data_6H7L
# 
_entry.id   6H7L 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.308 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6H7L         
WWPDB D_1200010077 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6H7L 
_pdbx_database_status.recvd_initial_deposition_date   2018-07-31 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Warne, T.'      1 0000-0001-9646-6080 
'Edwards, P.C.'  2 ?                   
'Dore, A.S.'     3 ?                   
'Leslie, A.G.W.' 4 ?                   
'Tate, C.G.'     5 0000-0002-2008-9183 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Science 
_citation.journal_id_ASTM           SCIEAS 
_citation.journal_id_CSD            0038 
_citation.journal_id_ISSN           1095-9203 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            364 
_citation.language                  ? 
_citation.page_first                775 
_citation.page_last                 778 
_citation.title                     'Molecular basis for high-affinity agonist binding in GPCRs.' 
_citation.year                      2019 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1126/science.aau5595 
_citation.pdbx_database_id_PubMed   31072904 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Warne, T.'      1 0000-0001-9646-6080 
primary 'Edwards, P.C.'  2 ?                   
primary 'Dore, A.S.'     3 0000-0002-9856-3252 
primary 'Leslie, A.G.W.' 4 0000-0002-5229-3656 
primary 'Tate, C.G.'     5 0000-0002-2008-9183 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6H7L 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     116.513 
_cell.length_a_esd                 ? 
_cell.length_b                     119.699 
_cell.length_b_esd                 ? 
_cell.length_c                     129.156 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6H7L 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Thioredoxin 1'                   11784.370 2  ? C32S,C35S                         ? ? 
2 polymer     man 'Beta-1 adrenergic receptor'      35002.777 2  ? R68S,M90V,C116L,F327A,F338M,C358A ? ? 
3 polymer     man 'Camelid antibody fragment Nb6B9' 13036.453 2  ? ?                                 ? ? 
4 non-polymer syn HEGA-10                           379.489   9  ? ?                                 ? ? 
5 non-polymer syn 'SODIUM ION'                      22.990    2  ? ?                                 ? ? 
6 non-polymer syn DOBUTAMINE                        301.380   2  ? ?                                 ? ? 
7 water       nat water                             18.015    14 ? ?                                 ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 Trx-1                          
2 'Beta-1 adrenoreceptor,Beta-T' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;SDKIIHLTDDSFDTDVLKADGAILVDFWAEWSGPSKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLL
FKNGEVAATKVGALSKGQLKEFLDANLAE
;
;SDKIIHLTDDSFDTDVLKADGAILVDFWAEWSGPSKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLL
FKNGEVAATKVGALSKGQLKEFLDANLAE
;
E,F ? 
2 'polypeptide(L)' no no 
;AAAKVMSLLMALVVLLIVAGNVLVIAAIGSTQRLQTLTNLFITSLACADLVVGLLVVPFGATLVVRGTWLWGSFLCELWT
SLDVLCVTASIETLCVIAIDRYLAITSPFRYQSLMTRARAKVIICTVWAISALVSFLPIMMHWWRDEDPQALKCYQDPGC
CDFVTNRAYAIASSIISFYIPLLIMIFVYLRVYREAKEQIRKIDRASKRKTSRVMAMKEHKALKTLGIIMGVFTLCWLPF
FLVNIVNVFNRDLVPDWLFVAFNWLGYANSAMNPIIYCRSPDFRKAFKRLLAFPRKADRRLHHHHHH
;
;AAAKVMSLLMALVVLLIVAGNVLVIAAIGSTQRLQTLTNLFITSLACADLVVGLLVVPFGATLVVRGTWLWGSFLCELWT
SLDVLCVTASIETLCVIAIDRYLAITSPFRYQSLMTRARAKVIICTVWAISALVSFLPIMMHWWRDEDPQALKCYQDPGC
CDFVTNRAYAIASSIISFYIPLLIMIFVYLRVYREAKEQIRKIDRASKRKTSRVMAMKEHKALKTLGIIMGVFTLCWLPF
FLVNIVNVFNRDLVPDWLFVAFNWLGYANSAMNPIIYCRSPDFRKAFKRLLAFPRKADRRLHHHHHH
;
A,B ? 
3 'polypeptide(L)' no no 
;SQVQLQESGGGLVQAGGSLRLSCAASGSIFALNIMGWYRQAPGKQRELVAAIHSGGTTNYANSVKGRFTISRDNAANTVY
LQMNSLKPEDTAVYYCNVKDFGAIIYDYDYWGQGTQVTVSS
;
;SQVQLQESGGGLVQAGGSLRLSCAASGSIFALNIMGWYRQAPGKQRELVAAIHSGGTTNYANSVKGRFTISRDNAANTVY
LQMNSLKPEDTAVYYCNVKDFGAIIYDYDYWGQGTQVTVSS
;
C,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   ASP n 
1 3   LYS n 
1 4   ILE n 
1 5   ILE n 
1 6   HIS n 
1 7   LEU n 
1 8   THR n 
1 9   ASP n 
1 10  ASP n 
1 11  SER n 
1 12  PHE n 
1 13  ASP n 
1 14  THR n 
1 15  ASP n 
1 16  VAL n 
1 17  LEU n 
1 18  LYS n 
1 19  ALA n 
1 20  ASP n 
1 21  GLY n 
1 22  ALA n 
1 23  ILE n 
1 24  LEU n 
1 25  VAL n 
1 26  ASP n 
1 27  PHE n 
1 28  TRP n 
1 29  ALA n 
1 30  GLU n 
1 31  TRP n 
1 32  SER n 
1 33  GLY n 
1 34  PRO n 
1 35  SER n 
1 36  LYS n 
1 37  MET n 
1 38  ILE n 
1 39  ALA n 
1 40  PRO n 
1 41  ILE n 
1 42  LEU n 
1 43  ASP n 
1 44  GLU n 
1 45  ILE n 
1 46  ALA n 
1 47  ASP n 
1 48  GLU n 
1 49  TYR n 
1 50  GLN n 
1 51  GLY n 
1 52  LYS n 
1 53  LEU n 
1 54  THR n 
1 55  VAL n 
1 56  ALA n 
1 57  LYS n 
1 58  LEU n 
1 59  ASN n 
1 60  ILE n 
1 61  ASP n 
1 62  GLN n 
1 63  ASN n 
1 64  PRO n 
1 65  GLY n 
1 66  THR n 
1 67  ALA n 
1 68  PRO n 
1 69  LYS n 
1 70  TYR n 
1 71  GLY n 
1 72  ILE n 
1 73  ARG n 
1 74  GLY n 
1 75  ILE n 
1 76  PRO n 
1 77  THR n 
1 78  LEU n 
1 79  LEU n 
1 80  LEU n 
1 81  PHE n 
1 82  LYS n 
1 83  ASN n 
1 84  GLY n 
1 85  GLU n 
1 86  VAL n 
1 87  ALA n 
1 88  ALA n 
1 89  THR n 
1 90  LYS n 
1 91  VAL n 
1 92  GLY n 
1 93  ALA n 
1 94  LEU n 
1 95  SER n 
1 96  LYS n 
1 97  GLY n 
1 98  GLN n 
1 99  LEU n 
1 100 LYS n 
1 101 GLU n 
1 102 PHE n 
1 103 LEU n 
1 104 ASP n 
1 105 ALA n 
1 106 ASN n 
1 107 LEU n 
1 108 ALA n 
1 109 GLU n 
2 1   ALA n 
2 2   ALA n 
2 3   ALA n 
2 4   LYS n 
2 5   VAL n 
2 6   MET n 
2 7   SER n 
2 8   LEU n 
2 9   LEU n 
2 10  MET n 
2 11  ALA n 
2 12  LEU n 
2 13  VAL n 
2 14  VAL n 
2 15  LEU n 
2 16  LEU n 
2 17  ILE n 
2 18  VAL n 
2 19  ALA n 
2 20  GLY n 
2 21  ASN n 
2 22  VAL n 
2 23  LEU n 
2 24  VAL n 
2 25  ILE n 
2 26  ALA n 
2 27  ALA n 
2 28  ILE n 
2 29  GLY n 
2 30  SER n 
2 31  THR n 
2 32  GLN n 
2 33  ARG n 
2 34  LEU n 
2 35  GLN n 
2 36  THR n 
2 37  LEU n 
2 38  THR n 
2 39  ASN n 
2 40  LEU n 
2 41  PHE n 
2 42  ILE n 
2 43  THR n 
2 44  SER n 
2 45  LEU n 
2 46  ALA n 
2 47  CYS n 
2 48  ALA n 
2 49  ASP n 
2 50  LEU n 
2 51  VAL n 
2 52  VAL n 
2 53  GLY n 
2 54  LEU n 
2 55  LEU n 
2 56  VAL n 
2 57  VAL n 
2 58  PRO n 
2 59  PHE n 
2 60  GLY n 
2 61  ALA n 
2 62  THR n 
2 63  LEU n 
2 64  VAL n 
2 65  VAL n 
2 66  ARG n 
2 67  GLY n 
2 68  THR n 
2 69  TRP n 
2 70  LEU n 
2 71  TRP n 
2 72  GLY n 
2 73  SER n 
2 74  PHE n 
2 75  LEU n 
2 76  CYS n 
2 77  GLU n 
2 78  LEU n 
2 79  TRP n 
2 80  THR n 
2 81  SER n 
2 82  LEU n 
2 83  ASP n 
2 84  VAL n 
2 85  LEU n 
2 86  CYS n 
2 87  VAL n 
2 88  THR n 
2 89  ALA n 
2 90  SER n 
2 91  ILE n 
2 92  GLU n 
2 93  THR n 
2 94  LEU n 
2 95  CYS n 
2 96  VAL n 
2 97  ILE n 
2 98  ALA n 
2 99  ILE n 
2 100 ASP n 
2 101 ARG n 
2 102 TYR n 
2 103 LEU n 
2 104 ALA n 
2 105 ILE n 
2 106 THR n 
2 107 SER n 
2 108 PRO n 
2 109 PHE n 
2 110 ARG n 
2 111 TYR n 
2 112 GLN n 
2 113 SER n 
2 114 LEU n 
2 115 MET n 
2 116 THR n 
2 117 ARG n 
2 118 ALA n 
2 119 ARG n 
2 120 ALA n 
2 121 LYS n 
2 122 VAL n 
2 123 ILE n 
2 124 ILE n 
2 125 CYS n 
2 126 THR n 
2 127 VAL n 
2 128 TRP n 
2 129 ALA n 
2 130 ILE n 
2 131 SER n 
2 132 ALA n 
2 133 LEU n 
2 134 VAL n 
2 135 SER n 
2 136 PHE n 
2 137 LEU n 
2 138 PRO n 
2 139 ILE n 
2 140 MET n 
2 141 MET n 
2 142 HIS n 
2 143 TRP n 
2 144 TRP n 
2 145 ARG n 
2 146 ASP n 
2 147 GLU n 
2 148 ASP n 
2 149 PRO n 
2 150 GLN n 
2 151 ALA n 
2 152 LEU n 
2 153 LYS n 
2 154 CYS n 
2 155 TYR n 
2 156 GLN n 
2 157 ASP n 
2 158 PRO n 
2 159 GLY n 
2 160 CYS n 
2 161 CYS n 
2 162 ASP n 
2 163 PHE n 
2 164 VAL n 
2 165 THR n 
2 166 ASN n 
2 167 ARG n 
2 168 ALA n 
2 169 TYR n 
2 170 ALA n 
2 171 ILE n 
2 172 ALA n 
2 173 SER n 
2 174 SER n 
2 175 ILE n 
2 176 ILE n 
2 177 SER n 
2 178 PHE n 
2 179 TYR n 
2 180 ILE n 
2 181 PRO n 
2 182 LEU n 
2 183 LEU n 
2 184 ILE n 
2 185 MET n 
2 186 ILE n 
2 187 PHE n 
2 188 VAL n 
2 189 TYR n 
2 190 LEU n 
2 191 ARG n 
2 192 VAL n 
2 193 TYR n 
2 194 ARG n 
2 195 GLU n 
2 196 ALA n 
2 197 LYS n 
2 198 GLU n 
2 199 GLN n 
2 200 ILE n 
2 201 ARG n 
2 202 LYS n 
2 203 ILE n 
2 204 ASP n 
2 205 ARG n 
2 206 ALA n 
2 207 SER n 
2 208 LYS n 
2 209 ARG n 
2 210 LYS n 
2 211 THR n 
2 212 SER n 
2 213 ARG n 
2 214 VAL n 
2 215 MET n 
2 216 ALA n 
2 217 MET n 
2 218 LYS n 
2 219 GLU n 
2 220 HIS n 
2 221 LYS n 
2 222 ALA n 
2 223 LEU n 
2 224 LYS n 
2 225 THR n 
2 226 LEU n 
2 227 GLY n 
2 228 ILE n 
2 229 ILE n 
2 230 MET n 
2 231 GLY n 
2 232 VAL n 
2 233 PHE n 
2 234 THR n 
2 235 LEU n 
2 236 CYS n 
2 237 TRP n 
2 238 LEU n 
2 239 PRO n 
2 240 PHE n 
2 241 PHE n 
2 242 LEU n 
2 243 VAL n 
2 244 ASN n 
2 245 ILE n 
2 246 VAL n 
2 247 ASN n 
2 248 VAL n 
2 249 PHE n 
2 250 ASN n 
2 251 ARG n 
2 252 ASP n 
2 253 LEU n 
2 254 VAL n 
2 255 PRO n 
2 256 ASP n 
2 257 TRP n 
2 258 LEU n 
2 259 PHE n 
2 260 VAL n 
2 261 ALA n 
2 262 PHE n 
2 263 ASN n 
2 264 TRP n 
2 265 LEU n 
2 266 GLY n 
2 267 TYR n 
2 268 ALA n 
2 269 ASN n 
2 270 SER n 
2 271 ALA n 
2 272 MET n 
2 273 ASN n 
2 274 PRO n 
2 275 ILE n 
2 276 ILE n 
2 277 TYR n 
2 278 CYS n 
2 279 ARG n 
2 280 SER n 
2 281 PRO n 
2 282 ASP n 
2 283 PHE n 
2 284 ARG n 
2 285 LYS n 
2 286 ALA n 
2 287 PHE n 
2 288 LYS n 
2 289 ARG n 
2 290 LEU n 
2 291 LEU n 
2 292 ALA n 
2 293 PHE n 
2 294 PRO n 
2 295 ARG n 
2 296 LYS n 
2 297 ALA n 
2 298 ASP n 
2 299 ARG n 
2 300 ARG n 
2 301 LEU n 
2 302 HIS n 
2 303 HIS n 
2 304 HIS n 
2 305 HIS n 
2 306 HIS n 
2 307 HIS n 
3 1   SER n 
3 2   GLN n 
3 3   VAL n 
3 4   GLN n 
3 5   LEU n 
3 6   GLN n 
3 7   GLU n 
3 8   SER n 
3 9   GLY n 
3 10  GLY n 
3 11  GLY n 
3 12  LEU n 
3 13  VAL n 
3 14  GLN n 
3 15  ALA n 
3 16  GLY n 
3 17  GLY n 
3 18  SER n 
3 19  LEU n 
3 20  ARG n 
3 21  LEU n 
3 22  SER n 
3 23  CYS n 
3 24  ALA n 
3 25  ALA n 
3 26  SER n 
3 27  GLY n 
3 28  SER n 
3 29  ILE n 
3 30  PHE n 
3 31  ALA n 
3 32  LEU n 
3 33  ASN n 
3 34  ILE n 
3 35  MET n 
3 36  GLY n 
3 37  TRP n 
3 38  TYR n 
3 39  ARG n 
3 40  GLN n 
3 41  ALA n 
3 42  PRO n 
3 43  GLY n 
3 44  LYS n 
3 45  GLN n 
3 46  ARG n 
3 47  GLU n 
3 48  LEU n 
3 49  VAL n 
3 50  ALA n 
3 51  ALA n 
3 52  ILE n 
3 53  HIS n 
3 54  SER n 
3 55  GLY n 
3 56  GLY n 
3 57  THR n 
3 58  THR n 
3 59  ASN n 
3 60  TYR n 
3 61  ALA n 
3 62  ASN n 
3 63  SER n 
3 64  VAL n 
3 65  LYS n 
3 66  GLY n 
3 67  ARG n 
3 68  PHE n 
3 69  THR n 
3 70  ILE n 
3 71  SER n 
3 72  ARG n 
3 73  ASP n 
3 74  ASN n 
3 75  ALA n 
3 76  ALA n 
3 77  ASN n 
3 78  THR n 
3 79  VAL n 
3 80  TYR n 
3 81  LEU n 
3 82  GLN n 
3 83  MET n 
3 84  ASN n 
3 85  SER n 
3 86  LEU n 
3 87  LYS n 
3 88  PRO n 
3 89  GLU n 
3 90  ASP n 
3 91  THR n 
3 92  ALA n 
3 93  VAL n 
3 94  TYR n 
3 95  TYR n 
3 96  CYS n 
3 97  ASN n 
3 98  VAL n 
3 99  LYS n 
3 100 ASP n 
3 101 PHE n 
3 102 GLY n 
3 103 ALA n 
3 104 ILE n 
3 105 ILE n 
3 106 TYR n 
3 107 ASP n 
3 108 TYR n 
3 109 ASP n 
3 110 TYR n 
3 111 TRP n 
3 112 GLY n 
3 113 GLN n 
3 114 GLY n 
3 115 THR n 
3 116 GLN n 
3 117 VAL n 
3 118 THR n 
3 119 VAL n 
3 120 SER n 
3 121 SER n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 109 ?      ? 'trxA, fipA, tsnC, b3781, JW5856' ? ? ? ? ? ? 'Escherichia coli (strain K12)' 
83333 ? ? ? ? ? ? ? 'cabbage looper' 'Trichoplusia ni'  7111 ? ? ? ? ? ? ? ? ? ? ? ? ? ? Baculovirus ? ? ? ?            ? ? 
2 1 sample 'Biological sequence' 1 307 turkey ? ADRB1                             ? ? ? ? ? ? 'Meleagris gallopavo'           9103 
? ? ? ? ? ? ? 'cabbage looper' 'Trichoplusia ni'  7111 ? ? ? ? ? ? ? ? ? ? ? ? ? ? Baculovirus ? ? ? ?            ? ? 
3 1 sample 'Biological sequence' 1 121 llama  ? ?                                 ? ? ? ? ? ? 'Lama glama'                    9844 
? ? ? ? ? ? ? ?                'Escherichia coli' 562  ? ? ? ? ? ? ? ? ? ? ? ? ? ? ?           ? ? ? 'pET-26b(+)' ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP THIO_ECOLI  P0AA25 ? 1 
;SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLL
FKNGEVAATKVGALSKGQLKEFLDANLA
;
2  
2 UNP ADRB1_MELGA P07700 ? 2 
;MSLLMALVVLLIVAGNVLVIAAIGRTQRLQTLTNLFITSLACADLVMGLLVVPFGATLVVRGTWLWGSFLCECWTSLDVL
CVTASIETLCVIAIDRYLAITSPFRYQSLMTRARAKVIICTVWAISALVSFLPIMMHWWRDEDPQALKCYQDPGCCDFVT
NRAYAIASSIISFYIPLLIMIFVYLRVYREAKEQIRKIDRCEGRFYGSQEQPQPPPLPQHQPILGNGRASKRKTSRVMAM
REHKALKTLGIIMGVFTLCWLPFFLVNIVNVFNRDLVPDWLFVFFNWLGYANSAFNPIIYCRSPDFRKAFKRLLCFPRKA
DRRLH
;
44 
3 PDB 6H7L        6H7L   ? 3 ? 1  
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6H7L E 1 ? 108 ? P0AA25 2  ? 109 ? 1  108 
2 2 6H7L A 6 ? 302 ? P07700 44 ? 368 ? 44 368 
3 3 6H7L C 1 ? 121 ? 6H7L   0  ? 120 ? 0  120 
4 1 6H7L F 1 ? 108 ? P0AA25 2  ? 109 ? 1  108 
5 2 6H7L B 6 ? 302 ? P07700 44 ? 368 ? 44 368 
6 3 6H7L D 1 ? 121 ? 6H7L   0  ? 120 ? 0  120 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6H7L SER E 32  ? UNP P0AA25 CYS 33  'engineered mutation' 32  1  
1 6H7L SER E 35  ? UNP P0AA25 CYS 36  'engineered mutation' 35  2  
1 6H7L GLU E 109 ? UNP P0AA25 ?   ?   'expression tag'      109 3  
2 6H7L ALA A 1   ? UNP P07700 ?   ?   'expression tag'      39  4  
2 6H7L ALA A 2   ? UNP P07700 ?   ?   'expression tag'      40  5  
2 6H7L ALA A 3   ? UNP P07700 ?   ?   'expression tag'      41  6  
2 6H7L LYS A 4   ? UNP P07700 ?   ?   'expression tag'      42  7  
2 6H7L VAL A 5   ? UNP P07700 ?   ?   'expression tag'      43  8  
2 6H7L SER A 30  ? UNP P07700 ARG 68  'engineered mutation' 68  9  
2 6H7L VAL A 52  ? UNP P07700 MET 90  'engineered mutation' 90  10 
2 6H7L LEU A 78  ? UNP P07700 CYS 116 'engineered mutation' 116 11 
2 6H7L ?   A ?   ? UNP P07700 ARG 243 deletion              ?   12 
2 6H7L ?   A ?   ? UNP P07700 CYS 244 deletion              ?   13 
2 6H7L ?   A ?   ? UNP P07700 GLU 245 deletion              ?   14 
2 6H7L ?   A ?   ? UNP P07700 GLY 246 deletion              ?   15 
2 6H7L ?   A ?   ? UNP P07700 ARG 247 deletion              ?   16 
2 6H7L ?   A ?   ? UNP P07700 PHE 248 deletion              ?   17 
2 6H7L ?   A ?   ? UNP P07700 TYR 249 deletion              ?   18 
2 6H7L ?   A ?   ? UNP P07700 GLY 250 deletion              ?   19 
2 6H7L ?   A ?   ? UNP P07700 SER 251 deletion              ?   20 
2 6H7L ?   A ?   ? UNP P07700 GLN 252 deletion              ?   21 
2 6H7L ?   A ?   ? UNP P07700 GLU 253 deletion              ?   22 
2 6H7L ?   A ?   ? UNP P07700 GLN 254 deletion              ?   23 
2 6H7L ?   A ?   ? UNP P07700 PRO 255 deletion              ?   24 
2 6H7L ?   A ?   ? UNP P07700 GLN 256 deletion              ?   25 
2 6H7L ?   A ?   ? UNP P07700 PRO 257 deletion              ?   26 
2 6H7L ?   A ?   ? UNP P07700 PRO 258 deletion              ?   27 
2 6H7L ?   A ?   ? UNP P07700 PRO 259 deletion              ?   28 
2 6H7L ?   A ?   ? UNP P07700 LEU 260 deletion              ?   29 
2 6H7L ?   A ?   ? UNP P07700 PRO 261 deletion              ?   30 
2 6H7L ?   A ?   ? UNP P07700 GLN 262 deletion              ?   31 
2 6H7L ?   A ?   ? UNP P07700 HIS 263 deletion              ?   32 
2 6H7L ?   A ?   ? UNP P07700 GLN 264 deletion              ?   33 
2 6H7L ?   A ?   ? UNP P07700 PRO 265 deletion              ?   34 
2 6H7L ?   A ?   ? UNP P07700 ILE 266 deletion              ?   35 
2 6H7L ?   A ?   ? UNP P07700 LEU 267 deletion              ?   36 
2 6H7L ?   A ?   ? UNP P07700 GLY 268 deletion              ?   37 
2 6H7L ?   A ?   ? UNP P07700 ASN 269 deletion              ?   38 
2 6H7L ?   A ?   ? UNP P07700 GLY 270 deletion              ?   39 
2 6H7L LYS A 218 ? UNP P07700 ARG 284 conflict              284 40 
2 6H7L ALA A 261 ? UNP P07700 PHE 327 'engineered mutation' 327 41 
2 6H7L MET A 272 ? UNP P07700 PHE 338 'engineered mutation' 338 42 
2 6H7L ALA A 292 ? UNP P07700 CYS 358 'engineered mutation' 358 43 
2 6H7L HIS A 303 ? UNP P07700 ?   ?   'expression tag'      369 44 
2 6H7L HIS A 304 ? UNP P07700 ?   ?   'expression tag'      370 45 
2 6H7L HIS A 305 ? UNP P07700 ?   ?   'expression tag'      371 46 
2 6H7L HIS A 306 ? UNP P07700 ?   ?   'expression tag'      372 47 
2 6H7L HIS A 307 ? UNP P07700 ?   ?   'expression tag'      373 48 
4 6H7L SER F 32  ? UNP P0AA25 CYS 33  'engineered mutation' 32  49 
4 6H7L SER F 35  ? UNP P0AA25 CYS 36  'engineered mutation' 35  50 
4 6H7L GLU F 109 ? UNP P0AA25 ?   ?   'expression tag'      109 51 
5 6H7L ALA B 1   ? UNP P07700 ?   ?   'expression tag'      39  52 
5 6H7L ALA B 2   ? UNP P07700 ?   ?   'expression tag'      40  53 
5 6H7L ALA B 3   ? UNP P07700 ?   ?   'expression tag'      41  54 
5 6H7L LYS B 4   ? UNP P07700 ?   ?   'expression tag'      42  55 
5 6H7L VAL B 5   ? UNP P07700 ?   ?   'expression tag'      43  56 
5 6H7L SER B 30  ? UNP P07700 ARG 68  'engineered mutation' 68  57 
5 6H7L VAL B 52  ? UNP P07700 MET 90  'engineered mutation' 90  58 
5 6H7L LEU B 78  ? UNP P07700 CYS 116 'engineered mutation' 116 59 
5 6H7L ?   B ?   ? UNP P07700 ARG 243 deletion              ?   60 
5 6H7L ?   B ?   ? UNP P07700 CYS 244 deletion              ?   61 
5 6H7L ?   B ?   ? UNP P07700 GLU 245 deletion              ?   62 
5 6H7L ?   B ?   ? UNP P07700 GLY 246 deletion              ?   63 
5 6H7L ?   B ?   ? UNP P07700 ARG 247 deletion              ?   64 
5 6H7L ?   B ?   ? UNP P07700 PHE 248 deletion              ?   65 
5 6H7L ?   B ?   ? UNP P07700 TYR 249 deletion              ?   66 
5 6H7L ?   B ?   ? UNP P07700 GLY 250 deletion              ?   67 
5 6H7L ?   B ?   ? UNP P07700 SER 251 deletion              ?   68 
5 6H7L ?   B ?   ? UNP P07700 GLN 252 deletion              ?   69 
5 6H7L ?   B ?   ? UNP P07700 GLU 253 deletion              ?   70 
5 6H7L ?   B ?   ? UNP P07700 GLN 254 deletion              ?   71 
5 6H7L ?   B ?   ? UNP P07700 PRO 255 deletion              ?   72 
5 6H7L ?   B ?   ? UNP P07700 GLN 256 deletion              ?   73 
5 6H7L ?   B ?   ? UNP P07700 PRO 257 deletion              ?   74 
5 6H7L ?   B ?   ? UNP P07700 PRO 258 deletion              ?   75 
5 6H7L ?   B ?   ? UNP P07700 PRO 259 deletion              ?   76 
5 6H7L ?   B ?   ? UNP P07700 LEU 260 deletion              ?   77 
5 6H7L ?   B ?   ? UNP P07700 PRO 261 deletion              ?   78 
5 6H7L ?   B ?   ? UNP P07700 GLN 262 deletion              ?   79 
5 6H7L ?   B ?   ? UNP P07700 HIS 263 deletion              ?   80 
5 6H7L ?   B ?   ? UNP P07700 GLN 264 deletion              ?   81 
5 6H7L ?   B ?   ? UNP P07700 PRO 265 deletion              ?   82 
5 6H7L ?   B ?   ? UNP P07700 ILE 266 deletion              ?   83 
5 6H7L ?   B ?   ? UNP P07700 LEU 267 deletion              ?   84 
5 6H7L ?   B ?   ? UNP P07700 GLY 268 deletion              ?   85 
5 6H7L ?   B ?   ? UNP P07700 ASN 269 deletion              ?   86 
5 6H7L ?   B ?   ? UNP P07700 GLY 270 deletion              ?   87 
5 6H7L LYS B 218 ? UNP P07700 ARG 284 conflict              284 88 
5 6H7L ALA B 261 ? UNP P07700 PHE 327 'engineered mutation' 327 89 
5 6H7L MET B 272 ? UNP P07700 PHE 338 'engineered mutation' 338 90 
5 6H7L ALA B 292 ? UNP P07700 CYS 358 'engineered mutation' 358 91 
5 6H7L HIS B 303 ? UNP P07700 ?   ?   'expression tag'      369 92 
5 6H7L HIS B 304 ? UNP P07700 ?   ?   'expression tag'      370 93 
5 6H7L HIS B 305 ? UNP P07700 ?   ?   'expression tag'      371 94 
5 6H7L HIS B 306 ? UNP P07700 ?   ?   'expression tag'      372 95 
5 6H7L HIS B 307 ? UNP P07700 ?   ?   'expression tag'      373 96 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
2CV non-polymer         . HEGA-10         ? 'C18 H37 N O7'   379.489 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
NA  non-polymer         . 'SODIUM ION'    ? 'Na 1'           22.990  
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
Y00 non-polymer         . DOBUTAMINE      ? 'C18 H23 N O3'   301.380 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6H7L 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.76 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         67.32 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.1 M Hepes-NaOH pH7.5 and 21-24% PEG1500' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS3 S 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-11-13 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.919 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ESRF BEAMLINE ID29' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.919 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   ID29 
_diffrn_source.pdbx_synchrotron_site       ESRF 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6H7L 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.70 
_reflns.d_resolution_low                 41.08 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       50091 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.4 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  15.8 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            4.9 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.7 
_reflns_shell.d_res_low                   2.79 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            -0.54 
_refine.aniso_B[1][2]                            -0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][2]                            0.42 
_refine.aniso_B[2][3]                            -0.00 
_refine.aniso_B[3][3]                            0.12 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               62.898 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               0.866 
_refine.correlation_coeff_Fo_to_Fc_free          0.779 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6H7L 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.70 
_refine.ls_d_res_low                             41.08 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     28040 
_refine.ls_number_reflns_R_free                  1416 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    58.75 
_refine.ls_percent_reflns_R_free                 4.8 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.24267 
_refine.ls_R_factor_R_free                       0.27826 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.24088 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      '2H6X, 3P0G' 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  0.496 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             18.284 
_refine.overall_SU_ML                            0.348 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         1 
_refine_hist.pdbx_number_atoms_protein        8014 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         252 
_refine_hist.number_atoms_solvent             14 
_refine_hist.number_atoms_total               8280 
_refine_hist.d_res_high                       2.70 
_refine_hist.d_res_low                        41.08 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.009  0.020  8435  ? r_bond_refined_d             ? ? 
'X-RAY DIFFRACTION' ? 0.001  0.020  8124  ? r_bond_other_d               ? ? 
'X-RAY DIFFRACTION' ? 1.286  1.981  11435 ? r_angle_refined_deg          ? ? 
'X-RAY DIFFRACTION' ? 0.888  3.000  18756 ? r_angle_other_deg            ? ? 
'X-RAY DIFFRACTION' ? 5.023  5.000  1023  ? r_dihedral_angle_1_deg       ? ? 
'X-RAY DIFFRACTION' ? 31.823 23.467 323   ? r_dihedral_angle_2_deg       ? ? 
'X-RAY DIFFRACTION' ? 13.303 15.000 1367  ? r_dihedral_angle_3_deg       ? ? 
'X-RAY DIFFRACTION' ? 17.874 15.000 46    ? r_dihedral_angle_4_deg       ? ? 
'X-RAY DIFFRACTION' ? 0.061  0.200  1334  ? r_chiral_restr               ? ? 
'X-RAY DIFFRACTION' ? 0.004  0.020  9098  ? r_gen_planes_refined         ? ? 
'X-RAY DIFFRACTION' ? 0.001  0.020  1748  ? r_gen_planes_other           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_nbd_refined                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_nbd_other                  ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_nbtor_refined              ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_nbtor_other                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_xyhbond_nbd_refined        ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_xyhbond_nbd_other          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_metal_ion_refined          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_metal_ion_other            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_vdw_refined       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_vdw_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_hbond_refined     ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_hbond_other       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_metal_ion_refined ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_metal_ion_other   ? ? 
'X-RAY DIFFRACTION' ? 3.103  6.347  4113  ? r_mcbond_it                  ? ? 
'X-RAY DIFFRACTION' ? 3.102  6.346  4112  ? r_mcbond_other               ? ? 
'X-RAY DIFFRACTION' ? 5.261  9.509  5129  ? r_mcangle_it                 ? ? 
'X-RAY DIFFRACTION' ? 5.260  9.510  5130  ? r_mcangle_other              ? ? 
'X-RAY DIFFRACTION' ? 2.675  6.516  4322  ? r_scbond_it                  ? ? 
'X-RAY DIFFRACTION' ? 2.675  6.516  4322  ? r_scbond_other               ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_scangle_it                 ? ? 
'X-RAY DIFFRACTION' ? 4.739  9.677  6307  ? r_scangle_other              ? ? 
'X-RAY DIFFRACTION' ? 7.748  72.164 9197  ? r_long_range_B_refined       ? ? 
'X-RAY DIFFRACTION' ? 7.748  72.170 9198  ? r_long_range_B_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_rigid_bond_restr           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_sphericity_free            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_sphericity_bonded          ? ? 
# 
loop_
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.pdbx_type 
'X-RAY DIFFRACTION' 1 1 1 ? 0.09 0.05 ? ? E 5676  'interatomic distance' 
'X-RAY DIFFRACTION' 2 1 2 ? 0.09 0.05 ? ? F 5676  'interatomic distance' 
'X-RAY DIFFRACTION' 1 2 3 ? 0.04 0.05 ? ? A 19616 'interatomic distance' 
'X-RAY DIFFRACTION' 2 2 4 ? 0.04 0.05 ? ? B 19616 'interatomic distance' 
'X-RAY DIFFRACTION' 1 3 5 ? 0.02 0.05 ? ? C 7420  'interatomic distance' 
'X-RAY DIFFRACTION' 2 3 6 ? 0.02 0.05 ? ? D 7420  'interatomic distance' 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       2.702 
_refine_ls_shell.d_res_low                        2.772 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             19 
_refine_ls_shell.number_reflns_R_work             441 
_refine_ls_shell.percent_reflns_obs               12.61 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.412 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.R_factor_R_work                  0.452 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
loop_
_struct_ncs_dom.id 
_struct_ncs_dom.details 
_struct_ncs_dom.pdbx_ens_id 
1 E 1 
2 F 1 
1 A 2 
2 B 2 
1 C 3 
2 D 3 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1 E 3  E 107 0 0 ? ? ? ? ? ? ? ? 1 ? 
2 F 3  F 107 0 0 ? ? ? ? ? ? ? ? 1 ? 
1 A 40 A 358 0 0 ? ? ? ? ? ? ? ? 2 ? 
2 B 40 B 358 0 0 ? ? ? ? ? ? ? ? 2 ? 
1 C 1  C 120 0 0 ? ? ? ? ? ? ? ? 3 ? 
2 D 1  D 120 0 0 ? ? ? ? ? ? ? ? 3 ? 
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1 ? 
2 ? 
3 ? 
# 
_struct.entry_id                     6H7L 
_struct.title                        'ACTIVATED TURKEY BETA1 ADRENOCEPTOR WITH BOUND PARTIAL AGONIST DOBUTAMINE AND NANOBODY Nb6B9' 
_struct.pdbx_descriptor              'Thioredoxin 1, Beta-1 adrenergic receptor, Camelid antibody fragment Nb6B9' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6H7L 
_struct_keywords.text            'Beta1 Adrenoceptor, Activated, Partial Agonist, Nanobody, immune system' 
_struct_keywords.pdbx_keywords   'IMMUNE SYSTEM' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 1 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
H N N 5 ? 
I N N 4 ? 
J N N 4 ? 
K N N 4 ? 
L N N 4 ? 
M N N 6 ? 
N N N 4 ? 
O N N 5 ? 
P N N 4 ? 
Q N N 4 ? 
R N N 4 ? 
S N N 6 ? 
T N N 7 ? 
U N N 7 ? 
V N N 7 ? 
W N N 7 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 SER A 11  ? VAL A 16  ? SER E 11  VAL E 16  1 ? 6  
HELX_P HELX_P2  AA2 SER A 32  ? ILE A 38  ? SER E 32  ILE E 38  1 ? 7  
HELX_P HELX_P3  AA3 ILE A 38  ? TYR A 49  ? ILE E 38  TYR E 49  1 ? 12 
HELX_P HELX_P4  AA4 GLY A 65  ? TYR A 70  ? GLY E 65  TYR E 70  1 ? 6  
HELX_P HELX_P5  AA5 SER A 95  ? ALA A 108 ? SER E 95  ALA E 108 1 ? 14 
HELX_P HELX_P6  AA6 ALA B 3   ? THR B 31  ? ALA A 41  THR A 69  1 ? 29 
HELX_P HELX_P7  AA7 GLN B 32  ? GLN B 35  ? GLN A 70  GLN A 73  5 ? 4  
HELX_P HELX_P8  AA8 LEU B 37  ? LEU B 55  ? LEU A 75  LEU A 93  1 ? 19 
HELX_P HELX_P9  AA9 LEU B 55  ? GLY B 67  ? LEU A 93  GLY A 105 1 ? 13 
HELX_P HELX_P10 AB1 TRP B 71  ? SER B 107 ? TRP A 109 SER A 145 1 ? 37 
HELX_P HELX_P11 AB2 SER B 107 ? MET B 115 ? SER A 145 MET A 153 1 ? 9  
HELX_P HELX_P12 AB3 THR B 116 ? MET B 141 ? THR A 154 MET A 179 1 ? 26 
HELX_P HELX_P13 AB4 ASP B 148 ? ASP B 157 ? ASP A 186 ASP A 195 1 ? 10 
HELX_P HELX_P14 AB5 ASN B 166 ? PHE B 178 ? ASN A 204 PHE A 216 1 ? 13 
HELX_P HELX_P15 AB6 PHE B 178 ? SER B 207 ? PHE A 216 SER A 273 1 ? 30 
HELX_P HELX_P16 AB7 ALA B 216 ? ASN B 250 ? ALA A 282 ASN A 316 1 ? 35 
HELX_P HELX_P17 AB8 PRO B 255 ? CYS B 278 ? PRO A 321 CYS A 344 1 ? 24 
HELX_P HELX_P18 AB9 SER B 280 ? LEU B 291 ? SER A 346 LEU A 357 1 ? 12 
HELX_P HELX_P19 AC1 LYS C 87  ? THR C 91  ? LYS C 86  THR C 90  5 ? 5  
HELX_P HELX_P20 AC2 SER D 11  ? VAL D 16  ? SER F 11  VAL F 16  1 ? 6  
HELX_P HELX_P21 AC3 SER D 32  ? ILE D 38  ? SER F 32  ILE F 38  1 ? 7  
HELX_P HELX_P22 AC4 ILE D 38  ? TYR D 49  ? ILE F 38  TYR F 49  1 ? 12 
HELX_P HELX_P23 AC5 GLY D 65  ? TYR D 70  ? GLY F 65  TYR F 70  1 ? 6  
HELX_P HELX_P24 AC6 SER D 95  ? LEU D 107 ? SER F 95  LEU F 107 1 ? 13 
HELX_P HELX_P25 AC7 ALA E 3   ? THR E 31  ? ALA B 41  THR B 69  1 ? 29 
HELX_P HELX_P26 AC8 GLN E 32  ? GLN E 35  ? GLN B 70  GLN B 73  5 ? 4  
HELX_P HELX_P27 AC9 LEU E 37  ? LEU E 55  ? LEU B 75  LEU B 93  1 ? 19 
HELX_P HELX_P28 AD1 LEU E 55  ? GLY E 67  ? LEU B 93  GLY B 105 1 ? 13 
HELX_P HELX_P29 AD2 TRP E 71  ? SER E 107 ? TRP B 109 SER B 145 1 ? 37 
HELX_P HELX_P30 AD3 SER E 107 ? MET E 115 ? SER B 145 MET B 153 1 ? 9  
HELX_P HELX_P31 AD4 THR E 116 ? MET E 141 ? THR B 154 MET B 179 1 ? 26 
HELX_P HELX_P32 AD5 ASP E 148 ? ASP E 157 ? ASP B 186 ASP B 195 1 ? 10 
HELX_P HELX_P33 AD6 ASN E 166 ? PHE E 178 ? ASN B 204 PHE B 216 1 ? 13 
HELX_P HELX_P34 AD7 PHE E 178 ? SER E 207 ? PHE B 216 SER B 273 1 ? 30 
HELX_P HELX_P35 AD8 ALA E 216 ? ASN E 250 ? ALA B 282 ASN B 316 1 ? 35 
HELX_P HELX_P36 AD9 PRO E 255 ? CYS E 278 ? PRO B 321 CYS B 344 1 ? 24 
HELX_P HELX_P37 AE1 SER E 280 ? LEU E 291 ? SER B 346 LEU B 357 1 ? 12 
HELX_P HELX_P38 AE2 LYS F 87  ? THR F 91  ? LYS D 86  THR D 90  5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? B CYS 76  SG ? ? ? 1_555 B CYS 161 SG ? ? A CYS 114 A CYS 199 1_555 ? ? ? ? ? ? ? 2.015 ? 
disulf2 disulf ? ? B CYS 154 SG ? ? ? 1_555 B CYS 160 SG ? ? A CYS 192 A CYS 198 1_555 ? ? ? ? ? ? ? 2.048 ? 
disulf3 disulf ? ? C CYS 23  SG ? ? ? 1_555 C CYS 96  SG ? ? C CYS 22  C CYS 95  1_555 ? ? ? ? ? ? ? 2.037 ? 
disulf4 disulf ? ? E CYS 76  SG ? ? ? 1_555 E CYS 161 SG ? ? B CYS 114 B CYS 199 1_555 ? ? ? ? ? ? ? 2.030 ? 
disulf5 disulf ? ? E CYS 154 SG ? ? ? 1_555 E CYS 160 SG ? ? B CYS 192 B CYS 198 1_555 ? ? ? ? ? ? ? 2.046 ? 
disulf6 disulf ? ? F CYS 23  SG ? ? ? 1_555 F CYS 96  SG ? ? D CYS 22  D CYS 95  1_555 ? ? ? ? ? ? ? 2.045 ? 
metalc1 metalc ? ? B CYS 154 O  ? ? ? 1_555 H NA  .   NA ? ? A CYS 192 A NA  401 1_555 ? ? ? ? ? ? ? 2.605 ? 
metalc2 metalc ? ? B ASP 157 O  ? ? ? 1_555 H NA  .   NA ? ? A ASP 195 A NA  401 1_555 ? ? ? ? ? ? ? 2.503 ? 
metalc3 metalc ? ? B CYS 160 O  ? ? ? 1_555 H NA  .   NA ? ? A CYS 198 A NA  401 1_555 ? ? ? ? ? ? ? 2.383 ? 
metalc4 metalc ? ? E CYS 154 O  ? ? ? 1_555 O NA  .   NA ? ? B CYS 192 B NA  401 1_555 ? ? ? ? ? ? ? 2.640 ? 
metalc5 metalc ? ? E ASP 157 O  ? ? ? 1_555 O NA  .   NA ? ? B ASP 195 B NA  401 1_555 ? ? ? ? ? ? ? 2.496 ? 
metalc6 metalc ? ? E CYS 160 O  ? ? ? 1_555 O NA  .   NA ? ? B CYS 198 B NA  401 1_555 ? ? ? ? ? ? ? 2.408 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ILE 75 A . ? ILE 75 E PRO 76 A ? PRO 76 E 1 3.82 
2 ILE 75 D . ? ILE 75 F PRO 76 D ? PRO 76 F 1 4.42 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 5 ? 
AA2 ? 4 ? 
AA3 ? 6 ? 
AA4 ? 4 ? 
AA5 ? 5 ? 
AA6 ? 4 ? 
AA7 ? 6 ? 
AA8 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel      
AA1 2 3 ? parallel      
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA3 1 2 ? parallel      
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA3 4 5 ? anti-parallel 
AA3 5 6 ? anti-parallel 
AA4 1 2 ? parallel      
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA5 1 2 ? parallel      
AA5 2 3 ? parallel      
AA5 3 4 ? anti-parallel 
AA5 4 5 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
AA7 1 2 ? parallel      
AA7 2 3 ? anti-parallel 
AA7 3 4 ? anti-parallel 
AA7 4 5 ? anti-parallel 
AA7 5 6 ? anti-parallel 
AA8 1 2 ? parallel      
AA8 2 3 ? anti-parallel 
AA8 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ILE A 5   ? LEU A 7   ? ILE E 5   LEU E 7   
AA1 2 THR A 54  ? ASN A 59  ? THR E 54  ASN E 59  
AA1 3 ALA A 22  ? TRP A 28  ? ALA E 22  TRP E 28  
AA1 4 THR A 77  ? LYS A 82  ? THR E 77  LYS E 82  
AA1 5 GLU A 85  ? VAL A 91  ? GLU E 85  VAL E 91  
AA2 1 GLN C 4   ? SER C 8   ? GLN C 3   SER C 7   
AA2 2 LEU C 19  ? SER C 26  ? LEU C 18  SER C 25  
AA2 3 THR C 78  ? MET C 83  ? THR C 77  MET C 82  
AA2 4 PHE C 68  ? ARG C 72  ? PHE C 67  ARG C 71  
AA3 1 GLY C 11  ? GLN C 14  ? GLY C 10  GLN C 13  
AA3 2 THR C 115 ? SER C 120 ? THR C 114 SER C 119 
AA3 3 ALA C 92  ? ASP C 100 ? ALA C 91  ASP C 99  
AA3 4 ASN C 33  ? GLN C 40  ? ASN C 32  GLN C 39  
AA3 5 GLU C 47  ? HIS C 53  ? GLU C 46  HIS C 52  
AA3 6 THR C 58  ? TYR C 60  ? THR C 57  TYR C 59  
AA4 1 GLY C 11  ? GLN C 14  ? GLY C 10  GLN C 13  
AA4 2 THR C 115 ? SER C 120 ? THR C 114 SER C 119 
AA4 3 ALA C 92  ? ASP C 100 ? ALA C 91  ASP C 99  
AA4 4 TYR C 108 ? TRP C 111 ? TYR C 107 TRP C 110 
AA5 1 ILE D 5   ? LEU D 7   ? ILE F 5   LEU F 7   
AA5 2 THR D 54  ? ASN D 59  ? THR F 54  ASN F 59  
AA5 3 ILE D 23  ? TRP D 28  ? ILE F 23  TRP F 28  
AA5 4 THR D 77  ? LYS D 82  ? THR F 77  LYS F 82  
AA5 5 GLU D 85  ? VAL D 91  ? GLU F 85  VAL F 91  
AA6 1 GLN F 4   ? SER F 8   ? GLN D 3   SER D 7   
AA6 2 LEU F 19  ? SER F 26  ? LEU D 18  SER D 25  
AA6 3 THR F 78  ? MET F 83  ? THR D 77  MET D 82  
AA6 4 PHE F 68  ? ARG F 72  ? PHE D 67  ARG D 71  
AA7 1 LEU F 12  ? GLN F 14  ? LEU D 11  GLN D 13  
AA7 2 THR F 115 ? SER F 120 ? THR D 114 SER D 119 
AA7 3 ALA F 92  ? ASP F 100 ? ALA D 91  ASP D 99  
AA7 4 ASN F 33  ? GLN F 40  ? ASN D 32  GLN D 39  
AA7 5 GLU F 47  ? HIS F 53  ? GLU D 46  HIS D 52  
AA7 6 THR F 58  ? TYR F 60  ? THR D 57  TYR D 59  
AA8 1 LEU F 12  ? GLN F 14  ? LEU D 11  GLN D 13  
AA8 2 THR F 115 ? SER F 120 ? THR D 114 SER D 119 
AA8 3 ALA F 92  ? ASP F 100 ? ALA D 91  ASP D 99  
AA8 4 TYR F 108 ? TRP F 111 ? TYR D 107 TRP D 110 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N LEU A 7   ? N LEU E 7   O LYS A 57  ? O LYS E 57  
AA1 2 3 O ALA A 56  ? O ALA E 56  N LEU A 24  ? N LEU E 24  
AA1 3 4 N ILE A 23  ? N ILE E 23  O PHE A 81  ? O PHE E 81  
AA1 4 5 N LEU A 78  ? N LEU E 78  O LYS A 90  ? O LYS E 90  
AA2 1 2 N GLN C 4   ? N GLN C 3   O SER C 26  ? O SER C 25  
AA2 2 3 N CYS C 23  ? N CYS C 22  O VAL C 79  ? O VAL C 78  
AA2 3 4 O TYR C 80  ? O TYR C 79  N SER C 71  ? N SER C 70  
AA3 1 2 N GLY C 11  ? N GLY C 10  O THR C 118 ? O THR C 117 
AA3 2 3 O THR C 115 ? O THR C 114 N TYR C 94  ? N TYR C 93  
AA3 3 4 O TYR C 95  ? O TYR C 94  N TYR C 38  ? N TYR C 37  
AA3 4 5 N TRP C 37  ? N TRP C 36  O ALA C 50  ? O ALA C 49  
AA3 5 6 N ALA C 51  ? N ALA C 50  O ASN C 59  ? O ASN C 58  
AA4 1 2 N GLY C 11  ? N GLY C 10  O THR C 118 ? O THR C 117 
AA4 2 3 O THR C 115 ? O THR C 114 N TYR C 94  ? N TYR C 93  
AA4 3 4 N ASP C 100 ? N ASP C 99  O TYR C 108 ? O TYR C 107 
AA5 1 2 N LEU D 7   ? N LEU F 7   O LYS D 57  ? O LYS F 57  
AA5 2 3 O ALA D 56  ? O ALA F 56  N LEU D 24  ? N LEU F 24  
AA5 3 4 N ILE D 23  ? N ILE F 23  O PHE D 81  ? O PHE F 81  
AA5 4 5 N LEU D 78  ? N LEU F 78  O LYS D 90  ? O LYS F 90  
AA6 1 2 N GLN F 4   ? N GLN D 3   O SER F 26  ? O SER D 25  
AA6 2 3 N CYS F 23  ? N CYS D 22  O VAL F 79  ? O VAL D 78  
AA6 3 4 O TYR F 80  ? O TYR D 79  N SER F 71  ? N SER D 70  
AA7 1 2 N VAL F 13  ? N VAL D 12  O SER F 120 ? O SER D 119 
AA7 2 3 O THR F 115 ? O THR D 114 N TYR F 94  ? N TYR D 93  
AA7 3 4 O TYR F 95  ? O TYR D 94  N TYR F 38  ? N TYR D 37  
AA7 4 5 N TRP F 37  ? N TRP D 36  O ALA F 50  ? O ALA D 49  
AA7 5 6 N ALA F 51  ? N ALA D 50  O ASN F 59  ? O ASN D 58  
AA8 1 2 N VAL F 13  ? N VAL D 12  O SER F 120 ? O SER D 119 
AA8 2 3 O THR F 115 ? O THR D 114 N TYR F 94  ? N TYR D 93  
AA8 3 4 N ASP F 100 ? N ASP D 99  O TYR F 108 ? O TYR D 107 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software E 2CV 201 ? 4  'binding site for residue 2CV E 201' 
AC2 Software A NA  401 ? 4  'binding site for residue NA A 401'  
AC3 Software A 2CV 402 ? 11 'binding site for residue 2CV A 402' 
AC4 Software A 2CV 403 ? 6  'binding site for residue 2CV A 403' 
AC5 Software A 2CV 404 ? 3  'binding site for residue 2CV A 404' 
AC6 Software A 2CV 405 ? 2  'binding site for residue 2CV A 405' 
AC7 Software A Y00 406 ? 12 'binding site for residue Y00 A 406' 
AC8 Software A 2CV 407 ? 6  'binding site for residue 2CV A 407' 
AC9 Software B NA  401 ? 4  'binding site for residue NA B 401'  
AD1 Software B 2CV 402 ? 9  'binding site for residue 2CV B 402' 
AD2 Software B 2CV 403 ? 1  'binding site for residue 2CV B 403' 
AD3 Software B 2CV 404 ? 1  'binding site for residue 2CV B 404' 
AD4 Software B Y00 405 ? 12 'binding site for residue Y00 B 405' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4  ARG B 205 ? ARG A 243 . ? 2_455 ? 
2  AC1 4  ARG B 209 ? ARG A 275 . ? 2_455 ? 
3  AC1 4  ILE A 4   ? ILE E 4   . ? 1_555 ? 
4  AC1 4  HIS A 6   ? HIS E 6   . ? 1_555 ? 
5  AC2 4  CYS B 154 ? CYS A 192 . ? 1_555 ? 
6  AC2 4  TYR B 155 ? TYR A 193 . ? 1_555 ? 
7  AC2 4  ASP B 157 ? ASP A 195 . ? 1_555 ? 
8  AC2 4  CYS B 160 ? CYS A 198 . ? 1_555 ? 
9  AC3 11 LEU B 133 ? LEU A 171 . ? 1_555 ? 
10 AC3 11 TRP B 143 ? TRP A 181 . ? 1_555 ? 
11 AC3 11 ASN B 166 ? ASN A 204 . ? 1_555 ? 
12 AC3 11 ALA B 168 ? ALA A 206 . ? 1_555 ? 
13 AC3 11 TYR B 169 ? TYR A 207 . ? 1_555 ? 
14 AC3 11 ALA B 172 ? ALA A 210 . ? 1_555 ? 
15 AC3 11 VAL E 22  ? VAL B 60  . ? 1_555 ? 
16 AC3 11 ILE E 25  ? ILE B 63  . ? 1_555 ? 
17 AC3 11 ALA E 26  ? ALA B 64  . ? 1_555 ? 
18 AC3 11 GLY E 29  ? GLY B 67  . ? 1_555 ? 
19 AC3 11 SER E 30  ? SER B 68  . ? 1_555 ? 
20 AC4 6  GLU B 92  ? GLU A 130 . ? 1_555 ? 
21 AC4 6  ARG B 119 ? ARG A 157 . ? 1_555 ? 
22 AC4 6  VAL B 122 ? VAL A 160 . ? 1_555 ? 
23 AC4 6  THR B 126 ? THR A 164 . ? 1_555 ? 
24 AC4 6  ARG E 66  ? ARG B 104 . ? 1_555 ? 
25 AC4 6  TRP E 71  ? TRP B 109 . ? 1_555 ? 
26 AC5 3  LEU B 223 ? LEU A 289 . ? 1_555 ? 
27 AC5 3  LYS B 224 ? LYS A 290 . ? 1_555 ? 
28 AC5 3  THR B 234 ? THR A 300 . ? 1_555 ? 
29 AC6 2  LEU B 40  ? LEU A 78  . ? 1_555 ? 
30 AC6 2  LYS B 121 ? LYS A 159 . ? 1_555 ? 
31 AC7 12 GLY B 60  ? GLY A 98  . ? 1_555 ? 
32 AC7 12 VAL B 64  ? VAL A 102 . ? 1_555 ? 
33 AC7 12 TRP B 79  ? TRP A 117 . ? 1_555 ? 
34 AC7 12 ASP B 83  ? ASP A 121 . ? 1_555 ? 
35 AC7 12 SER B 173 ? SER A 211 . ? 1_555 ? 
36 AC7 12 SER B 177 ? SER A 215 . ? 1_555 ? 
37 AC7 12 PHE B 240 ? PHE A 306 . ? 1_555 ? 
38 AC7 12 ASN B 244 ? ASN A 310 . ? 1_555 ? 
39 AC7 12 VAL B 260 ? VAL A 326 . ? 1_555 ? 
40 AC7 12 ASN B 263 ? ASN A 329 . ? 1_555 ? 
41 AC7 12 TRP B 264 ? TRP A 330 . ? 1_555 ? 
42 AC7 12 TYR B 267 ? TYR A 333 . ? 1_555 ? 
43 AC8 6  ARG B 167 ? ARG A 205 . ? 1_555 ? 
44 AC8 6  LEU E 40  ? LEU B 78  . ? 1_555 ? 
45 AC8 6  THR E 43  ? THR B 81  . ? 1_555 ? 
46 AC8 6  LYS E 121 ? LYS B 159 . ? 1_555 ? 
47 AC8 6  TRP E 128 ? TRP B 166 . ? 1_555 ? 
48 AC8 6  2CV P .   ? 2CV B 402 . ? 1_555 ? 
49 AC9 4  CYS E 154 ? CYS B 192 . ? 1_555 ? 
50 AC9 4  TYR E 155 ? TYR B 193 . ? 1_555 ? 
51 AC9 4  ASP E 157 ? ASP B 195 . ? 1_555 ? 
52 AC9 4  CYS E 160 ? CYS B 198 . ? 1_555 ? 
53 AD1 9  ARG B 167 ? ARG A 205 . ? 1_555 ? 
54 AD1 9  ALA B 168 ? ALA A 206 . ? 1_555 ? 
55 AD1 9  ILE B 171 ? ILE A 209 . ? 1_555 ? 
56 AD1 9  ILE B 175 ? ILE A 213 . ? 1_555 ? 
57 AD1 9  2CV N .   ? 2CV A 407 . ? 1_555 ? 
58 AD1 9  ILE E 25  ? ILE B 63  . ? 1_555 ? 
59 AD1 9  THR E 43  ? THR B 81  . ? 1_555 ? 
60 AD1 9  CYS E 47  ? CYS B 85  . ? 1_555 ? 
61 AD1 9  LEU E 55  ? LEU B 93  . ? 1_555 ? 
62 AD2 1  GLY E 227 ? GLY B 293 . ? 1_555 ? 
63 AD3 1  PHE E 136 ? PHE B 174 . ? 1_555 ? 
64 AD4 12 GLY E 60  ? GLY B 98  . ? 1_555 ? 
65 AD4 12 VAL E 64  ? VAL B 102 . ? 1_555 ? 
66 AD4 12 TRP E 79  ? TRP B 117 . ? 1_555 ? 
67 AD4 12 ASP E 83  ? ASP B 121 . ? 1_555 ? 
68 AD4 12 SER E 173 ? SER B 211 . ? 1_555 ? 
69 AD4 12 SER E 177 ? SER B 215 . ? 1_555 ? 
70 AD4 12 PHE E 240 ? PHE B 306 . ? 1_555 ? 
71 AD4 12 ASN E 244 ? ASN B 310 . ? 1_555 ? 
72 AD4 12 VAL E 260 ? VAL B 326 . ? 1_555 ? 
73 AD4 12 ASN E 263 ? ASN B 329 . ? 1_555 ? 
74 AD4 12 TRP E 264 ? TRP B 330 . ? 1_555 ? 
75 AD4 12 TYR E 267 ? TYR B 333 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6H7L 
_atom_sites.fract_transf_matrix[1][1]   0.008583 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008354 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007743 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
NA 
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . LYS A 1 3   ? -46.647  -6.716  22.007  1.00 90.56  ? 3   LYS E N   1 
ATOM   2    C  CA  . LYS A 1 3   ? -46.639  -5.221  21.987  1.00 90.74  ? 3   LYS E CA  1 
ATOM   3    C  C   . LYS A 1 3   ? -47.793  -4.594  21.187  1.00 92.03  ? 3   LYS E C   1 
ATOM   4    O  O   . LYS A 1 3   ? -48.143  -3.444  21.445  1.00 92.15  ? 3   LYS E O   1 
ATOM   5    C  CB  . LYS A 1 3   ? -45.296  -4.708  21.453  1.00 88.70  ? 3   LYS E CB  1 
ATOM   6    N  N   . ILE A 1 4   ? -48.373  -5.340  20.239  1.00 94.47  ? 4   ILE E N   1 
ATOM   7    C  CA  . ILE A 1 4   ? -49.468  -4.848  19.372  1.00 94.87  ? 4   ILE E CA  1 
ATOM   8    C  C   . ILE A 1 4   ? -50.839  -4.850  20.082  1.00 94.57  ? 4   ILE E C   1 
ATOM   9    O  O   . ILE A 1 4   ? -51.251  -5.864  20.673  1.00 93.34  ? 4   ILE E O   1 
ATOM   10   C  CB  . ILE A 1 4   ? -49.560  -5.686  18.058  1.00 94.85  ? 4   ILE E CB  1 
ATOM   11   C  CG1 . ILE A 1 4   ? -48.273  -5.506  17.237  1.00 96.07  ? 4   ILE E CG1 1 
ATOM   12   C  CG2 . ILE A 1 4   ? -50.799  -5.320  17.231  1.00 92.24  ? 4   ILE E CG2 1 
ATOM   13   C  CD1 . ILE A 1 4   ? -48.170  -6.378  15.997  1.00 96.25  ? 4   ILE E CD1 1 
ATOM   14   N  N   . ILE A 1 5   ? -51.540  -3.713  19.994  1.00 93.05  ? 5   ILE E N   1 
ATOM   15   C  CA  . ILE A 1 5   ? -52.906  -3.561  20.519  1.00 87.76  ? 5   ILE E CA  1 
ATOM   16   C  C   . ILE A 1 5   ? -53.880  -4.104  19.473  1.00 84.54  ? 5   ILE E C   1 
ATOM   17   O  O   . ILE A 1 5   ? -53.766  -3.790  18.284  1.00 80.83  ? 5   ILE E O   1 
ATOM   18   C  CB  . ILE A 1 5   ? -53.259  -2.083  20.856  1.00 84.73  ? 5   ILE E CB  1 
ATOM   19   C  CG1 . ILE A 1 5   ? -52.258  -1.516  21.883  1.00 86.26  ? 5   ILE E CG1 1 
ATOM   20   C  CG2 . ILE A 1 5   ? -54.682  -1.956  21.407  1.00 83.75  ? 5   ILE E CG2 1 
ATOM   21   C  CD1 . ILE A 1 5   ? -52.508  -0.085  22.325  1.00 85.63  ? 5   ILE E CD1 1 
ATOM   22   N  N   . HIS A 1 6   ? -54.834  -4.921  19.930  1.00 84.48  ? 6   HIS E N   1 
ATOM   23   C  CA  . HIS A 1 6   ? -55.844  -5.526  19.067  1.00 83.86  ? 6   HIS E CA  1 
ATOM   24   C  C   . HIS A 1 6   ? -57.179  -4.825  19.255  1.00 82.88  ? 6   HIS E C   1 
ATOM   25   O  O   . HIS A 1 6   ? -57.854  -5.018  20.264  1.00 78.84  ? 6   HIS E O   1 
ATOM   26   C  CB  . HIS A 1 6   ? -55.915  -7.031  19.328  1.00 84.72  ? 6   HIS E CB  1 
ATOM   27   C  CG  . HIS A 1 6   ? -54.661  -7.744  18.917  1.00 86.08  ? 6   HIS E CG  1 
ATOM   28   N  ND1 . HIS A 1 6   ? -53.598  -7.947  19.774  1.00 86.71  ? 6   HIS E ND1 1 
ATOM   29   C  CD2 . HIS A 1 6   ? -54.281  -8.257  17.721  1.00 84.94  ? 6   HIS E CD2 1 
ATOM   30   C  CE1 . HIS A 1 6   ? -52.629  -8.571  19.129  1.00 85.54  ? 6   HIS E CE1 1 
ATOM   31   N  NE2 . HIS A 1 6   ? -53.018  -8.770  17.882  1.00 84.21  ? 6   HIS E NE2 1 
ATOM   32   N  N   . LEU A 1 7   ? -57.548  -4.023  18.254  1.00 85.24  ? 7   LEU E N   1 
ATOM   33   C  CA  . LEU A 1 7   ? -58.652  -3.066  18.358  1.00 89.14  ? 7   LEU E CA  1 
ATOM   34   C  C   . LEU A 1 7   ? -60.015  -3.706  18.112  1.00 86.96  ? 7   LEU E C   1 
ATOM   35   O  O   . LEU A 1 7   ? -60.117  -4.740  17.445  1.00 88.44  ? 7   LEU E O   1 
ATOM   36   C  CB  . LEU A 1 7   ? -58.459  -1.921  17.352  1.00 92.99  ? 7   LEU E CB  1 
ATOM   37   C  CG  . LEU A 1 7   ? -57.133  -1.143  17.377  1.00 94.19  ? 7   LEU E CG  1 
ATOM   38   C  CD1 . LEU A 1 7   ? -57.075  -0.116  16.257  1.00 95.82  ? 7   LEU E CD1 1 
ATOM   39   C  CD2 . LEU A 1 7   ? -56.938  -0.455  18.708  1.00 93.09  ? 7   LEU E CD2 1 
ATOM   40   N  N   . THR A 1 8   ? -61.050  -3.079  18.671  1.00 83.44  ? 8   THR E N   1 
ATOM   41   C  CA  . THR A 1 8   ? -62.448  -3.396  18.366  1.00 83.18  ? 8   THR E CA  1 
ATOM   42   C  C   . THR A 1 8   ? -63.113  -2.117  17.829  1.00 86.94  ? 8   THR E C   1 
ATOM   43   O  O   . THR A 1 8   ? -62.417  -1.123  17.553  1.00 84.95  ? 8   THR E O   1 
ATOM   44   C  CB  . THR A 1 8   ? -63.194  -3.961  19.606  1.00 79.04  ? 8   THR E CB  1 
ATOM   45   O  OG1 . THR A 1 8   ? -63.350  -2.946  20.604  1.00 75.82  ? 8   THR E OG1 1 
ATOM   46   C  CG2 . THR A 1 8   ? -62.438  -5.135  20.203  1.00 77.57  ? 8   THR E CG2 1 
ATOM   47   N  N   . ASP A 1 9   ? -64.437  -2.145  17.663  1.00 90.15  ? 9   ASP E N   1 
ATOM   48   C  CA  . ASP A 1 9   ? -65.198  -0.948  17.270  1.00 92.16  ? 9   ASP E CA  1 
ATOM   49   C  C   . ASP A 1 9   ? -65.234  0.063   18.420  1.00 90.35  ? 9   ASP E C   1 
ATOM   50   O  O   . ASP A 1 9   ? -64.842  1.219   18.241  1.00 94.20  ? 9   ASP E O   1 
ATOM   51   C  CB  . ASP A 1 9   ? -66.642  -1.301  16.814  1.00 96.49  ? 9   ASP E CB  1 
ATOM   52   C  CG  . ASP A 1 9   ? -66.805  -1.362  15.277  1.00 98.21  ? 9   ASP E CG  1 
ATOM   53   O  OD1 . ASP A 1 9   ? -66.062  -0.661  14.559  1.00 97.30  ? 9   ASP E OD1 1 
ATOM   54   O  OD2 . ASP A 1 9   ? -67.695  -2.111  14.797  1.00 98.62  ? 9   ASP E OD2 1 
ATOM   55   N  N   . ASP A 1 10  ? -65.670  -0.389  19.594  1.00 88.74  ? 10  ASP E N   1 
ATOM   56   C  CA  . ASP A 1 10  ? -65.842  0.479   20.778  1.00 90.67  ? 10  ASP E CA  1 
ATOM   57   C  C   . ASP A 1 10  ? -64.516  0.988   21.355  1.00 92.44  ? 10  ASP E C   1 
ATOM   58   O  O   . ASP A 1 10  ? -64.414  2.148   21.773  1.00 89.63  ? 10  ASP E O   1 
ATOM   59   C  CB  . ASP A 1 10  ? -66.595  -0.252  21.899  1.00 89.85  ? 10  ASP E CB  1 
ATOM   60   C  CG  . ASP A 1 10  ? -67.983  -0.702  21.496  1.00 90.32  ? 10  ASP E CG  1 
ATOM   61   O  OD1 . ASP A 1 10  ? -68.351  -0.570  20.309  1.00 92.90  ? 10  ASP E OD1 1 
ATOM   62   O  OD2 . ASP A 1 10  ? -68.708  -1.200  22.382  1.00 89.70  ? 10  ASP E OD2 1 
ATOM   63   N  N   . SER A 1 11  ? -63.512  0.113   21.383  1.00 95.44  ? 11  SER E N   1 
ATOM   64   C  CA  . SER A 1 11  ? -62.189  0.466   21.896  1.00 101.92 ? 11  SER E CA  1 
ATOM   65   C  C   . SER A 1 11  ? -61.427  1.466   21.006  1.00 108.91 ? 11  SER E C   1 
ATOM   66   O  O   . SER A 1 11  ? -60.493  2.106   21.486  1.00 118.13 ? 11  SER E O   1 
ATOM   67   C  CB  . SER A 1 11  ? -61.341  -0.795  22.120  1.00 100.69 ? 11  SER E CB  1 
ATOM   68   O  OG  . SER A 1 11  ? -60.963  -1.403  20.896  1.00 100.36 ? 11  SER E OG  1 
ATOM   69   N  N   . PHE A 1 12  ? -61.823  1.599   19.734  1.00 108.32 ? 12  PHE E N   1 
ATOM   70   C  CA  . PHE A 1 12  ? -61.142  2.489   18.777  1.00 101.72 ? 12  PHE E CA  1 
ATOM   71   C  C   . PHE A 1 12  ? -60.996  3.945   19.247  1.00 94.10  ? 12  PHE E C   1 
ATOM   72   O  O   . PHE A 1 12  ? -59.960  4.570   18.997  1.00 89.38  ? 12  PHE E O   1 
ATOM   73   C  CB  . PHE A 1 12  ? -61.829  2.452   17.398  1.00 101.96 ? 12  PHE E CB  1 
ATOM   74   C  CG  . PHE A 1 12  ? -60.964  2.966   16.280  1.00 101.72 ? 12  PHE E CG  1 
ATOM   75   C  CD1 . PHE A 1 12  ? -61.005  4.304   15.918  1.00 102.96 ? 12  PHE E CD1 1 
ATOM   76   C  CD2 . PHE A 1 12  ? -60.073  2.115   15.614  1.00 103.05 ? 12  PHE E CD2 1 
ATOM   77   C  CE1 . PHE A 1 12  ? -60.194  4.789   14.898  1.00 105.66 ? 12  PHE E CE1 1 
ATOM   78   C  CE2 . PHE A 1 12  ? -59.268  2.594   14.586  1.00 100.94 ? 12  PHE E CE2 1 
ATOM   79   C  CZ  . PHE A 1 12  ? -59.320  3.935   14.234  1.00 104.10 ? 12  PHE E CZ  1 
ATOM   80   N  N   . ASP A 1 13  ? -62.018  4.474   19.922  1.00 85.80  ? 13  ASP E N   1 
ATOM   81   C  CA  . ASP A 1 13  ? -61.970  5.850   20.447  1.00 85.04  ? 13  ASP E CA  1 
ATOM   82   C  C   . ASP A 1 13  ? -60.914  6.021   21.559  1.00 80.81  ? 13  ASP E C   1 
ATOM   83   O  O   . ASP A 1 13  ? -60.222  7.042   21.597  1.00 81.31  ? 13  ASP E O   1 
ATOM   84   C  CB  . ASP A 1 13  ? -63.356  6.301   20.944  1.00 89.10  ? 13  ASP E CB  1 
ATOM   85   C  CG  . ASP A 1 13  ? -63.419  7.808   21.269  1.00 91.14  ? 13  ASP E CG  1 
ATOM   86   O  OD1 . ASP A 1 13  ? -62.910  8.634   20.478  1.00 88.73  ? 13  ASP E OD1 1 
ATOM   87   O  OD2 . ASP A 1 13  ? -63.983  8.175   22.326  1.00 90.25  ? 13  ASP E OD2 1 
ATOM   88   N  N   . THR A 1 14  ? -60.793  5.029   22.447  1.00 75.51  ? 14  THR E N   1 
ATOM   89   C  CA  . THR A 1 14  ? -59.829  5.083   23.562  1.00 72.22  ? 14  THR E CA  1 
ATOM   90   C  C   . THR A 1 14  ? -58.414  4.653   23.152  1.00 69.87  ? 14  THR E C   1 
ATOM   91   O  O   . THR A 1 14  ? -57.433  5.249   23.602  1.00 66.63  ? 14  THR E O   1 
ATOM   92   C  CB  . THR A 1 14  ? -60.281  4.215   24.759  1.00 71.21  ? 14  THR E CB  1 
ATOM   93   O  OG1 . THR A 1 14  ? -61.620  4.554   25.131  1.00 69.86  ? 14  THR E OG1 1 
ATOM   94   C  CG2 . THR A 1 14  ? -59.365  4.423   25.967  1.00 72.17  ? 14  THR E CG2 1 
ATOM   95   N  N   . ASP A 1 15  ? -58.317  3.624   22.313  1.00 71.01  ? 15  ASP E N   1 
ATOM   96   C  CA  . ASP A 1 15  ? -57.023  3.053   21.913  1.00 74.31  ? 15  ASP E CA  1 
ATOM   97   C  C   . ASP A 1 15  ? -56.256  3.881   20.882  1.00 75.40  ? 15  ASP E C   1 
ATOM   98   O  O   . ASP A 1 15  ? -55.025  3.792   20.828  1.00 76.96  ? 15  ASP E O   1 
ATOM   99   C  CB  . ASP A 1 15  ? -57.209  1.640   21.334  1.00 77.94  ? 15  ASP E CB  1 
ATOM   100  C  CG  . ASP A 1 15  ? -57.788  0.654   22.333  1.00 80.08  ? 15  ASP E CG  1 
ATOM   101  O  OD1 . ASP A 1 15  ? -58.080  1.049   23.481  1.00 83.38  ? 15  ASP E OD1 1 
ATOM   102  O  OD2 . ASP A 1 15  ? -57.967  -0.527  21.962  1.00 81.86  ? 15  ASP E OD2 1 
ATOM   103  N  N   . VAL A 1 16  ? -56.975  4.644   20.051  1.00 75.29  ? 16  VAL E N   1 
ATOM   104  C  CA  . VAL A 1 16  ? -56.375  5.374   18.921  1.00 75.15  ? 16  VAL E CA  1 
ATOM   105  C  C   . VAL A 1 16  ? -56.613  6.886   18.985  1.00 74.83  ? 16  VAL E C   1 
ATOM   106  O  O   . VAL A 1 16  ? -55.651  7.656   18.929  1.00 76.99  ? 16  VAL E O   1 
ATOM   107  C  CB  . VAL A 1 16  ? -56.881  4.836   17.561  1.00 76.06  ? 16  VAL E CB  1 
ATOM   108  C  CG1 . VAL A 1 16  ? -56.005  5.346   16.422  1.00 76.16  ? 16  VAL E CG1 1 
ATOM   109  C  CG2 . VAL A 1 16  ? -56.899  3.308   17.557  1.00 78.09  ? 16  VAL E CG2 1 
ATOM   110  N  N   . LEU A 1 17  ? -57.876  7.309   19.093  1.00 73.17  ? 17  LEU E N   1 
ATOM   111  C  CA  . LEU A 1 17  ? -58.224  8.740   19.050  1.00 69.97  ? 17  LEU E CA  1 
ATOM   112  C  C   . LEU A 1 17  ? -57.770  9.504   20.293  1.00 66.50  ? 17  LEU E C   1 
ATOM   113  O  O   . LEU A 1 17  ? -57.203  10.590  20.175  1.00 65.94  ? 17  LEU E O   1 
ATOM   114  C  CB  . LEU A 1 17  ? -59.733  8.950   18.827  1.00 70.57  ? 17  LEU E CB  1 
ATOM   115  C  CG  . LEU A 1 17  ? -60.358  8.318   17.577  1.00 70.23  ? 17  LEU E CG  1 
ATOM   116  C  CD1 . LEU A 1 17  ? -61.833  8.694   17.458  1.00 69.54  ? 17  LEU E CD1 1 
ATOM   117  C  CD2 . LEU A 1 17  ? -59.587  8.715   16.329  1.00 70.14  ? 17  LEU E CD2 1 
ATOM   118  N  N   . LYS A 1 18  ? -58.021  8.931   21.471  1.00 65.72  ? 18  LYS E N   1 
ATOM   119  C  CA  . LYS A 1 18  ? -57.579  9.513   22.747  1.00 64.89  ? 18  LYS E CA  1 
ATOM   120  C  C   . LYS A 1 18  ? -56.186  9.043   23.220  1.00 63.17  ? 18  LYS E C   1 
ATOM   121  O  O   . LYS A 1 18  ? -55.717  9.499   24.265  1.00 64.70  ? 18  LYS E O   1 
ATOM   122  C  CB  . LYS A 1 18  ? -58.635  9.255   23.837  1.00 64.10  ? 18  LYS E CB  1 
ATOM   123  C  CG  . LYS A 1 18  ? -59.981  9.895   23.524  1.00 65.98  ? 18  LYS E CG  1 
ATOM   124  C  CD  . LYS A 1 18  ? -60.876  10.048  24.747  1.00 67.93  ? 18  LYS E CD  1 
ATOM   125  C  CE  . LYS A 1 18  ? -62.094  10.921  24.440  1.00 69.04  ? 18  LYS E CE  1 
ATOM   126  N  NZ  . LYS A 1 18  ? -61.783  12.375  24.247  1.00 68.22  ? 18  LYS E NZ  1 
ATOM   127  N  N   . ALA A 1 19  ? -55.538  8.153   22.465  1.00 61.02  ? 19  ALA E N   1 
ATOM   128  C  CA  . ALA A 1 19  ? -54.269  7.559   22.894  1.00 64.29  ? 19  ALA E CA  1 
ATOM   129  C  C   . ALA A 1 19  ? -53.079  8.477   22.687  1.00 65.61  ? 19  ALA E C   1 
ATOM   130  O  O   . ALA A 1 19  ? -53.011  9.227   21.716  1.00 62.06  ? 19  ALA E O   1 
ATOM   131  C  CB  . ALA A 1 19  ? -54.024  6.227   22.202  1.00 65.00  ? 19  ALA E CB  1 
ATOM   132  N  N   . ASP A 1 20  ? -52.127  8.371   23.606  1.00 70.19  ? 20  ASP E N   1 
ATOM   133  C  CA  . ASP A 1 20  ? -50.922  9.176   23.580  1.00 76.21  ? 20  ASP E CA  1 
ATOM   134  C  C   . ASP A 1 20  ? -49.952  8.637   22.534  1.00 77.97  ? 20  ASP E C   1 
ATOM   135  O  O   . ASP A 1 20  ? -49.866  7.429   22.324  1.00 81.85  ? 20  ASP E O   1 
ATOM   136  C  CB  . ASP A 1 20  ? -50.256  9.175   24.971  1.00 79.35  ? 20  ASP E CB  1 
ATOM   137  C  CG  . ASP A 1 20  ? -51.025  9.987   25.995  1.00 81.99  ? 20  ASP E CG  1 
ATOM   138  O  OD1 . ASP A 1 20  ? -51.642  11.011  25.616  1.00 82.64  ? 20  ASP E OD1 1 
ATOM   139  O  OD2 . ASP A 1 20  ? -51.000  9.606   27.188  1.00 84.53  ? 20  ASP E OD2 1 
ATOM   140  N  N   . GLY A 1 21  ? -49.233  9.545   21.877  1.00 78.69  ? 21  GLY E N   1 
ATOM   141  C  CA  . GLY A 1 21  ? -48.188  9.178   20.930  1.00 76.70  ? 21  GLY E CA  1 
ATOM   142  C  C   . GLY A 1 21  ? -48.736  8.842   19.566  1.00 76.51  ? 21  GLY E C   1 
ATOM   143  O  O   . GLY A 1 21  ? -49.942  8.983   19.312  1.00 71.76  ? 21  GLY E O   1 
ATOM   144  N  N   . ALA A 1 22  ? -47.831  8.387   18.694  1.00 78.67  ? 22  ALA E N   1 
ATOM   145  C  CA  . ALA A 1 22  ? -48.157  8.010   17.318  1.00 79.38  ? 22  ALA E CA  1 
ATOM   146  C  C   . ALA A 1 22  ? -48.614  6.552   17.257  1.00 78.78  ? 22  ALA E C   1 
ATOM   147  O  O   . ALA A 1 22  ? -47.875  5.660   17.689  1.00 80.94  ? 22  ALA E O   1 
ATOM   148  C  CB  . ALA A 1 22  ? -46.952  8.217   16.414  1.00 80.41  ? 22  ALA E CB  1 
ATOM   149  N  N   . ILE A 1 23  ? -49.818  6.320   16.721  1.00 77.18  ? 23  ILE E N   1 
ATOM   150  C  CA  . ILE A 1 23  ? -50.393  4.974   16.590  1.00 77.66  ? 23  ILE E CA  1 
ATOM   151  C  C   . ILE A 1 23  ? -50.463  4.616   15.111  1.00 77.73  ? 23  ILE E C   1 
ATOM   152  O  O   . ILE A 1 23  ? -51.088  5.349   14.342  1.00 77.02  ? 23  ILE E O   1 
ATOM   153  C  CB  . ILE A 1 23  ? -51.830  4.861   17.179  1.00 76.27  ? 23  ILE E CB  1 
ATOM   154  C  CG1 . ILE A 1 23  ? -51.964  5.573   18.534  1.00 78.75  ? 23  ILE E CG1 1 
ATOM   155  C  CG2 . ILE A 1 23  ? -52.243  3.395   17.305  1.00 74.30  ? 23  ILE E CG2 1 
ATOM   156  C  CD1 . ILE A 1 23  ? -51.119  4.999   19.653  1.00 81.27  ? 23  ILE E CD1 1 
ATOM   157  N  N   . LEU A 1 24  ? -49.829  3.504   14.721  1.00 81.92  ? 24  LEU E N   1 
ATOM   158  C  CA  . LEU A 1 24  ? -49.948  2.965   13.362  1.00 86.03  ? 24  LEU E CA  1 
ATOM   159  C  C   . LEU A 1 24  ? -51.051  1.904   13.333  1.00 89.61  ? 24  LEU E C   1 
ATOM   160  O  O   . LEU A 1 24  ? -50.865  0.802   13.861  1.00 92.74  ? 24  LEU E O   1 
ATOM   161  C  CB  . LEU A 1 24  ? -48.619  2.358   12.893  1.00 86.17  ? 24  LEU E CB  1 
ATOM   162  C  CG  . LEU A 1 24  ? -48.599  1.818   11.441  1.00 87.35  ? 24  LEU E CG  1 
ATOM   163  C  CD1 . LEU A 1 24  ? -48.693  2.938   10.402  1.00 91.13  ? 24  LEU E CD1 1 
ATOM   164  C  CD2 . LEU A 1 24  ? -47.364  0.962   11.204  1.00 88.03  ? 24  LEU E CD2 1 
ATOM   165  N  N   . VAL A 1 25  ? -52.182  2.238   12.707  1.00 90.09  ? 25  VAL E N   1 
ATOM   166  C  CA  . VAL A 1 25  ? -53.337  1.341   12.642  1.00 91.45  ? 25  VAL E CA  1 
ATOM   167  C  C   . VAL A 1 25  ? -53.242  0.501   11.371  1.00 99.22  ? 25  VAL E C   1 
ATOM   168  O  O   . VAL A 1 25  ? -52.863  1.015   10.317  1.00 102.34 ? 25  VAL E O   1 
ATOM   169  C  CB  . VAL A 1 25  ? -54.673  2.119   12.658  1.00 87.99  ? 25  VAL E CB  1 
ATOM   170  C  CG1 . VAL A 1 25  ? -55.867  1.172   12.707  1.00 85.29  ? 25  VAL E CG1 1 
ATOM   171  C  CG2 . VAL A 1 25  ? -54.720  3.069   13.846  1.00 89.16  ? 25  VAL E CG2 1 
ATOM   172  N  N   . ASP A 1 26  ? -53.587  -0.780  11.483  1.00 113.00 ? 26  ASP E N   1 
ATOM   173  C  CA  . ASP A 1 26  ? -53.618  -1.712  10.345  1.00 125.45 ? 26  ASP E CA  1 
ATOM   174  C  C   . ASP A 1 26  ? -55.034  -2.276  10.181  1.00 133.54 ? 26  ASP E C   1 
ATOM   175  O  O   . ASP A 1 26  ? -55.622  -2.798  11.138  1.00 147.09 ? 26  ASP E O   1 
ATOM   176  C  CB  . ASP A 1 26  ? -52.607  -2.854  10.564  1.00 129.43 ? 26  ASP E CB  1 
ATOM   177  C  CG  . ASP A 1 26  ? -52.767  -4.014  9.568   1.00 129.84 ? 26  ASP E CG  1 
ATOM   178  O  OD1 . ASP A 1 26  ? -53.115  -3.788  8.383   1.00 129.00 ? 26  ASP E OD1 1 
ATOM   179  O  OD2 . ASP A 1 26  ? -52.530  -5.170  9.981   1.00 131.33 ? 26  ASP E OD2 1 
ATOM   180  N  N   . PHE A 1 27  ? -55.564  -2.170  8.959   1.00 131.91 ? 27  PHE E N   1 
ATOM   181  C  CA  . PHE A 1 27  ? -56.876  -2.705  8.592   1.00 129.35 ? 27  PHE E CA  1 
ATOM   182  C  C   . PHE A 1 27  ? -56.672  -3.984  7.790   1.00 140.11 ? 27  PHE E C   1 
ATOM   183  O  O   . PHE A 1 27  ? -56.411  -3.942  6.590   1.00 148.04 ? 27  PHE E O   1 
ATOM   184  C  CB  . PHE A 1 27  ? -57.657  -1.662  7.796   1.00 121.22 ? 27  PHE E CB  1 
ATOM   185  C  CG  . PHE A 1 27  ? -58.048  -0.472  8.615   1.00 111.72 ? 27  PHE E CG  1 
ATOM   186  C  CD1 . PHE A 1 27  ? -57.107  0.473   9.021   1.00 106.67 ? 27  PHE E CD1 1 
ATOM   187  C  CD2 . PHE A 1 27  ? -59.372  -0.309  9.006   1.00 107.41 ? 27  PHE E CD2 1 
ATOM   188  C  CE1 . PHE A 1 27  ? -57.487  1.557   9.790   1.00 105.36 ? 27  PHE E CE1 1 
ATOM   189  C  CE2 . PHE A 1 27  ? -59.759  0.779   9.771   1.00 105.03 ? 27  PHE E CE2 1 
ATOM   190  C  CZ  . PHE A 1 27  ? -58.814  1.709   10.168  1.00 105.21 ? 27  PHE E CZ  1 
ATOM   191  N  N   . TRP A 1 28  ? -56.792  -5.115  8.476   1.00 147.49 ? 28  TRP E N   1 
ATOM   192  C  CA  . TRP A 1 28  ? -56.496  -6.431  7.908   1.00 149.79 ? 28  TRP E CA  1 
ATOM   193  C  C   . TRP A 1 28  ? -57.770  -7.269  7.890   1.00 145.66 ? 28  TRP E C   1 
ATOM   194  O  O   . TRP A 1 28  ? -58.784  -6.890  8.476   1.00 136.30 ? 28  TRP E O   1 
ATOM   195  C  CB  . TRP A 1 28  ? -55.368  -7.122  8.701   1.00 156.02 ? 28  TRP E CB  1 
