? 29.637 46.947 11.917 1.00 0.00 ? 71 GLY A N    6  
ATOM 6451  C CA   . GLY A 1 101 ? 30.742 47.895 12.022 1.00 0.00 ? 71 GLY A CA   6  
ATOM 6452  C C    . GLY A 1 101 ? 31.933 47.265 12.735 1.00 0.00 ? 71 GLY A C    6  
ATOM 6453  O O    . GLY A 1 101 ? 32.335 47.713 13.809 1.00 0.00 ? 71 GLY A O    6  
ATOM 6454  H H    . GLY A 1 101 ? 29.702 46.202 11.284 1.00 0.00 ? 71 GLY A H    6  
ATOM 6455  H HA2  . GLY A 1 101 ? 31.041 48.200 11.029 1.00 0.00 ? 71 GLY A HA2  6  
ATOM 6456  H HA3  . GLY A 1 101 ? 30.419 48.763 12.577 1.00 0.00 ? 71 GLY A HA3  6  
ATOM 6457  N N    . GLU A 1 31  ? 48.227 42.455 18.151 1.00 0.00 ? 1  GLU A N    7  
ATOM 6458  C CA   . GLU A 1 31  ? 46.789 42.377 17.916 1.00 0.00 ? 1  GLU A CA   7  
ATOM 6459  C C    . GLU A 1 31  ? 46.499 42.118 16.442 1.00 0.00 ? 1  GLU A C    7  
ATOM 6460  O O    . GLU A 1 31  ? 46.487 43.042 15.630 1.00 0.00 ? 1  GLU A O    7  
ATOM 6461  C CB   . GLU A 1 31  ? 46.118 43.682 18.348 1.00 0.00 ? 1  GLU A CB   7  
ATOM 6462  C CG   . GLU A 1 31  ? 46.315 43.886 19.855 1.00 0.00 ? 1  GLU A CG   7  
ATOM 6463  C CD   . GLU A 1 31  ? 45.590 45.139 20.359 1.00 0.00 ? 1  GLU A CD   7  
ATOM 6464  O OE1  . GLU A 1 31  ? 45.509 45.294 21.566 1.00 0.00 ? 1  GLU A OE1  7  
ATOM 6465  O OE2  . GLU A 1 31  ? 45.133 45.932 19.548 1.00 0.00 ? 1  GLU A OE2  7  
ATOM 6466  H H    . GLU A 1 31  ? 48.598 42.168 19.012 1.00 0.00 ? 1  GLU A H    7  
ATOM 6467  H HA   . GLU A 1 31  ? 46.381 41.566 18.502 1.00 0.00 ? 1  GLU A HA   7  
ATOM 6468  H HB2  . GLU A 1 31  ? 46.560 44.509 17.811 1.00 0.00 ? 1  GLU A HB2  7  
ATOM 6469  H HB3  . GLU A 1 31  ? 45.062 43.634 18.131 1.00 0.00 ? 1  GLU A HB3  7  
ATOM 6470  H HG2  . GLU A 1 31  ? 45.933 43.024 20.381 1.00 0.00 ? 1  GLU A HG2  7  
ATOM 6471  H HG3  . GLU A 1 31  ? 47.370 43.983 20.062 1.00 0.00 ? 1  GLU A HG3  7  
ATOM 6472  N N    . THR A 1 32  ? 46.267 40.854 16.103 1.00 0.00 ? 2  THR A N    7  
ATOM 6473  C CA   . THR A 1 32  ? 45.966 40.486 14.724 1.00 0.00 ? 2  THR A CA   7  
ATOM 6474  C C    . THR A 1 32  ? 44.725 41.225 14.236 1.00 0.00 ? 2  THR A C    7  
ATOM 6475  O O    . THR A 1 32  ? 43.754 41.381 14.975 1.00 0.00 ? 2  THR A O    7  
ATOM 6476  C CB   . THR A 1 32  ? 45.738 38.976 14.626 1.00 0.00 ? 2  THR A CB   7  
ATOM 6477  O OG1  . THR A 1 32  ? 46.830 38.295 15.228 1.00 0.00 ? 2  THR A OG1  7  
ATOM 6478  C CG2  . THR A 1 32  ? 45.632 38.567 13.157 1.00 0.00 ? 2  THR A CG2  7  
ATOM 6479  H H    . THR A 1 32  ? 46.298 40.157 16.792 1.00 0.00 ? 2  THR A H    7  
ATOM 6480  H HA   . THR A 1 32  ? 46.804 40.754 14.098 1.00 0.00 ? 2  THR A HA   7  
ATOM 6481  H HB   . THR A 1 32  ? 44.824 38.715 15.136 1.00 0.00 ? 2  THR A HB   7  
ATOM 6482  H HG1  . THR A 1 32  ? 46.676 38.251 16.114 1.00 0.00 ? 2  THR A HG1  7  
ATOM 6483  H HG21 . THR A 1 32  ? 45.293 37.544 13.093 1.00 0.00 ? 2  THR A HG21 7  
ATOM 6484  H HG22 . THR A 1 32  ? 46.599 38.656 12.686 1.00 0.00 ? 2  THR A HG22 7  
ATOM 6485  H HG23 . THR A 1 32  ? 44.925 39.210 12.654 1.00 0.00 ? 2  THR A HG23 7  
ATOM 6486  N N    . LEU A 1 33  ? 44.732 41.622 12.969 1.00 0.00 ? 3  LEU A N    7  
ATOM 6487  C CA   . LEU A 1 33  ? 43.643 42.431 12.428 1.00 0.00 ? 3  LEU A CA   7  
ATOM 6488  C C    . LEU A 1 33  ? 42.286 41.737 12.562 1.00 0.00 ? 3  LEU A C    7  
ATOM 6489  O O    . LEU A 1 33  ? 41.259 42.403 12.689 1.00 0.00 ? 3  LEU A O    7  
ATOM 6490  C CB   . LEU A 1 33  ? 43.903 42.713 10.947 1.00 0.00 ? 3  LEU A CB   7  
ATOM 6491  C CG   . LEU A 1 33  ? 45.242 43.433 10.776 1.00 0.00 ? 3  LEU A CG   7  
ATOM 6492  C CD1  . LEU A 1 33  ? 45.590 43.509 9.288  1.00 0.00 ? 3  LEU A CD1  7  
ATOM 6493  C CD2  . LEU A 1 33  ? 45.131 44.851 11.339 1.00 0.00 ? 3  LEU A CD2  7  
ATOM 6494  H H    . LEU A 1 33  ? 45.478 41.366 12.388 1.00 0.00 ? 3  LEU A H    7  
ATOM 6495  H HA   . LEU A 1 33  ? 43.610 43.372 12.956 1.00 0.00 ? 3  LEU A HA   7  
ATOM 6496  H HB2  . LEU A 1 33  ? 43.925 41.779 10.404 1.00 0.00 ? 3  LEU A HB2  7  
ATOM 6497  H HB3  . LEU A 1 33  ? 43.111 43.334 10.562 1.00 0.00 ? 3  LEU A HB3  7  
ATOM 6498  H HG   . LEU A 1 33  ? 46.015 42.892 11.302 1.00 0.00 ? 3  LEU A HG   7  
ATOM 6499  H HD11 . LEU A 1 33  ? 44.858 44.115 8.776  1.00 0.00 ? 3  LEU A HD11 7  
ATOM 6500  H HD12 . LEU A 1 33  ? 45.592 42.514 8.868  1.00 0.00 ? 3  LEU A HD12 7  
ATOM 6501  H HD13 . LEU A 1 33  ? 46.570 43.950 9.170  1.00 0.00 ? 3  LEU A HD13 7  
ATOM 6502  H HD21 . LEU A 1 33  ? 44.258 45.333 10.927 1.00 0.00 ? 3  LEU A HD21 7  
ATOM 6503  H HD22 . LEU A 1 33  ? 46.013 45.414 11.071 1.00 0.00 ? 3  LEU A HD22 7  
ATOM 6504  H HD23 . LEU A 1 33  ? 45.044 44.806 12.415 1.00 0.00 ? 3  LEU A HD23 7  
ATOM 6505  N N    . ASN A 1 34  ? 42.278 40.407 12.536 1.00 0.00 ? 4  ASN A N    7  
ATOM 6506  C CA   . ASN A 1 34  ? 41.027 39.656 12.639 1.00 0.00 ? 4  ASN A CA   7  
ATOM 6507  C C    . ASN A 1 34  ? 40.727 39.184 14.071 1.00 0.00 ? 4  ASN A C    7  
ATOM 6508  O O    . ASN A 1 34  ? 39.772 38.434 14.284 1.00 0.00 ? 4  ASN A O    7  
ATOM 6509  C CB   . ASN A 1 34  ? 41.080 38.438 11.712 1.00 0.00 ? 4  ASN A CB   7  
ATOM 6510  C CG   . ASN A 1 34  ? 41.397 38.867 10.280 1.00 0.00 ? 4  ASN A CG   7  
ATOM 6511  O OD1  . ASN A 1 34  ? 40.771 39.782 9.742  1.00 0.00 ? 4  ASN A OD1  7  
ATOM 6512  N ND2  . ASN A 1 34  ? 42.336 38.245 9.619  1.00 0.00 ? 4  ASN A ND2  7  
ATOM 6513  H H    . ASN A 1 34  ? 43.125 39.923 12.447 1.00 0.00 ? 4  ASN A H    7  
ATOM 6514  H HA   . ASN A 1 34  ? 40.218 40.291 12.312 1.00 0.00 ? 4  ASN A HA   7  
ATOM 6515  H HB2  . ASN A 1 34  ? 41.847 37.760 12.058 1.00 0.00 ? 4  ASN A HB2  7  
ATOM 6516  H HB3  . ASN A 1 34  ? 40.126 37.933 11.728 1.00 0.00 ? 4  ASN A HB3  7  
ATOM 6517  H HD21 . ASN A 1 34  ? 42.821 37.503 10.038 1.00 0.00 ? 4  ASN A HD21 7  
ATOM 6518  H HD22 . ASN A 1 34  ? 42.566 38.531 8.710  1.00 0.00 ? 4  ASN A HD22 7  
ATOM 6519  N N    . GLY A 1 35  ? 41.516 39.616 15.058 1.00 0.00 ? 5  GLY A N    7  
ATOM 6520  C CA   . GLY A 1 35  ? 41.377 39.103 16.417 1.00 0.00 ? 5  GLY A CA   7  
ATOM 6521  C C    . GLY A 1 35  ? 39.948 39.242 16.928 1.00 0.00 ? 5  GLY A C    7  
ATOM 6522  O O    . GLY A 1 35  ? 39.434 38.342 17.594 1.00 0.00 ? 5  GLY A O    7  
ATOM 6523  H H    . GLY A 1 35  ? 42.195 40.296 14.872 1.00 0.00 ? 5  GLY A H    7  
ATOM 6524  H HA2  . GLY A 1 35  ? 41.657 38.059 16.429 1.00 0.00 ? 5  GLY A HA2  7  
ATOM 6525  H HA3  . GLY A 1 35  ? 42.038 39.652 17.070 1.00 0.00 ? 5  GLY A HA3  7  
ATOM 6526  N N    . ALA A 1 36  ? 39.297 40.354 16.595 1.00 0.00 ? 6  ALA A N    7  
ATOM 6527  C CA   . ALA A 1 36  ? 37.936 40.584 17.067 1.00 0.00 ? 6  ALA A CA   7  
ATOM 6528  C C    . ALA A 1 36  ? 37.010 39.478 16.569 1.00 0.00 ? 6  ALA A C    7  
ATOM 6529  O O    . ALA A 1 36  ? 36.252 38.891 17.344 1.00 0.00 ? 6  ALA A O    7  
ATOM 6530  C CB   . ALA A 1 36  ? 37.431 41.939 16.571 1.00 0.00 ? 6  ALA A CB   7  
ATOM 6531  H H    . ALA A 1 36  ? 39.735 41.023 16.028 1.00 0.00 ? 6  ALA A H    7  
ATOM 6532  H HA   . ALA A 1 36  ? 37.933 40.584 18.147 1.00 0.00 ? 6  ALA A HA   7  
ATOM 6533  H HB1  . ALA A 1 36  ? 37.763 42.097 15.555 1.00 0.00 ? 6  ALA A HB1  7  
ATOM 6534  H HB2  . ALA A 1 36  ? 37.822 42.723 17.203 1.00 0.00 ? 6  ALA A HB2  7  
ATOM 6535  H HB3  . ALA A 1 36  ? 36.352 41.956 16.603 1.00 0.00 ? 6  ALA A HB3  7  
ATOM 6536  N N    . LEU A 1 37  ? 37.101 39.170 15.277 1.00 0.00 ? 7  LEU A N    7  
ATOM 6537  C CA   . LEU A 1 37  ? 36.297 38.090 14.715 1.00 0.00 ? 7  LEU A CA   7  
ATOM 6538  C C    . LEU A 1 37  ? 36.649 36.753 15.362 1.00 0.00 ? 7  LEU A C    7  
ATOM 6539  O O    . LEU A 1 37  ? 35.767 35.931 15.610 1.00 0.00 ? 7  LEU A O    7  
ATOM 6540  C CB   . LEU A 1 37  ? 36.517 38.007 13.202 1.00 0.00 ? 7  LEU A CB   7  
ATOM 6541  C CG   . LEU A 1 37  ? 35.992 39.282 12.537 1.00 0.00 ? 7  LEU A CG   7  
ATOM 6542  C CD1  . LEU A 1 37  ? 36.411 39.308 11.066 1.00 0.00 ? 7  LEU A CD1  7  
ATOM 6543  C CD2  . LEU A 1 37  ? 34.464 39.304 12.620 1.00 0.00 ? 7  LEU A CD2  7  
ATOM 6544  H H    . LEU A 1 37  ? 37.711 39.674 14.700 1.00 0.00 ? 7  LEU A H    7  
ATOM 6545  H HA   . LEU A 1 37  ? 35.255 38.299 14.903 1.00 0.00 ? 7  LEU A HA   7  
ATOM 6546  H HB2  . LEU A 1 37  ? 37.572 37.901 12.997 1.00 0.00 ? 7  LEU A HB2  7  
ATOM 6547  H HB3  . LEU A 1 37  ? 35.986 37.154 12.807 1.00 0.00 ? 7  LEU A HB3  7  
ATOM 6548  H HG   . LEU A 1 37  ? 36.395 40.146 13.044 1.00 0.00 ? 7  LEU A HG   7  
ATOM 6549  H HD11 . LEU A 1 37  ? 37.432 39.653 10.989 1.00 0.00 ? 7  LEU A HD11 7  
ATOM 6550  H HD12 . LEU A 1 37  ? 35.762 39.978 10.521 1.00 0.00 ? 7  LEU A HD12 7  
ATOM 6551  H HD13 . LEU A 1 37  ? 36.334 38.314 10.652 1.00 0.00 ? 7  LEU A HD13 7  
ATOM 6552  H HD21 . LEU A 1 37  ? 34.162 39.638 13.602 1.00 0.00 ? 7  LEU A HD21 7  
ATOM 6553  H HD22 . LEU A 1 37  ? 34.079 38.312 12.442 1.00 0.00 ? 7  LEU A HD22 7  
ATOM 6554  H HD23 . LEU A 1 37  ? 34.074 39.980 11.873 1.00 0.00 ? 7  LEU A HD23 7  
ATOM 6555  N N    . VAL A 1 38  ? 37.927 36.553 15.677 1.00 0.00 ? 8  VAL A N    7  
ATOM 6556  C CA   . VAL A 1 38  ? 38.350 35.316 16.326 1.00 0.00 ? 8  VAL A CA   7  
ATOM 6557  C C    . VAL A 1 38  ? 37.636 35.165 17.669 1.00 0.00 ? 8  VAL A C    7  
ATOM 6558  O O    . VAL A 1 38  ? 37.135 34.087 17.997 1.00 0.00 ? 8  VAL A O    7  
ATOM 6559  C CB   . VAL A 1 38  ? 39.874 35.330 16.524 1.00 0.00 ? 8  VAL A CB   7  
ATOM 6560  C CG1  . VAL A 1 38  ? 40.348 34.044 17.210 1.00 0.00 ? 8  VAL A CG1  7  
ATOM 6561  C CG2  . VAL A 1 38  ? 40.567 35.441 15.163 1.00 0.00 ? 8  VAL A CG2  7  
ATOM 6562  H H    . VAL A 1 38  ? 38.595 37.230 15.439 1.00 0.00 ? 8  VAL A H    7  
ATOM 6563  H HA   . VAL A 1 38  ? 38.087 34.480 15.693 1.00 0.00 ? 8  VAL A HA   7  
ATOM 6564  H HB   . VAL A 1 38  ? 40.145 36.180 17.133 1.00 0.00 ? 8  VAL A HB   7  
ATOM 6565  H HG11 . VAL A 1 38  ? 40.229 33.210 16.534 1.00 0.00 ? 8  VAL A HG11 7  
ATOM 6566  H HG12 . VAL A 1 38  ? 39.765 33.871 18.102 1.00 0.00 ? 8  VAL A HG12 7  
ATOM 6567  H HG13 . VAL A 1 38  ? 41.390 34.143 17.477 1.00 0.00 ? 8  VAL A HG13 7  
ATOM 6568  H HG21 . VAL A 1 38  ? 40.050 36.161 14.548 1.00 0.00 ? 8  VAL A HG21 7  
ATOM 6569  H HG22 . VAL A 1 38  ? 40.554 34.478 14.674 1.00 0.00 ? 8  VAL A HG22 7  
ATOM 6570  H HG23 . VAL A 1 38  ? 41.589 35.757 15.305 1.00 0.00 ? 8  VAL A HG23 7  
ATOM 6571  N N    . ASN A 1 39  ? 37.556 36.257 18.425 1.00 0.00 ? 9  ASN A N    7  
ATOM 6572  C CA   . ASN A 1 39  ? 36.871 36.220 19.713 1.00 0.00 ? 9  ASN A CA   7  
ATOM 6573  C C    . ASN A 1 39  ? 35.397 35.870 19.532 1.00 0.00 ? 9  ASN A C    7  
ATOM 6574  O O    . ASN A 1 39  ? 34.854 35.033 20.256 1.00 0.00 ? 9  ASN A O    7  
ATOM 6575  C CB   . ASN A 1 39  ? 36.994 37.579 20.408 1.00 0.00 ? 9  ASN A CB   7  
ATOM 6576  C CG   . ASN A 1 39  ? 38.455 37.880 20.731 1.00 0.00 ? 9  ASN A CG   7  
ATOM 6577  O OD1  . ASN A 1 39  ? 39.277 36.968 20.821 1.00 0.00 ? 9  ASN A OD1  7  
ATOM 6578  N ND2  . ASN A 1 39  ? 38.828 39.116 20.914 1.00 0.00 ? 9  ASN A ND2  7  
ATOM 6579  H H    . ASN A 1 39  ? 37.988 37.084 18.128 1.00 0.00 ? 9  ASN A H    7  
ATOM 6580  H HA   . ASN A 1 39  ? 37.335 35.469 20.335 1.00 0.00 ? 9  ASN A HA   7  
ATOM 6581  H HB2  . ASN A 1 39  ? 36.605 38.348 19.757 1.00 0.00 ? 9  ASN A HB2  7  
ATOM 6582  H HB3  . ASN A 1 39  ? 36.422 37.564 21.323 1.00 0.00 ? 9  ASN A HB3  7  
ATOM 6583  H HD21 . ASN A 1 39  ? 38.174 39.842 20.842 1.00 0.00 ? 9  ASN A HD21 7  
ATOM 6584  H HD22 . ASN A 1 39  ? 39.765 39.320 21.122 1.00 0.00 ? 9  ASN A HD22 7  
ATOM 6585  N N    . MET A 1 40  ? 34.761 36.486 18.538 1.00 0.00 ? 10 MET A N    7  
ATOM 6586  C CA   . MET A 1 40  ? 33.353 36.207 18.276 1.00 0.00 ? 10 MET A CA   7  
ATOM 6587  C C    . MET A 1 40  ? 33.151 34.736 17.926 1.00 0.00 ? 10 MET A C    7  
ATOM 6588  O O    . MET A 1 40  ? 32.196 34.108 18.389 1.00 0.00 ? 10 MET A O    7  
ATOM 6589  C CB   . MET A 1 40  ? 32.859 37.085 17.123 1.00 0.00 ? 10 MET A CB   7  
ATOM 6590  C CG   . MET A 1 40  ? 31.351 36.901 16.944 1.00 0.00 ? 10 MET A CG   7  
ATOM 6591  S SD   . MET A 1 40  ? 30.794 37.854 15.508 1.00 0.00 ? 10 MET A SD   7  
ATOM 6592  C CE   . MET A 1 40  ? 31.527 36.801 14.232 1.00 0.00 ? 10 MET A CE   7  
ATOM 6593  H H    . MET A 1 40  ? 35.233 37.160 18.001 1.00 0.00 ? 10 MET A H    7  
ATOM 6594  H HA   . MET A 1 40  ? 32.780 36.440 19.161 1.00 0.00 ? 10 MET A HA   7  
ATOM 6595  H HB2  . MET A 1 40  ? 33.072 38.121 17.345 1.00 0.00 ? 10 MET A HB2  7  
ATOM 6596  H HB3  . MET A 1 40  ? 33.364 36.800 16.213 1.00 0.00 ? 10 MET A HB3  7  
ATOM 6597  H HG2  . MET A 1 40  ? 31.132 35.854 16.789 1.00 0.00 ? 10 MET A HG2  7  
ATOM 6598  H HG3  . MET A 1 40  ? 30.838 37.248 17.828 1.00 0.00 ? 10 MET A HG3  7  
ATOM 6599  H HE1  . MET A 1 40  ? 32.602 36.902 14.257 1.00 0.00 ? 10 MET A HE1  7  
ATOM 6600  H HE2  . MET A 1 40  ? 31.164 37.103 13.261 1.00 0.00 ? 10 MET A HE2  7  
ATOM 6601  H HE3  . MET A 1 40  ? 31.252 35.772 14.413 1.00 0.00 ? 10 MET A HE3  7  
ATOM 6602  N N    . LEU A 1 41  ? 34.076 34.174 17.151 1.00 0.00 ? 11 LEU A N    7  
ATOM 6603  C CA   . LEU A 1 41  ? 34.004 32.756 16.815 1.00 0.00 ? 11 LEU A CA   7  
ATOM 6604  C C    . LEU A 1 41  ? 34.110 31.895 18.068 1.00 0.00 ? 11 LEU A C    7  
ATOM 6605  O O    . LEU A 1 41  ? 33.383 30.912 18.212 1.00 0.00 ? 11 LEU A O    7  
ATOM 6606  C CB   . LEU A 1 41  ? 35.122 32.385 15.840 1.00 0.00 ? 11 LEU A CB   7  
ATOM 6607  C CG   . LEU A 1 41  ? 34.884 33.077 14.496 1.00 0.00 ? 11 LEU A CG   7  
ATOM 6608  C CD1  . LEU A 1 41  ? 36.120 32.908 13.610 1.00 0.00 ? 11 LEU A CD1  7  
ATOM 6609  C CD2  . LEU A 1 41  ? 33.677 32.442 13.801 1.00 0.00 ? 11 LEU A CD2  7  
ATOM 6610  H H    . LEU A 1 41  ? 34.794 34.723 16.777 1.00 0.00 ? 11 LEU A H    7  
ATOM 6611  H HA   . LEU A 1 41  ? 33.053 32.561 16.342 1.00 0.00 ? 11 LEU A HA   7  
ATOM 6612  H HB2  . LEU A 1 41  ? 36.072 32.702 16.246 1.00 0.00 ? 11 LEU A HB2  7  
ATOM 6613  H HB3  . LEU A 1 41  ? 35.132 31.315 15.693 1.00 0.00 ? 11 LEU A HB3  7  
ATOM 6614  H HG   . LEU A 1 41  ? 34.698 34.128 14.658 1.00 0.00 ? 11 LEU A HG   7  
ATOM 6615  H HD11 . LEU A 1 41  ? 36.925 33.516 13.995 1.00 0.00 ? 11 LEU A HD11 7  
ATOM 6616  H HD12 . LEU A 1 41  ? 35.886 33.217 12.603 1.00 0.00 ? 11 LEU A HD12 7  
ATOM 6617  H HD13 . LEU A 1 41  ? 36.422 31.871 13.609 1.00 0.00 ? 11 LEU A HD13 7  
ATOM 6618  H HD21 . LEU A 1 41  ? 32.768 32.818 14.246 1.00 0.00 ? 11 LEU A HD21 7  
ATOM 6619  H HD22 . LEU A 1 41  ? 33.718 31.370 13.918 1.00 0.00 ? 11 LEU A HD22 7  
ATOM 6620  H HD23 . LEU A 1 41  ? 33.694 32.691 12.750 1.00 0.00 ? 11 LEU A HD23 7  
ATOM 6621  N N    . LYS A 1 42  ? 34.997 32.278 18.983 1.00 0.00 ? 12 LYS A N    7  
ATOM 6622  C CA   . LYS A 1 42  ? 35.161 31.522 20.220 1.00 0.00 ? 12 LYS A CA   7  
ATOM 6623  C C    . LYS A 1 42  ? 33.850 31.475 20.998 1.00 0.00 ? 12 LYS A C    7  
ATOM 6624  O O    . LYS A 1 42  ? 33.451 30.421 21.497 1.00 0.00 ? 12 LYS A O    7  
ATOM 6625  C CB   . LYS A 1 42  ? 36.246 32.176 21.081 1.00 0.00 ? 12 LYS A CB   7  
ATOM 6626  C CG   . LYS A 1 42  ? 36.533 31.315 22.314 1.00 0.00 ? 12 LYS A CG   7  
ATOM 6627  C CD   . LYS A 1 42  ? 37.362 30.094 21.910 1.00 0.00 ? 12 LYS A CD   7  
ATOM 6628  C CE   . LYS A 1 42  ? 37.715 29.280 23.157 1.00 0.00 ? 12 LYS A CE   7  
ATOM 6629  N NZ   . LYS A 1 42  ? 38.708 30.030 23.975 1.00 0.00 ? 12 LYS A NZ   7  
ATOM 6630  H H    . LYS A 1 42  ? 35.576 33.049 18.805 1.00 0.00 ? 12 LYS A H    7  
ATOM 6631  H HA   . LYS A 1 42  ? 35.464 30.514 19.978 1.00 0.00 ? 12 LYS A HA   7  
ATOM 6632  H HB2  . LYS A 1 42  ? 37.150 32.280 20.498 1.00 0.00 ? 12 LYS A HB2  7  
ATOM 6633  H HB3  . LYS A 1 42  ? 35.910 33.152 21.399 1.00 0.00 ? 12 LYS A HB3  7  
ATOM 6634  H HG2  . LYS A 1 42  ? 37.082 31.899 23.037 1.00 0.00 ? 12 LYS A HG2  7  
ATOM 6635  H HG3  . LYS A 1 42  ? 35.603 30.985 22.752 1.00 0.00 ? 12 LYS A HG3  7  
ATOM 6636  H HD2  . LYS A 1 42  ? 36.792 29.481 21.228 1.00 0.00 ? 12 LYS A HD2  7  
ATOM 6637  H HD3  . LYS A 1 42  ? 38.271 30.419 21.428 1.00 0.00 ? 12 LYS A HD3  7  
ATOM 6638  H HE2  . LYS A 1 42  ? 36.821 29.111 23.740 1.00 0.00 ? 12 LYS A HE2  7  
ATOM 6639  H HE3  . LYS A 1 42  ? 38.136 28.331 22.860 1.00 0.00 ? 12 LYS A HE3  7  
ATOM 6640  H HZ1  . LYS A 1 42  ? 38.913 29.498 24.845 1.00 0.00 ? 12 LYS A HZ1  7  
ATOM 6641  H HZ2  . LYS A 1 42  ? 38.318 30.963 24.222 1.00 0.00 ? 12 LYS A HZ2  7  
ATOM 6642  H HZ3  . LYS A 1 42  ? 39.585 30.152 23.431 1.00 0.00 ? 12 LYS A HZ3  7  
ATOM 6643  N N    . GLU A 1 43  ? 33.153 32.610 21.055 1.00 0.00 ? 13 GLU A N    7  
ATOM 6644  C CA   . GLU A 1 43  ? 31.875 32.660 21.760 1.00 0.00 ? 13 GLU A CA   7  
ATOM 6645  C C    . GLU A 1 43  ? 30.848 31.753 21.088 1.00 0.00 ? 13 GLU A C    7  
ATOM 6646  O O    . GLU A 1 43  ? 30.140 30.997 21.757 1.00 0.00 ? 13 GLU A O    7  
ATOM 6647  C CB   . GLU A 1 43  ? 31.354 34.097 21.785 1.00 0.00 ? 13 GLU A CB   7  
ATOM 6648  C CG   . GLU A 1 43  ? 30.121 34.180 22.693 1.00 0.00 ? 13 GLU A CG   7  
ATOM 6649  C CD   . GLU A 1 43  ? 29.496 35.579 22.688 1.00 0.00 ? 13 GLU A CD   7  
ATOM 6650  O OE1  . GLU A 1 43  ? 28.523 35.761 23.400 1.00 0.00 ? 13 GLU A OE1  7  
ATOM 6651  O OE2  . GLU A 1 43  ? 29.982 36.450 21.980 1.00 0.00 ? 13 GLU A OE2  7  
ATOM 6652  H H    . GLU A 1 43  ? 33.522 33.425 20.653 1.00 0.00 ? 13 GLU A H    7  
ATOM 6653  H HA   . GLU A 1 43  ? 32.024 32.326 22.776 1.00 0.00 ? 13 GLU A HA   7  
ATOM 6654  H HB2  . GLU A 1 43  ? 32.126 34.753 22.163 1.00 0.00 ? 13 GLU A HB2  7  
ATOM 6655  H HB3  . GLU A 1 43  ? 31.081 34.400 20.786 1.00 0.00 ? 13 GLU A HB3  7  
ATOM 6656  H HG2  . GLU A 1 43  ? 29.386 33.466 22.351 1.00 0.00 ? 13 GLU A HG2  7  
ATOM 6657  H HG3  . GLU A 1 43  ? 30.411 33.926 23.702 1.00 0.00 ? 13 GLU A HG3  7  
ATOM 6658  N N    . GLU A 1 44  ? 30.798 31.796 19.759 1.00 0.00 ? 14 GLU A N    7  
ATOM 6659  C CA   . GLU A 1 44  ? 29.875 30.941 19.021 1.00 0.00 ? 14 GLU A CA   7  
ATOM 6660  C C    . GLU A 1 44  ? 30.199 29.466 19.240 1.00 0.00 ? 14 GLU A C    7  
ATOM 6661  O O    . GLU A 1 44  ? 29.297 28.639 19.374 1.00 0.00 ? 14 GLU A O    7  
ATOM 6662  C CB   . GLU A 1 44  ? 29.940 31.272 17.529 1.00 0.00 ? 14 GLU A CB   7  
ATOM 6663  C CG   . GLU A 1 44  ? 29.455 32.710 17.314 1.00 0.00 ? 14 GLU A CG   7  
ATOM 6664  C CD   . GLU A 1 44  ? 27.993 32.876 17.735 1.00 0.00 ? 14 GLU A CD   7  
ATOM 6665  O OE1  . GLU A 1 44  ? 27.589 34.010 17.934 1.00 0.00 ? 14 GLU A OE1  7  
ATOM 6666  O OE2  . GLU A 1 44  ? 27.290 31.881 17.841 1.00 0.00 ? 14 GLU A OE2  7  
ATOM 6667  H H    . GLU A 1 44  ? 31.365 32.433 19.273 1.00 0.00 ? 14 GLU A H    7  
ATOM 6668  H HA   . GLU A 1 44  ? 28.872 31.130 19.371 1.00 0.00 ? 14 GLU A HA   7  
ATOM 6669  H HB2  . GLU A 1 44  ? 30.959 31.176 17.182 1.00 0.00 ? 14 GLU A HB2  7  
ATOM 6670  H HB3  . GLU A 1 44  ? 29.304 30.595 16.980 1.00 0.00 ? 14 GLU A HB3  7  
ATOM 6671  H HG2  . GLU A 1 44  ? 30.066 33.380 17.899 1.00 0.00 ? 14 GLU A HG2  7  
ATOM 6672  H HG3  . GLU A 1 44  ? 29.554 32.965 16.270 1.00 0.00 ? 14 GLU A HG3  7  
ATOM 6673  N N    . GLY A 1 45  ? 31.488 29.142 19.304 1.00 0.00 ? 15 GLY A N    7  
ATOM 6674  C CA   . GLY A 1 45  ? 31.900 27.768 19.558 1.00 0.00 ? 15 GLY A CA   7  
ATOM 6675  C C    . GLY A 1 45  ? 31.360 27.283 20.897 1.00 0.00 ? 15 GLY A C    7  
ATOM 6676  O O    . GLY A 1 45  ? 30.834 26.174 20.999 1.00 0.00 ? 15 GLY A O    7  
ATOM 6677  H H    . GLY A 1 45  ? 32.167 29.829 19.152 1.00 0.00 ? 15 GLY A H    7  
ATOM 6678  H HA2  . GLY A 1 45  ? 31.523 27.132 18.769 1.00 0.00 ? 15 GLY A HA2  7  
ATOM 6679  H HA3  . GLY A 1 45  ? 32.978 27.715 19.573 1.00 0.00 ? 15 GLY A HA3  7  
ATOM 6680  N N    . ASN A 1 46  ? 31.463 28.132 21.917 1.00 0.00 ? 16 ASN A N    7  
ATOM 6681  C CA   . ASN A 1 46  ? 30.944 27.774 23.233 1.00 0.00 ? 16 ASN A CA   7  
ATOM 6682  C C    . ASN A 1 46  ? 29.438 27.538 23.172 1.00 0.00 ? 16 ASN A C    7  
ATOM 6683  O O    . ASN A 1 46  ? 28.928 26.601 23.788 1.00 0.00 ? 16 ASN A O    7  
ATOM 6684  C CB   . ASN A 1 46  ? 31.248 28.888 24.237 1.00 0.00 ? 16 ASN A CB   7  
ATOM 6685  C CG   . ASN A 1 46  ? 32.756 29.037 24.423 1.00 0.00 ? 16 ASN A CG   7  
ATOM 6686  O OD1  . ASN A 1 46  ? 33.516 28.107 24.154 1.00 0.00 ? 16 ASN A OD1  7  
ATOM 6687  N ND2  . ASN A 1 46  ? 33.237 30.163 24.875 1.00 0.00 ? 16 ASN A ND2  7  
ATOM 6688  H H    . ASN A 1 46  ? 31.927 28.988 21.794 1.00 0.00 ? 16 ASN A H    7  
ATOM 6689  H HA   . ASN A 1 46  ? 31.428 26.866 23.564 1.00 0.00 ? 16 ASN A HA   7  
ATOM 6690  H HB2  . ASN A 1 46  ? 30.839 29.818 23.871 1.00 0.00 ? 16 ASN A HB2  7  
ATOM 6691  H HB3  . ASN A 1 46  ? 30.794 28.646 25.186 1.00 0.00 ? 16 ASN A HB3  7  
ATOM 6692  H HD21 . ASN A 1 46  ? 32.631 30.903 25.090 1.00 0.00 ? 16 ASN A HD21 7  
ATOM 6693  H HD22 . ASN A 1 46  ? 34.203 30.270 24.997 1.00 0.00 ? 16 ASN A HD22 7  
ATOM 6694  N N    . LYS A 1 47  ? 28.731 28.359 22.395 1.00 0.00 ? 17 LYS A N    7  
ATOM 6695  C CA   . LYS A 1 47  ? 27.293 28.167 22.232 1.00 0.00 ? 17 LYS A CA   7  
ATOM 6696  C C    . LYS A 1 47  ? 26.988 26.812 21.599 1.00 0.00 ? 17 LYS A C    7  
ATOM 6697  O O    . LYS A 1 47  ? 26.111 26.081 22.072 1.00 0.00 ? 17 LYS A O    7  
ATOM 6698  C CB   . LYS A 1 47  ? 26.703 29.281 21.364 1.00 0.00 ? 17 LYS A CB   7  
ATOM 6699  C CG   . LYS A 1 47  ? 26.829 30.620 22.093 1.00 0.00 ? 17 LYS A CG   7  
ATOM 6700  C CD   . LYS A 1 47  ? 26.138 31.713 21.272 1.00 0.00 ? 17 LYS A CD   7  
ATOM 6701  C CE   . LYS A 1 47  ? 26.348 33.073 21.938 1.00 0.00 ? 17 LYS A CE   7  
ATOM 6702  N NZ   . LYS A 1 47  ? 26.263 34.149 20.910 1.00 0.00 ? 17 LYS A NZ   7  
ATOM 6703  H H    . LYS A 1 47  ? 29.174 29.123 21.967 1.00 0.00 ? 17 LYS A H    7  
ATOM 6704  H HA   . LYS A 1 47  ? 26.826 28.207 23.206 1.00 0.00 ? 17 LYS A HA   7  
ATOM 6705  H HB2  . LYS A 1 47  ? 27.240 29.328 20.428 1.00 0.00 ? 17 LYS A HB2  7  
ATOM 6706  H HB3  . LYS A 1 47  ? 25.661 29.075 21.174 1.00 0.00 ? 17 LYS A HB3  7  
ATOM 6707  H HG2  . LYS A 1 47  ? 26.360 30.547 23.063 1.00 0.00 ? 17 LYS A HG2  7  
ATOM 6708  H HG3  . LYS A 1 47  ? 27.871 30.870 22.213 1.00 0.00 ? 17 LYS A HG3  7  
ATOM 6709  H HD2  . LYS A 1 47  ? 26.556 31.731 20.275 1.00 0.00 ? 17 LYS A HD2  7  
ATOM 6710  H HD3  . LYS A 1 47  ? 25.080 31.503 21.214 1.00 0.00 ? 17 LYS A HD3  7  
ATOM 6711  H HE2  . LYS A 1 47  ? 25.584 33.229 22.686 1.00 0.00 ? 17 LYS A HE2  7  
ATOM 6712  H HE3  . LYS A 1 47  ? 27.321 33.100 22.408 1.00 0.00 ? 17 LYS A HE3  7  
ATOM 6713  H HZ1  . LYS A 1 47  ? 25.267 34.395 20.748 1.00 0.00 ? 17 LYS A HZ1  7  
ATOM 6714  H HZ2  . LYS A 1 47  ? 26.687 33.812 20.021 1.00 0.00 ? 17 LYS A HZ2  7  
ATOM 6715  H HZ3  . LYS A 1 47  ? 26.776 34.989 21.243 1.00 0.00 ? 17 LYS A HZ3  7  
ATOM 6716  N N    . ALA A 1 48  ? 27.741 26.454 20.558 1.00 0.00 ? 18 ALA A N    7  
ATOM 6717  C CA   . ALA A 1 48  ? 27.521 25.172 19.901 1.00 0.00 ? 18 ALA A CA   7  
ATOM 6718  C C    . ALA A 1 48  ? 27.733 24.032 20.891 1.00 0.00 ? 18 ALA A C    7  
ATOM 6719  O O    . ALA A 1 48  ? 26.974 23.064 20.900 1.00 0.00 ? 18 ALA A O    7  
ATOM 6720  C CB   . ALA A 1 48  ? 28.464 25.014 18.705 1.00 0.00 ? 18 ALA A CB   7  
ATOM 6721  H H    . ALA A 1 48  ? 28.430 27.064 20.219 1.00 0.00 ? 18 ALA A H    7  
ATOM 6722  H HA   . ALA A 1 48  ? 26.503 25.137 19.544 1.00 0.00 ? 18 ALA A HA   7  
ATOM 6723  H HB1  . ALA A 1 48  ? 28.723 25.989 18.320 1.00 0.00 ? 18 ALA A HB1  7  
ATOM 6724  H HB2  . ALA A 1 48  ? 27.969 24.443 17.932 1.00 0.00 ? 18 ALA A HB2  7  
ATOM 6725  H HB3  . ALA A 1 48  ? 29.360 24.498 19.013 1.00 0.00 ? 18 ALA A HB3  7  
ATOM 6726  N N    . LEU A 1 49  ? 28.769 24.146 21.721 1.00 0.00 ? 19 LEU A N    7  
ATOM 6727  C CA   . LEU A 1 49  ? 28.993 23.155 22.768 1.00 0.00 ? 19 LEU A CA   7  
ATOM 6728  C C    . LEU A 1 49  ? 27.811 23.108 23.734 1.00 0.00 ? 19 LEU A C    7  
ATOM 6729  O O    . LEU A 1 49  ? 27.357 22.031 24.117 1.00 0.00 ? 19 LEU A O    7  
ATOM 6730  C CB   . LEU A 1 49  ? 30.273 23.495 23.536 1.00 0.00 ? 19 LEU A CB   7  
ATOM 6731  C CG   . LEU A 1 49  ? 30.585 22.383 24.542 1.00 0.00 ? 19 LEU A CG   7  
ATOM 6732  C CD1  . LEU A 1 49  ? 31.017 21.122 23.791 1.00 0.00 ? 19 LEU A CD1  7  
ATOM 6733  C CD2  . LEU A 1 49  ? 31.717 22.836 25.466 1.00 0.00 ? 19 LEU A CD2  7  
ATOM 6734  H H    . LEU A 1 49  ? 29.401 24.885 21.609 1.00 0.00 ? 19 LEU A H    7  
ATOM 6735  H HA   . LEU A 1 49  ? 29.110 22.184 22.312 1.00 0.00 ? 19 LEU A HA   7  
ATOM 6736  H HB2  . LEU A 1 49  ? 31.094 23.592 22.841 1.00 0.00 ? 19 LEU A HB2  7  
ATOM 6737  H HB3  . LEU A 1 49  ? 30.139 24.426 24.066 1.00 0.00 ? 19 LEU A HB3  7  
ATOM 6738  H HG   . LEU A 1 49  ? 29.702 22.168 25.127 1.00 0.00 ? 19 LEU A HG   7  
ATOM 6739  H HD11 . LEU A 1 49  ? 30.147 20.631 23.382 1.00 0.00 ? 19 LEU A HD11 7  
ATOM 6740  H HD12 . LEU A 1 49  ? 31.522 20.452 24.472 1.00 0.00 ? 19 LEU A HD12 7  
ATOM 6741  H HD13 . LEU A 1 49  ? 31.688 21.393 22.989 1.00 0.00 ? 19 LEU A HD13 7  
ATOM 6742  H HD21 . LEU A 1 49  ? 31.930 22.057 26.182 1.00 0.00 ? 19 LEU A HD21 7  
ATOM 6743  H HD22 . LEU A 1 49  ? 31.417 23.733 25.988 1.00 0.00 ? 19 LEU A HD22 7  
ATOM 6744  H HD23 . LEU A 1 49  ? 32.601 23.040 24.880 1.00 0.00 ? 19 LEU A HD23 7  
ATOM 6745  N N    . SER A 1 50  ? 27.254 24.274 24.052 1.00 0.00 ? 20 SER A N    7  
ATOM 6746  C CA   . SER A 1 50  ? 26.140 24.343 24.994 1.00 0.00 ? 20 SER A CA   7  
ATOM 6747  C C    . SER A 1 50  ? 24.935 23.542 24.505 1.00 0.00 ? 20 SER A C    7  
ATOM 6748  O O    . SER A 1 50  ? 24.212 22.950 25.307 1.00 0.00 ? 20 SER A O    7  
ATOM 6749  C CB   . SER A 1 50  ? 25.728 25.800 25.201 1.00 0.00 ? 20 SER A CB   7  
ATOM 6750  O OG   . SER A 1 50  ? 24.758 25.868 26.237 1.00 0.00 ? 20 SER A OG   7  
ATOM 6751  H H    . SER A 1 50  ? 27.629 25.103 23.688 1.00 0.00 ? 20 SER A H    7  
ATOM 6752  H HA   . SER A 1 50  ? 26.463 23.940 25.942 1.00 0.00 ? 20 SER A HA   7  
ATOM 6753  H HB2  . SER A 1 50  ? 26.587 26.385 25.484 1.00 0.00 ? 20 SER A HB2  7  
ATOM 6754  H HB3  . SER A 1 50  ? 25.321 26.191 24.278 1.00 0.00 ? 20 SER A HB3  7  
ATOM 6755  H HG   . SER A 1 50  ? 25.192 25.912 27.023 1.00 0.00 ? 20 SER A HG   7  
ATOM 6756  N N    . VAL A 1 51  ? 24.721 23.524 23.194 1.00 0.00 ? 21 VAL A N    7  
ATOM 6757  C CA   . VAL A 1 51  ? 23.616 22.749 22.624 1.00 0.00 ? 21 VAL A CA   7  
ATOM 6758  C C    . VAL A 1 51  ? 23.984 21.290 22.320 1.00 0.00 ? 21 VAL A C    7  
ATOM 6759  O O    . VAL A 1 51  ? 23.147 20.547 21.807 1.00 0.00 ? 21 VAL A O    7  
ATOM 6760  C CB   . VAL A 1 51  ? 23.111 23.424 21.347 1.00 0.00 ? 21 VAL A CB   7  
ATOM 6761  C CG1  . VAL A 1 51  ? 22.646 24.845 21.670 1.00 0.00 ? 21 VAL A CG1  7  
ATOM 6762  C CG2  . VAL A 1 51  ? 24.241 23.485 20.317 1.00 0.00 ? 21 VAL A CG2  7  
ATOM 6763  H H    . VAL A 1 51  ? 25.275 24.088 22.610 1.00 0.00 ? 21 VAL A H    7  
ATOM 6764  H HA   . VAL A 1 51  ? 22.806 22.748 23.338 1.00 0.00 ? 21 VAL A HA   7  
ATOM 6765  H HB   . VAL A 1 51  ? 22.284 22.858 20.944 1.00 0.00 ? 21 VAL A HB   7  
ATOM 6766  H HG11 . VAL A 1 51  ? 22.401 25.361 20.754 1.00 0.00 ? 21 VAL A HG11 7  
ATOM 6767  H HG12 . VAL A 1 51  ? 23.437 25.375 22.180 1.00 0.00 ? 21 VAL A HG12 7  
ATOM 6768  H HG13 . VAL A 1 51  ? 21.773 24.803 22.304 1.00 0.00 ? 21 VAL A HG13 7  
ATOM 6769  H HG21 . VAL A 1 51  ? 24.983 24.197 20.642 1.00 0.00 ? 21 VAL A HG21 7  
ATOM 6770  H HG22 . VAL A 1 51  ? 23.841 23.793 19.362 1.00 0.00 ? 21 VAL A HG22 7  
ATOM 6771  H HG23 . VAL A 1 51  ? 24.696 22.510 20.220 1.00 0.00 ? 21 VAL A HG23 7  
ATOM 6772  N N    . GLY A 1 52  ? 25.213 20.870 22.625 1.00 0.00 ? 22 GLY A N    7  
ATOM 6773  C CA   . GLY A 1 52  ? 25.644 19.505 22.313 1.00 0.00 ? 22 GLY A CA   7  
ATOM 6774  C C    . GLY A 1 52  ? 26.214 19.360 20.894 1.00 0.00 ? 22 GLY A C    7  
ATOM 6775  O O    . GLY A 1 52  ? 26.418 18.242 20.425 1.00 0.00 ? 22 GLY A O    7  
ATOM 6776  H H    . GLY A 1 52  ? 25.830 21.469 23.090 1.00 0.00 ? 22 GLY A H    7  
ATOM 6777  H HA2  . GLY A 1 52  ? 26.403 19.212 23.023 1.00 0.00 ? 22 GLY A HA2  7  
ATOM 6778  H HA3  . GLY A 1 52  ? 24.798 18.843 22.417 1.00 0.00 ? 22 GLY A HA3  7  
ATOM 6779  N N    . ASN A 1 53  ? 26.472 20.476 20.212 1.00 0.00 ? 23 ASN A N    7  
ATOM 6780  C CA   . ASN A 1 53  ? 26.998 20.435 18.853 1.00 0.00 ? 23 ASN A CA   7  
ATOM 6781  C C    . ASN A 1 53  ? 28.521 20.583 18.867 1.00 0.00 ? 23 ASN A C    7  
ATOM 6782  O O    . ASN A 1 53  ? 29.076 21.588 18.412 1.00 0.00 ? 23 ASN A O    7  
ATOM 6783  C CB   . ASN A 1 53  ? 26.357 21.557 18.033 1.00 0.00 ? 23 ASN A CB   7  
ATOM 6784  C CG   . ASN A 1 53  ? 26.611 21.335 16.548 1.00 0.00 ? 23 ASN A CG   7  
ATOM 6785  O OD1  . ASN A 1 53  ? 27.620 20.739 16.173 1.00 0.00 ? 23 ASN A OD1  7  
ATOM 6786  N ND2  . ASN A 1 53  ? 25.752 21.792 15.679 1.00 0.00 ? 23 ASN A ND2  7  
ATOM 6787  H H    . ASN A 1 53  ? 26.318 21.344 20.636 1.00 0.00 ? 23 ASN A H    7  
ATOM 6788  H HA   . ASN A 1 53  ? 26.742 19.486 18.405 1.00 0.00 ? 23 ASN A HA   7  
ATOM 6789  H HB2  . ASN A 1 53  ? 25.291 21.569 18.216 1.00 0.00 ? 23 ASN A HB2  7  
ATOM 6790  H HB3  . ASN A 1 53  ? 26.781 22.504 18.330 1.00 0.00 ? 23 ASN A HB3  7  
ATOM 6791  H HD21 . ASN A 1 53  ? 24.957 22.275 15.987 1.00 0.00 ? 23 ASN A HD21 7  
ATOM 6792  H HD22 . ASN A 1 53  ? 25.901 21.651 14.721 1.00 0.00 ? 23 ASN A HD22 7  
ATOM 6793  N N    . ILE A 1 54  ? 29.199 19.555 19.366 1.00 0.00 ? 24 ILE A N    7  
ATOM 6794  C CA   . ILE A 1 54  ? 30.648 19.623 19.524 1.00 0.00 ? 24 ILE A CA   7  
ATOM 6795  C C    . ILE A 1 54  ? 31.335 19.782 18.168 1.00 0.00 ? 24 ILE A C    7  
ATOM 6796  O O    . ILE A 1 54  ? 32.324 20.508 18.056 1.00 0.00 ? 24 ILE A O    7  
ATOM 6797  C CB   . ILE A 1 54  ? 31.159 18.354 20.225 1.00 0.00 ? 24 ILE A CB   7  
ATOM 6798  C CG1  . ILE A 1 54  ? 30.454 18.189 21.575 1.00 0.00 ? 24 ILE A CG1  7  
ATOM 6799  C CG2  . ILE A 1 54  ? 32.668 18.457 20.467 1.00 0.00 ? 24 ILE A CG2  7  
ATOM 6800  C CD1  . ILE A 1 54  ? 30.822 16.836 22.186 1.00 0.00 ? 24 ILE A CD1  7  
ATOM 6801  H H    . ILE A 1 54  ? 28.720 18.742 19.632 1.00 0.00 ? 24 ILE A H    7  
ATOM 6802  H HA   . ILE A 1 54  ? 30.892 20.477 20.138 1.00 0.00 ? 24 ILE A HA   7  
ATOM 6803  H HB   . ILE A 1 54  ? 30.952 17.494 19.603 1.00 0.00 ? 24 ILE A HB   7  
ATOM 6804  H HG12 . ILE A 1 54  ? 30.764 18.981 22.240 1.00 0.00 ? 24 ILE A HG12 7  
ATOM 6805  H HG13 . ILE A 1 54  ? 29.384 18.237 21.431 1.00 0.00 ? 24 ILE A HG13 7  
ATOM 6806  H HG21 . ILE A 1 54  ? 33.175 18.594 19.524 1.00 0.00 ? 24 ILE A HG21 7  
ATOM 6807  H HG22 . ILE A 1 54  ? 33.021 17.550 20.936 1.00 0.00 ? 24 ILE A HG22 7  
ATOM 6808  H HG23 . ILE A 1 54  ? 32.872 19.299 21.112 1.00 0.00 ? 24 ILE A HG23 7  
ATOM 6809  H HD11 . ILE A 1 54  ? 30.274 16.694 23.106 1.00 0.00 ? 24 ILE A HD11 7  
ATOM 6810  H HD12 . ILE A 1 54  ? 31.882 16.809 22.390 1.00 0.00 ? 24 ILE A HD12 7  
ATOM 6811  H HD13 . ILE A 1 54  ? 30.570 16.047 21.492 1.00 0.00 ? 24 ILE A HD13 7  
ATOM 6812  N N    . ASP A 1 55  ? 30.795 19.138 17.133 1.00 0.00 ? 25 ASP A N    7  
ATOM 6813  C CA   . ASP A 1 55  ? 31.411 19.208 15.813 1.00 0.00 ? 25 ASP A CA   7  
ATOM 6814  C C    . ASP A 1 55  ? 31.452 20.649 15.310 1.00 0.00 ? 25 ASP A C    7  
ATOM 6815  O O    . ASP A 1 55  ? 32.495 21.131 14.865 1.00 0.00 ? 25 ASP A O    7  
ATOM 6816  C CB   . ASP A 1 55  ? 30.623 18.343 14.824 1.00 0.00 ? 25 ASP A CB   7  
ATOM 6817  C CG   . ASP A 1 55  ? 30.702 16.871 15.221 1.00 0.00 ? 25 ASP A CG   7  
ATOM 6818  O OD1  . ASP A 1 55  ? 29.753 16.155 14.945 1.00 0.00 ? 25 ASP A OD1  7  
ATOM 6819  O OD2  . ASP A 1 55  ? 31.709 16.475 15.787 1.00 0.00 ? 25 ASP A OD2  7  
ATOM 6820  H H    . ASP A 1 55  ? 29.976 18.614 17.261 1.00 0.00 ? 25 ASP A H    7  
ATOM 6821  H HA   . ASP A 1 55  ? 32.420 18.831 15.877 1.00 0.00 ? 25 ASP A HA   7  
ATOM 6822  H HB2  . ASP A 1 55  ? 29.589 18.657 14.820 1.00 0.00 ? 25 ASP A HB2  7  
ATOM 6823  H HB3  . ASP A 1 55  ? 31.036 18.467 13.835 1.00 0.00 ? 25 ASP A HB3  7  
ATOM 6824  N N    . ASP A 1 56  ? 30.329 21.351 15.432 1.00 0.00 ? 26 ASP A N    7  
ATOM 6825  C CA   . ASP A 1 56  ? 30.267 22.740 14.994 1.00 0.00 ? 26 ASP A CA   7  
ATOM 6826  C C    . ASP A 1 56  ? 31.215 23.608 15.813 1.00 0.00 ? 26 ASP A C    7  
ATOM 6827  O O    . ASP A 1 56  ? 31.901 24.472 15.263 1.00 0.00 ? 26 ASP A O    7  
ATOM 6828  C CB   . ASP A 1 56  ? 28.838 23.277 15.114 1.00 0.00 ? 26 ASP A CB   7  
ATOM 6829  C CG   . ASP A 1 56  ? 27.929 22.684 14.033 1.00 0.00 ? 26 ASP A CG   7  
ATOM 6830  O OD1  . ASP A 1 56  ? 26.885 23.267 13.794 1.00 0.00 ? 26 ASP A OD1  7  
ATOM 6831  O OD2  . ASP A 1 56  ? 28.272 21.655 13.470 1.00 0.00 ? 26 ASP A OD2  7  
ATOM 6832  H H    . ASP A 1 56  ? 29.528 20.927 15.806 1.00 0.00 ? 26 ASP A H    7  
ATOM 6833  H HA   . ASP A 1 56  ? 30.567 22.788 13.958 1.00 0.00 ? 26 ASP A HA   7  
ATOM 6834  H HB2  . ASP A 1 56  ? 28.444 23.020 16.086 1.00 0.00 ? 26 ASP A HB2  7  
ATOM 6835  H HB3  . ASP A 1 56  ? 28.854 24.353 15.012 1.00 0.00 ? 26 ASP A HB3  7  
ATOM 6836  N N    . ALA A 1 57  ? 31.289 23.349 17.117 1.00 0.00 ? 27 ALA A N    7  
ATOM 6837  C CA   . ALA A 1 57  ? 32.161 24.139 17.979 1.00 0.00 ? 27 ALA A CA   7  
ATOM 6838  C C    . ALA A 1 57  ? 33.613 24.011 17.521 1.00 0.00 ? 27 ALA A C    7  
ATOM 6839  O O    . ALA A 1 57  ? 34.308 25.014 17.349 1.00 0.00 ? 27 ALA A O    7  
ATOM 6840  C CB   . ALA A 1 57  ? 32.038 23.656 19.427 1.00 0.00 ? 27 ALA A CB   7  
ATOM 6841  H H    . ALA A 1 57  ? 30.722 22.648 17.507 1.00 0.00 ? 27 ALA A H    7  
ATOM 6842  H HA   . ALA A 1 57  ? 31.860 25.175 17.930 1.00 0.00 ? 27 ALA A HA   7  
ATOM 6843  H HB1  . ALA A 1 57  ? 32.958 23.855 19.956 1.00 0.00 ? 27 ALA A HB1  7  
ATOM 6844  H HB2  . ALA A 1 57  ? 31.842 22.595 19.437 1.00 0.00 ? 27 ALA A HB2  7  
ATOM 6845  H HB3  . ALA A 1 57  ? 31.227 24.176 19.913 1.00 0.00 ? 27 ALA A HB3  7  
ATOM 6846  N N    . LEU A 1 58  ? 34.056 22.777 17.284 1.00 0.00 ? 28 LEU A N    7  
ATOM 6847  C CA   . LEU A 1 58  ? 35.420 22.556 16.818 1.00 0.00 ? 28 LEU A CA   7  
ATOM 6848  C C    . LEU A 1 58  ? 35.662 23.255 15.484 1.00 0.00 ? 28 LEU A C    7  
ATOM 6849  O O    . LEU A 1 58  ? 36.718 23.854 15.274 1.00 0.00 ? 28 LEU A O    7  
ATOM 6850  C CB   . LEU A 1 58  ? 35.687 21.056 16.663 1.00 0.00 ? 28 LEU A CB   7  
ATOM 6851  C CG   . LEU A 1 58  ? 35.548 20.359 18.019 1.00 0.00 ? 28 LEU A CG   7  
ATOM 6852  C CD1  . LEU A 1 58  ? 35.648 18.845 17.825 1.00 0.00 ? 28 LEU A CD1  7  
ATOM 6853  C CD2  . LEU A 1 58  ? 36.672 20.821 18.949 1.00 0.00 ? 28 LEU A CD2  7  
ATOM 6854  H H    . LEU A 1 58  ? 33.467 22.011 17.440 1.00 0.00 ? 28 LEU A H    7  
ATOM 6855  H HA   . LEU A 1 58  ? 36.107 22.957 17.546 1.00 0.00 ? 28 LEU A HA   7  
ATOM 6856  H HB2  . LEU A 1 58  ? 34.975 20.636 15.968 1.00 0.00 ? 28 LEU A HB2  7  
ATOM 6857  H HB3  . LEU A 1 58  ? 36.687 20.906 16.286 1.00 0.00 ? 28 LEU A HB3  7  
ATOM 6858  H HG   . LEU A 1 58  ? 34.591 20.605 18.455 1.00 0.00 ? 28 LEU A HG   7  
ATOM 6859  H HD11 . LEU A 1 58  ? 35.560 18.353 18.783 1.00 0.00 ? 28 LEU A HD11 7  
ATOM 6860  H HD12 . LEU A 1 58  ? 36.602 18.601 17.381 1.00 0.00 ? 28 LEU A HD12 7  
ATOM 6861  H HD13 . LEU A 1 58  ? 34.852 18.512 17.175 1.00 0.00 ? 28 LEU A HD13 7  
ATOM 6862  H HD21 . LEU A 1 58  ? 37.603 20.848 18.403 1.00 0.00 ? 28 LEU A HD21 7  
ATOM 6863  H HD22 . LEU A 1 58  ? 36.758 20.134 19.777 1.00 0.00 ? 28 LEU A HD22 7  
ATOM 6864  H HD23 . LEU A 1 58  ? 36.445 21.808 19.325 1.00 0.00 ? 28 LEU A HD23 7  
ATOM 6865  N N    . GLN A 1 59  ? 34.668 23.214 14.596 1.00 0.00 ? 29 GLN A N    7  
ATOM 6866  C CA   . GLN A 1 59  ? 34.811 23.856 13.294 1.00 0.00 ? 29 GLN A CA   7  
ATOM 6867  C C    . GLN A 1 59  ? 35.036 25.358 13.446 1.00 0.00 ? 29 GLN A C    7  
ATOM 6868  O O    . GLN A 1 59  ? 35.934 25.923 12.817 1.00 0.00 ? 29 GLN A O    7  
ATOM 6869  C CB   . GLN A 1 59  ? 33.558 23.610 12.451 1.00 0.00 ? 29 GLN A CB   7  
ATOM 6870  C CG   . GLN A 1 59  ? 33.782 24.141 11.031 1.00 0.00 ? 29 GLN A CG   7  
ATOM 6871  C CD   . GLN A 1 59  ? 32.568 23.862 10.145 1.00 0.00 ? 29 GLN A CD   7  
ATOM 6872  O OE1  . GLN A 1 59  ? 31.640 23.153 10.542 1.00 0.00 ? 29 GLN A OE1  7  
ATOM 6873  N NE2  . GLN A 1 59  ? 32.518 24.385 8.951  1.00 0.00 ? 29 GLN A NE2  7  
ATOM 6874  H H    . GLN A 1 59  ? 33.851 22.711 14.802 1.00 0.00 ? 29 GLN A H    7  
ATOM 6875  H HA   . GLN A 1 59  ? 35.661 23.427 12.785 1.00 0.00 ? 29 GLN A HA   7  
ATOM 6876  H HB2  . GLN A 1 59  ? 33.355 22.550 12.412 1.00 0.00 ? 29 GLN A HB2  7  
ATOM 6877  H HB3  . GLN A 1 59  ? 32.719 24.123 12.895 1.00 0.00 ? 29 GLN A HB3  7  
ATOM 6878  H HG2  . GLN A 1 59  ? 33.952 25.206 11.073 1.00 0.00 ? 29 GLN A HG2  7  
ATOM 6879  H HG3  . GLN A 1 59  ? 34.650 23.660 10.606 1.00 0.00 ? 29 GLN A HG3  7  
ATOM 6880  H HE21 . GLN A 1 59  ? 33.253 24.949 8.631  1.00 0.00 ? 29 GLN A HE21 7  
ATOM 6881  H HE22 . GLN A 1 59  ? 31.745 24.213 8.372  1.00 0.00 ? 29 GLN A HE22 7  
ATOM 6882  N N    . TYR A 1 60  ? 34.248 25.997 14.310 1.00 0.00 ? 30 TYR A N    7  
ATOM 6883  C CA   . TYR A 1 60  ? 34.415 27.426 14.548 1.00 0.00 ? 30 TYR A CA   7  
ATOM 6884  C C    . TYR A 1 60  ? 35.806 27.730 15.091 1.00 0.00 ? 30 TYR A C    7  
ATOM 6885  O O    . TYR A 1 60  ? 36.450 28.684 14.653 1.00 0.00 ? 30 TYR A O    7  
ATOM 6886  C CB   . TYR A 1 60  ? 33.367 27.927 15.545 1.00 0.00 ? 30 TYR A CB   7  
ATOM 6887  C CG   . TYR A 1 60  ? 31.952 27.884 15.018 1.00 0.00 ? 30 TYR A CG   7  
ATOM 6888  C CD1  . TYR A 1 60  ? 30.985 27.113 15.671 1.00 0.00 ? 30 TYR A CD1  7  
ATOM 6889  C CD2  . TYR A 1 60  ? 31.608 28.619 13.876 1.00 0.00 ? 30 TYR A CD2  7  
ATOM 6890  C CE1  . TYR A 1 60  ? 29.673 27.076 15.184 1.00 0.00 ? 30 TYR A CE1  7  
ATOM 6891  C CE2  . TYR A 1 60  ? 30.297 28.581 13.389 1.00 0.00 ? 30 TYR A CE2  7  
ATOM 6892  C CZ   . TYR A 1 60  ? 29.328 27.810 14.044 1.00 0.00 ? 30 TYR A CZ   7  
ATOM 6893  O OH   . TYR A 1 60  ? 28.035 27.773 13.563 1.00 0.00 ? 30 TYR A OH   7  
ATOM 6894  H H    . TYR A 1 60  ? 33.526 25.512 14.758 1.00 0.00 ? 30 TYR A H    7  
ATOM 6895  H HA   . TYR A 1 60  ? 34.283 27.953 13.614 1.00 0.00 ? 30 TYR A HA   7  
ATOM 6896  H HB2  . TYR A 1 60  ? 33.417 27.316 16.433 1.00 0.00 ? 30 TYR A HB2  7  
ATOM 6897  H HB3  . TYR A 1 60  ? 33.611 28.945 15.815 1.00 0.00 ? 30 TYR A HB3  7  
ATOM 6898  H HD1  . TYR A 1 60  ? 31.249 26.547 16.551 1.00 0.00 ? 30 TYR A HD1  7  
ATOM 6899  H HD2  . TYR A 1 60  ? 32.355 29.215 13.373 1.00 0.00 ? 30 TYR A HD2  7  
ATOM 6900  H HE1  . TYR A 1 60  ? 28.925 26.481 15.689 1.00 0.00 ? 30 TYR A HE1  7  
ATOM 6901  H HE2  . TYR A 1 60  ? 30.031 29.147 12.509 1.00 0.00 ? 30 TYR A HE2  7  
ATOM 6902  H HH   . TYR A 1 60  ? 28.049 28.044 12.704 1.00 0.00 ? 30 TYR A HH   7  
ATOM 6903  N N    . TYR A 1 61  ? 36.286 26.898 16.016 1.00 0.00 ? 31 TYR A N    7  
ATOM 6904  C CA   . TYR A 1 61  ? 37.607 27.125 16.594 1.00 0.00 ? 31 TYR A CA   7  
ATOM 6905  C C    . TYR A 1 61  ? 38.692 27.045 15.524 1.00 0.00 ? 31 TYR A C    7  
ATOM 6906  O O    . TYR A 1 61  ? 39.598 27.879 15.487 1.00 0.00 ? 31 TYR A O    7  
ATOM 6907  C CB   . TYR A 1 61  ? 37.895 26.091 17.686 1.00 0.00 ? 31 TYR A CB   7  
ATOM 6908  C CG   . TYR A 1 61  ? 36.913 26.112 18.837 1.00 0.00 ? 31 TYR A CG   7  
ATOM 6909  C CD1  . TYR A 1 61  ? 36.433 27.328 19.339 1.00 0.00 ? 31 TYR A CD1  7  
ATOM 6910  C CD2  . TYR A 1 61  ? 36.489 24.906 19.407 1.00 0.00 ? 31 TYR A CD2  7  
ATOM 6911  C CE1  . TYR A 1 61  ? 35.528 27.337 20.408 1.00 0.00 ? 31 TYR A CE1  7  
ATOM 6912  C CE2  . TYR A 1 61  ? 35.585 24.915 20.477 1.00 0.00 ? 31 TYR A CE2  7  
ATOM 6913  C CZ   . TYR A 1 61  ? 35.105 26.130 20.977 1.00 0.00 ? 31 TYR A CZ   7  
ATOM 6914  O OH   . TYR A 1 61  ? 34.215 26.139 22.031 1.00 0.00 ? 31 TYR A OH   7  
ATOM 6915  H H    . TYR A 1 61  ? 35.733 26.153 16.336 1.00 0.00 ? 31 TYR A H    7  
ATOM 6916  H HA   . TYR A 1 61  ? 37.629 28.109 17.037 1.00 0.00 ? 31 TYR A HA   7  
ATOM 6917  H HB2  . TYR A 1 61  ? 37.873 25.108 17.243 1.00 0.00 ? 31 TYR A HB2  7  
ATOM 6918  H HB3  . TYR A 1 61  ? 38.890 26.269 18.071 1.00 0.00 ? 31 TYR A HB3  7  
ATOM 6919  H HD1  . TYR A 1 61  ? 36.758 28.260 18.900 1.00 0.00 ? 31 TYR A HD1  7  
ATOM 6920  H HD2  . TYR A 1 61  ? 36.860 23.968 19.025 1.00 0.00 ? 31 TYR A HD2  7  
ATOM 6921  H HE1  . TYR A 1 61  ? 35.159 28.275 20.794 1.00 0.00 ? 31 TYR A HE1  7  
ATOM 6922  H HE2  . TYR A 1 61  ? 35.258 23.983 20.916 1.00 0.00 ? 31 TYR A HE2  7  
ATOM 6923  H HH   . TYR A 1 61  ? 33.418 26.420 21.721 1.00 0.00 ? 31 TYR A HH   7  
ATOM 6924  N N    . ALA A 1 62  ? 38.561 26.083 14.614 1.00 0.00 ? 32 ALA A N    7  
ATOM 6925  C CA   . ALA A 1 62  ? 39.550 25.927 13.553 1.00 0.00 ? 32 ALA A CA   7  
ATOM 6926  C C    . ALA A 1 62  ? 39.565 27.153 12.648 1.00 0.00 ? 32 ALA A C    7  
ATOM 6927  O O    . ALA A 1 62  ? 40.630 27.681 12.317 1.00 0.00 ? 32 ALA A O    7  
ATOM 6928  C CB   . ALA A 1 62  ? 39.232 24.682 12.722 1.00 0.00 ? 32 ALA A CB   7  
ATOM 6929  H H    . ALA A 1 62  ? 37.814 25.450 14.678 1.00 0.00 ? 32 ALA A H    7  
ATOM 6930  H HA   . ALA A 1 62  ? 40.526 25.809 13.998 1.00 0.00 ? 32 ALA A HA   7  
ATOM 6931  H HB1  . ALA A 1 62  ? 39.934 24.605 11.905 1.00 0.00 ? 32 ALA A HB1  7  
ATOM 6932  H HB2  . ALA A 1 62  ? 38.229 24.758 12.329 1.00 0.00 ? 32 ALA A HB2  7  
ATOM 6933  H HB3  . ALA A 1 62  ? 39.309 23.804 13.346 1.00 0.00 ? 32 ALA A HB3  7  
ATOM 6934  N N    . ALA A 1 63  ? 38.378 27.635 12.288 1.00 0.00 ? 33 ALA A N    7  
ATOM 6935  C CA   . ALA A 1 63  ? 38.283 28.811 11.434 1.00 0.00 ? 33 ALA A CA   7  
ATOM 6936  C C    . ALA A 1 63  ? 38.890 30.028 12.122 1.00 0.00 ? 33 ALA A C    7  
ATOM 6937  O O    . ALA A 1 63  ? 39.601 30.811 11.493 1.00 0.00 ? 33 ALA A O    7  
ATOM 6938  C CB   . ALA A 1 63  ? 36.819 29.092 11.094 1.00 0.00 ? 33 ALA A CB   7  
ATOM 6939  H H    . ALA A 1 63  ? 37.560 27.177 12.578 1.00 0.00 ? 33 ALA A H    7  
ATOM 6940  H HA   . ALA A 1 63  ? 38.823 28.622 10.517 1.00 0.00 ? 33 ALA A HA   7  
ATOM 6941  H HB1  . ALA A 1 63  ? 36.209 28.932 11.970 1.00 0.00 ? 33 ALA A HB1  7  
ATOM 6942  H HB2  . ALA A 1 63  ? 36.498 28.429 10.305 1.00 0.00 ? 33 ALA A HB2  7  
ATOM 6943  H HB3  . ALA A 1 63  ? 36.716 30.117 10.766 1.00 0.00 ? 33 ALA A HB3  7  
ATOM 6944  N N    . ALA A 1 64  ? 38.648 30.162 13.423 1.00 0.00 ? 34 ALA A N    7  
ATOM 6945  C CA   . ALA A 1 64  ? 39.169 31.304 14.164 1.00 0.00 ? 34 ALA A CA   7  
ATOM 6946  C C    . ALA A 1 64  ? 40.696 31.324 14.144 1.00 0.00 ? 34 ALA A C    7  
ATOM 6947  O O    . ALA A 1 64  ? 41.305 32.363 13.878 1.00 0.00 ? 34 ALA A O    7  
ATOM 6948  C CB   . ALA A 1 64  ? 38.659 31.258 15.608 1.00 0.00 ? 34 ALA A CB   7  
ATOM 6949  H H    . ALA A 1 64  ? 38.084 29.505 13.882 1.00 0.00 ? 34 ALA A H    7  
ATOM 6950  H HA   . ALA A 1 64  ? 38.807 32.210 13.702 1.00 0.00 ? 34 ALA A HA   7  
ATOM 6951  H HB1  . ALA A 1 64  ? 38.452 32.261 15.949 1.00 0.00 ? 34 ALA A HB1  7  
ATOM 6952  H HB2  . ALA A 1 64  ? 39.404 30.806 16.247 1.00 0.00 ? 34 ALA A HB2  7  
ATOM 6953  H HB3  . ALA A 1 64  ? 37.753 30.672 15.647 1.00 0.00 ? 34 ALA A HB3  7  
ATOM 6954  N N    . ILE A 1 65  ? 41.314 30.167 14.378 1.00 0.00 ? 35 ILE A N    7  
ATOM 6955  C CA   . ILE A 1 65  ? 42.773 30.093 14.369 1.00 0.00 ? 35 ILE A CA   7  
ATOM 6956  C C    . ILE A 1 65  ? 43.317 30.474 12.993 1.00 0.00 ? 35 ILE A C    7  
ATOM 6957  O O    . ILE A 1 65  ? 44.273 31.247 12.896 1.00 0.00 ? 35 ILE A O    7  
ATOM 6958  C CB   . ILE A 1 65  ? 43.225 28.679 14.760 1.00 0.00 ? 35 ILE A CB   7  
ATOM 6959  C CG1  . ILE A 1 65  ? 42.705 28.356 16.162 1.00 0.00 ? 35 ILE A CG1  7  
ATOM 6960  C CG2  . ILE A 1 65  ? 44.755 28.587 14.772 1.00 0.00 ? 35 ILE A CG2  7  
ATOM 6961  C CD1  . ILE A 1 65  ? 42.908 26.868 16.453 1.00 0.00 ? 35 ILE A CD1  7  
ATOM 6962  H H    . ILE A 1 65  ? 40.787 29.366 14.589 1.00 0.00 ? 35 ILE A H    7  
ATOM 6963  H HA   . ILE A 1 65  ? 43.158 30.792 15.098 1.00 0.00 ? 35 ILE A HA   7  
ATOM 6964  H HB   . ILE A 1 65  ? 42.826 27.965 14.055 1.00 0.00 ? 35 ILE A HB   7  
ATOM 6965  H HG12 . ILE A 1 65  ? 43.250 28.943 16.888 1.00 0.00 ? 35 ILE A HG12 7  
ATOM 6966  H HG13 . ILE A 1 65  ? 41.656 28.595 16.224 1.00 0.00 ? 35 ILE A HG13 7  
ATOM 6967  H HG21 . ILE A 1 65  ? 45.136 28.820 13.789 1.00 0.00 ? 35 ILE A HG21 7  
ATOM 6968  H HG22 . ILE A 1 65  ? 45.053 27.586 15.045 1.00 0.00 ? 35 ILE A HG22 7  
ATOM 6969  H HG23 . ILE A 1 65  ? 45.153 29.290 15.488 1.00 0.00 ? 35 ILE A HG23 7  
ATOM 6970  H HD11 . ILE A 1 65  ? 42.510 26.284 15.637 1.00 0.00 ? 35 ILE A HD11 7  
ATOM 6971  H HD12 . ILE A 1 65  ? 42.394 26.607 17.367 1.00 0.00 ? 35 ILE A HD12 7  
ATOM 6972  H HD13 . ILE A 1 65  ? 43.962 26.663 16.563 1.00 0.00 ? 35 ILE A HD13 7  
ATOM 6973  N N    . THR A 1 66  ? 42.699 29.952 11.933 1.00 0.00 ? 36 THR A N    7  
ATOM 6974  C CA   . THR A 1 66  ? 43.150 30.280 10.583 1.00 0.00 ? 36 THR A CA   7  
ATOM 6975  C C    . THR A 1 66  ? 43.032 31.780 10.320 1.00 0.00 ? 36 THR A C    7  
ATOM 6976  O O    . THR A 1 66  ? 43.946 32.400 9.774  1.00 0.00 ? 36 THR A O    7  
ATOM 6977  C CB   . THR A 1 66  ? 42.320 29.514 9.551  1.00 0.00 ? 36 THR A CB   7  
ATOM 6978  O OG1  . THR A 1 66  ? 42.252 28.143 9.917  1.00 0.00 ? 36 THR A OG1  7  
ATOM 6979  C CG2  . THR A 1 66  ? 42.982 29.641 8.180  1.00 0.00 ? 36 THR A CG2  7  
ATOM 6980  H H    . THR A 1 66  ? 41.956 29.324 12.061 1.00 0.00 ? 36 THR A H    7  
ATOM 6981  H HA   . THR A 1 66  ? 44.185 29.988 10.481 1.00 0.00 ? 36 THR A HA   7  
ATOM 6982  H HB   . THR A 1 66  ? 41.325 29.928 9.505  1.00 0.00 ? 36 THR A HB   7  
ATOM 6983  H HG1  . THR A 1 66  ? 41.798 27.706 9.271  1.00 0.00 ? 36 THR A HG1  7  
ATOM 6984  H HG21 . THR A 1 66  ? 44.040 29.441 8.271  1.00 0.00 ? 36 THR A HG21 7  
ATOM 6985  H HG22 . THR A 1 66  ? 42.836 30.641 7.799  1.00 0.00 ? 36 THR A HG22 7  
ATOM 6986  H HG23 . THR A 1 66  ? 42.540 28.927 7.499  1.00 0.00 ? 36 THR A HG23 7  
ATOM 6987  N N    . LEU A 1 67  ? 41.922 32.372 10.755 1.00 0.00 ? 37 LEU A N    7  
ATOM 6988  C CA   . LEU A 1 67  ? 41.718 33.806 10.574 1.00 0.00 ? 37 LEU A CA   7  
ATOM 6989  C C    . LEU A 1 67  ? 42.801 34.618 11.278 1.00 0.00 ? 37 LEU A C    7  
ATOM 6990  O O    . LEU A 1 67  ? 43.198 35.678 10.792 1.00 0.00 ? 37 LEU A O    7  
ATOM 6991  C CB   . LEU A 1 67  ? 40.342 34.207 11.106 1.00 0.00 ? 37 LEU A CB   7  
ATOM 6992  C CG   . LEU A 1 67  ? 39.256 33.617 10.203 1.00 0.00 ? 37 LEU A CG   7  
ATOM 6993  C CD1  . LEU A 1 67  ? 37.894 33.746 10.889 1.00 0.00 ? 37 LEU A CD1  7  
ATOM 6994  C CD2  . LEU A 1 67  ? 39.232 34.381 8.879  1.00 0.00 ? 37 LEU A CD2  7  
ATOM 6995  H H    . LEU A 1 67  ? 41.221 31.835 11.178 1.00 0.00 ? 37 LEU A H    7  
ATOM 6996  H HA   . LEU A 1 67  ? 41.754 34.026 9.517  1.00 0.00 ? 37 LEU A HA   7  
ATOM 6997  H HB2  . LEU A 1 67  ? 40.221 33.832 12.111 1.00 0.00 ? 37 LEU A HB2  7  
ATOM 6998  H HB3  . LEU A 1 67  ? 40.257 35.284 11.110 1.00 0.00 ? 37 LEU A HB3  7  
ATOM 6999  H HG   . LEU A 1 67  ? 39.469 32.575 10.017 1.00 0.00 ? 37 LEU A HG   7  
ATOM 7000  H HD11 . LEU A 1 67  ? 37.753 32.913 11.562 1.00 0.00 ? 37 LEU A HD11 7  
ATOM 7001  H HD12 . LEU A 1 67  ? 37.113 33.743 10.143 1.00 0.00 ? 37 LEU A HD12 7  
ATOM 7002  H HD13 . LEU A 1 67  ? 37.857 34.670 11.446 1.00 0.00 ? 37 LEU A HD13 7  
ATOM 7003  H HD21 . LEU A 1 67  ? 38.263 34.267 8.415  1.00 0.00 ? 37 LEU A HD21 7  
ATOM 7004  H HD22 . LEU A 1 67  ? 39.994 33.988 8.222  1.00 0.00 ? 37 LEU A HD22 7  
ATOM 7005  H HD23 . LEU A 1 67  ? 39.421 35.428 9.064  1.00 0.00 ? 37 LEU A HD23 7  
ATOM 7006  N N    . ASP A 1 68  ? 43.248 34.142 12.437 1.00 0.00 ? 38 ASP A N    7  
ATOM 7007  C CA   . ASP A 1 68  ? 44.346 34.796 13.137 1.00 0.00 ? 38 ASP A CA   7  
ATOM 7008  C C    . ASP A 1 68  ? 45.637 34.714 12.327 1.00 0.00 ? 38 ASP A C    7  
ATOM 7009  O O    . ASP A 1 68  ? 46.312 35.722 12.115 1.00 0.00 ? 38 ASP A O    7  
ATOM 7010  C CB   . ASP A 1 68  ? 44.558 34.138 14.502 1.00 0.00 ? 38 ASP A CB   7  
ATOM 7011  C CG   . ASP A 1 68  ? 45.582 34.929 15.309 1.00 0.00 ? 38 ASP A CG   7  
ATOM 7012  O OD1  . ASP A 1 68  ? 46.742 34.553 15.288 1.00 0.00 ? 38 ASP A OD1  7  
ATOM 7013  O OD2  . ASP A 1 68  ? 45.190 35.898 15.938 1.00 0.00 ? 38 ASP A OD2  7  
ATOM 7014  H H    . ASP A 1 68  ? 42.803 33.369 12.846 1.00 0.00 ? 38 ASP A H    7  
ATOM 7015  H HA   . ASP A 1 68  ? 44.093 35.834 13.288 1.00 0.00 ? 38 ASP A HA   7  
ATOM 7016  H HB2  . ASP A 1 68  ? 43.619 34.115 15.037 1.00 0.00 ? 38 ASP A HB2  7  
ATOM 7017  H HB3  . ASP A 1 68  ? 44.916 33.129 14.362 1.00 0.00 ? 38 ASP A HB3  7  
ATOM 7018  N N    . LYS A 1 69  ? 45.977 33.510 11.877 1.00 0.00 ? 39 LYS A N    7  
ATOM 7019  C CA   . LYS A 1 69  ? 47.199 33.316 11.101 1.00 0.00 ? 39 LYS A CA   7  
ATOM 7020  C C    . LYS A 1 69  ? 47.204 34.139 9.812  1.00 0.00 ? 39 LYS A C    7  
ATOM 7021  O O    . LYS A 1 69  ? 48.267 34.541 9.339  1.00 0.00 ? 39 LYS A O    7  
ATOM 7022  C CB   . LYS A 1 69  ? 47.370 31.836 10.756 1.00 0.00 ? 39 LYS A CB   7  
ATOM 7023  C CG   . LYS A 1 69  ? 47.583 31.032 12.040 1.00 0.00 ? 39 LYS A CG   7  
ATOM 7024  C CD   . LYS A 1 69  ? 47.866 29.570 11.686 1.00 0.00 ? 39 LYS A CD   7  
ATOM 7025  C CE   . LYS A 1 69  ? 47.969 28.744 12.968 1.00 0.00 ? 39 LYS A CE   7  
ATOM 7026  N NZ   . LYS A 1 69  ? 47.755 27.304 12.650 1.00 0.00 ? 39 LYS A NZ   7  
ATOM 7027  H H    . LYS A 1 69  ? 45.410 32.738 12.088 1.00 0.00 ? 39 LYS A H    7  
ATOM 7028  H HA   . LYS A 1 69  ? 48.041 33.623 11.705 1.00 0.00 ? 39 LYS A HA   7  
ATOM 7029  H HB2  . LYS A 1 69  ? 46.483 31.482 10.251 1.00 0.00 ? 39 LYS A HB2  7  
ATOM 7030  H HB3  . LYS A 1 69  ? 48.227 31.712 10.111 1.00 0.00 ? 39 LYS A HB3  7  
ATOM 7031  H HG2  . LYS A 1 69  ? 48.421 31.441 12.586 1.00 0.00 ? 39 LYS A HG2  7  
ATOM 7032  H HG3  . LYS A 1 69  ? 46.694 31.085 12.651 1.00 0.00 ? 39 LYS A HG3  7  
ATOM 7033  H HD2  . LYS A 1 69  ? 47.062 29.188 11.073 1.00 0.00 ? 39 LYS A HD2  7  
ATOM 7034  H HD3  . LYS A 1 69  ? 48.797 29.505 11.143 1.00 0.00 ? 39 LYS A HD3  7  
ATOM 7035  H HE2  . LYS A 1 69  ? 48.949 28.874 13.403 1.00 0.00 ? 39 LYS A HE2  7  
ATOM 7036  H HE3  . LYS A 1 69  ? 47.217 29.072 13.671 1.00 0.00 ? 39 LYS A HE3  7  
ATOM 7037  H HZ1  . LYS A 1 69  ? 48.151 27.093 11.712 1.00 0.00 ? 39 LYS A HZ1  7  
ATOM 7038  H HZ2  . LYS A 1 69  ? 46.736 27.096 12.653 1.00 0.00 ? 39 LYS A HZ2  7  
ATOM 7039  H HZ3  . LYS A 1 69  ? 48.231 26.715 13.363 1.00 0.00 ? 39 LYS A HZ3  7  
ATOM 7040  N N    . TYR A 1 70  ? 46.024 34.390 9.245  1.00 0.00 ? 40 TYR A N    7  
ATOM 7041  C CA   . TYR A 1 70  ? 45.937 35.166 8.011  1.00 0.00 ? 40 TYR A CA   7  
ATOM 7042  C C    . TYR A 1 70  ? 46.560 36.555 8.222  1.00 0.00 ? 40 TYR A C    7  
ATOM 7043  O O    . TYR A 1 70  ? 46.244 37.217 9.211  1.00 0.00 ? 40 TYR A O    7  
ATOM 7044  C CB   . TYR A 1 70  ? 44.460 35.268 7.621  1.00 0.00 ? 40 TYR A CB   7  
ATOM 7045  C CG   . TYR A 1 70  ? 44.195 35.982 6.317  1.00 0.00 ? 40 TYR A CG   7  
ATOM 7046  C CD1  . TYR A 1 70  ? 44.561 35.391 5.101  1.00 0.00 ? 40 TYR A CD1  7  
ATOM 7047  C CD2  . TYR A 1 70  ? 43.543 37.219 6.327  1.00 0.00 ? 40 TYR A CD2  7  
ATOM 7048  C CE1  . TYR A 1 70  ? 44.280 36.044 3.896  1.00 0.00 ? 40 TYR A CE1  7  
ATOM 7049  C CE2  . TYR A 1 70  ? 43.264 37.872 5.123  1.00 0.00 ? 40 TYR A CE2  7  
ATOM 7050  C CZ   . TYR A 1 70  ? 43.632 37.285 3.906  1.00 0.00 ? 40 TYR A CZ   7  
ATOM 7051  O OH   . TYR A 1 70  ? 43.355 37.928 2.717  1.00 0.00 ? 40 TYR A OH   7  
ATOM 7052  H H    . TYR A 1 70  ? 45.211 34.000 9.630  1.00 0.00 ? 40 TYR A H    7  
ATOM 7053  H HA   . TYR A 1 70  ? 46.461 34.624 7.242  1.00 0.00 ? 40 TYR A HA   7  
ATOM 7054  H HB2  . TYR A 1 70  ? 44.057 34.271 7.542  1.00 0.00 ? 40 TYR A HB2  7  
ATOM 7055  H HB3  . TYR A 1 70  ? 43.935 35.782 8.414  1.00 0.00 ? 40 TYR A HB3  7  
ATOM 7056  H HD1  . TYR A 1 70  ? 45.064 34.436 5.096  1.00 0.00 ? 40 TYR A HD1  7  
ATOM 7057  H HD2  . TYR A 1 70  ? 43.258 37.670 7.265  1.00 0.00 ? 40 TYR A HD2  7  
ATOM 7058  H HE1  . TYR A 1 70  ? 44.562 35.589 2.957  1.00 0.00 ? 40 TYR A HE1  7  
ATOM 7059  H HE2  . TYR A 1 70  ? 42.759 38.826 5.133  1.00 0.00 ? 40 TYR A HE2  7  
ATOM 7060  H HH   . TYR A 1 70  ? 43.388 37.319 2.056  1.00 0.00 ? 40 TYR A HH   7  
ATOM 7061  N N    . PRO A 1 71  ? 47.422 37.024 7.339  1.00 0.00 ? 41 PRO A N    7  
ATOM 7062  C CA   . PRO A 1 71  ? 48.204 38.272 7.594  1.00 0.00 ? 41 PRO A CA   7  
ATOM 7063  C C    . PRO A 1 71  ? 47.490 39.578 7.242  1.00 0.00 ? 41 PRO A C    7  
ATOM 7064  O O    . PRO A 1 71  ? 48.140 40.624 7.181  1.00 0.00 ? 41 PRO A O    7  
ATOM 7065  C CB   . PRO A 1 71  ? 49.437 38.087 6.712  1.00 0.00 ? 41 PRO A CB   7  
ATOM 7066  C CG   . PRO A 1 71  ? 48.963 37.296 5.539  1.00 0.00 ? 41 PRO A CG   7  
ATOM 7067  C CD   . PRO A 1 71  ? 47.742 36.493 5.998  1.00 0.00 ? 41 PRO A CD   7  
ATOM 7068  H HA   . PRO A 1 71  ? 48.521 38.300 8.625  1.00 0.00 ? 41 PRO A HA   7  
ATOM 7069  H HB2  . PRO A 1 71  ? 49.816 39.049 6.394  1.00 0.00 ? 41 PRO A HB2  7  
ATOM 7070  H HB3  . PRO A 1 71  ? 50.199 37.536 7.241  1.00 0.00 ? 41 PRO A HB3  7  
ATOM 7071  H HG2  . PRO A 1 71  ? 48.689 37.964 4.734  1.00 0.00 ? 41 PRO A HG2  7  
ATOM 7072  H HG3  . PRO A 1 71  ? 49.735 36.618 5.214  1.00 0.00 ? 41 PRO A HG3  7  
ATOM 7073  H HD2  . PRO A 1 71  ? 46.915 36.648 5.320  1.00 0.00 ? 41 PRO A HD2  7  
ATOM 7074  H HD3  . PRO A 1 71  ? 47.987 35.445 6.067  1.00 0.00 ? 41 PRO A HD3  7  
ATOM 7075  N N    . HIS A 1 72  ? 46.177 39.540 7.016  1.00 0.00 ? 42 HIS A N    7  
ATOM 7076  C CA   . HIS A 1 72  ? 45.464 40.745 6.587  1.00 0.00 ? 42 HIS A CA   7  
ATOM 7077  C C    . HIS A 1 72  ? 44.060 40.825 7.176  1.00 0.00 ? 42 HIS A C    7  
ATOM 7078  O O    . HIS A 1 72  ? 43.435 39.805 7.461  1.00 0.00 ? 42 HIS A O    7  
ATOM 7079  C CB   . HIS A 1 72  ? 45.372 40.778 5.060  1.00 0.00 ? 42 HIS A CB   7  
ATOM 7080  C CG   . HIS A 1 72  ? 46.703 40.960 4.382  1.00 0.00 ? 42 HIS A CG   7  
ATOM 7081  N ND1  . HIS A 1 72  ? 47.440 39.889 3.902  1.00 0.00 ? 42 HIS A ND1  7  
ATOM 7082  C CD2  . HIS A 1 72  ? 47.440 42.082 4.094  1.00 0.00 ? 42 HIS A CD2  7  
ATOM 7083  C CE1  . HIS A 1 72  ? 48.566 40.383 3.357  1.00 0.00 ? 42 HIS A CE1  7  
ATOM 7084  N NE2  . HIS A 1 72  ? 48.617 41.715 3.447  1.00 0.00 ? 42 HIS A NE2  7  
ATOM 7085  H H    . HIS A 1 72  ? 45.685 38.701 7.138  1.00 0.00 ? 42 HIS A H    7  
ATOM 7086  H HA   . HIS A 1 72  ? 46.021 41.612 6.912  1.00 0.00 ? 42 HIS A HA   7  
ATOM 7087  H HB2  . HIS A 1 72  ? 44.940 39.850 4.720  1.00 0.00 ? 42 HIS A HB2  7  
ATOM 7088  H HB3  . HIS A 1 72  ? 44.716 41.589 4.773  1.00 0.00 ? 42 HIS A HB3  7  
ATOM 7089  H HD1  . HIS A 1 72  ? 47.188 38.943 3.951  1.00 0.00 ? 42 HIS A HD1  7  
ATOM 7090  H HD2  . HIS A 1 72  ? 47.151 43.094 4.335  1.00 0.00 ? 42 HIS A HD2  7  
ATOM 7091  H HE1  . HIS A 1 72  ? 49.334 39.777 2.901  1.00 0.00 ? 42 HIS A HE1  7  
ATOM 7092  N N    . LYS A 1 73  ? 43.579 42.048 7.386  1.00 0.00 ? 43 LYS A N    7  
ATOM 7093  C CA   . LYS A 1 73  ? 42.182 42.241 7.752  1.00 0.00 ? 43 LYS A CA   7  
ATOM 7094  C C    . LYS A 1 73  ? 41.296 41.746 6.615  1.00 0.00 ? 43 LYS A C    7  
ATOM 7095  O O    . LYS A 1 73  ? 41.538 42.076 5.452  1.00 0.00 ? 43 LYS A O    7  
ATOM 7096  C CB   . LYS A 1 73  ? 41.903 43.728 7.991  1.00 0.00 ? 43 LYS A CB   7  
ATOM 7097  C CG   . LYS A 1 73  ? 40.489 43.898 8.550  1.00 0.00 ? 43 LYS A CG   7  
ATOM 7098  C CD   . LYS A 1 73  ? 40.244 45.371 8.883  1.00 0.00 ? 43 LYS A CD   7  
ATOM 7099  C CE   . LYS A 1 73  ? 40.191 46.186 7.590  1.00 0.00 ? 43 LYS A CE   7  
ATOM 7100  N NZ   . LYS A 1 73  ? 39.487 47.475 7.844  1.00 0.00 ? 43 LYS A NZ   7  
ATOM 7101  H H    . LYS A 1 73  ? 44.172 42.825 7.303  1.00 0.00 ? 43 LYS A H    7  
ATOM 7102  H HA   . LYS A 1 73  ? 41.962 41.685 8.650  1.00 0.00 ? 43 LYS A HA   7  
ATOM 7103  H HB2  . LYS A 1 73  ? 42.622 44.125 8.690  1.00 0.00 ? 43 LYS A HB2  7  
ATOM 7104  H HB3  . LYS A 1 73  ? 41.980 44.261 7.056  1.00 0.00 ? 43 LYS A HB3  7  
ATOM 7105  H HG2  . LYS A 1 73  ? 39.769 43.569 7.815  1.00 0.00 ? 43 LYS A HG2  7  
ATOM 7106  H HG3  . LYS A 1 73  ? 40.382 43.307 9.448  1.00 0.00 ? 43 LYS A HG3  7  
ATOM 7107  H HD2  . LYS A 1 73  ? 39.306 45.469 9.411  1.00 0.00 ? 43 LYS A HD2  7  
ATOM 7108  H HD3  . LYS A 1 73  ? 41.047 45.739 9.504  1.00 0.00 ? 43 LYS A HD3  7  
ATOM 7109  H HE2  . LYS A 1 73  ? 41.196 46.385 7.248  1.00 0.00 ? 43 LYS A HE2  7  
ATOM 7110  H HE3  . LYS A 1 73  ? 39.658 45.627 6.834  1.00 0.00 ? 43 LYS A HE3  7  
ATOM 7111  H HZ1  . LYS A 1 73  ? 39.303 47.954 6.939  1.00 0.00 ? 43 LYS A HZ1  7  
ATOM 7112  H HZ2  . LYS A 1 73  ? 40.083 48.081 8.443  1.00 0.00 ? 43 LYS A HZ2  7  
ATOM 7113  H HZ3  . LYS A 1 73  ? 38.585 47.289 8.324  1.00 0.00 ? 43 LYS A HZ3  7  
ATOM 7114  N N    . ILE A 1 74  ? 40.276 40.959 6.944  1.00 0.00 ? 44 ILE A N    7  
ATOM 7115  C CA   . ILE A 1 74  ? 39.347 40.485 5.921  1.00 0.00 ? 44 ILE A CA   7  
ATOM 7116  C C    . ILE A 1 74  ? 38.172 41.452 5.774  1.00 0.00 ? 44 ILE A C    7  
ATOM 7117  O O    . ILE A 1 74  ? 37.541 41.835 6.760  1.00 0.00 ? 44 ILE A O    7  
ATOM 7118  C CB   . ILE A 1 74  ? 38.872 39.067 6.268  1.00 0.00 ? 44 ILE A CB   7  
ATOM 7119  C CG1  . ILE A 1 74  ? 40.096 38.148 6.331  1.00 0.00 ? 44 ILE A CG1  7  
ATOM 7120  C CG2  . ILE A 1 74  ? 37.907 38.551 5.196  1.00 0.00 ? 44 ILE A CG2  7  
ATOM 7121  C CD1  . ILE A 1 74  ? 39.688 36.759 6.823  1.00 0.00 ? 44 ILE A CD1  7  
ATOM 7122  H H    . ILE A 1 74  ? 40.165 40.675 7.878  1.00 0.00 ? 44 ILE A H    7  
ATOM 7123  H HA   . ILE A 1 74  ? 39.871 40.445 4.977  1.00 0.00 ? 44 ILE A HA   7  
ATOM 7124  H HB   . ILE A 1 74  ? 38.376 39.076 7.227  1.00 0.00 ? 44 ILE A HB   7  
ATOM 7125  H HG12 . ILE A 1 74  ? 40.532 38.064 5.347  1.00 0.00 ? 44 ILE A HG12 7  
ATOM 7126  H HG13 . ILE A 1 74  ? 40.824 38.566 7.011  1.00 0.00 ? 44 ILE A HG13 7  
ATOM 7127  H HG21 . ILE A 1 74  ? 37.031 39.181 5.171  1.00 0.00 ? 44 ILE A HG21 7  
ATOM 7128  H HG22 . ILE A 1 74  ? 37.616 37.537 5.426  1.00 0.00 ? 44 ILE A HG22 7  
ATOM 7129  H HG23 . ILE A 1 74  ? 38.394 38.575 4.232  1.00 0.00 ? 44 ILE A HG23 7  
ATOM 7130  H HD11 . ILE A 1 74  ? 39.280 36.192 5.999  1.00 0.00 ? 44 ILE A HD11 7  
ATOM 7131  H HD12 . ILE A 1 74  ? 38.944 36.856 7.599  1.00 0.00 ? 44 ILE A HD12 7  
ATOM 7132  H HD13 . ILE A 1 74  ? 40.557 36.250 7.214  1.00 0.00 ? 44 ILE A HD13 7  
ATOM 7133  N N    . LYS A 1 75  ? 37.889 41.840 4.533  1.00 0.00 ? 45 LYS A N    7  
ATOM 7134  C CA   . LYS A 1 75  ? 36.817 42.797 4.260  1.00 0.00 ? 45 LYS A CA   7  
ATOM 7135  C C    . LYS A 1 75  ? 35.436 42.141 4.178  1.00 0.00 ? 45 LYS A C    7  
ATOM 7136  O O    . LYS A 1 75  ? 34.422 42.827 4.310  1.00 0.00 ? 45 LYS A O    7  
ATOM 7137  C CB   . LYS A 1 75  ? 37.103 43.523 2.945  1.00 0.00 ? 45 LYS A CB   7  
ATOM 7138  C CG   . LYS A 1 75  ? 38.387 44.344 3.083  1.00 0.00 ? 45 LYS A CG   7  
ATOM 7139  C CD   . LYS A 1 75  ? 38.616 45.153 1.805  1.00 0.00 ? 45 LYS A CD   7  
ATOM 7140  C CE   . LYS A 1 75  ? 39.961 45.876 1.891  1.00 0.00 ? 45 LYS A CE   7  
ATOM 7141  N NZ   . LYS A 1 75  ? 39.857 47.007 2.855  1.00 0.00 ? 45 LYS A NZ   7  
ATOM 7142  H H    . LYS A 1 75  ? 38.411 41.478 3.787  1.00 0.00 ? 45 LYS A H    7  
ATOM 7143  H HA   . LYS A 1 75  ? 36.800 43.528 5.052  1.00 0.00 ? 45 LYS A HA   7  
ATOM 7144  H HB2  . LYS A 1 75  ? 37.221 42.798 2.152  1.00 0.00 ? 45 LYS A HB2  7  
ATOM 7145  H HB3  . LYS A 1 75  ? 36.281 44.183 2.711  1.00 0.00 ? 45 LYS A HB3  7  
ATOM 7146  H HG2  . LYS A 1 75  ? 38.296 45.014 3.923  1.00 0.00 ? 45 LYS A HG2  7  
ATOM 7147  H HG3  . LYS A 1 75  ? 39.224 43.680 3.239  1.00 0.00 ? 45 LYS A HG3  7  
ATOM 7148  H HD2  . LYS A 1 75  ? 38.617 44.487 0.953  1.00 0.00 ? 45 LYS A HD2  7  
ATOM 7149  H HD3  . LYS A 1 75  ? 37.826 45.881 1.691  1.00 0.00 ? 45 LYS A HD3  7  
ATOM 7150  H HE2  . LYS A 1 75  ? 40.720 45.185 2.227  1.00 0.00 ? 45 LYS A HE2  7  
ATOM 7151  H HE3  . LYS A 1 75  ? 40.229 46.257 0.917  1.00 0.00 ? 45 LYS A HE3  7  
ATOM 7152  H HZ1  . LYS A 1 75  ? 39.780 47.903 2.333  1.00 0.00 ? 45 LYS A HZ1  7  
ATOM 7153  H HZ2  . LYS A 1 75  ? 40.705 47.026 3.459  1.00 0.00 ? 45 LYS A HZ2  7  
ATOM 7154  H HZ3  . LYS A 1 75  ? 39.012 46.879 3.448  1.00 0.00 ? 45 LYS A HZ3  7  
ATOM 7155  N N    . SER A 1 76  ? 35.385 40.829 3.951  1.00 0.00 ? 46 SER A N    7  
ATOM 7156  C CA   . SER A 1 76  ? 34.106 40.131 3.862  1.00 0.00 ? 46 SER A CA   7  
ATOM 7157  C C    . SER A 1 76  ? 34.258 38.659 4.230  1.00 0.00 ? 46 SER A C    7  
ATOM 7158  O O    . SER A 1 76  ? 35.330 38.075 4.075  1.00 0.00 ? 46 SER A O    7  