ATOM   196  C  CG  . TRP A 1 28  ? -55.770  -7.712  10.034  1.00 162.07 ? 28  TRP E CG  1 
ATOM   197  C  CD1 . TRP A 1 28  ? -56.139  -7.035  11.166  1.00 165.00 ? 28  TRP E CD1 1 
ATOM   198  C  CD2 . TRP A 1 28  ? -55.826  -9.103  10.367  1.00 165.67 ? 28  TRP E CD2 1 
ATOM   199  N  NE1 . TRP A 1 28  ? -56.433  -7.917  12.175  1.00 165.27 ? 28  TRP E NE1 1 
ATOM   200  C  CE2 . TRP A 1 28  ? -56.247  -9.195  11.715  1.00 165.90 ? 28  TRP E CE2 1 
ATOM   201  C  CE3 . TRP A 1 28  ? -55.573  -10.286 9.652   1.00 167.76 ? 28  TRP E CE3 1 
ATOM   202  C  CZ2 . TRP A 1 28  ? -56.415  -10.425 12.368  1.00 166.04 ? 28  TRP E CZ2 1 
ATOM   203  C  CZ3 . TRP A 1 28  ? -55.730  -11.506 10.304  1.00 167.49 ? 28  TRP E CZ3 1 
ATOM   204  C  CH2 . TRP A 1 28  ? -56.160  -11.568 11.646  1.00 165.68 ? 28  TRP E CH2 1 
ATOM   205  N  N   . ALA A 1 29  ? -57.701  -8.397  7.195   1.00 148.70 ? 29  ALA E N   1 
ATOM   206  C  CA  . ALA A 1 29  ? -58.805  -9.343  7.099   1.00 156.37 ? 29  ALA E CA  1 
ATOM   207  C  C   . ALA A 1 29  ? -58.245  -10.747 6.881   1.00 162.13 ? 29  ALA E C   1 
ATOM   208  O  O   . ALA A 1 29  ? -57.204  -10.917 6.235   1.00 161.78 ? 29  ALA E O   1 
ATOM   209  C  CB  . ALA A 1 29  ? -59.721  -8.961  5.948   1.00 157.08 ? 29  ALA E CB  1 
ATOM   210  N  N   . GLU A 1 30  ? -58.947  -11.750 7.406   1.00 164.32 ? 30  GLU E N   1 
ATOM   211  C  CA  . GLU A 1 30  ? -58.500  -13.143 7.285   1.00 158.76 ? 30  GLU E CA  1 
ATOM   212  C  C   . GLU A 1 30  ? -58.587  -13.670 5.840   1.00 157.46 ? 30  GLU E C   1 
ATOM   213  O  O   . GLU A 1 30  ? -57.881  -14.618 5.489   1.00 160.05 ? 30  GLU E O   1 
ATOM   214  C  CB  . GLU A 1 30  ? -59.286  -14.058 8.243   1.00 154.90 ? 30  GLU E CB  1 
ATOM   215  C  CG  . GLU A 1 30  ? -58.616  -15.395 8.552   1.00 151.47 ? 30  GLU E CG  1 
ATOM   216  C  CD  . GLU A 1 30  ? -57.279  -15.244 9.264   1.00 148.88 ? 30  GLU E CD  1 
ATOM   217  O  OE1 . GLU A 1 30  ? -57.234  -14.550 10.305  1.00 144.51 ? 30  GLU E OE1 1 
ATOM   218  O  OE2 . GLU A 1 30  ? -56.269  -15.812 8.786   1.00 144.87 ? 30  GLU E OE2 1 
ATOM   219  N  N   . TRP A 1 31  ? -59.435  -13.044 5.015   1.00 152.88 ? 31  TRP E N   1 
ATOM   220  C  CA  . TRP A 1 31  ? -59.627  -13.443 3.608   1.00 148.73 ? 31  TRP E CA  1 
ATOM   221  C  C   . TRP A 1 31  ? -58.660  -12.794 2.605   1.00 146.76 ? 31  TRP E C   1 
ATOM   222  O  O   . TRP A 1 31  ? -58.618  -13.211 1.446   1.00 154.51 ? 31  TRP E O   1 
ATOM   223  C  CB  . TRP A 1 31  ? -61.081  -13.203 3.154   1.00 148.53 ? 31  TRP E CB  1 
ATOM   224  C  CG  . TRP A 1 31  ? -61.598  -11.792 3.329   1.00 148.93 ? 31  TRP E CG  1 
ATOM   225  C  CD1 . TRP A 1 31  ? -62.271  -11.301 4.414   1.00 147.35 ? 31  TRP E CD1 1 
ATOM   226  C  CD2 . TRP A 1 31  ? -61.499  -10.703 2.393   1.00 148.77 ? 31  TRP E CD2 1 
ATOM   227  N  NE1 . TRP A 1 31  ? -62.588  -9.978  4.220   1.00 146.18 ? 31  TRP E NE1 1 
ATOM   228  C  CE2 . TRP A 1 31  ? -62.129  -9.584  2.989   1.00 147.02 ? 31  TRP E CE2 1 
ATOM   229  C  CE3 . TRP A 1 31  ? -60.935  -10.561 1.114   1.00 144.65 ? 31  TRP E CE3 1 
ATOM   230  C  CZ2 . TRP A 1 31  ? -62.223  -8.338  2.343   1.00 141.61 ? 31  TRP E CZ2 1 
ATOM   231  C  CZ3 . TRP A 1 31  ? -61.028  -9.316  0.472   1.00 137.97 ? 31  TRP E CZ3 1 
ATOM   232  C  CH2 . TRP A 1 31  ? -61.664  -8.225  1.093   1.00 137.22 ? 31  TRP E CH2 1 
ATOM   233  N  N   . SER A 1 32  ? -57.884  -11.798 3.044   1.00 145.20 ? 32  SER E N   1 
ATOM   234  C  CA  . SER A 1 32  ? -56.979  -11.065 2.154   1.00 146.81 ? 32  SER E CA  1 
ATOM   235  C  C   . SER A 1 32  ? -55.541  -11.532 2.323   1.00 150.67 ? 32  SER E C   1 
ATOM   236  O  O   . SER A 1 32  ? -54.956  -11.350 3.381   1.00 150.39 ? 32  SER E O   1 
ATOM   237  C  CB  . SER A 1 32  ? -57.086  -9.559  2.398   1.00 144.48 ? 32  SER E CB  1 
ATOM   238  O  OG  . SER A 1 32  ? -58.062  -9.002  1.539   1.00 141.46 ? 32  SER E OG  1 
ATOM   239  N  N   . GLY A 1 33  ? -54.997  -12.141 1.273   1.00 156.24 ? 33  GLY E N   1 
ATOM   240  C  CA  . GLY A 1 33  ? -53.594  -12.538 1.228   1.00 158.64 ? 33  GLY E CA  1 
ATOM   241  C  C   . GLY A 1 33  ? -52.611  -11.380 1.306   1.00 162.66 ? 33  GLY E C   1 
ATOM   242  O  O   . GLY A 1 33  ? -51.535  -11.526 1.890   1.00 167.18 ? 33  GLY E O   1 
ATOM   243  N  N   . PRO A 1 34  ? -52.956  -10.228 0.695   1.00 161.87 ? 34  PRO E N   1 
ATOM   244  C  CA  . PRO A 1 34  ? -52.173  -9.006  0.916   1.00 162.93 ? 34  PRO E CA  1 
ATOM   245  C  C   . PRO A 1 34  ? -52.125  -8.546  2.384   1.00 166.90 ? 34  PRO E C   1 
ATOM   246  O  O   . PRO A 1 34  ? -51.087  -8.072  2.841   1.00 170.87 ? 34  PRO E O   1 
ATOM   247  C  CB  . PRO A 1 34  ? -52.894  -7.978  0.044   1.00 159.52 ? 34  PRO E CB  1 
ATOM   248  C  CG  . PRO A 1 34  ? -53.480  -8.772  -1.064  1.00 156.40 ? 34  PRO E CG  1 
ATOM   249  C  CD  . PRO A 1 34  ? -53.891  -10.073 -0.439  1.00 157.43 ? 34  PRO E CD  1 
ATOM   250  N  N   . SER A 1 35  ? -53.240  -8.685  3.099   1.00 163.44 ? 35  SER E N   1 
ATOM   251  C  CA  . SER A 1 35  ? -53.332  -8.288  4.510   1.00 157.06 ? 35  SER E CA  1 
ATOM   252  C  C   . SER A 1 35  ? -52.570  -9.217  5.479   1.00 161.45 ? 35  SER E C   1 
ATOM   253  O  O   . SER A 1 35  ? -52.271  -8.815  6.608   1.00 167.33 ? 35  SER E O   1 
ATOM   254  C  CB  . SER A 1 35  ? -54.798  -8.212  4.930   1.00 148.61 ? 35  SER E CB  1 
ATOM   255  O  OG  . SER A 1 35  ? -55.534  -7.338  4.091   1.00 140.11 ? 35  SER E OG  1 
ATOM   256  N  N   . LYS A 1 36  ? -52.283  -10.448 5.048   1.00 157.76 ? 36  LYS E N   1 
ATOM   257  C  CA  . LYS A 1 36  ? -51.445  -11.391 5.808   1.00 149.39 ? 36  LYS E CA  1 
ATOM   258  C  C   . LYS A 1 36  ? -49.940  -11.153 5.616   1.00 146.64 ? 36  LYS E C   1 
ATOM   259  O  O   . LYS A 1 36  ? -49.161  -11.386 6.548   1.00 142.46 ? 36  LYS E O   1 
ATOM   260  C  CB  . LYS A 1 36  ? -51.740  -12.838 5.407   1.00 147.51 ? 36  LYS E CB  1 
ATOM   261  C  CG  . LYS A 1 36  ? -53.134  -13.346 5.679   1.00 147.42 ? 36  LYS E CG  1 
ATOM   262  C  CD  . LYS A 1 36  ? -53.337  -14.637 4.894   1.00 145.21 ? 36  LYS E CD  1 
ATOM   263  C  CE  . LYS A 1 36  ? -54.567  -15.410 5.325   1.00 143.00 ? 36  LYS E CE  1 
ATOM   264  N  NZ  . LYS A 1 36  ? -54.542  -16.761 4.707   1.00 140.42 ? 36  LYS E NZ  1 
ATOM   265  N  N   . MET A 1 37  ? -49.537  -10.705 4.420   1.00 147.44 ? 37  MET E N   1 
ATOM   266  C  CA  . MET A 1 37  ? -48.127  -10.420 4.114   1.00 149.49 ? 37  MET E CA  1 
ATOM   267  C  C   . MET A 1 37  ? -47.480  -9.379  5.056   1.00 155.61 ? 37  MET E C   1 
ATOM   268  O  O   . MET A 1 37  ? -46.279  -9.449  5.308   1.00 157.38 ? 37  MET E O   1 
ATOM   269  C  CB  . MET A 1 37  ? -47.979  -9.989  2.656   1.00 145.09 ? 37  MET E CB  1 
ATOM   270  N  N   . ILE A 1 38  ? -48.275  -8.440  5.563   1.00 159.82 ? 38  ILE E N   1 
ATOM   271  C  CA  . ILE A 1 38  ? -47.826  -7.430  6.537   1.00 158.82 ? 38  ILE E CA  1 
ATOM   272  C  C   . ILE A 1 38  ? -47.813  -7.863  8.015   1.00 161.92 ? 38  ILE E C   1 
ATOM   273  O  O   . ILE A 1 38  ? -47.217  -7.172  8.840   1.00 167.15 ? 38  ILE E O   1 
ATOM   274  C  CB  . ILE A 1 38  ? -48.592  -6.072  6.420   1.00 155.43 ? 38  ILE E CB  1 
ATOM   275  C  CG1 . ILE A 1 38  ? -50.122  -6.198  6.585   1.00 150.82 ? 38  ILE E CG1 1 
ATOM   276  C  CG2 . ILE A 1 38  ? -48.333  -5.445  5.056   1.00 154.55 ? 38  ILE E CG2 1 
ATOM   277  C  CD1 . ILE A 1 38  ? -50.708  -6.411  7.963   1.00 146.43 ? 38  ILE E CD1 1 
ATOM   278  N  N   . ALA A 1 39  ? -48.450  -8.995  8.337   1.00 161.15 ? 39  ALA E N   1 
ATOM   279  C  CA  . ALA A 1 39  ? -48.586  -9.435  9.730   1.00 156.02 ? 39  ALA E CA  1 
ATOM   280  C  C   . ALA A 1 39  ? -47.244  -9.708  10.452  1.00 150.53 ? 39  ALA E C   1 
ATOM   281  O  O   . ALA A 1 39  ? -47.033  -9.172  11.551  1.00 147.60 ? 39  ALA E O   1 
ATOM   282  C  CB  . ALA A 1 39  ? -49.522  -10.640 9.826   1.00 155.80 ? 39  ALA E CB  1 
ATOM   283  N  N   . PRO A 1 40  ? -46.338  -10.526 9.848   1.00 142.69 ? 40  PRO E N   1 
ATOM   284  C  CA  . PRO A 1 40  ? -45.032  -10.738 10.491  1.00 140.53 ? 40  PRO E CA  1 
ATOM   285  C  C   . PRO A 1 40  ? -44.109  -9.512  10.460  1.00 149.06 ? 40  PRO E C   1 
ATOM   286  O  O   . PRO A 1 40  ? -43.298  -9.356  11.373  1.00 151.21 ? 40  PRO E O   1 
ATOM   287  C  CB  . PRO A 1 40  ? -44.422  -11.898 9.690   1.00 135.03 ? 40  PRO E CB  1 
ATOM   288  C  CG  . PRO A 1 40  ? -45.080  -11.830 8.362   1.00 134.39 ? 40  PRO E CG  1 
ATOM   289  C  CD  . PRO A 1 40  ? -46.476  -11.363 8.639   1.00 138.32 ? 40  PRO E CD  1 
ATOM   290  N  N   . ILE A 1 41  ? -44.222  -8.670  9.422   1.00 153.86 ? 41  ILE E N   1 
ATOM   291  C  CA  . ILE A 1 41  ? -43.396  -7.447  9.337   1.00 147.75 ? 41  ILE E CA  1 
ATOM   292  C  C   . ILE A 1 41  ? -43.846  -6.378  10.337  1.00 144.49 ? 41  ILE E C   1 
ATOM   293  O  O   . ILE A 1 41  ? -43.011  -5.648  10.861  1.00 146.37 ? 41  ILE E O   1 
ATOM   294  C  CB  . ILE A 1 41  ? -43.258  -6.865  7.901   1.00 143.72 ? 41  ILE E CB  1 
ATOM   295  C  CG1 . ILE A 1 41  ? -44.608  -6.574  7.266   1.00 143.82 ? 41  ILE E CG1 1 
ATOM   296  C  CG2 . ILE A 1 41  ? -42.422  -7.800  7.026   1.00 140.52 ? 41  ILE E CG2 1 
ATOM   297  C  CD1 . ILE A 1 41  ? -44.538  -5.962  5.882   1.00 143.20 ? 41  ILE E CD1 1 
ATOM   298  N  N   . LEU A 1 42  ? -45.145  -6.299  10.619  1.00 139.36 ? 42  LEU E N   1 
ATOM   299  C  CA  . LEU A 1 42  ? -45.651  -5.411  11.691  1.00 131.79 ? 42  LEU E CA  1 
ATOM   300  C  C   . LEU A 1 42  ? -45.232  -5.892  13.089  1.00 127.75 ? 42  LEU E C   1 
ATOM   301  O  O   . LEU A 1 42  ? -44.938  -5.071  13.962  1.00 126.52 ? 42  LEU E O   1 
ATOM   302  C  CB  . LEU A 1 42  ? -47.174  -5.244  11.625  1.00 129.15 ? 42  LEU E CB  1 
ATOM   303  C  CG  . LEU A 1 42  ? -47.729  -4.346  10.504  1.00 127.39 ? 42  LEU E CG  1 
ATOM   304  C  CD1 . LEU A 1 42  ? -49.241  -4.330  10.546  1.00 124.23 ? 42  LEU E CD1 1 
ATOM   305  C  CD2 . LEU A 1 42  ? -47.206  -2.917  10.565  1.00 129.99 ? 42  LEU E CD2 1 
ATOM   306  N  N   . ASP A 1 43  ? -45.216  -7.210  13.296  1.00 123.49 ? 43  ASP E N   1 
ATOM   307  C  CA  . ASP A 1 43  ? -44.689  -7.801  14.543  1.00 123.75 ? 43  ASP E CA  1 
ATOM   308  C  C   . ASP A 1 43  ? -43.225  -7.418  14.808  1.00 127.22 ? 43  ASP E C   1 
ATOM   309  O  O   . ASP A 1 43  ? -42.850  -7.169  15.948  1.00 128.04 ? 43  ASP E O   1 
ATOM   310  C  CB  . ASP A 1 43  ? -44.830  -9.334  14.539  1.00 120.87 ? 43  ASP E CB  1 
ATOM   311  C  CG  . ASP A 1 43  ? -46.181  -9.798  15.061  1.00 119.50 ? 43  ASP E CG  1 
ATOM   312  O  OD1 . ASP A 1 43  ? -46.495  -9.506  16.237  1.00 112.05 ? 43  ASP E OD1 1 
ATOM   313  O  OD2 . ASP A 1 43  ? -46.918  -10.471 14.311  1.00 122.96 ? 43  ASP E OD2 1 
ATOM   314  N  N   . GLU A 1 44  ? -42.415  -7.382  13.753  1.00 127.99 ? 44  GLU E N   1 
ATOM   315  C  CA  . GLU A 1 44  ? -41.020  -6.928  13.845  1.00 125.19 ? 44  GLU E CA  1 
ATOM   316  C  C   . GLU A 1 44  ? -40.918  -5.405  14.068  1.00 124.97 ? 44  GLU E C   1 
ATOM   317  O  O   . GLU A 1 44  ? -40.044  -4.951  14.811  1.00 127.59 ? 44  GLU E O   1 
ATOM   318  C  CB  . GLU A 1 44  ? -40.231  -7.342  12.594  1.00 122.55 ? 44  GLU E CB  1 
ATOM   319  C  CG  . GLU A 1 44  ? -40.062  -8.843  12.416  1.00 117.86 ? 44  GLU E CG  1 
ATOM   320  C  CD  . GLU A 1 44  ? -39.673  -9.237  10.994  1.00 115.09 ? 44  GLU E CD  1 
ATOM   321  O  OE1 . GLU A 1 44  ? -38.987  -8.454  10.293  1.00 109.98 ? 44  GLU E OE1 1 
ATOM   322  O  OE2 . GLU A 1 44  ? -40.064  -10.346 10.571  1.00 114.83 ? 44  GLU E OE2 1 
ATOM   323  N  N   . ILE A 1 45  ? -41.802  -4.630  13.431  1.00 119.23 ? 45  ILE E N   1 
ATOM   324  C  CA  . ILE A 1 45  ? -41.862  -3.165  13.620  1.00 115.20 ? 45  ILE E CA  1 
ATOM   325  C  C   . ILE A 1 45  ? -42.250  -2.762  15.055  1.00 112.20 ? 45  ILE E C   1 
ATOM   326  O  O   . ILE A 1 45  ? -41.755  -1.761  15.564  1.00 109.17 ? 45  ILE E O   1 
ATOM   327  C  CB  . ILE A 1 45  ? -42.820  -2.502  12.580  1.00 114.71 ? 45  ILE E CB  1 
ATOM   328  C  CG1 . ILE A 1 45  ? -42.227  -2.561  11.163  1.00 113.26 ? 45  ILE E CG1 1 
ATOM   329  C  CG2 . ILE A 1 45  ? -43.194  -1.072  12.951  1.00 114.07 ? 45  ILE E CG2 1 
ATOM   330  C  CD1 . ILE A 1 45  ? -40.901  -1.860  10.968  1.00 112.42 ? 45  ILE E CD1 1 
ATOM   331  N  N   . ALA A 1 46  ? -43.126  -3.531  15.697  1.00 111.15 ? 46  ALA E N   1 
ATOM   332  C  CA  . ALA A 1 46  ? -43.510  -3.275  17.092  1.00 114.16 ? 46  ALA E CA  1 
ATOM   333  C  C   . ALA A 1 46  ? -42.324  -3.348  18.071  1.00 112.99 ? 46  ALA E C   1 
ATOM   334  O  O   . ALA A 1 46  ? -42.253  -2.552  19.016  1.00 101.99 ? 46  ALA E O   1 
ATOM   335  C  CB  . ALA A 1 46  ? -44.608  -4.237  17.523  1.00 118.22 ? 46  ALA E CB  1 
ATOM   336  N  N   . ASP A 1 47  ? -41.402  -4.279  17.827  1.00 121.01 ? 47  ASP E N   1 
ATOM   337  C  CA  . ASP A 1 47  ? -40.182  -4.436  18.642  1.00 127.79 ? 47  ASP E CA  1 
ATOM   338  C  C   . ASP A 1 47  ? -39.131  -3.377  18.285  1.00 134.42 ? 47  ASP E C   1 
ATOM   339  O  O   . ASP A 1 47  ? -38.568  -2.726  19.173  1.00 134.93 ? 47  ASP E O   1 
ATOM   340  C  CB  . ASP A 1 47  ? -39.551  -5.827  18.448  1.00 125.86 ? 47  ASP E CB  1 
ATOM   341  C  CG  . ASP A 1 47  ? -40.525  -6.963  18.673  1.00 121.88 ? 47  ASP E CG  1 
ATOM   342  O  OD1 . ASP A 1 47  ? -41.379  -6.844  19.580  1.00 124.48 ? 47  ASP E OD1 1 
ATOM   343  O  OD2 . ASP A 1 47  ? -40.426  -7.973  17.935  1.00 115.34 ? 47  ASP E OD2 1 
ATOM   344  N  N   . GLU A 1 48  ? -38.869  -3.234  16.981  1.00 137.18 ? 48  GLU E N   1 
ATOM   345  C  CA  . GLU A 1 48  ? -37.839  -2.316  16.469  1.00 136.99 ? 48  GLU E CA  1 
ATOM   346  C  C   . GLU A 1 48  ? -38.186  -0.837  16.662  1.00 132.74 ? 48  GLU E C   1 
ATOM   347  O  O   . GLU A 1 48  ? -37.296  -0.032  16.941  1.00 132.46 ? 48  GLU E O   1 
ATOM   348  C  CB  . GLU A 1 48  ? -37.530  -2.593  14.989  1.00 141.03 ? 48  GLU E CB  1 
ATOM   349  C  CG  . GLU A 1 48  ? -36.731  -3.866  14.742  1.00 143.65 ? 48  GLU E CG  1 
ATOM   350  C  CD  . GLU A 1 48  ? -36.506  -4.130  13.262  1.00 149.19 ? 48  GLU E CD  1 
ATOM   351  O  OE1 . GLU A 1 48  ? -35.958  -3.254  12.563  1.00 151.47 ? 48  GLU E OE1 1 
ATOM   352  O  OE2 . GLU A 1 48  ? -36.908  -5.209  12.770  1.00 154.92 ? 48  GLU E OE2 1 
ATOM   353  N  N   . TYR A 1 49  ? -39.463  -0.481  16.505  1.00 126.93 ? 49  TYR E N   1 
ATOM   354  C  CA  . TYR A 1 49  ? -39.951  0.868   16.830  1.00 120.66 ? 49  TYR E CA  1 
ATOM   355  C  C   . TYR A 1 49  ? -40.678  0.900   18.196  1.00 117.20 ? 49  TYR E C   1 
ATOM   356  O  O   . TYR A 1 49  ? -41.671  1.633   18.368  1.00 115.45 ? 49  TYR E O   1 
ATOM   357  C  CB  . TYR A 1 49  ? -40.876  1.407   15.716  1.00 119.79 ? 49  TYR E CB  1 
ATOM   358  C  CG  . TYR A 1 49  ? -40.194  1.827   14.422  1.00 116.42 ? 49  TYR E CG  1 
ATOM   359  C  CD1 . TYR A 1 49  ? -39.824  3.160   14.199  1.00 116.89 ? 49  TYR E CD1 1 
ATOM   360  C  CD2 . TYR A 1 49  ? -39.937  0.899   13.409  1.00 112.60 ? 49  TYR E CD2 1 
ATOM   361  C  CE1 . TYR A 1 49  ? -39.206  3.545   13.013  1.00 117.95 ? 49  TYR E CE1 1 
ATOM   362  C  CE2 . TYR A 1 49  ? -39.327  1.277   12.219  1.00 113.10 ? 49  TYR E CE2 1 
ATOM   363  C  CZ  . TYR A 1 49  ? -38.955  2.594   12.027  1.00 115.83 ? 49  TYR E CZ  1 
ATOM   364  O  OH  . TYR A 1 49  ? -38.355  2.961   10.845  1.00 115.84 ? 49  TYR E OH  1 
ATOM   365  N  N   . GLN A 1 50  ? -40.192  0.120   19.172  1.00 114.89 ? 50  GLN E N   1 
ATOM   366  C  CA  . GLN A 1 50  ? -40.698  0.186   20.554  1.00 112.96 ? 50  GLN E CA  1 
ATOM   367  C  C   . GLN A 1 50  ? -40.367  1.566   21.135  1.00 110.92 ? 50  GLN E C   1 
ATOM   368  O  O   . GLN A 1 50  ? -39.264  2.071   20.940  1.00 117.71 ? 50  GLN E O   1 
ATOM   369  C  CB  . GLN A 1 50  ? -40.075  -0.921  21.421  1.00 110.88 ? 50  GLN E CB  1 
ATOM   370  C  CG  . GLN A 1 50  ? -40.540  -0.929  22.881  1.00 108.91 ? 50  GLN E CG  1 
ATOM   371  C  CD  . GLN A 1 50  ? -39.813  -1.948  23.740  1.00 106.42 ? 50  GLN E CD  1 
ATOM   372  O  OE1 . GLN A 1 50  ? -38.649  -2.271  23.504  1.00 105.72 ? 50  GLN E OE1 1 
ATOM   373  N  NE2 . GLN A 1 50  ? -40.499  -2.448  24.758  1.00 103.20 ? 50  GLN E NE2 1 
ATOM   374  N  N   . GLY A 1 51  ? -41.330  2.190   21.808  1.00 107.86 ? 51  GLY E N   1 
ATOM   375  C  CA  . GLY A 1 51  ? -41.152  3.541   22.353  1.00 105.94 ? 51  GLY E CA  1 
ATOM   376  C  C   . GLY A 1 51  ? -41.344  4.706   21.379  1.00 106.35 ? 51  GLY E C   1 
ATOM   377  O  O   . GLY A 1 51  ? -41.670  5.815   21.817  1.00 106.77 ? 51  GLY E O   1 
ATOM   378  N  N   . LYS A 1 52  ? -41.116  4.477   20.079  1.00 103.00 ? 52  LYS E N   1 
ATOM   379  C  CA  . LYS A 1 52  ? -41.236  5.503   19.025  1.00 96.56  ? 52  LYS E CA  1 
ATOM   380  C  C   . LYS A 1 52  ? -42.641  5.547   18.404  1.00 88.46  ? 52  LYS E C   1 
ATOM   381  O  O   . LYS A 1 52  ? -43.108  6.617   17.997  1.00 82.12  ? 52  LYS E O   1 
ATOM   382  C  CB  . LYS A 1 52  ? -40.195  5.260   17.919  1.00 99.07  ? 52  LYS E CB  1 
ATOM   383  C  CG  . LYS A 1 52  ? -38.742  5.377   18.372  1.00 100.83 ? 52  LYS E CG  1 
ATOM   384  C  CD  . LYS A 1 52  ? -37.766  5.036   17.255  1.00 100.87 ? 52  LYS E CD  1 
ATOM   385  C  CE  . LYS A 1 52  ? -36.343  4.892   17.775  1.00 97.69  ? 52  LYS E CE  1 
ATOM   386  N  NZ  . LYS A 1 52  ? -35.408  4.408   16.720  1.00 96.81  ? 52  LYS E NZ  1 
ATOM   387  N  N   . LEU A 1 53  ? -43.292  4.385   18.307  1.00 85.39  ? 53  LEU E N   1 
ATOM   388  C  CA  . LEU A 1 53  ? -44.722  4.313   17.975  1.00 88.17  ? 53  LEU E CA  1 
ATOM   389  C  C   . LEU A 1 53  ? -45.389  3.078   18.587  1.00 86.36  ? 53  LEU E C   1 
ATOM   390  O  O   . LEU A 1 53  ? -44.724  2.241   19.213  1.00 83.51  ? 53  LEU E O   1 
ATOM   391  C  CB  . LEU A 1 53  ? -44.939  4.375   16.450  1.00 89.85  ? 53  LEU E CB  1 
ATOM   392  C  CG  . LEU A 1 53  ? -44.568  3.203   15.528  1.00 92.26  ? 53  LEU E CG  1 
ATOM   393  C  CD1 . LEU A 1 53  ? -45.578  2.063   15.536  1.00 90.64  ? 53  LEU E CD1 1 
ATOM   394  C  CD2 . LEU A 1 53  ? -44.418  3.702   14.097  1.00 97.56  ? 53  LEU E CD2 1 
ATOM   395  N  N   . THR A 1 54  ? -46.711  3.000   18.414  1.00 84.69  ? 54  THR E N   1 
ATOM   396  C  CA  . THR A 1 54  ? -47.520  1.859   18.839  1.00 82.40  ? 54  THR E CA  1 
ATOM   397  C  C   . THR A 1 54  ? -48.218  1.277   17.617  1.00 84.70  ? 54  THR E C   1 
ATOM   398  O  O   . THR A 1 54  ? -48.930  1.986   16.906  1.00 88.30  ? 54  THR E O   1 
ATOM   399  C  CB  . THR A 1 54  ? -48.596  2.288   19.853  1.00 78.17  ? 54  THR E CB  1 
ATOM   400  O  OG1 . THR A 1 54  ? -47.976  2.951   20.959  1.00 74.29  ? 54  THR E OG1 1 
ATOM   401  C  CG2 . THR A 1 54  ? -49.415  1.090   20.361  1.00 76.53  ? 54  THR E CG2 1 
ATOM   402  N  N   . VAL A 1 55  ? -48.009  -0.013  17.375  1.00 87.61  ? 55  VAL E N   1 
ATOM   403  C  CA  . VAL A 1 55  ? -48.667  -0.700  16.263  1.00 90.58  ? 55  VAL E CA  1 
ATOM   404  C  C   . VAL A 1 55  ? -50.017  -1.196  16.784  1.00 92.29  ? 55  VAL E C   1 
ATOM   405  O  O   . VAL A 1 55  ? -50.073  -1.878  17.814  1.00 95.50  ? 55  VAL E O   1 
ATOM   406  C  CB  . VAL A 1 55  ? -47.825  -1.888  15.732  1.00 89.60  ? 55  VAL E CB  1 
ATOM   407  C  CG1 . VAL A 1 55  ? -48.497  -2.528  14.515  1.00 87.47  ? 55  VAL E CG1 1 
ATOM   408  C  CG2 . VAL A 1 55  ? -46.395  -1.460  15.428  1.00 90.25  ? 55  VAL E CG2 1 
ATOM   409  N  N   . ALA A 1 56  ? -51.095  -0.821  16.093  1.00 94.62  ? 56  ALA E N   1 
ATOM   410  C  CA  . ALA A 1 56  ? -52.440  -1.294  16.411  1.00 97.24  ? 56  ALA E CA  1 
ATOM   411  C  C   . ALA A 1 56  ? -53.034  -1.980  15.186  1.00 100.78 ? 56  ALA E C   1 
ATOM   412  O  O   . ALA A 1 56  ? -52.764  -1.581  14.049  1.00 102.86 ? 56  ALA E O   1 
ATOM   413  C  CB  . ALA A 1 56  ? -53.323  -0.150  16.869  1.00 96.66  ? 56  ALA E CB  1 
ATOM   414  N  N   . LYS A 1 57  ? -53.812  -3.035  15.430  1.00 104.94 ? 57  LYS E N   1 
ATOM   415  C  CA  . LYS A 1 57  ? -54.436  -3.824  14.363  1.00 106.61 ? 57  LYS E CA  1 
ATOM   416  C  C   . LYS A 1 57  ? -55.938  -3.907  14.598  1.00 101.42 ? 57  LYS E C   1 
ATOM   417  O  O   . LYS A 1 57  ? -56.388  -3.925  15.741  1.00 97.83  ? 57  LYS E O   1 
ATOM   418  C  CB  . LYS A 1 57  ? -53.825  -5.230  14.292  1.00 113.26 ? 57  LYS E CB  1 
ATOM   419  C  CG  . LYS A 1 57  ? -52.358  -5.252  13.852  1.00 116.39 ? 57  LYS E CG  1 
ATOM   420  C  CD  . LYS A 1 57  ? -51.750  -6.647  13.847  1.00 119.38 ? 57  LYS E CD  1 
ATOM   421  C  CE  . LYS A 1 57  ? -52.288  -7.494  12.699  1.00 124.03 ? 57  LYS E CE  1 
ATOM   422  N  NZ  . LYS A 1 57  ? -51.417  -8.641  12.323  1.00 127.56 ? 57  LYS E NZ  1 
ATOM   423  N  N   . LEU A 1 58  ? -56.702  -3.938  13.510  1.00 98.34  ? 58  LEU E N   1 
ATOM   424  C  CA  . LEU A 1 58  ? -58.158  -4.021  13.576  1.00 102.43 ? 58  LEU E CA  1 
ATOM   425  C  C   . LEU A 1 58  ? -58.675  -4.951  12.480  1.00 110.61 ? 58  LEU E C   1 
ATOM   426  O  O   . LEU A 1 58  ? -58.475  -4.682  11.294  1.00 111.84 ? 58  LEU E O   1 
ATOM   427  C  CB  . LEU A 1 58  ? -58.768  -2.629  13.437  1.00 101.57 ? 58  LEU E CB  1 
ATOM   428  C  CG  . LEU A 1 58  ? -60.297  -2.549  13.596  1.00 102.48 ? 58  LEU E CG  1 
ATOM   429  C  CD1 . LEU A 1 58  ? -60.728  -1.354  14.449  1.00 102.78 ? 58  LEU E CD1 1 
ATOM   430  C  CD2 . LEU A 1 58  ? -61.006  -2.509  12.244  1.00 104.33 ? 58  LEU E CD2 1 
ATOM   431  N  N   . ASN A 1 59  ? -59.342  -6.033  12.888  1.00 121.61 ? 59  ASN E N   1 
ATOM   432  C  CA  . ASN A 1 59  ? -59.951  -6.983  11.949  1.00 128.86 ? 59  ASN E CA  1 
ATOM   433  C  C   . ASN A 1 59  ? -61.245  -6.388  11.370  1.00 134.00 ? 59  ASN E C   1 
ATOM   434  O  O   . ASN A 1 59  ? -62.251  -6.273  12.075  1.00 131.30 ? 59  ASN E O   1 
ATOM   435  C  CB  . ASN A 1 59  ? -60.220  -8.332  12.640  1.00 129.98 ? 59  ASN E CB  1 
ATOM   436  C  CG  . ASN A 1 59  ? -60.329  -9.490  11.659  1.00 132.14 ? 59  ASN E CG  1 
ATOM   437  O  OD1 . ASN A 1 59  ? -60.914  -9.365  10.581  1.00 138.03 ? 59  ASN E OD1 1 
ATOM   438  N  ND2 . ASN A 1 59  ? -59.759  -10.631 12.034  1.00 129.31 ? 59  ASN E ND2 1 
ATOM   439  N  N   . ILE A 1 60  ? -61.201  -6.008  10.090  1.00 137.14 ? 60  ILE E N   1 
ATOM   440  C  CA  . ILE A 1 60  ? -62.336  -5.364  9.394   1.00 135.63 ? 60  ILE E CA  1 
ATOM   441  C  C   . ILE A 1 60  ? -63.588  -6.265  9.238   1.00 142.37 ? 60  ILE E C   1 
ATOM   442  O  O   . ILE A 1 60  ? -64.702  -5.751  9.057   1.00 145.22 ? 60  ILE E O   1 
ATOM   443  C  CB  . ILE A 1 60  ? -61.883  -4.798  8.018   1.00 129.40 ? 60  ILE E CB  1 
ATOM   444  C  CG1 . ILE A 1 60  ? -62.885  -3.768  7.483   1.00 128.23 ? 60  ILE E CG1 1 
ATOM   445  C  CG2 . ILE A 1 60  ? -61.645  -5.915  7.005   1.00 127.87 ? 60  ILE E CG2 1 
ATOM   446  C  CD1 . ILE A 1 60  ? -62.428  -3.111  6.199   1.00 128.73 ? 60  ILE E CD1 1 
ATOM   447  N  N   . ASP A 1 61  ? -63.403  -7.590  9.305   1.00 145.29 ? 61  ASP E N   1 
ATOM   448  C  CA  . ASP A 1 61  ? -64.525  -8.550  9.330   1.00 142.49 ? 61  ASP E CA  1 
ATOM   449  C  C   . ASP A 1 61  ? -65.290  -8.452  10.652  1.00 141.64 ? 61  ASP E C   1 
ATOM   450  O  O   . ASP A 1 61  ? -66.498  -8.215  10.659  1.00 146.23 ? 61  ASP E O   1 
ATOM   451  C  CB  . ASP A 1 61  ? -64.043  -10.002 9.139   1.00 137.68 ? 61  ASP E CB  1 
ATOM   452  C  CG  . ASP A 1 61  ? -63.447  -10.267 7.754   1.00 130.85 ? 61  ASP E CG  1 
ATOM   453  O  OD1 . ASP A 1 61  ? -63.909  -9.678  6.758   1.00 124.71 ? 61  ASP E OD1 1 
ATOM   454  O  OD2 . ASP A 1 61  ? -62.518  -11.094 7.670   1.00 125.19 ? 61  ASP E OD2 1 
ATOM   455  N  N   . GLN A 1 62  ? -64.572  -8.636  11.759  1.00 136.30 ? 62  GLN E N   1 
ATOM   456  C  CA  . GLN A 1 62  ? -65.159  -8.577  13.112  1.00 131.78 ? 62  GLN E CA  1 
ATOM   457  C  C   . GLN A 1 62  ? -65.664  -7.185  13.524  1.00 132.87 ? 62  GLN E C   1 
ATOM   458  O  O   . GLN A 1 62  ? -66.593  -7.080  14.326  1.00 128.50 ? 62  GLN E O   1 
ATOM   459  C  CB  . GLN A 1 62  ? -64.151  -9.060  14.157  1.00 127.51 ? 62  GLN E CB  1 
ATOM   460  C  CG  . GLN A 1 62  ? -63.804  -10.527 14.055  1.00 122.07 ? 62  GLN E CG  1 
ATOM   461  C  CD  . GLN A 1 62  ? -62.665  -10.897 14.973  1.00 118.08 ? 62  GLN E CD  1 
ATOM   462  O  OE1 . GLN A 1 62  ? -62.706  -10.633 16.179  1.00 112.61 ? 62  GLN E OE1 1 
ATOM   463  N  NE2 . GLN A 1 62  ? -61.633  -11.506 14.408  1.00 114.90 ? 62  GLN E NE2 1 
ATOM   464  N  N   . ASN A 1 63  ? -65.042  -6.133  12.986  1.00 136.76 ? 63  ASN E N   1 
ATOM   465  C  CA  . ASN A 1 63  ? -65.416  -4.743  13.270  1.00 135.79 ? 63  ASN E CA  1 
ATOM   466  C  C   . ASN A 1 63  ? -65.677  -4.003  11.944  1.00 140.22 ? 63  ASN E C   1 
ATOM   467  O  O   . ASN A 1 63  ? -64.813  -3.247  11.471  1.00 145.79 ? 63  ASN E O   1 
ATOM   468  C  CB  . ASN A 1 63  ? -64.301  -4.043  14.075  1.00 130.64 ? 63  ASN E CB  1 
ATOM   469  C  CG  . ASN A 1 63  ? -63.813  -4.868  15.251  1.00 123.88 ? 63  ASN E CG  1 
ATOM   470  O  OD1 . ASN A 1 63  ? -64.564  -5.150  16.178  1.00 122.99 ? 63  ASN E OD1 1 
ATOM   471  N  ND2 . ASN A 1 63  ? -62.544  -5.253  15.218  1.00 115.91 ? 63  ASN E ND2 1 
ATOM   472  N  N   . PRO A 1 64  ? -66.859  -4.223  11.326  1.00 137.02 ? 64  PRO E N   1 
ATOM   473  C  CA  . PRO A 1 64  ? -67.146  -3.543  10.055  1.00 136.79 ? 64  PRO E CA  1 
ATOM   474  C  C   . PRO A 1 64  ? -67.447  -2.041  10.183  1.00 141.52 ? 64  PRO E C   1 
ATOM   475  O  O   . PRO A 1 64  ? -67.414  -1.343  9.174   1.00 152.39 ? 64  PRO E O   1 
ATOM   476  C  CB  . PRO A 1 64  ? -68.375  -4.293  9.529   1.00 131.82 ? 64  PRO E CB  1 
ATOM   477  C  CG  . PRO A 1 64  ? -69.060  -4.749  10.766  1.00 131.00 ? 64  PRO E CG  1 
ATOM   478  C  CD  . PRO A 1 64  ? -67.976  -5.096  11.737  1.00 133.27 ? 64  PRO E CD  1 
ATOM   479  N  N   . GLY A 1 65  ? -67.732  -1.557  11.397  1.00 137.68 ? 65  GLY E N   1 
ATOM   480  C  CA  . GLY A 1 65  ? -68.112  -0.165  11.637  1.00 133.41 ? 65  GLY E CA  1 
ATOM   481  C  C   . GLY A 1 65  ? -67.028  0.893   11.482  1.00 129.75 ? 65  GLY E C   1 
ATOM   482  O  O   . GLY A 1 65  ? -67.317  1.996   11.004  1.00 126.30 ? 65  GLY E O   1 
ATOM   483  N  N   . THR A 1 66  ? -65.796  0.580   11.891  1.00 130.33 ? 66  THR E N   1 
ATOM   484  C  CA  . THR A 1 66  ? -64.687  1.544   11.844  1.00 131.63 ? 66  THR E CA  1 
ATOM   485  C  C   . THR A 1 66  ? -64.252  1.967   10.428  1.00 137.71 ? 66  THR E C   1 
ATOM   486  O  O   . THR A 1 66  ? -63.996  3.153   10.188  1.00 143.51 ? 66  THR E O   1 
ATOM   487  C  CB  . THR A 1 66  ? -63.419  1.003   12.548  1.00 129.19 ? 66  THR E CB  1 
ATOM   488  O  OG1 . THR A 1 66  ? -63.764  0.390   13.795  1.00 125.51 ? 66  THR E OG1 1 
ATOM   489  C  CG2 . THR A 1 66  ? -62.420  2.124   12.790  1.00 127.05 ? 66  THR E CG2 1 
ATOM   490  N  N   . ALA A 1 67  ? -64.156  1.000   9.513   1.00 143.15 ? 67  ALA E N   1 
ATOM   491  C  CA  . ALA A 1 67  ? -63.497  1.220   8.207   1.00 144.93 ? 67  ALA E CA  1 
ATOM   492  C  C   . ALA A 1 67  ? -64.203  2.205   7.244   1.00 144.30 ? 67  ALA E C   1 
ATOM   493  O  O   . ALA A 1 67  ? -63.528  3.010   6.592   1.00 143.41 ? 67  ALA E O   1 
ATOM   494  C  CB  . ALA A 1 67  ? -63.223  -0.111  7.512   1.00 145.01 ? 67  ALA E CB  1 
ATOM   495  N  N   . PRO A 1 68  ? -65.552  2.135   7.138   1.00 140.40 ? 68  PRO E N   1 
ATOM   496  C  CA  . PRO A 1 68  ? -66.266  3.142   6.339   1.00 139.52 ? 68  PRO E CA  1 
ATOM   497  C  C   . PRO A 1 68  ? -66.045  4.600   6.783   1.00 141.20 ? 68  PRO E C   1 
ATOM   498  O  O   . PRO A 1 68  ? -65.997  5.483   5.929   1.00 146.78 ? 68  PRO E O   1 
ATOM   499  C  CB  . PRO A 1 68  ? -67.734  2.736   6.504   1.00 135.73 ? 68  PRO E CB  1 
ATOM   500  C  CG  . PRO A 1 68  ? -67.683  1.264   6.718   1.00 131.79 ? 68  PRO E CG  1 
ATOM   501  C  CD  . PRO A 1 68  ? -66.461  1.051   7.569   1.00 136.55 ? 68  PRO E CD  1 
ATOM   502  N  N   . LYS A 1 69  ? -65.875  4.837   8.085   1.00 134.21 ? 69  LYS E N   1 
ATOM   503  C  CA  . LYS A 1 69  ? -65.715  6.201   8.631   1.00 126.98 ? 69  LYS E CA  1 
ATOM   504  C  C   . LYS A 1 69  ? -64.520  6.984   8.056   1.00 123.91 ? 69  LYS E C   1 
ATOM   505  O  O   . LYS A 1 69  ? -64.597  8.207   7.953   1.00 126.76 ? 69  LYS E O   1 
ATOM   506  C  CB  . LYS A 1 69  ? -65.654  6.180   10.169  1.00 122.19 ? 69  LYS E CB  1 
ATOM   507  C  CG  . LYS A 1 69  ? -66.988  5.791   10.803  1.00 118.18 ? 69  LYS E CG  1 
ATOM   508  C  CD  . LYS A 1 69  ? -66.940  5.618   12.308  1.00 113.63 ? 69  LYS E CD  1 
ATOM   509  C  CE  . LYS A 1 69  ? -68.233  4.970   12.794  1.00 109.56 ? 69  LYS E CE  1 
ATOM   510  N  NZ  . LYS A 1 69  ? -68.141  4.383   14.159  1.00 108.39 ? 69  LYS E NZ  1 
ATOM   511  N  N   . TYR A 1 70  ? -63.448  6.289   7.681   1.00 119.58 ? 70  TYR E N   1 
ATOM   512  C  CA  . TYR A 1 70  ? -62.255  6.922   7.083   1.00 120.41 ? 70  TYR E CA  1 
ATOM   513  C  C   . TYR A 1 70  ? -62.070  6.643   5.585   1.00 126.47 ? 70  TYR E C   1 
ATOM   514  O  O   . TYR A 1 70  ? -61.103  7.117   4.984   1.00 126.36 ? 70  TYR E O   1 
ATOM   515  C  CB  . TYR A 1 70  ? -60.991  6.525   7.861   1.00 116.43 ? 70  TYR E CB  1 
ATOM   516  C  CG  . TYR A 1 70  ? -61.033  6.907   9.325   1.00 114.21 ? 70  TYR E CG  1 
ATOM   517  C  CD1 . TYR A 1 70  ? -61.384  8.202   9.730   1.00 115.48 ? 70  TYR E CD1 1 
ATOM   518  C  CD2 . TYR A 1 70  ? -60.646  5.997   10.316  1.00 111.42 ? 70  TYR E CD2 1 
ATOM   519  C  CE1 . TYR A 1 70  ? -61.403  8.555   11.074  1.00 112.77 ? 70  TYR E CE1 1 
ATOM   520  C  CE2 . TYR A 1 70  ? -60.684  6.342   11.657  1.00 110.96 ? 70  TYR E CE2 1 
ATOM   521  C  CZ  . TYR A 1 70  ? -61.022  7.628   12.030  1.00 108.67 ? 70  TYR E CZ  1 
ATOM   522  O  OH  . TYR A 1 70  ? -61.076  7.981   13.350  1.00 104.51 ? 70  TYR E OH  1 
ATOM   523  N  N   . GLY A 1 71  ? -62.990  5.888   4.982   1.00 128.30 ? 71  GLY E N   1 
ATOM   524  C  CA  . GLY A 1 71  ? -62.993  5.669   3.534   1.00 125.06 ? 71  GLY E CA  1 
ATOM   525  C  C   . GLY A 1 71  ? -61.917  4.707   3.072   1.00 124.12 ? 71  GLY E C   1 
ATOM   526  O  O   . GLY A 1 71  ? -61.194  4.984   2.115   1.00 115.71 ? 71  GLY E O   1 
ATOM   527  N  N   . ILE A 1 72  ? -61.844  3.556   3.732   1.00 127.33 ? 72  ILE E N   1 
ATOM   528  C  CA  . ILE A 1 72  ? -60.872  2.518   3.408   1.00 132.01 ? 72  ILE E CA  1 
ATOM   529  C  C   . ILE A 1 72  ? -61.377  1.754   2.175   1.00 137.42 ? 72  ILE E C   1 
ATOM   530  O  O   . ILE A 1 72  ? -62.334  0.977   2.262   1.00 138.00 ? 72  ILE E O   1 
ATOM   531  C  CB  . ILE A 1 72  ? -60.674  1.522   4.585   1.00 132.97 ? 72  ILE E CB  1 
ATOM   532  C  CG1 . ILE A 1 72  ? -60.294  2.242   5.899   1.00 128.46 ? 72  ILE E CG1 1 
ATOM   533  C  CG2 . ILE A 1 72  ? -59.658  0.443   4.220   1.00 136.44 ? 72  ILE E CG2 1 
ATOM   534  C  CD1 . ILE A 1 72  ? -58.950  2.945   5.867   1.00 124.72 ? 72  ILE E CD1 1 
ATOM   535  N  N   . ARG A 1 73  ? -60.746  1.985   1.021   1.00 141.55 ? 73  ARG E N   1 
ATOM   536  C  CA  . ARG A 1 73  ? -61.117  1.281   -0.213  1.00 144.29 ? 73  ARG E CA  1 
ATOM   537  C  C   . ARG A 1 73  ? -60.565  -0.152  -0.241  1.00 150.52 ? 73  ARG E C   1 
ATOM   538  O  O   . ARG A 1 73  ? -61.340  -1.115  -0.213  1.00 155.85 ? 73  ARG E O   1 
ATOM   539  C  CB  . ARG A 1 73  ? -60.669  2.065   -1.448  1.00 142.08 ? 73  ARG E CB  1 
ATOM   540  C  CG  . ARG A 1 73  ? -61.453  3.364   -1.649  1.00 139.93 ? 73  ARG E CG  1 
ATOM   541  C  CD  . ARG A 1 73  ? -61.565  3.735   -3.125  1.00 137.39 ? 73  ARG E CD  1 
ATOM   542  N  NE  . ARG A 1 73  ? -62.934  4.099   -3.502  1.00 134.26 ? 73  ARG E NE  1 
ATOM   543  C  CZ  . ARG A 1 73  ? -63.367  4.283   -4.752  1.00 133.51 ? 73  ARG E CZ  1 
ATOM   544  N  NH1 . ARG A 1 73  ? -62.551  4.156   -5.802  1.00 132.53 ? 73  ARG E NH1 1 
ATOM   545  N  NH2 . ARG A 1 73  ? -64.643  4.608   -4.959  1.00 135.69 ? 73  ARG E NH2 1 
ATOM   546  N  N   . GLY A 1 74  ? -59.237  -0.275  -0.301  1.00 154.77 ? 74  GLY E N   1 
ATOM   547  C  CA  . GLY A 1 74  ? -58.557  -1.572  -0.330  1.00 154.20 ? 74  GLY E CA  1 
ATOM   548  C  C   . GLY A 1 74  ? -58.016  -1.978  1.029   1.00 155.11 ? 74  GLY E C   1 
ATOM   549  O  O   . GLY A 1 74  ? -58.217  -1.277  2.022   1.00 162.00 ? 74  GLY E O   1 
ATOM   550  N  N   . ILE A 1 75  ? -57.359  -3.136  1.063   1.00 157.24 ? 75  ILE E N   1 
ATOM   551  C  CA  . ILE A 1 75  ? -56.625  -3.608  2.244   1.00 163.06 ? 75  ILE E CA  1 
ATOM   552  C  C   . ILE A 1 75  ? -55.352  -4.356  1.803   1.00 169.95 ? 75  ILE E C   1 
ATOM   553  O  O   . ILE A 1 75  ? -55.360  -4.986  0.746   1.00 180.91 ? 75  ILE E O   1 
ATOM   554  C  CB  . ILE A 1 75  ? -57.483  -4.507  3.176   1.00 160.83 ? 75  ILE E CB  1 
ATOM   555  C  CG1 . ILE A 1 75  ? -58.232  -5.577  2.378   1.00 160.03 ? 75  ILE E CG1 1 
ATOM   556  C  CG2 . ILE A 1 75  ? -58.469  -3.668  3.983   1.00 157.90 ? 75  ILE E CG2 1 
ATOM   557  C  CD1 . ILE A 1 75  ? -58.941  -6.596  3.237   1.00 161.10 ? 75  ILE E CD1 1 
ATOM   558  N  N   . PRO A 1 76  ? -54.263  -4.299  2.582   1.00 169.94 ? 76  PRO E N   1 
ATOM   559  C  CA  . PRO A 1 76  ? -54.191  -3.637  3.888   1.00 169.23 ? 76  PRO E CA  1 
ATOM   560  C  C   . PRO A 1 76  ? -53.953  -2.123  3.807   1.00 173.11 ? 76  PRO E C   1 
ATOM   561  O  O   . PRO A 1 76  ? -53.184  -1.671  2.957   1.00 196.32 ? 76  PRO E O   1 
ATOM   562  C  CB  . PRO A 1 76  ? -52.989  -4.319  4.530   1.00 166.21 ? 76  PRO E CB  1 
ATOM   563  C  CG  . PRO A 1 76  ? -52.083  -4.656  3.389   1.00 167.14 ? 76  PRO E CG  1 
ATOM   564  C  CD  . PRO A 1 76  ? -52.937  -4.780  2.152   1.00 169.21 ? 76  PRO E CD  1 
ATOM   565  N  N   . THR A 1 77  ? -54.616  -1.364  4.685   1.00 159.31 ? 77  THR E N   1 
ATOM   566  C  CA  . THR A 1 77  ? -54.411  0.085   4.805   1.00 142.65 ? 77  THR E CA  1 
ATOM   567  C  C   . THR A 1 77  ? -53.713  0.375   6.127   1.00 133.90 ? 77  THR E C   1 
ATOM   568  O  O   . THR A 1 77  ? -54.156  -0.095  7.183   1.00 134.46 ? 77  THR E O   1 
ATOM   569  C  CB  . THR A 1 77  ? -55.740  0.868   4.736   1.00 135.06 ? 77  THR E CB  1 
ATOM   570  O  OG1 . THR A 1 77  ? -56.332  0.687   3.444   1.00 134.25 ? 77  THR E OG1 1 
ATOM   571  C  CG2 . THR A 1 77  ? -55.520  2.369   4.972   1.00 132.55 ? 77  THR E CG2 1 
ATOM   572  N  N   . LEU A 1 78  ? -52.624  1.144   6.050   1.00 125.94 ? 78  LEU E N   1 
ATOM   573  C  CA  . LEU A 1 78  ? -51.863  1.579   7.216   1.00 125.31 ? 78  LEU E CA  1 
ATOM   574  C  C   . LEU A 1 78  ? -52.031  3.094   7.427   1.00 125.29 ? 78  LEU E C   1 
ATOM   575  O  O   . LEU A 1 78  ? -51.421  3.901   6.714   1.00 138.61 ? 78  LEU E O   1 
ATOM   576  C  CB  . LEU A 1 78  ? -50.382  1.225   7.039   1.00 124.65 ? 78  LEU E CB  1 
ATOM   577  C  CG  . LEU A 1 78  ? -50.012  -0.265  7.039   1.00 121.77 ? 78  LEU E CG  1 
ATOM   578  C  CD1 . LEU A 1 78  ? -48.544  -0.453  6.671   1.00 121.32 ? 78  LEU E CD1 1 
ATOM   579  C  CD2 . LEU A 1 78  ? -50.297  -0.913  8.387   1.00 121.91 ? 78  LEU E CD2 1 
ATOM   580  N  N   . LEU A 1 79  ? -52.868  3.469   8.399   1.00 114.44 ? 79  LEU E N   1 
ATOM   581  C  CA  . LEU A 1 79  ? -53.072  4.871   8.781   1.00 102.74 ? 79  LEU E CA  1 
ATOM   582  C  C   . LEU A 1 79  ? -52.226  5.209   10.005  1.00 98.08  ? 79  LEU E C   1 
ATOM   583  O  O   . LEU A 1 79  ? -52.379  4.578   11.051  1.00 106.27 ? 79  LEU E O   1 
ATOM   584  C  CB  . LEU A 1 79  ? -54.534  5.123   9.128   1.00 96.12  ? 79  LEU E CB  1 
ATOM   585  C  CG  . LEU A 1 79  ? -55.629  4.882   8.095   1.00 94.99  ? 79  LEU E CG  1 
ATOM   586  C  CD1 . LEU A 1 79  ? -56.998  5.093   8.715   1.00 93.86  ? 79  LEU E CD1 1 
ATOM   587  C  CD2 . LEU A 1 79  ? -55.440  5.813   6.919   1.00 96.05  ? 79  LEU E CD2 1 
ATOM   588  N  N   . LEU A 1 80  ? -51.341  6.200   9.873   1.00 87.82  ? 80  LEU E N   1 
ATOM   589  C  CA  . LEU A 1 80  ? -50.511  6.658   10.989  1.00 86.27  ? 80  LEU E CA  1 
ATOM   590  C  C   . LEU A 1 80  ? -51.196  7.834   11.683  1.00 88.94  ? 80  LEU E C   1 
ATOM   591  O  O   . LEU A 1 80  ? -51.311  8.915   11.089  1.00 97.25  ? 80  LEU E O   1 
ATOM   592  C  CB  . LEU A 1 80  ? -49.111  7.046   10.495  1.00 84.87  ? 80  LEU E CB  1 
ATOM   593  C  CG  . LEU A 1 80  ? -48.080  7.484   11.554  1.00 85.75  ? 80  LEU E CG  1 
ATOM   594  C  CD1 . LEU A 1 80  ? -47.964  6.499   12.715  1.00 87.25  ? 80  LEU E CD1 1 
ATOM   595  C  CD2 . LEU A 1 80  ? -46.721  7.701   10.915  1.00 84.99  ? 80  LEU E CD2 1 
ATOM   596  N  N   . PHE A 1 81  ? -51.629  7.623   12.933  1.00 86.97  ? 81  PHE E N   1 
ATOM   597  C  CA  . PHE A 1 81  ? -52.378  8.630   13.706  1.00 82.04  ? 81  PHE E CA  1 
ATOM   598  C  C   . PHE A 1 81  ? -51.452  9.439   14.633  1.00 83.11  ? 81  PHE E C   1 
ATOM   599  O  O   . PHE A 1 81  ? -50.481  8.898   15.164  1.00 78.71  ? 81  PHE E O   1 
ATOM   600  C  CB  . PHE A 1 81  ? -53.475  7.961   14.552  1.00 77.79  ? 81  PHE E CB  1 
ATOM   601  C  CG  . PHE A 1 81  ? -54.743  7.631   13.793  1.00 76.62  ? 81  PHE E CG  1 
ATOM   602  C  CD1 . PHE A 1 81  ? -54.702  6.886   12.626  1.00 74.21  ? 81  PHE E CD1 1 
ATOM   603  C  CD2 . PHE A 1 81  ? -56.003  8.021   14.289  1.00 76.38  ? 81  PHE E CD2 1 
ATOM   604  C  CE1 . PHE A 1 81  ? -55.886  6.555   11.954  1.00 72.80  ? 81  PHE E CE1 1 
ATOM   605  C  CE2 . PHE A 1 81  ? -57.171  7.710   13.605  1.00 73.39  ? 81  PHE E CE2 1 
ATOM   606  C  CZ  . PHE A 1 81  ? -57.115  6.962   12.449  1.00 72.24  ? 81  PHE E CZ  1 
ATOM   607  N  N   . LYS A 1 82  ? -51.758  10.729  14.807  1.00 85.94  ? 82  LYS E N   1 
ATOM   608  C  CA  . LYS A 1 82  ? -51.074  11.610  15.773  1.00 89.19  ? 82  LYS E CA  1 
ATOM   609  C  C   . LYS A 1 82  ? -52.077  12.605  16.371  1.00 91.47  ? 82  LYS E C   1 
ATOM   610  O  O   . LYS A 1 82  ? -52.670  13.405  15.642  1.00 93.10  ? 82  LYS E O   1 
ATOM   611  C  CB  . LYS A 1 82  ? -49.927  12.383  15.111  1.00 89.96  ? 82  LYS E CB  1 
ATOM   612  C  CG  . LYS A 1 82  ? -48.752  11.528  14.660  1.00 89.24  ? 82  LYS E CG  1 
ATOM   613  C  CD  . LYS A 1 82  ? -47.682  12.394  14.008  1.00 87.82  ? 82  LYS E CD  1 
ATOM   614  C  CE  . LYS A 1 82  ? -46.623  11.565  13.306  1.00 88.30  ? 82  LYS E CE  1 
ATOM   615  N  NZ  . LYS A 1 82  ? -45.701  12.436  12.529  1.00 89.39  ? 82  LYS E NZ  1 
ATOM   616  N  N   . ASN A 1 83  ? -52.263  12.538  17.692  1.00 91.02  ? 83  ASN E N   1 
ATOM   617  C  CA  . ASN A 1 83  ? -53.222  13.377  18.443  1.00 88.88  ? 83  ASN E CA  1 
ATOM   618  C  C   . ASN A 1 83  ? -54.684  13.258  17.973  1.00 86.43  ? 83  ASN E C   1 
ATOM   619  O  O   . ASN A 1 83  ? -55.443  14.231  18.011  1.00 85.44  ? 83  ASN E O   1 
ATOM   620  C  CB  . ASN A 1 83  ? -52.774  14.848  18.462  1.00 87.46  ? 83  ASN E CB  1 
ATOM   621  C  CG  . ASN A 1 83  ? -51.368  15.032  19.021  1.00 87.68  ? 83  ASN E CG  1 
ATOM   622  O  OD1 . ASN A 1 83  ? -50.878  14.240  19.837  1.00 83.65  ? 83  ASN E OD1 1 
ATOM   623  N  ND2 . ASN A 1 83  ? -50.717  16.100  18.592  1.00 89.76  ? 83  ASN E ND2 1 
ATOM   624  N  N   . GLY A 1 84  ? -55.075  12.055  17.558  1.00 86.71  ? 84  GLY E N   1 
ATOM   625  C  CA  . GLY A 1 84  ? -56.420  11.806  17.042  1.00 90.76  ? 84  GLY E CA  1 
ATOM   626  C  C   . GLY A 1 84  ? -56.710  12.379  15.663  1.00 93.35  ? 84  GLY E C   1 
ATOM   627  O  O   . GLY A 1 84  ? -57.875  12.597  15.323  1.00 91.52  ? 84  GLY E O   1 
ATOM   628  N  N   . GLU A 1 85  ? -55.660  12.623  14.873  1.00 97.90  ? 85  GLU E N   1 
ATOM   629  C  CA  . GLU A 1 85  ? -55.779  13.061  13.475  1.00 101.91 ? 85  GLU E CA  1 
ATOM   630  C  C   . GLU A 1 85  ? -54.951  12.141  12.593  1.00 99.92  ? 85  GLU E C   1 
ATOM   631  O  O   . GLU A 1 85  ? -53.980  11.547  13.064  1.00 99.72  ? 85  GLU E O   1 
ATOM   632  C  CB  . GLU A 1 85  ? -55.281  14.502  13.306  1.00 108.56 ? 85  GLU E CB  1 
ATOM   633  C  CG  . GLU A 1 85  ? -56.154  15.552  13.986  1.00 113.07 ? 85  GLU E CG  1 
ATOM   634  C  CD  . GLU A 1 85  ? -55.860  16.977  13.530  1.00 113.21 ? 85  GLU E CD  1 
ATOM   635  O  OE1 . GLU A 1 85  ? -54.727  17.237  13.071  1.00 116.67 ? 85  GLU E OE1 1 
ATOM   636  O  OE2 . GLU A 1 85  ? -56.763  17.838  13.638  1.00 107.30 ? 85  GLU E OE2 1 
ATOM   637  N  N   . VAL A 1 86  ? -55.324  12.044  11.319  1.00 95.03  ? 86  VAL E N   1 
ATOM   638  C  CA  . VAL A 1 86  ? -54.646  11.144  10.375  1.00 92.65  ? 86  VAL E CA  1 
ATOM   639  C  C   . VAL A 1 86  ? -53.537  11.910  9.647   1.00 97.14  ? 86  VAL E C   1 
ATOM   640  O  O   . VAL A 1 86  ? -53.818  12.717  8.761   1.00 101.69 ? 86  VAL E O   1 
ATOM   641  C  CB  . VAL A 1 86  ? -55.633  10.536  9.353   1.00 88.42  ? 86  VAL E CB  1 
ATOM   642  C  CG1 . VAL A 1 86  ? -54.948  9.433   8.551   1.00 85.11  ? 86  VAL E CG1 1 
ATOM   643  C  CG2 . VAL A 1 86  ? -56.887  10.022  10.050  1.00 89.08  ? 86  VAL E CG2 1 
ATOM   644  N  N   . ALA A 1 87  ? -52.284  11.656  10.026  1.00 101.02 ? 87  ALA E N   1 
ATOM   645  C  CA  . ALA A 1 87  ? -51.139  12.377  9.473   1.00 103.15 ? 87  ALA E CA  1 
ATOM   646  C  C   . ALA A 1 87  ? -50.739  11.855  8.088   1.00 109.85 ? 87  ALA E C   1 
ATOM   647  O  O   . ALA A 1 87  ? -50.492  12.662  7.185   1.00 115.67 ? 87  ALA E O   1 
ATOM   648  C  CB  . ALA A 1 87  ? -49.957  12.318  10.431  1.00 101.03 ? 87  ALA E CB  1 
ATOM   649  N  N   . ALA A 1 88  ? -50.674  10.526  7.929   1.00 116.68 ? 88  ALA E N   1 
ATOM   650  C  CA  . ALA A 1 88  ? -50.369  9.890   6.630   1.00 120.07 ? 88  ALA E CA  1 
ATOM   651  C  C   . ALA A 1 88  ? -51.067  8.534   6.444   1.00 124.18 ? 88  ALA E C   1 
ATOM   652  O  O   . ALA A 1 88  ? -51.523  7.917   7.406   1.00 134.43 ? 88  ALA E O   1 
ATOM   653  C  CB  . ALA A 1 88  ? -48.866  9.733   6.458   1.00 117.27 ? 88  ALA E CB  1 
ATOM   654  N  N   . THR A 1 89  ? -51.103  8.074   5.192   1.00 120.06 ? 89  THR E N   1 
ATOM   655  C  CA  . THR A 1 89  ? -51.862  6.880   4.789   1.00 114.13 ? 89  THR E CA  1 
ATOM   656  C  C   . THR A 1 89  ? -51.132  6.082   3.688   1.00 117.36 ? 89  THR E C   1 
ATOM   657  O  O   . THR A 1 89  ? -50.579  6.673   2.757   1.00 124.16 ? 89  THR E O   1 
ATOM   658  C  CB  . THR A 1 89  ? -53.295  7.279   4.340   1.00 107.82 ? 89  THR E CB  1 
ATOM   659  O  OG1 . THR A 1 89  ? -54.069  6.109   4.047   1.00 103.79 ? 89  THR E OG1 1 
ATOM   660  C  CG2 . THR A 1 89  ? -53.290  8.185   3.107   1.00 107.77 ? 89  THR E CG2 1 
ATOM   661  N  N   . LYS A 1 90  ? -51.119  4.751   3.822   1.00 122.85 ? 90  LYS E N   1 
ATOM   662  C  CA  . LYS A 1 90  ? -50.498  3.831   2.837   1.00 124.46 ? 90  LYS E CA  1 
ATOM   663  C  C   . LYS A 1 90  ? -51.359  2.573   2.649   1.00 129.65 ? 90  LYS E C   1 
ATOM   664  O  O   . LYS A 1 90  ? -51.665  1.882   3.625   1.00 137.93 ? 90  LYS E O   1 
ATOM   665  C  CB  . LYS A 1 90  ? -49.093  3.412   3.283   1.00 112.47 ? 90  LYS E CB  1 
ATOM   666  N  N   . VAL A 1 91  ? -51.748  2.297   1.400   1.00 127.91 ? 91  VAL E N   1 
ATOM   667  C  CA  . VAL A 1 91  ? -52.626  1.167   1.064   1.00 122.73 ? 91  VAL E CA  1 
ATOM   668  C  C   . VAL A 1 91  ? -51.882  0.195   0.138   1.00 120.29 ? 91  VAL E C   1 
ATOM   669  O  O   . VAL A 1 91  ? -51.265  0.616   -0.846  1.00 126.30 ? 91  VAL E O   1 
ATOM   670  C  CB  . VAL A 1 91  ? -53.950  1.637   0.402   1.00 118.99 ? 91  VAL E CB  1 
ATOM   671  C  CG1 . VAL A 1 91  ? -54.887  0.454   0.154   1.00 116.02 ? 91  VAL E CG1 1 
ATOM   672  C  CG2 . VAL A 1 91  ? -54.636  2.703   1.259   1.00 115.59 ? 91  VAL E CG2 1 
ATOM   673  N  N   . GLY A 1 92  ? -51.948  -1.101  0.464   1.00 115.11 ? 92  GLY E N   1 
ATOM   674  C  CA  . GLY A 1 92  ? -51.230  -2.156  -0.261  1.00 110.17 ? 92  GLY E CA  1 
ATOM   675  C  C   . GLY A 1 92  ? -50.094  -2.758  0.557   1.00 107.89 ? 92  GLY E C   1 
ATOM   676  O  O   . GLY A 1 92  ? -49.607  -2.142  1.512   1.00 112.22 ? 92  GLY E O   1 
ATOM   677  N  N   . ALA A 1 93  ? -49.674  -3.960  0.171   1.00 104.64 ? 93  ALA E N   1 
ATOM   678  C  CA  . ALA A 1 93  ? -48.589  -4.681  0.848   1.00 103.45 ? 93  ALA E CA  1 
ATOM   679  C  C   . ALA A 1 93  ? -47.212  -4.095  0.519   1.00 99.25  ? 93  ALA E C   1 
ATOM   680  O  O   . ALA A 1 93  ? -46.943  -3.726  -0.623  1.00 93.05  ? 93  ALA E O   1 
ATOM   681  C  CB  . ALA A 1 93  ? -48.633  -6.163  0.492   1.00 104.59 ? 93  ALA E CB  1 
ATOM   682  N  N   . LEU A 1 94  ? -46.351  -4.037  1.533   1.00 100.51 ? 94  LEU E N   1 
ATOM   683  C  CA  . LEU A 1 94  ? -45.010  -3.461  1.417   1.00 105.13 ? 94  LEU E CA  1 
ATOM   684  C  C   . LEU A 1 94  ? -43.959  -4.432  1.919   1.00 102.87 ? 94  LEU E C   1 
ATOM   685  O  O   . LEU A 1 94  ? -44.269  -5.361  2.665   1.00 96.11  ? 94  LEU E O   1 
ATOM   686  C  CB  . LEU A 1 94  ? -44.916  -2.158  2.224   1.00 110.05 ? 94  LEU E CB  1 
ATOM   687  C  CG  . LEU A 1 94  ? -45.885  -1.021  1.847   1.00 111.88 ? 94  LEU E CG  1 
ATOM   688  C  CD1 . LEU A 1 94  ? -45.955  0.041   2.941   1.00 108.90 ? 94  LEU E CD1 1 
ATOM   689  C  CD2 . LEU A 1 94  ? -45.489  -0.409  0.505   1.00 111.61 ? 94  LEU E CD2 1 
ATOM   690  N  N   . SER A 1 95  ? -42.719  -4.212  1.483   1.00 107.90 ? 95  SER E N   1 
ATOM   691  C  CA  . SER A 1 95  ? -41.553  -4.867  2.081   1.00 113.04 ? 95  SER E CA  1 
ATOM   692  C  C   . SER A 1 95  ? -41.168  -4.110  3.359   1.00 116.23 ? 95  SER E C   1 
ATOM   693  O  O   . SER A 1 95  ? -41.713  -3.030  3.645   1.00 114.55 ? 95  SER E O   1 
ATOM   694  C  CB  . SER A 1 95  ? -40.377  -4.923  1.092   1.00 112.82 ? 95  SER E CB  1 
ATOM   695  O  OG  . SER A 1 95  ? -40.010  -3.634  0.635   1.00 110.47 ? 95  SER E OG  1 
ATOM   696  N  N   . LYS A 1 96  ? -40.245  -4.683  4.131   1.00 120.90 ? 96  LYS E N   1 
ATOM   697  C  CA  . LYS A 1 96  ? -39.781  -4.061  5.378   1.00 123.69 ? 96  LYS E CA  1 
ATOM   698  C  C   . LYS A 1 96  ? -39.055  -2.738  5.105   1.00 128.73 ? 96  LYS E C   1 
ATOM   699  O  O   . LYS A 1 96  ? -39.288  -1.760  5.808   1.00 132.98 ? 96  LYS E O   1 
ATOM   700  C  CB  . LYS A 1 96  ? -38.873  -5.016  6.162   1.00 124.71 ? 96  LYS E CB  1 
ATOM   701  C  CG  . LYS A 1 96  ? -38.592  -4.577  7.588   1.00 122.14 ? 96  LYS E CG  1 
ATOM   702  C  CD  . LYS A 1 96  ? -37.680  -5.554  8.309   1.00 121.89 ? 96  LYS E CD  1 
ATOM   703  C  CE  . LYS A 1 96  ? -37.245  -4.997  9.657   1.00 121.35 ? 96  LYS E CE  1 
ATOM   704  N  NZ  . LYS A 1 96  ? -38.412  -4.715  10.537  1.00 123.18 ? 96  LYS E NZ  1 
ATOM   705  N  N   . GLY A 1 97  ? -38.188  -2.724  4.088   1.00 131.38 ? 97  GLY E N   1 
ATOM   706  C  CA  . GLY A 1 97  ? -37.445  -1.525  3.677   1.00 127.98 ? 97  GLY E CA  1 
ATOM   707  C  C   . GLY A 1 97  ? -38.318  -0.364  3.222   1.00 128.81 ? 97  GLY E C   1 
ATOM   708  O  O   . GLY A 1 97  ? -38.000  0.801   3.509   1.00 124.78 ? 97  GLY E O   1 
ATOM   709  N  N   . GLN A 1 98  ? -39.409  -0.681  2.518   1.00 130.49 ? 98  GLN E N   1 
ATOM   710  C  CA  . GLN A 1 98  ? -40.406  0.318   2.103   1.00 132.57 ? 98  GLN E CA  1 
ATOM   711  C  C   . GLN A 1 98  ? -41.186  0.879   3.298   1.00 135.96 ? 98  GLN E C   1 
ATOM   712  O  O   . GLN A 1 98  ? -41.447  2.090   3.362   1.00 137.17 ? 98  GLN E O   1 
ATOM   713  C  CB  . GLN A 1 98  ? -41.400  -0.283  1.089   1.00 130.23 ? 98  GLN E CB  1 
ATOM   714  C  CG  . GLN A 1 98  ? -40.788  -0.667  -0.253  1.00 127.09 ? 98  GLN E CG  1 
ATOM   715  C  CD  . GLN A 1 98  ? -40.910  0.399   -1.325  1.00 125.88 ? 98  GLN E CD  1 
ATOM   716  O  OE1 . GLN A 1 98  ? -41.525  1.447   -1.123  1.00 129.65 ? 98  GLN E OE1 1 
ATOM   717  N  NE2 . GLN A 1 98  ? -40.323  0.127   -2.483  1.00 118.35 ? 98  GLN E NE2 1 
ATOM   718  N  N   . LEU A 1 99  ? -41.560  -0.004  4.229   1.00 135.30 ? 99  LEU E N   1 
ATOM   719  C  CA  . LEU A 1 99  ? -42.305  0.389   5.427   1.00 132.26 ? 99  LEU E CA  1 
ATOM   720  C  C   . LEU A 1 99  ? -41.455  1.237   6.379   1.00 126.44 ? 99  LEU E C   1 
ATOM   721  O  O   . LEU A 1 99  ? -41.944  2.225   6.920   1.00 124.06 ? 99  LEU E O   1 
ATOM   722  C  CB  . LEU A 1 99  ? -42.853  -0.852  6.154   1.00 136.27 ? 99  LEU E CB  1 
ATOM   723  C  CG  . LEU A 1 99  ? -43.718  -0.651  7.406   1.00 140.10 ? 99  LEU E CG  1 
ATOM   724  C  CD1 . LEU A 1 99  ? -44.950  0.193   7.109   1.00 142.00 ? 99  LEU E CD1 1 
ATOM   725  C  CD2 . LEU A 1 99  ? -44.110  -2.003  7.988   1.00 138.44 ? 99  LEU E CD2 1 
ATOM   726  N  N   . LYS A 1 100 ? -40.195  0.849   6.581   1.00 124.19 ? 100 LYS E N   1 
ATOM   727  C  CA  . LYS A 1 100 ? -39.271  1.619   7.433   1.00 122.05 ? 100 LYS E CA  1 
ATOM   728  C  C   . LYS A 1 100 ? -39.040  3.032   6.895   1.00 120.35 ? 100 LYS E C   1 
ATOM   729  O  O   . LYS A 1 100 ? -38.971  3.976   7.675   1.00 120.56 ? 100 LYS E O   1 
ATOM   730  C  CB  . LYS A 1 100 ? -37.923  0.900   7.630   1.00 122.05 ? 100 LYS E CB  1 
ATOM   731  C  CG  . LYS A 1 100 ? -37.996  -0.307  8.566   1.00 122.32 ? 100 LYS E CG  1 
ATOM   732  C  CD  . LYS A 1 100 ? -36.649  -0.690  9.137   1.00 124.30 ? 100 LYS E CD  1 
ATOM   733  C  CE  . LYS A 1 100 ? -36.193  0.314   10.177  1.00 126.21 ? 100 LYS E CE  1 
ATOM   734  N  NZ  . LYS A 1 100 ? -35.104  -0.249  11.022  1.00 127.02 ? 100 LYS E NZ  1 
ATOM   735  N  N   . GLU A 1 101 ? -38.932  3.176   5.574   1.00 118.00 ? 101 GLU E N   1 
ATOM   736  C  CA  . GLU A 1 101 ? -38.817  4.507   4.956   1.00 114.26 ? 101 GLU E CA  1 
ATOM   737  C  C   . GLU A 1 101 ? -40.047  5.388   5.209   1.00 111.56 ? 101 GLU E C   1 
ATOM   738  O  O   . GLU A 1 101 ? -39.911  6.595   5.413   1.00 108.39 ? 101 GLU E O   1 
ATOM   739  C  CB  . GLU A 1 101 ? -38.539  4.413   3.450   1.00 115.00 ? 101 GLU E CB  1 
ATOM   740  C  CG  . GLU A 1 101 ? -37.064  4.230   3.105   1.00 116.17 ? 101 GLU E CG  1 
ATOM   741  C  CD  . GLU A 1 101 ? -36.725  4.637   1.673   1.00 116.89 ? 101 GLU E CD  1 
ATOM   742  O  OE1 . GLU A 1 101 ? -37.589  4.469   0.788   1.00 118.56 ? 101 GLU E OE1 1 
ATOM   743  O  OE2 . GLU A 1 101 ? -35.594  5.124   1.428   1.00 113.00 ? 101 GLU E OE2 1 
ATOM   744  N  N   . PHE A 1 102 ? -41.236  4.782   5.197   1.00 113.10 ? 102 PHE E N   1 
ATOM   745  C  CA  . PHE A 1 102 ? -42.487  5.499   5.505   1.00 115.12 ? 102 PHE E CA  1 
ATOM   746  C  C   . PHE A 1 102 ? -42.568  5.923   6.981   1.00 117.65 ? 102 PHE E C   1 
ATOM   747  O  O   . PHE A 1 102 ? -42.914  7.065   7.281   1.00 109.81 ? 102 PHE E O   1 
ATOM   748  C  CB  . PHE A 1 102 ? -43.702  4.639   5.115   1.00 110.35 ? 102 PHE E CB  1 
ATOM   749  C  CG  . PHE A 1 102 ? -45.029  5.198   5.548   1.00 102.51 ? 102 PHE E CG  1 
ATOM   750  C  CD1 . PHE A 1 102 ? -45.570  6.311   4.919   1.00 98.65  ? 102 PHE E CD1 1 
ATOM   751  C  CD2 . PHE A 1 102 ? -45.745  4.594   6.571   1.00 100.52 ? 102 PHE E CD2 1 
ATOM   752  C  CE1 . PHE A 1 102 ? -46.810  6.810   5.300   1.00 98.35  ? 102 PHE E CE1 1 
ATOM   753  C  CE2 . PHE A 1 102 ? -46.985  5.082   6.959   1.00 102.55 ? 102 PHE E CE2 1 
ATOM   754  C  CZ  . PHE A 1 102 ? -47.517  6.190   6.321   1.00 101.95 ? 102 PHE E CZ  1 
ATOM   755  N  N   . LEU A 1 103 ? -42.248  4.998   7.885   1.00 124.65 ? 103 LEU E N   1 
ATOM   756  C  CA  . LEU A 1 103 ? -42.294  5.253   9.335   1.00 126.79 ? 103 LEU E CA  1 
ATOM   757  C  C   . LEU A 1 103 ? -41.176  6.164   9.815   1.00 128.72 ? 103 LEU E C   1 
ATOM   758  O  O   . LEU A 1 103 ? -41.414  7.055   10.626  1.00 135.59 ? 103 LEU E O   1 
ATOM   759  C  CB  . LEU A 1 103 ? -42.228  3.934   10.128  1.00 123.90 ? 103 LEU E CB  1 
ATOM   760  C  CG  . LEU A 1 103 ? -43.401  2.965   9.984   1.00 120.24 ? 103 LEU E CG  1 
ATOM   761  C  CD1 . LEU A 1 103 ? -43.093  1.709   10.768  1.00 119.21 ? 103 LEU E CD1 1 
ATOM   762  C  CD2 . LEU A 1 103 ? -44.705  3.586   10.455  1.00 118.23 ? 103 LEU E CD2 1 
ATOM   763  N  N   . ASP A 1 104 ? -39.962  5.922   9.328   1.00 127.18 ? 104 ASP E N   1 
ATOM   764  C  CA  . ASP A 1 104 ? -38.791  6.721   9.696   1.00 125.64 ? 104 ASP E CA  1 
ATOM   765  C  C   . ASP A 1 104 ? -38.869  8.156   9.157   1.00 125.79 ? 104 ASP E C   1 
ATOM   766  O  O   . ASP A 1 104 ? -38.395  9.086   9.816   1.00 123.01 ? 104 ASP E O   1 
ATOM   767  C  CB  . ASP A 1 104 ? -37.501  6.044   9.224   1.00 126.04 ? 104 ASP E CB  1 
ATOM   768  C  CG  . ASP A 1 104 ? -36.270  6.635   9.867   1.00 130.23 ? 104 ASP E CG  1 
ATOM   769  O  OD1 . ASP A 1 104 ? -36.243  6.785   11.109  1.00 130.41 ? 104 ASP E OD1 1 
ATOM   770  O  OD2 . ASP A 1 104 ? -35.315  6.943   9.132   1.00 141.11 ? 104 ASP E OD2 1 
ATOM   771  N  N   . ALA A 1 105 ? -39.468  8.333   7.973   1.00 124.97 ? 105 ALA E N   1 
ATOM   772  C  CA  . ALA A 1 105 ? -39.737  9.672   7.431   1.00 121.84 ? 105 ALA E CA  1 
ATOM   773  C  C   . ALA A 1 105 ? -40.844  10.409  8.205   1.00 120.07 ? 105 ALA E C   1 
ATOM   774  O  O   . ALA A 1 105 ? -40.695  11.580  8.532   1.00 121.85 ? 105 ALA E O   1 
ATOM   775  C  CB  . ALA A 1 105 ? -40.087  9.599   5.951   1.00 121.31 ? 105 ALA E CB  1 
ATOM   776  N  N   . ASN A 1 106 ? -41.942  9.719   8.504   1.00 116.13 ? 106 ASN E N   1 
ATOM   777  C  CA  . ASN A 1 106 ? -43.095  10.348  9.173   1.00 108.30 ? 106 ASN E CA  1 
ATOM   778  C  C   . ASN A 1 106 ? -42.929  10.615  10.682  1.00 109.20 ? 106 ASN E C   1 
ATOM   779  O  O   . ASN A 1 106 ? -43.547  11.556  11.187  1.00 109.25 ? 106 ASN E O   1 
ATOM   780  C  CB  . ASN A 1 106 ? -44.384  9.546   8.915   1.00 99.77  ? 106 ASN E CB  1 
ATOM   781  C  CG  . ASN A 1 106 ? -45.009  9.874   7.579   1.00 91.85  ? 106 ASN E CG  1 
ATOM   782  O  OD1 . ASN A 1 106 ? -46.048  10.523  7.509   1.00 86.63  ? 106 ASN E OD1 1 
ATOM   783  N  ND2 . ASN A 1 106 ? -44.362  9.445   6.510   1.00 90.88  ? 106 ASN E ND2 1 
ATOM   784  N  N   . LEU A 1 107 ? -42.149  9.787   11.380  1.00 111.06 ? 107 LEU E N   1 
ATOM   785  C  CA  . LEU A 1 107 ? -41.891  9.997   12.817  1.00 112.01 ? 107 LEU E CA  1 
ATOM   786  C  C   . LEU A 1 107 ? -40.877  11.116  13.137  1.00 112.43 ? 107 LEU E C   1 
ATOM   787  O  O   . LEU A 1 107 ? -41.017  11.789  14.167  1.00 105.18 ? 107 LEU E O   1 
ATOM   788  C  CB  . LEU A 1 107 ? -41.433  8.703   13.500  1.00 111.71 ? 107 LEU E CB  1 
ATOM   789  C  CG  . LEU A 1 107 ? -42.422  7.562   13.734  1.00 107.93 ? 107 LEU E CG  1 
ATOM   790  C  CD1 . LEU A 1 107 ? -41.650  6.362   14.291  1.00 106.41 ? 107 LEU E CD1 1 
ATOM   791  C  CD2 . LEU A 1 107 ? -43.551  7.976   14.674  1.00 105.26 ? 107 LEU E CD2 1 
ATOM   792  N  N   . ALA A 1 108 ? -39.879  11.338  12.274  1.00 120.20 ? 108 ALA E N   1 
ATOM   793  C  CA  . ALA A 1 108 ? -38.975  12.494  12.407  1.00 123.96 ? 108 ALA E CA  1 
ATOM   794  C  C   . ALA A 1 108 ? -39.637  13.865  12.060  1.00 126.62 ? 108 ALA E C   1 
ATOM   795  O  O   . ALA A 1 108 ? -38.935  14.838  11.741  1.00 122.08 ? 108 ALA E O   1 
ATOM   796  C  CB  . ALA A 1 108 ? -37.714  12.259  11.574  1.00 120.81 ? 108 ALA E CB  1 
ATOM   797  N  N   . GLU A 1 109 ? -40.977  13.922  12.146  1.00 125.71 ? 109 GLU E N   1 
ATOM   798  C  CA  . GLU A 1 109 ? -41.802  15.112  11.906  1.00 120.26 ? 109 GLU E CA  1 
ATOM   799  C  C   . GLU A 1 109 ? -41.658  15.693  10.496  1.00 122.26 ? 109 GLU E C   1 
ATOM   800  O  O   . GLU A 1 109 ? -40.694  16.391  10.187  1.00 129.31 ? 109 GLU E O   1 
ATOM   801  C  CB  . GLU A 1 109 ? -41.555  16.180  12.986  1.00 114.02 ? 109 GLU E CB  1 
ATOM   802  C  CG  . GLU A 1 109 ? -41.672  15.691  14.432  1.00 108.41 ? 109 GLU E CG  1 
ATOM   803  C  CD  . GLU A 1 109 ? -43.084  15.287  14.853  1.00 105.07 ? 109 GLU E CD  1 
ATOM   804  O  OE1 . GLU A 1 109 ? -43.997  15.225  14.005  1.00 102.12 ? 109 GLU E OE1 1 
ATOM   805  O  OE2 . GLU A 1 109 ? -43.289  15.033  16.059  1.00 101.06 ? 109 GLU E OE2 1 
ATOM   806  N  N   . ALA B 2 2   ? -37.848  14.319  8.989   1.00 94.61  ? 40  ALA A N   1 
ATOM   807  C  CA  . ALA B 2 2   ? -37.864  14.313  7.488   1.00 97.95  ? 40  ALA A CA  1 
ATOM   808  C  C   . ALA B 2 2   ? -38.241  15.674  6.910   1.00 102.08 ? 40  ALA A C   1 
ATOM   809  O  O   . ALA B 2 2   ? -37.532  16.178  6.038   1.00 107.09 ? 40  ALA A O   1 
ATOM   810  C  CB  . ALA B 2 2   ? -38.797  13.239  6.955   1.00 95.64  ? 40  ALA A CB  1 
ATOM   811  N  N   . ALA B 2 3   ? -39.349  16.249  7.384   1.00 104.90 ? 41  ALA A N   1 
ATOM   812  C  CA  . ALA B 2 3   ? -39.701  17.653  7.088   1.00 102.42 ? 41  ALA A CA  1 
ATOM   813  C  C   . ALA B 2 3   ? -38.846  18.647  7.901   1.00 99.18  ? 41  ALA A C   1 
ATOM   814  O  O   . ALA B 2 3   ? -38.657  19.810  7.505   1.00 93.52  ? 41  ALA A O   1 
ATOM   815  C  CB  . ALA B 2 3   ? -41.180  17.916  7.315   1.00 102.34 ? 41  ALA A CB  1 
ATOM   816  N  N   . LYS B 2 4   ? -38.294  18.166  9.020   1.00 97.77  ? 42  LYS A N   1 
ATOM   817  C  CA  . LYS B 2 4   ? -37.181  18.829  9.712   1.00 99.58  ? 42  LYS A CA  1 
ATOM   818  C  C   . LYS B 2 4   ? -35.912  18.851  8.848   1.00 95.65  ? 42  LYS A C   1 
ATOM   819  O  O   . LYS B 2 4   ? -35.240  19.874  8.762   1.00 91.59  ? 42  LYS A O   1 
ATOM   820  C  CB  . LYS B 2 4   ? -36.904  18.121  11.037  1.00 104.43 ? 42  LYS A CB  1 
ATOM   821  C  CG  . LYS B 2 4   ? -37.987  18.349  12.084  1.00 105.22 ? 42  LYS A CG  1 
ATOM   822  C  CD  . LYS B 2 4   ? -37.593  17.764  13.428  1.00 104.51 ? 42  LYS A CD  1 
ATOM   823  C  CE  . LYS B 2 4   ? -38.571  18.164  14.515  1.00 101.97 ? 42  LYS A CE  1 
ATOM   824  N  NZ  . LYS B 2 4   ? -38.307  17.379  15.745  1.00 101.48 ? 42  LYS A NZ  1 
ATOM   825  N  N   . VAL B 2 5   ? -35.600  17.715  8.226   1.00 93.95  ? 43  VAL A N   1 
ATOM   826  C  CA  . VAL B 2 5   ? -34.468  17.602  7.298   1.00 96.83  ? 43  VAL A CA  1 
ATOM   827  C  C   . VAL B 2 5   ? -34.709  18.433  6.026   1.00 97.59  ? 43  VAL A C   1 
ATOM   828  O  O   . VAL B 2 5   ? -33.792  19.090  5.540   1.00 106.80 ? 43  VAL A O   1 
ATOM   829  C  CB  . VAL B 2 5   ? -34.161  16.121  6.920   1.00 98.01  ? 43  VAL A CB  1 
ATOM   830  C  CG1 . VAL B 2 5   ? -33.006  16.031  5.919   1.00 97.77  ? 43  VAL A CG1 1 
ATOM   831  C  CG2 . VAL B 2 5   ? -33.843  15.295  8.163   1.00 99.05  ? 43  VAL A CG2 1 
ATOM   832  N  N   . MET B 2 6   ? -35.934  18.395  5.503   1.00 93.60  ? 44  MET A N   1 
ATOM   833  C  CA  . MET B 2 6   ? -36.333  19.169  4.317   1.00 88.90  ? 44  MET A CA  1 
ATOM   834  C  C   . MET B 2 6   ? -36.125  20.680  4.481   1.00 88.17  ? 44  MET A C   1 
ATOM   835  O  O   . MET B 2 6   ? -35.705  21.342  3.535   1.00 85.08  ? 44  MET A O   1 
ATOM   836  C  CB  . MET B 2 6   ? -37.800  18.893  3.977   1.00 88.73  ? 44  MET A CB  1 
ATOM   837  C  CG  . MET B 2 6   ? -38.360  19.655  2.789   1.00 94.20  ? 44  MET A CG  1 
ATOM   838  S  SD  . MET B 2 6   ? -40.057  19.156  2.424   1.00 98.69  ? 44  MET A SD  1 
ATOM   839  C  CE  . MET B 2 6   ? -40.939  19.784  3.855   1.00 96.03  ? 44  MET A CE  1 
ATOM   840  N  N   . SER B 2 7   ? -36.419  21.224  5.664   1.00 89.03  ? 45  SER A N   1 
ATOM   841  C  CA  . SER B 2 7   ? -36.250  22.665  5.920   1.00 88.49  ? 45  SER A CA  1 
ATOM   842  C  C   . SER B 2 7   ? -34.774  23.062  6.047   1.00 84.81  ? 45  SER A C   1 
ATOM   843  O  O   . SER B 2 7   ? -34.369  24.119  5.558   1.00 83.56  ? 45  SER A O   1 
ATOM   844  C  CB  . SER B 2 7   ? -37.029  23.096  7.166   1.00 92.58  ? 45  SER A CB  1 
ATOM   845  O  OG  . SER B 2 7   ? -36.696  22.299  8.287   1.00 96.56  ? 45  SER A OG  1 
ATOM   846  N  N   . LEU B 2 8   ? -33.987  22.214  6.711   1.00 86.27  ? 46  LEU A N   1 
ATOM   847  C  CA  . LEU B 2 8   ? -32.519  22.353  6.776   1.00 88.17  ? 46  LEU A CA  1 
ATOM   848  C  C   . LEU B 2 8   ? -31.872  22.339  5.386   1.00 83.51  ? 46  LEU A C   1 
ATOM   849  O  O   . LEU B 2 8   ? -30.882  23.039  5.144   1.00 84.56  ? 46  LEU A O   1 
ATOM   850  C  CB  . LEU B 2 8   ? -31.920  21.215  7.622   1.00 91.13  ? 46  LEU A CB  1 
ATOM   851  C  CG  . LEU B 2 8   ? -30.399  21.159  7.826   1.00 91.56  ? 46  LEU A CG  1 
ATOM   852  C  CD1 . LEU B 2 8   ? -29.961  22.252  8.790   1.00 91.83  ? 46  LEU A CD1 1 
ATOM   853  C  CD2 . LEU B 2 8   ? -29.965  19.785  8.307   1.00 91.22  ? 46  LEU A CD2 1 
ATOM   854  N  N   . LEU B 2 9   ? -32.438  21.531  4.491   1.00 78.19  ? 47  LEU A N   1 
ATOM   855  C  CA  . LEU B 2 9   ? -31.947  21.393  3.122   1.00 75.95  ? 47  LEU A CA  1 
ATOM   856  C  C   . LEU B 2 9   ? -32.227  22.626  2.249   1.00 75.68  ? 47  LEU A C   1 
ATOM   857  O  O   . LEU B 2 9   ? -31.466  22.900  1.327   1.00 78.99  ? 47  LEU A O   1 
ATOM   858  C  CB  . LEU B 2 9   ? -32.545  20.138  2.466   1.00 73.18  ? 47  LEU A CB  1 
ATOM   859  C  CG  . LEU B 2 9   ? -31.586  19.215  1.742   1.00 72.84  ? 47  LEU A CG  1 
ATOM   860  C  CD1 . LEU B 2 9   ? -30.664  18.498  2.731   1.00 72.96  ? 47  LEU A CD1 1 
ATOM   861  C  CD2 . LEU B 2 9   ? -32.402  18.216  0.932   1.00 71.04  ? 47  LEU A CD2 1 
ATOM   862  N  N   . MET B 2 10  ? -33.314  23.349  2.527   1.00 72.79  ? 48  MET A N   1 
ATOM   863  C  CA  . MET B 2 10  ? -33.595  24.624  1.851   1.00 68.95  ? 48  MET A CA  1 
ATOM   864  C  C   . MET B 2 10  ? -32.625  25.706  2.307   1.00 63.64  ? 48  MET A C   1 
ATOM   865  O  O   . MET B 2 10  ? -32.178  26.519  1.500   1.00 59.27  ? 48  MET A O   1 
ATOM   866  C  CB  . MET B 2 10  ? -35.025  25.100  2.127   1.00 70.99  ? 48  MET A CB  1 
ATOM   867  C  CG  . MET B 2 10  ? -36.105  24.184  1.574   1.00 71.84  ? 48  MET A CG  1 
ATOM   868  S  SD  . MET B 2 10  ? -37.761  24.674  2.084   1.00 71.79  ? 48  MET A SD  1 
ATOM   869  C  CE  . MET B 2 10  ? -38.659  23.272  1.422   1.00 74.28  ? 48  MET A CE  1 
ATOM   870  N  N   . ALA B 2 11  ? -32.310  25.710  3.600   1.00 63.32  ? 49  ALA A N   1 
ATOM   871  C  CA  . ALA B 2 11  ? -31.407  26.696  4.177   1.00 63.08  ? 49  ALA A CA  1 
ATOM   872  C  C   . ALA B 2 11  ? -30.020  26.655  3.539   1.00 62.17  ? 49  ALA A C   1 
ATOM   873  O  O   . ALA B 2 11  ? -29.490  27.710  3.169   1.00 60.22  ? 49  ALA A O   1 
ATOM   874  C  CB  . ALA B 2 11  ? -31.298  26.506  5.682   1.00 61.95  ? 49  ALA A CB  1 
ATOM   875  N  N   . LEU B 2 12  ? -29.442  25.455  3.400   1.00 61.97  ? 50  LEU A N   1 
ATOM   876  C  CA  . LEU B 2 12  ? -28.108  25.338  2.795   1.00 64.48  ? 50  LEU A CA  1 
ATOM   877  C  C   . LEU B 2 12  ? -28.155  25.707  1.307   1.00 64.77  ? 50  LEU A C   1 
ATOM   878  O  O   . LEU B 2 12  ? -27.234  26.355  0.809   1.00 66.74  ? 50  LEU A O   1 
ATOM   879  C  CB  . LEU B 2 12  ? -27.458  23.956  3.034   1.00 66.31  ? 50  LEU A CB  1 
ATOM   880  C  CG  . LEU B 2 12  ? -27.980  22.690  2.328   1.00 71.73  ? 50  LEU A CG  1 
ATOM   881  C  CD1 . LEU B 2 12  ? -27.369  22.459  0.946   1.00 76.38  ? 50  LEU A CD1 1 
ATOM   882  C  CD2 . LEU B 2 12  ? -27.734  21.455  3.182   1.00 72.22  ? 50  LEU A CD2 1 
ATOM   883  N  N   . VAL B 2 13  ? -29.232  25.323  0.611   1.00 61.79  ? 51  VAL A N   1 
ATOM   884  C  CA  . VAL B 2 13  ? -29.397  25.659  -0.813  1.00 57.81  ? 51  VAL A CA  1 
ATOM   885  C  C   . VAL B 2 13  ? -29.285  27.164  -1.002  1.00 54.06  ? 51  VAL A C   1 
ATOM   886  O  O   . VAL B 2 13  ? -28.469  27.610  -1.792  1.00 58.16  ? 51  VAL A O   1 
ATOM   887  C  CB  . VAL B 2 13  ? -30.716  25.090  -1.405  1.00 58.97  ? 51  VAL A CB  1 
ATOM   888  C  CG1 . VAL B 2 13  ? -31.109  25.771  -2.711  1.00 59.34  ? 51  VAL A CG1 1 
ATOM   889  C  CG2 . VAL B 2 13  ? -30.580  23.582  -1.624  1.00 58.95  ? 51  VAL A CG2 1 
ATOM   890  N  N   . VAL B 2 14  ? -30.062  27.933  -0.247  1.00 50.43  ? 52  VAL A N   1 
ATOM   891  C  CA  . VAL B 2 14  ? -29.993  29.394  -0.323  1.00 49.84  ? 52  VAL A CA  1 
ATOM   892  C  C   . VAL B 2 14  ? -28.589  29.901  0.039   1.00 50.25  ? 52  VAL A C   1 
ATOM   893  O  O   . VAL B 2 14  ? -28.058  30.806  -0.620  1.00 48.70  ? 52  VAL A O   1 
ATOM   894  C  CB  . VAL B 2 14  ? -31.048  30.069  0.583   1.00 51.30  ? 52  VAL A CB  1 
ATOM   895  C  CG1 . VAL B 2 14  ? -30.823  31.581  0.672   1.00 52.57  ? 52  VAL A CG1 1 
ATOM   896  C  CG2 . VAL B 2 14  ? -32.452  29.803  0.064   1.00 50.95  ? 52  VAL A CG2 1 
ATOM   897  N  N   . LEU B 2 15  ? -27.993  29.319  1.078   1.00 51.56  ? 53  LEU A N   1 
ATOM   898  C  CA  . LEU B 2 15  ? -26.664  29.741  1.529   1.00 51.98  ? 53  LEU A CA  1 
ATOM   899  C  C   . LEU B 2 15  ? -25.611  29.552  0.443   1.00 47.22  ? 53  LEU A C   1 
ATOM   900  O  O   . LEU B 2 15  ? -24.815  30.450  0.183   1.00 44.03  ? 53  LEU A O   1 
ATOM   901  C  CB  . LEU B 2 15  ? -26.245  28.964  2.781   1.00 55.03  ? 53  LEU A CB  1 
ATOM   902  C  CG  . LEU B 2 15  ? -24.982  29.470  3.475   1.00 56.80  ? 53  LEU A CG  1 
ATOM   903  C  CD1 . LEU B 2 15  ? -25.306  30.656  4.376   1.00 57.54  ? 53  LEU A CD1 1 
ATOM   904  C  CD2 . LEU B 2 15  ? -24.360  28.323  4.260   1.00 57.42  ? 53  LEU A CD2 1 
ATOM   905  N  N   . LEU B 2 16  ? -25.619  28.375  -0.176  1.00 44.60  ? 54  LEU A N   1 
ATOM   906  C  CA  . LEU B 2 16  ? -24.694  28.077  -1.252  1.00 44.87  ? 54  LEU A CA  1 
ATOM   907  C  C   . LEU B 2 16  ? -24.894  28.994  -2.453  1.00 44.50  ? 54  LEU A C   1 
ATOM   908  O  O   . LEU B 2 16  ? -23.922  29.503  -3.008  1.00 43.41  ? 54  LEU A O   1 
ATOM   909  C  CB  . LEU B 2 16  ? -24.853  26.629  -1.701  1.00 45.47  ? 54  LEU A CB  1 
ATOM   910  C  CG  . LEU B 2 16  ? -24.453  25.528  -0.735  1.00 45.18  ? 54  LEU A CG  1 
ATOM   911  C  CD1 . LEU B 2 16  ? -24.931  24.183  -1.282  1.00 45.64  ? 54  LEU A CD1 1 
ATOM   912  C  CD2 . LEU B 2 16  ? -22.953  25.547  -0.506  1.00 43.59  ? 54  LEU A CD2 1 
ATOM   913  N  N   . ILE B 2 17  ? -26.146  29.208  -2.850  1.00 44.58  ? 55  ILE A N   1 
ATOM   914  C  CA  . ILE B 2 17  ? -26.433  30.047  -4.007  1.00 45.31  ? 55  ILE A CA  1 
ATOM   915  C  C   . ILE B 2 17  ? -25.927  31.469  -3.772  1.00 46.84  ? 55  ILE A C   1 
ATOM   916  O  O   . ILE B 2 17  ? -25.203  32.010  -4.615  1.00 48.66  ? 55  ILE A O   1 
ATOM   917  C  CB  . ILE B 2 17  ? -27.931  30.092  -4.362  1.00 44.13  ? 55  ILE A CB  1 
ATOM   918  C  CG1 . ILE B 2 17  ? -28.396  28.729  -4.877  1.00 43.74  ? 55  ILE A CG1 1 
ATOM   919  C  CG2 . ILE B 2 17  ? -28.197  31.151  -5.429  1.00 44.13  ? 55  ILE A CG2 1 
ATOM   920  C  CD1 . ILE B 2 17  ? -29.902  28.618  -5.037  1.00 44.44  ? 55  ILE A CD1 1 
ATOM   921  N  N   . VAL B 2 18  ? -26.289  32.067  -2.639  1.00 45.01  ? 56  VAL A N   1 
ATOM   922  C  CA  . VAL B 2 18  ? -25.936  33.465  -2.417  1.00 42.86  ? 56  VAL A CA  1 
ATOM   923  C  C   . VAL B 2 18  ? -24.436  33.588  -2.218  1.00 41.77  ? 56  VAL A C   1 
ATOM   924  O  O   . VAL B 2 18  ? -23.805  34.436  -2.843  1.00 42.08  ? 56  VAL A O   1 
ATOM   925  C  CB  . VAL B 2 18  ? -26.685  34.115  -1.237  1.00 41.89  ? 56  VAL A CB  1 
ATOM   926  C  CG1 . VAL B 2 18  ? -26.246  35.577  -1.080  1.00 40.79  ? 56  VAL A CG1 1 
ATOM   927  C  CG2 . VAL B 2 18  ? -28.191  34.055  -1.462  1.00 41.91  ? 56  VAL A CG2 1 
ATOM   928  N  N   . ALA B 2 19  ? -23.871  32.727  -1.374  1.00 42.16  ? 57  ALA A N   1 
ATOM   929  C  CA  . ALA B 2 19  ? -22.435  32.766  -1.102  1.00 43.34  ? 57  ALA A CA  1 
ATOM   930  C  C   . ALA B 2 19  ? -21.637  32.672  -2.405  1.00 43.07  ? 57  ALA A C   1 
ATOM   931  O  O   . ALA B 2 19  ? -20.929  33.616  -2.781  1.00 43.80  ? 57  ALA A O   1 
ATOM   932  C  CB  . ALA B 2 19  ? -22.033  31.651  -0.148  1.00 43.25  ? 57  ALA A CB  1 
ATOM   933  N  N   . GLY B 2 20  ? -21.807  31.550  -3.102  1.00 41.36  ? 58  GLY A N   1 
ATOM   934  C  CA  . GLY B 2 20  ? -21.112  31.291  -4.350  1.00 39.80  ? 58  GLY A CA  1 
ATOM   935  C  C   . GLY B 2 20  ? -21.212  32.448  -5.323  1.00 39.08  ? 58  GLY A C   1 
ATOM   936  O  O   . GLY B 2 20  ? -20.199  33.038  -5.693  1.00 38.91  ? 58  GLY A O   1 
ATOM   937  N  N   . ASN B 2 21  ? -22.435  32.806  -5.697  1.00 38.45  ? 59  ASN A N   1 
ATOM   938  C  CA  . ASN B 2 21  ? -22.640  33.799  -6.753  1.00 37.66  ? 59  ASN A CA  1 
ATOM   939  C  C   . ASN B 2 21  ? -22.160  35.193  -6.360  1.00 37.30  ? 59  ASN A C   1 
ATOM   940  O  O   . ASN B 2 21  ? -21.625  35.901  -7.218  1.00 37.72  ? 59  ASN A O   1 
ATOM   941  C  CB  . ASN B 2 21  ? -24.090  33.805  -7.247  1.00 37.45  ? 59  ASN A CB  1 
ATOM   942  C  CG  . ASN B 2 21  ? -24.414  32.585  -8.105  1.00 37.83  ? 59  ASN A CG  1 
ATOM   943  O  OD1 . ASN B 2 21  ? -23.879  32.417  -9.214  1.00 38.35  ? 59  ASN A OD1 1 
ATOM   944  N  ND2 . ASN B 2 21  ? -25.291  31.726  -7.596  1.00 36.40  ? 59  ASN A ND2 1 
ATOM   945  N  N   . VAL B 2 22  ? -22.302  35.571  -5.085  1.00 36.37  ? 60  VAL A N   1 
ATOM   946  C  CA  . VAL B 2 22  ? -21.719  36.830  -4.585  1.00 36.75  ? 60  VAL A CA  1 
ATOM   947  C  C   . VAL B 2 22  ? -20.186  36.827  -4.706  1.00 38.36  ? 60  VAL A C   1 
ATOM   948  O  O   . VAL B 2 22  ? -19.568  37.850  -5.048  1.00 36.80  ? 60  VAL A O   1 
ATOM   949  C  CB  . VAL B 2 22  ? -22.130  37.112  -3.122  1.00 35.43  ? 60  VAL A CB  1 
ATOM   950  C  CG1 . VAL B 2 22  ? -21.284  38.230  -2.500  1.00 35.23  ? 60  VAL A CG1 1 
ATOM   951  C  CG2 . VAL B 2 22  ? -23.606  37.477  -3.055  1.00 35.06  ? 60  VAL A CG2 1 
ATOM   952  N  N   . LEU B 2 23  ? -19.595  35.667  -4.436  1.00 39.50  ? 61  LEU A N   1 
ATOM   953  C  CA  . LEU B 2 23  ? -18.150  35.503  -4.485  1.00 40.19  ? 61  LEU A CA  1 
ATOM   954  C  C   . LEU B 2 23  ? -17.610  35.659  -5.919  1.00 38.62  ? 61  LEU A C   1 
ATOM   955  O  O   . LEU B 2 23  ? -16.540  36.242  -6.123  1.00 35.83  ? 61  LEU A O   1 
ATOM   956  C  CB  . LEU B 2 23  ? -17.760  34.134  -3.897  1.00 42.29  ? 61  LEU A CB  1 
ATOM   957  C  CG  . LEU B 2 23  ? -16.557  34.050  -2.960  1.00 44.67  ? 61  LEU A CG  1 
ATOM   958  C  CD1 . LEU B 2 23  ? -16.690  35.025  -1.796  1.00 45.08  ? 61  LEU A CD1 1 
ATOM   959  C  CD2 . LEU B 2 23  ? -16.407  32.617  -2.483  1.00 46.48  ? 61  LEU A CD2 1 
ATOM   960  N  N   . VAL B 2 24  ? -18.365  35.142  -6.889  1.00 37.80  ? 62  VAL A N   1 
ATOM   961  C  CA  . VAL B 2 24  ? -18.016  35.229  -8.311  1.00 37.19  ? 62  VAL A CA  1 
ATOM   962  C  C   . VAL B 2 24  ? -18.074  36.660  -8.824  1.00 37.15  ? 62  VAL A C   1 
ATOM   963  O  O   . VAL B 2 24  ? -17.117  37.153  -9.419  1.00 36.22  ? 62  VAL A O   1 
ATOM   964  C  CB  . VAL B 2 24  ? -18.978  34.387  -9.179  1.00 36.25  ? 62  VAL A CB  1 
ATOM   965  C  CG1 . VAL B 2 24  ? -18.751  34.640  -10.662 1.00 35.82  ? 62  VAL A CG1 1 
ATOM   966  C  CG2 . VAL B 2 24  ? -18.810  32.904  -8.878  1.00 36.54  ? 62  VAL A CG2 1 
ATOM   967  N  N   . ILE B 2 25  ? -19.210  37.315  -8.606  1.00 37.23  ? 63  ILE A N   1 
ATOM   968  C  CA  . ILE B 2 25  ? -19.380  38.690  -9.057  1.00 38.41  ? 63  ILE A CA  1 
ATOM   969  C  C   . ILE B 2 25  ? -18.322  39.585  -8.416  1.00 40.66  ? 63  ILE A C   1 
ATOM   970  O  O   . ILE B 2 25  ? -17.768  40.469  -9.077  1.00 41.32  ? 63  ILE A O   1 
ATOM   971  C  CB  . ILE B 2 25  ? -20.778  39.233  -8.720  1.00 37.80  ? 63  ILE A CB  1 
ATOM   972  C  CG1 . ILE B 2 25  ? -21.849  38.445  -9.478  1.00 38.02  ? 63  ILE A CG1 1 
ATOM   973  C  CG2 . ILE B 2 25  ? -20.880  40.716  -9.083  1.00 37.67  ? 63  ILE A CG2 1 
ATOM   974  C  CD1 . ILE B 2 25  ? -23.226  38.557  -8.873  1.00 39.09  ? 63  ILE A CD1 1 
ATOM   975  N  N   . ALA B 2 26  ? -18.055  39.354  -7.130  1.00 41.64  ? 64  ALA A N   1 
ATOM   976  C  CA  . ALA B 2 26  ? -17.020  40.085  -6.415  1.00 41.36  ? 64  ALA A CA  1 
ATOM   977  C  C   . ALA B 2 26  ? -15.673  39.910  -7.080  1.00 41.95  ? 64  ALA A C   1 
ATOM   978  O  O   . ALA B 2 26  ? -14.976  40.885  -7.346  1.00 40.49  ? 64  ALA A O   1 
ATOM   979  C  CB  . ALA B 2 26  ? -16.946  39.612  -4.980  1.00 41.80  ? 64  ALA A CB  1 
ATOM   980  N  N   . ALA B 2 27  ? -15.319  38.652  -7.339  1.00 44.30  ? 65  ALA A N   1 
ATOM   981  C  CA  . ALA B 2 27  ? -14.029  38.310  -7.944  1.00 44.16  ? 65  ALA A CA  1 
ATOM   982  C  C   . ALA B 2 27  ? -13.847  39.030  -9.267  1.00 43.77  ? 65  ALA A C   1 
ATOM   983  O  O   . ALA B 2 27  ? -12.829  39.667  -9.493  1.00 43.22  ? 65  ALA A O   1 
ATOM   984  C  CB  . ALA B 2 27  ? -13.924  36.809  -8.149  1.00 43.58  ? 65  ALA A CB  1 
ATOM   985  N  N   . ILE B 2 28  ? -14.868  38.955  -10.111 1.00 44.02  ? 66  ILE A N   1 
ATOM   986  C  CA  . ILE B 2 28  ? -14.805  39.517  -11.450 1.00 42.89  ? 66  ILE A CA  1 
ATOM   987  C  C   . ILE B 2 28  ? -14.727  41.034  -11.381 1.00 44.07  ? 66  ILE A C   1 
ATOM   988  O  O   . ILE B 2 28  ? -13.890  41.651  -12.035 1.00 42.42  ? 66  ILE A O   1 
ATOM   989  C  CB  . ILE B 2 28  ? -16.018  39.090  -12.290 1.00 41.54  ? 66  ILE A CB  1 
ATOM   990  C  CG1 . ILE B 2 28  ? -15.997  37.579  -12.523 1.00 41.88  ? 66  ILE A CG1 1 
ATOM   991  C  CG2 . ILE B 2 28  ? -16.031  39.810  -13.631 1.00 41.71  ? 66  ILE A CG2 1 
ATOM   992  C  CD1 . ILE B 2 28  ? -17.337  37.006  -12.937 1.00 41.69  ? 66  ILE A CD1 1 
ATOM   993  N  N   . GLY B 2 29  ? -15.596  41.634  -10.581 1.00 47.10  ? 67  GLY A N   1 
ATOM   994  C  CA  . GLY B 2 29  ? -15.634  43.087  -10.472 1.00 49.70  ? 67  GLY A CA  1 
ATOM   995  C  C   . GLY B 2 29  ? -14.384  43.717  -9.883  1.00 50.63  ? 67  GLY A C   1 
ATOM   996  O  O   . GLY B 2 29  ? -14.041  44.851  -10.221 1.00 52.26  ? 67  GLY A O   1 
ATOM   997  N  N   . SER B 2 30  ? -13.712  42.981  -9.002  1.00 51.15  ? 68  SER A N   1 
ATOM   998  C  CA  . SER B 2 30  ? -12.565  43.491  -8.257  1.00 52.50  ? 68  SER A CA  1 
ATOM   999  C  C   . SER B 2 30  ? -11.226  43.229  -8.947  1.00 54.02  ? 68  SER A C   1 
ATOM   1000 O  O   . SER B 2 30  ? -10.265  43.951  -8.705  1.00 58.03  ? 68  SER A O   1 
ATOM   1001 C  CB  . SER B 2 30  ? -12.549  42.877  -6.854  1.00 51.81  ? 68  SER A CB  1 
ATOM   1002 O  OG  . SER B 2 30  ? -12.486  41.460  -6.910  1.00 51.52  ? 68  SER A OG  1 
ATOM   1003 N  N   . THR B 2 31  ? -11.164  42.209  -9.801  1.00 53.41  ? 69  THR A N   1 
ATOM   1004 C  CA  . THR B 2 31  ? -9.913   41.785  -10.427 1.00 53.25  ? 69  THR A CA  1 
ATOM   1005 C  C   . THR B 2 31  ? -9.867   42.136  -11.917 1.00 57.00  ? 69  THR A C   1 
ATOM   1006 O  O   . THR B 2 31  ? -10.680  41.650  -12.695 1.00 62.33  ? 69  THR A O   1 
ATOM   1007 C  CB  . THR B 2 31  ? -9.744   40.269  -10.253 1.00 51.06  ? 69  THR A CB  1 
ATOM   1008 O  OG1 . THR B 2 31  ? -9.866   39.937  -8.862  1.00 49.27  ? 69  THR A OG1 1 
ATOM   1009 C  CG2 . THR B 2 31  ? -8.391   39.800  -10.773 1.00 51.82  ? 69  THR A CG2 1 
ATOM   1010 N  N   . GLN B 2 32  ? -8.900   42.962  -12.313 1.00 60.02  ? 70  GLN A N   1 
ATOM   1011 C  CA  . GLN B 2 32  ? -8.746   43.390  -13.717 1.00 63.17  ? 70  GLN A CA  1 
ATOM   1012 C  C   . GLN B 2 32  ? -8.488   42.183  -14.614 1.00 59.04  ? 70  GLN A C   1 
ATOM   1013 O  O   . GLN B 2 32  ? -8.970   42.130  -15.738 1.00 52.82  ? 70  GLN A O   1 
ATOM   1014 C  CB  . GLN B 2 32  ? -7.571   44.382  -13.850 1.00 69.26  ? 70  GLN A CB  1 
ATOM   1015 C  CG  . GLN B 2 32  ? -7.447   45.104  -15.192 1.00 70.58  ? 70  GLN A CG  1 
ATOM   1016 C  CD  . GLN B 2 32  ? -8.152   46.454  -15.257 1.00 73.17  ? 70  GLN A CD  1 
ATOM   1017 O  OE1 . GLN B 2 32  ? -8.824   46.913  -14.319 1.00 76.34  ? 70  GLN A OE1 1 
ATOM   1018 N  NE2 . GLN B 2 32  ? -7.984   47.114  -16.391 1.00 72.22  ? 70  GLN A NE2 1 
ATOM   1019 N  N   . ARG B 2 33  ? -7.730   41.222  -14.093 1.00 58.82  ? 71  ARG A N   1 
ATOM   1020 C  CA  . ARG B 2 33  ? -7.393   40.013  -14.824 1.00 60.37  ? 71  ARG A CA  1 
ATOM   1021 C  C   . ARG B 2 33  ? -8.622   39.148  -15.176 1.00 58.43  ? 71  ARG A C   1 
ATOM   1022 O  O   . ARG B 2 33  ? -8.613   38.438  -16.191 1.00 57.94  ? 71  ARG A O   1 
ATOM   1023 C  CB  . ARG B 2 33  ? -6.384   39.177  -14.020 1.00 66.65  ? 71  ARG A CB  1 
ATOM   1024 C  CG  . ARG B 2 33  ? -5.015   39.823  -13.797 1.00 73.94  ? 71  ARG A CG  1 
ATOM   1025 C  CD  . ARG B 2 33  ? -4.217   39.964  -15.089 1.00 80.42  ? 71  ARG A CD  1 
ATOM   1026 N  NE  . ARG B 2 33  ? -3.967   38.659  -15.711 1.00 83.66  ? 71  ARG A NE  1 
ATOM   1027 C  CZ  . ARG B 2 33  ? -2.977   37.817  -15.395 1.00 83.22  ? 71  ARG A CZ  1 
ATOM   1028 N  NH1 . ARG B 2 33  ? -2.078   38.115  -14.457 1.00 83.07  ? 71  ARG A NH1 1 
ATOM   1029 N  NH2 . ARG B 2 33  ? -2.884   36.654  -16.036 1.00 82.53  ? 71  ARG A NH2 1 
ATOM   1030 N  N   . LEU B 2 34  ? -9.672   39.201  -14.348 1.00 55.37  ? 72  LEU A N   1 
ATOM   1031 C  CA  . LEU B 2 34  ? -10.871  38.376  -14.554 1.00 49.88  ? 72  LEU A CA  1 
ATOM   1032 C  C   . LEU B 2 34  ? -11.862  39.004  -15.527 1.00 48.34  ? 72  LEU A C   1 
ATOM   1033 O  O   . LEU B 2 34  ? -12.761  38.315  -16.002 1.00 48.55  ? 72  LEU A O   1 
ATOM   1034 C  CB  . LEU B 2 34  ? -11.570  38.061  -13.224 1.00 47.32  ? 72  LEU A CB  1 
ATOM   1035 C  CG  . LEU B 2 34  ? -10.925  36.973  -12.363 1.00 46.67  ? 72  LEU A CG  1 
ATOM   1036 C  CD1 . LEU B 2 34  ? -11.610  36.896  -11.005 1.00 46.34  ? 72  LEU A CD1 1 
ATOM   1037 C  CD2 . LEU B 2 34  ? -10.935  35.613  -13.062 1.00 46.11  ? 72  LEU A CD2 1 
ATOM   1038 N  N   . GLN B 2 35  ? -11.697  40.285  -15.849 1.00 45.68  ? 73  GLN A N   1 
ATOM   1039 C  CA  . GLN B 2 35  ? -12.653  40.988  -16.691 1.00 45.45  ? 73  GLN A CA  1 
ATOM   1040 C  C   . GLN B 2 35  ? -12.442  40.667  -18.160 1.00 42.86  ? 73  GLN A C   1 
ATOM   1041 O  O   . GLN B 2 35  ? -12.111  41.545  -18.952 1.00 42.59  ? 73  GLN A O   1 
ATOM   1042 C  CB  . GLN B 2 35  ? -12.572  42.490  -16.436 1.00 48.27  ? 73  GLN A CB  1 
ATOM   1043 C  CG  . GLN B 2 35  ? -12.995  42.855  -15.025 1.00 52.47  ? 73  GLN A CG  1 
ATOM   1044 C  CD  . GLN B 2 35  ? -12.606  44.257  -14.618 1.00 58.08  ? 73  GLN A CD  1 
ATOM   1045 O  OE1 . GLN B 2 35  ? -12.198  45.082  -15.449 1.00 62.44  ? 73  GLN A OE1 1 
ATOM   1046 N  NE2 . GLN B 2 35  ? -12.734  44.542  -13.328 1.00 63.43  ? 73  GLN A NE2 1 
ATOM   1047 N  N   . THR B 2 36  ? -12.666  39.402  -18.515 1.00 41.77  ? 74  THR A N   1 
ATOM   1048 C  CA  . THR B 2 36  ? -12.559  38.930  -19.898 1.00 40.86  ? 74  THR A CA  1 
ATOM   1049 C  C   . THR B 2 36  ? -13.949  38.900  -20.539 1.00 39.55  ? 74  THR A C   1 
ATOM   1050 O  O   . THR B 2 36  ? -14.948  39.298  -19.931 1.00 39.40  ? 74  THR A O   1 
ATOM   1051 C  CB  . THR B 2 36  ? -11.872  37.539  -19.992 1.00 40.51  ? 74  THR A CB  1 
ATOM   1052 O  OG1 . THR B 2 36  ? -12.773  36.499  -19.581 1.00 40.07  ? 74  THR A OG1 1 
ATOM   1053 C  CG2 . THR B 2 36  ? -10.617  37.508  -19.137 1.00 40.49  ? 74  THR A CG2 1 
ATOM   1054 N  N   . LEU B 2 37  ? -13.989  38.442  -21.782 1.00 40.20  ? 75  LEU A N   1 
ATOM   1055 C  CA  . LEU B 2 37  ? -15.222  38.394  -22.567 1.00 40.24  ? 75  LEU A CA  1 
ATOM   1056 C  C   . LEU B 2 37  ? -16.121  37.256  -22.086 1.00 36.77  ? 75  LEU A C   1 
ATOM   1057 O  O   . LEU B 2 37  ? -17.312  37.461  -21.875 1.00 35.16  ? 75  LEU A O   1 
ATOM   1058 C  CB  . LEU B 2 37  ? -14.872  38.235  -24.056 1.00 42.92  ? 75  LEU A CB  1 
ATOM   1059 C  CG  . LEU B 2 37  ? -15.848  38.823  -25.066 1.00 45.71  ? 75  LEU A CG  1 
ATOM   1060 C  CD1 . LEU B 2 37  ? -15.145  39.020  -26.400 1.00 47.92  ? 75  LEU A CD1 1 
ATOM   1061 C  CD2 . LEU B 2 37  ? -17.074  37.926  -25.208 1.00 48.21  ? 75  LEU A CD2 1 
ATOM   1062 N  N   . THR B 2 38  ? -15.544  36.072  -21.906 1.00 34.05  ? 76  THR A N   1 
ATOM   1063 C  CA  . THR B 2 38  ? -16.254  34.919  -21.357 1.00 31.63  ? 76  THR A CA  1 
ATOM   1064 C  C   . THR B 2 38  ? -16.843  35.236  -20.003 1.00 31.65  ? 76  THR A C   1 
ATOM   1065 O  O   . THR B 2 38  ? -18.027  35.009  -19.780 1.00 32.29  ? 76  THR A O   1 
ATOM   1066 C  CB  . THR B 2 38  ? -15.333  33.688  -21.230 1.00 30.00  ? 76  THR A CB  1 
ATOM   1067 O  OG1 . THR B 2 38  ? -14.885  33.291  -22.538 1.00 29.30  ? 76  THR A OG1 1 
ATOM   1068 C  CG2 . THR B 2 38  ? -16.056  32.522  -20.569 1.00 29.30  ? 76  THR A CG2 1 
ATOM   1069 N  N   . ASN B 2 39  ? -16.023  35.783  -19.112 1.00 31.79  ? 77  ASN A N   1 
ATOM   1070 C  CA  . ASN B 2 39  ? -16.477  36.161  -17.767 1.00 32.35  ? 77  ASN A CA  1 
ATOM   1071 C  C   . ASN B 2 39  ? -17.559  37.251  -17.733 1.00 32.57  ? 77  ASN A C   1 
ATOM   1072 O  O   . ASN B 2 39  ? -18.213  37.434  -16.708 1.00 31.07  ? 77  ASN A O   1 
ATOM   1073 C  CB  . ASN B 2 39  ? -15.282  36.566  -16.889 1.00 32.89  ? 77  ASN A CB  1 
ATOM   1074 C  CG  . ASN B 2 39  ? -14.424  35.377  -16.482 1.00 34.45  ? 77  ASN A CG  1 
ATOM   1075 O  OD1 . ASN B 2 39  ? -14.703  34.237  -16.844 1.00 35.82  ? 77  ASN A OD1 1 
ATOM   1076 N  ND2 . ASN B 2 39  ? -13.378  35.642  -15.717 1.00 36.66  ? 77  ASN A ND2 1 
ATOM   1077 N  N   . LEU B 2 40  ? -17.729  37.979  -18.834 1.00 33.75  ? 78  LEU A N   1 
ATOM   1078 C  CA  . LEU B 2 40  ? -18.886  38.855  -19.018 1.00 34.54  ? 78  LEU A CA  1 
ATOM   1079 C  C   . LEU B 2 40  ? -20.183  38.041  -19.030 1.00 32.88  ? 78  LEU A C   1 
ATOM   1080 O  O   . LEU B 2 40  ? -21.129  38.369  -18.310 1.00 33.75  ? 78  LEU A O   1 
ATOM   1081 C  CB  . LEU B 2 40  ? -18.744  39.638  -20.328 1.00 37.19  ? 78  LEU A CB  1 
ATOM   1082 C  CG  . LEU B 2 40  ? -19.186  41.084  -20.331 1.00 40.17  ? 78  LEU A CG  1 
ATOM   1083 C  CD1 . LEU B 2 40  ? -18.339  41.879  -19.344 1.00 42.26  ? 78  LEU A CD1 1 
ATOM   1084 C  CD2 . LEU B 2 40  ? -19.041  41.607  -21.751 1.00 40.92  ? 78  LEU A CD2 1 
ATOM   1085 N  N   . PHE B 2 41  ? -20.200  36.973  -19.836 1.00 29.81  ? 79  PHE A N   1 
ATOM   1086 C  CA  . PHE B 2 41  ? -21.312  36.026  -19.847 1.00 26.91  ? 79  PHE A CA  1 
ATOM   1087 C  C   . PHE B 2 41  ? -21.455  35.353  -18.489 1.00 26.67  ? 79  PHE A C   1 
ATOM   1088 O  O   . PHE B 2 41  ? -22.568  35.247  -17.988 1.00 27.10  ? 79  PHE A O   1 
ATOM   1089 C  CB  . PHE B 2 41  ? -21.143  34.966  -20.935 1.00 25.62  ? 79  PHE A CB  1 
ATOM   1090 C  CG  . PHE B 2 41  ? -21.103  35.520  -22.331 1.00 24.62  ? 79  PHE A CG  1 
ATOM   1091 C  CD1 . PHE B 2 41  ? -22.108  36.359  -22.788 1.00 24.07  ? 79  PHE A CD1 1 
ATOM   1092 C  CD2 . PHE B 2 41  ? -20.069  35.194  -23.200 1.00 23.80  ? 79  PHE A CD2 1 
ATOM   1093 C  CE1 . PHE B 2 41  ? -22.086  36.867  -24.088 1.00 23.57  ? 79  PHE A CE1 1 
ATOM   1094 C  CE2 . PHE B 2 41  ? -20.044  35.698  -24.496 1.00 23.45  ? 79  PHE A CE2 1 
ATOM   1095 C  CZ  . PHE B 2 41  ? -21.052  36.529  -24.940 1.00 23.55  ? 79  PHE A CZ  1 
ATOM   1096 N  N   . ILE B 2 42  ? -20.344  34.941  -17.873 1.00 26.23  ? 80  ILE A N   1 
ATOM   1097 C  CA  . ILE B 2 42  ? -20.385  34.354  -16.525 1.00 26.49  ? 80  ILE A CA  1 
ATOM   1098 C  C   . ILE B 2 42  ? -21.013  35.329  -15.532 1.00 26.90  ? 80  ILE A C   1 
ATOM   1099 O  O   . ILE B 2 42  ? -21.741  34.914  -14.635 1.00 25.13  ? 80  ILE A O   1 
ATOM   1100 C  CB  . ILE B 2 42  ? -18.991  33.960  -15.985 1.00 26.99  ? 80  ILE A CB  1 
ATOM   1101 C  CG1 . ILE B 2 42  ? -18.253  32.991  -16.923 1.00 28.05  ? 80  ILE A CG1 1 
ATOM   1102 C  CG2 . ILE B 2 42  ? -19.097  33.326  -14.598 1.00 27.07  ? 80  ILE A CG2 1 
ATOM   1103 C  CD1 . ILE B 2 42  ? -18.899  31.632  -17.066 1.00 28.14  ? 80  ILE A CD1 1 
ATOM   1104 N  N   . THR B 2 43  ? -20.727  36.620  -15.691 1.00 28.59  ? 81  THR A N   1 
ATOM   1105 C  CA  . THR B 2 43  ? -21.306  37.641  -14.827 1.00 29.38  ? 81  THR A CA  1 
ATOM   1106 C  C   . THR B 2 43  ? -22.819  37.681  -14.982 1.00 29.49  ? 81  THR A C   1 
ATOM   1107 O  O   . THR B 2 43  ? -23.521  37.824  -13.988 1.00 30.50  ? 81  THR A O   1 
ATOM   1108 C  CB  . THR B 2 43  ? -20.718  39.059  -15.080 1.00 30.37  ? 81  THR A CB  1 
ATOM   1109 O  OG1 . THR B 2 43  ? -19.280  39.009  -15.117 1.00 30.66  ? 81  THR A OG1 1 
ATOM   1110 C  CG2 . THR B 2 43  ? -21.143  40.026  -13.991 1.00 30.65  ? 81  THR A CG2 1 
ATOM   1111 N  N   . SER B 2 44  ? -23.320  37.558  -16.211 1.00 30.10  ? 82  SER A N   1 
ATOM   1112 C  CA  . SER B 2 44  ? -24.771  37.501  -16.452 1.00 31.22  ? 82  SER A CA  1 
ATOM   1113 C  C   . SER B 2 44  ? -25.394  36.296  -15.742 1.00 31.15  ? 82  SER A C   1 
ATOM   1114 O  O   . SER B 2 44  ? -26.421  36.418  -15.088 1.00 30.62  ? 82  SER A O   1 
ATOM   1115 C  CB  . SER B 2 44  ? -25.075  37.448  -17.959 1.00 32.03  ? 82  SER A CB  1 
ATOM   1116 O  OG  . SER B 2 44  ? -26.431  37.131  -18.228 1.00 33.18  ? 82  SER A OG  1 
ATOM   1117 N  N   . LEU B 2 45  ? -24.747  35.144  -15.883 1.00 31.11  ? 83  LEU A N   1 
ATOM   1118 C  CA  . LEU B 2 45  ? -25.174  33.918  -15.227 1.00 29.92  ? 83  LEU A CA  1 
ATOM   1119 C  C   . LEU B 2 45  ? -25.249  34.111  -13.719 1.00 29.94  ? 83  LEU A C   1 
ATOM   1120 O  O   . LEU B 2 45  ? -26.233  33.752  -13.106 1.00 31.49  ? 83  LEU A O   1 
ATOM   1121 C  CB  . LEU B 2 45  ? -24.208  32.774  -15.559 1.00 29.69  ? 83  LEU A CB  1 
ATOM   1122 C  CG  . LEU B 2 45  ? -24.491  31.396  -14.956 1.00 29.47  ? 83  LEU A CG  1 
ATOM   1123 C  CD1 . LEU B 2 45  ? -25.791  30.858  -15.504 1.00 29.93  ? 83  LEU A CD1 1 
ATOM   1124 C  CD2 . LEU B 2 45  ? -23.348  30.442  -15.239 1.00 29.50  ? 83  LEU A CD2 1 
ATOM   1125 N  N   . ALA B 2 46  ? -24.211  34.693  -13.130 1.00 30.76  ? 84  ALA A N   1 
ATOM   1126 C  CA  . ALA B 2 46  ? -24.142  34.848  -11.675 1.00 30.83  ? 84  ALA A CA  1 
ATOM   1127 C  C   . ALA B 2 46  ? -25.181  35.821  -11.150 1.00 30.99  ? 84  ALA A C   1 
ATOM   1128 O  O   . ALA B 2 46  ? -25.687  35.631  -10.047 1.00 32.19  ? 84  ALA A O   1 
ATOM   1129 C  CB  . ALA B 2 46  ? -22.754  35.293  -11.244 1.00 31.16  ? 84  ALA A CB  1 
ATOM   1130 N  N   . CYS B 2 47  ? -25.482  36.868  -11.919 1.00 30.60  ? 85  CYS A N   1 
ATOM   1131 C  CA  . CYS B 2 47  ? -26.561  37.781  -11.565 1.00 30.43  ? 85  CYS A CA  1 
ATOM   1132 C  C   . CYS B 2 47  ? -27.882  37.009  -11.480 1.00 30.04  ? 85  CYS A C   1 
ATOM   1133 O  O   . CYS B 2 47  ? -28.620  37.134  -10.506 1.00 30.35  ? 85  CYS A O   1 
ATOM   1134 C  CB  . CYS B 2 47  ? -26.674  38.920  -12.584 1.00 30.77  ? 85  CYS A CB  1 
ATOM   1135 S  SG  . CYS B 2 47  ? -25.271  40.055  -12.606 1.00 32.99  ? 85  CYS A SG  1 
ATOM   1136 N  N   . ALA B 2 48  ? -28.156  36.193  -12.491 1.00 29.53  ? 86  ALA A N   1 
ATOM   1137 C  CA  . ALA B 2 48  ? -29.401  35.459  -12.574 1.00 29.70  ? 86  ALA A CA  1 
ATOM   1138 C  C   . ALA B 2 48  ? -29.556  34.507  -11.396 1.00 30.80  ? 86  ALA A C   1 
ATOM   1139 O  O   . ALA B 2 48  ? -30.586  34.489  -10.741 1.00 30.51  ? 86  ALA A O   1 
ATOM   1140 C  CB  . ALA B 2 48  ? -29.472  34.694  -13.888 1.00 29.91  ? 86  ALA A CB  1 
ATOM   1141 N  N   . ASP B 2 49  ? -28.519  33.740  -11.123 1.00 34.02  ? 87  ASP A N   1 
ATOM   1142 C  CA  . ASP B 2 49  ? -28.549  32.758  -10.040 1.00 38.03  ? 87  ASP A CA  1 
ATOM   1143 C  C   . ASP B 2 49  ? -28.614  33.435  -8.669  1.00 38.82  ? 87  ASP A C   1 
ATOM   1144 O  O   . ASP B 2 49  ? -29.240  32.912  -7.753  1.00 38.87  ? 87  ASP A O   1 
ATOM   1145 C  CB  . ASP B 2 49  ? -27.315  31.838  -10.119 1.00 40.95  ? 87  ASP A CB  1 
ATOM   1146 C  CG  . ASP B 2 49  ? -27.276  30.990  -11.407 1.00 43.73  ? 87  ASP A CG  1 
ATOM   1147 O  OD1 . ASP B 2 49  ? -28.359  30.684  -11.975 1.00 44.48  ? 87  ASP A OD1 1 
ATOM   1148 O  OD2 . ASP B 2 49  ? -26.150  30.637  -11.854 1.00 45.49  ? 87  ASP A OD2 1 
ATOM   1149 N  N   . LEU B 2 50  ? -27.973  34.595  -8.543  1.00 38.22  ? 88  LEU A N   1 
ATOM   1150 C  CA  . LEU B 2 50  ? -28.005  35.372  -7.303  1.00 37.80  ? 88  LEU A CA  1 
ATOM   1151 C  C   . LEU B 2 50  ? -29.416  35.834  -6.970  1.00 37.05  ? 88  LEU A C   1 
ATOM   1152 O  O   . LEU B 2 50  ? -29.843  35.735  -5.822  1.00 39.24  ? 88  LEU A O   1 
ATOM   1153 C  CB  . LEU B 2 50  ? -27.064  36.584  -7.387  1.00 38.16  ? 88  LEU A CB  1 
ATOM   1154 C  CG  . LEU B 2 50  ? -27.038  37.548  -6.198  1.00 37.81  ? 88  LEU A CG  1 
ATOM   1155 C  CD1 . LEU B 2 50  ? -26.785  36.833  -4.864  1.00 38.23  ? 88  LEU A CD1 1 
ATOM   1156 C  CD2 . LEU B 2 50  ? -25.994  38.621  -6.446  1.00 36.20  ? 88  LEU A CD2 1 
ATOM   1157 N  N   . VAL B 2 51  ? -30.142  36.322  -7.969  1.00 35.51  ? 89  VAL A N   1 
ATOM   1158 C  CA  . VAL B 2 51  ? -31.526  36.765  -7.761  1.00 34.74  ? 89  VAL A CA  1 
ATOM   1159 C  C   . VAL B 2 51  ? -32.433  35.571  -7.456  1.00 33.80  ? 89  VAL A C   1 
ATOM   1160 O  O   . VAL B 2 51  ? -33.448  35.733  -6.802  1.00 33.14  ? 89  VAL A O   1 
ATOM   1161 C  CB  . VAL B 2 51  ? -32.068  37.584  -8.963  1.00 35.86  ? 89  VAL A CB  1 
ATOM   1162 C  CG1 . VAL B 2 51  ? -33.521  37.987  -8.754  1.00 36.99  ? 89  VAL A CG1 1 
ATOM   1163 C  CG2 . VAL B 2 51  ? -31.234  38.845  -9.179  1.00 36.03  ? 89  VAL A CG2 1 
ATOM   1164 N  N   . VAL B 2 52  ? -32.069  34.384  -7.940  1.00 34.83  ? 90  VAL A N   1 
ATOM   1165 C  CA  . VAL B 2 52  ? -32.755  33.138  -7.568  1.00 36.53  ? 90  VAL A CA  1 
ATOM   1166 C  C   . VAL B 2 52  ? -32.619  32.896  -6.067  1.00 38.72  ? 90  VAL A C   1 
ATOM   1167 O  O   . VAL B 2 52  ? -33.611  32.647  -5.388  1.00 42.09  ? 90  VAL A O   1 
ATOM   1168 C  CB  . VAL B 2 52  ? -32.258  31.904  -8.388  1.00 36.96  ? 90  VAL A CB  1 
ATOM   1169 C  CG1 . VAL B 2 52  ? -32.706  30.576  -7.793  1.00 35.70  ? 90  VAL A CG1 1 
ATOM   1170 C  CG2 . VAL B 2 52  ? -32.756  31.981  -9.821  1.00 39.11  ? 90  VAL A CG2 1 
ATOM   1171 N  N   . GLY B 2 53  ? -31.397  32.987  -5.556  1.00 39.89  ? 91  GLY A N   1 
ATOM   1172 C  CA  . GLY B 2 53  ? -31.130  32.779  -4.125  1.00 40.40  ? 91  GLY A CA  1 
ATOM   1173 C  C   . GLY B 2 53  ? -31.672  33.832  -3.170  1.00 40.96  ? 91  GLY A C   1 
ATOM   1174 O  O   . GLY B 2 53  ? -32.120  33.493  -2.077  1.00 41.18  ? 91  GLY A O   1 
ATOM   1175 N  N   . LEU B 2 54  ? -31.624  35.106  -3.563  1.00 41.72  ? 92  LEU A N   1 
ATOM   1176 C  CA  . LEU B 2 54  ? -32.098  36.198  -2.699  1.00 41.88  ? 92  LEU A CA  1 
ATOM   1177 C  C   . LEU B 2 54  ? -33.608  36.305  -2.625  1.00 42.69  ? 92  LEU A C   1 
ATOM   1178 O  O   . LEU B 2 54  ? -34.129  36.622  -1.574  1.00 45.98  ? 92  LEU A O   1 
ATOM   1179 C  CB  . LEU B 2 54  ? -31.559  37.548  -3.158  1.00 41.77  ? 92  LEU A CB  1 
ATOM   1180 C  CG  . LEU B 2 54  ? -30.052  37.745  -3.066  1.00 44.07  ? 92  LEU A CG  1 
ATOM   1181 C  CD1 . LEU B 2 54  ? -29.704  39.134  -3.566  1.00 45.21  ? 92  LEU A CD1 1 
ATOM   1182 C  CD2 . LEU B 2 54  ? -29.542  37.551  -1.648  1.00 44.47  ? 92  LEU A CD2 1 
ATOM   1183 N  N   . LEU B 2 55  ? -34.306  36.089  -3.736  1.00 42.04  ? 93  LEU A N   1 
ATOM   1184 C  CA  . LEU B 2 55  ? -35.747  36.345  -3.806  1.00 41.85  ? 93  LEU A CA  1 
ATOM   1185 C  C   . LEU B 2 55  ? -36.571  35.116  -4.157  1.00 43.11  ? 93  LEU A C   1 
ATOM   1186 O  O   . LEU B 2 55  ? -37.516  34.796  -3.446  1.00 45.81  ? 93  LEU A O   1 
ATOM   1187 C  CB  . LEU B 2 55  ? -36.036  37.450  -4.816  1.00 41.27  ? 93  LEU A CB  1 
ATOM   1188 C  CG  . LEU B 2 55  ? -35.261  38.748  -4.583  1.00 41.35  ? 93  LEU A CG  1 
ATOM   1189 C  CD1 . LEU B 2 55  ? -35.463  39.703  -5.747  1.00 42.20  ? 93  LEU A CD1 1 
ATOM   1190 C  CD2 . LEU B 2 55  ? -35.684  39.402  -3.282  1.00 41.79  ? 93  LEU A CD2 1 
ATOM   1191 N  N   . VAL B 2 56  ? -36.217  34.415  -5.230  1.00 42.85  ? 94  VAL A N   1 
ATOM   1192 C  CA  . VAL B 2 56  ? -37.069  33.341  -5.748  1.00 43.53  ? 94  VAL A CA  1 
ATOM   1193 C  C   . VAL B 2 56  ? -37.158  32.162  -4.781  1.00 44.46  ? 94  VAL A C   1 
ATOM   1194 O  O   . VAL B 2 56  ? -38.253  31.694  -4.464  1.00 44.39  ? 94  VAL A O   1 
ATOM   1195 C  CB  . VAL B 2 56  ? -36.607  32.852  -7.137  1.00 42.98  ? 94  VAL A CB  1 
ATOM   1196 C  CG1 . VAL B 2 56  ? -37.375  31.600  -7.589  1.00 42.62  ? 94  VAL A CG1 1 
ATOM   1197 C  CG2 . VAL B 2 56  ? -36.764  33.973  -8.151  1.00 43.73  ? 94  VAL A CG2 1 
ATOM   1198 N  N   . VAL B 2 57  ? -36.012  31.684  -4.318  1.00 44.36  ? 95  VAL A N   1 
ATOM   1199 C  CA  . VAL B 2 57  ? -35.995  30.495  -3.469  1.00 44.91  ? 95  VAL A CA  1 
ATOM   1200 C  C   . VAL B 2 57  ? -36.562  30.740  -2.054  1.00 44.99  ? 95  VAL A C   1 
ATOM   1201 O  O   . VAL B 2 57  ? -37.288  29.882  -1.559  1.00 45.89  ? 95  VAL A O   1 
ATOM   1202 C  CB  . VAL B 2 57  ? -34.600  29.829  -3.449  1.00 44.07  ? 95  VAL A CB  1 
ATOM   1203 C  CG1 . VAL B 2 57  ? -34.556  28.672  -2.476  1.00 43.78  ? 95  VAL A CG1 1 
ATOM   1204 C  CG2 . VAL B 2 57  ? -34.268  29.313  -4.838  1.00 43.91  ? 95  VAL A CG2 1 
ATOM   1205 N  N   . PRO B 2 58  ? -36.246  31.894  -1.409  1.00 44.08  ? 96  PRO A N   1 
ATOM   1206 C  CA  . PRO B 2 58  ? -36.803  32.207  -0.077  1.00 43.37  ? 96  PRO A CA  1 
ATOM   1207 C  C   . PRO B 2 58  ? -38.333  32.260  0.003   1.00 43.58  ? 96  PRO A C   1 
ATOM   1208 O  O   . PRO B 2 58  ? -38.925  31.589  0.863   1.00 42.17  ? 96  PRO A O   1 
ATOM   1209 C  CB  . PRO B 2 58  ? -36.196  33.573  0.229   1.00 43.48  ? 96  PRO A CB  1 
ATOM   1210 C  CG  . PRO B 2 58  ? -34.876  33.518  -0.446  1.00 43.01  ? 96  PRO A CG  1 
ATOM   1211 C  CD  . PRO B 2 58  ? -35.162  32.838  -1.750  1.00 43.35  ? 96  PRO A CD  1 
ATOM   1212 N  N   . PHE B 2 59  ? -38.951  33.013  -0.910  1.00 45.34  ? 97  PHE A N   1 
ATOM   1213 C  CA  . PHE B 2 59  ? -40.418  33.050  -1.062  1.00 45.07  ? 97  PHE A CA  1 
ATOM   1214 C  C   . PHE B 2 59  ? -40.944  31.654  -1.383  1.00 43.96  ? 97  PHE A C   1 
ATOM   1215 O  O   . PHE B 2 59  ? -42.006  31.279  -0.933  1.00 45.66  ? 97  PHE A O   1 
ATOM   1216 C  CB  . PHE B 2 59  ? -40.845  34.011  -2.185  1.00 45.92  ? 97  PHE A CB  1 
ATOM   1217 C  CG  . PHE B 2 59  ? -40.856  35.480  -1.793  1.00 48.16  ? 97  PHE A CG  1 
ATOM   1218 C  CD1 . PHE B 2 59  ? -39.673  36.164  -1.493  1.00 47.87  ? 97  PHE A CD1 1 
ATOM   1219 C  CD2 . PHE B 2 59  ? -42.050  36.201  -1.789  1.00 51.00  ? 97  PHE A CD2 1 
ATOM   1220 C  CE1 . PHE B 2 59  ? -39.686  37.511  -1.168  1.00 47.57  ? 97  PHE A CE1 1 
ATOM   1221 C  CE2 . PHE B 2 59  ? -42.066  37.553  -1.467  1.00 51.56  ? 97  PHE A CE2 1 
ATOM   1222 C  CZ  . PHE B 2 59  ? -40.877  38.206  -1.162  1.00 50.40  ? 97  PHE A CZ  1 
ATOM   1223 N  N   . GLY B 2 60  ? -40.193  30.893  -2.167  1.00 47.35  ? 98  GLY A N   1 
ATOM   1224 C  CA  . GLY B 2 60  ? -40.494  29.490  -2.401  1.00 50.02  ? 98  GLY A CA  1 
ATOM   1225 C  C   . GLY B 2 60  ? -40.463  28.651  -1.136  1.00 52.32  ? 98  GLY A C   1 
ATOM   1226 O  O   . GLY B 2 60  ? -41.390  27.881  -0.887  1.00 54.14  ? 98  GLY A O   1 
ATOM   1227 N  N   . ALA B 2 61  ? -39.404  28.805  -0.335  1.00 53.17  ? 99  ALA A N   1 
ATOM   1228 C  CA  . ALA B 2 61  ? -39.203  27.997  0.884   1.00 53.45  ? 99  ALA A CA  1 
ATOM   1229 C  C   . ALA B 2 61  ? -40.357  28.121  1.872   1.00 55.87  ? 99  ALA A C   1 
ATOM   1230 O  O   . ALA B 2 61  ? -40.689  27.150  2.569   1.00 57.06  ? 99  ALA A O   1 
ATOM   1231 C  CB  . ALA B 2 61  ? -37.895  28.362  1.570   1.00 51.07  ? 99  ALA A CB  1 
ATOM   1232 N  N   . THR B 2 62  ? -40.959  29.312  1.922   1.00 55.41  ? 100 THR A N   1 
ATOM   1233 C  CA  . THR B 2 62  ? -42.072  29.587  2.828   1.00 56.00  ? 100 THR A CA  1 
ATOM   1234 C  C   . THR B 2 62  ? -43.326  28.844  2.403   1.00 55.62  ? 100 THR A C   1 
ATOM   1235 O  O   . THR B 2 62  ? -44.017  28.261  3.235   1.00 60.88  ? 100 THR A O   1 
ATOM   1236 C  CB  . THR B 2 62  ? -42.414  31.087  2.898   1.00 55.12  ? 100 THR A CB  1 
ATOM   1237 O  OG1 . THR B 2 62  ? -42.783  31.552  1.596   1.00 54.76  ? 100 THR A OG1 1 
ATOM   1238 C  CG2 . THR B 2 62  ? -41.228  31.896  3.457   1.00 53.62  ? 100 THR A CG2 1 
ATOM   1239 N  N   . LEU B 2 63  ? -43.613  28.870  1.107   1.00 54.49  ? 101 LEU A N   1 
ATOM   1240 C  CA  . LEU B 2 63  ? -44.781  28.182  0.557   1.00 56.12  ? 101 LEU A CA  1 
ATOM   1241 C  C   . LEU B 2 63  ? -44.782  26.667  0.857   1.00 58.12  ? 101 LEU A C   1 
ATOM   1242 O  O   . LEU B 2 63  ? -45.848  26.055  0.925   1.00 57.59  ? 101 LEU A O   1 
ATOM   1243 C  CB  . LEU B 2 63  ? -44.874  28.462  -0.950  1.00 55.30  ? 101 LEU A CB  1 
ATOM   1244 C  CG  . LEU B 2 63  ? -46.117  28.047  -1.733  1.00 54.46  ? 101 LEU A CG  1 
ATOM   1245 C  CD1 . LEU B 2 63  ? -47.397  28.606  -1.129  1.00 54.92  ? 101 LEU A CD1 1 
ATOM   1246 C  CD2 . LEU B 2 63  ? -45.965  28.512  -3.174  1.00 54.31  ? 101 LEU A CD2 1 
ATOM   1247 N  N   . VAL B 2 64  ? -43.601  26.076  1.054   1.00 63.01  ? 102 VAL A N   1 
ATOM   1248 C  CA  . VAL B 2 64  ? -43.491  24.672  1.484   1.00 68.79  ? 102 VAL A CA  1 
ATOM   1249 C  C   . VAL B 2 64  ? -43.770  24.540  2.976   1.00 71.78  ? 102 VAL A C   1 
ATOM   1250 O  O   . VAL B 2 64  ? -44.494  23.635  3.391   1.00 73.67  ? 102 VAL A O   1 
ATOM   1251 C  CB  . VAL B 2 64  ? -42.092  24.056  1.206   1.00 71.36  ? 102 VAL A CB  1 
ATOM   1252 C  CG1 . VAL B 2 64  ? -42.084  22.574  1.582   1.00 72.02  ? 102 VAL A CG1 1 
ATOM   1253 C  CG2 . VAL B 2 64  ? -41.695  24.232  -0.253  1.00 71.66  ? 102 VAL A CG2 1 
ATOM   1254 N  N   . VAL B 2 65  ? -43.175  25.434  3.768   1.00 76.27  ? 103 VAL A N   1 
ATOM   1255 C  CA  . VAL B 2 65  ? -43.277  25.404  5.241   1.00 77.59  ? 103 VAL A CA  1 
ATOM   1256 C  C   . VAL B 2 65  ? -44.710  25.697  5.714   1.00 78.68  ? 103 VAL A C   1 
ATOM   1257 O  O   . VAL B 2 65  ? -45.288  24.922  6.479   1.00 82.74  ? 103 VAL A O   1 
ATOM   1258 C  CB  . VAL B 2 65  ? -42.278  26.399  5.903   1.00 75.74  ? 103 VAL A CB  1 
ATOM   1259 C  CG1 . VAL B 2 65  ? -42.498  26.498  7.411   1.00 74.67  ? 103 VAL A CG1 1 
ATOM   1260 C  CG2 . VAL B 2 65  ? -40.830  26.005  5.603   1.00 76.30  ? 103 VAL A CG2 1 
ATOM   1261 N  N   . ARG B 2 66  ? -45.267  26.816  5.253   1.00 78.61  ? 104 ARG A N   1 
ATOM   1262 C  CA  . ARG B 2 66  ? -46.627  27.237  5.617   1.00 76.96  ? 104 ARG A CA  1 
ATOM   1263 C  C   . ARG B 2 66  ? -47.726  26.478  4.883   1.00 69.52  ? 104 ARG A C   1 
ATOM   1264 O  O   . ARG B 2 66  ? -48.831  26.349  5.399   1.00 70.61  ? 104 ARG A O   1 
ATOM   1265 C  CB  . ARG B 2 66  ? -46.799  28.755  5.385   1.00 82.01  ? 104 ARG A CB  1 
ATOM   1266 C  CG  . ARG B 2 66  ? -45.835  29.623  6.192   1.00 89.20  ? 104 ARG A CG  1 
ATOM   1267 C  CD  . ARG B 2 66  ? -46.134  29.512  7.698   1.00 94.71  ? 104 ARG A CD  1 
ATOM   1268 N  NE  . ARG B 2 66  ? -45.328  30.391  8.558   1.00 98.92  ? 104 ARG A NE  1 
ATOM   1269 C  CZ  . ARG B 2 66  ? -45.722  31.538  9.139   1.00 99.79  ? 104 ARG A CZ  1 
ATOM   1270 N  NH1 . ARG B 2 66  ? -46.948  32.039  8.973   1.00 99.98  ? 104 ARG A NH1 1 
ATOM   1271 N  NH2 . ARG B 2 66  ? -44.860  32.213  9.896   1.00 100.66 ? 104 ARG A NH2 1 
ATOM   1272 N  N   . GLY B 2 67  ? -47.434  25.998  3.679   1.00 63.23  ? 105 GLY A N   1 
ATOM   1273 C  CA  . GLY B 2 67  ? -48.453  25.401  2.824   1.00 60.41  ? 105 GLY A CA  1 
ATOM   1274 C  C   . GLY B 2 67  ? -49.471  26.400  2.285   1.00 59.02  ? 105 GLY A C   1 
ATOM   1275 O  O   . GLY B 2 67  ? -50.571  26.006  1.911   1.00 59.65  ? 105 GLY A O   1 
ATOM   1276 N  N   . THR B 2 68  ? -49.115  27.686  2.241   1.00 59.89  ? 106 THR A N   1 
ATOM   1277 C  CA  . THR B 2 68  ? -49.981  28.722  1.657   1.00 59.34  ? 106 THR A CA  1 
ATOM   1278 C  C   . THR B 2 68  ? -49.221  30.038  1.404   1.00 58.95  ? 106 THR A C   1 
ATOM   1279 O  O   . THR B 2 68  ? -48.203  30.327  2.051   1.00 58.89  ? 106 THR A O   1 
ATOM   1280 C  CB  . THR B 2 68  ? -51.231  28.998  2.528   1.00 59.25  ? 106 THR A CB  1 
ATOM   1281 O  OG1 . THR B 2 68  ? -52.098  29.924  1.854   1.00 59.34  ? 106 THR A OG1 1 
ATOM   1282 C  CG2 . THR B 2 68  ? -50.835  29.556  3.910   1.00 61.12  ? 106 THR A CG2 1 
ATOM   1283 N  N   . TRP B 2 69  ? -49.734  30.820  0.458   1.00 59.05  ? 107 TRP A N   1 
ATOM   1284 C  CA  . TRP B 2 69  ? -49.112  32.074  0.051   1.00 60.17  ? 107 TRP A CA  1 
ATOM   1285 C  C   . TRP B 2 69  ? -49.524  33.200  0.988   1.00 58.78  ? 107 TRP A C   1 
ATOM   1286 O  O   . TRP B 2 69  ? -50.698  33.591  1.007   1.00 54.68  ? 107 TRP A O   1 
ATOM   1287 C  CB  . TRP B 2 69  ? -49.491  32.421  -1.395  1.00 61.27  ? 107 TRP A CB  1 
ATOM   1288 C  CG  . TRP B 2 69  ? -48.665  33.538  -1.957  1.00 61.51  ? 107 TRP A CG  1 
ATOM   1289 C  CD1 . TRP B 2 69  ? -49.075  34.812  -2.227  1.00 61.99  ? 107 TRP A CD1 1 
ATOM   1290 C  CD2 . TRP B 2 69  ? -47.274  33.484  -2.292  1.00 60.17  ? 107 TRP A CD2 1 
ATOM   1291 N  NE1 . TRP B 2 69  ? -48.024  35.559  -2.723  1.00 60.81  ? 107 TRP A NE1 1 
ATOM   1292 C  CE2 . TRP B 2 69  ? -46.909  34.768  -2.773  1.00 59.05  ? 107 TRP A CE2 1 
ATOM   1293 C  CE3 . TRP B 2 69  ? -46.303  32.474  -2.238  1.00 58.53  ? 107 TRP A CE3 1 
ATOM   1294 C  CZ2 . TRP B 2 69  ? -45.619  35.068  -3.193  1.00 59.71  ? 107 TRP A CZ2 1 
ATOM   1295 C  CZ3 . TRP B 2 69  ? -45.023  32.769  -2.651  1.00 59.83  ? 107 TRP A CZ3 1 
ATOM   1296 C  CH2 . TRP B 2 69  ? -44.689  34.061  -3.123  1.00 62.17  ? 107 TRP A CH2 1 
ATOM   1297 N  N   . LEU B 2 70  ? -48.547  33.727  1.735   1.00 60.03  ? 108 LEU A N   1 
ATOM   1298 C  CA  . LEU B 2 70  ? -48.812  34.732  2.760   1.00 62.20  ? 108 LEU A CA  1 
ATOM   1299 C  C   . LEU B 2 70  ? -48.740  36.188  2.285   1.00 64.88  ? 108 LEU A C   1 
ATOM   1300 O  O   . LEU B 2 70  ? -49.011  37.081  3.091   1.00 70.52  ? 108 LEU A O   1 
ATOM   1301 C  CB  . LEU B 2 70  ? -47.847  34.563  3.941   1.00 61.96  ? 108 LEU A CB  1 
ATOM   1302 C  CG  . LEU B 2 70  ? -47.630  33.151  4.518   1.00 61.79  ? 108 LEU A CG  1 
ATOM   1303 C  CD1 . LEU B 2 70  ? -46.648  33.188  5.688   1.00 62.07  ? 108 LEU A CD1 1 
ATOM   1304 C  CD2 . LEU B 2 70  ? -48.930  32.477  4.940   1.00 60.58  ? 108 LEU A CD2 1 
ATOM   1305 N  N   . TRP B 2 71  ? -48.394  36.441  1.016   1.00 64.72  ? 109 TRP A N   1 
ATOM   1306 C  CA  . TRP B 2 71  ? -48.127  37.823  0.537   1.00 66.63  ? 109 TRP A CA  1 
ATOM   1307 C  C   . TRP B 2 71  ? -49.055  38.360  -0.568  1.00 66.70  ? 109 TRP A C   1 
ATOM   1308 O  O   . TRP B 2 71  ? -48.715  39.328  -1.260  1.00 65.05  ? 109 TRP A O   1 
ATOM   1309 C  CB  . TRP B 2 71  ? -46.652  37.963  0.126   1.00 68.42  ? 109 TRP A CB  1 
ATOM   1310 C  CG  . TRP B 2 71  ? -45.738  37.641  1.244   1.00 69.12  ? 109 TRP A CG  1 
ATOM   1311 C  CD1 . TRP B 2 71  ? -45.290  38.492  2.211   1.00 68.38  ? 109 TRP A CD1 1 
ATOM   1312 C  CD2 . TRP B 2 71  ? -45.196  36.361  1.550   1.00 67.55  ? 109 TRP A CD2 1 
ATOM   1313 N  NE1 . TRP B 2 71  ? -44.462  37.827  3.084   1.00 66.35  ? 109 TRP A NE1 1 
ATOM   1314 C  CE2 . TRP B 2 71  ? -44.404  36.510  2.710   1.00 67.41  ? 109 TRP A CE2 1 
ATOM   1315 C  CE3 . TRP B 2 71  ? -45.287  35.102  0.945   1.00 66.18  ? 109 TRP A CE3 1 
ATOM   1316 C  CZ2 . TRP B 2 71  ? -43.700  35.455  3.266   1.00 67.97  ? 109 TRP A CZ2 1 
ATOM   1317 C  CZ3 . TRP B 2 71  ? -44.608  34.053  1.504   1.00 65.47  ? 109 TRP A CZ3 1 
ATOM   1318 C  CH2 . TRP B 2 71  ? -43.817  34.236  2.658   1.00 67.35  ? 109 TRP A CH2 1 
ATOM   1319 N  N   . GLY B 2 72  ? -50.232  37.757  -0.715  1.00 67.64  ? 110 GLY A N   1 
ATOM   1320 C  CA  . GLY B 2 72  ? -51.267  38.301  -1.605  1.00 69.64  ? 110 GLY A CA  1 
ATOM   1321 C  C   . GLY B 2 72  ? -51.030  38.111  -3.094  1.00 69.40  ? 110 GLY A C   1 
ATOM   1322 O  O   . GLY B 2 72  ? -49.902  37.935  -3.539  1.00 71.97  ? 110 GLY A O   1 
ATOM   1323 N  N   . SER B 2 73  ? -52.112  38.180  -3.859  1.00 71.12  ? 111 SER A N   1 
ATOM   1324 C  CA  . SER B 2 73  ? -52.114  37.799  -5.275  1.00 71.82  ? 111 SER A CA  1 
ATOM   1325 C  C   . SER B 2 73  ? -51.103  38.529  -6.160  1.00 68.47  ? 111 SER A C   1 
ATOM   1326 O  O   . SER B 2 73  ? -50.603  37.946  -7.122  1.00 69.15  ? 111 SER A O   1 
ATOM   1327 C  CB  . SER B 2 73  ? -53.513  37.980  -5.874  1.00 73.35  ? 111 SER A CB  1 
ATOM   1328 O  OG  . SER B 2 73  ? -54.403  37.034  -5.339  1.00 73.87  ? 111 SER A OG  1 
ATOM   1329 N  N   . PHE B 2 74  ? -50.813  39.792  -5.850  1.00 62.42  ? 112 PHE A N   1 
ATOM   1330 C  CA  . PHE B 2 74  ? -49.892  40.566  -6.674  1.00 58.90  ? 112 PHE A CA  1 
ATOM   1331 C  C   . PHE B 2 74  ? -48.467  40.026  -6.547  1.00 60.13  ? 112 PHE A C   1 
ATOM   1332 O  O   . PHE B 2 74  ? -47.819  39.714  -7.552  1.00 62.28  ? 112 PHE A O   1 
ATOM   1333 C  CB  . PHE B 2 74  ? -49.922  42.044  -6.306  1.00 55.46  ? 112 PHE A CB  1 
ATOM   1334 C  CG  . PHE B 2 74  ? -49.000  42.883  -7.137  1.00 54.10  ? 112 PHE A CG  1 
ATOM   1335 C  CD1 . PHE B 2 74  ? -49.428  43.423  -8.340  1.00 54.46  ? 112 PHE A CD1 1 
ATOM   1336 C  CD2 . PHE B 2 74  ? -47.694  43.120  -6.725  1.00 54.71  ? 112 PHE A CD2 1 
ATOM   1337 C  CE1 . PHE B 2 74  ? -48.571  44.198  -9.115  1.00 54.98  ? 112 PHE A CE1 1 
ATOM   1338 C  CE2 . PHE B 2 74  ? -46.827  43.882  -7.499  1.00 55.05  ? 112 PHE A CE2 1 
ATOM   1339 C  CZ  . PHE B 2 74  ? -47.269  44.428  -8.692  1.00 54.45  ? 112 PHE A CZ  1 
ATOM   1340 N  N   . LEU B 2 75  ? -47.987  39.919  -5.312  1.00 59.14  ? 113 LEU A N   1 
ATOM   1341 C  CA  . LEU B 2 75  ? -46.651  39.382  -5.076  1.00 58.83  ? 113 LEU A CA  1 
ATOM   1342 C  C   . LEU B 2 75  ? -46.511  37.917  -5.487  1.00 54.85  ? 113 LEU A C   1 
ATOM   1343 O  O   . LEU B 2 75  ? -45.394  37.477  -5.739  1.00 57.22  ? 113 LEU A O   1 
ATOM   1344 C  CB  . LEU B 2 75  ? -46.214  39.560  -3.622  1.00 62.52  ? 113 LEU A CB  1 
ATOM   1345 C  CG  . LEU B 2 75  ? -46.012  40.993  -3.099  1.00 63.92  ? 113 LEU A CG  1 
ATOM   1346 C  CD1 . LEU B 2 75  ? -45.406  40.960  -1.694  1.00 64.38  ? 113 LEU A CD1 1 
ATOM   1347 C  CD2 . LEU B 2 75  ? -45.159  41.845  -4.036  1.00 63.55  ? 113 LEU A CD2 1 
ATOM   1348 N  N   . CYS B 2 76  ? -47.615  37.173  -5.556  1.00 48.86  ? 114 CYS A N   1 
ATOM   1349 C  CA  . CYS B 2 76  ? -47.584  35.853  -6.179  1.00 47.64  ? 114 CYS A CA  1 
ATOM   1350 C  C   . CYS B 2 76  ? -47.244  36.024  -7.650  1.00 48.56  ? 114 CYS A C   1 
ATOM   1351 O  O   . CYS B 2 76  ? -46.259  35.462  -8.128  1.00 50.73  ? 114 CYS A O   1 
ATOM   1352 C  CB  . CYS B 2 76  ? -48.910  35.103  -6.021  1.00 46.67  ? 114 CYS A CB  1 
ATOM   1353 S  SG  . CYS B 2 76  ? -49.033  33.568  -6.965  1.00 43.78  ? 114 CYS A SG  1 
ATOM   1354 N  N   . GLU B 2 77  ? -48.046  36.822  -8.352  1.00 50.09  ? 115 GLU A N   1 
ATOM   1355 C  CA  . GLU B 2 77  ? -47.828  37.065  -9.788  1.00 51.53  ? 115 GLU A CA  1 
ATOM   1356 C  C   . GLU B 2 77  ? -46.389  37.516  -10.088 1.00 49.47  ? 115 GLU A C   1 
ATOM   1357 O  O   . GLU B 2 77  ? -45.753  37.026  -11.030 1.00 49.24  ? 115 GLU A O   1 
ATOM   1358 C  CB  . GLU B 2 77  ? -48.832  38.087  -10.360 1.00 52.75  ? 115 GLU A CB  1 
ATOM   1359 C  CG  . GLU B 2 77  ? -50.179  37.500  -10.767 1.00 55.33  ? 115 GLU A CG  1 
ATOM   1360 C  CD  . GLU B 2 77  ? -50.956  38.405  -11.718 1.00 58.33  ? 115 GLU A CD  1 
ATOM   1361 O  OE1 . GLU B 2 77  ? -50.831  39.646  -11.577 1.00 58.90  ? 115 GLU A OE1 1 
ATOM   1362 O  OE2 . GLU B 2 77  ? -51.708  37.873  -12.581 1.00 57.43  ? 115 GLU A OE2 1 
ATOM   1363 N  N   . LEU B 2 78  ? -45.880  38.425  -9.264  1.00 46.99  ? 116 LEU A N   1 
ATOM   1364 C  CA  . LEU B 2 78  ? -44.564  38.989  -9.484  1.00 45.69  ? 116 LEU A CA  1 
ATOM   1365 C  C   . LEU B 2 78  ? -43.469  37.945  -9.220  1.00 42.20  ? 116 LEU A C   1 
ATOM   1366 O  O   . LEU B 2 78  ? -42.579  37.742  -10.045 1.00 38.90  ? 116 LEU A O   1 
ATOM   1367 C  CB  . LEU B 2 78  ? -44.394  40.225  -8.612  1.00 47.98  ? 116 LEU A CB  1 
ATOM   1368 C  CG  . LEU B 2 78  ? -43.212  41.136  -8.944  1.00 51.04  ? 116 LEU A CG  1 
ATOM   1369 C  CD1 . LEU B 2 78  ? -43.653  42.597  -8.847  1.00 51.47  ? 116 LEU A CD1 1 
ATOM   1370 C  CD2 . LEU B 2 78  ? -42.004  40.824  -8.049  1.00 53.16  ? 116 LEU A CD2 1 
ATOM   1371 N  N   . TRP B 2 79  ? -43.559  37.273  -8.080  1.00 40.90  ? 117 TRP A N   1 
ATOM   1372 C  CA  . TRP B 2 79  ? -42.636  36.186  -7.744  1.00 40.52  ? 117 TRP A CA  1 
ATOM   1373 C  C   . TRP B 2 79  ? -42.592  35.119  -8.834  1.00 41.90  ? 117 TRP A C   1 
ATOM   1374 O  O   . TRP B 2 79  ? -41.528  34.615  -9.152  1.00 44.22  ? 117 TRP A O   1 
ATOM   1375 C  CB  . TRP B 2 79  ? -43.041  35.551  -6.410  1.00 38.29  ? 117 TRP A CB  1 
ATOM   1376 C  CG  . TRP B 2 79  ? -42.290  34.331  -6.027  1.00 34.97  ? 117 TRP A CG  1 
ATOM   1377 C  CD1 . TRP B 2 79  ? -41.006  34.273  -5.608  1.00 34.21  ? 117 TRP A CD1 1 
ATOM   1378 C  CD2 . TRP B 2 79  ? -42.789  32.988  -5.997  1.00 33.15  ? 117 TRP A CD2 1 
ATOM   1379 N  NE1 . TRP B 2 79  ? -40.657  32.976  -5.328  1.00 33.76  ? 117 TRP A NE1 1 
ATOM   1380 C  CE2 . TRP B 2 79  ? -41.731  32.164  -5.557  1.00 33.13  ? 117 TRP A CE2 1 
ATOM   1381 C  CE3 . TRP B 2 79  ? -44.025  32.402  -6.304  1.00 32.67  ? 117 TRP A CE3 1 
ATOM   1382 C  CZ2 . TRP B 2 79  ? -41.859  30.772  -5.421  1.00 33.57  ? 117 TRP A CZ2 1 
ATOM   1383 C  CZ3 . TRP B 2 79  ? -44.162  31.017  -6.163  1.00 34.03  ? 117 TRP A CZ3 1 
ATOM   1384 C  CH2 . TRP B 2 79  ? -43.078  30.217  -5.719  1.00 34.25  ? 117 TRP A CH2 1 
ATOM   1385 N  N   . THR B 2 80  ? -43.747  34.778  -9.398  1.00 43.55  ? 118 THR A N   1 
ATOM   1386 C  CA  . THR B 2 80  ? -43.819  33.822  -10.509 1.00 43.76  ? 118 THR A CA  1 
ATOM   1387 C  C   . THR B 2 80  ? -43.067  34.365  -11.728 1.00 41.46  ? 118 THR A C   1 
ATOM   1388 O  O   . THR B 2 80  ? -42.254  33.656  -12.325 1.00 41.14  ? 118 THR A O   1 
ATOM   1389 C  CB  . THR B 2 80  ? -45.290  33.482  -10.860 1.00 44.98  ? 118 THR A CB  1 
ATOM   1390 O  OG1 . THR B 2 80  ? -45.932  32.927  -9.706  1.00 46.59  ? 118 THR A OG1 1 
ATOM   1391 C  CG2 . THR B 2 80  ? -45.410  32.468  -12.001 1.00 45.92  ? 118 THR A CG2 1 
ATOM   1392 N  N   . SER B 2 81  ? -43.326  35.622  -12.074 1.00 38.96  ? 119 SER A N   1 
ATOM   1393 C  CA  . SER B 2 81  ? -42.605  36.271  -13.173 1.00 38.35  ? 119 SER A CA  1 
ATOM   1394 C  C   . SER B 2 81  ? -41.091  36.364  -12.933 1.00 37.07  ? 119 SER A C   1 
ATOM   1395 O  O   . SER B 2 81  ? -40.297  36.151  -13.843 1.00 36.18  ? 119 SER A O   1 
ATOM   1396 C  CB  . SER B 2 81  ? -43.153  37.669  -13.438 1.00 38.33  ? 119 SER A CB  1 
ATOM   1397 O  OG  . SER B 2 81  ? -44.497  37.614  -13.851 1.00 39.21  ? 119 SER A OG  1 
ATOM   1398 N  N   . LEU B 2 82  ? -40.708  36.684  -11.704 1.00 36.64  ? 120 LEU A N   1 
ATOM   1399 C  CA  . LEU B 2 82  ? -39.300  36.773  -11.336 1.00 35.78  ? 120 LEU A CA  1 
ATOM   1400 C  C   . LEU B 2 82  ? -38.610  35.416  -11.419 1.00 34.12  ? 120 LEU A C   1 
ATOM   1401 O  O   . LEU B 2 82  ? -37.440  35.336  -11.803 1.00 34.71  ? 120 LEU A O   1 
ATOM   1402 C  CB  . LEU B 2 82  ? -39.154  37.337  -9.926  1.00 36.84  ? 120 LEU A CB  1 
ATOM   1403 C  CG  . LEU B 2 82  ? -37.780  37.930  -9.639  1.00 38.45  ? 120 LEU A CG  1 
ATOM   1404 C  CD1 . LEU B 2 82  ? -37.729  39.377  -10.115 1.00 39.08  ? 120 LEU A CD1 1 
ATOM   1405 C  CD2 . LEU B 2 82  ? -37.450  37.841  -8.158  1.00 39.27  ? 120 LEU A CD2 1 
ATOM   1406 N  N   . ASP B 2 83  ? -39.331  34.359  -11.048 1.00 32.74  ? 121 ASP A N   1 
ATOM   1407 C  CA  . ASP B 2 83  ? -38.804  33.004  -11.138 1.00 33.17  ? 121 ASP A CA  1 
ATOM   1408 C  C   . ASP B 2 83  ? -38.554  32.653  -12.589 1.00 33.47  ? 121 ASP A C   1 
ATOM   1409 O  O   . ASP B 2 83  ? -37.438  32.283  -12.960 1.00 35.29  ? 121 ASP A O   1 
ATOM   1410 C  CB  . ASP B 2 83  ? -39.778  31.994  -10.534 1.00 33.91  ? 121 ASP A CB  1 
ATOM   1411 C  CG  . ASP B 2 83  ? -39.229  30.558  -10.511 1.00 34.72  ? 121 ASP A CG  1 
ATOM   1412 O  OD1 . ASP B 2 83  ? -38.191  30.247  -11.126 1.00 34.87  ? 121 ASP A OD1 1 
ATOM   1413 O  OD2 . ASP B 2 83  ? -39.865  29.712  -9.863  1.00 37.04  ? 121 ASP A OD2 1 
ATOM   1414 N  N   . VAL B 2 84  ? -39.590  32.782  -13.409 1.00 32.38  ? 122 VAL A N   1 
ATOM   1415 C  CA  . VAL B 2 84  ? -39.477  32.385  -14.802 1.00 31.06  ? 122 VAL A CA  1 
ATOM   1416 C  C   . VAL B 2 84  ? -38.334  33.161  -15.481 1.00 30.82  ? 122 VAL A C   1 
ATOM   1417 O  O   . VAL B 2 84  ? -37.479  32.550  -16.124 1.00 31.07  ? 122 VAL A O   1 
ATOM   1418 C  CB  . VAL B 2 84  ? -40.825  32.514  -15.528 1.00 30.71  ? 122 VAL A CB  1 
ATOM   1419 C  CG1 . VAL B 2 84  ? -40.669  32.298  -17.029 1.00 31.08  ? 122 VAL A CG1 1 
ATOM   1420 C  CG2 . VAL B 2 84  ? -41.801  31.491  -14.967 1.00 30.23  ? 122 VAL A CG2 1 
ATOM   1421 N  N   . LEU B 2 85  ? -38.296  34.482  -15.273 1.00 30.16  ? 123 LEU A N   1 
ATOM   1422 C  CA  . LEU B 2 85  ? -37.227  35.346  -15.801 1.00 29.61  ? 123 LEU A CA  1 
ATOM   1423 C  C   . LEU B 2 85  ? -35.845  34.836  -15.440 1.00 29.55  ? 123 LEU A C   1 
ATOM   1424 O  O   . LEU B 2 85  ? -35.026  34.611  -16.323 1.00 29.75  ? 123 LEU A O   1 
ATOM   1425 C  CB  . LEU B 2 85  ? -37.371  36.789  -15.296 1.00 29.04  ? 123 LEU A CB  1 
ATOM   1426 C  CG  . LEU B 2 85  ? -36.356  37.825  -15.836 1.00 28.49  ? 123 LEU A CG  1 
ATOM   1427 C  CD1 . LEU B 2 85  ? -36.992  39.128  -16.285 1.00 28.63  ? 123 LEU A CD1 1 
ATOM   1428 C  CD2 . LEU B 2 85  ? -35.294  38.127  -14.801 1.00 28.33  ? 123 LEU A CD2 1 
ATOM   1429 N  N   . CYS B 2 86  ? -35.593  34.643  -14.149 1.00 30.15  ? 124 CYS A N   1 
ATOM   1430 C  CA  . CYS B 2 86  ? -34.244  34.270  -13.694 1.00 31.69  ? 124 CYS A CA  1 
ATOM   1431 C  C   . CYS B 2 86  ? -33.786  32.888  -14.171 1.00 30.32  ? 124 CYS A C   1 
ATOM   1432 O  O   . CYS B 2 86  ? -32.606  32.697  -14.481 1.00 29.54  ? 124 CYS A O   1 
ATOM   1433 C  CB  . CYS B 2 86  ? -34.137  34.372  -12.174 1.00 33.59  ? 124 CYS A CB  1 
ATOM   1434 S  SG  . CYS B 2 86  ? -34.100  36.077  -11.573 1.00 36.35  ? 124 CYS A SG  1 
ATOM   1435 N  N   . VAL B 2 87  ? -34.719  31.939  -14.236 1.00 28.13  ? 125 VAL A N   1 
ATOM   1436 C  CA  . VAL B 2 87  ? -34.424  30.601  -14.721 1.00 26.38  ? 125 VAL A CA  1 
ATOM   1437 C  C   . VAL B 2 87  ? -34.127  30.659  -16.215 1.00 25.59  ? 125 VAL A C   1 
ATOM   1438 O  O   . VAL B 2 87  ? -33.150  30.080  -16.675 1.00 24.95  ? 125 VAL A O   1 
ATOM   1439 C  CB  . VAL B 2 87  ? -35.570  29.612  -14.396 1.00 25.77  ? 125 VAL A CB  1 
ATOM   1440 C  CG1 . VAL B 2 87  ? -35.471  28.324  -15.201 1.00 25.83  ? 125 VAL A CG1 1 
ATOM   1441 C  CG2 . VAL B 2 87  ? -35.549  29.289  -12.914 1.00 26.01  ? 125 VAL A CG2 1 
ATOM   1442 N  N   . THR B 2 88  ? -34.966  31.364  -16.962 1.00 25.11  ? 126 THR A N   1 
ATOM   1443 C  CA  . THR B 2 88  ? -34.753  31.522  -18.399 1.00 25.12  ? 126 THR A CA  1 
ATOM   1444 C  C   . THR B 2 88  ? -33.420  32.212  -18.712 1.00 24.50  ? 126 THR A C   1 
ATOM   1445 O  O   . THR B 2 88  ? -32.698  31.787  -19.609 1.00 24.66  ? 126 THR A O   1 
ATOM   1446 C  CB  . THR B 2 88  ? -35.897  32.323  -19.038 1.00 25.68  ? 126 THR A CB  1 
ATOM   1447 O  OG1 . THR B 2 88  ? -37.129  31.624  -18.815 1.00 25.43  ? 126 THR A OG1 1 
ATOM   1448 C  CG2 . THR B 2 88  ? -35.685  32.513  -20.547 1.00 25.94  ? 126 THR A CG2 1 
ATOM   1449 N  N   . ALA B 2 89  ? -33.101  33.271  -17.975 1.00 24.02  ? 127 ALA A N   1 
ATOM   1450 C  CA  . ALA B 2 89  ? -31.827  33.978  -18.148 1.00 23.87  ? 127 ALA A CA  1 
ATOM   1451 C  C   . ALA B 2 89  ? -30.639  33.108  -17.780 1.00 22.83  ? 127 ALA A C   1 
ATOM   1452 O  O   . ALA B 2 89  ? -29.627  33.122  -18.455 1.00 21.54  ? 127 ALA A O   1 
ATOM   1453 C  CB  . ALA B 2 89  ? -31.803  35.251  -17.308 1.00 24.59  ? 127 ALA A CB  1 
ATOM   1454 N  N   . SER B 2 90  ? -30.768  32.355  -16.698 1.00 22.95  ? 128 SER A N   1 
ATOM   1455 C  CA  . SER B 2 90  ? -29.703  31.460  -16.277 1.00 22.91  ? 128 SER A CA  1 
ATOM   1456 C  C   . SER B 2 90  ? -29.390  30.418  -17.350 1.00 22.49  ? 128 SER A C   1 
ATOM   1457 O  O   . SER B 2 90  ? -28.257  30.318  -17.791 1.00 22.62  ? 128 SER A O   1 
ATOM   1458 C  CB  . SER B 2 90  ? -30.073  30.767  -14.973 1.00 22.89  ? 128 SER A CB  1 
ATOM   1459 O  OG  . SER B 2 90  ? -28.973  30.067  -14.455 1.00 22.59  ? 128 SER A OG  1 
ATOM   1460 N  N   . ILE B 2 91  ? -30.402  29.683  -17.785 1.00 22.61  ? 129 ILE A N   1 
ATOM   1461 C  CA  . ILE B 2 91  ? -30.215  28.586  -18.738 1.00 23.16  ? 129 ILE A CA  1 
ATOM   1462 C  C   . ILE B 2 91  ? -29.815  29.106  -20.124 1.00 23.11  ? 129 ILE A C   1 
ATOM   1463 O  O   . ILE B 2 91  ? -28.872  28.585  -20.723 1.00 23.30  ? 129 ILE A O   1 
ATOM   1464 C  CB  . ILE B 2 91  ? -31.473  27.667  -18.849 1.00 23.78  ? 129 ILE A CB  1 
ATOM   1465 C  CG1 . ILE B 2 91  ? -31.784  27.011  -17.484 1.00 24.07  ? 129 ILE A CG1 1 
ATOM   1466 C  CG2 . ILE B 2 91  ? -31.279  26.590  -19.924 1.00 23.49  ? 129 ILE A CG2 1 
ATOM   1467 C  CD1 . ILE B 2 91  ? -33.104  26.264  -17.407 1.00 23.96  ? 129 ILE A CD1 1 
ATOM   1468 N  N   . GLU B 2 92  ? -30.506  30.126  -20.634 1.00 23.53  ? 130 GLU A N   1 
ATOM   1469 C  CA  . GLU B 2 92  ? -30.123  30.705  -21.920 1.00 24.46  ? 130 GLU A CA  1 
ATOM   1470 C  C   . GLU B 2 92  ? -28.692  31.242  -21.895 1.00 25.33  ? 130 GLU A C   1 
ATOM   1471 O  O   . GLU B 2 92  ? -27.998  31.156  -22.910 1.00 27.64  ? 130 GLU A O   1 
ATOM   1472 C  CB  . GLU B 2 92  ? -31.083  31.795  -22.381 1.00 25.04  ? 130 GLU A CB  1 
ATOM   1473 C  CG  . GLU B 2 92  ? -32.402  31.271  -22.921 1.00 25.79  ? 130 GLU A CG  1 
ATOM   1474 C  CD  . GLU B 2 92  ? -33.311  32.354  -23.476 1.00 27.33  ? 130 GLU A CD  1 
ATOM   1475 O  OE1 . GLU B 2 92  ? -32.877  33.504  -23.667 1.00 29.64  ? 130 GLU A OE1 1 
ATOM   1476 O  OE2 . GLU B 2 92  ? -34.483  32.053  -23.752 1.00 29.02  ? 130 GLU A OE2 1 
ATOM   1477 N  N   . THR B 2 93  ? -28.247  31.788  -20.755 1.00 25.32  ? 131 THR A N   1 
ATOM   1478 C  CA  . THR B 2 93  ? -26.852  32.244  -20.598 1.00 24.76  ? 131 THR A CA  1 
ATOM   1479 C  C   . THR B 2 93  ? -25.869  31.064  -20.568 1.00 24.78  ? 131 THR A C   1 
ATOM   1480 O  O   . THR B 2 93  ? -24.761  31.199  -21.058 1.00 25.63  ? 131 THR A O   1 
ATOM   1481 C  CB  . THR B 2 93  ? -26.665  33.174  -19.368 1.00 24.87  ? 131 THR A CB  1 
ATOM   1482 O  OG1 . THR B 2 93  ? -27.456  34.356  -19.541 1.00 26.00  ? 131 THR A OG1 1 
ATOM   1483 C  CG2 . THR B 2 93  ? -25.236  33.626  -19.215 1.00 24.85  ? 131 THR A CG2 1 
ATOM   1484 N  N   . LEU B 2 94  ? -26.260  29.915  -20.017 1.00 24.71  ? 132 LEU A N   1 
ATOM   1485 C  CA  . LEU B 2 94  ? -25.434  28.700  -20.121 1.00 24.39  ? 132 LEU A CA  1 
ATOM   1486 C  C   . LEU B 2 94  ? -25.210  28.304  -21.565 1.00 23.70  ? 132 LEU A C   1 
ATOM   1487 O  O   . LEU B 2 94  ? -24.129  27.876  -21.948 1.00 22.93  ? 132 LEU A O   1 
ATOM   1488 C  CB  . LEU B 2 94  ? -26.083  27.520  -19.403 1.00 25.20  ? 132 LEU A CB  1 
ATOM   1489 C  CG  . LEU B 2 94  ? -26.172  27.592  -17.877 1.00 26.19  ? 132 LEU A CG  1 
ATOM   1490 C  CD1 . LEU B 2 94  ? -26.827  26.332  -17.327 1.00 26.85  ? 132 LEU A CD1 1 
ATOM   1491 C  CD2 . LEU B 2 94  ? -24.797  27.796  -17.271 1.00 26.66  ? 132 LEU A CD2 1 
ATOM   1492 N  N   . CYS B 2 95  ? -26.264  28.437  -22.351 1.00 24.62  ? 133 CYS A N   1 
ATOM   1493 C  CA  . CYS B 2 95  ? -26.233  28.197  -23.791 1.00 24.40  ? 133 CYS A CA  1 
ATOM   1494 C  C   . CYS B 2 95  ? -25.286  29.143  -24.552 1.00 23.12  ? 133 CYS A C   1 