ATOM 7159  C CB   . SER A 1 76  ? 33.547 40.247 2.443  1.00 0.00 ? 46 SER A CB   7  
ATOM 7160  O OG   . SER A 1 76  ? 34.350 39.475 1.561  1.00 0.00 ? 46 SER A OG   7  
ATOM 7161  H H    . SER A 1 76  ? 36.217 40.327 3.830  1.00 0.00 ? 46 SER A H    7  
ATOM 7162  H HA   . SER A 1 76  ? 33.410 40.592 4.546  1.00 0.00 ? 46 SER A HA   7  
ATOM 7163  H HB2  . SER A 1 76  ? 32.537 39.874 2.417  1.00 0.00 ? 46 SER A HB2  7  
ATOM 7164  H HB3  . SER A 1 76  ? 33.551 41.287 2.142  1.00 0.00 ? 46 SER A HB3  7  
ATOM 7165  H HG   . SER A 1 76  ? 35.213 39.603 1.786  1.00 0.00 ? 46 SER A HG   7  
ATOM 7166  N N    . GLY A 1 77  ? 33.170 38.067 4.714  1.00 0.00 ? 47 GLY A N    7  
ATOM 7167  C CA   . GLY A 1 77  ? 33.167 36.652 5.068  1.00 0.00 ? 47 GLY A CA   7  
ATOM 7168  C C    . GLY A 1 77  ? 33.409 35.763 3.849  1.00 0.00 ? 47 GLY A C    7  
ATOM 7169  O O    . GLY A 1 77  ? 34.043 34.710 3.955  1.00 0.00 ? 47 GLY A O    7  
ATOM 7170  H H    . GLY A 1 77  ? 32.345 38.584 4.813  1.00 0.00 ? 47 GLY A H    7  
ATOM 7171  H HA2  . GLY A 1 77  ? 33.942 36.470 5.799  1.00 0.00 ? 47 GLY A HA2  7  
ATOM 7172  H HA3  . GLY A 1 77  ? 32.210 36.401 5.497  1.00 0.00 ? 47 GLY A HA3  7  
ATOM 7173  N N    . ALA A 1 78  ? 32.928 36.197 2.684  1.00 0.00 ? 48 ALA A N    7  
ATOM 7174  C CA   . ALA A 1 78  ? 33.061 35.389 1.477  1.00 0.00 ? 48 ALA A CA   7  
ATOM 7175  C C    . ALA A 1 78  ? 34.531 35.108 1.193  1.00 0.00 ? 48 ALA A C    7  
ATOM 7176  O O    . ALA A 1 78  ? 34.893 33.993 0.815  1.00 0.00 ? 48 ALA A O    7  
ATOM 7177  C CB   . ALA A 1 78  ? 32.437 36.120 0.287  1.00 0.00 ? 48 ALA A CB   7  
ATOM 7178  H H    . ALA A 1 78  ? 32.479 37.067 2.639  1.00 0.00 ? 48 ALA A H    7  
ATOM 7179  H HA   . ALA A 1 78  ? 32.544 34.451 1.622  1.00 0.00 ? 48 ALA A HA   7  
ATOM 7180  H HB1  . ALA A 1 78  ? 31.364 36.001 0.312  1.00 0.00 ? 48 ALA A HB1  7  
ATOM 7181  H HB2  . ALA A 1 78  ? 32.824 35.706 -0.633 1.00 0.00 ? 48 ALA A HB2  7  
ATOM 7182  H HB3  . ALA A 1 78  ? 32.684 37.170 0.340  1.00 0.00 ? 48 ALA A HB3  7  
ATOM 7183  N N    . GLU A 1 79  ? 35.377 36.119 1.374  1.00 0.00 ? 49 GLU A N    7  
ATOM 7184  C CA   . GLU A 1 79  ? 36.816 35.904 1.296  1.00 0.00 ? 49 GLU A CA   7  
ATOM 7185  C C    . GLU A 1 79  ? 37.272 34.926 2.378  1.00 0.00 ? 49 GLU A C    7  
ATOM 7186  O O    . GLU A 1 79  ? 38.067 34.025 2.111  1.00 0.00 ? 49 GLU A O    7  
ATOM 7187  C CB   . GLU A 1 79  ? 37.551 37.235 1.466  1.00 0.00 ? 49 GLU A CB   7  
ATOM 7188  C CG   . GLU A 1 79  ? 39.053 37.030 1.242  1.00 0.00 ? 49 GLU A CG   7  
ATOM 7189  C CD   . GLU A 1 79  ? 39.351 36.736 -0.228 1.00 0.00 ? 49 GLU A CD   7  
ATOM 7190  O OE1  . GLU A 1 79  ? 38.572 37.141 -1.078 1.00 0.00 ? 49 GLU A OE1  7  
ATOM 7191  O OE2  . GLU A 1 79  ? 40.365 36.107 -0.485 1.00 0.00 ? 49 GLU A OE2  7  
ATOM 7192  H H    . GLU A 1 79  ? 35.029 37.017 1.562  1.00 0.00 ? 49 GLU A H    7  
ATOM 7193  H HA   . GLU A 1 79  ? 37.058 35.494 0.326  1.00 0.00 ? 49 GLU A HA   7  
ATOM 7194  H HB2  . GLU A 1 79  ? 37.172 37.948 0.747  1.00 0.00 ? 49 GLU A HB2  7  
ATOM 7195  H HB3  . GLU A 1 79  ? 37.388 37.611 2.466  1.00 0.00 ? 49 GLU A HB3  7  
ATOM 7196  H HG2  . GLU A 1 79  ? 39.581 37.925 1.538  1.00 0.00 ? 49 GLU A HG2  7  
ATOM 7197  H HG3  . GLU A 1 79  ? 39.392 36.202 1.846  1.00 0.00 ? 49 GLU A HG3  7  
ATOM 7198  N N    . ALA A 1 80  ? 36.672 35.019 3.565  1.00 0.00 ? 50 ALA A N    7  
ATOM 7199  C CA   . ALA A 1 80  ? 37.076 34.166 4.679  1.00 0.00 ? 50 ALA A CA   7  
ATOM 7200  C C    . ALA A 1 80  ? 36.881 32.687 4.350  1.00 0.00 ? 50 ALA A C    7  
ATOM 7201  O O    . ALA A 1 80  ? 37.700 31.847 4.726  1.00 0.00 ? 50 ALA A O    7  
ATOM 7202  C CB   . ALA A 1 80  ? 36.263 34.520 5.926  1.00 0.00 ? 50 ALA A CB   7  
ATOM 7203  H H    . ALA A 1 80  ? 35.952 35.673 3.694  1.00 0.00 ? 50 ALA A H    7  
ATOM 7204  H HA   . ALA A 1 80  ? 38.120 34.341 4.890  1.00 0.00 ? 50 ALA A HA   7  
ATOM 7205  H HB1  . ALA A 1 80  ? 36.832 34.276 6.809  1.00 0.00 ? 50 ALA A HB1  7  
ATOM 7206  H HB2  . ALA A 1 80  ? 35.341 33.957 5.925  1.00 0.00 ? 50 ALA A HB2  7  
ATOM 7207  H HB3  . ALA A 1 80  ? 36.039 35.577 5.921  1.00 0.00 ? 50 ALA A HB3  7  
ATOM 7208  N N    . LYS A 1 81  ? 35.846 32.379 3.578  1.00 0.00 ? 51 LYS A N    7  
ATOM 7209  C CA   . LYS A 1 81  ? 35.560 30.994 3.217  1.00 0.00 ? 51 LYS A CA   7  
ATOM 7210  C C    . LYS A 1 81  ? 36.748 30.335 2.512  1.00 0.00 ? 51 LYS A C    7  
ATOM 7211  O O    . LYS A 1 81  ? 36.934 29.122 2.621  1.00 0.00 ? 51 LYS A O    7  
ATOM 7212  C CB   . LYS A 1 81  ? 34.332 30.945 2.304  1.00 0.00 ? 51 LYS A CB   7  
ATOM 7213  C CG   . LYS A 1 81  ? 33.930 29.490 2.050  1.00 0.00 ? 51 LYS A CG   7  
ATOM 7214  C CD   . LYS A 1 81  ? 32.756 29.447 1.069  1.00 0.00 ? 51 LYS A CD   7  
ATOM 7215  C CE   . LYS A 1 81  ? 32.255 28.009 0.932  1.00 0.00 ? 51 LYS A CE   7  
ATOM 7216  N NZ   . LYS A 1 81  ? 30.891 28.013 0.334  1.00 0.00 ? 51 LYS A NZ   7  
ATOM 7217  H H    . LYS A 1 81  ? 35.235 33.092 3.294  1.00 0.00 ? 51 LYS A H    7  
ATOM 7218  H HA   . LYS A 1 81  ? 35.339 30.439 4.116  1.00 0.00 ? 51 LYS A HA   7  
ATOM 7219  H HB2  . LYS A 1 81  ? 33.512 31.468 2.777  1.00 0.00 ? 51 LYS A HB2  7  
ATOM 7220  H HB3  . LYS A 1 81  ? 34.566 31.419 1.362  1.00 0.00 ? 51 LYS A HB3  7  
ATOM 7221  H HG2  . LYS A 1 81  ? 34.769 28.953 1.634  1.00 0.00 ? 51 LYS A HG2  7  
ATOM 7222  H HG3  . LYS A 1 81  ? 33.632 29.030 2.982  1.00 0.00 ? 51 LYS A HG3  7  
ATOM 7223  H HD2  . LYS A 1 81  ? 31.957 30.076 1.437  1.00 0.00 ? 51 LYS A HD2  7  
ATOM 7224  H HD3  . LYS A 1 81  ? 33.081 29.805 0.103  1.00 0.00 ? 51 LYS A HD3  7  
ATOM 7225  H HE2  . LYS A 1 81  ? 32.926 27.453 0.295  1.00 0.00 ? 51 LYS A HE2  7  
ATOM 7226  H HE3  . LYS A 1 81  ? 32.218 27.547 1.908  1.00 0.00 ? 51 LYS A HE3  7  
ATOM 7227  H HZ1  . LYS A 1 81  ? 30.664 27.063 -0.021 1.00 0.00 ? 51 LYS A HZ1  7  
ATOM 7228  H HZ2  . LYS A 1 81  ? 30.861 28.695 -0.452 1.00 0.00 ? 51 LYS A HZ2  7  
ATOM 7229  H HZ3  . LYS A 1 81  ? 30.195 28.286 1.057  1.00 0.00 ? 51 LYS A HZ3  7  
ATOM 7230  N N    . LYS A 1 82  ? 37.549 31.119 1.792  1.00 0.00 ? 52 LYS A N    7  
ATOM 7231  C CA   . LYS A 1 82  ? 38.691 30.567 1.068  1.00 0.00 ? 52 LYS A CA   7  
ATOM 7232  C C    . LYS A 1 82  ? 39.702 29.892 2.001  1.00 0.00 ? 52 LYS A C    7  
ATOM 7233  O O    . LYS A 1 82  ? 40.457 29.025 1.563  1.00 0.00 ? 52 LYS A O    7  
ATOM 7234  C CB   . LYS A 1 82  ? 39.390 31.675 0.278  1.00 0.00 ? 52 LYS A CB   7  
ATOM 7235  C CG   . LYS A 1 82  ? 38.449 32.200 -0.808 1.00 0.00 ? 52 LYS A CG   7  
ATOM 7236  C CD   . LYS A 1 82  ? 39.184 33.228 -1.669 1.00 0.00 ? 52 LYS A CD   7  
ATOM 7237  C CE   . LYS A 1 82  ? 38.214 33.834 -2.684 1.00 0.00 ? 52 LYS A CE   7  
ATOM 7238  N NZ   . LYS A 1 82  ? 37.230 34.702 -1.977 1.00 0.00 ? 52 LYS A NZ   7  
ATOM 7239  H H    . LYS A 1 82  ? 37.403 32.090 1.784  1.00 0.00 ? 52 LYS A H    7  
ATOM 7240  H HA   . LYS A 1 82  ? 38.327 29.830 0.368  1.00 0.00 ? 52 LYS A HA   7  
ATOM 7241  H HB2  . LYS A 1 82  ? 39.656 32.481 0.947  1.00 0.00 ? 52 LYS A HB2  7  
ATOM 7242  H HB3  . LYS A 1 82  ? 40.282 31.280 -0.184 1.00 0.00 ? 52 LYS A HB3  7  
ATOM 7243  H HG2  . LYS A 1 82  ? 38.121 31.378 -1.427 1.00 0.00 ? 52 LYS A HG2  7  
ATOM 7244  H HG3  . LYS A 1 82  ? 37.592 32.668 -0.347 1.00 0.00 ? 52 LYS A HG3  7  
ATOM 7245  H HD2  . LYS A 1 82  ? 39.579 34.010 -1.037 1.00 0.00 ? 52 LYS A HD2  7  
ATOM 7246  H HD3  . LYS A 1 82  ? 39.994 32.745 -2.195 1.00 0.00 ? 52 LYS A HD3  7  
ATOM 7247  H HE2  . LYS A 1 82  ? 38.764 34.425 -3.401 1.00 0.00 ? 52 LYS A HE2  7  
ATOM 7248  H HE3  . LYS A 1 82  ? 37.689 33.042 -3.199 1.00 0.00 ? 52 LYS A HE3  7  
ATOM 7249  H HZ1  . LYS A 1 82  ? 36.557 35.096 -2.664 1.00 0.00 ? 52 LYS A HZ1  7  
ATOM 7250  H HZ2  . LYS A 1 82  ? 37.734 35.479 -1.501 1.00 0.00 ? 52 LYS A HZ2  7  
ATOM 7251  H HZ3  . LYS A 1 82  ? 36.713 34.139 -1.272 1.00 0.00 ? 52 LYS A HZ3  7  
ATOM 7252  N N    . LEU A 1 83  ? 39.721 30.277 3.279  1.00 0.00 ? 53 LEU A N    7  
ATOM 7253  C CA   . LEU A 1 83  ? 40.737 29.777 4.196  1.00 0.00 ? 53 LEU A CA   7  
ATOM 7254  C C    . LEU A 1 83  ? 40.361 28.387 4.728  1.00 0.00 ? 53 LEU A C    7  
ATOM 7255  O O    . LEU A 1 83  ? 39.188 28.155 5.040  1.00 0.00 ? 53 LEU A O    7  
ATOM 7256  C CB   . LEU A 1 83  ? 40.888 30.746 5.370  1.00 0.00 ? 53 LEU A CB   7  
ATOM 7257  C CG   . LEU A 1 83  ? 41.369 32.103 4.854  1.00 0.00 ? 53 LEU A CG   7  
ATOM 7258  C CD1  . LEU A 1 83  ? 41.153 33.166 5.933  1.00 0.00 ? 53 LEU A CD1  7  
ATOM 7259  C CD2  . LEU A 1 83  ? 42.858 32.018 4.516  1.00 0.00 ? 53 LEU A CD2  7  
ATOM 7260  H H    . LEU A 1 83  ? 39.034 30.889 3.614  1.00 0.00 ? 53 LEU A H    7  
ATOM 7261  H HA   . LEU A 1 83  ? 41.670 29.737 3.662  1.00 0.00 ? 53 LEU A HA   7  
ATOM 7262  H HB2  . LEU A 1 83  ? 39.933 30.864 5.863  1.00 0.00 ? 53 LEU A HB2  7  
ATOM 7263  H HB3  . LEU A 1 83  ? 41.609 30.355 6.069  1.00 0.00 ? 53 LEU A HB3  7  
ATOM 7264  H HG   . LEU A 1 83  ? 40.811 32.370 3.969  1.00 0.00 ? 53 LEU A HG   7  
ATOM 7265  H HD11 . LEU A 1 83  ? 41.356 34.144 5.521  1.00 0.00 ? 53 LEU A HD11 7  
ATOM 7266  H HD12 . LEU A 1 83  ? 41.820 32.979 6.762  1.00 0.00 ? 53 LEU A HD12 7  
ATOM 7267  H HD13 . LEU A 1 83  ? 40.131 33.125 6.279  1.00 0.00 ? 53 LEU A HD13 7  
ATOM 7268  H HD21 . LEU A 1 83  ? 42.984 31.525 3.563  1.00 0.00 ? 53 LEU A HD21 7  
ATOM 7269  H HD22 . LEU A 1 83  ? 43.371 31.455 5.282  1.00 0.00 ? 53 LEU A HD22 7  
ATOM 7270  H HD23 . LEU A 1 83  ? 43.274 33.014 4.462  1.00 0.00 ? 53 LEU A HD23 7  
ATOM 7271  N N    . PRO A 1 84  ? 41.303 27.478 4.896  1.00 0.00 ? 54 PRO A N    7  
ATOM 7272  C CA   . PRO A 1 84  ? 40.970 26.102 5.379  1.00 0.00 ? 54 PRO A CA   7  
ATOM 7273  C C    . PRO A 1 84  ? 40.270 26.136 6.735  1.00 0.00 ? 54 PRO A C    7  
ATOM 7274  O O    . PRO A 1 84  ? 40.750 26.765 7.679  1.00 0.00 ? 54 PRO A O    7  
ATOM 7275  C CB   . PRO A 1 84  ? 42.319 25.379 5.481  1.00 0.00 ? 54 PRO A CB   7  
ATOM 7276  C CG   . PRO A 1 84  ? 43.271 26.176 4.659  1.00 0.00 ? 54 PRO A CG   7  
ATOM 7277  C CD   . PRO A 1 84  ? 42.757 27.614 4.675  1.00 0.00 ? 54 PRO A CD   7  
ATOM 7278  H HA   . PRO A 1 84  ? 40.347 25.599 4.656  1.00 0.00 ? 54 PRO A HA   7  
ATOM 7279  H HB2  . PRO A 1 84  ? 42.654 25.342 6.510  1.00 0.00 ? 54 PRO A HB2  7  
ATOM 7280  H HB3  . PRO A 1 84  ? 42.239 24.382 5.078  1.00 0.00 ? 54 PRO A HB3  7  
ATOM 7281  H HG2  . PRO A 1 84  ? 44.262 26.126 5.088  1.00 0.00 ? 54 PRO A HG2  7  
ATOM 7282  H HG3  . PRO A 1 84  ? 43.282 25.812 3.644  1.00 0.00 ? 54 PRO A HG3  7  
ATOM 7283  H HD2  . PRO A 1 84  ? 43.219 28.170 5.480  1.00 0.00 ? 54 PRO A HD2  7  
ATOM 7284  H HD3  . PRO A 1 84  ? 42.945 28.088 3.726  1.00 0.00 ? 54 PRO A HD3  7  
ATOM 7285  N N    . GLY A 1 85  ? 39.139 25.445 6.824  1.00 0.00 ? 55 GLY A N    7  
ATOM 7286  C CA   . GLY A 1 85  ? 38.396 25.367 8.079  1.00 0.00 ? 55 GLY A CA   7  
ATOM 7287  C C    . GLY A 1 85  ? 37.193 26.315 8.131  1.00 0.00 ? 55 GLY A C    7  
ATOM 7288  O O    . GLY A 1 85  ? 36.362 26.189 9.031  1.00 0.00 ? 55 GLY A O    7  
ATOM 7289  H H    . GLY A 1 85  ? 38.796 24.979 6.033  1.00 0.00 ? 55 GLY A H    7  
ATOM 7290  H HA2  . GLY A 1 85  ? 38.043 24.354 8.208  1.00 0.00 ? 55 GLY A HA2  7  
ATOM 7291  H HA3  . GLY A 1 85  ? 39.063 25.606 8.894  1.00 0.00 ? 55 GLY A HA3  7  
ATOM 7292  N N    . VAL A 1 86  ? 37.087 27.257 7.189  1.00 0.00 ? 56 VAL A N    7  
ATOM 7293  C CA   . VAL A 1 86  ? 35.952 28.178 7.181  1.00 0.00 ? 56 VAL A CA   7  
ATOM 7294  C C    . VAL A 1 86  ? 34.815 27.603 6.341  1.00 0.00 ? 56 VAL A C    7  
ATOM 7295  O O    . VAL A 1 86  ? 35.036 27.103 5.237  1.00 0.00 ? 56 VAL A O    7  
ATOM 7296  C CB   . VAL A 1 86  ? 36.373 29.544 6.623  1.00 0.00 ? 56 VAL A CB   7  
ATOM 7297  C CG1  . VAL A 1 86  ? 35.204 30.527 6.731  1.00 0.00 ? 56 VAL A CG1  7  
ATOM 7298  C CG2  . VAL A 1 86  ? 37.558 30.091 7.422  1.00 0.00 ? 56 VAL A CG2  7  
ATOM 7299  H H    . VAL A 1 86  ? 37.782 27.343 6.500  1.00 0.00 ? 56 VAL A H    7  
ATOM 7300  H HA   . VAL A 1 86  ? 35.604 28.309 8.194  1.00 0.00 ? 56 VAL A HA   7  
ATOM 7301  H HB   . VAL A 1 86  ? 36.656 29.436 5.585  1.00 0.00 ? 56 VAL A HB   7  
ATOM 7302  H HG11 . VAL A 1 86  ? 34.980 30.707 7.773  1.00 0.00 ? 56 VAL A HG11 7  
ATOM 7303  H HG12 . VAL A 1 86  ? 34.336 30.111 6.244  1.00 0.00 ? 56 VAL A HG12 7  
ATOM 7304  H HG13 . VAL A 1 86  ? 35.472 31.459 6.256  1.00 0.00 ? 56 VAL A HG13 7  
ATOM 7305  H HG21 . VAL A 1 86  ? 37.686 31.141 7.202  1.00 0.00 ? 56 VAL A HG21 7  
ATOM 7306  H HG22 . VAL A 1 86  ? 38.455 29.554 7.149  1.00 0.00 ? 56 VAL A HG22 7  
ATOM 7307  H HG23 . VAL A 1 86  ? 37.370 29.965 8.478  1.00 0.00 ? 56 VAL A HG23 7  
ATOM 7308  N N    . GLY A 1 87  ? 33.595 27.677 6.870  1.00 0.00 ? 57 GLY A N    7  
ATOM 7309  C CA   . GLY A 1 87  ? 32.425 27.165 6.163  1.00 0.00 ? 57 GLY A CA   7  
ATOM 7310  C C    . GLY A 1 87  ? 31.507 28.304 5.731  1.00 0.00 ? 57 GLY A C    7  
ATOM 7311  O O    . GLY A 1 87  ? 31.690 29.451 6.137  1.00 0.00 ? 57 GLY A O    7  
ATOM 7312  H H    . GLY A 1 87  ? 33.481 28.085 7.754  1.00 0.00 ? 57 GLY A H    7  
ATOM 7313  H HA2  . GLY A 1 87  ? 32.744 26.613 5.289  1.00 0.00 ? 57 GLY A HA2  7  
ATOM 7314  H HA3  . GLY A 1 87  ? 31.877 26.505 6.818  1.00 0.00 ? 57 GLY A HA3  7  
ATOM 7315  N N    . THR A 1 88  ? 30.503 27.976 4.925  1.00 0.00 ? 58 THR A N    7  
ATOM 7316  C CA   . THR A 1 88  ? 29.578 28.991 4.432  1.00 0.00 ? 58 THR A CA   7  
ATOM 7317  C C    . THR A 1 88  ? 28.895 29.707 5.593  1.00 0.00 ? 58 THR A C    7  
ATOM 7318  O O    . THR A 1 88  ? 28.775 30.933 5.593  1.00 0.00 ? 58 THR A O    7  
ATOM 7319  C CB   . THR A 1 88  ? 28.519 28.341 3.537  1.00 0.00 ? 58 THR A CB   7  
ATOM 7320  O OG1  . THR A 1 88  ? 29.163 27.590 2.517  1.00 0.00 ? 58 THR A OG1  7  
ATOM 7321  C CG2  . THR A 1 88  ? 27.647 29.425 2.902  1.00 0.00 ? 58 THR A CG2  7  
ATOM 7322  H H    . THR A 1 88  ? 30.381 27.041 4.657  1.00 0.00 ? 58 THR A H    7  
ATOM 7323  H HA   . THR A 1 88  ? 30.128 29.713 3.850  1.00 0.00 ? 58 THR A HA   7  
ATOM 7324  H HB   . THR A 1 88  ? 27.898 27.686 4.129  1.00 0.00 ? 58 THR A HB   7  
ATOM 7325  H HG1  . THR A 1 88  ? 28.525 27.182 2.029  1.00 0.00 ? 58 THR A HG1  7  
ATOM 7326  H HG21 . THR A 1 88  ? 28.258 30.280 2.655  1.00 0.00 ? 58 THR A HG21 7  
ATOM 7327  H HG22 . THR A 1 88  ? 26.876 29.722 3.599  1.00 0.00 ? 58 THR A HG22 7  
ATOM 7328  H HG23 . THR A 1 88  ? 27.190 29.038 2.002  1.00 0.00 ? 58 THR A HG23 7  
ATOM 7329  N N    . LYS A 1 89  ? 28.476 28.944 6.599  1.00 0.00 ? 59 LYS A N    7  
ATOM 7330  C CA   . LYS A 1 89  ? 27.787 29.529 7.743  1.00 0.00 ? 59 LYS A CA   7  
ATOM 7331  C C    . LYS A 1 89  ? 28.686 30.533 8.454  1.00 0.00 ? 59 LYS A C    7  
ATOM 7332  O O    . LYS A 1 89  ? 28.249 31.628 8.817  1.00 0.00 ? 59 LYS A O    7  
ATOM 7333  C CB   . LYS A 1 89  ? 27.372 28.429 8.722  1.00 0.00 ? 59 LYS A CB   7  
ATOM 7334  C CG   . LYS A 1 89  ? 26.342 27.514 8.057  1.00 0.00 ? 59 LYS A CG   7  
ATOM 7335  C CD   . LYS A 1 89  ? 26.028 26.338 8.984  1.00 0.00 ? 59 LYS A CD   7  
ATOM 7336  C CE   . LYS A 1 89  ? 25.271 26.843 10.214 1.00 0.00 ? 59 LYS A CE   7  
ATOM 7337  N NZ   . LYS A 1 89  ? 24.795 25.681 11.015 1.00 0.00 ? 59 LYS A NZ   7  
ATOM 7338  H H    . LYS A 1 89  ? 28.633 27.977 6.571  1.00 0.00 ? 59 LYS A H    7  
ATOM 7339  H HA   . LYS A 1 89  ? 26.899 30.038 7.395  1.00 0.00 ? 59 LYS A HA   7  
ATOM 7340  H HB2  . LYS A 1 89  ? 28.241 27.851 9.002  1.00 0.00 ? 59 LYS A HB2  7  
ATOM 7341  H HB3  . LYS A 1 89  ? 26.936 28.876 9.604  1.00 0.00 ? 59 LYS A HB3  7  
ATOM 7342  H HG2  . LYS A 1 89  ? 25.438 28.074 7.864  1.00 0.00 ? 59 LYS A HG2  7  
ATOM 7343  H HG3  . LYS A 1 89  ? 26.740 27.139 7.126  1.00 0.00 ? 59 LYS A HG3  7  
ATOM 7344  H HD2  . LYS A 1 89  ? 25.420 25.617 8.457  1.00 0.00 ? 59 LYS A HD2  7  
ATOM 7345  H HD3  . LYS A 1 89  ? 26.949 25.871 9.299  1.00 0.00 ? 59 LYS A HD3  7  
ATOM 7346  H HE2  . LYS A 1 89  ? 25.930 27.451 10.817 1.00 0.00 ? 59 LYS A HE2  7  
ATOM 7347  H HE3  . LYS A 1 89  ? 24.426 27.434 9.898  1.00 0.00 ? 59 LYS A HE3  7  
ATOM 7348  H HZ1  . LYS A 1 89  ? 25.599 25.064 11.246 1.00 0.00 ? 59 LYS A HZ1  7  
ATOM 7349  H HZ2  . LYS A 1 89  ? 24.093 25.146 10.465 1.00 0.00 ? 59 LYS A HZ2  7  
ATOM 7350  H HZ3  . LYS A 1 89  ? 24.359 26.021 11.896 1.00 0.00 ? 59 LYS A HZ3  7  
ATOM 7351  N N    . ILE A 1 90  ? 29.959 30.181 8.604  1.00 0.00 ? 60 ILE A N    7  
ATOM 7352  C CA   . ILE A 1 90  ? 30.906 31.071 9.267  1.00 0.00 ? 60 ILE A CA   7  
ATOM 7353  C C    . ILE A 1 90  ? 31.084 32.345 8.445  1.00 0.00 ? 60 ILE A C    7  
ATOM 7354  O O    . ILE A 1 90  ? 31.081 33.449 8.991  1.00 0.00 ? 60 ILE A O    7  
ATOM 7355  C CB   . ILE A 1 90  ? 32.248 30.360 9.478  1.00 0.00 ? 60 ILE A CB   7  
ATOM 7356  C CG1  . ILE A 1 90  ? 32.015 29.098 10.319 1.00 0.00 ? 60 ILE A CG1  7  
ATOM 7357  C CG2  . ILE A 1 90  ? 33.221 31.288 10.215 1.00 0.00 ? 60 ILE A CG2  7  
ATOM 7358  C CD1  . ILE A 1 90  ? 33.318 28.307 10.476 1.00 0.00 ? 60 ILE A CD1  7  
ATOM 7359  H H    . ILE A 1 90  ? 30.267 29.315 8.263  1.00 0.00 ? 60 ILE A H    7  
ATOM 7360  H HA   . ILE A 1 90  ? 30.503 31.340 10.232 1.00 0.00 ? 60 ILE A HA   7  
ATOM 7361  H HB   . ILE A 1 90  ? 32.667 30.085 8.521  1.00 0.00 ? 60 ILE A HB   7  
ATOM 7362  H HG12 . ILE A 1 90  ? 31.653 29.385 11.296 1.00 0.00 ? 60 ILE A HG12 7  
ATOM 7363  H HG13 . ILE A 1 90  ? 31.278 28.476 9.833  1.00 0.00 ? 60 ILE A HG13 7  
ATOM 7364  H HG21 . ILE A 1 90  ? 33.350 32.198 9.648  1.00 0.00 ? 60 ILE A HG21 7  
ATOM 7365  H HG22 . ILE A 1 90  ? 34.176 30.794 10.325 1.00 0.00 ? 60 ILE A HG22 7  
ATOM 7366  H HG23 . ILE A 1 90  ? 32.824 31.524 11.191 1.00 0.00 ? 60 ILE A HG23 7  
ATOM 7367  H HD11 . ILE A 1 90  ? 33.090 27.255 10.577 1.00 0.00 ? 60 ILE A HD11 7  
ATOM 7368  H HD12 . ILE A 1 90  ? 33.840 28.644 11.359 1.00 0.00 ? 60 ILE A HD12 7  
ATOM 7369  H HD13 . ILE A 1 90  ? 33.942 28.458 9.607  1.00 0.00 ? 60 ILE A HD13 7  
ATOM 7370  N N    . ALA A 1 91  ? 31.183 32.197 7.127  1.00 0.00 ? 61 ALA A N    7  
ATOM 7371  C CA   . ALA A 1 91  ? 31.345 33.355 6.254  1.00 0.00 ? 61 ALA A CA   7  
ATOM 7372  C C    . ALA A 1 91  ? 30.173 34.318 6.418  1.00 0.00 ? 61 ALA A C    7  
ATOM 7373  O O    . ALA A 1 91  ? 30.368 35.525 6.569  1.00 0.00 ? 61 ALA A O    7  
ATOM 7374  C CB   . ALA A 1 91  ? 31.436 32.902 4.796  1.00 0.00 ? 61 ALA A CB   7  
ATOM 7375  H H    . ALA A 1 91  ? 31.178 31.296 6.741  1.00 0.00 ? 61 ALA A H    7  
ATOM 7376  H HA   . ALA A 1 91  ? 32.259 33.867 6.518  1.00 0.00 ? 61 ALA A HA   7  
ATOM 7377  H HB1  . ALA A 1 91  ? 31.588 33.761 4.160  1.00 0.00 ? 61 ALA A HB1  7  
ATOM 7378  H HB2  . ALA A 1 91  ? 30.519 32.404 4.516  1.00 0.00 ? 61 ALA A HB2  7  
ATOM 7379  H HB3  . ALA A 1 91  ? 32.265 32.219 4.682  1.00 0.00 ? 61 ALA A HB3  7  
ATOM 7380  N N    . GLU A 1 92  ? 28.954 33.781 6.432  1.00 0.00 ? 62 GLU A N    7  
ATOM 7381  C CA   . GLU A 1 92  ? 27.774 34.623 6.607  1.00 0.00 ? 62 GLU A CA   7  
ATOM 7382  C C    . GLU A 1 92  ? 27.810 35.326 7.964  1.00 0.00 ? 62 GLU A C    7  
ATOM 7383  O O    . GLU A 1 92  ? 27.452 36.498 8.072  1.00 0.00 ? 62 GLU A O    7  
ATOM 7384  C CB   . GLU A 1 92  ? 26.506 33.774 6.504  1.00 0.00 ? 62 GLU A CB   7  
ATOM 7385  C CG   . GLU A 1 92  ? 26.400 33.179 5.094  1.00 0.00 ? 62 GLU A CG   7  
ATOM 7386  C CD   . GLU A 1 92  ? 25.103 32.384 4.908  1.00 0.00 ? 62 GLU A CD   7  
ATOM 7387  O OE1  . GLU A 1 92  ? 24.408 32.135 5.883  1.00 0.00 ? 62 GLU A OE1  7  
ATOM 7388  O OE2  . GLU A 1 92  ? 24.821 32.031 3.775  1.00 0.00 ? 62 GLU A OE2  7  
ATOM 7389  H H    . GLU A 1 92  ? 28.848 32.816 6.300  1.00 0.00 ? 62 GLU A H    7  
ATOM 7390  H HA   . GLU A 1 92  ? 27.757 35.369 5.826  1.00 0.00 ? 62 GLU A HA   7  
ATOM 7391  H HB2  . GLU A 1 92  ? 26.547 32.975 7.232  1.00 0.00 ? 62 GLU A HB2  7  
ATOM 7392  H HB3  . GLU A 1 92  ? 25.641 34.391 6.696  1.00 0.00 ? 62 GLU A HB3  7  
ATOM 7393  H HG2  . GLU A 1 92  ? 26.428 33.980 4.371  1.00 0.00 ? 62 GLU A HG2  7  
ATOM 7394  H HG3  . GLU A 1 92  ? 27.243 32.524 4.927  1.00 0.00 ? 62 GLU A HG3  7  
ATOM 7395  N N    . LYS A 1 93  ? 28.284 34.624 8.991  1.00 0.00 ? 63 LYS A N    7  
ATOM 7396  C CA   . LYS A 1 93  ? 28.419 35.226 10.312 1.00 0.00 ? 63 LYS A CA   7  
ATOM 7397  C C    . LYS A 1 93  ? 29.375 36.417 10.266 1.00 0.00 ? 63 LYS A C    7  
ATOM 7398  O O    . LYS A 1 93  ? 29.103 37.467 10.850 1.00 0.00 ? 63 LYS A O    7  
ATOM 7399  C CB   . LYS A 1 93  ? 28.944 34.178 11.295 1.00 0.00 ? 63 LYS A CB   7  
ATOM 7400  C CG   . LYS A 1 93  ? 28.767 34.677 12.729 1.00 0.00 ? 63 LYS A CG   7  
ATOM 7401  C CD   . LYS A 1 93  ? 29.645 33.843 13.661 1.00 0.00 ? 63 LYS A CD   7  
ATOM 7402  C CE   . LYS A 1 93  ? 29.080 32.423 13.754 1.00 0.00 ? 63 LYS A CE   7  
ATOM 7403  N NZ   . LYS A 1 93  ? 27.706 32.472 14.330 1.00 0.00 ? 63 LYS A NZ   7  
ATOM 7404  H H    . LYS A 1 93  ? 28.503 33.676 8.868  1.00 0.00 ? 63 LYS A H    7  
ATOM 7405  H HA   . LYS A 1 93  ? 27.451 35.565 10.646 1.00 0.00 ? 63 LYS A HA   7  
ATOM 7406  H HB2  . LYS A 1 93  ? 28.395 33.257 11.164 1.00 0.00 ? 63 LYS A HB2  7  
ATOM 7407  H HB3  . LYS A 1 93  ? 29.992 34.002 11.106 1.00 0.00 ? 63 LYS A HB3  7  
ATOM 7408  H HG2  . LYS A 1 93  ? 29.059 35.716 12.788 1.00 0.00 ? 63 LYS A HG2  7  
ATOM 7409  H HG3  . LYS A 1 93  ? 27.733 34.573 13.022 1.00 0.00 ? 63 LYS A HG3  7  
ATOM 7410  H HD2  . LYS A 1 93  ? 30.652 33.808 13.272 1.00 0.00 ? 63 LYS A HD2  7  
ATOM 7411  H HD3  . LYS A 1 93  ? 29.653 34.289 14.645 1.00 0.00 ? 63 LYS A HD3  7  
ATOM 7412  H HE2  . LYS A 1 93  ? 29.040 31.987 12.767 1.00 0.00 ? 63 LYS A HE2  7  
ATOM 7413  H HE3  . LYS A 1 93  ? 29.716 31.824 14.388 1.00 0.00 ? 63 LYS A HE3  7  
ATOM 7414  H HZ1  . LYS A 1 93  ? 27.511 31.586 14.839 1.00 0.00 ? 63 LYS A HZ1  7  
ATOM 7415  H HZ2  . LYS A 1 93  ? 27.013 32.594 13.564 1.00 0.00 ? 63 LYS A HZ2  7  
ATOM 7416  H HZ3  . LYS A 1 93  ? 27.636 33.271 14.992 1.00 0.00 ? 63 LYS A HZ3  7  
ATOM 7417  N N    . ILE A 1 94  ? 30.476 36.267 9.535  1.00 0.00 ? 64 ILE A N    7  
ATOM 7418  C CA   . ILE A 1 94  ? 31.421 37.367 9.367  1.00 0.00 ? 64 ILE A CA   7  
ATOM 7419  C C    . ILE A 1 94  ? 30.730 38.548 8.686  1.00 0.00 ? 64 ILE A C    7  
ATOM 7420  O O    . ILE A 1 94  ? 30.902 39.696 9.098  1.00 0.00 ? 64 ILE A O    7  
ATOM 7421  C CB   . ILE A 1 94  ? 32.626 36.888 8.542  1.00 0.00 ? 64 ILE A CB   7  
ATOM 7422  C CG1  . ILE A 1 94  ? 33.339 35.768 9.303  1.00 0.00 ? 64 ILE A CG1  7  
ATOM 7423  C CG2  . ILE A 1 94  ? 33.623 38.027 8.301  1.00 0.00 ? 64 ILE A CG2  7  
ATOM 7424  C CD1  . ILE A 1 94  ? 34.365 35.099 8.386  1.00 0.00 ? 64 ILE A CD1  7  
ATOM 7425  H H    . ILE A 1 94  ? 30.670 35.395 9.131  1.00 0.00 ? 64 ILE A H    7  
ATOM 7426  H HA   . ILE A 1 94  ? 31.768 37.679 10.342 1.00 0.00 ? 64 ILE A HA   7  
ATOM 7427  H HB   . ILE A 1 94  ? 32.279 36.507 7.592  1.00 0.00 ? 64 ILE A HB   7  
ATOM 7428  H HG12 . ILE A 1 94  ? 33.841 36.185 10.163 1.00 0.00 ? 64 ILE A HG12 7  
ATOM 7429  H HG13 . ILE A 1 94  ? 32.617 35.035 9.629  1.00 0.00 ? 64 ILE A HG13 7  
ATOM 7430  H HG21 . ILE A 1 94  ? 34.083 38.308 9.236  1.00 0.00 ? 64 ILE A HG21 7  
ATOM 7431  H HG22 . ILE A 1 94  ? 33.106 38.877 7.883  1.00 0.00 ? 64 ILE A HG22 7  
ATOM 7432  H HG23 . ILE A 1 94  ? 34.385 37.695 7.610  1.00 0.00 ? 64 ILE A HG23 7  
ATOM 7433  H HD11 . ILE A 1 94  ? 35.182 35.780 8.204  1.00 0.00 ? 64 ILE A HD11 7  
ATOM 7434  H HD12 . ILE A 1 94  ? 33.896 34.840 7.448  1.00 0.00 ? 64 ILE A HD12 7  
ATOM 7435  H HD13 . ILE A 1 94  ? 34.740 34.203 8.860  1.00 0.00 ? 64 ILE A HD13 7  
ATOM 7436  N N    . ASP A 1 95  ? 29.913 38.262 7.676  1.00 0.00 ? 65 ASP A N    7  
ATOM 7437  C CA   . ASP A 1 95  ? 29.201 39.323 6.970  1.00 0.00 ? 65 ASP A CA   7  
ATOM 7438  C C    . ASP A 1 95  ? 28.299 40.095 7.927  1.00 0.00 ? 65 ASP A C    7  
ATOM 7439  O O    . ASP A 1 95  ? 28.271 41.327 7.907  1.00 0.00 ? 65 ASP A O    7  
ATOM 7440  C CB   . ASP A 1 95  ? 28.349 38.729 5.843  1.00 0.00 ? 65 ASP A CB   7  
ATOM 7441  C CG   . ASP A 1 95  ? 29.227 38.104 4.759  1.00 0.00 ? 65 ASP A CG   7  
ATOM 7442  O OD1  . ASP A 1 95  ? 30.373 38.505 4.631  1.00 0.00 ? 65 ASP A OD1  7  
ATOM 7443  O OD2  . ASP A 1 95  ? 28.736 37.228 4.067  1.00 0.00 ? 65 ASP A OD2  7  
ATOM 7444  H H    . ASP A 1 95  ? 29.820 37.332 7.378  1.00 0.00 ? 65 ASP A H    7  
ATOM 7445  H HA   . ASP A 1 95  ? 29.922 40.002 6.540  1.00 0.00 ? 65 ASP A HA   7  
ATOM 7446  H HB2  . ASP A 1 95  ? 27.699 37.970 6.252  1.00 0.00 ? 65 ASP A HB2  7  
ATOM 7447  H HB3  . ASP A 1 95  ? 27.747 39.511 5.404  1.00 0.00 ? 65 ASP A HB3  7  
ATOM 7448  N N    . GLU A 1 96  ? 27.599 39.374 8.797  1.00 0.00 ? 66 GLU A N    7  
ATOM 7449  C CA   . GLU A 1 96  ? 26.717 40.021 9.762  1.00 0.00 ? 66 GLU A CA   7  
ATOM 7450  C C    . GLU A 1 96  ? 27.514 40.914 10.709 1.00 0.00 ? 66 GLU A C    7  
ATOM 7451  O O    . GLU A 1 96  ? 27.125 42.053 10.971 1.00 0.00 ? 66 GLU A O    7  
ATOM 7452  C CB   . GLU A 1 96  ? 25.956 38.968 10.569 1.00 0.00 ? 66 GLU A CB   7  
ATOM 7453  C CG   . GLU A 1 96  ? 25.035 38.172 9.637  1.00 0.00 ? 66 GLU A CG   7  
ATOM 7454  C CD   . GLU A 1 96  ? 24.189 37.154 10.408 1.00 0.00 ? 66 GLU A CD   7  
ATOM 7455  O OE1  . GLU A 1 96  ? 23.284 36.604 9.803  1.00 0.00 ? 66 GLU A OE1  7  
ATOM 7456  O OE2  . GLU A 1 96  ? 24.451 36.924 11.581 1.00 0.00 ? 66 GLU A OE2  7  
ATOM 7457  H H    . GLU A 1 96  ? 27.650 38.395 8.765  1.00 0.00 ? 66 GLU A H    7  
ATOM 7458  H HA   . GLU A 1 96  ? 26.003 40.631 9.228  1.00 0.00 ? 66 GLU A HA   7  
ATOM 7459  H HB2  . GLU A 1 96  ? 26.662 38.298 11.039 1.00 0.00 ? 66 GLU A HB2  7  
ATOM 7460  H HB3  . GLU A 1 96  ? 25.361 39.455 11.327 1.00 0.00 ? 66 GLU A HB3  7  
ATOM 7461  H HG2  . GLU A 1 96  ? 24.378 38.857 9.124  1.00 0.00 ? 66 GLU A HG2  7  
ATOM 7462  H HG3  . GLU A 1 96  ? 25.638 37.651 8.908  1.00 0.00 ? 66 GLU A HG3  7  
ATOM 7463  N N    . PHE A 1 97  ? 28.649 40.412 11.194 1.00 0.00 ? 67 PHE A N    7  
ATOM 7464  C CA   . PHE A 1 97  ? 29.468 41.193 12.116 1.00 0.00 ? 67 PHE A CA   7  
ATOM 7465  C C    . PHE A 1 97  ? 29.926 42.499 11.472 1.00 0.00 ? 67 PHE A C    7  
ATOM 7466  O O    . PHE A 1 97  ? 29.904 43.549 12.115 1.00 0.00 ? 67 PHE A O    7  
ATOM 7467  C CB   . PHE A 1 97  ? 30.693 40.385 12.546 1.00 0.00 ? 67 PHE A CB   7  
ATOM 7468  C CG   . PHE A 1 97  ? 31.548 41.097 13.568 1.00 0.00 ? 67 PHE A CG   7  
ATOM 7469  C CD1  . PHE A 1 97  ? 32.671 41.825 13.156 1.00 0.00 ? 67 PHE A CD1  7  
ATOM 7470  C CD2  . PHE A 1 97  ? 31.215 41.033 14.926 1.00 0.00 ? 67 PHE A CD2  7  
ATOM 7471  C CE1  . PHE A 1 97  ? 33.461 42.488 14.103 1.00 0.00 ? 67 PHE A CE1  7  
ATOM 7472  C CE2  . PHE A 1 97  ? 32.005 41.695 15.873 1.00 0.00 ? 67 PHE A CE2  7  
ATOM 7473  C CZ   . PHE A 1 97  ? 33.128 42.423 15.461 1.00 0.00 ? 67 PHE A CZ   7  
ATOM 7474  H H    . PHE A 1 97  ? 28.919 39.500 10.956 1.00 0.00 ? 67 PHE A H    7  
ATOM 7475  H HA   . PHE A 1 97  ? 28.880 41.424 12.993 1.00 0.00 ? 67 PHE A HA   7  
ATOM 7476  H HB2  . PHE A 1 97  ? 30.360 39.450 12.970 1.00 0.00 ? 67 PHE A HB2  7  
ATOM 7477  H HB3  . PHE A 1 97  ? 31.291 40.174 11.671 1.00 0.00 ? 67 PHE A HB3  7  
ATOM 7478  H HD1  . PHE A 1 97  ? 32.930 41.873 12.108 1.00 0.00 ? 67 PHE A HD1  7  
ATOM 7479  H HD2  . PHE A 1 97  ? 30.348 40.472 15.244 1.00 0.00 ? 67 PHE A HD2  7  
ATOM 7480  H HE1  . PHE A 1 97  ? 34.326 43.050 13.786 1.00 0.00 ? 67 PHE A HE1  7  
ATOM 7481  H HE2  . PHE A 1 97  ? 31.748 41.645 16.921 1.00 0.00 ? 67 PHE A HE2  7  
ATOM 7482  H HZ   . PHE A 1 97  ? 33.737 42.935 16.192 1.00 0.00 ? 67 PHE A HZ   7  
ATOM 7483  N N    . LEU A 1 98  ? 30.340 42.436 10.208 1.00 0.00 ? 68 LEU A N    7  
ATOM 7484  C CA   . LEU A 1 98  ? 30.719 43.650 9.488  1.00 0.00 ? 68 LEU A CA   7  
ATOM 7485  C C    . LEU A 1 98  ? 29.522 44.583 9.318  1.00 0.00 ? 68 LEU A C    7  
ATOM 7486  O O    . LEU A 1 98  ? 29.665 45.803 9.404  1.00 0.00 ? 68 LEU A O    7  
ATOM 7487  C CB   . LEU A 1 98  ? 31.300 43.297 8.115  1.00 0.00 ? 68 LEU A CB   7  
ATOM 7488  C CG   . LEU A 1 98  ? 32.538 42.409 8.275  1.00 0.00 ? 68 LEU A CG   7  
ATOM 7489  C CD1  . LEU A 1 98  ? 33.046 41.991 6.894  1.00 0.00 ? 68 LEU A CD1  7  
ATOM 7490  C CD2  . LEU A 1 98  ? 33.644 43.180 9.003  1.00 0.00 ? 68 LEU A CD2  7  
ATOM 7491  H H    . LEU A 1 98  ? 30.415 41.565 9.765  1.00 0.00 ? 68 LEU A H    7  
ATOM 7492  H HA   . LEU A 1 98  ? 31.471 44.169 10.062 1.00 0.00 ? 68 LEU A HA   7  
ATOM 7493  H HB2  . LEU A 1 98  ? 30.554 42.771 7.537  1.00 0.00 ? 68 LEU A HB2  7  
ATOM 7494  H HB3  . LEU A 1 98  ? 31.578 44.205 7.601  1.00 0.00 ? 68 LEU A HB3  7  
ATOM 7495  H HG   . LEU A 1 98  ? 32.278 41.529 8.844  1.00 0.00 ? 68 LEU A HG   7  
ATOM 7496  H HD11 . LEU A 1 98  ? 33.678 42.769 6.490  1.00 0.00 ? 68 LEU A HD11 7  
ATOM 7497  H HD12 . LEU A 1 98  ? 32.207 41.831 6.234  1.00 0.00 ? 68 LEU A HD12 7  
ATOM 7498  H HD13 . LEU A 1 98  ? 33.613 41.077 6.981  1.00 0.00 ? 68 LEU A HD13 7  
ATOM 7499  H HD21 . LEU A 1 98  ? 33.413 43.234 10.056 1.00 0.00 ? 68 LEU A HD21 7  
ATOM 7500  H HD22 . LEU A 1 98  ? 33.712 44.179 8.598  1.00 0.00 ? 68 LEU A HD22 7  
ATOM 7501  H HD23 . LEU A 1 98  ? 34.587 42.672 8.866  1.00 0.00 ? 68 LEU A HD23 7  
ATOM 7502  N N    . ALA A 1 99  ? 28.346 44.011 9.076  1.00 0.00 ? 69 ALA A N    7  
ATOM 7503  C CA   . ALA A 1 99  ? 27.132 44.815 8.951  1.00 0.00 ? 69 ALA A CA   7  
ATOM 7504  C C    . ALA A 1 99  ? 26.821 45.569 10.243 1.00 0.00 ? 69 ALA A C    7  
ATOM 7505  O O    . ALA A 1 99  ? 26.296 46.683 10.207 1.00 0.00 ? 69 ALA A O    7  
ATOM 7506  C CB   . ALA A 1 99  ? 25.948 43.913 8.592  1.00 0.00 ? 69 ALA A CB   7  
ATOM 7507  H H    . ALA A 1 99  ? 28.299 43.042 8.940  1.00 0.00 ? 69 ALA A H    7  
ATOM 7508  H HA   . ALA A 1 99  ? 27.271 45.532 8.155  1.00 0.00 ? 69 ALA A HA   7  
ATOM 7509  H HB1  . ALA A 1 99  ? 26.293 43.096 7.976  1.00 0.00 ? 69 ALA A HB1  7  
ATOM 7510  H HB2  . ALA A 1 99  ? 25.211 44.487 8.051  1.00 0.00 ? 69 ALA A HB2  7  
ATOM 7511  H HB3  . ALA A 1 99  ? 25.508 43.521 9.496  1.00 0.00 ? 69 ALA A HB3  7  
ATOM 7512  N N    . THR A 1 100 ? 27.143 44.963 11.383 1.00 0.00 ? 70 THR A N    7  
ATOM 7513  C CA   . THR A 1 100 ? 26.967 45.630 12.672 1.00 0.00 ? 70 THR A CA   7  
ATOM 7514  C C    . THR A 1 100 ? 28.035 46.701 12.921 1.00 0.00 ? 70 THR A C    7  
ATOM 7515  O O    . THR A 1 100 ? 27.806 47.633 13.693 1.00 0.00 ? 70 THR A O    7  
ATOM 7516  C CB   . THR A 1 100 ? 27.017 44.593 13.797 1.00 0.00 ? 70 THR A CB   7  
ATOM 7517  O OG1  . THR A 1 100 ? 26.093 43.551 13.517 1.00 0.00 ? 70 THR A OG1  7  
ATOM 7518  C CG2  . THR A 1 100 ? 26.651 45.256 15.128 1.00 0.00 ? 70 THR A CG2  7  
ATOM 7519  H H    . THR A 1 100 ? 27.458 44.035 11.359 1.00 0.00 ? 70 THR A H    7  
ATOM 7520  H HA   . THR A 1 100 ? 25.996 46.101 12.686 1.00 0.00 ? 70 THR A HA   7  
ATOM 7521  H HB   . THR A 1 100 ? 28.013 44.184 13.866 1.00 0.00 ? 70 THR A HB   7  
ATOM 7522  H HG1  . THR A 1 100 ? 26.489 42.972 12.954 1.00 0.00 ? 70 THR A HG1  7  
ATOM 7523  H HG21 . THR A 1 100 ? 27.378 46.017 15.362 1.00 0.00 ? 70 THR A HG21 7  
ATOM 7524  H HG22 . THR A 1 100 ? 26.643 44.512 15.909 1.00 0.00 ? 70 THR A HG22 7  
ATOM 7525  H HG23 . THR A 1 100 ? 25.673 45.705 15.048 1.00 0.00 ? 70 THR A HG23 7  
ATOM 7526  N N    . GLY A 1 101 ? 29.195 46.576 12.276 1.00 0.00 ? 71 GLY A N    7  
ATOM 7527  C CA   . GLY A 1 101 ? 30.265 47.551 12.452 1.00 0.00 ? 71 GLY A CA   7  
ATOM 7528  C C    . GLY A 1 101 ? 30.209 48.623 11.370 1.00 0.00 ? 71 GLY A C    7  
ATOM 7529  O O    . GLY A 1 101 ? 31.135 49.422 11.225 1.00 0.00 ? 71 GLY A O    7  
ATOM 7530  H H    . GLY A 1 101 ? 29.331 45.815 11.673 1.00 0.00 ? 71 GLY A H    7  
ATOM 7531  H HA2  . GLY A 1 101 ? 30.165 48.017 13.422 1.00 0.00 ? 71 GLY A HA2  7  
ATOM 7532  H HA3  . GLY A 1 101 ? 31.219 47.046 12.396 1.00 0.00 ? 71 GLY A HA3  7  
ATOM 7533  N N    . GLU A 1 31  ? 47.413 42.982 18.513 1.00 0.00 ? 1  GLU A N    8  
ATOM 7534  C CA   . GLU A 1 31  ? 46.141 42.324 18.239 1.00 0.00 ? 1  GLU A CA   8  
ATOM 7535  C C    . GLU A 1 31  ? 46.002 42.024 16.750 1.00 0.00 ? 1  GLU A C    8  
ATOM 7536  O O    . GLU A 1 31  ? 46.095 42.923 15.915 1.00 0.00 ? 1  GLU A O    8  
ATOM 7537  C CB   . GLU A 1 31  ? 44.983 43.216 18.691 1.00 0.00 ? 1  GLU A CB   8  
ATOM 7538  C CG   . GLU A 1 31  ? 45.062 43.435 20.207 1.00 0.00 ? 1  GLU A CG   8  
ATOM 7539  C CD   . GLU A 1 31  ? 43.875 44.253 20.726 1.00 0.00 ? 1  GLU A CD   8  
ATOM 7540  O OE1  . GLU A 1 31  ? 43.130 44.800 19.925 1.00 0.00 ? 1  GLU A OE1  8  
ATOM 7541  O OE2  . GLU A 1 31  ? 43.727 44.322 21.935 1.00 0.00 ? 1  GLU A OE2  8  
ATOM 7542  H H    . GLU A 1 31  ? 48.156 42.472 18.899 1.00 0.00 ? 1  GLU A H    8  
ATOM 7543  H HA   . GLU A 1 31  ? 46.101 41.395 18.789 1.00 0.00 ? 1  GLU A HA   8  
ATOM 7544  H HB2  . GLU A 1 31  ? 45.045 44.168 18.184 1.00 0.00 ? 1  GLU A HB2  8  
ATOM 7545  H HB3  . GLU A 1 31  ? 44.046 42.740 18.448 1.00 0.00 ? 1  GLU A HB3  8  
ATOM 7546  H HG2  . GLU A 1 31  ? 45.070 42.475 20.701 1.00 0.00 ? 1  GLU A HG2  8  
ATOM 7547  H HG3  . GLU A 1 31  ? 45.979 43.956 20.438 1.00 0.00 ? 1  GLU A HG3  8  
ATOM 7548  N N    . THR A 1 32  ? 45.780 40.755 16.424 1.00 0.00 ? 2  THR A N    8  
ATOM 7549  C CA   . THR A 1 32  ? 45.613 40.352 15.033 1.00 0.00 ? 2  THR A CA   8  
ATOM 7550  C C    . THR A 1 32  ? 44.444 41.103 14.403 1.00 0.00 ? 2  THR A C    8  
ATOM 7551  O O    . THR A 1 32  ? 43.418 41.319 15.044 1.00 0.00 ? 2  THR A O    8  
ATOM 7552  C CB   . THR A 1 32  ? 45.365 38.845 14.950 1.00 0.00 ? 2  THR A CB   8  
ATOM 7553  O OG1  . THR A 1 32  ? 46.392 38.160 15.651 1.00 0.00 ? 2  THR A OG1  8  
ATOM 7554  C CG2  . THR A 1 32  ? 45.362 38.401 13.486 1.00 0.00 ? 2  THR A CG2  8  
ATOM 7555  H H    . THR A 1 32  ? 45.728 40.078 17.131 1.00 0.00 ? 2  THR A H    8  
ATOM 7556  H HA   . THR A 1 32  ? 46.515 40.588 14.488 1.00 0.00 ? 2  THR A HA   8  
ATOM 7557  H HB   . THR A 1 32  ? 44.408 38.613 15.395 1.00 0.00 ? 2  THR A HB   8  
ATOM 7558  H HG1  . THR A 1 32  ? 46.374 38.434 16.508 1.00 0.00 ? 2  THR A HG1  8  
ATOM 7559  H HG21 . THR A 1 32  ? 46.065 38.997 12.923 1.00 0.00 ? 2  THR A HG21 8  
ATOM 7560  H HG22 . THR A 1 32  ? 44.373 38.527 13.074 1.00 0.00 ? 2  THR A HG22 8  
ATOM 7561  H HG23 . THR A 1 32  ? 45.647 37.360 13.426 1.00 0.00 ? 2  THR A HG23 8  
ATOM 7562  N N    . LEU A 1 33  ? 44.580 41.451 13.129 1.00 0.00 ? 3  LEU A N    8  
ATOM 7563  C CA   . LEU A 1 33  ? 43.566 42.261 12.459 1.00 0.00 ? 3  LEU A CA   8  
ATOM 7564  C C    . LEU A 1 33  ? 42.187 41.598 12.490 1.00 0.00 ? 3  LEU A C    8  
ATOM 7565  O O    . LEU A 1 33  ? 41.166 42.285 12.503 1.00 0.00 ? 3  LEU A O    8  
ATOM 7566  C CB   . LEU A 1 33  ? 43.974 42.486 11.003 1.00 0.00 ? 3  LEU A CB   8  
ATOM 7567  C CG   . LEU A 1 33  ? 45.332 43.188 10.945 1.00 0.00 ? 3  LEU A CG   8  
ATOM 7568  C CD1  . LEU A 1 33  ? 45.803 43.264 9.491  1.00 0.00 ? 3  LEU A CD1  8  
ATOM 7569  C CD2  . LEU A 1 33  ? 45.195 44.605 11.505 1.00 0.00 ? 3  LEU A CD2  8  
ATOM 7570  H H    . LEU A 1 33  ? 45.372 41.160 12.631 1.00 0.00 ? 3  LEU A H    8  
ATOM 7571  H HA   . LEU A 1 33  ? 43.503 43.221 12.951 1.00 0.00 ? 3  LEU A HA   8  
ATOM 7572  H HB2  . LEU A 1 33  ? 44.037 41.534 10.497 1.00 0.00 ? 3  LEU A HB2  8  
ATOM 7573  H HB3  . LEU A 1 33  ? 43.234 43.102 10.520 1.00 0.00 ? 3  LEU A HB3  8  
ATOM 7574  H HG   . LEU A 1 33  ? 46.051 42.633 11.528 1.00 0.00 ? 3  LEU A HG   8  
ATOM 7575  H HD11 . LEU A 1 33  ? 46.793 43.693 9.455  1.00 0.00 ? 3  LEU A HD11 8  
ATOM 7576  H HD12 . LEU A 1 33  ? 45.122 43.882 8.923  1.00 0.00 ? 3  LEU A HD12 8  
ATOM 7577  H HD13 . LEU A 1 33  ? 45.825 42.271 9.066  1.00 0.00 ? 3  LEU A HD13 8  
ATOM 7578  H HD21 . LEU A 1 33  ? 44.329 45.081 11.069 1.00 0.00 ? 3  LEU A HD21 8  
ATOM 7579  H HD22 . LEU A 1 33  ? 46.080 45.175 11.261 1.00 0.00 ? 3  LEU A HD22 8  
ATOM 7580  H HD23 . LEU A 1 33  ? 45.081 44.559 12.577 1.00 0.00 ? 3  LEU A HD23 8  
ATOM 7581  N N    . ASN A 1 34  ? 42.155 40.269 12.500 1.00 0.00 ? 4  ASN A N    8  
ATOM 7582  C CA   . ASN A 1 34  ? 40.887 39.538 12.546 1.00 0.00 ? 4  ASN A CA   8  
ATOM 7583  C C    . ASN A 1 34  ? 40.495 39.113 13.971 1.00 0.00 ? 4  ASN A C    8  
ATOM 7584  O O    . ASN A 1 34  ? 39.546 38.347 14.147 1.00 0.00 ? 4  ASN A O    8  
ATOM 7585  C CB   . ASN A 1 34  ? 40.981 38.296 11.654 1.00 0.00 ? 4  ASN A CB   8  
ATOM 7586  C CG   . ASN A 1 34  ? 41.374 38.693 10.232 1.00 0.00 ? 4  ASN A CG   8  
ATOM 7587  O OD1  . ASN A 1 34  ? 40.748 39.563 9.623  1.00 0.00 ? 4  ASN A OD1  8  
ATOM 7588  N ND2  . ASN A 1 34  ? 42.379 38.092 9.655  1.00 0.00 ? 4  ASN A ND2  8  
ATOM 7589  H H    . ASN A 1 34  ? 42.996 39.768 12.477 1.00 0.00 ? 4  ASN A H    8  
ATOM 7590  H HA   . ASN A 1 34  ? 40.110 40.178 12.154 1.00 0.00 ? 4  ASN A HA   8  
ATOM 7591  H HB2  . ASN A 1 34  ? 41.725 37.625 12.056 1.00 0.00 ? 4  ASN A HB2  8  
ATOM 7592  H HB3  . ASN A 1 34  ? 40.023 37.798 11.633 1.00 0.00 ? 4  ASN A HB3  8  
ATOM 7593  H HD21 . ASN A 1 34  ? 42.869 37.388 10.130 1.00 0.00 ? 4  ASN A HD21 8  
ATOM 7594  H HD22 . ASN A 1 34  ? 42.654 38.359 8.752  1.00 0.00 ? 4  ASN A HD22 8  
ATOM 7595  N N    . GLY A 1 35  ? 41.200 39.604 14.991 1.00 0.00 ? 5  GLY A N    8  
ATOM 7596  C CA   . GLY A 1 35  ? 40.998 39.126 16.354 1.00 0.00 ? 5  GLY A CA   8  
ATOM 7597  C C    . GLY A 1 35  ? 39.538 39.217 16.779 1.00 0.00 ? 5  GLY A C    8  
ATOM 7598  O O    . GLY A 1 35  ? 39.032 38.317 17.452 1.00 0.00 ? 5  GLY A O    8  
ATOM 7599  H H    . GLY A 1 35  ? 41.864 40.305 14.827 1.00 0.00 ? 5  GLY A H    8  
ATOM 7600  H HA2  . GLY A 1 35  ? 41.319 38.097 16.416 1.00 0.00 ? 5  GLY A HA2  8  
ATOM 7601  H HA3  . GLY A 1 35  ? 41.597 39.721 17.028 1.00 0.00 ? 5  GLY A HA3  8  
ATOM 7602  N N    . ALA A 1 36  ? 38.854 40.286 16.378 1.00 0.00 ? 6  ALA A N    8  
ATOM 7603  C CA   . ALA A 1 36  ? 37.463 40.464 16.781 1.00 0.00 ? 6  ALA A CA   8  
ATOM 7604  C C    . ALA A 1 36  ? 36.615 39.300 16.278 1.00 0.00 ? 6  ALA A C    8  
ATOM 7605  O O    . ALA A 1 36  ? 35.854 38.697 17.039 1.00 0.00 ? 6  ALA A O    8  
ATOM 7606  C CB   . ALA A 1 36  ? 36.918 41.778 16.215 1.00 0.00 ? 6  ALA A CB   8  
ATOM 7607  H H    . ALA A 1 36  ? 39.287 40.957 15.809 1.00 0.00 ? 6  ALA A H    8  
ATOM 7608  H HA   . ALA A 1 36  ? 37.410 40.499 17.858 1.00 0.00 ? 6  ALA A HA   8  
ATOM 7609  H HB1  . ALA A 1 36  ? 36.653 41.640 15.177 1.00 0.00 ? 6  ALA A HB1  8  
ATOM 7610  H HB2  . ALA A 1 36  ? 37.672 42.546 16.296 1.00 0.00 ? 6  ALA A HB2  8  
ATOM 7611  H HB3  . ALA A 1 36  ? 36.041 42.074 16.773 1.00 0.00 ? 6  ALA A HB3  8  
ATOM 7612  N N    . LEU A 1 37  ? 36.777 38.956 15.003 1.00 0.00 ? 7  LEU A N    8  
ATOM 7613  C CA   . LEU A 1 37  ? 36.058 37.816 14.443 1.00 0.00 ? 7  LEU A CA   8  
ATOM 7614  C C    . LEU A 1 37  ? 36.449 36.519 15.150 1.00 0.00 ? 7  LEU A C    8  
ATOM 7615  O O    . LEU A 1 37  ? 35.605 35.651 15.375 1.00 0.00 ? 7  LEU A O    8  
ATOM 7616  C CB   . LEU A 1 37  ? 36.339 37.707 12.942 1.00 0.00 ? 7  LEU A CB   8  
ATOM 7617  C CG   . LEU A 1 37  ? 35.926 39.006 12.241 1.00 0.00 ? 7  LEU A CG   8  
ATOM 7618  C CD1  . LEU A 1 37  ? 36.305 38.936 10.761 1.00 0.00 ? 7  LEU A CD1  8  
ATOM 7619  C CD2  . LEU A 1 37  ? 34.412 39.202 12.356 1.00 0.00 ? 7  LEU A CD2  8  
ATOM 7620  H H    . LEU A 1 37  ? 37.386 39.473 14.435 1.00 0.00 ? 7  LEU A H    8  
ATOM 7621  H HA   . LEU A 1 37  ? 34.999 37.975 14.587 1.00 0.00 ? 7  LEU A HA   8  
ATOM 7622  H HB2  . LEU A 1 37  ? 37.393 37.533 12.787 1.00 0.00 ? 7  LEU A HB2  8  
ATOM 7623  H HB3  . LEU A 1 37  ? 35.773 36.884 12.529 1.00 0.00 ? 7  LEU A HB3  8  
ATOM 7624  H HG   . LEU A 1 37  ? 36.434 39.840 12.703 1.00 0.00 ? 7  LEU A HG   8  
ATOM 7625  H HD11 . LEU A 1 37  ? 37.367 39.100 10.653 1.00 0.00 ? 7  LEU A HD11 8  
ATOM 7626  H HD12 . LEU A 1 37  ? 35.764 39.696 10.217 1.00 0.00 ? 7  LEU A HD12 8  
ATOM 7627  H HD13 . LEU A 1 37  ? 36.050 37.962 10.370 1.00 0.00 ? 7  LEU A HD13 8  
ATOM 7628  H HD21 . LEU A 1 37  ? 34.076 39.875 11.579 1.00 0.00 ? 7  LEU A HD21 8  
ATOM 7629  H HD22 . LEU A 1 37  ? 34.175 39.622 13.322 1.00 0.00 ? 7  LEU A HD22 8  
ATOM 7630  H HD23 . LEU A 1 37  ? 33.916 38.250 12.245 1.00 0.00 ? 7  LEU A HD23 8  
ATOM 7631  N N    . VAL A 1 38  ? 37.720 36.401 15.537 1.00 0.00 ? 8  VAL A N    8  
ATOM 7632  C CA   . VAL A 1 38  ? 38.169 35.223 16.275 1.00 0.00 ? 8  VAL A CA   8  
ATOM 7633  C C    . VAL A 1 38  ? 37.398 35.111 17.590 1.00 0.00 ? 8  VAL A C    8  
ATOM 7634  O O    . VAL A 1 38  ? 36.955 34.026 17.971 1.00 0.00 ? 8  VAL A O    8  
ATOM 7635  C CB   . VAL A 1 38  ? 39.678 35.318 16.546 1.00 0.00 ? 8  VAL A CB   8  
ATOM 7636  C CG1  . VAL A 1 38  ? 40.177 34.079 17.299 1.00 0.00 ? 8  VAL A CG1  8  
ATOM 7637  C CG2  . VAL A 1 38  ? 40.434 35.417 15.219 1.00 0.00 ? 8  VAL A CG2  8  
ATOM 7638  H H    . VAL A 1 38  ? 38.365 37.098 15.291 1.00 0.00 ? 8  VAL A H    8  
ATOM 7639  H HA   . VAL A 1 38  ? 37.976 34.343 15.680 1.00 0.00 ? 8  VAL A HA   8  
ATOM 7640  H HB   . VAL A 1 38  ? 39.880 36.198 17.138 1.00 0.00 ? 8  VAL A HB   8  
ATOM 7641  H HG11 . VAL A 1 38  ? 40.225 33.242 16.620 1.00 0.00 ? 8  VAL A HG11 8  
ATOM 7642  H HG12 . VAL A 1 38  ? 39.510 33.845 18.113 1.00 0.00 ? 8  VAL A HG12 8  
ATOM 7643  H HG13 . VAL A 1 38  ? 41.165 34.275 17.693 1.00 0.00 ? 8  VAL A HG13 8  
ATOM 7644  H HG21 . VAL A 1 38  ? 41.442 35.754 15.403 1.00 0.00 ? 8  VAL A HG21 8  
ATOM 7645  H HG22 . VAL A 1 38  ? 39.935 36.116 14.565 1.00 0.00 ? 8  VAL A HG22 8  
ATOM 7646  H HG23 . VAL A 1 38  ? 40.462 34.444 14.749 1.00 0.00 ? 8  VAL A HG23 8  
ATOM 7647  N N    . ASN A 1 39  ? 37.194 36.243 18.260 1.00 0.00 ? 9  ASN A N    8  
ATOM 7648  C CA   . ASN A 1 39  ? 36.408 36.254 19.490 1.00 0.00 ? 9  ASN A CA   8  
ATOM 7649  C C    . ASN A 1 39  ? 34.974 35.802 19.216 1.00 0.00 ? 9  ASN A C    8  
ATOM 7650  O O    . ASN A 1 39  ? 34.393 35.043 19.996 1.00 0.00 ? 9  ASN A O    8  
ATOM 7651  C CB   . ASN A 1 39  ? 36.396 37.662 20.089 1.00 0.00 ? 9  ASN A CB   8  
ATOM 7652  C CG   . ASN A 1 39  ? 35.742 37.637 21.466 1.00 0.00 ? 9  ASN A CG   8  
ATOM 7653  O OD1  . ASN A 1 39  ? 34.603 38.076 21.623 1.00 0.00 ? 9  ASN A OD1  8  
ATOM 7654  N ND2  . ASN A 1 39  ? 36.400 37.143 22.480 1.00 0.00 ? 9  ASN A ND2  8  
ATOM 7655  H H    . ASN A 1 39  ? 37.603 37.073 17.939 1.00 0.00 ? 9  ASN A H    8  
ATOM 7656  H HA   . ASN A 1 39  ? 36.859 35.577 20.201 1.00 0.00 ? 9  ASN A HA   8  
ATOM 7657  H HB2  . ASN A 1 39  ? 37.410 38.022 20.179 1.00 0.00 ? 9  ASN A HB2  8  
ATOM 7658  H HB3  . ASN A 1 39  ? 35.837 38.322 19.441 1.00 0.00 ? 9  ASN A HB3  8  
ATOM 7659  H HD21 . ASN A 1 39  ? 37.306 36.793 22.353 1.00 0.00 ? 9  ASN A HD21 8  
ATOM 7660  H HD22 . ASN A 1 39  ? 35.987 37.123 23.369 1.00 0.00 ? 9  ASN A HD22 8  
ATOM 7661  N N    . MET A 1 40  ? 34.426 36.229 18.081 1.00 0.00 ? 10 MET A N    8  
ATOM 7662  C CA   . MET A 1 40  ? 33.076 35.821 17.710 1.00 0.00 ? 10 MET A CA   8  
ATOM 7663  C C    . MET A 1 40  ? 33.002 34.304 17.568 1.00 0.00 ? 10 MET A C    8  
ATOM 7664  O O    . MET A 1 40  ? 32.059 33.669 18.042 1.00 0.00 ? 10 MET A O    8  
ATOM 7665  C CB   . MET A 1 40  ? 32.721 36.435 16.356 1.00 0.00 ? 10 MET A CB   8  
ATOM 7666  C CG   . MET A 1 40  ? 31.222 36.282 16.090 1.00 0.00 ? 10 MET A CG   8  
ATOM 7667  S SD   . MET A 1 40  ? 30.881 36.575 14.334 1.00 0.00 ? 10 MET A SD   8  
ATOM 7668  C CE   . MET A 1 40  ? 31.442 38.291 14.222 1.00 0.00 ? 10 MET A CE   8  
ATOM 7669  H H    . MET A 1 40  ? 34.917 36.864 17.516 1.00 0.00 ? 10 MET A H    8  
ATOM 7670  H HA   . MET A 1 40  ? 32.370 36.157 18.455 1.00 0.00 ? 10 MET A HA   8  
ATOM 7671  H HB2  . MET A 1 40  ? 32.980 37.483 16.368 1.00 0.00 ? 10 MET A HB2  8  
ATOM 7672  H HB3  . MET A 1 40  ? 33.276 35.935 15.576 1.00 0.00 ? 10 MET A HB3  8  
ATOM 7673  H HG2  . MET A 1 40  ? 30.911 35.283 16.355 1.00 0.00 ? 10 MET A HG2  8  
ATOM 7674  H HG3  . MET A 1 40  ? 30.676 36.998 16.687 1.00 0.00 ? 10 MET A HG3  8  
ATOM 7675  H HE1  . MET A 1 40  ? 32.472 38.357 14.540 1.00 0.00 ? 10 MET A HE1  8  
ATOM 7676  H HE2  . MET A 1 40  ? 30.830 38.918 14.851 1.00 0.00 ? 10 MET A HE2  8  
ATOM 7677  H HE3  . MET A 1 40  ? 31.360 38.621 13.196 1.00 0.00 ? 10 MET A HE3  8  
ATOM 7678  N N    . LEU A 1 41  ? 34.026 33.723 16.948 1.00 0.00 ? 11 LEU A N    8  
ATOM 7679  C CA   . LEU A 1 41  ? 34.074 32.276 16.786 1.00 0.00 ? 11 LEU A CA   8  
ATOM 7680  C C    . LEU A 1 41  ? 34.131 31.568 18.134 1.00 0.00 ? 11 LEU A C    8  
ATOM 7681  O O    . LEU A 1 41  ? 33.459 30.554 18.326 1.00 0.00 ? 11 LEU A O    8  
ATOM 7682  C CB   . LEU A 1 41  ? 35.281 31.884 15.932 1.00 0.00 ? 11 LEU A CB   8  
ATOM 7683  C CG   . LEU A 1 41  ? 35.145 32.502 14.539 1.00 0.00 ? 11 LEU A CG   8  
ATOM 7684  C CD1  . LEU A 1 41  ? 36.430 32.266 13.747 1.00 0.00 ? 11 LEU A CD1  8  
ATOM 7685  C CD2  . LEU A 1 41  ? 33.976 31.850 13.797 1.00 0.00 ? 11 LEU A CD2  8  
ATOM 7686  H H    . LEU A 1 41  ? 34.737 34.279 16.566 1.00 0.00 ? 11 LEU A H    8  
ATOM 7687  H HA   . LEU A 1 41  ? 33.175 31.960 16.280 1.00 0.00 ? 11 LEU A HA   8  
ATOM 7688  H HB2  . LEU A 1 41  ? 36.185 32.243 16.401 1.00 0.00 ? 11 LEU A HB2  8  
ATOM 7689  H HB3  . LEU A 1 41  ? 35.325 30.808 15.843 1.00 0.00 ? 11 LEU A HB3  8  
ATOM 7690  H HG   . LEU A 1 41  ? 34.969 33.564 14.631 1.00 0.00 ? 11 LEU A HG   8  
ATOM 7691  H HD11 . LEU A 1 41  ? 36.803 31.273 13.952 1.00 0.00 ? 11 LEU A HD11 8  
ATOM 7692  H HD12 . LEU A 1 41  ? 37.170 32.996 14.037 1.00 0.00 ? 11 LEU A HD12 8  
ATOM 7693  H HD13 . LEU A 1 41  ? 36.225 32.362 12.690 1.00 0.00 ? 11 LEU A HD13 8  
ATOM 7694  H HD21 . LEU A 1 41  ? 33.943 30.797 14.031 1.00 0.00 ? 11 LEU A HD21 8  
ATOM 7695  H HD22 . LEU A 1 41  ? 34.109 31.979 12.734 1.00 0.00 ? 11 LEU A HD22 8  
ATOM 7696  H HD23 . LEU A 1 41  ? 33.051 32.316 14.103 1.00 0.00 ? 11 LEU A HD23 8  
ATOM 7697  N N    . LYS A 1 42  ? 34.909 32.106 19.073 1.00 0.00 ? 12 LYS A N    8  
ATOM 7698  C CA   . LYS A 1 42  ? 34.993 31.497 20.397 1.00 0.00 ? 12 LYS A CA   8  
ATOM 7699  C C    . LYS A 1 42  ? 33.619 31.450 21.059 1.00 0.00 ? 12 LYS A C    8  
ATOM 7700  O O    . LYS A 1 42  ? 33.248 30.436 21.655 1.00 0.00 ? 12 LYS A O    8  
ATOM 7701  C CB   . LYS A 1 42  ? 35.955 32.285 21.288 1.00 0.00 ? 12 LYS A CB   8  
ATOM 7702  C CG   . LYS A 1 42  ? 37.378 32.184 20.735 1.00 0.00 ? 12 LYS A CG   8  
ATOM 7703  C CD   . LYS A 1 42  ? 38.347 32.883 21.690 1.00 0.00 ? 12 LYS A CD   8  
ATOM 7704  C CE   . LYS A 1 42  ? 39.751 32.887 21.087 1.00 0.00 ? 12 LYS A CE   8  
ATOM 7705  N NZ   . LYS A 1 42  ? 40.700 33.527 22.041 1.00 0.00 ? 12 LYS A NZ   8  
ATOM 7706  H H    . LYS A 1 42  ? 35.460 32.890 18.859 1.00 0.00 ? 12 LYS A H    8  
ATOM 7707  H HA   . LYS A 1 42  ? 35.364 30.489 20.293 1.00 0.00 ? 12 LYS A HA   8  
ATOM 7708  H HB2  . LYS A 1 42  ? 35.652 33.321 21.314 1.00 0.00 ? 12 LYS A HB2  8  
ATOM 7709  H HB3  . LYS A 1 42  ? 35.932 31.880 22.288 1.00 0.00 ? 12 LYS A HB3  8  
ATOM 7710  H HG2  . LYS A 1 42  ? 37.652 31.143 20.638 1.00 0.00 ? 12 LYS A HG2  8  
ATOM 7711  H HG3  . LYS A 1 42  ? 37.424 32.660 19.768 1.00 0.00 ? 12 LYS A HG3  8  
ATOM 7712  H HD2  . LYS A 1 42  ? 38.021 33.900 21.851 1.00 0.00 ? 12 LYS A HD2  8  
ATOM 7713  H HD3  . LYS A 1 42  ? 38.365 32.357 22.633 1.00 0.00 ? 12 LYS A HD3  8  
ATOM 7714  H HE2  . LYS A 1 42  ? 40.063 31.871 20.895 1.00 0.00 ? 12 LYS A HE2  8  
ATOM 7715  H HE3  . LYS A 1 42  ? 39.744 33.443 20.161 1.00 0.00 ? 12 LYS A HE3  8  
ATOM 7716  H HZ1  . LYS A 1 42  ? 41.650 33.124 21.909 1.00 0.00 ? 12 LYS A HZ1  8  
ATOM 7717  H HZ2  . LYS A 1 42  ? 40.381 33.352 23.016 1.00 0.00 ? 12 LYS A HZ2  8  
ATOM 7718  H HZ3  . LYS A 1 42  ? 40.734 34.550 21.865 1.00 0.00 ? 12 LYS A HZ3  8  
ATOM 7719  N N    . GLU A 1 43  ? 32.846 32.524 20.911 1.00 0.00 ? 13 GLU A N    8  
ATOM 7720  C CA   . GLU A 1 43  ? 31.502 32.550 21.482 1.00 0.00 ? 13 GLU A CA   8  
ATOM 7721  C C    . GLU A 1 43  ? 30.609 31.505 20.819 1.00 0.00 ? 13 GLU A C    8  
ATOM 7722  O O    . GLU A 1 43  ? 29.895 30.764 21.499 1.00 0.00 ? 13 GLU A O    8  
ATOM 7723  C CB   . GLU A 1 43  ? 30.886 33.939 21.302 1.00 0.00 ? 13 GLU A CB   8  
ATOM 7724  C CG   . GLU A 1 43  ? 29.557 34.011 22.064 1.00 0.00 ? 13 GLU A CG   8  
ATOM 7725  C CD   . GLU A 1 43  ? 28.845 35.351 21.848 1.00 0.00 ? 13 GLU A CD   8  
ATOM 7726  O OE1  . GLU A 1 43  ? 29.347 36.185 21.108 1.00 0.00 ? 13 GLU A OE1  8  
ATOM 7727  O OE2  . GLU A 1 43  ? 27.790 35.525 22.435 1.00 0.00 ? 13 GLU A OE2  8  
ATOM 7728  H H    . GLU A 1 43  ? 33.197 33.317 20.451 1.00 0.00 ? 13 GLU A H    8  
ATOM 7729  H HA   . GLU A 1 43  ? 31.568 32.334 22.538 1.00 0.00 ? 13 GLU A HA   8  
ATOM 7730  H HB2  . GLU A 1 43  ? 31.565 34.686 21.685 1.00 0.00 ? 13 GLU A HB2  8  
ATOM 7731  H HB3  . GLU A 1 43  ? 30.704 34.119 20.253 1.00 0.00 ? 13 GLU A HB3  8  
ATOM 7732  H HG2  . GLU A 1 43  ? 28.914 33.214 21.726 1.00 0.00 ? 13 GLU A HG2  8  
ATOM 7733  H HG3  . GLU A 1 43  ? 29.751 33.880 23.120 1.00 0.00 ? 13 GLU A HG3  8  
ATOM 7734  N N    . GLU A 1 44  ? 30.692 31.409 19.493 1.00 0.00 ? 14 GLU A N    8  
ATOM 7735  C CA   . GLU A 1 44  ? 29.905 30.415 18.770 1.00 0.00 ? 14 GLU A CA   8  
ATOM 7736  C C    . GLU A 1 44  ? 30.303 29.000 19.180 1.00 0.00 ? 14 GLU A C    8  
ATOM 7737  O O    . GLU A 1 44  ? 29.450 28.129 19.344 1.00 0.00 ? 14 GLU A O    8  
ATOM 7738  C CB   . GLU A 1 44  ? 30.102 30.586 17.262 1.00 0.00 ? 14 GLU A CB   8  
ATOM 7739  C CG   . GLU A 1 44  ? 29.554 31.949 16.826 1.00 0.00 ? 14 GLU A CG   8  
ATOM 7740  C CD   . GLU A 1 44  ? 28.050 32.060 17.090 1.00 0.00 ? 14 GLU A CD   8  
ATOM 7741  O OE1  . GLU A 1 44  ? 27.403 31.039 17.274 1.00 0.00 ? 14 GLU A OE1  8  
ATOM 7742  O OE2  . GLU A 1 44  ? 27.562 33.178 17.106 1.00 0.00 ? 14 GLU A OE2  8  
ATOM 7743  H H    . GLU A 1 44  ? 31.261 32.034 18.997 1.00 0.00 ? 14 GLU A H    8  
ATOM 7744  H HA   . GLU A 1 44  ? 28.860 30.562 19.001 1.00 0.00 ? 14 GLU A HA   8  
ATOM 7745  H HB2  . GLU A 1 44  ? 31.154 30.528 17.028 1.00 0.00 ? 14 GLU A HB2  8  
ATOM 7746  H HB3  . GLU A 1 44  ? 29.572 29.804 16.739 1.00 0.00 ? 14 GLU A HB3  8  
ATOM 7747  H HG2  . GLU A 1 44  ? 30.065 32.726 17.372 1.00 0.00 ? 14 GLU A HG2  8  
ATOM 7748  H HG3  . GLU A 1 44  ? 29.737 32.081 15.769 1.00 0.00 ? 14 GLU A HG3  8  
ATOM 7749  N N    . GLY A 1 45  ? 31.601 28.784 19.379 1.00 0.00 ? 15 GLY A N    8  
ATOM 7750  C CA   . GLY A 1 45  ? 32.089 27.469 19.773 1.00 0.00 ? 15 GLY A CA   8  
ATOM 7751  C C    . GLY A 1 45  ? 31.499 27.045 21.112 1.00 0.00 ? 15 GLY A C    8  
ATOM 7752  O O    . GLY A 1 45  ? 30.997 25.928 21.250 1.00 0.00 ? 15 GLY A O    8  
ATOM 7753  H H    . GLY A 1 45  ? 32.239 29.510 19.234 1.00 0.00 ? 15 GLY A H    8  
ATOM 7754  H HA2  . GLY A 1 45  ? 31.811 26.749 19.018 1.00 0.00 ? 15 GLY A HA2  8  
ATOM 7755  H HA3  . GLY A 1 45  ? 33.164 27.500 19.857 1.00 0.00 ? 15 GLY A HA3  8  
ATOM 7756  N N    . ASN A 1 46  ? 31.532 27.949 22.089 1.00 0.00 ? 16 ASN A N    8  
ATOM 7757  C CA   . ASN A 1 46  ? 30.991 27.634 23.405 1.00 0.00 ? 16 ASN A CA   8  
ATOM 7758  C C    . ASN A 1 46  ? 29.500 27.326 23.316 1.00 0.00 ? 16 ASN A C    8  
ATOM 7759  O O    . ASN A 1 46  ? 29.018 26.383 23.947 1.00 0.00 ? 16 ASN A O    8  
ATOM 7760  C CB   . ASN A 1 46  ? 31.216 28.812 24.356 1.00 0.00 ? 16 ASN A CB   8  
ATOM 7761  C CG   . ASN A 1 46  ? 32.709 29.048 24.562 1.00 0.00 ? 16 ASN A CG   8  
ATOM 7762  O OD1  . ASN A 1 46  ? 33.517 28.138 24.378 1.00 0.00 ? 16 ASN A OD1  8  
ATOM 7763  N ND2  . ASN A 1 46  ? 33.127 30.227 24.935 1.00 0.00 ? 16 ASN A ND2  8  
ATOM 7764  H H    . ASN A 1 46  ? 31.951 28.823 21.931 1.00 0.00 ? 16 ASN A H    8  
ATOM 7765  H HA   . ASN A 1 46  ? 31.505 26.769 23.796 1.00 0.00 ? 16 ASN A HA   8  
ATOM 7766  H HB2  . ASN A 1 46  ? 30.767 29.701 23.936 1.00 0.00 ? 16 ASN A HB2  8  
ATOM 7767  H HB3  . ASN A 1 46  ? 30.756 28.595 25.309 1.00 0.00 ? 16 ASN A HB3  8  
ATOM 7768  H HD21 . ASN A 1 46  ? 32.484 30.952 25.080 1.00 0.00 ? 16 ASN A HD21 8  
ATOM 7769  H HD22 . ASN A 1 46  ? 34.085 30.388 25.068 1.00 0.00 ? 16 ASN A HD22 8  
ATOM 7770  N N    . LYS A 1 47  ? 28.777 28.088 22.497 1.00 0.00 ? 17 LYS A N    8  
ATOM 7771  C CA   . LYS A 1 47  ? 27.348 27.842 22.324 1.00 0.00 ? 17 LYS A CA   8  
ATOM 7772  C C    . LYS A 1 47  ? 27.103 26.458 21.728 1.00 0.00 ? 17 LYS A C    8  
ATOM 7773  O O    . LYS A 1 47  ? 26.253 25.704 22.213 1.00 0.00 ? 17 LYS A O    8  
ATOM 7774  C CB   . LYS A 1 47  ? 26.742 28.913 21.413 1.00 0.00 ? 17 LYS A CB   8  
ATOM 7775  C CG   . LYS A 1 47  ? 25.223 28.737 21.352 1.00 0.00 ? 17 LYS A CG   8  
ATOM 7776  C CD   . LYS A 1 47  ? 24.610 29.872 20.528 1.00 0.00 ? 17 LYS A CD   8  
ATOM 7777  C CE   . LYS A 1 47  ? 25.029 29.726 19.065 1.00 0.00 ? 17 LYS A CE   8  
ATOM 7778  N NZ   . LYS A 1 47  ? 24.282 30.711 18.233 1.00 0.00 ? 17 LYS A NZ   8  
ATOM 7779  H H    . LYS A 1 47  ? 29.199 28.845 22.036 1.00 0.00 ? 17 LYS A H    8  
ATOM 7780  H HA   . LYS A 1 47  ? 26.866 27.896 23.288 1.00 0.00 ? 17 LYS A HA   8  
ATOM 7781  H HB2  . LYS A 1 47  ? 26.978 29.891 21.804 1.00 0.00 ? 17 LYS A HB2  8  
ATOM 7782  H HB3  . LYS A 1 47  ? 27.154 28.814 20.419 1.00 0.00 ? 17 LYS A HB3  8  
ATOM 7783  H HG2  . LYS A 1 47  ? 24.989 27.789 20.892 1.00 0.00 ? 17 LYS A HG2  8  
ATOM 7784  H HG3  . LYS A 1 47  ? 24.817 28.763 22.353 1.00 0.00 ? 17 LYS A HG3  8  
ATOM 7785  H HD2  . LYS A 1 47  ? 23.532 29.827 20.602 1.00 0.00 ? 17 LYS A HD2  8  
ATOM 7786  H HD3  . LYS A 1 47  ? 24.957 30.821 20.907 1.00 0.00 ? 17 LYS A HD3  8  
ATOM 7787  H HE2  . LYS A 1 47  ? 26.089 29.910 18.973 1.00 0.00 ? 17 LYS A HE2  8  
ATOM 7788  H HE3  . LYS A 1 47  ? 24.808 28.726 18.725 1.00 0.00 ? 17 LYS A HE3  8  
ATOM 7789  H HZ1  . LYS A 1 47  ? 23.614 30.207 17.615 1.00 0.00 ? 17 LYS A HZ1  8  
ATOM 7790  H HZ2  . LYS A 1 47  ? 24.952 31.253 17.652 1.00 0.00 ? 17 LYS A HZ2  8  
ATOM 7791  H HZ3  . LYS A 1 47  ? 23.755 31.358 18.852 1.00 0.00 ? 17 LYS A HZ3  8  
ATOM 7792  N N    . ALA A 1 48  ? 27.882 26.102 20.707 1.00 0.00 ? 18 ALA A N    8  
ATOM 7793  C CA   . ALA A 1 48  ? 27.715 24.802 20.072 1.00 0.00 ? 18 ALA A CA   8  
ATOM 7794  C C    . ALA A 1 48  ? 27.958 23.685 21.079 1.00 0.00 ? 18 ALA A C    8  
ATOM 7795  O O    . ALA A 1 48  ? 27.217 22.704 21.111 1.00 0.00 ? 18 ALA A O    8  
ATOM 7796  C CB   . ALA A 1 48  ? 28.679 24.656 18.893 1.00 0.00 ? 18 ALA A CB   8  
ATOM 7797  H H    . ALA A 1 48  ? 28.557 26.725 20.366 1.00 0.00 ? 18 ALA A H    8  
ATOM 7798  H HA   . ALA A 1 48  ? 26.704 24.724 19.702 1.00 0.00 ? 18 ALA A HA   8  
ATOM 7799  H HB1  . ALA A 1 48  ? 28.837 23.608 18.687 1.00 0.00 ? 18 ALA A HB1  8  
ATOM 7800  H HB2  . ALA A 1 48  ? 29.623 25.121 19.138 1.00 0.00 ? 18 ALA A HB2  8  
ATOM 7801  H HB3  . ALA A 1 48  ? 28.256 25.133 18.022 1.00 0.00 ? 18 ALA A HB3  8  
ATOM 7802  N N    . LEU A 1 49  ? 28.996 23.835 21.899 1.00 0.00 ? 19 LEU A N    8  
ATOM 7803  C CA   . LEU A 1 49  ? 29.268 22.848 22.938 1.00 0.00 ? 19 LEU A CA   8  
ATOM 7804  C C    . LEU A 1 49  ? 28.097 22.754 23.913 1.00 0.00 ? 19 LEU A C    8  
ATOM 7805  O O    . LEU A 1 49  ? 27.674 21.657 24.278 1.00 0.00 ? 19 LEU A O    8  
ATOM 7806  C CB   . LEU A 1 49  ? 30.542 23.230 23.695 1.00 0.00 ? 19 LEU A CB   8  
ATOM 7807  C CG   . LEU A 1 49  ? 30.903 22.124 24.690 1.00 0.00 ? 19 LEU A CG   8  
ATOM 7808  C CD1  . LEU A 1 49  ? 31.366 20.882 23.927 1.00 0.00 ? 19 LEU A CD1  8  
ATOM 7809  C CD2  . LEU A 1 49  ? 32.031 22.610 25.602 1.00 0.00 ? 19 LEU A CD2  8  
ATOM 7810  H H    . LEU A 1 49  ? 29.598 24.600 21.787 1.00 0.00 ? 19 LEU A H    8  
ATOM 7811  H HA   . LEU A 1 49  ? 29.416 21.884 22.475 1.00 0.00 ? 19 LEU A HA   8  
ATOM 7812  H HB2  . LEU A 1 49  ? 31.352 23.361 22.993 1.00 0.00 ? 19 LEU A HB2  8  
ATOM 7813  H HB3  . LEU A 1 49  ? 30.378 24.152 24.232 1.00 0.00 ? 19 LEU A HB3  8  
ATOM 7814  H HG   . LEU A 1 49  ? 30.036 21.878 25.285 1.00 0.00 ? 19 LEU A HG   8  
ATOM 7815  H HD11 . LEU A 1 49  ? 32.051 21.175 23.144 1.00 0.00 ? 19 LEU A HD11 8  
ATOM 7816  H HD12 . LEU A 1 49  ? 30.512 20.387 23.490 1.00 0.00 ? 19 LEU A HD12 8  
ATOM 7817  H HD13 . LEU A 1 49  ? 31.865 20.206 24.606 1.00 0.00 ? 19 LEU A HD13 8  
ATOM 7818  H HD21 . LEU A 1 49  ? 32.762 23.148 25.017 1.00 0.00 ? 19 LEU A HD21 8  
ATOM 7819  H HD22 . LEU A 1 49  ? 32.504 21.760 26.074 1.00 0.00 ? 19 LEU A HD22 8  
ATOM 7820  H HD23 . LEU A 1 49  ? 31.625 23.262 26.362 1.00 0.00 ? 19 LEU A HD23 8  
ATOM 7821  N N    . SER A 1 50  ? 27.514 23.899 24.261 1.00 0.00 ? 20 SER A N    8  
ATOM 7822  C CA   . SER A 1 50  ? 26.410 23.918 25.216 1.00 0.00 ? 20 SER A CA   8  
ATOM 7823  C C    . SER A 1 50  ? 25.222 23.096 24.722 1.00 0.00 ? 20 SER A C    8  
ATOM 7824  O O    . SER A 1 50  ? 24.526 22.466 25.520 1.00 0.00 ? 20 SER A O    8  
ATOM 7825  C CB   . SER A 1 50  ? 25.962 25.359 25.458 1.00 0.00 ? 20 SER A CB   8  
ATOM 7826  O OG   . SER A 1 50  ? 25.005 25.380 26.510 1.00 0.00 ? 20 SER A OG   8  
ATOM 7827  H H    . SER A 1 50  ? 27.861 24.744 23.906 1.00 0.00 ? 20 SER A H    8  
ATOM 7828  H HA   . SER A 1 50  ? 26.754 23.503 26.151 1.00 0.00 ? 20 SER A HA   8  
ATOM 7829  H HB2  . SER A 1 50  ? 26.809 25.962 25.743 1.00 0.00 ? 20 SER A HB2  8  
ATOM 7830  H HB3  . SER A 1 50  ? 25.531 25.757 24.549 1.00 0.00 ? 20 SER A HB3  8  
ATOM 7831  H HG   . SER A 1 50  ? 25.366 24.965 27.222 1.00 0.00 ? 20 SER A HG   8  
ATOM 7832  N N    . VAL A 1 51  ? 24.992 23.101 23.413 1.00 0.00 ? 21 VAL A N    8  
ATOM 7833  C CA   . VAL A 1 51  ? 23.895 22.318 22.842 1.00 0.00 ? 21 VAL A CA   8  
ATOM 7834  C C    . VAL A 1 51  ? 24.286 20.873 22.501 1.00 0.00 ? 21 VAL A C    8  
ATOM 7835  O O    . VAL A 1 51  ? 23.454 20.125 21.986 1.00 0.00 ? 21 VAL A O    8  
ATOM 7836  C CB   . VAL A 1 51  ? 23.363 23.010 21.585 1.00 0.00 ? 21 VAL A CB   8  
ATOM 7837  C CG1  . VAL A 1 51  ? 22.878 24.416 21.943 1.00 0.00 ? 21 VAL A CG1  8  
ATOM 7838  C CG2  . VAL A 1 51  ? 24.478 23.112 20.543 1.00 0.00 ? 21 VAL A CG2  8  
ATOM 7839  H H    . VAL A 1 51  ? 25.526 23.688 22.834 1.00 0.00 ? 21 VAL A H    8  
ATOM 7840  H HA   . VAL A 1 51  ? 23.095 22.286 23.565 1.00 0.00 ? 21 VAL A HA   8  
ATOM 7841  H HB   . VAL A 1 51  ? 22.540 22.438 21.181 1.00 0.00 ? 21 VAL A HB   8  
ATOM 7842  H HG11 . VAL A 1 51  ? 22.568 24.929 21.045 1.00 0.00 ? 21 VAL A HG11 8  
ATOM 7843  H HG12 . VAL A 1 51  ? 23.681 24.966 22.411 1.00 0.00 ? 21 VAL A HG12 8  
ATOM 7844  H HG13 . VAL A 1 51  ? 22.043 24.347 22.625 1.00 0.00 ? 21 VAL A HG13 8  
ATOM 7845  H HG21 . VAL A 1 51  ? 24.943 22.146 20.414 1.00 0.00 ? 21 VAL A HG21 8  
ATOM 7846  H HG22 . VAL A 1 51  ? 25.215 23.826 20.875 1.00 0.00 ? 21 VAL A HG22 8  
ATOM 7847  H HG23 . VAL A 1 51  ? 24.062 23.438 19.601 1.00 0.00 ? 21 VAL A HG23 8  
ATOM 7848  N N    . GLY A 1 52  ? 25.526 20.468 22.777 1.00 0.00 ? 22 GLY A N    8  
ATOM 7849  C CA   . GLY A 1 52  ? 25.978 19.119 22.423 1.00 0.00 ? 22 GLY A CA   8  
ATOM 7850  C C    . GLY A 1 52  ? 26.528 19.024 20.992 1.00 0.00 ? 22 GLY A C    8  
ATOM 7851  O O    . GLY A 1 52  ? 26.757 17.922 20.493 1.00 0.00 ? 22 GLY A O    8  
ATOM 7852  H H    . GLY A 1 52  ? 26.140 21.066 23.252 1.00 0.00 ? 22 GLY A H    8  
ATOM 7853  H HA2  . GLY A 1 52  ? 26.754 18.822 23.113 1.00 0.00 ? 22 GLY A HA2  8  
ATOM 7854  H HA3  . GLY A 1 52  ? 25.145 18.439 22.521 1.00 0.00 ? 22 GLY A HA3  8  
ATOM 7855  N N    . ASN A 1 53  ? 26.743 20.162 20.331 1.00 0.00 ? 23 ASN A N    8  
ATOM 7856  C CA   . ASN A 1 53  ? 27.227 20.170 18.955 1.00 0.00 ? 23 ASN A CA   8  
ATOM 7857  C C    . ASN A 1 53  ? 28.746 20.349 18.922 1.00 0.00 ? 23 ASN A C    8  
ATOM 7858  O O    . ASN A 1 53  ? 29.270 21.356 18.438 1.00 0.00 ? 23 ASN A O    8  
ATOM 7859  C CB   . ASN A 1 53  ? 26.536 21.304 18.192 1.00 0.00 ? 23 ASN A CB   8  
ATOM 7860  C CG   . ASN A 1 53  ? 26.820 21.190 16.700 1.00 0.00 ? 23 ASN A CG   8  
ATOM 7861  O OD1  . ASN A 1 53  ? 27.813 20.585 16.295 1.00 0.00 ? 23 ASN A OD1  8  
ATOM 7862  N ND2  . ASN A 1 53  ? 26.005 21.757 15.855 1.00 0.00 ? 23 ASN A ND2  8  
ATOM 7863  H H    . ASN A 1 53  ? 26.585 21.014 20.783 1.00 0.00 ? 23 ASN A H    8  
ATOM 7864  H HA   . ASN A 1 53  ? 26.974 19.230 18.487 1.00 0.00 ? 23 ASN A HA   8  
ATOM 7865  H HB2  . ASN A 1 53  ? 25.471 21.247 18.358 1.00 0.00 ? 23 ASN A HB2  8  
ATOM 7866  H HB3  . ASN A 1 53  ? 26.904 22.253 18.554 1.00 0.00 ? 23 ASN A HB3  8  
ATOM 7867  H HD21 . ASN A 1 53  ? 25.226 22.252 16.185 1.00 0.00 ? 23 ASN A HD21 8  