ATOM   1495 O  O   . CYS B 2 95  ? -24.620  28.731  -25.491 1.00 23.67  ? 133 CYS A O   1 
ATOM   1496 C  CB  . CYS B 2 95  ? -27.663  28.311  -24.327 1.00 24.90  ? 133 CYS A CB  1 
ATOM   1497 S  SG  . CYS B 2 95  ? -27.795  28.210  -26.086 1.00 27.11  ? 133 CYS A SG  1 
ATOM   1498 N  N   . VAL B 2 96  ? -25.236  30.408  -24.151 1.00 21.95  ? 134 VAL A N   1 
ATOM   1499 C  CA  . VAL B 2 96  ? -24.353  31.384  -24.789 1.00 20.98  ? 134 VAL A CA  1 
ATOM   1500 C  C   . VAL B 2 96  ? -22.892  31.099  -24.435 1.00 21.05  ? 134 VAL A C   1 
ATOM   1501 O  O   . VAL B 2 96  ? -22.009  31.211  -25.295 1.00 21.48  ? 134 VAL A O   1 
ATOM   1502 C  CB  . VAL B 2 96  ? -24.742  32.829  -24.405 1.00 20.86  ? 134 VAL A CB  1 
ATOM   1503 C  CG1 . VAL B 2 96  ? -23.702  33.833  -24.881 1.00 20.71  ? 134 VAL A CG1 1 
ATOM   1504 C  CG2 . VAL B 2 96  ? -26.122  33.179  -24.973 1.00 20.97  ? 134 VAL A CG2 1 
ATOM   1505 N  N   . ILE B 2 97  ? -22.641  30.741  -23.172 1.00 20.58  ? 135 ILE A N   1 
ATOM   1506 C  CA  . ILE B 2 97  ? -21.296  30.346  -22.698 1.00 19.48  ? 135 ILE A CA  1 
ATOM   1507 C  C   . ILE B 2 97  ? -20.773  29.149  -23.484 1.00 19.29  ? 135 ILE A C   1 
ATOM   1508 O  O   . ILE B 2 97  ? -19.615  29.139  -23.856 1.00 19.28  ? 135 ILE A O   1 
ATOM   1509 C  CB  . ILE B 2 97  ? -21.276  30.054  -21.173 1.00 19.07  ? 135 ILE A CB  1 
ATOM   1510 C  CG1 . ILE B 2 97  ? -21.384  31.361  -20.396 1.00 19.18  ? 135 ILE A CG1 1 
ATOM   1511 C  CG2 . ILE B 2 97  ? -20.003  29.335  -20.744 1.00 19.20  ? 135 ILE A CG2 1 
ATOM   1512 C  CD1 . ILE B 2 97  ? -21.948  31.191  -19.007 1.00 19.36  ? 135 ILE A CD1 1 
ATOM   1513 N  N   . ALA B 2 98  ? -21.619  28.155  -23.750 1.00 19.77  ? 136 ALA A N   1 
ATOM   1514 C  CA  . ALA B 2 98  ? -21.223  27.033  -24.598 1.00 20.17  ? 136 ALA A CA  1 
ATOM   1515 C  C   . ALA B 2 98  ? -20.769  27.495  -25.986 1.00 20.99  ? 136 ALA A C   1 
ATOM   1516 O  O   . ALA B 2 98  ? -19.699  27.075  -26.469 1.00 20.48  ? 136 ALA A O   1 
ATOM   1517 C  CB  . ALA B 2 98  ? -22.356  26.043  -24.736 1.00 19.78  ? 136 ALA A CB  1 
ATOM   1518 N  N   . ILE B 2 99  ? -21.570  28.364  -26.612 1.00 21.08  ? 137 ILE A N   1 
ATOM   1519 C  CA  . ILE B 2 99  ? -21.220  28.914  -27.922 1.00 21.69  ? 137 ILE A CA  1 
ATOM   1520 C  C   . ILE B 2 99  ? -19.913  29.688  -27.832 1.00 22.47  ? 137 ILE A C   1 
ATOM   1521 O  O   . ILE B 2 99  ? -19.039  29.515  -28.666 1.00 21.21  ? 137 ILE A O   1 
ATOM   1522 C  CB  . ILE B 2 99  ? -22.314  29.833  -28.497 1.00 21.52  ? 137 ILE A CB  1 
ATOM   1523 C  CG1 . ILE B 2 99  ? -23.590  29.031  -28.808 1.00 21.50  ? 137 ILE A CG1 1 
ATOM   1524 C  CG2 . ILE B 2 99  ? -21.823  30.521  -29.777 1.00 20.99  ? 137 ILE A CG2 1 
ATOM   1525 C  CD1 . ILE B 2 99  ? -24.817  29.880  -29.053 1.00 20.98  ? 137 ILE A CD1 1 
ATOM   1526 N  N   . ASP B 2 100 ? -19.803  30.545  -26.821 1.00 24.64  ? 138 ASP A N   1 
ATOM   1527 C  CA  . ASP B 2 100 ? -18.607  31.366  -26.621 1.00 26.00  ? 138 ASP A CA  1 
ATOM   1528 C  C   . ASP B 2 100 ? -17.337  30.524  -26.577 1.00 25.94  ? 138 ASP A C   1 
ATOM   1529 O  O   . ASP B 2 100 ? -16.424  30.739  -27.364 1.00 26.34  ? 138 ASP A O   1 
ATOM   1530 C  CB  . ASP B 2 100 ? -18.721  32.188  -25.333 1.00 27.48  ? 138 ASP A CB  1 
ATOM   1531 C  CG  . ASP B 2 100 ? -17.404  32.871  -24.965 1.00 28.91  ? 138 ASP A CG  1 
ATOM   1532 O  OD1 . ASP B 2 100 ? -16.925  33.649  -25.823 1.00 30.65  ? 138 ASP A OD1 1 
ATOM   1533 O  OD2 . ASP B 2 100 ? -16.876  32.627  -23.845 1.00 30.37  ? 138 ASP A OD2 1 
ATOM   1534 N  N   . ARG B 2 101 ? -17.297  29.559  -25.661 1.00 26.19  ? 139 ARG A N   1 
ATOM   1535 C  CA  . ARG B 2 101 ? -16.138  28.663  -25.517 1.00 25.98  ? 139 ARG A CA  1 
ATOM   1536 C  C   . ARG B 2 101 ? -15.910  27.783  -26.736 1.00 26.63  ? 139 ARG A C   1 
ATOM   1537 O  O   . ARG B 2 101 ? -14.786  27.429  -27.032 1.00 26.74  ? 139 ARG A O   1 
ATOM   1538 C  CB  . ARG B 2 101 ? -16.276  27.763  -24.291 1.00 25.17  ? 139 ARG A CB  1 
ATOM   1539 C  CG  . ARG B 2 101 ? -16.360  28.492  -22.969 1.00 25.23  ? 139 ARG A CG  1 
ATOM   1540 C  CD  . ARG B 2 101 ? -15.254  29.517  -22.800 1.00 25.37  ? 139 ARG A CD  1 
ATOM   1541 N  NE  . ARG B 2 101 ? -13.938  28.916  -22.964 1.00 24.99  ? 139 ARG A NE  1 
ATOM   1542 C  CZ  . ARG B 2 101 ? -12.844  29.542  -23.378 1.00 25.85  ? 139 ARG A CZ  1 
ATOM   1543 N  NH1 . ARG B 2 101 ? -11.684  28.859  -23.476 1.00 26.29  ? 139 ARG A NH1 1 
ATOM   1544 N  NH2 . ARG B 2 101 ? -12.879  30.841  -23.702 1.00 26.25  ? 139 ARG A NH2 1 
ATOM   1545 N  N   . TYR B 2 102 ? -16.970  27.419  -27.438 1.00 28.08  ? 140 TYR A N   1 
ATOM   1546 C  CA  . TYR B 2 102 ? -16.806  26.678  -28.679 1.00 29.19  ? 140 TYR A CA  1 
ATOM   1547 C  C   . TYR B 2 102 ? -16.015  27.464  -29.734 1.00 28.90  ? 140 TYR A C   1 
ATOM   1548 O  O   . TYR B 2 102 ? -15.111  26.919  -30.338 1.00 28.31  ? 140 TYR A O   1 
ATOM   1549 C  CB  . TYR B 2 102 ? -18.161  26.260  -29.232 1.00 30.85  ? 140 TYR A CB  1 
ATOM   1550 C  CG  . TYR B 2 102 ? -18.100  25.825  -30.664 1.00 31.79  ? 140 TYR A CG  1 
ATOM   1551 C  CD1 . TYR B 2 102 ? -17.689  24.547  -30.986 1.00 33.13  ? 140 TYR A CD1 1 
ATOM   1552 C  CD2 . TYR B 2 102 ? -18.421  26.708  -31.700 1.00 32.35  ? 140 TYR A CD2 1 
ATOM   1553 C  CE1 . TYR B 2 102 ? -17.612  24.135  -32.297 1.00 35.05  ? 140 TYR A CE1 1 
ATOM   1554 C  CE2 . TYR B 2 102 ? -18.337  26.326  -33.017 1.00 33.64  ? 140 TYR A CE2 1 
ATOM   1555 C  CZ  . TYR B 2 102 ? -17.942  25.035  -33.319 1.00 35.36  ? 140 TYR A CZ  1 
ATOM   1556 O  OH  . TYR B 2 102 ? -17.873  24.646  -34.639 1.00 36.51  ? 140 TYR A OH  1 
ATOM   1557 N  N   . LEU B 2 103 ? -16.370  28.726  -29.958 1.00 29.25  ? 141 LEU A N   1 
ATOM   1558 C  CA  . LEU B 2 103 ? -15.650  29.575  -30.913 1.00 30.13  ? 141 LEU A CA  1 
ATOM   1559 C  C   . LEU B 2 103 ? -14.222  29.858  -30.462 1.00 30.35  ? 141 LEU A C   1 
ATOM   1560 O  O   . LEU B 2 103 ? -13.292  29.797  -31.262 1.00 30.69  ? 141 LEU A O   1 
ATOM   1561 C  CB  . LEU B 2 103 ? -16.350  30.924  -31.121 1.00 30.85  ? 141 LEU A CB  1 
ATOM   1562 C  CG  . LEU B 2 103 ? -17.797  31.043  -31.558 1.00 32.42  ? 141 LEU A CG  1 
ATOM   1563 C  CD1 . LEU B 2 103 ? -18.060  32.523  -31.886 1.00 32.12  ? 141 LEU A CD1 1 
ATOM   1564 C  CD2 . LEU B 2 103 ? -18.141  30.105  -32.722 1.00 32.54  ? 141 LEU A CD2 1 
ATOM   1565 N  N   . ALA B 2 104 ? -14.055  30.180  -29.184 1.00 30.43  ? 142 ALA A N   1 
ATOM   1566 C  CA  . ALA B 2 104 ? -12.740  30.477  -28.630 1.00 31.10  ? 142 ALA A CA  1 
ATOM   1567 C  C   . ALA B 2 104 ? -11.752  29.294  -28.667 1.00 31.91  ? 142 ALA A C   1 
ATOM   1568 O  O   . ALA B 2 104 ? -10.542  29.506  -28.721 1.00 33.74  ? 142 ALA A O   1 
ATOM   1569 C  CB  . ALA B 2 104 ? -12.893  30.992  -27.213 1.00 31.37  ? 142 ALA A CB  1 
ATOM   1570 N  N   . ILE B 2 105 ? -12.272  28.070  -28.624 1.00 32.38  ? 143 ILE A N   1 
ATOM   1571 C  CA  . ILE B 2 105 ? -11.467  26.853  -28.662 1.00 32.30  ? 143 ILE A CA  1 
ATOM   1572 C  C   . ILE B 2 105 ? -11.218  26.349  -30.079 1.00 32.52  ? 143 ILE A C   1 
ATOM   1573 O  O   . ILE B 2 105 ? -10.151  25.811  -30.351 1.00 33.24  ? 143 ILE A O   1 
ATOM   1574 C  CB  . ILE B 2 105 ? -12.157  25.716  -27.878 1.00 33.74  ? 143 ILE A CB  1 
ATOM   1575 C  CG1 . ILE B 2 105 ? -12.153  26.013  -26.384 1.00 33.90  ? 143 ILE A CG1 1 
ATOM   1576 C  CG2 . ILE B 2 105 ? -11.470  24.376  -28.116 1.00 35.29  ? 143 ILE A CG2 1 
ATOM   1577 C  CD1 . ILE B 2 105 ? -13.022  25.054  -25.599 1.00 33.79  ? 143 ILE A CD1 1 
ATOM   1578 N  N   . THR B 2 106 ? -12.208  26.454  -30.957 1.00 34.11  ? 144 THR A N   1 
ATOM   1579 C  CA  . THR B 2 106 ? -12.102  25.894  -32.308 1.00 35.30  ? 144 THR A CA  1 
ATOM   1580 C  C   . THR B 2 106 ? -11.693  26.914  -33.363 1.00 34.71  ? 144 THR A C   1 
ATOM   1581 O  O   . THR B 2 106 ? -11.042  26.534  -34.318 1.00 34.49  ? 144 THR A O   1 
ATOM   1582 C  CB  . THR B 2 106 ? -13.408  25.193  -32.773 1.00 36.67  ? 144 THR A CB  1 
ATOM   1583 O  OG1 . THR B 2 106 ? -14.470  26.145  -32.900 1.00 36.80  ? 144 THR A OG1 1 
ATOM   1584 C  CG2 . THR B 2 106 ? -13.820  24.100  -31.798 1.00 36.78  ? 144 THR A CG2 1 
ATOM   1585 N  N   . SER B 2 107 ? -12.085  28.177  -33.214 1.00 35.06  ? 145 SER A N   1 
ATOM   1586 C  CA  . SER B 2 107 ? -11.779  29.225  -34.203 1.00 36.57  ? 145 SER A CA  1 
ATOM   1587 C  C   . SER B 2 107 ? -11.336  30.508  -33.513 1.00 36.01  ? 145 SER A C   1 
ATOM   1588 O  O   . SER B 2 107 ? -11.935  31.562  -33.722 1.00 36.26  ? 145 SER A O   1 
ATOM   1589 C  CB  . SER B 2 107 ? -13.006  29.488  -35.087 1.00 39.39  ? 145 SER A CB  1 
ATOM   1590 O  OG  . SER B 2 107 ? -13.400  28.305  -35.762 1.00 43.15  ? 145 SER A OG  1 
ATOM   1591 N  N   . PRO B 2 108 ? -10.277  30.426  -32.692 1.00 35.40  ? 146 PRO A N   1 
ATOM   1592 C  CA  . PRO B 2 108 ? -9.918   31.511  -31.772 1.00 35.75  ? 146 PRO A CA  1 
ATOM   1593 C  C   . PRO B 2 108 ? -9.613   32.843  -32.439 1.00 36.96  ? 146 PRO A C   1 
ATOM   1594 O  O   . PRO B 2 108 ? -9.891   33.881  -31.844 1.00 37.31  ? 146 PRO A O   1 
ATOM   1595 C  CB  . PRO B 2 108 ? -8.672   30.987  -31.059 1.00 35.06  ? 146 PRO A CB  1 
ATOM   1596 C  CG  . PRO B 2 108 ? -8.149   29.901  -31.920 1.00 34.93  ? 146 PRO A CG  1 
ATOM   1597 C  CD  . PRO B 2 108 ? -9.340   29.301  -32.599 1.00 34.97  ? 146 PRO A CD  1 
ATOM   1598 N  N   . PHE B 2 109 ? -9.055   32.826  -33.645 1.00 39.51  ? 147 PHE A N   1 
ATOM   1599 C  CA  . PHE B 2 109 ? -8.639   34.075  -34.291 1.00 43.94  ? 147 PHE A CA  1 
ATOM   1600 C  C   . PHE B 2 109 ? -9.838   34.762  -34.929 1.00 47.80  ? 147 PHE A C   1 
ATOM   1601 O  O   . PHE B 2 109 ? -9.987   35.988  -34.833 1.00 46.83  ? 147 PHE A O   1 
ATOM   1602 C  CB  . PHE B 2 109 ? -7.513   33.838  -35.306 1.00 44.14  ? 147 PHE A CB  1 
ATOM   1603 C  CG  . PHE B 2 109 ? -6.302   33.157  -34.715 1.00 43.73  ? 147 PHE A CG  1 
ATOM   1604 C  CD1 . PHE B 2 109 ? -5.620   33.728  -33.642 1.00 43.37  ? 147 PHE A CD1 1 
ATOM   1605 C  CD2 . PHE B 2 109 ? -5.856   31.934  -35.217 1.00 43.18  ? 147 PHE A CD2 1 
ATOM   1606 C  CE1 . PHE B 2 109 ? -4.520   33.098  -33.086 1.00 43.62  ? 147 PHE A CE1 1 
ATOM   1607 C  CE2 . PHE B 2 109 ? -4.757   31.296  -34.664 1.00 42.70  ? 147 PHE A CE2 1 
ATOM   1608 C  CZ  . PHE B 2 109 ? -4.083   31.884  -33.602 1.00 43.70  ? 147 PHE A CZ  1 
ATOM   1609 N  N   . ARG B 2 110 ? -10.697  33.968  -35.561 1.00 52.34  ? 148 ARG A N   1 
ATOM   1610 C  CA  . ARG B 2 110 ? -11.970  34.474  -36.076 1.00 58.07  ? 148 ARG A CA  1 
ATOM   1611 C  C   . ARG B 2 110 ? -12.804  35.038  -34.919 1.00 55.94  ? 148 ARG A C   1 
ATOM   1612 O  O   . ARG B 2 110 ? -13.325  36.143  -35.012 1.00 55.33  ? 148 ARG A O   1 
ATOM   1613 C  CB  . ARG B 2 110 ? -12.737  33.382  -36.841 1.00 66.18  ? 148 ARG A CB  1 
ATOM   1614 C  CG  . ARG B 2 110 ? -13.729  33.920  -37.876 1.00 72.23  ? 148 ARG A CG  1 
ATOM   1615 C  CD  . ARG B 2 110 ? -14.464  32.801  -38.628 1.00 77.11  ? 148 ARG A CD  1 
ATOM   1616 N  NE  . ARG B 2 110 ? -15.756  32.418  -38.019 1.00 82.46  ? 148 ARG A NE  1 
ATOM   1617 C  CZ  . ARG B 2 110 ? -16.344  31.216  -38.112 1.00 80.89  ? 148 ARG A CZ  1 
ATOM   1618 N  NH1 . ARG B 2 110 ? -15.775  30.216  -38.786 1.00 84.32  ? 148 ARG A NH1 1 
ATOM   1619 N  NH2 . ARG B 2 110 ? -17.517  31.002  -37.513 1.00 73.59  ? 148 ARG A NH2 1 
ATOM   1620 N  N   . TYR B 2 111 ? -12.887  34.292  -33.819 1.00 54.13  ? 149 TYR A N   1 
ATOM   1621 C  CA  . TYR B 2 111 ? -13.611  34.722  -32.611 1.00 56.72  ? 149 TYR A CA  1 
ATOM   1622 C  C   . TYR B 2 111 ? -13.210  36.102  -32.087 1.00 57.43  ? 149 TYR A C   1 
ATOM   1623 O  O   . TYR B 2 111 ? -14.078  36.871  -31.722 1.00 60.84  ? 149 TYR A O   1 
ATOM   1624 C  CB  . TYR B 2 111 ? -13.459  33.672  -31.494 1.00 59.60  ? 149 TYR A CB  1 
ATOM   1625 C  CG  . TYR B 2 111 ? -13.912  34.072  -30.092 1.00 63.27  ? 149 TYR A CG  1 
ATOM   1626 C  CD1 . TYR B 2 111 ? -15.263  34.087  -29.750 1.00 62.91  ? 149 TYR A CD1 1 
ATOM   1627 C  CD2 . TYR B 2 111 ? -12.969  34.432  -29.102 1.00 66.28  ? 149 TYR A CD2 1 
ATOM   1628 C  CE1 . TYR B 2 111 ? -15.681  34.458  -28.473 1.00 64.44  ? 149 TYR A CE1 1 
ATOM   1629 C  CE2 . TYR B 2 111 ? -13.370  34.786  -27.815 1.00 65.20  ? 149 TYR A CE2 1 
ATOM   1630 C  CZ  . TYR B 2 111 ? -14.720  34.785  -27.493 1.00 64.15  ? 149 TYR A CZ  1 
ATOM   1631 O  OH  . TYR B 2 111 ? -15.083  35.141  -26.214 1.00 58.62  ? 149 TYR A OH  1 
ATOM   1632 N  N   . GLN B 2 112 ? -11.920  36.414  -32.028 1.00 59.88  ? 150 GLN A N   1 
ATOM   1633 C  CA  . GLN B 2 112 ? -11.463  37.678  -31.424 1.00 60.53  ? 150 GLN A CA  1 
ATOM   1634 C  C   . GLN B 2 112 ? -11.967  38.913  -32.163 1.00 59.89  ? 150 GLN A C   1 
ATOM   1635 O  O   . GLN B 2 112 ? -12.402  39.881  -31.542 1.00 57.69  ? 150 GLN A O   1 
ATOM   1636 C  CB  . GLN B 2 112 ? -9.942   37.726  -31.353 1.00 60.34  ? 150 GLN A CB  1 
ATOM   1637 C  CG  . GLN B 2 112 ? -9.355   36.857  -30.266 1.00 60.87  ? 150 GLN A CG  1 
ATOM   1638 C  CD  . GLN B 2 112 ? -7.922   36.463  -30.547 1.00 61.97  ? 150 GLN A CD  1 
ATOM   1639 O  OE1 . GLN B 2 112 ? -7.211   37.114  -31.322 1.00 63.57  ? 150 GLN A OE1 1 
ATOM   1640 N  NE2 . GLN B 2 112 ? -7.491   35.372  -29.928 1.00 63.12  ? 150 GLN A NE2 1 
ATOM   1641 N  N   . SER B 2 113 ? -11.892  38.878  -33.486 1.00 61.61  ? 151 SER A N   1 
ATOM   1642 C  CA  . SER B 2 113 ? -12.426  39.951  -34.316 1.00 64.35  ? 151 SER A CA  1 
ATOM   1643 C  C   . SER B 2 113 ? -13.964  39.907  -34.365 1.00 63.91  ? 151 SER A C   1 
ATOM   1644 O  O   . SER B 2 113 ? -14.613  40.952  -34.364 1.00 68.02  ? 151 SER A O   1 
ATOM   1645 C  CB  . SER B 2 113 ? -11.830  39.861  -35.718 1.00 67.11  ? 151 SER A CB  1 
ATOM   1646 O  OG  . SER B 2 113 ? -11.828  38.515  -36.159 1.00 72.68  ? 151 SER A OG  1 
ATOM   1647 N  N   . LEU B 2 114 ? -14.538  38.705  -34.394 1.00 60.79  ? 152 LEU A N   1 
ATOM   1648 C  CA  . LEU B 2 114 ? -16.001  38.525  -34.478 1.00 57.46  ? 152 LEU A CA  1 
ATOM   1649 C  C   . LEU B 2 114 ? -16.750  38.911  -33.208 1.00 53.98  ? 152 LEU A C   1 
ATOM   1650 O  O   . LEU B 2 114 ? -17.752  39.605  -33.290 1.00 62.74  ? 152 LEU A O   1 
ATOM   1651 C  CB  . LEU B 2 114 ? -16.363  37.082  -34.871 1.00 56.35  ? 152 LEU A CB  1 
ATOM   1652 C  CG  . LEU B 2 114 ? -17.819  36.834  -35.306 1.00 57.83  ? 152 LEU A CG  1 
ATOM   1653 C  CD1 . LEU B 2 114 ? -17.892  35.853  -36.470 1.00 59.14  ? 152 LEU A CD1 1 
ATOM   1654 C  CD2 . LEU B 2 114 ? -18.710  36.384  -34.143 1.00 60.19  ? 152 LEU A CD2 1 
ATOM   1655 N  N   . MET B 2 115 ? -16.287  38.466  -32.048 1.00 47.85  ? 153 MET A N   1 
ATOM   1656 C  CA  . MET B 2 115 ? -16.951  38.756  -30.765 1.00 45.55  ? 153 MET A CA  1 
ATOM   1657 C  C   . MET B 2 115 ? -16.246  39.915  -30.078 1.00 43.91  ? 153 MET A C   1 
ATOM   1658 O  O   . MET B 2 115 ? -15.138  39.761  -29.593 1.00 43.56  ? 153 MET A O   1 
ATOM   1659 C  CB  . MET B 2 115 ? -16.904  37.528  -29.865 1.00 45.42  ? 153 MET A CB  1 
ATOM   1660 C  CG  . MET B 2 115 ? -17.683  37.640  -28.564 1.00 45.72  ? 153 MET A CG  1 
ATOM   1661 S  SD  . MET B 2 115 ? -19.469  37.420  -28.598 1.00 47.42  ? 153 MET A SD  1 
ATOM   1662 C  CE  . MET B 2 115 ? -19.720  36.183  -29.874 1.00 47.80  ? 153 MET A CE  1 
ATOM   1663 N  N   . THR B 2 116 ? -16.890  41.065  -30.016 1.00 46.87  ? 154 THR A N   1 
ATOM   1664 C  CA  . THR B 2 116 ? -16.372  42.201  -29.253 1.00 50.79  ? 154 THR A CA  1 
ATOM   1665 C  C   . THR B 2 116 ? -17.119  42.302  -27.932 1.00 52.55  ? 154 THR A C   1 
ATOM   1666 O  O   . THR B 2 116 ? -18.119  41.607  -27.732 1.00 55.39  ? 154 THR A O   1 
ATOM   1667 C  CB  . THR B 2 116 ? -16.528  43.514  -30.040 1.00 52.88  ? 154 THR A CB  1 
ATOM   1668 O  OG1 . THR B 2 116 ? -17.914  43.778  -30.273 1.00 53.09  ? 154 THR A OG1 1 
ATOM   1669 C  CG2 . THR B 2 116 ? -15.822  43.415  -31.369 1.00 54.48  ? 154 THR A CG2 1 
ATOM   1670 N  N   . ARG B 2 117 ? -16.638  43.167  -27.045 1.00 53.83  ? 155 ARG A N   1 
ATOM   1671 C  CA  . ARG B 2 117 ? -17.346  43.459  -25.792 1.00 56.57  ? 155 ARG A CA  1 
ATOM   1672 C  C   . ARG B 2 117 ? -18.716  44.100  -26.071 1.00 57.32  ? 155 ARG A C   1 
ATOM   1673 O  O   . ARG B 2 117 ? -19.693  43.789  -25.403 1.00 57.44  ? 155 ARG A O   1 
ATOM   1674 C  CB  . ARG B 2 117 ? -16.525  44.372  -24.867 1.00 59.79  ? 155 ARG A CB  1 
ATOM   1675 C  CG  . ARG B 2 117 ? -15.210  43.794  -24.379 1.00 63.35  ? 155 ARG A CG  1 
ATOM   1676 C  CD  . ARG B 2 117 ? -14.564  44.718  -23.353 1.00 64.20  ? 155 ARG A CD  1 
ATOM   1677 N  NE  . ARG B 2 117 ? -15.069  44.467  -22.005 1.00 64.64  ? 155 ARG A NE  1 
ATOM   1678 C  CZ  . ARG B 2 117 ? -14.686  43.459  -21.213 1.00 64.20  ? 155 ARG A CZ  1 
ATOM   1679 N  NH1 . ARG B 2 117 ? -13.785  42.557  -21.612 1.00 62.97  ? 155 ARG A NH1 1 
ATOM   1680 N  NH2 . ARG B 2 117 ? -15.221  43.340  -19.996 1.00 64.05  ? 155 ARG A NH2 1 
ATOM   1681 N  N   . ALA B 2 118 ? -18.778  44.988  -27.058 1.00 56.79  ? 156 ALA A N   1 
ATOM   1682 C  CA  . ALA B 2 118 ? -20.047  45.593  -27.470 1.00 56.58  ? 156 ALA A CA  1 
ATOM   1683 C  C   . ALA B 2 118 ? -21.034  44.554  -28.019 1.00 53.56  ? 156 ALA A C   1 
ATOM   1684 O  O   . ALA B 2 118 ? -22.236  44.648  -27.777 1.00 54.91  ? 156 ALA A O   1 
ATOM   1685 C  CB  . ALA B 2 118 ? -19.804  46.693  -28.496 1.00 57.56  ? 156 ALA A CB  1 
ATOM   1686 N  N   . ARG B 2 119 ? -20.525  43.565  -28.741 1.00 50.30  ? 157 ARG A N   1 
ATOM   1687 C  CA  . ARG B 2 119 ? -21.379  42.506  -29.270 1.00 50.82  ? 157 ARG A CA  1 
ATOM   1688 C  C   . ARG B 2 119 ? -21.886  41.585  -28.167 1.00 47.21  ? 157 ARG A C   1 
ATOM   1689 O  O   . ARG B 2 119 ? -23.042  41.175  -28.174 1.00 47.78  ? 157 ARG A O   1 
ATOM   1690 C  CB  . ARG B 2 119 ? -20.656  41.698  -30.352 1.00 55.46  ? 157 ARG A CB  1 
ATOM   1691 C  CG  . ARG B 2 119 ? -21.617  40.877  -31.218 1.00 58.32  ? 157 ARG A CG  1 
ATOM   1692 C  CD  . ARG B 2 119 ? -20.975  40.327  -32.489 1.00 60.66  ? 157 ARG A CD  1 
ATOM   1693 N  NE  . ARG B 2 119 ? -20.957  41.260  -33.623 1.00 62.48  ? 157 ARG A NE  1 
ATOM   1694 C  CZ  . ARG B 2 119 ? -19.964  42.097  -33.961 1.00 66.75  ? 157 ARG A CZ  1 
ATOM   1695 N  NH1 . ARG B 2 119 ? -18.830  42.205  -33.253 1.00 72.41  ? 157 ARG A NH1 1 
ATOM   1696 N  NH2 . ARG B 2 119 ? -20.109  42.863  -35.041 1.00 66.62  ? 157 ARG A NH2 1 
ATOM   1697 N  N   . ALA B 2 120 ? -21.020  41.269  -27.215 1.00 45.79  ? 158 ALA A N   1 
ATOM   1698 C  CA  . ALA B 2 120 ? -21.403  40.437  -26.069 1.00 44.88  ? 158 ALA A CA  1 
ATOM   1699 C  C   . ALA B 2 120 ? -22.483  41.092  -25.206 1.00 42.97  ? 158 ALA A C   1 
ATOM   1700 O  O   . ALA B 2 120 ? -23.376  40.400  -24.732 1.00 42.00  ? 158 ALA A O   1 
ATOM   1701 C  CB  . ALA B 2 120 ? -20.181  40.087  -25.230 1.00 43.58  ? 158 ALA A CB  1 
ATOM   1702 N  N   . LYS B 2 121 ? -22.406  42.413  -25.023 1.00 42.53  ? 159 LYS A N   1 
ATOM   1703 C  CA  . LYS B 2 121 ? -23.447  43.168  -24.302 1.00 43.82  ? 159 LYS A CA  1 
ATOM   1704 C  C   . LYS B 2 121 ? -24.797  43.028  -24.983 1.00 41.62  ? 159 LYS A C   1 
ATOM   1705 O  O   . LYS B 2 121 ? -25.803  42.825  -24.314 1.00 43.14  ? 159 LYS A O   1 
ATOM   1706 C  CB  . LYS B 2 121 ? -23.108  44.665  -24.189 1.00 46.60  ? 159 LYS A CB  1 
ATOM   1707 C  CG  . LYS B 2 121 ? -21.942  45.008  -23.282 1.00 49.52  ? 159 LYS A CG  1 
ATOM   1708 C  CD  . LYS B 2 121 ? -22.273  45.028  -21.790 1.00 50.64  ? 159 LYS A CD  1 
ATOM   1709 C  CE  . LYS B 2 121 ? -20.995  45.047  -20.946 1.00 52.31  ? 159 LYS A CE  1 
ATOM   1710 N  NZ  . LYS B 2 121 ? -19.925  46.043  -21.312 1.00 53.76  ? 159 LYS A NZ  1 
ATOM   1711 N  N   . VAL B 2 122 ? -24.814  43.128  -26.309 1.00 37.64  ? 160 VAL A N   1 
ATOM   1712 C  CA  . VAL B 2 122 ? -26.050  42.954  -27.058 1.00 36.08  ? 160 VAL A CA  1 
ATOM   1713 C  C   . VAL B 2 122 ? -26.591  41.543  -26.864 1.00 33.83  ? 160 VAL A C   1 
ATOM   1714 O  O   . VAL B 2 122 ? -27.789  41.376  -26.636 1.00 32.11  ? 160 VAL A O   1 
ATOM   1715 C  CB  . VAL B 2 122 ? -25.882  43.274  -28.556 1.00 36.76  ? 160 VAL A CB  1 
ATOM   1716 C  CG1 . VAL B 2 122 ? -27.130  42.867  -29.345 1.00 37.16  ? 160 VAL A CG1 1 
ATOM   1717 C  CG2 . VAL B 2 122 ? -25.610  44.756  -28.751 1.00 37.94  ? 160 VAL A CG2 1 
ATOM   1718 N  N   . ILE B 2 123 ? -25.713  40.542  -26.930 1.00 32.67  ? 161 ILE A N   1 
ATOM   1719 C  CA  . ILE B 2 123 ? -26.135  39.152  -26.707 1.00 32.27  ? 161 ILE A CA  1 
ATOM   1720 C  C   . ILE B 2 123 ? -26.743  39.019  -25.300 1.00 32.08  ? 161 ILE A C   1 
ATOM   1721 O  O   . ILE B 2 123 ? -27.812  38.415  -25.122 1.00 31.26  ? 161 ILE A O   1 
ATOM   1722 C  CB  . ILE B 2 123 ? -24.984  38.130  -26.892 1.00 31.41  ? 161 ILE A CB  1 
ATOM   1723 C  CG1 . ILE B 2 123 ? -24.500  38.100  -28.341 1.00 31.82  ? 161 ILE A CG1 1 
ATOM   1724 C  CG2 . ILE B 2 123 ? -25.436  36.724  -26.539 1.00 30.68  ? 161 ILE A CG2 1 
ATOM   1725 C  CD1 . ILE B 2 123 ? -23.128  37.460  -28.517 1.00 32.37  ? 161 ILE A CD1 1 
ATOM   1726 N  N   . ILE B 2 124 ? -26.066  39.595  -24.308 1.00 30.82  ? 162 ILE A N   1 
ATOM   1727 C  CA  . ILE B 2 124 ? -26.540  39.514  -22.934 1.00 31.09  ? 162 ILE A CA  1 
ATOM   1728 C  C   . ILE B 2 124 ? -27.884  40.231  -22.782 1.00 30.33  ? 162 ILE A C   1 
ATOM   1729 O  O   . ILE B 2 124 ? -28.813  39.670  -22.227 1.00 29.89  ? 162 ILE A O   1 
ATOM   1730 C  CB  . ILE B 2 124 ? -25.502  40.059  -21.940 1.00 30.82  ? 162 ILE A CB  1 
ATOM   1731 C  CG1 . ILE B 2 124 ? -24.291  39.125  -21.909 1.00 31.58  ? 162 ILE A CG1 1 
ATOM   1732 C  CG2 . ILE B 2 124 ? -26.087  40.147  -20.536 1.00 31.14  ? 162 ILE A CG2 1 
ATOM   1733 C  CD1 . ILE B 2 124 ? -23.009  39.778  -21.402 1.00 32.29  ? 162 ILE A CD1 1 
ATOM   1734 N  N   . CYS B 2 125 ? -27.974  41.454  -23.292 1.00 29.92  ? 163 CYS A N   1 
ATOM   1735 C  CA  . CYS B 2 125 ? -29.207  42.246  -23.223 1.00 29.26  ? 163 CYS A CA  1 
ATOM   1736 C  C   . CYS B 2 125 ? -30.366  41.531  -23.880 1.00 27.60  ? 163 CYS A C   1 
ATOM   1737 O  O   . CYS B 2 125 ? -31.480  41.529  -23.331 1.00 25.90  ? 163 CYS A O   1 
ATOM   1738 C  CB  . CYS B 2 125 ? -29.022  43.627  -23.868 1.00 30.52  ? 163 CYS A CB  1 
ATOM   1739 S  SG  . CYS B 2 125 ? -28.017  44.770  -22.903 1.00 35.57  ? 163 CYS A SG  1 
ATOM   1740 N  N   . THR B 2 126 ? -30.100  40.913  -25.034 1.00 26.45  ? 164 THR A N   1 
ATOM   1741 C  CA  . THR B 2 126 ? -31.084  40.080  -25.725 1.00 25.79  ? 164 THR A CA  1 
ATOM   1742 C  C   . THR B 2 126 ? -31.595  38.952  -24.840 1.00 26.70  ? 164 THR A C   1 
ATOM   1743 O  O   . THR B 2 126 ? -32.811  38.755  -24.728 1.00 26.95  ? 164 THR A O   1 
ATOM   1744 C  CB  . THR B 2 126 ? -30.496  39.451  -26.994 1.00 24.73  ? 164 THR A CB  1 
ATOM   1745 O  OG1 . THR B 2 126 ? -30.027  40.486  -27.852 1.00 25.35  ? 164 THR A OG1 1 
ATOM   1746 C  CG2 . THR B 2 126 ? -31.540  38.649  -27.734 1.00 24.31  ? 164 THR A CG2 1 
ATOM   1747 N  N   . VAL B 2 127 ? -30.672  38.217  -24.213 1.00 27.03  ? 165 VAL A N   1 
ATOM   1748 C  CA  . VAL B 2 127 ? -31.050  37.081  -23.368 1.00 26.24  ? 165 VAL A CA  1 
ATOM   1749 C  C   . VAL B 2 127 ? -32.020  37.527  -22.284 1.00 26.61  ? 165 VAL A C   1 
ATOM   1750 O  O   . VAL B 2 127 ? -33.042  36.885  -22.084 1.00 29.62  ? 165 VAL A O   1 
ATOM   1751 C  CB  . VAL B 2 127 ? -29.835  36.362  -22.736 1.00 26.27  ? 165 VAL A CB  1 
ATOM   1752 C  CG1 . VAL B 2 127 ? -30.284  35.346  -21.694 1.00 26.40  ? 165 VAL A CG1 1 
ATOM   1753 C  CG2 . VAL B 2 127 ? -28.990  35.669  -23.805 1.00 25.95  ? 165 VAL A CG2 1 
ATOM   1754 N  N   . TRP B 2 128 ? -31.712  38.631  -21.605 1.00 26.04  ? 166 TRP A N   1 
ATOM   1755 C  CA  . TRP B 2 128 ? -32.589  39.140  -20.537 1.00 25.17  ? 166 TRP A CA  1 
ATOM   1756 C  C   . TRP B 2 128 ? -33.886  39.703  -21.071 1.00 24.60  ? 166 TRP A C   1 
ATOM   1757 O  O   . TRP B 2 128 ? -34.911  39.557  -20.418 1.00 25.90  ? 166 TRP A O   1 
ATOM   1758 C  CB  . TRP B 2 128 ? -31.877  40.178  -19.675 1.00 25.24  ? 166 TRP A CB  1 
ATOM   1759 C  CG  . TRP B 2 128 ? -30.842  39.568  -18.793 1.00 24.46  ? 166 TRP A CG  1 
ATOM   1760 C  CD1 . TRP B 2 128 ? -29.560  39.336  -19.116 1.00 24.46  ? 166 TRP A CD1 1 
ATOM   1761 C  CD2 . TRP B 2 128 ? -31.017  39.100  -17.451 1.00 24.15  ? 166 TRP A CD2 1 
ATOM   1762 N  NE1 . TRP B 2 128 ? -28.906  38.758  -18.066 1.00 25.31  ? 166 TRP A NE1 1 
ATOM   1763 C  CE2 . TRP B 2 128 ? -29.777  38.607  -17.023 1.00 24.53  ? 166 TRP A CE2 1 
ATOM   1764 C  CE3 . TRP B 2 128 ? -32.101  39.046  -16.571 1.00 24.75  ? 166 TRP A CE3 1 
ATOM   1765 C  CZ2 . TRP B 2 128 ? -29.576  38.062  -15.745 1.00 24.41  ? 166 TRP A CZ2 1 
ATOM   1766 C  CZ3 . TRP B 2 128 ? -31.894  38.504  -15.292 1.00 24.87  ? 166 TRP A CZ3 1 
ATOM   1767 C  CH2 . TRP B 2 128 ? -30.637  38.020  -14.904 1.00 24.56  ? 166 TRP A CH2 1 
ATOM   1768 N  N   . ALA B 2 129 ? -33.862  40.330  -22.247 1.00 23.88  ? 167 ALA A N   1 
ATOM   1769 C  CA  . ALA B 2 129 ? -35.100  40.827  -22.860 1.00 23.78  ? 167 ALA A CA  1 
ATOM   1770 C  C   . ALA B 2 129 ? -36.035  39.690  -23.221 1.00 24.36  ? 167 ALA A C   1 
ATOM   1771 O  O   . ALA B 2 129 ? -37.234  39.822  -23.064 1.00 23.55  ? 167 ALA A O   1 
ATOM   1772 C  CB  . ALA B 2 129 ? -34.803  41.664  -24.084 1.00 23.82  ? 167 ALA A CB  1 
ATOM   1773 N  N   . ILE B 2 130 ? -35.484  38.570  -23.687 1.00 26.04  ? 168 ILE A N   1 
ATOM   1774 C  CA  . ILE B 2 130 ? -36.280  37.358  -23.975 1.00 27.08  ? 168 ILE A CA  1 
ATOM   1775 C  C   . ILE B 2 130 ? -36.831  36.745  -22.687 1.00 27.25  ? 168 ILE A C   1 
ATOM   1776 O  O   . ILE B 2 130 ? -37.982  36.338  -22.649 1.00 26.17  ? 168 ILE A O   1 
ATOM   1777 C  CB  . ILE B 2 130 ? -35.453  36.292  -24.733 1.00 27.19  ? 168 ILE A CB  1 
ATOM   1778 C  CG1 . ILE B 2 130 ? -35.102  36.790  -26.139 1.00 27.53  ? 168 ILE A CG1 1 
ATOM   1779 C  CG2 . ILE B 2 130 ? -36.205  34.977  -24.846 1.00 26.93  ? 168 ILE A CG2 1 
ATOM   1780 C  CD1 . ILE B 2 130 ? -33.872  36.110  -26.718 1.00 27.90  ? 168 ILE A CD1 1 
ATOM   1781 N  N   . SER B 2 131 ? -36.001  36.664  -21.650 1.00 27.87  ? 169 SER A N   1 
ATOM   1782 C  CA  . SER B 2 131 ? -36.449  36.193  -20.337 1.00 29.51  ? 169 SER A CA  1 
ATOM   1783 C  C   . SER B 2 131 ? -37.635  37.013  -19.819 1.00 30.92  ? 169 SER A C   1 
ATOM   1784 O  O   . SER B 2 131 ? -38.652  36.448  -19.404 1.00 31.87  ? 169 SER A O   1 
ATOM   1785 C  CB  . SER B 2 131 ? -35.313  36.258  -19.317 1.00 30.01  ? 169 SER A CB  1 
ATOM   1786 O  OG  . SER B 2 131 ? -34.220  35.448  -19.719 1.00 31.00  ? 169 SER A OG  1 
ATOM   1787 N  N   . ALA B 2 132 ? -37.498  38.337  -19.875 1.00 30.35  ? 170 ALA A N   1 
ATOM   1788 C  CA  . ALA B 2 132 ? -38.555  39.257  -19.471 1.00 29.97  ? 170 ALA A CA  1 
ATOM   1789 C  C   . ALA B 2 132 ? -39.859  39.064  -20.244 1.00 29.22  ? 170 ALA A C   1 
ATOM   1790 O  O   . ALA B 2 132 ? -40.935  38.976  -19.651 1.00 28.28  ? 170 ALA A O   1 
ATOM   1791 C  CB  . ALA B 2 132 ? -38.064  40.685  -19.630 1.00 30.47  ? 170 ALA A CB  1 
ATOM   1792 N  N   . LEU B 2 133 ? -39.750  38.983  -21.566 1.00 29.41  ? 171 LEU A N   1 
ATOM   1793 C  CA  . LEU B 2 133 ? -40.921  38.861  -22.428 1.00 30.07  ? 171 LEU A CA  1 
ATOM   1794 C  C   . LEU B 2 133 ? -41.621  37.508  -22.337 1.00 31.25  ? 171 LEU A C   1 
ATOM   1795 O  O   . LEU B 2 133 ? -42.775  37.407  -22.724 1.00 33.01  ? 171 LEU A O   1 
ATOM   1796 C  CB  . LEU B 2 133 ? -40.548  39.141  -23.885 1.00 30.24  ? 171 LEU A CB  1 
ATOM   1797 C  CG  . LEU B 2 133 ? -40.072  40.555  -24.185 1.00 30.68  ? 171 LEU A CG  1 
ATOM   1798 C  CD1 . LEU B 2 133 ? -39.542  40.614  -25.606 1.00 30.93  ? 171 LEU A CD1 1 
ATOM   1799 C  CD2 . LEU B 2 133 ? -41.159  41.588  -23.962 1.00 31.13  ? 171 LEU A CD2 1 
ATOM   1800 N  N   . VAL B 2 134 ? -40.937  36.472  -21.863 1.00 32.38  ? 172 VAL A N   1 
ATOM   1801 C  CA  . VAL B 2 134 ? -41.560  35.164  -21.660 1.00 33.51  ? 172 VAL A CA  1 
ATOM   1802 C  C   . VAL B 2 134 ? -42.136  35.050  -20.253 1.00 33.76  ? 172 VAL A C   1 
ATOM   1803 O  O   . VAL B 2 134 ? -43.041  34.258  -20.029 1.00 33.82  ? 172 VAL A O   1 
ATOM   1804 C  CB  . VAL B 2 134 ? -40.555  34.030  -21.912 1.00 36.28  ? 172 VAL A CB  1 
ATOM   1805 C  CG1 . VAL B 2 134 ? -41.169  32.674  -21.632 1.00 37.43  ? 172 VAL A CG1 1 
ATOM   1806 C  CG2 . VAL B 2 134 ? -40.097  34.055  -23.362 1.00 38.18  ? 172 VAL A CG2 1 
ATOM   1807 N  N   . SER B 2 135 ? -41.618  35.832  -19.308 1.00 33.90  ? 173 SER A N   1 
ATOM   1808 C  CA  . SER B 2 135 ? -42.062  35.774  -17.912 1.00 33.58  ? 173 SER A CA  1 
ATOM   1809 C  C   . SER B 2 135 ? -43.037  36.894  -17.544 1.00 33.59  ? 173 SER A C   1 
ATOM   1810 O  O   . SER B 2 135 ? -44.221  36.643  -17.335 1.00 33.55  ? 173 SER A O   1 
ATOM   1811 C  CB  . SER B 2 135 ? -40.856  35.832  -16.981 1.00 33.93  ? 173 SER A CB  1 
ATOM   1812 O  OG  . SER B 2 135 ? -40.309  37.137  -16.938 1.00 34.25  ? 173 SER A OG  1 
ATOM   1813 N  N   . PHE B 2 136 ? -42.542  38.128  -17.468 1.00 33.18  ? 174 PHE A N   1 
ATOM   1814 C  CA  . PHE B 2 136 ? -43.340  39.230  -16.931 1.00 32.27  ? 174 PHE A CA  1 
ATOM   1815 C  C   . PHE B 2 136 ? -44.496  39.554  -17.833 1.00 30.81  ? 174 PHE A C   1 
ATOM   1816 O  O   . PHE B 2 136 ? -45.621  39.613  -17.370 1.00 30.42  ? 174 PHE A O   1 
ATOM   1817 C  CB  . PHE B 2 136 ? -42.491  40.483  -16.656 1.00 33.48  ? 174 PHE A CB  1 
ATOM   1818 C  CG  . PHE B 2 136 ? -41.783  40.435  -15.331 1.00 34.44  ? 174 PHE A CG  1 
ATOM   1819 C  CD1 . PHE B 2 136 ? -42.409  40.893  -14.177 1.00 34.47  ? 174 PHE A CD1 1 
ATOM   1820 C  CD2 . PHE B 2 136 ? -40.513  39.889  -15.227 1.00 34.40  ? 174 PHE A CD2 1 
ATOM   1821 C  CE1 . PHE B 2 136 ? -41.773  40.826  -12.946 1.00 35.04  ? 174 PHE A CE1 1 
ATOM   1822 C  CE2 . PHE B 2 136 ? -39.870  39.822  -14.000 1.00 34.84  ? 174 PHE A CE2 1 
ATOM   1823 C  CZ  . PHE B 2 136 ? -40.500  40.296  -12.858 1.00 34.97  ? 174 PHE A CZ  1 
ATOM   1824 N  N   . LEU B 2 137 ? -44.232  39.718  -19.124 1.00 30.39  ? 175 LEU A N   1 
ATOM   1825 C  CA  . LEU B 2 137 ? -45.285  40.109  -20.053 1.00 30.97  ? 175 LEU A CA  1 
ATOM   1826 C  C   . LEU B 2 137 ? -46.493  39.148  -20.021 1.00 32.04  ? 175 LEU A C   1 
ATOM   1827 O  O   . LEU B 2 137 ? -47.620  39.607  -19.826 1.00 32.29  ? 175 LEU A O   1 
ATOM   1828 C  CB  . LEU B 2 137 ? -44.734  40.300  -21.471 1.00 30.41  ? 175 LEU A CB  1 
ATOM   1829 C  CG  . LEU B 2 137 ? -45.713  40.670  -22.583 1.00 30.87  ? 175 LEU A CG  1 
ATOM   1830 C  CD1 . LEU B 2 137 ? -46.425  41.980  -22.279 1.00 31.45  ? 175 LEU A CD1 1 
ATOM   1831 C  CD2 . LEU B 2 137 ? -44.974  40.752  -23.903 1.00 30.57  ? 175 LEU A CD2 1 
ATOM   1832 N  N   . PRO B 2 138 ? -46.277  37.827  -20.172 1.00 32.24  ? 176 PRO A N   1 
ATOM   1833 C  CA  . PRO B 2 138 ? -47.452  36.956  -20.187 1.00 32.65  ? 176 PRO A CA  1 
ATOM   1834 C  C   . PRO B 2 138 ? -48.094  36.726  -18.812 1.00 34.41  ? 176 PRO A C   1 
ATOM   1835 O  O   . PRO B 2 138 ? -49.297  36.502  -18.736 1.00 34.34  ? 176 PRO A O   1 
ATOM   1836 C  CB  . PRO B 2 138 ? -46.895  35.634  -20.736 1.00 32.29  ? 176 PRO A CB  1 
ATOM   1837 C  CG  . PRO B 2 138 ? -45.603  35.999  -21.375 1.00 31.82  ? 176 PRO A CG  1 
ATOM   1838 C  CD  . PRO B 2 138 ? -45.069  37.050  -20.463 1.00 31.31  ? 176 PRO A CD  1 
ATOM   1839 N  N   . ILE B 2 139 ? -47.305  36.757  -17.742 1.00 37.58  ? 177 ILE A N   1 
ATOM   1840 C  CA  . ILE B 2 139 ? -47.831  36.433  -16.417 1.00 39.96  ? 177 ILE A CA  1 
ATOM   1841 C  C   . ILE B 2 139 ? -48.584  37.611  -15.803 1.00 42.10  ? 177 ILE A C   1 
ATOM   1842 O  O   . ILE B 2 139 ? -49.681  37.428  -15.259 1.00 44.67  ? 177 ILE A O   1 
ATOM   1843 C  CB  . ILE B 2 139 ? -46.745  35.889  -15.474 1.00 39.54  ? 177 ILE A CB  1 
ATOM   1844 C  CG1 . ILE B 2 139 ? -46.184  34.563  -16.018 1.00 38.62  ? 177 ILE A CG1 1 
ATOM   1845 C  CG2 . ILE B 2 139 ? -47.312  35.677  -14.074 1.00 40.42  ? 177 ILE A CG2 1 
ATOM   1846 C  CD1 . ILE B 2 139 ? -44.878  34.141  -15.380 1.00 38.63  ? 177 ILE A CD1 1 
ATOM   1847 N  N   . MET B 2 140 ? -48.018  38.813  -15.907 1.00 43.20  ? 178 MET A N   1 
ATOM   1848 C  CA  . MET B 2 140 ? -48.700  40.024  -15.422 1.00 42.98  ? 178 MET A CA  1 
ATOM   1849 C  C   . MET B 2 140 ? -49.957  40.282  -16.262 1.00 42.77  ? 178 MET A C   1 
ATOM   1850 O  O   . MET B 2 140 ? -51.026  40.473  -15.701 1.00 48.42  ? 178 MET A O   1 
ATOM   1851 C  CB  . MET B 2 140 ? -47.789  41.261  -15.442 1.00 43.32  ? 178 MET A CB  1 
ATOM   1852 C  CG  . MET B 2 140 ? -46.499  41.136  -14.645 1.00 44.34  ? 178 MET A CG  1 
ATOM   1853 S  SD  . MET B 2 140 ? -46.626  40.629  -12.904 1.00 44.83  ? 178 MET A SD  1 
ATOM   1854 C  CE  . MET B 2 140 ? -47.836  41.785  -12.255 1.00 47.89  ? 178 MET A CE  1 
ATOM   1855 N  N   . MET B 2 141 ? -49.854  40.212  -17.587 1.00 40.07  ? 179 MET A N   1 
ATOM   1856 C  CA  . MET B 2 141 ? -51.022  40.453  -18.456 1.00 41.06  ? 179 MET A CA  1 
ATOM   1857 C  C   . MET B 2 141 ? -52.037  39.289  -18.476 1.00 41.06  ? 179 MET A C   1 
ATOM   1858 O  O   . MET B 2 141 ? -52.993  39.328  -19.263 1.00 39.73  ? 179 MET A O   1 
ATOM   1859 C  CB  . MET B 2 141 ? -50.588  40.767  -19.898 1.00 42.20  ? 179 MET A CB  1 
ATOM   1860 C  CG  . MET B 2 141 ? -49.677  41.986  -20.030 1.00 42.09  ? 179 MET A CG  1 
ATOM   1861 S  SD  . MET B 2 141 ? -50.501  43.551  -19.699 1.00 40.96  ? 179 MET A SD  1 
ATOM   1862 C  CE  . MET B 2 141 ? -51.393  43.713  -21.236 1.00 40.80  ? 179 MET A CE  1 
ATOM   1863 N  N   . HIS B 2 142 ? -51.832  38.263  -17.644 1.00 42.16  ? 180 HIS A N   1 
ATOM   1864 C  CA  . HIS B 2 142 ? -52.754  37.122  -17.502 1.00 45.91  ? 180 HIS A CA  1 
ATOM   1865 C  C   . HIS B 2 142 ? -52.822  36.206  -18.739 1.00 44.37  ? 180 HIS A C   1 
ATOM   1866 O  O   . HIS B 2 142 ? -53.756  35.415  -18.854 1.00 46.13  ? 180 HIS A O   1 
ATOM   1867 C  CB  . HIS B 2 142 ? -54.183  37.570  -17.116 1.00 50.05  ? 180 HIS A CB  1 
ATOM   1868 C  CG  . HIS B 2 142 ? -54.246  38.457  -15.913 1.00 54.77  ? 180 HIS A CG  1 
ATOM   1869 N  ND1 . HIS B 2 142 ? -54.448  37.976  -14.639 1.00 53.80  ? 180 HIS A ND1 1 
ATOM   1870 C  CD2 . HIS B 2 142 ? -54.156  39.804  -15.797 1.00 57.79  ? 180 HIS A CD2 1 
ATOM   1871 C  CE1 . HIS B 2 142 ? -54.462  38.986  -13.788 1.00 56.79  ? 180 HIS A CE1 1 
ATOM   1872 N  NE2 . HIS B 2 142 ? -54.291  40.107  -14.465 1.00 58.44  ? 180 HIS A NE2 1 
ATOM   1873 N  N   . TRP B 2 143 ? -51.837  36.280  -19.637 1.00 41.03  ? 181 TRP A N   1 
ATOM   1874 C  CA  . TRP B 2 143 ? -51.821  35.430  -20.833 1.00 37.60  ? 181 TRP A CA  1 
ATOM   1875 C  C   . TRP B 2 143 ? -51.527  33.973  -20.455 1.00 37.64  ? 181 TRP A C   1 
ATOM   1876 O  O   . TRP B 2 143 ? -51.994  33.043  -21.111 1.00 35.12  ? 181 TRP A O   1 
ATOM   1877 C  CB  . TRP B 2 143 ? -50.783  35.895  -21.849 1.00 35.31  ? 181 TRP A CB  1 
ATOM   1878 C  CG  . TRP B 2 143 ? -50.935  37.280  -22.362 1.00 33.60  ? 181 TRP A CG  1 
ATOM   1879 C  CD1 . TRP B 2 143 ? -51.950  38.139  -22.111 1.00 33.46  ? 181 TRP A CD1 1 
ATOM   1880 C  CD2 . TRP B 2 143 ? -50.048  37.957  -23.258 1.00 33.33  ? 181 TRP A CD2 1 
ATOM   1881 N  NE1 . TRP B 2 143 ? -51.753  39.322  -22.776 1.00 33.57  ? 181 TRP A NE1 1 
ATOM   1882 C  CE2 . TRP B 2 143 ? -50.589  39.240  -23.489 1.00 32.98  ? 181 TRP A CE2 1 
ATOM   1883 C  CE3 . TRP B 2 143 ? -48.835  37.610  -23.880 1.00 33.87  ? 181 TRP A CE3 1 
ATOM   1884 C  CZ2 . TRP B 2 143 ? -49.981  40.171  -24.340 1.00 32.62  ? 181 TRP A CZ2 1 
ATOM   1885 C  CZ3 . TRP B 2 143 ? -48.220  38.544  -24.722 1.00 32.95  ? 181 TRP A CZ3 1 
ATOM   1886 C  CH2 . TRP B 2 143 ? -48.812  39.800  -24.957 1.00 33.13  ? 181 TRP A CH2 1 
ATOM   1887 N  N   . TRP B 2 144 ? -50.746  33.785  -19.394 1.00 39.12  ? 182 TRP A N   1 
ATOM   1888 C  CA  . TRP B 2 144 ? -50.436  32.452  -18.874 1.00 42.38  ? 182 TRP A CA  1 
ATOM   1889 C  C   . TRP B 2 144 ? -51.642  31.683  -18.294 1.00 45.46  ? 182 TRP A C   1 
ATOM   1890 O  O   . TRP B 2 144 ? -51.553  30.463  -18.126 1.00 44.95  ? 182 TRP A O   1 
ATOM   1891 C  CB  . TRP B 2 144 ? -49.327  32.538  -17.821 1.00 43.24  ? 182 TRP A CB  1 
ATOM   1892 C  CG  . TRP B 2 144 ? -49.807  32.993  -16.484 1.00 43.58  ? 182 TRP A CG  1 
ATOM   1893 C  CD1 . TRP B 2 144 ? -50.416  34.168  -16.182 1.00 44.27  ? 182 TRP A CD1 1 
ATOM   1894 C  CD2 . TRP B 2 144 ? -49.723  32.263  -15.268 1.00 44.46  ? 182 TRP A CD2 1 
ATOM   1895 N  NE1 . TRP B 2 144 ? -50.714  34.219  -14.848 1.00 45.47  ? 182 TRP A NE1 1 
ATOM   1896 C  CE2 . TRP B 2 144 ? -50.307  33.056  -14.261 1.00 45.37  ? 182 TRP A CE2 1 
ATOM   1897 C  CE3 . TRP B 2 144 ? -49.208  31.008  -14.926 1.00 45.43  ? 182 TRP A CE3 1 
ATOM   1898 C  CZ2 . TRP B 2 144 ? -50.382  32.648  -12.927 1.00 47.03  ? 182 TRP A CZ2 1 
ATOM   1899 C  CZ3 . TRP B 2 144 ? -49.289  30.588  -13.604 1.00 47.73  ? 182 TRP A CZ3 1 
ATOM   1900 C  CH2 . TRP B 2 144 ? -49.880  31.406  -12.617 1.00 48.36  ? 182 TRP A CH2 1 
ATOM   1901 N  N   . ARG B 2 145 ? -52.744  32.395  -18.000 1.00 49.48  ? 183 ARG A N   1 
ATOM   1902 C  CA  . ARG B 2 145 ? -53.953  31.841  -17.341 1.00 49.04  ? 183 ARG A CA  1 
ATOM   1903 C  C   . ARG B 2 145 ? -54.652  30.719  -18.118 1.00 46.65  ? 183 ARG A C   1 
ATOM   1904 O  O   . ARG B 2 145 ? -54.880  30.837  -19.315 1.00 43.60  ? 183 ARG A O   1 
ATOM   1905 C  CB  . ARG B 2 145 ? -54.999  32.946  -17.109 1.00 51.97  ? 183 ARG A CB  1 
ATOM   1906 C  CG  . ARG B 2 145 ? -54.615  34.076  -16.165 1.00 55.31  ? 183 ARG A CG  1 
ATOM   1907 C  CD  . ARG B 2 145 ? -54.624  33.594  -14.737 1.00 61.06  ? 183 ARG A CD  1 
ATOM   1908 N  NE  . ARG B 2 145 ? -54.088  34.565  -13.791 1.00 68.12  ? 183 ARG A NE  1 
ATOM   1909 C  CZ  . ARG B 2 145 ? -54.788  35.494  -13.145 1.00 68.88  ? 183 ARG A CZ  1 
ATOM   1910 N  NH1 . ARG B 2 145 ? -56.095  35.647  -13.330 1.00 67.14  ? 183 ARG A NH1 1 
ATOM   1911 N  NH2 . ARG B 2 145 ? -54.154  36.300  -12.304 1.00 73.71  ? 183 ARG A NH2 1 
ATOM   1912 N  N   . ASP B 2 146 ? -55.007  29.648  -17.407 1.00 48.30  ? 184 ASP A N   1 
ATOM   1913 C  CA  . ASP B 2 146 ? -55.868  28.577  -17.931 1.00 51.03  ? 184 ASP A CA  1 
ATOM   1914 C  C   . ASP B 2 146 ? -57.351  28.922  -17.706 1.00 50.61  ? 184 ASP A C   1 
ATOM   1915 O  O   . ASP B 2 146 ? -57.700  29.535  -16.699 1.00 48.76  ? 184 ASP A O   1 
ATOM   1916 C  CB  . ASP B 2 146 ? -55.531  27.253  -17.226 1.00 53.49  ? 184 ASP A CB  1 
ATOM   1917 C  CG  . ASP B 2 146 ? -56.139  26.027  -17.914 1.00 55.85  ? 184 ASP A CG  1 
ATOM   1918 O  OD1 . ASP B 2 146 ? -56.434  26.102  -19.130 1.00 58.06  ? 184 ASP A OD1 1 
ATOM   1919 O  OD2 . ASP B 2 146 ? -56.298  24.976  -17.240 1.00 56.89  ? 184 ASP A OD2 1 
ATOM   1920 N  N   . GLU B 2 147 ? -58.211  28.523  -18.641 1.00 53.65  ? 185 GLU A N   1 
ATOM   1921 C  CA  . GLU B 2 147 ? -59.674  28.756  -18.534 1.00 58.05  ? 185 GLU A CA  1 
ATOM   1922 C  C   . GLU B 2 147 ? -60.355  27.858  -17.497 1.00 60.75  ? 185 GLU A C   1 
ATOM   1923 O  O   . GLU B 2 147 ? -61.319  28.277  -16.855 1.00 53.57  ? 185 GLU A O   1 
ATOM   1924 C  CB  . GLU B 2 147 ? -60.365  28.565  -19.890 1.00 58.64  ? 185 GLU A CB  1 
ATOM   1925 C  CG  . GLU B 2 147 ? -59.999  29.620  -20.921 1.00 60.67  ? 185 GLU A CG  1 
ATOM   1926 C  CD  . GLU B 2 147 ? -60.845  30.880  -20.845 1.00 61.79  ? 185 GLU A CD  1 
ATOM   1927 O  OE1 . GLU B 2 147 ? -61.075  31.505  -21.901 1.00 62.56  ? 185 GLU A OE1 1 
ATOM   1928 O  OE2 . GLU B 2 147 ? -61.270  31.257  -19.735 1.00 64.93  ? 185 GLU A OE2 1 
ATOM   1929 N  N   . ASP B 2 148 ? -59.848  26.630  -17.361 1.00 70.43  ? 186 ASP A N   1 
ATOM   1930 C  CA  . ASP B 2 148 ? -60.345  25.620  -16.404 1.00 75.28  ? 186 ASP A CA  1 
ATOM   1931 C  C   . ASP B 2 148 ? -60.852  26.229  -15.084 1.00 80.62  ? 186 ASP A C   1 
ATOM   1932 O  O   . ASP B 2 148 ? -60.192  27.111  -14.525 1.00 82.30  ? 186 ASP A O   1 
ATOM   1933 C  CB  . ASP B 2 148 ? -59.231  24.607  -16.098 1.00 77.23  ? 186 ASP A CB  1 
ATOM   1934 C  CG  . ASP B 2 148 ? -59.725  23.419  -15.297 1.00 77.40  ? 186 ASP A CG  1 
ATOM   1935 O  OD1 . ASP B 2 148 ? -60.248  22.465  -15.908 1.00 78.79  ? 186 ASP A OD1 1 
ATOM   1936 O  OD2 . ASP B 2 148 ? -59.590  23.436  -14.056 1.00 79.62  ? 186 ASP A OD2 1 
ATOM   1937 N  N   . PRO B 2 149 ? -62.023  25.769  -14.585 1.00 89.25  ? 187 PRO A N   1 
ATOM   1938 C  CA  . PRO B 2 149 ? -62.574  26.361  -13.358 1.00 89.30  ? 187 PRO A CA  1 
ATOM   1939 C  C   . PRO B 2 149 ? -61.744  26.115  -12.086 1.00 87.61  ? 187 PRO A C   1 
ATOM   1940 O  O   . PRO B 2 149 ? -61.614  27.037  -11.276 1.00 84.42  ? 187 PRO A O   1 
ATOM   1941 C  CB  . PRO B 2 149 ? -63.966  25.717  -13.248 1.00 90.33  ? 187 PRO A CB  1 
ATOM   1942 C  CG  . PRO B 2 149 ? -63.867  24.447  -14.017 1.00 89.98  ? 187 PRO A CG  1 
ATOM   1943 C  CD  . PRO B 2 149 ? -62.936  24.754  -15.148 1.00 90.32  ? 187 PRO A CD  1 
ATOM   1944 N  N   . GLN B 2 150 ? -61.190  24.909  -11.919 1.00 87.16  ? 188 GLN A N   1 
ATOM   1945 C  CA  . GLN B 2 150 ? -60.334  24.597  -10.749 1.00 89.27  ? 188 GLN A CA  1 
ATOM   1946 C  C   . GLN B 2 150 ? -59.034  25.418  -10.727 1.00 88.25  ? 188 GLN A C   1 
ATOM   1947 O  O   . GLN B 2 150 ? -58.562  25.816  -9.653  1.00 88.84  ? 188 GLN A O   1 
ATOM   1948 C  CB  . GLN B 2 150 ? -60.012  23.089  -10.657 1.00 90.17  ? 188 GLN A CB  1 
ATOM   1949 C  CG  . GLN B 2 150 ? -58.976  22.744  -9.580  1.00 89.71  ? 188 GLN A CG  1 
ATOM   1950 C  CD  . GLN B 2 150 ? -58.944  21.288  -9.179  1.00 87.09  ? 188 GLN A CD  1 
ATOM   1951 O  OE1 . GLN B 2 150 ? -59.957  20.599  -9.217  1.00 87.40  ? 188 GLN A OE1 1 
ATOM   1952 N  NE2 . GLN B 2 150 ? -57.772  20.818  -8.771  1.00 80.83  ? 188 GLN A NE2 1 
ATOM   1953 N  N   . ALA B 2 151 ? -58.457  25.640  -11.908 1.00 86.35  ? 189 ALA A N   1 
ATOM   1954 C  CA  . ALA B 2 151 ? -57.332  26.567  -12.076 1.00 86.19  ? 189 ALA A CA  1 
ATOM   1955 C  C   . ALA B 2 151 ? -57.752  27.992  -11.715 1.00 85.63  ? 189 ALA A C   1 
ATOM   1956 O  O   . ALA B 2 151 ? -57.044  28.695  -10.976 1.00 87.34  ? 189 ALA A O   1 
ATOM   1957 C  CB  . ALA B 2 151 ? -56.819  26.520  -13.508 1.00 85.12  ? 189 ALA A CB  1 
ATOM   1958 N  N   . LEU B 2 152 ? -58.918  28.390  -12.229 1.00 81.44  ? 190 LEU A N   1 
ATOM   1959 C  CA  . LEU B 2 152 ? -59.509  29.706  -11.971 1.00 78.11  ? 190 LEU A CA  1 
ATOM   1960 C  C   . LEU B 2 152 ? -59.876  29.930  -10.491 1.00 77.81  ? 190 LEU A C   1 
ATOM   1961 O  O   . LEU B 2 152 ? -60.001  31.082  -10.060 1.00 76.85  ? 190 LEU A O   1 
ATOM   1962 C  CB  . LEU B 2 152 ? -60.718  29.918  -12.901 1.00 77.17  ? 190 LEU A CB  1 
ATOM   1963 C  CG  . LEU B 2 152 ? -61.474  31.247  -12.957 1.00 76.95  ? 190 LEU A CG  1 
ATOM   1964 C  CD1 . LEU B 2 152 ? -60.549  32.413  -13.264 1.00 75.63  ? 190 LEU A CD1 1 
ATOM   1965 C  CD2 . LEU B 2 152 ? -62.589  31.145  -13.991 1.00 74.73  ? 190 LEU A CD2 1 
ATOM   1966 N  N   . LYS B 2 153 ? -60.049  28.846  -9.728  1.00 79.56  ? 191 LYS A N   1 
ATOM   1967 C  CA  . LYS B 2 153 ? -60.172  28.925  -8.258  1.00 81.18  ? 191 LYS A CA  1 
ATOM   1968 C  C   . LYS B 2 153 ? -58.871  29.325  -7.562  1.00 76.37  ? 191 LYS A C   1 
ATOM   1969 O  O   . LYS B 2 153 ? -58.915  30.052  -6.569  1.00 74.27  ? 191 LYS A O   1 
ATOM   1970 C  CB  . LYS B 2 153 ? -60.718  27.608  -7.661  1.00 87.23  ? 191 LYS A CB  1 
ATOM   1971 C  CG  . LYS B 2 153 ? -62.237  27.501  -7.805  1.00 91.90  ? 191 LYS A CG  1 
ATOM   1972 C  CD  . LYS B 2 153 ? -62.812  26.142  -7.442  1.00 93.86  ? 191 LYS A CD  1 
ATOM   1973 C  CE  . LYS B 2 153 ? -64.268  26.059  -7.888  1.00 95.29  ? 191 LYS A CE  1 
ATOM   1974 N  NZ  . LYS B 2 153 ? -64.922  24.771  -7.531  1.00 98.66  ? 191 LYS A NZ  1 
ATOM   1975 N  N   . CYS B 2 154 ? -57.732  28.848  -8.070  1.00 73.02  ? 192 CYS A N   1 
ATOM   1976 C  CA  . CYS B 2 154 ? -56.408  29.232  -7.541  1.00 70.95  ? 192 CYS A CA  1 
ATOM   1977 C  C   . CYS B 2 154 ? -56.009  30.680  -7.879  1.00 67.48  ? 192 CYS A C   1 
ATOM   1978 O  O   . CYS B 2 154 ? -55.299  31.349  -7.099  1.00 64.27  ? 192 CYS A O   1 
ATOM   1979 C  CB  . CYS B 2 154 ? -55.333  28.274  -8.048  1.00 71.43  ? 192 CYS A CB  1 
ATOM   1980 S  SG  . CYS B 2 154 ? -53.693  28.582  -7.342  1.00 74.39  ? 192 CYS A SG  1 
ATOM   1981 N  N   . TYR B 2 155 ? -56.462  31.162  -9.032  1.00 67.79  ? 193 TYR A N   1 
ATOM   1982 C  CA  . TYR B 2 155 ? -56.225  32.558  -9.407  1.00 71.11  ? 193 TYR A CA  1 
ATOM   1983 C  C   . TYR B 2 155 ? -57.023  33.533  -8.526  1.00 71.71  ? 193 TYR A C   1 
ATOM   1984 O  O   . TYR B 2 155 ? -56.555  34.632  -8.240  1.00 66.42  ? 193 TYR A O   1 
ATOM   1985 C  CB  . TYR B 2 155 ? -56.523  32.801  -10.901 1.00 72.39  ? 193 TYR A CB  1 
ATOM   1986 C  CG  . TYR B 2 155 ? -55.783  31.887  -11.879 1.00 75.11  ? 193 TYR A CG  1 
ATOM   1987 C  CD1 . TYR B 2 155 ? -54.478  31.448  -11.629 1.00 77.51  ? 193 TYR A CD1 1 
ATOM   1988 C  CD2 . TYR B 2 155 ? -56.389  31.469  -13.067 1.00 76.68  ? 193 TYR A CD2 1 
ATOM   1989 C  CE1 . TYR B 2 155 ? -53.807  30.622  -12.526 1.00 77.21  ? 193 TYR A CE1 1 
ATOM   1990 C  CE2 . TYR B 2 155 ? -55.720  30.650  -13.978 1.00 77.42  ? 193 TYR A CE2 1 
ATOM   1991 C  CZ  . TYR B 2 155 ? -54.431  30.228  -13.701 1.00 77.65  ? 193 TYR A CZ  1 
ATOM   1992 O  OH  . TYR B 2 155 ? -53.769  29.421  -14.595 1.00 75.94  ? 193 TYR A OH  1 
ATOM   1993 N  N   . GLN B 2 156 ? -58.209  33.114  -8.088  1.00 79.06  ? 194 GLN A N   1 
ATOM   1994 C  CA  . GLN B 2 156 ? -59.068  33.926  -7.211  1.00 82.81  ? 194 GLN A CA  1 
ATOM   1995 C  C   . GLN B 2 156 ? -58.671  33.871  -5.736  1.00 83.49  ? 194 GLN A C   1 
ATOM   1996 O  O   . GLN B 2 156 ? -58.800  34.878  -5.045  1.00 86.69  ? 194 GLN A O   1 
ATOM   1997 C  CB  . GLN B 2 156 ? -60.534  33.520  -7.383  1.00 87.32  ? 194 GLN A CB  1 
ATOM   1998 C  CG  . GLN B 2 156 ? -61.051  33.883  -8.783  1.00 91.50  ? 194 GLN A CG  1 
ATOM   1999 C  CD  . GLN B 2 156 ? -62.397  33.295  -9.124  1.00 97.69  ? 194 GLN A CD  1 
ATOM   2000 O  OE1 . GLN B 2 156 ? -62.884  32.370  -8.469  1.00 100.76 ? 194 GLN A OE1 1 
ATOM   2001 N  NE2 . GLN B 2 156 ? -63.009  33.835  -10.163 1.00 100.50 ? 194 GLN A NE2 1 
ATOM   2002 N  N   . ASP B 2 157 ? -58.222  32.703  -5.261  1.00 80.37  ? 195 ASP A N   1 
ATOM   2003 C  CA  . ASP B 2 157 ? -57.670  32.538  -3.893  1.00 76.04  ? 195 ASP A CA  1 
ATOM   2004 C  C   . ASP B 2 157 ? -56.288  33.231  -3.793  1.00 76.61  ? 195 ASP A C   1 
ATOM   2005 O  O   . ASP B 2 157 ? -55.349  32.845  -4.524  1.00 86.10  ? 195 ASP A O   1 
ATOM   2006 C  CB  . ASP B 2 157 ? -57.549  31.042  -3.540  1.00 73.94  ? 195 ASP A CB  1 
ATOM   2007 C  CG  . ASP B 2 157 ? -57.155  30.784  -2.073  1.00 71.85  ? 195 ASP A CG  1 
ATOM   2008 O  OD1 . ASP B 2 157 ? -56.824  31.722  -1.319  1.00 68.72  ? 195 ASP A OD1 1 
ATOM   2009 O  OD2 . ASP B 2 157 ? -57.173  29.603  -1.672  1.00 71.82  ? 195 ASP A OD2 1 
ATOM   2010 N  N   . PRO B 2 158 ? -56.150  34.251  -2.906  1.00 69.00  ? 196 PRO A N   1 
ATOM   2011 C  CA  . PRO B 2 158 ? -54.822  34.864  -2.701  1.00 67.11  ? 196 PRO A CA  1 
ATOM   2012 C  C   . PRO B 2 158 ? -53.831  33.996  -1.906  1.00 62.69  ? 196 PRO A C   1 
ATOM   2013 O  O   . PRO B 2 158 ? -52.623  34.250  -1.947  1.00 59.94  ? 196 PRO A O   1 
ATOM   2014 C  CB  . PRO B 2 158 ? -55.147  36.164  -1.939  1.00 66.85  ? 196 PRO A CB  1 
ATOM   2015 C  CG  . PRO B 2 158 ? -56.603  36.396  -2.153  1.00 65.35  ? 196 PRO A CG  1 
ATOM   2016 C  CD  . PRO B 2 158 ? -57.184  35.019  -2.192  1.00 67.02  ? 196 PRO A CD  1 
ATOM   2017 N  N   . GLY B 2 159 ? -54.350  33.007  -1.179  1.00 58.76  ? 197 GLY A N   1 
ATOM   2018 C  CA  . GLY B 2 159 ? -53.526  32.016  -0.503  1.00 56.59  ? 197 GLY A CA  1 
ATOM   2019 C  C   . GLY B 2 159 ? -52.998  30.942  -1.428  1.00 56.13  ? 197 GLY A C   1 
ATOM   2020 O  O   . GLY B 2 159 ? -52.067  30.231  -1.048  1.00 56.75  ? 197 GLY A O   1 
ATOM   2021 N  N   . CYS B 2 160 ? -53.592  30.806  -2.621  1.00 56.91  ? 198 CYS A N   1 
ATOM   2022 C  CA  . CYS B 2 160 ? -53.097  29.881  -3.654  1.00 58.54  ? 198 CYS A CA  1 
ATOM   2023 C  C   . CYS B 2 160 ? -52.160  30.587  -4.652  1.00 56.40  ? 198 CYS A C   1 
ATOM   2024 O  O   . CYS B 2 160 ? -52.497  31.639  -5.219  1.00 51.77  ? 198 CYS A O   1 
ATOM   2025 C  CB  . CYS B 2 160 ? -54.257  29.218  -4.403  1.00 62.46  ? 198 CYS A CB  1 
ATOM   2026 S  SG  . CYS B 2 160 ? -53.760  27.814  -5.445  1.00 68.29  ? 198 CYS A SG  1 
ATOM   2027 N  N   . CYS B 2 161 ? -50.978  29.993  -4.830  1.00 57.38  ? 199 CYS A N   1 
ATOM   2028 C  CA  . CYS B 2 161 ? -49.954  30.461  -5.767  1.00 54.60  ? 199 CYS A CA  1 
ATOM   2029 C  C   . CYS B 2 161 ? -49.332  29.259  -6.464  1.00 54.54  ? 199 CYS A C   1 
ATOM   2030 O  O   . CYS B 2 161 ? -48.111  29.164  -6.603  1.00 51.65  ? 199 CYS A O   1 
ATOM   2031 C  CB  . CYS B 2 161 ? -48.889  31.269  -5.016  1.00 52.53  ? 199 CYS A CB  1 
ATOM   2032 S  SG  . CYS B 2 161 ? -47.793  32.279  -6.038  1.00 48.61  ? 199 CYS A SG  1 
ATOM   2033 N  N   . ASP B 2 162 ? -50.187  28.328  -6.885  1.00 57.04  ? 200 ASP A N   1 
ATOM   2034 C  CA  . ASP B 2 162 ? -49.759  27.194  -7.697  1.00 58.00  ? 200 ASP A CA  1 
ATOM   2035 C  C   . ASP B 2 162 ? -49.452  27.681  -9.098  1.00 54.91  ? 200 ASP A C   1 
ATOM   2036 O  O   . ASP B 2 162 ? -49.978  28.709  -9.554  1.00 51.81  ? 200 ASP A O   1 
ATOM   2037 C  CB  . ASP B 2 162 ? -50.828  26.096  -7.782  1.00 59.57  ? 200 ASP A CB  1 
ATOM   2038 C  CG  . ASP B 2 162 ? -51.040  25.367  -6.469  1.00 61.47  ? 200 ASP A CG  1 
ATOM   2039 O  OD1 . ASP B 2 162 ? -50.132  25.378  -5.607  1.00 59.74  ? 200 ASP A OD1 1 
ATOM   2040 O  OD2 . ASP B 2 162 ? -52.124  24.763  -6.311  1.00 65.23  ? 200 ASP A OD2 1 
ATOM   2041 N  N   . PHE B 2 163 ? -48.589  26.922  -9.767  1.00 51.16  ? 201 PHE A N   1 
ATOM   2042 C  CA  . PHE B 2 163 ? -48.175  27.221  -11.120 1.00 48.75  ? 201 PHE A CA  1 
ATOM   2043 C  C   . PHE B 2 163 ? -49.066  26.425  -12.061 1.00 47.37  ? 201 PHE A C   1 
ATOM   2044 O  O   . PHE B 2 163 ? -48.855  25.236  -12.298 1.00 45.09  ? 201 PHE A O   1 
ATOM   2045 C  CB  . PHE B 2 163 ? -46.694  26.888  -11.319 1.00 48.69  ? 201 PHE A CB  1 
ATOM   2046 C  CG  . PHE B 2 163 ? -46.123  27.448  -12.587 1.00 47.80  ? 201 PHE A CG  1 
ATOM   2047 C  CD1 . PHE B 2 163 ? -46.027  28.826  -12.761 1.00 46.03  ? 201 PHE A CD1 1 
ATOM   2048 C  CD2 . PHE B 2 163 ? -45.694  26.608  -13.611 1.00 47.44  ? 201 PHE A CD2 1 
ATOM   2049 C  CE1 . PHE B 2 163 ? -45.523  29.362  -13.932 1.00 44.76  ? 201 PHE A CE1 1 
ATOM   2050 C  CE2 . PHE B 2 163 ? -45.176  27.139  -14.788 1.00 46.59  ? 201 PHE A CE2 1 
ATOM   2051 C  CZ  . PHE B 2 163 ? -45.095  28.517  -14.949 1.00 45.41  ? 201 PHE A CZ  1 
ATOM   2052 N  N   . VAL B 2 164 ? -50.098  27.096  -12.559 1.00 48.60  ? 202 VAL A N   1 
ATOM   2053 C  CA  . VAL B 2 164 ? -51.073  26.488  -13.446 1.00 49.97  ? 202 VAL A CA  1 
ATOM   2054 C  C   . VAL B 2 164 ? -51.178  27.377  -14.681 1.00 48.42  ? 202 VAL A C   1 
ATOM   2055 O  O   . VAL B 2 164 ? -51.465  28.567  -14.575 1.00 49.01  ? 202 VAL A O   1 
ATOM   2056 C  CB  . VAL B 2 164 ? -52.445  26.334  -12.755 1.00 52.25  ? 202 VAL A CB  1 
ATOM   2057 C  CG1 . VAL B 2 164 ? -53.424  25.612  -13.676 1.00 53.80  ? 202 VAL A CG1 1 
ATOM   2058 C  CG2 . VAL B 2 164 ? -52.299  25.584  -11.437 1.00 53.38  ? 202 VAL A CG2 1 
ATOM   2059 N  N   . THR B 2 165 ? -50.932  26.781  -15.844 1.00 44.03  ? 203 THR A N   1 
ATOM   2060 C  CA  . THR B 2 165 ? -50.856  27.512  -17.093 1.00 41.79  ? 203 THR A CA  1 
ATOM   2061 C  C   . THR B 2 165 ? -51.756  26.889  -18.134 1.00 41.37  ? 203 THR A C   1 
ATOM   2062 O  O   . THR B 2 165 ? -52.113  25.712  -18.027 1.00 41.88  ? 203 THR A O   1 
ATOM   2063 C  CB  . THR B 2 165 ? -49.444  27.409  -17.672 1.00 41.12  ? 203 THR A CB  1 
ATOM   2064 O  OG1 . THR B 2 165 ? -49.052  26.033  -17.677 1.00 40.12  ? 203 THR A OG1 1 
ATOM   2065 C  CG2 . THR B 2 165 ? -48.455  28.201  -16.865 1.00 41.49  ? 203 THR A CG2 1 
ATOM   2066 N  N   . ASN B 2 166 ? -52.076  27.664  -19.170 1.00 40.41  ? 204 ASN A N   1 
ATOM   2067 C  CA  . ASN B 2 166 ? -52.649  27.085  -20.388 1.00 40.70  ? 204 ASN A CA  1 
ATOM   2068 C  C   . ASN B 2 166 ? -51.620  26.179  -21.095 1.00 40.37  ? 204 ASN A C   1 
ATOM   2069 O  O   . ASN B 2 166 ? -50.456  26.079  -20.688 1.00 39.43  ? 204 ASN A O   1 
ATOM   2070 C  CB  . ASN B 2 166 ? -53.227  28.164  -21.325 1.00 41.72  ? 204 ASN A CB  1 
ATOM   2071 C  CG  . ASN B 2 166 ? -52.214  29.213  -21.733 1.00 41.78  ? 204 ASN A CG  1 
ATOM   2072 O  OD1 . ASN B 2 166 ? -51.162  28.885  -22.267 1.00 43.22  ? 204 ASN A OD1 1 
ATOM   2073 N  ND2 . ASN B 2 166 ? -52.541  30.484  -21.510 1.00 42.42  ? 204 ASN A ND2 1 
ATOM   2074 N  N   . ARG B 2 167 ? -52.067  25.502  -22.140 1.00 42.65  ? 205 ARG A N   1 
ATOM   2075 C  CA  . ARG B 2 167 ? -51.194  24.632  -22.929 1.00 46.13  ? 205 ARG A CA  1 
ATOM   2076 C  C   . ARG B 2 167 ? -50.044  25.440  -23.571 1.00 42.29  ? 205 ARG A C   1 
ATOM   2077 O  O   . ARG B 2 167 ? -48.867  25.182  -23.304 1.00 40.35  ? 205 ARG A O   1 
ATOM   2078 C  CB  . ARG B 2 167 ? -52.042  23.899  -23.979 1.00 53.60  ? 205 ARG A CB  1 
ATOM   2079 C  CG  . ARG B 2 167 ? -51.321  22.943  -24.926 1.00 60.39  ? 205 ARG A CG  1 
ATOM   2080 C  CD  . ARG B 2 167 ? -52.276  21.935  -25.602 1.00 66.35  ? 205 ARG A CD  1 
ATOM   2081 N  NE  . ARG B 2 167 ? -52.914  20.987  -24.661 1.00 68.85  ? 205 ARG A NE  1 
ATOM   2082 C  CZ  . ARG B 2 167 ? -54.217  20.942  -24.342 1.00 70.23  ? 205 ARG A CZ  1 
ATOM   2083 N  NH1 . ARG B 2 167 ? -54.631  20.043  -23.453 1.00 69.74  ? 205 ARG A NH1 1 
ATOM   2084 N  NH2 . ARG B 2 167 ? -55.124  21.760  -24.896 1.00 70.58  ? 205 ARG A NH2 1 
ATOM   2085 N  N   . ALA B 2 168 ? -50.421  26.451  -24.355 1.00 38.87  ? 206 ALA A N   1 
ATOM   2086 C  CA  . ALA B 2 168 ? -49.504  27.272  -25.145 1.00 36.97  ? 206 ALA A CA  1 
ATOM   2087 C  C   . ALA B 2 168 ? -48.347  27.830  -24.349 1.00 37.52  ? 206 ALA A C   1 
ATOM   2088 O  O   . ALA B 2 168 ? -47.194  27.746  -24.781 1.00 38.37  ? 206 ALA A O   1 
ATOM   2089 C  CB  . ALA B 2 168 ? -50.257  28.420  -25.798 1.00 37.23  ? 206 ALA A CB  1 
ATOM   2090 N  N   . TYR B 2 169 ? -48.654  28.417  -23.196 1.00 35.68  ? 207 TYR A N   1 
ATOM   2091 C  CA  . TYR B 2 169 ? -47.626  29.048  -22.375 1.00 33.17  ? 207 TYR A CA  1 
ATOM   2092 C  C   . TYR B 2 169 ? -46.645  28.023  -21.838 1.00 32.07  ? 207 TYR A C   1 
ATOM   2093 O  O   . TYR B 2 169 ? -45.453  28.269  -21.880 1.00 35.01  ? 207 TYR A O   1 
ATOM   2094 C  CB  . TYR B 2 169 ? -48.215  29.871  -21.214 1.00 31.53  ? 207 TYR A CB  1 
ATOM   2095 C  CG  . TYR B 2 169 ? -47.154  30.571  -20.404 1.00 29.34  ? 207 TYR A CG  1 
ATOM   2096 C  CD1 . TYR B 2 169 ? -46.669  31.815  -20.788 1.00 28.76  ? 207 TYR A CD1 1 
ATOM   2097 C  CD2 . TYR B 2 169 ? -46.593  29.966  -19.284 1.00 28.52  ? 207 TYR A CD2 1 
ATOM   2098 C  CE1 . TYR B 2 169 ? -45.672  32.442  -20.065 1.00 28.48  ? 207 TYR A CE1 1 
ATOM   2099 C  CE2 . TYR B 2 169 ? -45.587  30.583  -18.561 1.00 28.41  ? 207 TYR A CE2 1 
ATOM   2100 C  CZ  . TYR B 2 169 ? -45.138  31.823  -18.956 1.00 28.03  ? 207 TYR A CZ  1 
ATOM   2101 O  OH  . TYR B 2 169 ? -44.158  32.458  -18.247 1.00 27.87  ? 207 TYR A OH  1 
ATOM   2102 N  N   . ALA B 2 170 ? -47.128  26.893  -21.330 1.00 29.89  ? 208 ALA A N   1 
ATOM   2103 C  CA  . ALA B 2 170 ? -46.213  25.921  -20.718 1.00 28.77  ? 208 ALA A CA  1 
ATOM   2104 C  C   . ALA B 2 170 ? -45.308  25.276  -21.751 1.00 28.28  ? 208 ALA A C   1 
ATOM   2105 O  O   . ALA B 2 170 ? -44.151  24.985  -21.455 1.00 26.82  ? 208 ALA A O   1 
ATOM   2106 C  CB  . ALA B 2 170 ? -46.962  24.859  -19.959 1.00 29.46  ? 208 ALA A CB  1 
ATOM   2107 N  N   . ILE B 2 171 ? -45.846  25.055  -22.950 1.00 28.54  ? 209 ILE A N   1 
ATOM   2108 C  CA  . ILE B 2 171 ? -45.044  24.573  -24.082 1.00 28.44  ? 209 ILE A CA  1 
ATOM   2109 C  C   . ILE B 2 171 ? -44.001  25.628  -24.478 1.00 28.05  ? 209 ILE A C   1 
ATOM   2110 O  O   . ILE B 2 171 ? -42.795  25.368  -24.402 1.00 28.15  ? 209 ILE A O   1 
ATOM   2111 C  CB  . ILE B 2 171 ? -45.921  24.165  -25.297 1.00 28.34  ? 209 ILE A CB  1 
ATOM   2112 C  CG1 . ILE B 2 171 ? -46.780  22.942  -24.954 1.00 28.01  ? 209 ILE A CG1 1 
ATOM   2113 C  CG2 . ILE B 2 171 ? -45.061  23.860  -26.521 1.00 28.55  ? 209 ILE A CG2 1 
ATOM   2114 C  CD1 . ILE B 2 171 ? -47.905  22.687  -25.944 1.00 27.91  ? 209 ILE A CD1 1 
ATOM   2115 N  N   . ALA B 2 172 ? -44.482  26.814  -24.865 1.00 27.63  ? 210 ALA A N   1 
ATOM   2116 C  CA  . ALA B 2 172 ? -43.627  27.920  -25.318 1.00 27.37  ? 210 ALA A CA  1 
ATOM   2117 C  C   . ALA B 2 172 ? -42.535  28.315  -24.305 1.00 27.66  ? 210 ALA A C   1 
ATOM   2118 O  O   . ALA B 2 172 ? -41.358  28.434  -24.664 1.00 28.07  ? 210 ALA A O   1 
ATOM   2119 C  CB  . ALA B 2 172 ? -44.472  29.132  -25.673 1.00 26.83  ? 210 ALA A CB  1 
ATOM   2120 N  N   . SER B 2 173 ? -42.929  28.506  -23.049 1.00 27.51  ? 211 SER A N   1 
ATOM   2121 C  CA  . SER B 2 173 ? -41.989  28.883  -21.994 1.00 27.64  ? 211 SER A CA  1 
ATOM   2122 C  C   . SER B 2 173 ? -40.946  27.804  -21.748 1.00 27.47  ? 211 SER A C   1 
ATOM   2123 O  O   . SER B 2 173 ? -39.796  28.125  -21.484 1.00 28.42  ? 211 SER A O   1 
ATOM   2124 C  CB  . SER B 2 173 ? -42.709  29.238  -20.673 1.00 28.53  ? 211 SER A CB  1 
ATOM   2125 O  OG  . SER B 2 173 ? -43.062  28.094  -19.917 1.00 28.94  ? 211 SER A OG  1 
ATOM   2126 N  N   . SER B 2 174 ? -41.350  26.536  -21.828 1.00 27.25  ? 212 SER A N   1 
ATOM   2127 C  CA  . SER B 2 174 ? -40.412  25.420  -21.632 1.00 26.96  ? 212 SER A CA  1 
ATOM   2128 C  C   . SER B 2 174 ? -39.416  25.279  -22.795 1.00 25.43  ? 212 SER A C   1 
ATOM   2129 O  O   . SER B 2 174 ? -38.226  24.993  -22.592 1.00 24.92  ? 212 SER A O   1 
ATOM   2130 C  CB  . SER B 2 174 ? -41.156  24.101  -21.420 1.00 27.55  ? 212 SER A CB  1 
ATOM   2131 O  OG  . SER B 2 174 ? -41.896  24.126  -20.209 1.00 28.19  ? 212 SER A OG  1 
ATOM   2132 N  N   . ILE B 2 175 ? -39.915  25.488  -24.007 1.00 23.95  ? 213 ILE A N   1 
ATOM   2133 C  CA  . ILE B 2 175 ? -39.058  25.489  -25.199 1.00 22.88  ? 213 ILE A CA  1 
ATOM   2134 C  C   . ILE B 2 175 ? -38.042  26.641  -25.141 1.00 21.80  ? 213 ILE A C   1 
ATOM   2135 O  O   . ILE B 2 175 ? -36.839  26.431  -25.353 1.00 22.65  ? 213 ILE A O   1 
ATOM   2136 C  CB  . ILE B 2 175 ? -39.906  25.493  -26.508 1.00 22.32  ? 213 ILE A CB  1 
ATOM   2137 C  CG1 . ILE B 2 175 ? -40.554  24.115  -26.689 1.00 22.10  ? 213 ILE A CG1 1 
ATOM   2138 C  CG2 . ILE B 2 175 ? -39.053  25.824  -27.730 1.00 22.10  ? 213 ILE A CG2 1 
ATOM   2139 C  CD1 . ILE B 2 175 ? -41.613  24.052  -27.759 1.00 22.61  ? 213 ILE A CD1 1 
ATOM   2140 N  N   . ILE B 2 176 ? -38.525  27.841  -24.823 1.00 20.35  ? 214 ILE A N   1 
ATOM   2141 C  CA  . ILE B 2 176 ? -37.679  29.023  -24.812 1.00 19.91  ? 214 ILE A CA  1 
ATOM   2142 C  C   . ILE B 2 176 ? -36.709  29.005  -23.625 1.00 20.22  ? 214 ILE A C   1 
ATOM   2143 O  O   . ILE B 2 176 ? -35.540  29.340  -23.775 1.00 20.18  ? 214 ILE A O   1 
ATOM   2144 C  CB  . ILE B 2 176 ? -38.524  30.310  -24.892 1.00 19.47  ? 214 ILE A CB  1 