ATOM 7868  H HD22 . ASN A 1 53  ? 26.169 21.688 14.892 1.00 0.00 ? 23 ASN A HD22 8  
ATOM 7869  N N    . ILE A 1 54  ? 29.456 19.337 19.409 1.00 0.00 ? 24 ILE A N    8  
ATOM 7870  C CA   . ILE A 1 54  ? 30.907 19.436 19.534 1.00 0.00 ? 24 ILE A CA   8  
ATOM 7871  C C    . ILE A 1 54  ? 31.560 19.606 18.161 1.00 0.00 ? 24 ILE A C    8  
ATOM 7872  O O    . ILE A 1 54  ? 32.532 20.349 18.029 1.00 0.00 ? 24 ILE A O    8  
ATOM 7873  C CB   . ILE A 1 54  ? 31.459 18.179 20.223 1.00 0.00 ? 24 ILE A CB   8  
ATOM 7874  C CG1  . ILE A 1 54  ? 30.789 18.001 21.589 1.00 0.00 ? 24 ILE A CG1  8  
ATOM 7875  C CG2  . ILE A 1 54  ? 32.971 18.313 20.432 1.00 0.00 ? 24 ILE A CG2  8  
ATOM 7876  C CD1  . ILE A 1 54  ? 31.198 16.655 22.191 1.00 0.00 ? 24 ILE A CD1  8  
ATOM 7877  H H    . ILE A 1 54  ? 29.001 18.515 19.687 1.00 0.00 ? 24 ILE A H    8  
ATOM 7878  H HA   . ILE A 1 54  ? 31.146 20.296 20.141 1.00 0.00 ? 24 ILE A HA   8  
ATOM 7879  H HB   . ILE A 1 54  ? 31.256 17.314 19.607 1.00 0.00 ? 24 ILE A HB   8  
ATOM 7880  H HG12 . ILE A 1 54  ? 31.099 18.800 22.248 1.00 0.00 ? 24 ILE A HG12 8  
ATOM 7881  H HG13 . ILE A 1 54  ? 29.716 18.028 21.470 1.00 0.00 ? 24 ILE A HG13 8  
ATOM 7882  H HG21 . ILE A 1 54  ? 33.451 18.492 19.481 1.00 0.00 ? 24 ILE A HG21 8  
ATOM 7883  H HG22 . ILE A 1 54  ? 33.357 17.402 20.863 1.00 0.00 ? 24 ILE A HG22 8  
ATOM 7884  H HG23 . ILE A 1 54  ? 33.171 19.139 21.097 1.00 0.00 ? 24 ILE A HG23 8  
ATOM 7885  H HD11 . ILE A 1 54  ? 31.080 15.879 21.449 1.00 0.00 ? 24 ILE A HD11 8  
ATOM 7886  H HD12 . ILE A 1 54  ? 30.571 16.437 23.043 1.00 0.00 ? 24 ILE A HD12 8  
ATOM 7887  H HD13 . ILE A 1 54  ? 32.230 16.699 22.505 1.00 0.00 ? 24 ILE A HD13 8  
ATOM 7888  N N    . ASP A 1 55  ? 31.007 18.957 17.137 1.00 0.00 ? 25 ASP A N    8  
ATOM 7889  C CA   . ASP A 1 55  ? 31.613 19.012 15.811 1.00 0.00 ? 25 ASP A CA   8  
ATOM 7890  C C    . ASP A 1 55  ? 31.652 20.445 15.284 1.00 0.00 ? 25 ASP A C    8  
ATOM 7891  O O    . ASP A 1 55  ? 32.708 20.936 14.881 1.00 0.00 ? 25 ASP A O    8  
ATOM 7892  C CB   . ASP A 1 55  ? 30.818 18.134 14.840 1.00 0.00 ? 25 ASP A CB   8  
ATOM 7893  C CG   . ASP A 1 55  ? 31.547 18.043 13.504 1.00 0.00 ? 25 ASP A CG   8  
ATOM 7894  O OD1  . ASP A 1 55  ? 32.438 17.217 13.393 1.00 0.00 ? 25 ASP A OD1  8  
ATOM 7895  O OD2  . ASP A 1 55  ? 31.204 18.799 12.610 1.00 0.00 ? 25 ASP A OD2  8  
ATOM 7896  H H    . ASP A 1 55  ? 30.186 18.439 17.276 1.00 0.00 ? 25 ASP A H    8  
ATOM 7897  H HA   . ASP A 1 55  ? 32.622 18.635 15.871 1.00 0.00 ? 25 ASP A HA   8  
ATOM 7898  H HB2  . ASP A 1 55  ? 30.710 17.145 15.259 1.00 0.00 ? 25 ASP A HB2  8  
ATOM 7899  H HB3  . ASP A 1 55  ? 29.840 18.567 14.684 1.00 0.00 ? 25 ASP A HB3  8  
ATOM 7900  N N    . ASP A 1 56  ? 30.513 21.133 15.342 1.00 0.00 ? 26 ASP A N    8  
ATOM 7901  C CA   . ASP A 1 56  ? 30.452 22.508 14.858 1.00 0.00 ? 26 ASP A CA   8  
ATOM 7902  C C    . ASP A 1 56  ? 31.353 23.416 15.684 1.00 0.00 ? 26 ASP A C    8  
ATOM 7903  O O    . ASP A 1 56  ? 32.044 24.276 15.136 1.00 0.00 ? 26 ASP A O    8  
ATOM 7904  C CB   . ASP A 1 56  ? 29.012 23.031 14.889 1.00 0.00 ? 26 ASP A CB   8  
ATOM 7905  C CG   . ASP A 1 56  ? 28.151 22.397 13.788 1.00 0.00 ? 26 ASP A CG   8  
ATOM 7906  O OD1  . ASP A 1 56  ? 28.629 21.516 13.086 1.00 0.00 ? 26 ASP A OD1  8  
ATOM 7907  O OD2  . ASP A 1 56  ? 27.015 22.819 13.653 1.00 0.00 ? 26 ASP A OD2  8  
ATOM 7908  H H    . ASP A 1 56  ? 29.707 20.713 15.710 1.00 0.00 ? 26 ASP A H    8  
ATOM 7909  H HA   . ASP A 1 56  ? 30.798 22.524 13.835 1.00 0.00 ? 26 ASP A HA   8  
ATOM 7910  H HB2  . ASP A 1 56  ? 28.574 22.802 15.851 1.00 0.00 ? 26 ASP A HB2  8  
ATOM 7911  H HB3  . ASP A 1 56  ? 29.024 24.102 14.756 1.00 0.00 ? 26 ASP A HB3  8  
ATOM 7912  N N    . ALA A 1 57  ? 31.376 23.201 16.999 1.00 0.00 ? 27 ALA A N    8  
ATOM 7913  C CA   . ALA A 1 57  ? 32.195 24.036 17.869 1.00 0.00 ? 27 ALA A CA   8  
ATOM 7914  C C    . ALA A 1 57  ? 33.668 23.926 17.483 1.00 0.00 ? 27 ALA A C    8  
ATOM 7915  O O    . ALA A 1 57  ? 34.352 24.938 17.318 1.00 0.00 ? 27 ALA A O    8  
ATOM 7916  C CB   . ALA A 1 57  ? 32.016 23.603 19.326 1.00 0.00 ? 27 ALA A CB   8  
ATOM 7917  H H    . ALA A 1 57  ? 30.810 22.498 17.389 1.00 0.00 ? 27 ALA A H    8  
ATOM 7918  H HA   . ALA A 1 57  ? 31.877 25.064 17.770 1.00 0.00 ? 27 ALA A HA   8  
ATOM 7919  H HB1  . ALA A 1 57  ? 32.460 22.628 19.468 1.00 0.00 ? 27 ALA A HB1  8  
ATOM 7920  H HB2  . ALA A 1 57  ? 30.964 23.557 19.561 1.00 0.00 ? 27 ALA A HB2  8  
ATOM 7921  H HB3  . ALA A 1 57  ? 32.500 24.317 19.975 1.00 0.00 ? 27 ALA A HB3  8  
ATOM 7922  N N    . LEU A 1 58  ? 34.146 22.697 17.302 1.00 0.00 ? 28 LEU A N    8  
ATOM 7923  C CA   . LEU A 1 58  ? 35.533 22.491 16.899 1.00 0.00 ? 28 LEU A CA   8  
ATOM 7924  C C    . LEU A 1 58  ? 35.813 23.157 15.555 1.00 0.00 ? 28 LEU A C    8  
ATOM 7925  O O    . LEU A 1 58  ? 36.872 23.757 15.365 1.00 0.00 ? 28 LEU A O    8  
ATOM 7926  C CB   . LEU A 1 58  ? 35.838 20.994 16.802 1.00 0.00 ? 28 LEU A CB   8  
ATOM 7927  C CG   . LEU A 1 58  ? 35.705 20.346 18.183 1.00 0.00 ? 28 LEU A CG   8  
ATOM 7928  C CD1  . LEU A 1 58  ? 35.817 18.826 18.045 1.00 0.00 ? 28 LEU A CD1  8  
ATOM 7929  C CD2  . LEU A 1 58  ? 36.825 20.850 19.096 1.00 0.00 ? 28 LEU A CD2  8  
ATOM 7930  H H    . LEU A 1 58  ? 33.567 21.922 17.456 1.00 0.00 ? 28 LEU A H    8  
ATOM 7931  H HA   . LEU A 1 58  ? 36.180 22.930 17.642 1.00 0.00 ? 28 LEU A HA   8  
ATOM 7932  H HB2  . LEU A 1 58  ? 35.141 20.531 16.119 1.00 0.00 ? 28 LEU A HB2  8  
ATOM 7933  H HB3  . LEU A 1 58  ? 36.845 20.855 16.439 1.00 0.00 ? 28 LEU A HB3  8  
ATOM 7934  H HG   . LEU A 1 58  ? 34.747 20.599 18.612 1.00 0.00 ? 28 LEU A HG   8  
ATOM 7935  H HD11 . LEU A 1 58  ? 34.928 18.441 17.568 1.00 0.00 ? 28 LEU A HD11 8  
ATOM 7936  H HD12 . LEU A 1 58  ? 35.922 18.382 19.023 1.00 0.00 ? 28 LEU A HD12 8  
ATOM 7937  H HD13 . LEU A 1 58  ? 36.681 18.582 17.444 1.00 0.00 ? 28 LEU A HD13 8  
ATOM 7938  H HD21 . LEU A 1 58  ? 37.733 20.967 18.521 1.00 0.00 ? 28 LEU A HD21 8  
ATOM 7939  H HD22 . LEU A 1 58  ? 36.992 20.137 19.890 1.00 0.00 ? 28 LEU A HD22 8  
ATOM 7940  H HD23 . LEU A 1 58  ? 36.543 21.802 19.521 1.00 0.00 ? 28 LEU A HD23 8  
ATOM 7941  N N    . GLN A 1 59  ? 34.850 23.082 14.637 1.00 0.00 ? 29 GLN A N    8  
ATOM 7942  C CA   . GLN A 1 59  ? 35.033 23.693 13.324 1.00 0.00 ? 29 GLN A CA   8  
ATOM 7943  C C    . GLN A 1 59  ? 35.241 25.200 13.445 1.00 0.00 ? 29 GLN A C    8  
ATOM 7944  O O    . GLN A 1 59  ? 36.154 25.757 12.832 1.00 0.00 ? 29 GLN A O    8  
ATOM 7945  C CB   . GLN A 1 59  ? 33.810 23.415 12.448 1.00 0.00 ? 29 GLN A CB   8  
ATOM 7946  C CG   . GLN A 1 59  ? 34.077 23.910 11.023 1.00 0.00 ? 29 GLN A CG   8  
ATOM 7947  C CD   . GLN A 1 59  ? 32.893 23.598 10.106 1.00 0.00 ? 29 GLN A CD   8  
ATOM 7948  O OE1  . GLN A 1 59  ? 31.958 22.893 10.491 1.00 0.00 ? 29 GLN A OE1  8  
ATOM 7949  N NE2  . GLN A 1 59  ? 32.879 24.088 8.896  1.00 0.00 ? 29 GLN A NE2  8  
ATOM 7950  H H    . GLN A 1 59  ? 34.034 22.571 14.826 1.00 0.00 ? 29 GLN A H    8  
ATOM 7951  H HA   . GLN A 1 59  ? 35.901 23.257 12.854 1.00 0.00 ? 29 GLN A HA   8  
ATOM 7952  H HB2  . GLN A 1 59  ? 33.614 22.353 12.431 1.00 0.00 ? 29 GLN A HB2  8  
ATOM 7953  H HB3  . GLN A 1 59  ? 32.953 23.934 12.851 1.00 0.00 ? 29 GLN A HB3  8  
ATOM 7954  H HG2  . GLN A 1 59  ? 34.237 24.977 11.043 1.00 0.00 ? 29 GLN A HG2  8  
ATOM 7955  H HG3  . GLN A 1 59  ? 34.960 23.425 10.639 1.00 0.00 ? 29 GLN A HG3  8  
ATOM 7956  H HE21 . GLN A 1 59  ? 33.621 24.649 8.586  1.00 0.00 ? 29 GLN A HE21 8  
ATOM 7957  H HE22 . GLN A 1 59  ? 32.128 23.896 8.298  1.00 0.00 ? 29 GLN A HE22 8  
ATOM 7958  N N    . TYR A 1 60  ? 34.420 25.854 14.265 1.00 0.00 ? 30 TYR A N    8  
ATOM 7959  C CA   . TYR A 1 60  ? 34.576 27.290 14.479 1.00 0.00 ? 30 TYR A CA   8  
ATOM 7960  C C    . TYR A 1 60  ? 35.947 27.612 15.064 1.00 0.00 ? 30 TYR A C    8  
ATOM 7961  O O    . TYR A 1 60  ? 36.600 28.562 14.630 1.00 0.00 ? 30 TYR A O    8  
ATOM 7962  C CB   . TYR A 1 60  ? 33.489 27.801 15.428 1.00 0.00 ? 30 TYR A CB   8  
ATOM 7963  C CG   . TYR A 1 60  ? 32.092 27.698 14.862 1.00 0.00 ? 30 TYR A CG   8  
ATOM 7964  C CD1  . TYR A 1 60  ? 31.127 26.924 15.515 1.00 0.00 ? 30 TYR A CD1  8  
ATOM 7965  C CD2  . TYR A 1 60  ? 31.763 28.381 13.686 1.00 0.00 ? 30 TYR A CD2  8  
ATOM 7966  C CE1  . TYR A 1 60  ? 29.832 26.830 14.991 1.00 0.00 ? 30 TYR A CE1  8  
ATOM 7967  C CE2  . TYR A 1 60  ? 30.469 28.288 13.161 1.00 0.00 ? 30 TYR A CE2  8  
ATOM 7968  C CZ   . TYR A 1 60  ? 29.503 27.512 13.813 1.00 0.00 ? 30 TYR A CZ   8  
ATOM 7969  O OH   . TYR A 1 60  ? 28.227 27.421 13.296 1.00 0.00 ? 30 TYR A OH   8  
ATOM 7970  H H    . TYR A 1 60  ? 33.677 25.379 14.689 1.00 0.00 ? 30 TYR A H    8  
ATOM 7971  H HA   . TYR A 1 60  ? 34.473 27.796 13.532 1.00 0.00 ? 30 TYR A HA   8  
ATOM 7972  H HB2  . TYR A 1 60  ? 33.530 27.228 16.341 1.00 0.00 ? 30 TYR A HB2  8  
ATOM 7973  H HB3  . TYR A 1 60  ? 33.699 28.835 15.664 1.00 0.00 ? 30 TYR A HB3  8  
ATOM 7974  H HD1  . TYR A 1 60  ? 31.381 26.397 16.424 1.00 0.00 ? 30 TYR A HD1  8  
ATOM 7975  H HD2  . TYR A 1 60  ? 32.509 28.979 13.182 1.00 0.00 ? 30 TYR A HD2  8  
ATOM 7976  H HE1  . TYR A 1 60  ? 29.086 26.232 15.495 1.00 0.00 ? 30 TYR A HE1  8  
ATOM 7977  H HE2  . TYR A 1 60  ? 30.216 28.815 12.253 1.00 0.00 ? 30 TYR A HE2  8  
ATOM 7978  H HH   . TYR A 1 60  ? 28.093 26.570 13.035 1.00 0.00 ? 30 TYR A HH   8  
ATOM 7979  N N    . TYR A 1 61  ? 36.401 26.802 16.022 1.00 0.00 ? 31 TYR A N    8  
ATOM 7980  C CA   . TYR A 1 61  ? 37.710 27.035 16.626 1.00 0.00 ? 31 TYR A CA   8  
ATOM 7981  C C    . TYR A 1 61  ? 38.823 26.921 15.588 1.00 0.00 ? 31 TYR A C    8  
ATOM 7982  O O    . TYR A 1 61  ? 39.752 27.731 15.575 1.00 0.00 ? 31 TYR A O    8  
ATOM 7983  C CB   . TYR A 1 61  ? 37.957 26.035 17.757 1.00 0.00 ? 31 TYR A CB   8  
ATOM 7984  C CG   . TYR A 1 61  ? 37.008 26.195 18.923 1.00 0.00 ? 31 TYR A CG   8  
ATOM 7985  C CD1  . TYR A 1 61  ? 36.713 27.472 19.418 1.00 0.00 ? 31 TYR A CD1  8  
ATOM 7986  C CD2  . TYR A 1 61  ? 36.428 25.067 19.514 1.00 0.00 ? 31 TYR A CD2  8  
ATOM 7987  C CE1  . TYR A 1 61  ? 35.837 27.618 20.500 1.00 0.00 ? 31 TYR A CE1  8  
ATOM 7988  C CE2  . TYR A 1 61  ? 35.551 25.213 20.595 1.00 0.00 ? 31 TYR A CE2  8  
ATOM 7989  C CZ   . TYR A 1 61  ? 35.256 26.489 21.088 1.00 0.00 ? 31 TYR A CZ   8  
ATOM 7990  O OH   . TYR A 1 61  ? 34.392 26.633 22.156 1.00 0.00 ? 31 TYR A OH   8  
ATOM 7991  H H    . TYR A 1 61  ? 35.836 26.069 16.348 1.00 0.00 ? 31 TYR A H    8  
ATOM 7992  H HA   . TYR A 1 61  ? 37.726 28.032 17.039 1.00 0.00 ? 31 TYR A HA   8  
ATOM 7993  H HB2  . TYR A 1 61  ? 37.848 25.035 17.365 1.00 0.00 ? 31 TYR A HB2  8  
ATOM 7994  H HB3  . TYR A 1 61  ? 38.971 26.158 18.109 1.00 0.00 ? 31 TYR A HB3  8  
ATOM 7995  H HD1  . TYR A 1 61  ? 37.160 28.343 18.964 1.00 0.00 ? 31 TYR A HD1  8  
ATOM 7996  H HD2  . TYR A 1 61  ? 36.656 24.082 19.134 1.00 0.00 ? 31 TYR A HD2  8  
ATOM 7997  H HE1  . TYR A 1 61  ? 35.610 28.603 20.881 1.00 0.00 ? 31 TYR A HE1  8  
ATOM 7998  H HE2  . TYR A 1 61  ? 35.103 24.341 21.048 1.00 0.00 ? 31 TYR A HE2  8  
ATOM 7999  H HH   . TYR A 1 61  ? 34.867 26.535 22.913 1.00 0.00 ? 31 TYR A HH   8  
ATOM 8000  N N    . ALA A 1 62  ? 38.698 25.955 14.681 1.00 0.00 ? 32 ALA A N    8  
ATOM 8001  C CA   . ALA A 1 62  ? 39.701 25.784 13.635 1.00 0.00 ? 32 ALA A CA   8  
ATOM 8002  C C    . ALA A 1 62  ? 39.744 27.011 12.733 1.00 0.00 ? 32 ALA A C    8  
ATOM 8003  O O    . ALA A 1 62  ? 40.819 27.527 12.417 1.00 0.00 ? 32 ALA A O    8  
ATOM 8004  C CB   . ALA A 1 62  ? 39.379 24.545 12.798 1.00 0.00 ? 32 ALA A CB   8  
ATOM 8005  H H    . ALA A 1 62  ? 37.945 25.331 14.737 1.00 0.00 ? 32 ALA A H    8  
ATOM 8006  H HA   . ALA A 1 62  ? 40.669 25.651 14.096 1.00 0.00 ? 32 ALA A HA   8  
ATOM 8007  H HB1  . ALA A 1 62  ? 40.227 24.299 12.177 1.00 0.00 ? 32 ALA A HB1  8  
ATOM 8008  H HB2  . ALA A 1 62  ? 38.521 24.745 12.173 1.00 0.00 ? 32 ALA A HB2  8  
ATOM 8009  H HB3  . ALA A 1 62  ? 39.160 23.714 13.453 1.00 0.00 ? 32 ALA A HB3  8  
ATOM 8010  N N    . ALA A 1 63  ? 38.567 27.506 12.361 1.00 0.00 ? 33 ALA A N    8  
ATOM 8011  C CA   . ALA A 1 63  ? 38.495 28.697 11.523 1.00 0.00 ? 33 ALA A CA   8  
ATOM 8012  C C    . ALA A 1 63  ? 39.098 29.901 12.238 1.00 0.00 ? 33 ALA A C    8  
ATOM 8013  O O    . ALA A 1 63  ? 39.797 30.706 11.624 1.00 0.00 ? 33 ALA A O    8  
ATOM 8014  C CB   . ALA A 1 63  ? 37.038 28.991 11.163 1.00 0.00 ? 33 ALA A CB   8  
ATOM 8015  H H    . ALA A 1 63  ? 37.742 27.049 12.628 1.00 0.00 ? 33 ALA A H    8  
ATOM 8016  H HA   . ALA A 1 63  ? 39.048 28.517 10.613 1.00 0.00 ? 33 ALA A HA   8  
ATOM 8017  H HB1  . ALA A 1 63  ? 36.486 28.063 11.111 1.00 0.00 ? 33 ALA A HB1  8  
ATOM 8018  H HB2  . ALA A 1 63  ? 36.996 29.488 10.207 1.00 0.00 ? 33 ALA A HB2  8  
ATOM 8019  H HB3  . ALA A 1 63  ? 36.601 29.626 11.920 1.00 0.00 ? 33 ALA A HB3  8  
ATOM 8020  N N    . ALA A 1 64  ? 38.862 30.003 13.545 1.00 0.00 ? 34 ALA A N    8  
ATOM 8021  C CA   . ALA A 1 64  ? 39.394 31.122 14.314 1.00 0.00 ? 34 ALA A CA   8  
ATOM 8022  C C    . ALA A 1 64  ? 40.920 31.141 14.274 1.00 0.00 ? 34 ALA A C    8  
ATOM 8023  O O    . ALA A 1 64  ? 41.524 32.190 14.034 1.00 0.00 ? 34 ALA A O    8  
ATOM 8024  C CB   . ALA A 1 64  ? 38.893 31.037 15.762 1.00 0.00 ? 34 ALA A CB   8  
ATOM 8025  H H    . ALA A 1 64  ? 38.293 29.341 13.986 1.00 0.00 ? 34 ALA A H    8  
ATOM 8026  H HA   . ALA A 1 64  ? 39.033 32.042 13.880 1.00 0.00 ? 34 ALA A HA   8  
ATOM 8027  H HB1  . ALA A 1 64  ? 38.035 30.382 15.807 1.00 0.00 ? 34 ALA A HB1  8  
ATOM 8028  H HB2  . ALA A 1 64  ? 38.604 32.021 16.100 1.00 0.00 ? 34 ALA A HB2  8  
ATOM 8029  H HB3  . ALA A 1 64  ? 39.672 30.651 16.405 1.00 0.00 ? 34 ALA A HB3  8  
ATOM 8030  N N    . ILE A 1 65  ? 41.541 29.977 14.460 1.00 0.00 ? 35 ILE A N    8  
ATOM 8031  C CA   . ILE A 1 65  ? 42.997 29.905 14.413 1.00 0.00 ? 35 ILE A CA   8  
ATOM 8032  C C    . ILE A 1 65  ? 43.499 30.328 13.034 1.00 0.00 ? 35 ILE A C    8  
ATOM 8033  O O    . ILE A 1 65  ? 44.459 31.093 12.927 1.00 0.00 ? 35 ILE A O    8  
ATOM 8034  C CB   . ILE A 1 65  ? 43.463 28.480 14.740 1.00 0.00 ? 35 ILE A CB   8  
ATOM 8035  C CG1  . ILE A 1 65  ? 42.962 28.093 16.133 1.00 0.00 ? 35 ILE A CG1  8  
ATOM 8036  C CG2  . ILE A 1 65  ? 44.994 28.403 14.728 1.00 0.00 ? 35 ILE A CG2  8  
ATOM 8037  C CD1  . ILE A 1 65  ? 43.241 26.610 16.383 1.00 0.00 ? 35 ILE A CD1  8  
ATOM 8038  H H    . ILE A 1 65  ? 41.016 29.172 14.664 1.00 0.00 ? 35 ILE A H    8  
ATOM 8039  H HA   . ILE A 1 65  ? 43.402 30.580 15.151 1.00 0.00 ? 35 ILE A HA   8  
ATOM 8040  H HB   . ILE A 1 65  ? 43.063 27.793 14.008 1.00 0.00 ? 35 ILE A HB   8  
ATOM 8041  H HG12 . ILE A 1 65  ? 43.475 28.687 16.875 1.00 0.00 ? 35 ILE A HG12 8  
ATOM 8042  H HG13 . ILE A 1 65  ? 41.901 28.273 16.198 1.00 0.00 ? 35 ILE A HG13 8  
ATOM 8043  H HG21 . ILE A 1 65  ? 45.361 28.686 13.752 1.00 0.00 ? 35 ILE A HG21 8  
ATOM 8044  H HG22 . ILE A 1 65  ? 45.305 27.393 14.951 1.00 0.00 ? 35 ILE A HG22 8  
ATOM 8045  H HG23 . ILE A 1 65  ? 45.393 29.075 15.472 1.00 0.00 ? 35 ILE A HG23 8  
ATOM 8046  H HD11 . ILE A 1 65  ? 42.827 26.024 15.575 1.00 0.00 ? 35 ILE A HD11 8  
ATOM 8047  H HD12 . ILE A 1 65  ? 42.785 26.310 17.315 1.00 0.00 ? 35 ILE A HD12 8  
ATOM 8048  H HD13 . ILE A 1 65  ? 44.308 26.448 16.435 1.00 0.00 ? 35 ILE A HD13 8  
ATOM 8049  N N    . THR A 1 66  ? 42.834 29.855 11.980 1.00 0.00 ? 36 THR A N    8  
ATOM 8050  C CA   . THR A 1 66  ? 43.230 30.233 10.627 1.00 0.00 ? 36 THR A CA   8  
ATOM 8051  C C    . THR A 1 66  ? 43.117 31.743 10.421 1.00 0.00 ? 36 THR A C    8  
ATOM 8052  O O    . THR A 1 66  ? 44.017 32.372 9.862  1.00 0.00 ? 36 THR A O    8  
ATOM 8053  C CB   . THR A 1 66  ? 42.352 29.514 9.602  1.00 0.00 ? 36 THR A CB   8  
ATOM 8054  O OG1  . THR A 1 66  ? 42.304 28.127 9.904  1.00 0.00 ? 36 THR A OG1  8  
ATOM 8055  C CG2  . THR A 1 66  ? 42.943 29.709 8.206  1.00 0.00 ? 36 THR A CG2  8  
ATOM 8056  H H    . THR A 1 66  ? 42.094 29.222 12.114 1.00 0.00 ? 36 THR A H    8  
ATOM 8057  H HA   . THR A 1 66  ? 44.256 29.936 10.469 1.00 0.00 ? 36 THR A HA   8  
ATOM 8058  H HB   . THR A 1 66  ? 41.354 29.924 9.627  1.00 0.00 ? 36 THR A HB   8  
ATOM 8059  H HG1  . THR A 1 66  ? 41.774 27.728 9.297  1.00 0.00 ? 36 THR A HG1  8  
ATOM 8060  H HG21 . THR A 1 66  ? 42.728 30.710 7.860  1.00 0.00 ? 36 THR A HG21 8  
ATOM 8061  H HG22 . THR A 1 66  ? 42.506 28.993 7.526  1.00 0.00 ? 36 THR A HG22 8  
ATOM 8062  H HG23 . THR A 1 66  ? 44.013 29.564 8.243  1.00 0.00 ? 36 THR A HG23 8  
ATOM 8063  N N    . LEU A 1 67  ? 42.029 32.333 10.912 1.00 0.00 ? 37 LEU A N    8  
ATOM 8064  C CA   . LEU A 1 67  ? 41.828 33.772 10.768 1.00 0.00 ? 37 LEU A CA   8  
ATOM 8065  C C    . LEU A 1 67  ? 42.942 34.561 11.447 1.00 0.00 ? 37 LEU A C    8  
ATOM 8066  O O    . LEU A 1 67  ? 43.342 35.618 10.961 1.00 0.00 ? 37 LEU A O    8  
ATOM 8067  C CB   . LEU A 1 67  ? 40.477 34.179 11.359 1.00 0.00 ? 37 LEU A CB   8  
ATOM 8068  C CG   . LEU A 1 67  ? 39.346 33.618 10.494 1.00 0.00 ? 37 LEU A CG   8  
ATOM 8069  C CD1  . LEU A 1 67  ? 38.013 33.783 11.226 1.00 0.00 ? 37 LEU A CD1  8  
ATOM 8070  C CD2  . LEU A 1 67  ? 39.291 34.382 9.170  1.00 0.00 ? 37 LEU A CD2  8  
ATOM 8071  H H    . LEU A 1 67  ? 41.342 31.792 11.352 1.00 0.00 ? 37 LEU A H    8  
ATOM 8072  H HA   . LEU A 1 67  ? 41.828 34.014 9.716  1.00 0.00 ? 37 LEU A HA   8  
ATOM 8073  H HB2  . LEU A 1 67  ? 40.392 33.789 12.363 1.00 0.00 ? 37 LEU A HB2  8  
ATOM 8074  H HB3  . LEU A 1 67  ? 40.405 35.256 11.385 1.00 0.00 ? 37 LEU A HB3  8  
ATOM 8075  H HG   . LEU A 1 67  ? 39.526 32.571 10.302 1.00 0.00 ? 37 LEU A HG   8  
ATOM 8076  H HD11 . LEU A 1 67  ? 37.650 34.790 11.090 1.00 0.00 ? 37 LEU A HD11 8  
ATOM 8077  H HD12 . LEU A 1 67  ? 38.154 33.591 12.280 1.00 0.00 ? 37 LEU A HD12 8  
ATOM 8078  H HD13 . LEU A 1 67  ? 37.293 33.084 10.827 1.00 0.00 ? 37 LEU A HD13 8  
ATOM 8079  H HD21 . LEU A 1 67  ? 39.516 35.424 9.346  1.00 0.00 ? 37 LEU A HD21 8  
ATOM 8080  H HD22 . LEU A 1 67  ? 38.304 34.293 8.744  1.00 0.00 ? 37 LEU A HD22 8  
ATOM 8081  H HD23 . LEU A 1 67  ? 40.018 33.968 8.486  1.00 0.00 ? 37 LEU A HD23 8  
ATOM 8082  N N    . ASP A 1 68  ? 43.414 34.064 12.588 1.00 0.00 ? 38 ASP A N    8  
ATOM 8083  C CA   . ASP A 1 68  ? 44.543 34.693 13.262 1.00 0.00 ? 38 ASP A CA   8  
ATOM 8084  C C    . ASP A 1 68  ? 45.808 34.589 12.415 1.00 0.00 ? 38 ASP A C    8  
ATOM 8085  O O    . ASP A 1 68  ? 46.517 35.575 12.217 1.00 0.00 ? 38 ASP A O    8  
ATOM 8086  C CB   . ASP A 1 68  ? 44.780 34.022 14.615 1.00 0.00 ? 38 ASP A CB   8  
ATOM 8087  C CG   . ASP A 1 68  ? 45.837 34.789 15.401 1.00 0.00 ? 38 ASP A CG   8  
ATOM 8088  O OD1  . ASP A 1 68  ? 45.478 35.759 16.046 1.00 0.00 ? 38 ASP A OD1  8  
ATOM 8089  O OD2  . ASP A 1 68  ? 46.990 34.393 15.347 1.00 0.00 ? 38 ASP A OD2  8  
ATOM 8090  H H    . ASP A 1 68  ? 42.970 33.293 13.000 1.00 0.00 ? 38 ASP A H    8  
ATOM 8091  H HA   . ASP A 1 68  ? 44.316 35.735 13.426 1.00 0.00 ? 38 ASP A HA   8  
ATOM 8092  H HB2  . ASP A 1 68  ? 43.856 34.009 15.176 1.00 0.00 ? 38 ASP A HB2  8  
ATOM 8093  H HB3  . ASP A 1 68  ? 45.118 33.008 14.458 1.00 0.00 ? 38 ASP A HB3  8  
ATOM 8094  N N    . LYS A 1 69  ? 46.086 33.386 11.914 1.00 0.00 ? 39 LYS A N    8  
ATOM 8095  C CA   . LYS A 1 69  ? 47.277 33.166 11.100 1.00 0.00 ? 39 LYS A CA   8  
ATOM 8096  C C    . LYS A 1 69  ? 47.280 34.034 9.840  1.00 0.00 ? 39 LYS A C    8  
ATOM 8097  O O    . LYS A 1 69  ? 48.346 34.414 9.353  1.00 0.00 ? 39 LYS A O    8  
ATOM 8098  C CB   . LYS A 1 69  ? 47.361 31.689 10.703 1.00 0.00 ? 39 LYS A CB   8  
ATOM 8099  C CG   . LYS A 1 69  ? 48.693 31.416 10.001 1.00 0.00 ? 39 LYS A CG   8  
ATOM 8100  C CD   . LYS A 1 69  ? 48.735 29.960 9.534  1.00 0.00 ? 39 LYS A CD   8  
ATOM 8101  C CE   . LYS A 1 69  ? 50.124 29.642 8.977  1.00 0.00 ? 39 LYS A CE   8  
ATOM 8102  N NZ   . LYS A 1 69  ? 50.207 28.191 8.646  1.00 0.00 ? 39 LYS A NZ   8  
ATOM 8103  H H    . LYS A 1 69  ? 45.493 32.634 12.117 1.00 0.00 ? 39 LYS A H    8  
ATOM 8104  H HA   . LYS A 1 69  ? 48.148 33.411 11.690 1.00 0.00 ? 39 LYS A HA   8  
ATOM 8105  H HB2  . LYS A 1 69  ? 47.289 31.076 11.590 1.00 0.00 ? 39 LYS A HB2  8  
ATOM 8106  H HB3  . LYS A 1 69  ? 46.548 31.451 10.034 1.00 0.00 ? 39 LYS A HB3  8  
ATOM 8107  H HG2  . LYS A 1 69  ? 48.789 32.072 9.147  1.00 0.00 ? 39 LYS A HG2  8  
ATOM 8108  H HG3  . LYS A 1 69  ? 49.506 31.595 10.687 1.00 0.00 ? 39 LYS A HG3  8  
ATOM 8109  H HD2  . LYS A 1 69  ? 48.523 29.308 10.369 1.00 0.00 ? 39 LYS A HD2  8  
ATOM 8110  H HD3  . LYS A 1 69  ? 47.997 29.807 8.760  1.00 0.00 ? 39 LYS A HD3  8  
ATOM 8111  H HE2  . LYS A 1 69  ? 50.296 30.224 8.084  1.00 0.00 ? 39 LYS A HE2  8  
ATOM 8112  H HE3  . LYS A 1 69  ? 50.873 29.886 9.716  1.00 0.00 ? 39 LYS A HE3  8  
ATOM 8113  H HZ1  . LYS A 1 69  ? 49.330 27.891 8.175  1.00 0.00 ? 39 LYS A HZ1  8  
ATOM 8114  H HZ2  . LYS A 1 69  ? 50.336 27.643 9.522  1.00 0.00 ? 39 LYS A HZ2  8  
ATOM 8115  H HZ3  . LYS A 1 69  ? 51.013 28.025 8.010  1.00 0.00 ? 39 LYS A HZ3  8  
ATOM 8116  N N    . TYR A 1 70  ? 46.098 34.350 9.314  1.00 0.00 ? 40 TYR A N    8  
ATOM 8117  C CA   . TYR A 1 70  ? 46.005 35.195 8.126  1.00 0.00 ? 40 TYR A CA   8  
ATOM 8118  C C    . TYR A 1 70  ? 46.679 36.548 8.396  1.00 0.00 ? 40 TYR A C    8  
ATOM 8119  O O    . TYR A 1 70  ? 46.373 37.176 9.413  1.00 0.00 ? 40 TYR A O    8  
ATOM 8120  C CB   . TYR A 1 70  ? 44.524 35.391 7.799  1.00 0.00 ? 40 TYR A CB   8  
ATOM 8121  C CG   . TYR A 1 70  ? 44.230 35.625 6.337  1.00 0.00 ? 40 TYR A CG   8  
ATOM 8122  C CD1  . TYR A 1 70  ? 44.390 34.585 5.412  1.00 0.00 ? 40 TYR A CD1  8  
ATOM 8123  C CD2  . TYR A 1 70  ? 43.763 36.873 5.912  1.00 0.00 ? 40 TYR A CD2  8  
ATOM 8124  C CE1  . TYR A 1 70  ? 44.086 34.797 4.062  1.00 0.00 ? 40 TYR A CE1  8  
ATOM 8125  C CE2  . TYR A 1 70  ? 43.461 37.086 4.562  1.00 0.00 ? 40 TYR A CE2  8  
ATOM 8126  C CZ   . TYR A 1 70  ? 43.623 36.048 3.637  1.00 0.00 ? 40 TYR A CZ   8  
ATOM 8127  O OH   . TYR A 1 70  ? 43.325 36.258 2.305  1.00 0.00 ? 40 TYR A OH   8  
ATOM 8128  H H    . TYR A 1 70  ? 45.283 33.964 9.697  1.00 0.00 ? 40 TYR A H    8  
ATOM 8129  H HA   . TYR A 1 70  ? 46.479 34.679 7.308  1.00 0.00 ? 40 TYR A HA   8  
ATOM 8130  H HB2  . TYR A 1 70  ? 43.981 34.512 8.112  1.00 0.00 ? 40 TYR A HB2  8  
ATOM 8131  H HB3  . TYR A 1 70  ? 44.159 36.235 8.368  1.00 0.00 ? 40 TYR A HB3  8  
ATOM 8132  H HD1  . TYR A 1 70  ? 44.751 33.621 5.739  1.00 0.00 ? 40 TYR A HD1  8  
ATOM 8133  H HD2  . TYR A 1 70  ? 43.637 37.672 6.626  1.00 0.00 ? 40 TYR A HD2  8  
ATOM 8134  H HE1  . TYR A 1 70  ? 44.210 33.996 3.349  1.00 0.00 ? 40 TYR A HE1  8  
ATOM 8135  H HE2  . TYR A 1 70  ? 43.097 38.048 4.237  1.00 0.00 ? 40 TYR A HE2  8  
ATOM 8136  H HH   . TYR A 1 70  ? 44.049 36.623 1.914  1.00 0.00 ? 40 TYR A HH   8  
ATOM 8137  N N    . PRO A 1 71  ? 47.568 37.026 7.545  1.00 0.00 ? 41 PRO A N    8  
ATOM 8138  C CA   . PRO A 1 71  ? 48.324 38.282 7.827  1.00 0.00 ? 41 PRO A CA   8  
ATOM 8139  C C    . PRO A 1 71  ? 47.590 39.566 7.440  1.00 0.00 ? 41 PRO A C    8  
ATOM 8140  O O    . PRO A 1 71  ? 48.208 40.631 7.394  1.00 0.00 ? 41 PRO A O    8  
ATOM 8141  C CB   . PRO A 1 71  ? 49.592 38.117 6.994  1.00 0.00 ? 41 PRO A CB   8  
ATOM 8142  C CG   . PRO A 1 71  ? 49.181 37.308 5.810  1.00 0.00 ? 41 PRO A CG   8  
ATOM 8143  C CD   . PRO A 1 71  ? 47.948 36.496 6.220  1.00 0.00 ? 41 PRO A CD   8  
ATOM 8144  H HA   . PRO A 1 71  ? 48.596 38.319 8.871  1.00 0.00 ? 41 PRO A HA   8  
ATOM 8145  H HB2  . PRO A 1 71  ? 49.963 39.084 6.682  1.00 0.00 ? 41 PRO A HB2  8  
ATOM 8146  H HB3  . PRO A 1 71  ? 50.346 37.587 7.555  1.00 0.00 ? 41 PRO A HB3  8  
ATOM 8147  H HG2  . PRO A 1 71  ? 48.939 37.964 4.985  1.00 0.00 ? 41 PRO A HG2  8  
ATOM 8148  H HG3  . PRO A 1 71  ? 49.975 36.634 5.527  1.00 0.00 ? 41 PRO A HG3  8  
ATOM 8149  H HD2  . PRO A 1 71  ? 47.148 36.645 5.508  1.00 0.00 ? 41 PRO A HD2  8  
ATOM 8150  H HD3  . PRO A 1 71  ? 48.196 35.449 6.299  1.00 0.00 ? 41 PRO A HD3  8  
ATOM 8151  N N    . HIS A 1 72  ? 46.290 39.481 7.165  1.00 0.00 ? 42 HIS A N    8  
ATOM 8152  C CA   . HIS A 1 72  ? 45.550 40.656 6.706  1.00 0.00 ? 42 HIS A CA   8  
ATOM 8153  C C    . HIS A 1 72  ? 44.124 40.683 7.242  1.00 0.00 ? 42 HIS A C    8  
ATOM 8154  O O    . HIS A 1 72  ? 43.522 39.639 7.491  1.00 0.00 ? 42 HIS A O    8  
ATOM 8155  C CB   . HIS A 1 72  ? 45.514 40.676 5.177  1.00 0.00 ? 42 HIS A CB   8  
ATOM 8156  C CG   . HIS A 1 72  ? 46.878 40.740 4.546  1.00 0.00 ? 42 HIS A CG   8  
ATOM 8157  N ND1  . HIS A 1 72  ? 47.705 41.842 4.684  1.00 0.00 ? 42 HIS A ND1  8  
ATOM 8158  C CD2  . HIS A 1 72  ? 47.573 39.844 3.770  1.00 0.00 ? 42 HIS A CD2  8  
ATOM 8159  C CE1  . HIS A 1 72  ? 48.839 41.586 4.009  1.00 0.00 ? 42 HIS A CE1  8  
ATOM 8160  N NE2  . HIS A 1 72  ? 48.812 40.382 3.432  1.00 0.00 ? 42 HIS A NE2  8  
ATOM 8161  H H    . HIS A 1 72  ? 45.825 38.624 7.272  1.00 0.00 ? 42 HIS A H    8  
ATOM 8162  H HA   . HIS A 1 72  ? 46.063 41.544 7.045  1.00 0.00 ? 42 HIS A HA   8  
ATOM 8163  H HB2  . HIS A 1 72  ? 45.020 39.782 4.831  1.00 0.00 ? 42 HIS A HB2  8  
ATOM 8164  H HB3  . HIS A 1 72  ? 44.937 41.533 4.858  1.00 0.00 ? 42 HIS A HB3  8  
ATOM 8165  H HD1  . HIS A 1 72  ? 47.500 42.660 5.184  1.00 0.00 ? 42 HIS A HD1  8  
ATOM 8166  H HD2  . HIS A 1 72  ? 47.214 38.872 3.469  1.00 0.00 ? 42 HIS A HD2  8  
ATOM 8167  H HE1  . HIS A 1 72  ? 49.670 42.272 3.940  1.00 0.00 ? 42 HIS A HE1  8  
ATOM 8168  N N    . LYS A 1 73  ? 43.597 41.887 7.448  1.00 0.00 ? 43 LYS A N    8  
ATOM 8169  C CA   . LYS A 1 73  ? 42.178 42.034 7.744  1.00 0.00 ? 43 LYS A CA   8  
ATOM 8170  C C    . LYS A 1 73  ? 41.368 41.541 6.552  1.00 0.00 ? 43 LYS A C    8  
ATOM 8171  O O    . LYS A 1 73  ? 41.667 41.899 5.411  1.00 0.00 ? 43 LYS A O    8  
ATOM 8172  C CB   . LYS A 1 73  ? 41.839 43.505 7.998  1.00 0.00 ? 43 LYS A CB   8  
ATOM 8173  C CG   . LYS A 1 73  ? 40.397 43.617 8.500  1.00 0.00 ? 43 LYS A CG   8  
ATOM 8174  C CD   . LYS A 1 73  ? 40.030 45.092 8.675  1.00 0.00 ? 43 LYS A CD   8  
ATOM 8175  C CE   . LYS A 1 73  ? 38.647 45.200 9.321  1.00 0.00 ? 43 LYS A CE   8  
ATOM 8176  N NZ   . LYS A 1 73  ? 38.278 46.636 9.469  1.00 0.00 ? 43 LYS A NZ   8  
ATOM 8177  H H    . LYS A 1 73  ? 44.169 42.683 7.409  1.00 0.00 ? 43 LYS A H    8  
ATOM 8178  H HA   . LYS A 1 73  ? 41.928 41.451 8.618  1.00 0.00 ? 43 LYS A HA   8  
ATOM 8179  H HB2  . LYS A 1 73  ? 42.514 43.912 8.735  1.00 0.00 ? 43 LYS A HB2  8  
ATOM 8180  H HB3  . LYS A 1 73  ? 41.937 44.059 7.077  1.00 0.00 ? 43 LYS A HB3  8  
ATOM 8181  H HG2  . LYS A 1 73  ? 39.731 43.162 7.783  1.00 0.00 ? 43 LYS A HG2  8  
ATOM 8182  H HG3  . LYS A 1 73  ? 40.305 43.111 9.449  1.00 0.00 ? 43 LYS A HG3  8  
ATOM 8183  H HD2  . LYS A 1 73  ? 40.762 45.572 9.307  1.00 0.00 ? 43 LYS A HD2  8  
ATOM 8184  H HD3  . LYS A 1 73  ? 40.012 45.576 7.711  1.00 0.00 ? 43 LYS A HD3  8  
ATOM 8185  H HE2  . LYS A 1 73  ? 37.919 44.704 8.697  1.00 0.00 ? 43 LYS A HE2  8  
ATOM 8186  H HE3  . LYS A 1 73  ? 38.667 44.732 10.294 1.00 0.00 ? 43 LYS A HE3  8  
ATOM 8187  H HZ1  . LYS A 1 73  ? 38.949 47.102 10.114 1.00 0.00 ? 43 LYS A HZ1  8  
ATOM 8188  H HZ2  . LYS A 1 73  ? 37.315 46.709 9.856  1.00 0.00 ? 43 LYS A HZ2  8  
ATOM 8189  H HZ3  . LYS A 1 73  ? 38.315 47.102 8.540  1.00 0.00 ? 43 LYS A HZ3  8  
ATOM 8190  N N    . ILE A 1 74  ? 40.350 40.724 6.809  1.00 0.00 ? 44 ILE A N    8  
ATOM 8191  C CA   . ILE A 1 74  ? 39.478 40.265 5.730  1.00 0.00 ? 44 ILE A CA   8  
ATOM 8192  C C    . ILE A 1 74  ? 38.296 41.219 5.563  1.00 0.00 ? 44 ILE A C    8  
ATOM 8193  O O    . ILE A 1 74  ? 37.654 41.608 6.539  1.00 0.00 ? 44 ILE A O    8  
ATOM 8194  C CB   . ILE A 1 74  ? 39.021 38.826 6.004  1.00 0.00 ? 44 ILE A CB   8  
ATOM 8195  C CG1  . ILE A 1 74  ? 40.267 37.935 6.076  1.00 0.00 ? 44 ILE A CG1  8  
ATOM 8196  C CG2  . ILE A 1 74  ? 38.109 38.336 4.875  1.00 0.00 ? 44 ILE A CG2  8  
ATOM 8197  C CD1  . ILE A 1 74  ? 39.889 36.518 6.506  1.00 0.00 ? 44 ILE A CD1  8  
ATOM 8198  H H    . ILE A 1 74  ? 40.201 40.411 7.728  1.00 0.00 ? 44 ILE A H    8  
ATOM 8199  H HA   . ILE A 1 74  ? 40.046 40.270 4.810  1.00 0.00 ? 44 ILE A HA   8  
ATOM 8200  H HB   . ILE A 1 74  ? 38.492 38.786 6.944  1.00 0.00 ? 44 ILE A HB   8  
ATOM 8201  H HG12 . ILE A 1 74  ? 40.735 37.899 5.102  1.00 0.00 ? 44 ILE A HG12 8  
ATOM 8202  H HG13 . ILE A 1 74  ? 40.962 38.350 6.790  1.00 0.00 ? 44 ILE A HG13 8  
ATOM 8203  H HG21 . ILE A 1 74  ? 37.876 37.292 5.023  1.00 0.00 ? 44 ILE A HG21 8  
ATOM 8204  H HG22 . ILE A 1 74  ? 38.609 38.463 3.926  1.00 0.00 ? 44 ILE A HG22 8  
ATOM 8205  H HG23 . ILE A 1 74  ? 37.195 38.911 4.879  1.00 0.00 ? 44 ILE A HG23 8  
ATOM 8206  H HD11 . ILE A 1 74  ? 39.133 36.127 5.842  1.00 0.00 ? 44 ILE A HD11 8  
ATOM 8207  H HD12 . ILE A 1 74  ? 39.507 36.537 7.516  1.00 0.00 ? 44 ILE A HD12 8  
ATOM 8208  H HD13 . ILE A 1 74  ? 40.766 35.889 6.462  1.00 0.00 ? 44 ILE A HD13 8  
ATOM 8209  N N    . LYS A 1 75  ? 38.022 41.590 4.315  1.00 0.00 ? 45 LYS A N    8  
ATOM 8210  C CA   . LYS A 1 75  ? 36.984 42.578 4.022  1.00 0.00 ? 45 LYS A CA   8  
ATOM 8211  C C    . LYS A 1 75  ? 35.579 41.970 3.963  1.00 0.00 ? 45 LYS A C    8  
ATOM 8212  O O    . LYS A 1 75  ? 34.594 42.700 4.078  1.00 0.00 ? 45 LYS A O    8  
ATOM 8213  C CB   . LYS A 1 75  ? 37.302 43.263 2.690  1.00 0.00 ? 45 LYS A CB   8  
ATOM 8214  C CG   . LYS A 1 75  ? 36.330 44.420 2.447  1.00 0.00 ? 45 LYS A CG   8  
ATOM 8215  C CD   . LYS A 1 75  ? 36.726 45.166 1.171  1.00 0.00 ? 45 LYS A CD   8  
ATOM 8216  C CE   . LYS A 1 75  ? 36.489 44.276 -0.053 1.00 0.00 ? 45 LYS A CE   8  
ATOM 8217  N NZ   . LYS A 1 75  ? 37.706 43.459 -0.319 1.00 0.00 ? 45 LYS A NZ   8  
ATOM 8218  H H    . LYS A 1 75  ? 38.526 41.192 3.575  1.00 0.00 ? 45 LYS A H    8  
ATOM 8219  H HA   . LYS A 1 75  ? 36.995 43.327 4.800  1.00 0.00 ? 45 LYS A HA   8  
ATOM 8220  H HB2  . LYS A 1 75  ? 38.313 43.643 2.717  1.00 0.00 ? 45 LYS A HB2  8  
ATOM 8221  H HB3  . LYS A 1 75  ? 37.210 42.545 1.889  1.00 0.00 ? 45 LYS A HB3  8  
ATOM 8222  H HG2  . LYS A 1 75  ? 35.328 44.030 2.341  1.00 0.00 ? 45 LYS A HG2  8  
ATOM 8223  H HG3  . LYS A 1 75  ? 36.364 45.101 3.285  1.00 0.00 ? 45 LYS A HG3  8  
ATOM 8224  H HD2  . LYS A 1 75  ? 36.132 46.065 1.082  1.00 0.00 ? 45 LYS A HD2  8  
ATOM 8225  H HD3  . LYS A 1 75  ? 37.771 45.431 1.221  1.00 0.00 ? 45 LYS A HD3  8  
ATOM 8226  H HE2  . LYS A 1 75  ? 35.648 43.622 0.129  1.00 0.00 ? 45 LYS A HE2  8  
ATOM 8227  H HE3  . LYS A 1 75  ? 36.279 44.897 -0.912 1.00 0.00 ? 45 LYS A HE3  8  
ATOM 8228  H HZ1  . LYS A 1 75  ? 37.513 42.464 -0.091 1.00 0.00 ? 45 LYS A HZ1  8  
ATOM 8229  H HZ2  . LYS A 1 75  ? 38.491 43.805 0.272  1.00 0.00 ? 45 LYS A HZ2  8  
ATOM 8230  H HZ3  . LYS A 1 75  ? 37.965 43.539 -1.322 1.00 0.00 ? 45 LYS A HZ3  8  
ATOM 8231  N N    . SER A 1 76  ? 35.477 40.656 3.765  1.00 0.00 ? 46 SER A N    8  
ATOM 8232  C CA   . SER A 1 76  ? 34.170 40.009 3.700  1.00 0.00 ? 46 SER A CA   8  
ATOM 8233  C C    . SER A 1 76  ? 34.254 38.554 4.148  1.00 0.00 ? 46 SER A C    8  
ATOM 8234  O O    . SER A 1 76  ? 35.298 37.914 4.024  1.00 0.00 ? 46 SER A O    8  
ATOM 8235  C CB   . SER A 1 76  ? 33.629 40.071 2.271  1.00 0.00 ? 46 SER A CB   8  
ATOM 8236  O OG   . SER A 1 76  ? 34.411 39.226 1.439  1.00 0.00 ? 46 SER A OG   8  
ATOM 8237  H H    . SER A 1 76  ? 36.288 40.119 3.655  1.00 0.00 ? 46 SER A H    8  
ATOM 8238  H HA   . SER A 1 76  ? 33.488 40.535 4.351  1.00 0.00 ? 46 SER A HA   8  
ATOM 8239  H HB2  . SER A 1 76  ? 32.606 39.734 2.253  1.00 0.00 ? 46 SER A HB2  8  
ATOM 8240  H HB3  . SER A 1 76  ? 33.674 41.093 1.917  1.00 0.00 ? 46 SER A HB3  8  
ATOM 8241  H HG   . SER A 1 76  ? 34.667 39.701 0.719  1.00 0.00 ? 46 SER A HG   8  
ATOM 8242  N N    . GLY A 1 77  ? 33.144 38.039 4.667  1.00 0.00 ? 47 GLY A N    8  
ATOM 8243  C CA   . GLY A 1 77  ? 33.081 36.644 5.087  1.00 0.00 ? 47 GLY A CA   8  
ATOM 8244  C C    . GLY A 1 77  ? 33.272 35.698 3.905  1.00 0.00 ? 47 GLY A C    8  
ATOM 8245  O O    . GLY A 1 77  ? 33.901 34.646 4.033  1.00 0.00 ? 47 GLY A O    8  
ATOM 8246  H H    . GLY A 1 77  ? 32.343 38.598 4.744  1.00 0.00 ? 47 GLY A H    8  
ATOM 8247  H HA2  . GLY A 1 77  ? 33.855 36.460 5.819  1.00 0.00 ? 47 GLY A HA2  8  
ATOM 8248  H HA3  . GLY A 1 77  ? 32.117 36.454 5.537  1.00 0.00 ? 47 GLY A HA3  8  
ATOM 8249  N N    . ALA A 1 78  ? 32.750 36.084 2.741  1.00 0.00 ? 48 ALA A N    8  
ATOM 8250  C CA   . ALA A 1 78  ? 32.854 35.236 1.559  1.00 0.00 ? 48 ALA A CA   8  
ATOM 8251  C C    . ALA A 1 78  ? 34.320 34.962 1.240  1.00 0.00 ? 48 ALA A C    8  
ATOM 8252  O O    . ALA A 1 78  ? 34.685 33.837 0.898  1.00 0.00 ? 48 ALA A O    8  
ATOM 8253  C CB   . ALA A 1 78  ? 32.186 35.918 0.363  1.00 0.00 ? 48 ALA A CB   8  
ATOM 8254  H H    . ALA A 1 78  ? 32.291 36.948 2.678  1.00 0.00 ? 48 ALA A H    8  
ATOM 8255  H HA   . ALA A 1 78  ? 32.354 34.299 1.752  1.00 0.00 ? 48 ALA A HA   8  
ATOM 8256  H HB1  . ALA A 1 78  ? 31.140 36.078 0.578  1.00 0.00 ? 48 ALA A HB1  8  
ATOM 8257  H HB2  . ALA A 1 78  ? 32.284 35.291 -0.510 1.00 0.00 ? 48 ALA A HB2  8  
ATOM 8258  H HB3  . ALA A 1 78  ? 32.664 36.869 0.179  1.00 0.00 ? 48 ALA A HB3  8  
ATOM 8259  N N    . GLU A 1 79  ? 35.155 35.992 1.350  1.00 0.00 ? 49 GLU A N    8  
ATOM 8260  C CA   . GLU A 1 79  ? 36.594 35.794 1.233  1.00 0.00 ? 49 GLU A CA   8  
ATOM 8261  C C    . GLU A 1 79  ? 37.104 34.868 2.339  1.00 0.00 ? 49 GLU A C    8  
ATOM 8262  O O    . GLU A 1 79  ? 37.921 33.986 2.085  1.00 0.00 ? 49 GLU A O    8  
ATOM 8263  C CB   . GLU A 1 79  ? 37.316 37.141 1.324  1.00 0.00 ? 49 GLU A CB   8  
ATOM 8264  C CG   . GLU A 1 79  ? 38.806 36.947 1.019  1.00 0.00 ? 49 GLU A CG   8  
ATOM 8265  C CD   . GLU A 1 79  ? 39.598 38.250 1.186  1.00 0.00 ? 49 GLU A CD   8  
ATOM 8266  O OE1  . GLU A 1 79  ? 39.019 39.262 1.554  1.00 0.00 ? 49 GLU A OE1  8  
ATOM 8267  O OE2  . GLU A 1 79  ? 40.793 38.213 0.941  1.00 0.00 ? 49 GLU A OE2  8  
ATOM 8268  H H    . GLU A 1 79  ? 34.800 36.891 1.512  1.00 0.00 ? 49 GLU A H    8  
ATOM 8269  H HA   . GLU A 1 79  ? 36.809 35.347 0.274  1.00 0.00 ? 49 GLU A HA   8  
ATOM 8270  H HB2  . GLU A 1 79  ? 36.886 37.827 0.608  1.00 0.00 ? 49 GLU A HB2  8  
ATOM 8271  H HB3  . GLU A 1 79  ? 37.204 37.542 2.320  1.00 0.00 ? 49 GLU A HB3  8  
ATOM 8272  H HG2  . GLU A 1 79  ? 39.208 36.204 1.691  1.00 0.00 ? 49 GLU A HG2  8  
ATOM 8273  H HG3  . GLU A 1 79  ? 38.912 36.597 0.003  1.00 0.00 ? 49 GLU A HG3  8  
ATOM 8274  N N    . ALA A 1 80  ? 36.530 34.988 3.536  1.00 0.00 ? 50 ALA A N    8  
ATOM 8275  C CA   . ALA A 1 80  ? 36.969 34.167 4.664  1.00 0.00 ? 50 ALA A CA   8  
ATOM 8276  C C    . ALA A 1 80  ? 36.780 32.678 4.376  1.00 0.00 ? 50 ALA A C    8  
ATOM 8277  O O    . ALA A 1 80  ? 37.614 31.855 4.751  1.00 0.00 ? 50 ALA A O    8  
ATOM 8278  C CB   . ALA A 1 80  ? 36.181 34.547 5.920  1.00 0.00 ? 50 ALA A CB   8  
ATOM 8279  H H    . ALA A 1 80  ? 35.807 35.639 3.666  1.00 0.00 ? 50 ALA A H    8  
ATOM 8280  H HA   . ALA A 1 80  ? 38.017 34.357 4.844  1.00 0.00 ? 50 ALA A HA   8  
ATOM 8281  H HB1  . ALA A 1 80  ? 35.270 33.970 5.961  1.00 0.00 ? 50 ALA A HB1  8  
ATOM 8282  H HB2  . ALA A 1 80  ? 35.939 35.600 5.889  1.00 0.00 ? 50 ALA A HB2  8  
ATOM 8283  H HB3  . ALA A 1 80  ? 36.778 34.340 6.795  1.00 0.00 ? 50 ALA A HB3  8  
ATOM 8284  N N    . LYS A 1 81  ? 35.727 32.344 3.635  1.00 0.00 ? 51 LYS A N    8  
ATOM 8285  C CA   . LYS A 1 81  ? 35.455 30.950 3.294  1.00 0.00 ? 51 LYS A CA   8  
ATOM 8286  C C    . LYS A 1 81  ? 36.634 30.303 2.561  1.00 0.00 ? 51 LYS A C    8  
ATOM 8287  O O    . LYS A 1 81  ? 36.818 29.088 2.642  1.00 0.00 ? 51 LYS A O    8  
ATOM 8288  C CB   . LYS A 1 81  ? 34.204 30.874 2.416  1.00 0.00 ? 51 LYS A CB   8  
ATOM 8289  C CG   . LYS A 1 81  ? 33.816 29.411 2.195  1.00 0.00 ? 51 LYS A CG   8  
ATOM 8290  C CD   . LYS A 1 81  ? 32.613 29.336 1.253  1.00 0.00 ? 51 LYS A CD   8  
ATOM 8291  C CE   . LYS A 1 81  ? 32.129 27.887 1.157  1.00 0.00 ? 51 LYS A CE   8  
ATOM 8292  N NZ   . LYS A 1 81  ? 30.791 27.852 0.503  1.00 0.00 ? 51 LYS A NZ   8  
ATOM 8293  H H    . LYS A 1 81  ? 35.096 33.043 3.362  1.00 0.00 ? 51 LYS A H    8  
ATOM 8294  H HA   . LYS A 1 81  ? 35.268 30.400 4.203  1.00 0.00 ? 51 LYS A HA   8  
ATOM 8295  H HB2  . LYS A 1 81  ? 33.391 31.393 2.903  1.00 0.00 ? 51 LYS A HB2  8  
ATOM 8296  H HB3  . LYS A 1 81  ? 34.406 31.337 1.462  1.00 0.00 ? 51 LYS A HB3  8  
ATOM 8297  H HG2  . LYS A 1 81  ? 34.649 28.879 1.759  1.00 0.00 ? 51 LYS A HG2  8  
ATOM 8298  H HG3  . LYS A 1 81  ? 33.557 28.960 3.141  1.00 0.00 ? 51 LYS A HG3  8  
ATOM 8299  H HD2  . LYS A 1 81  ? 31.817 29.957 1.638  1.00 0.00 ? 51 LYS A HD2  8  
ATOM 8300  H HD3  . LYS A 1 81  ? 32.900 29.683 0.273  1.00 0.00 ? 51 LYS A HD3  8  
ATOM 8301  H HE2  . LYS A 1 81  ? 32.830 27.312 0.570  1.00 0.00 ? 51 LYS A HE2  8  
ATOM 8302  H HE3  . LYS A 1 81  ? 32.058 27.465 2.148  1.00 0.00 ? 51 LYS A HE3  8  
ATOM 8303  H HZ1  . LYS A 1 81  ? 30.814 28.417 -0.369 1.00 0.00 ? 51 LYS A HZ1  8  
ATOM 8304  H HZ2  . LYS A 1 81  ? 30.079 28.246 1.153  1.00 0.00 ? 51 LYS A HZ2  8  
ATOM 8305  H HZ3  . LYS A 1 81  ? 30.542 26.869 0.272  1.00 0.00 ? 51 LYS A HZ3  8  
ATOM 8306  N N    . LYS A 1 82  ? 37.433 31.099 1.851  1.00 0.00 ? 52 LYS A N    8  
ATOM 8307  C CA   . LYS A 1 82  ? 38.567 30.560 1.104  1.00 0.00 ? 52 LYS A CA   8  
ATOM 8308  C C    . LYS A 1 82  ? 39.581 29.860 2.017  1.00 0.00 ? 52 LYS A C    8  
ATOM 8309  O O    . LYS A 1 82  ? 40.324 28.992 1.557  1.00 0.00 ? 52 LYS A O    8  
ATOM 8310  C CB   . LYS A 1 82  ? 39.259 31.695 0.345  1.00 0.00 ? 52 LYS A CB   8  
ATOM 8311  C CG   . LYS A 1 82  ? 40.342 31.122 -0.573 1.00 0.00 ? 52 LYS A CG   8  
ATOM 8312  C CD   . LYS A 1 82  ? 41.080 32.267 -1.269 1.00 0.00 ? 52 LYS A CD   8  
ATOM 8313  C CE   . LYS A 1 82  ? 42.053 31.696 -2.302 1.00 0.00 ? 52 LYS A CE   8  
ATOM 8314  N NZ   . LYS A 1 82  ? 41.286 31.120 -3.442 1.00 0.00 ? 52 LYS A NZ   8  
ATOM 8315  H H    . LYS A 1 82  ? 37.286 32.068 1.859  1.00 0.00 ? 52 LYS A H    8  
ATOM 8316  H HA   . LYS A 1 82  ? 38.198 29.845 0.386  1.00 0.00 ? 52 LYS A HA   8  
ATOM 8317  H HB2  . LYS A 1 82  ? 38.531 32.227 -0.247 1.00 0.00 ? 52 LYS A HB2  8  
ATOM 8318  H HB3  . LYS A 1 82  ? 39.714 32.373 1.051  1.00 0.00 ? 52 LYS A HB3  8  
ATOM 8319  H HG2  . LYS A 1 82  ? 41.043 30.545 0.012  1.00 0.00 ? 52 LYS A HG2  8  
ATOM 8320  H HG3  . LYS A 1 82  ? 39.885 30.487 -1.317 1.00 0.00 ? 52 LYS A HG3  8  
ATOM 8321  H HD2  . LYS A 1 82  ? 40.364 32.908 -1.763 1.00 0.00 ? 52 LYS A HD2  8  
ATOM 8322  H HD3  . LYS A 1 82  ? 41.632 32.838 -0.538 1.00 0.00 ? 52 LYS A HD3  8  
ATOM 8323  H HE2  . LYS A 1 82  ? 42.697 32.483 -2.663 1.00 0.00 ? 52 LYS A HE2  8  
ATOM 8324  H HE3  . LYS A 1 82  ? 42.652 30.923 -1.843 1.00 0.00 ? 52 LYS A HE3  8  
ATOM 8325  H HZ1  . LYS A 1 82  ? 41.939 30.878 -4.214 1.00 0.00 ? 52 LYS A HZ1  8  
ATOM 8326  H HZ2  . LYS A 1 82  ? 40.592 31.818 -3.781 1.00 0.00 ? 52 LYS A HZ2  8  
ATOM 8327  H HZ3  . LYS A 1 82  ? 40.791 30.261 -3.129 1.00 0.00 ? 52 LYS A HZ3  8  
ATOM 8328  N N    . LEU A 1 83  ? 39.611 30.217 3.303  1.00 0.00 ? 53 LEU A N    8  
ATOM 8329  C CA   . LEU A 1 83  ? 40.623 29.682 4.206  1.00 0.00 ? 53 LEU A CA   8  
ATOM 8330  C C    . LEU A 1 83  ? 40.173 28.343 4.803  1.00 0.00 ? 53 LEU A C    8  
ATOM 8331  O O    . LEU A 1 83  ? 38.998 28.203 5.158  1.00 0.00 ? 53 LEU A O    8  
ATOM 8332  C CB   . LEU A 1 83  ? 40.880 30.679 5.337  1.00 0.00 ? 53 LEU A CB   8  
ATOM 8333  C CG   . LEU A 1 83  ? 41.706 31.854 4.808  1.00 0.00 ? 53 LEU A CG   8  
ATOM 8334  C CD1  . LEU A 1 83  ? 41.486 33.076 5.703  1.00 0.00 ? 53 LEU A CD1  8  
ATOM 8335  C CD2  . LEU A 1 83  ? 43.189 31.478 4.816  1.00 0.00 ? 53 LEU A CD2  8  
ATOM 8336  H H    . LEU A 1 83  ? 38.935 30.835 3.653  1.00 0.00 ? 53 LEU A H    8  
ATOM 8337  H HA   . LEU A 1 83  ? 41.533 29.559 3.642  1.00 0.00 ? 53 LEU A HA   8  
ATOM 8338  H HB2  . LEU A 1 83  ? 39.936 31.042 5.716  1.00 0.00 ? 53 LEU A HB2  8  
ATOM 8339  H HB3  . LEU A 1 83  ? 41.423 30.190 6.130  1.00 0.00 ? 53 LEU A HB3  8  
ATOM 8340  H HG   . LEU A 1 83  ? 41.395 32.086 3.800  1.00 0.00 ? 53 LEU A HG   8  
ATOM 8341  H HD11 . LEU A 1 83  ? 41.852 33.960 5.202  1.00 0.00 ? 53 LEU A HD11 8  
ATOM 8342  H HD12 . LEU A 1 83  ? 42.019 32.942 6.633  1.00 0.00 ? 53 LEU A HD12 8  
ATOM 8343  H HD13 . LEU A 1 83  ? 40.432 33.188 5.906  1.00 0.00 ? 53 LEU A HD13 8  
ATOM 8344  H HD21 . LEU A 1 83  ? 43.555 31.479 5.832  1.00 0.00 ? 53 LEU A HD21 8  
ATOM 8345  H HD22 . LEU A 1 83  ? 43.745 32.197 4.232  1.00 0.00 ? 53 LEU A HD22 8  
ATOM 8346  H HD23 . LEU A 1 83  ? 43.312 30.494 4.388  1.00 0.00 ? 53 LEU A HD23 8  
ATOM 8347  N N    . PRO A 1 84  ? 41.058 27.378 4.978  1.00 0.00 ? 54 PRO A N    8  
ATOM 8348  C CA   . PRO A 1 84  ? 40.650 26.049 5.530  1.00 0.00 ? 54 PRO A CA   8  
ATOM 8349  C C    . PRO A 1 84  ? 40.002 26.187 6.905  1.00 0.00 ? 54 PRO A C    8  
ATOM 8350  O O    . PRO A 1 84  ? 40.555 26.825 7.803  1.00 0.00 ? 54 PRO A O    8  
ATOM 8351  C CB   . PRO A 1 84  ? 41.950 25.239 5.619  1.00 0.00 ? 54 PRO A CB   8  
ATOM 8352  C CG   . PRO A 1 84  ? 42.923 25.937 4.732  1.00 0.00 ? 54 PRO A CG   8  
ATOM 8353  C CD   . PRO A 1 84  ? 42.508 27.405 4.704  1.00 0.00 ? 54 PRO A CD   8  
ATOM 8354  H HA   . PRO A 1 84  ? 39.969 25.560 4.851  1.00 0.00 ? 54 PRO A HA   8  
ATOM 8355  H HB2  . PRO A 1 84  ? 42.317 25.222 6.635  1.00 0.00 ? 54 PRO A HB2  8  
ATOM 8356  H HB3  . PRO A 1 84  ? 41.789 24.234 5.261  1.00 0.00 ? 54 PRO A HB3  8  
ATOM 8357  H HG2  . PRO A 1 84  ? 43.923 25.835 5.130  1.00 0.00 ? 54 PRO A HG2  8  
ATOM 8358  H HG3  . PRO A 1 84  ? 42.875 25.531 3.734  1.00 0.00 ? 54 PRO A HG3  8  
ATOM 8359  H HD2  . PRO A 1 84  ? 43.035 27.960 5.469  1.00 0.00 ? 54 PRO A HD2  8  
ATOM 8360  H HD3  . PRO A 1 84  ? 42.694 27.827 3.730  1.00 0.00 ? 54 PRO A HD3  8  
ATOM 8361  N N    . GLY A 1 85  ? 38.836 25.571 7.064  1.00 0.00 ? 55 GLY A N    8  
ATOM 8362  C CA   . GLY A 1 85  ? 38.129 25.602 8.341  1.00 0.00 ? 55 GLY A CA   8  
ATOM 8363  C C    . GLY A 1 85  ? 36.979 26.615 8.374  1.00 0.00 ? 55 GLY A C    8  
ATOM 8364  O O    . GLY A 1 85  ? 36.170 26.582 9.302  1.00 0.00 ? 55 GLY A O    8  
ATOM 8365  H H    . GLY A 1 85  ? 38.441 25.088 6.308  1.00 0.00 ? 55 GLY A H    8  
ATOM 8366  H HA2  . GLY A 1 85  ? 37.728 24.619 8.538  1.00 0.00 ? 55 GLY A HA2  8  
ATOM 8367  H HA3  . GLY A 1 85  ? 38.832 25.851 9.123  1.00 0.00 ? 55 GLY A HA3  8  
ATOM 8368  N N    . VAL A 1 86  ? 36.892 27.507 7.383  1.00 0.00 ? 56 VAL A N    8  
ATOM 8369  C CA   . VAL A 1 86  ? 35.803 28.480 7.347  1.00 0.00 ? 56 VAL A CA   8  
ATOM 8370  C C    . VAL A 1 86  ? 34.622 27.915 6.558  1.00 0.00 ? 56 VAL A C    8  
ATOM 8371  O O    . VAL A 1 86  ? 34.801 27.350 5.479  1.00 0.00 ? 56 VAL A O    8  
ATOM 8372  C CB   . VAL A 1 86  ? 36.278 29.793 6.713  1.00 0.00 ? 56 VAL A CB   8  
ATOM 8373  C CG1  . VAL A 1 86  ? 35.159 30.835 6.784  1.00 0.00 ? 56 VAL A CG1  8  
ATOM 8374  C CG2  . VAL A 1 86  ? 37.499 30.325 7.467  1.00 0.00 ? 56 VAL A CG2  8  
ATOM 8375  H H    . VAL A 1 86  ? 37.574 27.522 6.676  1.00 0.00 ? 56 VAL A H    8  
ATOM 8376  H HA   . VAL A 1 86  ? 35.481 28.678 8.359  1.00 0.00 ? 56 VAL A HA   8  
ATOM 8377  H HB   . VAL A 1 86  ? 36.539 29.618 5.680  1.00 0.00 ? 56 VAL A HB   8  
ATOM 8378  H HG11 . VAL A 1 86  ? 34.864 30.976 7.814  1.00 0.00 ? 56 VAL A HG11 8  
ATOM 8379  H HG12 . VAL A 1 86  ? 34.310 30.492 6.211  1.00 0.00 ? 56 VAL A HG12 8  
ATOM 8380  H HG13 . VAL A 1 86  ? 35.512 31.772 6.380  1.00 0.00 ? 56 VAL A HG13 8  
ATOM 8381  H HG21 . VAL A 1 86  ? 37.913 31.168 6.934  1.00 0.00 ? 56 VAL A HG21 8  
ATOM 8382  H HG22 . VAL A 1 86  ? 38.244 29.546 7.542  1.00 0.00 ? 56 VAL A HG22 8  
ATOM 8383  H HG23 . VAL A 1 86  ? 37.204 30.636 8.459  1.00 0.00 ? 56 VAL A HG23 8  
ATOM 8384  N N    . GLY A 1 87  ? 33.418 28.074 7.102  1.00 0.00 ? 57 GLY A N    8  
ATOM 8385  C CA   . GLY A 1 87  ? 32.213 27.564 6.449  1.00 0.00 ? 57 GLY A CA   8  
ATOM 8386  C C    . GLY A 1 87  ? 31.288 28.704 6.033  1.00 0.00 ? 57 GLY A C    8  
ATOM 8387  O O    . GLY A 1 87  ? 31.497 29.857 6.409  1.00 0.00 ? 57 GLY A O    8  
ATOM 8388  H H    . GLY A 1 87  ? 33.337 28.542 7.958  1.00 0.00 ? 57 GLY A H    8  
ATOM 8389  H HA2  . GLY A 1 87  ? 32.490 26.995 5.573  1.00 0.00 ? 57 GLY A HA2  8  
ATOM 8390  H HA3  . GLY A 1 87  ? 31.685 26.920 7.136  1.00 0.00 ? 57 GLY A HA3  8  
ATOM 8391  N N    . THR A 1 88  ? 30.250 28.370 5.272  1.00 0.00 ? 58 THR A N    8  
ATOM 8392  C CA   . THR A 1 88  ? 29.319 29.384 4.789  1.00 0.00 ? 58 THR A CA   8  
ATOM 8393  C C    . THR A 1 88  ? 28.686 30.136 5.955  1.00 0.00 ? 58 THR A C    8  
ATOM 8394  O O    . THR A 1 88  ? 28.587 31.364 5.931  1.00 0.00 ? 58 THR A O    8  
ATOM 8395  C CB   . THR A 1 88  ? 28.223 28.727 3.946  1.00 0.00 ? 58 THR A CB   8  
ATOM 8396  O OG1  . THR A 1 88  ? 28.822 27.943 2.924  1.00 0.00 ? 58 THR A OG1  8  
ATOM 8397  C CG2  . THR A 1 88  ? 27.343 29.807 3.314  1.00 0.00 ? 58 THR A CG2  8  
ATOM 8398  H H    . THR A 1 88  ? 30.108 27.431 5.033  1.00 0.00 ? 58 THR A H    8  
ATOM 8399  H HA   . THR A 1 88  ? 29.858 30.087 4.171  1.00 0.00 ? 58 THR A HA   8  
ATOM 8400  H HB   . THR A 1 88  ? 27.614 28.095 4.575  1.00 0.00 ? 58 THR A HB   8  
ATOM 8401  H HG1  . THR A 1 88  ? 29.104 27.172 3.293  1.00 0.00 ? 58 THR A HG1  8  
ATOM 8402  H HG21 . THR A 1 88  ? 27.970 30.551 2.845  1.00 0.00 ? 58 THR A HG21 8  
ATOM 8403  H HG22 . THR A 1 88  ? 26.741 30.274 4.079  1.00 0.00 ? 58 THR A HG22 8  
ATOM 8404  H HG23 . THR A 1 88  ? 26.700 29.358 2.572  1.00 0.00 ? 58 THR A HG23 8  
ATOM 8405  N N    . LYS A 1 89  ? 28.290 29.402 6.991  1.00 0.00 ? 59 LYS A N    8  
ATOM 8406  C CA   . LYS A 1 89  ? 27.648 30.026 8.144  1.00 0.00 ? 59 LYS A CA   8  
ATOM 8407  C C    . LYS A 1 89  ? 28.591 31.034 8.796  1.00 0.00 ? 59 LYS A C    8  
ATOM 8408  O O    . LYS A 1 89  ? 28.188 32.146 9.142  1.00 0.00 ? 59 LYS A O    8  
ATOM 8409  C CB   . LYS A 1 89  ? 27.255 28.954 9.165  1.00 0.00 ? 59 LYS A CB   8  
ATOM 8410  C CG   . LYS A 1 89  ? 26.438 29.582 10.296 1.00 0.00 ? 59 LYS A CG   8  
ATOM 8411  C CD   . LYS A 1 89  ? 25.015 29.868 9.810  1.00 0.00 ? 59 LYS A CD   8  
ATOM 8412  C CE   . LYS A 1 89  ? 24.170 30.403 10.969 1.00 0.00 ? 59 LYS A CE   8  
ATOM 8413  N NZ   . LYS A 1 89  ? 22.734 30.102 10.717 1.00 0.00 ? 59 LYS A NZ   8  
ATOM 8414  H H    . LYS A 1 89  ? 28.430 28.433 6.981  1.00 0.00 ? 59 LYS A H    8  
ATOM 8415  H HA   . LYS A 1 89  ? 26.758 30.539 7.813  1.00 0.00 ? 59 LYS A HA   8  
ATOM 8416  H HB2  . LYS A 1 89  ? 26.665 28.193 8.675  1.00 0.00 ? 59 LYS A HB2  8  
ATOM 8417  H HB3  . LYS A 1 89  ? 28.147 28.506 9.575  1.00 0.00 ? 59 LYS A HB3  8  
ATOM 8418  H HG2  . LYS A 1 89  ? 26.402 28.900 11.133 1.00 0.00 ? 59 LYS A HG2  8  
ATOM 8419  H HG3  . LYS A 1 89  ? 26.901 30.508 10.605 1.00 0.00 ? 59 LYS A HG3  8  
ATOM 8420  H HD2  . LYS A 1 89  ? 25.044 30.602 9.019  1.00 0.00 ? 59 LYS A HD2  8  
ATOM 8421  H HD3  . LYS A 1 89  ? 24.572 28.956 9.438  1.00 0.00 ? 59 LYS A HD3  8  
ATOM 8422  H HE2  . LYS A 1 89  ? 24.480 29.932 11.890 1.00 0.00 ? 59 LYS A HE2  8  
ATOM 8423  H HE3  . LYS A 1 89  ? 24.305 31.472 11.048 1.00 0.00 ? 59 LYS A HE3  8  
ATOM 8424  H HZ1  . LYS A 1 89  ? 22.587 29.933 9.701  1.00 0.00 ? 59 LYS A HZ1  8  
ATOM 8425  H HZ2  . LYS A 1 89  ? 22.152 30.908 11.022 1.00 0.00 ? 59 LYS A HZ2  8  
ATOM 8426  H HZ3  . LYS A 1 89  ? 22.458 29.253 11.250 1.00 0.00 ? 59 LYS A HZ3  8  
ATOM 8427  N N    . ILE A 1 90  ? 29.865 30.668 8.900  1.00 0.00 ? 60 ILE A N    8  
ATOM 8428  C CA   . ILE A 1 90  ? 30.852 31.554 9.502  1.00 0.00 ? 60 ILE A CA   8  
ATOM 8429  C C    . ILE A 1 90  ? 31.013 32.809 8.646  1.00 0.00 ? 60 ILE A C    8  
ATOM 8430  O O    . ILE A 1 90  ? 31.057 33.924 9.168  1.00 0.00 ? 60 ILE A O    8  
ATOM 8431  C CB   . ILE A 1 90  ? 32.185 30.806 9.661  1.00 0.00 ? 60 ILE A CB   8  
ATOM 8432  C CG1  . ILE A 1 90  ? 31.962 29.599 10.581 1.00 0.00 ? 60 ILE A CG1  8  
ATOM 8433  C CG2  . ILE A 1 90  ? 33.240 31.730 10.280 1.00 0.00 ? 60 ILE A CG2  8  
ATOM 8434  C CD1  . ILE A 1 90  ? 33.187 28.677 10.574 1.00 0.00 ? 60 ILE A CD1  8  
ATOM 8435  H H    . ILE A 1 90  ? 30.143 29.789 8.567  1.00 0.00 ? 60 ILE A H    8  
ATOM 8436  H HA   . ILE A 1 90  ? 30.502 31.846 10.482 1.00 0.00 ? 60 ILE A HA   8  
ATOM 8437  H HB   . ILE A 1 90  ? 32.526 30.466 8.693  1.00 0.00 ? 60 ILE A HB   8  
ATOM 8438  H HG12 . ILE A 1 90  ? 31.785 29.949 11.587 1.00 0.00 ? 60 ILE A HG12 8  
ATOM 8439  H HG13 . ILE A 1 90  ? 31.101 29.045 10.239 1.00 0.00 ? 60 ILE A HG13 8  
ATOM 8440  H HG21 . ILE A 1 90  ? 33.580 32.436 9.537  1.00 0.00 ? 60 ILE A HG21 8  
ATOM 8441  H HG22 . ILE A 1 90  ? 34.077 31.142 10.626 1.00 0.00 ? 60 ILE A HG22 8  
ATOM 8442  H HG23 . ILE A 1 90  ? 32.806 32.265 11.111 1.00 0.00 ? 60 ILE A HG23 8  
ATOM 8443  H HD11 . ILE A 1 90  ? 33.265 28.176 11.530 1.00 0.00 ? 60 ILE A HD11 8  
ATOM 8444  H HD12 . ILE A 1 90  ? 34.081 29.257 10.399 1.00 0.00 ? 60 ILE A HD12 8  
ATOM 8445  H HD13 . ILE A 1 90  ? 33.078 27.941 9.792  1.00 0.00 ? 60 ILE A HD13 8  
ATOM 8446  N N    . ALA A 1 91  ? 31.050 32.631 7.329  1.00 0.00 ? 61 ALA A N    8  
ATOM 8447  C CA   . ALA A 1 91  ? 31.160 33.769 6.424  1.00 0.00 ? 61 ALA A CA   8  
ATOM 8448  C C    . ALA A 1 91  ? 29.986 34.723 6.627  1.00 0.00 ? 61 ALA A C    8  
ATOM 8449  O O    . ALA A 1 91  ? 30.164 35.941 6.651  1.00 0.00 ? 61 ALA A O    8  
ATOM 8450  C CB   . ALA A 1 91  ? 31.181 33.283 4.973  1.00 0.00 ? 61 ALA A CB   8  
ATOM 8451  H H    . ALA A 1 91  ? 31.032 31.721 6.964  1.00 0.00 ? 61 ALA A H    8  
ATOM 8452  H HA   . ALA A 1 91  ? 32.079 34.295 6.630  1.00 0.00 ? 61 ALA A HA   8  
ATOM 8453  H HB1  . ALA A 1 91  ? 30.859 34.084 4.322  1.00 0.00 ? 61 ALA A HB1  8  
ATOM 8454  H HB2  . ALA A 1 91  ? 30.515 32.441 4.865  1.00 0.00 ? 61 ALA A HB2  8  
ATOM 8455  H HB3  . ALA A 1 91  ? 32.184 32.986 4.708  1.00 0.00 ? 61 ALA A HB3  8  
ATOM 8456  N N    . GLU A 1 92  ? 28.790 34.168 6.806  1.00 0.00 ? 62 GLU A N    8  
ATOM 8457  C CA   . GLU A 1 92  ? 27.605 34.997 7.007  1.00 0.00 ? 62 GLU A CA   8  
ATOM 8458  C C    . GLU A 1 92  ? 27.731 35.836 8.278  1.00 0.00 ? 62 GLU A C    8  
ATOM 8459  O O    . GLU A 1 92  ? 27.412 37.026 8.269  1.00 0.00 ? 62 GLU A O    8  
ATOM 8460  C CB   . GLU A 1 92  ? 26.360 34.113 7.100  1.00 0.00 ? 62 GLU A CB   8  
ATOM 8461  C CG   . GLU A 1 92  ? 25.106 34.996 7.123  1.00 0.00 ? 62 GLU A CG   8  
ATOM 8462  C CD   . GLU A 1 92  ? 23.827 34.171 7.303  1.00 0.00 ? 62 GLU A CD   8  
ATOM 8463  O OE1  . GLU A 1 92  ? 22.767 34.774 7.308  1.00 0.00 ? 62 GLU A OE1  8  
ATOM 8464  O OE2  . GLU A 1 92  ? 23.909 32.957 7.437  1.00 0.00 ? 62 GLU A OE2  8  
ATOM 8465  H H    . GLU A 1 92  ? 28.697 33.193 6.762  1.00 0.00 ? 62 GLU A H    8  
ATOM 8466  H HA   . GLU A 1 92  ? 27.496 35.660 6.162  1.00 0.00 ? 62 GLU A HA   8  
ATOM 8467  H HB2  . GLU A 1 92  ? 26.324 33.453 6.245  1.00 0.00 ? 62 GLU A HB2  8  
ATOM 8468  H HB3  . GLU A 1 92  ? 26.400 33.528 8.007  1.00 0.00 ? 62 GLU A HB3  8  
ATOM 8469  H HG2  . GLU A 1 92  ? 25.186 35.699 7.938  1.00 0.00 ? 62 GLU A HG2  8  
ATOM 8470  H HG3  . GLU A 1 92  ? 25.046 35.542 6.193  1.00 0.00 ? 62 GLU A HG3  8  
ATOM 8471  N N    . LYS A 1 93  ? 28.227 35.231 9.357  1.00 0.00 ? 63 LYS A N    8  
ATOM 8472  C CA   . LYS A 1 93  ? 28.433 35.982 10.596 1.00 0.00 ? 63 LYS A CA   8  
ATOM 8473  C C    . LYS A 1 93  ? 29.420 37.126 10.377 1.00 0.00 ? 63 LYS A C    8  
ATOM 8474  O O    . LYS A 1 93  ? 29.203 38.241 10.854 1.00 0.00 ? 63 LYS A O    8  
ATOM 8475  C CB   . LYS A 1 93  ? 28.959 35.061 11.700 1.00 0.00 ? 63 LYS A CB   8  
ATOM 8476  C CG   . LYS A 1 93  ? 27.974 33.916 11.954 1.00 0.00 ? 63 LYS A CG   8  
ATOM 8477  C CD   . LYS A 1 93  ? 26.658 34.470 12.506 1.00 0.00 ? 63 LYS A CD   8  
ATOM 8478  C CE   . LYS A 1 93  ? 25.772 33.310 12.964 1.00 0.00 ? 63 LYS A CE   8  
ATOM 8479  N NZ   . LYS A 1 93  ? 24.417 33.827 13.312 1.00 0.00 ? 63 LYS A NZ   8  
ATOM 8480  H H    . LYS A 1 93  ? 28.417 34.269 9.331  1.00 0.00 ? 63 LYS A H    8  
ATOM 8481  H HA   . LYS A 1 93  ? 27.489 36.399 10.912 1.00 0.00 ? 63 LYS A HA   8  
ATOM 8482  H HB2  . LYS A 1 93  ? 29.913 34.651 11.400 1.00 0.00 ? 63 LYS A HB2  8  
ATOM 8483  H HB3  . LYS A 1 93  ? 29.084 35.629 12.609 1.00 0.00 ? 63 LYS A HB3  8  
ATOM 8484  H HG2  . LYS A 1 93  ? 27.782 33.397 11.028 1.00 0.00 ? 63 LYS A HG2  8  
ATOM 8485  H HG3  . LYS A 1 93  ? 28.399 33.229 12.671 1.00 0.00 ? 63 LYS A HG3  8  
ATOM 8486  H HD2  . LYS A 1 93  ? 26.862 35.121 13.343 1.00 0.00 ? 63 LYS A HD2  8  
ATOM 8487  H HD3  . LYS A 1 93  ? 26.145 35.023 11.735 1.00 0.00 ? 63 LYS A HD3  8  
ATOM 8488  H HE2  . LYS A 1 93  ? 25.687 32.587 12.167 1.00 0.00 ? 63 LYS A HE2  8  
ATOM 8489  H HE3  . LYS A 1 93  ? 26.212 32.841 13.831 1.00 0.00 ? 63 LYS A HE3  8  
ATOM 8490  H HZ1  . LYS A 1 93  ? 24.486 34.830 13.576 1.00 0.00 ? 63 LYS A HZ1  8  
ATOM 8491  H HZ2  . LYS A 1 93  ? 24.034 33.282 14.111 1.00 0.00 ? 63 LYS A HZ2  8  
ATOM 8492  H HZ3  . LYS A 1 93  ? 23.787 33.731 12.491 1.00 0.00 ? 63 LYS A HZ3  8  
ATOM 8493  N N    . ILE A 1 94  ? 30.483 36.861 9.624  1.00 0.00 ? 64 ILE A N    8  
ATOM 8494  C CA   . ILE A 1 94  ? 31.461 37.903 9.317  1.00 0.00 ? 64 ILE A CA   8  
ATOM 8495  C C    . ILE A 1 94  ? 30.788 39.042 8.549  1.00 0.00 ? 64 ILE A C    8  
ATOM 8496  O O    . ILE A 1 94  ? 31.005 40.217 8.853  1.00 0.00 ? 64 ILE A O    8  
ATOM 8497  C CB   . ILE A 1 94  ? 32.615 37.298 8.502  1.00 0.00 ? 64 ILE A CB   8  
ATOM 8498  C CG1  . ILE A 1 94  ? 33.297 36.212 9.340  1.00 0.00 ? 64 ILE A CG1  8  
ATOM 8499  C CG2  . ILE A 1 94  ? 33.650 38.372 8.146  1.00 0.00 ? 64 ILE A CG2  8  
ATOM 8500  C CD1  . ILE A 1 94  ? 34.227 35.376 8.456  1.00 0.00 ? 64 ILE A CD1  8  
ATOM 8501  H H    . ILE A 1 94  ? 30.630 35.948 9.299  1.00 0.00 ? 64 ILE A H    8  
ATOM 8502  H HA   . ILE A 1 94  ? 31.854 38.293 10.244 1.00 0.00 ? 64 ILE A HA   8  
ATOM 8503  H HB   . ILE A 1 94  ? 32.225 36.860 7.596  1.00 0.00 ? 64 ILE A HB   8  
ATOM 8504  H HG12 . ILE A 1 94  ? 33.874 36.677 10.125 1.00 0.00 ? 64 ILE A HG12 8  
ATOM 8505  H HG13 . ILE A 1 94  ? 32.549 35.571 9.778  1.00 0.00 ? 64 ILE A HG13 8  
ATOM 8506  H HG21 . ILE A 1 94  ? 34.382 37.954 7.469  1.00 0.00 ? 64 ILE A HG21 8  
ATOM 8507  H HG22 . ILE A 1 94  ? 34.143 38.711 9.045  1.00 0.00 ? 64 ILE A HG22 8  
ATOM 8508  H HG23 . ILE A 1 94  ? 33.155 39.206 7.669  1.00 0.00 ? 64 ILE A HG23 8  
ATOM 8509  H HD11 . ILE A 1 94  ? 33.659 34.589 7.982  1.00 0.00 ? 64 ILE A HD11 8  
ATOM 8510  H HD12 . ILE A 1 94  ? 35.005 34.941 9.064  1.00 0.00 ? 64 ILE A HD12 8  
ATOM 8511  H HD13 . ILE A 1 94  ? 34.672 36.005 7.699  1.00 0.00 ? 64 ILE A HD13 8  
ATOM 8512  N N    . ASP A 1 95  ? 29.942 38.693 7.584  1.00 0.00 ? 65 ASP A N    8  
ATOM 8513  C CA   . ASP A 1 95  ? 29.245 39.707 6.798  1.00 0.00 ? 65 ASP A CA   8  
ATOM 8514  C C    . ASP A 1 95  ? 28.383 40.587 7.697  1.00 0.00 ? 65 ASP A C    8  
ATOM 8515  O O    . ASP A 1 95  ? 28.381 41.811 7.560  1.00 0.00 ? 65 ASP A O    8  
ATOM 8516  C CB   . ASP A 1 95  ? 28.357 39.038 5.743  1.00 0.00 ? 65 ASP A CB   8  
ATOM 8517  C CG   . ASP A 1 95  ? 29.197 38.289 4.708  1.00 0.00 ? 65 ASP A CG   8  
ATOM 8518  O OD1  . ASP A 1 95  ? 30.362 38.619 4.547  1.00 0.00 ? 65 ASP A OD1  8  
ATOM 8519  O OD2  . ASP A 1 95  ? 28.658 37.391 4.083  1.00 0.00 ? 65 ASP A OD2  8  
ATOM 8520  H H    . ASP A 1 95  ? 29.813 37.745 7.375  1.00 0.00 ? 65 ASP A H    8  
ATOM 8521  H HA   . ASP A 1 95  ? 29.974 40.325 6.298  1.00 0.00 ? 65 ASP A HA   8  
ATOM 8522  H HB2  . ASP A 1 95  ? 27.693 38.340 6.230  1.00 0.00 ? 65 ASP A HB2  8  
ATOM 8523  H HB3  . ASP A 1 95  ? 27.770 39.795 5.245  1.00 0.00 ? 65 ASP A HB3  8  
ATOM 8524  N N    . GLU A 1 96  ? 27.681 39.967 8.641  1.00 0.00 ? 66 GLU A N    8  
ATOM 8525  C CA   . GLU A 1 96  ? 26.818 40.722 9.543  1.00 0.00 ? 66 GLU A CA   8  
ATOM 8526  C C    . GLU A 1 96  ? 27.637 41.694 10.389 1.00 0.00 ? 66 GLU A C    8  
ATOM 8527  O O    . GLU A 1 96  ? 27.277 42.865 10.521 1.00 0.00 ? 66 GLU A O    8  
ATOM 8528  C CB   . GLU A 1 96  ? 26.057 39.762 10.461 1.00 0.00 ? 66 GLU A CB   8  
ATOM 8529  C CG   . GLU A 1 96  ? 25.021 40.545 11.277 1.00 0.00 ? 66 GLU A CG   8  
ATOM 8530  C CD   . GLU A 1 96  ? 24.288 39.650 12.282 1.00 0.00 ? 66 GLU A CD   8  
ATOM 8531  O OE1  . GLU A 1 96  ? 24.591 38.467 12.365 1.00 0.00 ? 66 GLU A OE1  8  
ATOM 8532  O OE2  . GLU A 1 96  ? 23.419 40.169 12.965 1.00 0.00 ? 66 GLU A OE2  8  
ATOM 8533  H H    . GLU A 1 96  ? 27.715 38.990 8.707  1.00 0.00 ? 66 GLU A H    8  
ATOM 8534  H HA   . GLU A 1 96  ? 26.104 41.283 8.959  1.00 0.00 ? 66 GLU A HA   8  
ATOM 8535  H HB2  . GLU A 1 96  ? 25.556 39.016 9.863  1.00 0.00 ? 66 GLU A HB2  8  
ATOM 8536  H HB3  . GLU A 1 96  ? 26.750 39.281 11.133 1.00 0.00 ? 66 GLU A HB3  8  
ATOM 8537  H HG2  . GLU A 1 96  ? 25.522 41.336 11.814 1.00 0.00 ? 66 GLU A HG2  8  
ATOM 8538  H HG3  . GLU A 1 96  ? 24.300 40.982 10.601 1.00 0.00 ? 66 GLU A HG3  8  
ATOM 8539  N N    . PHE A 1 97  ? 28.757 41.220 10.928 1.00 0.00 ? 67 PHE A N    8  
ATOM 8540  C CA   . PHE A 1 97  ? 29.604 42.077 11.751 1.00 0.00 ? 67 PHE A CA   8  
ATOM 8541  C C    . PHE A 1 97  ? 30.101 43.283 10.958 1.00 0.00 ? 67 PHE A C    8  
ATOM 8542  O O    . PHE A 1 97  ? 30.152 44.394 11.486 1.00 0.00 ? 67 PHE A O    8  
ATOM 8543  C CB   . PHE A 1 97  ? 30.793 41.274 12.279 1.00 0.00 ? 67 PHE A CB   8  
ATOM 8544  C CG   . PHE A 1 97  ? 31.743 42.080 13.134 1.00 0.00 ? 67 PHE A CG   8  
ATOM 8545  C CD1  . PHE A 1 97  ? 33.000 42.439 12.633 1.00 0.00 ? 67 PHE A CD1  8  
ATOM 8546  C CD2  . PHE A 1 97  ? 31.367 42.472 14.424 1.00 0.00 ? 67 PHE A CD2  8  
ATOM 8547  C CE1  . PHE A 1 97  ? 33.881 43.188 13.423 1.00 0.00 ? 67 PHE A CE1  8  
ATOM 8548  C CE2  . PHE A 1 97  ? 32.247 43.221 15.214 1.00 0.00 ? 67 PHE A CE2  8  
ATOM 8549  C CZ   . PHE A 1 97  ? 33.505 43.579 14.714 1.00 0.00 ? 67 PHE A CZ   8  
ATOM 8550  H H    . PHE A 1 97  ? 29.000 40.279 10.797 1.00 0.00 ? 67 PHE A H    8  
ATOM 8551  H HA   . PHE A 1 97  ? 29.026 42.431 12.592 1.00 0.00 ? 67 PHE A HA   8  
ATOM 8552  H HB2  . PHE A 1 97  ? 30.414 40.458 12.872 1.00 0.00 ? 67 PHE A HB2  8  
ATOM 8553  H HB3  . PHE A 1 97  ? 31.334 40.866 11.438 1.00 0.00 ? 67 PHE A HB3  8  
ATOM 8554  H HD1  . PHE A 1 97  ? 33.293 42.135 11.638 1.00 0.00 ? 67 PHE A HD1  8  
ATOM 8555  H HD2  . PHE A 1 97  ? 30.397 42.195 14.810 1.00 0.00 ? 67 PHE A HD2  8  
ATOM 8556  H HE1  . PHE A 1 97  ? 34.852 43.466 13.036 1.00 0.00 ? 67 PHE A HE1  8  
ATOM 8557  H HE2  . PHE A 1 97  ? 31.957 43.521 16.210 1.00 0.00 ? 67 PHE A HE2  8  
ATOM 8558  H HZ   . PHE A 1 97  ? 34.183 44.158 15.323 1.00 0.00 ? 67 PHE A HZ   8  
ATOM 8559  N N    . LEU A 1 98  ? 30.476 43.067 9.699  1.00 0.00 ? 68 LEU A N    8  
ATOM 8560  C CA   . LEU A 1 98  ? 30.865 44.181 8.838  1.00 0.00 ? 68 LEU A CA   8  
ATOM 8561  C C    . LEU A 1 98  ? 29.689 45.123 8.597  1.00 0.00 ? 68 LEU A C    8  
ATOM 8562  O O    . LEU A 1 98  ? 29.859 46.342 8.561  1.00 0.00 ? 68 LEU A O    8  
ATOM 8563  C CB   . LEU A 1 98  ? 31.389 43.657 7.498  1.00 0.00 ? 68 LEU A CB   8  
ATOM 8564  C CG   . LEU A 1 98  ? 32.631 42.787 7.719  1.00 0.00 ? 68 LEU A CG   8  
ATOM 8565  C CD1  . LEU A 1 98  ? 33.060 42.159 6.389  1.00 0.00 ? 68 LEU A CD1  8  
ATOM 8566  C CD2  . LEU A 1 98  ? 33.774 43.650 8.263  1.00 0.00 ? 68 LEU A CD2  8  
ATOM 8567  H H    . LEU A 1 98  ? 30.517 42.149 9.355  1.00 0.00 ? 68 LEU A H    8  
ATOM 8568  H HA   . LEU A 1 98  ? 31.650 44.736 9.327  1.00 0.00 ? 68 LEU A HA   8  
ATOM 8569  H HB2  . LEU A 1 98  ? 30.620 43.069 7.019  1.00 0.00 ? 68 LEU A HB2  8  
ATOM 8570  H HB3  . LEU A 1 98  ? 31.647 44.492 6.865  1.00 0.00 ? 68 LEU A HB3  8  
ATOM 8571  H HG   . LEU A 1 98  ? 32.399 42.005 8.427  1.00 0.00 ? 68 LEU A HG   8  
ATOM 8572  H HD11 . LEU A 1 98  ? 32.508 41.244 6.229  1.00 0.00 ? 68 LEU A HD11 8  
ATOM 8573  H HD12 . LEU A 1 98  ? 34.118 41.940 6.411  1.00 0.00 ? 68 LEU A HD12 8  
ATOM 8574  H HD13 . LEU A 1 98  ? 32.855 42.847 5.581  1.00 0.00 ? 68 LEU A HD13 8  
ATOM 8575  H HD21 . LEU A 1 98  ? 34.718 43.172 8.049  1.00 0.00 ? 68 LEU A HD21 8  
ATOM 8576  H HD22 . LEU A 1 98  ? 33.662 43.765 9.330  1.00 0.00 ? 68 LEU A HD22 8  
ATOM 8577  H HD23 . LEU A 1 98  ? 33.748 44.621 7.792  1.00 0.00 ? 68 LEU A HD23 8  
ATOM 8578  N N    . ALA A 1 99  ? 28.495 44.559 8.433  1.00 0.00 ? 69 ALA A N    8  
ATOM 8579  C CA   . ALA A 1 99  ? 27.300 45.371 8.219  1.00 0.00 ? 69 ALA A CA   8  
ATOM 8580  C C    . ALA A 1 99  ? 27.015 46.283 9.412  1.00 0.00 ? 69 ALA A C    8  
ATOM 8581  O O    . ALA A 1 99  ? 26.517 47.396 9.243  1.00 0.00 ? 69 ALA A O    8  
ATOM 8582  C CB   . ALA A 1 99  ? 26.095 44.462 7.976  1.00 0.00 ? 69 ALA A CB   8  
ATOM 8583  H H    . ALA A 1 99  ? 28.422 43.582 8.414  1.00 0.00 ? 69 ALA A H    8  
ATOM 8584  H HA   . ALA A 1 99  ? 27.451 45.983 7.343  1.00 0.00 ? 69 ALA A HA   8  
ATOM 8585  H HB1  . ALA A 1 99  ? 25.761 44.048 8.916  1.00 0.00 ? 69 ALA A HB1  8  
ATOM 8586  H HB2  . ALA A 1 99  ? 26.377 43.660 7.310  1.00 0.00 ? 69 ALA A HB2  8  
ATOM 8587  H HB3  . ALA A 1 99  ? 25.295 45.035 7.531  1.00 0.00 ? 69 ALA A HB3  8  
ATOM 8588  N N    . THR A 1 100 ? 27.330 45.814 10.616 1.00 0.00 ? 70 THR A N    8  
ATOM 8589  C CA   . THR A 1 100 ? 27.165 46.638 11.813 1.00 0.00 ? 70 THR A CA   8  
ATOM 8590  C C    . THR A 1 100 ? 28.250 47.714 11.939 1.00 0.00 ? 70 THR A C    8  
ATOM 8591  O O    . THR A 1 100 ? 28.052 48.709 12.637 1.00 0.00 ? 70 THR A O    8  
ATOM 8592  C CB   . THR A 1 100 ? 27.186 45.755 13.064 1.00 0.00 ? 70 THR A CB   8  
ATOM 8593  O OG1  . THR A 1 100 ? 28.450 45.116 13.170 1.00 0.00 ? 70 THR A OG1  8  
ATOM 8594  C CG2  . THR A 1 100 ? 26.082 44.698 12.971 1.00 0.00 ? 70 THR A CG2  8  
ATOM 8595  H H    . THR A 1 100 ? 27.629 44.885 10.705 1.00 0.00 ? 70 THR A H    8  
ATOM 8596  H HA   . THR A 1 100 ? 26.204 47.126 11.761 1.00 0.00 ? 70 THR A HA   8  
ATOM 8597  H HB   . THR A 1 100 ? 27.017 46.366 13.938 1.00 0.00 ? 70 THR A HB   8  
ATOM 8598  H HG1  . THR A 1 100 ? 29.050 45.731 13.441 1.00 0.00 ? 70 THR A HG1  8  
ATOM 8599  H HG21 . THR A 1 100 ? 26.215 43.969 13.757 1.00 0.00 ? 70 THR A HG21 8  
ATOM 8600  H HG22 . THR A 1 100 ? 26.134 44.207 12.011 1.00 0.00 ? 70 THR A HG22 8  
ATOM 8601  H HG23 . THR A 1 100 ? 25.118 45.174 13.080 1.00 0.00 ? 70 THR A HG23 8  
ATOM 8602  N N    . GLY A 1 101 ? 29.389 47.526 11.272 1.00 0.00 ? 71 GLY A N    8  
ATOM 8603  C CA   . GLY A 1 101 ? 30.471 48.501 11.334 1.00 0.00 ? 71 GLY A CA   8  
ATOM 8604  C C    . GLY A 1 101 ? 31.001 48.638 12.756 1.00 0.00 ? 71 GLY A C    8  
ATOM 8605  O O    . GLY A 1 101 ? 31.252 47.643 13.434 1.00 0.00 ? 71 GLY A O    8  
ATOM 8606  H H    . GLY A 1 101 ? 29.501 46.716 10.731 1.00 0.00 ? 71 GLY A H    8  
ATOM 8607  H HA2  . GLY A 1 101 ? 31.273 48.182 10.683 1.00 0.00 ? 71 GLY A HA2  8  
ATOM 8608  H HA3  . GLY A 1 101 ? 30.104 49.460 11.002 1.00 0.00 ? 71 GLY A HA3  8  
ATOM 8609  N N    . GLU A 1 31  ? 47.622 43.105 18.473 1.00 0.00 ? 1  GLU A N    9  
ATOM 8610  C CA   . GLU A 1 31  ? 46.371 42.394 18.241 1.00 0.00 ? 1  GLU A CA   9  
ATOM 8611  C C    . GLU A 1 31  ? 46.186 42.100 16.756 1.00 0.00 ? 1  GLU A C    9  
ATOM 8612  O O    . GLU A 1 31  ? 46.249 43.005 15.924 1.00 0.00 ? 1  GLU A O    9  
ATOM 8613  C CB   . GLU A 1 31  ? 45.192 43.228 18.750 1.00 0.00 ? 1  GLU A CB   9  
ATOM 8614  C CG   . GLU A 1 31  ? 45.323 43.432 20.263 1.00 0.00 ? 1  GLU A CG   9  
ATOM 8615  C CD   . GLU A 1 31  ? 44.123 44.191 20.839 1.00 0.00 ? 1  GLU A CD   9  
ATOM 8616  O OE1  . GLU A 1 31  ? 43.321 44.710 20.077 1.00 0.00 ? 1  GLU A OE1  9  
ATOM 8617  O OE2  . GLU A 1 31  ? 44.023 44.242 22.054 1.00 0.00 ? 1  GLU A OE2  9  
ATOM 8618  H H    . GLU A 1 31  ? 47.611 44.066 18.665 1.00 0.00 ? 1  GLU A H    9  
ATOM 8619  H HA   . GLU A 1 31  ? 46.394 41.459 18.782 1.00 0.00 ? 1  GLU A HA   9  
ATOM 8620  H HB2  . GLU A 1 31  ? 45.192 44.187 18.253 1.00 0.00 ? 1  GLU A HB2  9  
ATOM 8621  H HB3  . GLU A 1 31  ? 44.268 42.713 18.537 1.00 0.00 ? 1  GLU A HB3  9  
ATOM 8622  H HG2  . GLU A 1 31  ? 45.392 42.469 20.743 1.00 0.00 ? 1  GLU A HG2  9  
ATOM 8623  H HG3  . GLU A 1 31  ? 46.225 43.991 20.465 1.00 0.00 ? 1  GLU A HG3  9  
ATOM 8624  N N    . THR A 1 32  ? 45.957 40.832 16.431 1.00 0.00 ? 2  THR A N    9  
ATOM 8625  C CA   . THR A 1 32  ? 45.757 40.434 15.042 1.00 0.00 ? 2  THR A CA   9  
ATOM 8626  C C    . THR A 1 32  ? 44.573 41.184 14.442 1.00 0.00 ? 2  THR A C    9  
ATOM 8627  O O    . THR A 1 32  ? 43.551 41.379 15.099 1.00 0.00 ? 2  THR A O    9  
ATOM 8628  C CB   . THR A 1 32  ? 45.510 38.926 14.965 1.00 0.00 ? 2  THR A CB   9  
ATOM 8629  O OG1  . THR A 1 32  ? 46.562 38.244 15.630 1.00 0.00 ? 2  THR A OG1  9  
ATOM 8630  C CG2  . THR A 1 32  ? 45.459 38.487 13.500 1.00 0.00 ? 2  THR A CG2  9  
ATOM 8631  H H    . THR A 1 32  ? 45.922 40.153 17.136 1.00 0.00 ? 2  THR A H    9  
ATOM 8632  H HA   . THR A 1 32  ? 46.646 40.672 14.478 1.00 0.00 ? 2  THR A HA   9  
ATOM 8633  H HB   . THR A 1 32  ? 44.569 38.690 15.440 1.00 0.00 ? 2  THR A HB   9  
ATOM 8634  H HG1  . THR A 1 32  ? 47.332 38.673 15.447 1.00 0.00 ? 2  THR A HG1  9  
ATOM 8635  H HG21 . THR A 1 32  ? 44.459 38.625 13.117 1.00 0.00 ? 2  THR A HG21 9  
ATOM 8636  H HG22 . THR A 1 32  ? 45.729 37.443 13.428 1.00 0.00 ? 2  THR A HG22 9  
ATOM 8637  H HG23 . THR A 1 32  ? 46.152 39.079 12.921 1.00 0.00 ? 2  THR A HG23 9  
ATOM 8638  N N    . LEU A 1 33  ? 44.689 41.551 13.171 1.00 0.00 ? 3  LEU A N    9  
ATOM 8639  C CA   . LEU A 1 33  ? 43.665 42.372 12.530 1.00 0.00 ? 3  LEU A CA   9  
ATOM 8640  C C    . LEU A 1 33  ? 42.285 41.712 12.572 1.00 0.00 ? 3  LEU A C    9  
ATOM 8641  O O    . LEU A 1 33  ? 41.267 42.402 12.614 1.00 0.00 ? 3  LEU A O    9  
ATOM 8642  C CB   . LEU A 1 33  ? 44.049 42.615 11.071 1.00 0.00 ? 3  LEU A CB   9  
ATOM 8643  C CG   . LEU A 1 33  ? 45.404 43.320 10.999 1.00 0.00 ? 3  LEU A CG   9  
ATOM 8644  C CD1  . LEU A 1 33  ? 45.888 43.350 9.547  1.00 0.00 ? 3  LEU A CD1  9  
ATOM 8645  C CD2  . LEU A 1 33  ? 45.257 44.755 11.507 1.00 0.00 ? 3  LEU A CD2  9  
ATOM 8646  H H    . LEU A 1 33  ? 45.472 41.267 12.656 1.00 0.00 ? 3  LEU A H    9  
ATOM 8647  H HA   . LEU A 1 33  ? 43.612 43.325 13.035 1.00 0.00 ? 3  LEU A HA   9  
ATOM 8648  H HB2  . LEU A 1 33  ? 44.106 41.669 10.552 1.00 0.00 ? 3  LEU A HB2  9  
ATOM 8649  H HB3  . LEU A 1 33  ? 43.299 43.235 10.606 1.00 0.00 ? 3  LEU A HB3  9  
ATOM 8650  H HG   . LEU A 1 33  ? 46.121 42.790 11.608 1.00 0.00 ? 3  LEU A HG   9  
ATOM 8651  H HD11 . LEU A 1 33  ? 46.902 43.717 9.512  1.00 0.00 ? 3  LEU A HD11 9  
ATOM 8652  H HD12 . LEU A 1 33  ? 45.249 44.001 8.968  1.00 0.00 ? 3  LEU A HD12 9  
ATOM 8653  H HD13 . LEU A 1 33  ? 45.852 42.352 9.136  1.00 0.00 ? 3  LEU A HD13 9  
ATOM 8654  H HD21 . LEU A 1 33  ? 44.417 45.225 11.016 1.00 0.00 ? 3  LEU A HD21 9  
ATOM 8655  H HD22 . LEU A 1 33  ? 46.158 45.309 11.288 1.00 0.00 ? 3  LEU A HD22 9  
ATOM 8656  H HD23 . LEU A 1 33  ? 45.091 44.744 12.574 1.00 0.00 ? 3  LEU A HD23 9  
ATOM 8657  N N    . ASN A 1 34  ? 42.250 40.383 12.563 1.00 0.00 ? 4  ASN A N    9  
ATOM 8658  C CA   . ASN A 1 34  ? 40.978 39.658 12.596 1.00 0.00 ? 4  ASN A CA   9  
ATOM 8659  C C    . ASN A 1 34  ? 40.581 39.212 14.013 1.00 0.00 ? 4  ASN A C    9  
ATOM 8660  O O    . ASN A 1 34  ? 39.613 38.467 14.175 1.00 0.00 ? 4  ASN A O    9  
ATOM 8661  C CB   . ASN A 1 34  ? 41.066 38.429 11.686 1.00 0.00 ? 4  ASN A CB   9  
ATOM 8662  C CG   . ASN A 1 34  ? 41.463 38.844 10.271 1.00 0.00 ? 4  ASN A CG   9  
ATOM 8663  O OD1  . ASN A 1 34  ? 40.882 39.768 9.699  1.00 0.00 ? 4  ASN A OD1  9  
ATOM 8664  N ND2  . ASN A 1 34  ? 42.422 38.202 9.660  1.00 0.00 ? 4  ASN A ND2  9  
ATOM 8665  H H    . ASN A 1 34  ? 43.089 39.880 12.532 1.00 0.00 ? 4  ASN A H    9  
ATOM 8666  H HA   . ASN A 1 34  ? 40.205 40.306 12.212 1.00 0.00 ? 4  ASN A HA   9  
ATOM 8667  H HB2  . ASN A 1 34  ? 41.805 37.747 12.080 1.00 0.00 ? 4  ASN A HB2  9  
ATOM 8668  H HB3  . ASN A 1 34  ? 40.106 37.937 11.657 1.00 0.00 ? 4  ASN A HB3  9  
ATOM 8669  H HD21 . ASN A 1 34  ? 42.874 37.455 10.105 1.00 0.00 ? 4  ASN A HD21 9  
ATOM 8670  H HD22 . ASN A 1 34  ? 42.702 38.483 8.762  1.00 0.00 ? 4  ASN A HD22 9  
ATOM 8671  N N    . GLY A 1 35  ? 41.304 39.661 15.041 1.00 0.00 ? 5  GLY A N    9  
ATOM 8672  C CA   . GLY A 1 35  ? 41.085 39.166 16.395 1.00 0.00 ? 5  GLY A CA   9  
ATOM 8673  C C    . GLY A 1 35  ? 39.628 39.304 16.820 1.00 0.00 ? 5  GLY A C    9  
ATOM 8674  O O    . GLY A 1 35  ? 39.085 38.410 17.470 1.00 0.00 ? 5  GLY A O    9  
ATOM 8675  H H    . GLY A 1 35  ? 41.990 40.343 14.888 1.00 0.00 ? 5  GLY A H    9  
ATOM 8676  H HA2  . GLY A 1 35  ? 41.367 38.124 16.437 1.00 0.00 ? 5  GLY A HA2  9  
ATOM 8677  H HA3  . GLY A 1 35  ? 41.703 39.727 17.079 1.00 0.00 ? 5  GLY A HA3  9  
ATOM 8678  N N    . ALA A 1 36  ? 38.986 40.407 16.437 1.00 0.00 ? 6  ALA A N    9  
ATOM 8679  C CA   . ALA A 1 36  ? 37.605 40.638 16.850 1.00 0.00 ? 6  ALA A CA   9  
ATOM 8680  C C    . ALA A 1 36  ? 36.704 39.520 16.334 1.00 0.00 ? 6  ALA A C    9  
ATOM 8681  O O    . ALA A 1 36  ? 35.922 38.940 17.093 1.00 0.00 ? 6  ALA A O    9  
ATOM 8682  C CB   . ALA A 1 36  ? 37.116 41.983 16.308 1.00 0.00 ? 6  ALA A CB   9  
ATOM 8683  H H    . ALA A 1 36  ? 39.444 41.067 15.876 1.00 0.00 ? 6  ALA A H    9  
ATOM 8684  H HA   . ALA A 1 36  ? 37.560 40.658 17.928 1.00 0.00 ? 6  ALA A HA   9  
ATOM 8685  H HB1  . ALA A 1 36  ? 37.048 41.935 15.231 1.00 0.00 ? 6  ALA A HB1  9  
ATOM 8686  H HB2  . ALA A 1 36  ? 37.811 42.759 16.590 1.00 0.00 ? 6  ALA A HB2  9  
ATOM 8687  H HB3  . ALA A 1 36  ? 36.143 42.204 16.721 1.00 0.00 ? 6  ALA A HB3  9  
ATOM 8688  N N    . LEU A 1 37  ? 36.843 39.190 15.052 1.00 0.00 ? 7  LEU A N    9  
ATOM 8689  C CA   . LEU A 1 37  ? 36.077 38.087 14.483 1.00 0.00 ? 7  LEU A CA   9  
ATOM 8690  C C    . LEU A 1 37  ? 36.427 36.767 15.166 1.00 0.00 ? 7  LEU A C    9  
ATOM 8691  O O    . LEU A 1 37  ? 35.550 35.938 15.409 1.00 0.00 ? 7  LEU A O    9  
ATOM 8692  C CB   . LEU A 1 37  ? 36.346 37.981 12.981 1.00 0.00 ? 7  LEU A CB   9  
ATOM 8693  C CG   . LEU A 1 37  ? 35.770 39.209 12.272 1.00 0.00 ? 7  LEU A CG   9  
ATOM 8694  C CD1  . LEU A 1 37  ? 36.305 39.276 10.841 1.00 0.00 ? 7  LEU A CD1  9  
ATOM 8695  C CD2  . LEU A 1 37  ? 34.244 39.104 12.230 1.00 0.00 ? 7  LEU A CD2  9  
ATOM 8696  H H    . LEU A 1 37  ? 37.465 39.692 14.487 1.00 0.00 ? 7  LEU A H    9  
ATOM 8697  H HA   . LEU A 1 37  ? 35.026 38.282 14.633 1.00 0.00 ? 7  LEU A HA   9  
ATOM 8698  H HB2  . LEU A 1 37  ? 37.411 37.930 12.808 1.00 0.00 ? 7  LEU A HB2  9  
ATOM 8699  H HB3  . LEU A 1 37  ? 35.874 37.091 12.591 1.00 0.00 ? 7  LEU A HB3  9  
ATOM 8700  H HG   . LEU A 1 37  ? 36.057 40.103 12.808 1.00 0.00 ? 7  LEU A HG   9  
ATOM 8701  H HD11 . LEU A 1 37  ? 37.347 39.561 10.859 1.00 0.00 ? 7  LEU A HD11 9  
ATOM 8702  H HD12 . LEU A 1 37  ? 35.742 40.009 10.281 1.00 0.00 ? 7  LEU A HD12 9  
ATOM 8703  H HD13 . LEU A 1 37  ? 36.203 38.308 10.373 1.00 0.00 ? 7  LEU A HD13 9  
ATOM 8704  H HD21 . LEU A 1 37  ? 33.962 38.118 11.892 1.00 0.00 ? 7  LEU A HD21 9  
ATOM 8705  H HD22 . LEU A 1 37  ? 33.851 39.843 11.549 1.00 0.00 ? 7  LEU A HD22 9  
ATOM 8706  H HD23 . LEU A 1 37  ? 33.842 39.274 13.217 1.00 0.00 ? 7  LEU A HD23 9  
ATOM 8707  N N    . VAL A 1 38  ? 37.699 36.592 15.516 1.00 0.00 ? 8  VAL A N    9  
ATOM 8708  C CA   . VAL A 1 38  ? 38.124 35.375 16.198 1.00 0.00 ? 8  VAL A CA   9  
ATOM 8709  C C    . VAL A 1 38  ? 37.382 35.237 17.527 1.00 0.00 ? 8  VAL A C    9  
ATOM 8710  O O    . VAL A 1 38  ? 36.892 34.158 17.864 1.00 0.00 ? 8  VAL A O    9  
ATOM 8711  C CB   . VAL A 1 38  ? 39.642 35.418 16.432 1.00 0.00 ? 8  VAL A CB   9  
ATOM 8712  C CG1  . VAL A 1 38  ? 40.122 34.157 17.161 1.00 0.00 ? 8  VAL A CG1  9  
ATOM 8713  C CG2  . VAL A 1 38  ? 40.367 35.508 15.086 1.00 0.00 ? 8  VAL A CG2  9  
ATOM 8714  H H    . VAL A 1 38  ? 38.362 37.275 15.283 1.00 0.00 ? 8  VAL A H    9  
ATOM 8715  H HA   . VAL A 1 38  ? 37.890 34.524 15.575 1.00 0.00 ? 8  VAL A HA   9  
ATOM 8716  H HB   . VAL A 1 38  ? 39.886 36.286 17.027 1.00 0.00 ? 8  VAL A HB   9  
ATOM 8717  H HG11 . VAL A 1 38  ? 40.032 33.305 16.502 1.00 0.00 ? 8  VAL A HG11 9  
ATOM 8718  H HG12 . VAL A 1 38  ? 39.520 33.995 18.043 1.00 0.00 ? 8  VAL A HG12 9  
ATOM 8719  H HG13 . VAL A 1 38  ? 41.155 34.280 17.449 1.00 0.00 ? 8  VAL A HG13 9  
ATOM 8720  H HG21 . VAL A 1 38  ? 41.373 35.868 15.244 1.00 0.00 ? 8  VAL A HG21 9  
ATOM 8721  H HG22 . VAL A 1 38  ? 39.842 36.187 14.432 1.00 0.00 ? 8  VAL A HG22 9  
ATOM 8722  H HG23 . VAL A 1 38  ? 40.404 34.529 14.632 1.00 0.00 ? 8  VAL A HG23 9  
ATOM 8723  N N    . ASN A 1 39  ? 37.264 36.342 18.258 1.00 0.00 ? 9  ASN A N    9  
ATOM 8724  C CA   . ASN A 1 39  ? 36.563 36.316 19.537 1.00 0.00 ? 9  ASN A CA   9  
ATOM 8725  C C    . ASN A 1 39  ? 35.099 35.933 19.348 1.00 0.00 ? 9  ASN A C    9  
ATOM 8726  O O    . ASN A 1 39  ? 34.569 35.098 20.085 1.00 0.00 ? 9  ASN A O    9  
ATOM 8727  C CB   . ASN A 1 39  ? 36.650 37.691 20.206 1.00 0.00 ? 9  ASN A CB   9  
ATOM 8728  C CG   . ASN A 1 39  ? 38.100 38.026 20.543 1.00 0.00 ? 9  ASN A CG   9  
ATOM 8729  O OD1  . ASN A 1 39  ? 38.937 37.133 20.665 1.00 0.00 ? 9  ASN A OD1  9  
ATOM 8730  N ND2  . ASN A 1 39  ? 38.448 39.274 20.703 1.00 0.00 ? 9  ASN A ND2  9  
ATOM 8731  H H    . ASN A 1 39  ? 37.678 37.174 17.949 1.00 0.00 ? 9  ASN A H    9  
ATOM 8732  H HA   . ASN A 1 39  ? 37.035 35.588 20.179 1.00 0.00 ? 9  ASN A HA   9  
ATOM 8733  H HB2  . ASN A 1 39  ? 36.256 38.439 19.535 1.00 0.00 ? 9  ASN A HB2  9  
ATOM 8734  H HB3  . ASN A 1 39  ? 36.065 37.683 21.114 1.00 0.00 ? 9  ASN A HB3  9  
ATOM 8735  H HD21 . ASN A 1 39  ? 37.782 39.986 20.605 1.00 0.00 ? 9  ASN A HD21 9  
ATOM 8736  H HD22 . ASN A 1 39  ? 39.377 39.499 20.919 1.00 0.00 ? 9  ASN A HD22 9  
ATOM 8737  N N    . MET A 1 40  ? 34.457 36.516 18.336 1.00 0.00 ? 10 MET A N    9  
ATOM 8738  C CA   . MET A 1 40  ? 33.059 36.195 18.070 1.00 0.00 ? 10 MET A CA   9  
ATOM 8739  C C    . MET A 1 40  ? 32.898 34.713 17.748 1.00 0.00 ? 10 MET A C    9  
ATOM 8740  O O    . MET A 1 40  ? 31.967 34.063 18.227 1.00 0.00 ? 10 MET A O    9  
ATOM 8741  C CB   . MET A 1 40  ? 32.547 37.036 16.898 1.00 0.00 ? 10 MET A CB   9  
ATOM 8742  C CG   . MET A 1 40  ? 31.034 36.855 16.760 1.00 0.00 ? 10 MET A CG   9  
ATOM 8743  S SD   . MET A 1 40  ? 30.448 37.755 15.303 1.00 0.00 ? 10 MET A SD   9  
ATOM 8744  C CE   . MET A 1 40  ? 31.131 36.641 14.052 1.00 0.00 ? 10 MET A CE   9  
ATOM 8745  H H    . MET A 1 40  ? 34.918 37.189 17.790 1.00 0.00 ? 10 MET A H    9  
ATOM 8746  H HA   . MET A 1 40  ? 32.473 36.429 18.946 1.00 0.00 ? 10 MET A HA   9  
ATOM 8747  H HB2  . MET A 1 40  ? 32.772 38.077 17.077 1.00 0.00 ? 10 MET A HB2  9  
ATOM 8748  H HB3  . MET A 1 40  ? 33.029 36.714 15.986 1.00 0.00 ? 10 MET A HB3  9  
ATOM 8749  H HG2  . MET A 1 40  ? 30.805 35.805 16.650 1.00 0.00 ? 10 MET A HG2  9  
ATOM 8750  H HG3  . MET A 1 40  ? 30.544 37.239 17.642 1.00 0.00 ? 10 MET A HG3  9  
ATOM 8751  H HE1  . MET A 1 40  ? 32.209 36.720 14.053 1.00 0.00 ? 10 MET A HE1  9  
ATOM 8752  H HE2  . MET A 1 40  ? 30.754 36.916 13.079 1.00 0.00 ? 10 MET A HE2  9  
ATOM 8753  H HE3  . MET A 1 40  ? 30.838 35.626 14.276 1.00 0.00 ? 10 MET A HE3  9  
ATOM 8754  N N    . LEU A 1 41  ? 33.837 34.166 16.979 1.00 0.00 ? 11 LEU A N    9  
ATOM 8755  C CA   . LEU A 1 41  ? 33.808 32.743 16.668 1.00 0.00 ? 11 LEU A CA   9  
ATOM 8756  C C    . LEU A 1 41  ? 33.947 31.906 17.934 1.00 0.00 ? 11 LEU A C    9  
ATOM 8757  O O    . LEU A 1 41  ? 33.255 30.902 18.098 1.00 0.00 ? 11 LEU A O    9  
ATOM 8758  C CB   . LEU A 1 41  ? 34.932 32.392 15.690 1.00 0.00 ? 11 LEU A CB   9  
ATOM 8759  C CG   . LEU A 1 41  ? 34.673 33.069 14.343 1.00 0.00 ? 11 LEU A CG   9  
ATOM 8760  C CD1  . LEU A 1 41  ? 35.906 32.916 13.451 1.00 0.00 ? 11 LEU A CD1  9  
ATOM 8761  C CD2  . LEU A 1 41  ? 33.473 32.407 13.660 1.00 0.00 ? 11 LEU A CD2  9  
ATOM 8762  H H    . LEU A 1 41  ? 34.537 34.733 16.593 1.00 0.00 ? 11 LEU A H    9  
ATOM 8763  H HA   . LEU A 1 41  ? 32.862 32.509 16.205 1.00 0.00 ? 11 LEU A HA   9  
ATOM 8764  H HB2  . LEU A 1 41  ? 35.875 32.733 16.090 1.00 0.00 ? 11 LEU A HB2  9  
ATOM 8765  H HB3  . LEU A 1 41  ? 34.967 31.321 15.551 1.00 0.00 ? 11 LEU A HB3  9  
ATOM 8766  H HG   . LEU A 1 41  ? 34.467 34.118 14.499 1.00 0.00 ? 11 LEU A HG   9  
ATOM 8767  H HD11 . LEU A 1 41  ? 36.690 33.568 13.807 1.00 0.00 ? 11 LEU A HD11 9  
ATOM 8768  H HD12 . LEU A 1 41  ? 35.651 33.181 12.435 1.00 0.00 ? 11 LEU A HD12 9  
ATOM 8769  H HD13 . LEU A 1 41  ? 36.247 31.892 13.482 1.00 0.00 ? 11 LEU A HD13 9  
ATOM 8770  H HD21 . LEU A 1 41  ? 33.516 32.592 12.598 1.00 0.00 ? 11 LEU A HD21 9  
ATOM 8771  H HD22 . LEU A 1 41  ? 32.558 32.819 14.061 1.00 0.00 ? 11 LEU A HD22 9  
ATOM 8772  H HD23 . LEU A 1 41  ? 33.498 31.342 13.842 1.00 0.00 ? 11 LEU A HD23 9  
ATOM 8773  N N    . LYS A 1 42  ? 34.824 32.333 18.840 1.00 0.00 ? 12 LYS A N    9  
ATOM 8774  C CA   . LYS A 1 42  ? 35.011 31.609 20.092 1.00 0.00 ? 12 LYS A CA   9  
ATOM 8775  C C    . LYS A 1 42  ? 33.702 31.541 20.872 1.00 0.00 ? 12 LYS A C    9  
ATOM 8776  O O    . LYS A 1 42  ? 33.350 30.494 21.417 1.00 0.00 ? 12 LYS A O    9  
ATOM 8777  C CB   . LYS A 1 42  ? 36.078 32.311 20.938 1.00 0.00 ? 12 LYS A CB   9  
ATOM 8778  C CG   . LYS A 1 42  ? 36.387 31.486 22.191 1.00 0.00 ? 12 LYS A CG   9  
ATOM 8779  C CD   . LYS A 1 42  ? 37.247 30.278 21.813 1.00 0.00 ? 12 LYS A CD   9  
ATOM 8780  C CE   . LYS A 1 42  ? 37.621 29.503 23.078 1.00 0.00 ? 12 LYS A CE   9  
ATOM 8781  N NZ   . LYS A 1 42  ? 38.381 30.395 23.999 1.00 0.00 ? 12 LYS A NZ   9  
ATOM 8782  H H    . LYS A 1 42  ? 35.378 33.118 18.645 1.00 0.00 ? 12 LYS A H    9  
ATOM 8783  H HA   . LYS A 1 42  ? 35.342 30.606 19.871 1.00 0.00 ? 12 LYS A HA   9  
ATOM 8784  H HB2  . LYS A 1 42  ? 36.979 32.425 20.353 1.00 0.00 ? 12 LYS A HB2  9  
ATOM 8785  H HB3  . LYS A 1 42  ? 35.717 33.285 21.234 1.00 0.00 ? 12 LYS A HB3  9  
ATOM 8786  H HG2  . LYS A 1 42  ? 36.923 32.101 22.900 1.00 0.00 ? 12 LYS A HG2  9  
ATOM 8787  H HG3  . LYS A 1 42  ? 35.467 31.143 22.637 1.00 0.00 ? 12 LYS A HG3  9  
ATOM 8788  H HD2  . LYS A 1 42  ? 36.691 29.634 21.147 1.00 0.00 ? 12 LYS A HD2  9  
ATOM 8789  H HD3  . LYS A 1 42  ? 38.147 30.615 21.321 1.00 0.00 ? 12 LYS A HD3  9  
ATOM 8790  H HE2  . LYS A 1 42  ? 36.723 29.160 23.569 1.00 0.00 ? 12 LYS A HE2  9  
ATOM 8791  H HE3  . LYS A 1 42  ? 38.235 28.654 22.812 1.00 0.00 ? 12 LYS A HE3  9  
ATOM 8792  H HZ1  . LYS A 1 42  ? 37.720 30.866 24.649 1.00 0.00 ? 12 LYS A HZ1  9  
ATOM 8793  H HZ2  . LYS A 1 42  ? 38.890 31.113 23.443 1.00 0.00 ? 12 LYS A HZ2  9  
ATOM 8794  H HZ3  . LYS A 1 42  ? 39.062 29.831 24.546 1.00 0.00 ? 12 LYS A HZ3  9  
ATOM 8795  N N    . GLU A 1 43  ? 32.960 32.647 20.884 1.00 0.00 ? 13 GLU A N    9  
ATOM 8796  C CA   . GLU A 1 43  ? 31.673 32.667 21.572 1.00 0.00 ? 13 GLU A CA   9  
ATOM 8797  C C    . GLU A 1 43  ? 30.698 31.691 20.922 1.00 0.00 ? 13 GLU A C    9  
ATOM 8798  O O    . GLU A 1 43  ? 30.016 30.929 21.609 1.00 0.00 ? 13 GLU A O    9  
ATOM 8799  C CB   . GLU A 1 43  ? 31.084 34.078 21.534 1.00 0.00 ? 13 GLU A CB   9  
ATOM 8800  C CG   . GLU A 1 43  ? 32.004 35.039 22.296 1.00 0.00 ? 13 GLU A CG   9  
ATOM 8801  C CD   . GLU A 1 43  ? 32.124 34.649 23.772 1.00 0.00 ? 13 GLU A CD   9  
ATOM 8802  O OE1  . GLU A 1 43  ? 31.285 33.905 24.258 1.00 0.00 ? 13 GLU A OE1  9  
ATOM 8803  O OE2  . GLU A 1 43  ? 33.064 35.105 24.400 1.00 0.00 ? 13 GLU A OE2  9  
ATOM 8804  H H    . GLU A 1 43  ? 33.301 33.464 20.461 1.00 0.00 ? 13 GLU A H    9  
ATOM 8805  H HA   . GLU A 1 43  ? 31.822 32.380 22.602 1.00 0.00 ? 13 GLU A HA   9  
ATOM 8806  H HB2  . GLU A 1 43  ? 30.993 34.402 20.508 1.00 0.00 ? 13 GLU A HB2  9  
ATOM 8807  H HB3  . GLU A 1 43  ? 30.110 34.074 21.999 1.00 0.00 ? 13 GLU A HB3  9  
ATOM 8808  H HG2  . GLU A 1 43  ? 32.986 35.020 21.846 1.00 0.00 ? 13 GLU A HG2  9  
ATOM 8809  H HG3  . GLU A 1 43  ? 31.606 36.041 22.226 1.00 0.00 ? 13 GLU A HG3  9  
ATOM 8810  N N    . GLU A 1 44  ? 30.667 31.683 19.591 1.00 0.00 ? 14 GLU A N    9  
ATOM 8811  C CA   . GLU A 1 44  ? 29.794 30.761 18.873 1.00 0.00 ? 14 GLU A CA   9  
ATOM 8812  C C    . GLU A 1 44  ? 30.178 29.312 19.155 1.00 0.00 ? 14 GLU A C    9  
ATOM 8813  O O    . GLU A 1 44  ? 29.311 28.454 19.326 1.00 0.00 ? 14 GLU A O    9  
ATOM 8814  C CB   . GLU A 1 44  ? 29.874 31.036 17.371 1.00 0.00 ? 14 GLU A CB   9  
ATOM 8815  C CG   . GLU A 1 44  ? 29.347 32.446 17.083 1.00 0.00 ? 14 GLU A CG   9  
ATOM 8816  C CD   . GLU A 1 44  ? 27.874 32.585 17.476 1.00 0.00 ? 14 GLU A CD   9  
ATOM 8817  O OE1  . GLU A 1 44  ? 27.203 31.575 17.632 1.00 0.00 ? 14 GLU A OE1  9  
ATOM 8818  O OE2  . GLU A 1 44  ? 27.434 33.714 17.617 1.00 0.00 ? 14 GLU A OE2  9  
ATOM 8819  H H    . GLU A 1 44  ? 31.213 32.327 19.090 1.00 0.00 ? 14 GLU A H    9  
ATOM 8820  H HA   . GLU A 1 44  ? 28.776 30.921 19.199 1.00 0.00 ? 14 GLU A HA   9  
ATOM 8821  H HB2  . GLU A 1 44  ? 30.902 30.959 17.046 1.00 0.00 ? 14 GLU A HB2  9  
ATOM 8822  H HB3  . GLU A 1 44  ? 29.272 30.315 16.838 1.00 0.00 ? 14 GLU A HB3  9  
ATOM 8823  H HG2  . GLU A 1 44  ? 29.928 33.161 17.646 1.00 0.00 ? 14 GLU A HG2  9  
ATOM 8824  H HG3  . GLU A 1 44  ? 29.456 32.657 16.030 1.00 0.00 ? 14 GLU A HG3  9  
ATOM 8825  N N    . GLY A 1 45  ? 31.479 29.046 19.237 1.00 0.00 ? 15 GLY A N    9  
ATOM 8826  C CA   . GLY A 1 45  ? 31.949 27.701 19.540 1.00 0.00 ? 15 GLY A CA   9  
ATOM 8827  C C    . GLY A 1 45  ? 31.444 27.245 20.904 1.00 0.00 ? 15 GLY A C    9  
ATOM 8828  O O    . GLY A 1 45  ? 30.945 26.127 21.048 1.00 0.00 ? 15 GLY A O    9  
ATOM 8829  H H    . GLY A 1 45  ? 32.128 29.757 19.064 1.00 0.00 ? 15 GLY A H    9  
ATOM 8830  H HA2  . GLY A 1 45  ? 31.591 27.021 18.781 1.00 0.00 ? 15 GLY A HA2  9  
ATOM 8831  H HA3  . GLY A 1 45  ? 33.029 27.694 19.547 1.00 0.00 ? 15 GLY A HA3  9  
ATOM 8832  N N    . ASN A 1 46  ? 31.545 28.126 21.896 1.00 0.00 ? 16 ASN A N    9  
ATOM 8833  C CA   . ASN A 1 46  ? 31.061 27.795 23.232 1.00 0.00 ? 16 ASN A CA   9  
ATOM 8834  C C    . ASN A 1 46  ? 29.558 27.523 23.209 1.00 0.00 ? 16 ASN A C    9  
ATOM 8835  O O    . ASN A 1 46  ? 29.082 26.601 23.872 1.00 0.00 ? 16 ASN A O    9  
ATOM 8836  C CB   . ASN A 1 46  ? 31.358 28.947 24.195 1.00 0.00 ? 16 ASN A CB   9  
ATOM 8837  C CG   . ASN A 1 46  ? 32.864 29.143 24.339 1.00 0.00 ? 16 ASN A CG   9  
ATOM 8838  O OD1  . ASN A 1 46  ? 33.643 28.223 24.085 1.00 0.00 ? 16 ASN A OD1  9  
ATOM 8839  N ND2  . ASN A 1 46  ? 33.326 30.297 24.736 1.00 0.00 ? 16 ASN A ND2  9  
ATOM 8840  H H    . ASN A 1 46  ? 31.978 28.991 21.737 1.00 0.00 ? 16 ASN A H    9  
ATOM 8841  H HA   . ASN A 1 46  ? 31.571 26.910 23.580 1.00 0.00 ? 16 ASN A HA   9  
ATOM 8842  H HB2  . ASN A 1 46  ? 30.914 29.855 23.813 1.00 0.00 ? 16 ASN A HB2  9  
ATOM 8843  H HB3  . ASN A 1 46  ? 30.933 28.721 25.163 1.00 0.00 ? 16 ASN A HB3  9  
ATOM 8844  H HD21 . ASN A 1 46  ? 32.707 31.029 24.939 1.00 0.00 ? 16 ASN A HD21 9  
ATOM 8845  H HD22 . ASN A 1 46  ? 34.292 30.432 24.831 1.00 0.00 ? 16 ASN A HD22 9  
ATOM 8846  N N    . LYS A 1 47  ? 28.818 28.295 22.417 1.00 0.00 ? 17 LYS A N    9  
ATOM 8847  C CA   . LYS A 1 47  ? 27.381 28.074 22.296 1.00 0.00 ? 17 LYS A CA   9  
ATOM 8848  C C    . LYS A 1 47  ? 27.093 26.688 21.727 1.00 0.00 ? 17 LYS A C    9  
ATOM 8849  O O    . LYS A 1 47  ? 26.246 25.956 22.249 1.00 0.00 ? 17 LYS A O    9  
ATOM 8850  C CB   . LYS A 1 47  ? 26.767 29.140 21.385 1.00 0.00 ? 17 LYS A CB   9  
ATOM 8851  C CG   . LYS A 1 47  ? 25.243 28.999 21.384 1.00 0.00 ? 17 LYS A CG   9  
ATOM 8852  C CD   . LYS A 1 47  ? 24.636 30.009 20.408 1.00 0.00 ? 17 LYS A CD   9  
ATOM 8853  C CE   . LYS A 1 47  ? 23.111 29.975 20.521 1.00 0.00 ? 17 LYS A CE   9  
ATOM 8854  N NZ   . LYS A 1 47  ? 22.681 30.801 21.685 1.00 0.00 ? 17 LYS A NZ   9  
ATOM 8855  H H    . LYS A 1 47  ? 29.236 29.047 21.945 1.00 0.00 ? 17 LYS A H    9  
ATOM 8856  H HA   . LYS A 1 47  ? 26.931 28.153 23.274 1.00 0.00 ? 17 LYS A HA   9  
ATOM 8857  H HB2  . LYS A 1 47  ? 27.038 30.121 21.746 1.00 0.00 ? 17 LYS A HB2  9  
ATOM 8858  H HB3  . LYS A 1 47  ? 27.137 29.012 20.378 1.00 0.00 ? 17 LYS A HB3  9  
ATOM 8859  H HG2  . LYS A 1 47  ? 24.975 27.997 21.080 1.00 0.00 ? 17 LYS A HG2  9  
ATOM 8860  H HG3  . LYS A 1 47  ? 24.863 29.189 22.376 1.00 0.00 ? 17 LYS A HG3  9  
ATOM 8861  H HD2  . LYS A 1 47  ? 24.994 30.999 20.647 1.00 0.00 ? 17 LYS A HD2  9  
ATOM 8862  H HD3  . LYS A 1 47  ? 24.924 29.754 19.400 1.00 0.00 ? 17 LYS A HD3  9  
ATOM 8863  H HE2  . LYS A 1 47  ? 22.675 30.372 19.617 1.00 0.00 ? 17 LYS A HE2  9  
ATOM 8864  H HE3  . LYS A 1 47  ? 22.783 28.956 20.661 1.00 0.00 ? 17 LYS A HE3  9  
ATOM 8865  H HZ1  . LYS A 1 47  ? 22.810 31.808 21.463 1.00 0.00 ? 17 LYS A HZ1  9  
ATOM 8866  H HZ2  . LYS A 1 47  ? 23.253 30.552 22.516 1.00 0.00 ? 17 LYS A HZ2  9  
ATOM 8867  H HZ3  . LYS A 1 47  ? 21.677 30.619 21.886 1.00 0.00 ? 17 LYS A HZ3  9  
ATOM 8868  N N    . ALA A 1 48  ? 27.835 26.305 20.687 1.00 0.00 ? 18 ALA A N    9  
ATOM 8869  C CA   . ALA A 1 48  ? 27.640 24.992 20.089 1.00 0.00 ? 18 ALA A CA   9  
ATOM 8870  C C    . ALA A 1 48  ? 27.906 23.901 21.119 1.00 0.00 ? 18 ALA A C    9  
ATOM 8871  O O    . ALA A 1 48  ? 27.174 22.916 21.188 1.00 0.00 ? 18 ALA A O    9  
ATOM 8872  C CB   . ALA A 1 48  ? 28.569 24.811 18.887 1.00 0.00 ? 18 ALA A CB   9  
ATOM 8873  H H    . ALA A 1 48  ? 28.497 26.920 20.306 1.00 0.00 ? 18 ALA A H    9  
ATOM 8874  H HA   . ALA A 1 48  ? 26.617 24.911 19.750 1.00 0.00 ? 18 ALA A HA   9  
ATOM 8875  H HB1  . ALA A 1 48  ? 28.672 25.751 18.366 1.00 0.00 ? 18 ALA A HB1  9  
ATOM 8876  H HB2  . ALA A 1 48  ? 28.151 24.072 18.218 1.00 0.00 ? 18 ALA A HB2  9  
ATOM 8877  H HB3  . ALA A 1 48  ? 29.539 24.481 19.228 1.00 0.00 ? 18 ALA A HB3  9  
ATOM 8878  N N    . LEU A 1 49  ? 28.961 24.076 21.913 1.00 0.00 ? 19 LEU A N    9  
ATOM 8879  C CA   . LEU A 1 49  ? 29.244 23.132 22.988 1.00 0.00 ? 19 LEU A CA   9  
ATOM 8880  C C    . LEU A 1 49  ? 28.091 23.085 23.987 1.00 0.00 ? 19 LEU A C    9  
ATOM 8881  O O    . LEU A 1 49  ? 27.676 22.009 24.417 1.00 0.00 ? 19 LEU A O    9  
ATOM 8882  C CB   . LEU A 1 49  ? 30.533 23.538 23.706 1.00 0.00 ? 19 LEU A CB   9  
ATOM 8883  C CG   . LEU A 1 49  ? 30.908 22.475 24.742 1.00 0.00 ? 19 LEU A CG   9  
ATOM 8884  C CD1  . LEU A 1 49  ? 31.367 21.203 24.026 1.00 0.00 ? 19 LEU A CD1  9  
ATOM 8885  C CD2  . LEU A 1 49  ? 32.046 23.000 25.619 1.00 0.00 ? 19 LEU A CD2  9  
ATOM 8886  H H    . LEU A 1 49  ? 29.566 24.830 21.757 1.00 0.00 ? 19 LEU A H    9  
ATOM 8887  H HA   . LEU A 1 49  ? 29.378 22.148 22.562 1.00 0.00 ? 19 LEU A HA   9  
ATOM 8888  H HB2  . LEU A 1 49  ? 31.331 23.634 22.984 1.00 0.00 ? 19 LEU A HB2  9  
ATOM 8889  H HB3  . LEU A 1 49  ? 30.384 24.484 24.205 1.00 0.00 ? 19 LEU A HB3  9  
ATOM 8890  H HG   . LEU A 1 49  ? 30.049 22.251 25.357 1.00 0.00 ? 19 LEU A HG   9  
ATOM 8891  H HD11 . LEU A 1 49  ? 31.944 21.468 23.154 1.00 0.00 ? 19 LEU A HD11 9  
ATOM 8892  H HD12 . LEU A 1 49  ? 30.502 20.629 23.725 1.00 0.00 ? 19 LEU A HD12 9  
ATOM 8893  H HD13 . LEU A 1 49  ? 31.975 20.612 24.696 1.00 0.00 ? 19 LEU A HD13 9  
ATOM 8894  H HD21 . LEU A 1 49  ? 32.741 23.561 25.012 1.00 0.00 ? 19 LEU A HD21 9  
ATOM 8895  H HD22 . LEU A 1 49  ? 32.560 22.169 26.080 1.00 0.00 ? 19 LEU A HD22 9  
ATOM 8896  H HD23 . LEU A 1 49  ? 31.640 23.642 26.389 1.00 0.00 ? 19 LEU A HD23 9  
ATOM 8897  N N    . SER A 1 50  ? 27.515 24.246 24.286 1.00 0.00 ? 20 SER A N    9  
ATOM 8898  C CA   . SER A 1 50  ? 26.426 24.317 25.258 1.00 0.00 ? 20 SER A CA   9  
ATOM 8899  C C    . SER A 1 50  ? 25.229 23.471 24.831 1.00 0.00 ? 20 SER A C    9  
ATOM 8900  O O    . SER A 1 50  ? 24.546 22.885 25.671 1.00 0.00 ? 20 SER A O    9  
ATOM 8901  C CB   . SER A 1 50  ? 25.984 25.770 25.434 1.00 0.00 ? 20 SER A CB   9  
ATOM 8902  O OG   . SER A 1 50  ? 25.042 25.847 26.495 1.00 0.00 ? 20 SER A OG   9  
ATOM 8903  H H    . SER A 1 50  ? 27.855 25.071 23.883 1.00 0.00 ? 20 SER A H    9  
ATOM 8904  H HA   . SER A 1 50  ? 26.787 23.951 26.209 1.00 0.00 ? 20 SER A HA   9  
ATOM 8905  H HB2  . SER A 1 50  ? 26.837 26.383 25.675 1.00 0.00 ? 20 SER A HB2  9  
ATOM 8906  H HB3  . SER A 1 50  ? 25.542 26.123 24.512 1.00 0.00 ? 20 SER A HB3  9  
ATOM 8907  H HG   . SER A 1 50  ? 25.190 26.613 26.944 1.00 0.00 ? 20 SER A HG   9  
ATOM 8908  N N    . VAL A 1 51  ? 24.977 23.409 23.527 1.00 0.00 ? 21 VAL A N    9  
ATOM 8909  C CA   . VAL A 1 51  ? 23.873 22.593 23.014 1.00 0.00 ? 21 VAL A CA   9  
ATOM 8910  C C    . VAL A 1 51  ? 24.264 21.133 22.745 1.00 0.00 ? 21 VAL A C    9  
ATOM 8911  O O    . VAL A 1 51  ? 23.428 20.356 22.279 1.00 0.00 ? 21 VAL A O    9  
ATOM 8912  C CB   . VAL A 1 51  ? 23.319 23.217 21.731 1.00 0.00 ? 21 VAL A CB   9  
ATOM 8913  C CG1  . VAL A 1 51  ? 22.837 24.638 22.022 1.00 0.00 ? 21 VAL A CG1  9  
ATOM 8914  C CG2  . VAL A 1 51  ? 24.418 23.267 20.667 1.00 0.00 ? 21 VAL A CG2  9  
ATOM 8915  H H    . VAL A 1 51  ? 25.500 23.965 22.911 1.00 0.00 ? 21 VAL A H    9  
ATOM 8916  H HA   . VAL A 1 51  ? 23.085 22.598 23.751 1.00 0.00 ? 21 VAL A HA   9  
ATOM 8917  H HB   . VAL A 1 51  ? 22.492 22.623 21.371 1.00 0.00 ? 21 VAL A HB   9  
ATOM 8918  H HG11 . VAL A 1 51  ? 22.138 24.946 21.258 1.00 0.00 ? 21 VAL A HG11 9  
ATOM 8919  H HG12 . VAL A 1 51  ? 23.682 25.311 22.030 1.00 0.00 ? 21 VAL A HG12 9  
ATOM 8920  H HG13 . VAL A 1 51  ? 22.349 24.662 22.987 1.00 0.00 ? 21 VAL A HG13 9  
ATOM 8921  H HG21 . VAL A 1 51  ? 25.154 24.003 20.948 1.00 0.00 ? 21 VAL A HG21 9  
ATOM 8922  H HG22 . VAL A 1 51  ? 23.984 23.535 19.715 1.00 0.00 ? 21 VAL A HG22 9  
ATOM 8923  H HG23 . VAL A 1 51  ? 24.888 22.298 20.587 1.00 0.00 ? 21 VAL A HG23 9  
ATOM 8924  N N    . GLY A 1 52  ? 25.510 20.746 23.026 1.00 0.00 ? 22 GLY A N    9  
ATOM 8925  C CA   . GLY A 1 52  ? 25.962 19.384 22.743 1.00 0.00 ? 22 GLY A CA   9  
ATOM 8926  C C    . GLY A 1 52  ? 26.494 19.207 21.314 1.00 0.00 ? 22 GLY A C    9  
ATOM 8927  O O    . GLY A 1 52  ? 26.715 18.080 20.873 1.00 0.00 ? 22 GLY A O    9  
ATOM 8928  H H    . GLY A 1 52  ? 26.128 21.374 23.456 1.00 0.00 ? 22 GLY A H    9  
ATOM 8929  H HA2  . GLY A 1 52  ? 26.748 19.127 23.439 1.00 0.00 ? 22 GLY A HA2  9  
ATOM 8930  H HA3  . GLY A 1 52  ? 25.133 18.706 22.891 1.00 0.00 ? 22 GLY A HA3  9  
ATOM 8931  N N    . ASN A 1 53  ? 26.703 20.307 20.589 1.00 0.00 ? 23 ASN A N    9  
ATOM 8932  C CA   . ASN A 1 53  ? 27.185 20.237 19.214 1.00 0.00 ? 23 ASN A CA   9  
ATOM 8933  C C    . ASN A 1 53  ? 28.703 20.420 19.173 1.00 0.00 ? 23 ASN A C    9  
ATOM 8934  O O    . ASN A 1 53  ? 29.219 21.419 18.662 1.00 0.00 ? 23 ASN A O    9  
ATOM 8935  C CB   . ASN A 1 53  ? 26.490 21.320 18.383 1.00 0.00 ? 23 ASN A CB   9  
ATOM 8936  C CG   . ASN A 1 53  ? 26.710 21.065 16.898 1.00 0.00 ? 23 ASN A CG   9  
ATOM 8937  O OD1  . ASN A 1 53  ? 27.719 20.474 16.512 1.00 0.00 ? 23 ASN A OD1  9  
ATOM 8938  N ND2  . ASN A 1 53  ? 25.825 21.492 16.040 1.00 0.00 ? 23 ASN A ND2  9  
ATOM 8939  H H    . ASN A 1 53  ? 26.543 21.185 20.991 1.00 0.00 ? 23 ASN A H    9  
ATOM 8940  H HA   . ASN A 1 53  ? 26.937 19.269 18.805 1.00 0.00 ? 23 ASN A HA   9  
ATOM 8941  H HB2  . ASN A 1 53  ? 25.430 21.307 18.595 1.00 0.00 ? 23 ASN A HB2  9  
ATOM 8942  H HB3  . ASN A 1 53  ? 26.895 22.286 18.643 1.00 0.00 ? 23 ASN A HB3  9  
ATOM 8943  H HD21 . ASN A 1 53  ? 25.032 21.971 16.356 1.00 0.00 ? 23 ASN A HD21 9  
ATOM 8944  H HD22 . ASN A 1 53  ? 25.950 21.327 15.082 1.00 0.00 ? 23 ASN A HD22 9  
ATOM 8945  N N    . ILE A 1 54  ? 29.421 19.428 19.690 1.00 0.00 ? 24 ILE A N    9  
ATOM 8946  C CA   . ILE A 1 54  ? 30.872 19.536 19.799 1.00 0.00 ? 24 ILE A CA   9  
ATOM 8947  C C    . ILE A 1 54  ? 31.512 19.659 18.415 1.00 0.00 ? 24 ILE A C    9  
ATOM 8948  O O    . ILE A 1 54  ? 32.478 20.404 18.245 1.00 0.00 ? 24 ILE A O    9  
ATOM 8949  C CB   . ILE A 1 54  ? 31.435 18.308 20.529 1.00 0.00 ? 24 ILE A CB   9  
ATOM 8950  C CG1  . ILE A 1 54  ? 30.777 18.179 21.907 1.00 0.00 ? 24 ILE A CG1  9  
ATOM 8951  C CG2  . ILE A 1 54  ? 32.949 18.455 20.719 1.00 0.00 ? 24 ILE A CG2  9  
ATOM 8952  C CD1  . ILE A 1 54  ? 31.193 16.858 22.554 1.00 0.00 ? 24 ILE A CD1  9  
ATOM 8953  H H    . ILE A 1 54  ? 28.971 18.616 20.001 1.00 0.00 ? 24 ILE A H    9  
ATOM 8954  H HA   . ILE A 1 54  ? 31.112 20.419 20.372 1.00 0.00 ? 24 ILE A HA   9  
ATOM 8955  H HB   . ILE A 1 54  ? 31.231 17.421 19.949 1.00 0.00 ? 24 ILE A HB   9  
ATOM 8956  H HG12 . ILE A 1 54  ? 31.091 19.004 22.533 1.00 0.00 ? 24 ILE A HG12 9  
ATOM 8957  H HG13 . ILE A 1 54  ? 29.703 18.200 21.797 1.00 0.00 ? 24 ILE A HG13 9  
ATOM 8958  H HG21 . ILE A 1 54  ? 33.417 18.612 19.760 1.00 0.00 ? 24 ILE A HG21 9  
ATOM 8959  H HG22 . ILE A 1 54  ? 33.344 17.557 21.170 1.00 0.00 ? 24 ILE A HG22 9  
ATOM 8960  H HG23 . ILE A 1 54  ? 33.150 19.299 21.362 1.00 0.00 ? 24 ILE A HG23 9  
ATOM 8961  H HD11 . ILE A 1 54  ? 32.210 16.936 22.911 1.00 0.00 ? 24 ILE A HD11 9  
ATOM 8962  H HD12 . ILE A 1 54  ? 31.128 16.063 21.825 1.00 0.00 ? 24 ILE A HD12 9  
ATOM 8963  H HD13 . ILE A 1 54  ? 30.536 16.641 23.382 1.00 0.00 ? 24 ILE A HD13 9  
ATOM 8964  N N    . ASP A 1 55  ? 30.955 18.966 17.423 1.00 0.00 ? 25 ASP A N    9  
ATOM 8965  C CA   . ASP A 1 55  ? 31.531 18.997 16.082 1.00 0.00 ? 25 ASP A CA   9  
ATOM 8966  C C    . ASP A 1 55  ? 31.530 20.417 15.525 1.00 0.00 ? 25 ASP A C    9  
ATOM 8967  O O    . ASP A 1 55  ? 32.557 20.910 15.055 1.00 0.00 ? 25 ASP A O    9  
ATOM 8968  C CB   . ASP A 1 55  ? 30.735 18.080 15.149 1.00 0.00 ? 25 ASP A CB   9  
ATOM 8969  C CG   . ASP A 1 55  ? 30.857 16.625 15.596 1.00 0.00 ? 25 ASP A CG   9  
ATOM 8970  O OD1  . ASP A 1 55  ? 29.918 15.880 15.371 1.00 0.00 ? 25 ASP A OD1  9  
ATOM 8971  O OD2  . ASP A 1 55  ? 31.887 16.272 16.148 1.00 0.00 ? 25 ASP A OD2  9  
ATOM 8972  H H    . ASP A 1 55  ? 30.153 18.430 17.595 1.00 0.00 ? 25 ASP A H    9  
ATOM 8973  H HA   . ASP A 1 55  ? 32.550 18.642 16.131 1.00 0.00 ? 25 ASP A HA   9  
ATOM 8974  H HB2  . ASP A 1 55  ? 29.696 18.372 15.165 1.00 0.00 ? 25 ASP A HB2  9  
ATOM 8975  H HB3  . ASP A 1 55  ? 31.118 18.176 14.144 1.00 0.00 ? 25 ASP A HB3  9  
ATOM 8976  N N    . ASP A 1 56  ? 30.392 21.098 15.636 1.00 0.00 ? 26 ASP A N    9  
ATOM 8977  C CA   . ASP A 1 56  ? 30.292 22.466 15.139 1.00 0.00 ? 26 ASP A CA   9  
ATOM 8978  C C    . ASP A 1 56  ? 31.233 23.389 15.903 1.00 0.00 ? 26 ASP A C    9  
ATOM 8979  O O    . ASP A 1 56  ? 31.887 24.246 15.307 1.00 0.00 ? 26 ASP A O    9  
ATOM 8980  C CB   . ASP A 1 56  ? 28.853 22.978 15.259 1.00 0.00 ? 26 ASP A CB   9  
ATOM 8981  C CG   . ASP A 1 56  ? 27.935 22.317 14.227 1.00 0.00 ? 26 ASP A CG   9  
ATOM 8982  O OD1  . ASP A 1 56  ? 26.856 22.845 14.013 1.00 0.00 ? 26 ASP A OD1  9  
ATOM 8983  O OD2  . ASP A 1 56  ? 28.304 21.290 13.675 1.00 0.00 ? 26 ASP A OD2  9  
ATOM 8984  H H    . ASP A 1 56  ? 29.608 20.674 16.043 1.00 0.00 ? 26 ASP A H    9  
ATOM 8985  H HA   . ASP A 1 56  ? 30.574 22.475 14.096 1.00 0.00 ? 26 ASP A HA   9  
ATOM 8986  H HB2  . ASP A 1 56  ? 28.483 22.762 16.250 1.00 0.00 ? 26 ASP A HB2  9  
ATOM 8987  H HB3  . ASP A 1 56  ? 28.845 24.047 15.105 1.00 0.00 ? 26 ASP A HB3  9  
ATOM 8988  N N    . ALA A 1 57  ? 31.335 23.184 17.216 1.00 0.00 ? 27 ALA A N    9  
ATOM 8989  C CA   . ALA A 1 57  ? 32.207 24.024 18.028 1.00 0.00 ? 27 ALA A CA   9  
ATOM 8990  C C    . ALA A 1 57  ? 33.652 23.903 17.551 1.00 0.00 ? 27 ALA A C    9  
ATOM 8991  O O    . ALA A 1 57  ? 34.338 24.910 17.364 1.00 0.00 ? 27 ALA A O    9  
ATOM 8992  C CB   . ALA A 1 57  ? 32.115 23.602 19.497 1.00 0.00 ? 27 ALA A CB   9  
ATOM 8993  H H    . ALA A 1 57  ? 30.789 22.489 17.645 1.00 0.00 ? 27 ALA A H    9  
ATOM 8994  H HA   . ALA A 1 57  ? 31.887 25.053 17.941 1.00 0.00 ? 27 ALA A HA   9  
ATOM 8995  H HB1  . ALA A 1 57  ? 32.283 24.461 20.129 1.00 0.00 ? 27 ALA A HB1  9  
ATOM 8996  H HB2  . ALA A 1 57  ? 32.861 22.850 19.707 1.00 0.00 ? 27 ALA A HB2  9  
ATOM 8997  H HB3  . ALA A 1 57  ? 31.133 23.198 19.693 1.00 0.00 ? 27 ALA A HB3  9  
ATOM 8998  N N    . LEU A 1 58  ? 34.102 22.672 17.318 1.00 0.00 ? 28 LEU A N    9  
ATOM 8999  C CA   . LEU A 1 58  ? 35.461 22.455 16.833 1.00 0.00 ? 28 LEU A CA   9  
ATOM 9000  C C    . LEU A 1 58  ? 35.683 23.142 15.489 1.00 0.00 ? 28 LEU A C    9  
ATOM 9001  O O    . LEU A 1 58  ? 36.729 23.756 15.271 1.00 0.00 ? 28 LEU A O    9  
ATOM 9002  C CB   . LEU A 1 58  ? 35.736 20.956 16.692 1.00 0.00 ? 28 LEU A CB   9  
ATOM 9003  C CG   . LEU A 1 58  ? 35.678 20.285 18.068 1.00 0.00 ? 28 LEU A CG   9  
ATOM 9004  C CD1  . LEU A 1 58  ? 35.745 18.767 17.896 1.00 0.00 ? 28 LEU A CD1  9  
ATOM 9005  C CD2  . LEU A 1 58  ? 36.866 20.749 18.914 1.00 0.00 ? 28 LEU A CD2  9  
ATOM 9006  H H    . LEU A 1 58  ? 33.523 21.902 17.495 1.00 0.00 ? 28 LEU A H    9  
ATOM 9007  H HA   . LEU A 1 58  ? 36.155 22.868 17.549 1.00 0.00 ? 28 LEU A HA   9  
ATOM 9008  H HB2  . LEU A 1 58  ? 34.993 20.515 16.045 1.00 0.00 ? 28 LEU A HB2  9  
ATOM 9009  H HB3  . LEU A 1 58  ? 36.717 20.809 16.266 1.00 0.00 ? 28 LEU A HB3  9  
ATOM 9010  H HG   . LEU A 1 58  ? 34.755 20.552 18.560 1.00 0.00 ? 28 LEU A HG   9  
ATOM 9011  H HD11 . LEU A 1 58  ? 34.845 18.418 17.411 1.00 0.00 ? 28 LEU A HD11 9  
ATOM 9012  H HD12 . LEU A 1 58  ? 35.836 18.299 18.866 1.00 0.00 ? 28 LEU A HD12 9  
ATOM 9013  H HD13 . LEU A 1 58  ? 36.603 18.509 17.292 1.00 0.00 ? 28 LEU A HD13 9  
ATOM 9014  H HD21 . LEU A 1 58  ? 37.737 20.852 18.285 1.00 0.00 ? 28 LEU A HD21 9  
ATOM 9015  H HD22 . LEU A 1 58  ? 37.064 20.021 19.686 1.00 0.00 ? 28 LEU A HD22 9  
ATOM 9016  H HD23 . LEU A 1 58  ? 36.634 21.701 19.368 1.00 0.00 ? 28 LEU A HD23 9  
ATOM 9017  N N    . GLN A 1 59  ? 34.688 23.076 14.605 1.00 0.00 ? 29 GLN A N    9  
ATOM 9018  C CA   . GLN A 1 59  ? 34.818 23.716 13.297 1.00 0.00 ? 29 GLN A CA   9  
ATOM 9019  C C    . GLN A 1 59  ? 35.006 25.224 13.437 1.00 0.00 ? 29 GLN A C    9  
ATOM 9020  O O    . GLN A 1 59  ? 35.890 25.805 12.801 1.00 0.00 ? 29 GLN A O    9  
ATOM 9021  C CB   . GLN A 1 59  ? 33.579 23.433 12.444 1.00 0.00 ? 29 GLN A CB   9  
ATOM 9022  C CG   . GLN A 1 59  ? 33.518 21.941 12.108 1.00 0.00 ? 29 GLN A CG   9  
ATOM 9023  C CD   . GLN A 1 59  ? 32.240 21.615 11.338 1.00 0.00 ? 29 GLN A CD   9  
ATOM 9024  O OE1  . GLN A 1 59  ? 31.281 22.389 11.353 1.00 0.00 ? 29 GLN A OE1  9  
ATOM 9025  N NE2  . GLN A 1 59  ? 32.168 20.504 10.658 1.00 0.00 ? 29 GLN A NE2  9  
ATOM 9026  H H    . GLN A 1 59  ? 33.883 22.555 14.815 1.00 0.00 ? 29 GLN A H    9  
ATOM 9027  H HA   . GLN A 1 59  ? 35.681 23.304 12.796 1.00 0.00 ? 29 GLN A HA   9  
ATOM 9028  H HB2  . GLN A 1 59  ? 32.693 23.715 12.994 1.00 0.00 ? 29 GLN A HB2  9  
ATOM 9029  H HB3  . GLN A 1 59  ? 33.633 24.004 11.529 1.00 0.00 ? 29 GLN A HB3  9  
ATOM 9030  H HG2  . GLN A 1 59  ? 34.374 21.678 11.504 1.00 0.00 ? 29 GLN A HG2  9  
ATOM 9031  H HG3  . GLN A 1 59  ? 33.539 21.367 13.022 1.00 0.00 ? 29 GLN A HG3  9  
ATOM 9032  H HE21 . GLN A 1 59  ? 32.930 19.888 10.645 1.00 0.00 ? 29 GLN A HE21 9  
ATOM 9033  H HE22 . GLN A 1 59  ? 31.353 20.285 10.160 1.00 0.00 ? 29 GLN A HE22 9  
ATOM 9034  N N    . TYR A 1 60  ? 34.203 25.852 14.294 1.00 0.00 ? 30 TYR A N    9  
ATOM 9035  C CA   . TYR A 1 60  ? 34.341 27.288 14.519 1.00 0.00 ? 30 TYR A CA   9  
ATOM 9036  C C    . TYR A 1 60  ? 35.726 27.626 15.058 1.00 0.00 ? 30 TYR A C    9  
ATOM 9037  O O    . TYR A 1 60  ? 36.354 28.584 14.603 1.00 0.00 ? 30 TYR A O    9  
ATOM 9038  C CB   . TYR A 1 60  ? 33.284 27.773 15.515 1.00 0.00 ? 30 TYR A CB   9  
ATOM 9039  C CG   . TYR A 1 60  ? 31.871 27.698 14.989 1.00 0.00 ? 30 TYR A CG   9  
ATOM 9040  C CD1  . TYR A 1 60  ? 30.928 26.885 15.628 1.00 0.00 ? 30 TYR A CD1  9  
ATOM 9041  C CD2  . TYR A 1 60  ? 31.502 28.447 13.865 1.00 0.00 ? 30 TYR A CD2  9  
ATOM 9042  C CE1  . TYR A 1 60  ? 29.617 26.819 15.143 1.00 0.00 ? 30 TYR A CE1  9  
ATOM 9043  C CE2  . TYR A 1 60  ? 30.191 28.381 13.379 1.00 0.00 ? 30 TYR A CE2  9  
ATOM 9044  C CZ   . TYR A 1 60  ? 29.248 27.568 14.018 1.00 0.00 ? 30 TYR A CZ   9  
ATOM 9045  O OH   . TYR A 1 60  ? 27.954 27.503 13.540 1.00 0.00 ? 30 TYR A OH   9  
ATOM 9046  H H    . TYR A 1 60  ? 33.491 25.355 14.745 1.00 0.00 ? 30 TYR A H    9  
ATOM 9047  H HA   . TYR A 1 60  ? 34.194 27.803 13.581 1.00 0.00 ? 30 TYR A HA   9  
ATOM 9048  H HB2  . TYR A 1 60  ? 33.346 27.167 16.406 1.00 0.00 ? 30 TYR A HB2  9  
ATOM 9049  H HB3  . TYR A 1 60  ? 33.508 28.796 15.780 1.00 0.00 ? 30 TYR A HB3  9  
ATOM 9050  H HD1  . TYR A 1 60  ? 31.213 26.308 16.495 1.00 0.00 ? 30 TYR A HD1  9  
ATOM 9051  H HD2  . TYR A 1 60  ? 32.230 29.075 13.372 1.00 0.00 ? 30 TYR A HD2  9  
ATOM 9052  H HE1  . TYR A 1 60  ? 28.889 26.192 15.636 1.00 0.00 ? 30 TYR A HE1  9  
ATOM 9053  H HE2  . TYR A 1 60  ? 29.907 28.958 12.512 1.00 0.00 ? 30 TYR A HE2  9  
ATOM 9054  H HH   . TYR A 1 60  ? 27.413 27.304 14.231 1.00 0.00 ? 30 TYR A HH   9  
ATOM 9055  N N    . TYR A 1 61  ? 36.219 26.819 15.997 1.00 0.00 ? 31 TYR A N    9  
ATOM 9056  C CA   . TYR A 1 61  ? 37.537 27.073 16.568 1.00 0.00 ? 31 TYR A CA   9  
ATOM 9057  C C    . TYR A 1 61  ? 38.623 26.987 15.501 1.00 0.00 ? 31 TYR A C    9  
ATOM 9058  O O    . TYR A 1 61  ? 39.528 27.821 15.460 1.00 0.00 ? 31 TYR A O    9  
ATOM 9059  C CB   . TYR A 1 61  ? 37.835 26.066 17.682 1.00 0.00 ? 31 TYR A CB   9  
ATOM 9060  C CG   . TYR A 1 61  ? 36.860 26.123 18.837 1.00 0.00 ? 31 TYR A CG   9  
ATOM 9061  C CD1  . TYR A 1 61  ? 36.428 27.359 19.336 1.00 0.00 ? 31 TYR A CD1  9  
ATOM 9062  C CD2  . TYR A 1 61  ? 36.393 24.937 19.414 1.00 0.00 ? 31 TYR A CD2  9  
ATOM 9063  C CE1  . TYR A 1 61  ? 35.527 27.406 20.407 1.00 0.00 ? 31 TYR A CE1  9  
ATOM 9064  C CE2  . TYR A 1 61  ? 35.492 24.984 20.485 1.00 0.00 ? 31 TYR A CE2  9  
ATOM 9065  C CZ   . TYR A 1 61  ? 35.060 26.219 20.982 1.00 0.00 ? 31 TYR A CZ   9  
ATOM 9066  O OH   . TYR A 1 61  ? 34.173 26.267 22.038 1.00 0.00 ? 31 TYR A OH   9  
ATOM 9067  H H    . TYR A 1 61  ? 35.679 26.071 16.329 1.00 0.00 ? 31 TYR A H    9  
ATOM 9068  H HA   . TYR A 1 61  ? 37.546 28.066 16.992 1.00 0.00 ? 31 TYR A HA   9  
ATOM 9069  H HB2  . TYR A 1 61  ? 37.807 25.071 17.264 1.00 0.00 ? 31 TYR A HB2  9  
ATOM 9070  H HB3  . TYR A 1 61  ? 38.832 26.252 18.055 1.00 0.00 ? 31 TYR A HB3  9  
ATOM 9071  H HD1  . TYR A 1 61  ? 36.787 28.276 18.892 1.00 0.00 ? 31 TYR A HD1  9  
ATOM 9072  H HD2  . TYR A 1 61  ? 36.727 23.984 19.034 1.00 0.00 ? 31 TYR A HD2  9  
ATOM 9073  H HE1  . TYR A 1 61  ? 35.195 28.359 20.791 1.00 0.00 ? 31 TYR A HE1  9  
ATOM 9074  H HE2  . TYR A 1 61  ? 35.132 24.068 20.928 1.00 0.00 ? 31 TYR A HE2  9  
ATOM 9075  H HH   . TYR A 1 61  ? 34.651 26.300 22.800 1.00 0.00 ? 31 TYR A HH   9  
ATOM 9076  N N    . ALA A 1 62  ? 38.496 26.018 14.596 1.00 0.00 ? 32 ALA A N    9  
ATOM 9077  C CA   . ALA A 1 62  ? 39.486 25.859 13.537 1.00 0.00 ? 32 ALA A CA   9  
ATOM 9078  C C    . ALA A 1 62  ? 39.501 27.080 12.626 1.00 0.00 ? 32 ALA A C    9  
ATOM 9079  O O    . ALA A 1 62  ? 40.566 27.606 12.294 1.00 0.00 ? 32 ALA A O    9  
ATOM 9080  C CB   . ALA A 1 62  ? 39.170 24.609 12.713 1.00 0.00 ? 32 ALA A CB   9  
ATOM 9081  H H    . ALA A 1 62  ? 37.754 25.382 14.667 1.00 0.00 ? 32 ALA A H    9  
ATOM 9082  H HA   . ALA A 1 62  ? 40.462 25.742 13.984 1.00 0.00 ? 32 ALA A HA   9  
ATOM 9083  H HB1  . ALA A 1 62  ? 38.248 24.759 12.171 1.00 0.00 ? 32 ALA A HB1  9  
ATOM 9084  H HB2  . ALA A 1 62  ? 39.064 23.760 13.373 1.00 0.00 ? 32 ALA A HB2  9  
ATOM 9085  H HB3  . ALA A 1 62  ? 39.973 24.425 12.016 1.00 0.00 ? 32 ALA A HB3  9  
ATOM 9086  N N    . ALA A 1 63  ? 38.314 27.561 12.265 1.00 0.00 ? 33 ALA A N    9  
ATOM 9087  C CA   . ALA A 1 63  ? 38.222 28.737 11.409 1.00 0.00 ? 33 ALA A CA   9  
ATOM 9088  C C    . ALA A 1 63  ? 38.824 29.955 12.100 1.00 0.00 ? 33 ALA A C    9  
ATOM 9089  O O    . ALA A 1 63  ? 39.538 30.738 11.475 1.00 0.00 ? 33 ALA A O    9  
ATOM 9090  C CB   . ALA A 1 63  ? 36.759 29.016 11.062 1.00 0.00 ? 33 ALA A CB   9  
ATOM 9091  H H    . ALA A 1 63  ? 37.496 27.101 12.551 1.00 0.00 ? 33 ALA A H    9  
ATOM 9092  H HA   . ALA A 1 63  ? 38.766 28.548 10.495 1.00 0.00 ? 33 ALA A HA   9  
ATOM 9093  H HB1  . ALA A 1 63  ? 36.702 29.870 10.403 1.00 0.00 ? 33 ALA A HB1  9  
ATOM 9094  H HB2  . ALA A 1 63  ? 36.206 29.223 11.966 1.00 0.00 ? 33 ALA A HB2  9  
ATOM 9095  H HB3  . ALA A 1 63  ? 36.334 28.153 10.570 1.00 0.00 ? 33 ALA A HB3  9  
ATOM 9096  N N    . ALA A 1 64  ? 38.574 30.088 13.400 1.00 0.00 ? 34 ALA A N    9  
ATOM 9097  C CA   . ALA A 1 64  ? 39.096 31.229 14.145 1.00 0.00 ? 34 ALA A CA   9  
ATOM 9098  C C    . ALA A 1 64  ? 40.623 31.244 14.132 1.00 0.00 ? 34 ALA A C    9  
ATOM 9099  O O    . ALA A 1 64  ? 41.236 32.282 13.874 1.00 0.00 ? 34 ALA A O    9  
ATOM 9100  C CB   . ALA A 1 64  ? 38.578 31.180 15.586 1.00 0.00 ? 34 ALA A CB   9  
ATOM 9101  H H    . ALA A 1 64  ? 38.005 29.433 13.855 1.00 0.00 ? 34 ALA A H    9  
ATOM 9102  H HA   . ALA A 1 64  ? 38.738 32.136 13.681 1.00 0.00 ? 34 ALA A HA   9  
ATOM 9103  H HB1  . ALA A 1 64  ? 39.323 30.740 16.233 1.00 0.00 ? 34 ALA A HB1  9  
ATOM 9104  H HB2  . ALA A 1 64  ? 37.678 30.585 15.622 1.00 0.00 ? 34 ALA A HB2  9  
ATOM 9105  H HB3  . ALA A 1 64  ? 38.358 32.184 15.922 1.00 0.00 ? 34 ALA A HB3  9  
ATOM 9106  N N    . ILE A 1 65  ? 41.236 30.085 14.367 1.00 0.00 ? 35 ILE A N    9  
ATOM 9107  C CA   . ILE A 1 65  ? 42.693 30.006 14.365 1.00 0.00 ? 35 ILE A CA   9  
ATOM 9108  C C    . ILE A 1 65  ? 43.247 30.389 12.992 1.00 0.00 ? 35 ILE A C    9  
ATOM 9109  O O    . ILE A 1 65  ? 44.211 31.151 12.904 1.00 0.00 ? 35 ILE A O    9  
ATOM 9110  C CB   . ILE A 1 65  ? 43.137 28.588 14.756 1.00 0.00 ? 35 ILE A CB   9  
ATOM 9111  C CG1  . ILE A 1 65  ? 42.619 28.271 16.161 1.00 0.00 ? 35 ILE A CG1  9  
ATOM 9112  C CG2  . ILE A 1 65  ? 44.667 28.483 14.764 1.00 0.00 ? 35 ILE A CG2  9  
ATOM 9113  C CD1  . ILE A 1 65  ? 42.792 26.779 16.446 1.00 0.00 ? 35 ILE A CD1  9  
ATOM 9114  H H    . ILE A 1 65  ? 40.706 29.286 14.571 1.00 0.00 ? 35 ILE A H    9  
ATOM 9115  H HA   . ILE A 1 65  ? 43.078 30.702 15.097 1.00 0.00 ? 35 ILE A HA   9  
ATOM 9116  H HB   . ILE A 1 65  ? 42.731 27.877 14.053 1.00 0.00 ? 35 ILE A HB   9  
ATOM 9117  H HG12 . ILE A 1 65  ? 43.181 28.844 16.886 1.00 0.00 ? 35 ILE A HG12 9  
ATOM 9118  H HG13 . ILE A 1 65  ? 41.575 28.533 16.229 1.00 0.00 ? 35 ILE A HG13 9  
ATOM 9119  H HG21 . ILE A 1 65  ? 45.045 28.676 13.771 1.00 0.00 ? 35 ILE A HG21 9  
ATOM 9120  H HG22 . ILE A 1 65  ? 44.958 27.489 15.073 1.00 0.00 ? 35 ILE A HG22 9  
ATOM 9121  H HG23 . ILE A 1 65  ? 45.074 29.208 15.453 1.00 0.00 ? 35 ILE A HG23 9  
ATOM 9122  H HD11 . ILE A 1 65  ? 42.202 26.507 17.310 1.00 0.00 ? 35 ILE A HD11 9  
ATOM 9123  H HD12 . ILE A 1 65  ? 43.833 26.567 16.641 1.00 0.00 ? 35 ILE A HD12 9  
ATOM 9124  H HD13 . ILE A 1 65  ? 42.461 26.208 15.592 1.00 0.00 ? 35 ILE A HD13 9  
ATOM 9125  N N    . THR A 1 66  ? 42.626 29.883 11.927 1.00 0.00 ? 36 THR A N    9  
ATOM 9126  C CA   . THR A 1 66  ? 43.087 30.213 10.582 1.00 0.00 ? 36 THR A CA   9  
ATOM 9127  C C    . THR A 1 66  ? 42.990 31.717 10.330 1.00 0.00 ? 36 THR A C    9  
ATOM 9128  O O    . THR A 1 66  ? 43.915 32.331 9.795  1.00 0.00 ? 36 THR A O    9  
ATOM 9129  C CB   . THR A 1 66  ? 42.250 29.466 9.540  1.00 0.00 ? 36 THR A CB   9  
ATOM 9130  O OG1  . THR A 1 66  ? 42.118 28.105 9.921  1.00 0.00 ? 36 THR A OG1  9  
ATOM 9131  C CG2  . THR A 1 66  ? 42.950 29.545 8.183  1.00 0.00 ? 36 THR A CG2  9  
ATOM 9132  H H    . THR A 1 66  ? 41.875 29.262 12.047 1.00 0.00 ? 36 THR A H    9  
ATOM 9133  H HA   . THR A 1 66  ? 44.118 29.909 10.481 1.00 0.00 ? 36 THR A HA   9  
ATOM 9134  H HB   . THR A 1 66  ? 41.274 29.920 9.465  1.00 0.00 ? 36 THR A HB   9  
ATOM 9135  H HG1  . THR A 1 66  ? 41.612 27.691 9.301  1.00 0.00 ? 36 THR A HG1  9  
ATOM 9136  H HG21 . THR A 1 66  ? 43.957 29.165 8.274  1.00 0.00 ? 36 THR A HG21 9  
ATOM 9137  H HG22 . THR A 1 66  ? 42.981 30.572 7.854  1.00 0.00 ? 36 THR A HG22 9  
ATOM 9138  H HG23 . THR A 1 66  ? 42.405 28.952 7.463  1.00 0.00 ? 36 THR A HG23 9  
ATOM 9139  N N    . LEU A 1 67  ? 41.885 32.319 10.765 1.00 0.00 ? 37 LEU A N    9  
ATOM 9140  C CA   . LEU A 1 67  ? 41.701 33.758 10.597 1.00 0.00 ? 37 LEU A CA   9  
ATOM 9141  C C    . LEU A 1 67  ? 42.791 34.547 11.318 1.00 0.00 ? 37 LEU A C    9  
ATOM 9142  O O    . LEU A 1 67  ? 43.209 35.606 10.847 1.00 0.00 ? 37 LEU A O    9  
ATOM 9143  C CB   . LEU A 1 67  ? 40.327 34.171 11.126 1.00 0.00 ? 37 LEU A CB   9  
ATOM 9144  C CG   . LEU A 1 67  ? 39.241 33.575 10.229 1.00 0.00 ? 37 LEU A CG   9  
ATOM 9145  C CD1  . LEU A 1 67  ? 37.882 33.689 10.924 1.00 0.00 ? 37 LEU A CD1  9  
ATOM 9146  C CD2  . LEU A 1 67  ? 39.200 34.343 8.906  1.00 0.00 ? 37 LEU A CD2  9  
ATOM 9147  H H    . LEU A 1 67  ? 41.174 31.787 11.176 1.00 0.00 ? 37 LEU A H    9  
ATOM 9148  H HA   . LEU A 1 67  ? 41.747 33.991 9.544  1.00 0.00 ? 37 LEU A HA   9  
ATOM 9149  H HB2  . LEU A 1 67  ? 40.205 33.805 12.135 1.00 0.00 ? 37 LEU A HB2  9  
ATOM 9150  H HB3  . LEU A 1 67  ? 40.246 35.248 11.119 1.00 0.00 ? 37 LEU A HB3  9  
ATOM 9151  H HG   . LEU A 1 67  ? 39.461 32.536 10.036 1.00 0.00 ? 37 LEU A HG   9  
ATOM 9152  H HD11 . LEU A 1 67  ? 37.754 32.854 11.597 1.00 0.00 ? 37 LEU A HD11 9  
ATOM 9153  H HD12 . LEU A 1 67  ? 37.096 33.679 10.184 1.00 0.00 ? 37 LEU A HD12 9  
ATOM 9154  H HD13 . LEU A 1 67  ? 37.840 34.612 11.483 1.00 0.00 ? 37 LEU A HD13 9  
ATOM 9155  H HD21 . LEU A 1 67  ? 38.228 34.222 8.449  1.00 0.00 ? 37 LEU A HD21 9  
ATOM 9156  H HD22 . LEU A 1 67  ? 39.961 33.959 8.243  1.00 0.00 ? 37 LEU A HD22 9  
ATOM 9157  H HD23 . LEU A 1 67  ? 39.381 35.391 9.093  1.00 0.00 ? 37 LEU A HD23 9  
ATOM 9158  N N    . ASP A 1 68  ? 43.221 34.053 12.475 1.00 0.00 ? 38 ASP A N    9  
ATOM 9159  C CA   . ASP A 1 68  ? 44.333 34.674 13.185 1.00 0.00 ? 38 ASP A CA   9  
ATOM 9160  C C    . ASP A 1 68  ? 45.621 34.576 12.371 1.00 0.00 ? 38 ASP A C    9  
ATOM 9161  O O    . ASP A 1 68  ? 46.337 35.563 12.206 1.00 0.00 ? 38 ASP A O    9  
ATOM 9162  C CB   . ASP A 1 68  ? 44.531 33.987 14.539 1.00 0.00 ? 38 ASP A CB   9  
ATOM 9163  C CG   . ASP A 1 68  ? 45.567 34.737 15.372 1.00 0.00 ? 38 ASP A CG   9  
ATOM 9164  O OD1  . ASP A 1 68  ? 46.258 34.090 16.140 1.00 0.00 ? 38 ASP A OD1  9  
ATOM 9165  O OD2  . ASP A 1 68  ? 45.650 35.947 15.236 1.00 0.00 ? 38 ASP A OD2  9  
ATOM 9166  H H    . ASP A 1 68  ? 42.754 33.289 12.878 1.00 0.00 ? 38 ASP A H    9  
ATOM 9167  H HA   . ASP A 1 68  ? 44.103 35.715 13.354 1.00 0.00 ? 38 ASP A HA   9  
ATOM 9168  H HB2  . ASP A 1 68  ? 43.591 33.969 15.069 1.00 0.00 ? 38 ASP A HB2  9  
ATOM 9169  H HB3  . ASP A 1 68  ? 44.869 32.974 14.378 1.00 0.00 ? 38 ASP A HB3  9  
ATOM 9170  N N    . LYS A 1 69  ? 45.908 33.380 11.864 1.00 0.00 ? 39 LYS A N    9  
ATOM 9171  C CA   . LYS A 1 69  ? 47.113 33.169 11.065 1.00 0.00 ? 39 LYS A CA   9  
ATOM 9172  C C    . LYS A 1 69  ? 47.141 34.043 9.812  1.00 0.00 ? 39 LYS A C    9  
ATOM 9173  O O    . LYS A 1 69  ? 48.216 34.407 9.334  1.00 0.00 ? 39 LYS A O    9  
ATOM 9174  C CB   . LYS A 1 69  ? 47.218 31.698 10.656 1.00 0.00 ? 39 LYS A CB   9  
ATOM 9175  C CG   . LYS A 1 69  ? 47.427 30.833 11.900 1.00 0.00 ? 39 LYS A CG   9  
ATOM 9176  C CD   . LYS A 1 69  ? 47.642 29.376 11.479 1.00 0.00 ? 39 LYS A CD   9  
ATOM 9177  C CE   . LYS A 1 69  ? 47.749 28.487 12.721 1.00 0.00 ? 39 LYS A CE   9  
ATOM 9178  N NZ   . LYS A 1 69  ? 49.162 28.458 13.191 1.00 0.00 ? 39 LYS A NZ   9  
ATOM 9179  H H    . LYS A 1 69  ? 45.315 32.622 12.053 1.00 0.00 ? 39 LYS A H    9  
ATOM 9180  H HA   . LYS A 1 69  ? 47.973 33.413 11.671 1.00 0.00 ? 39 LYS A HA   9  
ATOM 9181  H HB2  . LYS A 1 69  ? 46.308 31.399 10.156 1.00 0.00 ? 39 LYS A HB2  9  
ATOM 9182  H HB3  . LYS A 1 69  ? 48.056 31.570 9.987  1.00 0.00 ? 39 LYS A HB3  9  
ATOM 9183  H HG2  . LYS A 1 69  ? 48.293 31.184 12.441 1.00 0.00 ? 39 LYS A HG2  9  
ATOM 9184  H HG3  . LYS A 1 69  ? 46.555 30.896 12.534 1.00 0.00 ? 39 LYS A HG3  9  
ATOM 9185  H HD2  . LYS A 1 69  ? 46.809 29.052 10.873 1.00 0.00 ? 39 LYS A HD2  9  
ATOM 9186  H HD3  . LYS A 1 69  ? 48.555 29.300 10.907 1.00 0.00 ? 39 LYS A HD3  9  
ATOM 9187  H HE2  . LYS A 1 69  ? 47.117 28.879 13.503 1.00 0.00 ? 39 LYS A HE2  9  
ATOM 9188  H HE3  . LYS A 1 69  ? 47.433 27.485 12.472 1.00 0.00 ? 39 LYS A HE3  9  
ATOM 9189  H HZ1  . LYS A 1 69  ? 49.791 28.255 12.389 1.00 0.00 ? 39 LYS A HZ1  9  
ATOM 9190  H HZ2  . LYS A 1 69  ? 49.271 27.718 13.915 1.00 0.00 ? 39 LYS A HZ2  9  
ATOM 9191  H HZ3  . LYS A 1 69  ? 49.411 29.381 13.598 1.00 0.00 ? 39 LYS A HZ3  9  
ATOM 9192  N N    . TYR A 1 70  ? 45.968 34.382 9.277  1.00 0.00 ? 40 TYR A N    9  
ATOM 9193  C CA   . TYR A 1 70  ? 45.902 35.219 8.081  1.00 0.00 ? 40 TYR A CA   9  
ATOM 9194  C C    . TYR A 1 70  ? 46.634 36.549 8.324  1.00 0.00 ? 40 TYR A C    9  
ATOM 9195  O O    . TYR A 1 70  ? 46.384 37.194 9.344  1.00 0.00 ? 40 TYR A O    9  
ATOM 9196  C CB   . TYR A 1 70  ? 44.427 35.475 7.762  1.00 0.00 ? 40 TYR A CB   9  
ATOM 9197  C CG   . TYR A 1 70  ? 44.141 35.741 6.304  1.00 0.00 ? 40 TYR A CG   9  
ATOM 9198  C CD1  . TYR A 1 70  ? 44.261 34.711 5.364  1.00 0.00 ? 40 TYR A CD1  9  
ATOM 9199  C CD2  . TYR A 1 70  ? 43.721 37.013 5.899  1.00 0.00 ? 40 TYR A CD2  9  
ATOM 9200  C CE1  . TYR A 1 70  ? 43.966 34.955 4.017  1.00 0.00 ? 40 TYR A CE1  9  
ATOM 9201  C CE2  . TYR A 1 70  ? 43.428 37.257 4.553  1.00 0.00 ? 40 TYR A CE2  9  
ATOM 9202  C CZ   . TYR A 1 70  ? 43.550 36.229 3.611  1.00 0.00 ? 40 TYR A CZ   9  
ATOM 9203  O OH   . TYR A 1 70  ? 43.259 36.470 2.284  1.00 0.00 ? 40 TYR A OH   9  
ATOM 9204  H H    . TYR A 1 70  ? 45.142 34.012 9.656  1.00 0.00 ? 40 TYR A H    9  
ATOM 9205  H HA   . TYR A 1 70  ? 46.346 34.674 7.266  1.00 0.00 ? 40 TYR A HA   9  
ATOM 9206  H HB2  . TYR A 1 70  ? 43.856 34.610 8.063  1.00 0.00 ? 40 TYR A HB2  9  
ATOM 9207  H HB3  . TYR A 1 70  ? 44.095 36.321 8.346  1.00 0.00 ? 40 TYR A HB3  9  
ATOM 9208  H HD1  . TYR A 1 70  ? 44.585 33.729 5.677  1.00 0.00 ? 40 TYR A HD1  9  
ATOM 9209  H HD2  . TYR A 1 70  ? 43.626 37.805 6.625  1.00 0.00 ? 40 TYR A HD2  9  
ATOM 9210  H HE1  . TYR A 1 70  ? 44.058 34.160 3.291  1.00 0.00 ? 40 TYR A HE1  9  
ATOM 9211  H HE2  . TYR A 1 70  ? 43.102 38.238 4.243  1.00 0.00 ? 40 TYR A HE2  9  
ATOM 9212  H HH   . TYR A 1 70  ? 42.770 37.224 2.239  1.00 0.00 ? 40 TYR A HH   9  
ATOM 9213  N N    . PRO A 1 71  ? 47.516 36.985 7.443  1.00 0.00 ? 41 PRO A N    9  
ATOM 9214  C CA   . PRO A 1 71  ? 48.335 38.209 7.695  1.00 0.00 ? 41 PRO A CA   9  
ATOM 9215  C C    . PRO A 1 71  ? 47.646 39.521 7.323  1.00 0.00 ? 41 PRO A C    9  
ATOM 9216  O O    . PRO A 1 71  ? 48.308 40.558 7.250  1.00 0.00 ? 41 PRO A O    9  
ATOM 9217  C CB   . PRO A 1 71  ? 49.567 37.985 6.821  1.00 0.00 ? 41 PRO A CB   9  
ATOM 9218  C CG   . PRO A 1 71  ? 49.086 37.185 5.657  1.00 0.00 ? 41 PRO A CG   9  
ATOM 9219  C CD   . PRO A 1 71  ? 47.826 36.439 6.107  1.00 0.00 ? 41 PRO A CD   9  
ATOM 9220  H HA   . PRO A 1 71  ? 48.642 38.238 8.728  1.00 0.00 ? 41 PRO A HA   9  
ATOM 9221  H HB2  . PRO A 1 71  ? 49.968 38.933 6.491  1.00 0.00 ? 41 PRO A HB2  9  
ATOM 9222  H HB3  . PRO A 1 71  ? 50.316 37.427 7.363  1.00 0.00 ? 41 PRO A HB3  9  
ATOM 9223  H HG2  . PRO A 1 71  ? 48.853 37.845 4.831  1.00 0.00 ? 41 PRO A HG2  9  
ATOM 9224  H HG3  . PRO A 1 71  ? 49.839 36.472 5.360  1.00 0.00 ? 41 PRO A HG3  9  
ATOM 9225  H HD2  . PRO A 1 71  ? 47.014 36.628 5.420  1.00 0.00 ? 41 PRO A HD2  9  
ATOM 9226  H HD3  . PRO A 1 71  ? 48.022 35.380 6.180  1.00 0.00 ? 41 PRO A HD3  9  
ATOM 9227  N N    . HIS A 1 72  ? 46.335 39.491 7.091  1.00 0.00 ? 42 HIS A N    9  
ATOM 9228  C CA   . HIS A 1 72  ? 45.634 40.692 6.639  1.00 0.00 ? 42 HIS A CA   9  
ATOM 9229  C C    . HIS A 1 72  ? 44.229 40.789 7.221  1.00 0.00 ? 42 HIS A C    9  
ATOM 9230  O O    . HIS A 1 72  ? 43.586 39.774 7.493  1.00 0.00 ? 42 HIS A O    9  
ATOM 9231  C CB   . HIS A 1 72  ? 45.548 40.694 5.112  1.00 0.00 ? 42 HIS A CB   9  
ATOM 9232  C CG   . HIS A 1 72  ? 46.893 40.730 4.437  1.00 0.00 ? 42 HIS A CG   9  
ATOM 9233  N ND1  . HIS A 1 72  ? 47.727 41.834 4.512  1.00 0.00 ? 42 HIS A ND1  9  
ATOM 9234  C CD2  . HIS A 1 72  ? 47.560 39.807 3.670  1.00 0.00 ? 42 HIS A CD2  9  
ATOM 9235  C CE1  . HIS A 1 72  ? 48.839 41.551 3.810  1.00 0.00 ? 42 HIS A CE1  9  
ATOM 9236  N NE2  . HIS A 1 72  ? 48.790 40.328 3.274  1.00 0.00 ? 42 HIS A NE2  9  
ATOM 9237  H H    . HIS A 1 72  ? 45.837 38.657 7.224  1.00 0.00 ? 42 HIS A H    9  
ATOM 9238  H HA   . HIS A 1 72  ? 46.196 41.560 6.950  1.00 0.00 ? 42 HIS A HA   9  
ATOM 9239  H HB2  . HIS A 1 72  ? 45.031 39.802 4.793  1.00 0.00 ? 42 HIS A HB2  9  
ATOM 9240  H HB3  . HIS A 1 72  ? 44.974 41.554 4.801  1.00 0.00 ? 42 HIS A HB3  9  
ATOM 9241  H HD1  . HIS A 1 72  ? 47.541 42.669 4.991  1.00 0.00 ? 42 HIS A HD1  9  
ATOM 9242  H HD2  . HIS A 1 72  ? 47.188 38.826 3.412  1.00 0.00 ? 42 HIS A HD2  9  
ATOM 9243  H HE1  . HIS A 1 72  ? 49.670 42.230 3.692  1.00 0.00 ? 42 HIS A HE1  9  
ATOM 9244  N N    . LYS A 1 73  ? 43.768 42.017 7.443  1.00 0.00 ? 43 LYS A N    9  
ATOM 9245  C CA   . LYS A 1 73  ? 42.373 42.233 7.797  1.00 0.00 ? 43 LYS A CA   9  
ATOM 9246  C C    . LYS A 1 73  ? 41.487 41.784 6.640  1.00 0.00 ? 43 LYS A C    9  
ATOM 9247  O O    . LYS A 1 73  ? 41.729 42.165 5.494  1.00 0.00 ? 43 LYS A O    9  
ATOM 9248  C CB   . LYS A 1 73  ? 42.122 43.719 8.061  1.00 0.00 ? 43 LYS A CB   9  
ATOM 9249  C CG   . LYS A 1 73  ? 40.719 43.907 8.640  1.00 0.00 ? 43 LYS A CG   9  
ATOM 9250  C CD   . LYS A 1 73  ? 40.438 45.400 8.827  1.00 0.00 ? 43 LYS A CD   9  
ATOM 9251  C CE   . LYS A 1 73  ? 39.101 45.583 9.546  1.00 0.00 ? 43 LYS A CE   9  
ATOM 9252  N NZ   . LYS A 1 73  ? 37.991 45.525 8.553  1.00 0.00 ? 43 LYS A NZ   9  
ATOM 9253  H H    . LYS A 1 73  ? 44.377 42.785 7.378  1.00 0.00 ? 43 LYS A H    9  
ATOM 9254  H HA   . LYS A 1 73  ? 42.130 41.663 8.682  1.00 0.00 ? 43 LYS A HA   9  
ATOM 9255  H HB2  . LYS A 1 73  ? 42.857 44.095 8.757  1.00 0.00 ? 43 LYS A HB2  9  
ATOM 9256  H HB3  . LYS A 1 73  ? 42.198 44.264 7.133  1.00 0.00 ? 43 LYS A HB3  9  
ATOM 9257  H HG2  . LYS A 1 73  ? 39.991 43.485 7.961  1.00 0.00 ? 43 LYS A HG2  9  
ATOM 9258  H HG3  . LYS A 1 73  ? 40.653 43.409 9.595  1.00 0.00 ? 43 LYS A HG3  9  
ATOM 9259  H HD2  . LYS A 1 73  ? 41.229 45.842 9.415  1.00 0.00 ? 43 LYS A HD2  9  
ATOM 9260  H HD3  . LYS A 1 73  ? 40.394 45.882 7.862  1.00 0.00 ? 43 LYS A HD3  9  
ATOM 9261  H HE2  . LYS A 1 73  ? 38.973 44.796 10.274 1.00 0.00 ? 43 LYS A HE2  9  
ATOM 9262  H HE3  . LYS A 1 73  ? 39.089 46.541 10.044 1.00 0.00 ? 43 LYS A HE3  9  
ATOM 9263  H HZ1  . LYS A 1 73  ? 37.884 44.551 8.207  1.00 0.00 ? 43 LYS A HZ1  9  
ATOM 9264  H HZ2  . LYS A 1 73  ? 38.209 46.155 7.754  1.00 0.00 ? 43 LYS A HZ2  9  
ATOM 9265  H HZ3  . LYS A 1 73  ? 37.105 45.830 9.004  1.00 0.00 ? 43 LYS A HZ3  9  
ATOM 9266  N N    . ILE A 1 74  ? 40.471 40.978 6.933  1.00 0.00 ? 44 ILE A N    9  
ATOM 9267  C CA   . ILE A 1 74  ? 39.529 40.565 5.895  1.00 0.00 ? 44 ILE A CA   9  
ATOM 9268  C C    . ILE A 1 74  ? 38.356 41.540 5.825  1.00 0.00 ? 44 ILE A C    9  
ATOM 9269  O O    . ILE A 1 74  ? 37.728 41.846 6.838  1.00 0.00 ? 44 ILE A O    9  
ATOM 9270  C CB   . ILE A 1 74  ? 39.057 39.129 6.156  1.00 0.00 ? 44 ILE A CB   9  
ATOM 9271  C CG1  . ILE A 1 74  ? 40.282 38.207 6.153  1.00 0.00 ? 44 ILE A CG1  9  
ATOM 9272  C CG2  . ILE A 1 74  ? 38.084 38.684 5.059  1.00 0.00 ? 44 ILE A CG2  9  
ATOM 9273  C CD1  . ILE A 1 74  ? 39.876 36.782 6.531  1.00 0.00 ? 44 ILE A CD1  9  
ATOM 9274  H H    . ILE A 1 74  ? 40.364 40.646 7.852  1.00 0.00 ? 44 ILE A H    9  
ATOM 9275  H HA   . ILE A 1 74  ? 40.043 40.585 4.944  1.00 0.00 ? 44 ILE A HA   9  
ATOM 9276  H HB   . ILE A 1 74  ? 38.567 39.077 7.118  1.00 0.00 ? 44 ILE A HB   9  
ATOM 9277  H HG12 . ILE A 1 74  ? 40.723 38.203 5.166  1.00 0.00 ? 44 ILE A HG12 9  
ATOM 9278  H HG13 . ILE A 1 74  ? 41.006 38.572 6.866  1.00 0.00 ? 44 ILE A HG13 9  
ATOM 9279  H HG21 . ILE A 1 74  ? 37.775 37.665 5.240  1.00 0.00 ? 44 ILE A HG21 9  
ATOM 9280  H HG22 . ILE A 1 74  ? 38.574 38.745 4.098  1.00 0.00 ? 44 ILE A HG22 9  
ATOM 9281  H HG23 . ILE A 1 74  ? 37.219 39.328 5.064  1.00 0.00 ? 44 ILE A HG23 9  
ATOM 9282  H HD11 . ILE A 1 74  ? 39.151 36.414 5.821  1.00 0.00 ? 44 ILE A HD11 9  
ATOM 9283  H HD12 . ILE A 1 74  ? 39.447 36.781 7.521  1.00 0.00 ? 44 ILE A HD12 9  
ATOM 9284  H HD13 . ILE A 1 74  ? 40.751 36.148 6.514  1.00 0.00 ? 44 ILE A HD13 9  