ATOM   2145 C  CG1 . ILE B 2 176 ? -39.210  30.364  -26.261 1.00 19.70  ? 214 ILE A CG1 1 
ATOM   2146 C  CG2 . ILE B 2 176 ? -37.671  31.552  -24.714 1.00 19.39  ? 214 ILE A CG2 1 
ATOM   2147 C  CD1 . ILE B 2 176 ? -40.220  31.482  -26.433 1.00 20.04  ? 214 ILE A CD1 1 
ATOM   2148 N  N   . SER B 2 177 ? -37.161  28.575  -22.462 1.00 21.30  ? 215 SER A N   1 
ATOM   2149 C  CA  . SER B 2 177 ? -36.286  28.556  -21.296 1.00 22.77  ? 215 SER A CA  1 
ATOM   2150 C  C   . SER B 2 177 ? -35.316  27.377  -21.272 1.00 23.52  ? 215 SER A C   1 
ATOM   2151 O  O   . SER B 2 177 ? -34.210  27.514  -20.740 1.00 23.55  ? 215 SER A O   1 
ATOM   2152 C  CB  . SER B 2 177 ? -37.102  28.555  -20.004 1.00 23.21  ? 215 SER A CB  1 
ATOM   2153 O  OG  . SER B 2 177 ? -38.073  29.580  -20.024 1.00 24.00  ? 215 SER A OG  1 
ATOM   2154 N  N   . PHE B 2 178 ? -35.718  26.227  -21.811 1.00 24.27  ? 216 PHE A N   1 
ATOM   2155 C  CA  . PHE B 2 178 ? -34.950  25.006  -21.603 1.00 25.85  ? 216 PHE A CA  1 
ATOM   2156 C  C   . PHE B 2 178 ? -34.581  24.210  -22.853 1.00 27.38  ? 216 PHE A C   1 
ATOM   2157 O  O   . PHE B 2 178 ? -33.402  23.843  -23.020 1.00 28.64  ? 216 PHE A O   1 
ATOM   2158 C  CB  . PHE B 2 178 ? -35.691  24.092  -20.650 1.00 26.50  ? 216 PHE A CB  1 
ATOM   2159 C  CG  . PHE B 2 178 ? -34.967  22.811  -20.375 1.00 27.52  ? 216 PHE A CG  1 
ATOM   2160 C  CD1 . PHE B 2 178 ? -33.804  22.815  -19.622 1.00 28.19  ? 216 PHE A CD1 1 
ATOM   2161 C  CD2 . PHE B 2 178 ? -35.446  21.598  -20.872 1.00 28.29  ? 216 PHE A CD2 1 
ATOM   2162 C  CE1 . PHE B 2 178 ? -33.129  21.633  -19.362 1.00 29.32  ? 216 PHE A CE1 1 
ATOM   2163 C  CE2 . PHE B 2 178 ? -34.771  20.416  -20.623 1.00 28.70  ? 216 PHE A CE2 1 
ATOM   2164 C  CZ  . PHE B 2 178 ? -33.614  20.430  -19.860 1.00 28.92  ? 216 PHE A CZ  1 
ATOM   2165 N  N   . TYR B 2 179 ? -35.563  23.901  -23.702 1.00 27.62  ? 217 TYR A N   1 
ATOM   2166 C  CA  . TYR B 2 179 ? -35.322  22.942  -24.791 1.00 26.65  ? 217 TYR A CA  1 
ATOM   2167 C  C   . TYR B 2 179 ? -34.433  23.473  -25.908 1.00 25.28  ? 217 TYR A C   1 
ATOM   2168 O  O   . TYR B 2 179 ? -33.498  22.782  -26.305 1.00 28.10  ? 217 TYR A O   1 
ATOM   2169 C  CB  . TYR B 2 179 ? -36.636  22.358  -25.341 1.00 26.95  ? 217 TYR A CB  1 
ATOM   2170 C  CG  . TYR B 2 179 ? -37.313  21.452  -24.346 1.00 26.83  ? 217 TYR A CG  1 
ATOM   2171 C  CD1 . TYR B 2 179 ? -36.702  20.268  -23.936 1.00 27.12  ? 217 TYR A CD1 1 
ATOM   2172 C  CD2 . TYR B 2 179 ? -38.543  21.781  -23.790 1.00 26.56  ? 217 TYR A CD2 1 
ATOM   2173 C  CE1 . TYR B 2 179 ? -37.299  19.437  -22.999 1.00 27.35  ? 217 TYR A CE1 1 
ATOM   2174 C  CE2 . TYR B 2 179 ? -39.153  20.961  -22.854 1.00 26.78  ? 217 TYR A CE2 1 
ATOM   2175 C  CZ  . TYR B 2 179 ? -38.531  19.788  -22.466 1.00 27.24  ? 217 TYR A CZ  1 
ATOM   2176 O  OH  . TYR B 2 179 ? -39.143  18.953  -21.558 1.00 27.63  ? 217 TYR A OH  1 
ATOM   2177 N  N   . ILE B 2 180 ? -34.703  24.679  -26.407 1.00 23.43  ? 218 ILE A N   1 
ATOM   2178 C  CA  . ILE B 2 180 ? -33.804  25.289  -27.401 1.00 22.94  ? 218 ILE A CA  1 
ATOM   2179 C  C   . ILE B 2 180 ? -32.369  25.453  -26.845 1.00 23.62  ? 218 ILE A C   1 
ATOM   2180 O  O   . ILE B 2 180 ? -31.414  25.046  -27.509 1.00 23.53  ? 218 ILE A O   1 
ATOM   2181 C  CB  . ILE B 2 180 ? -34.371  26.607  -27.969 1.00 22.31  ? 218 ILE A CB  1 
ATOM   2182 C  CG1 . ILE B 2 180 ? -35.499  26.286  -28.962 1.00 21.71  ? 218 ILE A CG1 1 
ATOM   2183 C  CG2 . ILE B 2 180 ? -33.276  27.451  -28.628 1.00 21.78  ? 218 ILE A CG2 1 
ATOM   2184 C  CD1 . ILE B 2 180 ? -36.366  27.467  -29.314 1.00 21.33  ? 218 ILE A CD1 1 
ATOM   2185 N  N   . PRO B 2 181 ? -32.215  26.044  -25.631 1.00 24.29  ? 219 PRO A N   1 
ATOM   2186 C  CA  . PRO B 2 181 ? -30.888  26.071  -24.981 1.00 24.20  ? 219 PRO A CA  1 
ATOM   2187 C  C   . PRO B 2 181 ? -30.210  24.709  -24.889 1.00 24.87  ? 219 PRO A C   1 
ATOM   2188 O  O   . PRO B 2 181 ? -29.014  24.593  -25.215 1.00 25.54  ? 219 PRO A O   1 
ATOM   2189 C  CB  . PRO B 2 181 ? -31.202  26.601  -23.586 1.00 23.96  ? 219 PRO A CB  1 
ATOM   2190 C  CG  . PRO B 2 181 ? -32.322  27.556  -23.836 1.00 24.50  ? 219 PRO A CG  1 
ATOM   2191 C  CD  . PRO B 2 181 ? -33.159  26.950  -24.934 1.00 24.57  ? 219 PRO A CD  1 
ATOM   2192 N  N   . LEU B 2 182 ? -30.960  23.694  -24.462 1.00 24.68  ? 220 LEU A N   1 
ATOM   2193 C  CA  . LEU B 2 182 ? -30.418  22.349  -24.373 1.00 24.86  ? 220 LEU A CA  1 
ATOM   2194 C  C   . LEU B 2 182 ? -29.933  21.854  -25.725 1.00 24.68  ? 220 LEU A C   1 
ATOM   2195 O  O   . LEU B 2 182 ? -28.817  21.368  -25.833 1.00 24.34  ? 220 LEU A O   1 
ATOM   2196 C  CB  . LEU B 2 182 ? -31.447  21.384  -23.828 1.00 25.25  ? 220 LEU A CB  1 
ATOM   2197 C  CG  . LEU B 2 182 ? -31.049  19.908  -23.827 1.00 25.36  ? 220 LEU A CG  1 
ATOM   2198 C  CD1 . LEU B 2 182 ? -29.891  19.634  -22.877 1.00 25.27  ? 220 LEU A CD1 1 
ATOM   2199 C  CD2 . LEU B 2 182 ? -32.282  19.098  -23.449 1.00 26.05  ? 220 LEU A CD2 1 
ATOM   2200 N  N   . LEU B 2 183 ? -30.768  21.977  -26.749 1.00 24.66  ? 221 LEU A N   1 
ATOM   2201 C  CA  . LEU B 2 183 ? -30.369  21.526  -28.084 1.00 25.83  ? 221 LEU A CA  1 
ATOM   2202 C  C   . LEU B 2 183 ? -29.098  22.217  -28.584 1.00 26.12  ? 221 LEU A C   1 
ATOM   2203 O  O   . LEU B 2 183 ? -28.198  21.570  -29.123 1.00 25.07  ? 221 LEU A O   1 
ATOM   2204 C  CB  . LEU B 2 183 ? -31.479  21.717  -29.109 1.00 26.09  ? 221 LEU A CB  1 
ATOM   2205 C  CG  . LEU B 2 183 ? -32.664  20.756  -29.008 1.00 27.66  ? 221 LEU A CG  1 
ATOM   2206 C  CD1 . LEU B 2 183 ? -33.546  20.949  -30.241 1.00 28.78  ? 221 LEU A CD1 1 
ATOM   2207 C  CD2 . LEU B 2 183 ? -32.260  19.293  -28.822 1.00 27.51  ? 221 LEU A CD2 1 
ATOM   2208 N  N   . ILE B 2 184 ? -29.035  23.529  -28.390 1.00 26.42  ? 222 ILE A N   1 
ATOM   2209 C  CA  . ILE B 2 184 ? -27.866  24.284  -28.785 1.00 26.45  ? 222 ILE A CA  1 
ATOM   2210 C  C   . ILE B 2 184 ? -26.641  23.795  -27.989 1.00 27.11  ? 222 ILE A C   1 
ATOM   2211 O  O   . ILE B 2 184 ? -25.592  23.535  -28.569 1.00 26.28  ? 222 ILE A O   1 
ATOM   2212 C  CB  . ILE B 2 184 ? -28.083  25.806  -28.636 1.00 25.73  ? 222 ILE A CB  1 
ATOM   2213 C  CG1 . ILE B 2 184 ? -29.153  26.290  -29.616 1.00 24.57  ? 222 ILE A CG1 1 
ATOM   2214 C  CG2 . ILE B 2 184 ? -26.770  26.570  -28.897 1.00 26.25  ? 222 ILE A CG2 1 
ATOM   2215 C  CD1 . ILE B 2 184 ? -29.634  27.696  -29.351 1.00 24.41  ? 222 ILE A CD1 1 
ATOM   2216 N  N   . MET B 2 185 ? -26.788  23.630  -26.680 1.00 28.09  ? 223 MET A N   1 
ATOM   2217 C  CA  . MET B 2 185 ? -25.688  23.101  -25.862 1.00 29.23  ? 223 MET A CA  1 
ATOM   2218 C  C   . MET B 2 185 ? -25.192  21.715  -26.291 1.00 30.28  ? 223 MET A C   1 
ATOM   2219 O  O   . MET B 2 185 ? -23.998  21.458  -26.254 1.00 31.60  ? 223 MET A O   1 
ATOM   2220 C  CB  . MET B 2 185 ? -26.072  23.075  -24.381 1.00 29.24  ? 223 MET A CB  1 
ATOM   2221 C  CG  . MET B 2 185 ? -26.159  24.456  -23.764 1.00 29.38  ? 223 MET A CG  1 
ATOM   2222 S  SD  . MET B 2 185 ? -26.829  24.434  -22.103 1.00 30.63  ? 223 MET A SD  1 
ATOM   2223 C  CE  . MET B 2 185 ? -25.529  23.571  -21.210 1.00 29.37  ? 223 MET A CE  1 
ATOM   2224 N  N   . ILE B 2 186 ? -26.099  20.839  -26.711 1.00 33.18  ? 224 ILE A N   1 
ATOM   2225 C  CA  . ILE B 2 186 ? -25.723  19.495  -27.169 1.00 34.90  ? 224 ILE A CA  1 
ATOM   2226 C  C   . ILE B 2 186 ? -24.967  19.594  -28.491 1.00 36.47  ? 224 ILE A C   1 
ATOM   2227 O  O   . ILE B 2 186 ? -23.878  19.047  -28.634 1.00 39.64  ? 224 ILE A O   1 
ATOM   2228 C  CB  . ILE B 2 186 ? -26.949  18.586  -27.403 1.00 36.09  ? 224 ILE A CB  1 
ATOM   2229 C  CG1 . ILE B 2 186 ? -27.735  18.361  -26.100 1.00 36.82  ? 224 ILE A CG1 1 
ATOM   2230 C  CG2 . ILE B 2 186 ? -26.528  17.243  -27.991 1.00 35.95  ? 224 ILE A CG2 1 
ATOM   2231 C  CD1 . ILE B 2 186 ? -29.200  18.095  -26.338 1.00 36.57  ? 224 ILE A CD1 1 
ATOM   2232 N  N   . PHE B 2 187 ? -25.570  20.281  -29.454 1.00 37.82  ? 225 PHE A N   1 
ATOM   2233 C  CA  . PHE B 2 187 ? -24.972  20.470  -30.775 1.00 40.00  ? 225 PHE A CA  1 
ATOM   2234 C  C   . PHE B 2 187 ? -23.570  21.096  -30.705 1.00 38.07  ? 225 PHE A C   1 
ATOM   2235 O  O   . PHE B 2 187 ? -22.638  20.603  -31.323 1.00 38.57  ? 225 PHE A O   1 
ATOM   2236 C  CB  . PHE B 2 187 ? -25.907  21.321  -31.640 1.00 45.54  ? 225 PHE A CB  1 
ATOM   2237 C  CG  . PHE B 2 187 ? -25.292  21.800  -32.922 1.00 51.29  ? 225 PHE A CG  1 
ATOM   2238 C  CD1 . PHE B 2 187 ? -24.952  20.897  -33.926 1.00 54.35  ? 225 PHE A CD1 1 
ATOM   2239 C  CD2 . PHE B 2 187 ? -25.063  23.162  -33.134 1.00 56.78  ? 225 PHE A CD2 1 
ATOM   2240 C  CE1 . PHE B 2 187 ? -24.382  21.335  -35.115 1.00 56.63  ? 225 PHE A CE1 1 
ATOM   2241 C  CE2 . PHE B 2 187 ? -24.497  23.607  -34.321 1.00 59.22  ? 225 PHE A CE2 1 
ATOM   2242 C  CZ  . PHE B 2 187 ? -24.158  22.693  -35.316 1.00 58.19  ? 225 PHE A CZ  1 
ATOM   2243 N  N   . VAL B 2 188 ? -23.444  22.167  -29.933 1.00 36.78  ? 226 VAL A N   1 
ATOM   2244 C  CA  . VAL B 2 188 ? -22.203  22.927  -29.796 1.00 35.38  ? 226 VAL A CA  1 
ATOM   2245 C  C   . VAL B 2 188 ? -21.104  22.083  -29.162 1.00 34.37  ? 226 VAL A C   1 
ATOM   2246 O  O   . VAL B 2 188 ? -20.050  21.888  -29.765 1.00 34.53  ? 226 VAL A O   1 
ATOM   2247 C  CB  . VAL B 2 188 ? -22.431  24.250  -29.003 1.00 36.35  ? 226 VAL A CB  1 
ATOM   2248 C  CG1 . VAL B 2 188 ? -21.119  24.852  -28.515 1.00 36.29  ? 226 VAL A CG1 1 
ATOM   2249 C  CG2 . VAL B 2 188 ? -23.147  25.267  -29.879 1.00 37.25  ? 226 VAL A CG2 1 
ATOM   2250 N  N   . TYR B 2 189 ? -21.349  21.588  -27.954 1.00 33.45  ? 227 TYR A N   1 
ATOM   2251 C  CA  . TYR B 2 189 ? -20.346  20.781  -27.242 1.00 32.72  ? 227 TYR A CA  1 
ATOM   2252 C  C   . TYR B 2 189 ? -20.046  19.459  -27.944 1.00 32.90  ? 227 TYR A C   1 
ATOM   2253 O  O   . TYR B 2 189 ? -19.018  18.836  -27.663 1.00 32.12  ? 227 TYR A O   1 
ATOM   2254 C  CB  . TYR B 2 189 ? -20.761  20.493  -25.783 1.00 31.78  ? 227 TYR A CB  1 
ATOM   2255 C  CG  . TYR B 2 189 ? -20.574  21.664  -24.841 1.00 29.85  ? 227 TYR A CG  1 
ATOM   2256 C  CD1 . TYR B 2 189 ? -19.321  22.207  -24.637 1.00 29.76  ? 227 TYR A CD1 1 
ATOM   2257 C  CD2 . TYR B 2 189 ? -21.637  22.214  -24.139 1.00 28.91  ? 227 TYR A CD2 1 
ATOM   2258 C  CE1 . TYR B 2 189 ? -19.130  23.285  -23.782 1.00 29.39  ? 227 TYR A CE1 1 
ATOM   2259 C  CE2 . TYR B 2 189 ? -21.453  23.287  -23.292 1.00 28.85  ? 227 TYR A CE2 1 
ATOM   2260 C  CZ  . TYR B 2 189 ? -20.200  23.828  -23.123 1.00 28.49  ? 227 TYR A CZ  1 
ATOM   2261 O  OH  . TYR B 2 189 ? -20.013  24.894  -22.273 1.00 28.66  ? 227 TYR A OH  1 
ATOM   2262 N  N   . LEU B 2 190 ? -20.947  19.014  -28.819 1.00 33.39  ? 228 LEU A N   1 
ATOM   2263 C  CA  . LEU B 2 190 ? -20.674  17.857  -29.663 1.00 34.90  ? 228 LEU A CA  1 
ATOM   2264 C  C   . LEU B 2 190 ? -19.625  18.188  -30.733 1.00 36.52  ? 228 LEU A C   1 
ATOM   2265 O  O   . LEU B 2 190 ? -18.708  17.405  -30.969 1.00 37.87  ? 228 LEU A O   1 
ATOM   2266 C  CB  . LEU B 2 190 ? -21.964  17.344  -30.314 1.00 35.18  ? 228 LEU A CB  1 
ATOM   2267 C  CG  . LEU B 2 190 ? -21.900  15.965  -30.970 1.00 34.63  ? 228 LEU A CG  1 
ATOM   2268 C  CD1 . LEU B 2 190 ? -21.437  14.894  -29.983 1.00 34.53  ? 228 LEU A CD1 1 
ATOM   2269 C  CD2 . LEU B 2 190 ? -23.273  15.611  -31.513 1.00 34.21  ? 228 LEU A CD2 1 
ATOM   2270 N  N   . ARG B 2 191 ? -19.760  19.348  -31.369 1.00 37.42  ? 229 ARG A N   1 
ATOM   2271 C  CA  . ARG B 2 191 ? -18.743  19.830  -32.309 1.00 38.08  ? 229 ARG A CA  1 
ATOM   2272 C  C   . ARG B 2 191 ? -17.370  20.020  -31.646 1.00 35.60  ? 229 ARG A C   1 
ATOM   2273 O  O   . ARG B 2 191 ? -16.390  19.784  -32.289 1.00 36.15  ? 229 ARG A O   1 
ATOM   2274 C  CB  . ARG B 2 191 ? -19.199  21.090  -33.068 1.00 41.54  ? 229 ARG A CB  1 
ATOM   2275 C  CG  . ARG B 2 191 ? -20.130  20.778  -34.229 1.00 47.14  ? 229 ARG A CG  1 
ATOM   2276 C  CD  . ARG B 2 191 ? -20.744  22.033  -34.848 1.00 54.75  ? 229 ARG A CD  1 
ATOM   2277 N  NE  . ARG B 2 191 ? -19.927  22.701  -35.875 1.00 62.80  ? 229 ARG A NE  1 
ATOM   2278 C  CZ  . ARG B 2 191 ? -20.217  23.880  -36.461 1.00 66.17  ? 229 ARG A CZ  1 
ATOM   2279 N  NH1 . ARG B 2 191 ? -21.300  24.583  -36.123 1.00 66.80  ? 229 ARG A NH1 1 
ATOM   2280 N  NH2 . ARG B 2 191 ? -19.398  24.388  -37.388 1.00 67.78  ? 229 ARG A NH2 1 
ATOM   2281 N  N   . VAL B 2 192 ? -17.288  20.401  -30.375 1.00 34.99  ? 230 VAL A N   1 
ATOM   2282 C  CA  . VAL B 2 192 ? -15.993  20.424  -29.646 1.00 35.83  ? 230 VAL A CA  1 
ATOM   2283 C  C   . VAL B 2 192 ? -15.416  19.020  -29.548 1.00 37.27  ? 230 VAL A C   1 
ATOM   2284 O  O   . VAL B 2 192 ? -14.231  18.819  -29.788 1.00 38.10  ? 230 VAL A O   1 
ATOM   2285 C  CB  . VAL B 2 192 ? -16.084  21.003  -28.208 1.00 36.43  ? 230 VAL A CB  1 
ATOM   2286 C  CG1 . VAL B 2 192 ? -14.767  20.829  -27.446 1.00 35.69  ? 230 VAL A CG1 1 
ATOM   2287 C  CG2 . VAL B 2 192 ? -16.466  22.480  -28.245 1.00 37.63  ? 230 VAL A CG2 1 
ATOM   2288 N  N   . TYR B 2 193 ? -16.239  18.054  -29.168 1.00 40.05  ? 231 TYR A N   1 
ATOM   2289 C  CA  . TYR B 2 193 ? -15.783  16.669  -29.090 1.00 42.47  ? 231 TYR A CA  1 
ATOM   2290 C  C   . TYR B 2 193 ? -15.339  16.166  -30.452 1.00 43.75  ? 231 TYR A C   1 
ATOM   2291 O  O   . TYR B 2 193 ? -14.280  15.557  -30.572 1.00 43.97  ? 231 TYR A O   1 
ATOM   2292 C  CB  . TYR B 2 193 ? -16.874  15.757  -28.559 1.00 43.54  ? 231 TYR A CB  1 
ATOM   2293 C  CG  . TYR B 2 193 ? -16.514  14.287  -28.630 1.00 44.37  ? 231 TYR A CG  1 
ATOM   2294 C  CD1 . TYR B 2 193 ? -15.651  13.717  -27.691 1.00 45.17  ? 231 TYR A CD1 1 
ATOM   2295 C  CD2 . TYR B 2 193 ? -17.037  13.463  -29.634 1.00 43.85  ? 231 TYR A CD2 1 
ATOM   2296 C  CE1 . TYR B 2 193 ? -15.336  12.366  -27.738 1.00 45.53  ? 231 TYR A CE1 1 
ATOM   2297 C  CE2 . TYR B 2 193 ? -16.714  12.115  -29.700 1.00 43.76  ? 231 TYR A CE2 1 
ATOM   2298 C  CZ  . TYR B 2 193 ? -15.866  11.571  -28.754 1.00 45.39  ? 231 TYR A CZ  1 
ATOM   2299 O  OH  . TYR B 2 193 ? -15.547  10.239  -28.815 1.00 47.77  ? 231 TYR A OH  1 
ATOM   2300 N  N   . ARG B 2 194 ? -16.170  16.403  -31.465 1.00 46.56  ? 232 ARG A N   1 
ATOM   2301 C  CA  . ARG B 2 194 ? -15.838  16.022  -32.841 1.00 51.50  ? 232 ARG A CA  1 
ATOM   2302 C  C   . ARG B 2 194 ? -14.552  16.700  -33.333 1.00 48.08  ? 232 ARG A C   1 
ATOM   2303 O  O   . ARG B 2 194 ? -13.711  16.055  -33.927 1.00 48.30  ? 232 ARG A O   1 
ATOM   2304 C  CB  . ARG B 2 194 ? -16.990  16.332  -33.809 1.00 59.19  ? 232 ARG A CB  1 
ATOM   2305 C  CG  . ARG B 2 194 ? -18.177  15.378  -33.746 1.00 67.03  ? 232 ARG A CG  1 
ATOM   2306 C  CD  . ARG B 2 194 ? -19.182  15.683  -34.865 1.00 72.93  ? 232 ARG A CD  1 
ATOM   2307 N  NE  . ARG B 2 194 ? -20.508  15.110  -34.612 1.00 76.63  ? 232 ARG A NE  1 
ATOM   2308 C  CZ  . ARG B 2 194 ? -20.851  13.832  -34.794 1.00 78.24  ? 232 ARG A CZ  1 
ATOM   2309 N  NH1 . ARG B 2 194 ? -19.971  12.934  -35.249 1.00 78.95  ? 232 ARG A NH1 1 
ATOM   2310 N  NH2 . ARG B 2 194 ? -22.099  13.448  -34.513 1.00 78.68  ? 232 ARG A NH2 1 
ATOM   2311 N  N   . GLU B 2 195 ? -14.408  17.994  -33.076 1.00 45.27  ? 233 GLU A N   1 
ATOM   2312 C  CA  . GLU B 2 195 ? -13.231  18.749  -33.483 1.00 45.01  ? 233 GLU A CA  1 
ATOM   2313 C  C   . GLU B 2 195 ? -11.959  18.199  -32.849 1.00 44.46  ? 233 GLU A C   1 
ATOM   2314 O  O   . GLU B 2 195 ? -10.944  18.060  -33.523 1.00 42.29  ? 233 GLU A O   1 
ATOM   2315 C  CB  . GLU B 2 195 ? -13.391  20.226  -33.111 1.00 46.33  ? 233 GLU A CB  1 
ATOM   2316 C  CG  . GLU B 2 195 ? -12.553  21.203  -33.906 1.00 51.00  ? 233 GLU A CG  1 
ATOM   2317 C  CD  . GLU B 2 195 ? -12.998  21.370  -35.340 1.00 54.62  ? 233 GLU A CD  1 
ATOM   2318 O  OE1 . GLU B 2 195 ? -12.291  22.086  -36.066 1.00 62.05  ? 233 GLU A OE1 1 
ATOM   2319 O  OE2 . GLU B 2 195 ? -14.019  20.765  -35.739 1.00 56.38  ? 233 GLU A OE2 1 
ATOM   2320 N  N   . ALA B 2 196 ? -12.035  17.881  -31.561 1.00 44.35  ? 234 ALA A N   1 
ATOM   2321 C  CA  . ALA B 2 196 ? -10.914  17.302  -30.821 1.00 46.01  ? 234 ALA A CA  1 
ATOM   2322 C  C   . ALA B 2 196 ? -10.565  15.890  -31.312 1.00 49.06  ? 234 ALA A C   1 
ATOM   2323 O  O   . ALA B 2 196 ? -9.385   15.556  -31.483 1.00 48.90  ? 234 ALA A O   1 
ATOM   2324 C  CB  . ALA B 2 196 ? -11.207  17.292  -29.324 1.00 45.41  ? 234 ALA A CB  1 
ATOM   2325 N  N   . LYS B 2 197 ? -11.585  15.063  -31.525 1.00 54.12  ? 235 LYS A N   1 
ATOM   2326 C  CA  . LYS B 2 197 ? -11.369  13.727  -32.069 1.00 59.62  ? 235 LYS A CA  1 
ATOM   2327 C  C   . LYS B 2 197 ? -10.847  13.772  -33.509 1.00 60.04  ? 235 LYS A C   1 
ATOM   2328 O  O   . LYS B 2 197 ? -9.994   12.976  -33.881 1.00 63.33  ? 235 LYS A O   1 
ATOM   2329 C  CB  . LYS B 2 197 ? -12.647  12.885  -32.004 1.00 65.78  ? 235 LYS A CB  1 
ATOM   2330 C  CG  . LYS B 2 197 ? -12.395  11.413  -32.298 1.00 72.87  ? 235 LYS A CG  1 
ATOM   2331 C  CD  . LYS B 2 197 ? -13.536  10.510  -31.869 1.00 77.55  ? 235 LYS A CD  1 
ATOM   2332 C  CE  . LYS B 2 197 ? -13.110  9.053   -31.978 1.00 81.29  ? 235 LYS A CE  1 
ATOM   2333 N  NZ  . LYS B 2 197 ? -14.273  8.131   -31.889 1.00 87.65  ? 235 LYS A NZ  1 
ATOM   2334 N  N   . GLU B 2 198 ? -11.369  14.695  -34.306 1.00 61.59  ? 236 GLU A N   1 
ATOM   2335 C  CA  . GLU B 2 198 ? -10.947  14.869  -35.704 1.00 64.49  ? 236 GLU A CA  1 
ATOM   2336 C  C   . GLU B 2 198 ? -9.530   15.394  -35.817 1.00 62.57  ? 236 GLU A C   1 
ATOM   2337 O  O   . GLU B 2 198 ? -8.840   15.097  -36.789 1.00 66.56  ? 236 GLU A O   1 
ATOM   2338 C  CB  . GLU B 2 198 ? -11.882  15.814  -36.454 1.00 70.38  ? 236 GLU A CB  1 
ATOM   2339 C  CG  . GLU B 2 198 ? -11.710  15.736  -37.961 1.00 75.39  ? 236 GLU A CG  1 
ATOM   2340 C  CD  . GLU B 2 198 ? -12.636  16.645  -38.732 1.00 81.84  ? 236 GLU A CD  1 
ATOM   2341 O  OE1 . GLU B 2 198 ? -13.749  16.932  -38.232 1.00 82.71  ? 236 GLU A OE1 1 
ATOM   2342 O  OE2 . GLU B 2 198 ? -12.250  17.055  -39.857 1.00 85.67  ? 236 GLU A OE2 1 
ATOM   2343 N  N   . GLN B 2 199 ? -9.099   16.187  -34.845 1.00 60.24  ? 237 GLN A N   1 
ATOM   2344 C  CA  . GLN B 2 199 ? -7.721   16.683  -34.811 1.00 58.44  ? 237 GLN A CA  1 
ATOM   2345 C  C   . GLN B 2 199 ? -6.739   15.578  -34.424 1.00 55.69  ? 237 GLN A C   1 
ATOM   2346 O  O   . GLN B 2 199 ? -5.654   15.509  -34.985 1.00 57.94  ? 237 GLN A O   1 
ATOM   2347 C  CB  . GLN B 2 199 ? -7.599   17.881  -33.858 1.00 61.06  ? 237 GLN A CB  1 
ATOM   2348 C  CG  . GLN B 2 199 ? -6.218   18.529  -33.773 1.00 62.02  ? 237 GLN A CG  1 
ATOM   2349 C  CD  . GLN B 2 199 ? -5.688   19.005  -35.112 1.00 63.12  ? 237 GLN A CD  1 
ATOM   2350 O  OE1 . GLN B 2 199 ? -6.458   19.391  -35.999 1.00 65.55  ? 237 GLN A OE1 1 
ATOM   2351 N  NE2 . GLN B 2 199 ? -4.364   18.985  -35.263 1.00 59.65  ? 237 GLN A NE2 1 
ATOM   2352 N  N   . ILE B 2 200 ? -7.111   14.726  -33.472 1.00 52.97  ? 238 ILE A N   1 
ATOM   2353 C  CA  . ILE B 2 200 ? -6.286   13.565  -33.098 1.00 53.25  ? 238 ILE A CA  1 
ATOM   2354 C  C   . ILE B 2 200 ? -6.142   12.608  -34.276 1.00 52.63  ? 238 ILE A C   1 
ATOM   2355 O  O   . ILE B 2 200 ? -5.111   11.984  -34.442 1.00 53.77  ? 238 ILE A O   1 
ATOM   2356 C  CB  . ILE B 2 200 ? -6.848   12.822  -31.860 1.00 55.00  ? 238 ILE A CB  1 
ATOM   2357 C  CG1 . ILE B 2 200 ? -6.700   13.711  -30.612 1.00 56.88  ? 238 ILE A CG1 1 
ATOM   2358 C  CG2 . ILE B 2 200 ? -6.114   11.504  -31.616 1.00 54.97  ? 238 ILE A CG2 1 
ATOM   2359 C  CD1 . ILE B 2 200 ? -7.432   13.219  -29.386 1.00 58.06  ? 238 ILE A CD1 1 
ATOM   2360 N  N   . ARG B 2 201 ? -7.187   12.497  -35.083 1.00 57.58  ? 239 ARG A N   1 
ATOM   2361 C  CA  . ARG B 2 201 ? -7.163   11.707  -36.320 1.00 64.69  ? 239 ARG A CA  1 
ATOM   2362 C  C   . ARG B 2 201 ? -6.120   12.256  -37.319 1.00 63.98  ? 239 ARG A C   1 
ATOM   2363 O  O   . ARG B 2 201 ? -5.357   11.480  -37.902 1.00 62.08  ? 239 ARG A O   1 
ATOM   2364 C  CB  . ARG B 2 201 ? -8.573   11.657  -36.924 1.00 69.67  ? 239 ARG A CB  1 
ATOM   2365 C  CG  . ARG B 2 201 ? -8.816   10.740  -38.111 1.00 75.04  ? 239 ARG A CG  1 
ATOM   2366 C  CD  . ARG B 2 201 ? -10.254  10.880  -38.595 1.00 84.04  ? 239 ARG A CD  1 
ATOM   2367 N  NE  . ARG B 2 201 ? -10.554  12.223  -39.109 1.00 95.59  ? 239 ARG A NE  1 
ATOM   2368 C  CZ  . ARG B 2 201 ? -10.181  12.697  -40.305 1.00 106.96 ? 239 ARG A CZ  1 
ATOM   2369 N  NH1 . ARG B 2 201 ? -9.476   11.953  -41.160 1.00 114.59 ? 239 ARG A NH1 1 
ATOM   2370 N  NH2 . ARG B 2 201 ? -10.510  13.941  -40.662 1.00 107.26 ? 239 ARG A NH2 1 
ATOM   2371 N  N   . LYS B 2 202 ? -6.067   13.577  -37.491 1.00 65.37  ? 240 LYS A N   1 
ATOM   2372 C  CA  . LYS B 2 202 ? -5.084   14.200  -38.393 1.00 68.59  ? 240 LYS A CA  1 
ATOM   2373 C  C   . LYS B 2 202 ? -3.636   14.049  -37.915 1.00 65.79  ? 240 LYS A C   1 
ATOM   2374 O  O   . LYS B 2 202 ? -2.728   13.962  -38.741 1.00 64.41  ? 240 LYS A O   1 
ATOM   2375 C  CB  . LYS B 2 202 ? -5.412   15.674  -38.652 1.00 74.95  ? 240 LYS A CB  1 
ATOM   2376 C  CG  . LYS B 2 202 ? -6.616   15.845  -39.563 1.00 82.23  ? 240 LYS A CG  1 
ATOM   2377 C  CD  . LYS B 2 202 ? -7.105   17.278  -39.628 1.00 88.05  ? 240 LYS A CD  1 
ATOM   2378 C  CE  . LYS B 2 202 ? -8.493   17.333  -40.248 1.00 91.70  ? 240 LYS A CE  1 
ATOM   2379 N  NZ  . LYS B 2 202 ? -8.942   18.738  -40.425 1.00 97.45  ? 240 LYS A NZ  1 
ATOM   2380 N  N   . ILE B 2 203 ? -3.427   14.015  -36.597 1.00 64.91  ? 241 ILE A N   1 
ATOM   2381 C  CA  . ILE B 2 203 ? -2.098   13.767  -36.000 1.00 61.99  ? 241 ILE A CA  1 
ATOM   2382 C  C   . ILE B 2 203 ? -1.598   12.349  -36.301 1.00 62.73  ? 241 ILE A C   1 
ATOM   2383 O  O   . ILE B 2 203 ? -0.403   12.147  -36.500 1.00 63.74  ? 241 ILE A O   1 
ATOM   2384 C  CB  . ILE B 2 203 ? -2.092   14.021  -34.459 1.00 60.51  ? 241 ILE A CB  1 
ATOM   2385 C  CG1 . ILE B 2 203 ? -2.270   15.513  -34.156 1.00 57.46  ? 241 ILE A CG1 1 
ATOM   2386 C  CG2 . ILE B 2 203 ? -0.807   13.519  -33.796 1.00 61.29  ? 241 ILE A CG2 1 
ATOM   2387 C  CD1 . ILE B 2 203 ? -2.578   15.826  -32.708 1.00 56.54  ? 241 ILE A CD1 1 
ATOM   2388 N  N   . ASP B 2 204 ? -2.503   11.375  -36.331 1.00 65.04  ? 242 ASP A N   1 
ATOM   2389 C  CA  . ASP B 2 204 ? -2.140   9.982   -36.621 1.00 68.16  ? 242 ASP A CA  1 
ATOM   2390 C  C   . ASP B 2 204 ? -1.834   9.757   -38.100 1.00 70.97  ? 242 ASP A C   1 
ATOM   2391 O  O   . ASP B 2 204 ? -0.961   8.943   -38.429 1.00 71.02  ? 242 ASP A O   1 
ATOM   2392 C  CB  . ASP B 2 204 ? -3.238   9.030   -36.143 1.00 68.78  ? 242 ASP A CB  1 
ATOM   2393 C  CG  . ASP B 2 204 ? -3.450   9.098   -34.638 1.00 69.95  ? 242 ASP A CG  1 
ATOM   2394 O  OD1 . ASP B 2 204 ? -2.483   9.403   -33.906 1.00 67.85  ? 242 ASP A OD1 1 
ATOM   2395 O  OD2 . ASP B 2 204 ? -4.583   8.851   -34.173 1.00 76.43  ? 242 ASP A OD2 1 
ATOM   2396 N  N   . ARG B 2 205 ? -2.549   10.472  -38.969 1.00 72.37  ? 243 ARG A N   1 
ATOM   2397 C  CA  . ARG B 2 205 ? -2.241   10.522  -40.404 1.00 74.82  ? 243 ARG A CA  1 
ATOM   2398 C  C   . ARG B 2 205 ? -0.854   11.144  -40.694 1.00 73.83  ? 243 ARG A C   1 
ATOM   2399 O  O   . ARG B 2 205 ? -0.176   10.766  -41.658 1.00 71.07  ? 243 ARG A O   1 
ATOM   2400 C  CB  . ARG B 2 205 ? -3.326   11.291  -41.162 1.00 78.25  ? 243 ARG A CB  1 
ATOM   2401 C  CG  . ARG B 2 205 ? -3.033   11.349  -42.647 1.00 86.73  ? 243 ARG A CG  1 
ATOM   2402 C  CD  . ARG B 2 205 ? -4.162   11.772  -43.550 1.00 98.06  ? 243 ARG A CD  1 
ATOM   2403 N  NE  . ARG B 2 205 ? -3.659   11.797  -44.923 1.00 109.40 ? 243 ARG A NE  1 
ATOM   2404 C  CZ  . ARG B 2 205 ? -4.388   12.036  -46.017 1.00 118.68 ? 243 ARG A CZ  1 
ATOM   2405 N  NH1 . ARG B 2 205 ? -5.694   12.276  -45.928 1.00 120.14 ? 243 ARG A NH1 1 
ATOM   2406 N  NH2 . ARG B 2 205 ? -3.797   12.025  -47.209 1.00 125.16 ? 243 ARG A NH2 1 
ATOM   2407 N  N   . ALA B 2 206 ? -0.461   12.107  -39.872 1.00 74.24  ? 272 ALA A N   1 
ATOM   2408 C  CA  . ALA B 2 206 ? 0.842    12.759  -39.988 1.00 75.83  ? 272 ALA A CA  1 
ATOM   2409 C  C   . ALA B 2 206 ? 2.023    11.852  -39.698 1.00 78.30  ? 272 ALA A C   1 
ATOM   2410 O  O   . ALA B 2 206 ? 3.039    11.907  -40.401 1.00 83.34  ? 272 ALA A O   1 
ATOM   2411 C  CB  . ALA B 2 206 ? 0.911    13.939  -39.051 1.00 76.87  ? 272 ALA A CB  1 
ATOM   2412 N  N   . SER B 2 207 ? 1.903    11.018  -38.673 1.00 78.69  ? 273 SER A N   1 
ATOM   2413 C  CA  . SER B 2 207 ? 3.056    10.266  -38.173 1.00 82.50  ? 273 SER A CA  1 
ATOM   2414 C  C   . SER B 2 207 ? 3.621    9.168   -39.104 1.00 85.04  ? 273 SER A C   1 
ATOM   2415 O  O   . SER B 2 207 ? 4.599    8.514   -38.735 1.00 88.38  ? 273 SER A O   1 
ATOM   2416 C  CB  . SER B 2 207 ? 2.731    9.685   -36.797 1.00 83.43  ? 273 SER A CB  1 
ATOM   2417 O  OG  . SER B 2 207 ? 2.352    10.723  -35.911 1.00 84.71  ? 273 SER A OG  1 
ATOM   2418 N  N   . LYS B 2 208 ? 3.039    8.984   -40.296 1.00 86.36  ? 274 LYS A N   1 
ATOM   2419 C  CA  . LYS B 2 208 ? 3.486    7.969   -41.266 1.00 86.61  ? 274 LYS A CA  1 
ATOM   2420 C  C   . LYS B 2 208 ? 3.517    6.581   -40.615 1.00 85.59  ? 274 LYS A C   1 
ATOM   2421 O  O   . LYS B 2 208 ? 4.536    5.888   -40.648 1.00 92.37  ? 274 LYS A O   1 
ATOM   2422 C  CB  . LYS B 2 208 ? 4.858    8.316   -41.878 1.00 86.50  ? 274 LYS A CB  1 
ATOM   2423 C  CG  . LYS B 2 208 ? 4.983    9.701   -42.489 1.00 85.54  ? 274 LYS A CG  1 
ATOM   2424 C  CD  . LYS B 2 208 ? 4.029    9.924   -43.646 1.00 83.87  ? 274 LYS A CD  1 
ATOM   2425 C  CE  . LYS B 2 208 ? 4.352    11.240  -44.327 1.00 84.87  ? 274 LYS A CE  1 
ATOM   2426 N  NZ  . LYS B 2 208 ? 3.215    11.726  -45.147 1.00 87.61  ? 274 LYS A NZ  1 
ATOM   2427 N  N   . ARG B 2 209 ? 2.401    6.214   -39.984 1.00 80.87  ? 275 ARG A N   1 
ATOM   2428 C  CA  . ARG B 2 209 ? 2.219    4.905   -39.362 1.00 76.60  ? 275 ARG A CA  1 
ATOM   2429 C  C   . ARG B 2 209 ? 3.239    4.590   -38.258 1.00 75.16  ? 275 ARG A C   1 
ATOM   2430 O  O   . ARG B 2 209 ? 3.443    3.423   -37.932 1.00 77.95  ? 275 ARG A O   1 
ATOM   2431 C  CB  . ARG B 2 209 ? 2.233    3.818   -40.441 1.00 76.91  ? 275 ARG A CB  1 
ATOM   2432 C  CG  . ARG B 2 209 ? 1.202    4.028   -41.553 1.00 81.92  ? 275 ARG A CG  1 
ATOM   2433 C  CD  . ARG B 2 209 ? -0.208   3.664   -41.117 1.00 84.70  ? 275 ARG A CD  1 
ATOM   2434 N  NE  . ARG B 2 209 ? -0.230   2.303   -40.590 1.00 93.25  ? 275 ARG A NE  1 
ATOM   2435 C  CZ  . ARG B 2 209 ? -1.266   1.712   -39.992 1.00 99.50  ? 275 ARG A CZ  1 
ATOM   2436 N  NH1 . ARG B 2 209 ? -2.438   2.325   -39.854 1.00 98.35  ? 275 ARG A NH1 1 
ATOM   2437 N  NH2 . ARG B 2 209 ? -1.127   0.467   -39.544 1.00 106.47 ? 275 ARG A NH2 1 
ATOM   2438 N  N   . LYS B 2 210 ? 3.857    5.621   -37.674 1.00 74.58  ? 276 LYS A N   1 
ATOM   2439 C  CA  . LYS B 2 210 ? 4.883    5.440   -36.643 1.00 74.55  ? 276 LYS A CA  1 
ATOM   2440 C  C   . LYS B 2 210 ? 4.278    5.471   -35.251 1.00 71.30  ? 276 LYS A C   1 
ATOM   2441 O  O   . LYS B 2 210 ? 4.710    4.706   -34.398 1.00 73.45  ? 276 LYS A O   1 
ATOM   2442 C  CB  . LYS B 2 210 ? 6.001    6.491   -36.749 1.00 80.03  ? 276 LYS A CB  1 
ATOM   2443 C  CG  . LYS B 2 210 ? 6.894    6.357   -37.986 1.00 82.81  ? 276 LYS A CG  1 
ATOM   2444 C  CD  . LYS B 2 210 ? 7.928    5.237   -37.845 1.00 81.53  ? 276 LYS A CD  1 
ATOM   2445 C  CE  . LYS B 2 210 ? 8.461    4.765   -39.190 1.00 79.31  ? 276 LYS A CE  1 
ATOM   2446 N  NZ  . LYS B 2 210 ? 9.112    3.436   -39.068 1.00 78.16  ? 276 LYS A NZ  1 
ATOM   2447 N  N   . THR B 2 211 ? 3.302    6.353   -35.018 1.00 70.11  ? 277 THR A N   1 
ATOM   2448 C  CA  . THR B 2 211 ? 2.567    6.411   -33.739 1.00 68.62  ? 277 THR A CA  1 
ATOM   2449 C  C   . THR B 2 211 ? 1.054    6.501   -33.937 1.00 64.94  ? 277 THR A C   1 
ATOM   2450 O  O   . THR B 2 211 ? 0.578    7.046   -34.940 1.00 62.72  ? 277 THR A O   1 
ATOM   2451 C  CB  . THR B 2 211 ? 2.973    7.629   -32.892 1.00 70.60  ? 277 THR A CB  1 
ATOM   2452 O  OG1 . THR B 2 211 ? 2.907    8.808   -33.701 1.00 77.34  ? 277 THR A OG1 1 
ATOM   2453 C  CG2 . THR B 2 211 ? 4.371    7.482   -32.359 1.00 71.69  ? 277 THR A CG2 1 
ATOM   2454 N  N   . SER B 2 212 ? 0.324    5.952   -32.961 1.00 62.29  ? 278 SER A N   1 
ATOM   2455 C  CA  . SER B 2 212 ? -1.122   6.126   -32.805 1.00 57.44  ? 278 SER A CA  1 
ATOM   2456 C  C   . SER B 2 212 ? -1.353   6.832   -31.485 1.00 58.20  ? 278 SER A C   1 
ATOM   2457 O  O   . SER B 2 212 ? -0.879   6.366   -30.455 1.00 56.43  ? 278 SER A O   1 
ATOM   2458 C  CB  . SER B 2 212 ? -1.825   4.780   -32.755 1.00 53.68  ? 278 SER A CB  1 
ATOM   2459 O  OG  . SER B 2 212 ? -1.835   4.179   -34.028 1.00 52.96  ? 278 SER A OG  1 
ATOM   2460 N  N   . ARG B 2 213 ? -2.085   7.943   -31.516 1.00 62.39  ? 279 ARG A N   1 
ATOM   2461 C  CA  . ARG B 2 213 ? -2.410   8.716   -30.308 1.00 64.25  ? 279 ARG A CA  1 
ATOM   2462 C  C   . ARG B 2 213 ? -3.397   7.976   -29.413 1.00 61.16  ? 279 ARG A C   1 
ATOM   2463 O  O   . ARG B 2 213 ? -4.280   7.274   -29.909 1.00 55.06  ? 279 ARG A O   1 
ATOM   2464 C  CB  . ARG B 2 213 ? -3.004   10.089  -30.674 1.00 68.85  ? 279 ARG A CB  1 
ATOM   2465 C  CG  . ARG B 2 213 ? -1.982   11.209  -30.749 1.00 71.90  ? 279 ARG A CG  1 
ATOM   2466 C  CD  . ARG B 2 213 ? -1.565   11.677  -29.356 1.00 76.77  ? 279 ARG A CD  1 
ATOM   2467 N  NE  . ARG B 2 213 ? -2.047   13.034  -29.047 1.00 80.64  ? 279 ARG A NE  1 
ATOM   2468 C  CZ  . ARG B 2 213 ? -2.983   13.383  -28.153 1.00 79.30  ? 279 ARG A CZ  1 
ATOM   2469 N  NH1 . ARG B 2 213 ? -3.636   12.491  -27.401 1.00 79.63  ? 279 ARG A NH1 1 
ATOM   2470 N  NH2 . ARG B 2 213 ? -3.267   14.678  -28.006 1.00 78.05  ? 279 ARG A NH2 1 
ATOM   2471 N  N   . VAL B 2 214 ? -3.235   8.151   -28.102 1.00 61.49  ? 280 VAL A N   1 
ATOM   2472 C  CA  . VAL B 2 214 ? -4.201   7.673   -27.101 1.00 66.06  ? 280 VAL A CA  1 
ATOM   2473 C  C   . VAL B 2 214 ? -4.708   8.895   -26.315 1.00 65.51  ? 280 VAL A C   1 
ATOM   2474 O  O   . VAL B 2 214 ? -4.136   9.988   -26.433 1.00 65.80  ? 280 VAL A O   1 
ATOM   2475 C  CB  . VAL B 2 214 ? -3.554   6.629   -26.155 1.00 68.49  ? 280 VAL A CB  1 
ATOM   2476 C  CG1 . VAL B 2 214 ? -4.580   6.009   -25.202 1.00 68.23  ? 280 VAL A CG1 1 
ATOM   2477 C  CG2 . VAL B 2 214 ? -2.878   5.538   -26.970 1.00 70.27  ? 280 VAL A CG2 1 
ATOM   2478 N  N   . MET B 2 215 ? -5.795   8.733   -25.556 1.00 61.88  ? 281 MET A N   1 
ATOM   2479 C  CA  . MET B 2 215 ? -6.228   9.789   -24.627 1.00 58.75  ? 281 MET A CA  1 
ATOM   2480 C  C   . MET B 2 215 ? -5.254   10.062  -23.461 1.00 54.45  ? 281 MET A C   1 
ATOM   2481 O  O   . MET B 2 215 ? -4.998   9.224   -22.597 1.00 50.22  ? 281 MET A O   1 
ATOM   2482 C  CB  . MET B 2 215 ? -7.624   9.513   -24.080 1.00 58.78  ? 281 MET A CB  1 
ATOM   2483 C  CG  . MET B 2 215 ? -8.723   9.612   -25.115 1.00 59.45  ? 281 MET A CG  1 
ATOM   2484 S  SD  . MET B 2 215 ? -10.314  9.898   -24.319 1.00 61.01  ? 281 MET A SD  1 
ATOM   2485 C  CE  . MET B 2 215 ? -10.539  8.423   -23.322 1.00 61.73  ? 281 MET A CE  1 
ATOM   2486 N  N   . ALA B 2 216 ? -4.723   11.278  -23.465 1.00 53.62  ? 282 ALA A N   1 
ATOM   2487 C  CA  . ALA B 2 216 ? -3.787   11.747  -22.455 1.00 55.59  ? 282 ALA A CA  1 
ATOM   2488 C  C   . ALA B 2 216 ? -4.555   12.317  -21.268 1.00 55.20  ? 282 ALA A C   1 
ATOM   2489 O  O   . ALA B 2 216 ? -5.784   12.332  -21.267 1.00 52.82  ? 282 ALA A O   1 
ATOM   2490 C  CB  . ALA B 2 216 ? -2.884   12.818  -23.074 1.00 56.43  ? 282 ALA A CB  1 
ATOM   2491 N  N   . MET B 2 217 ? -3.811   12.800  -20.266 1.00 57.46  ? 283 MET A N   1 
ATOM   2492 C  CA  . MET B 2 217 ? -4.366   13.506  -19.098 1.00 58.12  ? 283 MET A CA  1 
ATOM   2493 C  C   . MET B 2 217 ? -5.354   14.606  -19.511 1.00 53.08  ? 283 MET A C   1 
ATOM   2494 O  O   . MET B 2 217 ? -6.470   14.656  -19.014 1.00 51.93  ? 283 MET A O   1 
ATOM   2495 C  CB  . MET B 2 217 ? -3.216   14.114  -18.267 1.00 62.94  ? 283 MET A CB  1 
ATOM   2496 C  CG  . MET B 2 217 ? -3.623   14.895  -17.016 1.00 67.43  ? 283 MET A CG  1 
ATOM   2497 S  SD  . MET B 2 217 ? -4.416   13.901  -15.723 1.00 77.53  ? 283 MET A SD  1 
ATOM   2498 C  CE  . MET B 2 217 ? -5.592   15.067  -15.012 1.00 75.97  ? 283 MET A CE  1 
ATOM   2499 N  N   . LYS B 2 218 ? -4.935   15.460  -20.438 1.00 49.62  ? 284 LYS A N   1 
ATOM   2500 C  CA  . LYS B 2 218 ? -5.743   16.603  -20.860 1.00 48.36  ? 284 LYS A CA  1 
ATOM   2501 C  C   . LYS B 2 218 ? -7.044   16.192  -21.552 1.00 47.25  ? 284 LYS A C   1 
ATOM   2502 O  O   . LYS B 2 218 ? -8.062   16.873  -21.396 1.00 47.06  ? 284 LYS A O   1 
ATOM   2503 C  CB  . LYS B 2 218 ? -4.941   17.547  -21.772 1.00 48.38  ? 284 LYS A CB  1 
ATOM   2504 C  CG  . LYS B 2 218 ? -3.731   18.216  -21.139 1.00 47.77  ? 284 LYS A CG  1 
ATOM   2505 C  CD  . LYS B 2 218 ? -4.106   19.215  -20.056 1.00 48.25  ? 284 LYS A CD  1 
ATOM   2506 C  CE  . LYS B 2 218 ? -2.895   19.658  -19.280 1.00 50.27  ? 284 LYS A CE  1 
ATOM   2507 N  NZ  . LYS B 2 218 ? -1.894   20.345  -20.134 1.00 52.01  ? 284 LYS A NZ  1 
ATOM   2508 N  N   . GLU B 2 219 ? -7.020   15.090  -22.303 1.00 46.34  ? 285 GLU A N   1 
ATOM   2509 C  CA  . GLU B 2 219 ? -8.216   14.631  -23.024 1.00 47.45  ? 285 GLU A CA  1 
ATOM   2510 C  C   . GLU B 2 219 ? -9.240   13.977  -22.099 1.00 51.41  ? 285 GLU A C   1 
ATOM   2511 O  O   . GLU B 2 219 ? -10.436  14.119  -22.305 1.00 50.87  ? 285 GLU A O   1 
ATOM   2512 C  CB  . GLU B 2 219 ? -7.859   13.701  -24.195 1.00 46.35  ? 285 GLU A CB  1 
ATOM   2513 C  CG  . GLU B 2 219 ? -7.382   14.410  -25.461 1.00 45.20  ? 285 GLU A CG  1 
ATOM   2514 C  CD  . GLU B 2 219 ? -5.910   14.783  -25.452 1.00 43.98  ? 285 GLU A CD  1 
ATOM   2515 O  OE1 . GLU B 2 219 ? -5.264   14.814  -24.383 1.00 45.98  ? 285 GLU A OE1 1 
ATOM   2516 O  OE2 . GLU B 2 219 ? -5.392   15.064  -26.538 1.00 44.48  ? 285 GLU A OE2 1 
ATOM   2517 N  N   . HIS B 2 220 ? -8.778   13.260  -21.081 1.00 57.46  ? 286 HIS A N   1 
ATOM   2518 C  CA  . HIS B 2 220 ? -9.685   12.699  -20.064 1.00 60.51  ? 286 HIS A CA  1 
ATOM   2519 C  C   . HIS B 2 220 ? -10.342  13.817  -19.275 1.00 58.87  ? 286 HIS A C   1 
ATOM   2520 O  O   . HIS B 2 220 ? -11.536  13.795  -19.088 1.00 60.15  ? 286 HIS A O   1 
ATOM   2521 C  CB  . HIS B 2 220 ? -8.956   11.742  -19.116 1.00 64.48  ? 286 HIS A CB  1 
ATOM   2522 C  CG  . HIS B 2 220 ? -8.534   10.449  -19.756 1.00 69.15  ? 286 HIS A CG  1 
ATOM   2523 N  ND1 . HIS B 2 220 ? -7.211   10.059  -19.828 1.00 76.41  ? 286 HIS A ND1 1 
ATOM   2524 C  CD2 . HIS B 2 220 ? -9.250   9.456   -20.346 1.00 71.47  ? 286 HIS A CD2 1 
ATOM   2525 C  CE1 . HIS B 2 220 ? -7.129   8.888   -20.433 1.00 77.48  ? 286 HIS A CE1 1 
ATOM   2526 N  NE2 . HIS B 2 220 ? -8.352   8.497   -20.746 1.00 75.56  ? 286 HIS A NE2 1 
ATOM   2527 N  N   . LYS B 2 221 ? -9.554   14.788  -18.824 1.00 58.23  ? 287 LYS A N   1 
ATOM   2528 C  CA  . LYS B 2 221 ? -10.051  15.947  -18.059 1.00 59.62  ? 287 LYS A CA  1 
ATOM   2529 C  C   . LYS B 2 221 ? -11.078  16.790  -18.827 1.00 53.44  ? 287 LYS A C   1 
ATOM   2530 O  O   . LYS B 2 221 ? -12.053  17.249  -18.238 1.00 53.45  ? 287 LYS A O   1 
ATOM   2531 C  CB  . LYS B 2 221 ? -8.875   16.831  -17.597 1.00 66.29  ? 287 LYS A CB  1 
ATOM   2532 C  CG  . LYS B 2 221 ? -9.274   18.113  -16.861 1.00 73.81  ? 287 LYS A CG  1 
ATOM   2533 C  CD  . LYS B 2 221 ? -8.086   18.843  -16.220 1.00 80.08  ? 287 LYS A CD  1 
ATOM   2534 C  CE  . LYS B 2 221 ? -7.021   19.293  -17.230 1.00 86.23  ? 287 LYS A CE  1 
ATOM   2535 N  NZ  . LYS B 2 221 ? -7.562   20.121  -18.351 1.00 87.64  ? 287 LYS A NZ  1 
ATOM   2536 N  N   . ALA B 2 222 ? -10.853  16.998  -20.121 1.00 47.35  ? 288 ALA A N   1 
ATOM   2537 C  CA  . ALA B 2 222 ? -11.765  17.790  -20.973 1.00 44.18  ? 288 ALA A CA  1 
ATOM   2538 C  C   . ALA B 2 222 ? -13.099  17.094  -21.165 1.00 44.30  ? 288 ALA A C   1 
ATOM   2539 O  O   . ALA B 2 222 ? -14.149  17.725  -21.291 1.00 44.14  ? 288 ALA A O   1 
ATOM   2540 C  CB  . ALA B 2 222 ? -11.133  18.068  -22.328 1.00 42.81  ? 288 ALA A CB  1 
ATOM   2541 N  N   . LEU B 2 223 ? -13.033  15.776  -21.201 1.00 44.83  ? 289 LEU A N   1 
ATOM   2542 C  CA  . LEU B 2 223 ? -14.206  14.944  -21.390 1.00 44.96  ? 289 LEU A CA  1 
ATOM   2543 C  C   . LEU B 2 223 ? -15.011  14.833  -20.086 1.00 44.83  ? 289 LEU A C   1 
ATOM   2544 O  O   . LEU B 2 223 ? -16.231  14.778  -20.120 1.00 48.78  ? 289 LEU A O   1 
ATOM   2545 C  CB  . LEU B 2 223 ? -13.767  13.572  -21.907 1.00 45.94  ? 289 LEU A CB  1 
ATOM   2546 C  CG  . LEU B 2 223 ? -14.735  12.808  -22.788 1.00 48.35  ? 289 LEU A CG  1 
ATOM   2547 C  CD1 . LEU B 2 223 ? -14.921  13.497  -24.146 1.00 48.87  ? 289 LEU A CD1 1 
ATOM   2548 C  CD2 . LEU B 2 223 ? -14.183  11.394  -22.962 1.00 49.69  ? 289 LEU A CD2 1 
ATOM   2549 N  N   . LYS B 2 224 ? -14.335  14.798  -18.942 1.00 43.22  ? 290 LYS A N   1 
ATOM   2550 C  CA  . LYS B 2 224 ? -14.981  14.895  -17.616 1.00 42.48  ? 290 LYS A CA  1 
ATOM   2551 C  C   . LYS B 2 224 ? -15.703  16.236  -17.473 1.00 39.54  ? 290 LYS A C   1 
ATOM   2552 O  O   . LYS B 2 224 ? -16.873  16.284  -17.079 1.00 36.35  ? 290 LYS A O   1 
ATOM   2553 C  CB  . LYS B 2 224 ? -13.930  14.688  -16.494 1.00 45.47  ? 290 LYS A CB  1 
ATOM   2554 C  CG  . LYS B 2 224 ? -14.302  15.134  -15.088 1.00 50.00  ? 290 LYS A CG  1 
ATOM   2555 C  CD  . LYS B 2 224 ? -13.109  14.995  -14.141 1.00 55.72  ? 290 LYS A CD  1 
ATOM   2556 C  CE  . LYS B 2 224 ? -13.164  16.008  -13.009 1.00 59.27  ? 290 LYS A CE  1 
ATOM   2557 N  NZ  . LYS B 2 224 ? -12.907  17.425  -13.420 1.00 61.40  ? 290 LYS A NZ  1 
ATOM   2558 N  N   . THR B 2 225 ? -15.004  17.318  -17.811 1.00 37.77  ? 291 THR A N   1 
ATOM   2559 C  CA  . THR B 2 225 ? -15.573  18.671  -17.796 1.00 35.59  ? 291 THR A CA  1 
ATOM   2560 C  C   . THR B 2 225 ? -16.842  18.745  -18.644 1.00 33.31  ? 291 THR A C   1 
ATOM   2561 O  O   . THR B 2 225 ? -17.856  19.239  -18.179 1.00 34.42  ? 291 THR A O   1 
ATOM   2562 C  CB  . THR B 2 225 ? -14.540  19.719  -18.270 1.00 34.88  ? 291 THR A CB  1 
ATOM   2563 O  OG1 . THR B 2 225 ? -13.463  19.773  -17.335 1.00 35.43  ? 291 THR A OG1 1 
ATOM   2564 C  CG2 . THR B 2 225 ? -15.167  21.110  -18.384 1.00 34.73  ? 291 THR A CG2 1 
ATOM   2565 N  N   . LEU B 2 226 ? -16.776  18.243  -19.871 1.00 31.41  ? 292 LEU A N   1 
ATOM   2566 C  CA  . LEU B 2 226 ? -17.950  18.163  -20.746 1.00 30.36  ? 292 LEU A CA  1 
ATOM   2567 C  C   . LEU B 2 226 ? -19.093  17.340  -20.144 1.00 29.70  ? 292 LEU A C   1 
ATOM   2568 O  O   . LEU B 2 226 ? -20.262  17.596  -20.372 1.00 27.66  ? 292 LEU A O   1 
ATOM   2569 C  CB  . LEU B 2 226 ? -17.559  17.575  -22.102 1.00 30.69  ? 292 LEU A CB  1 
ATOM   2570 C  CG  . LEU B 2 226 ? -17.732  18.470  -23.319 1.00 32.29  ? 292 LEU A CG  1 
ATOM   2571 C  CD1 . LEU B 2 226 ? -17.147  19.863  -23.097 1.00 33.26  ? 292 LEU A CD1 1 
ATOM   2572 C  CD2 . LEU B 2 226 ? -17.069  17.776  -24.498 1.00 32.99  ? 292 LEU A CD2 1 
ATOM   2573 N  N   . GLY B 2 227 ? -18.719  16.323  -19.391 1.00 30.40  ? 293 GLY A N   1 
ATOM   2574 C  CA  . GLY B 2 227 ? -19.663  15.502  -18.659 1.00 30.46  ? 293 GLY A CA  1 
ATOM   2575 C  C   . GLY B 2 227 ? -20.355  16.250  -17.558 1.00 29.01  ? 293 GLY A C   1 
ATOM   2576 O  O   . GLY B 2 227 ? -21.575  16.203  -17.466 1.00 30.00  ? 293 GLY A O   1 
ATOM   2577 N  N   . ILE B 2 228 ? -19.581  16.948  -16.736 1.00 27.73  ? 294 ILE A N   1 
ATOM   2578 C  CA  . ILE B 2 228 ? -20.143  17.712  -15.633 1.00 27.69  ? 294 ILE A CA  1 
ATOM   2579 C  C   . ILE B 2 228 ? -21.040  18.844  -16.153 1.00 26.98  ? 294 ILE A C   1 
ATOM   2580 O  O   . ILE B 2 228 ? -22.103  19.101  -15.587 1.00 25.23  ? 294 ILE A O   1 
ATOM   2581 C  CB  . ILE B 2 228 ? -19.050  18.311  -14.723 1.00 28.34  ? 294 ILE A CB  1 
ATOM   2582 C  CG1 . ILE B 2 228 ? -18.242  17.221  -14.041 1.00 28.75  ? 294 ILE A CG1 1 
ATOM   2583 C  CG2 . ILE B 2 228 ? -19.679  19.187  -13.643 1.00 29.15  ? 294 ILE A CG2 1 
ATOM   2584 C  CD1 . ILE B 2 228 ? -17.020  17.747  -13.301 1.00 29.80  ? 294 ILE A CD1 1 
ATOM   2585 N  N   . ILE B 2 229 ? -20.598  19.520  -17.218 1.00 27.06  ? 295 ILE A N   1 
ATOM   2586 C  CA  . ILE B 2 229 ? -21.355  20.631  -17.809 1.00 27.51  ? 295 ILE A CA  1 
ATOM   2587 C  C   . ILE B 2 229 ? -22.743  20.150  -18.242 1.00 27.73  ? 295 ILE A C   1 
ATOM   2588 O  O   . ILE B 2 229 ? -23.738  20.676  -17.765 1.00 27.69  ? 295 ILE A O   1 
ATOM   2589 C  CB  . ILE B 2 229 ? -20.587  21.300  -18.987 1.00 27.21  ? 295 ILE A CB  1 
ATOM   2590 C  CG1 . ILE B 2 229 ? -19.399  22.101  -18.453 1.00 26.51  ? 295 ILE A CG1 1 
ATOM   2591 C  CG2 . ILE B 2 229 ? -21.487  22.221  -19.805 1.00 27.62  ? 295 ILE A CG2 1 
ATOM   2592 C  CD1 . ILE B 2 229 ? -18.339  22.398  -19.496 1.00 26.48  ? 295 ILE A CD1 1 
ATOM   2593 N  N   . MET B 2 230 ? -22.790  19.146  -19.115 1.00 28.12  ? 296 MET A N   1 
ATOM   2594 C  CA  . MET B 2 230 ? -24.053  18.606  -19.625 1.00 28.98  ? 296 MET A CA  1 
ATOM   2595 C  C   . MET B 2 230 ? -24.800  17.749  -18.607 1.00 29.26  ? 296 MET A C   1 
ATOM   2596 O  O   . MET B 2 230 ? -26.036  17.712  -18.611 1.00 28.56  ? 296 MET A O   1 
ATOM   2597 C  CB  . MET B 2 230 ? -23.822  17.782  -20.889 1.00 29.55  ? 296 MET A CB  1 
ATOM   2598 C  CG  . MET B 2 230 ? -23.298  18.571  -22.067 1.00 30.16  ? 296 MET A CG  1 
ATOM   2599 S  SD  . MET B 2 230 ? -24.361  19.902  -22.602 1.00 32.98  ? 296 MET A SD  1 
ATOM   2600 C  CE  . MET B 2 230 ? -25.834  18.987  -23.061 1.00 34.33  ? 296 MET A CE  1 
ATOM   2601 N  N   . GLY B 2 231 ? -24.065  17.064  -17.737 1.00 29.39  ? 297 GLY A N   1 
ATOM   2602 C  CA  . GLY B 2 231 ? -24.673  16.189  -16.738 1.00 29.75  ? 297 GLY A CA  1 
ATOM   2603 C  C   . GLY B 2 231 ? -25.488  16.918  -15.684 1.00 29.37  ? 297 GLY A C   1 
ATOM   2604 O  O   . GLY B 2 231 ? -26.683  16.627  -15.494 1.00 31.70  ? 297 GLY A O   1 
ATOM   2605 N  N   . VAL B 2 232 ? -24.841  17.878  -15.024 1.00 27.77  ? 298 VAL A N   1 
ATOM   2606 C  CA  . VAL B 2 232 ? -25.437  18.611  -13.912 1.00 26.99  ? 298 VAL A CA  1 
ATOM   2607 C  C   . VAL B 2 232 ? -26.566  19.518  -14.411 1.00 28.18  ? 298 VAL A C   1 
ATOM   2608 O  O   . VAL B 2 232 ? -27.634  19.562  -13.803 1.00 28.07  ? 298 VAL A O   1 
ATOM   2609 C  CB  . VAL B 2 232 ? -24.381  19.410  -13.127 1.00 26.56  ? 298 VAL A CB  1 
ATOM   2610 C  CG1 . VAL B 2 232 ? -25.019  20.254  -12.048 1.00 26.43  ? 298 VAL A CG1 1 
ATOM   2611 C  CG2 . VAL B 2 232 ? -23.368  18.469  -12.496 1.00 27.11  ? 298 VAL A CG2 1 
ATOM   2612 N  N   . PHE B 2 233 ? -26.339  20.220  -15.519 1.00 29.05  ? 299 PHE A N   1 
ATOM   2613 C  CA  . PHE B 2 233 ? -27.406  21.012  -16.161 1.00 29.79  ? 299 PHE A CA  1 
ATOM   2614 C  C   . PHE B 2 233 ? -28.626  20.160  -16.479 1.00 31.44  ? 299 PHE A C   1 
ATOM   2615 O  O   . PHE B 2 233 ? -29.742  20.582  -16.192 1.00 33.88  ? 299 PHE A O   1 
ATOM   2616 C  CB  . PHE B 2 233 ? -26.910  21.695  -17.450 1.00 28.99  ? 299 PHE A CB  1 
ATOM   2617 C  CG  . PHE B 2 233 ? -28.010  22.259  -18.319 1.00 27.42  ? 299 PHE A CG  1 
ATOM   2618 C  CD1 . PHE B 2 233 ? -28.824  23.271  -17.845 1.00 27.22  ? 299 PHE A CD1 1 
ATOM   2619 C  CD2 . PHE B 2 233 ? -28.225  21.781  -19.608 1.00 27.02  ? 299 PHE A CD2 1 
ATOM   2620 C  CE1 . PHE B 2 233 ? -29.840  23.799  -18.633 1.00 27.03  ? 299 PHE A CE1 1 
ATOM   2621 C  CE2 . PHE B 2 233 ? -29.237  22.308  -20.405 1.00 26.85  ? 299 PHE A CE2 1 
ATOM   2622 C  CZ  . PHE B 2 233 ? -30.048  23.319  -19.917 1.00 26.81  ? 299 PHE A CZ  1 
ATOM   2623 N  N   . THR B 2 234 ? -28.422  18.975  -17.060 1.00 32.14  ? 300 THR A N   1 
ATOM   2624 C  CA  . THR B 2 234 ? -29.552  18.136  -17.493 1.00 32.71  ? 300 THR A CA  1 
ATOM   2625 C  C   . THR B 2 234 ? -30.211  17.431  -16.306 1.00 33.36  ? 300 THR A C   1 
ATOM   2626 O  O   . THR B 2 234 ? -31.443  17.486  -16.169 1.00 30.53  ? 300 THR A O   1 
ATOM   2627 C  CB  . THR B 2 234 ? -29.148  17.141  -18.595 1.00 32.41  ? 300 THR A CB  1 
ATOM   2628 O  OG1 . THR B 2 234 ? -28.536  17.865  -19.665 1.00 34.62  ? 300 THR A OG1 1 
ATOM   2629 C  CG2 . THR B 2 234 ? -30.362  16.447  -19.167 1.00 31.91  ? 300 THR A CG2 1 
ATOM   2630 N  N   . LEU B 2 235 ? -29.404  16.801  -15.441 1.00 33.76  ? 301 LEU A N   1 
ATOM   2631 C  CA  . LEU B 2 235 ? -29.934  16.216  -14.201 1.00 33.18  ? 301 LEU A CA  1 
ATOM   2632 C  C   . LEU B 2 235 ? -30.834  17.216  -13.468 1.00 33.29  ? 301 LEU A C   1 
ATOM   2633 O  O   . LEU B 2 235 ? -31.938  16.864  -13.066 1.00 34.22  ? 301 LEU A O   1 
ATOM   2634 C  CB  . LEU B 2 235 ? -28.816  15.738  -13.266 1.00 32.98  ? 301 LEU A CB  1 
ATOM   2635 C  CG  . LEU B 2 235 ? -29.242  15.377  -11.821 1.00 33.62  ? 301 LEU A CG  1 
ATOM   2636 C  CD1 . LEU B 2 235 ? -30.265  14.252  -11.822 1.00 34.53  ? 301 LEU A CD1 1 
ATOM   2637 C  CD2 . LEU B 2 235 ? -28.075  15.005  -10.924 1.00 33.44  ? 301 LEU A CD2 1 
ATOM   2638 N  N   . CYS B 2 236 ? -30.368  18.457  -13.311 1.00 33.10  ? 302 CYS A N   1 
ATOM   2639 C  CA  . CYS B 2 236 ? -31.102  19.469  -12.535 1.00 32.55  ? 302 CYS A CA  1 
ATOM   2640 C  C   . CYS B 2 236 ? -32.406  19.984  -13.177 1.00 32.01  ? 302 CYS A C   1 
ATOM   2641 O  O   . CYS B 2 236 ? -33.418  20.114  -12.481 1.00 32.28  ? 302 CYS A O   1 
ATOM   2642 C  CB  . CYS B 2 236 ? -30.201  20.664  -12.192 1.00 32.51  ? 302 CYS A CB  1 
ATOM   2643 S  SG  . CYS B 2 236 ? -28.921  20.322  -10.973 1.00 33.72  ? 302 CYS A SG  1 
ATOM   2644 N  N   . TRP B 2 237 ? -32.376  20.290  -14.475 1.00 31.26  ? 303 TRP A N   1 
ATOM   2645 C  CA  . TRP B 2 237 ? -33.513  20.942  -15.141 1.00 31.17  ? 303 TRP A CA  1 
ATOM   2646 C  C   . TRP B 2 237 ? -34.342  20.048  -16.058 1.00 32.45  ? 303 TRP A C   1 
ATOM   2647 O  O   . TRP B 2 237 ? -35.475  20.419  -16.355 1.00 33.52  ? 303 TRP A O   1 
ATOM   2648 C  CB  . TRP B 2 237 ? -33.069  22.202  -15.909 1.00 29.58  ? 303 TRP A CB  1 
ATOM   2649 C  CG  . TRP B 2 237 ? -32.893  23.393  -15.039 1.00 28.71  ? 303 TRP A CG  1 
ATOM   2650 C  CD1 . TRP B 2 237 ? -31.749  24.091  -14.838 1.00 29.02  ? 303 TRP A CD1 1 
ATOM   2651 C  CD2 . TRP B 2 237 ? -33.888  24.014  -14.229 1.00 28.65  ? 303 TRP A CD2 1 
ATOM   2652 N  NE1 . TRP B 2 237 ? -31.965  25.120  -13.958 1.00 28.53  ? 303 TRP A NE1 1 
ATOM   2653 C  CE2 . TRP B 2 237 ? -33.271  25.096  -13.566 1.00 28.10  ? 303 TRP A CE2 1 
ATOM   2654 C  CE3 . TRP B 2 237 ? -35.248  23.766  -14.000 1.00 27.98  ? 303 TRP A CE3 1 
ATOM   2655 C  CZ2 . TRP B 2 237 ? -33.963  25.934  -12.693 1.00 28.08  ? 303 TRP A CZ2 1 
ATOM   2656 C  CZ3 . TRP B 2 237 ? -35.938  24.597  -13.136 1.00 27.84  ? 303 TRP A CZ3 1 
ATOM   2657 C  CH2 . TRP B 2 237 ? -35.294  25.669  -12.486 1.00 28.22  ? 303 TRP A CH2 1 
ATOM   2658 N  N   . LEU B 2 238 ? -33.820  18.898  -16.506 1.00 32.62  ? 304 LEU A N   1 
ATOM   2659 C  CA  . LEU B 2 238 ? -34.608  18.016  -17.399 1.00 32.23  ? 304 LEU A CA  1 
ATOM   2660 C  C   . LEU B 2 238 ? -35.858  17.418  -16.740 1.00 33.29  ? 304 LEU A C   1 
ATOM   2661 O  O   . LEU B 2 238 ? -36.930  17.417  -17.370 1.00 32.83  ? 304 LEU A O   1 
ATOM   2662 C  CB  . LEU B 2 238 ? -33.770  16.899  -18.017 1.00 31.46  ? 304 LEU A CB  1 
ATOM   2663 C  CG  . LEU B 2 238 ? -34.497  15.973  -18.998 1.00 31.32  ? 304 LEU A CG  1 
ATOM   2664 C  CD1 . LEU B 2 238 ? -34.986  16.708  -20.231 1.00 31.32  ? 304 LEU A CD1 1 
ATOM   2665 C  CD2 . LEU B 2 238 ? -33.583  14.827  -19.393 1.00 32.19  ? 304 LEU A CD2 1 
ATOM   2666 N  N   . PRO B 2 239 ? -35.730  16.901  -15.495 1.00 33.34  ? 305 PRO A N   1 
ATOM   2667 C  CA  . PRO B 2 239 ? -36.916  16.335  -14.844 1.00 34.66  ? 305 PRO A CA  1 
ATOM   2668 C  C   . PRO B 2 239 ? -38.078  17.328  -14.757 1.00 35.11  ? 305 PRO A C   1 
ATOM   2669 O  O   . PRO B 2 239 ? -39.157  17.038  -15.260 1.00 34.90  ? 305 PRO A O   1 
ATOM   2670 C  CB  . PRO B 2 239 ? -36.407  15.938  -13.451 1.00 34.58  ? 305 PRO A CB  1 
ATOM   2671 C  CG  . PRO B 2 239 ? -34.940  15.763  -13.615 1.00 34.18  ? 305 PRO A CG  1 
ATOM   2672 C  CD  . PRO B 2 239 ? -34.530  16.761  -14.652 1.00 33.71  ? 305 PRO A CD  1 
ATOM   2673 N  N   . PHE B 2 240 ? -37.832  18.501  -14.178 1.00 35.94  ? 306 PHE A N   1 
ATOM   2674 C  CA  . PHE B 2 240 ? -38.866  19.521  -14.025 1.00 36.26  ? 306 PHE A CA  1 
ATOM   2675 C  C   . PHE B 2 240 ? -39.515  19.925  -15.351 1.00 36.67  ? 306 PHE A C   1 
ATOM   2676 O  O   . PHE B 2 240 ? -40.749  19.995  -15.440 1.00 38.01  ? 306 PHE A O   1 
ATOM   2677 C  CB  . PHE B 2 240 ? -38.312  20.775  -13.334 1.00 36.63  ? 306 PHE A CB  1 
ATOM   2678 C  CG  . PHE B 2 240 ? -39.253  21.944  -13.379 1.00 36.30  ? 306 PHE A CG  1 
ATOM   2679 C  CD1 . PHE B 2 240 ? -40.248  22.080  -12.420 1.00 37.74  ? 306 PHE A CD1 1 
ATOM   2680 C  CD2 . PHE B 2 240 ? -39.181  22.877  -14.405 1.00 35.45  ? 306 PHE A CD2 1 
ATOM   2681 C  CE1 . PHE B 2 240 ? -41.141  23.138  -12.473 1.00 38.18  ? 306 PHE A CE1 1 
ATOM   2682 C  CE2 . PHE B 2 240 ? -40.065  23.935  -14.464 1.00 36.63  ? 306 PHE A CE2 1 
ATOM   2683 C  CZ  . PHE B 2 240 ? -41.053  24.066  -13.497 1.00 37.73  ? 306 PHE A CZ  1 
ATOM   2684 N  N   . PHE B 2 241 ? -38.692  20.216  -16.357 1.00 35.58  ? 307 PHE A N   1 
ATOM   2685 C  CA  . PHE B 2 241 ? -39.200  20.722  -17.645 1.00 35.59  ? 307 PHE A CA  1 
ATOM   2686 C  C   . PHE B 2 241 ? -39.879  19.657  -18.498 1.00 36.20  ? 307 PHE A C   1 
ATOM   2687 O  O   . PHE B 2 241 ? -40.680  19.981  -19.388 1.00 35.27  ? 307 PHE A O   1 
ATOM   2688 C  CB  . PHE B 2 241 ? -38.087  21.421  -18.446 1.00 34.08  ? 307 PHE A CB  1 
ATOM   2689 C  CG  . PHE B 2 241 ? -37.920  22.860  -18.077 1.00 33.21  ? 307 PHE A CG  1 
ATOM   2690 C  CD1 . PHE B 2 241 ? -38.842  23.798  -18.524 1.00 33.30  ? 307 PHE A CD1 1 
ATOM   2691 C  CD2 . PHE B 2 241 ? -36.872  23.281  -17.260 1.00 32.74  ? 307 PHE A CD2 1 
ATOM   2692 C  CE1 . PHE B 2 241 ? -38.719  25.133  -18.180 1.00 33.39  ? 307 PHE A CE1 1 
ATOM   2693 C  CE2 . PHE B 2 241 ? -36.742  24.611  -16.913 1.00 32.92  ? 307 PHE A CE2 1 
ATOM   2694 C  CZ  . PHE B 2 241 ? -37.668  25.539  -17.371 1.00 33.56  ? 307 PHE A CZ  1 
ATOM   2695 N  N   . LEU B 2 242 ? -39.544  18.395  -18.232 1.00 36.67  ? 308 LEU A N   1 
ATOM   2696 C  CA  . LEU B 2 242 ? -40.250  17.266  -18.818 1.00 36.78  ? 308 LEU A CA  1 
ATOM   2697 C  C   . LEU B 2 242 ? -41.663  17.212  -18.228 1.00 36.79  ? 308 LEU A C   1 
ATOM   2698 O  O   . LEU B 2 242 ? -42.663  17.260  -18.958 1.00 37.37  ? 308 LEU A O   1 
ATOM   2699 C  CB  . LEU B 2 242 ? -39.458  15.978  -18.529 1.00 37.85  ? 308 LEU A CB  1 
ATOM   2700 C  CG  . LEU B 2 242 ? -39.397  14.826  -19.522 1.00 38.27  ? 308 LEU A CG  1 
ATOM   2701 C  CD1 . LEU B 2 242 ? -39.156  15.308  -20.948 1.00 38.34  ? 308 LEU A CD1 1 
ATOM   2702 C  CD2 . LEU B 2 242 ? -38.283  13.886  -19.060 1.00 39.05  ? 308 LEU A CD2 1 
ATOM   2703 N  N   . VAL B 2 243 ? -41.718  17.179  -16.894 1.00 36.27  ? 309 VAL A N   1 
ATOM   2704 C  CA  . VAL B 2 243 ? -42.968  17.135  -16.123 1.00 36.26  ? 309 VAL A CA  1 
ATOM   2705 C  C   . VAL B 2 243 ? -43.875  18.338  -16.402 1.00 36.69  ? 309 VAL A C   1 
ATOM   2706 O  O   . VAL B 2 243 ? -45.094  18.202  -16.441 1.00 34.00  ? 309 VAL A O   1 
ATOM   2707 C  CB  . VAL B 2 243 ? -42.660  17.026  -14.609 1.00 35.88  ? 309 VAL A CB  1 
ATOM   2708 C  CG1 . VAL B 2 243 ? -43.924  17.154  -13.770 1.00 37.16  ? 309 VAL A CG1 1 
ATOM   2709 C  CG2 . VAL B 2 243 ? -41.991  15.686  -14.311 1.00 35.79  ? 309 VAL A CG2 1 
ATOM   2710 N  N   . ASN B 2 244 ? -43.268  19.506  -16.593 1.00 39.77  ? 310 ASN A N   1 
ATOM   2711 C  CA  . ASN B 2 244 ? -44.003  20.740  -16.891 1.00 41.86  ? 310 ASN A CA  1 
ATOM   2712 C  C   . ASN B 2 244 ? -44.827  20.672  -18.196 1.00 41.94  ? 310 ASN A C   1 
ATOM   2713 O  O   . ASN B 2 244 ? -45.894  21.279  -18.272 1.00 39.78  ? 310 ASN A O   1 
ATOM   2714 C  CB  . ASN B 2 244 ? -43.020  21.936  -16.931 1.00 42.96  ? 310 ASN A CB  1 
ATOM   2715 C  CG  . ASN B 2 244 ? -43.708  23.279  -16.695 1.00 42.39  ? 310 ASN A CG  1 
ATOM   2716 O  OD1 . ASN B 2 244 ? -44.607  23.398  -15.856 1.00 42.78  ? 310 ASN A OD1 1 
ATOM   2717 N  ND2 . ASN B 2 244 ? -43.269  24.307  -17.428 1.00 39.45  ? 310 ASN A ND2 1 
ATOM   2718 N  N   . ILE B 2 245 ? -44.332  19.953  -19.207 1.00 44.19  ? 311 ILE A N   1 
ATOM   2719 C  CA  . ILE B 2 245 ? -45.093  19.720  -20.447 1.00 46.49  ? 311 ILE A CA  1 
ATOM   2720 C  C   . ILE B 2 245 ? -46.129  18.610  -20.249 1.00 51.25  ? 311 ILE A C   1 
ATOM   2721 O  O   . ILE B 2 245 ? -47.247  18.694  -20.784 1.00 53.15  ? 311 ILE A O   1 
ATOM   2722 C  CB  . ILE B 2 245 ? -44.171  19.338  -21.630 1.00 46.36  ? 311 ILE A CB  1 
ATOM   2723 C  CG1 . ILE B 2 245 ? -43.180  20.462  -21.933 1.00 46.92  ? 311 ILE A CG1 1 
ATOM   2724 C  CG2 . ILE B 2 245 ? -44.980  18.986  -22.881 1.00 46.48  ? 311 ILE A CG2 1 
ATOM   2725 C  CD1 . ILE B 2 245 ? -43.822  21.735  -22.428 1.00 47.15  ? 311 ILE A CD1 1 
ATOM   2726 N  N   . VAL B 2 246 ? -45.734  17.568  -19.509 1.00 53.55  ? 312 VAL A N   1 
ATOM   2727 C  CA  . VAL B 2 246 ? -46.619  16.446  -19.153 1.00 50.75  ? 312 VAL A CA  1 
ATOM   2728 C  C   . VAL B 2 246 ? -47.911  16.948  -18.488 1.00 47.94  ? 312 VAL A C   1 
ATOM   2729 O  O   . VAL B 2 246 ? -49.000  16.534  -18.875 1.00 47.33  ? 312 VAL A O   1 
ATOM   2730 C  CB  . VAL B 2 246 ? -45.869  15.408  -18.271 1.00 51.49  ? 312 VAL A CB  1 
ATOM   2731 C  CG1 . VAL B 2 246 ? -46.827  14.459  -17.575 1.00 53.17  ? 312 VAL A CG1 1 
ATOM   2732 C  CG2 . VAL B 2 246 ? -44.895  14.601  -19.121 1.00 51.58  ? 312 VAL A CG2 1 
ATOM   2733 N  N   . ASN B 2 247 ? -47.782  17.853  -17.522 1.00 46.85  ? 313 ASN A N   1 
ATOM   2734 C  CA  . ASN B 2 247 ? -48.944  18.415  -16.811 1.00 49.65  ? 313 ASN A CA  1 
ATOM   2735 C  C   . ASN B 2 247 ? -49.999  19.058  -17.724 1.00 52.95  ? 313 ASN A C   1 
ATOM   2736 O  O   . ASN B 2 247 ? -51.193  18.949  -17.465 1.00 55.40  ? 313 ASN A O   1 
ATOM   2737 C  CB  . ASN B 2 247 ? -48.494  19.446  -15.769 1.00 48.71  ? 313 ASN A CB  1 
ATOM   2738 C  CG  . ASN B 2 247 ? -47.763  18.825  -14.603 1.00 48.41  ? 313 ASN A CG  1 
ATOM   2739 O  OD1 . ASN B 2 247 ? -47.664  17.598  -14.481 1.00 46.92  ? 313 ASN A OD1 1 
ATOM   2740 N  ND2 . ASN B 2 247 ? -47.236  19.683  -13.731 1.00 49.23  ? 313 ASN A ND2 1 
ATOM   2741 N  N   . VAL B 2 248 ? -49.552  19.728  -18.780 1.00 56.69  ? 314 VAL A N   1 
ATOM   2742 C  CA  . VAL B 2 248 ? -50.455  20.387  -19.738 1.00 59.15  ? 314 VAL A CA  1 
ATOM   2743 C  C   . VAL B 2 248 ? -51.363  19.410  -20.501 1.00 59.60  ? 314 VAL A C   1 
ATOM   2744 O  O   . VAL B 2 248 ? -52.457  19.791  -20.913 1.00 61.08  ? 314 VAL A O   1 
ATOM   2745 C  CB  . VAL B 2 248 ? -49.650  21.316  -20.695 1.00 63.48  ? 314 VAL A CB  1 
ATOM   2746 C  CG1 . VAL B 2 248 ? -50.165  21.310  -22.130 1.00 65.60  ? 314 VAL A CG1 1 
ATOM   2747 C  CG2 . VAL B 2 248 ? -49.642  22.737  -20.142 1.00 63.61  ? 314 VAL A CG2 1 
ATOM   2748 N  N   . PHE B 2 249 ? -50.912  18.177  -20.697 1.00 62.53  ? 315 PHE A N   1 
ATOM   2749 C  CA  . PHE B 2 249 ? -51.736  17.144  -21.314 1.00 68.19  ? 315 PHE A CA  1 
ATOM   2750 C  C   . PHE B 2 249 ? -52.483  16.308  -20.251 1.00 71.91  ? 315 PHE A C   1 
ATOM   2751 O  O   . PHE B 2 249 ? -53.643  16.609  -19.979 1.00 76.54  ? 315 PHE A O   1 
ATOM   2752 C  CB  . PHE B 2 249 ? -50.895  16.331  -22.301 1.00 69.66  ? 315 PHE A CB  1 
ATOM   2753 C  CG  . PHE B 2 249 ? -50.345  17.163  -23.432 1.00 71.60  ? 315 PHE A CG  1 
ATOM   2754 C  CD1 . PHE B 2 249 ? -51.200  17.689  -24.394 1.00 72.17  ? 315 PHE A CD1 1 
ATOM   2755 C  CD2 . PHE B 2 249 ? -48.983  17.429  -23.536 1.00 75.45  ? 315 PHE A CD2 1 
ATOM   2756 C  CE1 . PHE B 2 249 ? -50.716  18.468  -25.438 1.00 72.40  ? 315 PHE A CE1 1 
ATOM   2757 C  CE2 . PHE B 2 249 ? -48.486  18.203  -24.580 1.00 76.90  ? 315 PHE A CE2 1 
ATOM   2758 C  CZ  . PHE B 2 249 ? -49.355  18.720  -25.536 1.00 75.60  ? 315 PHE A CZ  1 
ATOM   2759 N  N   . ASN B 2 250 ? -51.842  15.324  -19.624 1.00 75.52  ? 316 ASN A N   1 
ATOM   2760 C  CA  . ASN B 2 250 ? -52.494  14.492  -18.579 1.00 79.02  ? 316 ASN A CA  1 
ATOM   2761 C  C   . ASN B 2 250 ? -52.194  15.058  -17.193 1.00 79.89  ? 316 ASN A C   1 
ATOM   2762 O  O   . ASN B 2 250 ? -51.186  14.711  -16.597 1.00 85.78  ? 316 ASN A O   1 
ATOM   2763 C  CB  . ASN B 2 250 ? -52.028  13.022  -18.652 1.00 84.46  ? 316 ASN A CB  1 
ATOM   2764 C  CG  . ASN B 2 250 ? -52.594  12.261  -19.851 1.00 90.78  ? 316 ASN A CG  1 
ATOM   2765 O  OD1 . ASN B 2 250 ? -53.229  12.836  -20.746 1.00 97.03  ? 316 ASN A OD1 1 
ATOM   2766 N  ND2 . ASN B 2 250 ? -52.346  10.954  -19.878 1.00 91.94  ? 316 ASN A ND2 1 
ATOM   2767 N  N   . ARG B 2 251 ? -53.089  15.899  -16.676 1.00 82.84  ? 317 ARG A N   1 
ATOM   2768 C  CA  . ARG B 2 251 ? -52.835  16.664  -15.435 1.00 89.02  ? 317 ARG A CA  1 
ATOM   2769 C  C   . ARG B 2 251 ? -52.662  15.835  -14.139 1.00 85.77  ? 317 ARG A C   1 
ATOM   2770 O  O   . ARG B 2 251 ? -51.955  16.266  -13.228 1.00 82.84  ? 317 ARG A O   1 
ATOM   2771 C  CB  . ARG B 2 251 ? -53.919  17.744  -15.261 1.00 98.70  ? 317 ARG A CB  1 
ATOM   2772 C  CG  . ARG B 2 251 ? -53.782  18.693  -14.063 1.00 110.52 ? 317 ARG A CG  1 
ATOM   2773 C  CD  . ARG B 2 251 ? -55.080  19.461  -13.779 1.00 124.02 ? 317 ARG A CD  1 
ATOM   2774 N  NE  . ARG B 2 251 ? -55.398  20.449  -14.828 1.00 134.95 ? 317 ARG A NE  1 
ATOM   2775 C  CZ  . ARG B 2 251 ? -56.496  20.486  -15.599 1.00 135.98 ? 317 ARG A CZ  1 
ATOM   2776 N  NH1 . ARG B 2 251 ? -57.482  19.587  -15.484 1.00 135.17 ? 317 ARG A NH1 1 
ATOM   2777 N  NH2 . ARG B 2 251 ? -56.603  21.458  -16.513 1.00 134.21 ? 317 ARG A NH2 1 
ATOM   2778 N  N   . ASP B 2 252 ? -53.273  14.654  -14.061 1.00 84.02  ? 318 ASP A N   1 
ATOM   2779 C  CA  . ASP B 2 252 ? -53.230  13.830  -12.828 1.00 82.94  ? 318 ASP A CA  1 
ATOM   2780 C  C   . ASP B 2 252 ? -51.952  12.997  -12.701 1.00 81.71  ? 318 ASP A C   1 
ATOM   2781 O  O   . ASP B 2 252 ? -51.531  12.689  -11.582 1.00 78.68  ? 318 ASP A O   1 
ATOM   2782 C  CB  . ASP B 2 252 ? -54.426  12.861  -12.744 1.00 83.57  ? 318 ASP A CB  1 
ATOM   2783 C  CG  . ASP B 2 252 ? -55.744  13.549  -12.410 1.00 82.71  ? 318 ASP A CG  1 
ATOM   2784 O  OD1 . ASP B 2 252 ? -55.755  14.499  -11.596 1.00 83.55  ? 318 ASP A OD1 1 
ATOM   2785 O  OD2 . ASP B 2 252 ? -56.789  13.115  -12.951 1.00 79.68  ? 318 ASP A OD2 1 
ATOM   2786 N  N   . LEU B 2 253 ? -51.368  12.621  -13.843 1.00 80.13  ? 319 LEU A N   1 
ATOM   2787 C  CA  . LEU B 2 253 ? -50.303  11.602  -13.925 1.00 79.35  ? 319 LEU A CA  1 
ATOM   2788 C  C   . LEU B 2 253 ? -49.181  11.787  -12.889 1.00 77.59  ? 319 LEU A C   1 
ATOM   2789 O  O   . LEU B 2 253 ? -48.829  10.832  -12.181 1.00 81.42  ? 319 LEU A O   1 
ATOM   2790 C  CB  . LEU B 2 253 ? -49.734  11.537  -15.359 1.00 77.22  ? 319 LEU A CB  1 
ATOM   2791 C  CG  . LEU B 2 253 ? -48.673  10.493  -15.738 1.00 77.05  ? 319 LEU A CG  1 
ATOM   2792 C  CD1 . LEU B 2 253 ? -49.109  9.070   -15.432 1.00 76.42  ? 319 LEU A CD1 1 
ATOM   2793 C  CD2 . LEU B 2 253 ? -48.337  10.597  -17.222 1.00 77.65  ? 319 LEU A CD2 1 