ATOM 9285  N N    . LYS A 1 75  ? 38.068 42.024 4.618  1.00 0.00 ? 45 LYS A N    9  
ATOM 9286  C CA   . LYS A 1 75  ? 36.993 42.996 4.427  1.00 0.00 ? 45 LYS A CA   9  
ATOM 9287  C C    . LYS A 1 75  ? 35.610 42.348 4.299  1.00 0.00 ? 45 LYS A C    9  
ATOM 9288  O O    . LYS A 1 75  ? 34.596 43.024 4.489  1.00 0.00 ? 45 LYS A O    9  
ATOM 9289  C CB   . LYS A 1 75  ? 37.301 43.870 3.204  1.00 0.00 ? 45 LYS A CB   9  
ATOM 9290  C CG   . LYS A 1 75  ? 37.214 43.055 1.909  1.00 0.00 ? 45 LYS A CG   9  
ATOM 9291  C CD   . LYS A 1 75  ? 37.650 43.926 0.729  1.00 0.00 ? 45 LYS A CD   9  
ATOM 9292  C CE   . LYS A 1 75  ? 37.271 43.239 -0.584 1.00 0.00 ? 45 LYS A CE   9  
ATOM 9293  N NZ   . LYS A 1 75  ? 37.166 44.258 -1.666 1.00 0.00 ? 45 LYS A NZ   9  
ATOM 9294  H H    . LYS A 1 75  ? 38.587 41.724 3.844  1.00 0.00 ? 45 LYS A H    9  
ATOM 9295  H HA   . LYS A 1 75  ? 36.975 43.640 5.295  1.00 0.00 ? 45 LYS A HA   9  
ATOM 9296  H HB2  . LYS A 1 75  ? 36.590 44.682 3.161  1.00 0.00 ? 45 LYS A HB2  9  
ATOM 9297  H HB3  . LYS A 1 75  ? 38.297 44.278 3.301  1.00 0.00 ? 45 LYS A HB3  9  
ATOM 9298  H HG2  . LYS A 1 75  ? 37.861 42.193 1.981  1.00 0.00 ? 45 LYS A HG2  9  
ATOM 9299  H HG3  . LYS A 1 75  ? 36.195 42.730 1.755  1.00 0.00 ? 45 LYS A HG3  9  
ATOM 9300  H HD2  . LYS A 1 75  ? 37.157 44.886 0.790  1.00 0.00 ? 45 LYS A HD2  9  
ATOM 9301  H HD3  . LYS A 1 75  ? 38.720 44.067 0.762  1.00 0.00 ? 45 LYS A HD3  9  
ATOM 9302  H HE2  . LYS A 1 75  ? 38.029 42.516 -0.843 1.00 0.00 ? 45 LYS A HE2  9  
ATOM 9303  H HE3  . LYS A 1 75  ? 36.320 42.739 -0.467 1.00 0.00 ? 45 LYS A HE3  9  
ATOM 9304  H HZ1  . LYS A 1 75  ? 37.751 45.083 -1.424 1.00 0.00 ? 45 LYS A HZ1  9  
ATOM 9305  H HZ2  . LYS A 1 75  ? 36.174 44.554 -1.768 1.00 0.00 ? 45 LYS A HZ2  9  
ATOM 9306  H HZ3  . LYS A 1 75  ? 37.501 43.850 -2.562 1.00 0.00 ? 45 LYS A HZ3  9  
ATOM 9307  N N    . SER A 1 76  ? 35.557 41.058 3.966  1.00 0.00 ? 46 SER A N    9  
ATOM 9308  C CA   . SER A 1 76  ? 34.276 40.374 3.816  1.00 0.00 ? 46 SER A CA   9  
ATOM 9309  C C    . SER A 1 76  ? 34.407 38.881 4.100  1.00 0.00 ? 46 SER A C    9  
ATOM 9310  O O    . SER A 1 76  ? 35.480 38.298 3.951  1.00 0.00 ? 46 SER A O    9  
ATOM 9311  C CB   . SER A 1 76  ? 33.745 40.577 2.397  1.00 0.00 ? 46 SER A CB   9  
ATOM 9312  O OG   . SER A 1 76  ? 34.566 39.859 1.485  1.00 0.00 ? 46 SER A OG   9  
ATOM 9313  H H    . SER A 1 76  ? 36.390 40.565 3.814  1.00 0.00 ? 46 SER A H    9  
ATOM 9314  H HA   . SER A 1 76  ? 33.571 40.801 4.512  1.00 0.00 ? 46 SER A HA   9  
ATOM 9315  H HB2  . SER A 1 76  ? 32.735 40.207 2.328  1.00 0.00 ? 46 SER A HB2  9  
ATOM 9316  H HB3  . SER A 1 76  ? 33.754 41.633 2.159  1.00 0.00 ? 46 SER A HB3  9  
ATOM 9317  H HG   . SER A 1 76  ? 34.617 40.336 0.723  1.00 0.00 ? 46 SER A HG   9  
ATOM 9318  N N    . GLY A 1 77  ? 33.298 38.272 4.507  1.00 0.00 ? 47 GLY A N    9  
ATOM 9319  C CA   . GLY A 1 77  ? 33.261 36.834 4.765  1.00 0.00 ? 47 GLY A CA   9  
ATOM 9320  C C    . GLY A 1 77  ? 33.552 36.016 3.505  1.00 0.00 ? 47 GLY A C    9  
ATOM 9321  O O    . GLY A 1 77  ? 34.105 34.916 3.583  1.00 0.00 ? 47 GLY A O    9  
ATOM 9322  H H    . GLY A 1 77  ? 32.476 38.792 4.619  1.00 0.00 ? 47 GLY A H    9  
ATOM 9323  H HA2  . GLY A 1 77  ? 33.997 36.594 5.518  1.00 0.00 ? 47 GLY A HA2  9  
ATOM 9324  H HA3  . GLY A 1 77  ? 32.281 36.568 5.133  1.00 0.00 ? 47 GLY A HA3  9  
ATOM 9325  N N    . ALA A 1 78  ? 33.191 36.554 2.339  1.00 0.00 ? 48 ALA A N    9  
ATOM 9326  C CA   . ALA A 1 78  ? 33.359 35.814 1.094  1.00 0.00 ? 48 ALA A CA   9  
ATOM 9327  C C    . ALA A 1 78  ? 34.824 35.445 0.898  1.00 0.00 ? 48 ALA A C    9  
ATOM 9328  O O    . ALA A 1 78  ? 35.139 34.322 0.503  1.00 0.00 ? 48 ALA A O    9  
ATOM 9329  C CB   . ALA A 1 78  ? 32.881 36.661 -0.088 1.00 0.00 ? 48 ALA A CB   9  
ATOM 9330  H H    . ALA A 1 78  ? 32.809 37.456 2.319  1.00 0.00 ? 48 ALA A H    9  
ATOM 9331  H HA   . ALA A 1 78  ? 32.769 34.912 1.139  1.00 0.00 ? 48 ALA A HA   9  
ATOM 9332  H HB1  . ALA A 1 78  ? 31.958 37.157 0.174  1.00 0.00 ? 48 ALA A HB1  9  
ATOM 9333  H HB2  . ALA A 1 78  ? 32.716 36.024 -0.944 1.00 0.00 ? 48 ALA A HB2  9  
ATOM 9334  H HB3  . ALA A 1 78  ? 33.630 37.400 -0.328 1.00 0.00 ? 48 ALA A HB3  9  
ATOM 9335  N N    . GLU A 1 79  ? 35.716 36.391 1.176  1.00 0.00 ? 49 GLU A N    9  
ATOM 9336  C CA   . GLU A 1 79  ? 37.140 36.080 1.204  1.00 0.00 ? 49 GLU A CA   9  
ATOM 9337  C C    . GLU A 1 79  ? 37.454 35.046 2.287  1.00 0.00 ? 49 GLU A C    9  
ATOM 9338  O O    . GLU A 1 79  ? 38.256 34.137 2.069  1.00 0.00 ? 49 GLU A O    9  
ATOM 9339  C CB   . GLU A 1 79  ? 37.950 37.351 1.466  1.00 0.00 ? 49 GLU A CB   9  
ATOM 9340  C CG   . GLU A 1 79  ? 37.759 38.331 0.302  1.00 0.00 ? 49 GLU A CG   9  
ATOM 9341  C CD   . GLU A 1 79  ? 38.617 39.589 0.472  1.00 0.00 ? 49 GLU A CD   9  
ATOM 9342  O OE1  . GLU A 1 79  ? 39.176 39.792 1.541  1.00 0.00 ? 49 GLU A OE1  9  
ATOM 9343  O OE2  . GLU A 1 79  ? 38.707 40.340 -0.485 1.00 0.00 ? 49 GLU A OE2  9  
ATOM 9344  H H    . GLU A 1 79  ? 35.414 37.305 1.364  1.00 0.00 ? 49 GLU A H    9  
ATOM 9345  H HA   . GLU A 1 79  ? 37.428 35.678 0.244  1.00 0.00 ? 49 GLU A HA   9  
ATOM 9346  H HB2  . GLU A 1 79  ? 37.612 37.809 2.384  1.00 0.00 ? 49 GLU A HB2  9  
ATOM 9347  H HB3  . GLU A 1 79  ? 38.997 37.100 1.552  1.00 0.00 ? 49 GLU A HB3  9  
ATOM 9348  H HG2  . GLU A 1 79  ? 38.033 37.841 -0.620 1.00 0.00 ? 49 GLU A HG2  9  
ATOM 9349  H HG3  . GLU A 1 79  ? 36.719 38.618 0.251  1.00 0.00 ? 49 GLU A HG3  9  
ATOM 9350  N N    . ALA A 1 80  ? 36.739 35.111 3.409  1.00 0.00 ? 50 ALA A N    9  
ATOM 9351  C CA   . ALA A 1 80  ? 37.023 34.228 4.535  1.00 0.00 ? 50 ALA A CA   9  
ATOM 9352  C C    . ALA A 1 80  ? 36.857 32.758 4.150  1.00 0.00 ? 50 ALA A C    9  
ATOM 9353  O O    . ALA A 1 80  ? 37.631 31.908 4.591  1.00 0.00 ? 50 ALA A O    9  
ATOM 9354  C CB   . ALA A 1 80  ? 36.090 34.556 5.702  1.00 0.00 ? 50 ALA A CB   9  
ATOM 9355  H H    . ALA A 1 80  ? 36.014 35.768 3.485  1.00 0.00 ? 50 ALA A H    9  
ATOM 9356  H HA   . ALA A 1 80  ? 38.042 34.389 4.855  1.00 0.00 ? 50 ALA A HA   9  
ATOM 9357  H HB1  . ALA A 1 80  ? 35.129 34.092 5.534  1.00 0.00 ? 50 ALA A HB1  9  
ATOM 9358  H HB2  . ALA A 1 80  ? 35.965 35.626 5.773  1.00 0.00 ? 50 ALA A HB2  9  
ATOM 9359  H HB3  . ALA A 1 80  ? 36.516 34.180 6.620  1.00 0.00 ? 50 ALA A HB3  9  
ATOM 9360  N N    . LYS A 1 81  ? 35.906 32.472 3.266  1.00 0.00 ? 51 LYS A N    9  
ATOM 9361  C CA   . LYS A 1 81  ? 35.673 31.093 2.838  1.00 0.00 ? 51 LYS A CA   9  
ATOM 9362  C C    . LYS A 1 81  ? 36.933 30.462 2.240  1.00 0.00 ? 51 LYS A C    9  
ATOM 9363  O O    . LYS A 1 81  ? 37.108 29.246 2.314  1.00 0.00 ? 51 LYS A O    9  
ATOM 9364  C CB   . LYS A 1 81  ? 34.551 31.038 1.798  1.00 0.00 ? 51 LYS A CB   9  
ATOM 9365  C CG   . LYS A 1 81  ? 33.257 31.586 2.403  1.00 0.00 ? 51 LYS A CG   9  
ATOM 9366  C CD   . LYS A 1 81  ? 32.076 31.258 1.486  1.00 0.00 ? 51 LYS A CD   9  
ATOM 9367  C CE   . LYS A 1 81  ? 32.237 31.975 0.143  1.00 0.00 ? 51 LYS A CE   9  
ATOM 9368  N NZ   . LYS A 1 81  ? 31.045 31.709 -0.709 1.00 0.00 ? 51 LYS A NZ   9  
ATOM 9369  H H    . LYS A 1 81  ? 35.317 33.191 2.947  1.00 0.00 ? 51 LYS A H    9  
ATOM 9370  H HA   . LYS A 1 81  ? 35.372 30.512 3.696  1.00 0.00 ? 51 LYS A HA   9  
ATOM 9371  H HB2  . LYS A 1 81  ? 34.828 31.633 0.940  1.00 0.00 ? 51 LYS A HB2  9  
ATOM 9372  H HB3  . LYS A 1 81  ? 34.395 30.014 1.492  1.00 0.00 ? 51 LYS A HB3  9  
ATOM 9373  H HG2  . LYS A 1 81  ? 33.099 31.137 3.372  1.00 0.00 ? 51 LYS A HG2  9  
ATOM 9374  H HG3  . LYS A 1 81  ? 33.337 32.658 2.513  1.00 0.00 ? 51 LYS A HG3  9  
ATOM 9375  H HD2  . LYS A 1 81  ? 32.039 30.190 1.319  1.00 0.00 ? 51 LYS A HD2  9  
ATOM 9376  H HD3  . LYS A 1 81  ? 31.158 31.580 1.954  1.00 0.00 ? 51 LYS A HD3  9  
ATOM 9377  H HE2  . LYS A 1 81  ? 32.328 33.037 0.311  1.00 0.00 ? 51 LYS A HE2  9  
ATOM 9378  H HE3  . LYS A 1 81  ? 33.124 31.613 -0.355 1.00 0.00 ? 51 LYS A HE3  9  
ATOM 9379  H HZ1  . LYS A 1 81  ? 30.727 32.595 -1.150 1.00 0.00 ? 51 LYS A HZ1  9  
ATOM 9380  H HZ2  . LYS A 1 81  ? 30.279 31.319 -0.121 1.00 0.00 ? 51 LYS A HZ2  9  
ATOM 9381  H HZ3  . LYS A 1 81  ? 31.295 31.025 -1.451 1.00 0.00 ? 51 LYS A HZ3  9  
ATOM 9382  N N    . LYS A 1 82  ? 37.807 31.275 1.649  1.00 0.00 ? 52 LYS A N    9  
ATOM 9383  C CA   . LYS A 1 82  ? 39.023 30.754 1.032  1.00 0.00 ? 52 LYS A CA   9  
ATOM 9384  C C    . LYS A 1 82  ? 39.925 30.032 2.038  1.00 0.00 ? 52 LYS A C    9  
ATOM 9385  O O    . LYS A 1 82  ? 40.728 29.184 1.648  1.00 0.00 ? 52 LYS A O    9  
ATOM 9386  C CB   . LYS A 1 82  ? 39.805 31.903 0.389  1.00 0.00 ? 52 LYS A CB   9  
ATOM 9387  C CG   . LYS A 1 82  ? 38.979 32.511 -0.746 1.00 0.00 ? 52 LYS A CG   9  
ATOM 9388  C CD   . LYS A 1 82  ? 39.802 33.589 -1.455 1.00 0.00 ? 52 LYS A CD   9  
ATOM 9389  C CE   . LYS A 1 82  ? 38.937 34.282 -2.509 1.00 0.00 ? 52 LYS A CE   9  
ATOM 9390  N NZ   . LYS A 1 82  ? 38.713 33.356 -3.655 1.00 0.00 ? 52 LYS A NZ   9  
ATOM 9391  H H    . LYS A 1 82  ? 37.657 32.244 1.664  1.00 0.00 ? 52 LYS A H    9  
ATOM 9392  H HA   . LYS A 1 82  ? 38.745 30.056 0.257  1.00 0.00 ? 52 LYS A HA   9  
ATOM 9393  H HB2  . LYS A 1 82  ? 40.008 32.659 1.134  1.00 0.00 ? 52 LYS A HB2  9  
ATOM 9394  H HB3  . LYS A 1 82  ? 40.735 31.528 -0.007 1.00 0.00 ? 52 LYS A HB3  9  
ATOM 9395  H HG2  . LYS A 1 82  ? 38.713 31.737 -1.451 1.00 0.00 ? 52 LYS A HG2  9  
ATOM 9396  H HG3  . LYS A 1 82  ? 38.082 32.956 -0.342 1.00 0.00 ? 52 LYS A HG3  9  
ATOM 9397  H HD2  . LYS A 1 82  ? 40.142 34.316 -0.731 1.00 0.00 ? 52 LYS A HD2  9  
ATOM 9398  H HD3  . LYS A 1 82  ? 40.655 33.134 -1.936 1.00 0.00 ? 52 LYS A HD3  9  
ATOM 9399  H HE2  . LYS A 1 82  ? 37.987 34.554 -2.074 1.00 0.00 ? 52 LYS A HE2  9  
ATOM 9400  H HE3  . LYS A 1 82  ? 39.440 35.172 -2.859 1.00 0.00 ? 52 LYS A HE3  9  
ATOM 9401  H HZ1  . LYS A 1 82  ? 38.003 33.763 -4.296 1.00 0.00 ? 52 LYS A HZ1  9  
ATOM 9402  H HZ2  . LYS A 1 82  ? 38.374 32.439 -3.297 1.00 0.00 ? 52 LYS A HZ2  9  
ATOM 9403  H HZ3  . LYS A 1 82  ? 39.605 33.219 -4.172 1.00 0.00 ? 52 LYS A HZ3  9  
ATOM 9404  N N    . LEU A 1 83  ? 39.800 30.358 3.326  1.00 0.00 ? 53 LEU A N    9  
ATOM 9405  C CA   . LEU A 1 83  ? 40.720 29.829 4.326  1.00 0.00 ? 53 LEU A CA   9  
ATOM 9406  C C    . LEU A 1 83  ? 40.271 28.444 4.812  1.00 0.00 ? 53 LEU A C    9  
ATOM 9407  O O    . LEU A 1 83  ? 39.077 28.251 5.069  1.00 0.00 ? 53 LEU A O    9  
ATOM 9408  C CB   . LEU A 1 83  ? 40.783 30.792 5.513  1.00 0.00 ? 53 LEU A CB   9  
ATOM 9409  C CG   . LEU A 1 83  ? 41.624 32.013 5.134  1.00 0.00 ? 53 LEU A CG   9  
ATOM 9410  C CD1  . LEU A 1 83  ? 41.297 33.172 6.078  1.00 0.00 ? 53 LEU A CD1  9  
ATOM 9411  C CD2  . LEU A 1 83  ? 43.114 31.666 5.238  1.00 0.00 ? 53 LEU A CD2  9  
ATOM 9412  H H    . LEU A 1 83  ? 39.073 30.949 3.611  1.00 0.00 ? 53 LEU A H    9  
ATOM 9413  H HA   . LEU A 1 83  ? 41.696 29.778 3.876  1.00 0.00 ? 53 LEU A HA   9  
ATOM 9414  H HB2  . LEU A 1 83  ? 39.782 31.109 5.771  1.00 0.00 ? 53 LEU A HB2  9  
ATOM 9415  H HB3  . LEU A 1 83  ? 41.231 30.296 6.358  1.00 0.00 ? 53 LEU A HB3  9  
ATOM 9416  H HG   . LEU A 1 83  ? 41.393 32.303 4.119  1.00 0.00 ? 53 LEU A HG   9  
ATOM 9417  H HD11 . LEU A 1 83  ? 41.737 34.082 5.699  1.00 0.00 ? 53 LEU A HD11 9  
ATOM 9418  H HD12 . LEU A 1 83  ? 41.696 32.960 7.059  1.00 0.00 ? 53 LEU A HD12 9  
ATOM 9419  H HD13 . LEU A 1 83  ? 40.226 33.291 6.144  1.00 0.00 ? 53 LEU A HD13 9  
ATOM 9420  H HD21 . LEU A 1 83  ? 43.266 30.628 4.981  1.00 0.00 ? 53 LEU A HD21 9  
ATOM 9421  H HD22 . LEU A 1 83  ? 43.457 31.838 6.248  1.00 0.00 ? 53 LEU A HD22 9  
ATOM 9422  H HD23 . LEU A 1 83  ? 43.675 32.289 4.558  1.00 0.00 ? 53 LEU A HD23 9  
ATOM 9423  N N    . PRO A 1 84  ? 41.168 27.492 4.998  1.00 0.00 ? 54 PRO A N    9  
ATOM 9424  C CA   . PRO A 1 84  ? 40.761 26.124 5.443  1.00 0.00 ? 54 PRO A CA   9  
ATOM 9425  C C    . PRO A 1 84  ? 40.011 26.162 6.770  1.00 0.00 ? 54 PRO A C    9  
ATOM 9426  O O    . PRO A 1 84  ? 40.468 26.774 7.737  1.00 0.00 ? 54 PRO A O    9  
ATOM 9427  C CB   . PRO A 1 84  ? 42.075 25.343 5.583  1.00 0.00 ? 54 PRO A CB   9  
ATOM 9428  C CG   . PRO A 1 84  ? 43.084 26.112 4.805  1.00 0.00 ? 54 PRO A CG   9  
ATOM 9429  C CD   . PRO A 1 84  ? 42.634 27.570 4.836  1.00 0.00 ? 54 PRO A CD   9  
ATOM 9430  H HA   . PRO A 1 84  ? 40.147 25.658 4.686  1.00 0.00 ? 54 PRO A HA   9  
ATOM 9431  H HB2  . PRO A 1 84  ? 42.370 25.281 6.622  1.00 0.00 ? 54 PRO A HB2  9  
ATOM 9432  H HB3  . PRO A 1 84  ? 41.968 24.355 5.164  1.00 0.00 ? 54 PRO A HB3  9  
ATOM 9433  H HG2  . PRO A 1 84  ? 44.059 26.008 5.260  1.00 0.00 ? 54 PRO A HG2  9  
ATOM 9434  H HG3  . PRO A 1 84  ? 43.110 25.767 3.783  1.00 0.00 ? 54 PRO A HG3  9  
ATOM 9435  H HD2  . PRO A 1 84  ? 43.088 28.085 5.672  1.00 0.00 ? 54 PRO A HD2  9  
ATOM 9436  H HD3  . PRO A 1 84  ? 42.879 28.058 3.907  1.00 0.00 ? 54 PRO A HD3  9  
ATOM 9437  N N    . GLY A 1 85  ? 38.865 25.491 6.809  1.00 0.00 ? 55 GLY A N    9  
ATOM 9438  C CA   . GLY A 1 85  ? 38.060 25.433 8.026  1.00 0.00 ? 55 GLY A CA   9  
ATOM 9439  C C    . GLY A 1 85  ? 36.875 26.406 8.014  1.00 0.00 ? 55 GLY A C    9  
ATOM 9440  O O    . GLY A 1 85  ? 35.997 26.303 8.872  1.00 0.00 ? 55 GLY A O    9  
ATOM 9441  H H    . GLY A 1 85  ? 38.553 25.025 6.006  1.00 0.00 ? 55 GLY A H    9  
ATOM 9442  H HA2  . GLY A 1 85  ? 37.681 24.428 8.144  1.00 0.00 ? 55 GLY A HA2  9  
ATOM 9443  H HA3  . GLY A 1 85  ? 38.691 25.666 8.871  1.00 0.00 ? 55 GLY A HA3  9  
ATOM 9444  N N    . VAL A 1 86  ? 36.837 27.344 7.063  1.00 0.00 ? 56 VAL A N    9  
ATOM 9445  C CA   . VAL A 1 86  ? 35.713 28.274 6.976  1.00 0.00 ? 56 VAL A CA   9  
ATOM 9446  C C    . VAL A 1 86  ? 34.558 27.632 6.211  1.00 0.00 ? 56 VAL A C    9  
ATOM 9447  O O    . VAL A 1 86  ? 34.763 27.020 5.163  1.00 0.00 ? 56 VAL A O    9  
ATOM 9448  C CB   . VAL A 1 86  ? 36.145 29.570 6.276  1.00 0.00 ? 56 VAL A CB   9  
ATOM 9449  C CG1  . VAL A 1 86  ? 34.989 30.574 6.288  1.00 0.00 ? 56 VAL A CG1  9  
ATOM 9450  C CG2  . VAL A 1 86  ? 37.343 30.182 7.009  1.00 0.00 ? 56 VAL A CG2  9  
ATOM 9451  H H    . VAL A 1 86  ? 37.577 27.422 6.422  1.00 0.00 ? 56 VAL A H    9  
ATOM 9452  H HA   . VAL A 1 86  ? 35.379 28.512 7.976  1.00 0.00 ? 56 VAL A HA   9  
ATOM 9453  H HB   . VAL A 1 86  ? 36.419 29.350 5.255  1.00 0.00 ? 56 VAL A HB   9  
ATOM 9454  H HG11 . VAL A 1 86  ? 34.238 30.266 5.576  1.00 0.00 ? 56 VAL A HG11 9  
ATOM 9455  H HG12 . VAL A 1 86  ? 35.360 31.552 6.020  1.00 0.00 ? 56 VAL A HG12 9  
ATOM 9456  H HG13 . VAL A 1 86  ? 34.554 30.612 7.276  1.00 0.00 ? 56 VAL A HG13 9  
ATOM 9457  H HG21 . VAL A 1 86  ? 37.224 30.044 8.074  1.00 0.00 ? 56 VAL A HG21 9  
ATOM 9458  H HG22 . VAL A 1 86  ? 37.400 31.238 6.788  1.00 0.00 ? 56 VAL A HG22 9  
ATOM 9459  H HG23 . VAL A 1 86  ? 38.251 29.696 6.683  1.00 0.00 ? 56 VAL A HG23 9  
ATOM 9460  N N    . GLY A 1 87  ? 33.345 27.771 6.743  1.00 0.00 ? 57 GLY A N    9  
ATOM 9461  C CA   . GLY A 1 87  ? 32.160 27.226 6.086  1.00 0.00 ? 57 GLY A CA   9  
ATOM 9462  C C    . GLY A 1 87  ? 31.225 28.347 5.643  1.00 0.00 ? 57 GLY A C    9  
ATOM 9463  O O    . GLY A 1 87  ? 31.414 29.507 6.011  1.00 0.00 ? 57 GLY A O    9  
ATOM 9464  H H    . GLY A 1 87  ? 33.246 28.252 7.592  1.00 0.00 ? 57 GLY A H    9  
ATOM 9465  H HA2  . GLY A 1 87  ? 32.456 26.647 5.223  1.00 0.00 ? 57 GLY A HA2  9  
ATOM 9466  H HA3  . GLY A 1 87  ? 31.633 26.588 6.779  1.00 0.00 ? 57 GLY A HA3  9  
ATOM 9467  N N    . THR A 1 88  ? 30.199 27.993 4.875  1.00 0.00 ? 58 THR A N    9  
ATOM 9468  C CA   . THR A 1 88  ? 29.266 28.993 4.367  1.00 0.00 ? 58 THR A CA   9  
ATOM 9469  C C    . THR A 1 88  ? 28.600 29.744 5.516  1.00 0.00 ? 58 THR A C    9  
ATOM 9470  O O    . THR A 1 88  ? 28.530 30.974 5.508  1.00 0.00 ? 58 THR A O    9  
ATOM 9471  C CB   . THR A 1 88  ? 28.197 28.319 3.506  1.00 0.00 ? 58 THR A CB   9  
ATOM 9472  O OG1  . THR A 1 88  ? 28.827 27.537 2.500  1.00 0.00 ? 58 THR A OG1  9  
ATOM 9473  C CG2  . THR A 1 88  ? 27.318 29.384 2.849  1.00 0.00 ? 58 THR A CG2  9  
ATOM 9474  H H    . THR A 1 88  ? 30.066 27.049 4.647  1.00 0.00 ? 58 THR A H    9  
ATOM 9475  H HA   . THR A 1 88  ? 29.810 29.699 3.756  1.00 0.00 ? 58 THR A HA   9  
ATOM 9476  H HB   . THR A 1 88  ? 27.583 27.682 4.125  1.00 0.00 ? 58 THR A HB   9  
ATOM 9477  H HG1  . THR A 1 88  ? 29.121 28.095 1.858  1.00 0.00 ? 58 THR A HG1  9  
ATOM 9478  H HG21 . THR A 1 88  ? 26.873 30.006 3.612  1.00 0.00 ? 58 THR A HG21 9  
ATOM 9479  H HG22 . THR A 1 88  ? 26.538 28.904 2.276  1.00 0.00 ? 58 THR A HG22 9  
ATOM 9480  H HG23 . THR A 1 88  ? 27.921 29.995 2.194  1.00 0.00 ? 58 THR A HG23 9  
ATOM 9481  N N    . LYS A 1 89  ? 28.142 29.004 6.521  1.00 0.00 ? 59 LYS A N    9  
ATOM 9482  C CA   . LYS A 1 89  ? 27.465 29.622 7.656  1.00 0.00 ? 59 LYS A CA   9  
ATOM 9483  C C    . LYS A 1 89  ? 28.400 30.593 8.369  1.00 0.00 ? 59 LYS A C    9  
ATOM 9484  O O    . LYS A 1 89  ? 28.005 31.707 8.717  1.00 0.00 ? 59 LYS A O    9  
ATOM 9485  C CB   . LYS A 1 89  ? 26.995 28.548 8.642  1.00 0.00 ? 59 LYS A CB   9  
ATOM 9486  C CG   . LYS A 1 89  ? 26.093 27.535 7.930  1.00 0.00 ? 59 LYS A CG   9  
ATOM 9487  C CD   . LYS A 1 89  ? 24.820 28.227 7.433  1.00 0.00 ? 59 LYS A CD   9  
ATOM 9488  C CE   . LYS A 1 89  ? 23.842 27.176 6.906  1.00 0.00 ? 59 LYS A CE   9  
ATOM 9489  N NZ   . LYS A 1 89  ? 23.444 26.266 8.018  1.00 0.00 ? 59 LYS A NZ   9  
ATOM 9490  H H    . LYS A 1 89  ? 28.262 28.031 6.500  1.00 0.00 ? 59 LYS A H    9  
ATOM 9491  H HA   . LYS A 1 89  ? 26.607 30.168 7.298  1.00 0.00 ? 59 LYS A HA   9  
ATOM 9492  H HB2  . LYS A 1 89  ? 27.855 28.037 9.050  1.00 0.00 ? 59 LYS A HB2  9  
ATOM 9493  H HB3  . LYS A 1 89  ? 26.444 29.015 9.444  1.00 0.00 ? 59 LYS A HB3  9  
ATOM 9494  H HG2  . LYS A 1 89  ? 26.623 27.112 7.090  1.00 0.00 ? 59 LYS A HG2  9  
ATOM 9495  H HG3  . LYS A 1 89  ? 25.824 26.749 8.620  1.00 0.00 ? 59 LYS A HG3  9  
ATOM 9496  H HD2  . LYS A 1 89  ? 24.364 28.771 8.248  1.00 0.00 ? 59 LYS A HD2  9  
ATOM 9497  H HD3  . LYS A 1 89  ? 25.069 28.911 6.636  1.00 0.00 ? 59 LYS A HD3  9  
ATOM 9498  H HE2  . LYS A 1 89  ? 22.964 27.666 6.512  1.00 0.00 ? 59 LYS A HE2  9  
ATOM 9499  H HE3  . LYS A 1 89  ? 24.316 26.601 6.124  1.00 0.00 ? 59 LYS A HE3  9  
ATOM 9500  H HZ1  . LYS A 1 89  ? 24.207 25.585 8.199  1.00 0.00 ? 59 LYS A HZ1  9  
ATOM 9501  H HZ2  . LYS A 1 89  ? 22.578 25.756 7.754  1.00 0.00 ? 59 LYS A HZ2  9  
ATOM 9502  H HZ3  . LYS A 1 89  ? 23.269 26.825 8.878  1.00 0.00 ? 59 LYS A HZ3  9  
ATOM 9503  N N    . ILE A 1 90  ? 29.659 30.195 8.526  1.00 0.00 ? 60 ILE A N    9  
ATOM 9504  C CA   . ILE A 1 90  ? 30.628 31.043 9.211  1.00 0.00 ? 60 ILE A CA   9  
ATOM 9505  C C    . ILE A 1 90  ? 30.854 32.321 8.406  1.00 0.00 ? 60 ILE A C    9  
ATOM 9506  O O    . ILE A 1 90  ? 30.863 33.418 8.962  1.00 0.00 ? 60 ILE A O    9  
ATOM 9507  C CB   . ILE A 1 90  ? 31.945 30.283 9.417  1.00 0.00 ? 60 ILE A CB   9  
ATOM 9508  C CG1  . ILE A 1 90  ? 31.669 29.016 10.238 1.00 0.00 ? 60 ILE A CG1  9  
ATOM 9509  C CG2  . ILE A 1 90  ? 32.941 31.167 10.177 1.00 0.00 ? 60 ILE A CG2  9  
ATOM 9510  C CD1  . ILE A 1 90  ? 32.903 28.106 10.260 1.00 0.00 ? 60 ILE A CD1  9  
ATOM 9511  H H    . ILE A 1 90  ? 29.938 29.323 8.179  1.00 0.00 ? 60 ILE A H    9  
ATOM 9512  H HA   . ILE A 1 90  ? 30.227 31.311 10.178 1.00 0.00 ? 60 ILE A HA   9  
ATOM 9513  H HB   . ILE A 1 90  ? 32.360 30.011 8.457  1.00 0.00 ? 60 ILE A HB   9  
ATOM 9514  H HG12 . ILE A 1 90  ? 31.415 29.297 11.249 1.00 0.00 ? 60 ILE A HG12 9  
ATOM 9515  H HG13 . ILE A 1 90  ? 30.840 28.480 9.799  1.00 0.00 ? 60 ILE A HG13 9  
ATOM 9516  H HG21 . ILE A 1 90  ? 33.825 30.593 10.412 1.00 0.00 ? 60 ILE A HG21 9  
ATOM 9517  H HG22 . ILE A 1 90  ? 32.486 31.519 11.091 1.00 0.00 ? 60 ILE A HG22 9  
ATOM 9518  H HG23 . ILE A 1 90  ? 33.213 32.012 9.562  1.00 0.00 ? 60 ILE A HG23 9  
ATOM 9519  H HD11 . ILE A 1 90  ? 32.936 27.569 11.197 1.00 0.00 ? 60 ILE A HD11 9  
ATOM 9520  H HD12 . ILE A 1 90  ? 33.800 28.698 10.154 1.00 0.00 ? 60 ILE A HD12 9  
ATOM 9521  H HD13 . ILE A 1 90  ? 32.841 27.399 9.446  1.00 0.00 ? 60 ILE A HD13 9  
ATOM 9522  N N    . ALA A 1 91  ? 30.972 32.183 7.089  1.00 0.00 ? 61 ALA A N    9  
ATOM 9523  C CA   . ALA A 1 91  ? 31.197 33.341 6.233  1.00 0.00 ? 61 ALA A CA   9  
ATOM 9524  C C    . ALA A 1 91  ? 30.060 34.349 6.383  1.00 0.00 ? 61 ALA A C    9  
ATOM 9525  O O    . ALA A 1 91  ? 30.301 35.550 6.519  1.00 0.00 ? 61 ALA A O    9  
ATOM 9526  C CB   . ALA A 1 91  ? 31.299 32.893 4.773  1.00 0.00 ? 61 ALA A CB   9  
ATOM 9527  H H    . ALA A 1 91  ? 30.937 31.288 6.693  1.00 0.00 ? 61 ALA A H    9  
ATOM 9528  H HA   . ALA A 1 91  ? 32.124 33.814 6.517  1.00 0.00 ? 61 ALA A HA   9  
ATOM 9529  H HB1  . ALA A 1 91  ? 31.691 31.888 4.733  1.00 0.00 ? 61 ALA A HB1  9  
ATOM 9530  H HB2  . ALA A 1 91  ? 31.960 33.558 4.237  1.00 0.00 ? 61 ALA A HB2  9  
ATOM 9531  H HB3  . ALA A 1 91  ? 30.320 32.914 4.317  1.00 0.00 ? 61 ALA A HB3  9  
ATOM 9532  N N    . GLU A 1 92  ? 28.822 33.857 6.391  1.00 0.00 ? 62 GLU A N    9  
ATOM 9533  C CA   . GLU A 1 92  ? 27.674 34.745 6.545  1.00 0.00 ? 62 GLU A CA   9  
ATOM 9534  C C    . GLU A 1 92  ? 27.725 35.458 7.894  1.00 0.00 ? 62 GLU A C    9  
ATOM 9535  O O    . GLU A 1 92  ? 27.433 36.651 7.983  1.00 0.00 ? 62 GLU A O    9  
ATOM 9536  C CB   . GLU A 1 92  ? 26.375 33.945 6.436  1.00 0.00 ? 62 GLU A CB   9  
ATOM 9537  C CG   . GLU A 1 92  ? 26.261 33.341 5.031  1.00 0.00 ? 62 GLU A CG   9  
ATOM 9538  C CD   . GLU A 1 92  ? 24.936 32.596 4.837  1.00 0.00 ? 62 GLU A CD   9  
ATOM 9539  O OE1  . GLU A 1 92  ? 24.649 32.246 3.704  1.00 0.00 ? 62 GLU A OE1  9  
ATOM 9540  O OE2  . GLU A 1 92  ? 24.228 32.372 5.809  1.00 0.00 ? 62 GLU A OE2  9  
ATOM 9541  H H    . GLU A 1 92  ? 28.681 32.896 6.261  1.00 0.00 ? 62 GLU A H    9  
ATOM 9542  H HA   . GLU A 1 92  ? 27.695 35.483 5.758  1.00 0.00 ? 62 GLU A HA   9  
ATOM 9543  H HB2  . GLU A 1 92  ? 26.379 33.151 7.170  1.00 0.00 ? 62 GLU A HB2  9  
ATOM 9544  H HB3  . GLU A 1 92  ? 25.533 34.597 6.614  1.00 0.00 ? 62 GLU A HB3  9  
ATOM 9545  H HG2  . GLU A 1 92  ? 26.327 34.135 4.301  1.00 0.00 ? 62 GLU A HG2  9  
ATOM 9546  H HG3  . GLU A 1 92  ? 27.079 32.654 4.875  1.00 0.00 ? 62 GLU A HG3  9  
ATOM 9547  N N    . LYS A 1 93  ? 28.127 34.737 8.938  1.00 0.00 ? 63 LYS A N    9  
ATOM 9548  C CA   . LYS A 1 93  ? 28.275 35.349 10.255 1.00 0.00 ? 63 LYS A CA   9  
ATOM 9549  C C    . LYS A 1 93  ? 29.312 36.471 10.218 1.00 0.00 ? 63 LYS A C    9  
ATOM 9550  O O    . LYS A 1 93  ? 29.115 37.526 10.822 1.00 0.00 ? 63 LYS A O    9  
ATOM 9551  C CB   . LYS A 1 93  ? 28.679 34.284 11.277 1.00 0.00 ? 63 LYS A CB   9  
ATOM 9552  C CG   . LYS A 1 93  ? 27.522 33.298 11.451 1.00 0.00 ? 63 LYS A CG   9  
ATOM 9553  C CD   . LYS A 1 93  ? 27.973 32.106 12.298 1.00 0.00 ? 63 LYS A CD   9  
ATOM 9554  C CE   . LYS A 1 93  ? 28.158 32.538 13.755 1.00 0.00 ? 63 LYS A CE   9  
ATOM 9555  N NZ   . LYS A 1 93  ? 27.908 31.372 14.650 1.00 0.00 ? 63 LYS A NZ   9  
ATOM 9556  H H    . LYS A 1 93  ? 28.288 33.775 8.830  1.00 0.00 ? 63 LYS A H    9  
ATOM 9557  H HA   . LYS A 1 93  ? 27.324 35.767 10.551 1.00 0.00 ? 63 LYS A HA   9  
ATOM 9558  H HB2  . LYS A 1 93  ? 29.555 33.759 10.922 1.00 0.00 ? 63 LYS A HB2  9  
ATOM 9559  H HB3  . LYS A 1 93  ? 28.895 34.753 12.225 1.00 0.00 ? 63 LYS A HB3  9  
ATOM 9560  H HG2  . LYS A 1 93  ? 26.699 33.798 11.943 1.00 0.00 ? 63 LYS A HG2  9  
ATOM 9561  H HG3  . LYS A 1 93  ? 27.199 32.947 10.482 1.00 0.00 ? 63 LYS A HG3  9  
ATOM 9562  H HD2  . LYS A 1 93  ? 27.225 31.328 12.247 1.00 0.00 ? 63 LYS A HD2  9  
ATOM 9563  H HD3  . LYS A 1 93  ? 28.910 31.729 11.916 1.00 0.00 ? 63 LYS A HD3  9  
ATOM 9564  H HE2  . LYS A 1 93  ? 29.168 32.892 13.900 1.00 0.00 ? 63 LYS A HE2  9  
ATOM 9565  H HE3  . LYS A 1 93  ? 27.462 33.328 13.993 1.00 0.00 ? 63 LYS A HE3  9  
ATOM 9566  H HZ1  . LYS A 1 93  ? 28.801 31.077 15.094 1.00 0.00 ? 63 LYS A HZ1  9  
ATOM 9567  H HZ2  . LYS A 1 93  ? 27.520 30.583 14.092 1.00 0.00 ? 63 LYS A HZ2  9  
ATOM 9568  H HZ3  . LYS A 1 93  ? 27.229 31.642 15.389 1.00 0.00 ? 63 LYS A HZ3  9  
ATOM 9569  N N    . ILE A 1 94  ? 30.395 36.260 9.476  1.00 0.00 ? 64 ILE A N    9  
ATOM 9570  C CA   . ILE A 1 94  ? 31.403 37.304 9.304  1.00 0.00 ? 64 ILE A CA   9  
ATOM 9571  C C    . ILE A 1 94  ? 30.774 38.528 8.638  1.00 0.00 ? 64 ILE A C    9  
ATOM 9572  O O    . ILE A 1 94  ? 30.988 39.658 9.078  1.00 0.00 ? 64 ILE A O    9  
ATOM 9573  C CB   . ILE A 1 94  ? 32.573 36.762 8.468  1.00 0.00 ? 64 ILE A CB   9  
ATOM 9574  C CG1  . ILE A 1 94  ? 33.237 35.608 9.224  1.00 0.00 ? 64 ILE A CG1  9  
ATOM 9575  C CG2  . ILE A 1 94  ? 33.628 37.847 8.216  1.00 0.00 ? 64 ILE A CG2  9  
ATOM 9576  C CD1  . ILE A 1 94  ? 34.196 34.867 8.291  1.00 0.00 ? 64 ILE A CD1  9  
ATOM 9577  H H    . ILE A 1 94  ? 30.535 35.381 9.066  1.00 0.00 ? 64 ILE A H    9  
ATOM 9578  H HA   . ILE A 1 94  ? 31.773 37.590 10.278 1.00 0.00 ? 64 ILE A HA   9  
ATOM 9579  H HB   . ILE A 1 94  ? 32.199 36.399 7.522  1.00 0.00 ? 64 ILE A HB   9  
ATOM 9580  H HG12 . ILE A 1 94  ? 33.787 36.004 10.065 1.00 0.00 ? 64 ILE A HG12 9  
ATOM 9581  H HG13 . ILE A 1 94  ? 32.482 34.926 9.580  1.00 0.00 ? 64 ILE A HG13 9  
ATOM 9582  H HG21 . ILE A 1 94  ? 34.107 38.108 9.148  1.00 0.00 ? 64 ILE A HG21 9  
ATOM 9583  H HG22 . ILE A 1 94  ? 33.152 38.722 7.797  1.00 0.00 ? 64 ILE A HG22 9  
ATOM 9584  H HG23 . ILE A 1 94  ? 34.367 37.474 7.522  1.00 0.00 ? 64 ILE A HG23 9  
ATOM 9585  H HD11 . ILE A 1 94  ? 35.149 35.375 8.277  1.00 0.00 ? 64 ILE A HD11 9  
ATOM 9586  H HD12 . ILE A 1 94  ? 33.784 34.848 7.293  1.00 0.00 ? 64 ILE A HD12 9  
ATOM 9587  H HD13 . ILE A 1 94  ? 34.331 33.856 8.645  1.00 0.00 ? 64 ILE A HD13 9  
ATOM 9588  N N    . ASP A 1 95  ? 29.965 38.298 7.608  1.00 0.00 ? 65 ASP A N    9  
ATOM 9589  C CA   . ASP A 1 95  ? 29.322 39.404 6.903  1.00 0.00 ? 65 ASP A CA   9  
ATOM 9590  C C    . ASP A 1 95  ? 28.439 40.206 7.854  1.00 0.00 ? 65 ASP A C    9  
ATOM 9591  O O    . ASP A 1 95  ? 28.474 41.438 7.852  1.00 0.00 ? 65 ASP A O    9  
ATOM 9592  C CB   . ASP A 1 95  ? 28.468 38.871 5.749  1.00 0.00 ? 65 ASP A CB   9  
ATOM 9593  C CG   . ASP A 1 95  ? 29.344 38.237 4.671  1.00 0.00 ? 65 ASP A CG   9  
ATOM 9594  O OD1  . ASP A 1 95  ? 30.491 38.639 4.542  1.00 0.00 ? 65 ASP A OD1  9  
ATOM 9595  O OD2  . ASP A 1 95  ? 28.854 37.356 3.986  1.00 0.00 ? 65 ASP A OD2  9  
ATOM 9596  H H    . ASP A 1 95  ? 29.832 37.379 7.293  1.00 0.00 ? 65 ASP A H    9  
ATOM 9597  H HA   . ASP A 1 95  ? 30.085 40.054 6.501  1.00 0.00 ? 65 ASP A HA   9  
ATOM 9598  H HB2  . ASP A 1 95  ? 27.782 38.129 6.129  1.00 0.00 ? 65 ASP A HB2  9  
ATOM 9599  H HB3  . ASP A 1 95  ? 27.905 39.684 5.317  1.00 0.00 ? 65 ASP A HB3  9  
ATOM 9600  N N    . GLU A 1 96  ? 27.684 39.510 8.697  1.00 0.00 ? 66 GLU A N    9  
ATOM 9601  C CA   . GLU A 1 96  ? 26.810 40.187 9.649  1.00 0.00 ? 66 GLU A CA   9  
ATOM 9602  C C    . GLU A 1 96  ? 27.625 41.028 10.628 1.00 0.00 ? 66 GLU A C    9  
ATOM 9603  O O    . GLU A 1 96  ? 27.296 42.189 10.880 1.00 0.00 ? 66 GLU A O    9  
ATOM 9604  C CB   . GLU A 1 96  ? 25.979 39.160 10.421 1.00 0.00 ? 66 GLU A CB   9  
ATOM 9605  C CG   . GLU A 1 96  ? 25.054 38.415 9.452  1.00 0.00 ? 66 GLU A CG   9  
ATOM 9606  C CD   . GLU A 1 96  ? 24.065 39.370 8.777  1.00 0.00 ? 66 GLU A CD   9  
ATOM 9607  O OE1  . GLU A 1 96  ? 23.866 40.469 9.275  1.00 0.00 ? 66 GLU A OE1  9  
ATOM 9608  O OE2  . GLU A 1 96  ? 23.514 38.983 7.760  1.00 0.00 ? 66 GLU A OE2  9  
ATOM 9609  H H    . GLU A 1 96  ? 27.689 38.530 8.654  1.00 0.00 ? 66 GLU A H    9  
ATOM 9610  H HA   . GLU A 1 96  ? 26.140 40.836 9.106  1.00 0.00 ? 66 GLU A HA   9  
ATOM 9611  H HB2  . GLU A 1 96  ? 26.639 38.456 10.905 1.00 0.00 ? 66 GLU A HB2  9  
ATOM 9612  H HB3  . GLU A 1 96  ? 25.383 39.666 11.166 1.00 0.00 ? 66 GLU A HB3  9  
ATOM 9613  H HG2  . GLU A 1 96  ? 25.652 37.934 8.693  1.00 0.00 ? 66 GLU A HG2  9  
ATOM 9614  H HG3  . GLU A 1 96  ? 24.504 37.663 9.998  1.00 0.00 ? 66 GLU A HG3  9  
ATOM 9615  N N    . PHE A 1 97  ? 28.707 40.458 11.153 1.00 0.00 ? 67 PHE A N    9  
ATOM 9616  C CA   . PHE A 1 97  ? 29.535 41.181 12.112 1.00 0.00 ? 67 PHE A CA   9  
ATOM 9617  C C    . PHE A 1 97  ? 30.094 42.462 11.498 1.00 0.00 ? 67 PHE A C    9  
ATOM 9618  O O    . PHE A 1 97  ? 30.110 43.508 12.146 1.00 0.00 ? 67 PHE A O    9  
ATOM 9619  C CB   . PHE A 1 97  ? 30.692 40.296 12.577 1.00 0.00 ? 67 PHE A CB   9  
ATOM 9620  C CG   . PHE A 1 97  ? 31.547 40.939 13.642 1.00 0.00 ? 67 PHE A CG   9  
ATOM 9621  C CD1  . PHE A 1 97  ? 32.708 41.635 13.282 1.00 0.00 ? 67 PHE A CD1  9  
ATOM 9622  C CD2  . PHE A 1 97  ? 31.179 40.842 14.989 1.00 0.00 ? 67 PHE A CD2  9  
ATOM 9623  C CE1  . PHE A 1 97  ? 33.501 42.232 14.270 1.00 0.00 ? 67 PHE A CE1  9  
ATOM 9624  C CE2  . PHE A 1 97  ? 31.971 41.439 15.977 1.00 0.00 ? 67 PHE A CE2  9  
ATOM 9625  C CZ   . PHE A 1 97  ? 33.132 42.135 15.617 1.00 0.00 ? 67 PHE A CZ   9  
ATOM 9626  H H    . PHE A 1 97  ? 28.935 39.535 10.914 1.00 0.00 ? 67 PHE A H    9  
ATOM 9627  H HA   . PHE A 1 97  ? 28.930 41.440 12.969 1.00 0.00 ? 67 PHE A HA   9  
ATOM 9628  H HB2  . PHE A 1 97  ? 30.288 39.377 12.972 1.00 0.00 ? 67 PHE A HB2  9  
ATOM 9629  H HB3  . PHE A 1 97  ? 31.310 40.061 11.722 1.00 0.00 ? 67 PHE A HB3  9  
ATOM 9630  H HD1  . PHE A 1 97  ? 32.995 41.709 12.243 1.00 0.00 ? 67 PHE A HD1  9  
ATOM 9631  H HD2  . PHE A 1 97  ? 30.284 40.306 15.267 1.00 0.00 ? 67 PHE A HD2  9  
ATOM 9632  H HE1  . PHE A 1 97  ? 34.396 42.769 13.992 1.00 0.00 ? 67 PHE A HE1  9  
ATOM 9633  H HE2  . PHE A 1 97  ? 31.687 41.364 17.016 1.00 0.00 ? 67 PHE A HE2  9  
ATOM 9634  H HZ   . PHE A 1 97  ? 33.743 42.596 16.379 1.00 0.00 ? 67 PHE A HZ   9  
ATOM 9635  N N    . LEU A 1 98  ? 30.551 42.379 10.250 1.00 0.00 ? 68 LEU A N    9  
ATOM 9636  C CA   . LEU A 1 98  ? 31.041 43.566 9.556  1.00 0.00 ? 68 LEU A CA   9  
ATOM 9637  C C    . LEU A 1 98  ? 29.923 44.584 9.347  1.00 0.00 ? 68 LEU A C    9  
ATOM 9638  O O    . LEU A 1 98  ? 30.144 45.789 9.461  1.00 0.00 ? 68 LEU A O    9  
ATOM 9639  C CB   . LEU A 1 98  ? 31.647 43.174 8.205  1.00 0.00 ? 68 LEU A CB   9  
ATOM 9640  C CG   . LEU A 1 98  ? 32.827 42.222 8.420  1.00 0.00 ? 68 LEU A CG   9  
ATOM 9641  C CD1  . LEU A 1 98  ? 33.323 41.711 7.066  1.00 0.00 ? 68 LEU A CD1  9  
ATOM 9642  C CD2  . LEU A 1 98  ? 33.966 42.964 9.126  1.00 0.00 ? 68 LEU A CD2  9  
ATOM 9643  H H    . LEU A 1 98  ? 30.581 41.508 9.801  1.00 0.00 ? 68 LEU A H    9  
ATOM 9644  H HA   . LEU A 1 98  ? 31.810 44.025 10.160 1.00 0.00 ? 68 LEU A HA   9  
ATOM 9645  H HB2  . LEU A 1 98  ? 30.894 42.684 7.605  1.00 0.00 ? 68 LEU A HB2  9  
ATOM 9646  H HB3  . LEU A 1 98  ? 31.991 44.061 7.695  1.00 0.00 ? 68 LEU A HB3  9  
ATOM 9647  H HG   . LEU A 1 98  ? 32.510 41.387 9.025  1.00 0.00 ? 68 LEU A HG   9  
ATOM 9648  H HD11 . LEU A 1 98  ? 33.833 40.770 7.202  1.00 0.00 ? 68 LEU A HD11 9  
ATOM 9649  H HD12 . LEU A 1 98  ? 34.005 42.431 6.636  1.00 0.00 ? 68 LEU A HD12 9  
ATOM 9650  H HD13 . LEU A 1 98  ? 32.482 41.573 6.403  1.00 0.00 ? 68 LEU A HD13 9  
ATOM 9651  H HD21 . LEU A 1 98  ? 33.776 42.985 10.190 1.00 0.00 ? 68 LEU A HD21 9  
ATOM 9652  H HD22 . LEU A 1 98  ? 34.025 43.974 8.751  1.00 0.00 ? 68 LEU A HD22 9  
ATOM 9653  H HD23 . LEU A 1 98  ? 34.898 42.454 8.937  1.00 0.00 ? 68 LEU A HD23 9  
ATOM 9654  N N    . ALA A 1 99  ? 28.722 44.098 9.041  1.00 0.00 ? 69 ALA A N    9  
ATOM 9655  C CA   . ALA A 1 99  ? 27.574 44.985 8.873  1.00 0.00 ? 69 ALA A CA   9  
ATOM 9656  C C    . ALA A 1 99  ? 27.253 45.741 10.163 1.00 0.00 ? 69 ALA A C    9  
ATOM 9657  O O    . ALA A 1 99  ? 26.809 46.887 10.121 1.00 0.00 ? 69 ALA A O    9  
ATOM 9658  C CB   . ALA A 1 99  ? 26.350 44.173 8.443  1.00 0.00 ? 69 ALA A CB   9  
ATOM 9659  H H    . ALA A 1 99  ? 28.615 43.136 8.888  1.00 0.00 ? 69 ALA A H    9  
ATOM 9660  H HA   . ALA A 1 99  ? 27.800 45.702 8.098  1.00 0.00 ? 69 ALA A HA   9  
ATOM 9661  H HB1  . ALA A 1 99  ? 25.608 44.836 8.025  1.00 0.00 ? 69 ALA A HB1  9  
ATOM 9662  H HB2  . ALA A 1 99  ? 25.936 43.664 9.301  1.00 0.00 ? 69 ALA A HB2  9  
ATOM 9663  H HB3  . ALA A 1 99  ? 26.644 43.446 7.699  1.00 0.00 ? 69 ALA A HB3  9  
ATOM 9664  N N    . THR A 1 100 ? 27.478 45.098 11.306 1.00 0.00 ? 70 THR A N    9  
ATOM 9665  C CA   . THR A 1 100 ? 27.284 45.756 12.596 1.00 0.00 ? 70 THR A CA   9  
ATOM 9666  C C    . THR A 1 100 ? 28.408 46.749 12.916 1.00 0.00 ? 70 THR A C    9  
ATOM 9667  O O    . THR A 1 100 ? 28.205 47.682 13.693 1.00 0.00 ? 70 THR A O    9  
ATOM 9668  C CB   . THR A 1 100 ? 27.209 44.702 13.703 1.00 0.00 ? 70 THR A CB   9  
ATOM 9669  O OG1  . THR A 1 100 ? 26.234 43.728 13.359 1.00 0.00 ? 70 THR A OG1  9  
ATOM 9670  C CG2  . THR A 1 100 ? 26.819 45.368 15.024 1.00 0.00 ? 70 THR A CG2  9  
ATOM 9671  H H    . THR A 1 100 ? 27.733 44.151 11.280 1.00 0.00 ? 70 THR A H    9  
ATOM 9672  H HA   . THR A 1 100 ? 26.347 46.292 12.572 1.00 0.00 ? 70 THR A HA   9  
ATOM 9673  H HB   . THR A 1 100 ? 28.171 44.226 13.815 1.00 0.00 ? 70 THR A HB   9  
ATOM 9674  H HG1  . THR A 1 100 ? 26.655 42.939 13.252 1.00 0.00 ? 70 THR A HG1  9  
ATOM 9675  H HG21 . THR A 1 100 ? 26.793 44.626 15.808 1.00 0.00 ? 70 THR A HG21 9  
ATOM 9676  H HG22 . THR A 1 100 ? 25.843 45.820 14.925 1.00 0.00 ? 70 THR A HG22 9  
ATOM 9677  H HG23 . THR A 1 100 ? 27.544 46.129 15.272 1.00 0.00 ? 70 THR A HG23 9  
ATOM 9678  N N    . GLY A 1 101 ? 29.588 46.554 12.326 1.00 0.00 ? 71 GLY A N    9  
ATOM 9679  C CA   . GLY A 1 101 ? 30.712 47.449 12.572 1.00 0.00 ? 71 GLY A CA   9  
ATOM 9680  C C    . GLY A 1 101 ? 30.846 48.477 11.454 1.00 0.00 ? 71 GLY A C    9  
ATOM 9681  O O    . GLY A 1 101 ? 30.847 49.683 11.703 1.00 0.00 ? 71 GLY A O    9  
ATOM 9682  H H    . GLY A 1 101 ? 29.700 45.796 11.715 1.00 0.00 ? 71 GLY A H    9  
ATOM 9683  H HA2  . GLY A 1 101 ? 30.558 47.962 13.511 1.00 0.00 ? 71 GLY A HA2  9  
ATOM 9684  H HA3  . GLY A 1 101 ? 31.621 46.871 12.628 1.00 0.00 ? 71 GLY A HA3  9  
ATOM 9685  N N    . GLU A 1 31  ? 45.318 41.336 19.262 1.00 0.00 ? 1  GLU A N    10 
ATOM 9686  C CA   . GLU A 1 31  ? 46.439 41.903 18.525 1.00 0.00 ? 1  GLU A CA   10 
ATOM 9687  C C    . GLU A 1 31  ? 46.271 41.663 17.028 1.00 0.00 ? 1  GLU A C    10 
ATOM 9688  O O    . GLU A 1 31  ? 46.420 42.580 16.220 1.00 0.00 ? 1  GLU A O    10 
ATOM 9689  C CB   . GLU A 1 31  ? 47.748 41.274 19.001 1.00 0.00 ? 1  GLU A CB   10 
ATOM 9690  C CG   . GLU A 1 31  ? 48.934 42.013 18.370 1.00 0.00 ? 1  GLU A CG   10 
ATOM 9691  C CD   . GLU A 1 31  ? 50.275 41.369 18.741 1.00 0.00 ? 1  GLU A CD   10 
ATOM 9692  O OE1  . GLU A 1 31  ? 50.286 40.366 19.437 1.00 0.00 ? 1  GLU A OE1  10 
ATOM 9693  O OE2  . GLU A 1 31  ? 51.288 41.901 18.315 1.00 0.00 ? 1  GLU A OE2  10 
ATOM 9694  H H    . GLU A 1 31  ? 44.937 41.821 20.024 1.00 0.00 ? 1  GLU A H    10 
ATOM 9695  H HA   . GLU A 1 31  ? 46.478 42.967 18.707 1.00 0.00 ? 1  GLU A HA   10 
ATOM 9696  H HB2  . GLU A 1 31  ? 47.811 41.344 20.078 1.00 0.00 ? 1  GLU A HB2  10 
ATOM 9697  H HB3  . GLU A 1 31  ? 47.779 40.236 18.706 1.00 0.00 ? 1  GLU A HB3  10 
ATOM 9698  H HG2  . GLU A 1 31  ? 48.824 42.001 17.296 1.00 0.00 ? 1  GLU A HG2  10 
ATOM 9699  H HG3  . GLU A 1 31  ? 48.929 43.039 18.710 1.00 0.00 ? 1  GLU A HG3  10 
ATOM 9700  N N    . THR A 1 32  ? 45.961 40.422 16.664 1.00 0.00 ? 2  THR A N    10 
ATOM 9701  C CA   . THR A 1 32  ? 45.766 40.074 15.262 1.00 0.00 ? 2  THR A CA   10 
ATOM 9702  C C    . THR A 1 32  ? 44.651 40.917 14.654 1.00 0.00 ? 2  THR A C    10 
ATOM 9703  O O    . THR A 1 32  ? 43.637 41.181 15.300 1.00 0.00 ? 2  THR A O    10 
ATOM 9704  C CB   . THR A 1 32  ? 45.413 38.589 15.140 1.00 0.00 ? 2  THR A CB   10 
ATOM 9705  O OG1  . THR A 1 32  ? 46.377 37.818 15.842 1.00 0.00 ? 2  THR A OG1  10 
ATOM 9706  C CG2  . THR A 1 32  ? 45.406 38.178 13.666 1.00 0.00 ? 2  THR A CG2  10 
ATOM 9707  H H    . THR A 1 32  ? 45.861 39.730 17.351 1.00 0.00 ? 2  THR A H    10 
ATOM 9708  H HA   . THR A 1 32  ? 46.682 40.259 14.722 1.00 0.00 ? 2  THR A HA   10 
ATOM 9709  H HB   . THR A 1 32  ? 44.435 38.415 15.562 1.00 0.00 ? 2  THR A HB   10 
ATOM 9710  H HG1  . THR A 1 32  ? 46.071 37.682 16.677 1.00 0.00 ? 2  THR A HG1  10 
ATOM 9711  H HG21 . THR A 1 32  ? 45.612 37.121 13.588 1.00 0.00 ? 2  THR A HG21 10 
ATOM 9712  H HG22 . THR A 1 32  ? 46.164 38.732 13.133 1.00 0.00 ? 2  THR A HG22 10 
ATOM 9713  H HG23 . THR A 1 32  ? 44.437 38.387 13.238 1.00 0.00 ? 2  THR A HG23 10 
ATOM 9714  N N    . LEU A 1 33  ? 44.813 41.294 13.391 1.00 0.00 ? 3  LEU A N    10 
ATOM 9715  C CA   . LEU A 1 33  ? 43.852 42.180 12.741 1.00 0.00 ? 3  LEU A CA   10 
ATOM 9716  C C    . LEU A 1 33  ? 42.437 41.596 12.746 1.00 0.00 ? 3  LEU A C    10 
ATOM 9717  O O    . LEU A 1 33  ? 41.456 42.339 12.781 1.00 0.00 ? 3  LEU A O    10 
ATOM 9718  C CB   . LEU A 1 33  ? 44.281 42.419 11.292 1.00 0.00 ? 3  LEU A CB   10 
ATOM 9719  C CG   . LEU A 1 33  ? 45.675 43.047 11.261 1.00 0.00 ? 3  LEU A CG   10 
ATOM 9720  C CD1  . LEU A 1 33  ? 46.163 43.128 9.812  1.00 0.00 ? 3  LEU A CD1  10 
ATOM 9721  C CD2  . LEU A 1 33  ? 45.608 44.458 11.848 1.00 0.00 ? 3  LEU A CD2  10 
ATOM 9722  H H    . LEU A 1 33  ? 45.591 40.973 12.888 1.00 0.00 ? 3  LEU A H    10 
ATOM 9723  H HA   . LEU A 1 33  ? 43.842 43.127 13.257 1.00 0.00 ? 3  LEU A HA   10 
ATOM 9724  H HB2  . LEU A 1 33  ? 44.299 41.476 10.764 1.00 0.00 ? 3  LEU A HB2  10 
ATOM 9725  H HB3  . LEU A 1 33  ? 43.579 43.084 10.819 1.00 0.00 ? 3  LEU A HB3  10 
ATOM 9726  H HG   . LEU A 1 33  ? 46.358 42.444 11.840 1.00 0.00 ? 3  LEU A HG   10 
ATOM 9727  H HD11 . LEU A 1 33  ? 46.194 42.136 9.387  1.00 0.00 ? 3  LEU A HD11 10 
ATOM 9728  H HD12 . LEU A 1 33  ? 47.153 43.561 9.790  1.00 0.00 ? 3  LEU A HD12 10 
ATOM 9729  H HD13 . LEU A 1 33  ? 45.487 43.745 9.239  1.00 0.00 ? 3  LEU A HD13 10 
ATOM 9730  H HD21 . LEU A 1 33  ? 44.772 44.987 11.415 1.00 0.00 ? 3  LEU A HD21 10 
ATOM 9731  H HD22 . LEU A 1 33  ? 46.523 44.986 11.623 1.00 0.00 ? 3  LEU A HD22 10 
ATOM 9732  H HD23 . LEU A 1 33  ? 45.480 44.397 12.918 1.00 0.00 ? 3  LEU A HD23 10 
ATOM 9733  N N    . ASN A 1 34  ? 42.330 40.271 12.714 1.00 0.00 ? 4  ASN A N    10 
ATOM 9734  C CA   . ASN A 1 34  ? 41.023 39.611 12.734 1.00 0.00 ? 4  ASN A CA   10 
ATOM 9735  C C    . ASN A 1 34  ? 40.601 39.164 14.143 1.00 0.00 ? 4  ASN A C    10 
ATOM 9736  O O    . ASN A 1 34  ? 39.618 38.438 14.288 1.00 0.00 ? 4  ASN A O    10 
ATOM 9737  C CB   . ASN A 1 34  ? 41.051 38.392 11.808 1.00 0.00 ? 4  ASN A CB   10 
ATOM 9738  C CG   . ASN A 1 34  ? 41.471 38.806 10.400 1.00 0.00 ? 4  ASN A CG   10 
ATOM 9739  O OD1  . ASN A 1 34  ? 40.921 39.751 9.832  1.00 0.00 ? 4  ASN A OD1  10 
ATOM 9740  N ND2  . ASN A 1 34  ? 42.417 38.144 9.792  1.00 0.00 ? 4  ASN A ND2  10 
ATOM 9741  H H    . ASN A 1 34  ? 43.142 39.724 12.676 1.00 0.00 ? 4  ASN A H    10 
ATOM 9742  H HA   . ASN A 1 34  ? 40.284 40.304 12.359 1.00 0.00 ? 4  ASN A HA   10 
ATOM 9743  H HB2  . ASN A 1 34  ? 41.754 37.668 12.193 1.00 0.00 ? 4  ASN A HB2  10 
ATOM 9744  H HB3  . ASN A 1 34  ? 40.067 37.950 11.770 1.00 0.00 ? 4  ASN A HB3  10 
ATOM 9745  H HD21 . ASN A 1 34  ? 42.845 37.380 10.234 1.00 0.00 ? 4  ASN A HD21 10 
ATOM 9746  H HD22 . ASN A 1 34  ? 42.713 38.422 8.899  1.00 0.00 ? 4  ASN A HD22 10 
ATOM 9747  N N    . GLY A 1 35  ? 41.324 39.591 15.181 1.00 0.00 ? 5  GLY A N    10 
ATOM 9748  C CA   . GLY A 1 35  ? 41.088 39.081 16.526 1.00 0.00 ? 5  GLY A CA   10 
ATOM 9749  C C    . GLY A 1 35  ? 39.629 39.229 16.944 1.00 0.00 ? 5  GLY A C    10 
ATOM 9750  O O    . GLY A 1 35  ? 39.076 38.330 17.578 1.00 0.00 ? 5  GLY A O    10 
ATOM 9751  H H    . GLY A 1 35  ? 42.021 40.263 15.043 1.00 0.00 ? 5  GLY A H    10 
ATOM 9752  H HA2  . GLY A 1 35  ? 41.358 38.035 16.557 1.00 0.00 ? 5  GLY A HA2  10 
ATOM 9753  H HA3  . GLY A 1 35  ? 41.707 39.626 17.222 1.00 0.00 ? 5  GLY A HA3  10 
ATOM 9754  N N    . ALA A 1 36  ? 38.999 40.342 16.574 1.00 0.00 ? 6  ALA A N    10 
ATOM 9755  C CA   . ALA A 1 36  ? 37.619 40.580 16.985 1.00 0.00 ? 6  ALA A CA   10 
ATOM 9756  C C    . ALA A 1 36  ? 36.703 39.491 16.432 1.00 0.00 ? 6  ALA A C    10 
ATOM 9757  O O    . ALA A 1 36  ? 35.911 38.898 17.170 1.00 0.00 ? 6  ALA A O    10 
ATOM 9758  C CB   . ALA A 1 36  ? 37.150 41.947 16.484 1.00 0.00 ? 6  ALA A CB   10 
ATOM 9759  H H    . ALA A 1 36  ? 39.463 41.006 16.022 1.00 0.00 ? 6  ALA A H    10 
ATOM 9760  H HA   . ALA A 1 36  ? 37.566 40.566 18.064 1.00 0.00 ? 6  ALA A HA   10 
ATOM 9761  H HB1  . ALA A 1 36  ? 36.080 42.029 16.611 1.00 0.00 ? 6  ALA A HB1  10 
ATOM 9762  H HB2  . ALA A 1 36  ? 37.397 42.052 15.438 1.00 0.00 ? 6  ALA A HB2  10 
ATOM 9763  H HB3  . ALA A 1 36  ? 37.640 42.724 17.050 1.00 0.00 ? 6  ALA A HB3  10 
ATOM 9764  N N    . LEU A 1 37  ? 36.841 39.199 15.140 1.00 0.00 ? 7  LEU A N    10 
ATOM 9765  C CA   . LEU A 1 37  ? 36.065 38.121 14.538 1.00 0.00 ? 7  LEU A CA   10 
ATOM 9766  C C    . LEU A 1 37  ? 36.402 36.779 15.184 1.00 0.00 ? 7  LEU A C    10 
ATOM 9767  O O    . LEU A 1 37  ? 35.517 35.954 15.412 1.00 0.00 ? 7  LEU A O    10 
ATOM 9768  C CB   . LEU A 1 37  ? 36.335 38.057 13.032 1.00 0.00 ? 7  LEU A CB   10 
ATOM 9769  C CG   . LEU A 1 37  ? 35.853 39.349 12.367 1.00 0.00 ? 7  LEU A CG   10 
ATOM 9770  C CD1  . LEU A 1 37  ? 36.303 39.377 10.905 1.00 0.00 ? 7  LEU A CD1  10 
ATOM 9771  C CD2  . LEU A 1 37  ? 34.326 39.410 12.418 1.00 0.00 ? 7  LEU A CD2  10 
ATOM 9772  H H    . LEU A 1 37  ? 37.472 39.711 14.592 1.00 0.00 ? 7  LEU A H    10 
ATOM 9773  H HA   . LEU A 1 37  ? 35.015 38.323 14.694 1.00 0.00 ? 7  LEU A HA   10 
ATOM 9774  H HB2  . LEU A 1 37  ? 37.395 37.938 12.863 1.00 0.00 ? 7  LEU A HB2  10 
ATOM 9775  H HB3  . LEU A 1 37  ? 35.806 37.217 12.607 1.00 0.00 ? 7  LEU A HB3  10 
ATOM 9776  H HG   . LEU A 1 37  ? 36.267 40.199 12.889 1.00 0.00 ? 7  LEU A HG   10 
ATOM 9777  H HD11 . LEU A 1 37  ? 36.216 38.385 10.482 1.00 0.00 ? 7  LEU A HD11 10 
ATOM 9778  H HD12 . LEU A 1 37  ? 37.330 39.704 10.850 1.00 0.00 ? 7  LEU A HD12 10 
ATOM 9779  H HD13 . LEU A 1 37  ? 35.676 40.059 10.352 1.00 0.00 ? 7  LEU A HD13 10 
ATOM 9780  H HD21 . LEU A 1 37  ? 34.010 39.764 13.387 1.00 0.00 ? 7  LEU A HD21 10 
ATOM 9781  H HD22 . LEU A 1 37  ? 33.920 38.423 12.245 1.00 0.00 ? 7  LEU A HD22 10 
ATOM 9782  H HD23 . LEU A 1 37  ? 33.967 40.084 11.653 1.00 0.00 ? 7  LEU A HD23 10 
ATOM 9783  N N    . VAL A 1 38  ? 37.674 36.581 15.521 1.00 0.00 ? 8  VAL A N    10 
ATOM 9784  C CA   . VAL A 1 38  ? 38.091 35.341 16.168 1.00 0.00 ? 8  VAL A CA   10 
ATOM 9785  C C    . VAL A 1 38  ? 37.357 35.177 17.498 1.00 0.00 ? 8  VAL A C    10 
ATOM 9786  O O    . VAL A 1 38  ? 36.874 34.091 17.820 1.00 0.00 ? 8  VAL A O    10 
ATOM 9787  C CB   . VAL A 1 38  ? 39.612 35.361 16.391 1.00 0.00 ? 8  VAL A CB   10 
ATOM 9788  C CG1  . VAL A 1 38  ? 40.076 34.072 17.079 1.00 0.00 ? 8  VAL A CG1  10 
ATOM 9789  C CG2  . VAL A 1 38  ? 40.332 35.479 15.043 1.00 0.00 ? 8  VAL A CG2  10 
ATOM 9790  H H    . VAL A 1 38  ? 38.343 37.264 15.305 1.00 0.00 ? 8  VAL A H    10 
ATOM 9791  H HA   . VAL A 1 38  ? 37.842 34.510 15.525 1.00 0.00 ? 8  VAL A HA   10 
ATOM 9792  H HB   . VAL A 1 38  ? 39.871 36.208 17.009 1.00 0.00 ? 8  VAL A HB   10 
ATOM 9793  H HG11 . VAL A 1 38  ? 39.931 33.238 16.411 1.00 0.00 ? 8  VAL A HG11 10 
ATOM 9794  H HG12 . VAL A 1 38  ? 39.499 33.916 17.980 1.00 0.00 ? 8  VAL A HG12 10 
ATOM 9795  H HG13 . VAL A 1 38  ? 41.122 34.154 17.331 1.00 0.00 ? 8  VAL A HG13 10 
ATOM 9796  H HG21 . VAL A 1 38  ? 39.784 36.140 14.391 1.00 0.00 ? 8  VAL A HG21 10 
ATOM 9797  H HG22 . VAL A 1 38  ? 40.401 34.503 14.587 1.00 0.00 ? 8  VAL A HG22 10 
ATOM 9798  H HG23 . VAL A 1 38  ? 41.326 35.872 15.202 1.00 0.00 ? 8  VAL A HG23 10 
ATOM 9799  N N    . ASN A 1 39  ? 37.245 36.268 18.252 1.00 0.00 ? 9  ASN A N    10 
ATOM 9800  C CA   . ASN A 1 39  ? 36.546 36.221 19.531 1.00 0.00 ? 9  ASN A CA   10 
ATOM 9801  C C    . ASN A 1 39  ? 35.081 35.844 19.335 1.00 0.00 ? 9  ASN A C    10 
ATOM 9802  O O    . ASN A 1 39  ? 34.547 35.002 20.059 1.00 0.00 ? 9  ASN A O    10 
ATOM 9803  C CB   . ASN A 1 39  ? 36.634 37.584 20.222 1.00 0.00 ? 9  ASN A CB   10 
ATOM 9804  C CG   . ASN A 1 39  ? 38.095 37.942 20.483 1.00 0.00 ? 9  ASN A CG   10 
ATOM 9805  O OD1  . ASN A 1 39  ? 38.518 39.064 20.205 1.00 0.00 ? 9  ASN A OD1  10 
ATOM 9806  N ND2  . ASN A 1 39  ? 38.893 37.051 21.004 1.00 0.00 ? 9  ASN A ND2  10 
ATOM 9807  H H    . ASN A 1 39  ? 37.662 37.102 17.959 1.00 0.00 ? 9  ASN A H    10 
ATOM 9808  H HA   . ASN A 1 39  ? 37.017 35.481 20.160 1.00 0.00 ? 9  ASN A HA   10 
ATOM 9809  H HB2  . ASN A 1 39  ? 36.188 38.336 19.588 1.00 0.00 ? 9  ASN A HB2  10 
ATOM 9810  H HB3  . ASN A 1 39  ? 36.104 37.544 21.161 1.00 0.00 ? 9  ASN A HB3  10 
ATOM 9811  H HD21 . ASN A 1 39  ? 38.553 36.158 21.224 1.00 0.00 ? 9  ASN A HD21 10 
ATOM 9812  H HD22 . ASN A 1 39  ? 39.831 37.274 21.174 1.00 0.00 ? 9  ASN A HD22 10 
ATOM 9813  N N    . MET A 1 40  ? 34.444 36.444 18.333 1.00 0.00 ? 10 MET A N    10 
ATOM 9814  C CA   . MET A 1 40  ? 33.041 36.147 18.064 1.00 0.00 ? 10 MET A CA   10 
ATOM 9815  C C    . MET A 1 40  ? 32.852 34.669 17.728 1.00 0.00 ? 10 MET A C    10 
ATOM 9816  O O    . MET A 1 40  ? 31.924 34.023 18.224 1.00 0.00 ? 10 MET A O    10 
ATOM 9817  C CB   . MET A 1 40  ? 32.555 37.022 16.906 1.00 0.00 ? 10 MET A CB   10 
ATOM 9818  C CG   . MET A 1 40  ? 31.062 36.795 16.656 1.00 0.00 ? 10 MET A CG   10 
ATOM 9819  S SD   . MET A 1 40  ? 30.526 37.815 15.258 1.00 0.00 ? 10 MET A SD   10 
ATOM 9820  C CE   . MET A 1 40  ? 31.381 36.901 13.950 1.00 0.00 ? 10 MET A CE   10 
ATOM 9821  H H    . MET A 1 40  ? 34.911 37.119 17.795 1.00 0.00 ? 10 MET A H    10 
ATOM 9822  H HA   . MET A 1 40  ? 32.458 36.381 18.944 1.00 0.00 ? 10 MET A HA   10 
ATOM 9823  H HB2  . MET A 1 40  ? 32.722 38.061 17.150 1.00 0.00 ? 10 MET A HB2  10 
ATOM 9824  H HB3  . MET A 1 40  ? 33.107 36.771 16.012 1.00 0.00 ? 10 MET A HB3  10 
ATOM 9825  H HG2  . MET A 1 40  ? 30.889 35.754 16.430 1.00 0.00 ? 10 MET A HG2  10 
ATOM 9826  H HG3  . MET A 1 40  ? 30.503 37.072 17.539 1.00 0.00 ? 10 MET A HG3  10 
ATOM 9827  H HE1  . MET A 1 40  ? 31.233 35.842 14.100 1.00 0.00 ? 10 MET A HE1  10 
ATOM 9828  H HE2  . MET A 1 40  ? 32.437 37.122 13.985 1.00 0.00 ? 10 MET A HE2  10 
ATOM 9829  H HE3  . MET A 1 40  ? 30.984 37.194 12.988 1.00 0.00 ? 10 MET A HE3  10 
ATOM 9830  N N    . LEU A 1 41  ? 33.772 34.114 16.938 1.00 0.00 ? 11 LEU A N    10 
ATOM 9831  C CA   . LEU A 1 41  ? 33.723 32.690 16.629 1.00 0.00 ? 11 LEU A CA   10 
ATOM 9832  C C    . LEU A 1 41  ? 33.897 31.857 17.893 1.00 0.00 ? 11 LEU A C    10 
ATOM 9833  O O    . LEU A 1 41  ? 33.174 30.884 18.110 1.00 0.00 ? 11 LEU A O    10 
ATOM 9834  C CB   . LEU A 1 41  ? 34.827 32.327 15.631 1.00 0.00 ? 11 LEU A CB   10 
ATOM 9835  C CG   . LEU A 1 41  ? 34.595 33.059 14.307 1.00 0.00 ? 11 LEU A CG   10 
ATOM 9836  C CD1  . LEU A 1 41  ? 35.794 32.833 13.387 1.00 0.00 ? 11 LEU A CD1  10 
ATOM 9837  C CD2  . LEU A 1 41  ? 33.336 32.509 13.632 1.00 0.00 ? 11 LEU A CD2  10 
ATOM 9838  H H    . LEU A 1 41  ? 34.470 34.675 16.538 1.00 0.00 ? 11 LEU A H    10 
ATOM 9839  H HA   . LEU A 1 41  ? 32.765 32.459 16.188 1.00 0.00 ? 11 LEU A HA   10 
ATOM 9840  H HB2  . LEU A 1 41  ? 35.785 32.614 16.036 1.00 0.00 ? 11 LEU A HB2  10 
ATOM 9841  H HB3  . LEU A 1 41  ? 34.815 31.262 15.455 1.00 0.00 ? 11 LEU A HB3  10 
ATOM 9842  H HG   . LEU A 1 41  ? 34.475 34.116 14.494 1.00 0.00 ? 11 LEU A HG   10 
ATOM 9843  H HD11 . LEU A 1 41  ? 36.672 33.290 13.821 1.00 0.00 ? 11 LEU A HD11 10 
ATOM 9844  H HD12 . LEU A 1 41  ? 35.597 33.276 12.422 1.00 0.00 ? 11 LEU A HD12 10 
ATOM 9845  H HD13 . LEU A 1 41  ? 35.963 31.773 13.268 1.00 0.00 ? 11 LEU A HD13 10 
ATOM 9846  H HD21 . LEU A 1 41  ? 32.463 32.873 14.152 1.00 0.00 ? 11 LEU A HD21 10 
ATOM 9847  H HD22 . LEU A 1 41  ? 33.352 31.429 13.664 1.00 0.00 ? 11 LEU A HD22 10 
ATOM 9848  H HD23 . LEU A 1 41  ? 33.306 32.839 12.604 1.00 0.00 ? 11 LEU A HD23 10 
ATOM 9849  N N    . LYS A 1 42  ? 34.838 32.260 18.743 1.00 0.00 ? 12 LYS A N    10 
ATOM 9850  C CA   . LYS A 1 42  ? 35.105 31.515 19.968 1.00 0.00 ? 12 LYS A CA   10 
ATOM 9851  C C    . LYS A 1 42  ? 33.865 31.450 20.853 1.00 0.00 ? 12 LYS A C    10 
ATOM 9852  O O    . LYS A 1 42  ? 33.550 30.397 21.409 1.00 0.00 ? 12 LYS A O    10 
ATOM 9853  C CB   . LYS A 1 42  ? 36.250 32.183 20.735 1.00 0.00 ? 12 LYS A CB   10 
ATOM 9854  C CG   . LYS A 1 42  ? 36.649 31.329 21.941 1.00 0.00 ? 12 LYS A CG   10 
ATOM 9855  C CD   . LYS A 1 42  ? 37.455 30.116 21.471 1.00 0.00 ? 12 LYS A CD   10 
ATOM 9856  C CE   . LYS A 1 42  ? 37.931 29.316 22.684 1.00 0.00 ? 12 LYS A CE   10 
ATOM 9857  N NZ   . LYS A 1 42  ? 39.061 30.034 23.340 1.00 0.00 ? 12 LYS A NZ   10 
ATOM 9858  H H    . LYS A 1 42  ? 35.380 33.046 18.528 1.00 0.00 ? 12 LYS A H    10 
ATOM 9859  H HA   . LYS A 1 42  ? 35.401 30.511 19.707 1.00 0.00 ? 12 LYS A HA   10 
ATOM 9860  H HB2  . LYS A 1 42  ? 37.101 32.296 20.079 1.00 0.00 ? 12 LYS A HB2  10 
ATOM 9861  H HB3  . LYS A 1 42  ? 35.931 33.155 21.079 1.00 0.00 ? 12 LYS A HB3  10 
ATOM 9862  H HG2  . LYS A 1 42  ? 37.253 31.922 22.615 1.00 0.00 ? 12 LYS A HG2  10 
ATOM 9863  H HG3  . LYS A 1 42  ? 35.763 30.990 22.457 1.00 0.00 ? 12 LYS A HG3  10 
ATOM 9864  H HD2  . LYS A 1 42  ? 36.834 29.491 20.847 1.00 0.00 ? 12 LYS A HD2  10 
ATOM 9865  H HD3  . LYS A 1 42  ? 38.312 30.450 20.905 1.00 0.00 ? 12 LYS A HD3  10 
ATOM 9866  H HE2  . LYS A 1 42  ? 37.118 29.207 23.386 1.00 0.00 ? 12 LYS A HE2  10 
ATOM 9867  H HE3  . LYS A 1 42  ? 38.263 28.339 22.363 1.00 0.00 ? 12 LYS A HE3  10 
ATOM 9868  H HZ1  . LYS A 1 42  ? 39.961 29.603 23.047 1.00 0.00 ? 12 LYS A HZ1  10 
ATOM 9869  H HZ2  . LYS A 1 42  ? 38.963 29.963 24.373 1.00 0.00 ? 12 LYS A HZ2  10 
ATOM 9870  H HZ3  . LYS A 1 42  ? 39.048 31.033 23.055 1.00 0.00 ? 12 LYS A HZ3  10 
ATOM 9871  N N    . GLU A 1 43  ? 33.141 32.564 20.955 1.00 0.00 ? 13 GLU A N    10 
ATOM 9872  C CA   . GLU A 1 43  ? 31.959 32.600 21.807 1.00 0.00 ? 13 GLU A CA   10 
ATOM 9873  C C    . GLU A 1 43  ? 30.881 31.655 21.288 1.00 0.00 ? 13 GLU A C    10 
ATOM 9874  O O    . GLU A 1 43  ? 30.293 30.893 22.062 1.00 0.00 ? 13 GLU A O    10 
ATOM 9875  C CB   . GLU A 1 43  ? 31.406 34.026 21.867 1.00 0.00 ? 13 GLU A CB   10 
ATOM 9876  C CG   . GLU A 1 43  ? 30.261 34.093 22.885 1.00 0.00 ? 13 GLU A CG   10 
ATOM 9877  C CD   . GLU A 1 43  ? 30.790 33.938 24.311 1.00 0.00 ? 13 GLU A CD   10 
ATOM 9878  O OE1  . GLU A 1 43  ? 30.026 33.500 25.154 1.00 0.00 ? 13 GLU A OE1  10 
ATOM 9879  O OE2  . GLU A 1 43  ? 31.942 34.270 24.548 1.00 0.00 ? 13 GLU A OE2  10 
ATOM 9880  H H    . GLU A 1 43  ? 33.428 33.375 20.484 1.00 0.00 ? 13 GLU A H    10 
ATOM 9881  H HA   . GLU A 1 43  ? 32.239 32.296 22.805 1.00 0.00 ? 13 GLU A HA   10 
ATOM 9882  H HB2  . GLU A 1 43  ? 32.193 34.705 22.163 1.00 0.00 ? 13 GLU A HB2  10 
ATOM 9883  H HB3  . GLU A 1 43  ? 31.032 34.307 20.893 1.00 0.00 ? 13 GLU A HB3  10 
ATOM 9884  H HG2  . GLU A 1 43  ? 29.762 35.047 22.793 1.00 0.00 ? 13 GLU A HG2  10 
ATOM 9885  H HG3  . GLU A 1 43  ? 29.556 33.301 22.680 1.00 0.00 ? 13 GLU A HG3  10 
ATOM 9886  N N    . GLU A 1 44  ? 30.657 31.660 19.974 1.00 0.00 ? 14 GLU A N    10 
ATOM 9887  C CA   . GLU A 1 44  ? 29.689 30.738 19.389 1.00 0.00 ? 14 GLU A CA   10 
ATOM 9888  C C    . GLU A 1 44  ? 30.137 29.289 19.545 1.00 0.00 ? 14 GLU A C    10 
ATOM 9889  O O    . GLU A 1 44  ? 29.317 28.405 19.791 1.00 0.00 ? 14 GLU A O    10 
ATOM 9890  C CB   . GLU A 1 44  ? 29.444 31.071 17.917 1.00 0.00 ? 14 GLU A CB   10 
ATOM 9891  C CG   . GLU A 1 44  ? 28.760 32.438 17.830 1.00 0.00 ? 14 GLU A CG   10 
ATOM 9892  C CD   . GLU A 1 44  ? 28.377 32.796 16.392 1.00 0.00 ? 14 GLU A CD   10 
ATOM 9893  O OE1  . GLU A 1 44  ? 27.643 33.757 16.234 1.00 0.00 ? 14 GLU A OE1  10 
ATOM 9894  O OE2  . GLU A 1 44  ? 28.817 32.122 15.471 1.00 0.00 ? 14 GLU A OE2  10 
ATOM 9895  H H    . GLU A 1 44  ? 31.125 32.308 19.401 1.00 0.00 ? 14 GLU A H    10 
ATOM 9896  H HA   . GLU A 1 44  ? 28.754 30.856 19.919 1.00 0.00 ? 14 GLU A HA   10 
ATOM 9897  H HB2  . GLU A 1 44  ? 30.387 31.097 17.390 1.00 0.00 ? 14 GLU A HB2  10 
ATOM 9898  H HB3  . GLU A 1 44  ? 28.803 30.321 17.477 1.00 0.00 ? 14 GLU A HB3  10 
ATOM 9899  H HG2  . GLU A 1 44  ? 27.867 32.424 18.436 1.00 0.00 ? 14 GLU A HG2  10 
ATOM 9900  H HG3  . GLU A 1 44  ? 29.432 33.192 18.214 1.00 0.00 ? 14 GLU A HG3  10 
ATOM 9901  N N    . GLY A 1 45  ? 31.441 29.048 19.429 1.00 0.00 ? 15 GLY A N    10 
ATOM 9902  C CA   . GLY A 1 45  ? 31.968 27.700 19.612 1.00 0.00 ? 15 GLY A CA   10 
ATOM 9903  C C    . GLY A 1 45  ? 31.644 27.178 21.008 1.00 0.00 ? 15 GLY A C    10 
ATOM 9904  O O    . GLY A 1 45  ? 31.162 26.056 21.163 1.00 0.00 ? 15 GLY A O    10 
ATOM 9905  H H    . GLY A 1 45  ? 32.050 29.776 19.191 1.00 0.00 ? 15 GLY A H    10 
ATOM 9906  H HA2  . GLY A 1 45  ? 31.529 27.045 18.874 1.00 0.00 ? 15 GLY A HA2  10 
ATOM 9907  H HA3  . GLY A 1 45  ? 33.040 27.717 19.482 1.00 0.00 ? 15 GLY A HA3  10 
ATOM 9908  N N    . ASN A 1 46  ? 31.877 28.011 22.019 1.00 0.00 ? 16 ASN A N    10 
ATOM 9909  C CA   . ASN A 1 46  ? 31.565 27.617 23.390 1.00 0.00 ? 16 ASN A CA   10 
ATOM 9910  C C    . ASN A 1 46  ? 30.071 27.349 23.548 1.00 0.00 ? 16 ASN A C    10 
ATOM 9911  O O    . ASN A 1 46  ? 29.675 26.393 24.218 1.00 0.00 ? 16 ASN A O    10 
ATOM 9912  C CB   . ASN A 1 46  ? 31.993 28.722 24.360 1.00 0.00 ? 16 ASN A CB   10 
ATOM 9913  C CG   . ASN A 1 46  ? 33.508 28.906 24.321 1.00 0.00 ? 16 ASN A CG   10 
ATOM 9914  O OD1  . ASN A 1 46  ? 34.239 27.994 23.935 1.00 0.00 ? 16 ASN A OD1  10 
ATOM 9915  N ND2  . ASN A 1 46  ? 34.025 30.042 24.702 1.00 0.00 ? 16 ASN A ND2  10 
ATOM 9916  H H    . ASN A 1 46  ? 32.287 28.884 21.846 1.00 0.00 ? 16 ASN A H    10 
ATOM 9917  H HA   . ASN A 1 46  ? 32.110 26.717 23.628 1.00 0.00 ? 16 ASN A HA   10 
ATOM 9918  H HB2  . ASN A 1 46  ? 31.512 29.648 24.079 1.00 0.00 ? 16 ASN A HB2  10 
ATOM 9919  H HB3  . ASN A 1 46  ? 31.692 28.455 25.361 1.00 0.00 ? 16 ASN A HB3  10 
ATOM 9920  H HD21 . ASN A 1 46  ? 33.443 30.768 25.011 1.00 0.00 ? 16 ASN A HD21 10 
ATOM 9921  H HD22 . ASN A 1 46  ? 34.997 30.168 24.679 1.00 0.00 ? 16 ASN A HD22 10 
ATOM 9922  N N    . LYS A 1 47  ? 29.242 28.164 22.897 1.00 0.00 ? 17 LYS A N    10 
ATOM 9923  C CA   . LYS A 1 47  ? 27.800 27.951 22.947 1.00 0.00 ? 17 LYS A CA   10 
ATOM 9924  C C    . LYS A 1 47  ? 27.438 26.595 22.347 1.00 0.00 ? 17 LYS A C    10 
ATOM 9925  O O    . LYS A 1 47  ? 26.655 25.836 22.929 1.00 0.00 ? 17 LYS A O    10 
ATOM 9926  C CB   . LYS A 1 47  ? 27.084 29.064 22.175 1.00 0.00 ? 17 LYS A CB   10 
ATOM 9927  C CG   . LYS A 1 47  ? 25.567 28.935 22.350 1.00 0.00 ? 17 LYS A CG   10 
ATOM 9928  C CD   . LYS A 1 47  ? 25.165 29.413 23.746 1.00 0.00 ? 17 LYS A CD   10 
ATOM 9929  C CE   . LYS A 1 47  ? 23.642 29.374 23.879 1.00 0.00 ? 17 LYS A CE   10 
ATOM 9930  N NZ   . LYS A 1 47  ? 23.232 30.107 25.112 1.00 0.00 ? 17 LYS A NZ   10 
ATOM 9931  H H    . LYS A 1 47  ? 29.603 28.941 22.416 1.00 0.00 ? 17 LYS A H    10 
ATOM 9932  H HA   . LYS A 1 47  ? 27.479 27.976 23.977 1.00 0.00 ? 17 LYS A HA   10 
ATOM 9933  H HB2  . LYS A 1 47  ? 27.407 30.025 22.551 1.00 0.00 ? 17 LYS A HB2  10 
ATOM 9934  H HB3  . LYS A 1 47  ? 27.330 28.989 21.126 1.00 0.00 ? 17 LYS A HB3  10 
ATOM 9935  H HG2  . LYS A 1 47  ? 25.070 29.540 21.605 1.00 0.00 ? 17 LYS A HG2  10 
ATOM 9936  H HG3  . LYS A 1 47  ? 25.276 27.903 22.228 1.00 0.00 ? 17 LYS A HG3  10 
ATOM 9937  H HD2  . LYS A 1 47  ? 25.608 28.768 24.492 1.00 0.00 ? 17 LYS A HD2  10 
ATOM 9938  H HD3  . LYS A 1 47  ? 25.510 30.424 23.895 1.00 0.00 ? 17 LYS A HD3  10 
ATOM 9939  H HE2  . LYS A 1 47  ? 23.192 29.842 23.017 1.00 0.00 ? 17 LYS A HE2  10 
ATOM 9940  H HE3  . LYS A 1 47  ? 23.312 28.348 23.946 1.00 0.00 ? 17 LYS A HE3  10 
ATOM 9941  H HZ1  . LYS A 1 47  ? 23.680 29.669 25.941 1.00 0.00 ? 17 LYS A HZ1  10 
ATOM 9942  H HZ2  . LYS A 1 47  ? 22.197 30.062 25.212 1.00 0.00 ? 17 LYS A HZ2  10 
ATOM 9943  H HZ3  . LYS A 1 47  ? 23.533 31.099 25.042 1.00 0.00 ? 17 LYS A HZ3  10 
ATOM 9944  N N    . ALA A 1 48  ? 28.043 26.268 21.207 1.00 0.00 ? 18 ALA A N    10 
ATOM 9945  C CA   . ALA A 1 48  ? 27.762 24.993 20.562 1.00 0.00 ? 18 ALA A CA   10 
ATOM 9946  C C    . ALA A 1 48  ? 28.123 23.843 21.492 1.00 0.00 ? 18 ALA A C    10 
ATOM 9947  O O    . ALA A 1 48  ? 27.378 22.869 21.599 1.00 0.00 ? 18 ALA A O    10 
ATOM 9948  C CB   . ALA A 1 48  ? 28.554 24.874 19.258 1.00 0.00 ? 18 ALA A CB   10 
ATOM 9949  H H    . ALA A 1 48  ? 28.667 26.895 20.787 1.00 0.00 ? 18 ALA A H    10 
ATOM 9950  H HA   . ALA A 1 48  ? 26.707 24.942 20.333 1.00 0.00 ? 18 ALA A HA   10 
ATOM 9951  H HB1  . ALA A 1 48  ? 28.121 24.099 18.644 1.00 0.00 ? 18 ALA A HB1  10 
ATOM 9952  H HB2  . ALA A 1 48  ? 29.581 24.625 19.483 1.00 0.00 ? 18 ALA A HB2  10 
ATOM 9953  H HB3  . ALA A 1 48  ? 28.519 25.815 18.728 1.00 0.00 ? 18 ALA A HB3  10 
ATOM 9954  N N    . LEU A 1 49  ? 29.268 23.954 22.161 1.00 0.00 ? 19 LEU A N    10 
ATOM 9955  C CA   . LEU A 1 49  ? 29.656 22.945 23.141 1.00 0.00 ? 19 LEU A CA   10 
ATOM 9956  C C    . LEU A 1 49  ? 28.632 22.862 24.271 1.00 0.00 ? 19 LEU A C    10 
ATOM 9957  O O    . LEU A 1 49  ? 28.240 21.772 24.683 1.00 0.00 ? 19 LEU A O    10 
ATOM 9958  C CB   . LEU A 1 49  ? 31.033 23.284 23.717 1.00 0.00 ? 19 LEU A CB   10 
ATOM 9959  C CG   . LEU A 1 49  ? 31.503 22.154 24.635 1.00 0.00 ? 19 LEU A CG   10 
ATOM 9960  C CD1  . LEU A 1 49  ? 31.840 20.920 23.796 1.00 0.00 ? 19 LEU A CD1  10 
ATOM 9961  C CD2  . LEU A 1 49  ? 32.752 22.607 25.396 1.00 0.00 ? 19 LEU A CD2  10 
ATOM 9962  H H    . LEU A 1 49  ? 29.868 24.706 21.972 1.00 0.00 ? 19 LEU A H    10 
ATOM 9963  H HA   . LEU A 1 49  ? 29.713 21.985 22.649 1.00 0.00 ? 19 LEU A HA   10 
ATOM 9964  H HB2  . LEU A 1 49  ? 31.739 23.408 22.908 1.00 0.00 ? 19 LEU A HB2  10 
ATOM 9965  H HB3  . LEU A 1 49  ? 30.970 24.201 24.283 1.00 0.00 ? 19 LEU A HB3  10 
ATOM 9966  H HG   . LEU A 1 49  ? 30.720 21.910 25.338 1.00 0.00 ? 19 LEU A HG   10 
ATOM 9967  H HD11 . LEU A 1 49  ? 32.472 20.257 24.370 1.00 0.00 ? 19 LEU A HD11 10 
ATOM 9968  H HD12 . LEU A 1 49  ? 32.359 21.225 22.899 1.00 0.00 ? 19 LEU A HD12 10 
ATOM 9969  H HD13 . LEU A 1 49  ? 30.929 20.407 23.530 1.00 0.00 ? 19 LEU A HD13 10 
ATOM 9970  H HD21 . LEU A 1 49  ? 33.125 21.787 25.994 1.00 0.00 ? 19 LEU A HD21 10 
ATOM 9971  H HD22 . LEU A 1 49  ? 32.502 23.436 26.040 1.00 0.00 ? 19 LEU A HD22 10 
ATOM 9972  H HD23 . LEU A 1 49  ? 33.512 22.913 24.692 1.00 0.00 ? 19 LEU A HD23 10 
ATOM 9973  N N    . SER A 1 50  ? 28.129 24.016 24.705 1.00 0.00 ? 20 SER A N    10 
ATOM 9974  C CA   . SER A 1 50  ? 27.170 24.049 25.806 1.00 0.00 ? 20 SER A CA   10 
ATOM 9975  C C    . SER A 1 50  ? 25.905 23.256 25.480 1.00 0.00 ? 20 SER A C    10 
ATOM 9976  O O    . SER A 1 50  ? 25.313 22.636 26.363 1.00 0.00 ? 20 SER A O    10 
ATOM 9977  C CB   . SER A 1 50  ? 26.792 25.498 26.117 1.00 0.00 ? 20 SER A CB   10 
ATOM 9978  O OG   . SER A 1 50  ? 25.996 25.529 27.294 1.00 0.00 ? 20 SER A OG   10 
ATOM 9979  H H    . SER A 1 50  ? 28.439 24.856 24.310 1.00 0.00 ? 20 SER A H    10 
ATOM 9980  H HA   . SER A 1 50  ? 27.633 23.620 26.681 1.00 0.00 ? 20 SER A HA   10 
ATOM 9981  H HB2  . SER A 1 50  ? 27.684 26.080 26.280 1.00 0.00 ? 20 SER A HB2  10 
ATOM 9982  H HB3  . SER A 1 50  ? 26.244 25.912 25.282 1.00 0.00 ? 20 SER A HB3  10 
ATOM 9983  H HG   . SER A 1 50  ? 25.135 25.432 27.052 1.00 0.00 ? 20 SER A HG   10 
ATOM 9984  N N    . VAL A 1 51  ? 25.495 23.277 24.216 1.00 0.00 ? 21 VAL A N    10 
ATOM 9985  C CA   . VAL A 1 51  ? 24.310 22.526 23.797 1.00 0.00 ? 21 VAL A CA   10 
ATOM 9986  C C    . VAL A 1 51  ? 24.614 21.074 23.403 1.00 0.00 ? 21 VAL A C    10 
ATOM 9987  O O    . VAL A 1 51  ? 23.701 20.350 23.001 1.00 0.00 ? 21 VAL A O    10 
ATOM 9988  C CB   . VAL A 1 51  ? 23.629 23.240 22.628 1.00 0.00 ? 21 VAL A CB   10 
ATOM 9989  C CG1  . VAL A 1 51  ? 23.233 24.654 23.055 1.00 0.00 ? 21 VAL A CG1  10 
ATOM 9990  C CG2  . VAL A 1 51  ? 24.591 23.322 21.442 1.00 0.00 ? 21 VAL A CG2  10 
ATOM 9991  H H    . VAL A 1 51  ? 25.961 23.852 23.570 1.00 0.00 ? 21 VAL A H    10 
ATOM 9992  H HA   . VAL A 1 51  ? 23.617 22.510 24.624 1.00 0.00 ? 21 VAL A HA   10 
ATOM 9993  H HB   . VAL A 1 51  ? 22.744 22.692 22.339 1.00 0.00 ? 21 VAL A HB   10 
ATOM 9994  H HG11 . VAL A 1 51  ? 22.817 24.627 24.051 1.00 0.00 ? 21 VAL A HG11 10 
ATOM 9995  H HG12 . VAL A 1 51  ? 22.498 25.046 22.368 1.00 0.00 ? 21 VAL A HG12 10 
ATOM 9996  H HG13 . VAL A 1 51  ? 24.107 25.289 23.048 1.00 0.00 ? 21 VAL A HG13 10 
ATOM 9997  H HG21 . VAL A 1 51  ? 25.382 24.021 21.671 1.00 0.00 ? 21 VAL A HG21 10 
ATOM 9998  H HG22 . VAL A 1 51  ? 24.057 23.656 20.566 1.00 0.00 ? 21 VAL A HG22 10 
ATOM 9999  H HG23 . VAL A 1 51  ? 25.017 22.347 21.253 1.00 0.00 ? 21 VAL A HG23 10 
ATOM 10000 N N    . GLY A 1 52  ? 25.870 20.635 23.509 1.00 0.00 ? 22 GLY A N    10 
ATOM 10001 C CA   . GLY A 1 52  ? 26.234 19.278 23.102 1.00 0.00 ? 22 GLY A CA   10 
ATOM 10002 C C    . GLY A 1 52  ? 26.584 19.167 21.611 1.00 0.00 ? 22 GLY A C    10 
ATOM 10003 O O    . GLY A 1 52  ? 26.694 18.059 21.087 1.00 0.00 ? 22 GLY A O    10 
ATOM 10004 H H    . GLY A 1 52  ? 26.558 21.220 23.892 1.00 0.00 ? 22 GLY A H    10 
ATOM 10005 H HA2  . GLY A 1 52  ? 27.089 18.961 23.682 1.00 0.00 ? 22 GLY A HA2  10 
ATOM 10006 H HA3  . GLY A 1 52  ? 25.407 18.618 23.314 1.00 0.00 ? 22 GLY A HA3  10 
ATOM 10007 N N    . ASN A 1 53  ? 26.757 20.297 20.927 1.00 0.00 ? 23 ASN A N    10 
ATOM 10008 C CA   . ASN A 1 53  ? 27.091 20.288 19.508 1.00 0.00 ? 23 ASN A CA   10 
ATOM 10009 C C    . ASN A 1 53  ? 28.602 20.423 19.318 1.00 0.00 ? 23 ASN A C    10 
ATOM 10010 O O    . ASN A 1 53  ? 29.103 21.432 18.814 1.00 0.00 ? 23 ASN A O    10 
ATOM 10011 C CB   . ASN A 1 53  ? 26.357 21.436 18.812 1.00 0.00 ? 23 ASN A CB   10 
ATOM 10012 C CG   . ASN A 1 53  ? 26.471 21.294 17.299 1.00 0.00 ? 23 ASN A CG   10 
ATOM 10013 O OD1  . ASN A 1 53  ? 27.444 20.731 16.799 1.00 0.00 ? 23 ASN A OD1  10 
ATOM 10014 N ND2  . ASN A 1 53  ? 25.530 21.779 16.539 1.00 0.00 ? 23 ASN A ND2  10 
ATOM 10015 H H    . ASN A 1 53  ? 26.675 21.156 21.390 1.00 0.00 ? 23 ASN A H    10 
ATOM 10016 H HA   . ASN A 1 53  ? 26.765 19.352 19.077 1.00 0.00 ? 23 ASN A HA   10 
ATOM 10017 H HB2  . ASN A 1 53  ? 25.315 21.418 19.096 1.00 0.00 ? 23 ASN A HB2  10 
ATOM 10018 H HB3  . ASN A 1 53  ? 26.794 22.376 19.114 1.00 0.00 ? 23 ASN A HB3  10 
ATOM 10019 H HD21 . ASN A 1 53  ? 24.760 22.232 16.943 1.00 0.00 ? 23 ASN A HD21 10 
ATOM 10020 H HD22 . ASN A 1 53  ? 25.590 21.692 15.565 1.00 0.00 ? 23 ASN A HD22 10 
ATOM 10021 N N    . ILE A 1 54  ? 29.328 19.376 19.700 1.00 0.00 ? 24 ILE A N    10 
ATOM 10022 C CA   . ILE A 1 54  ? 30.785 19.432 19.682 1.00 0.00 ? 24 ILE A CA   10 
ATOM 10023 C C    . ILE A 1 54  ? 31.305 19.631 18.258 1.00 0.00 ? 24 ILE A C    10 
ATOM 10024 O O    . ILE A 1 54  ? 32.282 20.352 18.053 1.00 0.00 ? 24 ILE A O    10 
ATOM 10025 C CB   . ILE A 1 54  ? 31.364 18.139 20.275 1.00 0.00 ? 24 ILE A CB   10 
ATOM 10026 C CG1  . ILE A 1 54  ? 30.828 17.935 21.694 1.00 0.00 ? 24 ILE A CG1  10 
ATOM 10027 C CG2  . ILE A 1 54  ? 32.893 18.224 20.335 1.00 0.00 ? 24 ILE A CG2  10 
ATOM 10028 C CD1  . ILE A 1 54  ? 31.249 16.557 22.209 1.00 0.00 ? 24 ILE A CD1  10 
ATOM 10029 H H    . ILE A 1 54  ? 28.878 18.557 19.995 1.00 0.00 ? 24 ILE A H    10 
ATOM 10030 H HA   . ILE A 1 54  ? 31.108 20.264 20.288 1.00 0.00 ? 24 ILE A HA   10 
ATOM 10031 H HB   . ILE A 1 54  ? 31.076 17.301 19.656 1.00 0.00 ? 24 ILE A HB   10 
ATOM 10032 H HG12 . ILE A 1 54  ? 31.230 18.699 22.343 1.00 0.00 ? 24 ILE A HG12 10 
ATOM 10033 H HG13 . ILE A 1 54  ? 29.750 17.999 21.686 1.00 0.00 ? 24 ILE A HG13 10 
ATOM 10034 H HG21 . ILE A 1 54  ? 33.280 18.455 19.354 1.00 0.00 ? 24 ILE A HG21 10 
ATOM 10035 H HG22 . ILE A 1 54  ? 33.294 17.278 20.667 1.00 0.00 ? 24 ILE A HG22 10 
ATOM 10036 H HG23 . ILE A 1 54  ? 33.183 19.000 21.029 1.00 0.00 ? 24 ILE A HG23 10 
ATOM 10037 H HD11 . ILE A 1 54  ? 31.121 15.826 21.424 1.00 0.00 ? 24 ILE A HD11 10 
ATOM 10038 H HD12 . ILE A 1 54  ? 30.637 16.285 23.056 1.00 0.00 ? 24 ILE A HD12 10 
ATOM 10039 H HD13 . ILE A 1 54  ? 32.286 16.585 22.508 1.00 0.00 ? 24 ILE A HD13 10 
ATOM 10040 N N    . ASP A 1 55  ? 30.635 19.032 17.274 1.00 0.00 ? 25 ASP A N    10 
ATOM 10041 C CA   . ASP A 1 55  ? 31.101 19.128 15.894 1.00 0.00 ? 25 ASP A CA   10 
ATOM 10042 C C    . ASP A 1 55  ? 31.125 20.581 15.429 1.00 0.00 ? 25 ASP A C    10 
ATOM 10043 O O    . ASP A 1 55  ? 32.141 21.065 14.925 1.00 0.00 ? 25 ASP A O    10 
ATOM 10044 C CB   . ASP A 1 55  ? 30.188 18.312 14.976 1.00 0.00 ? 25 ASP A CB   10 
ATOM 10045 C CG   . ASP A 1 55  ? 30.271 16.826 15.320 1.00 0.00 ? 25 ASP A CG   10 
ATOM 10046 O OD1  . ASP A 1 55  ? 31.322 16.390 15.764 1.00 0.00 ? 25 ASP A OD1  10 
ATOM 10047 O OD2  . ASP A 1 55  ? 29.277 16.143 15.134 1.00 0.00 ? 25 ASP A OD2  10 
ATOM 10048 H H    . ASP A 1 55  ? 29.822 18.525 17.477 1.00 0.00 ? 25 ASP A H    10 
ATOM 10049 H HA   . ASP A 1 55  ? 32.101 18.726 15.834 1.00 0.00 ? 25 ASP A HA   10 
ATOM 10050 H HB2  . ASP A 1 55  ? 29.169 18.650 15.096 1.00 0.00 ? 25 ASP A HB2  10 
ATOM 10051 H HB3  . ASP A 1 55  ? 30.493 18.457 13.949 1.00 0.00 ? 25 ASP A HB3  10 
ATOM 10052 N N    . ASP A 1 56  ? 30.024 21.294 15.654 1.00 0.00 ? 26 ASP A N    10 
ATOM 10053 C CA   . ASP A 1 56  ? 29.948 22.692 15.243 1.00 0.00 ? 26 ASP A CA   10 
ATOM 10054 C C    . ASP A 1 56  ? 30.973 23.532 15.996 1.00 0.00 ? 26 ASP A C    10 
ATOM 10055 O O    . ASP A 1 56  ? 31.634 24.387 15.406 1.00 0.00 ? 26 ASP A O    10 
ATOM 10056 C CB   . ASP A 1 56  ? 28.541 23.248 15.488 1.00 0.00 ? 26 ASP A CB   10 
ATOM 10057 C CG   . ASP A 1 56  ? 27.524 22.680 14.491 1.00 0.00 ? 26 ASP A CG   10 
ATOM 10058 O OD1  . ASP A 1 56  ? 26.413 23.183 14.477 1.00 0.00 ? 26 ASP A OD1  10 
ATOM 10059 O OD2  . ASP A 1 56  ? 27.852 21.753 13.764 1.00 0.00 ? 26 ASP A OD2  10 
ATOM 10060 H H    . ASP A 1 56  ? 29.255 20.876 16.093 1.00 0.00 ? 26 ASP A H    10 
ATOM 10061 H HA   . ASP A 1 56  ? 30.163 22.753 14.187 1.00 0.00 ? 26 ASP A HA   10 
ATOM 10062 H HB2  . ASP A 1 56  ? 28.230 22.991 16.491 1.00 0.00 ? 26 ASP A HB2  10 
ATOM 10063 H HB3  . ASP A 1 56  ? 28.566 24.323 15.394 1.00 0.00 ? 26 ASP A HB3  10 
ATOM 10064 N N    . ALA A 1 57  ? 31.137 23.253 17.288 1.00 0.00 ? 27 ALA A N    10 
ATOM 10065 C CA   . ALA A 1 57  ? 32.087 24.013 18.092 1.00 0.00 ? 27 ALA A CA   10 
ATOM 10066 C C    . ALA A 1 57  ? 33.499 23.864 17.531 1.00 0.00 ? 27 ALA A C    10 
ATOM 10067 O O    . ALA A 1 57  ? 34.211 24.853 17.355 1.00 0.00 ? 27 ALA A O    10 
ATOM 10068 C CB   . ALA A 1 57  ? 32.060 23.514 19.538 1.00 0.00 ? 27 ALA A CB   10 
ATOM 10069 H H    . ALA A 1 57  ? 30.590 22.555 17.711 1.00 0.00 ? 27 ALA A H    10 
ATOM 10070 H HA   . ALA A 1 57  ? 31.805 25.057 18.078 1.00 0.00 ? 27 ALA A HA   10 
ATOM 10071 H HB1  . ALA A 1 57  ? 31.065 23.172 19.783 1.00 0.00 ? 27 ALA A HB1  10 
ATOM 10072 H HB2  . ALA A 1 57  ? 32.339 24.318 20.201 1.00 0.00 ? 27 ALA A HB2  10 
ATOM 10073 H HB3  . ALA A 1 57  ? 32.758 22.696 19.651 1.00 0.00 ? 27 ALA A HB3  10 
ATOM 10074 N N    . LEU A 1 58  ? 33.887 22.630 17.214 1.00 0.00 ? 28 LEU A N    10 
ATOM 10075 C CA   . LEU A 1 58  ? 35.215 22.388 16.658 1.00 0.00 ? 28 LEU A CA   10 
ATOM 10076 C C    . LEU A 1 58  ? 35.410 23.133 15.341 1.00 0.00 ? 28 LEU A C    10 
ATOM 10077 O O    . LEU A 1 58  ? 36.470 23.718 15.110 1.00 0.00 ? 28 LEU A O    10 
ATOM 10078 C CB   . LEU A 1 58  ? 35.422 20.888 16.429 1.00 0.00 ? 28 LEU A CB   10 
ATOM 10079 C CG   . LEU A 1 58  ? 35.431 20.156 17.773 1.00 0.00 ? 28 LEU A CG   10 
ATOM 10080 C CD1  . LEU A 1 58  ? 35.405 18.645 17.532 1.00 0.00 ? 28 LEU A CD1  10 
ATOM 10081 C CD2  . LEU A 1 58  ? 36.703 20.521 18.543 1.00 0.00 ? 28 LEU A CD2  10 
ATOM 10082 H H    . LEU A 1 58  ? 33.285 21.875 17.373 1.00 0.00 ? 28 LEU A H    10 
ATOM 10083 H HA   . LEU A 1 58  ? 35.954 22.734 17.363 1.00 0.00 ? 28 LEU A HA   10 
ATOM 10084 H HB2  . LEU A 1 58  ? 34.620 20.505 15.815 1.00 0.00 ? 28 LEU A HB2  10 
ATOM 10085 H HB3  . LEU A 1 58  ? 36.365 20.728 15.929 1.00 0.00 ? 28 LEU A HB3  10 
ATOM 10086 H HG   . LEU A 1 58  ? 34.565 20.446 18.348 1.00 0.00 ? 28 LEU A HG   10 
ATOM 10087 H HD11 . LEU A 1 58  ? 36.128 18.390 16.772 1.00 0.00 ? 28 LEU A HD11 10 
ATOM 10088 H HD12 . LEU A 1 58  ? 34.418 18.351 17.204 1.00 0.00 ? 28 LEU A HD12 10 
ATOM 10089 H HD13 . LEU A 1 58  ? 35.648 18.131 18.449 1.00 0.00 ? 28 LEU A HD13 10 
ATOM 10090 H HD21 . LEU A 1 58  ? 37.541 20.546 17.863 1.00 0.00 ? 28 LEU A HD21 10 
ATOM 10091 H HD22 . LEU A 1 58  ? 36.884 19.781 19.310 1.00 0.00 ? 28 LEU A HD22 10 
ATOM 10092 H HD23 . LEU A 1 58  ? 36.581 21.491 19.001 1.00 0.00 ? 28 LEU A HD23 10 
ATOM 10093 N N    . GLN A 1 59  ? 34.380 23.147 14.493 1.00 0.00 ? 29 GLN A N    10 
ATOM 10094 C CA   . GLN A 1 59  ? 34.492 23.836 13.210 1.00 0.00 ? 29 GLN A CA   10 
ATOM 10095 C C    . GLN A 1 59  ? 34.742 25.328 13.404 1.00 0.00 ? 29 GLN A C    10 
ATOM 10096 O O    . GLN A 1 59  ? 35.629 25.902 12.766 1.00 0.00 ? 29 GLN A O    10 
ATOM 10097 C CB   . GLN A 1 59  ? 33.215 23.633 12.392 1.00 0.00 ? 29 GLN A CB   10 
ATOM 10098 C CG   . GLN A 1 59  ? 33.084 22.159 12.002 1.00 0.00 ? 29 GLN A CG   10 
ATOM 10099 C CD   . GLN A 1 59  ? 31.767 21.912 11.269 1.00 0.00 ? 29 GLN A CD   10 
ATOM 10100 O OE1  . GLN A 1 59  ? 30.840 22.719 11.351 1.00 0.00 ? 29 GLN A OE1  10 
ATOM 10101 N NE2  . GLN A 1 59  ? 31.630 20.833 10.549 1.00 0.00 ? 29 GLN A NE2  10 
ATOM 10102 H H    . GLN A 1 59  ? 33.560 22.655 14.714 1.00 0.00 ? 29 GLN A H    10 
ATOM 10103 H HA   . GLN A 1 59  ? 35.322 23.414 12.663 1.00 0.00 ? 29 GLN A HA   10 
ATOM 10104 H HB2  . GLN A 1 59  ? 32.359 23.928 12.983 1.00 0.00 ? 29 GLN A HB2  10 
ATOM 10105 H HB3  . GLN A 1 59  ? 33.260 24.236 11.497 1.00 0.00 ? 29 GLN A HB3  10 
ATOM 10106 H HG2  . GLN A 1 59  ? 33.907 21.888 11.358 1.00 0.00 ? 29 GLN A HG2  10 
ATOM 10107 H HG3  . GLN A 1 59  ? 33.115 21.550 12.893 1.00 0.00 ? 29 GLN A HG3  10 
ATOM 10108 H HE21 . GLN A 1 59  ? 32.366 20.189 10.483 1.00 0.00 ? 29 GLN A HE21 10 
ATOM 10109 H HE22 . GLN A 1 59  ? 30.789 20.664 10.075 1.00 0.00 ? 29 GLN A HE22 10 
ATOM 10110 N N    . TYR A 1 60  ? 33.991 25.951 14.314 1.00 0.00 ? 30 TYR A N    10 
ATOM 10111 C CA   . TYR A 1 60  ? 34.197 27.367 14.599 1.00 0.00 ? 30 TYR A CA   10 
ATOM 10112 C C    . TYR A 1 60  ? 35.608 27.622 15.116 1.00 0.00 ? 30 TYR A C    10 
ATOM 10113 O O    . TYR A 1 60  ? 36.264 28.578 14.694 1.00 0.00 ? 30 TYR A O    10 
ATOM 10114 C CB   . TYR A 1 60  ? 33.182 27.854 15.633 1.00 0.00 ? 30 TYR A CB   10 
ATOM 10115 C CG   . TYR A 1 60  ? 31.762 27.890 15.120 1.00 0.00 ? 30 TYR A CG   10 
ATOM 10116 C CD1  . TYR A 1 60  ? 30.787 27.066 15.697 1.00 0.00 ? 30 TYR A CD1  10 
ATOM 10117 C CD2  . TYR A 1 60  ? 31.420 28.748 14.068 1.00 0.00 ? 30 TYR A CD2  10 
ATOM 10118 C CE1  . TYR A 1 60  ? 29.470 27.101 15.220 1.00 0.00 ? 30 TYR A CE1  10 
ATOM 10119 C CE2  . TYR A 1 60  ? 30.104 28.782 13.592 1.00 0.00 ? 30 TYR A CE2  10 
ATOM 10120 C CZ   . TYR A 1 60  ? 29.129 27.959 14.168 1.00 0.00 ? 30 TYR A CZ   10 
ATOM 10121 O OH   . TYR A 1 60  ? 27.832 27.992 13.699 1.00 0.00 ? 30 TYR A OH   10 
ATOM 10122 H H    . TYR A 1 60  ? 33.269 25.464 14.761 1.00 0.00 ? 30 TYR A H    10 
ATOM 10123 H HA   . TYR A 1 60  ? 34.056 27.928 13.686 1.00 0.00 ? 30 TYR A HA   10 
ATOM 10124 H HB2  . TYR A 1 60  ? 33.218 27.197 16.489 1.00 0.00 ? 30 TYR A HB2  10 
ATOM 10125 H HB3  . TYR A 1 60  ? 33.466 28.848 15.951 1.00 0.00 ? 30 TYR A HB3  10 
ATOM 10126 H HD1  . TYR A 1 60  ? 31.049 26.404 16.509 1.00 0.00 ? 30 TYR A HD1  10 
ATOM 10127 H HD2  . TYR A 1 60  ? 32.172 29.383 13.626 1.00 0.00 ? 30 TYR A HD2  10 
ATOM 10128 H HE1  . TYR A 1 60  ? 28.719 26.466 15.664 1.00 0.00 ? 30 TYR A HE1  10 
ATOM 10129 H HE2  . TYR A 1 60  ? 29.841 29.444 12.780 1.00 0.00 ? 30 TYR A HE2  10 
ATOM 10130 H HH   . TYR A 1 60  ? 27.455 27.193 13.866 1.00 0.00 ? 30 TYR A HH   10 
ATOM 10131 N N    . TYR A 1 61  ? 36.093 26.750 16.000 1.00 0.00 ? 31 TYR A N    10 
ATOM 10132 C CA   . TYR A 1 61  ? 37.438 26.918 16.541 1.00 0.00 ? 31 TYR A CA   10 
ATOM 10133 C C    . TYR A 1 61  ? 38.489 26.839 15.439 1.00 0.00 ? 31 TYR A C    10 
ATOM 10134 O O    . TYR A 1 61  ? 39.432 27.630 15.416 1.00 0.00 ? 31 TYR A O    10 
ATOM 10135 C CB   . TYR A 1 61  ? 37.722 25.845 17.597 1.00 0.00 ? 31 TYR A CB   10 
ATOM 10136 C CG   . TYR A 1 61  ? 36.803 25.908 18.796 1.00 0.00 ? 31 TYR A CG   10 
ATOM 10137 C CD1  . TYR A 1 61  ? 36.474 27.142 19.369 1.00 0.00 ? 31 TYR A CD1  10 
ATOM 10138 C CD2  . TYR A 1 61  ? 36.282 24.726 19.338 1.00 0.00 ? 31 TYR A CD2  10 
ATOM 10139 C CE1  . TYR A 1 61  ? 35.625 27.195 20.481 1.00 0.00 ? 31 TYR A CE1  10 
ATOM 10140 C CE2  . TYR A 1 61  ? 35.433 24.778 20.449 1.00 0.00 ? 31 TYR A CE2  10 
ATOM 10141 C CZ   . TYR A 1 61  ? 35.104 26.013 21.021 1.00 0.00 ? 31 TYR A CZ   10 
ATOM 10142 O OH   . TYR A 1 61  ? 34.267 26.066 22.116 1.00 0.00 ? 31 TYR A OH   10 
ATOM 10143 H H    . TYR A 1 61  ? 35.531 26.010 16.313 1.00 0.00 ? 31 TYR A H    10 
ATOM 10144 H HA   . TYR A 1 61  ? 37.502 27.888 17.012 1.00 0.00 ? 31 TYR A HA   10 
ATOM 10145 H HB2  . TYR A 1 61  ? 37.618 24.875 17.139 1.00 0.00 ? 31 TYR A HB2  10 
ATOM 10146 H HB3  . TYR A 1 61  ? 38.744 25.957 17.932 1.00 0.00 ? 31 TYR A HB3  10 
ATOM 10147 H HD1  . TYR A 1 61  ? 36.874 28.055 18.953 1.00 0.00 ? 31 TYR A HD1  10 
ATOM 10148 H HD2  . TYR A 1 61  ? 36.536 23.773 18.898 1.00 0.00 ? 31 TYR A HD2  10 
ATOM 10149 H HE1  . TYR A 1 61  ? 35.372 28.146 20.924 1.00 0.00 ? 31 TYR A HE1  10 
ATOM 10150 H HE2  . TYR A 1 61  ? 35.031 23.866 20.866 1.00 0.00 ? 31 TYR A HE2  10 
ATOM 10151 H HH   . TYR A 1 61  ? 33.877 26.877 22.130 1.00 0.00 ? 31 TYR A HH   10 
ATOM 10152 N N    . ALA A 1 62  ? 38.291 25.928 14.489 1.00 0.00 ? 32 ALA A N    10 
ATOM 10153 C CA   . ALA A 1 62  ? 39.241 25.781 13.392 1.00 0.00 ? 32 ALA A CA   10 
ATOM 10154 C C    . ALA A 1 62  ? 39.292 27.053 12.554 1.00 0.00 ? 32 ALA A C    10 
ATOM 10155 O O    . ALA A 1 62  ? 40.371 27.547 12.219 1.00 0.00 ? 32 ALA A O    10 
ATOM 10156 C CB   . ALA A 1 62  ? 38.839 24.600 12.506 1.00 0.00 ? 32 ALA A CB   10 
ATOM 10157 H H    . ALA A 1 62  ? 37.521 25.324 14.548 1.00 0.00 ? 32 ALA A H    10 
ATOM 10158 H HA   . ALA A 1 62  ? 40.223 25.591 13.800 1.00 0.00 ? 32 ALA A HA   10 
ATOM 10159 H HB1  . ALA A 1 62  ? 39.592 24.446 11.748 1.00 0.00 ? 32 ALA A HB1  10 
ATOM 10160 H HB2  . ALA A 1 62  ? 37.890 24.812 12.034 1.00 0.00 ? 32 ALA A HB2  10 
ATOM 10161 H HB3  . ALA A 1 62  ? 38.749 23.711 13.111 1.00 0.00 ? 32 ALA A HB3  10 
ATOM 10162 N N    . ALA A 1 63  ? 38.118 27.609 12.260 1.00 0.00 ? 33 ALA A N    10 
ATOM 10163 C CA   . ALA A 1 63  ? 38.059 28.845 11.491 1.00 0.00 ? 33 ALA A CA   10 
ATOM 10164 C C    . ALA A 1 63  ? 38.735 29.986 12.245 1.00 0.00 ? 33 ALA A C    10 
ATOM 10165 O O    . ALA A 1 63  ? 39.458 30.784 11.650 1.00 0.00 ? 33 ALA A O    10 
ATOM 10166 C CB   . ALA A 1 63  ? 36.601 29.213 11.206 1.00 0.00 ? 33 ALA A CB   10 
ATOM 10167 H H    . ALA A 1 63  ? 37.288 27.167 12.538 1.00 0.00 ? 33 ALA A H    10 
ATOM 10168 H HA   . ALA A 1 63  ? 38.569 28.696 10.550 1.00 0.00 ? 33 ALA A HA   10 
ATOM 10169 H HB1  . ALA A 1 63  ? 36.053 28.324 10.928 1.00 0.00 ? 33 ALA A HB1  10 
ATOM 10170 H HB2  . ALA A 1 63  ? 36.561 29.927 10.398 1.00 0.00 ? 33 ALA A HB2  10 
ATOM 10171 H HB3  . ALA A 1 63  ? 36.159 29.646 12.092 1.00 0.00 ? 33 ALA A HB3  10 
ATOM 10172 N N    . ALA A 1 64  ? 38.538 30.032 13.560 1.00 0.00 ? 34 ALA A N    10 
ATOM 10173 C CA   . ALA A 1 64  ? 39.137 31.092 14.364 1.00 0.00 ? 34 ALA A CA   10 
ATOM 10174 C C    . ALA A 1 64  ? 40.661 31.051 14.277 1.00 0.00 ? 34 ALA A C    10 
ATOM 10175 O O    . ALA A 1 64  ? 41.304 32.081 14.058 1.00 0.00 ? 34 ALA A O    10 
ATOM 10176 C CB   . ALA A 1 64  ? 38.679 30.940 15.821 1.00 0.00 ? 34 ALA A CB   10 
ATOM 10177 H H    . ALA A 1 64  ? 37.953 29.372 13.987 1.00 0.00 ? 34 ALA A H    10 
ATOM 10178 H HA   . ALA A 1 64  ? 38.793 32.046 13.994 1.00 0.00 ? 34 ALA A HA   10 
ATOM 10179 H HB1  . ALA A 1 64  ? 39.485 31.191 16.496 1.00 0.00 ? 34 ALA A HB1  10 
ATOM 10180 H HB2  . ALA A 1 64  ? 38.373 29.919 15.996 1.00 0.00 ? 34 ALA A HB2  10 
ATOM 10181 H HB3  . ALA A 1 64  ? 37.842 31.599 16.002 1.00 0.00 ? 34 ALA A HB3  10 
ATOM 10182 N N    . ILE A 1 65  ? 41.236 29.854 14.391 1.00 0.00 ? 35 ILE A N    10 
ATOM 10183 C CA   . ILE A 1 65  ? 42.688 29.722 14.316 1.00 0.00 ? 35 ILE A CA   10 
ATOM 10184 C C    . ILE A 1 65  ? 43.196 30.193 12.954 1.00 0.00 ? 35 ILE A C    10 
ATOM 10185 O O    . ILE A 1 65  ? 44.159 30.959 12.880 1.00 0.00 ? 35 ILE A O    10 
ATOM 10186 C CB   . ILE A 1 65  ? 43.093 28.263 14.570 1.00 0.00 ? 35 ILE A CB   10 
ATOM 10187 C CG1  . ILE A 1 65  ? 42.609 27.841 15.959 1.00 0.00 ? 35 ILE A CG1  10 
ATOM 10188 C CG2  . ILE A 1 65  ? 44.618 28.112 14.516 1.00 0.00 ? 35 ILE A CG2  10 
ATOM 10189 C CD1  . ILE A 1 65  ? 42.736 26.324 16.106 1.00 0.00 ? 35 ILE A CD1  10 
ATOM 10190 H H    . ILE A 1 65  ? 40.682 29.062 14.560 1.00 0.00 ? 35 ILE A H    10 
ATOM 10191 H HA   . ILE A 1 65  ? 43.131 30.342 15.082 1.00 0.00 ? 35 ILE A HA   10 
ATOM 10192 H HB   . ILE A 1 65  ? 42.642 27.629 13.823 1.00 0.00 ? 35 ILE A HB   10 
ATOM 10193 H HG12 . ILE A 1 65  ? 43.212 28.328 16.711 1.00 0.00 ? 35 ILE A HG12 10 
ATOM 10194 H HG13 . ILE A 1 65  ? 41.577 28.128 16.085 1.00 0.00 ? 35 ILE A HG13 10 
ATOM 10195 H HG21 . ILE A 1 65  ? 44.957 28.253 13.500 1.00 0.00 ? 35 ILE A HG21 10 
ATOM 10196 H HG22 . ILE A 1 65  ? 44.895 27.124 14.853 1.00 0.00 ? 35 ILE A HG22 10 
ATOM 10197 H HG23 . ILE A 1 65  ? 45.076 28.853 15.155 1.00 0.00 ? 35 ILE A HG23 10 
ATOM 10198 H HD11 . ILE A 1 65  ? 42.162 25.837 15.334 1.00 0.00 ? 35 ILE A HD11 10 
ATOM 10199 H HD12 . ILE A 1 65  ? 42.363 26.024 17.074 1.00 0.00 ? 35 ILE A HD12 10 
ATOM 10200 H HD13 . ILE A 1 65  ? 43.774 26.039 16.016 1.00 0.00 ? 35 ILE A HD13 10 
ATOM 10201 N N    . THR A 1 66  ? 42.538 29.754 11.881 1.00 0.00 ? 36 THR A N    10 
ATOM 10202 C CA   . THR A 1 66  ? 42.969 30.144 10.543 1.00 0.00 ? 36 THR A CA   10 
ATOM 10203 C C    . THR A 1 66  ? 42.897 31.660 10.361 1.00 0.00 ? 36 THR A C    10 
ATOM 10204 O O    . THR A 1 66  ? 43.823 32.274 9.829  1.00 0.00 ? 36 THR A O    10 
ATOM 10205 C CB   . THR A 1 66  ? 42.098 29.460 9.489  1.00 0.00 ? 36 THR A CB   10 
ATOM 10206 O OG1  . THR A 1 66  ? 41.980 28.078 9.794  1.00 0.00 ? 36 THR A OG1  10 
ATOM 10207 C CG2  . THR A 1 66  ? 42.749 29.623 8.115  1.00 0.00 ? 36 THR A CG2  10 
ATOM 10208 H H    . THR A 1 66  ? 41.775 29.145 11.991 1.00 0.00 ? 36 THR A H    10 
ATOM 10209 H HA   . THR A 1 66  ? 43.992 29.827 10.402 1.00 0.00 ? 36 THR A HA   10 
ATOM 10210 H HB   . THR A 1 66  ? 41.118 29.914 9.476  1.00 0.00 ? 36 THR A HB   10 
ATOM 10211 H HG1  . THR A 1 66  ? 41.569 27.675 9.102  1.00 0.00 ? 36 THR A HG1  10 
ATOM 10212 H HG21 . THR A 1 66  ? 42.666 30.651 7.796  1.00 0.00 ? 36 THR A HG21 10 
ATOM 10213 H HG22 . THR A 1 66  ? 42.250 28.982 7.403  1.00 0.00 ? 36 THR A HG22 10 
ATOM 10214 H HG23 . THR A 1 66  ? 43.792 29.348 8.177  1.00 0.00 ? 36 THR A HG23 10 
ATOM 10215 N N    . LEU A 1 67  ? 41.816 32.269 10.845 1.00 0.00 ? 37 LEU A N    10 
ATOM 10216 C CA   . LEU A 1 67  ? 41.656 33.716 10.720 1.00 0.00 ? 37 LEU A CA   10 
ATOM 10217 C C    . LEU A 1 67  ? 42.776 34.466 11.434 1.00 0.00 ? 37 LEU A C    10 
ATOM 10218 O O    . LEU A 1 67  ? 43.202 35.527 10.979 1.00 0.00 ? 37 LEU A O    10 
ATOM 10219 C CB   . LEU A 1 67  ? 40.305 34.150 11.292 1.00 0.00 ? 37 LEU A CB   10 
ATOM 10220 C CG   . LEU A 1 67  ? 39.177 33.623 10.405 1.00 0.00 ? 37 LEU A CG   10 
ATOM 10221 C CD1  . LEU A 1 67  ? 37.836 33.818 11.116 1.00 0.00 ? 37 LEU A CD1  10 
ATOM 10222 C CD2  . LEU A 1 67  ? 39.165 34.397 9.084  1.00 0.00 ? 37 LEU A CD2  10 
ATOM 10223 H H    . LEU A 1 67  ? 41.110 31.741 11.268 1.00 0.00 ? 37 LEU A H    10 
ATOM 10224 H HA   . LEU A 1 67  ? 41.684 33.976 9.673  1.00 0.00 ? 37 LEU A HA   10 
ATOM 10225 H HB2  . LEU A 1 67  ? 40.194 33.752 12.290 1.00 0.00 ? 37 LEU A HB2  10 
ATOM 10226 H HB3  . LEU A 1 67  ? 40.258 35.228 11.327 1.00 0.00 ? 37 LEU A HB3  10 
ATOM 10227 H HG   . LEU A 1 67  ? 39.332 32.573 10.206 1.00 0.00 ? 37 LEU A HG   10 
ATOM 10228 H HD11 . LEU A 1 67  ? 37.481 34.824 10.949 1.00 0.00 ? 37 LEU A HD11 10 
ATOM 10229 H HD12 . LEU A 1 67  ? 37.966 33.653 12.175 1.00 0.00 ? 37 LEU A HD12 10 
ATOM 10230 H HD13 . LEU A 1 67  ? 37.117 33.111 10.728 1.00 0.00 ? 37 LEU A HD13 10 
ATOM 10231 H HD21 . LEU A 1 67  ? 39.904 33.978 8.415  1.00 0.00 ? 37 LEU A HD21 10 
ATOM 10232 H HD22 . LEU A 1 67  ? 39.398 35.434 9.272  1.00 0.00 ? 37 LEU A HD22 10 
ATOM 10233 H HD23 . LEU A 1 67  ? 38.187 34.323 8.631  1.00 0.00 ? 37 LEU A HD23 10 
ATOM 10234 N N    . ASP A 1 68  ? 43.223 33.935 12.570 1.00 0.00 ? 38 ASP A N    10 
ATOM 10235 C CA   . ASP A 1 68  ? 44.356 34.524 13.271 1.00 0.00 ? 38 ASP A CA   10 
ATOM 10236 C C    . ASP A 1 68  ? 45.630 34.411 12.441 1.00 0.00 ? 38 ASP A C    10 
ATOM 10237 O O    . ASP A 1 68  ? 46.354 35.390 12.258 1.00 0.00 ? 38 ASP A O    10 
ATOM 10238 C CB   . ASP A 1 68  ? 44.557 33.821 14.615 1.00 0.00 ? 38 ASP A CB   10 
ATOM 10239 C CG   . ASP A 1 68  ? 45.610 34.558 15.436 1.00 0.00 ? 38 ASP A CG   10 
ATOM 10240 O OD1  . ASP A 1 68  ? 45.254 35.517 16.101 1.00 0.00 ? 38 ASP A OD1  10 
ATOM 10241 O OD2  . ASP A 1 68  ? 46.760 34.151 15.389 1.00 0.00 ? 38 ASP A OD2  10 
ATOM 10242 H H    . ASP A 1 68  ? 42.754 33.167 12.963 1.00 0.00 ? 38 ASP A H    10 
ATOM 10243 H HA   . ASP A 1 68  ? 44.149 35.569 13.453 1.00 0.00 ? 38 ASP A HA   10 
ATOM 10244 H HB2  . ASP A 1 68  ? 43.622 33.813 15.157 1.00 0.00 ? 38 ASP A HB2  10 
ATOM 10245 H HB3  . ASP A 1 68  ? 44.882 32.806 14.444 1.00 0.00 ? 38 ASP A HB3  10 
ATOM 10246 N N    . LYS A 1 69  ? 45.902 33.211 11.935 1.00 0.00 ? 39 LYS A N    10 
ATOM 10247 C CA   . LYS A 1 69  ? 47.103 32.986 11.135 1.00 0.00 ? 39 LYS A CA   10 
ATOM 10248 C C    . LYS A 1 69  ? 47.138 33.860 9.882  1.00 0.00 ? 39 LYS A C    10 
ATOM 10249 O O    . LYS A 1 69  ? 48.217 34.216 9.407  1.00 0.00 ? 39 LYS A O    10 
ATOM 10250 C CB   . LYS A 1 69  ? 47.193 31.512 10.733 1.00 0.00 ? 39 LYS A CB   10 
ATOM 10251 C CG   . LYS A 1 69  ? 47.384 30.654 11.984 1.00 0.00 ? 39 LYS A CG   10 
ATOM 10252 C CD   . LYS A 1 69  ? 47.586 29.192 11.578 1.00 0.00 ? 39 LYS A CD   10 
ATOM 10253 C CE   . LYS A 1 69  ? 47.670 28.319 12.832 1.00 0.00 ? 39 LYS A CE   10 
ATOM 10254 N NZ   . LYS A 1 69  ? 47.278 26.923 12.492 1.00 0.00 ? 39 LYS A NZ   10 
ATOM 10255 H H    . LYS A 1 69  ? 45.297 32.462 12.122 1.00 0.00 ? 39 LYS A H    10 
ATOM 10256 H HA   . LYS A 1 69  ? 47.965 33.224 11.741 1.00 0.00 ? 39 LYS A HA   10 
ATOM 10257 H HB2  . LYS A 1 69  ? 46.281 31.221 10.231 1.00 0.00 ? 39 LYS A HB2  10 
ATOM 10258 H HB3  . LYS A 1 69  ? 48.032 31.370 10.070 1.00 0.00 ? 39 LYS A HB3  10 
ATOM 10259 H HG2  . LYS A 1 69  ? 48.250 31.000 12.529 1.00 0.00 ? 39 LYS A HG2  10 
ATOM 10260 H HG3  . LYS A 1 69  ? 46.509 30.731 12.612 1.00 0.00 ? 39 LYS A HG3  10 
ATOM 10261 H HD2  . LYS A 1 69  ? 46.753 28.870 10.968 1.00 0.00 ? 39 LYS A HD2  10 
ATOM 10262 H HD3  . LYS A 1 69  ? 48.501 29.098 11.015 1.00 0.00 ? 39 LYS A HD3  10 
ATOM 10263 H HE2  . LYS A 1 69  ? 48.684 28.326 13.207 1.00 0.00 ? 39 LYS A HE2  10 
ATOM 10264 H HE3  . LYS A 1 69  ? 47.005 28.707 13.587 1.00 0.00 ? 39 LYS A HE3  10 
ATOM 10265 H HZ1  . LYS A 1 69  ? 47.564 26.284 13.261 1.00 0.00 ? 39 LYS A HZ1  10 
ATOM 10266 H HZ2  . LYS A 1 69  ? 47.747 26.636 11.609 1.00 0.00 ? 39 LYS A HZ2  10 
ATOM 10267 H HZ3  . LYS A 1 69  ? 46.246 26.872 12.368 1.00 0.00 ? 39 LYS A HZ3  10 
ATOM 10268 N N    . TYR A 1 70  ? 45.969 34.208 9.345  1.00 0.00 ? 40 TYR A N    10 
ATOM 10269 C CA   . TYR A 1 70  ? 45.911 35.061 8.162  1.00 0.00 ? 40 TYR A CA   10 
ATOM 10270 C C    . TYR A 1 70  ? 46.617 36.397 8.446  1.00 0.00 ? 40 TYR A C    10 
ATOM 10271 O O    . TYR A 1 70  ? 46.327 37.023 9.467  1.00 0.00 ? 40 TYR A O    10 
ATOM 10272 C CB   . TYR A 1 70  ? 44.438 35.287 7.813  1.00 0.00 ? 40 TYR A CB   10 
ATOM 10273 C CG   . TYR A 1 70  ? 44.190 35.761 6.401  1.00 0.00 ? 40 TYR A CG   10 
ATOM 10274 C CD1  . TYR A 1 70  ? 44.405 34.899 5.320  1.00 0.00 ? 40 TYR A CD1  10 
ATOM 10275 C CD2  . TYR A 1 70  ? 43.708 37.054 6.179  1.00 0.00 ? 40 TYR A CD2  10 
ATOM 10276 C CE1  . TYR A 1 70  ? 44.142 35.333 4.015  1.00 0.00 ? 40 TYR A CE1  10 
ATOM 10277 C CE2  . TYR A 1 70  ? 43.446 37.492 4.876  1.00 0.00 ? 40 TYR A CE2  10 
ATOM 10278 C CZ   . TYR A 1 70  ? 43.663 36.631 3.792  1.00 0.00 ? 40 TYR A CZ   10 
ATOM 10279 O OH   . TYR A 1 70  ? 43.404 37.061 2.507  1.00 0.00 ? 40 TYR A OH   10 
ATOM 10280 H H    . TYR A 1 70  ? 45.140 33.840 9.717  1.00 0.00 ? 40 TYR A H    10 
ATOM 10281 H HA   . TYR A 1 70  ? 46.386 34.538 7.348  1.00 0.00 ? 40 TYR A HA   10 
ATOM 10282 H HB2  . TYR A 1 70  ? 43.907 34.359 7.952  1.00 0.00 ? 40 TYR A HB2  10 
ATOM 10283 H HB3  . TYR A 1 70  ? 44.034 36.014 8.503  1.00 0.00 ? 40 TYR A HB3  10 
ATOM 10284 H HD1  . TYR A 1 70  ? 44.778 33.900 5.491  1.00 0.00 ? 40 TYR A HD1  10 
ATOM 10285 H HD2  . TYR A 1 70  ? 43.539 37.715 7.014  1.00 0.00 ? 40 TYR A HD2  10 
ATOM 10286 H HE1  . TYR A 1 70  ? 44.308 34.669 3.181  1.00 0.00 ? 40 TYR A HE1  10 
ATOM 10287 H HE2  . TYR A 1 70  ? 43.071 38.490 4.708  1.00 0.00 ? 40 TYR A HE2  10 
ATOM 10288 H HH   . TYR A 1 70  ? 42.911 37.812 2.560  1.00 0.00 ? 40 TYR A HH   10 
ATOM 10289 N N    . PRO A 1 71  ? 47.517 36.858 7.599  1.00 0.00 ? 41 PRO A N    10 
ATOM 10290 C CA   . PRO A 1 71  ? 48.341 38.065 7.913  1.00 0.00 ? 41 PRO A CA   10 
ATOM 10291 C C    . PRO A 1 71  ? 47.679 39.403 7.583  1.00 0.00 ? 41 PRO A C    10 
ATOM 10292 O O    . PRO A 1 71  ? 48.362 40.429 7.569  1.00 0.00 ? 41 PRO A O    10 
ATOM 10293 C CB   . PRO A 1 71  ? 49.589 37.859 7.056  1.00 0.00 ? 41 PRO A CB   10 
ATOM 10294 C CG   . PRO A 1 71  ? 49.123 37.109 5.853  1.00 0.00 ? 41 PRO A CG   10 
ATOM 10295 C CD   . PRO A 1 71  ? 47.847 36.361 6.248  1.00 0.00 ? 41 PRO A CD   10 
ATOM 10296 H HA   . PRO A 1 71  ? 48.630 38.050 8.951  1.00 0.00 ? 41 PRO A HA   10 
ATOM 10297 H HB2  . PRO A 1 71  ? 50.004 38.815 6.768  1.00 0.00 ? 41 PRO A HB2  10 
ATOM 10298 H HB3  . PRO A 1 71  ? 50.321 37.275 7.592  1.00 0.00 ? 41 PRO A HB3  10 
ATOM 10299 H HG2  . PRO A 1 71  ? 48.917 37.800 5.048  1.00 0.00 ? 41 PRO A HG2  10 
ATOM 10300 H HG3  . PRO A 1 71  ? 49.875 36.397 5.548  1.00 0.00 ? 41 PRO A HG3  10 
ATOM 10301 H HD2  . PRO A 1 71  ? 47.049 36.588 5.555  1.00 0.00 ? 41 PRO A HD2  10 
ATOM 10302 H HD3  . PRO A 1 71  ? 48.028 35.298 6.282  1.00 0.00 ? 41 PRO A HD3  10 
ATOM 10303 N N    . HIS A 1 72  ? 46.372 39.411 7.327  1.00 0.00 ? 42 HIS A N    10 
ATOM 10304 C CA   . HIS A 1 72  ? 45.703 40.649 6.920  1.00 0.00 ? 42 HIS A CA   10 
ATOM 10305 C C    . HIS A 1 72  ? 44.288 40.750 7.478  1.00 0.00 ? 42 HIS A C    10 
ATOM 10306 O O    . HIS A 1 72  ? 43.629 39.741 7.720  1.00 0.00 ? 42 HIS A O    10 
ATOM 10307 C CB   . HIS A 1 72  ? 45.649 40.729 5.394  1.00 0.00 ? 42 HIS A CB   10 
ATOM 10308 C CG   . HIS A 1 72  ? 47.003 40.878 4.755  1.00 0.00 ? 42 HIS A CG   10 
ATOM 10309 N ND1  . HIS A 1 72  ? 47.725 39.790 4.288  1.00 0.00 ? 42 HIS A ND1  10 
ATOM 10310 C CD2  . HIS A 1 72  ? 47.781 41.982 4.499  1.00 0.00 ? 42 HIS A CD2  10 
ATOM 10311 C CE1  . HIS A 1 72  ? 48.880 40.257 3.781  1.00 0.00 ? 42 HIS A CE1  10 
ATOM 10312 N NE2  . HIS A 1 72  ? 48.966 41.585 3.883  1.00 0.00 ? 42 HIS A NE2  10 
ATOM 10313 H H    . HIS A 1 72  ? 45.853 38.583 7.411  1.00 0.00 ? 42 HIS A H    10 
ATOM 10314 H HA   . HIS A 1 72  ? 46.277 41.487 7.284  1.00 0.00 ? 42 HIS A HA   10 
ATOM 10315 H HB2  . HIS A 1 72  ? 45.192 39.828 5.015  1.00 0.00 ? 42 HIS A HB2  10 
ATOM 10316 H HB3  . HIS A 1 72  ? 45.033 41.571 5.114  1.00 0.00 ? 42 HIS A HB3  10 
ATOM 10317 H HD1  . HIS A 1 72  ? 47.444 38.852 4.322  1.00 0.00 ? 42 HIS A HD1  10 
ATOM 10318 H HD2  . HIS A 1 72  ? 47.513 43.000 4.738  1.00 0.00 ? 42 HIS A HD2  10 
ATOM 10319 H HE1  . HIS A 1 72  ? 49.645 39.633 3.344  1.00 0.00 ? 42 HIS A HE1  10 
ATOM 10320 N N    . LYS A 1 73  ? 43.836 41.980 7.714  1.00 0.00 ? 43 LYS A N    10 
ATOM 10321 C CA   . LYS A 1 73  ? 42.434 42.203 8.045  1.00 0.00 ? 43 LYS A CA   10 
ATOM 10322 C C    . LYS A 1 73  ? 41.568 41.781 6.862  1.00 0.00 ? 43 LYS A C    10 
ATOM 10323 O O    . LYS A 1 73  ? 41.844 42.165 5.725  1.00 0.00 ? 43 LYS A O    10 
ATOM 10324 C CB   . LYS A 1 73  ? 42.194 43.687 8.337  1.00 0.00 ? 43 LYS A CB   10 
ATOM 10325 C CG   . LYS A 1 73  ? 40.763 43.894 8.843  1.00 0.00 ? 43 LYS A CG   10 
ATOM 10326 C CD   . LYS A 1 73  ? 40.652 43.423 10.296 1.00 0.00 ? 43 LYS A CD   10 
ATOM 10327 C CE   . LYS A 1 73  ? 39.245 43.718 10.820 1.00 0.00 ? 43 LYS A CE   10 
ATOM 10328 N NZ   . LYS A 1 73  ? 39.135 45.165 11.162 1.00 0.00 ? 43 LYS A NZ   10 
ATOM 10329 H H    . LYS A 1 73  ? 44.452 42.741 7.676  1.00 0.00 ? 43 LYS A H    10 
ATOM 10330 H HA   . LYS A 1 73  ? 42.171 41.617 8.911  1.00 0.00 ? 43 LYS A HA   10 
ATOM 10331 H HB2  . LYS A 1 73  ? 42.894 44.027 9.083  1.00 0.00 ? 43 LYS A HB2  10 
ATOM 10332 H HB3  . LYS A 1 73  ? 42.333 44.256 7.430  1.00 0.00 ? 43 LYS A HB3  10 
ATOM 10333 H HG2  . LYS A 1 73  ? 40.511 44.943 8.784  1.00 0.00 ? 43 LYS A HG2  10 
ATOM 10334 H HG3  . LYS A 1 73  ? 40.080 43.325 8.231  1.00 0.00 ? 43 LYS A HG3  10 
ATOM 10335 H HD2  . LYS A 1 73  ? 40.841 42.361 10.348 1.00 0.00 ? 43 LYS A HD2  10 
ATOM 10336 H HD3  . LYS A 1 73  ? 41.376 43.949 10.902 1.00 0.00 ? 43 LYS A HD3  10 
ATOM 10337 H HE2  . LYS A 1 73  ? 38.519 43.472 10.060 1.00 0.00 ? 43 LYS A HE2  10 
ATOM 10338 H HE3  . LYS A 1 73  ? 39.059 43.125 11.702 1.00 0.00 ? 43 LYS A HE3  10 
ATOM 10339 H HZ1  . LYS A 1 73  ? 39.006 45.719 10.291 1.00 0.00 ? 43 LYS A HZ1  10 
ATOM 10340 H HZ2  . LYS A 1 73  ? 40.003 45.474 11.646 1.00 0.00 ? 43 LYS A HZ2  10 
ATOM 10341 H HZ3  . LYS A 1 73  ? 38.318 45.312 11.788 1.00 0.00 ? 43 LYS A HZ3  10 
ATOM 10342 N N    . ILE A 1 74  ? 40.527 40.996 7.125  1.00 0.00 ? 44 ILE A N    10 
ATOM 10343 C CA   . ILE A 1 74  ? 39.613 40.593 6.060  1.00 0.00 ? 44 ILE A CA   10 
ATOM 10344 C C    . ILE A 1 74  ? 38.460 41.589 5.944  1.00 0.00 ? 44 ILE A C    10 
ATOM 10345 O O    . ILE A 1 74  ? 37.795 41.905 6.930  1.00 0.00 ? 44 ILE A O    10 
ATOM 10346 C CB   . ILE A 1 74  ? 39.104 39.168 6.317  1.00 0.00 ? 44 ILE A CB   10 
ATOM 10347 C CG1  . ILE A 1 74  ? 40.310 38.222 6.366  1.00 0.00 ? 44 ILE A CG1  10 
ATOM 10348 C CG2  . ILE A 1 74  ? 38.163 38.731 5.190  1.00 0.00 ? 44 ILE A CG2  10 
ATOM 10349 C CD1  . ILE A 1 74  ? 39.862 36.809 6.742  1.00 0.00 ? 44 ILE A CD1  10 
ATOM 10350 H H    . ILE A 1 74  ? 40.388 40.671 8.040  1.00 0.00 ? 44 ILE A H    10 
ATOM 10351 H HA   . ILE A 1 74  ? 40.158 40.597 5.128  1.00 0.00 ? 44 ILE A HA   10 
ATOM 10352 H HB   . ILE A 1 74  ? 38.580 39.135 7.261  1.00 0.00 ? 44 ILE A HB   10 
ATOM 10353 H HG12 . ILE A 1 74  ? 40.786 38.201 5.397  1.00 0.00 ? 44 ILE A HG12 10 
ATOM 10354 H HG13 . ILE A 1 74  ? 41.015 38.580 7.102  1.00 0.00 ? 44 ILE A HG13 10 
ATOM 10355 H HG21 . ILE A 1 74  ? 37.822 37.724 5.374  1.00 0.00 ? 44 ILE A HG21 10 
ATOM 10356 H HG22 . ILE A 1 74  ? 38.689 38.767 4.247  1.00 0.00 ? 44 ILE A HG22 10 
ATOM 10357 H HG23 . ILE A 1 74  ? 37.314 39.398 5.155  1.00 0.00 ? 44 ILE A HG23 10 
ATOM 10358 H HD11 . ILE A 1 74  ? 39.375 36.830 7.704  1.00 0.00 ? 44 ILE A HD11 10 
ATOM 10359 H HD12 . ILE A 1 74  ? 40.725 36.162 6.786  1.00 0.00 ? 44 ILE A HD12 10 
ATOM 10360 H HD13 . ILE A 1 74  ? 39.174 36.441 5.995  1.00 0.00 ? 44 ILE A HD13 10 
ATOM 10361 N N    . LYS A 1 75  ? 38.232 42.076 4.727  1.00 0.00 ? 45 LYS A N    10 
ATOM 10362 C CA   . LYS A 1 75  ? 37.184 43.066 4.487  1.00 0.00 ? 45 LYS A CA   10 
ATOM 10363 C C    . LYS A 1 75  ? 35.800 42.440 4.299  1.00 0.00 ? 45 LYS A C    10 
ATOM 10364 O O    . LYS A 1 75  ? 34.792 43.134 4.441  1.00 0.00 ? 45 LYS A O    10 
ATOM 10365 C CB   . LYS A 1 75  ? 37.534 43.894 3.250  1.00 0.00 ? 45 LYS A CB   10 
ATOM 10366 C CG   . LYS A 1 75  ? 38.816 44.684 3.510  1.00 0.00 ? 45 LYS A CG   10 
ATOM 10367 C CD   . LYS A 1 75  ? 39.111 45.593 2.315  1.00 0.00 ? 45 LYS A CD   10 
ATOM 10368 C CE   . LYS A 1 75  ? 40.456 46.290 2.525  1.00 0.00 ? 45 LYS A CE   10 
ATOM 10369 N NZ   . LYS A 1 75  ? 41.555 45.290 2.419  1.00 0.00 ? 45 LYS A NZ   10 
ATOM 10370 H H    . LYS A 1 75  ? 38.779 41.765 3.976  1.00 0.00 ? 45 LYS A H    10 
ATOM 10371 H HA   . LYS A 1 75  ? 37.139 43.730 5.337  1.00 0.00 ? 45 LYS A HA   10 
ATOM 10372 H HB2  . LYS A 1 75  ? 37.681 43.234 2.406  1.00 0.00 ? 45 LYS A HB2  10 
ATOM 10373 H HB3  . LYS A 1 75  ? 36.728 44.580 3.035  1.00 0.00 ? 45 LYS A HB3  10 
ATOM 10374 H HG2  . LYS A 1 75  ? 38.692 45.287 4.399  1.00 0.00 ? 45 LYS A HG2  10 
ATOM 10375 H HG3  . LYS A 1 75  ? 39.640 44.000 3.651  1.00 0.00 ? 45 LYS A HG3  10 
ATOM 10376 H HD2  . LYS A 1 75  ? 39.147 45.000 1.414  1.00 0.00 ? 45 LYS A HD2  10 
ATOM 10377 H HD3  . LYS A 1 75  ? 38.333 46.337 2.227  1.00 0.00 ? 45 LYS A HD3  10 
ATOM 10378 H HE2  . LYS A 1 75  ? 40.588 47.052 1.770  1.00 0.00 ? 45 LYS A HE2  10 
ATOM 10379 H HE3  . LYS A 1 75  ? 40.477 46.747 3.503  1.00 0.00 ? 45 LYS A HE3  10 
ATOM 10380 H HZ1  . LYS A 1 75  ? 41.257 44.510 1.799  1.00 0.00 ? 45 LYS A HZ1  10 
ATOM 10381 H HZ2  . LYS A 1 75  ? 41.774 44.916 3.365  1.00 0.00 ? 45 LYS A HZ2  10 
ATOM 10382 H HZ3  . LYS A 1 75  ? 42.401 45.743 2.020  1.00 0.00 ? 45 LYS A HZ3  10 
ATOM 10383 N N    . SER A 1 76  ? 35.739 41.151 3.967  1.00 0.00 ? 46 SER A N    10 
ATOM 10384 C CA   . SER A 1 76  ? 34.455 40.492 3.756  1.00 0.00 ? 46 SER A CA   10 
ATOM 10385 C C    . SER A 1 76  ? 34.522 39.015 4.128  1.00 0.00 ? 46 SER A C    10 
ATOM 10386 O O    . SER A 1 76  ? 35.574 38.383 4.033  1.00 0.00 ? 46 SER A O    10 
ATOM 10387 C CB   . SER A 1 76  ? 34.035 40.626 2.291  1.00 0.00 ? 46 SER A CB   10 
ATOM 10388 O OG   . SER A 1 76  ? 34.901 39.840 1.484  1.00 0.00 ? 46 SER A OG   10 
ATOM 10389 H H    . SER A 1 76  ? 36.569 40.641 3.857  1.00 0.00 ? 46 SER A H    10 
ATOM 10390 H HA   . SER A 1 76  ? 33.711 40.973 4.373  1.00 0.00 ? 46 SER A HA   10 
ATOM 10391 H HB2  . SER A 1 76  ? 33.024 40.274 2.168  1.00 0.00 ? 46 SER A HB2  10 
ATOM 10392 H HB3  . SER A 1 76  ? 34.089 41.666 2.000  1.00 0.00 ? 46 SER A HB3  10 
ATOM 10393 H HG   . SER A 1 76  ? 35.136 40.331 0.768  1.00 0.00 ? 46 SER A HG   10 
ATOM 10394 N N    . GLY A 1 77  ? 33.384 38.474 4.548  1.00 0.00 ? 47 GLY A N    10 
ATOM 10395 C CA   . GLY A 1 77  ? 33.290 37.060 4.893  1.00 0.00 ? 47 GLY A CA   10 
ATOM 10396 C C    . GLY A 1 77  ? 33.508 36.173 3.670  1.00 0.00 ? 47 GLY A C    10 
ATOM 10397 O O    . GLY A 1 77  ? 34.106 35.099 3.769  1.00 0.00 ? 47 GLY A O    10 
ATOM 10398 H H    . GLY A 1 77  ? 32.580 39.030 4.605  1.00 0.00 ? 47 GLY A H    10 
ATOM 10399 H HA2  . GLY A 1 77  ? 34.036 36.827 5.639  1.00 0.00 ? 47 GLY A HA2  10 
ATOM 10400 H HA3  . GLY A 1 77  ? 32.310 36.861 5.297  1.00 0.00 ? 47 GLY A HA3  10 
ATOM 10401 N N    . ALA A 1 78  ? 33.045 36.630 2.508  1.00 0.00 ? 48 ALA A N    10 
ATOM 10402 C CA   . ALA A 1 78  ? 33.157 35.831 1.292  1.00 0.00 ? 48 ALA A CA   10 
ATOM 10403 C C    . ALA A 1 78  ? 34.621 35.510 1.013  1.00 0.00 ? 48 ALA A C    10 
ATOM 10404 O O    . ALA A 1 78  ? 34.956 34.383 0.646  1.00 0.00 ? 48 ALA A O    10 
ATOM 10405 C CB   . ALA A 1 78  ? 32.562 36.591 0.107  1.00 0.00 ? 48 ALA A CB   10 
ATOM 10406 H H    . ALA A 1 78  ? 32.623 37.514 2.468  1.00 0.00 ? 48 ALA A H    10 
ATOM 10407 H HA   . ALA A 1 78  ? 32.614 34.907 1.426  1.00 0.00 ? 48 ALA A HA   10 
ATOM 10408 H HB1  . ALA A 1 78  ? 33.005 36.234 -0.811 1.00 0.00 ? 48 ALA A HB1  10 
ATOM 10409 H HB2  . ALA A 1 78  ? 32.765 37.647 0.218  1.00 0.00 ? 48 ALA A HB2  10 
ATOM 10410 H HB3  . ALA A 1 78  ? 31.494 36.432 0.076  1.00 0.00 ? 48 ALA A HB3  10 
ATOM 10411 N N    . GLU A 1 79  ? 35.488 36.504 1.185  1.00 0.00 ? 49 GLU A N    10 
ATOM 10412 C CA   . GLU A 1 79  ? 36.923 36.252 1.119  1.00 0.00 ? 49 GLU A CA   10 
ATOM 10413 C C    . GLU A 1 79  ? 37.352 35.278 2.217  1.00 0.00 ? 49 GLU A C    10 
ATOM 10414 O O    . GLU A 1 79  ? 38.144 34.370 1.972  1.00 0.00 ? 49 GLU A O    10 
ATOM 10415 C CB   . GLU A 1 79  ? 37.691 37.567 1.273  1.00 0.00 ? 49 GLU A CB   10 
ATOM 10416 C CG   . GLU A 1 79  ? 39.183 37.321 1.021  1.00 0.00 ? 49 GLU A CG   10 
ATOM 10417 C CD   . GLU A 1 79  ? 40.019 38.586 1.250  1.00 0.00 ? 49 GLU A CD   10 
ATOM 10418 O OE1  . GLU A 1 79  ? 39.465 39.613 1.618  1.00 0.00 ? 49 GLU A OE1  10 
ATOM 10419 O OE2  . GLU A 1 79  ? 41.220 38.508 1.050  1.00 0.00 ? 49 GLU A OE2  10 
ATOM 10420 H H    . GLU A 1 79  ? 35.162 37.412 1.359  1.00 0.00 ? 49 GLU A H    10 
ATOM 10421 H HA   . GLU A 1 79  ? 37.158 35.822 0.158  1.00 0.00 ? 49 GLU A HA   10 
ATOM 10422 H HB2  . GLU A 1 79  ? 37.317 38.287 0.558  1.00 0.00 ? 49 GLU A HB2  10 
ATOM 10423 H HB3  . GLU A 1 79  ? 37.555 37.948 2.274  1.00 0.00 ? 49 GLU A HB3  10 
ATOM 10424 H HG2  . GLU A 1 79  ? 39.530 36.548 1.691  1.00 0.00 ? 49 GLU A HG2  10 
ATOM 10425 H HG3  . GLU A 1 79  ? 39.317 36.988 0.004  1.00 0.00 ? 49 GLU A HG3  10 
ATOM 10426 N N    . ALA A 1 80  ? 36.736 35.388 3.394  1.00 0.00 ? 50 ALA A N    10 
ATOM 10427 C CA   . ALA A 1 80  ? 37.108 34.536 4.521  1.00 0.00 ? 50 ALA A CA   10 
ATOM 10428 C C    . ALA A 1 80  ? 36.893 33.058 4.199  1.00 0.00 ? 50 ALA A C    10 
ATOM 10429 O O    . ALA A 1 80  ? 37.690 32.207 4.594  1.00 0.00 ? 50 ALA A O    10 
ATOM 10430 C CB   . ALA A 1 80  ? 36.282 34.912 5.752  1.00 0.00 ? 50 ALA A CB   10 
ATOM 10431 H H    . ALA A 1 80  ? 36.025 36.055 3.509  1.00 0.00 ? 50 ALA A H    10 
ATOM 10432 H HA   . ALA A 1 80  ? 38.154 34.694 4.746  1.00 0.00 ? 50 ALA A HA   10 
ATOM 10433 H HB1  . ALA A 1 80  ? 36.142 35.982 5.778  1.00 0.00 ? 50 ALA A HB1  10 
ATOM 10434 H HB2  . ALA A 1 80  ? 36.802 34.595 6.645  1.00 0.00 ? 50 ALA A HB2  10 
ATOM 10435 H HB3  . ALA A 1 80  ? 35.320 34.424 5.703  1.00 0.00 ? 50 ALA A HB3  10 
ATOM 10436 N N    . LYS A 1 81  ? 35.864 32.764 3.412  1.00 0.00 ? 51 LYS A N    10 
ATOM 10437 C CA   . LYS A 1 81  ? 35.567 31.383 3.039  1.00 0.00 ? 51 LYS A CA   10 
ATOM 10438 C C    . LYS A 1 81  ? 36.757 30.716 2.343  1.00 0.00 ? 51 LYS A C    10 
ATOM 10439 O O    . LYS A 1 81  ? 36.913 29.497 2.424  1.00 0.00 ? 51 LYS A O    10 
ATOM 10440 C CB   . LYS A 1 81  ? 34.350 31.356 2.110  1.00 0.00 ? 51 LYS A CB   10 
ATOM 10441 C CG   . LYS A 1 81  ? 33.934 29.908 1.840  1.00 0.00 ? 51 LYS A CG   10 
ATOM 10442 C CD   . LYS A 1 81  ? 32.774 29.890 0.843  1.00 0.00 ? 51 LYS A CD   10 
ATOM 10443 C CE   . LYS A 1 81  ? 32.253 28.460 0.688  1.00 0.00 ? 51 LYS A CE   10 
ATOM 10444 N NZ   . LYS A 1 81  ? 31.053 28.462 -0.195 1.00 0.00 ? 51 LYS A NZ   10 
ATOM 10445 H H    . LYS A 1 81  ? 35.265 33.484 3.123  1.00 0.00 ? 51 LYS A H    10 
ATOM 10446 H HA   . LYS A 1 81  ? 35.329 30.827 3.932  1.00 0.00 ? 51 LYS A HA   10 
ATOM 10447 H HB2  . LYS A 1 81  ? 33.532 31.885 2.576  1.00 0.00 ? 51 LYS A HB2  10 
ATOM 10448 H HB3  . LYS A 1 81  ? 34.602 31.835 1.176  1.00 0.00 ? 51 LYS A HB3  10 
ATOM 10449 H HG2  . LYS A 1 81  ? 34.772 29.364 1.429  1.00 0.00 ? 51 LYS A HG2  10 
ATOM 10450 H HG3  . LYS A 1 81  ? 33.620 29.445 2.763  1.00 0.00 ? 51 LYS A HG3  10 
ATOM 10451 H HD2  . LYS A 1 81  ? 31.979 30.526 1.206  1.00 0.00 ? 51 LYS A HD2  10 
ATOM 10452 H HD3  . LYS A 1 81  ? 33.116 30.251 -0.114 1.00 0.00 ? 51 LYS A HD3  10 
ATOM 10453 H HE2  . LYS A 1 81  ? 33.022 27.843 0.249  1.00 0.00 ? 51 LYS A HE2  10 
ATOM 10454 H HE3  . LYS A 1 81  ? 31.986 28.067 1.658  1.00 0.00 ? 51 LYS A HE3  10 
ATOM 10455 H HZ1  . LYS A 1 81  ? 31.271 28.968 -1.076 1.00 0.00 ? 51 LYS A HZ1  10 
ATOM 10456 H HZ2  . LYS A 1 81  ? 30.265 28.936 0.292  1.00 0.00 ? 51 LYS A HZ2  10 
ATOM 10457 H HZ3  . LYS A 1 81  ? 30.785 27.482 -0.418 1.00 0.00 ? 51 LYS A HZ3  10 
ATOM 10458 N N    . LYS A 1 82  ? 37.593 31.498 1.664  1.00 0.00 ? 52 LYS A N    10 
ATOM 10459 C CA   . LYS A 1 82  ? 38.747 30.941 0.962  1.00 0.00 ? 52 LYS A CA   10 
ATOM 10460 C C    . LYS A 1 82  ? 39.710 30.225 1.919  1.00 0.00 ? 52 LYS A C    10 
ATOM 10461 O O    . LYS A 1 82  ? 40.439 29.323 1.507  1.00 0.00 ? 52 LYS A O    10 
ATOM 10462 C CB   . LYS A 1 82  ? 39.480 32.074 0.236  1.00 0.00 ? 52 LYS A CB   10 
ATOM 10463 C CG   . LYS A 1 82  ? 40.594 31.516 -0.656 1.00 0.00 ? 52 LYS A CG   10 
ATOM 10464 C CD   . LYS A 1 82  ? 39.985 30.863 -1.900 1.00 0.00 ? 52 LYS A CD   10 
ATOM 10465 C CE   . LYS A 1 82  ? 41.106 30.398 -2.832 1.00 0.00 ? 52 LYS A CE   10 
ATOM 10466 N NZ   . LYS A 1 82  ? 41.778 29.206 -2.243 1.00 0.00 ? 52 LYS A NZ   10 
ATOM 10467 H H    . LYS A 1 82  ? 37.463 32.470 1.669  1.00 0.00 ? 52 LYS A H    10 
ATOM 10468 H HA   . LYS A 1 82  ? 38.396 30.231 0.230  1.00 0.00 ? 52 LYS A HA   10 
ATOM 10469 H HB2  . LYS A 1 82  ? 38.776 32.618 -0.374 1.00 0.00 ? 52 LYS A HB2  10 
ATOM 10470 H HB3  . LYS A 1 82  ? 39.911 32.744 0.965  1.00 0.00 ? 52 LYS A HB3  10 
ATOM 10471 H HG2  . LYS A 1 82  ? 41.246 32.323 -0.958 1.00 0.00 ? 52 LYS A HG2  10 
ATOM 10472 H HG3  . LYS A 1 82  ? 41.166 30.782 -0.112 1.00 0.00 ? 52 LYS A HG3  10 
ATOM 10473 H HD2  . LYS A 1 82  ? 39.386 30.014 -1.605 1.00 0.00 ? 52 LYS A HD2  10 
ATOM 10474 H HD3  . LYS A 1 82  ? 39.367 31.582 -2.417 1.00 0.00 ? 52 LYS A HD3  10 
ATOM 10475 H HE2  . LYS A 1 82  ? 40.690 30.138 -3.794 1.00 0.00 ? 52 LYS A HE2  10 
ATOM 10476 H HE3  . LYS A 1 82  ? 41.826 31.194 -2.955 1.00 0.00 ? 52 LYS A HE3  10 
ATOM 10477 H HZ1  . LYS A 1 82  ? 42.503 28.857 -2.902 1.00 0.00 ? 52 LYS A HZ1  10 
ATOM 10478 H HZ2  . LYS A 1 82  ? 41.074 28.460 -2.074 1.00 0.00 ? 52 LYS A HZ2  10 
ATOM 10479 H HZ3  . LYS A 1 82  ? 42.229 29.470 -1.344 1.00 0.00 ? 52 LYS A HZ3  10 
ATOM 10480 N N    . LEU A 1 83  ? 39.691 30.589 3.204  1.00 0.00 ? 53 LEU A N    10 
ATOM 10481 C CA   . LEU A 1 83  ? 40.653 30.049 4.156  1.00 0.00 ? 53 LEU A CA   10 
ATOM 10482 C C    . LEU A 1 83  ? 40.260 28.628 4.586  1.00 0.00 ? 53 LEU A C    10 
ATOM 10483 O O    . LEU A 1 83  ? 39.082 28.392 4.878  1.00 0.00 ? 53 LEU A O    10 
ATOM 10484 C CB   . LEU A 1 83  ? 40.703 30.954 5.387  1.00 0.00 ? 53 LEU A CB   10 
ATOM 10485 C CG   . LEU A 1 83  ? 41.558 32.185 5.082  1.00 0.00 ? 53 LEU A CG   10 
ATOM 10486 C CD1  . LEU A 1 83  ? 41.218 33.301 6.071  1.00 0.00 ? 53 LEU A CD1  10 
ATOM 10487 C CD2  . LEU A 1 83  ? 43.039 31.822 5.209  1.00 0.00 ? 53 LEU A CD2  10 
ATOM 10488 H H    . LEU A 1 83  ? 39.010 31.217 3.520  1.00 0.00 ? 53 LEU A H    10 
ATOM 10489 H HA   . LEU A 1 83  ? 41.620 30.054 3.684  1.00 0.00 ? 53 LEU A HA   10 
ATOM 10490 H HB2  . LEU A 1 83  ? 39.701 31.264 5.645  1.00 0.00 ? 53 LEU A HB2  10 
ATOM 10491 H HB3  . LEU A 1 83  ? 41.137 30.415 6.214  1.00 0.00 ? 53 LEU A HB3  10 
ATOM 10492 H HG   . LEU A 1 83  ? 41.352 32.524 4.076  1.00 0.00 ? 53 LEU A HG   10 
ATOM 10493 H HD11 . LEU A 1 83  ? 40.174 33.560 5.978  1.00 0.00 ? 53 LEU A HD11 10 
ATOM 10494 H HD12 . LEU A 1 83  ? 41.824 34.169 5.857  1.00 0.00 ? 53 LEU A HD12 10 
ATOM 10495 H HD13 . LEU A 1 83  ? 41.416 32.963 7.078  1.00 0.00 ? 53 LEU A HD13 10 
ATOM 10496 H HD21 . LEU A 1 83  ? 43.194 30.811 4.865  1.00 0.00 ? 53 LEU A HD21 10 
ATOM 10497 H HD22 . LEU A 1 83  ? 43.343 31.902 6.243  1.00 0.00 ? 53 LEU A HD22 10 
ATOM 10498 H HD23 . LEU A 1 83  ? 43.628 32.500 4.609  1.00 0.00 ? 53 LEU A HD23 10 
ATOM 10499 N N    . PRO A 1 84  ? 41.188 27.695 4.691  1.00 0.00 ? 54 PRO A N    10 
ATOM 10500 C CA   . PRO A 1 84  ? 40.832 26.295 5.081  1.00 0.00 ? 54 PRO A CA   10 
ATOM 10501 C C    . PRO A 1 84  ? 40.132 26.249 6.435  1.00 0.00 ? 54 PRO A C    10 
ATOM 10502 O O    . PRO A 1 84  ? 40.613 26.821 7.414  1.00 0.00 ? 54 PRO A O    10 
ATOM 10503 C CB   . PRO A 1 84  ? 42.168 25.545 5.133  1.00 0.00 ? 54 PRO A CB   10 
ATOM 10504 C CG   . PRO A 1 84  ? 43.129 26.380 4.358  1.00 0.00 ? 54 PRO A CG   10 
ATOM 10505 C CD   . PRO A 1 84  ? 42.644 27.821 4.482  1.00 0.00 ? 54 PRO A CD   10 
ATOM 10506 H HA   . PRO A 1 84  ? 40.202 25.852 4.326  1.00 0.00 ? 54 PRO A HA   10 
ATOM 10507 H HB2  . PRO A 1 84  ? 42.506 25.438 6.155  1.00 0.00 ? 54 PRO A HB2  10 
ATOM 10508 H HB3  . PRO A 1 84  ? 42.072 24.576 4.667  1.00 0.00 ? 54 PRO A HB3  10 
ATOM 10509 H HG2  . PRO A 1 84  ? 44.123 26.279 4.774  1.00 0.00 ? 54 PRO A HG2  10 
ATOM 10510 H HG3  . PRO A 1 84  ? 43.127 26.087 3.320  1.00 0.00 ? 54 PRO A HG3  10 
ATOM 10511 H HD2  . PRO A 1 84  ? 43.115 28.306 5.328  1.00 0.00 ? 54 PRO A HD2  10 
ATOM 10512 H HD3  . PRO A 1 84  ? 42.842 28.362 3.572  1.00 0.00 ? 54 PRO A HD3  10 
ATOM 10513 N N    . GLY A 1 85  ? 39.001 25.556 6.483  1.00 0.00 ? 55 GLY A N    10 
ATOM 10514 C CA   . GLY A 1 85  ? 38.252 25.415 7.730  1.00 0.00 ? 55 GLY A CA   10 
ATOM 10515 C C    . GLY A 1 85  ? 37.055 26.368 7.828  1.00 0.00 ? 55 GLY A C    10 
ATOM 10516 O O    . GLY A 1 85  ? 36.219 26.198 8.717  1.00 0.00 ? 55 GLY A O    10 
ATOM 10517 H H    . GLY A 1 85  ? 38.663 25.130 5.668  1.00 0.00 ? 55 GLY A H    10 
ATOM 10518 H HA2  . GLY A 1 85  ? 37.892 24.399 7.802  1.00 0.00 ? 55 GLY A HA2  10 
ATOM 10519 H HA3  . GLY A 1 85  ? 38.917 25.606 8.559  1.00 0.00 ? 55 GLY A HA3  10 
ATOM 10520 N N    . VAL A 1 86  ? 36.960 27.359 6.937  1.00 0.00 ? 56 VAL A N    10 
ATOM 10521 C CA   . VAL A 1 86  ? 35.824 28.279 6.965  1.00 0.00 ? 56 VAL A CA   10 
ATOM 10522 C C    . VAL A 1 86  ? 34.685 27.729 6.112  1.00 0.00 ? 56 VAL A C    10 
ATOM 10523 O O    . VAL A 1 86  ? 34.899 27.293 4.982  1.00 0.00 ? 56 VAL A O    10 
ATOM 10524 C CB   . VAL A 1 86  ? 36.246 29.660 6.445  1.00 0.00 ? 56 VAL A CB   10 
ATOM 10525 C CG1  . VAL A 1 86  ? 35.076 30.641 6.569  1.00 0.00 ? 56 VAL A CG1  10 
ATOM 10526 C CG2  . VAL A 1 86  ? 37.425 30.187 7.268  1.00 0.00 ? 56 VAL A CG2  10 
ATOM 10527 H H    . VAL A 1 86  ? 37.664 27.484 6.263  1.00 0.00 ? 56 VAL A H    10 
ATOM 10528 H HA   . VAL A 1 86  ? 35.481 28.380 7.984  1.00 0.00 ? 56 VAL A HA   10 
ATOM 10529 H HB   . VAL A 1 86  ? 36.537 29.579 5.408  1.00 0.00 ? 56 VAL A HB   10 
ATOM 10530 H HG11 . VAL A 1 86  ? 34.217 30.244 6.050  1.00 0.00 ? 56 VAL A HG11 10 
ATOM 10531 H HG12 . VAL A 1 86  ? 35.354 31.589 6.132  1.00 0.00 ? 56 VAL A HG12 10 
ATOM 10532 H HG13 . VAL A 1 86  ? 34.834 30.782 7.612  1.00 0.00 ? 56 VAL A HG13 10 
ATOM 10533 H HG21 . VAL A 1 86  ? 38.213 29.448 7.279  1.00 0.00 ? 56 VAL A HG21 10 
ATOM 10534 H HG22 . VAL A 1 86  ? 37.100 30.383 8.279  1.00 0.00 ? 56 VAL A HG22 10 
ATOM 10535 H HG23 . VAL A 1 86  ? 37.793 31.100 6.825  1.00 0.00 ? 56 VAL A HG23 10 
ATOM 10536 N N    . GLY A 1 87  ? 33.472 27.750 6.660  1.00 0.00 ? 57 GLY A N    10 
ATOM 10537 C CA   . GLY A 1 87  ? 32.304 27.267 5.932  1.00 0.00 ? 57 GLY A CA   10 
ATOM 10538 C C    . GLY A 1 87  ? 31.458 28.428 5.422  1.00 0.00 ? 57 GLY A C    10 
ATOM 10539 O O    . GLY A 1 87  ? 31.673 29.581 5.801  1.00 0.00 ? 57 GLY A O    10 
ATOM 10540 H H    . GLY A 1 87  ? 33.362 28.099 7.570  1.00 0.00 ? 57 GLY A H    10 
ATOM 10541 H HA2  . GLY A 1 87  ? 32.630 26.668 5.092  1.00 0.00 ? 57 GLY A HA2  10 
ATOM 10542 H HA3  . GLY A 1 87  ? 31.703 26.658 6.589  1.00 0.00 ? 57 GLY A HA3  10 
ATOM 10543 N N    . THR A 1 88  ? 30.469 28.116 4.592  1.00 0.00 ? 58 THR A N    10 
ATOM 10544 C CA   . THR A 1 88  ? 29.609 29.151 4.028  1.00 0.00 ? 58 THR A CA   10 
ATOM 10545 C C    . THR A 1 88  ? 28.882 29.907 5.134  1.00 0.00 ? 58 THR A C    10 
ATOM 10546 O O    . THR A 1 88  ? 28.822 31.136 5.122  1.00 0.00 ? 58 THR A O    10 
ATOM 10547 C CB   . THR A 1 88  ? 28.589 28.520 3.077  1.00 0.00 ? 58 THR A CB   10 
ATOM 10548 O OG1  . THR A 1 88  ? 29.270 27.736 2.109  1.00 0.00 ? 58 THR A OG1  10 
ATOM 10549 C CG2  . THR A 1 88  ? 27.794 29.622 2.374  1.00 0.00 ? 58 THR A CG2  10 
ATOM 10550 H H    . THR A 1 88  ? 30.314 27.177 4.355  1.00 0.00 ? 58 THR A H    10 
ATOM 10551 H HA   . THR A 1 88  ? 30.220 29.847 3.472  1.00 0.00 ? 58 THR A HA   10 
ATOM 10552 H HB   . THR A 1 88  ? 27.911 27.896 3.638  1.00 0.00 ? 58 THR A HB   10 
ATOM 10553 H HG1  . THR A 1 88  ? 28.692 27.124 1.791  1.00 0.00 ? 58 THR A HG1  10 
ATOM 10554 H HG21 . THR A 1 88  ? 27.333 30.262 3.113  1.00 0.00 ? 58 THR A HG21 10 
ATOM 10555 H HG22 . THR A 1 88  ? 27.028 29.176 1.757  1.00 0.00 ? 58 THR A HG22 10 
ATOM 10556 H HG23 . THR A 1 88  ? 28.459 30.208 1.756  1.00 0.00 ? 58 THR A HG23 10 
ATOM 10557 N N    . LYS A 1 89  ? 28.359 29.170 6.111  1.00 0.00 ? 59 LYS A N    10 
ATOM 10558 C CA   . LYS A 1 89  ? 27.603 29.794 7.192  1.00 0.00 ? 59 LYS A CA   10 
ATOM 10559 C C    . LYS A 1 89  ? 28.479 30.775 7.963  1.00 0.00 ? 59 LYS A C    10 
ATOM 10560 O O    . LYS A 1 89  ? 28.060 31.894 8.262  1.00 0.00 ? 59 LYS A O    10 
ATOM 10561 C CB   . LYS A 1 89  ? 27.073 28.720 8.146  1.00 0.00 ? 59 LYS A CB   10 
ATOM 10562 C CG   . LYS A 1 89  ? 26.153 29.367 9.183  1.00 0.00 ? 59 LYS A CG   10 
ATOM 10563 C CD   . LYS A 1 89  ? 25.688 28.308 10.185 1.00 0.00 ? 59 LYS A CD   10 
ATOM 10564 C CE   . LYS A 1 89  ? 24.642 28.915 11.123 1.00 0.00 ? 59 LYS A CE   10 
ATOM 10565 N NZ   . LYS A 1 89  ? 23.320 28.948 10.437 1.00 0.00 ? 59 LYS A NZ   10 
ATOM 10566 H H    . LYS A 1 89  ? 28.483 28.198 6.104  1.00 0.00 ? 59 LYS A H    10 
ATOM 10567 H HA   . LYS A 1 89  ? 26.766 30.329 6.770  1.00 0.00 ? 59 LYS A HA   10 
ATOM 10568 H HB2  . LYS A 1 89  ? 26.520 27.981 7.583  1.00 0.00 ? 59 LYS A HB2  10 
ATOM 10569 H HB3  . LYS A 1 89  ? 27.901 28.245 8.649  1.00 0.00 ? 59 LYS A HB3  10 
ATOM 10570 H HG2  . LYS A 1 89  ? 26.690 30.146 9.704  1.00 0.00 ? 59 LYS A HG2  10 
ATOM 10571 H HG3  . LYS A 1 89  ? 25.293 29.791 8.687  1.00 0.00 ? 59 LYS A HG3  10 
ATOM 10572 H HD2  . LYS A 1 89  ? 25.254 27.474 9.651  1.00 0.00 ? 59 LYS A HD2  10 
ATOM 10573 H HD3  . LYS A 1 89  ? 26.531 27.966 10.765 1.00 0.00 ? 59 LYS A HD3  10 
ATOM 10574 H HE2  . LYS A 1 89  ? 24.569 28.315 12.017 1.00 0.00 ? 59 LYS A HE2  10 
ATOM 10575 H HE3  . LYS A 1 89  ? 24.936 29.920 11.386 1.00 0.00 ? 59 LYS A HE3  10 
ATOM 10576 H HZ1  . LYS A 1 89  ? 23.256 28.155 9.768  1.00 0.00 ? 59 LYS A HZ1  10 
ATOM 10577 H HZ2  . LYS A 1 89  ? 23.219 29.847 9.921  1.00 0.00 ? 59 LYS A HZ2  10 
ATOM 10578 H HZ3  . LYS A 1 89  ? 22.561 28.866 11.142 1.00 0.00 ? 59 LYS A HZ3  10 
ATOM 10579 N N    . ILE A 1 90  ? 29.718 30.372 8.238  1.00 0.00 ? 60 ILE A N    10 
ATOM 10580 C CA   . ILE A 1 90  ? 30.631 31.231 8.982  1.00 0.00 ? 60 ILE A CA   10 
ATOM 10581 C C    . ILE A 1 90  ? 30.940 32.487 8.168  1.00 0.00 ? 60 ILE A C    10 
ATOM 10582 O O    . ILE A 1 90  ? 30.919 33.596 8.701  1.00 0.00 ? 60 ILE A O    10 
ATOM 10583 C CB   . ILE A 1 90  ? 31.915 30.464 9.330  1.00 0.00 ? 60 ILE A CB   10 
ATOM 10584 C CG1  . ILE A 1 90  ? 31.543 29.235 10.169 1.00 0.00 ? 60 ILE A CG1  10 
ATOM 10585 C CG2  . ILE A 1 90  ? 32.859 31.361 10.138 1.00 0.00 ? 60 ILE A CG2  10 
ATOM 10586 C CD1  . ILE A 1 90  ? 32.785 28.381 10.445 1.00 0.00 ? 60 ILE A CD1  10 
ATOM 10587 H H    . ILE A 1 90  ? 30.019 29.490 7.937  1.00 0.00 ? 60 ILE A H    10 
ATOM 10588 H HA   . ILE A 1 90  ? 30.148 31.528 9.899  1.00 0.00 ? 60 ILE A HA   10 
ATOM 10589 H HB   . ILE A 1 90  ? 32.406 30.149 8.422  1.00 0.00 ? 60 ILE A HB   10 
ATOM 10590 H HG12 . ILE A 1 90  ? 31.117 29.561 11.107 1.00 0.00 ? 60 ILE A HG12 10 
ATOM 10591 H HG13 . ILE A 1 90  ? 30.817 28.643 9.632  1.00 0.00 ? 60 ILE A HG13 10 
ATOM 10592 H HG21 . ILE A 1 90  ? 32.423 31.565 11.105 1.00 0.00 ? 60 ILE A HG21 10 
ATOM 10593 H HG22 . ILE A 1 90  ? 33.012 32.292 9.610  1.00 0.00 ? 60 ILE A HG22 10 
ATOM 10594 H HG23 . ILE A 1 90  ? 33.807 30.862 10.267 1.00 0.00 ? 60 ILE A HG23 10 
ATOM 10595 H HD11 . ILE A 1 90  ? 33.523 28.971 10.971 1.00 0.00 ? 60 ILE A HD11 10 
ATOM 10596 H HD12 . ILE A 1 90  ? 33.202 28.036 9.510  1.00 0.00 ? 60 ILE A HD12 10 
ATOM 10597 H HD13 . ILE A 1 90  ? 32.509 27.530 11.054 1.00 0.00 ? 60 ILE A HD13 10 
ATOM 10598 N N    . ALA A 1 91  ? 31.173 32.320 6.869  1.00 0.00 ? 61 ALA A N    10 
ATOM 10599 C CA   . ALA A 1 91  ? 31.471 33.460 6.010  1.00 0.00 ? 61 ALA A CA   10 
ATOM 10600 C C    . ALA A 1 91  ? 30.326 34.470 6.040  1.00 0.00 ? 61 ALA A C    10 
ATOM 10601 O O    . ALA A 1 91  ? 30.553 35.671 6.200  1.00 0.00 ? 61 ALA A O    10 
ATOM 10602 C CB   . ALA A 1 91  ? 31.699 32.986 4.574  1.00 0.00 ? 61 ALA A CB   10 
ATOM 10603 H H    . ALA A 1 91  ? 31.172 31.414 6.492  1.00 0.00 ? 61 ALA A H    10 
ATOM 10604 H HA   . ALA A 1 91  ? 32.371 33.939 6.366  1.00 0.00 ? 61 ALA A HA   10 
ATOM 10605 H HB1  . ALA A 1 91  ? 31.781 33.841 3.921  1.00 0.00 ? 61 ALA A HB1  10 
ATOM 10606 H HB2  . ALA A 1 91  ? 30.867 32.372 4.261  1.00 0.00 ? 61 ALA A HB2  10 
ATOM 10607 H HB3  . ALA A 1 91  ? 32.610 32.407 4.527  1.00 0.00 ? 61 ALA A HB3  10 
ATOM 10608 N N    . GLU A 1 92  ? 29.094 33.982 5.924  1.00 0.00 ? 62 GLU A N    10 
ATOM 10609 C CA   . GLU A 1 92  ? 27.935 34.870 5.961  1.00 0.00 ? 62 GLU A CA   10 
ATOM 10610 C C    . GLU A 1 92  ? 27.846 35.589 7.306  1.00 0.00 ? 62 GLU A C    10 
ATOM 10611 O O    . GLU A 1 92  ? 27.512 36.773 7.362  1.00 0.00 ? 62 GLU A O    10 
ATOM 10612 C CB   . GLU A 1 92  ? 26.652 34.071 5.721  1.00 0.00 ? 62 GLU A CB   10 
ATOM 10613 C CG   . GLU A 1 92  ? 26.672 33.482 4.305  1.00 0.00 ? 62 GLU A CG   10 
ATOM 10614 C CD   . GLU A 1 92  ? 25.372 32.737 3.982  1.00 0.00 ? 62 GLU A CD   10 
ATOM 10615 O OE1  . GLU A 1 92  ? 24.574 32.511 4.880  1.00 0.00 ? 62 GLU A OE1  10 
ATOM 10616 O OE2  . GLU A 1 92  ? 25.193 32.397 2.824  1.00 0.00 ? 62 GLU A OE2  10 
ATOM 10617 H H    . GLU A 1 92  ? 28.963 33.020 5.789  1.00 0.00 ? 62 GLU A H    10 
ATOM 10618 H HA   . GLU A 1 92  ? 28.036 35.607 5.179  1.00 0.00 ? 62 GLU A HA   10 
ATOM 10619 H HB2  . GLU A 1 92  ? 26.586 33.271 6.444  1.00 0.00 ? 62 GLU A HB2  10 
ATOM 10620 H HB3  . GLU A 1 92  ? 25.798 34.723 5.824  1.00 0.00 ? 62 GLU A HB3  10 
ATOM 10621 H HG2  . GLU A 1 92  ? 26.802 34.284 3.592  1.00 0.00 ? 62 GLU A HG2  10 
ATOM 10622 H HG3  . GLU A 1 92  ? 27.503 32.799 4.220  1.00 0.00 ? 62 GLU A HG3  10 
ATOM 10623 N N    . LYS A 1 93  ? 28.174 34.884 8.386  1.00 0.00 ? 63 LYS A N    10 
ATOM 10624 C CA   . LYS A 1 93  ? 28.187 35.505 9.706  1.00 0.00 ? 63 LYS A CA   10 
ATOM 10625 C C    . LYS A 1 93  ? 29.191 36.656 9.749  1.00 0.00 ? 63 LYS A C    10 
ATOM 10626 O O    . LYS A 1 93  ? 28.907 37.715 10.311 1.00 0.00 ? 63 LYS A O    10 
ATOM 10627 C CB   . LYS A 1 93  ? 28.536 34.460 10.767 1.00 0.00 ? 63 LYS A CB   10 
ATOM 10628 C CG   . LYS A 1 93  ? 28.429 35.085 12.159 1.00 0.00 ? 63 LYS A CG   10 
ATOM 10629 C CD   . LYS A 1 93  ? 28.646 34.006 13.222 1.00 0.00 ? 63 LYS A CD   10 
ATOM 10630 C CE   . LYS A 1 93  ? 30.082 33.479 13.152 1.00 0.00 ? 63 LYS A CE   10 
ATOM 10631 N NZ   . LYS A 1 93  ? 30.145 32.330 12.206 1.00 0.00 ? 63 LYS A NZ   10 
ATOM 10632 H H    . LYS A 1 93  ? 28.367 33.926 8.300  1.00 0.00 ? 63 LYS A H    10 
ATOM 10633 H HA   . LYS A 1 93  ? 27.203 35.895 9.915  1.00 0.00 ? 63 LYS A HA   10 
ATOM 10634 H HB2  . LYS A 1 93  ? 27.851 33.628 10.691 1.00 0.00 ? 63 LYS A HB2  10 
ATOM 10635 H HB3  . LYS A 1 93  ? 29.546 34.111 10.610 1.00 0.00 ? 63 LYS A HB3  10 
ATOM 10636 H HG2  . LYS A 1 93  ? 29.181 35.854 12.265 1.00 0.00 ? 63 LYS A HG2  10 
ATOM 10637 H HG3  . LYS A 1 93  ? 27.448 35.518 12.286 1.00 0.00 ? 63 LYS A HG3  10 
ATOM 10638 H HD2  . LYS A 1 93  ? 28.469 34.433 14.197 1.00 0.00 ? 63 LYS A HD2  10 
ATOM 10639 H HD3  . LYS A 1 93  ? 27.957 33.192 13.053 1.00 0.00 ? 63 LYS A HD3  10 
ATOM 10640 H HE2  . LYS A 1 93  ? 30.745 34.261 12.812 1.00 0.00 ? 63 LYS A HE2  10 
ATOM 10641 H HE3  . LYS A 1 93  ? 30.388 33.152 14.134 1.00 0.00 ? 63 LYS A HE3  10 
ATOM 10642 H HZ1  . LYS A 1 93  ? 30.503 31.490 12.703 1.00 0.00 ? 63 LYS A HZ1  10 
ATOM 10643 H HZ2  . LYS A 1 93  ? 30.783 32.566 11.419 1.00 0.00 ? 63 LYS A HZ2  10 
ATOM 10644 H HZ3  . LYS A 1 93  ? 29.195 32.131 11.834 1.00 0.00 ? 63 LYS A HZ3  10 
ATOM 10645 N N    . ILE A 1 94  ? 30.353 36.461 9.130  1.00 0.00 ? 64 ILE A N    10 
ATOM 10646 C CA   . ILE A 1 94  ? 31.348 37.527 9.054  1.00 0.00 ? 64 ILE A CA   10 
ATOM 10647 C C    . ILE A 1 94  ? 30.769 38.729 8.306  1.00 0.00 ? 64 ILE A C    10 
ATOM 10648 O O    . ILE A 1 94  ? 30.959 39.873 8.718  1.00 0.00 ? 64 ILE A O    10 
ATOM 10649 C CB   . ILE A 1 94  ? 32.614 37.001 8.359  1.00 0.00 ? 64 ILE A CB   10 
ATOM 10650 C CG1  . ILE A 1 94  ? 33.208 35.865 9.193  1.00 0.00 ? 64 ILE A CG1  10 
ATOM 10651 C CG2  . ILE A 1 94  ? 33.667 38.106 8.217  1.00 0.00 ? 64 ILE A CG2  10 
ATOM 10652 C CD1  . ILE A 1 94  ? 34.302 35.157 8.391  1.00 0.00 ? 64 ILE A CD1  10 
ATOM 10653 H H    . ILE A 1 94  ? 30.556 35.579 8.752  1.00 0.00 ? 64 ILE A H    10 
ATOM 10654 H HA   . ILE A 1 94  ? 31.604 37.831 10.060 1.00 0.00 ? 64 ILE A HA   10 
ATOM 10655 H HB   . ILE A 1 94  ? 32.353 36.626 7.381  1.00 0.00 ? 64 ILE A HB   10 
ATOM 10656 H HG12 . ILE A 1 94  ? 33.632 36.271 10.100 1.00 0.00 ? 64 ILE A HG12 10 
ATOM 10657 H HG13 . ILE A 1 94  ? 32.434 35.158 9.445  1.00 0.00 ? 64 ILE A HG13 10 
ATOM 10658 H HG21 . ILE A 1 94  ? 33.224 38.969 7.742  1.00 0.00 ? 64 ILE A HG21 10 
ATOM 10659 H HG22 . ILE A 1 94  ? 34.487 37.746 7.611  1.00 0.00 ? 64 ILE A HG22 10 
ATOM 10660 H HG23 . ILE A 1 94  ? 34.035 38.381 9.193  1.00 0.00 ? 64 ILE A HG23 10 
ATOM 10661 H HD11 . ILE A 1 94  ? 33.934 34.934 7.400  1.00 0.00 ? 64 ILE A HD11 10 
ATOM 10662 H HD12 . ILE A 1 94  ? 34.576 34.238 8.890  1.00 0.00 ? 64 ILE A HD12 10 
ATOM 10663 H HD13 . ILE A 1 94  ? 35.166 35.799 8.318  1.00 0.00 ? 64 ILE A HD13 10 
ATOM 10664 N N    . ASP A 1 95  ? 30.032 38.465 7.228  1.00 0.00 ? 65 ASP A N    10 
ATOM 10665 C CA   . ASP A 1 95  ? 29.398 39.545 6.476  1.00 0.00 ? 65 ASP A CA   10 
ATOM 10666 C C    . ASP A 1 95  ? 28.437 40.321 7.371  1.00 0.00 ? 65 ASP A C    10 
ATOM 10667 O O    . ASP A 1 95  ? 28.422 41.553 7.363  1.00 0.00 ? 65 ASP A O    10 
ATOM 10668 C CB   . ASP A 1 95  ? 28.626 38.984 5.279  1.00 0.00 ? 65 ASP A CB   10 
ATOM 10669 C CG   . ASP A 1 95  ? 29.578 38.377 4.252  1.00 0.00 ? 65 ASP A CG   10 
ATOM 10670 O OD1  . ASP A 1 95  ? 30.713 38.819 4.179  1.00 0.00 ? 65 ASP A OD1  10 
ATOM 10671 O OD2  . ASP A 1 95  ? 29.156 37.474 3.548  1.00 0.00 ? 65 ASP A OD2  10 
ATOM 10672 H H    . ASP A 1 95  ? 29.950 37.539 6.914  1.00 0.00 ? 65 ASP A H    10 
ATOM 10673 H HA   . ASP A 1 95  ? 30.163 40.218 6.116  1.00 0.00 ? 65 ASP A HA   10 
ATOM 10674 H HB2  . ASP A 1 95  ? 27.942 38.222 5.622  1.00 0.00 ? 65 ASP A HB2  10 
ATOM 10675 H HB3  . ASP A 1 95  ? 28.065 39.782 4.813  1.00 0.00 ? 65 ASP A HB3  10 
ATOM 10676 N N    . GLU A 1 96  ? 27.667 39.597 8.176  1.00 0.00 ? 66 GLU A N    10 
ATOM 10677 C CA   . GLU A 1 96  ? 26.722 40.239 9.081  1.00 0.00 ? 66 GLU A CA   10 
ATOM 10678 C C    . GLU A 1 96  ? 27.458 41.108 10.096 1.00 0.00 ? 66 GLU A C    10 
ATOM 10679 O O    . GLU A 1 96  ? 27.061 42.249 10.349 1.00 0.00 ? 66 GLU A O    10 
ATOM 10680 C CB   . GLU A 1 96  ? 25.902 39.176 9.817  1.00 0.00 ? 66 GLU A CB   10 
ATOM 10681 C CG   . GLU A 1 96  ? 24.790 39.856 10.626 1.00 0.00 ? 66 GLU A CG   10 
ATOM 10682 C CD   . GLU A 1 96  ? 23.991 38.846 11.460 1.00 0.00 ? 66 GLU A CD   10 
ATOM 10683 O OE1  . GLU A 1 96  ? 24.305 37.665 11.435 1.00 0.00 ? 66 GLU A OE1  10 
ATOM 10684 O OE2  . GLU A 1 96  ? 23.061 39.277 12.121 1.00 0.00 ? 66 GLU A OE2  10 
ATOM 10685 H H    . GLU A 1 96  ? 27.708 38.618 8.132  1.00 0.00 ? 66 GLU A H    10 
ATOM 10686 H HA   . GLU A 1 96  ? 26.052 40.860 8.506  1.00 0.00 ? 66 GLU A HA   10 
ATOM 10687 H HB2  . GLU A 1 96  ? 25.464 38.500 9.097  1.00 0.00 ? 66 GLU A HB2  10 
ATOM 10688 H HB3  . GLU A 1 96  ? 26.545 38.626 10.486 1.00 0.00 ? 66 GLU A HB3  10 
ATOM 10689 H HG2  . GLU A 1 96  ? 25.232 40.583 11.288 1.00 0.00 ? 66 GLU A HG2  10 
ATOM 10690 H HG3  . GLU A 1 96  ? 24.120 40.360 9.946  1.00 0.00 ? 66 GLU A HG3  10 
ATOM 10691 N N    . PHE A 1 97  ? 28.551 40.590 10.650 1.00 0.00 ? 67 PHE A N    10 
ATOM 10692 C CA   . PHE A 1 97  ? 29.314 41.345 11.637 1.00 0.00 ? 67 PHE A CA   10 
ATOM 10693 C C    . PHE A 1 97  ? 29.828 42.654 11.044 1.00 0.00 ? 67 PHE A C    10 
ATOM 10694 O O    . PHE A 1 97  ? 29.791 43.692 11.706 1.00 0.00 ? 67 PHE A O    10 
ATOM 10695 C CB   . PHE A 1 97  ? 30.496 40.511 12.134 1.00 0.00 ? 67 PHE A CB   10 
ATOM 10696 C CG   . PHE A 1 97  ? 31.291 41.189 13.224 1.00 0.00 ? 67 PHE A CG   10 
ATOM 10697 C CD1  . PHE A 1 97  ? 32.462 41.890 12.905 1.00 0.00 ? 67 PHE A CD1  10 
ATOM 10698 C CD2  . PHE A 1 97  ? 30.856 41.122 14.552 1.00 0.00 ? 67 PHE A CD2  10 
ATOM 10699 C CE1  . PHE A 1 97  ? 33.195 42.522 13.915 1.00 0.00 ? 67 PHE A CE1  10 
ATOM 10700 C CE2  . PHE A 1 97  ? 31.590 41.753 15.563 1.00 0.00 ? 67 PHE A CE2  10 
ATOM 10701 C CZ   . PHE A 1 97  ? 32.760 42.453 15.244 1.00 0.00 ? 67 PHE A CZ   10 