ATOM   2794 N  N   . VAL B 2 254 ? -48.664  13.010  -12.774 1.00 71.68  ? 320 VAL A N   1 
ATOM   2795 C  CA  . VAL B 2 254 ? -47.564  13.322  -11.853 1.00 70.22  ? 320 VAL A CA  1 
ATOM   2796 C  C   . VAL B 2 254 ? -48.091  14.078  -10.626 1.00 70.53  ? 320 VAL A C   1 
ATOM   2797 O  O   . VAL B 2 254 ? -48.817  15.062  -10.793 1.00 73.93  ? 320 VAL A O   1 
ATOM   2798 C  CB  . VAL B 2 254 ? -46.480  14.191  -12.536 1.00 68.73  ? 320 VAL A CB  1 
ATOM   2799 C  CG1 . VAL B 2 254 ? -45.256  14.333  -11.632 1.00 67.72  ? 320 VAL A CG1 1 
ATOM   2800 C  CG2 . VAL B 2 254 ? -46.080  13.601  -13.882 1.00 66.56  ? 320 VAL A CG2 1 
ATOM   2801 N  N   . PRO B 2 255 ? -47.718  13.642  -9.397  1.00 70.91  ? 321 PRO A N   1 
ATOM   2802 C  CA  . PRO B 2 255 ? -48.155  14.400  -8.212  1.00 71.28  ? 321 PRO A CA  1 
ATOM   2803 C  C   . PRO B 2 255 ? -47.573  15.814  -8.095  1.00 70.03  ? 321 PRO A C   1 
ATOM   2804 O  O   . PRO B 2 255 ? -46.597  16.148  -8.762  1.00 68.59  ? 321 PRO A O   1 
ATOM   2805 C  CB  . PRO B 2 255 ? -47.685  13.529  -7.036  1.00 69.73  ? 321 PRO A CB  1 
ATOM   2806 C  CG  . PRO B 2 255 ? -46.625  12.638  -7.582  1.00 67.97  ? 321 PRO A CG  1 
ATOM   2807 C  CD  . PRO B 2 255 ? -47.004  12.405  -9.017  1.00 68.41  ? 321 PRO A CD  1 
ATOM   2808 N  N   . ASP B 2 256 ? -48.188  16.629  -7.244  1.00 72.51  ? 322 ASP A N   1 
ATOM   2809 C  CA  . ASP B 2 256 ? -47.742  18.008  -7.043  1.00 76.17  ? 322 ASP A CA  1 
ATOM   2810 C  C   . ASP B 2 256 ? -46.484  18.083  -6.186  1.00 75.44  ? 322 ASP A C   1 
ATOM   2811 O  O   . ASP B 2 256 ? -45.624  18.908  -6.445  1.00 78.29  ? 322 ASP A O   1 
ATOM   2812 C  CB  . ASP B 2 256 ? -48.853  18.864  -6.425  1.00 81.45  ? 322 ASP A CB  1 
ATOM   2813 C  CG  . ASP B 2 256 ? -48.565  20.367  -6.521  1.00 83.17  ? 322 ASP A CG  1 
ATOM   2814 O  OD1 . ASP B 2 256 ? -48.892  21.082  -5.556  1.00 89.74  ? 322 ASP A OD1 1 
ATOM   2815 O  OD2 . ASP B 2 256 ? -48.026  20.847  -7.550  1.00 77.38  ? 322 ASP A OD2 1 
ATOM   2816 N  N   . TRP B 2 257 ? -46.375  17.239  -5.162  1.00 77.40  ? 323 TRP A N   1 
ATOM   2817 C  CA  . TRP B 2 257 ? -45.151  17.182  -4.327  1.00 78.91  ? 323 TRP A CA  1 
ATOM   2818 C  C   . TRP B 2 257 ? -43.883  16.852  -5.139  1.00 79.28  ? 323 TRP A C   1 
ATOM   2819 O  O   . TRP B 2 257 ? -42.805  17.352  -4.810  1.00 83.02  ? 323 TRP A O   1 
ATOM   2820 C  CB  . TRP B 2 257 ? -45.299  16.197  -3.151  1.00 78.22  ? 323 TRP A CB  1 
ATOM   2821 C  CG  . TRP B 2 257 ? -45.347  14.769  -3.581  1.00 78.52  ? 323 TRP A CG  1 
ATOM   2822 C  CD1 . TRP B 2 257 ? -46.458  14.056  -3.924  1.00 78.81  ? 323 TRP A CD1 1 
ATOM   2823 C  CD2 . TRP B 2 257 ? -44.234  13.885  -3.744  1.00 79.97  ? 323 TRP A CD2 1 
ATOM   2824 N  NE1 . TRP B 2 257 ? -46.110  12.780  -4.293  1.00 80.01  ? 323 TRP A NE1 1 
ATOM   2825 C  CE2 . TRP B 2 257 ? -44.749  12.645  -4.191  1.00 80.97  ? 323 TRP A CE2 1 
ATOM   2826 C  CE3 . TRP B 2 257 ? -42.850  14.019  -3.561  1.00 78.81  ? 323 TRP A CE3 1 
ATOM   2827 C  CZ2 . TRP B 2 257 ? -43.929  11.539  -4.451  1.00 79.18  ? 323 TRP A CZ2 1 
ATOM   2828 C  CZ3 . TRP B 2 257 ? -42.034  12.919  -3.820  1.00 79.24  ? 323 TRP A CZ3 1 
ATOM   2829 C  CH2 . TRP B 2 257 ? -42.579  11.695  -4.259  1.00 79.12  ? 323 TRP A CH2 1 
ATOM   2830 N  N   . LEU B 2 258 ? -44.016  16.023  -6.185  1.00 75.55  ? 324 LEU A N   1 
ATOM   2831 C  CA  . LEU B 2 258 ? -42.881  15.677  -7.063  1.00 69.82  ? 324 LEU A CA  1 
ATOM   2832 C  C   . LEU B 2 258 ? -42.530  16.857  -7.966  1.00 67.16  ? 324 LEU A C   1 
ATOM   2833 O  O   . LEU B 2 258 ? -41.375  17.282  -8.012  1.00 63.65  ? 324 LEU A O   1 
ATOM   2834 C  CB  . LEU B 2 258 ? -43.173  14.421  -7.911  1.00 65.63  ? 324 LEU A CB  1 
ATOM   2835 C  CG  . LEU B 2 258 ? -41.985  13.821  -8.682  1.00 62.84  ? 324 LEU A CG  1 
ATOM   2836 C  CD1 . LEU B 2 258 ? -40.944  13.245  -7.729  1.00 62.10  ? 324 LEU A CD1 1 
ATOM   2837 C  CD2 . LEU B 2 258 ? -42.448  12.775  -9.683  1.00 61.18  ? 324 LEU A CD2 1 
ATOM   2838 N  N   . PHE B 2 259 ? -43.534  17.384  -8.665  1.00 63.66  ? 325 PHE A N   1 
ATOM   2839 C  CA  . PHE B 2 259 ? -43.371  18.561  -9.529  1.00 61.01  ? 325 PHE A CA  1 
ATOM   2840 C  C   . PHE B 2 259 ? -42.602  19.675  -8.836  1.00 58.65  ? 325 PHE A C   1 
ATOM   2841 O  O   . PHE B 2 259 ? -41.638  20.187  -9.394  1.00 62.04  ? 325 PHE A O   1 
ATOM   2842 C  CB  . PHE B 2 259 ? -44.741  19.083  -9.950  1.00 62.22  ? 325 PHE A CB  1 
ATOM   2843 C  CG  . PHE B 2 259 ? -44.699  20.252  -10.894 1.00 62.29  ? 325 PHE A CG  1 
ATOM   2844 C  CD1 . PHE B 2 259 ? -44.101  20.124  -12.135 1.00 63.25  ? 325 PHE A CD1 1 
ATOM   2845 C  CD2 . PHE B 2 259 ? -45.303  21.469  -10.563 1.00 61.65  ? 325 PHE A CD2 1 
ATOM   2846 C  CE1 . PHE B 2 259 ? -44.082  21.181  -13.030 1.00 64.58  ? 325 PHE A CE1 1 
ATOM   2847 C  CE2 . PHE B 2 259 ? -45.296  22.533  -11.459 1.00 61.64  ? 325 PHE A CE2 1 
ATOM   2848 C  CZ  . PHE B 2 259 ? -44.680  22.391  -12.694 1.00 62.74  ? 325 PHE A CZ  1 
ATOM   2849 N  N   . VAL B 2 260 ? -43.017  20.029  -7.620  1.00 55.21  ? 326 VAL A N   1 
ATOM   2850 C  CA  . VAL B 2 260 ? -42.333  21.063  -6.843  1.00 54.53  ? 326 VAL A CA  1 
ATOM   2851 C  C   . VAL B 2 260 ? -40.924  20.592  -6.467  1.00 55.22  ? 326 VAL A C   1 
ATOM   2852 O  O   . VAL B 2 260 ? -39.978  21.371  -6.566  1.00 60.59  ? 326 VAL A O   1 
ATOM   2853 C  CB  . VAL B 2 260 ? -43.133  21.500  -5.588  1.00 53.65  ? 326 VAL A CB  1 
ATOM   2854 C  CG1 . VAL B 2 260 ? -42.329  22.472  -4.728  1.00 53.33  ? 326 VAL A CG1 1 
ATOM   2855 C  CG2 . VAL B 2 260 ? -44.439  22.170  -5.990  1.00 55.05  ? 326 VAL A CG2 1 
ATOM   2856 N  N   . ALA B 2 261 ? -40.778  19.328  -6.072  1.00 51.43  ? 327 ALA A N   1 
ATOM   2857 C  CA  . ALA B 2 261 ? -39.454  18.786  -5.740  1.00 49.58  ? 327 ALA A CA  1 
ATOM   2858 C  C   . ALA B 2 261 ? -38.482  18.792  -6.930  1.00 47.57  ? 327 ALA A C   1 
ATOM   2859 O  O   . ALA B 2 261 ? -37.280  19.018  -6.739  1.00 45.79  ? 327 ALA A O   1 
ATOM   2860 C  CB  . ALA B 2 261 ? -39.570  17.385  -5.165  1.00 51.62  ? 327 ALA A CB  1 
ATOM   2861 N  N   . PHE B 2 262 ? -38.994  18.547  -8.143  1.00 43.52  ? 328 PHE A N   1 
ATOM   2862 C  CA  . PHE B 2 262 ? -38.181  18.693  -9.362  1.00 40.07  ? 328 PHE A CA  1 
ATOM   2863 C  C   . PHE B 2 262 ? -37.808  20.151  -9.650  1.00 38.37  ? 328 PHE A C   1 
ATOM   2864 O  O   . PHE B 2 262 ? -36.722  20.403  -10.174 1.00 40.46  ? 328 PHE A O   1 
ATOM   2865 C  CB  . PHE B 2 262 ? -38.853  18.074  -10.605 1.00 38.59  ? 328 PHE A CB  1 
ATOM   2866 C  CG  . PHE B 2 262 ? -38.863  16.549  -10.641 1.00 38.51  ? 328 PHE A CG  1 
ATOM   2867 C  CD1 . PHE B 2 262 ? -37.955  15.760  -9.919  1.00 37.18  ? 328 PHE A CD1 1 
ATOM   2868 C  CD2 . PHE B 2 262 ? -39.793  15.896  -11.455 1.00 39.25  ? 328 PHE A CD2 1 
ATOM   2869 C  CE1 . PHE B 2 262 ? -38.000  14.372  -9.998  1.00 37.27  ? 328 PHE A CE1 1 
ATOM   2870 C  CE2 . PHE B 2 262 ? -39.836  14.506  -11.536 1.00 38.18  ? 328 PHE A CE2 1 
ATOM   2871 C  CZ  . PHE B 2 262 ? -38.938  13.746  -10.809 1.00 37.56  ? 328 PHE A CZ  1 
ATOM   2872 N  N   . ASN B 2 263 ? -38.692  21.096  -9.325  1.00 35.76  ? 329 ASN A N   1 
ATOM   2873 C  CA  . ASN B 2 263 ? -38.370  22.527  -9.438  1.00 35.15  ? 329 ASN A CA  1 
ATOM   2874 C  C   . ASN B 2 263 ? -37.281  22.925  -8.450  1.00 35.03  ? 329 ASN A C   1 
ATOM   2875 O  O   . ASN B 2 263 ? -36.459  23.777  -8.762  1.00 35.29  ? 329 ASN A O   1 
ATOM   2876 C  CB  . ASN B 2 263 ? -39.613  23.418  -9.234  1.00 35.33  ? 329 ASN A CB  1 
ATOM   2877 C  CG  . ASN B 2 263 ? -39.487  24.795  -9.894  1.00 35.86  ? 329 ASN A CG  1 
ATOM   2878 O  OD1 . ASN B 2 263 ? -40.476  25.355  -10.367 1.00 38.35  ? 329 ASN A OD1 1 
ATOM   2879 N  ND2 . ASN B 2 263 ? -38.283  25.342  -9.929  1.00 35.11  ? 329 ASN A ND2 1 
ATOM   2880 N  N   . TRP B 2 264 ? -37.270  22.327  -7.264  1.00 36.89  ? 330 TRP A N   1 
ATOM   2881 C  CA  . TRP B 2 264 ? -36.201  22.604  -6.295  1.00 40.24  ? 330 TRP A CA  1 
ATOM   2882 C  C   . TRP B 2 264 ? -34.849  22.099  -6.780  1.00 39.87  ? 330 TRP A C   1 
ATOM   2883 O  O   . TRP B 2 264 ? -33.823  22.746  -6.559  1.00 38.70  ? 330 TRP A O   1 
ATOM   2884 C  CB  . TRP B 2 264 ? -36.543  22.060  -4.891  1.00 43.96  ? 330 TRP A CB  1 
ATOM   2885 C  CG  . TRP B 2 264 ? -37.391  23.038  -4.106  1.00 47.18  ? 330 TRP A CG  1 
ATOM   2886 C  CD1 . TRP B 2 264 ? -38.752  23.196  -4.168  1.00 47.51  ? 330 TRP A CD1 1 
ATOM   2887 C  CD2 . TRP B 2 264 ? -36.918  24.034  -3.189  1.00 47.80  ? 330 TRP A CD2 1 
ATOM   2888 N  NE1 . TRP B 2 264 ? -39.151  24.209  -3.335  1.00 48.10  ? 330 TRP A NE1 1 
ATOM   2889 C  CE2 . TRP B 2 264 ? -38.047  24.744  -2.724  1.00 48.14  ? 330 TRP A CE2 1 
ATOM   2890 C  CE3 . TRP B 2 264 ? -35.648  24.391  -2.711  1.00 47.45  ? 330 TRP A CE3 1 
ATOM   2891 C  CZ2 . TRP B 2 264 ? -37.947  25.771  -1.795  1.00 48.01  ? 330 TRP A CZ2 1 
ATOM   2892 C  CZ3 . TRP B 2 264 ? -35.548  25.419  -1.799  1.00 47.18  ? 330 TRP A CZ3 1 
ATOM   2893 C  CH2 . TRP B 2 264 ? -36.695  26.086  -1.333  1.00 47.51  ? 330 TRP A CH2 1 
ATOM   2894 N  N   . LEU B 2 265 ? -34.858  20.965  -7.472  1.00 39.97  ? 331 LEU A N   1 
ATOM   2895 C  CA  . LEU B 2 265 ? -33.650  20.420  -8.078  1.00 39.77  ? 331 LEU A CA  1 
ATOM   2896 C  C   . LEU B 2 265 ? -33.051  21.388  -9.105  1.00 41.02  ? 331 LEU A C   1 
ATOM   2897 O  O   . LEU B 2 265 ? -31.830  21.546  -9.177  1.00 42.35  ? 331 LEU A O   1 
ATOM   2898 C  CB  . LEU B 2 265 ? -33.970  19.079  -8.722  1.00 39.30  ? 331 LEU A CB  1 
ATOM   2899 C  CG  . LEU B 2 265 ? -32.789  18.282  -9.265  1.00 40.74  ? 331 LEU A CG  1 
ATOM   2900 C  CD1 . LEU B 2 265 ? -31.765  17.959  -8.184  1.00 39.31  ? 331 LEU A CD1 1 
ATOM   2901 C  CD2 . LEU B 2 265 ? -33.306  17.013  -9.925  1.00 42.44  ? 331 LEU A CD2 1 
ATOM   2902 N  N   . GLY B 2 266 ? -33.912  22.041  -9.882  1.00 41.75  ? 332 GLY A N   1 
ATOM   2903 C  CA  . GLY B 2 266 ? -33.498  23.100  -10.808 1.00 42.58  ? 332 GLY A CA  1 
ATOM   2904 C  C   . GLY B 2 266 ? -32.844  24.298  -10.136 1.00 43.48  ? 332 GLY A C   1 
ATOM   2905 O  O   . GLY B 2 266 ? -31.833  24.817  -10.625 1.00 44.26  ? 332 GLY A O   1 
ATOM   2906 N  N   . TYR B 2 267 ? -33.405  24.742  -9.011  1.00 42.43  ? 333 TYR A N   1 
ATOM   2907 C  CA  . TYR B 2 267 ? -32.775  25.822  -8.243  1.00 42.83  ? 333 TYR A CA  1 
ATOM   2908 C  C   . TYR B 2 267 ? -31.402  25.414  -7.721  1.00 42.79  ? 333 TYR A C   1 
ATOM   2909 O  O   . TYR B 2 267 ? -30.564  26.278  -7.488  1.00 44.79  ? 333 TYR A O   1 
ATOM   2910 C  CB  . TYR B 2 267 ? -33.641  26.294  -7.066  1.00 43.40  ? 333 TYR A CB  1 
ATOM   2911 C  CG  . TYR B 2 267 ? -35.025  26.811  -7.431  1.00 42.92  ? 333 TYR A CG  1 
ATOM   2912 C  CD1 . TYR B 2 267 ? -35.230  27.619  -8.556  1.00 41.85  ? 333 TYR A CD1 1 
ATOM   2913 C  CD2 . TYR B 2 267 ? -36.124  26.517  -6.625  1.00 42.14  ? 333 TYR A CD2 1 
ATOM   2914 C  CE1 . TYR B 2 267 ? -36.487  28.089  -8.877  1.00 41.78  ? 333 TYR A CE1 1 
ATOM   2915 C  CE2 . TYR B 2 267 ? -37.383  26.984  -6.939  1.00 43.35  ? 333 TYR A CE2 1 
ATOM   2916 C  CZ  . TYR B 2 267 ? -37.559  27.769  -8.065  1.00 43.41  ? 333 TYR A CZ  1 
ATOM   2917 O  OH  . TYR B 2 267 ? -38.816  28.216  -8.374  1.00 42.93  ? 333 TYR A OH  1 
ATOM   2918 N  N   . ALA B 2 268 ? -31.180  24.111  -7.528  1.00 41.50  ? 334 ALA A N   1 
ATOM   2919 C  CA  . ALA B 2 268 ? -29.876  23.601  -7.094  1.00 41.21  ? 334 ALA A CA  1 
ATOM   2920 C  C   . ALA B 2 268 ? -28.764  23.899  -8.103  1.00 41.05  ? 334 ALA A C   1 
ATOM   2921 O  O   . ALA B 2 268 ? -27.642  24.208  -7.706  1.00 38.26  ? 334 ALA A O   1 
ATOM   2922 C  CB  . ALA B 2 268 ? -29.947  22.104  -6.807  1.00 41.62  ? 334 ALA A CB  1 
ATOM   2923 N  N   . ASN B 2 269 ? -29.090  23.822  -9.396  1.00 41.22  ? 335 ASN A N   1 
ATOM   2924 C  CA  . ASN B 2 269 ? -28.157  24.190  -10.483 1.00 39.85  ? 335 ASN A CA  1 
ATOM   2925 C  C   . ASN B 2 269 ? -27.562  25.584  -10.282 1.00 39.46  ? 335 ASN A C   1 
ATOM   2926 O  O   . ASN B 2 269 ? -26.390  25.793  -10.574 1.00 42.02  ? 335 ASN A O   1 
ATOM   2927 C  CB  . ASN B 2 269 ? -28.859  24.108  -11.855 1.00 39.81  ? 335 ASN A CB  1 
ATOM   2928 C  CG  . ASN B 2 269 ? -27.908  24.261  -13.047 1.00 39.79  ? 335 ASN A CG  1 
ATOM   2929 O  OD1 . ASN B 2 269 ? -28.264  24.902  -14.025 1.00 39.20  ? 335 ASN A OD1 1 
ATOM   2930 N  ND2 . ASN B 2 269 ? -26.729  23.649  -12.989 1.00 39.98  ? 335 ASN A ND2 1 
ATOM   2931 N  N   . SER B 2 270 ? -28.353  26.525  -9.760  1.00 38.38  ? 336 SER A N   1 
ATOM   2932 C  CA  . SER B 2 270 ? -27.864  27.882  -9.481  1.00 36.70  ? 336 SER A CA  1 
ATOM   2933 C  C   . SER B 2 270 ? -26.732  27.916  -8.445  1.00 37.10  ? 336 SER A C   1 
ATOM   2934 O  O   . SER B 2 270 ? -25.932  28.845  -8.450  1.00 38.67  ? 336 SER A O   1 
ATOM   2935 C  CB  . SER B 2 270 ? -29.018  28.799  -9.053  1.00 35.83  ? 336 SER A CB  1 
ATOM   2936 O  OG  . SER B 2 270 ? -29.974  28.969  -10.093 1.00 35.33  ? 336 SER A OG  1 
ATOM   2937 N  N   . ALA B 2 271 ? -26.678  26.925  -7.553  1.00 37.21  ? 337 ALA A N   1 
ATOM   2938 C  CA  . ALA B 2 271 ? -25.567  26.769  -6.605  1.00 37.34  ? 337 ALA A CA  1 
ATOM   2939 C  C   . ALA B 2 271 ? -24.384  26.039  -7.236  1.00 38.48  ? 337 ALA A C   1 
ATOM   2940 O  O   . ALA B 2 271 ? -23.228  26.268  -6.867  1.00 41.56  ? 337 ALA A O   1 
ATOM   2941 C  CB  . ALA B 2 271 ? -26.028  26.009  -5.380  1.00 37.31  ? 337 ALA A CB  1 
ATOM   2942 N  N   . MET B 2 272 ? -24.687  25.128  -8.155  1.00 37.99  ? 338 MET A N   1 
ATOM   2943 C  CA  . MET B 2 272 ? -23.669  24.376  -8.880  1.00 38.20  ? 338 MET A CA  1 
ATOM   2944 C  C   . MET B 2 272 ? -22.857  25.222  -9.867  1.00 37.89  ? 338 MET A C   1 
ATOM   2945 O  O   . MET B 2 272 ? -21.661  24.976  -10.037 1.00 38.55  ? 338 MET A O   1 
ATOM   2946 C  CB  . MET B 2 272 ? -24.314  23.205  -9.644  1.00 39.02  ? 338 MET A CB  1 
ATOM   2947 C  CG  . MET B 2 272 ? -24.961  22.137  -8.771  1.00 38.77  ? 338 MET A CG  1 
ATOM   2948 S  SD  . MET B 2 272 ? -23.862  21.447  -7.537  1.00 39.12  ? 338 MET A SD  1 
ATOM   2949 C  CE  . MET B 2 272 ? -22.516  20.794  -8.529  1.00 40.48  ? 338 MET A CE  1 
ATOM   2950 N  N   . ASN B 2 273 ? -23.489  26.197  -10.522 1.00 35.58  ? 339 ASN A N   1 
ATOM   2951 C  CA  . ASN B 2 273 ? -22.825  26.937  -11.609 1.00 33.93  ? 339 ASN A CA  1 
ATOM   2952 C  C   . ASN B 2 273 ? -21.487  27.618  -11.243 1.00 32.70  ? 339 ASN A C   1 
ATOM   2953 O  O   . ASN B 2 273 ? -20.531  27.493  -11.996 1.00 31.92  ? 339 ASN A O   1 
ATOM   2954 C  CB  . ASN B 2 273 ? -23.785  27.934  -12.274 1.00 33.56  ? 339 ASN A CB  1 
ATOM   2955 C  CG  . ASN B 2 273 ? -24.794  27.258  -13.201 1.00 33.80  ? 339 ASN A CG  1 
ATOM   2956 O  OD1 . ASN B 2 273 ? -24.588  26.129  -13.689 1.00 32.99  ? 339 ASN A OD1 1 
ATOM   2957 N  ND2 . ASN B 2 273 ? -25.899  27.954  -13.454 1.00 33.08  ? 339 ASN A ND2 1 
ATOM   2958 N  N   . PRO B 2 274 ? -21.406  28.331  -10.097 1.00 31.69  ? 340 PRO A N   1 
ATOM   2959 C  CA  . PRO B 2 274 ? -20.105  28.870  -9.677  1.00 30.18  ? 340 PRO A CA  1 
ATOM   2960 C  C   . PRO B 2 274 ? -18.992  27.818  -9.592  1.00 29.22  ? 340 PRO A C   1 
ATOM   2961 O  O   . PRO B 2 274 ? -17.865  28.090  -9.993  1.00 28.05  ? 340 PRO A O   1 
ATOM   2962 C  CB  . PRO B 2 274 ? -20.399  29.447  -8.285  1.00 30.78  ? 340 PRO A CB  1 
ATOM   2963 C  CG  . PRO B 2 274 ? -21.837  29.792  -8.306  1.00 31.22  ? 340 PRO A CG  1 
ATOM   2964 C  CD  . PRO B 2 274 ? -22.500  28.804  -9.220  1.00 32.15  ? 340 PRO A CD  1 
ATOM   2965 N  N   . ILE B 2 275 ? -19.329  26.629  -9.105  1.00 29.25  ? 341 ILE A N   1 
ATOM   2966 C  CA  . ILE B 2 275 ? -18.360  25.545  -8.945  1.00 29.48  ? 341 ILE A CA  1 
ATOM   2967 C  C   . ILE B 2 275 ? -17.859  25.050  -10.304 1.00 28.84  ? 341 ILE A C   1 
ATOM   2968 O  O   . ILE B 2 275 ? -16.687  24.723  -10.434 1.00 29.48  ? 341 ILE A O   1 
ATOM   2969 C  CB  . ILE B 2 275 ? -18.944  24.329  -8.157  1.00 31.01  ? 341 ILE A CB  1 
ATOM   2970 C  CG1 . ILE B 2 275 ? -19.576  24.757  -6.812  1.00 31.65  ? 341 ILE A CG1 1 
ATOM   2971 C  CG2 . ILE B 2 275 ? -17.872  23.244  -7.958  1.00 30.73  ? 341 ILE A CG2 1 
ATOM   2972 C  CD1 . ILE B 2 275 ? -18.673  25.614  -5.956  1.00 32.98  ? 341 ILE A CD1 1 
ATOM   2973 N  N   . ILE B 2 276 ? -18.738  25.012  -11.303 1.00 28.27  ? 342 ILE A N   1 
ATOM   2974 C  CA  . ILE B 2 276 ? -18.410  24.484  -12.633 1.00 27.95  ? 342 ILE A CA  1 
ATOM   2975 C  C   . ILE B 2 276 ? -17.622  25.506  -13.444 1.00 28.21  ? 342 ILE A C   1 
ATOM   2976 O  O   . ILE B 2 276 ? -16.530  25.219  -13.944 1.00 30.46  ? 342 ILE A O   1 
ATOM   2977 C  CB  . ILE B 2 276 ? -19.694  24.126  -13.419 1.00 28.12  ? 342 ILE A CB  1 
ATOM   2978 C  CG1 . ILE B 2 276 ? -20.494  23.044  -12.682 1.00 28.61  ? 342 ILE A CG1 1 
ATOM   2979 C  CG2 . ILE B 2 276 ? -19.367  23.680  -14.842 1.00 27.79  ? 342 ILE A CG2 1 
ATOM   2980 C  CD1 . ILE B 2 276 ? -21.939  22.922  -13.118 1.00 29.00  ? 342 ILE A CD1 1 
ATOM   2981 N  N   . TYR B 2 277 ? -18.188  26.702  -13.561 1.00 28.17  ? 343 TYR A N   1 
ATOM   2982 C  CA  . TYR B 2 277 ? -17.713  27.699  -14.511 1.00 28.21  ? 343 TYR A CA  1 
ATOM   2983 C  C   . TYR B 2 277 ? -16.726  28.731  -13.962 1.00 29.71  ? 343 TYR A C   1 
ATOM   2984 O  O   . TYR B 2 277 ? -16.421  29.695  -14.672 1.00 31.85  ? 343 TYR A O   1 
ATOM   2985 C  CB  . TYR B 2 277 ? -18.912  28.429  -15.137 1.00 26.35  ? 343 TYR A CB  1 
ATOM   2986 C  CG  . TYR B 2 277 ? -19.823  27.564  -15.962 1.00 24.37  ? 343 TYR A CG  1 
ATOM   2987 C  CD1 . TYR B 2 277 ? -20.931  26.977  -15.387 1.00 24.10  ? 343 TYR A CD1 1 
ATOM   2988 C  CD2 . TYR B 2 277 ? -19.588  27.339  -17.318 1.00 23.18  ? 343 TYR A CD2 1 
ATOM   2989 C  CE1 . TYR B 2 277 ? -21.792  26.187  -16.124 1.00 23.27  ? 343 TYR A CE1 1 
ATOM   2990 C  CE2 . TYR B 2 277 ? -20.450  26.548  -18.066 1.00 22.92  ? 343 TYR A CE2 1 
ATOM   2991 C  CZ  . TYR B 2 277 ? -21.559  25.982  -17.454 1.00 22.54  ? 343 TYR A CZ  1 
ATOM   2992 O  OH  . TYR B 2 277 ? -22.437  25.177  -18.131 1.00 21.20  ? 343 TYR A OH  1 
ATOM   2993 N  N   . CYS B 2 278 ? -16.237  28.569  -12.734 1.00 31.28  ? 344 CYS A N   1 
ATOM   2994 C  CA  . CYS B 2 278 ? -15.272  29.542  -12.171 1.00 33.04  ? 344 CYS A CA  1 
ATOM   2995 C  C   . CYS B 2 278 ? -14.082  28.863  -11.504 1.00 33.03  ? 344 CYS A C   1 
ATOM   2996 O  O   . CYS B 2 278 ? -13.651  29.279  -10.440 1.00 31.15  ? 344 CYS A O   1 
ATOM   2997 C  CB  . CYS B 2 278 ? -15.968  30.492  -11.193 1.00 33.09  ? 344 CYS A CB  1 
ATOM   2998 S  SG  . CYS B 2 278 ? -17.462  31.223  -11.879 1.00 33.81  ? 344 CYS A SG  1 
ATOM   2999 N  N   . ARG B 2 279 ? -13.551  27.834  -12.160 1.00 34.33  ? 345 ARG A N   1 
ATOM   3000 C  CA  . ARG B 2 279 ? -12.417  27.060  -11.646 1.00 35.19  ? 345 ARG A CA  1 
ATOM   3001 C  C   . ARG B 2 279 ? -11.059  27.564  -12.163 1.00 33.86  ? 345 ARG A C   1 
ATOM   3002 O  O   . ARG B 2 279 ? -10.024  26.987  -11.818 1.00 33.26  ? 345 ARG A O   1 
ATOM   3003 C  CB  . ARG B 2 279 ? -12.542  25.590  -12.052 1.00 38.04  ? 345 ARG A CB  1 
ATOM   3004 C  CG  . ARG B 2 279 ? -13.725  24.813  -11.537 1.00 38.70  ? 345 ARG A CG  1 
ATOM   3005 C  CD  . ARG B 2 279 ? -13.616  23.415  -12.124 1.00 42.63  ? 345 ARG A CD  1 
ATOM   3006 N  NE  . ARG B 2 279 ? -14.628  22.523  -11.594 1.00 49.95  ? 345 ARG A NE  1 
ATOM   3007 C  CZ  . ARG B 2 279 ? -14.647  22.018  -10.356 1.00 58.15  ? 345 ARG A CZ  1 
ATOM   3008 N  NH1 . ARG B 2 279 ? -13.671  22.299  -9.481  1.00 60.77  ? 345 ARG A NH1 1 
ATOM   3009 N  NH2 . ARG B 2 279 ? -15.675  21.236  -9.975  1.00 60.93  ? 345 ARG A NH2 1 
ATOM   3010 N  N   . SER B 2 280 ? -11.044  28.621  -12.980 1.00 33.69  ? 346 SER A N   1 
ATOM   3011 C  CA  . SER B 2 280 ? -9.790   29.096  -13.580 1.00 34.85  ? 346 SER A CA  1 
ATOM   3012 C  C   . SER B 2 280 ? -8.771   29.464  -12.494 1.00 36.42  ? 346 SER A C   1 
ATOM   3013 O  O   . SER B 2 280 ? -9.172   29.866  -11.405 1.00 35.48  ? 346 SER A O   1 
ATOM   3014 C  CB  . SER B 2 280 ? -10.018  30.274  -14.561 1.00 33.82  ? 346 SER A CB  1 
ATOM   3015 O  OG  . SER B 2 280 ? -10.176  31.530  -13.916 1.00 32.77  ? 346 SER A OG  1 
ATOM   3016 N  N   . PRO B 2 281 ? -7.459   29.321  -12.782 1.00 39.43  ? 347 PRO A N   1 
ATOM   3017 C  CA  . PRO B 2 281 ? -6.448   29.678  -11.791 1.00 40.04  ? 347 PRO A CA  1 
ATOM   3018 C  C   . PRO B 2 281 ? -6.545   31.131  -11.350 1.00 41.22  ? 347 PRO A C   1 
ATOM   3019 O  O   . PRO B 2 281 ? -6.272   31.412  -10.193 1.00 42.66  ? 347 PRO A O   1 
ATOM   3020 C  CB  . PRO B 2 281 ? -5.124   29.446  -12.526 1.00 40.51  ? 347 PRO A CB  1 
ATOM   3021 C  CG  . PRO B 2 281 ? -5.464   28.585  -13.688 1.00 40.06  ? 347 PRO A CG  1 
ATOM   3022 C  CD  . PRO B 2 281 ? -6.836   29.007  -14.080 1.00 40.24  ? 347 PRO A CD  1 
ATOM   3023 N  N   . ASP B 2 282 ? -6.930   32.036  -12.256 1.00 42.51  ? 348 ASP A N   1 
ATOM   3024 C  CA  . ASP B 2 282 ? -7.241   33.424  -11.876 1.00 44.31  ? 348 ASP A CA  1 
ATOM   3025 C  C   . ASP B 2 282 ? -8.452   33.555  -10.936 1.00 44.87  ? 348 ASP A C   1 
ATOM   3026 O  O   . ASP B 2 282 ? -8.433   34.391  -10.025 1.00 46.69  ? 348 ASP A O   1 
ATOM   3027 C  CB  . ASP B 2 282 ? -7.452   34.304  -13.108 1.00 46.32  ? 348 ASP A CB  1 
ATOM   3028 C  CG  . ASP B 2 282 ? -6.144   34.708  -13.763 1.00 49.36  ? 348 ASP A CG  1 
ATOM   3029 O  OD1 . ASP B 2 282 ? -5.155   34.997  -13.046 1.00 54.94  ? 348 ASP A OD1 1 
ATOM   3030 O  OD2 . ASP B 2 282 ? -6.098   34.750  -15.006 1.00 50.29  ? 348 ASP A OD2 1 
ATOM   3031 N  N   . PHE B 2 283 ? -9.501   32.759  -11.159 1.00 43.03  ? 349 PHE A N   1 
ATOM   3032 C  CA  . PHE B 2 283 ? -10.627  32.705  -10.210 1.00 41.36  ? 349 PHE A CA  1 
ATOM   3033 C  C   . PHE B 2 283 ? -10.158  32.179  -8.848  1.00 42.41  ? 349 PHE A C   1 
ATOM   3034 O  O   . PHE B 2 283 ? -10.468  32.774  -7.827  1.00 42.53  ? 349 PHE A O   1 
ATOM   3035 C  CB  . PHE B 2 283 ? -11.813  31.858  -10.732 1.00 39.14  ? 349 PHE A CB  1 
ATOM   3036 C  CG  . PHE B 2 283 ? -12.903  32.656  -11.410 1.00 36.22  ? 349 PHE A CG  1 
ATOM   3037 C  CD1 . PHE B 2 283 ? -13.615  33.610  -10.707 1.00 35.20  ? 349 PHE A CD1 1 
ATOM   3038 C  CD2 . PHE B 2 283 ? -13.243  32.423  -12.741 1.00 34.68  ? 349 PHE A CD2 1 
ATOM   3039 C  CE1 . PHE B 2 283 ? -14.623  34.347  -11.323 1.00 34.65  ? 349 PHE A CE1 1 
ATOM   3040 C  CE2 . PHE B 2 283 ? -14.252  33.153  -13.362 1.00 33.50  ? 349 PHE A CE2 1 
ATOM   3041 C  CZ  . PHE B 2 283 ? -14.948  34.111  -12.652 1.00 32.87  ? 349 PHE A CZ  1 
ATOM   3042 N  N   . ARG B 2 284 ? -9.397   31.085  -8.838  1.00 45.93  ? 350 ARG A N   1 
ATOM   3043 C  CA  . ARG B 2 284 ? -8.904   30.488  -7.586  1.00 49.34  ? 350 ARG A CA  1 
ATOM   3044 C  C   . ARG B 2 284 ? -8.072   31.464  -6.766  1.00 50.43  ? 350 ARG A C   1 
ATOM   3045 O  O   . ARG B 2 284 ? -8.132   31.429  -5.546  1.00 51.15  ? 350 ARG A O   1 
ATOM   3046 C  CB  . ARG B 2 284 ? -8.053   29.240  -7.849  1.00 53.48  ? 350 ARG A CB  1 
ATOM   3047 C  CG  . ARG B 2 284 ? -8.771   28.057  -8.467  1.00 57.44  ? 350 ARG A CG  1 
ATOM   3048 C  CD  . ARG B 2 284 ? -9.703   27.386  -7.479  1.00 63.35  ? 350 ARG A CD  1 
ATOM   3049 N  NE  . ARG B 2 284 ? -10.445  26.277  -8.085  1.00 69.69  ? 350 ARG A NE  1 
ATOM   3050 C  CZ  . ARG B 2 284 ? -9.963   25.052  -8.331  1.00 73.56  ? 350 ARG A CZ  1 
ATOM   3051 N  NH1 . ARG B 2 284 ? -8.703   24.726  -8.037  1.00 74.06  ? 350 ARG A NH1 1 
ATOM   3052 N  NH2 . ARG B 2 284 ? -10.759  24.136  -8.882  1.00 77.83  ? 350 ARG A NH2 1 
ATOM   3053 N  N   . LYS B 2 285 ? -7.287   32.311  -7.435  1.00 51.69  ? 351 LYS A N   1 
ATOM   3054 C  CA  . LYS B 2 285 ? -6.503   33.355  -6.760  1.00 52.30  ? 351 LYS A CA  1 
ATOM   3055 C  C   . LYS B 2 285 ? -7.397   34.435  -6.181  1.00 49.38  ? 351 LYS A C   1 
ATOM   3056 O  O   . LYS B 2 285 ? -7.253   34.803  -5.020  1.00 48.97  ? 351 LYS A O   1 
ATOM   3057 C  CB  . LYS B 2 285 ? -5.492   34.007  -7.712  1.00 55.98  ? 351 LYS A CB  1 
ATOM   3058 C  CG  . LYS B 2 285 ? -4.297   33.122  -8.021  1.00 61.20  ? 351 LYS A CG  1 
ATOM   3059 C  CD  . LYS B 2 285 ? -3.405   33.690  -9.116  1.00 65.33  ? 351 LYS A CD  1 
ATOM   3060 C  CE  . LYS B 2 285 ? -2.488   32.604  -9.673  1.00 68.77  ? 351 LYS A CE  1 
ATOM   3061 N  NZ  . LYS B 2 285 ? -1.505   33.137  -10.655 1.00 70.20  ? 351 LYS A NZ  1 
ATOM   3062 N  N   . ALA B 2 286 ? -8.310   34.944  -7.002  1.00 48.35  ? 352 ALA A N   1 
ATOM   3063 C  CA  . ALA B 2 286 ? -9.225   36.003  -6.582  1.00 47.78  ? 352 ALA A CA  1 
ATOM   3064 C  C   . ALA B 2 286 ? -10.068  35.592  -5.370  1.00 48.04  ? 352 ALA A C   1 
ATOM   3065 O  O   . ALA B 2 286 ? -10.278  36.403  -4.474  1.00 48.52  ? 352 ALA A O   1 
ATOM   3066 C  CB  . ALA B 2 286 ? -10.118  36.429  -7.738  1.00 46.83  ? 352 ALA A CB  1 
ATOM   3067 N  N   . PHE B 2 287 ? -10.523  34.338  -5.336  1.00 48.84  ? 353 PHE A N   1 
ATOM   3068 C  CA  . PHE B 2 287 ? -11.327  33.830  -4.215  1.00 48.38  ? 353 PHE A CA  1 
ATOM   3069 C  C   . PHE B 2 287 ? -10.539  33.780  -2.895  1.00 51.15  ? 353 PHE A C   1 
ATOM   3070 O  O   . PHE B 2 287 ? -11.083  34.098  -1.832  1.00 48.73  ? 353 PHE A O   1 
ATOM   3071 C  CB  . PHE B 2 287 ? -11.908  32.437  -4.518  1.00 45.77  ? 353 PHE A CB  1 
ATOM   3072 C  CG  . PHE B 2 287 ? -12.925  32.401  -5.642  1.00 43.84  ? 353 PHE A CG  1 
ATOM   3073 C  CD1 . PHE B 2 287 ? -13.916  33.371  -5.770  1.00 42.24  ? 353 PHE A CD1 1 
ATOM   3074 C  CD2 . PHE B 2 287 ? -12.930  31.341  -6.544  1.00 43.07  ? 353 PHE A CD2 1 
ATOM   3075 C  CE1 . PHE B 2 287 ? -14.847  33.305  -6.795  1.00 41.29  ? 353 PHE A CE1 1 
ATOM   3076 C  CE2 . PHE B 2 287 ? -13.871  31.274  -7.567  1.00 42.15  ? 353 PHE A CE2 1 
ATOM   3077 C  CZ  . PHE B 2 287 ? -14.825  32.260  -7.695  1.00 41.81  ? 353 PHE A CZ  1 
ATOM   3078 N  N   . LYS B 2 288 ? -9.271   33.380  -2.958  1.00 56.70  ? 354 LYS A N   1 
ATOM   3079 C  CA  . LYS B 2 288 ? -8.410   33.408  -1.772  1.00 62.18  ? 354 LYS A CA  1 
ATOM   3080 C  C   . LYS B 2 288 ? -8.205   34.851  -1.320  1.00 61.00  ? 354 LYS A C   1 
ATOM   3081 O  O   . LYS B 2 288 ? -8.398   35.175  -0.145  1.00 63.11  ? 354 LYS A O   1 
ATOM   3082 C  CB  . LYS B 2 288 ? -7.072   32.694  -2.019  1.00 67.62  ? 354 LYS A CB  1 
ATOM   3083 C  CG  . LYS B 2 288 ? -7.229   31.179  -2.048  1.00 76.19  ? 354 LYS A CG  1 
ATOM   3084 C  CD  . LYS B 2 288 ? -5.920   30.424  -2.251  1.00 83.02  ? 354 LYS A CD  1 
ATOM   3085 C  CE  . LYS B 2 288 ? -6.201   28.945  -2.521  1.00 88.98  ? 354 LYS A CE  1 
ATOM   3086 N  NZ  . LYS B 2 288 ? -5.010   28.195  -3.009  1.00 91.84  ? 354 LYS A NZ  1 
ATOM   3087 N  N   . ARG B 2 289 ? -7.864   35.718  -2.270  1.00 59.25  ? 355 ARG A N   1 
ATOM   3088 C  CA  . ARG B 2 289 ? -7.707   37.149  -2.009  1.00 58.96  ? 355 ARG A CA  1 
ATOM   3089 C  C   . ARG B 2 289 ? -8.959   37.767  -1.387  1.00 58.17  ? 355 ARG A C   1 
ATOM   3090 O  O   . ARG B 2 289 ? -8.844   38.595  -0.495  1.00 59.70  ? 355 ARG A O   1 
ATOM   3091 C  CB  . ARG B 2 289 ? -7.344   37.894  -3.295  1.00 61.84  ? 355 ARG A CB  1 
ATOM   3092 C  CG  . ARG B 2 289 ? -6.974   39.364  -3.106  1.00 64.51  ? 355 ARG A CG  1 
ATOM   3093 C  CD  . ARG B 2 289 ? -6.669   40.061  -4.429  1.00 67.89  ? 355 ARG A CD  1 
ATOM   3094 N  NE  . ARG B 2 289 ? -7.795   39.983  -5.364  1.00 71.31  ? 355 ARG A NE  1 
ATOM   3095 C  CZ  . ARG B 2 289 ? -8.931   40.683  -5.276  1.00 71.74  ? 355 ARG A CZ  1 
ATOM   3096 N  NH1 . ARG B 2 289 ? -9.134   41.556  -4.284  1.00 72.21  ? 355 ARG A NH1 1 
ATOM   3097 N  NH2 . ARG B 2 289 ? -9.885   40.502  -6.188  1.00 70.78  ? 355 ARG A NH2 1 
ATOM   3098 N  N   . LEU B 2 290 ? -10.142  37.367  -1.853  1.00 60.41  ? 356 LEU A N   1 
ATOM   3099 C  CA  . LEU B 2 290 ? -11.406  37.891  -1.312  1.00 62.83  ? 356 LEU A CA  1 
ATOM   3100 C  C   . LEU B 2 290 ? -11.757  37.372  0.083   1.00 63.59  ? 356 LEU A C   1 
ATOM   3101 O  O   . LEU B 2 290 ? -12.436  38.068  0.833   1.00 65.38  ? 356 LEU A O   1 
ATOM   3102 C  CB  . LEU B 2 290 ? -12.592  37.596  -2.243  1.00 61.60  ? 356 LEU A CB  1 
ATOM   3103 C  CG  . LEU B 2 290 ? -12.708  38.328  -3.584  1.00 60.55  ? 356 LEU A CG  1 
ATOM   3104 C  CD1 . LEU B 2 290 ? -13.960  37.796  -4.277  1.00 61.71  ? 356 LEU A CD1 1 
ATOM   3105 C  CD2 . LEU B 2 290 ? -12.749  39.852  -3.466  1.00 58.40  ? 356 LEU A CD2 1 
ATOM   3106 N  N   . LEU B 2 291 ? -11.329  36.156  0.420   1.00 63.20  ? 357 LEU A N   1 
ATOM   3107 C  CA  . LEU B 2 291 ? -11.600  35.580  1.737   1.00 64.93  ? 357 LEU A CA  1 
ATOM   3108 C  C   . LEU B 2 291 ? -10.401  35.737  2.687   1.00 72.27  ? 357 LEU A C   1 
ATOM   3109 O  O   . LEU B 2 291 ? -10.058  34.820  3.430   1.00 75.99  ? 357 LEU A O   1 
ATOM   3110 C  CB  . LEU B 2 291 ? -12.013  34.112  1.579   1.00 60.49  ? 357 LEU A CB  1 
ATOM   3111 C  CG  . LEU B 2 291 ? -13.274  33.869  0.732   1.00 56.70  ? 357 LEU A CG  1 
ATOM   3112 C  CD1 . LEU B 2 291 ? -13.448  32.397  0.385   1.00 54.67  ? 357 LEU A CD1 1 
ATOM   3113 C  CD2 . LEU B 2 291 ? -14.511  34.405  1.447   1.00 56.20  ? 357 LEU A CD2 1 
ATOM   3114 N  N   . ALA B 2 292 ? -9.789   36.926  2.667   1.00 78.28  ? 358 ALA A N   1 
ATOM   3115 C  CA  . ALA B 2 292 ? -8.761   37.375  3.620   1.00 78.78  ? 358 ALA A CA  1 
ATOM   3116 C  C   . ALA B 2 292 ? -7.412   36.675  3.443   1.00 79.88  ? 358 ALA A C   1 
ATOM   3117 O  O   . ALA B 2 292 ? -7.030   35.822  4.238   1.00 85.03  ? 358 ALA A O   1 
ATOM   3118 C  CB  . ALA B 2 292 ? -9.255   37.303  5.073   1.00 78.08  ? 358 ALA A CB  1 
ATOM   3119 N  N   . GLN C 3 2   ? 4.756    16.400  -16.530 1.00 91.44  ? 1   GLN C N   1 
ATOM   3120 C  CA  . GLN C 3 2   ? 4.987    17.878  -16.572 1.00 94.13  ? 1   GLN C CA  1 
ATOM   3121 C  C   . GLN C 3 2   ? 5.191    18.369  -18.010 1.00 89.51  ? 1   GLN C C   1 
ATOM   3122 O  O   . GLN C 3 2   ? 5.863    17.709  -18.794 1.00 91.35  ? 1   GLN C O   1 
ATOM   3123 C  CB  . GLN C 3 2   ? 6.211    18.249  -15.709 1.00 99.50  ? 1   GLN C CB  1 
ATOM   3124 C  CG  . GLN C 3 2   ? 6.394    19.746  -15.441 1.00 103.87 ? 1   GLN C CG  1 
ATOM   3125 C  CD  . GLN C 3 2   ? 5.320    20.336  -14.531 1.00 107.00 ? 1   GLN C CD  1 
ATOM   3126 O  OE1 . GLN C 3 2   ? 4.983    19.755  -13.501 1.00 109.32 ? 1   GLN C OE1 1 
ATOM   3127 N  NE2 . GLN C 3 2   ? 4.791    21.505  -14.901 1.00 106.03 ? 1   GLN C NE2 1 
ATOM   3128 N  N   . VAL C 3 3   ? 4.606    19.519  -18.349 1.00 83.36  ? 2   VAL C N   1 
ATOM   3129 C  CA  . VAL C 3 3   ? 4.797    20.143  -19.675 1.00 76.50  ? 2   VAL C CA  1 
ATOM   3130 C  C   . VAL C 3 3   ? 6.039    21.015  -19.641 1.00 71.41  ? 2   VAL C C   1 
ATOM   3131 O  O   . VAL C 3 3   ? 6.216    21.762  -18.679 1.00 69.47  ? 2   VAL C O   1 
ATOM   3132 C  CB  . VAL C 3 3   ? 3.590    21.017  -20.091 1.00 78.03  ? 2   VAL C CB  1 
ATOM   3133 C  CG1 . VAL C 3 3   ? 3.822    21.670  -21.448 1.00 77.57  ? 2   VAL C CG1 1 
ATOM   3134 C  CG2 . VAL C 3 3   ? 2.302    20.207  -20.092 1.00 80.25  ? 2   VAL C CG2 1 
ATOM   3135 N  N   . GLN C 3 4   ? 6.876    20.915  -20.674 1.00 67.46  ? 3   GLN C N   1 
ATOM   3136 C  CA  . GLN C 3 4   ? 8.043    21.788  -20.834 1.00 64.65  ? 3   GLN C CA  1 
ATOM   3137 C  C   . GLN C 3 4   ? 8.219    22.193  -22.282 1.00 56.74  ? 3   GLN C C   1 
ATOM   3138 O  O   . GLN C 3 4   ? 7.950    21.429  -23.187 1.00 55.05  ? 3   GLN C O   1 
ATOM   3139 C  CB  . GLN C 3 4   ? 9.328    21.116  -20.317 1.00 70.76  ? 3   GLN C CB  1 
ATOM   3140 C  CG  . GLN C 3 4   ? 9.541    21.392  -18.827 1.00 76.32  ? 3   GLN C CG  1 
ATOM   3141 C  CD  . GLN C 3 4   ? 10.509   20.445  -18.164 1.00 82.03  ? 3   GLN C CD  1 
ATOM   3142 O  OE1 . GLN C 3 4   ? 11.495   20.025  -18.771 1.00 89.23  ? 3   GLN C OE1 1 
ATOM   3143 N  NE2 . GLN C 3 4   ? 10.232   20.104  -16.907 1.00 84.46  ? 3   GLN C NE2 1 
ATOM   3144 N  N   . LEU C 3 5   ? 8.686    23.418  -22.473 1.00 51.28  ? 4   LEU C N   1 
ATOM   3145 C  CA  . LEU C 3 5   ? 8.886    24.001  -23.787 1.00 49.03  ? 4   LEU C CA  1 
ATOM   3146 C  C   . LEU C 3 5   ? 10.374   24.258  -23.985 1.00 46.68  ? 4   LEU C C   1 
ATOM   3147 O  O   . LEU C 3 5   ? 10.981   25.016  -23.224 1.00 47.86  ? 4   LEU C O   1 
ATOM   3148 C  CB  . LEU C 3 5   ? 8.111    25.310  -23.880 1.00 49.19  ? 4   LEU C CB  1 
ATOM   3149 C  CG  . LEU C 3 5   ? 6.617    25.224  -23.543 1.00 48.25  ? 4   LEU C CG  1 
ATOM   3150 C  CD1 . LEU C 3 5   ? 5.905    26.547  -23.745 1.00 49.42  ? 4   LEU C CD1 1 
ATOM   3151 C  CD2 . LEU C 3 5   ? 5.941    24.131  -24.360 1.00 46.76  ? 4   LEU C CD2 1 
ATOM   3152 N  N   . GLN C 3 6   ? 10.954   23.634  -25.006 1.00 44.68  ? 5   GLN C N   1 
ATOM   3153 C  CA  . GLN C 3 6   ? 12.391   23.729  -25.280 1.00 42.40  ? 5   GLN C CA  1 
ATOM   3154 C  C   . GLN C 3 6   ? 12.647   24.578  -26.526 1.00 38.59  ? 5   GLN C C   1 
ATOM   3155 O  O   . GLN C 3 6   ? 12.296   24.161  -27.627 1.00 37.22  ? 5   GLN C O   1 
ATOM   3156 C  CB  . GLN C 3 6   ? 12.961   22.330  -25.484 1.00 43.89  ? 5   GLN C CB  1 
ATOM   3157 C  CG  . GLN C 3 6   ? 12.871   21.407  -24.272 1.00 45.74  ? 5   GLN C CG  1 
ATOM   3158 C  CD  . GLN C 3 6   ? 12.984   19.932  -24.665 1.00 46.78  ? 5   GLN C CD  1 
ATOM   3159 O  OE1 . GLN C 3 6   ? 12.100   19.395  -25.348 1.00 49.07  ? 5   GLN C OE1 1 
ATOM   3160 N  NE2 . GLN C 3 6   ? 14.065   19.267  -24.229 1.00 44.15  ? 5   GLN C NE2 1 
ATOM   3161 N  N   . GLU C 3 7   ? 13.241   25.763  -26.343 1.00 36.30  ? 6   GLU C N   1 
ATOM   3162 C  CA  . GLU C 3 7   ? 13.502   26.700  -27.446 1.00 36.82  ? 6   GLU C CA  1 
ATOM   3163 C  C   . GLU C 3 7   ? 14.905   26.542  -28.047 1.00 36.64  ? 6   GLU C C   1 
ATOM   3164 O  O   . GLU C 3 7   ? 15.884   26.343  -27.336 1.00 36.65  ? 6   GLU C O   1 
ATOM   3165 C  CB  . GLU C 3 7   ? 13.292   28.147  -26.984 1.00 36.47  ? 6   GLU C CB  1 
ATOM   3166 C  CG  . GLU C 3 7   ? 11.834   28.522  -26.752 1.00 37.55  ? 6   GLU C CG  1 
ATOM   3167 C  CD  . GLU C 3 7   ? 11.571   29.139  -25.391 1.00 39.50  ? 6   GLU C CD  1 
ATOM   3168 O  OE1 . GLU C 3 7   ? 10.736   30.059  -25.301 1.00 42.50  ? 6   GLU C OE1 1 
ATOM   3169 O  OE2 . GLU C 3 7   ? 12.178   28.694  -24.395 1.00 42.14  ? 6   GLU C OE2 1 
ATOM   3170 N  N   . SER C 3 8   ? 14.991   26.650  -29.362 1.00 37.44  ? 7   SER C N   1 
ATOM   3171 C  CA  . SER C 3 8   ? 16.264   26.572  -30.049 1.00 38.70  ? 7   SER C CA  1 
ATOM   3172 C  C   . SER C 3 8   ? 16.199   27.331  -31.365 1.00 38.33  ? 7   SER C C   1 
ATOM   3173 O  O   . SER C 3 8   ? 15.104   27.629  -31.868 1.00 36.33  ? 7   SER C O   1 
ATOM   3174 C  CB  . SER C 3 8   ? 16.636   25.107  -30.291 1.00 39.93  ? 7   SER C CB  1 
ATOM   3175 O  OG  . SER C 3 8   ? 15.545   24.384  -30.825 1.00 40.36  ? 7   SER C OG  1 
ATOM   3176 N  N   . GLY C 3 9   ? 17.382   27.652  -31.895 1.00 35.97  ? 8   GLY C N   1 
ATOM   3177 C  CA  . GLY C 3 9   ? 17.512   28.286  -33.200 1.00 34.81  ? 8   GLY C CA  1 
ATOM   3178 C  C   . GLY C 3 9   ? 17.833   29.761  -33.150 1.00 33.74  ? 8   GLY C C   1 
ATOM   3179 O  O   . GLY C 3 9   ? 18.050   30.379  -34.196 1.00 32.35  ? 8   GLY C O   1 
ATOM   3180 N  N   . GLY C 3 10  ? 17.858   30.326  -31.946 1.00 33.89  ? 9   GLY C N   1 
ATOM   3181 C  CA  . GLY C 3 10  ? 18.182   31.732  -31.766 1.00 36.54  ? 9   GLY C CA  1 
ATOM   3182 C  C   . GLY C 3 10  ? 19.672   32.026  -31.862 1.00 38.90  ? 9   GLY C C   1 
ATOM   3183 O  O   . GLY C 3 10  ? 20.512   31.104  -31.918 1.00 40.13  ? 9   GLY C O   1 
ATOM   3184 N  N   . GLY C 3 11  ? 20.001   33.317  -31.895 1.00 40.28  ? 10  GLY C N   1 
ATOM   3185 C  CA  . GLY C 3 11  ? 21.384   33.771  -31.764 1.00 42.28  ? 10  GLY C CA  1 
ATOM   3186 C  C   . GLY C 3 11  ? 21.701   35.075  -32.464 1.00 43.56  ? 10  GLY C C   1 
ATOM   3187 O  O   . GLY C 3 11  ? 20.826   35.907  -32.665 1.00 41.88  ? 10  GLY C O   1 
ATOM   3188 N  N   . LEU C 3 12  ? 22.978   35.245  -32.804 1.00 47.36  ? 11  LEU C N   1 
ATOM   3189 C  CA  . LEU C 3 12  ? 23.446   36.368  -33.613 1.00 50.82  ? 11  LEU C CA  1 
ATOM   3190 C  C   . LEU C 3 12  ? 23.279   36.060  -35.098 1.00 49.03  ? 11  LEU C C   1 
ATOM   3191 O  O   . LEU C 3 12  ? 23.447   34.913  -35.538 1.00 44.81  ? 11  LEU C O   1 
ATOM   3192 C  CB  . LEU C 3 12  ? 24.917   36.669  -33.347 1.00 57.76  ? 11  LEU C CB  1 
ATOM   3193 C  CG  . LEU C 3 12  ? 25.328   37.051  -31.919 1.00 62.20  ? 11  LEU C CG  1 
ATOM   3194 C  CD1 . LEU C 3 12  ? 26.837   36.932  -31.714 1.00 64.71  ? 11  LEU C CD1 1 
ATOM   3195 C  CD2 . LEU C 3 12  ? 24.829   38.446  -31.597 1.00 62.41  ? 11  LEU C CD2 1 
ATOM   3196 N  N   . VAL C 3 13  ? 22.970   37.105  -35.858 1.00 49.10  ? 12  VAL C N   1 
ATOM   3197 C  CA  . VAL C 3 13  ? 22.776   36.996  -37.295 1.00 49.66  ? 12  VAL C CA  1 
ATOM   3198 C  C   . VAL C 3 13  ? 22.833   38.391  -37.916 1.00 52.36  ? 12  VAL C C   1 
ATOM   3199 O  O   . VAL C 3 13  ? 22.407   39.380  -37.304 1.00 46.97  ? 12  VAL C O   1 
ATOM   3200 C  CB  . VAL C 3 13  ? 21.446   36.273  -37.646 1.00 49.02  ? 12  VAL C CB  1 
ATOM   3201 C  CG1 . VAL C 3 13  ? 20.231   37.095  -37.211 1.00 49.40  ? 12  VAL C CG1 1 
ATOM   3202 C  CG2 . VAL C 3 13  ? 21.383   35.924  -39.131 1.00 47.38  ? 12  VAL C CG2 1 
ATOM   3203 N  N   . GLN C 3 14  ? 23.389   38.449  -39.124 1.00 59.84  ? 13  GLN C N   1 
ATOM   3204 C  CA  . GLN C 3 14  ? 23.529   39.694  -39.874 1.00 63.63  ? 13  GLN C CA  1 
ATOM   3205 C  C   . GLN C 3 14  ? 22.158   40.139  -40.386 1.00 57.85  ? 13  GLN C C   1 
ATOM   3206 O  O   . GLN C 3 14  ? 21.352   39.309  -40.801 1.00 56.46  ? 13  GLN C O   1 
ATOM   3207 C  CB  . GLN C 3 14  ? 24.499   39.491  -41.055 1.00 71.06  ? 13  GLN C CB  1 
ATOM   3208 C  CG  . GLN C 3 14  ? 24.915   40.768  -41.790 1.00 77.19  ? 13  GLN C CG  1 
ATOM   3209 C  CD  . GLN C 3 14  ? 25.877   41.635  -40.990 1.00 80.38  ? 13  GLN C CD  1 
ATOM   3210 O  OE1 . GLN C 3 14  ? 27.079   41.361  -40.952 1.00 78.96  ? 13  GLN C OE1 1 
ATOM   3211 N  NE2 . GLN C 3 14  ? 25.354   42.694  -40.359 1.00 81.56  ? 13  GLN C NE2 1 
ATOM   3212 N  N   . ALA C 3 15  ? 21.901   41.444  -40.353 1.00 53.37  ? 14  ALA C N   1 
ATOM   3213 C  CA  . ALA C 3 15  ? 20.683   42.008  -40.940 1.00 51.06  ? 14  ALA C CA  1 
ATOM   3214 C  C   . ALA C 3 15  ? 20.554   41.614  -42.410 1.00 49.76  ? 14  ALA C C   1 
ATOM   3215 O  O   . ALA C 3 15  ? 21.551   41.501  -43.128 1.00 51.19  ? 14  ALA C O   1 
ATOM   3216 C  CB  . ALA C 3 15  ? 20.665   43.523  -40.798 1.00 51.47  ? 14  ALA C CB  1 
ATOM   3217 N  N   . GLY C 3 16  ? 19.317   41.382  -42.839 1.00 48.57  ? 15  GLY C N   1 
ATOM   3218 C  CA  . GLY C 3 16  ? 19.034   40.821  -44.156 1.00 47.13  ? 15  GLY C CA  1 
ATOM   3219 C  C   . GLY C 3 16  ? 19.022   39.296  -44.181 1.00 46.92  ? 15  GLY C C   1 
ATOM   3220 O  O   . GLY C 3 16  ? 18.563   38.707  -45.163 1.00 49.22  ? 15  GLY C O   1 
ATOM   3221 N  N   . GLY C 3 17  ? 19.493   38.652  -43.108 1.00 45.38  ? 16  GLY C N   1 
ATOM   3222 C  CA  . GLY C 3 17  ? 19.609   37.195  -43.041 1.00 43.97  ? 16  GLY C CA  1 
ATOM   3223 C  C   . GLY C 3 17  ? 18.360   36.531  -42.495 1.00 42.67  ? 16  GLY C C   1 
ATOM   3224 O  O   . GLY C 3 17  ? 17.268   37.109  -42.510 1.00 42.33  ? 16  GLY C O   1 
ATOM   3225 N  N   . SER C 3 18  ? 18.527   35.302  -42.018 1.00 41.16  ? 17  SER C N   1 
ATOM   3226 C  CA  . SER C 3 18  ? 17.400   34.490  -41.598 1.00 39.53  ? 17  SER C CA  1 
ATOM   3227 C  C   . SER C 3 18  ? 17.740   33.545  -40.443 1.00 38.23  ? 17  SER C C   1 
ATOM   3228 O  O   . SER C 3 18  ? 18.860   33.041  -40.355 1.00 40.57  ? 17  SER C O   1 
ATOM   3229 C  CB  . SER C 3 18  ? 16.842   33.698  -42.796 1.00 39.76  ? 17  SER C CB  1 
ATOM   3230 O  OG  . SER C 3 18  ? 17.427   32.406  -42.924 1.00 40.74  ? 17  SER C OG  1 
ATOM   3231 N  N   . LEU C 3 19  ? 16.758   33.330  -39.566 1.00 36.83  ? 18  LEU C N   1 
ATOM   3232 C  CA  . LEU C 3 19  ? 16.810   32.295  -38.537 1.00 35.18  ? 18  LEU C CA  1 
ATOM   3233 C  C   . LEU C 3 19  ? 15.571   31.423  -38.601 1.00 34.80  ? 18  LEU C C   1 
ATOM   3234 O  O   . LEU C 3 19  ? 14.588   31.761  -39.259 1.00 35.41  ? 18  LEU C O   1 
ATOM   3235 C  CB  . LEU C 3 19  ? 16.899   32.919  -37.155 1.00 34.27  ? 18  LEU C CB  1 
ATOM   3236 C  CG  . LEU C 3 19  ? 18.144   33.738  -36.879 1.00 33.97  ? 18  LEU C CG  1 
ATOM   3237 C  CD1 . LEU C 3 19  ? 18.001   34.425  -35.534 1.00 33.94  ? 18  LEU C CD1 1 
ATOM   3238 C  CD2 . LEU C 3 19  ? 19.382   32.857  -36.923 1.00 34.23  ? 18  LEU C CD2 1 
ATOM   3239 N  N   . ARG C 3 20  ? 15.646   30.292  -37.912 1.00 33.59  ? 19  ARG C N   1 
ATOM   3240 C  CA  . ARG C 3 20  ? 14.529   29.377  -37.790 1.00 33.24  ? 19  ARG C CA  1 
ATOM   3241 C  C   . ARG C 3 20  ? 14.421   28.882  -36.358 1.00 31.65  ? 19  ARG C C   1 
ATOM   3242 O  O   . ARG C 3 20  ? 15.105   27.933  -35.964 1.00 30.24  ? 19  ARG C O   1 
ATOM   3243 C  CB  . ARG C 3 20  ? 14.674   28.204  -38.754 1.00 35.13  ? 19  ARG C CB  1 
ATOM   3244 C  CG  . ARG C 3 20  ? 13.439   27.309  -38.801 1.00 38.14  ? 19  ARG C CG  1 
ATOM   3245 C  CD  . ARG C 3 20  ? 13.606   26.171  -39.793 1.00 40.39  ? 19  ARG C CD  1 
ATOM   3246 N  NE  . ARG C 3 20  ? 12.336   25.472  -40.030 1.00 41.97  ? 19  ARG C NE  1 
ATOM   3247 C  CZ  . ARG C 3 20  ? 12.075   24.182  -39.776 1.00 44.46  ? 19  ARG C CZ  1 
ATOM   3248 N  NH1 . ARG C 3 20  ? 12.990   23.348  -39.256 1.00 43.46  ? 19  ARG C NH1 1 
ATOM   3249 N  NH2 . ARG C 3 20  ? 10.854   23.710  -40.053 1.00 46.15  ? 19  ARG C NH2 1 
ATOM   3250 N  N   . LEU C 3 21  ? 13.538   29.531  -35.597 1.00 30.41  ? 20  LEU C N   1 
ATOM   3251 C  CA  . LEU C 3 21  ? 13.233   29.114  -34.231 1.00 29.25  ? 20  LEU C CA  1 
ATOM   3252 C  C   . LEU C 3 21  ? 12.430   27.833  -34.239 1.00 27.44  ? 20  LEU C C   1 
ATOM   3253 O  O   . LEU C 3 21  ? 11.790   27.499  -35.229 1.00 25.44  ? 20  LEU C O   1 
ATOM   3254 C  CB  . LEU C 3 21  ? 12.464   30.202  -33.465 1.00 29.14  ? 20  LEU C CB  1 
ATOM   3255 C  CG  . LEU C 3 21  ? 13.094   31.594  -33.444 1.00 28.79  ? 20  LEU C CG  1 
ATOM   3256 C  CD1 . LEU C 3 21  ? 12.352   32.480  -32.457 1.00 28.27  ? 20  LEU C CD1 1 
ATOM   3257 C  CD2 . LEU C 3 21  ? 14.585   31.521  -33.112 1.00 29.21  ? 20  LEU C CD2 1 
ATOM   3258 N  N   . SER C 3 22  ? 12.491   27.125  -33.122 1.00 27.70  ? 21  SER C N   1 
ATOM   3259 C  CA  . SER C 3 22  ? 11.848   25.830  -32.991 1.00 29.34  ? 21  SER C CA  1 
ATOM   3260 C  C   . SER C 3 22  ? 11.577   25.546  -31.527 1.00 29.83  ? 21  SER C C   1 
ATOM   3261 O  O   . SER C 3 22  ? 12.516   25.501  -30.732 1.00 27.43  ? 21  SER C O   1 
ATOM   3262 C  CB  . SER C 3 22  ? 12.747   24.740  -33.583 1.00 30.19  ? 21  SER C CB  1 
ATOM   3263 O  OG  . SER C 3 22  ? 12.274   23.431  -33.299 1.00 30.37  ? 21  SER C OG  1 
ATOM   3264 N  N   . CYS C 3 23  ? 10.303   25.345  -31.188 1.00 32.42  ? 22  CYS C N   1 
ATOM   3265 C  CA  . CYS C 3 23  ? 9.891    25.059  -29.820 1.00 36.73  ? 22  CYS C CA  1 
ATOM   3266 C  C   . CYS C 3 23  ? 9.245    23.687  -29.748 1.00 39.47  ? 22  CYS C C   1 
ATOM   3267 O  O   . CYS C 3 23  ? 8.197    23.495  -30.327 1.00 44.84  ? 22  CYS C O   1 
ATOM   3268 C  CB  . CYS C 3 23  ? 8.901    26.119  -29.346 1.00 37.71  ? 22  CYS C CB  1 
ATOM   3269 S  SG  . CYS C 3 23  ? 8.140    25.801  -27.733 1.00 38.19  ? 22  CYS C SG  1 
ATOM   3270 N  N   . ALA C 3 24  ? 9.861    22.755  -29.028 1.00 42.07  ? 23  ALA C N   1 
ATOM   3271 C  CA  . ALA C 3 24  ? 9.327    21.401  -28.859 1.00 44.75  ? 23  ALA C CA  1 
ATOM   3272 C  C   . ALA C 3 24  ? 8.707    21.251  -27.470 1.00 48.91  ? 23  ALA C C   1 
ATOM   3273 O  O   . ALA C 3 24  ? 9.419    21.259  -26.460 1.00 50.57  ? 23  ALA C O   1 
ATOM   3274 C  CB  . ALA C 3 24  ? 10.422   20.364  -29.046 1.00 44.95  ? 23  ALA C CB  1 
ATOM   3275 N  N   . ALA C 3 25  ? 7.387    21.087  -27.437 1.00 51.36  ? 24  ALA C N   1 
ATOM   3276 C  CA  . ALA C 3 25  ? 6.648    20.918  -26.192 1.00 53.97  ? 24  ALA C CA  1 
ATOM   3277 C  C   . ALA C 3 25  ? 6.555    19.449  -25.787 1.00 54.51  ? 24  ALA C C   1 
ATOM   3278 O  O   . ALA C 3 25  ? 5.838    18.675  -26.411 1.00 53.51  ? 24  ALA C O   1 
ATOM   3279 C  CB  . ALA C 3 25  ? 5.257    21.513  -26.330 1.00 56.51  ? 24  ALA C CB  1 
ATOM   3280 N  N   . SER C 3 26  ? 7.281    19.074  -24.737 1.00 60.23  ? 25  SER C N   1 
ATOM   3281 C  CA  . SER C 3 26  ? 7.208    17.723  -24.170 1.00 66.31  ? 25  SER C CA  1 
ATOM   3282 C  C   . SER C 3 26  ? 6.258    17.721  -22.989 1.00 67.18  ? 25  SER C C   1 
ATOM   3283 O  O   . SER C 3 26  ? 6.581    18.287  -21.948 1.00 72.73  ? 25  SER C O   1 
ATOM   3284 C  CB  . SER C 3 26  ? 8.592    17.271  -23.696 1.00 72.17  ? 25  SER C CB  1 
ATOM   3285 O  OG  . SER C 3 26  ? 9.072    18.111  -22.651 1.00 77.00  ? 25  SER C OG  1 
ATOM   3286 N  N   . GLY C 3 27  ? 5.101    17.098  -23.150 1.00 62.74  ? 26  GLY C N   1 
ATOM   3287 C  CA  . GLY C 3 27  ? 4.145    16.916  -22.047 1.00 59.18  ? 26  GLY C CA  1 
ATOM   3288 C  C   . GLY C 3 27  ? 2.745    16.719  -22.570 1.00 59.16  ? 26  GLY C C   1 
ATOM   3289 O  O   . GLY C 3 27  ? 2.533    16.754  -23.788 1.00 61.71  ? 26  GLY C O   1 
ATOM   3290 N  N   . SER C 3 28  ? 1.781    16.537  -21.662 1.00 57.87  ? 27  SER C N   1 
ATOM   3291 C  CA  . SER C 3 28  ? 0.376    16.334  -22.044 1.00 56.38  ? 27  SER C CA  1 
ATOM   3292 C  C   . SER C 3 28  ? -0.295   17.645  -22.427 1.00 53.34  ? 27  SER C C   1 
ATOM   3293 O  O   . SER C 3 28  ? -0.492   18.513  -21.576 1.00 54.85  ? 27  SER C O   1 
ATOM   3294 C  CB  . SER C 3 28  ? -0.429   15.673  -20.918 1.00 58.56  ? 27  SER C CB  1 
ATOM   3295 O  OG  . SER C 3 28  ? -1.743   15.359  -21.368 1.00 57.34  ? 27  SER C OG  1 
ATOM   3296 N  N   . ILE C 3 29  ? -0.646   17.773  -23.706 1.00 47.82  ? 28  ILE C N   1 
ATOM   3297 C  CA  . ILE C 3 29  ? -1.345   18.937  -24.228 1.00 43.00  ? 28  ILE C CA  1 
ATOM   3298 C  C   . ILE C 3 29  ? -2.662   18.440  -24.847 1.00 41.21  ? 28  ILE C C   1 
ATOM   3299 O  O   . ILE C 3 29  ? -2.727   17.324  -25.392 1.00 43.84  ? 28  ILE C O   1 
ATOM   3300 C  CB  . ILE C 3 29  ? -0.439   19.722  -25.209 1.00 40.25  ? 28  ILE C CB  1 
ATOM   3301 C  CG1 . ILE C 3 29  ? 0.713    20.351  -24.428 1.00 39.96  ? 28  ILE C CG1 1 
ATOM   3302 C  CG2 . ILE C 3 29  ? -1.207   20.850  -25.886 1.00 40.75  ? 28  ILE C CG2 1 
ATOM   3303 C  CD1 . ILE C 3 29  ? 1.862    20.854  -25.284 1.00 41.07  ? 28  ILE C CD1 1 
ATOM   3304 N  N   . PHE C 3 30  ? -3.714   19.253  -24.724 1.00 36.89  ? 29  PHE C N   1 
ATOM   3305 C  CA  . PHE C 3 30  ? -5.029   18.944  -25.300 1.00 33.62  ? 29  PHE C CA  1 
ATOM   3306 C  C   . PHE C 3 30  ? -4.905   19.117  -26.802 1.00 30.29  ? 29  PHE C C   1 
ATOM   3307 O  O   . PHE C 3 30  ? -4.168   19.966  -27.280 1.00 27.91  ? 29  PHE C O   1 
ATOM   3308 C  CB  . PHE C 3 30  ? -6.112   19.876  -24.706 1.00 34.31  ? 29  PHE C CB  1 
ATOM   3309 C  CG  . PHE C 3 30  ? -7.545   19.540  -25.110 1.00 34.33  ? 29  PHE C CG  1 
ATOM   3310 C  CD1 . PHE C 3 30  ? -8.099   18.302  -24.843 1.00 34.57  ? 29  PHE C CD1 1 
ATOM   3311 C  CD2 . PHE C 3 30  ? -8.357   20.499  -25.716 1.00 33.18  ? 29  PHE C CD2 1 
ATOM   3312 C  CE1 . PHE C 3 30  ? -9.407   18.006  -25.211 1.00 34.37  ? 29  PHE C CE1 1 
ATOM   3313 C  CE2 . PHE C 3 30  ? -9.665   20.213  -26.088 1.00 32.52  ? 29  PHE C CE2 1 
ATOM   3314 C  CZ  . PHE C 3 30  ? -10.186  18.962  -25.846 1.00 33.41  ? 29  PHE C CZ  1 
ATOM   3315 N  N   . ALA C 3 31  ? -5.612   18.279  -27.540 1.00 29.18  ? 30  ALA C N   1 
ATOM   3316 C  CA  . ALA C 3 31  ? -5.567   18.303  -29.000 1.00 29.25  ? 30  ALA C CA  1 
ATOM   3317 C  C   . ALA C 3 31  ? -5.871   19.690  -29.559 1.00 28.83  ? 30  ALA C C   1 
ATOM   3318 O  O   . ALA C 3 31  ? -5.255   20.110  -30.546 1.00 29.29  ? 30  ALA C O   1 
ATOM   3319 C  CB  . ALA C 3 31  ? -6.554   17.297  -29.567 1.00 29.72  ? 30  ALA C CB  1 
ATOM   3320 N  N   . LEU C 3 32  ? -6.830   20.386  -28.938 1.00 27.53  ? 31  LEU C N   1 
ATOM   3321 C  CA  . LEU C 3 32  ? -7.150   21.759  -29.315 1.00 26.72  ? 31  LEU C CA  1 
ATOM   3322 C  C   . LEU C 3 32  ? -6.289   22.741  -28.521 1.00 25.82  ? 31  LEU C C   1 
ATOM   3323 O  O   . LEU C 3 32  ? -6.357   22.785  -27.294 1.00 24.68  ? 31  LEU C O   1 
ATOM   3324 C  CB  . LEU C 3 32  ? -8.638   22.042  -29.115 1.00 26.69  ? 31  LEU C CB  1 
ATOM   3325 C  CG  . LEU C 3 32  ? -9.592   21.122  -29.888 1.00 26.65  ? 31  LEU C CG  1 
ATOM   3326 C  CD1 . LEU C 3 32  ? -11.037  21.416  -29.550 1.00 27.39  ? 31  LEU C CD1 1 
ATOM   3327 C  CD2 . LEU C 3 32  ? -9.396   21.199  -31.398 1.00 26.89  ? 31  LEU C CD2 1 
ATOM   3328 N  N   . ASN C 3 33  ? -5.477   23.524  -29.235 1.00 25.50  ? 32  ASN C N   1 
ATOM   3329 C  CA  . ASN C 3 33  ? -4.508   24.435  -28.609 1.00 25.08  ? 32  ASN C CA  1 
ATOM   3330 C  C   . ASN C 3 33  ? -3.948   25.452  -29.589 1.00 24.42  ? 32  ASN C C   1 
ATOM   3331 O  O   . ASN C 3 33  ? -4.137   25.325  -30.797 1.00 23.70  ? 32  ASN C O   1 
ATOM   3332 C  CB  . ASN C 3 33  ? -3.347   23.642  -27.996 1.00 25.87  ? 32  ASN C CB  1 
ATOM   3333 C  CG  . ASN C 3 33  ? -2.590   22.811  -29.019 1.00 26.80  ? 32  ASN C CG  1 
ATOM   3334 O  OD1 . ASN C 3 33  ? -2.134   23.316  -30.043 1.00 28.65  ? 32  ASN C OD1 1 
ATOM   3335 N  ND2 . ASN C 3 33  ? -2.445   21.529  -28.735 1.00 28.07  ? 32  ASN C ND2 1 
ATOM   3336 N  N   . ILE C 3 34  ? -3.264   26.456  -29.049 1.00 24.59  ? 33  ILE C N   1 
ATOM   3337 C  CA  . ILE C 3 34  ? -2.504   27.415  -29.845 1.00 25.41  ? 33  ILE C CA  1 
ATOM   3338 C  C   . ILE C 3 34  ? -1.042   27.382  -29.408 1.00 25.01  ? 33  ILE C C   1 
ATOM   3339 O  O   . ILE C 3 34  ? -0.748   27.556  -28.223 1.00 23.07  ? 33  ILE C O   1 
ATOM   3340 C  CB  . ILE C 3 34  ? -3.008   28.864  -29.668 1.00 25.91  ? 33  ILE C CB  1 
ATOM   3341 C  CG1 . ILE C 3 34  ? -4.455   28.984  -30.120 1.00 26.28  ? 33  ILE C CG1 1 
ATOM   3342 C  CG2 . ILE C 3 34  ? -2.125   29.852  -30.450 1.00 26.42  ? 33  ILE C CG2 1 
ATOM   3343 C  CD1 . ILE C 3 34  ? -5.060   30.342  -29.831 1.00 27.07  ? 33  ILE C CD1 1 
ATOM   3344 N  N   . MET C 3 35  ? -0.147   27.172  -30.382 1.00 25.16  ? 34  MET C N   1 
ATOM   3345 C  CA  . MET C 3 35  ? 1.298    27.336  -30.193 1.00 24.96  ? 34  MET C CA  1 
ATOM   3346 C  C   . MET C 3 35  ? 1.730    28.636  -30.858 1.00 23.98  ? 34  MET C C   1 
ATOM   3347 O  O   . MET C 3 35  ? 1.319    28.941  -31.983 1.00 22.46  ? 34  MET C O   1 
ATOM   3348 C  CB  . MET C 3 35  ? 2.056    26.149  -30.773 1.00 25.14  ? 34  MET C CB  1 
ATOM   3349 C  CG  . MET C 3 35  ? 1.676    24.839  -30.117 1.00 25.47  ? 34  MET C CG  1 
ATOM   3350 S  SD  . MET C 3 35  ? 2.743    23.483  -30.617 1.00 25.67  ? 34  MET C SD  1 
ATOM   3351 C  CE  . MET C 3 35  ? 4.066    23.656  -29.420 1.00 25.52  ? 34  MET C CE  1 
ATOM   3352 N  N   . GLY C 3 36  ? 2.548    29.403  -30.149 1.00 24.32  ? 35  GLY C N   1 
ATOM   3353 C  CA  . GLY C 3 36  ? 2.893    30.747  -30.587 1.00 25.74  ? 35  GLY C CA  1 
ATOM   3354 C  C   . GLY C 3 36  ? 4.262    31.216  -30.156 1.00 27.61  ? 35  GLY C C   1 
ATOM   3355 O  O   . GLY C 3 36  ? 4.946    30.576  -29.332 1.00 27.91  ? 35  GLY C O   1 
ATOM   3356 N  N   . TRP C 3 37  ? 4.660    32.336  -30.754 1.00 29.35  ? 36  TRP C N   1 
ATOM   3357 C  CA  . TRP C 3 37  ? 5.894    33.016  -30.418 1.00 31.34  ? 36  TRP C CA  1 
ATOM   3358 C  C   . TRP C 3 37  ? 5.545    34.437  -30.023 1.00 31.95  ? 36  TRP C C   1 
ATOM   3359 O  O   . TRP C 3 37  ? 4.808    35.120  -30.730 1.00 30.89  ? 36  TRP C O   1 
ATOM   3360 C  CB  . TRP C 3 37  ? 6.865    33.008  -31.604 1.00 31.84  ? 36  TRP C CB  1 
ATOM   3361 C  CG  . TRP C 3 37  ? 7.456    31.660  -31.869 1.00 31.14  ? 36  TRP C CG  1 
ATOM   3362 C  CD1 . TRP C 3 37  ? 7.025    30.736  -32.776 1.00 30.79  ? 36  TRP C CD1 1 
ATOM   3363 C  CD2 . TRP C 3 37  ? 8.564    31.077  -31.196 1.00 30.63  ? 36  TRP C CD2 1 
ATOM   3364 N  NE1 . TRP C 3 37  ? 7.813    29.617  -32.720 1.00 30.72  ? 36  TRP C NE1 1 
ATOM   3365 C  CE2 . TRP C 3 37  ? 8.769    29.799  -31.759 1.00 31.04  ? 36  TRP C CE2 1 
ATOM   3366 C  CE3 . TRP C 3 37  ? 9.407    31.508  -30.169 1.00 31.70  ? 36  TRP C CE3 1 
ATOM   3367 C  CZ2 . TRP C 3 37  ? 9.786    28.940  -31.328 1.00 33.27  ? 36  TRP C CZ2 1 
ATOM   3368 C  CZ3 . TRP C 3 37  ? 10.422   30.658  -29.734 1.00 33.50  ? 36  TRP C CZ3 1 
ATOM   3369 C  CH2 . TRP C 3 37  ? 10.605   29.387  -30.319 1.00 33.95  ? 36  TRP C CH2 1 
ATOM   3370 N  N   . TYR C 3 38  ? 6.061    34.844  -28.869 1.00 34.34  ? 37  TYR C N   1 
ATOM   3371 C  CA  . TYR C 3 38  ? 6.003    36.215  -28.406 1.00 37.39  ? 37  TYR C CA  1 
ATOM   3372 C  C   . TYR C 3 38  ? 7.441    36.710  -28.264 1.00 41.64  ? 37  TYR C C   1 
ATOM   3373 O  O   . TYR C 3 38  ? 8.377    35.910  -28.215 1.00 42.84  ? 37  TYR C O   1 
ATOM   3374 C  CB  . TYR C 3 38  ? 5.310    36.274  -27.052 1.00 37.36  ? 37  TYR C CB  1 
ATOM   3375 C  CG  . TYR C 3 38  ? 3.827    35.937  -27.086 1.00 39.32  ? 37  TYR C CG  1 
ATOM   3376 C  CD1 . TYR C 3 38  ? 3.391    34.616  -27.214 1.00 39.95  ? 37  TYR C CD1 1 
ATOM   3377 C  CD2 . TYR C 3 38  ? 2.854    36.936  -26.962 1.00 39.23  ? 37  TYR C CD2 1 
ATOM   3378 C  CE1 . TYR C 3 38  ? 2.038    34.304  -27.244 1.00 39.69  ? 37  TYR C CE1 1 
ATOM   3379 C  CE2 . TYR C 3 38  ? 1.504    36.630  -26.987 1.00 39.85  ? 37  TYR C CE2 1 
ATOM   3380 C  CZ  . TYR C 3 38  ? 1.099    35.311  -27.129 1.00 40.43  ? 37  TYR C CZ  1 
ATOM   3381 O  OH  . TYR C 3 38  ? -0.242   34.989  -27.159 1.00 40.81  ? 37  TYR C OH  1 
ATOM   3382 N  N   . ARG C 3 39  ? 7.613    38.026  -28.196 1.00 44.64  ? 38  ARG C N   1 
ATOM   3383 C  CA  . ARG C 3 39  ? 8.934    38.621  -28.020 1.00 46.36  ? 38  ARG C CA  1 
ATOM   3384 C  C   . ARG C 3 39  ? 8.892    39.865  -27.142 1.00 49.17  ? 38  ARG C C   1 
ATOM   3385 O  O   . ARG C 3 39  ? 7.869    40.529  -27.060 1.00 52.26  ? 38  ARG C O   1 
ATOM   3386 C  CB  . ARG C 3 39  ? 9.544    38.957  -29.379 1.00 45.98  ? 38  ARG C CB  1 
ATOM   3387 C  CG  . ARG C 3 39  ? 8.901    40.127  -30.114 1.00 44.77  ? 38  ARG C CG  1 
ATOM   3388 C  CD  . ARG C 3 39  ? 9.610    40.350  -31.441 1.00 43.99  ? 38  ARG C CD  1 
ATOM   3389 N  NE  . ARG C 3 39  ? 8.978    41.394  -32.236 1.00 42.63  ? 38  ARG C NE  1 
ATOM   3390 C  CZ  . ARG C 3 39  ? 9.365    41.742  -33.460 1.00 43.85  ? 38  ARG C CZ  1 
ATOM   3391 N  NH1 . ARG C 3 39  ? 10.388   41.133  -34.054 1.00 43.64  ? 38  ARG C NH1 1 
ATOM   3392 N  NH2 . ARG C 3 39  ? 8.708    42.704  -34.108 1.00 45.99  ? 38  ARG C NH2 1 
ATOM   3393 N  N   . GLN C 3 40  ? 10.022   40.184  -26.514 1.00 50.55  ? 39  GLN C N   1 
ATOM   3394 C  CA  . GLN C 3 40  ? 10.140   41.363  -25.673 1.00 52.02  ? 39  GLN C CA  1 
ATOM   3395 C  C   . GLN C 3 40  ? 11.464   42.069  -25.954 1.00 56.74  ? 39  GLN C C   1 
ATOM   3396 O  O   . GLN C 3 40  ? 12.517   41.624  -25.489 1.00 55.05  ? 39  GLN C O   1 
ATOM   3397 C  CB  . GLN C 3 40  ? 10.045   40.958  -24.207 1.00 50.50  ? 39  GLN C CB  1 
ATOM   3398 C  CG  . GLN C 3 40  ? 10.062   42.130  -23.236 1.00 51.40  ? 39  GLN C CG  1 
ATOM   3399 C  CD  . GLN C 3 40  ? 9.587    41.745  -21.846 1.00 54.18  ? 39  GLN C CD  1 
ATOM   3400 O  OE1 . GLN C 3 40  ? 9.649    40.567  -21.443 1.00 57.38  ? 39  GLN C OE1 1 
ATOM   3401 N  NE2 . GLN C 3 40  ? 9.106    42.736  -21.101 1.00 54.75  ? 39  GLN C NE2 1 
ATOM   3402 N  N   . ALA C 3 41  ? 11.394   43.158  -26.729 1.00 62.96  ? 40  ALA C N   1 
ATOM   3403 C  CA  . ALA C 3 41  ? 12.552   44.017  -27.004 1.00 67.08  ? 40  ALA C CA  1 
ATOM   3404 C  C   . ALA C 3 41  ? 13.038   44.722  -25.739 1.00 71.25  ? 40  ALA C C   1 
ATOM   3405 O  O   . ALA C 3 41  ? 12.233   44.962  -24.836 1.00 77.60  ? 40  ALA C O   1 
ATOM   3406 C  CB  . ALA C 3 41  ? 12.210   45.037  -28.088 1.00 68.23  ? 40  ALA C CB  1 
ATOM   3407 N  N   . PRO C 3 42  ? 14.344   45.070  -25.657 1.00 73.77  ? 41  PRO C N   1 
ATOM   3408 C  CA  . PRO C 3 42  ? 14.823   45.679  -24.404 1.00 72.95  ? 41  PRO C CA  1 
ATOM   3409 C  C   . PRO C 3 42  ? 14.108   46.994  -24.120 1.00 73.92  ? 41  PRO C C   1 
ATOM   3410 O  O   . PRO C 3 42  ? 13.958   47.819  -25.027 1.00 72.67  ? 41  PRO C O   1 
ATOM   3411 C  CB  . PRO C 3 42  ? 16.322   45.904  -24.652 1.00 73.49  ? 41  PRO C CB  1 
ATOM   3412 C  CG  . PRO C 3 42  ? 16.660   45.082  -25.849 1.00 75.95  ? 41  PRO C CG  1 
ATOM   3413 C  CD  . PRO C 3 42  ? 15.411   45.020  -26.674 1.00 74.64  ? 41  PRO C CD  1 
ATOM   3414 N  N   . GLY C 3 43  ? 13.643   47.157  -22.881 1.00 74.87  ? 42  GLY C N   1 
ATOM   3415 C  CA  . GLY C 3 43  ? 12.856   48.325  -22.481 1.00 75.20  ? 42  GLY C CA  1 
ATOM   3416 C  C   . GLY C 3 43  ? 11.532   48.482  -23.213 1.00 76.22  ? 42  GLY C C   1 
ATOM   3417 O  O   . GLY C 3 43  ? 11.103   49.611  -23.460 1.00 83.29  ? 42  GLY C O   1 
ATOM   3418 N  N   . LYS C 3 44  ? 10.908   47.365  -23.588 1.00 73.92  ? 43  LYS C N   1 
ATOM   3419 C  CA  . LYS C 3 44  ? 9.579    47.360  -24.207 1.00 70.97  ? 43  LYS C CA  1 
ATOM   3420 C  C   . LYS C 3 44  ? 8.739    46.260  -23.570 1.00 65.11  ? 43  LYS C C   1 
ATOM   3421 O  O   . LYS C 3 44  ? 9.239    45.466  -22.766 1.00 62.99  ? 43  LYS C O   1 
ATOM   3422 C  CB  . LYS C 3 44  ? 9.679    47.167  -25.725 1.00 73.74  ? 43  LYS C CB  1 
ATOM   3423 C  CG  . LYS C 3 44  ? 10.527   48.224  -26.415 1.00 77.48  ? 43  LYS C CG  1 
ATOM   3424 C  CD  . LYS C 3 44  ? 10.075   48.522  -27.840 1.00 84.30  ? 43  LYS C CD  1 
ATOM   3425 C  CE  . LYS C 3 44  ? 10.450   49.938  -28.268 1.00 89.18  ? 43  LYS C CE  1 
ATOM   3426 N  NZ  . LYS C 3 44  ? 9.783    50.326  -29.539 1.00 92.48  ? 43  LYS C NZ  1 
ATOM   3427 N  N   . GLN C 3 45  ? 7.457    46.231  -23.911 1.00 59.38  ? 44  GLN C N   1 
ATOM   3428 C  CA  . GLN C 3 45  ? 6.556    45.198  -23.403 1.00 58.31  ? 44  GLN C CA  1 
ATOM   3429 C  C   . GLN C 3 45  ? 6.547    44.016  -24.355 1.00 55.24  ? 44  GLN C C   1 
ATOM   3430 O  O   . GLN C 3 45  ? 6.889    44.155  -25.533 1.00 56.63  ? 44  GLN C O   1 
ATOM   3431 C  CB  . GLN C 3 45  ? 5.131    45.729  -23.250 1.00 61.93  ? 44  GLN C CB  1 
ATOM   3432 C  CG  . GLN C 3 45  ? 4.980    46.867  -22.252 1.00 62.33  ? 44  GLN C CG  1 
ATOM   3433 C  CD  . GLN C 3 45  ? 3.544    47.089  -21.798 1.00 62.00  ? 44  GLN C CD  1 
ATOM   3434 O  OE1 . GLN C 3 45  ? 2.740    46.158  -21.737 1.00 60.47  ? 44  GLN C OE1 1 
ATOM   3435 N  NE2 . GLN C 3 45  ? 3.224    48.334  -21.454 1.00 64.20  ? 44  GLN C NE2 1 
ATOM   3436 N  N   . ARG C 3 46  ? 6.142    42.861  -23.836 1.00 50.93  ? 45  ARG C N   1 
ATOM   3437 C  CA  . ARG C 3 46  ? 6.007    41.639  -24.628 1.00 49.26  ? 45  ARG C CA  1 
ATOM   3438 C  C   . ARG C 3 46  ? 4.893    41.788  -25.655 1.00 47.79  ? 45  ARG C C   1 
ATOM   3439 O  O   . ARG C 3 46  ? 3.842    42.327  -25.346 1.00 45.85  ? 45  ARG C O   1 
ATOM   3440 C  CB  . ARG C 3 46  ? 5.710    40.462  -23.705 1.00 51.70  ? 45  ARG C CB  1 
ATOM   3441 C  CG  . ARG C 3 46  ? 5.543    39.109  -24.371 1.00 55.03  ? 45  ARG C CG  1 
ATOM   3442 C  CD  . ARG C 3 46  ? 5.047    38.088  -23.352 1.00 59.47  ? 45  ARG C CD  1 
ATOM   3443 N  NE  . ARG C 3 46  ? 6.121    37.581  -22.491 1.00 64.32  ? 45  ARG C NE  1 