ATOM 10702 H H    . PHE A 1 97  ? 28.827 39.678 10.417 1.00 0.00 ? 67 PHE A H    10 
ATOM 10703 H HA   . PHE A 1 97  ? 28.671 41.569 12.477 1.00 0.00 ? 67 PHE A HA   10 
ATOM 10704 H HB2  . PHE A 1 97  ? 30.124 39.573 12.515 1.00 0.00 ? 67 PHE A HB2  10 
ATOM 10705 H HB3  . PHE A 1 97  ? 31.148 40.307 11.296 1.00 0.00 ? 67 PHE A HB3  10 
ATOM 10706 H HD1  . PHE A 1 97  ? 32.799 41.940 11.881 1.00 0.00 ? 67 PHE A HD1  10 
ATOM 10707 H HD2  . PHE A 1 97  ? 29.954 40.581 14.798 1.00 0.00 ? 67 PHE A HD2  10 
ATOM 10708 H HE1  . PHE A 1 97  ? 34.097 43.062 13.670 1.00 0.00 ? 67 PHE A HE1  10 
ATOM 10709 H HE2  . PHE A 1 97  ? 31.254 41.700 16.589 1.00 0.00 ? 67 PHE A HE2  10 
ATOM 10710 H HZ   . PHE A 1 97  ? 33.327 42.941 16.024 1.00 0.00 ? 67 PHE A HZ   10 
ATOM 10711 N N    . LEU A 1 98  ? 30.309 42.607 9.803  1.00 0.00 ? 68 LEU A N    10 
ATOM 10712 C CA   . LEU A 1 98  ? 30.736 43.828 9.124  1.00 0.00 ? 68 LEU A CA   10 
ATOM 10713 C C    . LEU A 1 98  ? 29.560 44.777 8.901  1.00 0.00 ? 68 LEU A C    10 
ATOM 10714 O O    . LEU A 1 98  ? 29.701 45.992 9.042  1.00 0.00 ? 68 LEU A O    10 
ATOM 10715 C CB   . LEU A 1 98  ? 31.383 43.493 7.777  1.00 0.00 ? 68 LEU A CB   10 
ATOM 10716 C CG   . LEU A 1 98  ? 32.658 42.667 7.986  1.00 0.00 ? 68 LEU A CG   10 
ATOM 10717 C CD1  . LEU A 1 98  ? 33.205 42.219 6.626  1.00 0.00 ? 68 LEU A CD1  10 
ATOM 10718 C CD2  . LEU A 1 98  ? 33.714 43.520 8.699  1.00 0.00 ? 68 LEU A CD2  10 
ATOM 10719 H H    . LEU A 1 98  ? 30.403 41.742 9.352  1.00 0.00 ? 68 LEU A H    10 
ATOM 10720 H HA   . LEU A 1 98  ? 31.462 44.330 9.745  1.00 0.00 ? 68 LEU A HA   10 
ATOM 10721 H HB2  . LEU A 1 98  ? 30.685 42.926 7.178  1.00 0.00 ? 68 LEU A HB2  10 
ATOM 10722 H HB3  . LEU A 1 98  ? 31.633 44.409 7.263  1.00 0.00 ? 68 LEU A HB3  10 
ATOM 10723 H HG   . LEU A 1 98  ? 32.430 41.798 8.586  1.00 0.00 ? 68 LEU A HG   10 
ATOM 10724 H HD11 . LEU A 1 98  ? 32.722 41.298 6.332  1.00 0.00 ? 68 LEU A HD11 10 
ATOM 10725 H HD12 . LEU A 1 98  ? 34.272 42.057 6.694  1.00 0.00 ? 68 LEU A HD12 10 
ATOM 10726 H HD13 . LEU A 1 98  ? 33.006 42.980 5.887  1.00 0.00 ? 68 LEU A HD13 10 
ATOM 10727 H HD21 . LEU A 1 98  ? 33.735 44.507 8.260  1.00 0.00 ? 68 LEU A HD21 10 
ATOM 10728 H HD22 . LEU A 1 98  ? 34.683 43.057 8.589  1.00 0.00 ? 68 LEU A HD22 10 
ATOM 10729 H HD23 . LEU A 1 98  ? 33.467 43.596 9.747  1.00 0.00 ? 68 LEU A HD23 10 
ATOM 10730 N N    . ALA A 1 99  ? 28.402 44.221 8.552  1.00 0.00 ? 69 ALA A N    10 
ATOM 10731 C CA   . ALA A 1 99  ? 27.214 45.043 8.331  1.00 0.00 ? 69 ALA A CA   10 
ATOM 10732 C C    . ALA A 1 99  ? 26.797 45.787 9.599  1.00 0.00 ? 69 ALA A C    10 
ATOM 10733 O O    . ALA A 1 99  ? 26.291 46.907 9.527  1.00 0.00 ? 69 ALA A O    10 
ATOM 10734 C CB   . ALA A 1 99  ? 26.057 44.160 7.858  1.00 0.00 ? 69 ALA A CB   10 
ATOM 10735 H H    . ALA A 1 99  ? 28.355 43.255 8.402  1.00 0.00 ? 69 ALA A H    10 
ATOM 10736 H HA   . ALA A 1 99  ? 27.431 45.766 7.560  1.00 0.00 ? 69 ALA A HA   10 
ATOM 10737 H HB1  . ALA A 1 99  ? 26.425 43.437 7.146  1.00 0.00 ? 69 ALA A HB1  10 
ATOM 10738 H HB2  . ALA A 1 99  ? 25.303 44.775 7.388  1.00 0.00 ? 69 ALA A HB2  10 
ATOM 10739 H HB3  . ALA A 1 99  ? 25.626 43.646 8.704  1.00 0.00 ? 69 ALA A HB3  10 
ATOM 10740 N N    . THR A 1 100 ? 27.009 45.168 10.756 1.00 0.00 ? 70 THR A N    10 
ATOM 10741 C CA   . THR A 1 100 ? 26.725 45.830 12.030 1.00 0.00 ? 70 THR A CA   10 
ATOM 10742 C C    . THR A 1 100 ? 27.779 46.883 12.389 1.00 0.00 ? 70 THR A C    10 
ATOM 10743 O O    . THR A 1 100 ? 27.505 47.786 13.180 1.00 0.00 ? 70 THR A O    10 
ATOM 10744 C CB   . THR A 1 100 ? 26.645 44.791 13.151 1.00 0.00 ? 70 THR A CB   10 
ATOM 10745 O OG1  . THR A 1 100 ? 27.900 44.139 13.282 1.00 0.00 ? 70 THR A OG1  10 
ATOM 10746 C CG2  . THR A 1 100 ? 25.562 43.761 12.825 1.00 0.00 ? 70 THR A CG2  10 
ATOM 10747 H H    . THR A 1 100 ? 27.316 44.237 10.754 1.00 0.00 ? 70 THR A H    10 
ATOM 10748 H HA   . THR A 1 100 ? 25.766 46.319 11.954 1.00 0.00 ? 70 THR A HA   10 
ATOM 10749 H HB   . THR A 1 100 ? 26.397 45.285 14.080 1.00 0.00 ? 70 THR A HB   10 
ATOM 10750 H HG1  . THR A 1 100 ? 27.925 43.745 14.092 1.00 0.00 ? 70 THR A HG1  10 
ATOM 10751 H HG21 . THR A 1 100 ? 24.589 44.224 12.907 1.00 0.00 ? 70 THR A HG21 10 
ATOM 10752 H HG22 . THR A 1 100 ? 25.627 42.936 13.520 1.00 0.00 ? 70 THR A HG22 10 
ATOM 10753 H HG23 . THR A 1 100 ? 25.703 43.396 11.818 1.00 0.00 ? 70 THR A HG23 10 
ATOM 10754 N N    . GLY A 1 101 ? 28.980 46.777 11.818 1.00 0.00 ? 71 GLY A N    10 
ATOM 10755 C CA   . GLY A 1 101 ? 30.041 47.735 12.103 1.00 0.00 ? 71 GLY A CA   10 
ATOM 10756 C C    . GLY A 1 101 ? 31.116 47.696 11.022 1.00 0.00 ? 71 GLY A C    10 
ATOM 10757 O O    . GLY A 1 101 ? 31.904 46.753 10.951 1.00 0.00 ? 71 GLY A O    10 
ATOM 10758 H H    . GLY A 1 101 ? 29.151 46.041 11.194 1.00 0.00 ? 71 GLY A H    10 
ATOM 10759 H HA2  . GLY A 1 101 ? 29.618 48.728 12.151 1.00 0.00 ? 71 GLY A HA2  10 
ATOM 10760 H HA3  . GLY A 1 101 ? 30.491 47.494 13.054 1.00 0.00 ? 71 GLY A HA3  10 
ATOM 10761 N N    . GLU A 1 31  ? 47.615 42.925 18.596 1.00 0.00 ? 1  GLU A N    11 
ATOM 10762 C CA   . GLU A 1 31  ? 46.336 42.279 18.324 1.00 0.00 ? 1  GLU A CA   11 
ATOM 10763 C C    . GLU A 1 31  ? 46.190 41.988 16.834 1.00 0.00 ? 1  GLU A C    11 
ATOM 10764 O O    . GLU A 1 31  ? 46.278 42.893 16.004 1.00 0.00 ? 1  GLU A O    11 
ATOM 10765 C CB   . GLU A 1 31  ? 45.189 43.181 18.787 1.00 0.00 ? 1  GLU A CB   11 
ATOM 10766 C CG   . GLU A 1 31  ? 43.856 42.440 18.633 1.00 0.00 ? 1  GLU A CG   11 
ATOM 10767 C CD   . GLU A 1 31  ? 43.744 41.299 19.645 1.00 0.00 ? 1  GLU A CD   11 
ATOM 10768 O OE1  . GLU A 1 31  ? 44.377 41.375 20.686 1.00 0.00 ? 1  GLU A OE1  11 
ATOM 10769 O OE2  . GLU A 1 31  ? 43.019 40.360 19.360 1.00 0.00 ? 1  GLU A OE2  11 
ATOM 10770 H H    . GLU A 1 31  ? 47.641 43.780 19.072 1.00 0.00 ? 1  GLU A H    11 
ATOM 10771 H HA   . GLU A 1 31  ? 46.289 41.349 18.869 1.00 0.00 ? 1  GLU A HA   11 
ATOM 10772 H HB2  . GLU A 1 31  ? 45.336 43.446 19.824 1.00 0.00 ? 1  GLU A HB2  11 
ATOM 10773 H HB3  . GLU A 1 31  ? 45.170 44.076 18.185 1.00 0.00 ? 1  GLU A HB3  11 
ATOM 10774 H HG2  . GLU A 1 31  ? 43.044 43.135 18.790 1.00 0.00 ? 1  GLU A HG2  11 
ATOM 10775 H HG3  . GLU A 1 31  ? 43.788 42.036 17.634 1.00 0.00 ? 1  GLU A HG3  11 
ATOM 10776 N N    . THR A 1 32  ? 45.966 40.721 16.502 1.00 0.00 ? 2  THR A N    11 
ATOM 10777 C CA   . THR A 1 32  ? 45.799 40.325 15.109 1.00 0.00 ? 2  THR A CA   11 
ATOM 10778 C C    . THR A 1 32  ? 44.633 41.080 14.481 1.00 0.00 ? 2  THR A C    11 
ATOM 10779 O O    . THR A 1 32  ? 43.606 41.299 15.122 1.00 0.00 ? 2  THR A O    11 
ATOM 10780 C CB   . THR A 1 32  ? 45.547 38.818 15.022 1.00 0.00 ? 2  THR A CB   11 
ATOM 10781 O OG1  . THR A 1 32  ? 46.582 38.129 15.710 1.00 0.00 ? 2  THR A OG1  11 
ATOM 10782 C CG2  . THR A 1 32  ? 45.526 38.381 13.556 1.00 0.00 ? 2  THR A CG2  11 
ATOM 10783 H H    . THR A 1 32  ? 45.913 40.041 17.206 1.00 0.00 ? 2  THR A H    11 
ATOM 10784 H HA   . THR A 1 32  ? 46.702 40.560 14.566 1.00 0.00 ? 2  THR A HA   11 
ATOM 10785 H HB   . THR A 1 32  ? 44.595 38.584 15.476 1.00 0.00 ? 2  THR A HB   11 
ATOM 10786 H HG1  . THR A 1 32  ? 46.622 37.290 15.387 1.00 0.00 ? 2  THR A HG1  11 
ATOM 10787 H HG21 . THR A 1 32  ? 46.232 38.974 12.992 1.00 0.00 ? 2  THR A HG21 11 
ATOM 10788 H HG22 . THR A 1 32  ? 44.535 38.522 13.153 1.00 0.00 ? 2  THR A HG22 11 
ATOM 10789 H HG23 . THR A 1 32  ? 45.798 37.337 13.488 1.00 0.00 ? 2  THR A HG23 11 
ATOM 10790 N N    . LEU A 1 33  ? 44.771 41.430 13.207 1.00 0.00 ? 3  LEU A N    11 
ATOM 10791 C CA   . LEU A 1 33  ? 43.765 42.253 12.539 1.00 0.00 ? 3  LEU A CA   11 
ATOM 10792 C C    . LEU A 1 33  ? 42.379 41.606 12.569 1.00 0.00 ? 3  LEU A C    11 
ATOM 10793 O O    . LEU A 1 33  ? 41.367 42.306 12.586 1.00 0.00 ? 3  LEU A O    11 
ATOM 10794 C CB   . LEU A 1 33  ? 44.179 42.476 11.085 1.00 0.00 ? 3  LEU A CB   11 
ATOM 10795 C CG   . LEU A 1 33  ? 45.538 43.175 11.033 1.00 0.00 ? 3  LEU A CG   11 
ATOM 10796 C CD1  . LEU A 1 33  ? 46.025 43.235 9.584  1.00 0.00 ? 3  LEU A CD1  11 
ATOM 10797 C CD2  . LEU A 1 33  ? 45.396 44.599 11.573 1.00 0.00 ? 3  LEU A CD2  11 
ATOM 10798 H H    . LEU A 1 33  ? 45.559 41.133 12.708 1.00 0.00 ? 3  LEU A H    11 
ATOM 10799 H HA   . LEU A 1 33  ? 43.713 43.212 13.034 1.00 0.00 ? 3  LEU A HA   11 
ATOM 10800 H HB2  . LEU A 1 33  ? 44.243 41.524 10.579 1.00 0.00 ? 3  LEU A HB2  11 
ATOM 10801 H HB3  . LEU A 1 33  ? 43.443 43.094 10.598 1.00 0.00 ? 3  LEU A HB3  11 
ATOM 10802 H HG   . LEU A 1 33  ? 46.251 42.628 11.631 1.00 0.00 ? 3  LEU A HG   11 
ATOM 10803 H HD11 . LEU A 1 33  ? 45.442 43.961 9.037  1.00 0.00 ? 3  LEU A HD11 11 
ATOM 10804 H HD12 . LEU A 1 33  ? 45.911 42.264 9.126  1.00 0.00 ? 3  LEU A HD12 11 
ATOM 10805 H HD13 . LEU A 1 33  ? 47.066 43.522 9.565  1.00 0.00 ? 3  LEU A HD13 11 
ATOM 10806 H HD21 . LEU A 1 33  ? 44.534 45.068 11.125 1.00 0.00 ? 3  LEU A HD21 11 
ATOM 10807 H HD22 . LEU A 1 33  ? 46.282 45.166 11.331 1.00 0.00 ? 3  LEU A HD22 11 
ATOM 10808 H HD23 . LEU A 1 33  ? 45.272 44.566 12.646 1.00 0.00 ? 3  LEU A HD23 11 
ATOM 10809 N N    . ASN A 1 34  ? 42.331 40.278 12.575 1.00 0.00 ? 4  ASN A N    11 
ATOM 10810 C CA   . ASN A 1 34  ? 41.053 39.564 12.618 1.00 0.00 ? 4  ASN A CA   11 
ATOM 10811 C C    . ASN A 1 34  ? 40.655 39.139 14.041 1.00 0.00 ? 4  ASN A C    11 
ATOM 10812 O O    . ASN A 1 34  ? 39.697 38.383 14.212 1.00 0.00 ? 4  ASN A O    11 
ATOM 10813 C CB   . ASN A 1 34  ? 41.129 38.324 11.724 1.00 0.00 ? 4  ASN A CB   11 
ATOM 10814 C CG   . ASN A 1 34  ? 41.518 38.719 10.301 1.00 0.00 ? 4  ASN A CG   11 
ATOM 10815 O OD1  . ASN A 1 34  ? 40.895 39.594 9.697  1.00 0.00 ? 4  ASN A OD1  11 
ATOM 10816 N ND2  . ASN A 1 34  ? 42.518 38.113 9.720  1.00 0.00 ? 4  ASN A ND2  11 
ATOM 10817 H H    . ASN A 1 34  ? 43.166 39.766 12.549 1.00 0.00 ? 4  ASN A H    11 
ATOM 10818 H HA   . ASN A 1 34  ? 40.284 40.214 12.228 1.00 0.00 ? 4  ASN A HA   11 
ATOM 10819 H HB2  . ASN A 1 34  ? 41.866 37.643 12.121 1.00 0.00 ? 4  ASN A HB2  11 
ATOM 10820 H HB3  . ASN A 1 34  ? 40.165 37.836 11.706 1.00 0.00 ? 4  ASN A HB3  11 
ATOM 10821 H HD21 . ASN A 1 34  ? 43.005 37.405 10.192 1.00 0.00 ? 4  ASN A HD21 11 
ATOM 10822 H HD22 . ASN A 1 34  ? 42.791 38.378 8.816  1.00 0.00 ? 4  ASN A HD22 11 
ATOM 10823 N N    . GLY A 1 35  ? 41.366 39.616 15.065 1.00 0.00 ? 5  GLY A N    11 
ATOM 10824 C CA   . GLY A 1 35  ? 41.157 39.130 16.424 1.00 0.00 ? 5  GLY A CA   11 
ATOM 10825 C C    . GLY A 1 35  ? 39.696 39.233 16.849 1.00 0.00 ? 5  GLY A C    11 
ATOM 10826 O O    . GLY A 1 35  ? 39.179 38.333 17.512 1.00 0.00 ? 5  GLY A O    11 
ATOM 10827 H H    . GLY A 1 35  ? 42.036 40.310 14.905 1.00 0.00 ? 5  GLY A H    11 
ATOM 10828 H HA2  . GLY A 1 35  ? 41.467 38.097 16.479 1.00 0.00 ? 5  GLY A HA2  11 
ATOM 10829 H HA3  . GLY A 1 35  ? 41.759 39.715 17.102 1.00 0.00 ? 5  GLY A HA3  11 
ATOM 10830 N N    . ALA A 1 36  ? 39.023 40.314 16.455 1.00 0.00 ? 6  ALA A N    11 
ATOM 10831 C CA   . ALA A 1 36  ? 37.632 40.499 16.856 1.00 0.00 ? 6  ALA A CA   11 
ATOM 10832 C C    . ALA A 1 36  ? 36.772 39.357 16.325 1.00 0.00 ? 6  ALA A C    11 
ATOM 10833 O O    . ALA A 1 36  ? 36.002 38.745 17.070 1.00 0.00 ? 6  ALA A O    11 
ATOM 10834 C CB   . ALA A 1 36  ? 37.105 41.831 16.317 1.00 0.00 ? 6  ALA A CB   11 
ATOM 10835 H H    . ALA A 1 36  ? 39.464 40.985 15.894 1.00 0.00 ? 6  ALA A H    11 
ATOM 10836 H HA   . ALA A 1 36  ? 37.575 40.512 17.934 1.00 0.00 ? 6  ALA A HA   11 
ATOM 10837 H HB1  . ALA A 1 36  ? 37.352 41.919 15.270 1.00 0.00 ? 6  ALA A HB1  11 
ATOM 10838 H HB2  . ALA A 1 36  ? 37.559 42.645 16.863 1.00 0.00 ? 6  ALA A HB2  11 
ATOM 10839 H HB3  . ALA A 1 36  ? 36.033 41.869 16.438 1.00 0.00 ? 6  ALA A HB3  11 
ATOM 10840 N N    . LEU A 1 37  ? 36.936 39.040 15.043 1.00 0.00 ? 7  LEU A N    11 
ATOM 10841 C CA   . LEU A 1 37  ? 36.206 37.920 14.456 1.00 0.00 ? 7  LEU A CA   11 
ATOM 10842 C C    . LEU A 1 37  ? 36.585 36.603 15.134 1.00 0.00 ? 7  LEU A C    11 
ATOM 10843 O O    . LEU A 1 37  ? 35.733 35.739 15.335 1.00 0.00 ? 7  LEU A O    11 
ATOM 10844 C CB   . LEU A 1 37  ? 36.483 37.845 12.951 1.00 0.00 ? 7  LEU A CB   11 
ATOM 10845 C CG   . LEU A 1 37  ? 36.079 39.164 12.283 1.00 0.00 ? 7  LEU A CG   11 
ATOM 10846 C CD1  . LEU A 1 37  ? 36.450 39.126 10.800 1.00 0.00 ? 7  LEU A CD1  11 
ATOM 10847 C CD2  . LEU A 1 37  ? 34.567 39.372 12.408 1.00 0.00 ? 7  LEU A CD2  11 
ATOM 10848 H H    . LEU A 1 37  ? 37.551 39.563 14.488 1.00 0.00 ? 7  LEU A H    11 
ATOM 10849 H HA   . LEU A 1 37  ? 35.150 38.083 14.606 1.00 0.00 ? 7  LEU A HA   11 
ATOM 10850 H HB2  . LEU A 1 37  ? 37.537 37.667 12.789 1.00 0.00 ? 7  LEU A HB2  11 
ATOM 10851 H HB3  . LEU A 1 37  ? 35.911 37.037 12.521 1.00 0.00 ? 7  LEU A HB3  11 
ATOM 10852 H HG   . LEU A 1 37  ? 36.597 39.983 12.762 1.00 0.00 ? 7  LEU A HG   11 
ATOM 10853 H HD11 . LEU A 1 37  ? 35.862 39.858 10.266 1.00 0.00 ? 7  LEU A HD11 11 
ATOM 10854 H HD12 . LEU A 1 37  ? 36.246 38.142 10.404 1.00 0.00 ? 7  LEU A HD12 11 
ATOM 10855 H HD13 . LEU A 1 37  ? 37.499 39.351 10.685 1.00 0.00 ? 7  LEU A HD13 11 
ATOM 10856 H HD21 . LEU A 1 37  ? 34.335 39.747 13.394 1.00 0.00 ? 7  LEU A HD21 11 
ATOM 10857 H HD22 . LEU A 1 37  ? 34.060 38.431 12.252 1.00 0.00 ? 7  LEU A HD22 11 
ATOM 10858 H HD23 . LEU A 1 37  ? 34.239 40.085 11.666 1.00 0.00 ? 7  LEU A HD23 11 
ATOM 10859 N N    . VAL A 1 38  ? 37.852 36.466 15.525 1.00 0.00 ? 8  VAL A N    11 
ATOM 10860 C CA   . VAL A 1 38  ? 38.289 35.264 16.231 1.00 0.00 ? 8  VAL A CA   11 
ATOM 10861 C C    . VAL A 1 38  ? 37.507 35.119 17.537 1.00 0.00 ? 8  VAL A C    11 
ATOM 10862 O O    . VAL A 1 38  ? 37.061 34.024 17.885 1.00 0.00 ? 8  VAL A O    11 
ATOM 10863 C CB   . VAL A 1 38  ? 39.799 35.345 16.513 1.00 0.00 ? 8  VAL A CB   11 
ATOM 10864 C CG1  . VAL A 1 38  ? 40.286 34.096 17.258 1.00 0.00 ? 8  VAL A CG1  11 
ATOM 10865 C CG2  . VAL A 1 38  ? 40.562 35.453 15.191 1.00 0.00 ? 8  VAL A CG2  11 
ATOM 10866 H H    . VAL A 1 38  ? 38.503 37.166 15.307 1.00 0.00 ? 8  VAL A H    11 
ATOM 10867 H HA   . VAL A 1 38  ? 38.096 34.402 15.610 1.00 0.00 ? 8  VAL A HA   11 
ATOM 10868 H HB   . VAL A 1 38  ? 40.003 36.218 17.115 1.00 0.00 ? 8  VAL A HB   11 
ATOM 10869 H HG11 . VAL A 1 38  ? 40.294 33.255 16.582 1.00 0.00 ? 8  VAL A HG11 11 
ATOM 10870 H HG12 . VAL A 1 38  ? 39.635 33.884 18.092 1.00 0.00 ? 8  VAL A HG12 11 
ATOM 10871 H HG13 . VAL A 1 38  ? 41.288 34.269 17.624 1.00 0.00 ? 8  VAL A HG13 11 
ATOM 10872 H HG21 . VAL A 1 38  ? 41.557 35.828 15.381 1.00 0.00 ? 8  VAL A HG21 11 
ATOM 10873 H HG22 . VAL A 1 38  ? 40.046 36.126 14.524 1.00 0.00 ? 8  VAL A HG22 11 
ATOM 10874 H HG23 . VAL A 1 38  ? 40.628 34.476 14.735 1.00 0.00 ? 8  VAL A HG23 11 
ATOM 10875 N N    . ASN A 1 39  ? 37.303 36.232 18.237 1.00 0.00 ? 9  ASN A N    11 
ATOM 10876 C CA   . ASN A 1 39  ? 36.493 36.214 19.451 1.00 0.00 ? 9  ASN A CA   11 
ATOM 10877 C C    . ASN A 1 39  ? 35.060 35.788 19.137 1.00 0.00 ? 9  ASN A C    11 
ATOM 10878 O O    . ASN A 1 39  ? 34.454 35.019 19.885 1.00 0.00 ? 9  ASN A O    11 
ATOM 10879 C CB   . ASN A 1 39  ? 36.485 37.603 20.095 1.00 0.00 ? 9  ASN A CB   11 
ATOM 10880 C CG   . ASN A 1 39  ? 37.892 37.985 20.547 1.00 0.00 ? 9  ASN A CG   11 
ATOM 10881 O OD1  . ASN A 1 39  ? 38.738 37.117 20.762 1.00 0.00 ? 9  ASN A OD1  11 
ATOM 10882 N ND2  . ASN A 1 39  ? 38.192 39.245 20.708 1.00 0.00 ? 9  ASN A ND2  11 
ATOM 10883 H H    . ASN A 1 39  ? 37.729 37.066 17.952 1.00 0.00 ? 9  ASN A H    11 
ATOM 10884 H HA   . ASN A 1 39  ? 36.922 35.510 20.148 1.00 0.00 ? 9  ASN A HA   11 
ATOM 10885 H HB2  . ASN A 1 39  ? 36.133 38.327 19.375 1.00 0.00 ? 9  ASN A HB2  11 
ATOM 10886 H HB3  . ASN A 1 39  ? 35.825 37.597 20.948 1.00 0.00 ? 9  ASN A HB3  11 
ATOM 10887 H HD21 . ASN A 1 39  ? 37.519 39.936 20.537 1.00 0.00 ? 9  ASN A HD21 11 
ATOM 10888 H HD22 . ASN A 1 39  ? 39.093 39.500 20.999 1.00 0.00 ? 9  ASN A HD22 11 
ATOM 10889 N N    . MET A 1 40  ? 34.538 36.252 18.003 1.00 0.00 ? 10 MET A N    11 
ATOM 10890 C CA   . MET A 1 40  ? 33.186 35.881 17.602 1.00 0.00 ? 10 MET A CA   11 
ATOM 10891 C C    . MET A 1 40  ? 33.082 34.371 17.423 1.00 0.00 ? 10 MET A C    11 
ATOM 10892 O O    . MET A 1 40  ? 32.129 33.741 17.886 1.00 0.00 ? 10 MET A O    11 
ATOM 10893 C CB   . MET A 1 40  ? 32.867 36.538 16.257 1.00 0.00 ? 10 MET A CB   11 
ATOM 10894 C CG   . MET A 1 40  ? 31.368 36.438 15.967 1.00 0.00 ? 10 MET A CG   11 
ATOM 10895 S SD   . MET A 1 40  ? 31.059 36.804 14.218 1.00 0.00 ? 10 MET A SD   11 
ATOM 10896 C CE   . MET A 1 40  ? 31.687 38.501 14.175 1.00 0.00 ? 10 MET A CE   11 
ATOM 10897 H H    . MET A 1 40  ? 35.050 36.890 17.461 1.00 0.00 ? 10 MET A H    11 
ATOM 10898 H HA   . MET A 1 40  ? 32.476 36.215 18.343 1.00 0.00 ? 10 MET A HA   11 
ATOM 10899 H HB2  . MET A 1 40  ? 33.159 37.576 16.297 1.00 0.00 ? 10 MET A HB2  11 
ATOM 10900 H HB3  . MET A 1 40  ? 33.417 36.039 15.474 1.00 0.00 ? 10 MET A HB3  11 
ATOM 10901 H HG2  . MET A 1 40  ? 31.025 35.439 16.191 1.00 0.00 ? 10 MET A HG2  11 
ATOM 10902 H HG3  . MET A 1 40  ? 30.835 37.148 16.583 1.00 0.00 ? 10 MET A HG3  11 
ATOM 10903 H HE1  . MET A 1 40  ? 32.721 38.512 14.484 1.00 0.00 ? 10 MET A HE1  11 
ATOM 10904 H HE2  . MET A 1 40  ? 31.106 39.122 14.838 1.00 0.00 ? 10 MET A HE2  11 
ATOM 10905 H HE3  . MET A 1 40  ? 31.608 38.880 13.166 1.00 0.00 ? 10 MET A HE3  11 
ATOM 10906 N N    . LEU A 1 41  ? 34.094 33.786 16.790 1.00 0.00 ? 11 LEU A N    11 
ATOM 10907 C CA   . LEU A 1 41  ? 34.113 32.344 16.588 1.00 0.00 ? 11 LEU A CA   11 
ATOM 10908 C C    . LEU A 1 41  ? 34.162 31.602 17.917 1.00 0.00 ? 11 LEU A C    11 
ATOM 10909 O O    . LEU A 1 41  ? 33.473 30.598 18.095 1.00 0.00 ? 11 LEU A O    11 
ATOM 10910 C CB   . LEU A 1 41  ? 35.317 31.957 15.730 1.00 0.00 ? 11 LEU A CB   11 
ATOM 10911 C CG   . LEU A 1 41  ? 35.206 32.646 14.369 1.00 0.00 ? 11 LEU A CG   11 
ATOM 10912 C CD1  . LEU A 1 41  ? 36.498 32.434 13.582 1.00 0.00 ? 11 LEU A CD1  11 
ATOM 10913 C CD2  . LEU A 1 41  ? 34.039 32.047 13.583 1.00 0.00 ? 11 LEU A CD2  11 
ATOM 10914 H H    . LEU A 1 41  ? 34.818 34.337 16.425 1.00 0.00 ? 11 LEU A H    11 
ATOM 10915 H HA   . LEU A 1 41  ? 33.211 32.055 16.068 1.00 0.00 ? 11 LEU A HA   11 
ATOM 10916 H HB2  . LEU A 1 41  ? 36.226 32.270 16.223 1.00 0.00 ? 11 LEU A HB2  11 
ATOM 10917 H HB3  . LEU A 1 41  ? 35.332 30.887 15.589 1.00 0.00 ? 11 LEU A HB3  11 
ATOM 10918 H HG   . LEU A 1 41  ? 35.040 33.702 14.513 1.00 0.00 ? 11 LEU A HG   11 
ATOM 10919 H HD11 . LEU A 1 41  ? 36.313 32.607 12.532 1.00 0.00 ? 11 LEU A HD11 11 
ATOM 10920 H HD12 . LEU A 1 41  ? 36.847 31.422 13.726 1.00 0.00 ? 11 LEU A HD12 11 
ATOM 10921 H HD13 . LEU A 1 41  ? 37.247 33.127 13.933 1.00 0.00 ? 11 LEU A HD13 11 
ATOM 10922 H HD21 . LEU A 1 41  ? 34.079 30.969 13.640 1.00 0.00 ? 11 LEU A HD21 11 
ATOM 10923 H HD22 . LEU A 1 41  ? 34.110 32.355 12.552 1.00 0.00 ? 11 LEU A HD22 11 
ATOM 10924 H HD23 . LEU A 1 41  ? 33.105 32.396 13.999 1.00 0.00 ? 11 LEU A HD23 11 
ATOM 10925 N N    . LYS A 1 42  ? 34.958 32.110 18.857 1.00 0.00 ? 12 LYS A N    11 
ATOM 10926 C CA   . LYS A 1 42  ? 35.049 31.477 20.168 1.00 0.00 ? 12 LYS A CA   11 
ATOM 10927 C C    . LYS A 1 42  ? 33.682 31.440 20.844 1.00 0.00 ? 12 LYS A C    11 
ATOM 10928 O O    . LYS A 1 42  ? 33.297 30.422 21.426 1.00 0.00 ? 12 LYS A O    11 
ATOM 10929 C CB   . LYS A 1 42  ? 36.039 32.242 21.049 1.00 0.00 ? 12 LYS A CB   11 
ATOM 10930 C CG   . LYS A 1 42  ? 36.246 31.488 22.364 1.00 0.00 ? 12 LYS A CG   11 
ATOM 10931 C CD   . LYS A 1 42  ? 37.171 32.294 23.276 1.00 0.00 ? 12 LYS A CD   11 
ATOM 10932 C CE   . LYS A 1 42  ? 37.508 31.471 24.521 1.00 0.00 ? 12 LYS A CE   11 
ATOM 10933 N NZ   . LYS A 1 42  ? 38.379 32.272 25.427 1.00 0.00 ? 12 LYS A NZ   11 
ATOM 10934 H H    . LYS A 1 42  ? 35.517 32.889 18.652 1.00 0.00 ? 12 LYS A H    11 
ATOM 10935 H HA   . LYS A 1 42  ? 35.405 30.465 20.044 1.00 0.00 ? 12 LYS A HA   11 
ATOM 10936 H HB2  . LYS A 1 42  ? 36.984 32.334 20.532 1.00 0.00 ? 12 LYS A HB2  11 
ATOM 10937 H HB3  . LYS A 1 42  ? 35.647 33.226 21.260 1.00 0.00 ? 12 LYS A HB3  11 
ATOM 10938 H HG2  . LYS A 1 42  ? 35.292 31.346 22.850 1.00 0.00 ? 12 LYS A HG2  11 
ATOM 10939 H HG3  . LYS A 1 42  ? 36.695 30.527 22.161 1.00 0.00 ? 12 LYS A HG3  11 
ATOM 10940 H HD2  . LYS A 1 42  ? 38.081 32.535 22.745 1.00 0.00 ? 12 LYS A HD2  11 
ATOM 10941 H HD3  . LYS A 1 42  ? 36.677 33.207 23.575 1.00 0.00 ? 12 LYS A HD3  11 
ATOM 10942 H HE2  . LYS A 1 42  ? 36.596 31.210 25.037 1.00 0.00 ? 12 LYS A HE2  11 
ATOM 10943 H HE3  . LYS A 1 42  ? 38.026 30.569 24.228 1.00 0.00 ? 12 LYS A HE3  11 
ATOM 10944 H HZ1  . LYS A 1 42  ? 38.775 33.079 24.904 1.00 0.00 ? 12 LYS A HZ1  11 
ATOM 10945 H HZ2  . LYS A 1 42  ? 39.153 31.674 25.781 1.00 0.00 ? 12 LYS A HZ2  11 
ATOM 10946 H HZ3  . LYS A 1 42  ? 37.817 32.623 26.228 1.00 0.00 ? 12 LYS A HZ3  11 
ATOM 10947 N N    . GLU A 1 43  ? 32.926 32.530 20.720 1.00 0.00 ? 13 GLU A N    11 
ATOM 10948 C CA   . GLU A 1 43  ? 31.590 32.572 21.304 1.00 0.00 ? 13 GLU A CA   11 
ATOM 10949 C C    . GLU A 1 43  ? 30.680 31.542 20.641 1.00 0.00 ? 13 GLU A C    11 
ATOM 10950 O O    . GLU A 1 43  ? 29.972 30.800 21.324 1.00 0.00 ? 13 GLU A O    11 
ATOM 10951 C CB   . GLU A 1 43  ? 30.988 33.968 21.136 1.00 0.00 ? 13 GLU A CB   11 
ATOM 10952 C CG   . GLU A 1 43  ? 31.822 34.985 21.923 1.00 0.00 ? 13 GLU A CG   11 
ATOM 10953 C CD   . GLU A 1 43  ? 31.216 36.391 21.859 1.00 0.00 ? 13 GLU A CD   11 
ATOM 10954 O OE1  . GLU A 1 43  ? 31.682 37.238 22.603 1.00 0.00 ? 13 GLU A OE1  11 
ATOM 10955 O OE2  . GLU A 1 43  ? 30.309 36.614 21.069 1.00 0.00 ? 13 GLU A OE2  11 
ATOM 10956 H H    . GLU A 1 43  ? 33.287 33.323 20.269 1.00 0.00 ? 13 GLU A H    11 
ATOM 10957 H HA   . GLU A 1 43  ? 31.661 32.349 22.358 1.00 0.00 ? 13 GLU A HA   11 
ATOM 10958 H HB2  . GLU A 1 43  ? 30.985 34.236 20.090 1.00 0.00 ? 13 GLU A HB2  11 
ATOM 10959 H HB3  . GLU A 1 43  ? 29.975 33.972 21.511 1.00 0.00 ? 13 GLU A HB3  11 
ATOM 10960 H HG2  . GLU A 1 43  ? 31.874 34.674 22.956 1.00 0.00 ? 13 GLU A HG2  11 
ATOM 10961 H HG3  . GLU A 1 43  ? 32.822 35.012 21.515 1.00 0.00 ? 13 GLU A HG3  11 
ATOM 10962 N N    . GLU A 1 44  ? 30.752 31.449 19.315 1.00 0.00 ? 14 GLU A N    11 
ATOM 10963 C CA   . GLU A 1 44  ? 29.938 30.473 18.595 1.00 0.00 ? 14 GLU A CA   11 
ATOM 10964 C C    . GLU A 1 44  ? 30.308 29.050 19.004 1.00 0.00 ? 14 GLU A C    11 
ATOM 10965 O O    . GLU A 1 44  ? 29.436 28.195 19.165 1.00 0.00 ? 14 GLU A O    11 
ATOM 10966 C CB   . GLU A 1 44  ? 30.131 30.639 17.086 1.00 0.00 ? 14 GLU A CB   11 
ATOM 10967 C CG   . GLU A 1 44  ? 29.615 32.016 16.652 1.00 0.00 ? 14 GLU A CG   11 
ATOM 10968 C CD   . GLU A 1 44  ? 28.117 32.164 16.926 1.00 0.00 ? 14 GLU A CD   11 
ATOM 10969 O OE1  . GLU A 1 44  ? 27.445 31.160 17.112 1.00 0.00 ? 14 GLU A OE1  11 
ATOM 10970 O OE2  . GLU A 1 44  ? 27.657 33.295 16.946 1.00 0.00 ? 14 GLU A OE2  11 
ATOM 10971 H H    . GLU A 1 44  ? 31.330 32.065 18.816 1.00 0.00 ? 14 GLU A H    11 
ATOM 10972 H HA   . GLU A 1 44  ? 28.899 30.644 18.833 1.00 0.00 ? 14 GLU A HA   11 
ATOM 10973 H HB2  . GLU A 1 44  ? 31.182 30.555 16.847 1.00 0.00 ? 14 GLU A HB2  11 
ATOM 10974 H HB3  . GLU A 1 44  ? 29.579 29.871 16.566 1.00 0.00 ? 14 GLU A HB3  11 
ATOM 10975 H HG2  . GLU A 1 44  ? 30.149 32.780 17.194 1.00 0.00 ? 14 GLU A HG2  11 
ATOM 10976 H HG3  . GLU A 1 44  ? 29.796 32.141 15.595 1.00 0.00 ? 14 GLU A HG3  11 
ATOM 10977 N N    . GLY A 1 45  ? 31.601 28.806 19.204 1.00 0.00 ? 15 GLY A N    11 
ATOM 10978 C CA   . GLY A 1 45  ? 32.054 27.490 19.635 1.00 0.00 ? 15 GLY A CA   11 
ATOM 10979 C C    . GLY A 1 45  ? 31.441 27.116 20.978 1.00 0.00 ? 15 GLY A C    11 
ATOM 10980 O O    . GLY A 1 45  ? 30.965 25.994 21.157 1.00 0.00 ? 15 GLY A O    11 
ATOM 10981 H H    . GLY A 1 45  ? 32.258 29.511 19.034 1.00 0.00 ? 15 GLY A H    11 
ATOM 10982 H HA2  . GLY A 1 45  ? 31.768 26.759 18.895 1.00 0.00 ? 15 GLY A HA2  11 
ATOM 10983 H HA3  . GLY A 1 45  ? 33.130 27.499 19.730 1.00 0.00 ? 15 GLY A HA3  11 
ATOM 10984 N N    . ASN A 1 46  ? 31.424 28.067 21.910 1.00 0.00 ? 16 ASN A N    11 
ATOM 10985 C CA   . ASN A 1 46  ? 30.853 27.802 23.226 1.00 0.00 ? 16 ASN A CA   11 
ATOM 10986 C C    . ASN A 1 46  ? 29.372 27.450 23.120 1.00 0.00 ? 16 ASN A C    11 
ATOM 10987 O O    . ASN A 1 46  ? 28.908 26.514 23.774 1.00 0.00 ? 16 ASN A O    11 
ATOM 10988 C CB   . ASN A 1 46  ? 31.023 29.030 24.124 1.00 0.00 ? 16 ASN A CB   11 
ATOM 10989 C CG   . ASN A 1 46  ? 32.504 29.305 24.373 1.00 0.00 ? 16 ASN A CG   11 
ATOM 10990 O OD1  . ASN A 1 46  ? 33.338 28.408 24.241 1.00 0.00 ? 16 ASN A OD1  11 
ATOM 10991 N ND2  . ASN A 1 46  ? 32.883 30.502 24.727 1.00 0.00 ? 16 ASN A ND2  11 
ATOM 10992 H H    . ASN A 1 46  ? 31.836 28.938 21.724 1.00 0.00 ? 16 ASN A H    11 
ATOM 10993 H HA   . ASN A 1 46  ? 31.379 26.971 23.673 1.00 0.00 ? 16 ASN A HA   11 
ATOM 10994 H HB2  . ASN A 1 46  ? 30.576 29.888 23.644 1.00 0.00 ? 16 ASN A HB2  11 
ATOM 10995 H HB3  . ASN A 1 46  ? 30.530 28.851 25.069 1.00 0.00 ? 16 ASN A HB3  11 
ATOM 10996 H HD21 . ASN A 1 46  ? 32.218 31.215 24.833 1.00 0.00 ? 16 ASN A HD21 11 
ATOM 10997 H HD22 . ASN A 1 46  ? 33.831 30.688 24.890 1.00 0.00 ? 16 ASN A HD22 11 
ATOM 10998 N N    . LYS A 1 47  ? 28.639 28.164 22.266 1.00 0.00 ? 17 LYS A N    11 
ATOM 10999 C CA   . LYS A 1 47  ? 27.223 27.855 22.070 1.00 0.00 ? 17 LYS A CA   11 
ATOM 11000 C C    . LYS A 1 47  ? 27.041 26.447 21.509 1.00 0.00 ? 17 LYS A C    11 
ATOM 11001 O O    . LYS A 1 47  ? 26.204 25.683 22.000 1.00 0.00 ? 17 LYS A O    11 
ATOM 11002 C CB   . LYS A 1 47  ? 26.578 28.870 21.122 1.00 0.00 ? 17 LYS A CB   11 
ATOM 11003 C CG   . LYS A 1 47  ? 26.720 30.288 21.684 1.00 0.00 ? 17 LYS A CG   11 
ATOM 11004 C CD   . LYS A 1 47  ? 25.932 30.421 22.990 1.00 0.00 ? 17 LYS A CD   11 
ATOM 11005 C CE   . LYS A 1 47  ? 25.909 31.890 23.421 1.00 0.00 ? 17 LYS A CE   11 
ATOM 11006 N NZ   . LYS A 1 47  ? 25.152 32.690 22.417 1.00 0.00 ? 17 LYS A NZ   11 
ATOM 11007 H H    . LYS A 1 47  ? 29.044 28.924 21.794 1.00 0.00 ? 17 LYS A H    11 
ATOM 11008 H HA   . LYS A 1 47  ? 26.724 27.906 23.025 1.00 0.00 ? 17 LYS A HA   11 
ATOM 11009 H HB2  . LYS A 1 47  ? 27.062 28.817 20.159 1.00 0.00 ? 17 LYS A HB2  11 
ATOM 11010 H HB3  . LYS A 1 47  ? 25.529 28.636 21.010 1.00 0.00 ? 17 LYS A HB3  11 
ATOM 11011 H HG2  . LYS A 1 47  ? 27.762 30.492 21.876 1.00 0.00 ? 17 LYS A HG2  11 
ATOM 11012 H HG3  . LYS A 1 47  ? 26.341 30.999 20.965 1.00 0.00 ? 17 LYS A HG3  11 
ATOM 11013 H HD2  . LYS A 1 47  ? 24.922 30.072 22.838 1.00 0.00 ? 17 LYS A HD2  11 
ATOM 11014 H HD3  . LYS A 1 47  ? 26.406 29.835 23.762 1.00 0.00 ? 17 LYS A HD3  11 
ATOM 11015 H HE2  . LYS A 1 47  ? 25.429 31.974 24.384 1.00 0.00 ? 17 LYS A HE2  11 
ATOM 11016 H HE3  . LYS A 1 47  ? 26.921 32.262 23.488 1.00 0.00 ? 17 LYS A HE3  11 
ATOM 11017 H HZ1  . LYS A 1 47  ? 24.394 32.107 22.008 1.00 0.00 ? 17 LYS A HZ1  11 
ATOM 11018 H HZ2  . LYS A 1 47  ? 25.798 32.999 21.663 1.00 0.00 ? 17 LYS A HZ2  11 
ATOM 11019 H HZ3  . LYS A 1 47  ? 24.734 33.522 22.880 1.00 0.00 ? 17 LYS A HZ3  11 
ATOM 11020 N N    . ALA A 1 48  ? 27.853 26.085 20.516 1.00 0.00 ? 18 ALA A N    11 
ATOM 11021 C CA   . ALA A 1 48  ? 27.736 24.761 19.920 1.00 0.00 ? 18 ALA A CA   11 
ATOM 11022 C C    . ALA A 1 48  ? 27.983 23.686 20.972 1.00 0.00 ? 18 ALA A C    11 
ATOM 11023 O O    . ALA A 1 48  ? 27.272 22.683 21.017 1.00 0.00 ? 18 ALA A O    11 
ATOM 11024 C CB   . ALA A 1 48  ? 28.729 24.602 18.768 1.00 0.00 ? 18 ALA A CB   11 
ATOM 11025 H H    . ALA A 1 48  ? 28.519 26.717 20.169 1.00 0.00 ? 18 ALA A H    11 
ATOM 11026 H HA   . ALA A 1 48  ? 26.734 24.643 19.533 1.00 0.00 ? 18 ALA A HA   11 
ATOM 11027 H HB1  . ALA A 1 48  ? 29.687 24.295 19.157 1.00 0.00 ? 18 ALA A HB1  11 
ATOM 11028 H HB2  . ALA A 1 48  ? 28.835 25.545 18.252 1.00 0.00 ? 18 ALA A HB2  11 
ATOM 11029 H HB3  . ALA A 1 48  ? 28.363 23.855 18.078 1.00 0.00 ? 18 ALA A HB3  11 
ATOM 11030 N N    . LEU A 1 49  ? 28.992 23.894 21.815 1.00 0.00 ? 19 LEU A N    11 
ATOM 11031 C CA   . LEU A 1 49  ? 29.252 22.962 22.906 1.00 0.00 ? 19 LEU A CA   11 
ATOM 11032 C C    . LEU A 1 49  ? 28.059 22.888 23.854 1.00 0.00 ? 19 LEU A C    11 
ATOM 11033 O O    . LEU A 1 49  ? 27.650 21.803 24.265 1.00 0.00 ? 19 LEU A O    11 
ATOM 11034 C CB   . LEU A 1 49  ? 30.498 23.402 23.679 1.00 0.00 ? 19 LEU A CB   11 
ATOM 11035 C CG   . LEU A 1 49  ? 30.858 22.346 24.728 1.00 0.00 ? 19 LEU A CG   11 
ATOM 11036 C CD1  . LEU A 1 49  ? 31.401 21.098 24.031 1.00 0.00 ? 19 LEU A CD1  11 
ATOM 11037 C CD2  . LEU A 1 49  ? 31.925 22.909 25.668 1.00 0.00 ? 19 LEU A CD2  11 
ATOM 11038 H H    . LEU A 1 49  ? 29.580 24.668 21.687 1.00 0.00 ? 19 LEU A H    11 
ATOM 11039 H HA   . LEU A 1 49  ? 29.431 21.981 22.491 1.00 0.00 ? 19 LEU A HA   11 
ATOM 11040 H HB2  . LEU A 1 49  ? 31.322 23.523 22.992 1.00 0.00 ? 19 LEU A HB2  11 
ATOM 11041 H HB3  . LEU A 1 49  ? 30.301 24.342 24.173 1.00 0.00 ? 19 LEU A HB3  11 
ATOM 11042 H HG   . LEU A 1 49  ? 29.977 22.087 25.295 1.00 0.00 ? 19 LEU A HG   11 
ATOM 11043 H HD11 . LEU A 1 49  ? 32.009 21.392 23.187 1.00 0.00 ? 19 LEU A HD11 11 
ATOM 11044 H HD12 . LEU A 1 49  ? 30.578 20.489 23.687 1.00 0.00 ? 19 LEU A HD12 11 
ATOM 11045 H HD13 . LEU A 1 49  ? 32.002 20.531 24.727 1.00 0.00 ? 19 LEU A HD13 11 
ATOM 11046 H HD21 . LEU A 1 49  ? 32.784 23.221 25.091 1.00 0.00 ? 19 LEU A HD21 11 
ATOM 11047 H HD22 . LEU A 1 49  ? 32.223 22.147 26.372 1.00 0.00 ? 19 LEU A HD22 11 
ATOM 11048 H HD23 . LEU A 1 49  ? 31.524 23.757 26.202 1.00 0.00 ? 19 LEU A HD23 11 
ATOM 11049 N N    . SER A 1 50  ? 27.442 24.036 24.126 1.00 0.00 ? 20 SER A N    11 
ATOM 11050 C CA   . SER A 1 50  ? 26.313 24.081 25.051 1.00 0.00 ? 20 SER A CA   11 
ATOM 11051 C C    . SER A 1 50  ? 25.156 23.206 24.574 1.00 0.00 ? 20 SER A C    11 
ATOM 11052 O O    . SER A 1 50  ? 24.451 22.606 25.385 1.00 0.00 ? 20 SER A O    11 
ATOM 11053 C CB   . SER A 1 50  ? 25.829 25.523 25.206 1.00 0.00 ? 20 SER A CB   11 
ATOM 11054 O OG   . SER A 1 50  ? 26.921 26.342 25.600 1.00 0.00 ? 20 SER A OG   11 
ATOM 11055 H H    . SER A 1 50  ? 27.780 24.869 23.737 1.00 0.00 ? 20 SER A H    11 
ATOM 11056 H HA   . SER A 1 50  ? 26.642 23.724 26.016 1.00 0.00 ? 20 SER A HA   11 
ATOM 11057 H HB2  . SER A 1 50  ? 25.443 25.880 24.265 1.00 0.00 ? 20 SER A HB2  11 
ATOM 11058 H HB3  . SER A 1 50  ? 25.044 25.559 25.948 1.00 0.00 ? 20 SER A HB3  11 
ATOM 11059 H HG   . SER A 1 50  ? 27.131 26.135 26.451 1.00 0.00 ? 20 SER A HG   11 
ATOM 11060 N N    . VAL A 1 51  ? 24.960 23.137 23.261 1.00 0.00 ? 21 VAL A N    11 
ATOM 11061 C CA   . VAL A 1 51  ? 23.898 22.299 22.703 1.00 0.00 ? 21 VAL A CA   11 
ATOM 11062 C C    . VAL A 1 51  ? 24.331 20.847 22.453 1.00 0.00 ? 21 VAL A C    11 
ATOM 11063 O O    . VAL A 1 51  ? 23.532 20.052 21.955 1.00 0.00 ? 21 VAL A O    11 
ATOM 11064 C CB   . VAL A 1 51  ? 23.389 22.909 21.395 1.00 0.00 ? 21 VAL A CB   11 
ATOM 11065 C CG1  . VAL A 1 51  ? 22.861 24.319 21.664 1.00 0.00 ? 21 VAL A CG1  11 
ATOM 11066 C CG2  . VAL A 1 51  ? 24.533 22.983 20.383 1.00 0.00 ? 21 VAL A CG2  11 
ATOM 11067 H H    . VAL A 1 51  ? 25.499 23.703 22.665 1.00 0.00 ? 21 VAL A H    11 
ATOM 11068 H HA   . VAL A 1 51  ? 23.078 22.288 23.405 1.00 0.00 ? 21 VAL A HA   11 
ATOM 11069 H HB   . VAL A 1 51  ? 22.593 22.297 20.999 1.00 0.00 ? 21 VAL A HB   11 
ATOM 11070 H HG11 . VAL A 1 51  ? 23.691 24.992 21.821 1.00 0.00 ? 21 VAL A HG11 11 
ATOM 11071 H HG12 . VAL A 1 51  ? 22.235 24.308 22.544 1.00 0.00 ? 21 VAL A HG12 11 
ATOM 11072 H HG13 . VAL A 1 51  ? 22.282 24.655 20.816 1.00 0.00 ? 21 VAL A HG13 11 
ATOM 11073 H HG21 . VAL A 1 51  ? 25.242 23.734 20.696 1.00 0.00 ? 21 VAL A HG21 11 
ATOM 11074 H HG22 . VAL A 1 51  ? 24.138 23.245 19.412 1.00 0.00 ? 21 VAL A HG22 11 
ATOM 11075 H HG23 . VAL A 1 51  ? 25.027 22.024 20.323 1.00 0.00 ? 21 VAL A HG23 11 
ATOM 11076 N N    . GLY A 1 52  ? 25.573 20.488 22.787 1.00 0.00 ? 22 GLY A N    11 
ATOM 11077 C CA   . GLY A 1 52  ? 26.064 19.133 22.523 1.00 0.00 ? 22 GLY A CA   11 
ATOM 11078 C C    . GLY A 1 52  ? 26.658 18.970 21.117 1.00 0.00 ? 22 GLY A C    11 
ATOM 11079 O O    . GLY A 1 52  ? 26.927 17.847 20.689 1.00 0.00 ? 22 GLY A O    11 
ATOM 11080 H H    . GLY A 1 52  ? 26.158 21.128 23.242 1.00 0.00 ? 22 GLY A H    11 
ATOM 11081 H HA2  . GLY A 1 52  ? 26.826 18.894 23.251 1.00 0.00 ? 22 GLY A HA2  11 
ATOM 11082 H HA3  . GLY A 1 52  ? 25.245 18.439 22.637 1.00 0.00 ? 22 GLY A HA3  11 
ATOM 11083 N N    . ASN A 1 53  ? 26.864 20.073 20.395 1.00 0.00 ? 23 ASN A N    11 
ATOM 11084 C CA   . ASN A 1 53  ? 27.393 20.014 19.039 1.00 0.00 ? 23 ASN A CA   11 
ATOM 11085 C C    . ASN A 1 53  ? 28.906 20.235 19.045 1.00 0.00 ? 23 ASN A C    11 
ATOM 11086 O O    . ASN A 1 53  ? 29.414 21.246 18.549 1.00 0.00 ? 23 ASN A O    11 
ATOM 11087 C CB   . ASN A 1 53  ? 26.697 21.077 18.186 1.00 0.00 ? 23 ASN A CB   11 
ATOM 11088 C CG   . ASN A 1 53  ? 26.972 20.830 16.709 1.00 0.00 ? 23 ASN A CG   11 
ATOM 11089 O OD1  . ASN A 1 53  ? 27.994 20.243 16.354 1.00 0.00 ? 23 ASN A OD1  11 
ATOM 11090 N ND2  . ASN A 1 53  ? 26.115 21.258 15.822 1.00 0.00 ? 23 ASN A ND2  11 
ATOM 11091 H H    . ASN A 1 53  ? 26.668 20.946 20.791 1.00 0.00 ? 23 ASN A H    11 
ATOM 11092 H HA   . ASN A 1 53  ? 27.183 19.040 18.622 1.00 0.00 ? 23 ASN A HA   11 
ATOM 11093 H HB2  . ASN A 1 53  ? 25.633 21.037 18.364 1.00 0.00 ? 23 ASN A HB2  11 
ATOM 11094 H HB3  . ASN A 1 53  ? 27.070 22.054 18.459 1.00 0.00 ? 23 ASN A HB3  11 
ATOM 11095 H HD21 . ASN A 1 53  ? 25.312 21.737 16.112 1.00 0.00 ? 23 ASN A HD21 11 
ATOM 11096 H HD22 . ASN A 1 53  ? 26.274 21.096 14.869 1.00 0.00 ? 23 ASN A HD22 11 
ATOM 11097 N N    . ILE A 1 54  ? 29.633 19.262 19.584 1.00 0.00 ? 24 ILE A N    11 
ATOM 11098 C CA   . ILE A 1 54  ? 31.079 19.404 19.732 1.00 0.00 ? 24 ILE A CA   11 
ATOM 11099 C C    . ILE A 1 54  ? 31.752 19.537 18.364 1.00 0.00 ? 24 ILE A C    11 
ATOM 11100 O O    . ILE A 1 54  ? 32.705 20.302 18.218 1.00 0.00 ? 24 ILE A O    11 
ATOM 11101 C CB   . ILE A 1 54  ? 31.650 18.192 20.481 1.00 0.00 ? 24 ILE A CB   11 
ATOM 11102 C CG1  . ILE A 1 54  ? 30.959 18.053 21.841 1.00 0.00 ? 24 ILE A CG1  11 
ATOM 11103 C CG2  . ILE A 1 54  ? 33.154 18.375 20.711 1.00 0.00 ? 24 ILE A CG2  11 
ATOM 11104 C CD1  . ILE A 1 54  ? 31.389 16.742 22.504 1.00 0.00 ? 24 ILE A CD1  11 
ATOM 11105 H H    . ILE A 1 54  ? 29.194 18.439 19.885 1.00 0.00 ? 24 ILE A H    11 
ATOM 11106 H HA   . ILE A 1 54  ? 31.283 20.294 20.307 1.00 0.00 ? 24 ILE A HA   11 
ATOM 11107 H HB   . ILE A 1 54  ? 31.482 17.297 19.900 1.00 0.00 ? 24 ILE A HB   11 
ATOM 11108 H HG12 . ILE A 1 54  ? 31.238 18.885 22.472 1.00 0.00 ? 24 ILE A HG12 11 
ATOM 11109 H HG13 . ILE A 1 54  ? 29.888 18.048 21.703 1.00 0.00 ? 24 ILE A HG13 11 
ATOM 11110 H HG21 . ILE A 1 54  ? 33.316 19.206 21.381 1.00 0.00 ? 24 ILE A HG21 11 
ATOM 11111 H HG22 . ILE A 1 54  ? 33.640 18.573 19.767 1.00 0.00 ? 24 ILE A HG22 11 
ATOM 11112 H HG23 . ILE A 1 54  ? 33.564 17.475 21.146 1.00 0.00 ? 24 ILE A HG23 11 
ATOM 11113 H HD11 . ILE A 1 54  ? 30.767 16.554 23.365 1.00 0.00 ? 24 ILE A HD11 11 
ATOM 11114 H HD12 . ILE A 1 54  ? 32.421 16.817 22.813 1.00 0.00 ? 24 ILE A HD12 11 
ATOM 11115 H HD13 . ILE A 1 54  ? 31.283 15.932 21.798 1.00 0.00 ? 24 ILE A HD13 11 
ATOM 11116 N N    . ASP A 1 55  ? 31.235 18.832 17.358 1.00 0.00 ? 25 ASP A N    11 
ATOM 11117 C CA   . ASP A 1 55  ? 31.845 18.873 16.034 1.00 0.00 ? 25 ASP A CA   11 
ATOM 11118 C C    . ASP A 1 55  ? 31.832 20.293 15.476 1.00 0.00 ? 25 ASP A C    11 
ATOM 11119 O O    . ASP A 1 55  ? 32.863 20.807 15.036 1.00 0.00 ? 25 ASP A O    11 
ATOM 11120 C CB   . ASP A 1 55  ? 31.089 17.942 15.083 1.00 0.00 ? 25 ASP A CB   11 
ATOM 11121 C CG   . ASP A 1 55  ? 31.224 16.490 15.537 1.00 0.00 ? 25 ASP A CG   11 
ATOM 11122 O OD1  . ASP A 1 55  ? 32.248 16.154 16.109 1.00 0.00 ? 25 ASP A OD1  11 
ATOM 11123 O OD2  . ASP A 1 55  ? 30.296 15.732 15.304 1.00 0.00 ? 25 ASP A OD2  11 
ATOM 11124 H H    . ASP A 1 55  ? 30.439 18.281 17.510 1.00 0.00 ? 25 ASP A H    11 
ATOM 11125 H HA   . ASP A 1 55  ? 32.868 18.536 16.109 1.00 0.00 ? 25 ASP A HA   11 
ATOM 11126 H HB2  . ASP A 1 55  ? 30.045 18.216 15.070 1.00 0.00 ? 25 ASP A HB2  11 
ATOM 11127 H HB3  . ASP A 1 55  ? 31.497 18.043 14.087 1.00 0.00 ? 25 ASP A HB3  11 
ATOM 11128 N N    . ASP A 1 56  ? 30.678 20.952 15.552 1.00 0.00 ? 26 ASP A N    11 
ATOM 11129 C CA   . ASP A 1 56  ? 30.566 22.317 15.053 1.00 0.00 ? 26 ASP A CA   11 
ATOM 11130 C C    . ASP A 1 56  ? 31.464 23.259 15.847 1.00 0.00 ? 26 ASP A C    11 
ATOM 11131 O O    . ASP A 1 56  ? 32.116 24.132 15.271 1.00 0.00 ? 26 ASP A O    11 
ATOM 11132 C CB   . ASP A 1 56  ? 29.114 22.802 15.128 1.00 0.00 ? 26 ASP A CB   11 
ATOM 11133 C CG   . ASP A 1 56  ? 28.246 22.139 14.054 1.00 0.00 ? 26 ASP A CG   11 
ATOM 11134 O OD1  . ASP A 1 56  ? 27.159 22.642 13.822 1.00 0.00 ? 26 ASP A OD1  11 
ATOM 11135 O OD2  . ASP A 1 56  ? 28.660 21.139 13.488 1.00 0.00 ? 26 ASP A OD2  11 
ATOM 11136 H H    . ASP A 1 56  ? 29.890 20.510 15.933 1.00 0.00 ? 26 ASP A H    11 
ATOM 11137 H HA   . ASP A 1 56  ? 30.880 22.333 14.020 1.00 0.00 ? 26 ASP A HA   11 
ATOM 11138 H HB2  . ASP A 1 56  ? 28.712 22.563 16.102 1.00 0.00 ? 26 ASP A HB2  11 
ATOM 11139 H HB3  . ASP A 1 56  ? 29.091 23.873 14.991 1.00 0.00 ? 26 ASP A HB3  11 
ATOM 11140 N N    . ALA A 1 57  ? 31.539 23.049 17.161 1.00 0.00 ? 27 ALA A N    11 
ATOM 11141 C CA   . ALA A 1 57  ? 32.370 23.906 17.998 1.00 0.00 ? 27 ALA A CA   11 
ATOM 11142 C C    . ALA A 1 57  ? 33.828 23.822 17.551 1.00 0.00 ? 27 ALA A C    11 
ATOM 11143 O O    . ALA A 1 57  ? 34.501 24.844 17.398 1.00 0.00 ? 27 ALA A O    11 
ATOM 11144 C CB   . ALA A 1 57  ? 32.253 23.475 19.463 1.00 0.00 ? 27 ALA A CB   11 
ATOM 11145 H H    . ALA A 1 57  ? 30.999 22.341 17.573 1.00 0.00 ? 27 ALA A H    11 
ATOM 11146 H HA   . ALA A 1 57  ? 32.027 24.927 17.906 1.00 0.00 ? 27 ALA A HA   11 
ATOM 11147 H HB1  . ALA A 1 57  ? 32.358 24.338 20.102 1.00 0.00 ? 27 ALA A HB1  11 
ATOM 11148 H HB2  . ALA A 1 57  ? 33.027 22.758 19.696 1.00 0.00 ? 27 ALA A HB2  11 
ATOM 11149 H HB3  . ALA A 1 57  ? 31.286 23.022 19.628 1.00 0.00 ? 27 ALA A HB3  11 
ATOM 11150 N N    . LEU A 1 58  ? 34.302 22.602 17.301 1.00 0.00 ? 28 LEU A N    11 
ATOM 11151 C CA   . LEU A 1 58  ? 35.669 22.419 16.825 1.00 0.00 ? 28 LEU A CA   11 
ATOM 11152 C C    . LEU A 1 58  ? 35.886 23.134 15.494 1.00 0.00 ? 28 LEU A C    11 
ATOM 11153 O O    . LEU A 1 58  ? 36.930 23.754 15.286 1.00 0.00 ? 28 LEU A O    11 
ATOM 11154 C CB   . LEU A 1 58  ? 35.974 20.928 16.658 1.00 0.00 ? 28 LEU A CB   11 
ATOM 11155 C CG   . LEU A 1 58  ? 35.917 20.231 18.020 1.00 0.00 ? 28 LEU A CG   11 
ATOM 11156 C CD1  . LEU A 1 58  ? 36.017 18.718 17.820 1.00 0.00 ? 28 LEU A CD1  11 
ATOM 11157 C CD2  . LEU A 1 58  ? 37.088 20.702 18.886 1.00 0.00 ? 28 LEU A CD2  11 
ATOM 11158 H H    . LEU A 1 58  ? 33.736 21.819 17.462 1.00 0.00 ? 28 LEU A H    11 
ATOM 11159 H HA   . LEU A 1 58  ? 36.349 22.832 17.553 1.00 0.00 ? 28 LEU A HA   11 
ATOM 11160 H HB2  . LEU A 1 58  ? 35.244 20.485 15.996 1.00 0.00 ? 28 LEU A HB2  11 
ATOM 11161 H HB3  . LEU A 1 58  ? 36.961 20.809 16.238 1.00 0.00 ? 28 LEU A HB3  11 
ATOM 11162 H HG   . LEU A 1 58  ? 34.985 20.470 18.509 1.00 0.00 ? 28 LEU A HG   11 
ATOM 11163 H HD11 . LEU A 1 58  ? 36.105 18.234 18.782 1.00 0.00 ? 28 LEU A HD11 11 
ATOM 11164 H HD12 . LEU A 1 58  ? 36.887 18.490 17.222 1.00 0.00 ? 28 LEU A HD12 11 
ATOM 11165 H HD13 . LEU A 1 58  ? 35.130 18.362 17.317 1.00 0.00 ? 28 LEU A HD13 11 
ATOM 11166 H HD21 . LEU A 1 58  ? 37.281 19.972 19.657 1.00 0.00 ? 28 LEU A HD21 11 
ATOM 11167 H HD22 . LEU A 1 58  ? 36.840 21.650 19.341 1.00 0.00 ? 28 LEU A HD22 11 
ATOM 11168 H HD23 . LEU A 1 58  ? 37.967 20.818 18.270 1.00 0.00 ? 28 LEU A HD23 11 
ATOM 11169 N N    . GLN A 1 59  ? 34.891 23.080 14.609 1.00 0.00 ? 29 GLN A N    11 
ATOM 11170 C CA   . GLN A 1 59  ? 35.017 23.747 13.315 1.00 0.00 ? 29 GLN A CA   11 
ATOM 11171 C C    . GLN A 1 59  ? 35.208 25.252 13.483 1.00 0.00 ? 29 GLN A C    11 
ATOM 11172 O O    . GLN A 1 59  ? 36.091 25.840 12.855 1.00 0.00 ? 29 GLN A O    11 
ATOM 11173 C CB   . GLN A 1 59  ? 33.775 23.484 12.461 1.00 0.00 ? 29 GLN A CB   11 
ATOM 11174 C CG   . GLN A 1 59  ? 33.710 22.000 12.091 1.00 0.00 ? 29 GLN A CG   11 
ATOM 11175 C CD   . GLN A 1 59  ? 32.427 21.694 11.322 1.00 0.00 ? 29 GLN A CD   11 
ATOM 11176 O OE1  . GLN A 1 59  ? 31.469 22.467 11.362 1.00 0.00 ? 29 GLN A OE1  11 
ATOM 11177 N NE2  . GLN A 1 59  ? 32.351 20.599 10.615 1.00 0.00 ? 29 GLN A NE2  11 
ATOM 11178 H H    . GLN A 1 59  ? 34.091 22.548 14.809 1.00 0.00 ? 29 GLN A H    11 
ATOM 11179 H HA   . GLN A 1 59  ? 35.877 23.344 12.803 1.00 0.00 ? 29 GLN A HA   11 
ATOM 11180 H HB2  . GLN A 1 59  ? 32.890 23.755 13.021 1.00 0.00 ? 29 GLN A HB2  11 
ATOM 11181 H HB3  . GLN A 1 59  ? 33.826 24.075 11.560 1.00 0.00 ? 29 GLN A HB3  11 
ATOM 11182 H HG2  . GLN A 1 59  ? 34.562 21.751 11.476 1.00 0.00 ? 29 GLN A HG2  11 
ATOM 11183 H HG3  . GLN A 1 59  ? 33.737 21.405 12.992 1.00 0.00 ? 29 GLN A HG3  11 
ATOM 11184 H HE21 . GLN A 1 59  ? 33.113 19.984 10.582 1.00 0.00 ? 29 GLN A HE21 11 
ATOM 11185 H HE22 . GLN A 1 59  ? 31.532 20.393 10.119 1.00 0.00 ? 29 GLN A HE22 11 
ATOM 11186 N N    . TYR A 1 60  ? 34.411 25.869 14.355 1.00 0.00 ? 30 TYR A N    11 
ATOM 11187 C CA   . TYR A 1 60  ? 34.563 27.298 14.611 1.00 0.00 ? 30 TYR A CA   11 
ATOM 11188 C C    . TYR A 1 60  ? 35.955 27.608 15.153 1.00 0.00 ? 30 TYR A C    11 
ATOM 11189 O O    . TYR A 1 60  ? 36.595 28.566 14.714 1.00 0.00 ? 30 TYR A O    11 
ATOM 11190 C CB   . TYR A 1 60  ? 33.516 27.776 15.620 1.00 0.00 ? 30 TYR A CB   11 
ATOM 11191 C CG   . TYR A 1 60  ? 32.096 27.711 15.109 1.00 0.00 ? 30 TYR A CG   11 
ATOM 11192 C CD1  . TYR A 1 60  ? 31.201 26.777 15.644 1.00 0.00 ? 30 TYR A CD1  11 
ATOM 11193 C CD2  . TYR A 1 60  ? 31.672 28.589 14.104 1.00 0.00 ? 30 TYR A CD2  11 
ATOM 11194 C CE1  . TYR A 1 60  ? 29.883 26.719 15.174 1.00 0.00 ? 30 TYR A CE1  11 
ATOM 11195 C CE2  . TYR A 1 60  ? 30.354 28.531 13.634 1.00 0.00 ? 30 TYR A CE2  11 
ATOM 11196 C CZ   . TYR A 1 60  ? 29.461 27.596 14.168 1.00 0.00 ? 30 TYR A CZ   11 
ATOM 11197 O OH   . TYR A 1 60  ? 28.162 27.540 13.704 1.00 0.00 ? 30 TYR A OH   11 
ATOM 11198 H H    . TYR A 1 60  ? 33.688 25.370 14.790 1.00 0.00 ? 30 TYR A H    11 
ATOM 11199 H HA   . TYR A 1 60  ? 34.421 27.835 13.685 1.00 0.00 ? 30 TYR A HA   11 
ATOM 11200 H HB2  . TYR A 1 60  ? 33.585 27.163 16.505 1.00 0.00 ? 30 TYR A HB2  11 
ATOM 11201 H HB3  . TYR A 1 60  ? 33.745 28.796 15.893 1.00 0.00 ? 30 TYR A HB3  11 
ATOM 11202 H HD1  . TYR A 1 60  ? 31.527 26.100 16.419 1.00 0.00 ? 30 TYR A HD1  11 
ATOM 11203 H HD2  . TYR A 1 60  ? 32.362 29.310 13.690 1.00 0.00 ? 30 TYR A HD2  11 
ATOM 11204 H HE1  . TYR A 1 60  ? 29.194 25.998 15.587 1.00 0.00 ? 30 TYR A HE1  11 
ATOM 11205 H HE2  . TYR A 1 60  ? 30.027 29.207 12.858 1.00 0.00 ? 30 TYR A HE2  11 
ATOM 11206 H HH   . TYR A 1 60  ? 27.618 27.808 14.369 1.00 0.00 ? 30 TYR A HH   11 
ATOM 11207 N N    . TYR A 1 61  ? 36.441 26.776 16.074 1.00 0.00 ? 31 TYR A N    11 
ATOM 11208 C CA   . TYR A 1 61  ? 37.767 26.999 16.643 1.00 0.00 ? 31 TYR A CA   11 
ATOM 11209 C C    . TYR A 1 61  ? 38.848 26.915 15.570 1.00 0.00 ? 31 TYR A C    11 
ATOM 11210 O O    . TYR A 1 61  ? 39.776 27.727 15.551 1.00 0.00 ? 31 TYR A O    11 
ATOM 11211 C CB   . TYR A 1 61  ? 38.052 25.967 17.737 1.00 0.00 ? 31 TYR A CB   11 
ATOM 11212 C CG   . TYR A 1 61  ? 37.124 26.070 18.926 1.00 0.00 ? 31 TYR A CG   11 
ATOM 11213 C CD1  . TYR A 1 61  ? 36.809 27.324 19.465 1.00 0.00 ? 31 TYR A CD1  11 
ATOM 11214 C CD2  . TYR A 1 61  ? 36.581 24.910 19.491 1.00 0.00 ? 31 TYR A CD2  11 
ATOM 11215 C CE1  . TYR A 1 61  ? 35.952 27.416 20.567 1.00 0.00 ? 31 TYR A CE1  11 
ATOM 11216 C CE2  . TYR A 1 61  ? 35.724 25.003 20.593 1.00 0.00 ? 31 TYR A CE2  11 
ATOM 11217 C CZ   . TYR A 1 61  ? 35.409 26.256 21.131 1.00 0.00 ? 31 TYR A CZ   11 
ATOM 11218 O OH   . TYR A 1 61  ? 34.564 26.347 22.220 1.00 0.00 ? 31 TYR A OH   11 
ATOM 11219 H H    . TYR A 1 61  ? 35.890 26.032 16.397 1.00 0.00 ? 31 TYR A H    11 
ATOM 11220 H HA   . TYR A 1 61  ? 37.793 27.983 17.084 1.00 0.00 ? 31 TYR A HA   11 
ATOM 11221 H HB2  . TYR A 1 61  ? 37.956 24.979 17.315 1.00 0.00 ? 31 TYR A HB2  11 
ATOM 11222 H HB3  . TYR A 1 61  ? 39.071 26.098 18.074 1.00 0.00 ? 31 TYR A HB3  11 
ATOM 11223 H HD1  . TYR A 1 61  ? 37.227 28.219 19.029 1.00 0.00 ? 31 TYR A HD1  11 
ATOM 11224 H HD2  . TYR A 1 61  ? 36.826 23.943 19.077 1.00 0.00 ? 31 TYR A HD2  11 
ATOM 11225 H HE1  . TYR A 1 61  ? 35.709 28.383 20.982 1.00 0.00 ? 31 TYR A HE1  11 
ATOM 11226 H HE2  . TYR A 1 61  ? 35.305 24.108 21.029 1.00 0.00 ? 31 TYR A HE2  11 
ATOM 11227 H HH   . TYR A 1 61  ? 34.943 25.902 22.904 1.00 0.00 ? 31 TYR A HH   11 
ATOM 11228 N N    . ALA A 1 62  ? 38.699 25.972 14.642 1.00 0.00 ? 32 ALA A N    11 
ATOM 11229 C CA   . ALA A 1 62  ? 39.679 25.821 13.573 1.00 0.00 ? 32 ALA A CA   11 
ATOM 11230 C C    . ALA A 1 62  ? 39.715 27.069 12.699 1.00 0.00 ? 32 ALA A C    11 
ATOM 11231 O O    . ALA A 1 62  ? 40.788 27.584 12.375 1.00 0.00 ? 32 ALA A O    11 
ATOM 11232 C CB   . ALA A 1 62  ? 39.330 24.605 12.712 1.00 0.00 ? 32 ALA A CB   11 
ATOM 11233 H H    . ALA A 1 62  ? 37.943 25.351 14.699 1.00 0.00 ? 32 ALA A H    11 
ATOM 11234 H HA   . ALA A 1 62  ? 40.655 25.670 14.010 1.00 0.00 ? 32 ALA A HA   11 
ATOM 11235 H HB1  . ALA A 1 62  ? 39.735 23.713 13.168 1.00 0.00 ? 32 ALA A HB1  11 
ATOM 11236 H HB2  . ALA A 1 62  ? 39.752 24.728 11.726 1.00 0.00 ? 32 ALA A HB2  11 
ATOM 11237 H HB3  . ALA A 1 62  ? 38.257 24.515 12.636 1.00 0.00 ? 32 ALA A HB3  11 
ATOM 11238 N N    . ALA A 1 63  ? 38.535 27.582 12.362 1.00 0.00 ? 33 ALA A N    11 
ATOM 11239 C CA   . ALA A 1 63  ? 38.459 28.792 11.553 1.00 0.00 ? 33 ALA A CA   11 
ATOM 11240 C C    . ALA A 1 63  ? 39.086 29.974 12.286 1.00 0.00 ? 33 ALA A C    11 
ATOM 11241 O O    . ALA A 1 63  ? 39.786 30.783 11.679 1.00 0.00 ? 33 ALA A O    11 
ATOM 11242 C CB   . ALA A 1 63  ? 36.999 29.110 11.226 1.00 0.00 ? 33 ALA A CB   11 
ATOM 11243 H H    . ALA A 1 63  ? 37.710 27.127 12.634 1.00 0.00 ? 33 ALA A H    11 
ATOM 11244 H HA   . ALA A 1 63  ? 38.994 28.629 10.629 1.00 0.00 ? 33 ALA A HA   11 
ATOM 11245 H HB1  . ALA A 1 63  ? 36.903 30.158 10.986 1.00 0.00 ? 33 ALA A HB1  11 
ATOM 11246 H HB2  . ALA A 1 63  ? 36.379 28.877 12.080 1.00 0.00 ? 33 ALA A HB2  11 
ATOM 11247 H HB3  . ALA A 1 63  ? 36.682 28.517 10.379 1.00 0.00 ? 33 ALA A HB3  11 
ATOM 11248 N N    . ALA A 1 64  ? 38.868 30.051 13.596 1.00 0.00 ? 34 ALA A N    11 
ATOM 11249 C CA   . ALA A 1 64  ? 39.420 31.150 14.381 1.00 0.00 ? 34 ALA A CA   11 
ATOM 11250 C C    . ALA A 1 64  ? 40.946 31.154 14.324 1.00 0.00 ? 34 ALA A C    11 
ATOM 11251 O O    . ALA A 1 64  ? 41.559 32.199 14.091 1.00 0.00 ? 34 ALA A O    11 
ATOM 11252 C CB   . ALA A 1 64  ? 38.933 31.043 15.833 1.00 0.00 ? 34 ALA A CB   11 
ATOM 11253 H H    . ALA A 1 64  ? 38.298 29.384 14.033 1.00 0.00 ? 34 ALA A H    11 
ATOM 11254 H HA   . ALA A 1 64  ? 39.064 32.081 13.967 1.00 0.00 ? 34 ALA A HA   11 
ATOM 11255 H HB1  . ALA A 1 64  ? 38.647 32.023 16.186 1.00 0.00 ? 34 ALA A HB1  11 
ATOM 11256 H HB2  . ALA A 1 64  ? 39.718 30.650 16.463 1.00 0.00 ? 34 ALA A HB2  11 
ATOM 11257 H HB3  . ALA A 1 64  ? 38.078 30.386 15.878 1.00 0.00 ? 34 ALA A HB3  11 
ATOM 11258 N N    . ILE A 1 65  ? 41.556 29.981 14.486 1.00 0.00 ? 35 ILE A N    11 
ATOM 11259 C CA   . ILE A 1 65  ? 43.011 29.892 14.417 1.00 0.00 ? 35 ILE A CA   11 
ATOM 11260 C C    . ILE A 1 65  ? 43.503 30.327 13.039 1.00 0.00 ? 35 ILE A C    11 
ATOM 11261 O O    . ILE A 1 65  ? 44.471 31.083 12.931 1.00 0.00 ? 35 ILE A O    11 
ATOM 11262 C CB   . ILE A 1 65  ? 43.465 28.459 14.722 1.00 0.00 ? 35 ILE A CB   11 
ATOM 11263 C CG1  . ILE A 1 65  ? 42.977 28.062 16.116 1.00 0.00 ? 35 ILE A CG1  11 
ATOM 11264 C CG2  . ILE A 1 65  ? 44.995 28.366 14.691 1.00 0.00 ? 35 ILE A CG2  11 
ATOM 11265 C CD1  . ILE A 1 65  ? 43.240 26.573 16.348 1.00 0.00 ? 35 ILE A CD1  11 
ATOM 11266 H H    . ILE A 1 65  ? 41.026 29.178 14.681 1.00 0.00 ? 35 ILE A H    11 
ATOM 11267 H HA   . ILE A 1 65  ? 43.433 30.554 15.159 1.00 0.00 ? 35 ILE A HA   11 
ATOM 11268 H HB   . ILE A 1 65  ? 43.049 27.785 13.988 1.00 0.00 ? 35 ILE A HB   11 
ATOM 11269 H HG12 . ILE A 1 65  ? 43.508 28.641 16.859 1.00 0.00 ? 35 ILE A HG12 11 
ATOM 11270 H HG13 . ILE A 1 65  ? 41.919 28.256 16.198 1.00 0.00 ? 35 ILE A HG13 11 
ATOM 11271 H HG21 . ILE A 1 65  ? 45.360 28.745 13.748 1.00 0.00 ? 35 ILE A HG21 11 
ATOM 11272 H HG22 . ILE A 1 65  ? 45.296 27.334 14.806 1.00 0.00 ? 35 ILE A HG22 11 
ATOM 11273 H HG23 . ILE A 1 65  ? 45.407 28.952 15.499 1.00 0.00 ? 35 ILE A HG23 11 
ATOM 11274 H HD11 . ILE A 1 65  ? 42.851 26.284 17.313 1.00 0.00 ? 35 ILE A HD11 11 
ATOM 11275 H HD12 . ILE A 1 65  ? 44.303 26.385 16.316 1.00 0.00 ? 35 ILE A HD12 11 
ATOM 11276 H HD13 . ILE A 1 65  ? 42.750 25.997 15.576 1.00 0.00 ? 35 ILE A HD13 11 
ATOM 11277 N N    . THR A 1 66  ? 42.821 29.873 11.988 1.00 0.00 ? 36 THR A N    11 
ATOM 11278 C CA   . THR A 1 66  ? 43.218 30.243 10.633 1.00 0.00 ? 36 THR A CA   11 
ATOM 11279 C C    . THR A 1 66  ? 43.142 31.755 10.425 1.00 0.00 ? 36 THR A C    11 
ATOM 11280 O O    . THR A 1 66  ? 44.065 32.361 9.877  1.00 0.00 ? 36 THR A O    11 
ATOM 11281 C CB   . THR A 1 66  ? 42.315 29.544 9.615  1.00 0.00 ? 36 THR A CB   11 
ATOM 11282 O OG1  . THR A 1 66  ? 42.238 28.159 9.925  1.00 0.00 ? 36 THR A OG1  11 
ATOM 11283 C CG2  . THR A 1 66  ? 42.900 29.720 8.214  1.00 0.00 ? 36 THR A CG2  11 
ATOM 11284 H H    . THR A 1 66  ? 42.067 29.259 12.124 1.00 0.00 ? 36 THR A H    11 
ATOM 11285 H HA   . THR A 1 66  ? 44.235 29.921 10.470 1.00 0.00 ? 36 THR A HA   11 
ATOM 11286 H HB   . THR A 1 66  ? 41.327 29.978 9.648  1.00 0.00 ? 36 THR A HB   11 
ATOM 11287 H HG1  . THR A 1 66  ? 41.647 27.780 9.361  1.00 0.00 ? 36 THR A HG1  11 
ATOM 11288 H HG21 . THR A 1 66  ? 43.966 29.554 8.245  1.00 0.00 ? 36 THR A HG21 11 
ATOM 11289 H HG22 . THR A 1 66  ? 42.702 30.723 7.865  1.00 0.00 ? 36 THR A HG22 11 
ATOM 11290 H HG23 . THR A 1 66  ? 42.444 29.009 7.541  1.00 0.00 ? 36 THR A HG23 11 
ATOM 11291 N N    . LEU A 1 67  ? 42.064 32.373 10.904 1.00 0.00 ? 37 LEU A N    11 
ATOM 11292 C CA   . LEU A 1 67  ? 41.908 33.819 10.761 1.00 0.00 ? 37 LEU A CA   11 
ATOM 11293 C C    . LEU A 1 67  ? 43.029 34.573 11.469 1.00 0.00 ? 37 LEU A C    11 
ATOM 11294 O O    . LEU A 1 67  ? 43.458 35.629 11.000 1.00 0.00 ? 37 LEU A O    11 
ATOM 11295 C CB   . LEU A 1 67  ? 40.556 34.268 11.320 1.00 0.00 ? 37 LEU A CB   11 
ATOM 11296 C CG   . LEU A 1 67  ? 39.421 33.703 10.462 1.00 0.00 ? 37 LEU A CG   11 
ATOM 11297 C CD1  . LEU A 1 67  ? 38.081 33.966 11.155 1.00 0.00 ? 37 LEU A CD1  11 
ATOM 11298 C CD2  . LEU A 1 67  ? 39.424 34.387 9.092  1.00 0.00 ? 37 LEU A CD2  11 
ATOM 11299 H H    . LEU A 1 67  ? 41.357 31.851 11.334 1.00 0.00 ? 37 LEU A H    11 
ATOM 11300 H HA   . LEU A 1 67  ? 41.944 34.063 9.710  1.00 0.00 ? 37 LEU A HA   11 
ATOM 11301 H HB2  . LEU A 1 67  ? 40.452 33.912 12.334 1.00 0.00 ? 37 LEU A HB2  11 
ATOM 11302 H HB3  . LEU A 1 67  ? 40.505 35.347 11.312 1.00 0.00 ? 37 LEU A HB3  11 
ATOM 11303 H HG   . LEU A 1 67  ? 39.558 32.640 10.336 1.00 0.00 ? 37 LEU A HG   11 
ATOM 11304 H HD11 . LEU A 1 67  ? 37.354 33.241 10.820 1.00 0.00 ? 37 LEU A HD11 11 
ATOM 11305 H HD12 . LEU A 1 67  ? 37.736 34.960 10.911 1.00 0.00 ? 37 LEU A HD12 11 
ATOM 11306 H HD13 . LEU A 1 67  ? 38.206 33.882 12.224 1.00 0.00 ? 37 LEU A HD13 11 
ATOM 11307 H HD21 . LEU A 1 67  ? 38.438 34.325 8.656  1.00 0.00 ? 37 LEU A HD21 11 
ATOM 11308 H HD22 . LEU A 1 67  ? 40.135 33.895 8.446  1.00 0.00 ? 37 LEU A HD22 11 
ATOM 11309 H HD23 . LEU A 1 67  ? 39.701 35.424 9.210  1.00 0.00 ? 37 LEU A HD23 11 
ATOM 11310 N N    . ASP A 1 68  ? 43.474 34.054 12.610 1.00 0.00 ? 38 ASP A N    11 
ATOM 11311 C CA   . ASP A 1 68  ? 44.612 34.647 13.302 1.00 0.00 ? 38 ASP A CA   11 
ATOM 11312 C C    . ASP A 1 68  ? 45.876 34.536 12.455 1.00 0.00 ? 38 ASP A C    11 
ATOM 11313 O O    . ASP A 1 68  ? 46.608 35.512 12.284 1.00 0.00 ? 38 ASP A O    11 
ATOM 11314 C CB   . ASP A 1 68  ? 44.831 33.942 14.641 1.00 0.00 ? 38 ASP A CB   11 
ATOM 11315 C CG   . ASP A 1 68  ? 45.880 34.685 15.460 1.00 0.00 ? 38 ASP A CG   11 
ATOM 11316 O OD1  . ASP A 1 68  ? 47.040 34.313 15.378 1.00 0.00 ? 38 ASP A OD1  11 
ATOM 11317 O OD2  . ASP A 1 68  ? 45.509 35.615 16.158 1.00 0.00 ? 38 ASP A OD2  11 
ATOM 11318 H H    . ASP A 1 68  ? 43.003 33.293 13.013 1.00 0.00 ? 38 ASP A H    11 
ATOM 11319 H HA   . ASP A 1 68  ? 44.405 35.691 13.488 1.00 0.00 ? 38 ASP A HA   11 
ATOM 11320 H HB2  . ASP A 1 68  ? 43.900 33.918 15.189 1.00 0.00 ? 38 ASP A HB2  11 
ATOM 11321 H HB3  . ASP A 1 68  ? 45.167 32.931 14.464 1.00 0.00 ? 38 ASP A HB3  11 
ATOM 11322 N N    . LYS A 1 69  ? 46.127 33.341 11.928 1.00 0.00 ? 39 LYS A N    11 
ATOM 11323 C CA   . LYS A 1 69  ? 47.304 33.115 11.092 1.00 0.00 ? 39 LYS A CA   11 
ATOM 11324 C C    . LYS A 1 69  ? 47.304 34.007 9.848  1.00 0.00 ? 39 LYS A C    11 
ATOM 11325 O O    . LYS A 1 69  ? 48.369 34.382 9.355  1.00 0.00 ? 39 LYS A O    11 
ATOM 11326 C CB   . LYS A 1 69  ? 47.353 31.645 10.667 1.00 0.00 ? 39 LYS A CB   11 
ATOM 11327 C CG   . LYS A 1 69  ? 48.664 31.358 9.932  1.00 0.00 ? 39 LYS A CG   11 
ATOM 11328 C CD   . LYS A 1 69  ? 48.667 29.909 9.439  1.00 0.00 ? 39 LYS A CD   11 
ATOM 11329 C CE   . LYS A 1 69  ? 50.035 29.574 8.842  1.00 0.00 ? 39 LYS A CE   11 
ATOM 11330 N NZ   . LYS A 1 69  ? 50.019 28.182 8.312  1.00 0.00 ? 39 LYS A NZ   11 
ATOM 11331 H H    . LYS A 1 69  ? 45.524 32.593 12.124 1.00 0.00 ? 39 LYS A H    11 
ATOM 11332 H HA   . LYS A 1 69  ? 48.187 33.331 11.673 1.00 0.00 ? 39 LYS A HA   11 
ATOM 11333 H HB2  . LYS A 1 69  ? 47.286 31.017 11.543 1.00 0.00 ? 39 LYS A HB2  11 
ATOM 11334 H HB3  . LYS A 1 69  ? 46.522 31.433 10.010 1.00 0.00 ? 39 LYS A HB3  11 
ATOM 11335 H HG2  . LYS A 1 69  ? 48.757 32.028 9.088  1.00 0.00 ? 39 LYS A HG2  11 
ATOM 11336 H HG3  . LYS A 1 69  ? 49.494 31.508 10.604 1.00 0.00 ? 39 LYS A HG3  11 
ATOM 11337 H HD2  . LYS A 1 69  ? 48.463 29.248 10.268 1.00 0.00 ? 39 LYS A HD2  11 
ATOM 11338 H HD3  . LYS A 1 69  ? 47.908 29.784 8.683  1.00 0.00 ? 39 LYS A HD3  11 
ATOM 11339 H HE2  . LYS A 1 69  ? 50.256 30.263 8.039  1.00 0.00 ? 39 LYS A HE2  11 
ATOM 11340 H HE3  . LYS A 1 69  ? 50.792 29.659 9.608  1.00 0.00 ? 39 LYS A HE3  11 
ATOM 11341 H HZ1  . LYS A 1 69  ? 50.984 27.796 8.320  1.00 0.00 ? 39 LYS A HZ1  11 
ATOM 11342 H HZ2  . LYS A 1 69  ? 49.655 28.187 7.338  1.00 0.00 ? 39 LYS A HZ2  11 
ATOM 11343 H HZ3  . LYS A 1 69  ? 49.407 27.590 8.909  1.00 0.00 ? 39 LYS A HZ3  11 
ATOM 11344 N N    . TYR A 1 70  ? 46.120 34.347 9.343  1.00 0.00 ? 40 TYR A N    11 
ATOM 11345 C CA   . TYR A 1 70  ? 46.023 35.194 8.157  1.00 0.00 ? 40 TYR A CA   11 
ATOM 11346 C C    . TYR A 1 70  ? 46.729 36.534 8.418  1.00 0.00 ? 40 TYR A C    11 
ATOM 11347 O O    . TYR A 1 70  ? 46.453 37.166 9.440  1.00 0.00 ? 40 TYR A O    11 
ATOM 11348 C CB   . TYR A 1 70  ? 44.539 35.423 7.854  1.00 0.00 ? 40 TYR A CB   11 
ATOM 11349 C CG   . TYR A 1 70  ? 44.222 35.623 6.392  1.00 0.00 ? 40 TYR A CG   11 
ATOM 11350 C CD1  . TYR A 1 70  ? 44.332 34.552 5.497  1.00 0.00 ? 40 TYR A CD1  11 
ATOM 11351 C CD2  . TYR A 1 70  ? 43.782 36.871 5.938  1.00 0.00 ? 40 TYR A CD2  11 
ATOM 11352 C CE1  . TYR A 1 70  ? 44.007 34.731 4.147  1.00 0.00 ? 40 TYR A CE1  11 
ATOM 11353 C CE2  . TYR A 1 70  ? 43.460 37.050 4.588  1.00 0.00 ? 40 TYR A CE2  11 
ATOM 11354 C CZ   . TYR A 1 70  ? 43.572 35.981 3.692  1.00 0.00 ? 40 TYR A CZ   11 
ATOM 11355 O OH   . TYR A 1 70  ? 43.251 36.158 2.362  1.00 0.00 ? 40 TYR A OH   11 
ATOM 11356 H H    . TYR A 1 70  ? 45.304 33.974 9.739  1.00 0.00 ? 40 TYR A H    11 
ATOM 11357 H HA   . TYR A 1 70  ? 46.472 34.669 7.330  1.00 0.00 ? 40 TYR A HA   11 
ATOM 11358 H HB2  . TYR A 1 70  ? 43.978 34.569 8.202  1.00 0.00 ? 40 TYR A HB2  11 
ATOM 11359 H HB3  . TYR A 1 70  ? 44.209 36.292 8.406  1.00 0.00 ? 40 TYR A HB3  11 
ATOM 11360 H HD1  . TYR A 1 70  ? 44.672 33.589 5.848  1.00 0.00 ? 40 TYR A HD1  11 
ATOM 11361 H HD2  . TYR A 1 70  ? 43.694 37.695 6.628  1.00 0.00 ? 40 TYR A HD2  11 
ATOM 11362 H HE1  . TYR A 1 70  ? 44.092 33.904 3.457  1.00 0.00 ? 40 TYR A HE1  11 
ATOM 11363 H HE2  . TYR A 1 70  ? 43.118 38.014 4.240  1.00 0.00 ? 40 TYR A HE2  11 
ATOM 11364 H HH   . TYR A 1 70  ? 43.612 36.936 2.090  1.00 0.00 ? 40 TYR A HH   11 
ATOM 11365 N N    . PRO A 1 71  ? 47.615 36.996 7.552  1.00 0.00 ? 41 PRO A N    11 
ATOM 11366 C CA   . PRO A 1 71  ? 48.393 38.242 7.822  1.00 0.00 ? 41 PRO A CA   11 
ATOM 11367 C C    . PRO A 1 71  ? 47.673 39.534 7.439  1.00 0.00 ? 41 PRO A C    11 
ATOM 11368 O O    . PRO A 1 71  ? 48.304 40.591 7.381  1.00 0.00 ? 41 PRO A O    11 
ATOM 11369 C CB   . PRO A 1 71  ? 49.649 38.055 6.972  1.00 0.00 ? 41 PRO A CB   11 
ATOM 11370 C CG   . PRO A 1 71  ? 49.216 37.239 5.801  1.00 0.00 ? 41 PRO A CG   11 
ATOM 11371 C CD   . PRO A 1 71  ? 47.969 36.456 6.225  1.00 0.00 ? 41 PRO A CD   11 
ATOM 11372 H HA   . PRO A 1 71  ? 48.679 38.278 8.861  1.00 0.00 ? 41 PRO A HA   11 
ATOM 11373 H HB2  . PRO A 1 71  ? 50.025 39.015 6.647  1.00 0.00 ? 41 PRO A HB2  11 
ATOM 11374 H HB3  . PRO A 1 71  ? 50.403 37.522 7.529  1.00 0.00 ? 41 PRO A HB3  11 
ATOM 11375 H HG2  . PRO A 1 71  ? 48.983 37.890 4.968  1.00 0.00 ? 41 PRO A HG2  11 
ATOM 11376 H HG3  . PRO A 1 71  ? 49.994 36.547 5.523  1.00 0.00 ? 41 PRO A HG3  11 
ATOM 11377 H HD2  . PRO A 1 71  ? 47.166 36.622 5.521  1.00 0.00 ? 41 PRO A HD2  11 
ATOM 11378 H HD3  . PRO A 1 71  ? 48.192 35.404 6.302  1.00 0.00 ? 41 PRO A HD3  11 
ATOM 11379 N N    . HIS A 1 72  ? 46.369 39.463 7.181  1.00 0.00 ? 42 HIS A N    11 
ATOM 11380 C CA   . HIS A 1 72  ? 45.633 40.648 6.737  1.00 0.00 ? 42 HIS A CA   11 
ATOM 11381 C C    . HIS A 1 72  ? 44.215 40.682 7.293  1.00 0.00 ? 42 HIS A C    11 
ATOM 11382 O O    . HIS A 1 72  ? 43.612 39.639 7.545  1.00 0.00 ? 42 HIS A O    11 
ATOM 11383 C CB   . HIS A 1 72  ? 45.578 40.678 5.209  1.00 0.00 ? 42 HIS A CB   11 
ATOM 11384 C CG   . HIS A 1 72  ? 46.923 40.870 4.563  1.00 0.00 ? 42 HIS A CG   11 
ATOM 11385 N ND1  . HIS A 1 72  ? 47.699 39.802 4.142  1.00 0.00 ? 42 HIS A ND1  11 
ATOM 11386 C CD2  . HIS A 1 72  ? 47.644 42.000 4.261  1.00 0.00 ? 42 HIS A CD2  11 
ATOM 11387 C CE1  . HIS A 1 72  ? 48.829 40.306 3.614  1.00 0.00 ? 42 HIS A CE1  11 
ATOM 11388 N NE2  . HIS A 1 72  ? 48.848 41.640 3.661  1.00 0.00 ? 42 HIS A NE2  11 
ATOM 11389 H H    . HIS A 1 72  ? 45.897 38.611 7.290  1.00 0.00 ? 42 HIS A H    11 
ATOM 11390 H HA   . HIS A 1 72  ? 46.158 41.528 7.076  1.00 0.00 ? 42 HIS A HA   11 
ATOM 11391 H HB2  . HIS A 1 72  ? 45.162 39.746 4.859  1.00 0.00 ? 42 HIS A HB2  11 
ATOM 11392 H HB3  . HIS A 1 72  ? 44.923 41.482 4.904  1.00 0.00 ? 42 HIS A HB3  11 
ATOM 11393 H HD1  . HIS A 1 72  ? 47.468 38.854 4.213  1.00 0.00 ? 42 HIS A HD1  11 
ATOM 11394 H HD2  . HIS A 1 72  ? 47.324 43.012 4.458  1.00 0.00 ? 42 HIS A HD2  11 
ATOM 11395 H HE1  . HIS A 1 72  ? 49.625 39.704 3.201  1.00 0.00 ? 42 HIS A HE1  11 
ATOM 11396 N N    . LYS A 1 73  ? 43.695 41.887 7.516  1.00 0.00 ? 43 LYS A N    11 
ATOM 11397 C CA   . LYS A 1 73  ? 42.280 42.035 7.832  1.00 0.00 ? 43 LYS A CA   11 
ATOM 11398 C C    . LYS A 1 73  ? 41.451 41.562 6.645  1.00 0.00 ? 43 LYS A C    11 
ATOM 11399 O O    . LYS A 1 73  ? 41.737 41.932 5.505  1.00 0.00 ? 43 LYS A O    11 
ATOM 11400 C CB   . LYS A 1 73  ? 41.952 43.504 8.113  1.00 0.00 ? 43 LYS A CB   11 
ATOM 11401 C CG   . LYS A 1 73  ? 40.517 43.615 8.634  1.00 0.00 ? 43 LYS A CG   11 
ATOM 11402 C CD   . LYS A 1 73  ? 40.158 45.088 8.837  1.00 0.00 ? 43 LYS A CD   11 
ATOM 11403 C CE   . LYS A 1 73  ? 38.784 45.194 9.499  1.00 0.00 ? 43 LYS A CE   11 
ATOM 11404 N NZ   . LYS A 1 73  ? 38.874 44.723 10.910 1.00 0.00 ? 43 LYS A NZ   11 
ATOM 11405 H H    . LYS A 1 73  ? 44.270 42.680 7.477  1.00 0.00 ? 43 LYS A H    11 
ATOM 11406 H HA   . LYS A 1 73  ? 42.040 41.440 8.701  1.00 0.00 ? 43 LYS A HA   11 
ATOM 11407 H HB2  . LYS A 1 73  ? 42.636 43.896 8.849  1.00 0.00 ? 43 LYS A HB2  11 
ATOM 11408 H HB3  . LYS A 1 73  ? 42.042 44.072 7.200  1.00 0.00 ? 43 LYS A HB3  11 
ATOM 11409 H HG2  . LYS A 1 73  ? 39.839 43.175 7.916  1.00 0.00 ? 43 LYS A HG2  11 
ATOM 11410 H HG3  . LYS A 1 73  ? 40.434 43.094 9.575  1.00 0.00 ? 43 LYS A HG3  11 
ATOM 11411 H HD2  . LYS A 1 73  ? 40.901 45.555 9.470  1.00 0.00 ? 43 LYS A HD2  11 
ATOM 11412 H HD3  . LYS A 1 73  ? 40.134 45.589 7.881  1.00 0.00 ? 43 LYS A HD3  11 
ATOM 11413 H HE2  . LYS A 1 73  ? 38.455 46.222 9.484  1.00 0.00 ? 43 LYS A HE2  11 
ATOM 11414 H HE3  . LYS A 1 73  ? 38.076 44.582 8.959  1.00 0.00 ? 43 LYS A HE3  11 
ATOM 11415 H HZ1  . LYS A 1 73  ? 38.703 43.697 10.944 1.00 0.00 ? 43 LYS A HZ1  11 
ATOM 11416 H HZ2  . LYS A 1 73  ? 38.160 45.214 11.485 1.00 0.00 ? 43 LYS A HZ2  11 
ATOM 11417 H HZ3  . LYS A 1 73  ? 39.822 44.926 11.284 1.00 0.00 ? 43 LYS A HZ3  11 
ATOM 11418 N N    . ILE A 1 74  ? 40.430 40.749 6.904  1.00 0.00 ? 44 ILE A N    11 
ATOM 11419 C CA   . ILE A 1 74  ? 39.534 40.320 5.832  1.00 0.00 ? 44 ILE A CA   11 
ATOM 11420 C C    . ILE A 1 74  ? 38.358 41.288 5.709  1.00 0.00 ? 44 ILE A C    11 
ATOM 11421 O O    . ILE A 1 74  ? 37.702 41.616 6.697  1.00 0.00 ? 44 ILE A O    11 
ATOM 11422 C CB   . ILE A 1 74  ? 39.063 38.882 6.084  1.00 0.00 ? 44 ILE A CB   11 
ATOM 11423 C CG1  . ILE A 1 74  ? 40.294 37.972 6.137  1.00 0.00 ? 44 ILE A CG1  11 
ATOM 11424 C CG2  . ILE A 1 74  ? 38.139 38.424 4.949  1.00 0.00 ? 44 ILE A CG2  11 
ATOM 11425 C CD1  . ILE A 1 74  ? 39.887 36.541 6.492  1.00 0.00 ? 44 ILE A CD1  11 
ATOM 11426 H H    . ILE A 1 74  ? 40.294 40.421 7.820  1.00 0.00 ? 44 ILE A H    11 
ATOM 11427 H HA   . ILE A 1 74  ? 40.084 40.339 4.902  1.00 0.00 ? 44 ILE A HA   11 
ATOM 11428 H HB   . ILE A 1 74  ? 38.533 38.833 7.025  1.00 0.00 ? 44 ILE A HB   11 
ATOM 11429 H HG12 . ILE A 1 74  ? 40.782 37.975 5.173  1.00 0.00 ? 44 ILE A HG12 11 
ATOM 11430 H HG13 . ILE A 1 74  ? 40.980 38.343 6.885  1.00 0.00 ? 44 ILE A HG13 11 
ATOM 11431 H HG21 . ILE A 1 74  ? 37.270 39.064 4.914  1.00 0.00 ? 44 ILE A HG21 11 
ATOM 11432 H HG22 . ILE A 1 74  ? 37.827 37.406 5.125  1.00 0.00 ? 44 ILE A HG22 11 
ATOM 11433 H HG23 . ILE A 1 74  ? 38.667 38.482 4.009  1.00 0.00 ? 44 ILE A HG23 11 
ATOM 11434 H HD11 . ILE A 1 74  ? 39.400 36.534 7.456  1.00 0.00 ? 44 ILE A HD11 11 
ATOM 11435 H HD12 . ILE A 1 74  ? 40.768 35.918 6.526  1.00 0.00 ? 44 ILE A HD12 11 
ATOM 11436 H HD13 . ILE A 1 74  ? 39.208 36.165 5.742  1.00 0.00 ? 44 ILE A HD13 11 
ATOM 11437 N N    . LYS A 1 75  ? 38.102 41.738 4.484  1.00 0.00 ? 45 LYS A N    11 
ATOM 11438 C CA   . LYS A 1 75  ? 37.059 42.731 4.238  1.00 0.00 ? 45 LYS A CA   11 
ATOM 11439 C C    . LYS A 1 75  ? 35.659 42.122 4.107  1.00 0.00 ? 45 LYS A C    11 
ATOM 11440 O O    . LYS A 1 75  ? 34.667 42.839 4.248  1.00 0.00 ? 45 LYS A O    11 
ATOM 11441 C CB   . LYS A 1 75  ? 37.415 43.549 2.990  1.00 0.00 ? 45 LYS A CB   11 
ATOM 11442 C CG   . LYS A 1 75  ? 37.339 42.680 1.729  1.00 0.00 ? 45 LYS A CG   11 
ATOM 11443 C CD   . LYS A 1 75  ? 37.823 43.485 0.521  1.00 0.00 ? 45 LYS A CD   11 
ATOM 11444 C CE   . LYS A 1 75  ? 37.461 42.744 -0.767 1.00 0.00 ? 45 LYS A CE   11 
ATOM 11445 N NZ   . LYS A 1 75  ? 36.060 43.074 -1.154 1.00 0.00 ? 45 LYS A NZ   11 
ATOM 11446 H H    . LYS A 1 75  ? 38.625 41.397 3.729  1.00 0.00 ? 45 LYS A H    11 
ATOM 11447 H HA   . LYS A 1 75  ? 37.041 43.406 5.080  1.00 0.00 ? 45 LYS A HA   11 
ATOM 11448 H HB2  . LYS A 1 75  ? 36.723 44.373 2.895  1.00 0.00 ? 45 LYS A HB2  11 
ATOM 11449 H HB3  . LYS A 1 75  ? 38.418 43.937 3.093  1.00 0.00 ? 45 LYS A HB3  11 
ATOM 11450 H HG2  . LYS A 1 75  ? 37.963 41.807 1.855  1.00 0.00 ? 45 LYS A HG2  11 
ATOM 11451 H HG3  . LYS A 1 75  ? 36.317 42.371 1.565  1.00 0.00 ? 45 LYS A HG3  11 
ATOM 11452 H HD2  . LYS A 1 75  ? 37.350 44.456 0.525  1.00 0.00 ? 45 LYS A HD2  11 
ATOM 11453 H HD3  . LYS A 1 75  ? 38.895 43.606 0.575  1.00 0.00 ? 45 LYS A HD3  11 
ATOM 11454 H HE2  . LYS A 1 75  ? 38.132 43.047 -1.557 1.00 0.00 ? 45 LYS A HE2  11 
ATOM 11455 H HE3  . LYS A 1 75  ? 37.550 41.680 -0.608 1.00 0.00 ? 45 LYS A HE3  11 
ATOM 11456 H HZ1  . LYS A 1 75  ? 35.433 42.930 -0.337 1.00 0.00 ? 45 LYS A HZ1  11 
ATOM 11457 H HZ2  . LYS A 1 75  ? 35.761 42.456 -1.935 1.00 0.00 ? 45 LYS A HZ2  11 
ATOM 11458 H HZ3  . LYS A 1 75  ? 36.008 44.067 -1.456 1.00 0.00 ? 45 LYS A HZ3  11 
ATOM 11459 N N    . SER A 1 76  ? 35.572 40.825 3.819  1.00 0.00 ? 46 SER A N    11 
ATOM 11460 C CA   . SER A 1 76  ? 34.271 40.180 3.668  1.00 0.00 ? 46 SER A CA   11 
ATOM 11461 C C    . SER A 1 76  ? 34.315 38.731 4.141  1.00 0.00 ? 46 SER A C    11 
ATOM 11462 O O    . SER A 1 76  ? 35.354 38.075 4.077  1.00 0.00 ? 46 SER A O    11 
ATOM 11463 C CB   . SER A 1 76  ? 33.837 40.224 2.202  1.00 0.00 ? 46 SER A CB   11 
ATOM 11464 O OG   . SER A 1 76  ? 34.685 39.376 1.439  1.00 0.00 ? 46 SER A OG   11 
ATOM 11465 H H    . SER A 1 76  ? 36.390 40.300 3.700  1.00 0.00 ? 46 SER A H    11 
ATOM 11466 H HA   . SER A 1 76  ? 33.545 40.717 4.259  1.00 0.00 ? 46 SER A HA   11 
ATOM 11467 H HB2  . SER A 1 76  ? 32.820 39.879 2.113  1.00 0.00 ? 46 SER A HB2  11 
ATOM 11468 H HB3  . SER A 1 76  ? 33.901 41.242 1.842  1.00 0.00 ? 46 SER A HB3  11 
ATOM 11469 H HG   . SER A 1 76  ? 35.230 39.897 0.948  1.00 0.00 ? 46 SER A HG   11 
ATOM 11470 N N    . GLY A 1 77  ? 33.173 38.242 4.615  1.00 0.00 ? 47 GLY A N    11 
ATOM 11471 C CA   . GLY A 1 77  ? 33.061 36.854 5.048  1.00 0.00 ? 47 GLY A CA   11 
ATOM 11472 C C    . GLY A 1 77  ? 33.237 35.890 3.878  1.00 0.00 ? 47 GLY A C    11 
ATOM 11473 O O    . GLY A 1 77  ? 33.833 34.820 4.024  1.00 0.00 ? 47 GLY A O    11 
ATOM 11474 H H    . GLY A 1 77  ? 32.382 38.817 4.652  1.00 0.00 ? 47 GLY A H    11 
ATOM 11475 H HA2  . GLY A 1 77  ? 33.819 36.653 5.792  1.00 0.00 ? 47 GLY A HA2  11 
ATOM 11476 H HA3  . GLY A 1 77  ? 32.086 36.697 5.484  1.00 0.00 ? 47 GLY A HA3  11 
ATOM 11477 N N    . ALA A 1 78  ? 32.740 36.279 2.703  1.00 0.00 ? 48 ALA A N    11 
ATOM 11478 C CA   . ALA A 1 78  ? 32.820 35.410 1.535  1.00 0.00 ? 48 ALA A CA   11 
ATOM 11479 C C    . ALA A 1 78  ? 34.275 35.072 1.233  1.00 0.00 ? 48 ALA A C    11 
ATOM 11480 O O    . ALA A 1 78  ? 34.600 33.926 0.925  1.00 0.00 ? 48 ALA A O    11 
ATOM 11481 C CB   . ALA A 1 78  ? 32.190 36.100 0.324  1.00 0.00 ? 48 ALA A CB   11 
ATOM 11482 H H    . ALA A 1 78  ? 32.318 37.160 2.625  1.00 0.00 ? 48 ALA A H    11 
ATOM 11483 H HA   . ALA A 1 78  ? 32.280 34.497 1.738  1.00 0.00 ? 48 ALA A HA   11 
ATOM 11484 H HB1  . ALA A 1 78  ? 31.136 36.252 0.504  1.00 0.00 ? 48 ALA A HB1  11 
ATOM 11485 H HB2  . ALA A 1 78  ? 32.320 35.481 -0.551 1.00 0.00 ? 48 ALA A HB2  11 
ATOM 11486 H HB3  . ALA A 1 78  ? 32.668 37.055 0.164  1.00 0.00 ? 48 ALA A HB3  11 
ATOM 11487 N N    . GLU A 1 79  ? 35.145 36.074 1.321  1.00 0.00 ? 49 GLU A N    11 
ATOM 11488 C CA   . GLU A 1 79  ? 36.577 35.819 1.222  1.00 0.00 ? 49 GLU A CA   11 
ATOM 11489 C C    . GLU A 1 79  ? 37.043 34.909 2.359  1.00 0.00 ? 49 GLU A C    11 
ATOM 11490 O O    . GLU A 1 79  ? 37.831 33.990 2.138  1.00 0.00 ? 49 GLU A O    11 
ATOM 11491 C CB   . GLU A 1 79  ? 37.348 37.141 1.276  1.00 0.00 ? 49 GLU A CB   11 
ATOM 11492 C CG   . GLU A 1 79  ? 38.831 36.881 0.986  1.00 0.00 ? 49 GLU A CG   11 
ATOM 11493 C CD   . GLU A 1 79  ? 39.671 38.156 1.115  1.00 0.00 ? 49 GLU A CD   11 
ATOM 11494 O OE1  . GLU A 1 79  ? 40.865 38.067 0.877  1.00 0.00 ? 49 GLU A OE1  11 
ATOM 11495 O OE2  . GLU A 1 79  ? 39.130 39.202 1.447  1.00 0.00 ? 49 GLU A OE2  11 
ATOM 11496 H H    . GLU A 1 79  ? 34.822 36.990 1.453  1.00 0.00 ? 49 GLU A H    11 
ATOM 11497 H HA   . GLU A 1 79  ? 36.782 35.335 0.279  1.00 0.00 ? 49 GLU A HA   11 
ATOM 11498 H HB2  . GLU A 1 79  ? 36.948 37.820 0.537  1.00 0.00 ? 49 GLU A HB2  11 
ATOM 11499 H HB3  . GLU A 1 79  ? 37.247 37.577 2.259  1.00 0.00 ? 49 GLU A HB3  11 
ATOM 11500 H HG2  . GLU A 1 79  ? 39.201 36.145 1.684  1.00 0.00 ? 49 GLU A HG2  11 
ATOM 11501 H HG3  . GLU A 1 79  ? 38.929 36.493 -0.017 1.00 0.00 ? 49 GLU A HG3  11 
ATOM 11502 N N    . ALA A 1 80  ? 36.466 35.085 3.547  1.00 0.00 ? 50 ALA A N    11 
ATOM 11503 C CA   . ALA A 1 80  ? 36.877 34.294 4.706  1.00 0.00 ? 50 ALA A CA   11 
ATOM 11504 C C    . ALA A 1 80  ? 36.652 32.801 4.469  1.00 0.00 ? 50 ALA A C    11 
ATOM 11505 O O    . ALA A 1 80  ? 37.465 31.972 4.878  1.00 0.00 ? 50 ALA A O    11 
ATOM 11506 C CB   . ALA A 1 80  ? 36.092 34.736 5.942  1.00 0.00 ? 50 ALA A CB   11 
ATOM 11507 H H    . ALA A 1 80  ? 35.759 35.757 3.648  1.00 0.00 ? 50 ALA A H    11 
ATOM 11508 H HA   . ALA A 1 80  ? 37.928 34.462 4.886  1.00 0.00 ? 50 ALA A HA   11 
ATOM 11509 H HB1  . ALA A 1 80  ? 36.635 34.457 6.833  1.00 0.00 ? 50 ALA A HB1  11 
ATOM 11510 H HB2  . ALA A 1 80  ? 35.125 34.258 5.944  1.00 0.00 ? 50 ALA A HB2  11 
ATOM 11511 H HB3  . ALA A 1 80  ? 35.964 35.809 5.920  1.00 0.00 ? 50 ALA A HB3  11 
ATOM 11512 N N    . LYS A 1 81  ? 35.596 32.466 3.737  1.00 0.00 ? 51 LYS A N    11 
ATOM 11513 C CA   . LYS A 1 81  ? 35.289 31.068 3.449  1.00 0.00 ? 51 LYS A CA   11 
ATOM 11514 C C    . LYS A 1 81  ? 36.454 30.364 2.746  1.00 0.00 ? 51 LYS A C    11 
ATOM 11515 O O    . LYS A 1 81  ? 36.613 29.151 2.882  1.00 0.00 ? 51 LYS A O    11 
ATOM 11516 C CB   . LYS A 1 81  ? 34.039 30.989 2.570  1.00 0.00 ? 51 LYS A CB   11 
ATOM 11517 C CG   . LYS A 1 81  ? 33.616 29.529 2.396  1.00 0.00 ? 51 LYS A CG   11 
ATOM 11518 C CD   . LYS A 1 81  ? 32.417 29.453 1.450  1.00 0.00 ? 51 LYS A CD   11 
ATOM 11519 C CE   . LYS A 1 81  ? 31.896 28.015 1.395  1.00 0.00 ? 51 LYS A CE   11 
ATOM 11520 N NZ   . LYS A 1 81  ? 30.732 27.944 0.467  1.00 0.00 ? 51 LYS A NZ   11 
ATOM 11521 H H    . LYS A 1 81  ? 34.984 33.170 3.433  1.00 0.00 ? 51 LYS A H    11 
ATOM 11522 H HA   . LYS A 1 81  ? 35.087 30.558 4.379  1.00 0.00 ? 51 LYS A HA   11 
ATOM 11523 H HB2  . LYS A 1 81  ? 33.237 31.543 3.035  1.00 0.00 ? 51 LYS A HB2  11 
ATOM 11524 H HB3  . LYS A 1 81  ? 34.254 31.414 1.600  1.00 0.00 ? 51 LYS A HB3  11 
ATOM 11525 H HG2  . LYS A 1 81  ? 34.439 28.963 1.984  1.00 0.00 ? 51 LYS A HG2  11 
ATOM 11526 H HG3  . LYS A 1 81  ? 33.340 29.116 3.356  1.00 0.00 ? 51 LYS A HG3  11 
ATOM 11527 H HD2  . LYS A 1 81  ? 31.636 30.107 1.808  1.00 0.00 ? 51 LYS A HD2  11 
ATOM 11528 H HD3  . LYS A 1 81  ? 32.719 29.760 0.460  1.00 0.00 ? 51 LYS A HD3  11 
ATOM 11529 H HE2  . LYS A 1 81  ? 32.679 27.362 1.041  1.00 0.00 ? 51 LYS A HE2  11 
ATOM 11530 H HE3  . LYS A 1 81  ? 31.588 27.707 2.383  1.00 0.00 ? 51 LYS A HE3  11 
ATOM 11531 H HZ1  . LYS A 1 81  ? 29.858 28.153 0.989  1.00 0.00 ? 51 LYS A HZ1  11 
ATOM 11532 H HZ2  . LYS A 1 81  ? 30.674 26.989 0.059  1.00 0.00 ? 51 LYS A HZ2  11 
ATOM 11533 H HZ3  . LYS A 1 81  ? 30.853 28.642 -0.295 1.00 0.00 ? 51 LYS A HZ3  11 
ATOM 11534 N N    . LYS A 1 82  ? 37.265 31.111 1.998  1.00 0.00 ? 52 LYS A N    11 
ATOM 11535 C CA   . LYS A 1 82  ? 38.391 30.516 1.281  1.00 0.00 ? 52 LYS A CA   11 
ATOM 11536 C C    . LYS A 1 82  ? 39.389 29.846 2.234  1.00 0.00 ? 52 LYS A C    11 
ATOM 11537 O O    . LYS A 1 82  ? 40.099 28.921 1.837  1.00 0.00 ? 52 LYS A O    11 
ATOM 11538 C CB   . LYS A 1 82  ? 39.096 31.609 0.470  1.00 0.00 ? 52 LYS A CB   11 
ATOM 11539 C CG   . LYS A 1 82  ? 40.173 31.003 -0.436 1.00 0.00 ? 52 LYS A CG   11 
ATOM 11540 C CD   . LYS A 1 82  ? 39.515 30.290 -1.621 1.00 0.00 ? 52 LYS A CD   11 
ATOM 11541 C CE   . LYS A 1 82  ? 40.597 29.770 -2.569 1.00 0.00 ? 52 LYS A CE   11 
ATOM 11542 N NZ   . LYS A 1 82  ? 39.957 29.050 -3.706 1.00 0.00 ? 52 LYS A NZ   11 
ATOM 11543 H H    . LYS A 1 82  ? 37.136 32.082 1.959  1.00 0.00 ? 52 LYS A H    11 
ATOM 11544 H HA   . LYS A 1 82  ? 38.010 29.773 0.598  1.00 0.00 ? 52 LYS A HA   11 
ATOM 11545 H HB2  . LYS A 1 82  ? 38.369 32.126 -0.139 1.00 0.00 ? 52 LYS A HB2  11 
ATOM 11546 H HB3  . LYS A 1 82  ? 39.557 32.312 1.147  1.00 0.00 ? 52 LYS A HB3  11 
ATOM 11547 H HG2  . LYS A 1 82  ? 40.813 31.791 -0.804 1.00 0.00 ? 52 LYS A HG2  11 
ATOM 11548 H HG3  . LYS A 1 82  ? 40.766 30.296 0.123  1.00 0.00 ? 52 LYS A HG3  11 
ATOM 11549 H HD2  . LYS A 1 82  ? 38.925 29.461 -1.260 1.00 0.00 ? 52 LYS A HD2  11 
ATOM 11550 H HD3  . LYS A 1 82  ? 38.880 30.983 -2.150 1.00 0.00 ? 52 LYS A HD3  11 
ATOM 11551 H HE2  . LYS A 1 82  ? 41.173 30.602 -2.948 1.00 0.00 ? 52 LYS A HE2  11 
ATOM 11552 H HE3  . LYS A 1 82  ? 41.248 29.094 -2.035 1.00 0.00 ? 52 LYS A HE3  11 
ATOM 11553 H HZ1  . LYS A 1 82  ? 39.946 29.665 -4.544 1.00 0.00 ? 52 LYS A HZ1  11 
ATOM 11554 H HZ2  . LYS A 1 82  ? 38.981 28.797 -3.449 1.00 0.00 ? 52 LYS A HZ2  11 
ATOM 11555 H HZ3  . LYS A 1 82  ? 40.497 28.188 -3.919 1.00 0.00 ? 52 LYS A HZ3  11 
ATOM 11556 N N    . LEU A 1 83  ? 39.421 30.271 3.499  1.00 0.00 ? 53 LEU A N    11 
ATOM 11557 C CA   . LEU A 1 83  ? 40.416 29.767 4.438  1.00 0.00 ? 53 LEU A CA   11 
ATOM 11558 C C    . LEU A 1 83  ? 39.983 28.414 5.017  1.00 0.00 ? 53 LEU A C    11 
ATOM 11559 O O    . LEU A 1 83  ? 38.803 28.238 5.339  1.00 0.00 ? 53 LEU A O    11 
ATOM 11560 C CB   . LEU A 1 83  ? 40.602 30.773 5.575  1.00 0.00 ? 53 LEU A CB   11 
ATOM 11561 C CG   . LEU A 1 83  ? 41.454 31.945 5.086  1.00 0.00 ? 53 LEU A CG   11 
ATOM 11562 C CD1  . LEU A 1 83  ? 41.229 33.155 5.996  1.00 0.00 ? 53 LEU A CD1  11 
ATOM 11563 C CD2  . LEU A 1 83  ? 42.932 31.550 5.119  1.00 0.00 ? 53 LEU A CD2  11 
ATOM 11564 H H    . LEU A 1 83  ? 38.756 30.919 3.811  1.00 0.00 ? 53 LEU A H    11 
ATOM 11565 H HA   . LEU A 1 83  ? 41.349 29.665 3.908  1.00 0.00 ? 53 LEU A HA   11 
ATOM 11566 H HB2  . LEU A 1 83  ? 39.636 31.136 5.894  1.00 0.00 ? 53 LEU A HB2  11 
ATOM 11567 H HB3  . LEU A 1 83  ? 41.097 30.292 6.403  1.00 0.00 ? 53 LEU A HB3  11 
ATOM 11568 H HG   . LEU A 1 83  ? 41.170 32.199 4.075  1.00 0.00 ? 53 LEU A HG   11 
ATOM 11569 H HD11 . LEU A 1 83  ? 41.771 34.005 5.606  1.00 0.00 ? 53 LEU A HD11 11 
ATOM 11570 H HD12 . LEU A 1 83  ? 41.585 32.928 6.991  1.00 0.00 ? 53 LEU A HD12 11 
ATOM 11571 H HD13 . LEU A 1 83  ? 40.176 33.387 6.034  1.00 0.00 ? 53 LEU A HD13 11 
ATOM 11572 H HD21 . LEU A 1 83  ? 43.484 32.159 4.419  1.00 0.00 ? 53 LEU A HD21 11 
ATOM 11573 H HD22 . LEU A 1 83  ? 43.032 30.509 4.850  1.00 0.00 ? 53 LEU A HD22 11 
ATOM 11574 H HD23 . LEU A 1 83  ? 43.323 31.704 6.115  1.00 0.00 ? 53 LEU A HD23 11 
ATOM 11575 N N    . PRO A 1 84  ? 40.890 27.477 5.216  1.00 0.00 ? 54 PRO A N    11 
ATOM 11576 C CA   . PRO A 1 84  ? 40.504 26.120 5.710  1.00 0.00 ? 54 PRO A CA   11 
ATOM 11577 C C    . PRO A 1 84  ? 39.828 26.195 7.075  1.00 0.00 ? 54 PRO A C    11 
ATOM 11578 O O    . PRO A 1 84  ? 40.349 26.815 8.003  1.00 0.00 ? 54 PRO A O    11 
ATOM 11579 C CB   . PRO A 1 84  ? 41.821 25.341 5.788  1.00 0.00 ? 54 PRO A CB   11 
ATOM 11580 C CG   . PRO A 1 84  ? 42.893 26.374 5.835  1.00 0.00 ? 54 PRO A CG   11 
ATOM 11581 C CD   . PRO A 1 84  ? 42.356 27.578 5.066  1.00 0.00 ? 54 PRO A CD   11 
ATOM 11582 H HA   . PRO A 1 84  ? 39.847 25.643 5.000  1.00 0.00 ? 54 PRO A HA   11 
ATOM 11583 H HB2  . PRO A 1 84  ? 41.846 24.729 6.679  1.00 0.00 ? 54 PRO A HB2  11 
ATOM 11584 H HB3  . PRO A 1 84  ? 41.945 24.728 4.909  1.00 0.00 ? 54 PRO A HB3  11 
ATOM 11585 H HG2  . PRO A 1 84  ? 43.101 26.643 6.861  1.00 0.00 ? 54 PRO A HG2  11 
ATOM 11586 H HG3  . PRO A 1 84  ? 43.787 26.009 5.353  1.00 0.00 ? 54 PRO A HG3  11 
ATOM 11587 H HD2  . PRO A 1 84  ? 42.724 28.497 5.501  1.00 0.00 ? 54 PRO A HD2  11 
ATOM 11588 H HD3  . PRO A 1 84  ? 42.626 27.515 4.023  1.00 0.00 ? 54 PRO A HD3  11 
ATOM 11589 N N    . GLY A 1 85  ? 38.671 25.551 7.189  1.00 0.00 ? 55 GLY A N    11 
ATOM 11590 C CA   . GLY A 1 85  ? 37.938 25.527 8.452  1.00 0.00 ? 55 GLY A CA   11 
ATOM 11591 C C    . GLY A 1 85  ? 36.764 26.512 8.488  1.00 0.00 ? 55 GLY A C    11 
ATOM 11592 O O    . GLY A 1 85  ? 35.938 26.435 9.399  1.00 0.00 ? 55 GLY A O    11 
ATOM 11593 H H    . GLY A 1 85  ? 38.303 25.083 6.411  1.00 0.00 ? 55 GLY A H    11 
ATOM 11594 H HA2  . GLY A 1 85  ? 37.556 24.530 8.611  1.00 0.00 ? 55 GLY A HA2  11 
ATOM 11595 H HA3  . GLY A 1 85  ? 38.618 25.769 9.255  1.00 0.00 ? 55 GLY A HA3  11 
ATOM 11596 N N    . VAL A 1 86  ? 36.676 27.432 7.521  1.00 0.00 ? 56 VAL A N    11 
ATOM 11597 C CA   . VAL A 1 86  ? 35.563 28.379 7.494  1.00 0.00 ? 56 VAL A CA   11 
ATOM 11598 C C    . VAL A 1 86  ? 34.406 27.805 6.678  1.00 0.00 ? 56 VAL A C    11 
ATOM 11599 O O    . VAL A 1 86  ? 34.610 27.269 5.588  1.00 0.00 ? 56 VAL A O    11 
ATOM 11600 C CB   . VAL A 1 86  ? 36.009 29.718 6.891  1.00 0.00 ? 56 VAL A CB   11 
ATOM 11601 C CG1  . VAL A 1 86  ? 34.865 30.730 6.985  1.00 0.00 ? 56 VAL A CG1  11 
ATOM 11602 C CG2  . VAL A 1 86  ? 37.217 30.260 7.662  1.00 0.00 ? 56 VAL A CG2  11 
ATOM 11603 H H    . VAL A 1 86  ? 37.371 27.484 6.829  1.00 0.00 ? 56 VAL A H    11 
ATOM 11604 H HA   . VAL A 1 86  ? 35.225 28.548 8.505  1.00 0.00 ? 56 VAL A HA   11 
ATOM 11605 H HB   . VAL A 1 86  ? 36.276 29.573 5.855  1.00 0.00 ? 56 VAL A HB   11 
ATOM 11606 H HG11 . VAL A 1 86  ? 34.003 30.348 6.458  1.00 0.00 ? 56 VAL A HG11 11 
ATOM 11607 H HG12 . VAL A 1 86  ? 35.174 31.665 6.541  1.00 0.00 ? 56 VAL A HG12 11 
ATOM 11608 H HG13 . VAL A 1 86  ? 34.611 30.891 8.022  1.00 0.00 ? 56 VAL A HG13 11 
ATOM 11609 H HG21 . VAL A 1 86  ? 36.999 30.260 8.720  1.00 0.00 ? 56 VAL A HG21 11 
ATOM 11610 H HG22 . VAL A 1 86  ? 37.426 31.269 7.338  1.00 0.00 ? 56 VAL A HG22 11 
ATOM 11611 H HG23 . VAL A 1 86  ? 38.076 29.635 7.470  1.00 0.00 ? 56 VAL A HG23 11 
ATOM 11612 N N    . GLY A 1 87  ? 33.193 27.924 7.212  1.00 0.00 ? 57 GLY A N    11 
ATOM 11613 C CA   . GLY A 1 87  ? 32.008 27.417 6.525  1.00 0.00 ? 57 GLY A CA   11 
ATOM 11614 C C    . GLY A 1 87  ? 31.137 28.563 6.022  1.00 0.00 ? 57 GLY A C    11 
ATOM 11615 O O    . GLY A 1 87  ? 31.360 29.724 6.364  1.00 0.00 ? 57 GLY A O    11 
ATOM 11616 H H    . GLY A 1 87  ? 33.094 28.361 8.083  1.00 0.00 ? 57 GLY A H    11 
ATOM 11617 H HA2  . GLY A 1 87  ? 32.311 26.805 5.688  1.00 0.00 ? 57 GLY A HA2  11 
ATOM 11618 H HA3  . GLY A 1 87  ? 31.431 26.817 7.212  1.00 0.00 ? 57 GLY A HA3  11 
ATOM 11619 N N    . THR A 1 88  ? 30.125 28.227 5.226  1.00 0.00 ? 58 THR A N    11 
ATOM 11620 C CA   . THR A 1 88  ? 29.240 29.245 4.674  1.00 0.00 ? 58 THR A CA   11 
ATOM 11621 C C    . THR A 1 88  ? 28.571 30.039 5.792  1.00 0.00 ? 58 THR A C    11 
ATOM 11622 O O    . THR A 1 88  ? 28.527 31.269 5.753  1.00 0.00 ? 58 THR A O    11 
ATOM 11623 C CB   . THR A 1 88  ? 28.169 28.587 3.801  1.00 0.00 ? 58 THR A CB   11 
ATOM 11624 O OG1  . THR A 1 88  ? 28.797 27.769 2.823  1.00 0.00 ? 58 THR A OG1  11 
ATOM 11625 C CG2  . THR A 1 88  ? 27.337 29.666 3.105  1.00 0.00 ? 58 THR A CG2  11 
ATOM 11626 H H    . THR A 1 88  ? 29.973 27.285 5.008  1.00 0.00 ? 58 THR A H    11 
ATOM 11627 H HA   . THR A 1 88  ? 29.820 29.922 4.063  1.00 0.00 ? 58 THR A HA   11 
ATOM 11628 H HB   . THR A 1 88  ? 27.523 27.982 4.417  1.00 0.00 ? 58 THR A HB   11 
ATOM 11629 H HG1  . THR A 1 88  ? 28.154 27.415 2.303  1.00 0.00 ? 58 THR A HG1  11 
ATOM 11630 H HG21 . THR A 1 88  ? 27.995 30.364 2.608  1.00 0.00 ? 58 THR A HG21 11 
ATOM 11631 H HG22 . THR A 1 88  ? 26.743 30.192 3.839  1.00 0.00 ? 58 THR A HG22 11 
ATOM 11632 H HG23 . THR A 1 88  ? 26.685 29.206 2.379  1.00 0.00 ? 58 THR A HG23 11 
ATOM 11633 N N    . LYS A 1 89  ? 28.093 29.335 6.815  1.00 0.00 ? 59 LYS A N    11 
ATOM 11634 C CA   . LYS A 1 89  ? 27.411 29.997 7.922  1.00 0.00 ? 59 LYS A CA   11 
ATOM 11635 C C    . LYS A 1 89  ? 28.348 30.983 8.614  1.00 0.00 ? 59 LYS A C    11 
ATOM 11636 O O    . LYS A 1 89  ? 27.959 32.109 8.924  1.00 0.00 ? 59 LYS A O    11 
ATOM 11637 C CB   . LYS A 1 89  ? 26.921 28.958 8.932  1.00 0.00 ? 59 LYS A CB   11 
ATOM 11638 C CG   . LYS A 1 89  ? 25.937 29.614 9.903  1.00 0.00 ? 59 LYS A CG   11 
ATOM 11639 C CD   . LYS A 1 89  ? 25.779 28.734 11.145 1.00 0.00 ? 59 LYS A CD   11 
ATOM 11640 C CE   . LYS A 1 89  ? 25.003 27.467 10.778 1.00 0.00 ? 59 LYS A CE   11 
ATOM 11641 N NZ   . LYS A 1 89  ? 24.629 26.736 12.020 1.00 0.00 ? 59 LYS A NZ   11 
ATOM 11642 H H    . LYS A 1 89  ? 28.202 28.361 6.826  1.00 0.00 ? 59 LYS A H    11 
ATOM 11643 H HA   . LYS A 1 89  ? 26.559 30.535 7.535  1.00 0.00 ? 59 LYS A HA   11 
ATOM 11644 H HB2  . LYS A 1 89  ? 26.429 28.151 8.409  1.00 0.00 ? 59 LYS A HB2  11 
ATOM 11645 H HB3  . LYS A 1 89  ? 27.763 28.568 9.486  1.00 0.00 ? 59 LYS A HB3  11 
ATOM 11646 H HG2  . LYS A 1 89  ? 26.312 30.584 10.193 1.00 0.00 ? 59 LYS A HG2  11 
ATOM 11647 H HG3  . LYS A 1 89  ? 24.977 29.727 9.422  1.00 0.00 ? 59 LYS A HG3  11 
ATOM 11648 H HD2  . LYS A 1 89  ? 26.755 28.463 11.520 1.00 0.00 ? 59 LYS A HD2  11 
ATOM 11649 H HD3  . LYS A 1 89  ? 25.238 29.276 11.905 1.00 0.00 ? 59 LYS A HD3  11 
ATOM 11650 H HE2  . LYS A 1 89  ? 24.108 27.737 10.237 1.00 0.00 ? 59 LYS A HE2  11 
ATOM 11651 H HE3  . LYS A 1 89  ? 25.620 26.833 10.159 1.00 0.00 ? 59 LYS A HE3  11 
ATOM 11652 H HZ1  . LYS A 1 89  ? 24.464 25.733 11.798 1.00 0.00 ? 59 LYS A HZ1  11 
ATOM 11653 H HZ2  . LYS A 1 89  ? 23.762 27.151 12.419 1.00 0.00 ? 59 LYS A HZ2  11 
ATOM 11654 H HZ3  . LYS A 1 89  ? 25.401 26.812 12.714 1.00 0.00 ? 59 LYS A HZ3  11 
ATOM 11655 N N    . ILE A 1 90  ? 29.604 30.584 8.786  1.00 0.00 ? 60 ILE A N    11 
ATOM 11656 C CA   . ILE A 1 90  ? 30.577 31.444 9.447  1.00 0.00 ? 60 ILE A CA   11 
ATOM 11657 C C    . ILE A 1 90  ? 30.812 32.700 8.608  1.00 0.00 ? 60 ILE A C    11 
ATOM 11658 O O    . ILE A 1 90  ? 30.839 33.812 9.136  1.00 0.00 ? 60 ILE A O    11 
ATOM 11659 C CB   . ILE A 1 90  ? 31.883 30.668 9.669  1.00 0.00 ? 60 ILE A CB   11 
ATOM 11660 C CG1  . ILE A 1 90  ? 31.590 29.451 10.555 1.00 0.00 ? 60 ILE A CG1  11 
ATOM 11661 C CG2  . ILE A 1 90  ? 32.915 31.561 10.364 1.00 0.00 ? 60 ILE A CG2  11 
ATOM 11662 C CD1  . ILE A 1 90  ? 32.804 28.516 10.625 1.00 0.00 ? 60 ILE A CD1  11 
ATOM 11663 H H    . ILE A 1 90  ? 29.880 29.700 8.463  1.00 0.00 ? 60 ILE A H    11 
ATOM 11664 H HA   . ILE A 1 90  ? 30.181 31.739 10.408 1.00 0.00 ? 60 ILE A HA   11 
ATOM 11665 H HB   . ILE A 1 90  ? 32.274 30.337 8.718  1.00 0.00 ? 60 ILE A HB   11 
ATOM 11666 H HG12 . ILE A 1 90  ? 31.346 29.789 11.551 1.00 0.00 ? 60 ILE A HG12 11 
ATOM 11667 H HG13 . ILE A 1 90  ? 30.748 28.910 10.147 1.00 0.00 ? 60 ILE A HG13 11 
ATOM 11668 H HG21 . ILE A 1 90  ? 32.480 31.987 11.256 1.00 0.00 ? 60 ILE A HG21 11 
ATOM 11669 H HG22 . ILE A 1 90  ? 33.214 32.355 9.695  1.00 0.00 ? 60 ILE A HG22 11 
ATOM 11670 H HG23 . ILE A 1 90  ? 33.779 30.972 10.632 1.00 0.00 ? 60 ILE A HG23 11 
ATOM 11671 H HD11 . ILE A 1 90  ? 32.698 27.737 9.885  1.00 0.00 ? 60 ILE A HD11 11 
ATOM 11672 H HD12 . ILE A 1 90  ? 32.858 28.069 11.608 1.00 0.00 ? 60 ILE A HD12 11 
ATOM 11673 H HD13 . ILE A 1 90  ? 33.711 29.071 10.434 1.00 0.00 ? 60 ILE A HD13 11 
ATOM 11674 N N    . ALA A 1 91  ? 30.921 32.526 7.294  1.00 0.00 ? 61 ALA A N    11 
ATOM 11675 C CA   . ALA A 1 91  ? 31.115 33.666 6.404  1.00 0.00 ? 61 ALA A CA   11 
ATOM 11676 C C    . ALA A 1 91  ? 29.959 34.654 6.540  1.00 0.00 ? 61 ALA A C    11 
ATOM 11677 O O    . ALA A 1 91  ? 30.176 35.865 6.597  1.00 0.00 ? 61 ALA A O    11 
ATOM 11678 C CB   . ALA A 1 91  ? 31.209 33.185 4.955  1.00 0.00 ? 61 ALA A CB   11 
ATOM 11679 H H    . ALA A 1 91  ? 30.901 31.619 6.923  1.00 0.00 ? 61 ALA A H    11 
ATOM 11680 H HA   . ALA A 1 91  ? 32.036 34.163 6.667  1.00 0.00 ? 61 ALA A HA   11 
ATOM 11681 H HB1  . ALA A 1 91  ? 30.282 32.710 4.671  1.00 0.00 ? 61 ALA A HB1  11 
ATOM 11682 H HB2  . ALA A 1 91  ? 32.020 32.477 4.863  1.00 0.00 ? 61 ALA A HB2  11 
ATOM 11683 H HB3  . ALA A 1 91  ? 31.395 34.030 4.307  1.00 0.00 ? 61 ALA A HB3  11 
ATOM 11684 N N    . GLU A 1 92  ? 28.734 34.138 6.624  1.00 0.00 ? 62 GLU A N    11 
ATOM 11685 C CA   . GLU A 1 92  ? 27.569 35.009 6.757  1.00 0.00 ? 62 GLU A CA   11 
ATOM 11686 C C    . GLU A 1 92  ? 27.627 35.824 8.048  1.00 0.00 ? 62 GLU A C    11 
ATOM 11687 O O    . GLU A 1 92  ? 27.322 37.018 8.039  1.00 0.00 ? 62 GLU A O    11 
ATOM 11688 C CB   . GLU A 1 92  ? 26.285 34.178 6.735  1.00 0.00 ? 62 GLU A CB   11 
ATOM 11689 C CG   . GLU A 1 92  ? 26.121 33.521 5.359  1.00 0.00 ? 62 GLU A CG   11 
ATOM 11690 C CD   . GLU A 1 92  ? 24.810 32.736 5.254  1.00 0.00 ? 62 GLU A CD   11 
ATOM 11691 O OE1  . GLU A 1 92  ? 24.148 32.539 6.264  1.00 0.00 ? 62 GLU A OE1  11 
ATOM 11692 O OE2  . GLU A 1 92  ? 24.481 32.337 4.149  1.00 0.00 ? 62 GLU A OE2  11 
ATOM 11693 H H    . GLU A 1 92  ? 28.611 33.168 6.558  1.00 0.00 ? 62 GLU A H    11 
ATOM 11694 H HA   . GLU A 1 92  ? 27.550 35.691 5.919  1.00 0.00 ? 62 GLU A HA   11 
ATOM 11695 H HB2  . GLU A 1 92  ? 26.339 33.412 7.495  1.00 0.00 ? 62 GLU A HB2  11 
ATOM 11696 H HB3  . GLU A 1 92  ? 25.437 34.817 6.927  1.00 0.00 ? 62 GLU A HB3  11 
ATOM 11697 H HG2  . GLU A 1 92  ? 26.130 34.290 4.599  1.00 0.00 ? 62 GLU A HG2  11 
ATOM 11698 H HG3  . GLU A 1 92  ? 26.949 32.850 5.188  1.00 0.00 ? 62 GLU A HG3  11 
ATOM 11699 N N    . LYS A 1 93  ? 28.052 35.200 9.148  1.00 0.00 ? 63 LYS A N    11 
ATOM 11700 C CA   . LYS A 1 93  ? 28.195 35.933 10.405 1.00 0.00 ? 63 LYS A CA   11 
ATOM 11701 C C    . LYS A 1 93  ? 29.206 37.067 10.253 1.00 0.00 ? 63 LYS A C    11 
ATOM 11702 O O    . LYS A 1 93  ? 28.983 38.175 10.741 1.00 0.00 ? 63 LYS A O    11 
ATOM 11703 C CB   . LYS A 1 93  ? 28.641 34.998 11.533 1.00 0.00 ? 63 LYS A CB   11 
ATOM 11704 C CG   . LYS A 1 93  ? 27.622 33.870 11.724 1.00 0.00 ? 63 LYS A CG   11 
ATOM 11705 C CD   . LYS A 1 93  ? 26.285 34.443 12.205 1.00 0.00 ? 63 LYS A CD   11 
ATOM 11706 C CE   . LYS A 1 93  ? 25.352 33.295 12.595 1.00 0.00 ? 63 LYS A CE   11 
ATOM 11707 N NZ   . LYS A 1 93  ? 25.957 32.521 13.715 1.00 0.00 ? 63 LYS A NZ   11 
ATOM 11708 H H    . LYS A 1 93  ? 28.230 34.235 9.121  1.00 0.00 ? 63 LYS A H    11 
ATOM 11709 H HA   . LYS A 1 93  ? 27.240 36.362 10.666 1.00 0.00 ? 63 LYS A HA   11 
ATOM 11710 H HB2  . LYS A 1 93  ? 29.601 34.572 11.283 1.00 0.00 ? 63 LYS A HB2  11 
ATOM 11711 H HB3  . LYS A 1 93  ? 28.726 35.560 12.450 1.00 0.00 ? 63 LYS A HB3  11 
ATOM 11712 H HG2  . LYS A 1 93  ? 27.472 33.360 10.787 1.00 0.00 ? 63 LYS A HG2  11 
ATOM 11713 H HG3  . LYS A 1 93  ? 27.993 33.172 12.459 1.00 0.00 ? 63 LYS A HG3  11 
ATOM 11714 H HD2  . LYS A 1 93  ? 26.452 35.080 13.061 1.00 0.00 ? 63 LYS A HD2  11 
ATOM 11715 H HD3  . LYS A 1 93  ? 25.828 35.015 11.412 1.00 0.00 ? 63 LYS A HD3  11 
ATOM 11716 H HE2  . LYS A 1 93  ? 24.399 33.696 12.908 1.00 0.00 ? 63 LYS A HE2  11 
ATOM 11717 H HE3  . LYS A 1 93  ? 25.207 32.645 11.745 1.00 0.00 ? 63 LYS A HE3  11 
ATOM 11718 H HZ1  . LYS A 1 93  ? 26.731 33.070 14.138 1.00 0.00 ? 63 LYS A HZ1  11 
ATOM 11719 H HZ2  . LYS A 1 93  ? 26.328 31.619 13.352 1.00 0.00 ? 63 LYS A HZ2  11 
ATOM 11720 H HZ3  . LYS A 1 93  ? 25.233 32.333 14.438 1.00 0.00 ? 63 LYS A HZ3  11 
ATOM 11721 N N    . ILE A 1 94  ? 30.297 36.802 9.539  1.00 0.00 ? 64 ILE A N    11 
ATOM 11722 C CA   . ILE A 1 94  ? 31.293 37.839 9.285  1.00 0.00 ? 64 ILE A CA   11 
ATOM 11723 C C    . ILE A 1 94  ? 30.661 38.995 8.507  1.00 0.00 ? 64 ILE A C    11 
ATOM 11724 O O    . ILE A 1 94  ? 30.870 40.162 8.840  1.00 0.00 ? 64 ILE A O    11 
ATOM 11725 C CB   . ILE A 1 94  ? 32.472 37.238 8.506  1.00 0.00 ? 64 ILE A CB   11 
ATOM 11726 C CG1  . ILE A 1 94  ? 33.116 36.133 9.346  1.00 0.00 ? 64 ILE A CG1  11 
ATOM 11727 C CG2  . ILE A 1 94  ? 33.530 38.304 8.201  1.00 0.00 ? 64 ILE A CG2  11 
ATOM 11728 C CD1  . ILE A 1 94  ? 34.131 35.369 8.495  1.00 0.00 ? 64 ILE A CD1  11 
ATOM 11729 H H    . ILE A 1 94  ? 30.451 35.889 9.213  1.00 0.00 ? 64 ILE A H    11 
ATOM 11730 H HA   . ILE A 1 94  ? 31.655 38.213 10.233 1.00 0.00 ? 64 ILE A HA   11 
ATOM 11731 H HB   . ILE A 1 94  ? 32.110 36.817 7.580  1.00 0.00 ? 64 ILE A HB   11 
ATOM 11732 H HG12 . ILE A 1 94  ? 33.616 36.576 10.195 1.00 0.00 ? 64 ILE A HG12 11 
ATOM 11733 H HG13 . ILE A 1 94  ? 32.354 35.452 9.693  1.00 0.00 ? 64 ILE A HG13 11 
ATOM 11734 H HG21 . ILE A 1 94  ? 34.279 37.889 7.540  1.00 0.00 ? 64 ILE A HG21 11 
ATOM 11735 H HG22 . ILE A 1 94  ? 33.998 38.621 9.122  1.00 0.00 ? 64 ILE A HG22 11 
ATOM 11736 H HG23 . ILE A 1 94  ? 33.063 39.152 7.725  1.00 0.00 ? 64 ILE A HG23 11 
ATOM 11737 H HD11 . ILE A 1 94  ? 35.008 35.982 8.345  1.00 0.00 ? 64 ILE A HD11 11 
ATOM 11738 H HD12 . ILE A 1 94  ? 33.693 35.129 7.539  1.00 0.00 ? 64 ILE A HD12 11 
ATOM 11739 H HD13 . ILE A 1 94  ? 34.412 34.457 9.002  1.00 0.00 ? 64 ILE A HD13 11 
ATOM 11740 N N    . ASP A 1 95  ? 29.862 38.668 7.493  1.00 0.00 ? 65 ASP A N    11 
ATOM 11741 C CA   . ASP A 1 95  ? 29.217 39.703 6.688  1.00 0.00 ? 65 ASP A CA   11 
ATOM 11742 C C    . ASP A 1 95  ? 28.317 40.584 7.550  1.00 0.00 ? 65 ASP A C    11 
ATOM 11743 O O    . ASP A 1 95  ? 28.343 41.810 7.434  1.00 0.00 ? 65 ASP A O    11 
ATOM 11744 C CB   . ASP A 1 95  ? 28.379 39.062 5.578  1.00 0.00 ? 65 ASP A CB   11 
ATOM 11745 C CG   . ASP A 1 95  ? 29.270 38.340 4.568  1.00 0.00 ? 65 ASP A CG   11 
ATOM 11746 O OD1  . ASP A 1 95  ? 30.421 38.720 4.429  1.00 0.00 ? 65 ASP A OD1  11 
ATOM 11747 O OD2  . ASP A 1 95  ? 28.782 37.413 3.943  1.00 0.00 ? 65 ASP A OD2  11 
ATOM 11748 H H    . ASP A 1 95  ? 29.736 37.724 7.262  1.00 0.00 ? 65 ASP A H    11 
ATOM 11749 H HA   . ASP A 1 95  ? 29.979 40.319 6.236  1.00 0.00 ? 65 ASP A HA   11 
ATOM 11750 H HB2  . ASP A 1 95  ? 27.694 38.352 6.016  1.00 0.00 ? 65 ASP A HB2  11 
ATOM 11751 H HB3  . ASP A 1 95  ? 27.816 39.830 5.070  1.00 0.00 ? 65 ASP A HB3  11 
ATOM 11752 N N    . GLU A 1 96  ? 27.554 39.962 8.445  1.00 0.00 ? 66 GLU A N    11 
ATOM 11753 C CA   . GLU A 1 96  ? 26.663 40.721 9.318  1.00 0.00 ? 66 GLU A CA   11 
ATOM 11754 C C    . GLU A 1 96  ? 27.463 41.652 10.224 1.00 0.00 ? 66 GLU A C    11 
ATOM 11755 O O    . GLU A 1 96  ? 27.123 42.828 10.373 1.00 0.00 ? 66 GLU A O    11 
ATOM 11756 C CB   . GLU A 1 96  ? 25.826 39.768 10.173 1.00 0.00 ? 66 GLU A CB   11 
ATOM 11757 C CG   . GLU A 1 96  ? 24.909 38.938 9.267  1.00 0.00 ? 66 GLU A CG   11 
ATOM 11758 C CD   . GLU A 1 96  ? 23.987 38.021 10.078 1.00 0.00 ? 66 GLU A CD   11 
ATOM 11759 O OE1  . GLU A 1 96  ? 23.083 37.462 9.478  1.00 0.00 ? 66 GLU A OE1  11 
ATOM 11760 O OE2  . GLU A 1 96  ? 24.191 37.876 11.275 1.00 0.00 ? 66 GLU A OE2  11 
ATOM 11761 H H    . GLU A 1 96  ? 27.566 38.984 8.495  1.00 0.00 ? 66 GLU A H    11 
ATOM 11762 H HA   . GLU A 1 96  ? 25.999 41.313 8.708  1.00 0.00 ? 66 GLU A HA   11 
ATOM 11763 H HB2  . GLU A 1 96  ? 26.483 39.109 10.724 1.00 0.00 ? 66 GLU A HB2  11 
ATOM 11764 H HB3  . GLU A 1 96  ? 25.225 40.337 10.865 1.00 0.00 ? 66 GLU A HB3  11 
ATOM 11765 H HG2  . GLU A 1 96  ? 24.304 39.606 8.673  1.00 0.00 ? 66 GLU A HG2  11 
ATOM 11766 H HG3  . GLU A 1 96  ? 25.517 38.335 8.608  1.00 0.00 ? 66 GLU A HG3  11 
ATOM 11767 N N    . PHE A 1 97  ? 28.546 41.138 10.800 1.00 0.00 ? 67 PHE A N    11 
ATOM 11768 C CA   . PHE A 1 97  ? 29.372 41.950 11.687 1.00 0.00 ? 67 PHE A CA   11 
ATOM 11769 C C    . PHE A 1 97  ? 29.933 43.167 10.957 1.00 0.00 ? 67 PHE A C    11 
ATOM 11770 O O    . PHE A 1 97  ? 29.979 44.261 11.521 1.00 0.00 ? 67 PHE A O    11 
ATOM 11771 C CB   . PHE A 1 97  ? 30.516 41.099 12.239 1.00 0.00 ? 67 PHE A CB   11 
ATOM 11772 C CG   . PHE A 1 97  ? 31.440 41.850 13.169 1.00 0.00 ? 67 PHE A CG   11 
ATOM 11773 C CD1  . PHE A 1 97  ? 32.736 42.180 12.753 1.00 0.00 ? 67 PHE A CD1  11 
ATOM 11774 C CD2  . PHE A 1 97  ? 30.999 42.220 14.445 1.00 0.00 ? 67 PHE A CD2  11 
ATOM 11775 C CE1  . PHE A 1 97  ? 33.591 42.879 13.614 1.00 0.00 ? 67 PHE A CE1  11 
ATOM 11776 C CE2  . PHE A 1 97  ? 31.853 42.918 15.306 1.00 0.00 ? 67 PHE A CE2  11 
ATOM 11777 C CZ   . PHE A 1 97  ? 33.149 43.247 14.891 1.00 0.00 ? 67 PHE A CZ   11 
ATOM 11778 H H    . PHE A 1 97  ? 28.775 40.197 10.652 1.00 0.00 ? 67 PHE A H    11 
ATOM 11779 H HA   . PHE A 1 97  ? 28.766 42.289 12.513 1.00 0.00 ? 67 PHE A HA   11 
ATOM 11780 H HB2  . PHE A 1 97  ? 30.091 40.269 12.779 1.00 0.00 ? 67 PHE A HB2  11 
ATOM 11781 H HB3  . PHE A 1 97  ? 31.090 40.713 11.408 1.00 0.00 ? 67 PHE A HB3  11 
ATOM 11782 H HD1  . PHE A 1 97  ? 33.079 41.894 11.769 1.00 0.00 ? 67 PHE A HD1  11 
ATOM 11783 H HD2  . PHE A 1 97  ? 29.999 41.966 14.766 1.00 0.00 ? 67 PHE A HD2  11 
ATOM 11784 H HE1  . PHE A 1 97  ? 34.589 43.133 13.294 1.00 0.00 ? 67 PHE A HE1  11 
ATOM 11785 H HE2  . PHE A 1 97  ? 31.514 43.202 16.292 1.00 0.00 ? 67 PHE A HE2  11 
ATOM 11786 H HZ   . PHE A 1 97  ? 33.809 43.785 15.555 1.00 0.00 ? 67 PHE A HZ   11 
ATOM 11787 N N    . LEU A 1 98  ? 30.360 42.981 9.709  1.00 0.00 ? 68 LEU A N    11 
ATOM 11788 C CA   . LEU A 1 98  ? 30.813 44.111 8.902  1.00 0.00 ? 68 LEU A CA   11 
ATOM 11789 C C    . LEU A 1 98  ? 29.674 45.096 8.648  1.00 0.00 ? 68 LEU A C    11 
ATOM 11790 O O    . LEU A 1 98  ? 29.879 46.309 8.665  1.00 0.00 ? 68 LEU A O    11 
ATOM 11791 C CB   . LEU A 1 98  ? 31.372 43.619 7.565  1.00 0.00 ? 68 LEU A CB   11 
ATOM 11792 C CG   . LEU A 1 98  ? 32.608 42.741 7.794  1.00 0.00 ? 68 LEU A CG   11 
ATOM 11793 C CD1  . LEU A 1 98  ? 33.057 42.128 6.462  1.00 0.00 ? 68 LEU A CD1  11 
ATOM 11794 C CD2  . LEU A 1 98  ? 33.744 43.594 8.369  1.00 0.00 ? 68 LEU A CD2  11 
ATOM 11795 H H    . LEU A 1 98  ? 30.396 42.075 9.339  1.00 0.00 ? 68 LEU A H    11 
ATOM 11796 H HA   . LEU A 1 98  ? 31.595 44.626 9.439  1.00 0.00 ? 68 LEU A HA   11 
ATOM 11797 H HB2  . LEU A 1 98  ? 30.615 43.044 7.052  1.00 0.00 ? 68 LEU A HB2  11 
ATOM 11798 H HB3  . LEU A 1 98  ? 31.648 44.469 6.958  1.00 0.00 ? 68 LEU A HB3  11 
ATOM 11799 H HG   . LEU A 1 98  ? 32.362 41.950 8.488  1.00 0.00 ? 68 LEU A HG   11 
ATOM 11800 H HD11 . LEU A 1 98  ? 32.848 42.816 5.657  1.00 0.00 ? 68 LEU A HD11 11 
ATOM 11801 H HD12 . LEU A 1 98  ? 32.520 41.206 6.293  1.00 0.00 ? 68 LEU A HD12 11 
ATOM 11802 H HD13 . LEU A 1 98  ? 34.118 41.923 6.491  1.00 0.00 ? 68 LEU A HD13 11 
ATOM 11803 H HD21 . LEU A 1 98  ? 33.574 43.754 9.424  1.00 0.00 ? 68 LEU A HD21 11 
ATOM 11804 H HD22 . LEU A 1 98  ? 33.771 44.546 7.861  1.00 0.00 ? 68 LEU A HD22 11 
ATOM 11805 H HD23 . LEU A 1 98  ? 34.684 43.082 8.228  1.00 0.00 ? 68 LEU A HD23 11 
ATOM 11806 N N    . ALA A 1 99  ? 28.474 44.571 8.411  1.00 0.00 ? 69 ALA A N    11 
ATOM 11807 C CA   . ALA A 1 99  ? 27.309 45.425 8.198  1.00 0.00 ? 69 ALA A CA   11 
ATOM 11808 C C    . ALA A 1 99  ? 27.004 46.281 9.428  1.00 0.00 ? 69 ALA A C    11 
ATOM 11809 O O    . ALA A 1 99  ? 26.541 47.414 9.302  1.00 0.00 ? 69 ALA A O    11 
ATOM 11810 C CB   . ALA A 1 99  ? 26.090 44.563 7.864  1.00 0.00 ? 69 ALA A CB   11 
ATOM 11811 H H    . ALA A 1 99  ? 28.379 43.598 8.337  1.00 0.00 ? 69 ALA A H    11 
ATOM 11812 H HA   . ALA A 1 99  ? 27.506 46.079 7.362  1.00 0.00 ? 69 ALA A HA   11 
ATOM 11813 H HB1  . ALA A 1 99  ? 26.116 43.660 8.455  1.00 0.00 ? 69 ALA A HB1  11 
ATOM 11814 H HB2  . ALA A 1 99  ? 26.106 44.308 6.815  1.00 0.00 ? 69 ALA A HB2  11 
ATOM 11815 H HB3  . ALA A 1 99  ? 25.188 45.113 8.086  1.00 0.00 ? 69 ALA A HB3  11 
ATOM 11816 N N    . THR A 1 100 ? 27.265 45.738 10.614 1.00 0.00 ? 70 THR A N    11 
ATOM 11817 C CA   . THR A 1 100 ? 27.080 46.494 11.851 1.00 0.00 ? 70 THR A CA   11 
ATOM 11818 C C    . THR A 1 100 ? 28.188 47.532 12.067 1.00 0.00 ? 70 THR A C    11 
ATOM 11819 O O    . THR A 1 100 ? 27.977 48.521 12.770 1.00 0.00 ? 70 THR A O    11 
ATOM 11820 C CB   . THR A 1 100 ? 27.049 45.531 13.040 1.00 0.00 ? 70 THR A CB   11 
ATOM 11821 O OG1  . THR A 1 100 ? 26.090 44.511 12.795 1.00 0.00 ? 70 THR A OG1  11 
ATOM 11822 C CG2  . THR A 1 100 ? 26.671 46.292 14.311 1.00 0.00 ? 70 THR A CG2  11 
ATOM 11823 H H    . THR A 1 100 ? 27.540 44.798 10.658 1.00 0.00 ? 70 THR A H    11 
ATOM 11824 H HA   . THR A 1 100 ? 26.131 47.006 11.803 1.00 0.00 ? 70 THR A HA   11 
ATOM 11825 H HB   . THR A 1 100 ? 28.024 45.085 13.168 1.00 0.00 ? 70 THR A HB   11 
ATOM 11826 H HG1  . THR A 1 100 ? 25.312 44.909 12.580 1.00 0.00 ? 70 THR A HG1  11 
ATOM 11827 H HG21 . THR A 1 100 ? 27.433 47.025 14.532 1.00 0.00 ? 70 THR A HG21 11 
ATOM 11828 H HG22 . THR A 1 100 ? 26.589 45.599 15.135 1.00 0.00 ? 70 THR A HG22 11 
ATOM 11829 H HG23 . THR A 1 100 ? 25.725 46.790 14.164 1.00 0.00 ? 70 THR A HG23 11 
ATOM 11830 N N    . GLY A 1 101 ? 29.360 47.317 11.470 1.00 0.00 ? 71 GLY A N    11 
ATOM 11831 C CA   . GLY A 1 101 ? 30.467 48.255 11.617 1.00 0.00 ? 71 GLY A CA   11 
ATOM 11832 C C    . GLY A 1 101 ? 30.999 48.250 13.046 1.00 0.00 ? 71 GLY A C    11 
ATOM 11833 O O    . GLY A 1 101 ? 30.976 47.222 13.724 1.00 0.00 ? 71 GLY A O    11 
ATOM 11834 H H    . GLY A 1 101 ? 29.480 46.514 10.921 1.00 0.00 ? 71 GLY A H    11 
ATOM 11835 H HA2  . GLY A 1 101 ? 31.260 47.975 10.940 1.00 0.00 ? 71 GLY A HA2  11 
ATOM 11836 H HA3  . GLY A 1 101 ? 30.124 49.250 11.375 1.00 0.00 ? 71 GLY A HA3  11 
ATOM 11837 N N    . GLU A 1 31  ? 47.989 42.424 18.434 1.00 0.00 ? 1  GLU A N    12 
ATOM 11838 C CA   . GLU A 1 31  ? 46.586 42.122 18.173 1.00 0.00 ? 1  GLU A CA   12 
ATOM 11839 C C    . GLU A 1 31  ? 46.355 41.904 16.681 1.00 0.00 ? 1  GLU A C    12 
ATOM 11840 O O    . GLU A 1 31  ? 46.371 42.851 15.895 1.00 0.00 ? 1  GLU A O    12 
ATOM 11841 C CB   . GLU A 1 31  ? 45.705 43.273 18.666 1.00 0.00 ? 1  GLU A CB   12 
ATOM 11842 C CG   . GLU A 1 31  ? 44.229 42.891 18.520 1.00 0.00 ? 1  GLU A CG   12 
ATOM 11843 C CD   . GLU A 1 31  ? 43.848 41.792 19.513 1.00 0.00 ? 1  GLU A CD   12 
ATOM 11844 O OE1  . GLU A 1 31  ? 42.909 41.069 19.225 1.00 0.00 ? 1  GLU A OE1  12 
ATOM 11845 O OE2  . GLU A 1 31  ? 44.485 41.694 20.551 1.00 0.00 ? 1  GLU A OE2  12 
ATOM 11846 H H    . GLU A 1 31  ? 48.242 42.906 19.248 1.00 0.00 ? 1  GLU A H    12 
ATOM 11847 H HA   . GLU A 1 31  ? 46.316 41.223 18.706 1.00 0.00 ? 1  GLU A HA   12 
ATOM 11848 H HB2  . GLU A 1 31  ? 45.925 43.473 19.705 1.00 0.00 ? 1  GLU A HB2  12 
ATOM 11849 H HB3  . GLU A 1 31  ? 45.904 44.157 18.080 1.00 0.00 ? 1  GLU A HB3  12 
ATOM 11850 H HG2  . GLU A 1 31  ? 43.617 43.762 18.703 1.00 0.00 ? 1  GLU A HG2  12 
ATOM 11851 H HG3  . GLU A 1 31  ? 44.051 42.537 17.515 1.00 0.00 ? 1  GLU A HG3  12 
ATOM 11852 N N    . THR A 1 32  ? 46.140 40.650 16.299 1.00 0.00 ? 2  THR A N    12 
ATOM 11853 C CA   . THR A 1 32  ? 45.901 40.319 14.898 1.00 0.00 ? 2  THR A CA   12 
ATOM 11854 C C    . THR A 1 32  ? 44.682 41.072 14.376 1.00 0.00 ? 2  THR A C    12 
ATOM 11855 O O    . THR A 1 32  ? 43.687 41.230 15.081 1.00 0.00 ? 2  THR A O    12 
ATOM 11856 C CB   . THR A 1 32  ? 45.683 38.812 14.744 1.00 0.00 ? 2  THR A CB   12 
ATOM 11857 O OG1  . THR A 1 32  ? 46.732 38.116 15.399 1.00 0.00 ? 2  THR A OG1  12 
ATOM 11858 C CG2  . THR A 1 32  ? 45.677 38.448 13.259 1.00 0.00 ? 2  THR A CG2  12 
ATOM 11859 H H    . THR A 1 32  ? 46.142 39.934 16.969 1.00 0.00 ? 2  THR A H    12 
ATOM 11860 H HA   . THR A 1 32  ? 46.766 40.607 14.319 1.00 0.00 ? 2  THR A HA   12 
ATOM 11861 H HB   . THR A 1 32  ? 44.735 38.536 15.183 1.00 0.00 ? 2  THR A HB   12 
ATOM 11862 H HG1  . THR A 1 32  ? 46.652 37.240 15.201 1.00 0.00 ? 2  THR A HG1  12 
ATOM 11863 H HG21 . THR A 1 32  ? 46.623 38.724 12.816 1.00 0.00 ? 2  THR A HG21 12 
ATOM 11864 H HG22 . THR A 1 32  ? 44.879 38.978 12.760 1.00 0.00 ? 2  THR A HG22 12 
ATOM 11865 H HG23 . THR A 1 32  ? 45.525 37.384 13.149 1.00 0.00 ? 2  THR A HG23 12 
ATOM 11866 N N    . LEU A 1 33  ? 44.739 41.483 13.115 1.00 0.00 ? 3  LEU A N    12 
ATOM 11867 C CA   . LEU A 1 33  ? 43.679 42.311 12.543 1.00 0.00 ? 3  LEU A CA   12 
ATOM 11868 C C    . LEU A 1 33  ? 42.309 41.632 12.620 1.00 0.00 ? 3  LEU A C    12 
ATOM 11869 O O    . LEU A 1 33  ? 41.284 42.311 12.698 1.00 0.00 ? 3  LEU A O    12 
ATOM 11870 C CB   . LEU A 1 33  ? 43.999 42.606 11.078 1.00 0.00 ? 3  LEU A CB   12 
ATOM 11871 C CG   . LEU A 1 33  ? 45.343 43.327 10.971 1.00 0.00 ? 3  LEU A CG   12 
ATOM 11872 C CD1  . LEU A 1 33  ? 45.747 43.437 9.500  1.00 0.00 ? 3  LEU A CD1  12 
ATOM 11873 C CD2  . LEU A 1 33  ? 45.213 44.731 11.564 1.00 0.00 ? 3  LEU A CD2  12 
ATOM 11874 H H    . LEU A 1 33  ? 45.504 41.227 12.558 1.00 0.00 ? 3  LEU A H    12 
ATOM 11875 H HA   . LEU A 1 33  ? 43.638 43.246 13.081 1.00 0.00 ? 3  LEU A HA   12 
ATOM 11876 H HB2  . LEU A 1 33  ? 44.042 41.678 10.526 1.00 0.00 ? 3  LEU A HB2  12 
ATOM 11877 H HB3  . LEU A 1 33  ? 43.224 43.233 10.668 1.00 0.00 ? 3  LEU A HB3  12 
ATOM 11878 H HG   . LEU A 1 33  ? 46.096 42.772 11.513 1.00 0.00 ? 3  LEU A HG   12 
ATOM 11879 H HD11 . LEU A 1 33  ? 45.055 44.086 8.984  1.00 0.00 ? 3  LEU A HD11 12 
ATOM 11880 H HD12 . LEU A 1 33  ? 45.728 42.456 9.047  1.00 0.00 ? 3  LEU A HD12 12 
ATOM 11881 H HD13 . LEU A 1 33  ? 46.744 43.847 9.430  1.00 0.00 ? 3  LEU A HD13 12 
ATOM 11882 H HD21 . LEU A 1 33  ? 44.335 45.211 11.158 1.00 0.00 ? 3  LEU A HD21 12 
ATOM 11883 H HD22 . LEU A 1 33  ? 46.089 45.310 11.311 1.00 0.00 ? 3  LEU A HD22 12 
ATOM 11884 H HD23 . LEU A 1 33  ? 45.123 44.662 12.638 1.00 0.00 ? 3  LEU A HD23 12 
ATOM 11885 N N    . ASN A 1 34  ? 42.287 40.304 12.597 1.00 0.00 ? 4  ASN A N    12 
ATOM 11886 C CA   . ASN A 1 34  ? 41.022 39.566 12.640 1.00 0.00 ? 4  ASN A CA   12 
ATOM 11887 C C    . ASN A 1 34  ? 40.649 39.105 14.060 1.00 0.00 ? 4  ASN A C    12 
ATOM 11888 O O    . ASN A 1 34  ? 39.705 38.332 14.230 1.00 0.00 ? 4  ASN A O    12 
ATOM 11889 C CB   . ASN A 1 34  ? 41.111 38.344 11.721 1.00 0.00 ? 4  ASN A CB   12 
ATOM 11890 C CG   . ASN A 1 34  ? 41.507 38.764 10.308 1.00 0.00 ? 4  ASN A CG   12 
ATOM 11891 O OD1  . ASN A 1 34  ? 40.899 39.664 9.723  1.00 0.00 ? 4  ASN A OD1  12 
ATOM 11892 N ND2  . ASN A 1 34  ? 42.496 38.154 9.710  1.00 0.00 ? 4  ASN A ND2  12 
ATOM 11893 H H    . ASN A 1 34  ? 43.130 39.809 12.550 1.00 0.00 ? 4  ASN A H    12 
ATOM 11894 H HA   . ASN A 1 34  ? 40.237 40.209 12.272 1.00 0.00 ? 4  ASN A HA   12 
ATOM 11895 H HB2  . ASN A 1 34  ? 41.851 37.658 12.110 1.00 0.00 ? 4  ASN A HB2  12 
ATOM 11896 H HB3  . ASN A 1 34  ? 40.151 37.850 11.691 1.00 0.00 ? 4  ASN A HB3  12 
ATOM 11897 H HD21 . ASN A 1 34  ? 42.970 37.428 10.166 1.00 0.00 ? 4  ASN A HD21 12 
ATOM 11898 H HD22 . ASN A 1 34  ? 42.775 38.438 8.815  1.00 0.00 ? 4  ASN A HD22 12 
ATOM 11899 N N    . GLY A 1 35  ? 41.368 39.572 15.084 1.00 0.00 ? 5  GLY A N    12 
ATOM 11900 C CA   . GLY A 1 35  ? 41.165 39.077 16.440 1.00 0.00 ? 5  GLY A CA   12 
ATOM 11901 C C    . GLY A 1 35  ? 39.708 39.185 16.874 1.00 0.00 ? 5  GLY A C    12 
ATOM 11902 O O    . GLY A 1 35  ? 39.192 38.284 17.537 1.00 0.00 ? 5  GLY A O    12 
ATOM 11903 H H    . GLY A 1 35  ? 42.046 40.260 14.923 1.00 0.00 ? 5  GLY A H    12 
ATOM 11904 H HA2  . GLY A 1 35  ? 41.472 38.042 16.486 1.00 0.00 ? 5  GLY A HA2  12 
ATOM 11905 H HA3  . GLY A 1 35  ? 41.775 39.655 17.118 1.00 0.00 ? 5  GLY A HA3  12 
ATOM 11906 N N    . ALA A 1 36  ? 39.037 40.270 16.491 1.00 0.00 ? 6  ALA A N    12 
ATOM 11907 C CA   . ALA A 1 36  ? 37.654 40.468 16.912 1.00 0.00 ? 6  ALA A CA   12 
ATOM 11908 C C    . ALA A 1 36  ? 36.776 39.329 16.405 1.00 0.00 ? 6  ALA A C    12 
ATOM 11909 O O    . ALA A 1 36  ? 36.012 38.731 17.167 1.00 0.00 ? 6  ALA A O    12 
ATOM 11910 C CB   . ALA A 1 36  ? 37.128 41.799 16.374 1.00 0.00 ? 6  ALA A CB   12 
ATOM 11911 H H    . ALA A 1 36  ? 39.475 40.939 15.923 1.00 0.00 ? 6  ALA A H    12 
ATOM 11912 H HA   . ALA A 1 36  ? 37.615 40.488 17.991 1.00 0.00 ? 6  ALA A HA   12 
ATOM 11913 H HB1  . ALA A 1 36  ? 36.049 41.777 16.350 1.00 0.00 ? 6  ALA A HB1  12 
ATOM 11914 H HB2  . ALA A 1 36  ? 37.508 41.959 15.375 1.00 0.00 ? 6  ALA A HB2  12 
ATOM 11915 H HB3  . ALA A 1 36  ? 37.458 42.603 17.017 1.00 0.00 ? 6  ALA A HB3  12 
ATOM 11916 N N    . LEU A 1 37  ? 36.911 39.001 15.122 1.00 0.00 ? 7  LEU A N    12 
ATOM 11917 C CA   . LEU A 1 37  ? 36.158 37.884 14.558 1.00 0.00 ? 7  LEU A CA   12 
ATOM 11918 C C    . LEU A 1 37  ? 36.535 36.568 15.240 1.00 0.00 ? 7  LEU A C    12 
ATOM 11919 O O    . LEU A 1 37  ? 35.678 35.714 15.464 1.00 0.00 ? 7  LEU A O    12 
ATOM 11920 C CB   . LEU A 1 37  ? 36.406 37.792 13.049 1.00 0.00 ? 7  LEU A CB   12 
ATOM 11921 C CG   . LEU A 1 37  ? 35.998 39.108 12.376 1.00 0.00 ? 7  LEU A CG   12 
ATOM 11922 C CD1  . LEU A 1 37  ? 36.345 39.054 10.887 1.00 0.00 ? 7  LEU A CD1  12 
ATOM 11923 C CD2  . LEU A 1 37  ? 34.489 39.325 12.525 1.00 0.00 ? 7  LEU A CD2  12 
ATOM 11924 H H    . LEU A 1 37  ? 37.523 39.511 14.552 1.00 0.00 ? 7  LEU A H    12 
ATOM 11925 H HA   . LEU A 1 37  ? 35.106 38.061 14.726 1.00 0.00 ? 7  LEU A HA   12 
ATOM 11926 H HB2  . LEU A 1 37  ? 37.454 37.605 12.870 1.00 0.00 ? 7  LEU A HB2  12 
ATOM 11927 H HB3  . LEU A 1 37  ? 35.821 36.985 12.637 1.00 0.00 ? 7  LEU A HB3  12 
ATOM 11928 H HG   . LEU A 1 37  ? 36.529 39.928 12.839 1.00 0.00 ? 7  LEU A HG   12 
ATOM 11929 H HD11 . LEU A 1 37  ? 35.745 39.777 10.353 1.00 0.00 ? 7  LEU A HD11 12 
ATOM 11930 H HD12 . LEU A 1 37  ? 36.142 38.065 10.506 1.00 0.00 ? 7  LEU A HD12 12 
ATOM 11931 H HD13 . LEU A 1 37  ? 37.391 39.284 10.752 1.00 0.00 ? 7  LEU A HD13 12 
ATOM 11932 H HD21 . LEU A 1 37  ? 33.976 38.384 12.388 1.00 0.00 ? 7  LEU A HD21 12 
ATOM 11933 H HD22 . LEU A 1 37  ? 34.152 40.030 11.780 1.00 0.00 ? 7  LEU A HD22 12 
ATOM 11934 H HD23 . LEU A 1 37  ? 34.277 39.712 13.510 1.00 0.00 ? 7  LEU A HD23 12 
ATOM 11935 N N    . VAL A 1 38  ? 37.809 36.419 15.602 1.00 0.00 ? 8  VAL A N    12 
ATOM 11936 C CA   . VAL A 1 38  ? 38.243 35.229 16.328 1.00 0.00 ? 8  VAL A CA   12 
ATOM 11937 C C    . VAL A 1 38  ? 37.495 35.125 17.660 1.00 0.00 ? 8  VAL A C    12 
ATOM 11938 O O    . VAL A 1 38  ? 37.062 34.042 18.054 1.00 0.00 ? 8  VAL A O    12 
ATOM 11939 C CB   . VAL A 1 38  ? 39.760 35.283 16.560 1.00 0.00 ? 8  VAL A CB   12 
ATOM 11940 C CG1  . VAL A 1 38  ? 40.234 34.041 17.325 1.00 0.00 ? 8  VAL A CG1  12 
ATOM 11941 C CG2  . VAL A 1 38  ? 40.475 35.341 15.206 1.00 0.00 ? 8  VAL A CG2  12 
ATOM 11942 H H    . VAL A 1 38  ? 38.466 37.101 15.348 1.00 0.00 ? 8  VAL A H    12 
ATOM 11943 H HA   . VAL A 1 38  ? 38.014 34.356 15.734 1.00 0.00 ? 8  VAL A HA   12 
ATOM 11944 H HB   . VAL A 1 38  ? 40.002 36.166 17.131 1.00 0.00 ? 8  VAL A HB   12 
ATOM 11945 H HG11 . VAL A 1 38  ? 40.115 34.207 18.386 1.00 0.00 ? 8  VAL A HG11 12 
ATOM 11946 H HG12 . VAL A 1 38  ? 41.275 33.851 17.106 1.00 0.00 ? 8  VAL A HG12 12 
ATOM 11947 H HG13 . VAL A 1 38  ? 39.641 33.190 17.026 1.00 0.00 ? 8  VAL A HG13 12 
ATOM 11948 H HG21 . VAL A 1 38  ? 41.507 35.625 15.355 1.00 0.00 ? 8  VAL A HG21 12 
ATOM 11949 H HG22 . VAL A 1 38  ? 39.992 36.070 14.572 1.00 0.00 ? 8  VAL A HG22 12 
ATOM 11950 H HG23 . VAL A 1 38  ? 40.434 34.371 14.735 1.00 0.00 ? 8  VAL A HG23 12 
ATOM 11951 N N    . ASN A 1 39  ? 37.308 36.260 18.329 1.00 0.00 ? 9  ASN A N    12 
ATOM 11952 C CA   . ASN A 1 39  ? 36.537 36.280 19.567 1.00 0.00 ? 9  ASN A CA   12 
ATOM 11953 C C    . ASN A 1 39  ? 35.099 35.837 19.309 1.00 0.00 ? 9  ASN A C    12 
ATOM 11954 O O    . ASN A 1 39  ? 34.519 35.087 20.100 1.00 0.00 ? 9  ASN A O    12 
ATOM 11955 C CB   . ASN A 1 39  ? 36.539 37.689 20.161 1.00 0.00 ? 9  ASN A CB   12 
ATOM 11956 C CG   . ASN A 1 39  ? 35.906 37.670 21.548 1.00 0.00 ? 9  ASN A CG   12 
ATOM 11957 O OD1  . ASN A 1 39  ? 34.770 38.112 21.720 1.00 0.00 ? 9  ASN A OD1  12 
ATOM 11958 N ND2  . ASN A 1 39  ? 36.578 37.182 22.556 1.00 0.00 ? 9  ASN A ND2  12 
ATOM 11959 H H    . ASN A 1 39  ? 37.724 37.085 18.004 1.00 0.00 ? 9  ASN A H    12 
ATOM 11960 H HA   . ASN A 1 39  ? 36.991 35.601 20.274 1.00 0.00 ? 9  ASN A HA   12 
ATOM 11961 H HB2  . ASN A 1 39  ? 37.557 38.045 20.236 1.00 0.00 ? 9  ASN A HB2  12 
ATOM 11962 H HB3  . ASN A 1 39  ? 35.974 38.349 19.521 1.00 0.00 ? 9  ASN A HB3  12 
ATOM 11963 H HD21 . ASN A 1 39  ? 37.483 36.831 22.417 1.00 0.00 ? 9  ASN A HD21 12 
ATOM 11964 H HD22 . ASN A 1 39  ? 36.179 37.166 23.449 1.00 0.00 ? 9  ASN A HD22 12 
ATOM 11965 N N    . MET A 1 40  ? 34.539 36.264 18.177 1.00 0.00 ? 10 MET A N    12 
ATOM 11966 C CA   . MET A 1 40  ? 33.183 35.860 17.823 1.00 0.00 ? 10 MET A CA   12 
ATOM 11967 C C    . MET A 1 40  ? 33.106 34.344 17.692 1.00 0.00 ? 10 MET A C    12 
ATOM 11968 O O    . MET A 1 40  ? 32.195 33.710 18.226 1.00 0.00 ? 10 MET A O    12 
ATOM 11969 C CB   . MET A 1 40  ? 32.809 36.464 16.469 1.00 0.00 ? 10 MET A CB   12 
ATOM 11970 C CG   . MET A 1 40  ? 31.314 36.263 16.208 1.00 0.00 ? 10 MET A CG   12 
ATOM 11971 S SD   . MET A 1 40  ? 30.957 36.497 14.447 1.00 0.00 ? 10 MET A SD   12 
ATOM 11972 C CE   . MET A 1 40  ? 31.423 38.238 14.290 1.00 0.00 ? 10 MET A CE   12 
ATOM 11973 H H    . MET A 1 40  ? 35.027 36.894 17.604 1.00 0.00 ? 10 MET A H    12 
ATOM 11974 H HA   . MET A 1 40  ? 32.489 36.203 18.575 1.00 0.00 ? 10 MET A HA   12 
ATOM 11975 H HB2  . MET A 1 40  ? 33.036 37.520 16.480 1.00 0.00 ? 10 MET A HB2  12 
ATOM 11976 H HB3  . MET A 1 40  ? 33.377 35.981 15.688 1.00 0.00 ? 10 MET A HB3  12 
ATOM 11977 H HG2  . MET A 1 40  ? 31.030 35.265 16.501 1.00 0.00 ? 10 MET A HG2  12 
ATOM 11978 H HG3  . MET A 1 40  ? 30.751 36.981 16.786 1.00 0.00 ? 10 MET A HG3  12 
ATOM 11979 H HE1  . MET A 1 40  ? 30.721 38.850 14.838 1.00 0.00 ? 10 MET A HE1  12 
ATOM 11980 H HE2  . MET A 1 40  ? 31.407 38.517 13.247 1.00 0.00 ? 10 MET A HE2  12 
ATOM 11981 H HE3  . MET A 1 40  ? 32.419 38.384 14.680 1.00 0.00 ? 10 MET A HE3  12 
ATOM 11982 N N    . LEU A 1 41  ? 34.099 33.761 17.026 1.00 0.00 ? 11 LEU A N    12 
ATOM 11983 C CA   . LEU A 1 41  ? 34.128 32.315 16.853 1.00 0.00 ? 11 LEU A CA   12 
ATOM 11984 C C    . LEU A 1 41  ? 34.221 31.604 18.197 1.00 0.00 ? 11 LEU A C    12 
ATOM 11985 O O    . LEU A 1 41  ? 33.546 30.600 18.416 1.00 0.00 ? 11 LEU A O    12 
ATOM 11986 C CB   . LEU A 1 41  ? 35.317 31.909 15.979 1.00 0.00 ? 11 LEU A CB   12 
ATOM 11987 C CG   . LEU A 1 41  ? 35.191 32.553 14.595 1.00 0.00 ? 11 LEU A CG   12 
ATOM 11988 C CD1  . LEU A 1 41  ? 36.455 32.258 13.785 1.00 0.00 ? 11 LEU A CD1  12 
ATOM 11989 C CD2  . LEU A 1 41  ? 33.978 31.975 13.863 1.00 0.00 ? 11 LEU A CD2  12 
ATOM 11990 H H    . LEU A 1 41  ? 34.798 34.314 16.619 1.00 0.00 ? 11 LEU A H    12 
ATOM 11991 H HA   . LEU A 1 41  ? 33.216 32.005 16.365 1.00 0.00 ? 11 LEU A HA   12 
ATOM 11992 H HB2  . LEU A 1 41  ? 36.233 32.239 16.446 1.00 0.00 ? 11 LEU A HB2  12 
ATOM 11993 H HB3  . LEU A 1 41  ? 35.333 30.835 15.871 1.00 0.00 ? 11 LEU A HB3  12 
ATOM 11994 H HG   . LEU A 1 41  ? 35.075 33.621 14.704 1.00 0.00 ? 11 LEU A HG   12 
ATOM 11995 H HD11 . LEU A 1 41  ? 37.221 32.973 14.042 1.00 0.00 ? 11 LEU A HD11 12 
ATOM 11996 H HD12 . LEU A 1 41  ? 36.232 32.331 12.731 1.00 0.00 ? 11 LEU A HD12 12 
ATOM 11997 H HD13 . LEU A 1 41  ? 36.802 31.260 14.011 1.00 0.00 ? 11 LEU A HD13 12 
ATOM 11998 H HD21 . LEU A 1 41  ? 34.100 32.113 12.799 1.00 0.00 ? 11 LEU A HD21 12 
ATOM 11999 H HD22 . LEU A 1 41  ? 33.083 32.483 14.192 1.00 0.00 ? 11 LEU A HD22 12 
ATOM 12000 H HD23 . LEU A 1 41  ? 33.894 30.921 14.083 1.00 0.00 ? 11 LEU A HD23 12 
ATOM 12001 N N    . LYS A 1 42  ? 35.036 32.139 19.104 1.00 0.00 ? 12 LYS A N    12 
ATOM 12002 C CA   . LYS A 1 42  ? 35.206 31.509 20.408 1.00 0.00 ? 12 LYS A CA   12 
ATOM 12003 C C    . LYS A 1 42  ? 33.876 31.419 21.151 1.00 0.00 ? 12 LYS A C    12 
ATOM 12004 O O    . LYS A 1 42  ? 33.520 30.358 21.670 1.00 0.00 ? 12 LYS A O    12 
ATOM 12005 C CB   . LYS A 1 42  ? 36.206 32.315 21.242 1.00 0.00 ? 12 LYS A CB   12 
ATOM 12006 C CG   . LYS A 1 42  ? 36.512 31.588 22.554 1.00 0.00 ? 12 LYS A CG   12 
ATOM 12007 C CD   . LYS A 1 42  ? 37.436 30.397 22.286 1.00 0.00 ? 12 LYS A CD   12 
ATOM 12008 C CE   . LYS A 1 42  ? 37.811 29.732 23.610 1.00 0.00 ? 12 LYS A CE   12 
ATOM 12009 N NZ   . LYS A 1 42  ? 36.678 28.883 24.079 1.00 0.00 ? 12 LYS A NZ   12 
ATOM 12010 H H    . LYS A 1 42  ? 35.557 32.938 18.878 1.00 0.00 ? 12 LYS A H    12 
ATOM 12011 H HA   . LYS A 1 42  ? 35.595 30.512 20.265 1.00 0.00 ? 12 LYS A HA   12 
ATOM 12012 H HB2  . LYS A 1 42  ? 37.121 32.438 20.679 1.00 0.00 ? 12 LYS A HB2  12 
ATOM 12013 H HB3  . LYS A 1 42  ? 35.788 33.285 21.461 1.00 0.00 ? 12 LYS A HB3  12 
ATOM 12014 H HG2  . LYS A 1 42  ? 36.997 32.272 23.237 1.00 0.00 ? 12 LYS A HG2  12 
ATOM 12015 H HG3  . LYS A 1 42  ? 35.594 31.233 22.997 1.00 0.00 ? 12 LYS A HG3  12 
ATOM 12016 H HD2  . LYS A 1 42  ? 36.928 29.683 21.653 1.00 0.00 ? 12 LYS A HD2  12 
ATOM 12017 H HD3  . LYS A 1 42  ? 38.333 30.741 21.792 1.00 0.00 ? 12 LYS A HD3  12 
ATOM 12018 H HE2  . LYS A 1 42  ? 38.687 29.116 23.469 1.00 0.00 ? 12 LYS A HE2  12 
ATOM 12019 H HE3  . LYS A 1 42  ? 38.020 30.491 24.348 1.00 0.00 ? 12 LYS A HE3  12 
ATOM 12020 H HZ1  . LYS A 1 42  ? 35.790 29.229 23.661 1.00 0.00 ? 12 LYS A HZ1  12 
ATOM 12021 H HZ2  . LYS A 1 42  ? 36.616 28.931 25.116 1.00 0.00 ? 12 LYS A HZ2  12 
ATOM 12022 H HZ3  . LYS A 1 42  ? 36.836 27.899 23.783 1.00 0.00 ? 12 LYS A HZ3  12 
ATOM 12023 N N    . GLU A 1 43  ? 33.116 32.515 21.155 1.00 0.00 ? 13 GLU A N    12 
ATOM 12024 C CA   . GLU A 1 43  ? 31.834 32.521 21.853 1.00 0.00 ? 13 GLU A CA   12 
ATOM 12025 C C    . GLU A 1 43  ? 30.848 31.562 21.195 1.00 0.00 ? 13 GLU A C    12 
ATOM 12026 O O    . GLU A 1 43  ? 30.173 30.786 21.876 1.00 0.00 ? 13 GLU A O    12 
ATOM 12027 C CB   . GLU A 1 43  ? 31.248 33.934 21.856 1.00 0.00 ? 13 GLU A CB   12 
ATOM 12028 C CG   . GLU A 1 43  ? 30.001 33.970 22.749 1.00 0.00 ? 13 GLU A CG   12 
ATOM 12029 C CD   . GLU A 1 43  ? 29.313 35.340 22.717 1.00 0.00 ? 13 GLU A CD   12 
ATOM 12030 O OE1  . GLU A 1 43  ? 28.326 35.486 23.419 1.00 0.00 ? 13 GLU A OE1  12 
ATOM 12031 O OE2  . GLU A 1 43  ? 29.767 36.222 22.002 1.00 0.00 ? 13 GLU A OE2  12 
ATOM 12032 H H    . GLU A 1 43  ? 33.436 33.331 20.712 1.00 0.00 ? 13 GLU A H    12 
ATOM 12033 H HA   . GLU A 1 43  ? 31.993 32.210 22.875 1.00 0.00 ? 13 GLU A HA   12 
ATOM 12034 H HB2  . GLU A 1 43  ? 31.985 34.627 22.235 1.00 0.00 ? 13 GLU A HB2  12 
ATOM 12035 H HB3  . GLU A 1 43  ? 30.974 34.212 20.849 1.00 0.00 ? 13 GLU A HB3  12 
ATOM 12036 H HG2  . GLU A 1 43  ? 29.303 33.221 22.408 1.00 0.00 ? 13 GLU A HG2  12 
ATOM 12037 H HG3  . GLU A 1 43  ? 30.291 33.743 23.764 1.00 0.00 ? 13 GLU A HG3  12 
ATOM 12038 N N    . GLU A 1 44  ? 30.799 31.582 19.867 1.00 0.00 ? 14 GLU A N    12 
ATOM 12039 C CA   . GLU A 1 44  ? 29.901 30.690 19.141 1.00 0.00 ? 14 GLU A CA   12 
ATOM 12040 C C    . GLU A 1 44  ? 30.279 29.227 19.358 1.00 0.00 ? 14 GLU A C    12 
ATOM 12041 O O    . GLU A 1 44  ? 29.406 28.369 19.491 1.00 0.00 ? 14 GLU A O    12 
ATOM 12042 C CB   . GLU A 1 44  ? 29.931 31.036 17.651 1.00 0.00 ? 14 GLU A CB   12 
ATOM 12043 C CG   . GLU A 1 44  ? 29.359 32.446 17.465 1.00 0.00 ? 14 GLU A CG   12 
ATOM 12044 C CD   . GLU A 1 44  ? 29.296 32.851 15.991 1.00 0.00 ? 14 GLU A CD   12 
ATOM 12045 O OE1  . GLU A 1 44  ? 28.706 33.885 15.720 1.00 0.00 ? 14 GLU A OE1  12 
ATOM 12046 O OE2  . GLU A 1 44  ? 29.836 32.143 15.152 1.00 0.00 ? 14 GLU A OE2  12 
ATOM 12047 H H    . GLU A 1 44  ? 31.354 32.218 19.369 1.00 0.00 ? 14 GLU A H    12 
ATOM 12048 H HA   . GLU A 1 44  ? 28.897 30.843 19.506 1.00 0.00 ? 14 GLU A HA   12 
ATOM 12049 H HB2  . GLU A 1 44  ? 30.950 31.005 17.292 1.00 0.00 ? 14 GLU A HB2  12 
ATOM 12050 H HB3  . GLU A 1 44  ? 29.328 30.330 17.101 1.00 0.00 ? 14 GLU A HB3  12 
ATOM 12051 H HG2  . GLU A 1 44  ? 28.360 32.474 17.875 1.00 0.00 ? 14 GLU A HG2  12 
ATOM 12052 H HG3  . GLU A 1 44  ? 29.976 33.151 18.001 1.00 0.00 ? 14 GLU A HG3  12 
ATOM 12053 N N    . GLY A 1 45  ? 31.578 28.949 19.426 1.00 0.00 ? 15 GLY A N    12 
ATOM 12054 C CA   . GLY A 1 45  ? 32.037 27.589 19.677 1.00 0.00 ? 15 GLY A CA   12 
ATOM 12055 C C    . GLY A 1 45  ? 31.531 27.088 21.022 1.00 0.00 ? 15 GLY A C    12 
ATOM 12056 O O    . GLY A 1 45  ? 31.002 25.979 21.123 1.00 0.00 ? 15 GLY A O    12 
ATOM 12057 H H    . GLY A 1 45  ? 32.234 29.661 19.285 1.00 0.00 ? 15 GLY A H    12 
ATOM 12058 H HA2  . GLY A 1 45  ? 31.673 26.941 18.892 1.00 0.00 ? 15 GLY A HA2  12 
ATOM 12059 H HA3  . GLY A 1 45  ? 33.117 27.573 19.679 1.00 0.00 ? 15 GLY A HA3  12 
ATOM 12060 N N    . ASN A 1 46  ? 31.661 27.921 22.052 1.00 0.00 ? 16 ASN A N    12 
ATOM 12061 C CA   . ASN A 1 46  ? 31.170 27.545 23.374 1.00 0.00 ? 16 ASN A CA   12 
ATOM 12062 C C    . ASN A 1 46  ? 29.661 27.317 23.346 1.00 0.00 ? 16 ASN A C    12 
ATOM 12063 O O    . ASN A 1 46  ? 29.160 26.385 23.975 1.00 0.00 ? 16 ASN A O    12 
ATOM 12064 C CB   . ASN A 1 46  ? 31.505 28.642 24.388 1.00 0.00 ? 16 ASN A CB   12 
ATOM 12065 C CG   . ASN A 1 46  ? 33.016 28.767 24.558 1.00 0.00 ? 16 ASN A CG   12 
ATOM 12066 O OD1  . ASN A 1 46  ? 33.760 27.831 24.260 1.00 0.00 ? 16 ASN A OD1  12 
ATOM 12067 N ND2  . ASN A 1 46  ? 33.519 29.878 25.024 1.00 0.00 ? 16 ASN A ND2  12 
ATOM 12068 H H    . ASN A 1 46  ? 32.119 28.781 21.928 1.00 0.00 ? 16 ASN A H    12 
ATOM 12069 H HA   . ASN A 1 46  ? 31.656 26.632 23.680 1.00 0.00 ? 16 ASN A HA   12 
ATOM 12070 H HB2  . ASN A 1 46  ? 31.105 29.584 24.039 1.00 0.00 ? 16 ASN A HB2  12 
ATOM 12071 H HB3  . ASN A 1 46  ? 31.058 28.395 25.340 1.00 0.00 ? 16 ASN A HB3  12 
ATOM 12072 H HD21 . ASN A 1 46  ? 32.927 30.622 25.261 1.00 0.00 ? 16 ASN A HD21 12 
ATOM 12073 H HD22 . ASN A 1 46  ? 34.488 29.967 25.137 1.00 0.00 ? 16 ASN A HD22 12 
ATOM 12074 N N    . LYS A 1 47  ? 28.941 28.139 22.583 1.00 0.00 ? 17 LYS A N    12 
ATOM 12075 C CA   . LYS A 1 47  ? 27.499 27.959 22.455 1.00 0.00 ? 17 LYS A CA   12 
ATOM 12076 C C    . LYS A 1 47  ? 27.180 26.602 21.835 1.00 0.00 ? 17 LYS A C    12 
ATOM 12077 O O    . LYS A 1 47  ? 26.314 25.870 22.327 1.00 0.00 ? 17 LYS A O    12 
ATOM 12078 C CB   . LYS A 1 47  ? 26.911 29.075 21.585 1.00 0.00 ? 17 LYS A CB   12 
ATOM 12079 C CG   . LYS A 1 47  ? 25.382 28.984 21.575 1.00 0.00 ? 17 LYS A CG   12 
ATOM 12080 C CD   . LYS A 1 47  ? 24.826 29.500 22.904 1.00 0.00 ? 17 LYS A CD   12 
ATOM 12081 C CE   . LYS A 1 47  ? 23.297 29.501 22.854 1.00 0.00 ? 17 LYS A CE   12 
ATOM 12082 N NZ   . LYS A 1 47  ? 22.761 30.214 24.047 1.00 0.00 ? 17 LYS A NZ   12 
ATOM 12083 H H    . LYS A 1 47  ? 29.378 28.896 22.139 1.00 0.00 ? 17 LYS A H    12 
ATOM 12084 H HA   . LYS A 1 47  ? 27.053 28.011 23.437 1.00 0.00 ? 17 LYS A HA   12 
ATOM 12085 H HB2  . LYS A 1 47  ? 27.212 30.034 21.981 1.00 0.00 ? 17 LYS A HB2  12 
ATOM 12086 H HB3  . LYS A 1 47  ? 27.281 28.972 20.575 1.00 0.00 ? 17 LYS A HB3  12 
ATOM 12087 H HG2  . LYS A 1 47  ? 24.994 29.583 20.765 1.00 0.00 ? 17 LYS A HG2  12 
ATOM 12088 H HG3  . LYS A 1 47  ? 25.081 27.956 21.438 1.00 0.00 ? 17 LYS A HG3  12 
ATOM 12089 H HD2  . LYS A 1 47  ? 25.159 28.861 23.708 1.00 0.00 ? 17 LYS A HD2  12 
ATOM 12090 H HD3  . LYS A 1 47  ? 25.177 30.507 23.075 1.00 0.00 ? 17 LYS A HD3  12 
ATOM 12091 H HE2  . LYS A 1 47  ? 22.967 30.003 21.956 1.00 0.00 ? 17 LYS A HE2  12 
ATOM 12092 H HE3  . LYS A 1 47  ? 22.936 28.483 22.850 1.00 0.00 ? 17 LYS A HE3  12 
ATOM 12093 H HZ1  . LYS A 1 47  ? 22.706 29.555 24.850 1.00 0.00 ? 17 LYS A HZ1  12 
ATOM 12094 H HZ2  . LYS A 1 47  ? 21.813 30.583 23.832 1.00 0.00 ? 17 LYS A HZ2  12 
ATOM 12095 H HZ3  . LYS A 1 47  ? 23.393 31.003 24.293 1.00 0.00 ? 17 LYS A HZ3  12 
ATOM 12096 N N    . ALA A 1 48  ? 27.914 26.242 20.782 1.00 0.00 ? 18 ALA A N    12 
ATOM 12097 C CA   . ALA A 1 48  ? 27.690 24.956 20.135 1.00 0.00 ? 18 ALA A CA   12 
ATOM 12098 C C    . ALA A 1 48  ? 27.924 23.822 21.127 1.00 0.00 ? 18 ALA A C    12 
ATOM 12099 O O    . ALA A 1 48  ? 27.170 22.851 21.152 1.00 0.00 ? 18 ALA A O    12 
ATOM 12100 C CB   . ALA A 1 48  ? 28.619 24.796 18.931 1.00 0.00 ? 18 ALA A CB   12 
ATOM 12101 H H    . ALA A 1 48  ? 28.593 26.853 20.426 1.00 0.00 ? 18 ALA A H    12 
ATOM 12102 H HA   . ALA A 1 48  ? 26.667 24.915 19.790 1.00 0.00 ? 18 ALA A HA   12 
ATOM 12103 H HB1  . ALA A 1 48  ? 28.773 25.757 18.463 1.00 0.00 ? 18 ALA A HB1  12 
ATOM 12104 H HB2  . ALA A 1 48  ? 28.171 24.116 18.220 1.00 0.00 ? 18 ALA A HB2  12 
ATOM 12105 H HB3  . ALA A 1 48  ? 29.568 24.399 19.259 1.00 0.00 ? 18 ALA A HB3  12 
ATOM 12106 N N    . LEU A 1 49  ? 28.973 23.946 21.939 1.00 0.00 ? 19 LEU A N    12 
ATOM 12107 C CA   . LEU A 1 49  ? 29.224 22.956 22.981 1.00 0.00 ? 19 LEU A CA   12 
ATOM 12108 C C    . LEU A 1 49  ? 28.056 22.898 23.965 1.00 0.00 ? 19 LEU A C    12 
ATOM 12109 O O    . LEU A 1 49  ? 27.616 21.816 24.351 1.00 0.00 ? 19 LEU A O    12 
ATOM 12110 C CB   . LEU A 1 49  ? 30.510 23.308 23.733 1.00 0.00 ? 19 LEU A CB   12 
ATOM 12111 C CG   . LEU A 1 49  ? 30.878 22.183 24.705 1.00 0.00 ? 19 LEU A CG   12 
ATOM 12112 C CD1  . LEU A 1 49  ? 31.556 21.043 23.942 1.00 0.00 ? 19 LEU A CD1  12 
ATOM 12113 C CD2  . LEU A 1 49  ? 31.836 22.725 25.767 1.00 0.00 ? 19 LEU A CD2  12 
ATOM 12114 H H    . LEU A 1 49  ? 29.597 24.691 21.817 1.00 0.00 ? 19 LEU A H    12 
ATOM 12115 H HA   . LEU A 1 49  ? 29.342 21.987 22.522 1.00 0.00 ? 19 LEU A HA   12 
ATOM 12116 H HB2  . LEU A 1 49  ? 31.313 23.444 23.022 1.00 0.00 ? 19 LEU A HB2  12 
ATOM 12117 H HB3  . LEU A 1 49  ? 30.363 24.223 24.287 1.00 0.00 ? 19 LEU A HB3  12 
ATOM 12118 H HG   . LEU A 1 49  ? 29.984 21.811 25.184 1.00 0.00 ? 19 LEU A HG   12 
ATOM 12119 H HD11 . LEU A 1 49