ATOM   3444 C  CZ  . ARG C 3 46  ? 5.948    36.832  -21.397 1.00 69.21  ? 45  ARG C CZ  1 
ATOM   3445 N  NH1 . ARG C 3 46  ? 4.722    36.503  -20.975 1.00 73.22  ? 45  ARG C NH1 1 
ATOM   3446 N  NH2 . ARG C 3 46  ? 7.016    36.422  -20.701 1.00 66.96  ? 45  ARG C NH2 1 
ATOM   3447 N  N   . GLU C 3 47  ? 5.135    41.311  -26.869 1.00 48.14  ? 46  GLU C N   1 
ATOM   3448 C  CA  . GLU C 3 47  ? 4.176    41.422  -27.971 1.00 47.72  ? 46  GLU C CA  1 
ATOM   3449 C  C   . GLU C 3 47  ? 4.083    40.097  -28.707 1.00 44.53  ? 46  GLU C C   1 
ATOM   3450 O  O   . GLU C 3 47  ? 5.036    39.326  -28.726 1.00 43.53  ? 46  GLU C O   1 
ATOM   3451 C  CB  . GLU C 3 47  ? 4.594    42.527  -28.954 1.00 51.13  ? 46  GLU C CB  1 
ATOM   3452 C  CG  . GLU C 3 47  ? 5.990    42.349  -29.558 1.00 54.76  ? 46  GLU C CG  1 
ATOM   3453 C  CD  . GLU C 3 47  ? 6.280    43.270  -30.736 1.00 58.06  ? 46  GLU C CD  1 
ATOM   3454 O  OE1 . GLU C 3 47  ? 5.355    43.587  -31.513 1.00 58.56  ? 46  GLU C OE1 1 
ATOM   3455 O  OE2 . GLU C 3 47  ? 7.473    43.622  -30.911 1.00 61.83  ? 46  GLU C OE2 1 
ATOM   3456 N  N   . LEU C 3 48  ? 2.937    39.831  -29.319 1.00 43.25  ? 47  LEU C N   1 
ATOM   3457 C  CA  . LEU C 3 48  ? 2.774    38.625  -30.119 1.00 40.66  ? 47  LEU C CA  1 
ATOM   3458 C  C   . LEU C 3 48  ? 3.514    38.809  -31.434 1.00 37.61  ? 47  LEU C C   1 
ATOM   3459 O  O   . LEU C 3 48  ? 3.358    39.836  -32.095 1.00 37.01  ? 47  LEU C O   1 
ATOM   3460 C  CB  . LEU C 3 48  ? 1.301    38.337  -30.406 1.00 41.51  ? 47  LEU C CB  1 
ATOM   3461 C  CG  . LEU C 3 48  ? 1.023    37.119  -31.306 1.00 42.63  ? 47  LEU C CG  1 
ATOM   3462 C  CD1 . LEU C 3 48  ? 1.217    35.828  -30.522 1.00 43.07  ? 47  LEU C CD1 1 
ATOM   3463 C  CD2 . LEU C 3 48  ? -0.356   37.182  -31.948 1.00 42.19  ? 47  LEU C CD2 1 
ATOM   3464 N  N   . VAL C 3 49  ? 4.305    37.801  -31.796 1.00 34.68  ? 48  VAL C N   1 
ATOM   3465 C  CA  . VAL C 3 49  ? 4.986    37.752  -33.081 1.00 32.68  ? 48  VAL C CA  1 
ATOM   3466 C  C   . VAL C 3 49  ? 4.088    36.997  -34.049 1.00 32.26  ? 48  VAL C C   1 
ATOM   3467 O  O   . VAL C 3 49  ? 3.647    37.553  -35.061 1.00 30.57  ? 48  VAL C O   1 
ATOM   3468 C  CB  . VAL C 3 49  ? 6.359    37.053  -32.972 1.00 31.49  ? 48  VAL C CB  1 
ATOM   3469 C  CG1 . VAL C 3 49  ? 7.068    37.045  -34.326 1.00 30.69  ? 48  VAL C CG1 1 
ATOM   3470 C  CG2 . VAL C 3 49  ? 7.214    37.738  -31.918 1.00 31.80  ? 48  VAL C CG2 1 
ATOM   3471 N  N   . ALA C 3 50  ? 3.811    35.737  -33.714 1.00 32.62  ? 49  ALA C N   1 
ATOM   3472 C  CA  . ALA C 3 50  ? 2.995    34.867  -34.553 1.00 32.11  ? 49  ALA C CA  1 
ATOM   3473 C  C   . ALA C 3 50  ? 2.469    33.655  -33.786 1.00 31.07  ? 49  ALA C C   1 
ATOM   3474 O  O   . ALA C 3 50  ? 3.084    33.200  -32.818 1.00 30.91  ? 49  ALA C O   1 
ATOM   3475 C  CB  . ALA C 3 50  ? 3.795    34.411  -35.760 1.00 32.06  ? 49  ALA C CB  1 
ATOM   3476 N  N   . ALA C 3 51  ? 1.341    33.132  -34.256 1.00 30.14  ? 50  ALA C N   1 
ATOM   3477 C  CA  . ALA C 3 51  ? 0.632    32.040  -33.594 1.00 29.47  ? 50  ALA C CA  1 
ATOM   3478 C  C   . ALA C 3 51  ? -0.093   31.127  -34.578 1.00 27.20  ? 50  ALA C C   1 
ATOM   3479 O  O   . ALA C 3 51  ? -0.612   31.586  -35.581 1.00 25.23  ? 50  ALA C O   1 
ATOM   3480 C  CB  . ALA C 3 51  ? -0.369   32.618  -32.608 1.00 30.61  ? 50  ALA C CB  1 
ATOM   3481 N  N   . ILE C 3 52  ? -0.146   29.841  -34.252 1.00 26.06  ? 51  ILE C N   1 
ATOM   3482 C  CA  . ILE C 3 52  ? -0.828   28.854  -35.070 1.00 25.28  ? 51  ILE C CA  1 
ATOM   3483 C  C   . ILE C 3 52  ? -1.673   27.933  -34.188 1.00 25.39  ? 51  ILE C C   1 
ATOM   3484 O  O   . ILE C 3 52  ? -1.187   27.363  -33.205 1.00 24.63  ? 51  ILE C O   1 
ATOM   3485 C  CB  . ILE C 3 52  ? 0.160    28.044  -35.943 1.00 25.64  ? 51  ILE C CB  1 
ATOM   3486 C  CG1 . ILE C 3 52  ? -0.588   27.039  -36.819 1.00 25.62  ? 51  ILE C CG1 1 
ATOM   3487 C  CG2 . ILE C 3 52  ? 1.224    27.320  -35.108 1.00 25.77  ? 51  ILE C CG2 1 
ATOM   3488 C  CD1 . ILE C 3 52  ? 0.204    26.553  -38.006 1.00 26.08  ? 51  ILE C CD1 1 
ATOM   3489 N  N   . HIS C 3 53  ? -2.948   27.810  -34.559 1.00 26.16  ? 52  HIS C N   1 
ATOM   3490 C  CA  . HIS C 3 53  ? -3.916   26.935  -33.893 1.00 26.09  ? 52  HIS C CA  1 
ATOM   3491 C  C   . HIS C 3 53  ? -3.726   25.485  -34.359 1.00 26.83  ? 52  HIS C C   1 
ATOM   3492 O  O   . HIS C 3 53  ? -3.129   25.245  -35.404 1.00 27.91  ? 52  HIS C O   1 
ATOM   3493 C  CB  . HIS C 3 53  ? -5.328   27.430  -34.208 1.00 26.04  ? 52  HIS C CB  1 
ATOM   3494 C  CG  . HIS C 3 53  ? -6.410   26.721  -33.450 1.00 26.15  ? 52  HIS C CG  1 
ATOM   3495 N  ND1 . HIS C 3 53  ? -7.374   25.949  -34.060 1.00 25.25  ? 52  HIS C ND1 1 
ATOM   3496 C  CD2 . HIS C 3 53  ? -6.684   26.684  -32.127 1.00 25.90  ? 52  HIS C CD2 1 
ATOM   3497 C  CE1 . HIS C 3 53  ? -8.177   25.445  -33.142 1.00 25.07  ? 52  HIS C CE1 1 
ATOM   3498 N  NE2 . HIS C 3 53  ? -7.790   25.889  -31.962 1.00 25.15  ? 52  HIS C NE2 1 
ATOM   3499 N  N   . SER C 3 54  ? -4.213   24.530  -33.567 1.00 27.55  ? 53  SER C N   1 
ATOM   3500 C  CA  . SER C 3 54  ? -4.158   23.098  -33.910 1.00 28.97  ? 53  SER C CA  1 
ATOM   3501 C  C   . SER C 3 54  ? -4.804   22.770  -35.264 1.00 30.54  ? 53  SER C C   1 
ATOM   3502 O  O   . SER C 3 54  ? -4.324   21.914  -36.003 1.00 30.29  ? 53  SER C O   1 
ATOM   3503 C  CB  . SER C 3 54  ? -4.835   22.272  -32.811 1.00 29.62  ? 53  SER C CB  1 
ATOM   3504 O  OG  . SER C 3 54  ? -6.204   22.632  -32.673 1.00 28.68  ? 53  SER C OG  1 
ATOM   3505 N  N   . GLY C 3 55  ? -5.922   23.435  -35.546 1.00 33.08  ? 54  GLY C N   1 
ATOM   3506 C  CA  . GLY C 3 55  ? -6.600   23.386  -36.841 1.00 33.79  ? 54  GLY C CA  1 
ATOM   3507 C  C   . GLY C 3 55  ? -5.750   23.782  -38.029 1.00 35.06  ? 54  GLY C C   1 
ATOM   3508 O  O   . GLY C 3 55  ? -5.835   23.145  -39.070 1.00 38.47  ? 54  GLY C O   1 
ATOM   3509 N  N   . GLY C 3 56  ? -4.934   24.825  -37.879 1.00 35.80  ? 55  GLY C N   1 
ATOM   3510 C  CA  . GLY C 3 56  ? -4.044   25.304  -38.949 1.00 36.40  ? 55  GLY C CA  1 
ATOM   3511 C  C   . GLY C 3 56  ? -4.134   26.791  -39.262 1.00 36.60  ? 55  GLY C C   1 
ATOM   3512 O  O   . GLY C 3 56  ? -3.271   27.341  -39.960 1.00 37.87  ? 55  GLY C O   1 
ATOM   3513 N  N   . THR C 3 57  ? -5.188   27.440  -38.773 1.00 37.02  ? 56  THR C N   1 
ATOM   3514 C  CA  . THR C 3 57  ? -5.333   28.891  -38.887 1.00 36.53  ? 56  THR C CA  1 
ATOM   3515 C  C   . THR C 3 57  ? -4.180   29.588  -38.157 1.00 35.95  ? 56  THR C C   1 
ATOM   3516 O  O   . THR C 3 57  ? -3.640   29.057  -37.191 1.00 34.41  ? 56  THR C O   1 
ATOM   3517 C  CB  . THR C 3 57  ? -6.711   29.368  -38.353 1.00 35.78  ? 56  THR C CB  1 
ATOM   3518 O  OG1 . THR C 3 57  ? -6.980   28.798  -37.059 1.00 34.93  ? 56  THR C OG1 1 
ATOM   3519 C  CG2 . THR C 3 57  ? -7.811   28.944  -39.303 1.00 35.66  ? 56  THR C CG2 1 
ATOM   3520 N  N   . THR C 3 58  ? -3.796   30.762  -38.644 1.00 37.53  ? 57  THR C N   1 
ATOM   3521 C  CA  . THR C 3 58  ? -2.657   31.507  -38.113 1.00 38.94  ? 57  THR C CA  1 
ATOM   3522 C  C   . THR C 3 58  ? -2.985   32.978  -37.853 1.00 42.58  ? 57  THR C C   1 
ATOM   3523 O  O   . THR C 3 58  ? -4.023   33.490  -38.272 1.00 47.14  ? 57  THR C O   1 
ATOM   3524 C  CB  . THR C 3 58  ? -1.476   31.436  -39.080 1.00 38.28  ? 57  THR C CB  1 
ATOM   3525 O  OG1 . THR C 3 58  ? -1.902   31.885  -40.372 1.00 39.19  ? 57  THR C OG1 1 
ATOM   3526 C  CG2 . THR C 3 58  ? -0.952   30.005  -39.168 1.00 38.41  ? 57  THR C CG2 1 
ATOM   3527 N  N   . ASN C 3 59  ? -2.080   33.644  -37.148 1.00 44.50  ? 58  ASN C N   1 
ATOM   3528 C  CA  . ASN C 3 59  ? -2.228   35.046  -36.801 1.00 45.55  ? 58  ASN C CA  1 
ATOM   3529 C  C   . ASN C 3 59  ? -0.829   35.635  -36.662 1.00 46.09  ? 58  ASN C C   1 
ATOM   3530 O  O   . ASN C 3 59  ? 0.000    35.072  -35.952 1.00 50.28  ? 58  ASN C O   1 
ATOM   3531 C  CB  . ASN C 3 59  ? -3.005   35.157  -35.483 1.00 46.43  ? 58  ASN C CB  1 
ATOM   3532 C  CG  . ASN C 3 59  ? -3.437   36.577  -35.162 1.00 47.62  ? 58  ASN C CG  1 
ATOM   3533 O  OD1 . ASN C 3 59  ? -3.648   37.391  -36.054 1.00 49.50  ? 58  ASN C OD1 1 
ATOM   3534 N  ND2 . ASN C 3 59  ? -3.589   36.872  -33.874 1.00 48.11  ? 58  ASN C ND2 1 
ATOM   3535 N  N   . TYR C 3 60  ? -0.568   36.749  -37.345 1.00 44.94  ? 59  TYR C N   1 
ATOM   3536 C  CA  . TYR C 3 60  ? 0.750    37.394  -37.374 1.00 43.74  ? 59  TYR C CA  1 
ATOM   3537 C  C   . TYR C 3 60  ? 0.655    38.870  -36.996 1.00 46.04  ? 59  TYR C C   1 
ATOM   3538 O  O   . TYR C 3 60  ? -0.300   39.542  -37.385 1.00 47.91  ? 59  TYR C O   1 
ATOM   3539 C  CB  . TYR C 3 60  ? 1.311    37.345  -38.791 1.00 41.42  ? 59  TYR C CB  1 
ATOM   3540 C  CG  . TYR C 3 60  ? 1.711    35.987  -39.300 1.00 38.22  ? 59  TYR C CG  1 
ATOM   3541 C  CD1 . TYR C 3 60  ? 3.010    35.506  -39.123 1.00 36.35  ? 59  TYR C CD1 1 
ATOM   3542 C  CD2 . TYR C 3 60  ? 0.817    35.213  -40.023 1.00 36.96  ? 59  TYR C CD2 1 
ATOM   3543 C  CE1 . TYR C 3 60  ? 3.385    34.271  -39.618 1.00 35.49  ? 59  TYR C CE1 1 
ATOM   3544 C  CE2 . TYR C 3 60  ? 1.183    33.980  -40.530 1.00 36.69  ? 59  TYR C CE2 1 
ATOM   3545 C  CZ  . TYR C 3 60  ? 2.464    33.518  -40.328 1.00 36.55  ? 59  TYR C CZ  1 
ATOM   3546 O  OH  . TYR C 3 60  ? 2.814    32.293  -40.832 1.00 37.43  ? 59  TYR C OH  1 
ATOM   3547 N  N   . ALA C 3 61  ? 1.664    39.382  -36.291 1.00 49.73  ? 60  ALA C N   1 
ATOM   3548 C  CA  . ALA C 3 61  ? 1.812    40.838  -36.098 1.00 51.99  ? 60  ALA C CA  1 
ATOM   3549 C  C   . ALA C 3 61  ? 2.144    41.547  -37.422 1.00 53.27  ? 60  ALA C C   1 
ATOM   3550 O  O   . ALA C 3 61  ? 2.729    40.951  -38.326 1.00 51.13  ? 60  ALA C O   1 
ATOM   3551 C  CB  . ALA C 3 61  ? 2.876    41.140  -35.051 1.00 51.82  ? 60  ALA C CB  1 
ATOM   3552 N  N   . ASN C 3 62  ? 1.770    42.819  -37.526 1.00 56.22  ? 61  ASN C N   1 
ATOM   3553 C  CA  . ASN C 3 62  ? 1.962    43.575  -38.771 1.00 59.10  ? 61  ASN C CA  1 
ATOM   3554 C  C   . ASN C 3 62  ? 3.430    43.799  -39.113 1.00 57.81  ? 61  ASN C C   1 
ATOM   3555 O  O   . ASN C 3 62  ? 3.809    43.709  -40.282 1.00 58.52  ? 61  ASN C O   1 
ATOM   3556 C  CB  . ASN C 3 62  ? 1.203    44.905  -38.738 1.00 63.86  ? 61  ASN C CB  1 
ATOM   3557 C  CG  . ASN C 3 62  ? -0.286   44.725  -39.006 1.00 69.70  ? 61  ASN C CG  1 
ATOM   3558 O  OD1 . ASN C 3 62  ? -0.695   44.316  -40.103 1.00 72.04  ? 61  ASN C OD1 1 
ATOM   3559 N  ND2 . ASN C 3 62  ? -1.107   45.019  -38.001 1.00 73.53  ? 61  ASN C ND2 1 
ATOM   3560 N  N   . SER C 3 63  ? 4.255    44.071  -38.106 1.00 56.64  ? 62  SER C N   1 
ATOM   3561 C  CA  . SER C 3 63  ? 5.695    44.266  -38.318 1.00 55.06  ? 62  SER C CA  1 
ATOM   3562 C  C   . SER C 3 63  ? 6.393    43.076  -38.995 1.00 53.74  ? 62  SER C C   1 
ATOM   3563 O  O   . SER C 3 63  ? 7.315    43.283  -39.776 1.00 55.46  ? 62  SER C O   1 
ATOM   3564 C  CB  . SER C 3 63  ? 6.402    44.607  -36.997 1.00 54.55  ? 62  SER C CB  1 
ATOM   3565 O  OG  . SER C 3 63  ? 6.156    43.623  -36.014 1.00 53.86  ? 62  SER C OG  1 
ATOM   3566 N  N   . VAL C 3 64  ? 5.946    41.850  -38.713 1.00 51.92  ? 63  VAL C N   1 
ATOM   3567 C  CA  . VAL C 3 64  ? 6.560    40.628  -39.274 1.00 50.51  ? 63  VAL C CA  1 
ATOM   3568 C  C   . VAL C 3 64  ? 5.821    39.999  -40.465 1.00 49.42  ? 63  VAL C C   1 
ATOM   3569 O  O   . VAL C 3 64  ? 6.260    38.968  -40.980 1.00 46.05  ? 63  VAL C O   1 
ATOM   3570 C  CB  . VAL C 3 64  ? 6.775    39.542  -38.184 1.00 50.03  ? 63  VAL C CB  1 
ATOM   3571 C  CG1 . VAL C 3 64  ? 7.351    40.160  -36.917 1.00 49.26  ? 63  VAL C CG1 1 
ATOM   3572 C  CG2 . VAL C 3 64  ? 5.496    38.757  -37.882 1.00 52.04  ? 63  VAL C CG2 1 
ATOM   3573 N  N   . LYS C 3 65  ? 4.709    40.593  -40.893 1.00 51.78  ? 64  LYS C N   1 
ATOM   3574 C  CA  . LYS C 3 65  ? 3.939    40.057  -42.029 1.00 54.44  ? 64  LYS C CA  1 
ATOM   3575 C  C   . LYS C 3 65  ? 4.765    40.100  -43.307 1.00 53.32  ? 64  LYS C C   1 
ATOM   3576 O  O   . LYS C 3 65  ? 5.505    41.056  -43.544 1.00 58.04  ? 64  LYS C O   1 
ATOM   3577 C  CB  . LYS C 3 65  ? 2.620    40.815  -42.239 1.00 57.04  ? 64  LYS C CB  1 
ATOM   3578 C  CG  . LYS C 3 65  ? 1.458    40.281  -41.417 1.00 60.46  ? 64  LYS C CG  1 
ATOM   3579 C  CD  . LYS C 3 65  ? 0.180    41.043  -41.738 1.00 62.11  ? 64  LYS C CD  1 
ATOM   3580 C  CE  . LYS C 3 65  ? -0.978   40.632  -40.848 1.00 62.20  ? 64  LYS C CE  1 
ATOM   3581 N  NZ  . LYS C 3 65  ? -2.229   41.299  -41.308 1.00 64.28  ? 64  LYS C NZ  1 
ATOM   3582 N  N   . GLY C 3 66  ? 4.661    39.045  -44.108 1.00 49.99  ? 65  GLY C N   1 
ATOM   3583 C  CA  . GLY C 3 66  ? 5.462    38.913  -45.326 1.00 47.73  ? 65  GLY C CA  1 
ATOM   3584 C  C   . GLY C 3 66  ? 6.890    38.434  -45.106 1.00 47.23  ? 65  GLY C C   1 
ATOM   3585 O  O   . GLY C 3 66  ? 7.570    38.110  -46.075 1.00 48.98  ? 65  GLY C O   1 
ATOM   3586 N  N   . ARG C 3 67  ? 7.347    38.371  -43.852 1.00 45.51  ? 66  ARG C N   1 
ATOM   3587 C  CA  . ARG C 3 67  ? 8.725    38.007  -43.527 1.00 44.19  ? 66  ARG C CA  1 
ATOM   3588 C  C   . ARG C 3 67  ? 8.784    36.710  -42.735 1.00 44.47  ? 66  ARG C C   1 
ATOM   3589 O  O   . ARG C 3 67  ? 9.452    35.751  -43.145 1.00 45.52  ? 66  ARG C O   1 
ATOM   3590 C  CB  . ARG C 3 67  ? 9.373    39.133  -42.734 1.00 42.35  ? 66  ARG C CB  1 
ATOM   3591 C  CG  . ARG C 3 67  ? 9.445    40.417  -43.528 1.00 41.34  ? 66  ARG C CG  1 
ATOM   3592 C  CD  . ARG C 3 67  ? 10.386   41.412  -42.888 1.00 41.28  ? 66  ARG C CD  1 
ATOM   3593 N  NE  . ARG C 3 67  ? 9.941    41.791  -41.549 1.00 40.00  ? 66  ARG C NE  1 
ATOM   3594 C  CZ  . ARG C 3 67  ? 10.677   41.797  -40.436 1.00 39.03  ? 66  ARG C CZ  1 
ATOM   3595 N  NH1 . ARG C 3 67  ? 11.963   41.447  -40.439 1.00 40.70  ? 66  ARG C NH1 1 
ATOM   3596 N  NH2 . ARG C 3 67  ? 10.112   42.178  -39.289 1.00 38.53  ? 66  ARG C NH2 1 
ATOM   3597 N  N   . PHE C 3 68  ? 8.093    36.690  -41.597 1.00 43.64  ? 67  PHE C N   1 
ATOM   3598 C  CA  . PHE C 3 68  ? 8.095    35.531  -40.706 1.00 42.69  ? 67  PHE C CA  1 
ATOM   3599 C  C   . PHE C 3 68  ? 6.991    34.575  -41.129 1.00 40.84  ? 67  PHE C C   1 
ATOM   3600 O  O   . PHE C 3 68  ? 5.975    34.999  -41.673 1.00 42.99  ? 67  PHE C O   1 
ATOM   3601 C  CB  . PHE C 3 68  ? 7.906    35.951  -39.241 1.00 41.48  ? 67  PHE C CB  1 
ATOM   3602 C  CG  . PHE C 3 68  ? 9.057    36.744  -38.655 1.00 40.62  ? 67  PHE C CG  1 
ATOM   3603 C  CD1 . PHE C 3 68  ? 10.101   37.252  -39.430 1.00 40.87  ? 67  PHE C CD1 1 
ATOM   3604 C  CD2 . PHE C 3 68  ? 9.053    37.036  -37.298 1.00 40.98  ? 67  PHE C CD2 1 
ATOM   3605 C  CE1 . PHE C 3 68  ? 11.119   37.999  -38.850 1.00 41.63  ? 67  PHE C CE1 1 
ATOM   3606 C  CE2 . PHE C 3 68  ? 10.070   37.785  -36.717 1.00 40.78  ? 67  PHE C CE2 1 
ATOM   3607 C  CZ  . PHE C 3 68  ? 11.100   38.271  -37.492 1.00 40.56  ? 67  PHE C CZ  1 
ATOM   3608 N  N   . THR C 3 69  ? 7.213    33.286  -40.878 1.00 39.42  ? 68  THR C N   1 
ATOM   3609 C  CA  . THR C 3 69  ? 6.247    32.228  -41.180 1.00 37.59  ? 68  THR C CA  1 
ATOM   3610 C  C   . THR C 3 69  ? 6.233    31.199  -40.050 1.00 37.40  ? 68  THR C C   1 
ATOM   3611 O  O   . THR C 3 69  ? 7.271    30.615  -39.701 1.00 35.85  ? 68  THR C O   1 
ATOM   3612 C  CB  . THR C 3 69  ? 6.576    31.532  -42.510 1.00 36.28  ? 68  THR C CB  1 
ATOM   3613 O  OG1 . THR C 3 69  ? 6.466    32.484  -43.568 1.00 38.29  ? 68  THR C OG1 1 
ATOM   3614 C  CG2 . THR C 3 69  ? 5.635    30.370  -42.784 1.00 35.23  ? 68  THR C CG2 1 
ATOM   3615 N  N   . ILE C 3 70  ? 5.039    30.980  -39.499 1.00 36.86  ? 69  ILE C N   1 
ATOM   3616 C  CA  . ILE C 3 70  ? 4.839    30.040  -38.404 1.00 35.56  ? 69  ILE C CA  1 
ATOM   3617 C  C   . ILE C 3 70  ? 4.171    28.789  -38.955 1.00 34.11  ? 69  ILE C C   1 
ATOM   3618 O  O   . ILE C 3 70  ? 3.287    28.848  -39.809 1.00 34.67  ? 69  ILE C O   1 
ATOM   3619 C  CB  . ILE C 3 70  ? 4.051    30.657  -37.222 1.00 35.78  ? 69  ILE C CB  1 
ATOM   3620 C  CG1 . ILE C 3 70  ? 4.105    29.736  -35.994 1.00 35.74  ? 69  ILE C CG1 1 
ATOM   3621 C  CG2 . ILE C 3 70  ? 2.601    30.974  -37.582 1.00 35.99  ? 69  ILE C CG2 1 
ATOM   3622 C  CD1 . ILE C 3 70  ? 3.706    30.421  -34.705 1.00 35.78  ? 69  ILE C CD1 1 
ATOM   3623 N  N   . SER C 3 71  ? 4.636    27.653  -38.480 1.00 33.31  ? 70  SER C N   1 
ATOM   3624 C  CA  . SER C 3 71  ? 4.193    26.377  -38.973 1.00 34.90  ? 70  SER C CA  1 
ATOM   3625 C  C   . SER C 3 71  ? 4.443    25.436  -37.849 1.00 37.74  ? 70  SER C C   1 
ATOM   3626 O  O   . SER C 3 71  ? 5.265    25.714  -36.984 1.00 36.59  ? 70  SER C O   1 
ATOM   3627 C  CB  . SER C 3 71  ? 5.009    25.968  -40.196 1.00 35.43  ? 70  SER C CB  1 
ATOM   3628 O  OG  . SER C 3 71  ? 6.408    25.913  -39.913 1.00 34.26  ? 70  SER C OG  1 
ATOM   3629 N  N   . ARG C 3 72  ? 3.737    24.323  -37.843 1.00 44.08  ? 71  ARG C N   1 
ATOM   3630 C  CA  . ARG C 3 72  ? 3.893    23.364  -36.761 1.00 52.21  ? 71  ARG C CA  1 
ATOM   3631 C  C   . ARG C 3 72  ? 4.090    21.987  -37.317 1.00 55.93  ? 71  ARG C C   1 
ATOM   3632 O  O   . ARG C 3 72  ? 3.610    21.673  -38.409 1.00 54.24  ? 71  ARG C O   1 
ATOM   3633 C  CB  . ARG C 3 72  ? 2.720    23.422  -35.761 1.00 56.79  ? 71  ARG C CB  1 
ATOM   3634 C  CG  . ARG C 3 72  ? 1.340    23.044  -36.291 1.00 62.65  ? 71  ARG C CG  1 
ATOM   3635 C  CD  . ARG C 3 72  ? 0.251    23.277  -35.237 1.00 65.88  ? 71  ARG C CD  1 
ATOM   3636 N  NE  . ARG C 3 72  ? 0.454    22.445  -34.045 1.00 68.18  ? 71  ARG C NE  1 
ATOM   3637 C  CZ  . ARG C 3 72  ? -0.065   22.666  -32.831 1.00 64.86  ? 71  ARG C CZ  1 
ATOM   3638 N  NH1 . ARG C 3 72  ? 0.216    21.822  -31.844 1.00 64.84  ? 71  ARG C NH1 1 
ATOM   3639 N  NH2 . ARG C 3 72  ? -0.848   23.708  -32.575 1.00 59.95  ? 71  ARG C NH2 1 
ATOM   3640 N  N   . ASP C 3 73  ? 4.816    21.180  -36.548 1.00 65.73  ? 72  ASP C N   1 
ATOM   3641 C  CA  . ASP C 3 73  ? 5.024    19.780  -36.854 1.00 75.03  ? 72  ASP C CA  1 
ATOM   3642 C  C   . ASP C 3 73  ? 3.671    19.093  -36.738 1.00 80.11  ? 72  ASP C C   1 
ATOM   3643 O  O   . ASP C 3 73  ? 2.966    19.202  -35.726 1.00 82.25  ? 72  ASP C O   1 
ATOM   3644 C  CB  . ASP C 3 73  ? 6.038    19.131  -35.898 1.00 80.65  ? 72  ASP C CB  1 
ATOM   3645 C  CG  . ASP C 3 73  ? 6.526    17.765  -36.378 1.00 85.92  ? 72  ASP C CG  1 
ATOM   3646 O  OD1 . ASP C 3 73  ? 6.111    17.293  -37.458 1.00 90.21  ? 72  ASP C OD1 1 
ATOM   3647 O  OD2 . ASP C 3 73  ? 7.339    17.153  -35.653 1.00 93.16  ? 72  ASP C OD2 1 
ATOM   3648 N  N   . ASN C 3 74  ? 3.304    18.430  -37.827 1.00 81.33  ? 73  ASN C N   1 
ATOM   3649 C  CA  . ASN C 3 74  ? 2.029    17.735  -37.951 1.00 78.98  ? 73  ASN C CA  1 
ATOM   3650 C  C   . ASN C 3 74  ? 1.925    16.554  -36.960 1.00 77.18  ? 73  ASN C C   1 
ATOM   3651 O  O   . ASN C 3 74  ? 0.871    16.349  -36.354 1.00 75.08  ? 73  ASN C O   1 
ATOM   3652 C  CB  . ASN C 3 74  ? 1.798    17.303  -39.413 1.00 78.83  ? 73  ASN C CB  1 
ATOM   3653 C  CG  . ASN C 3 74  ? 3.067    16.767  -40.092 1.00 78.52  ? 73  ASN C CG  1 
ATOM   3654 O  OD1 . ASN C 3 74  ? 4.002    16.310  -39.425 1.00 75.00  ? 73  ASN C OD1 1 
ATOM   3655 N  ND2 . ASN C 3 74  ? 3.121    16.874  -41.421 1.00 79.38  ? 73  ASN C ND2 1 
ATOM   3656 N  N   . ALA C 3 75  ? 3.022    15.809  -36.776 1.00 77.91  ? 74  ALA C N   1 
ATOM   3657 C  CA  . ALA C 3 75  ? 3.086    14.741  -35.779 1.00 75.74  ? 74  ALA C CA  1 
ATOM   3658 C  C   . ALA C 3 75  ? 3.238    15.322  -34.357 1.00 75.02  ? 74  ALA C C   1 
ATOM   3659 O  O   . ALA C 3 75  ? 2.267    15.354  -33.602 1.00 74.45  ? 74  ALA C O   1 
ATOM   3660 C  CB  . ALA C 3 75  ? 4.223    13.770  -36.099 1.00 75.11  ? 74  ALA C CB  1 
ATOM   3661 N  N   . ALA C 3 76  ? 4.437    15.797  -34.017 1.00 73.27  ? 75  ALA C N   1 
ATOM   3662 C  CA  . ALA C 3 76  ? 4.787    16.203  -32.640 1.00 70.62  ? 75  ALA C CA  1 
ATOM   3663 C  C   . ALA C 3 76  ? 4.254    17.584  -32.243 1.00 66.42  ? 75  ALA C C   1 
ATOM   3664 O  O   . ALA C 3 76  ? 3.863    18.379  -33.100 1.00 68.43  ? 75  ALA C O   1 
ATOM   3665 C  CB  . ALA C 3 76  ? 6.305    16.166  -32.439 1.00 67.55  ? 75  ALA C CB  1 
ATOM   3666 N  N   . ASN C 3 77  ? 4.268    17.860  -30.942 1.00 58.75  ? 76  ASN C N   1 
ATOM   3667 C  CA  . ASN C 3 77  ? 4.027    19.198  -30.424 1.00 53.23  ? 76  ASN C CA  1 
ATOM   3668 C  C   . ASN C 3 77  ? 5.285    20.055  -30.594 1.00 48.08  ? 76  ASN C C   1 
ATOM   3669 O  O   . ASN C 3 77  ? 5.987    20.329  -29.613 1.00 45.89  ? 76  ASN C O   1 
ATOM   3670 C  CB  . ASN C 3 77  ? 3.645    19.141  -28.944 1.00 55.80  ? 76  ASN C CB  1 
ATOM   3671 C  CG  . ASN C 3 77  ? 2.278    18.554  -28.703 1.00 59.52  ? 76  ASN C CG  1 
ATOM   3672 O  OD1 . ASN C 3 77  ? 1.354    18.751  -29.490 1.00 61.90  ? 76  ASN C OD1 1 
ATOM   3673 N  ND2 . ASN C 3 77  ? 2.130    17.844  -27.584 1.00 62.04  ? 76  ASN C ND2 1 
ATOM   3674 N  N   . THR C 3 78  ? 5.562    20.467  -31.835 1.00 41.82  ? 77  THR C N   1 
ATOM   3675 C  CA  . THR C 3 78  ? 6.691    21.347  -32.143 1.00 38.19  ? 77  THR C CA  1 
ATOM   3676 C  C   . THR C 3 78  ? 6.272    22.438  -33.116 1.00 33.72  ? 77  THR C C   1 
ATOM   3677 O  O   . THR C 3 78  ? 5.641    22.156  -34.105 1.00 33.42  ? 77  THR C O   1 
ATOM   3678 C  CB  . THR C 3 78  ? 7.895    20.570  -32.706 1.00 38.70  ? 77  THR C CB  1 
ATOM   3679 O  OG1 . THR C 3 78  ? 8.285    19.545  -31.777 1.00 40.28  ? 77  THR C OG1 1 
ATOM   3680 C  CG2 . THR C 3 78  ? 9.089    21.506  -32.962 1.00 38.02  ? 77  THR C CG2 1 
ATOM   3681 N  N   . VAL C 3 79  ? 6.633    23.678  -32.826 1.00 31.78  ? 78  VAL C N   1 
ATOM   3682 C  CA  . VAL C 3 79  ? 6.235    24.828  -33.625 1.00 31.48  ? 78  VAL C CA  1 
ATOM   3683 C  C   . VAL C 3 79  ? 7.496    25.558  -34.072 1.00 32.83  ? 78  VAL C C   1 
ATOM   3684 O  O   . VAL C 3 79  ? 8.429    25.745  -33.279 1.00 34.50  ? 78  VAL C O   1 
ATOM   3685 C  CB  . VAL C 3 79  ? 5.273    25.769  -32.853 1.00 31.19  ? 78  VAL C CB  1 
ATOM   3686 C  CG1 . VAL C 3 79  ? 5.902    26.342  -31.586 1.00 31.68  ? 78  VAL C CG1 1 
ATOM   3687 C  CG2 . VAL C 3 79  ? 4.787    26.901  -33.746 1.00 31.45  ? 78  VAL C CG2 1 
ATOM   3688 N  N   . TYR C 3 80  ? 7.509    25.960  -35.342 1.00 32.66  ? 79  TYR C N   1 
ATOM   3689 C  CA  . TYR C 3 80  ? 8.664    26.578  -35.989 1.00 33.33  ? 79  TYR C CA  1 
ATOM   3690 C  C   . TYR C 3 80  ? 8.326    28.002  -36.420 1.00 33.36  ? 79  TYR C C   1 
ATOM   3691 O  O   . TYR C 3 80  ? 7.272    28.234  -37.016 1.00 35.39  ? 79  TYR C O   1 
ATOM   3692 C  CB  . TYR C 3 80  ? 9.058    25.787  -37.242 1.00 34.45  ? 79  TYR C CB  1 
ATOM   3693 C  CG  . TYR C 3 80  ? 9.372    24.321  -37.023 1.00 36.26  ? 79  TYR C CG  1 
ATOM   3694 C  CD1 . TYR C 3 80  ? 10.581   23.923  -36.448 1.00 39.20  ? 79  TYR C CD1 1 
ATOM   3695 C  CD2 . TYR C 3 80  ? 8.480    23.323  -37.431 1.00 38.43  ? 79  TYR C CD2 1 
ATOM   3696 C  CE1 . TYR C 3 80  ? 10.886   22.572  -36.251 1.00 40.99  ? 79  TYR C CE1 1 
ATOM   3697 C  CE2 . TYR C 3 80  ? 8.773    21.972  -37.242 1.00 39.82  ? 79  TYR C CE2 1 
ATOM   3698 C  CZ  . TYR C 3 80  ? 9.970    21.599  -36.649 1.00 41.23  ? 79  TYR C CZ  1 
ATOM   3699 O  OH  . TYR C 3 80  ? 10.246   20.260  -36.459 1.00 42.51  ? 79  TYR C OH  1 
ATOM   3700 N  N   . LEU C 3 81  ? 9.213    28.951  -36.130 1.00 32.72  ? 80  LEU C N   1 
ATOM   3701 C  CA  . LEU C 3 81  ? 9.125    30.300  -36.703 1.00 32.47  ? 80  LEU C CA  1 
ATOM   3702 C  C   . LEU C 3 81  ? 10.300   30.535  -37.637 1.00 33.11  ? 80  LEU C C   1 
ATOM   3703 O  O   . LEU C 3 81  ? 11.436   30.652  -37.187 1.00 34.11  ? 80  LEU C O   1 
ATOM   3704 C  CB  . LEU C 3 81  ? 9.118    31.367  -35.614 1.00 31.74  ? 80  LEU C CB  1 
ATOM   3705 C  CG  . LEU C 3 81  ? 8.847    32.794  -36.099 1.00 31.19  ? 80  LEU C CG  1 
ATOM   3706 C  CD1 . LEU C 3 81  ? 7.399    32.947  -36.544 1.00 31.06  ? 80  LEU C CD1 1 
ATOM   3707 C  CD2 . LEU C 3 81  ? 9.172    33.792  -34.996 1.00 31.26  ? 80  LEU C CD2 1 
ATOM   3708 N  N   . GLN C 3 82  ? 10.011   30.599  -38.932 1.00 34.48  ? 81  GLN C N   1 
ATOM   3709 C  CA  . GLN C 3 82  ? 11.011   30.841  -39.961 1.00 36.33  ? 81  GLN C CA  1 
ATOM   3710 C  C   . GLN C 3 82  ? 11.113   32.344  -40.176 1.00 36.80  ? 81  GLN C C   1 
ATOM   3711 O  O   . GLN C 3 82  ? 10.264   32.928  -40.843 1.00 35.74  ? 81  GLN C O   1 
ATOM   3712 C  CB  . GLN C 3 82  ? 10.596   30.139  -41.257 1.00 38.58  ? 81  GLN C CB  1 
ATOM   3713 C  CG  . GLN C 3 82  ? 11.496   30.383  -42.463 1.00 40.48  ? 81  GLN C CG  1 
ATOM   3714 C  CD  . GLN C 3 82  ? 12.896   29.855  -42.262 1.00 41.46  ? 81  GLN C CD  1 
ATOM   3715 O  OE1 . GLN C 3 82  ? 13.092   28.699  -41.906 1.00 43.17  ? 81  GLN C OE1 1 
ATOM   3716 N  NE2 . GLN C 3 82  ? 13.879   30.704  -42.489 1.00 43.56  ? 81  GLN C NE2 1 
ATOM   3717 N  N   . MET C 3 83  ? 12.157   32.965  -39.621 1.00 38.07  ? 82  MET C N   1 
ATOM   3718 C  CA  . MET C 3 83  ? 12.341   34.419  -39.684 1.00 38.54  ? 82  MET C CA  1 
ATOM   3719 C  C   . MET C 3 83  ? 13.285   34.812  -40.814 1.00 40.39  ? 82  MET C C   1 
ATOM   3720 O  O   . MET C 3 83  ? 14.473   34.555  -40.707 1.00 41.45  ? 82  MET C O   1 
ATOM   3721 C  CB  . MET C 3 83  ? 12.907   34.927  -38.361 1.00 37.23  ? 82  MET C CB  1 
ATOM   3722 C  CG  . MET C 3 83  ? 12.013   34.647  -37.174 1.00 37.91  ? 82  MET C CG  1 
ATOM   3723 S  SD  . MET C 3 83  ? 12.644   35.387  -35.676 1.00 37.78  ? 82  MET C SD  1 
ATOM   3724 C  CE  . MET C 3 83  ? 14.001   34.293  -35.326 1.00 39.31  ? 82  MET C CE  1 
ATOM   3725 N  N   . ASN C 3 84  ? 12.756   35.423  -41.883 1.00 41.81  ? 83  ASN C N   1 
ATOM   3726 C  CA  . ASN C 3 84  ? 13.563   35.922  -43.016 1.00 42.03  ? 83  ASN C CA  1 
ATOM   3727 C  C   . ASN C 3 84  ? 13.553   37.448  -43.063 1.00 46.37  ? 83  ASN C C   1 
ATOM   3728 O  O   . ASN C 3 84  ? 12.727   38.081  -42.400 1.00 46.14  ? 83  ASN C O   1 
ATOM   3729 C  CB  . ASN C 3 84  ? 13.023   35.374  -44.332 1.00 39.32  ? 83  ASN C CB  1 
ATOM   3730 C  CG  . ASN C 3 84  ? 13.055   33.867  -44.389 1.00 38.71  ? 83  ASN C CG  1 
ATOM   3731 O  OD1 . ASN C 3 84  ? 13.618   33.206  -43.526 1.00 37.65  ? 83  ASN C OD1 1 
ATOM   3732 N  ND2 . ASN C 3 84  ? 12.434   33.313  -45.409 1.00 39.89  ? 83  ASN C ND2 1 
ATOM   3733 N  N   . SER C 3 85  ? 14.474   38.025  -43.845 1.00 51.04  ? 84  SER C N   1 
ATOM   3734 C  CA  . SER C 3 85  ? 14.614   39.492  -44.009 1.00 52.75  ? 84  SER C CA  1 
ATOM   3735 C  C   . SER C 3 85  ? 14.761   40.228  -42.671 1.00 54.20  ? 84  SER C C   1 
ATOM   3736 O  O   . SER C 3 85  ? 14.165   41.293  -42.460 1.00 53.68  ? 84  SER C O   1 
ATOM   3737 C  CB  . SER C 3 85  ? 13.431   40.084  -44.805 1.00 53.03  ? 84  SER C CB  1 
ATOM   3738 O  OG  . SER C 3 85  ? 13.302   39.504  -46.089 1.00 54.65  ? 84  SER C OG  1 
ATOM   3739 N  N   . LEU C 3 86  ? 15.565   39.656  -41.777 1.00 55.92  ? 85  LEU C N   1 
ATOM   3740 C  CA  . LEU C 3 86  ? 15.686   40.168  -40.414 1.00 60.79  ? 85  LEU C CA  1 
ATOM   3741 C  C   . LEU C 3 86  ? 16.230   41.591  -40.382 1.00 64.94  ? 85  LEU C C   1 
ATOM   3742 O  O   . LEU C 3 86  ? 16.982   41.996  -41.268 1.00 68.63  ? 85  LEU C O   1 
ATOM   3743 C  CB  . LEU C 3 86  ? 16.574   39.253  -39.564 1.00 61.69  ? 85  LEU C CB  1 
ATOM   3744 C  CG  . LEU C 3 86  ? 15.940   37.940  -39.110 1.00 62.00  ? 85  LEU C CG  1 
ATOM   3745 C  CD1 . LEU C 3 86  ? 16.998   37.033  -38.501 1.00 62.78  ? 85  LEU C CD1 1 
ATOM   3746 C  CD2 . LEU C 3 86  ? 14.802   38.190  -38.127 1.00 61.73  ? 85  LEU C CD2 1 
ATOM   3747 N  N   . LYS C 3 87  ? 15.823   42.340  -39.360 1.00 66.69  ? 86  LYS C N   1 
ATOM   3748 C  CA  . LYS C 3 87  ? 16.223   43.735  -39.175 1.00 68.39  ? 86  LYS C CA  1 
ATOM   3749 C  C   . LYS C 3 87  ? 16.654   43.912  -37.734 1.00 66.17  ? 86  LYS C C   1 
ATOM   3750 O  O   . LYS C 3 87  ? 16.246   43.132  -36.882 1.00 70.74  ? 86  LYS C O   1 
ATOM   3751 C  CB  . LYS C 3 87  ? 15.045   44.663  -39.470 1.00 73.58  ? 86  LYS C CB  1 
ATOM   3752 C  CG  . LYS C 3 87  ? 14.416   44.410  -40.828 1.00 79.39  ? 86  LYS C CG  1 
ATOM   3753 C  CD  . LYS C 3 87  ? 13.436   45.475  -41.267 1.00 83.40  ? 86  LYS C CD  1 
ATOM   3754 C  CE  . LYS C 3 87  ? 13.002   45.169  -42.698 1.00 87.03  ? 86  LYS C CE  1 
ATOM   3755 N  NZ  . LYS C 3 87  ? 12.086   46.182  -43.290 1.00 90.91  ? 86  LYS C NZ  1 
ATOM   3756 N  N   . PRO C 3 88  ? 17.455   44.949  -37.438 1.00 66.03  ? 87  PRO C N   1 
ATOM   3757 C  CA  . PRO C 3 88  ? 17.833   45.185  -36.034 1.00 65.38  ? 87  PRO C CA  1 
ATOM   3758 C  C   . PRO C 3 88  ? 16.647   45.449  -35.083 1.00 62.36  ? 87  PRO C C   1 
ATOM   3759 O  O   . PRO C 3 88  ? 16.751   45.209  -33.882 1.00 56.23  ? 87  PRO C O   1 
ATOM   3760 C  CB  . PRO C 3 88  ? 18.767   46.406  -36.118 1.00 65.25  ? 87  PRO C CB  1 
ATOM   3761 C  CG  . PRO C 3 88  ? 18.473   47.046  -37.431 1.00 64.61  ? 87  PRO C CG  1 
ATOM   3762 C  CD  . PRO C 3 88  ? 18.090   45.924  -38.344 1.00 65.98  ? 87  PRO C CD  1 
ATOM   3763 N  N   . GLU C 3 89  ? 15.538   45.919  -35.637 1.00 65.56  ? 88  GLU C N   1 
ATOM   3764 C  CA  . GLU C 3 89  ? 14.291   46.128  -34.897 1.00 70.83  ? 88  GLU C CA  1 
ATOM   3765 C  C   . GLU C 3 89  ? 13.744   44.838  -34.273 1.00 67.83  ? 88  GLU C C   1 
ATOM   3766 O  O   . GLU C 3 89  ? 13.150   44.882  -33.203 1.00 69.87  ? 88  GLU C O   1 
ATOM   3767 C  CB  . GLU C 3 89  ? 13.228   46.722  -35.846 1.00 76.56  ? 88  GLU C CB  1 
ATOM   3768 C  CG  . GLU C 3 89  ? 13.628   48.039  -36.531 1.00 81.93  ? 88  GLU C CG  1 
ATOM   3769 C  CD  . GLU C 3 89  ? 13.544   48.000  -38.069 1.00 85.99  ? 88  GLU C CD  1 
ATOM   3770 O  OE1 . GLU C 3 89  ? 12.586   47.398  -38.601 1.00 89.00  ? 88  GLU C OE1 1 
ATOM   3771 O  OE2 . GLU C 3 89  ? 14.456   48.546  -38.737 1.00 88.12  ? 88  GLU C OE2 1 
ATOM   3772 N  N   . ASP C 3 90  ? 13.963   43.692  -34.928 1.00 62.91  ? 89  ASP C N   1 
ATOM   3773 C  CA  . ASP C 3 90  ? 13.488   42.381  -34.436 1.00 56.99  ? 89  ASP C CA  1 
ATOM   3774 C  C   . ASP C 3 90  ? 14.270   41.824  -33.246 1.00 55.73  ? 89  ASP C C   1 
ATOM   3775 O  O   . ASP C 3 90  ? 13.884   40.798  -32.686 1.00 56.38  ? 89  ASP C O   1 
ATOM   3776 C  CB  . ASP C 3 90  ? 13.525   41.329  -35.554 1.00 54.51  ? 89  ASP C CB  1 
ATOM   3777 C  CG  . ASP C 3 90  ? 12.675   41.710  -36.753 1.00 54.17  ? 89  ASP C CG  1 
ATOM   3778 O  OD1 . ASP C 3 90  ? 11.488   42.073  -36.564 1.00 56.52  ? 89  ASP C OD1 1 
ATOM   3779 O  OD2 . ASP C 3 90  ? 13.195   41.631  -37.889 1.00 51.60  ? 89  ASP C OD2 1 
ATOM   3780 N  N   . THR C 3 91  ? 15.375   42.468  -32.880 1.00 54.36  ? 90  THR C N   1 
ATOM   3781 C  CA  . THR C 3 91  ? 16.170   42.045  -31.738 1.00 53.46  ? 90  THR C CA  1 
ATOM   3782 C  C   . THR C 3 91  ? 15.327   42.022  -30.465 1.00 50.61  ? 90  THR C C   1 
ATOM   3783 O  O   . THR C 3 91  ? 14.829   43.053  -30.023 1.00 47.66  ? 90  THR C O   1 
ATOM   3784 C  CB  . THR C 3 91  ? 17.385   42.975  -31.526 1.00 53.35  ? 90  THR C CB  1 
ATOM   3785 O  OG1 . THR C 3 91  ? 18.172   43.008  -32.722 1.00 55.81  ? 90  THR C OG1 1 
ATOM   3786 C  CG2 . THR C 3 91  ? 18.246   42.521  -30.334 1.00 51.69  ? 90  THR C CG2 1 
ATOM   3787 N  N   . ALA C 3 92  ? 15.180   40.830  -29.896 1.00 48.92  ? 91  ALA C N   1 
ATOM   3788 C  CA  . ALA C 3 92  ? 14.470   40.646  -28.641 1.00 46.90  ? 91  ALA C CA  1 
ATOM   3789 C  C   . ALA C 3 92  ? 14.687   39.237  -28.071 1.00 43.89  ? 91  ALA C C   1 
ATOM   3790 O  O   . ALA C 3 92  ? 15.257   38.366  -28.720 1.00 39.53  ? 91  ALA C O   1 
ATOM   3791 C  CB  . ALA C 3 92  ? 12.982   40.903  -28.856 1.00 48.60  ? 91  ALA C CB  1 
ATOM   3792 N  N   . VAL C 3 93  ? 14.217   39.036  -26.848 1.00 43.75  ? 92  VAL C N   1 
ATOM   3793 C  CA  . VAL C 3 93  ? 14.109   37.705  -26.267 1.00 43.53  ? 92  VAL C CA  1 
ATOM   3794 C  C   . VAL C 3 93  ? 12.787   37.136  -26.793 1.00 42.24  ? 92  VAL C C   1 
ATOM   3795 O  O   . VAL C 3 93  ? 11.733   37.733  -26.573 1.00 40.67  ? 92  VAL C O   1 
ATOM   3796 C  CB  . VAL C 3 93  ? 14.084   37.758  -24.724 1.00 44.79  ? 92  VAL C CB  1 
ATOM   3797 C  CG1 . VAL C 3 93  ? 14.029   36.352  -24.133 1.00 45.03  ? 92  VAL C CG1 1 
ATOM   3798 C  CG2 . VAL C 3 93  ? 15.285   38.530  -24.196 1.00 46.71  ? 92  VAL C CG2 1 
ATOM   3799 N  N   . TYR C 3 94  ? 12.851   36.005  -27.498 1.00 39.61  ? 93  TYR C N   1 
ATOM   3800 C  CA  . TYR C 3 94  ? 11.662   35.357  -28.047 1.00 37.82  ? 93  TYR C CA  1 
ATOM   3801 C  C   . TYR C 3 94  ? 11.221   34.226  -27.129 1.00 37.64  ? 93  TYR C C   1 
ATOM   3802 O  O   . TYR C 3 94  ? 12.039   33.368  -26.776 1.00 36.20  ? 93  TYR C O   1 
ATOM   3803 C  CB  . TYR C 3 94  ? 11.941   34.796  -29.434 1.00 37.44  ? 93  TYR C CB  1 
ATOM   3804 C  CG  . TYR C 3 94  ? 11.974   35.831  -30.527 1.00 37.71  ? 93  TYR C CG  1 
ATOM   3805 C  CD1 . TYR C 3 94  ? 13.049   36.701  -30.652 1.00 38.33  ? 93  TYR C CD1 1 
ATOM   3806 C  CD2 . TYR C 3 94  ? 10.943   35.916  -31.463 1.00 37.74  ? 93  TYR C CD2 1 
ATOM   3807 C  CE1 . TYR C 3 94  ? 13.088   37.639  -31.672 1.00 39.28  ? 93  TYR C CE1 1 
ATOM   3808 C  CE2 . TYR C 3 94  ? 10.968   36.852  -32.479 1.00 37.30  ? 93  TYR C CE2 1 
ATOM   3809 C  CZ  . TYR C 3 94  ? 12.036   37.715  -32.578 1.00 38.92  ? 93  TYR C CZ  1 
ATOM   3810 O  OH  . TYR C 3 94  ? 12.061   38.648  -33.584 1.00 40.65  ? 93  TYR C OH  1 
ATOM   3811 N  N   . TYR C 3 95  ? 9.932    34.232  -26.766 1.00 38.27  ? 94  TYR C N   1 
ATOM   3812 C  CA  . TYR C 3 95  ? 9.320    33.217  -25.896 1.00 38.91  ? 94  TYR C CA  1 
ATOM   3813 C  C   . TYR C 3 95  ? 8.305    32.350  -26.651 1.00 38.79  ? 94  TYR C C   1 
ATOM   3814 O  O   . TYR C 3 95  ? 7.510    32.854  -27.440 1.00 40.13  ? 94  TYR C O   1 
ATOM   3815 C  CB  . TYR C 3 95  ? 8.613    33.877  -24.703 1.00 39.34  ? 94  TYR C CB  1 
ATOM   3816 C  CG  . TYR C 3 95  ? 9.503    34.737  -23.827 1.00 39.89  ? 94  TYR C CG  1 
ATOM   3817 C  CD1 . TYR C 3 95  ? 9.682    36.087  -24.108 1.00 40.51  ? 94  TYR C CD1 1 
ATOM   3818 C  CD2 . TYR C 3 95  ? 10.149   34.206  -22.707 1.00 39.01  ? 94  TYR C CD2 1 
ATOM   3819 C  CE1 . TYR C 3 95  ? 10.487   36.883  -23.309 1.00 40.02  ? 94  TYR C CE1 1 
ATOM   3820 C  CE2 . TYR C 3 95  ? 10.962   34.989  -21.909 1.00 38.48  ? 94  TYR C CE2 1 
ATOM   3821 C  CZ  . TYR C 3 95  ? 11.124   36.326  -22.216 1.00 39.07  ? 94  TYR C CZ  1 
ATOM   3822 O  OH  . TYR C 3 95  ? 11.912   37.138  -21.445 1.00 40.20  ? 94  TYR C OH  1 
ATOM   3823 N  N   . CYS C 3 96  ? 8.337    31.048  -26.385 1.00 37.72  ? 95  CYS C N   1 
ATOM   3824 C  CA  . CYS C 3 96  ? 7.380    30.100  -26.940 1.00 36.14  ? 95  CYS C CA  1 
ATOM   3825 C  C   . CYS C 3 96  ? 6.194    30.006  -25.995 1.00 35.51  ? 95  CYS C C   1 
ATOM   3826 O  O   . CYS C 3 96  ? 6.393    29.865  -24.792 1.00 38.80  ? 95  CYS C O   1 
ATOM   3827 C  CB  . CYS C 3 96  ? 8.042    28.734  -27.059 1.00 35.93  ? 95  CYS C CB  1 
ATOM   3828 S  SG  . CYS C 3 96  ? 6.903    27.398  -27.472 1.00 38.90  ? 95  CYS C SG  1 
ATOM   3829 N  N   . ASN C 3 97  ? 4.973    30.070  -26.521 1.00 35.02  ? 96  ASN C N   1 
ATOM   3830 C  CA  . ASN C 3 97  ? 3.740    30.004  -25.692 1.00 34.69  ? 96  ASN C CA  1 
ATOM   3831 C  C   . ASN C 3 97  ? 2.817    28.892  -26.180 1.00 32.15  ? 96  ASN C C   1 
ATOM   3832 O  O   . ASN C 3 97  ? 2.670    28.698  -27.384 1.00 33.05  ? 96  ASN C O   1 
ATOM   3833 C  CB  . ASN C 3 97  ? 2.986    31.345  -25.724 1.00 36.12  ? 96  ASN C CB  1 
ATOM   3834 C  CG  . ASN C 3 97  ? 1.689    31.334  -24.901 1.00 38.48  ? 96  ASN C CG  1 
ATOM   3835 O  OD1 . ASN C 3 97  ? 0.656    31.826  -25.354 1.00 40.58  ? 96  ASN C OD1 1 
ATOM   3836 N  ND2 . ASN C 3 97  ? 1.739    30.787  -23.691 1.00 39.49  ? 96  ASN C ND2 1 
ATOM   3837 N  N   . VAL C 3 98  ? 2.211    28.167  -25.238 1.00 29.68  ? 97  VAL C N   1 
ATOM   3838 C  CA  . VAL C 3 98  ? 1.172    27.186  -25.537 1.00 28.57  ? 97  VAL C CA  1 
ATOM   3839 C  C   . VAL C 3 98  ? -0.076   27.533  -24.734 1.00 28.69  ? 97  VAL C C   1 
ATOM   3840 O  O   . VAL C 3 98  ? -0.010   27.617  -23.511 1.00 28.71  ? 97  VAL C O   1 
ATOM   3841 C  CB  . VAL C 3 98  ? 1.623    25.753  -25.187 1.00 27.85  ? 97  VAL C CB  1 
ATOM   3842 C  CG1 . VAL C 3 98  ? 0.508    24.738  -25.432 1.00 27.66  ? 97  VAL C CG1 1 
ATOM   3843 C  CG2 . VAL C 3 98  ? 2.855    25.384  -26.001 1.00 27.98  ? 97  VAL C CG2 1 
ATOM   3844 N  N   . LYS C 3 99  ? -1.193   27.760  -25.431 1.00 29.66  ? 98  LYS C N   1 
ATOM   3845 C  CA  . LYS C 3 99  ? -2.511   27.863  -24.805 1.00 30.64  ? 98  LYS C CA  1 
ATOM   3846 C  C   . LYS C 3 99  ? -3.225   26.531  -24.947 1.00 32.17  ? 98  LYS C C   1 
ATOM   3847 O  O   . LYS C 3 99  ? -3.574   26.117  -26.048 1.00 32.28  ? 98  LYS C O   1 
ATOM   3848 C  CB  . LYS C 3 99  ? -3.361   28.960  -25.438 1.00 30.86  ? 98  LYS C CB  1 
ATOM   3849 C  CG  . LYS C 3 99  ? -2.784   30.338  -25.241 1.00 31.50  ? 98  LYS C CG  1 
ATOM   3850 C  CD  . LYS C 3 99  ? -3.796   31.456  -25.441 1.00 32.02  ? 98  LYS C CD  1 
ATOM   3851 C  CE  . LYS C 3 99  ? -3.060   32.772  -25.638 1.00 32.67  ? 98  LYS C CE  1 
ATOM   3852 N  NZ  . LYS C 3 99  ? -2.007   33.043  -24.611 1.00 32.56  ? 98  LYS C NZ  1 
ATOM   3853 N  N   . ASP C 3 100 ? -3.439   25.876  -23.813 1.00 34.45  ? 99  ASP C N   1 
ATOM   3854 C  CA  . ASP C 3 100 ? -4.134   24.600  -23.734 1.00 35.98  ? 99  ASP C CA  1 
ATOM   3855 C  C   . ASP C 3 100 ? -5.632   24.850  -23.456 1.00 35.57  ? 99  ASP C C   1 
ATOM   3856 O  O   . ASP C 3 100 ? -5.968   25.474  -22.450 1.00 37.20  ? 99  ASP C O   1 
ATOM   3857 C  CB  . ASP C 3 100 ? -3.486   23.794  -22.600 1.00 37.49  ? 99  ASP C CB  1 
ATOM   3858 C  CG  . ASP C 3 100 ? -3.974   22.359  -22.529 1.00 39.58  ? 99  ASP C CG  1 
ATOM   3859 O  OD1 . ASP C 3 100 ? -5.188   22.112  -22.675 1.00 40.22  ? 99  ASP C OD1 1 
ATOM   3860 O  OD2 . ASP C 3 100 ? -3.139   21.469  -22.277 1.00 41.23  ? 99  ASP C OD2 1 
ATOM   3861 N  N   . PHE C 3 101 ? -6.521   24.353  -24.322 1.00 34.03  ? 100 PHE C N   1 
ATOM   3862 C  CA  . PHE C 3 101 ? -7.970   24.506  -24.115 1.00 34.92  ? 100 PHE C CA  1 
ATOM   3863 C  C   . PHE C 3 101 ? -8.644   23.341  -23.372 1.00 35.67  ? 100 PHE C C   1 
ATOM   3864 O  O   . PHE C 3 101 ? -9.850   23.166  -23.464 1.00 37.20  ? 100 PHE C O   1 
ATOM   3865 C  CB  . PHE C 3 101 ? -8.671   24.715  -25.460 1.00 34.94  ? 100 PHE C CB  1 
ATOM   3866 C  CG  . PHE C 3 101 ? -8.254   25.959  -26.194 1.00 34.99  ? 100 PHE C CG  1 
ATOM   3867 C  CD1 . PHE C 3 101 ? -8.144   27.185  -25.538 1.00 35.09  ? 100 PHE C CD1 1 
ATOM   3868 C  CD2 . PHE C 3 101 ? -8.000   25.915  -27.561 1.00 34.48  ? 100 PHE C CD2 1 
ATOM   3869 C  CE1 . PHE C 3 101 ? -7.773   28.330  -26.223 1.00 33.99  ? 100 PHE C CE1 1 
ATOM   3870 C  CE2 . PHE C 3 101 ? -7.635   27.057  -28.243 1.00 33.85  ? 100 PHE C CE2 1 
ATOM   3871 C  CZ  . PHE C 3 101 ? -7.521   28.266  -27.574 1.00 33.86  ? 100 PHE C CZ  1 
ATOM   3872 N  N   . GLY C 3 102 ? -7.874   22.565  -22.617 1.00 36.57  ? 101 GLY C N   1 
ATOM   3873 C  CA  . GLY C 3 102 ? -8.369   21.319  -22.026 1.00 35.98  ? 101 GLY C CA  1 
ATOM   3874 C  C   . GLY C 3 102 ? -9.398   21.465  -20.923 1.00 35.72  ? 101 GLY C C   1 
ATOM   3875 O  O   . GLY C 3 102 ? -10.027  20.478  -20.561 1.00 38.95  ? 101 GLY C O   1 
ATOM   3876 N  N   . ALA C 3 103 ? -9.574   22.663  -20.369 1.00 33.44  ? 102 ALA C N   1 
ATOM   3877 C  CA  . ALA C 3 103 ? -10.589  22.881  -19.337 1.00 32.43  ? 102 ALA C CA  1 
ATOM   3878 C  C   . ALA C 3 103 ? -11.913  23.382  -19.917 1.00 31.61  ? 102 ALA C C   1 
ATOM   3879 O  O   . ALA C 3 103 ? -12.902  23.488  -19.193 1.00 32.13  ? 102 ALA C O   1 
ATOM   3880 C  CB  . ALA C 3 103 ? -10.071  23.852  -18.298 1.00 32.56  ? 102 ALA C CB  1 
ATOM   3881 N  N   . ILE C 3 104 ? -11.927  23.710  -21.208 1.00 30.29  ? 103 ILE C N   1 
ATOM   3882 C  CA  . ILE C 3 104 ? -13.122  24.165  -21.918 1.00 29.56  ? 103 ILE C CA  1 
ATOM   3883 C  C   . ILE C 3 104 ? -13.536  25.584  -21.568 1.00 30.16  ? 103 ILE C C   1 
ATOM   3884 O  O   . ILE C 3 104 ? -13.684  26.420  -22.454 1.00 30.74  ? 103 ILE C O   1 
ATOM   3885 C  CB  . ILE C 3 104 ? -14.336  23.223  -21.741 1.00 29.86  ? 103 ILE C CB  1 
ATOM   3886 C  CG1 . ILE C 3 104 ? -13.924  21.753  -21.920 1.00 29.49  ? 103 ILE C CG1 1 
ATOM   3887 C  CG2 . ILE C 3 104 ? -15.470  23.606  -22.706 1.00 30.30  ? 103 ILE C CG2 1 
ATOM   3888 C  CD1 . ILE C 3 104 ? -13.185  21.472  -23.209 1.00 29.47  ? 103 ILE C CD1 1 
ATOM   3889 N  N   . ILE C 3 105 ? -13.743  25.856  -20.287 1.00 31.02  ? 104 ILE C N   1 
ATOM   3890 C  CA  . ILE C 3 105 ? -14.268  27.149  -19.848 1.00 32.50  ? 104 ILE C CA  1 
ATOM   3891 C  C   . ILE C 3 105 ? -13.151  28.197  -19.823 1.00 33.04  ? 104 ILE C C   1 
ATOM   3892 O  O   . ILE C 3 105 ? -13.388  29.369  -20.123 1.00 30.47  ? 104 ILE C O   1 
ATOM   3893 C  CB  . ILE C 3 105 ? -14.984  27.036  -18.472 1.00 33.35  ? 104 ILE C CB  1 
ATOM   3894 C  CG1 . ILE C 3 105 ? -15.984  25.857  -18.444 1.00 32.68  ? 104 ILE C CG1 1 
ATOM   3895 C  CG2 . ILE C 3 105 ? -15.695  28.346  -18.121 1.00 33.72  ? 104 ILE C CG2 1 
ATOM   3896 C  CD1 . ILE C 3 105 ? -16.955  25.823  -19.614 1.00 33.01  ? 104 ILE C CD1 1 
ATOM   3897 N  N   . TYR C 3 106 ? -11.942  27.758  -19.477 1.00 35.64  ? 105 TYR C N   1 
ATOM   3898 C  CA  . TYR C 3 106 ? -10.762  28.613  -19.459 1.00 39.32  ? 105 TYR C CA  1 
ATOM   3899 C  C   . TYR C 3 106 ? -9.563   27.963  -20.142 1.00 41.07  ? 105 TYR C C   1 
ATOM   3900 O  O   . TYR C 3 106 ? -9.521   26.752  -20.353 1.00 42.41  ? 105 TYR C O   1 
ATOM   3901 C  CB  . TYR C 3 106 ? -10.399  28.966  -18.016 1.00 42.43  ? 105 TYR C CB  1 
ATOM   3902 C  CG  . TYR C 3 106 ? -10.053  27.778  -17.137 1.00 44.11  ? 105 TYR C CG  1 
ATOM   3903 C  CD1 . TYR C 3 106 ? -11.039  27.079  -16.438 1.00 44.74  ? 105 TYR C CD1 1 
ATOM   3904 C  CD2 . TYR C 3 106 ? -8.731   27.359  -16.996 1.00 44.71  ? 105 TYR C CD2 1 
ATOM   3905 C  CE1 . TYR C 3 106 ? -10.711  25.993  -15.627 1.00 45.33  ? 105 TYR C CE1 1 
ATOM   3906 C  CE2 . TYR C 3 106 ? -8.396   26.276  -16.194 1.00 44.66  ? 105 TYR C CE2 1 
ATOM   3907 C  CZ  . TYR C 3 106 ? -9.379   25.599  -15.513 1.00 45.04  ? 105 TYR C CZ  1 
ATOM   3908 O  OH  . TYR C 3 106 ? -9.006   24.537  -14.734 1.00 46.96  ? 105 TYR C OH  1 
ATOM   3909 N  N   . ASP C 3 107 ? -8.576   28.786  -20.465 1.00 42.88  ? 106 ASP C N   1 
ATOM   3910 C  CA  . ASP C 3 107 ? -7.345   28.312  -21.098 1.00 43.64  ? 106 ASP C CA  1 
ATOM   3911 C  C   . ASP C 3 107 ? -6.222   28.360  -20.081 1.00 42.63  ? 106 ASP C C   1 
ATOM   3912 O  O   . ASP C 3 107 ? -6.136   29.310  -19.314 1.00 41.01  ? 106 ASP C O   1 
ATOM   3913 C  CB  . ASP C 3 107 ? -6.955   29.074  -22.407 1.00 45.09  ? 106 ASP C CB  1 
ATOM   3914 C  CG  . ASP C 3 107 ? -7.752   30.349  -22.665 1.00 46.64  ? 106 ASP C CG  1 
ATOM   3915 O  OD1 . ASP C 3 107 ? -8.742   30.633  -21.958 1.00 51.79  ? 106 ASP C OD1 1 
ATOM   3916 O  OD2 . ASP C 3 107 ? -7.372   31.066  -23.615 1.00 45.74  ? 106 ASP C OD2 1 
ATOM   3917 N  N   . TYR C 3 108 ? -5.394   27.314  -20.071 1.00 43.23  ? 107 TYR C N   1 
ATOM   3918 C  CA  . TYR C 3 108 ? -4.174   27.260  -19.265 1.00 41.77  ? 107 TYR C CA  1 
ATOM   3919 C  C   . TYR C 3 108 ? -2.971   27.619  -20.142 1.00 38.92  ? 107 TYR C C   1 
ATOM   3920 O  O   . TYR C 3 108 ? -2.842   27.092  -21.245 1.00 35.31  ? 107 TYR C O   1 
ATOM   3921 C  CB  . TYR C 3 108 ? -3.994   25.864  -18.651 1.00 43.22  ? 107 TYR C CB  1 
ATOM   3922 C  CG  . TYR C 3 108 ? -3.004   25.860  -17.506 1.00 46.70  ? 107 TYR C CG  1 
ATOM   3923 C  CD1 . TYR C 3 108 ? -3.369   26.326  -16.248 1.00 49.15  ? 107 TYR C CD1 1 
ATOM   3924 C  CD2 . TYR C 3 108 ? -1.692   25.421  -17.684 1.00 48.27  ? 107 TYR C CD2 1 
ATOM   3925 C  CE1 . TYR C 3 108 ? -2.464   26.339  -15.194 1.00 50.33  ? 107 TYR C CE1 1 
ATOM   3926 C  CE2 . TYR C 3 108 ? -0.777   25.434  -16.635 1.00 48.84  ? 107 TYR C CE2 1 
ATOM   3927 C  CZ  . TYR C 3 108 ? -1.172   25.891  -15.391 1.00 49.47  ? 107 TYR C CZ  1 
ATOM   3928 O  OH  . TYR C 3 108 ? -0.282   25.905  -14.340 1.00 51.60  ? 107 TYR C OH  1 
ATOM   3929 N  N   . ASP C 3 109 ? -2.099   28.488  -19.635 1.00 37.88  ? 108 ASP C N   1 
ATOM   3930 C  CA  . ASP C 3 109 ? -0.887   28.938  -20.353 1.00 38.19  ? 108 ASP C CA  1 
ATOM   3931 C  C   . ASP C 3 109 ? 0.431    28.296  -19.903 1.00 36.11  ? 108 ASP C C   1 
ATOM   3932 O  O   . ASP C 3 109 ? 0.680    28.160  -18.708 1.00 35.66  ? 108 ASP C O   1 
ATOM   3933 C  CB  . ASP C 3 109 ? -0.744   30.461  -20.215 1.00 40.73  ? 108 ASP C CB  1 
ATOM   3934 C  CG  . ASP C 3 109 ? -1.528   31.217  -21.243 1.00 43.55  ? 108 ASP C CG  1 
ATOM   3935 O  OD1 . ASP C 3 109 ? -2.435   30.630  -21.860 1.00 43.32  ? 108 ASP C OD1 1 
ATOM   3936 O  OD2 . ASP C 3 109 ? -1.232   32.412  -21.422 1.00 48.86  ? 108 ASP C OD2 1 
ATOM   3937 N  N   . TYR C 3 110 ? 1.267    27.939  -20.881 1.00 33.57  ? 109 TYR C N   1 
ATOM   3938 C  CA  . TYR C 3 110 ? 2.646    27.509  -20.661 1.00 32.38  ? 109 TYR C CA  1 
ATOM   3939 C  C   . TYR C 3 110 ? 3.576    28.472  -21.377 1.00 31.95  ? 109 TYR C C   1 
ATOM   3940 O  O   . TYR C 3 110 ? 3.324    28.822  -22.527 1.00 30.67  ? 109 TYR C O   1 
ATOM   3941 C  CB  . TYR C 3 110 ? 2.866    26.096  -21.204 1.00 31.76  ? 109 TYR C CB  1 
ATOM   3942 C  CG  . TYR C 3 110 ? 1.976    25.063  -20.563 1.00 31.82  ? 109 TYR C CG  1 
ATOM   3943 C  CD1 . TYR C 3 110 ? 2.278    24.541  -19.312 1.00 31.97  ? 109 TYR C CD1 1 
ATOM   3944 C  CD2 . TYR C 3 110 ? 0.828    24.605  -21.208 1.00 32.40  ? 109 TYR C CD2 1 
ATOM   3945 C  CE1 . TYR C 3 110 ? 1.466    23.595  -18.718 1.00 32.80  ? 109 TYR C CE1 1 
ATOM   3946 C  CE2 . TYR C 3 110 ? 0.004    23.653  -20.621 1.00 32.31  ? 109 TYR C CE2 1 
ATOM   3947 C  CZ  . TYR C 3 110 ? 0.326    23.148  -19.376 1.00 32.77  ? 109 TYR C CZ  1 
ATOM   3948 O  OH  . TYR C 3 110 ? -0.481   22.199  -18.779 1.00 32.27  ? 109 TYR C OH  1 
ATOM   3949 N  N   . TRP C 3 111 ? 4.638    28.908  -20.699 1.00 33.56  ? 110 TRP C N   1 
ATOM   3950 C  CA  . TRP C 3 111 ? 5.658    29.771  -21.310 1.00 35.09  ? 110 TRP C CA  1 
ATOM   3951 C  C   . TRP C 3 111 ? 7.045    29.145  -21.289 1.00 35.79  ? 110 TRP C C   1 
ATOM   3952 O  O   . TRP C 3 111 ? 7.418    28.505  -20.325 1.00 37.20  ? 110 TRP C O   1 
ATOM   3953 C  CB  . TRP C 3 111 ? 5.693    31.105  -20.589 1.00 34.92  ? 110 TRP C CB  1 
ATOM   3954 C  CG  . TRP C 3 111 ? 4.493    31.880  -20.854 1.00 35.88  ? 110 TRP C CG  1 
ATOM   3955 C  CD1 . TRP C 3 111 ? 3.328    31.826  -20.173 1.00 36.01  ? 110 TRP C CD1 1 
ATOM   3956 C  CD2 . TRP C 3 111 ? 4.306    32.822  -21.908 1.00 37.26  ? 110 TRP C CD2 1 
ATOM   3957 N  NE1 . TRP C 3 111 ? 2.414    32.692  -20.722 1.00 36.93  ? 110 TRP C NE1 1 
ATOM   3958 C  CE2 . TRP C 3 111 ? 2.987    33.320  -21.792 1.00 36.85  ? 110 TRP C CE2 1 
ATOM   3959 C  CE3 . TRP C 3 111 ? 5.125    33.302  -22.940 1.00 38.40  ? 110 TRP C CE3 1 
ATOM   3960 C  CZ2 . TRP C 3 111 ? 2.460    34.282  -22.666 1.00 37.29  ? 110 TRP C CZ2 1 
ATOM   3961 C  CZ3 . TRP C 3 111 ? 4.601    34.263  -23.822 1.00 39.06  ? 110 TRP C CZ3 1 
ATOM   3962 C  CH2 . TRP C 3 111 ? 3.279    34.742  -23.674 1.00 38.51  ? 110 TRP C CH2 1 
ATOM   3963 N  N   . GLY C 3 112 ? 7.793    29.322  -22.371 1.00 37.38  ? 111 GLY C N   1 
ATOM   3964 C  CA  . GLY C 3 112 ? 9.210    28.949  -22.424 1.00 41.66  ? 111 GLY C CA  1 
ATOM   3965 C  C   . GLY C 3 112 ? 10.113   29.911  -21.666 1.00 44.65  ? 111 GLY C C   1 
ATOM   3966 O  O   . GLY C 3 112 ? 9.728    31.057  -21.387 1.00 45.73  ? 111 GLY C O   1 
ATOM   3967 N  N   . GLN C 3 113 ? 11.309   29.438  -21.313 1.00 46.50  ? 112 GLN C N   1 
ATOM   3968 C  CA  . GLN C 3 113 ? 12.314   30.273  -20.631 1.00 49.46  ? 112 GLN C CA  1 
ATOM   3969 C  C   . GLN C 3 113 ? 12.728   31.478  -21.491 1.00 46.07  ? 112 GLN C C   1 
ATOM   3970 O  O   . GLN C 3 113 ? 13.005   32.558  -20.969 1.00 46.13  ? 112 GLN C O   1 
ATOM   3971 C  CB  . GLN C 3 113 ? 13.561   29.445  -20.269 1.00 56.29  ? 112 GLN C CB  1 
ATOM   3972 C  CG  . GLN C 3 113 ? 13.358   28.435  -19.149 1.00 62.13  ? 112 GLN C CG  1 
ATOM   3973 C  CD  . GLN C 3 113 ? 13.044   29.081  -17.799 1.00 70.22  ? 112 GLN C CD  1 
ATOM   3974 O  OE1 . GLN C 3 113 ? 13.492   30.192  -17.505 1.00 81.80  ? 112 GLN C OE1 1 
ATOM   3975 N  NE2 . GLN C 3 113 ? 12.269   28.384  -16.972 1.00 73.95  ? 112 GLN C NE2 1 
ATOM   3976 N  N   . GLY C 3 114 ? 12.769   31.264  -22.805 1.00 42.13  ? 113 GLY C N   1 
ATOM   3977 C  CA  . GLY C 3 114 ? 13.079   32.294  -23.781 1.00 40.68  ? 113 GLY C CA  1 
ATOM   3978 C  C   . GLY C 3 114 ? 14.400   31.992  -24.458 1.00 40.32  ? 113 GLY C C   1 
ATOM   3979 O  O   . GLY C 3 114 ? 15.235   31.265  -23.908 1.00 37.43  ? 113 GLY C O   1 
ATOM   3980 N  N   . THR C 3 115 ? 14.574   32.531  -25.666 1.00 40.04  ? 114 THR C N   1 
ATOM   3981 C  CA  . THR C 3 115 ? 15.832   32.424  -26.397 1.00 39.86  ? 114 THR C CA  1 
ATOM   3982 C  C   . THR C 3 115 ? 16.153   33.768  -27.065 1.00 39.19  ? 114 THR C C   1 
ATOM   3983 O  O   . THR C 3 115 ? 15.276   34.429  -27.613 1.00 38.96  ? 114 THR C O   1 
ATOM   3984 C  CB  . THR C 3 115 ? 15.807   31.249  -27.402 1.00 40.65  ? 114 THR C CB  1 
ATOM   3985 O  OG1 . THR C 3 115 ? 17.137   30.948  -27.848 1.00 43.76  ? 114 THR C OG1 1 
ATOM   3986 C  CG2 . THR C 3 115 ? 14.924   31.547  -28.608 1.00 41.58  ? 114 THR C CG2 1 
ATOM   3987 N  N   . GLN C 3 116 ? 17.418   34.170  -26.979 1.00 39.61  ? 115 GLN C N   1 
ATOM   3988 C  CA  . GLN C 3 116 ? 17.849   35.494  -27.417 1.00 39.03  ? 115 GLN C CA  1 
ATOM   3989 C  C   . GLN C 3 116 ? 18.077   35.488  -28.915 1.00 39.93  ? 115 GLN C C   1 
ATOM   3990 O  O   . GLN C 3 116 ? 18.663   34.553  -29.455 1.00 41.40  ? 115 GLN C O   1 
ATOM   3991 C  CB  . GLN C 3 116 ? 19.136   35.906  -26.687 1.00 37.22  ? 115 GLN C CB  1 
ATOM   3992 C  CG  . GLN C 3 116 ? 19.748   37.232  -27.120 1.00 35.96  ? 115 GLN C CG  1 
ATOM   3993 C  CD  . GLN C 3 116 ? 18.862   38.411  -26.818 1.00 35.55  ? 115 GLN C CD  1 
ATOM   3994 O  OE1 . GLN C 3 116 ? 18.473   38.630  -25.662 1.00 34.15  ? 115 GLN C OE1 1 
ATOM   3995 N  NE2 . GLN C 3 116 ? 18.552   39.196  -27.849 1.00 36.51  ? 115 GLN C NE2 1 
ATOM   3996 N  N   . VAL C 3 117 ? 17.615   36.544  -29.566 1.00 40.91  ? 116 VAL C N   1 
ATOM   3997 C  CA  . VAL C 3 117 ? 17.854   36.772  -30.977 1.00 42.85  ? 116 VAL C CA  1 
ATOM   3998 C  C   . VAL C 3 117 ? 18.374   38.197  -31.099 1.00 46.54  ? 116 VAL C C   1 
ATOM   3999 O  O   . VAL C 3 117 ? 17.690   39.128  -30.695 1.00 47.88  ? 116 VAL C O   1 
ATOM   4000 C  CB  . VAL C 3 117 ? 16.550   36.615  -31.778 1.00 42.35  ? 116 VAL C CB  1 
ATOM   4001 C  CG1 . VAL C 3 117 ? 16.741   37.017  -33.238 1.00 42.33  ? 116 VAL C CG1 1 
ATOM   4002 C  CG2 . VAL C 3 117 ? 16.041   35.188  -31.656 1.00 42.38  ? 116 VAL C CG2 1 
ATOM   4003 N  N   . THR C 3 118 ? 19.582   38.358  -31.640 1.00 48.89  ? 117 THR C N   1 
ATOM   4004 C  CA  . THR C 3 118 ? 20.185   39.671  -31.839 1.00 48.34  ? 117 THR C CA  1 
ATOM   4005 C  C   . THR C 3 118 ? 20.545   39.849  -33.296 1.00 51.28  ? 117 THR C C   1 
ATOM   4006 O  O   . THR C 3 118 ? 21.306   39.066  -33.841 1.00 52.25  ? 117 THR C O   1 
ATOM   4007 C  CB  . THR C 3 118 ? 21.451   39.825  -30.996 1.00 46.63  ? 117 THR C CB  1 
ATOM   4008 O  OG1 . THR C 3 118 ? 21.161   39.516  -29.625 1.00 46.17  ? 117 THR C OG1 1 
ATOM   4009 C  CG2 . THR C 3 118 ? 21.997   41.235  -31.094 1.00 46.78  ? 117 THR C CG2 1 
ATOM   4010 N  N   . VAL C 3 119 ? 19.993   40.878  -33.923 1.00 56.38  ? 118 VAL C N   1 
ATOM   4011 C  CA  . VAL C 3 119 ? 20.278   41.180  -35.315 1.00 63.39  ? 118 VAL C CA  1 
ATOM   4012 C  C   . VAL C 3 119 ? 21.111   42.457  -35.378 1.00 67.29  ? 118 VAL C C   1 
ATOM   4013 O  O   . VAL C 3 119 ? 20.651   43.518  -34.942 1.00 67.51  ? 118 VAL C O   1 
ATOM   4014 C  CB  . VAL C 3 119 ? 18.977   41.350  -36.122 1.00 67.22  ? 118 VAL C CB  1 
ATOM   4015 C  CG1 . VAL C 3 119 ? 19.275   41.729  -37.574 1.00 68.60  ? 118 VAL C CG1 1 
ATOM   4016 C  CG2 . VAL C 3 119 ? 18.149   40.073  -36.055 1.00 67.69  ? 118 VAL C CG2 1 
ATOM   4017 N  N   . SER C 3 120 ? 22.331   42.341  -35.909 1.00 70.13  ? 119 SER C N   1 
ATOM   4018 C  CA  . SER C 3 120 ? 23.253   43.481  -36.055 1.00 70.81  ? 119 SER C CA  1 
ATOM   4019 C  C   . SER C 3 120 ? 23.125   44.078  -37.454 1.00 71.86  ? 119 SER C C   1 
ATOM   4020 O  O   . SER C 3 120 ? 22.774   43.372  -38.400 1.00 72.04  ? 119 SER C O   1 
ATOM   4021 C  CB  . SER C 3 120 ? 24.691   43.034  -35.794 1.00 70.73  ? 119 SER C CB  1 
ATOM   4022 O  OG  . SER C 3 120 ? 25.017   41.909  -36.598 1.00 70.79  ? 119 SER C OG  1 
ATOM   4023 N  N   . SER C 3 121 ? 23.413   45.374  -37.576 1.00 72.99  ? 120 SER C N   1 
ATOM   4024 C  CA  . SER C 3 121 ? 23.159   46.130  -38.821 1.00 74.25  ? 120 SER C CA  1 
ATOM   4025 C  C   . SER C 3 121 ? 24.053   45.717  -39.985 1.00 71.10  ? 120 SER C C   1 
ATOM   4026 O  O   . SER C 3 121 ? 25.246   45.511  -39.808 1.00 70.56  ? 120 SER C O   1 
ATOM   4027 C  CB  . SER C 3 121 ? 23.306   47.626  -38.574 1.00 76.58  ? 120 SER C CB  1 
ATOM   4028 O  OG  . SER C 3 121 ? 22.430   48.031  -37.534 1.00 78.88  ? 120 SER C OG  1 
ATOM   4029 N  N   . ASP D 1 2   ? -7.953   43.400  -38.290 1.00 112.53 ? 2   ASP F N   1 
ATOM   4030 C  CA  . ASP D 1 2   ? -8.063   42.504  -39.482 1.00 112.50 ? 2   ASP F CA  1 
ATOM   4031 C  C   . ASP D 1 2   ? -8.838   43.147  -40.645 1.00 112.28 ? 2   ASP F C   1 
ATOM   4032 O  O   . ASP D 1 2   ? -8.424   43.046  -41.805 1.00 111.58 ? 2   ASP F O   1 
ATOM   4033 C  CB  . ASP D 1 2   ? -8.716   41.180  -39.081 1.00 112.13 ? 2   ASP F CB  1 
ATOM   4034 C  CG  . ASP D 1 2   ? -8.686   40.150  -40.199 1.00 115.40 ? 2   ASP F CG  1 
ATOM   4035 O  OD1 . ASP D 1 2   ? -7.664   40.055  -40.919 1.00 114.61 ? 2   ASP F OD1 1 
ATOM   4036 O  OD2 . ASP D 1 2   ? -9.691   39.429  -40.358 1.00 117.51 ? 2   ASP F OD2 1 
ATOM   4037 N  N   . LYS D 1 3   ? -9.959   43.797  -40.320 1.00 110.38 ? 3   LYS F N   1 
ATOM   4038 C  CA  . LYS D 1 3   ? -10.755  44.570  -41.297 1.00 106.68 ? 3   LYS F CA  1 
ATOM   4039 C  C   . LYS D 1 3   ? -10.056  45.853  -41.803 1.00 102.65 ? 3   LYS F C   1 
ATOM   4040 O  O   . LYS D 1 3   ? -10.419  46.382  -42.855 1.00 99.48  ? 3   LYS F O   1 
ATOM   4041 C  CB  . LYS D 1 3   ? -12.130  44.950  -40.706 1.00 107.71 ? 3   LYS F CB  1 
ATOM   4042 C  CG  . LYS D 1 3   ? -13.021  43.792  -40.256 1.00 108.20 ? 3   LYS F CG  1 
ATOM   4043 C  CD  . LYS D 1 3   ? -13.423  42.869  -41.401 1.00 111.58 ? 3   LYS F CD  1 
ATOM   4044 C  CE  . LYS D 1 3   ? -14.140  41.621  -40.899 1.00 114.68 ? 3   LYS F CE  1 
ATOM   4045 N  NZ  . LYS D 1 3   ? -13.971  40.466  -41.829 1.00 116.30 ? 3   LYS F NZ  1 
ATOM   4046 N  N   . ILE D 1 4   ? -9.072   46.350  -41.048 1.00 102.93 ? 4   ILE F N   1 
ATOM   4047 C  CA  . ILE D 1 4   ? -8.315   47.567  -41.394 1.00 100.59 ? 4   ILE F CA  1 
ATOM   4048 C  C   . ILE D 1 4   ? -7.244   47.336  -42.483 1.00 100.45 ? 4   ILE F C   1 
ATOM   4049 O  O   . ILE D 1 4   ? -6.422   46.420  -42.374 1.00 96.13  ? 4   ILE F O   1 
ATOM   4050 C  CB  . ILE D 1 4   ? -7.667   48.210  -40.133 1.00 97.93  ? 4   ILE F CB  1 
ATOM   4051 C  CG1 . ILE D 1 4   ? -8.762   48.663  -39.152 1.00 93.44  ? 4   ILE F CG1 1 
ATOM   4052 C  CG2 . ILE D 1 4   ? -6.774   49.388  -40.517 1.00 99.82  ? 4   ILE F CG2 1 
ATOM   4053 C  CD1 . ILE D 1 4   ? -8.264   49.222  -37.839 1.00 91.92  ? 4   ILE F CD1 1 
ATOM   4054 N  N   . ILE D 1 5   ? -7.257   48.198  -43.505 1.00 100.03 ? 5   ILE F N   1 
ATOM   4055 C  CA  . ILE D 1 5   ? -6.249   48.192  -44.577 1.00 99.31  ? 5   ILE F CA  1 
ATOM   4056 C  C   . ILE D 1 5   ? -5.027   48.978  -44.092 1.00 100.52 ? 5   ILE F C   1 
ATOM   4057 O  O   . ILE D 1 5   ? -5.176   50.072  -43.544 1.00 98.27  ? 5   ILE F O   1 
ATOM   4058 C  CB  . ILE D 1 5   ? -6.781   48.821  -45.901 1.00 95.64  ? 5   ILE F CB  1 
ATOM   4059 C  CG1 . ILE D 1 5   ? -8.081   48.145  -46.364 1.00 90.82  ? 5   ILE F CG1 1 
ATOM   4060 C  CG2 . ILE D 1 5   ? -5.731   48.701  -47.002 1.00 95.45  ? 5   ILE F CG2 1 
ATOM   4061 C  CD1 . ILE D 1 5   ? -8.679   48.734  -47.626 1.00 87.12  ? 5   ILE F CD1 1 
ATOM   4062 N  N   . HIS D 1 6   ? -3.837   48.427  -44.315 1.00 99.50  ? 6   HIS F N   1 
ATOM   4063 C  CA  . HIS D 1 6   ? -2.576   49.068  -43.917 1.00 99.50  ? 6   HIS F CA  1 
ATOM   4064 C  C   . HIS D 1 6   ? -1.883   49.659  -45.152 1.00 96.54  ? 6   HIS F C   1 
ATOM   4065 O  O   . HIS D 1 6   ? -1.326   48.928  -45.979 1.00 95.64  ? 6   HIS F O   1 
ATOM   4066 C  CB  . HIS D 1 6   ? -1.671   48.053  -43.227 1.00 101.89 ? 6   HIS F CB  1 
ATOM   4067 C  CG  . HIS D 1 6   ? -2.277   47.433  -42.010 1.00 107.08 ? 6   HIS F CG  1 
ATOM   4068 N  ND1 . HIS D 1 6   ? -2.093   47.943  -40.743 1.00 106.92 ? 6   HIS F ND1 1 
ATOM   4069 C  CD2 . HIS D 1 6   ? -3.085   46.356  -41.871 1.00 109.88 ? 6   HIS F CD2 1 
ATOM   4070 C  CE1 . HIS D 1 6   ? -2.751   47.198  -39.872 1.00 106.72 ? 6   HIS F CE1 1 
ATOM   4071 N  NE2 . HIS D 1 6   ? -3.362   46.229  -40.531 1.00 109.30 ? 6   HIS F NE2 1 
ATOM   4072 N  N   . LEU D 1 7   ? -1.933   50.986  -45.267 1.00 95.34  ? 7   LEU F N   1 
ATOM   4073 C  CA  . LEU D 1 7   ? -1.562   51.693  -46.498 1.00 94.09  ? 7   LEU F CA  1 
ATOM   4074 C  C   . LEU D 1 7   ? -0.059   51.928  -46.629 1.00 98.56  ? 7   LEU F C   1 
ATOM   4075 O  O   . LEU D 1 7   ? 0.658    51.962  -45.633 1.00 98.24  ? 7   LEU F O   1 
ATOM   4076 C  CB  . LEU D 1 7   ? -2.290   53.046  -46.566 1.00 87.92  ? 7   LEU F CB  1 
ATOM   4077 C  CG  . LEU D 1 7   ? -3.815   53.063  -46.452 1.00 85.08  ? 7   LEU F CG  1 
ATOM   4078 C  CD1 . LEU D 1 7   ? -4.345   54.493  -46.449 1.00 82.89  ? 7   LEU F CD1 1 
ATOM   4079 C  CD2 . LEU D 1 7   ? -4.445   52.245  -47.574 1.00 85.39  ? 7   LEU F CD2 1 
ATOM   4080 N  N   . THR D 1 8   ? 0.393    52.084  -47.874 1.00 104.47 ? 8   THR F N   1 
ATOM   4081 C  CA  . THR D 1 8   ? 1.734    52.578  -48.197 1.00 106.70 ? 8   THR F CA  1 
ATOM   4082 C  C   . THR D 1 8   ? 1.570    53.857  -49.043 1.00 114.15 ? 8   THR F C   1 
ATOM   4083 O  O   . THR D 1 8   ? 0.461    54.387  -49.161 1.00 111.39 ? 8   THR F O   1 
ATOM   4084 C  CB  . THR D 1 8   ? 2.588    51.504  -48.922 1.00 102.39 ? 8   THR F CB  1 
ATOM   4085 O  OG1 . THR D 1 8   ? 2.075    51.265  -50.240 1.00 101.35 ? 8   THR F OG1 1 
ATOM   4086 C  CG2 . THR D 1 8   ? 2.603    50.201  -48.136 1.00 98.94  ? 8   THR F CG2 1 
ATOM   4087 N  N   . ASP D 1 9   ? 2.671    54.367  -49.598 1.00 124.91 ? 9   ASP F N   1 
ATOM   4088 C  CA  . ASP D 1 9   ? 2.635    55.533  -50.488 1.00 131.74 ? 9   ASP F CA  1 
ATOM   4089 C  C   . ASP D 1 9   ? 1.997    55.133  -51.830 1.00 133.89 ? 9   ASP F C   1 
ATOM   4090 O  O   . ASP D 1 9   ? 1.025    55.753  -52.268 1.00 128.04 ? 9   ASP F O   1 
ATOM   4091 C  CB  . ASP D 1 9   ? 4.060    56.106  -50.708 1.00 137.18 ? 9   ASP F CB  1 
ATOM   4092 C  CG  . ASP D 1 9   ? 4.180    57.603  -50.368 1.00 140.62 ? 9   ASP F CG  1 
ATOM   4093 O  OD1 . ASP D 1 9   ? 3.164    58.329  -50.237 1.00 146.37 ? 9   ASP F OD1 1 
ATOM   4094 O  OD2 . ASP D 1 9   ? 5.330    58.071  -50.220 1.00 137.44 ? 9   ASP F OD2 1 
ATOM   4095 N  N   . ASP D 1 10  ? 2.543    54.086  -52.459 1.00 136.86 ? 10  ASP F N   1 
ATOM   4096 C  CA  . ASP D 1 10  ? 2.088    53.628  -53.785 1.00 133.45 ? 10  ASP F CA  1 
ATOM   4097 C  C   . ASP D 1 10  ? 0.693    53.011  -53.772 1.00 128.01 ? 10  ASP F C   1 
ATOM   4098 O  O   . ASP D 1 10  ? -0.090   53.225  -54.703 1.00 130.09 ? 10  ASP F O   1 
ATOM   4099 C  CB  . ASP D 1 10  ? 3.072    52.610  -54.377 1.00 133.72 ? 10  ASP F CB  1 
ATOM   4100 C  CG  . ASP D 1 10  ? 4.451    53.197  -54.623 1.00 136.06 ? 10  ASP F CG  1 
ATOM   4101 O  OD1 . ASP D 1 10  ? 4.712    54.350  -54.206 1.00 138.12 ? 10  ASP F OD1 1 
ATOM   4102 O  OD2 . ASP D 1 10  ? 5.281    52.491  -55.231 1.00 135.84 ? 10  ASP F OD2 1 
ATOM   4103 N  N   . SER D 1 11  ? 0.393    52.242  -52.728 1.00 117.91 ? 11  SER F N   1 
ATOM   4104 C  CA  . SER D 1 11  ? -0.923   51.609  -52.583 1.00 108.35 ? 11  SER F CA  1 
ATOM   4105 C  C   . SER D 1 11  ? -2.061   52.601  -52.310 1.00 104.36 ? 11  SER F C   1 
ATOM   4106 O  O   . SER D 1 11  ? -3.219   52.258  -52.529 1.00 105.36 ? 11  SER F O   1 
ATOM   4107 C  CB  . SER D 1 11  ? -0.892   50.527  -51.492 1.00 104.14 ? 11  SER F CB  1 
ATOM   4108 O  OG  . SER D 1 11  ? -0.776   51.089  -50.197 1.00 102.67 ? 11  SER F OG  1 
ATOM   4109 N  N   . PHE D 1 12  ? -1.739   53.817  -51.854 1.00 103.29 ? 12  PHE F N   1 
ATOM   4110 C  CA  . PHE D 1 12  ? -2.750   54.845  -51.525 1.00 106.28 ? 12  PHE F CA  1 
ATOM   4111 C  C   . PHE D 1 12  ? -3.740   55.143  -52.664 1.00 111.97 ? 12  PHE F C   1 
ATOM   4112 O  O   . PHE D 1 12  ? -4.928   55.356  -52.407 1.00 113.33 ? 12  PHE F O   1 
ATOM   4113 C  CB  . PHE D 1 12  ? -2.070   56.149  -51.079 1.00 106.06 ? 12  PHE F CB  1 
ATOM   4114 C  CG  . PHE D 1 12  ? -2.985   57.093  -50.350 1.00 105.19 ? 12  PHE F CG  1 
ATOM   4115 C  CD1 . PHE D 1 12  ? -3.715   58.063  -51.035 1.00 102.31 ? 12  PHE F CD1 1 
ATOM   4116 C  CD2 . PHE D 1 12  ? -3.097   57.024  -48.970 1.00 104.38 ? 12  PHE F CD2 1 
ATOM   4117 C  CE1 . PHE D 1 12  ? -4.551   58.928  -50.352 1.00 100.39 ? 12  PHE F CE1 1 
ATOM   4118 C  CE2 . PHE D 1 12  ? -3.936   57.886  -48.277 1.00 101.28 ? 12  PHE F CE2 1 
ATOM   4119 C  CZ  . PHE D 1 12  ? -4.657   58.844  -48.970 1.00 100.42 ? 12  PHE F CZ  1 
ATOM   4120 N  N   . ASP D 1 13  ? -3.255   55.161  -53.907 1.00 122.00 ? 13  ASP F N   1 
ATOM   4121 C  CA  . ASP D 1 13  ? -4.113   55.423  -55.069 1.00 126.10 ? 13  ASP F CA  1 
ATOM   4122 C  C   . ASP D 1 13  ? -5.124   54.291  -55.314 1.00 130.63 ? 13  ASP F C   1 
ATOM   4123 O  O   . ASP D 1 13  ? -6.276   54.564  -55.651 1.00 126.35 ? 13  ASP F O   1 
ATOM   4124 C  CB  . ASP D 1 13  ? -3.265   55.678  -56.333 1.00 124.39 ? 13  ASP F CB  1 
ATOM   4125 C  CG  . ASP D 1 13  ? -4.091   56.208  -57.510 1.00 122.20 ? 13  ASP F CG  1 
ATOM   4126 O  OD1 . ASP D 1 13  ? -4.930   57.113  -57.312 1.00 122.41 ? 13  ASP F OD1 1 
ATOM   4127 O  OD2 . ASP D 1 13  ? -3.885   55.725  -58.642 1.00 119.02 ? 13  ASP F OD2 1 
ATOM   4128 N  N   . THR D 1 14  ? -4.696   53.036  -55.140 1.00 132.56 ? 14  THR F N   1 
ATOM   4129 C  CA  . THR D 1 14  ? -5.563   51.861  -55.353 1.00 128.16 ? 14  THR F CA  1 
ATOM   4130 C  C   . THR D 1 14  ? -6.448   51.545  -54.141 1.00 131.14 ? 14  THR F C   1 
ATOM   4131 O  O   . THR D 1 14  ? -7.605   51.170  -54.307 1.00 135.50 ? 14  THR F O   1 
ATOM   4132 C  CB  . THR D 1 14  ? -4.735   50.601  -55.710 1.00 120.70 ? 14  THR F CB  1 
ATOM   4133 O  OG1 . THR D 1 14  ? -3.891   50.884  -56.830 1.00 117.87 ? 14  THR F OG1 1 
ATOM   4134 C  CG2 . THR D 1 14  ? -5.633   49.417  -56.067 1.00 116.77 ? 14  THR F CG2 1 
ATOM   4135 N  N   . ASP D 1 15  ? -5.899   51.684  -52.934 1.00 130.18 ? 15  ASP F N   1 
ATOM   4136 C  CA  . ASP D 1 15  ? -6.612   51.325  -51.695 1.00 124.34 ? 15  ASP F CA  1 
ATOM   4137 C  C   . ASP D 1 15  ? -7.663   52.345  -51.259 1.00 119.40 ? 15  ASP F C   1 
ATOM   4138 O  O   . ASP D 1 15  ? -8.618   51.972  -50.570 1.00 114.13 ? 15  ASP F O   1 
ATOM   4139 C  CB  . ASP D 1 15  ? -5.626   51.138  -50.532 1.00 124.52 ? 15  ASP F CB  1 
ATOM   4140 C  CG  . ASP D 1 15  ? -4.630   50.011  -50.766 1.00 124.91 ? 15  ASP F CG  1 
ATOM   4141 O  OD1 . ASP D 1 15  ? -4.681   49.361  -51.833 1.00 128.81 ? 15  ASP F OD1 1 
ATOM   4142 O  OD2 . ASP D 1 15  ? -3.787   49.778  -49.870 1.00 124.02 ? 15  ASP F OD2 1 
ATOM   4143 N  N   . VAL D 1 16  ? -7.469   53.617  -51.622 1.00 119.78 ? 16  VAL F N   1 
ATOM   4144 C  CA  . VAL D 1 16  ? -8.320   54.717  -51.138 1.00 124.57 ? 16  VAL F CA  1 
ATOM   4145 C  C   . VAL D 1 16  ? -8.995   55.503  -52.264 1.00 124.44 ? 16  VAL F C   1 
ATOM   4146 O  O   . VAL D 1 16  ? -10.217  55.645  -52.258 1.00 131.38 ? 16  VAL F O   1 
ATOM   4147 C  CB  . VAL D 1 16  ? -7.536   55.704  -50.235 1.00 126.62 ? 16  VAL F CB  1 
ATOM   4148 C  CG1 . VAL D 1 16  ? -8.491   56.594  -49.450 1.00 123.72 ? 16  VAL F CG1 1 
ATOM   4149 C  CG2 . VAL D 1 16  ? -6.635   54.955  -49.267 1.00 128.95 ? 16  VAL F CG2 1 
ATOM   4150 N  N   . LEU D 1 17  ? -8.211   56.017  -53.212 1.00 121.34 ? 17  LEU F N   1 
ATOM   4151 C  CA  . LEU D 1 17  ? -8.747   56.886  -54.277 1.00 120.59 ? 17  LEU F CA  1 
ATOM   4152 C  C   . LEU D 1 17  ? -9.617   56.132  -55.286 1.00 123.13 ? 17  LEU F C   1 
ATOM   4153 O  O   . LEU D 1 17  ? -10.707  56.597  -55.631 1.00 119.39 ? 17  LEU F O   1 
ATOM   4154 C  CB  . LEU D 1 17  ? -7.619   57.630  -55.004 1.00 117.46 ? 17  LEU F CB  1 
ATOM   4155 C  CG  . LEU D 1 17  ? -6.692   58.509  -54.148 1.00 115.43 ? 17  LEU F CG  1 
ATOM   4156 C  CD1 . LEU D 1 17  ? -5.665   59.233  -55.014 1.00 112.24 ? 17  LEU F CD1 1 
ATOM   4157 C  CD2 . LEU D 1 17  ? -7.500   59.490  -53.297 1.00 114.80 ? 17  LEU F CD2 1 
ATOM   4158 N  N   . LYS D 1 18  ? -9.136   54.976  -55.742 1.00 126.72 ? 18  LYS F N   1 
ATOM   4159 C  CA  . LYS D 1 18  ? -9.891   54.107  -56.664 1.00 130.64 ? 18  LYS F CA  1 
ATOM   4160 C  C   . LYS D 1 18  ? -10.749  53.038  -55.960 1.00 134.86 ? 18  LYS F C   1 
ATOM   4161 O  O   . LYS D 1 18  ? -11.463  52.284  -56.629 1.00 133.92 ? 18  LYS F O   1 
ATOM   4162 C  CB  . LYS D 1 18  ? -8.935   53.436  -57.660 1.00 128.22 ? 18  LYS F CB  1 
ATOM   4163 C  CG  . LYS D 1 18  ? -8.172   54.426  -58.529 1.00 126.14 ? 18  LYS F CG  1 
ATOM   4164 C  CD  . LYS D 1 18  ? -7.354   53.727  -59.601 1.00 121.29 ? 18  LYS F CD  1 
ATOM   4165 C  CE  . LYS D 1 18  ? -6.741   54.727  -60.569 1.00 118.13 ? 18  LYS F CE  1 
ATOM   4166 N  NZ  . LYS D 1 18  ? -5.824   54.053  -61.521 1.00 120.21 ? 18  LYS F NZ  1 
ATOM   4167 N  N   . ALA D 1 19  ? -10.715  52.987  -54.624 1.00 138.43 ? 19  ALA F N   1 
ATOM   4168 C  CA  . ALA D 1 19  ? -11.487  51.995  -53.863 1.00 133.77 ? 19  ALA F CA  1 
ATOM   4169 C  C   . ALA D 1 19  ? -12.954  52.392  -53.745 1.00 128.92 ? 19  ALA F C   1 
ATOM   4170 O  O   . ALA D 1 19  ? -13.298  53.576  -53.646 1.00 127.86 ? 19  ALA F O   1 
ATOM   4171 C  CB  . ALA D 1 19  ? -10.897  51.784  -52.477 1.00 133.65 ? 19  ALA F CB  1 
ATOM   4172 N  N   . ASP D 1 20  ? -13.809  51.378  -53.736 1.00 121.11 ? 20  ASP F N   1 
ATOM   4173 C  CA  . ASP D 1 20  ? -15.250  51.587  -53.711 1.00 116.57 ? 20  ASP F CA  1 
ATOM   4174 C  C   . ASP D 1 20  ? -15.695  51.921  -52.284 1.00 111.82 ? 20  ASP F C   1 
ATOM   4175 O  O   . ASP D 1 20  ? -15.126  51.417  -51.310 1.00 110.03 ? 20  ASP F O   1 
ATOM   4176 C  CB  . ASP D 1 20  ? -15.970  50.336  -54.237 1.00 117.15 ? 20  ASP F CB  1 
ATOM   4177 C  CG  . ASP D 1 20  ? -17.118  50.658  -55.183 1.00 117.23 ? 20  ASP F CG  1 
ATOM   4178 O  OD1 . ASP D 1 20  ? -17.112  51.728  -55.842 1.00 118.36 ? 20  ASP F OD1 1 
ATOM   4179 O  OD2 . ASP D 1 20  ? -18.023  49.807  -55.283 1.00 112.84 ? 20  ASP F OD2 1 
ATOM   4180 N  N   . GLY D 1 21  ? -16.699  52.785  -52.173 1.00 104.90 ? 21  GLY F N   1 
ATOM   4181 C  CA  . GLY D 1 21  ? -17.280  53.140  -50.882 1.00 102.89 ? 21  GLY F CA  1 
ATOM   4182 C  C   . GLY D 1 21  ? -16.475  54.189  -50.145 1.00 104.22 ? 21  GLY F C   1 
ATOM   4183 O  O   . GLY D 1 21  ? -15.512  54.738  -50.686 1.00 106.95 ? 21  GLY F O   1 
ATOM   4184 N  N   . ALA D 1 22  ? -16.895  54.463  -48.911 1.00 101.47 ? 22  ALA F N   1 
ATOM   4185 C  CA  . ALA D 1 22  ? -16.291  55.492  -48.056 1.00 99.13  ? 22  ALA F CA  1 
ATOM   4186 C  C   . ALA D 1 22  ? -15.113  54.918  -47.272 1.00 100.46 ? 22  ALA F C   1 
ATOM   4187 O  O   . ALA D 1 22  ? -15.285  53.932  -46.557 1.00 104.79 ? 22  ALA F O   1 
ATOM   4188 C  CB  . ALA D 1 22  ? -17.332  56.045  -47.090 1.00 96.00  ? 22  ALA F CB  1 
ATOM   4189 N  N   . ILE D 1 23  ? -13.931  55.532  -47.408 1.00 96.70  ? 23  ILE F N   1 
ATOM   4190 C  CA  . ILE D 1 23  ? -12.712  55.087  -46.702 1.00 90.16  ? 23  ILE F CA  1 
ATOM   4191 C  C   . ILE D 1 23  ? -12.329  56.124  -45.649 1.00 81.03  ? 23  ILE F C   1 
ATOM   4192 O  O   . ILE D 1 23  ? -12.155  57.284  -45.984 1.00 82.36  ? 23  ILE F O   1 
ATOM   4193 C  CB  . ILE D 1 23  ? -11.500  54.895  -47.654 1.00 94.64  ? 23  ILE F CB  1 
ATOM   4194 C  CG1 . ILE D 1 23  ? -11.895  54.179  -48.964 1.00 101.74 ? 23  ILE F CG1 1 
ATOM   4195 C  CG2 . ILE D 1 23  ? -10.381  54.130  -46.947 1.00 94.17  ? 23  ILE F CG2 1 
ATOM   4196 C  CD1 . ILE D 1 23  ? -12.392  52.750  -48.807 1.00 105.17 ? 23  ILE F CD1 1 
ATOM   4197 N  N   . LEU D 1 24  ? -12.220  55.711  -44.385 1.00 72.79  ? 24  LEU F N   1 
ATOM   4198 C  CA  . LEU D 1 24  ? -11.715  56.575  -43.301 1.00 68.53  ? 24  LEU F CA  1 
ATOM   4199 C  C   . LEU D 1 24  ? -10.216  56.337  -43.125 1.00 71.28  ? 24  LEU F C   1 
ATOM   4200 O  O   . LEU D 1 24  ? -9.802   55.281  -42.645 1.00 71.65  ? 24  LEU F O   1 
ATOM   4201 C  CB  . LEU D 1 24  ? -12.437  56.285  -41.983 1.00 63.45  ? 24  LEU F CB  1 
ATOM   4202 C  CG  . LEU D 1 24  ? -12.057  57.104  -40.754 1.00 60.92  ? 24  LEU F CG  1 
ATOM   4203 C  CD1 . LEU D 1 24  ? -12.615  58.500  -40.877 1.00 59.93  ? 24  LEU F CD1 1 
ATOM   4204 C  CD2 . LEU D 1 24  ? -12.587  56.462  -39.483 1.00 60.43  ? 24  LEU F CD2 1 
ATOM   4205 N  N   . VAL D 1 25  ? -9.405   57.314  -43.527 1.00 75.03  ? 25  VAL F N   1 
ATOM   4206 C  CA  . VAL D 1 25  ? -7.942   57.209  -43.448 1.00 74.49  ? 25  VAL F CA  1 
ATOM   4207 C  C   . VAL D 1 25  ? -7.467   57.766  -42.109 1.00 72.38  ? 25  VAL F C   1 
ATOM   4208 O  O   . VAL D 1 25  ? -7.978   58.778  -41.650 1.00 67.52  ? 25  VAL F O   1 
ATOM   4209 C  CB  . VAL D 1 25  ? -7.242   57.954  -44.610 1.00 75.31  ? 25  VAL F CB  1 
ATOM   4210 C  CG1 . VAL D 1 25  ? -5.734   57.706  -44.578 1.00 75.56  ? 25  VAL F CG1 1 
ATOM   4211 C  CG2 . VAL D 1 25  ? -7.813   57.510  -45.952 1.00 75.55  ? 25  VAL F CG2 1 
ATOM   4212 N  N   . ASP D 1 26  ? -6.491   57.090  -41.497 1.00 72.53  ? 26  ASP F N   1 
ATOM   4213 C  CA  . ASP D 1 26  ? -5.848   57.537  -40.254 1.00 75.81  ? 26  ASP F CA  1 
ATOM   4214 C  C   . ASP D 1 26  ? -4.353   57.784  -40.489 1.00 76.63  ? 26  ASP F C   1 
ATOM   4215 O  O   . ASP D 1 26  ? -3.649   56.908  -41.005 1.00 74.70  ? 26  ASP F O   1 
ATOM   4216 C  CB  . ASP D 1 26  ? -6.057   56.487  -39.150 1.00 78.89  ? 26  ASP F CB  1 
ATOM   4217 C  CG  . ASP D 1 26  ? -5.188   56.731  -37.895 1.00 78.07  ? 26  ASP F CG  1 
ATOM   4218 O  OD1 . ASP D 1 26  ? -4.953   57.893  -37.520 1.00 76.83  ? 26  ASP F OD1 1 
ATOM   4219 O  OD2 . ASP D 1 26  ? -4.751   55.740  -37.271 1.00 79.19  ? 26  ASP F OD2 1 
ATOM   4220 N  N   . PHE D 1 27  ? -3.893   58.975  -40.095 1.00 76.33  ? 27  PHE F N   1 
ATOM   4221 C  CA  . PHE D 1 27  ? -2.480   59.365  -40.174 1.00 71.53  ? 27  PHE F CA  1 
ATOM   4222 C  C   . PHE D 1 27  ? -1.874   59.277  -38.777 1.00 71.55  ? 27  PHE F C   1 
ATOM   4223 O  O   . PHE D 1 27  ? -2.039   60.183  -37.947 1.00 69.81  ? 27  PHE F O   1 
ATOM   4224 C  CB  . PHE D 1 27  ? -2.351   60.782  -40.729 1.00 66.35  ? 27  PHE F CB  1 
ATOM   4225 C  CG  . PHE D 1 27  ? -2.827   60.913  -42.141 1.00 62.51  ? 27  PHE F CG  1 
ATOM   4226 C  CD1 . PHE D 1 27  ? -2.059   60.432  -43.190 1.00 61.48  ? 27  PHE F CD1 1 
ATOM   4227 C  CD2 . PHE D 1 27  ? -4.080   61.469  -42.412 1.00 59.45  ? 27  PHE F CD2 1 
ATOM   4228 C  CE1 . PHE D 1 27  ? -2.517   60.531  -44.494 1.00 62.57  ? 27  PHE F CE1 1 
ATOM   4229 C  CE2 . PHE D 1 27  ? -4.545   61.568  -43.703 1.00 58.82  ? 27  PHE F CE2 1 
ATOM   4230 C  CZ  . PHE D 1 27  ? -3.765   61.103  -44.750 1.00 62.33  ? 27  PHE F CZ  1 
ATOM   4231 N  N   . TRP D 1 28  ? -1.188   58.165  -38.525 1.00 71.16  ? 28  TRP F N   1 
ATOM   4232 C  CA  . TRP D 1 28  ? -0.635   57.854  -37.215 1.00 70.89  ? 28  TRP F CA  1 
ATOM   4233 C  C   . TRP D 1 28  ? 0.885    57.805  -37.312 1.00 70.66  ? 28  TRP F C   1 
ATOM   4234 O  O   . TRP D 1 28  ? 1.454    57.818  -38.409 1.00 71.44  ? 28  TRP F O   1 
ATOM   4235 C  CB  . TRP D 1 28  ? -1.226   56.533  -36.674 1.00 71.94  ? 28  TRP F CB  1 
ATOM   4236 C  CG  . TRP D 1 28  ? -0.657   55.270  -37.276 1.00 74.43  ? 28  TRP F CG  1 
ATOM   4237 C  CD1 . TRP D 1 28  ? -0.831   54.811  -38.552 1.00 76.27  ? 28  TRP F CD1 1 
ATOM   4238 C  CD2 . TRP D 1 28  ? 0.165    54.301  -36.615 1.00 77.67  ? 28  TRP F CD2 1 
ATOM   4239 N  NE1 . TRP D 1 28  ? -0.156   53.625  -38.730 1.00 77.23  ? 28  TRP F NE1 1 
ATOM   4240 C  CE2 . TRP D 1 28  ? 0.466    53.291  -37.558 1.00 77.88  ? 28  TRP F CE2 1 
ATOM   4241 C  CE3 . TRP D 1 28  ? 0.681    54.189  -35.315 1.00 80.05  ? 28  TRP F CE3 1 
ATOM   4242 C  CZ2 . TRP D 1 28  ? 1.261    52.182  -37.246 1.00 80.99  ? 28  TRP F CZ2 1 
ATOM   4243 C  CZ3 . TRP D 1 28  ? 1.489    53.088  -35.002 1.00 80.98  ? 28  TRP F CZ3 1 
ATOM   4244 C  CH2 . TRP D 1 28  ? 1.756    52.094  -35.966 1.00 82.88  ? 28  TRP F CH2 1 
ATOM   4245 N  N   . ALA D 1 29  ? 1.532    57.765  -36.153 1.00 70.73  ? 29  ALA F N   1 
ATOM   4246 C  CA  . ALA D 1 29  ? 2.986    57.659  -36.068 1.00 70.75  ? 29  ALA F CA  1 
ATOM   4247 C  C   . ALA D 1 29  ? 3.377    56.918  -34.803 1.00 71.44  ? 29  ALA F C   1 
ATOM   4248 O  O   . ALA D 1 29  ? 2.685    57.025  -33.784 1.00 74.03  ? 29  ALA F O   1 
ATOM   4249 C  CB  . ALA D 1 29  ? 3.609    59.038  -36.091 1.00 72.04  ? 29  ALA F CB  1 
ATOM   4250 N  N   . GLU D 1 30  ? 4.484    56.180  -34.858 1.00 71.83  ? 30  GLU F N   1 
ATOM   4251 C  CA  . GLU D 1 30  ? 4.952    55.414  -33.694 1.00 74.72  ? 30  GLU F CA  1 
ATOM   4252 C  C   . GLU D 1 30  ? 5.438    56.317  -32.540 1.00 75.29  ? 30  GLU F C   1 
ATOM   4253 O  O   . GLU D 1 30  ? 5.457    55.888  -31.390 1.00 78.92  ? 30  GLU F O   1 
ATOM   4254 C  CB  . GLU D 1 30  ? 6.048    54.417  -34.110 1.00 75.46  ? 30  GLU F CB  1 
ATOM   4255 C  CG  . GLU D 1 30  ? 6.289    53.272  -33.126 1.00 74.99  ? 30  GLU F CG  1 
ATOM   4256 C  CD  . GLU D 1 30  ? 5.078    52.370  -32.951 1.00 75.65  ? 30  GLU F CD  1 
ATOM   4257 O  OE1 . GLU D 1 30  ? 4.519    51.898  -33.963 1.00 78.06  ? 30  GLU F OE1 1 
ATOM   4258 O  OE2 . GLU D 1 30  ? 4.687    52.129  -31.793 1.00 74.79  ? 30  GLU F OE2 1 
ATOM   4259 N  N   . TRP D 1 31  ? 5.817    57.556  -32.854 1.00 70.89  ? 31  TRP F N   1 
ATOM   4260 C  CA  . TRP D 1 31  ? 6.298    58.532  -31.853 1.00 65.90  ? 31  TRP F CA  1 
ATOM   4261 C  C   . TRP D 1 31  ? 5.204    59.375  -31.182 1.00 63.54  ? 31  TRP F C   1 
ATOM   4262 O  O   . TRP D 1 31  ? 5.495    60.074  -30.207 1.00 66.62  ? 31  TRP F O   1 
ATOM   4263 C  CB  . TRP D 1 31  ? 7.375    59.460  -32.456 1.00 63.70  ? 31  TRP F CB  1 
ATOM   4264 C  CG  . TRP D 1 31  ? 6.965    60.206  -33.704 1.00 61.42  ? 31  TRP F CG  1 
ATOM   4265 C  CD1 . TRP D 1 31  ? 7.156    59.797  -34.993 1.00 61.60  ? 31  TRP F CD1 1 
ATOM   4266 C  CD2 . TRP D 1 31  ? 6.315    61.488  -33.783 1.00 59.39  ? 31  TRP F CD2 1 
ATOM   4267 N  NE1 . TRP D 1 31  ? 6.654    60.731  -35.873 1.00 62.11  ? 31  TRP F NE1 1 
ATOM   4268 C  CE2 . TRP D 1 31  ? 6.135    61.781  -35.160 1.00 60.28  ? 31  TRP F CE2 1 
ATOM   4269 C  CE3 . TRP D 1 31  ? 5.871    62.418  -32.829 1.00 56.67  ? 31  TRP F CE3 1 
ATOM   4270 C  CZ2 . TRP D 1 31  ? 5.518    62.960  -35.607 1.00 57.75  ? 31  TRP F CZ2 1 
ATOM   4271 C  CZ3 . TRP D 1 31  ? 5.259    63.593  -33.271 1.00 56.76  ? 31  TRP F CZ3 1 
ATOM   4272 C  CH2 . TRP D 1 31  ? 5.092    63.853  -34.653 1.00 57.62  ? 31  TRP F CH2 1 
ATOM   4273 N  N   . SER D 1 32  ? 3.967    59.310  -31.678 1.00 59.20  ? 32  SER F N   1 
ATOM   4274 C  CA  . SER D 1 32  ? 2.872    60.150  -31.172 1.00 55.12  ? 32  SER F CA  1 
ATOM   4275 C  C   . SER D 1 32  ? 1.951    59.347  -30.270 1.00 52.79  ? 32  SER F C   1 
ATOM   4276 O  O   . SER D 1 32  ? 1.263    58.429  -30.727 1.00 54.07  ? 32  SER F O   1 
ATOM   4277 C  CB  . SER D 1 32  ? 2.081    60.760  -32.333 1.00 53.41  ? 32  SER F CB  1 
ATOM   4278 O  OG  . SER D 1 32  ? 0.930    61.449  -31.890 1.00 52.64  ? 32  SER F OG  1 
ATOM   4279 N  N   . GLY D 1 33  ? 1.949    59.695  -28.987 1.00 51.99  ? 33  GLY F N   1 
ATOM   4280 C  CA  . GLY D 1 33  ? 1.039    59.101  -28.017 1.00 53.65  ? 33  GLY F CA  1 
ATOM   4281 C  C   . GLY D 1 33  ? -0.423   59.398  -28.275 1.00 55.89  ? 33  GLY F C   1 
ATOM   4282 O  O   . GLY D 1 33  ? -1.269   58.557  -27.990 1.00 56.58  ? 33  GLY F O   1 
ATOM   4283 N  N   . PRO D 1 34  ? -0.736   60.606  -28.787 1.00 62.31  ? 34  PRO F N   1 
ATOM   4284 C  CA  . PRO D 1 34  ? -2.090   60.882  -29.284 1.00 65.66  ? 34  PRO F CA  1 
ATOM   4285 C  C   . PRO D 1 34  ? -2.544   59.964  -30.422 1.00 66.71  ? 34  PRO F C   1 
ATOM   4286 O  O   . PRO D 1 34  ? -3.712   59.572  -30.449 1.00 69.54  ? 34  PRO F O   1 
ATOM   4287 C  CB  . PRO D 1 34  ? -1.990   62.332  -29.778 1.00 67.00  ? 34  PRO F CB  1 
ATOM   4288 C  CG  . PRO D 1 34  ? -0.953   62.940  -28.887 1.00 65.52  ? 34  PRO F CG  1 
ATOM   4289 C  CD  . PRO D 1 34  ? 0.051    61.849  -28.654 1.00 64.11  ? 34  PRO F CD  1 
ATOM   4290 N  N   . SER D 1 35  ? -1.627   59.626  -31.330 1.00 67.40  ? 35  SER F N   1 
ATOM   4291 C  CA  . SER D 1 35  ? -1.921   58.742  -32.463 1.00 71.27  ? 35  SER F CA  1 
ATOM   4292 C  C   . SER D 1 35  ? -2.168   57.277  -32.096 1.00 73.47  ? 35  SER F C   1 
ATOM   4293 O  O   . SER D 1 35  ? -2.805   56.538  -32.863 1.00 73.13  ? 35  SER F O   1 
ATOM   4294 C  CB  . SER D 1 35  ? -0.801   58.835  -33.497 1.00 72.70  ? 35  SER F CB  1 
ATOM   4295 O  OG  . SER D 1 35  ? -0.639   60.177  -33.925 1.00 74.77  ? 35  SER F OG  1 
ATOM   4296 N  N   . LYS D 1 36  ? -1.651   56.863  -30.938 1.00 77.48  ? 36  LYS F N   1 
ATOM   4297 C  CA  . LYS D 1 36  ? -1.891   55.517  -30.386 1.00 79.46  ? 36  LYS F CA  1 
ATOM   4298 C  C   . LYS D 1 36  ? -3.218   55.398  -29.627 1.00 75.97  ? 36  LYS F C   1 
ATOM   4299 O  O   . LYS D 1 36  ? -3.818   54.330  -29.622 1.00 76.05  ? 36  LYS F O   1 
ATOM   4300 C  CB  . LYS D 1 36  ? -0.735   55.114  -29.465 1.00 81.32  ? 36  LYS F CB  1 
ATOM   4301 C  CG  . LYS D 1 36  ? 0.581    54.936  -30.217 1.00 80.02  ? 36  LYS F CG  1 
ATOM   4302 C  CD  . LYS D 1 36  ? 1.780    54.916  -29.301 1.00 79.13  ? 36  LYS F CD  1 
ATOM   4303 C  CE  . LYS D 1 36  ? 3.024    54.923  -30.157 1.00 79.12  ? 36  LYS F CE  1 
ATOM   4304 N  NZ  . LYS D 1 36  ? 4.274    54.924  -29.351 1.00 82.77  ? 36  LYS F NZ  1 
ATOM   4305 N  N   . MET D 1 37  ? -3.657   56.477  -28.978 1.00 71.67  ? 37  MET F N   1 
ATOM   4306 C  CA  . MET D 1 37  ? -4.919   56.496  -28.218 1.00 69.47  ? 37  MET F CA  1 
ATOM   4307 C  C   . MET D 1 37  ? -6.155   56.133  -29.061 1.00 70.17  ? 37  MET F C   1 
ATOM   4308 O  O   . MET D 1 37  ? -7.109   55.562  -28.527 1.00 72.41  ? 37  MET F O   1 
ATOM   4309 C  CB  . MET D 1 37  ? -5.117   57.851  -27.538 1.00 67.91  ? 37  MET F CB  1 
ATOM   4310 N  N   . ILE D 1 38  ? -6.146   56.463  -30.364 1.00 69.44  ? 38  ILE F N   1 
ATOM   4311 C  CA  . ILE D 1 38  ? -7.266   56.081  -31.264 1.00 67.86  ? 38  ILE F CA  1 
ATOM   4312 C  C   . ILE D 1 38  ? -7.122   54.705  -31.938 1.00 72.75  ? 38  ILE F C   1 
ATOM   4313 O  O   . ILE D 1 38  ? -8.047   54.255  -32.616 1.00 80.30  ? 38  ILE F O   1 
ATOM   4314 C  CB  . ILE D 1 38  ? -7.596   57.149  -32.345 1.00 64.41  ? 38  ILE F CB  1 
ATOM   4315 C  CG1 . ILE D 1 38  ? -6.430   57.421  -33.303 1.00 64.39  ? 38  ILE F CG1 1 
ATOM   4316 C  CG2 . ILE D 1 38  ? -8.063   58.439  -31.705 1.00 64.27  ? 38  ILE F CG2 1 
ATOM   4317 C  CD1 . ILE D 1 38  ? -6.950   57.851  -34.649 1.00 63.42  ? 38  ILE F CD1 1 
ATOM   4318 N  N   . ALA D 1 39  ? -5.985   54.038  -31.780 1.00 75.04  ? 39  ALA F N   1 
ATOM   4319 C  CA  . ALA D 1 39  ? -5.748   52.727  -32.419 1.00 77.80  ? 39  ALA F CA  1 
ATOM   4320 C  C   . ALA D 1 39  ? -6.749   51.620  -32.013 1.00 81.92  ? 39  ALA F C   1 
ATOM   4321 O  O   . ALA D 1 39  ? -7.313   50.977  -32.900 1.00 81.61  ? 39  ALA F O   1 
ATOM   4322 C  CB  . ALA D 1 39  ? -4.305   52.268  -32.207 1.00 78.00  ? 39  ALA F CB  1 
ATOM   4323 N  N   . PRO D 1 40  ? -6.979   51.399  -30.690 1.00 85.58  ? 40  PRO F N   1 
ATOM   4324 C  CA  . PRO D 1 40  ? -8.006   50.415  -30.298 1.00 84.13  ? 40  PRO F CA  1 
ATOM   4325 C  C   . PRO D 1 40  ? -9.448   50.842  -30.596 1.00 83.38  ? 40  PRO F C   1 
ATOM   4326 O  O   . PRO D 1 40  ? -10.286  49.974  -30.857 1.00 88.80  ? 40  PRO F O   1 
ATOM   4327 C  CB  . PRO D 1 40  ? -7.793   50.254  -28.786 1.00 83.14  ? 40  PRO F CB  1 
ATOM   4328 C  CG  . PRO D 1 40  ? -7.155   51.518  -28.359 1.00 84.18  ? 40  PRO F CG  1 
ATOM   4329 C  CD  . PRO D 1 40  ? -6.279   51.940  -29.507 1.00 85.09  ? 40  PRO F CD  1 
ATOM   4330 N  N   . ILE D 1 41  ? -9.730   52.146  -30.568 1.00 79.59  ? 41  ILE F N   1 
ATOM   4331 C  CA  . ILE D 1 41  ? -11.078  52.674  -30.872 1.00 79.02  ? 41  ILE F CA  1 
ATOM   4332 C  C   . ILE D 1 41  ? -11.394  52.546  -32.381 1.00 77.94  ? 41  ILE F C   1 
ATOM   4333 O  O   . ILE D 1 41  ? -12.541  52.283  -32.744 1.00 77.36  ? 41  ILE F O   1 
ATOM   4334 C  CB  . ILE D 1 41  ? -11.279  54.150  -30.388 1.00 77.67  ? 41  ILE F CB  1 
ATOM   4335 C  CG1 . ILE D 1 41  ? -10.971  54.307  -28.884 1.00 79.75  ? 41  ILE F CG1 1 
ATOM   4336 C  CG2 . ILE D 1 41  ? -12.690  54.657  -30.686 1.00 75.93  ? 41  ILE F CG2 1 
ATOM   4337 C  CD1 . ILE D 1 41  ? -11.023  55.735  -28.387 1.00 81.35  ? 41  ILE F CD1 1 
ATOM   4338 N  N   . LEU D 1 42  ? -10.390  52.729  -33.245 1.00 78.27  ? 42  LEU F N   1 
ATOM   4339 C  CA  . LEU D 1 42  ? -10.561  52.496  -34.682 1.00 82.95  ? 42  LEU F CA  1 
ATOM   4340 C  C   . LEU D 1 42  ? -10.753  51.014  -35.015 1.00 88.73  ? 42  LEU F C   1 
ATOM   4341 O  O   . LEU D 1 42  ? -11.521  50.687  -35.925 1.00 95.31  ? 42  LEU F O   1 
ATOM   4342 C  CB  . LEU D 1 42  ? -9.379   53.058  -35.492 1.00 80.15  ? 42  LEU F CB  1 
ATOM   4343 C  CG  . LEU D 1 42  ? -9.272   54.566  -35.690 1.00 76.10  ? 42  LEU F CG  1 
ATOM   4344 C  CD1 . LEU D 1 42  ? -7.972   54.850  -36.437 1.00 76.20  ? 42  LEU F CD1 1 
ATOM   4345 C  CD2 . LEU D 1 42  ? -10.484  55.108  -36.436 1.00 73.86  ? 42  LEU F CD2 1 
ATOM   4346 N  N   . ASP D 1 43  ? -10.052  50.131  -34.296 1.00 91.46  ? 43  ASP F N   1 
ATOM   4347 C  CA  . ASP D 1 43  ? -10.255  48.672  -34.419 1.00 96.14  ? 43  ASP F CA  1 
ATOM   4348 C  C   . ASP D 1 43  ? -11.699  48.257  -34.139 1.00 95.66  ? 43  ASP F C   1 
ATOM   4349 O  O   . ASP D 1 43  ? -12.245  47.383  -34.830 1.00 101.34 ? 43  ASP F O   1 
ATOM   4350 C  CB  . ASP D 1 43  ? -9.306   47.885  -33.497 1.00 100.21 ? 43  ASP F CB  1 
ATOM   4351 C  CG  . ASP D 1 43  ? -7.959   47.605  -34.132 1.00 102.46 ? 43  ASP F CG  1 
ATOM   4352 O  OD1 . ASP D 1 43  ? -7.259   48.573  -34.502 1.00 106.36 ? 43  ASP F OD1 1 
ATOM   4353 O  OD2 . ASP D 1 43  ? -7.595   46.415  -34.249 1.00 103.52 ? 43  ASP F OD2 1 
ATOM   4354 N  N   . GLU D 1 44  ? -12.305  48.882  -33.130 1.00 92.78  ? 44  GLU F N   1 
ATOM   4355 C  CA  . GLU D 1 44  ? -13.714  48.656  -32.801 1.00 89.64  ? 44  GLU F CA  1 
ATOM   4356 C  C   . GLU D 1 44  ? -14.662  49.272  -33.846 1.00 88.43  ? 44  GLU F C   1 
ATOM   4357 O  O   . GLU D 1 44  ? -15.689  48.673  -34.168 1.00 93.67  ? 44  GLU F O   1 
ATOM   4358 C  CB  . GLU D 1 44  ? -14.025  49.174  -31.387 1.00 87.07  ? 44  GLU F CB  1 
ATOM   4359 C  CG  . GLU D 1 44  ? -13.296  48.393  -30.287 1.00 82.46  ? 44  GLU F CG  1 
ATOM   4360 C  CD  . GLU D 1 44  ? -13.274  49.101  -28.945 1.00 79.72  ? 44  GLU F CD  1 
ATOM   4361 O  OE1 . GLU D 1 44  ? -14.265  49.790  -28.613 1.00 75.08  ? 44  GLU F OE1 1 
ATOM   4362 O  OE2 . GLU D 1 44  ? -12.268  48.950  -28.217 1.00 75.67  ? 44  GLU F OE2 1 
ATOM   4363 N  N   . ILE D 1 45  ? -14.314  50.453  -34.366 1.00 84.47  ? 45  ILE F N   1 
ATOM   4364 C  CA  . ILE D 1 45  ? -15.097  51.120  -35.426 1.00 85.64  ? 45  ILE F CA  1 
ATOM   4365 C  C   . ILE D 1 45  ? -15.125  50.332  -36.746 1.00 85.49  ? 45  ILE F C   1 
ATOM   4366 O  O   . ILE D 1 45  ? -16.147  50.336  -37.443 1.00 79.86  ? 45  ILE F O   1 
ATOM   4367 C  CB  . ILE D 1 45  ? -14.604  52.579  -35.660 1.00 86.45  ? 45  ILE F CB  1 
ATOM   4368 C  CG1 . ILE D 1 45  ? -14.987  53.468  -34.456 1.00 86.25  ? 45  ILE F CG1 1 
ATOM   4369 C  CG2 . ILE D 1 45  ? -15.142  53.184  -36.969 1.00 84.84  ? 45  ILE F CG2 1 
ATOM   4370 C  CD1 . ILE D 1 45  ? -16.472  53.599  -34.158 1.00 86.63  ? 45  ILE F CD1 1 
ATOM   4371 N  N   . ALA D 1 46  ? -14.021  49.665  -37.083 1.00 87.28  ? 46  ALA F N   1 
ATOM   4372 C  CA  . ALA D 1 46  ? -13.962  48.826  -38.290 1.00 93.26  ? 46  ALA F CA  1 
ATOM   4373 C  C   . ALA D 1 46  ? -14.989  47.683  -38.284 1.00 99.12  ? 46  ALA F C   1 
ATOM   4374 O  O   . ALA D 1 46  ? -15.566  47.357  -39.321 1.00 101.38 ? 46  ALA F O   1 
ATOM   4375 C  CB  . ALA D 1 46  ? -12.557  48.266  -38.477 1.00 94.00  ? 46  ALA F CB  1 
ATOM   4376 N  N   . ASP D 1 47  ? -15.201  47.083  -37.107 1.00 101.69 ? 47  ASP F N   1 
ATOM   4377 C  CA  . ASP D 1 47  ? -16.182  45.997  -36.923 1.00 97.08  ? 47  ASP F CA  1 
ATOM   4378 C  C   . ASP D 1 47  ? -17.608  46.537  -36.834 1.00 92.74  ? 47  ASP F C   1 
ATOM   4379 O  O   . ASP D 1 47  ? -18.511  46.030  -37.505 1.00 84.44  ? 47  ASP F O   1 
ATOM   4380 C  CB  . ASP D 1 47  ? -15.868  45.195  -35.654 1.00 97.52  ? 47  ASP F CB  1 
ATOM   4381 C  CG  . ASP D 1 47  ? -14.445  44.638  -35.645 1.00 98.98  ? 47  ASP F CG  1 
ATOM   4382 O  OD1 . ASP D 1 47  ? -13.928  44.266  -36.729 1.00 94.71  ? 47  ASP F OD1 1 
ATOM   4383 O  OD2 . ASP D 1 47  ? -13.844  44.578  -34.550 1.00 97.86  ? 47  ASP F OD2 1 
ATOM   4384 N  N   . GLU D 1 48  ? -17.796  47.560  -35.998 1.00 91.12  ? 48  GLU F N   1 
ATOM   4385 C  CA  . GLU D 1 48  ? -19.117  48.168  -35.753 1.00 90.11  ? 48  GLU F CA  1 
ATOM   4386 C  C   . GLU D 1 48  ? -19.682  48.922  -36.957 1.00 86.72  ? 48  GLU F C   1 
ATOM   4387 O  O   . GLU D 1 48  ? -20.889  48.882  -37.186 1.00 83.91  ? 48  GLU F O   1 
ATOM   4388 C  CB  . GLU D 1 48  ? -19.082  49.101  -34.528 1.00 91.01  ? 48  GLU F CB  1 
ATOM   4389 C  CG  . GLU D 1 48  ? -19.017  48.371  -33.191 1.00 90.40  ? 48  GLU F CG  1 
ATOM   4390 C  CD  . GLU D 1 48  ? -18.919  49.316  -32.009 1.00 87.25  ? 48  GLU F CD  1 
ATOM   4391 O  OE1 . GLU D 1 48  ? -19.778  50.219  -31.883 1.00 81.64  ? 48  GLU F OE1 1 
ATOM   4392 O  OE2 . GLU D 1 48  ? -17.969  49.145  -31.222 1.00 88.21  ? 48  GLU F OE2 1 
ATOM   4393 N  N   . TYR D 1 49  ? -18.821  49.612  -37.707 1.00 87.76  ? 49  TYR F N   1 
ATOM   4394 C  CA  . TYR D 1 49  ? -19.215  50.228  -38.986 1.00 89.26  ? 49  TYR F CA  1 
ATOM   4395 C  C   . TYR D 1 49  ? -18.770  49.369  -40.197 1.00 93.70  ? 49  TYR F C   1 
ATOM   4396 O  O   . TYR D 1 49  ? -18.423  49.919  -41.233 1.00 101.15 ? 49  TYR F O   1 
ATOM   4397 C  CB  . TYR D 1 49  ? -18.660  51.664  -39.100 1.00 85.18  ? 49  TYR F CB  1 
ATOM   4398 C  CG  . TYR D 1 49  ? -19.355  52.724  -38.260 1.00 82.71  ? 49  TYR F CG  1 
ATOM   4399 C  CD1 . TYR D 1 49  ? -20.331  53.553  -38.820 1.00 80.73  ? 49  TYR F CD1 1 
ATOM   4400 C  CD2 . TYR D 1 49  ? -18.992  52.947  -36.928 1.00 83.51  ? 49  TYR F CD2 1 
ATOM   4401 C  CE1 . TYR D 1 49  ? -20.949  54.553  -38.071 1.00 80.06  ? 49  TYR F CE1 1 
ATOM   4402 C  CE2 . TYR D 1 49  ? -19.608  53.939  -36.165 1.00 80.57  ? 49  TYR F CE2 1 
ATOM   4403 C  CZ  . TYR D 1 49  ? -20.581  54.748  -36.739 1.00 79.74  ? 49  TYR F CZ  1 
ATOM   4404 O  OH  . TYR D 1 49  ? -21.195  55.726  -35.976 1.00 75.47  ? 49  TYR F OH  1 
ATOM   4405 N  N   . GLN D 1 50  ? -18.791  48.037  -40.067 1.00 93.89  ? 50  GLN F N   1 
ATOM   4406 C  CA  . GLN D 1 50  ? -18.501  47.134  -41.200 1.00 92.58  ? 50  GLN F CA  1 
ATOM   4407 C  C   . GLN D 1 50  ? -19.586  47.294  -42.260 1.00 93.76  ? 50  GLN F C   1 
ATOM   4408 O  O   . GLN D 1 50  ? -20.766  47.367  -41.918 1.00 99.68  ? 50  GLN F O   1 
ATOM   4409 C  CB  . GLN D 1 50  ? -18.419  45.666  -40.741 1.00 89.88  ? 50  GLN F CB  1 
ATOM   4410 C  CG  . GLN D 1 50  ? -18.069  44.680  -41.861 1.00 89.51  ? 50  GLN F CG  1 
ATOM   4411 C  CD  . GLN D 1 50  ? -17.575  43.314  -41.384 1.00 87.05  ? 50  GLN F CD  1 
ATOM   4412 O  OE1 . GLN D 1 50  ? -17.284  42.435  -42.201 1.00 81.54  ? 50  GLN F OE1 1 
ATOM   4413 N  NE2 . GLN D 1 50  ? -17.475  43.128  -40.069 1.00 85.11  ? 50  GLN F NE2 1 
ATOM   4414 N  N   . GLY D 1 51  ? -19.194  47.404  -43.530 1.00 92.33  ? 51  GLY F N   1 
ATOM   4415 C  CA  . GLY D 1 51  ? -20.157  47.601  -44.620 1.00 94.64  ? 51  GLY F CA  1 
ATOM   4416 C  C   . GLY D 1 51  ? -20.675  49.022  -44.841 1.00 97.63  ? 51  GLY F C   1 
ATOM   4417 O  O   . GLY D 1 51  ? -21.140  49.327  -45.939 1.00 95.97  ? 51  GLY F O   1 
ATOM   4418 N  N   . LYS D 1 52  ? -20.597  49.886  -43.817 1.00 103.63 ? 52  LYS F N   1 
ATOM   4419 C  CA  . LYS D 1 52  ? -20.921  51.327  -43.947 1.00 106.98 ? 52  LYS F CA  1 
ATOM   4420 C  C   . LYS D 1 52  ? -19.687  52.168  -44.331 1.00 103.53 ? 52  LYS F C   1 
ATOM   4421 O  O   . LYS D 1 52  ? -19.813  53.192  -45.014 1.00 95.74  ? 52  LYS F O   1 
ATOM   4422 C  CB  . LYS D 1 52  ? -21.529  51.871  -42.642 1.00 111.47 ? 52  LYS F CB  1 
ATOM   4423 C  CG  . LYS D 1 52  ? -22.838  51.216  -42.226 1.00 111.64 ? 52  LYS F CG  1 
ATOM   4424 C  CD  . LYS D 1 52  ? -23.437  51.893  -40.998 1.00 109.80 ? 52  LYS F CD  1 
ATOM   4425 C  CE  . LYS D 1 52  ? -24.846  51.388  -40.718 1.00 108.77 ? 52  LYS F CE  1 
ATOM   4426 N  NZ  . LYS D 1 52  ? -25.457  52.073  -39.549 1.00 107.64 ? 52  LYS F NZ  1 
ATOM   4427 N  N   . LEU D 1 53  ? -18.515  51.761  -43.841 1.00 98.82  ? 53  LEU F N   1 
ATOM   4428 C  CA  . LEU D 1 53  ? -17.233  52.327  -44.271 1.00 95.18  ? 53  LEU F CA  1 
ATOM   4429 C  C   . LEU D 1 53  ? -16.087  51.311  -44.119 1.00 93.90  ? 53  LEU F C   1 
ATOM   4430 O  O   . LEU D 1 53  ? -16.281  50.202  -43.607 1.00 87.89  ? 53  LEU F O   1 
ATOM   4431 C  CB  . LEU D 1 53  ? -16.917  53.646  -43.527 1.00 90.70  ? 53  LEU F CB  1 
ATOM   4432 C  CG  . LEU D 1 53  ? -16.545  53.654  -42.027 1.00 86.39  ? 53  LEU F CG  1 
ATOM   4433 C  CD1 . LEU D 1 53  ? -15.086  53.287  -41.784 1.00 87.66  ? 53  LEU F CD1 1 
ATOM   4434 C  CD2 . LEU D 1 53  ? -16.843  55.013  -41.405 1.00 83.53  ? 53  LEU F CD2 1 
ATOM   4435 N  N   . THR D 1 54  ? -14.908  51.713  -44.591 1.00 93.21  ? 54  THR F N   1 
ATOM   4436 C  CA  . THR D 1 54  ? -13.669  50.947  -44.464 1.00 94.45  ? 54  THR F CA  1 
ATOM   4437 C  C   . THR D 1 54  ? -12.643  51.806  -43.735 1.00 93.36  ? 54  THR F C   1 
ATOM   4438 O  O   . THR D 1 54  ? -12.359  52.921  -44.173 1.00 95.37  ? 54  THR F O   1 
ATOM   4439 C  CB  . THR D 1 54  ? -13.091  50.580  -45.851 1.00 96.31  ? 54  THR F CB  1 
ATOM   4440 O  OG1 . THR D 1 54  ? -14.089  49.912  -46.636 1.00 91.92  ? 54  THR F OG1 1 
ATOM   4441 C  CG2 . THR D 1 54  ? -11.864  49.683  -45.707 1.00 98.68  ? 54  THR F CG2 1 
ATOM   4442 N  N   . VAL D 1 55  ? -12.084  51.300  -42.638 1.00 90.83  ? 55  VAL F N   1 
ATOM   4443 C  CA  . VAL D 1 55  ? -11.030  52.009  -41.914 1.00 88.89  ? 55  VAL F CA  1 
ATOM   4444 C  C   . VAL D 1 55  ? -9.687   51.659  -42.562 1.00 86.24  ? 55  VAL F C   1 
ATOM   4445 O  O   . VAL D 1 55  ? -9.372   50.490  -42.726 1.00 83.03  ? 55  VAL F O   1 
ATOM   4446 C  CB  . VAL D 1 55  ? -11.031  51.667  -40.401 1.00 87.14  ? 55  VAL F CB  1 
ATOM   4447 C  CG1 . VAL D 1 55  ? -9.983   52.483  -39.649 1.00 86.61  ? 55  VAL F CG1 1 
ATOM   4448 C  CG2 . VAL D 1 55  ? -12.406  51.941  -39.794 1.00 85.58  ? 55  VAL F CG2 1 
ATOM   4449 N  N   . ALA D 1 56  ? -8.926   52.678  -42.959 1.00 84.28  ? 56  ALA F N   1 
ATOM   4450 C  CA  . ALA D 1 56  ? -7.556   52.508  -43.462 1.00 81.90  ? 56  ALA F CA  1 
ATOM   4451 C  C   . ALA D 1 56  ? -6.584   53.318  -42.599 1.00 79.40  ? 56  ALA F C   1 
ATOM   4452 O  O   . ALA D 1 56  ? -6.940   54.379  -42.076 1.00 72.11  ? 56  ALA F O   1 
ATOM   4453 C  CB  . ALA D 1 56  ? -7.471   52.944  -44.916 1.00 81.69  ? 56  ALA F CB  1 
ATOM   4454 N  N   . LYS D 1 57  ? -5.365   52.807  -42.447 1.00 80.41  ? 57  LYS F N   1 
ATOM   4455 C  CA  . LYS D 1 57  ? -4.327   53.444  -41.631 1.00 86.50  ? 57  LYS F CA  1 
ATOM   4456 C  C   . LYS D 1 57  ? -3.058   53.610  -42.456 1.00 89.12  ? 57  LYS F C   1 
ATOM   4457 O  O   . LYS D 1 57  ? -2.756   52.779  -43.318 1.00 91.26  ? 57  LYS F O   1 
ATOM   4458 C  CB  . LYS D 1 57  ? -4.027   52.605  -40.378 1.00 87.17  ? 57  LYS F CB  1 
ATOM   4459 C  CG  . LYS D 1 57  ? -5.172   52.533  -39.379 1.00 87.98  ? 57  LYS F CG  1 
ATOM   4460 C  CD  . LYS D 1 57  ? -4.855   51.622  -38.199 1.00 87.00  ? 57  LYS F CD  1 
ATOM   4461 C  CE  . LYS D 1 57  ? -3.864   52.253  -37.237 1.00 89.81  ? 57  LYS F CE  1 
ATOM   4462 N  NZ  . LYS D 1 57  ? -3.506   51.291  -36.159 1.00 93.21  ? 57  LYS F NZ  1 
ATOM   4463 N  N   . LEU D 1 58  ? -2.317   54.681  -42.175 1.00 92.47  ? 58  LEU F N   1 
ATOM   4464 C  CA  . LEU D 1 58  ? -1.076   54.979  -42.877 1.00 93.80  ? 58  LEU F CA  1 
ATOM   4465 C  C   . LEU D 1 58  ? -0.036   55.543  -41.912 1.00 93.81  ? 58  LEU F C   1 
ATOM   4466 O  O   . LEU D 1 58  ? -0.263   56.593  -41.294 1.00 92.57  ? 58  LEU F O   1 
ATOM   4467 C  CB  . LEU D 1 58  ? -1.351   55.976  -44.009 1.00 93.59  ? 58  LEU F CB  1 
ATOM   4468 C  CG  . LEU D 1 58  ? -0.159   56.323  -44.908 1.00 94.34  ? 58  LEU F CG  1 
ATOM   4469 C  CD1 . LEU D 1 58  ? -0.559   56.321  -46.375 1.00 97.46  ? 58  LEU F CD1 1 
ATOM   4470 C  CD2 . LEU D 1 58  ? 0.464    57.653  -44.503 1.00 94.30  ? 58  LEU F CD2 1 
ATOM   4471 N  N   . ASN D 1 59  ? 1.098    54.848  -41.791 1.00 93.32  ? 59  ASN F N   1 
ATOM   4472 C  CA  . ASN D 1 59  ? 2.212    55.298  -40.948 1.00 94.68  ? 59  ASN F CA  1 
ATOM   4473 C  C   . ASN D 1 59  ? 2.971    56.441  -41.649 1.00 94.04  ? 59  ASN F C   1 
ATOM   4474 O  O   . ASN D 1 59  ? 3.672    56.213  -42.637 1.00 90.08  ? 59  ASN F O   1 
ATOM   4475 C  CB  . ASN D 1 59  ? 3.155    54.126  -40.621 1.00 93.26  ? 59  ASN F CB  1 
ATOM   4476 C  CG  . ASN D 1 59  ? 3.985    54.367  -39.368 1.00 93.71  ? 59  ASN F CG  1 
ATOM   4477 O  OD1 . ASN D 1 59  ? 4.484    55.466  -39.131 1.00 89.17  ? 59  ASN F OD1 1 
ATOM   4478 N  ND2 . ASN D 1 59  ? 4.142    53.328  -38.560 1.00 98.09  ? 59  ASN F ND2 1 
ATOM   4479 N  N   . ILE D 1 60  ? 2.814    57.660  -41.127 1.00 96.56  ? 60  ILE F N   1 
ATOM   4480 C  CA  . ILE D 1 60  ? 3.421    58.876  -41.704 1.00 99.98  ? 60  ILE F CA  1 
ATOM   4481 C  C   . ILE D 1 60  ? 4.973    58.900  -41.679 1.00 101.63 ? 60  ILE F C   1 
ATOM   4482 O  O   . ILE D 1 60  ? 5.594    59.631  -42.467 1.00 96.75  ? 60  ILE F O   1 
ATOM   4483 C  CB  . ILE D 1 60  ? 2.838    60.150  -41.028 1.00 101.37 ? 60  ILE F CB  1 
ATOM   4484 C  CG1 . ILE D 1 60  ? 3.111    61.402  -41.865 1.00 106.33 ? 60  ILE F CG1 1 
ATOM   4485 C  CG2 . ILE D 1 60  ? 3.369    60.323  -39.606 1.00 99.86  ? 60  ILE F CG2 1 
ATOM   4486 C  CD1 . ILE D 1 60  ? 2.450    62.643  -41.309 1.00 111.06 ? 60  ILE F CD1 1 
ATOM   4487 N  N   . ASP D 1 61  ? 5.587    58.118  -40.780 1.00 101.62 ? 61  ASP F N   1 
ATOM   4488 C  CA  . ASP D 1 61  ? 7.049    57.933  -40.754 1.00 97.79  ? 61  ASP F CA  1 
ATOM   4489 C  C   . ASP D 1 61  ? 7.511    57.131  -41.971 1.00 100.64 ? 61  ASP F C   1 
ATOM   4490 O  O   . ASP D 1 61  ? 8.355    57.598  -42.741 1.00 107.65 ? 61  ASP F O   1 
ATOM   4491 C  CB  . ASP D 1 61  ? 7.514    57.199  -39.479 1.00 95.18  ? 61  ASP F CB  1 
ATOM   4492 C  CG  . ASP D 1 61  ? 7.304    58.005  -38.204 1.00 92.91  ? 61  ASP F CG  1 
ATOM   4493 O  OD1 . ASP D 1 61  ? 7.430    59.253  -38.228 1.00 84.18  ? 61  ASP F OD1 1 
ATOM   4494 O  OD2 . ASP D 1 61  ? 7.024    57.369  -37.160 1.00 95.46  ? 61  ASP F OD2 1 
ATOM   4495 N  N   . GLN D 1 62  ? 6.950    55.929  -42.132 1.00 100.43 ? 62  GLN F N   1 
ATOM   4496 C  CA  . GLN D 1 62  ? 7.292    55.039  -43.254 1.00 100.24 ? 62  GLN F CA  1 
ATOM   4497 C  C   . GLN D 1 62  ? 6.867    55.562  -44.633 1.00 104.53 ? 62  GLN F C   1 
ATOM   4498 O  O   . GLN D 1 62  ? 7.504    55.236  -45.638 1.00 110.59 ? 62  GLN F O   1 
ATOM   4499 C  CB  . GLN D 1 62  ? 6.684    53.655  -43.045 1.00 94.07  ? 62  GLN F CB  1 
ATOM   4500 C  CG  . GLN D 1 62  ? 7.308    52.882  -41.905 1.00 91.36  ? 62  GLN F CG  1 
ATOM   4501 C  CD  . GLN D 1 62  ? 6.654    51.535  -41.734 1.00 93.68  ? 62  GLN F CD  1 
ATOM   4502 O  OE1 . GLN D 1 62  ? 5.437    51.449  -41.564 1.00 95.15  ? 62  GLN F OE1 1 
ATOM   4503 N  NE2 . GLN D 1 62  ? 7.452    50.472  -41.784 1.00 97.13  ? 62  GLN F NE2 1 
ATOM   4504 N  N   . ASN D 1 63  ? 5.790    56.349  -44.675 1.00 108.38 ? 63  ASN F N   1 
ATOM   4505 C  CA  . ASN D 1 63  ? 5.260    56.926  -45.917 1.00 110.96 ? 63  ASN F CA  1 
ATOM   4506 C  C   . ASN D 1 63  ? 5.134    58.456  -45.753 1.00 116.33 ? 63  ASN F C   1 
ATOM   4507 O  O   . ASN D 1 63  ? 4.034    58.974  -45.522 1.00 119.23 ? 63  ASN F O   1 
ATOM   4508 C  CB  . ASN D 1 63  ? 3.895    56.299  -46.253 1.00 110.96 ? 63  ASN F CB  1 
ATOM   4509 C  CG  . ASN D 1 63  ? 3.903    54.777  -46.154 1.00 110.62 ? 63  ASN F CG  1 
ATOM   4510 O  OD1 . ASN D 1 63  ? 4.617    54.096  -46.889 1.00 109.44 ? 63  ASN F OD1 1 
ATOM   4511 N  ND2 . ASN D 1 63  ? 3.096    54.238  -45.242 1.00 111.03 ? 63  ASN F ND2 1 
ATOM   4512 N  N   . PRO D 1 64  ? 6.268    59.190  -45.855 1.00 115.73 ? 64  PRO F N   1 
ATOM   4513 C  CA  . PRO D 1 64  ? 6.194    60.648  -45.699 1.00 111.82 ? 64  PRO F CA  1 
ATOM   4514 C  C   . PRO D 1 64  ? 5.555    61.395  -46.878 1.00 109.09 ? 64  PRO F C   1 
ATOM   4515 O  O   . PRO D 1 64  ? 5.201    62.559  -46.716 1.00 100.77 ? 64  PRO F O   1 
ATOM   4516 C  CB  . PRO D 1 64  ? 7.667    61.071  -45.536 1.00 111.52 ? 64  PRO F CB  1 
ATOM   4517 C  CG  . PRO D 1 64  ? 8.469    59.819  -45.420 1.00 111.81 ? 64  PRO F CG  1 
ATOM   4518 C  CD  . PRO D 1 64  ? 7.654    58.750  -46.092 1.00 112.81 ? 64  PRO F CD  1 
ATOM   4519 N  N   . GLY D 1 65  ? 5.410    60.742  -48.036 1.00 114.34 ? 65  GLY F N   1 
ATOM   4520 C  CA  . GLY D 1 65  ? 4.896    61.394  -49.249 1.00 120.14 ? 65  GLY F CA  1 
ATOM   4521 C  C   . GLY D 1 65  ? 3.414    61.740  -49.284 1.00 125.03 ? 65  GLY F C   1 
ATOM   4522 O  O   . GLY D 1 65  ? 3.029    62.762  -49.851 1.00 131.01 ? 65  GLY F O   1 
ATOM   4523 N  N   . THR D 1 66  ? 2.578    60.882  -48.708 1.00 126.45 ? 66  THR F N   1 
ATOM   4524 C  CA  . THR D 1 66  ? 1.115    61.074  -48.718 1.00 128.06 ? 66  THR F CA  1 
ATOM   4525 C  C   . THR D 1 66  ? 0.618    62.291  -47.919 1.00 124.87 ? 66  THR F C   1 
ATOM   4526 O  O   . THR D 1 66  ? -0.276   63.000  -48.373 1.00 117.25 ? 66  THR F O   1 
ATOM   4527 C  CB  . THR D 1 66  ? 0.388    59.832  -48.158 1.00 131.20 ? 66  THR F CB  1 
ATOM   4528 O  OG1 . THR D 1 66  ? 1.062    59.395  -46.973 1.00 148.60 ? 66  THR F OG1 1 
ATOM   4529 C  CG2 . THR D 1 66  ? 0.330    58.677  -49.174 1.00 125.85 ? 66  THR F CG2 1 
ATOM   4530 N  N   . ALA D 1 67  ? 1.184    62.517  -46.735 1.00 124.57 ? 67  ALA F N   1 
ATOM   4531 C  CA  . ALA D 1 67  ? 0.646    63.502  -45.777 1.00 125.22 ? 67  ALA F CA  1 
ATOM   4532 C  C   . ALA D 1 67  ? 0.710    64.984  -46.213 1.00 127.02 ? 67  ALA F C   1 
ATOM   4533 O  O   . ALA D 1 67  ? -0.250   65.730  -45.972 1.00 115.02 ? 67  ALA F O   1 
ATOM   4534 C  CB  . ALA D 1 67  ? 1.285    63.309  -44.404 1.00 126.43 ? 67  ALA F CB  1 
ATOM   4535 N  N   . PRO D 1 68  ? 1.831    65.425  -46.829 1.00 131.94 ? 68  PRO F N   1 
ATOM   4536 C  CA  . PRO D 1 68  ? 1.875    66.778  -47.391 1.00 128.37 ? 68  PRO F CA  1 
ATOM   4537 C  C   . PRO D 1 68  ? 0.784    67.087  -48.423 1.00 124.41 ? 68  PRO F C   1 
ATOM   4538 O  O   . PRO D 1 68  ? 0.289    68.219  -48.443 1.00 128.14 ? 68  PRO F O   1 
ATOM   4539 C  CB  . PRO D 1 68  ? 3.264    66.840  -48.040 1.00 130.35 ? 68  PRO F CB  1 
ATOM   4540 C  CG  . PRO D 1 68  ? 4.089    65.929  -47.212 1.00 132.12 ? 68  PRO F CG  1 
ATOM   4541 C  CD  . PRO D 1 68  ? 3.166    64.804  -46.845 1.00 131.81 ? 68  PRO F CD  1 
ATOM   4542 N  N   . LYS D 1 69  ? 0.396    66.095  -49.237 1.00 117.25 ? 69  LYS F N   1 
ATOM   4543 C  CA  . LYS D 1 69  ? -0.589   66.303  -50.316 1.00 114.59 ? 69  LYS F CA  1 
ATOM   4544 C  C   . LYS D 1 69  ? -1.953   66.836  -49.838 1.00 114.30 ? 69  LYS F C   1 
ATOM   4545 O  O   . LYS D 1 69  ? -2.619   67.569  -50.573 1.00 116.62 ? 69  LYS F O   1 
ATOM   4546 C  CB  . LYS D 1 69  ? -0.811   65.014  -51.128 1.00 112.82 ? 69  LYS F CB  1 
ATOM   4547 C  CG  . LYS D 1 69  ? 0.377    64.533  -51.943 1.00 112.85 ? 69  LYS F CG  1 
ATOM   4548 C  CD  . LYS D 1 69  ? 0.139    63.099  -52.420 1.00 111.94 ? 69  LYS F CD  1 
ATOM   4549 C  CE  . LYS D 1 69  ? 1.375    62.454  -53.024 1.00 113.38 ? 69  LYS F CE  1 
ATOM   4550 N  NZ  . LYS D 1 69  ? 1.240    60.970  -53.018 1.00 116.57 ? 69  LYS F NZ  1 
ATOM   4551 N  N   . TYR D 1 70  ? -2.365   66.461  -48.619 1.00 110.92 ? 70  TYR F N   1 
ATOM   4552 C  CA  . TYR D 1 70  ? -3.648   66.881  -48.040 1.00 105.39 ? 70  TYR F CA  1 
ATOM   4553 C  C   . TYR D 1 70  ? -3.513   67.892  -46.892 1.00 96.06  ? 70  TYR F C   1 
ATOM   4554 O  O   . TYR D 1 70  ? -4.527   68.301  -46.322 1.00 91.20  ? 70  TYR F O   1 
ATOM   4555 C  CB  . TYR D 1 70  ? -4.445   65.646  -47.587 1.00 109.95 ? 70  TYR F CB  1 
ATOM   4556 C  CG  . TYR D 1 70  ? -4.717   64.678  -48.726 1.00 114.97 ? 70  TYR F CG  1 
ATOM   4557 C  CD1 . TYR D 1 70  ? -3.804   63.662  -49.038 1.00 115.49 ? 70  TYR F CD1 1 
ATOM   4558 C  CD2 . TYR D 1 70  ? -5.823   64.841  -49.551 1.00 113.92 ? 70  TYR F CD2 1 
ATOM   4559 C  CE1 . TYR D 1 70  ? -4.019   62.801  -50.105 1.00 115.52 ? 70  TYR F CE1 1 
ATOM   4560 C  CE2 . TYR D 1 70  ? -6.059   63.973  -50.610 1.00 115.28 ? 70  TYR F CE2 1 
ATOM   4561 C  CZ  . TYR D 1 70  ? -5.131   62.978  -50.905 1.00 117.07 ? 70  TYR F CZ  1 
ATOM   4562 O  OH  . TYR D 1 70  ? -5.370   62.112  -51.945 1.00 120.91 ? 70  TYR F OH  1 
ATOM   4563 N  N   . GLY D 1 71  ? -2.283   68.291  -46.559 1.00 88.97  ? 71  GLY F N   1 
ATOM   4564 C  CA  . GLY D 1 71  ? -2.049   69.385  -45.621 1.00 89.82  ? 71  GLY F CA  1 
ATOM   4565 C  C   . GLY D 1 71  ? -2.290   69.010  -44.171 1.00 88.33  ? 71  GLY F C   1 
ATOM   4566 O  O   . GLY D 1 71  ? -3.005   69.712  -43.440 1.00 82.38  ? 71  GLY F O   1 
ATOM   4567 N  N   . ILE D 1 72  ? -1.673   67.904  -43.764 1.00 88.84  ? 72  ILE F N   1 
ATOM   4568 C  CA  . ILE D 1 72  ? -1.849   67.368  -42.413 1.00 89.35  ? 72  ILE F CA  1 
ATOM   4569 C  C   . ILE D 1 72  ? -1.004   68.181  -41.420 1.00 86.47  ? 72  ILE F C   1 
ATOM   4570 O  O   . ILE D 1 72  ? 0.216    68.060  -41.412 1.00 83.32  ? 72  ILE F O   1 
ATOM   4571 C  CB  . ILE D 1 72  ? -1.463   65.864  -42.343 1.00 89.80  ? 72  ILE F CB  1 
ATOM   4572 C  CG1 . ILE D 1 72  ? -2.261   65.024  -43.355 1.00 89.87  ? 72  ILE F CG1 1 
ATOM   4573 C  CG2 . ILE D 1 72  ? -1.674   65.316  -40.933 1.00 89.91  ? 72  ILE F CG2 1 
ATOM   4574 C  CD1 . ILE D 1 72  ? -3.761   64.984  -43.157 1.00 91.42  ? 72  ILE F CD1 1 
ATOM   4575 N  N   . ARG D 1 73  ? -1.654   69.000  -40.599 1.00 87.59  ? 73  ARG F N   1 
ATOM   4576 C  CA  . ARG D 1 73  ? -0.955   69.806  -39.586 1.00 90.75  ? 73  ARG F CA  1 
ATOM   4577 C  C   . ARG D 1 73  ? -0.511   68.970  -38.372 1.00 85.99  ? 73  ARG F C   1 
ATOM   4578 O  O   . ARG D 1 73  ? 0.686    68.779  -38.143 1.00 79.03  ? 73  ARG F O   1 
ATOM   4579 C  CB  . ARG D 1 73  ? -1.836   70.975  -39.114 1.00 98.28  ? 73  ARG F CB  1 
ATOM   4580 C  CG  . ARG D 1 73  ? -2.251   71.970  -40.182 1.00 104.52 ? 73  ARG F CG  1 
ATOM   4581 C  CD  . ARG D 1 73  ? -1.084   72.697  -40.844 1.00 113.15 ? 73  ARG F CD  1 
ATOM   4582 N  NE  . ARG D 1 73  ? -0.078   73.246  -39.921 1.00 121.55 ? 73  ARG F NE  1 
ATOM   4583 C  CZ  . ARG D 1 73  ? -0.207   74.358  -39.189 1.00 123.99 ? 73  ARG F CZ  1 
ATOM   4584 N  NH1 . ARG D 1 73  ? -1.328   75.077  -39.205 1.00 126.57 ? 73  ARG F NH1 1 
ATOM   4585 N  NH2 . ARG D 1 73  ? 0.799    74.748  -38.412 1.00 123.13 ? 73  ARG F NH2 1 
ATOM   4586 N  N   . GLY D 1 74  ? -1.480   68.471  -37.605 1.00 83.01  ? 74  GLY F N   1 
ATOM   4587 C  CA  . GLY D 1 74  ? -1.217   67.635  -36.424 1.00 77.73  ? 74  GLY F CA  1 
ATOM   4588 C  C   . GLY D 1 74  ? -1.452   66.163  -36.713 1.00 71.25  ? 74  GLY F C   1 
ATOM   4589 O  O   . GLY D 1 74  ? -1.731   65.789  -37.852 1.00 65.86  ? 74  GLY F O   1 
ATOM   4590 N  N   . ILE D 1 75  ? -1.320   65.331  -35.679 1.00 66.65  ? 75  ILE F N   1 
ATOM   4591 C  CA  . ILE D 1 75  ? -1.749   63.922  -35.721 1.00 65.76  ? 75  ILE F CA  1 
ATOM   4592 C  C   . ILE D 1 75  ? -2.323   63.515  -34.353 1.00 67.73  ? 75  ILE F C   1 
ATOM   4593 O  O   . ILE D 1 75  ? -1.866   64.034  -33.331 1.00 65.81  ? 75  ILE F O   1 
ATOM   4594 C  CB  . ILE D 1 75  ? -0.607   62.955  -36.132 1.00 63.52  ? 75  ILE F CB  1 
ATOM   4595 C  CG1 . ILE D 1 75  ? 0.684    63.241  -35.359 1.00 62.78  ? 75  ILE F CG1 1 
ATOM   4596 C  CG2 . ILE D 1 75  ? -0.345   63.033  -37.633 1.00 64.10  ? 75  ILE F CG2 1 
ATOM   4597 C  CD1 . ILE D 1 75  ? 1.771    62.209  -35.606 1.00 61.66  ? 75  ILE F CD1 1 
ATOM   4598 N  N   . PRO D 1 76  ? -3.305   62.607  -34.302 1.00 71.25  ? 76  PRO F N   1 
ATOM   4599 C  CA  . PRO D 1 76  ? -3.845   61.872  -35.455 1.00 71.31  ? 76  PRO F CA  1 
ATOM   4600 C  C   . PRO D 1 76  ? -4.903   62.645  -36.252 1.00 70.55  ? 76  PRO F C   1 
ATOM   4601 O  O   . PRO D 1 76  ? -5.738   63.327  -35.655 1.00 67.01  ? 76  PRO F O   1 
ATOM   4602 C  CB  . PRO D 1 76  ? -4.489   60.650  -34.796 1.00 71.54  ? 76  PRO F CB  1 
ATOM   4603 C  CG  . PRO D 1 76  ? -4.924   61.150  -33.448 1.00 69.59  ? 76  PRO F CG  1 
ATOM   4604 C  CD  . PRO D 1 76  ? -4.070   62.329  -33.071 1.00 69.52  ? 76  PRO F CD  1 
ATOM   4605 N  N   . THR D 1 77  ? -4.853   62.530  -37.580 1.00 74.03  ? 77  THR F N   1 
ATOM   4606 C  CA  . THR D 1 77  ? -5.843   63.135  -38.474 1.00 82.19  ? 77  THR F CA  1 
ATOM   4607 C  C   . THR D 1 77  ? -6.661   62.026  -39.125 1.00 85.89  ? 77  THR F C   1 
ATOM   4608 O  O   . THR D 1 77  ? -6.099   61.072  -39.669 1.00 81.75  ? 77  THR F O   1 
ATOM   4609 C  CB  . THR D 1 77  ? -5.179   63.997  -39.574 1.00 89.15  ? 77  THR F CB  1 
ATOM   4610 O  OG1 . THR D 1 77  ? -4.514   65.114  -38.976 1.00 97.25  ? 77  THR F OG1 1 
ATOM   4611 C  CG2 . THR D 1 77  ? -6.209   64.531  -40.573 1.00 89.26  ? 77  THR F CG2 1 
ATOM   4612 N  N   . LEU D 1 78  ? -7.986   62.170  -39.062 1.00 89.54  ? 78  LEU F N   1 
ATOM   4613 C  CA  . LEU D 1 78  ? -8.934   61.240  -39.677 1.00 88.66  ? 78  LEU F CA  1 
ATOM   4614 C  C   . LEU D 1 78  ? -9.662   61.906  -40.853 1.00 90.55  ? 78  LEU F C   1 
ATOM   4615 O  O   . LEU D 1 78  ? -10.580  62.704  -40.640 1.00 87.09  ? 78  LEU F O   1 
ATOM   4616 C  CB  . LEU D 1 78  ? -9.952   60.748  -38.634 1.00 86.15  ? 78  LEU F CB  1 
ATOM   4617 C  CG  . LEU D 1 78  ? -9.421   59.888  -37.485 1.00 84.17  ? 78  LEU F CG  1 
ATOM   4618 C  CD1 . LEU D 1 78  ? -10.484  59.682  -36.416 1.00 83.82  ? 78  LEU F CD1 1 
ATOM   4619 C  CD2 . LEU D 1 78  ? -8.913   58.558  -38.017 1.00 82.56  ? 78  LEU F CD2 1 
ATOM   4620 N  N   . LEU D 1 79  ? -9.237   61.583  -42.078 1.00 92.74  ? 79  LEU F N   1 
ATOM   4621 C  CA  . LEU D 1 79  ? -9.891   62.078  -43.293 1.00 97.11  ? 79  LEU F CA  1 
ATOM   4622 C  C   . LEU D 1 79  ? -10.833  61.026  -43.863 1.00 100.00 ? 79  LEU F C   1 
ATOM   4623 O  O   . LEU D 1 79  ? -10.386  59.929  -44.204 1.00 98.28  ? 79  LEU F O   1 
ATOM   4624 C  CB  . LEU D 1 79  ? -8.860   62.435  -44.363 1.00 98.95  ? 79  LEU F CB  1 
ATOM   4625 C  CG  . LEU D 1 79  ? -7.833   63.532  -44.096 1.00 99.50  ? 79  LEU F CG  1 
ATOM   4626 C  CD1 . LEU D 1 79  ? -6.929   63.665  -45.318 1.00 101.06 ? 79  LEU F CD1 1 
ATOM   4627 C  CD2 . LEU D 1 79  ? -8.499   64.869  -43.767 1.00 96.78  ? 79  LEU F CD2 1 
ATOM   4628 N  N   . LEU D 1 80  ? -12.117  61.367  -43.984 1.00 102.91 ? 80  LEU F N   1 
ATOM   4629 C  CA  . LEU D 1 80  ? -13.125  60.468  -44.551 1.00 104.19 ? 80  LEU F CA  1 
ATOM   4630 C  C   . LEU D 1 80  ? -13.285  60.735  -46.051 1.00 103.79 ? 80  LEU F C   1 
ATOM   4631 O  O   . LEU D 1 80  ? -13.741  61.799  -46.449 1.00 97.62  ? 80  LEU F O   1 
ATOM   4632 C  CB  . LEU D 1 80  ? -14.463  60.658  -43.831 1.00 107.44 ? 80  LEU F CB  1 
ATOM   4633 C  CG  . LEU D 1 80  ? -15.654  59.781  -44.225 1.00 110.70 ? 80  LEU F CG  1 
ATOM   4634 C  CD1 . LEU D 1 80  ? -15.307  58.301  -44.279 1.00 112.15 ? 80  LEU F CD1 1 
ATOM   4635 C  CD2 . LEU D 1 80  ? -16.792  60.020  -43.240 1.00 111.02 ? 80  LEU F CD2 1 
ATOM   4636 N  N   . PHE D 1 81  ? -12.890  59.760  -46.870 1.00 111.20 ? 81  PHE F N   1 
ATOM   4637 C  CA  . PHE D 1 81  ? -12.841  59.888  -48.341 1.00 118.47 ? 81  PHE F CA  1 
ATOM   4638 C  C   . PHE D 1 81  ? -14.094  59.306  -49.011 1.00 119.05 ? 81  PHE F C   1 
ATOM   4639 O  O   . PHE D 1 81  ? -14.645  58.315  -48.533 1.00 126.00 ? 81  PHE F O   1 
ATOM   4640 C  CB  . PHE D 1 81  ? -11.600  59.169  -48.902 1.00 122.27 ? 81  PHE F CB  1 
ATOM   4641 C  CG  . PHE D 1 81  ? -10.310  59.953  -48.800 1.00 126.57 ? 81  PHE F CG  1 
ATOM   4642 C  CD1 . PHE D 1 81  ? -10.046  60.855  -47.750 1.00 128.39 ? 81  PHE F CD1 1 
ATOM   4643 C  CD2 . PHE D 1 81  ? -9.333   59.768  -49.760 1.00 128.46 ? 81  PHE F CD2 1 
ATOM   4644 C  CE1 . PHE D 1 81  ? -8.856   61.547  -47.694 1.00 129.61 ? 81  PHE F CE1 1 
ATOM   4645 C  CE2 . PHE D 1 81  ? -8.122   60.442  -49.692 1.00 133.36 ? 81  PHE F CE2 1 
ATOM   4646 C  CZ  . PHE D 1 81  ? -7.898   61.355  -48.664 1.00 132.63 ? 81  PHE F CZ  1 
ATOM   4647 N  N   . LYS D 1 82  ? -14.526  59.932  -50.113 1.00 114.64 ? 82  LYS F N   1 
ATOM   4648 C  CA  . LYS D 1 82  ? -15.602  59.418  -50.988 1.00 108.56 ? 82  LYS F CA  1 
ATOM   4649 C  C   . LYS D 1 82  ? -15.301  59.773  -52.455 1.00 110.97 ? 82  LYS F C   1 
ATOM   4650 O  O   . LYS D 1 82  ? -15.202  60.952  -52.795 1.00 107.59 ? 82  LYS F O   1 
ATOM   4651 C  CB  . LYS D 1 82  ? -16.964  60.008  -50.603 1.00 103.77 ? 82  LYS F CB  1 
ATOM   4652 C  CG  . LYS D 1 82  ? -17.486  59.575  -49.248 1.00 102.91 ? 82  LYS F CG  1 
ATOM   4653 C  CD  . LYS D 1 82  ? -18.883  60.086  -48.966 1.00 101.50 ? 82  LYS F CD  1 
ATOM   4654 C  CE  . LYS D 1 82  ? -19.303  59.664  -47.565 1.00 103.39 ? 82  LYS F CE  1 
ATOM   4655 N  NZ  . LYS D 1 82  ? -20.677  60.084  -47.185 1.00 104.63 ? 82  LYS F NZ  1 
ATOM   4656 N  N   . ASN D 1 83  ? -15.166  58.751  -53.303 1.00 119.99 ? 83  ASN F N   1 
ATOM   4657 C  CA  . ASN D 1 83  ? -14.829  58.897  -54.740 1.00 123.77 ? 83  ASN F CA  1 
ATOM   4658 C  C   . ASN D 1 83  ? -13.506  59.635  -55.020 1.00 126.42 ? 83  ASN F C   1 
ATOM   4659 O  O   . ASN D 1 83  ? -13.386  60.342  -56.020 1.00 134.18 ? 83  ASN F O   1 
ATOM   4660 C  CB  . ASN D 1 83  ? -15.987  59.558  -55.521 1.00 123.65 ? 83  ASN F CB  1 
ATOM   4661 C  CG  . ASN D 1 83  ? -17.304  58.822  -55.371 1.00 122.22 ? 83  ASN F CG  1 
ATOM   4662 O  OD1 . ASN D 1 83  ? -17.338  57.610  -55.166 1.00 123.79 ? 83  ASN F OD1 1 
ATOM   4663 N  ND2 . ASN D 1 83  ? -18.400  59.561  -55.479 1.00 120.90 ? 83  ASN F ND2 1 
ATOM   4664 N  N   . GLY D 1 84  ? -12.515  59.449  -54.150 1.00 124.41 ? 84  GLY F N   1 
ATOM   4665 C  CA  . GLY D 1 84  ? -11.227  60.142  -54.269 1.00 116.22 ? 84  GLY F CA  1 
ATOM   4666 C  C   . GLY D 1 84  ? -11.256  61.632  -53.941 1.00 115.40 ? 84  GLY F C   1 
ATOM   4667 O  O   . GLY D 1 84  ? -10.400  62.382  -54.414 1.00 112.01 ? 84  GLY F O   1 
ATOM   4668 N  N   . GLU D 1 85  ? -12.240  62.061  -53.147 1.00 119.02 ? 85  GLU F N   1 
ATOM   4669 C  CA  . GLU D 1 85  ? -12.332  63.439  -52.634 1.00 120.01 ? 85  GLU F CA  1 
ATOM   4670 C  C   . GLU D 1 85  ? -12.499  63.392  -51.120 1.00 119.05 ? 85  GLU F C   1 
ATOM   4671 O  O   . GLU D 1 85  ? -13.010  62.413  -50.581 1.00 129.40 ? 85  GLU F O   1 
ATOM   4672 C  CB  . GLU D 1 85  ? -13.526  64.181  -53.236 1.00 120.88 ? 85  GLU F CB  1 
ATOM   4673 C  CG  . GLU D 1 85  ? -13.452  64.416  -54.735 1.00 123.24 ? 85  GLU F CG  1 
ATOM   4674 C  CD  . GLU D 1 85  ? -14.571  65.313  -55.258 1.00 124.95 ? 85  GLU F CD  1 
ATOM   4675 O  OE1 . GLU D 1 85  ? -15.567  65.566  -54.535 1.00 127.90 ? 85  GLU F OE1 1 
ATOM   4676 O  OE2 . GLU D 1 85  ? -14.450  65.775  -56.412 1.00 125.10 ? 85  GLU F OE2 1 
ATOM   4677 N  N   . VAL D 1 86  ? -12.089  64.464  -50.445 1.00 113.46 ? 86  VAL F N   1 
ATOM   4678 C  CA  . VAL D 1 86  ? -12.146  64.548  -48.986 1.00 111.27 ? 86  VAL F CA  1 
ATOM   4679 C  C   . VAL D 1 86  ? -13.472  65.187  -48.559 1.00 109.12 ? 86  VAL F C   1 
ATOM   4680 O  O   . VAL D 1 86  ? -13.663  66.397  -48.698 1.00 113.96 ? 86  VAL F O   1 
ATOM   4681 C  CB  . VAL D 1 86  ? -10.949  65.359  -48.433 1.00 111.11 ? 86  VAL F CB  1 
ATOM   4682 C  CG1 . VAL D 1 86  ? -10.913  65.323  -46.907 1.00 111.84 ? 86  VAL F CG1 1 
ATOM   4683 C  CG2 . VAL D 1 86  ? -9.640   64.829  -49.016 1.00 107.69 ? 86  VAL F CG2 1 
ATOM   4684 N  N   . ALA D 1 87  ? -14.384  64.371  -48.037 1.00 104.21 ? 87  ALA F N   1 
ATOM   4685 C  CA  . ALA D 1 87  ? -15.702  64.854  -47.610 1.00 105.32 ? 87  ALA F CA  1 
ATOM   4686 C  C   . ALA D 1 87  ? -15.658  65.553  -46.246 1.00 105.96 ? 87  ALA F C   1 
ATOM   4687 O  O   . ALA D 1 87  ? -16.253  66.613  -46.083 1.00 107.05 ? 87  ALA F O   1 
ATOM   4688 C  CB  . ALA D 1 87  ? -16.708  63.711  -47.597 1.00 107.02 ? 87  ALA F CB  1 
ATOM   4689 N  N   . ALA D 1 88  ? -14.958  64.960  -45.276 1.00 108.89 ? 88  ALA F N   1 
ATOM   4690 C  CA  . ALA D 1 88  ? -14.882  65.490  -43.891 1.00 109.40 ? 88  ALA F CA  1 
ATOM   4691 C  C   . ALA D 1 88  ? -13.549  65.178  -43.207 1.00 107.60 ? 88  ALA F C   1 
ATOM   4692 O  O   . ALA D 1 88  ? -12.810  64.283  -43.644 1.00 104.27 ? 88  ALA F O   1 
ATOM   4693 C  CB  . ALA D 1 88  ? -16.033  64.960  -43.047 1.00 108.61 ? 88  ALA F CB  1 
ATOM   4694 N  N   . THR D 1 89  ? -13.264  65.912  -42.128 1.00 107.08 ? 89  THR F N   1 
ATOM   4695 C  CA  . THR D 1 89  ? -11.945  65.891  -41.479 1.00 105.27 ? 89  THR F CA  1 
ATOM   4696 C  C   . THR D 1 89  ? -12.045  66.064  -39.947 1.00 95.57  ? 89  THR F C   1 
ATOM   4697 O  O   . THR D 1 89  ? -12.826  66.885  -39.467 1.00 84.85  ? 89  THR F O   1 
ATOM   4698 C  CB  . THR D 1 89  ? -11.013  66.972  -42.103 1.00 110.16 ? 89  THR F CB  1 
ATOM   4699 O  OG1 . THR D 1 89  ? -9.691   66.852  -41.564 1.00 116.24 ? 89  THR F OG1 1 
ATOM   4700 C  CG2 . THR D 1 89  ? -11.552  68.402  -41.871 1.00 108.07 ? 89  THR F CG2 1 
ATOM   4701 N  N   . LYS D 1 90  ? -11.259  65.272  -39.202 1.00 89.19  ? 90  LYS F N   1 
ATOM   4702 C  CA  . LYS D 1 90  ? -11.109  65.400  -37.740 1.00 86.51  ? 90  LYS F CA  1 
ATOM   4703 C  C   . LYS D 1 90  ? -9.652   65.213  -37.311 1.00 85.67  ? 90  LYS F C   1 
ATOM   4704 O  O   . LYS D 1 90  ? -9.050   64.179  -37.610 1.00 80.44  ? 90  LYS F O   1 
ATOM   4705 C  CB  . LYS D 1 90  ? -11.977  64.372  -37.010 1.00 85.70  ? 90  LYS F CB  1 
ATOM   4706 C  CG  . LYS D 1 90  ? -13.187  64.962  -36.325 1.00 86.34  ? 90  LYS F CG  1 
ATOM   4707 C  CD  . LYS D 1 90  ? -12.832  65.634  -35.013 1.00 85.90  ? 90  LYS F CD  1 
ATOM   4708 C  CE  . LYS D 1 90  ? -14.108  66.075  -34.306 1.00 88.07  ? 90  LYS F CE  1 
ATOM   4709 N  NZ  . LYS D 1 90  ? -13.895  66.502  -32.897 1.00 88.38  ? 90  LYS F NZ  1 
ATOM   4710 N  N   . VAL D 1 91  ? -9.103   66.194  -36.590 1.00 87.11  ? 91  VAL F N   1 
ATOM   4711 C  CA  . VAL D 1 91  ? -7.724   66.137  -36.082 1.00 87.34  ? 91  VAL F CA  1 
ATOM   4712 C  C   . VAL D 1 91  ? -7.741   66.140  -34.546 1.00 85.88  ? 91  VAL F C   1 
ATOM   4713 O  O   . VAL D 1 91  ? -8.433   66.957  -33.927 1.00 77.19  ? 91  VAL F O   1 
ATOM   4714 C  CB  . VAL D 1 91  ? -6.860   67.311  -36.617 1.00 88.24  ? 91  VAL F CB  1 
ATOM   4715 C  CG1 . VAL D 1 91  ? -5.402   67.171  -36.163 1.00 89.99  ? 91  VAL F CG1 1 
ATOM   4716 C  CG2 . VAL D 1 91  ? -6.942   67.391  -38.140 1.00 86.10  ? 91  VAL F CG2 1 
ATOM   4717 N  N   . GLY D 1 92  ? -6.978   65.221  -33.954 1.00 87.00  ? 92  GLY F N   1 
ATOM   4718 C  CA  . GLY D 1 92  ? -6.873   65.076  -32.501 1.00 85.38  ? 92  GLY F CA  1 
ATOM   4719 C  C   . GLY D 1 92  ? -7.470   63.776  -32.007 1.00 83.89  ? 92  GLY F C   1 
ATOM   4720 O  O   . GLY D 1 92  ? -8.289   63.156  -32.691 1.00 78.97  ? 92  GLY F O   1 
ATOM   4721 N  N   . ALA D 1 93  ? -7.056   63.377  -30.803 1.00 84.35  ? 93  ALA F N   1 
ATOM   4722 C  CA  . ALA D 1 93  ? -7.517   62.134  -30.172 1.00 84.41  ? 93  ALA F CA  1 
ATOM   4723 C  C   . ALA D 1 93  ? -8.930   62.292  -29.610 1.00 83.66  ? 93  ALA F C   1 
ATOM   4724 O  O   . ALA D 1 93  ? -9.262   63.330  -29.023 1.00 81.89  ? 93  ALA F O   1 
ATOM   4725 C  CB  . ALA D 1 93  ? -6.563   61.714  -29.063 1.00 84.66  ? 93  ALA F CB  1 
ATOM   4726 N  N   . LEU D 1 94  ? -9.749   61.253  -29.783 1.00 82.92  ? 94  LEU F N   1 
ATOM   4727 C  CA  . LEU D 1 94  ? -11.146  61.258  -29.365 1.00 80.30  ? 94  LEU F CA  1 
ATOM   4728 C  C   . LEU D 1 94  ? -11.446  60.016  -28.535 1.00 77.59  ? 94  LEU F C   1 
ATOM   4729 O  O   . LEU D 1 94  ? -10.725  59.014  -28.603 1.00 70.31  ? 94  LEU F O   1 
ATOM   4730 C  CB  . LEU D 1 94  ? -12.061  61.265  -30.596 1.00 83.69  ? 94  LEU F CB  1 
ATOM   4731 C  CG  . LEU D 1 94  ? -11.945  62.431  -31.582 1.00 88.90  ? 94  LEU F CG  1 
ATOM   4732 C  CD1 . LEU D 1 94  ? -12.672  62.114  -32.884 1.00 89.18  ? 94  LEU F CD1 1 
ATOM   4733 C  CD2 . LEU D 1 94  ? -12.460  63.737  -30.993 1.00 89.51  ? 94  LEU F CD2 1 
ATOM   4734 N  N   . SER D 1 95  ? -12.520  60.096  -27.749 1.00 81.25  ? 95  SER F N   1 
ATOM   4735 C  CA  . SER D 1 95  ? -13.145  58.918  -27.140 1.00 82.36  ? 95  SER F CA  1 
ATOM   4736 C  C   . SER D 1 95  ? -14.041  58.235  -28.188 1.00 85.92  ? 95  SER F C   1 
ATOM   4737 O  O   . SER D 1 95  ? -14.248  58.770  -29.282 1.00 88.93  ? 95  SER F O   1 
ATOM   4738 C  CB  . SER D 1 95  ? -13.953  59.306  -25.891 1.00 78.03  ? 95  SER F CB  1 
ATOM   4739 O  OG  . SER D 1 95  ? -14.954  60.270  -26.185 1.00 75.79  ? 95  SER F OG  1 
ATOM   4740 N  N   . LYS D 1 96  ? -14.565  57.055  -27.860 1.00 84.67  ? 96  LYS F N   1 
ATOM   4741 C  CA  . LYS D 1 96  ? -15.430  56.311  -28.786 1.00 80.95  ? 96  LYS F CA  1 
ATOM   4742 C  C   . LYS D 1 96  ? -16.744  57.056  -29.060 1.00 76.36  ? 96  LYS F C   1 
ATOM   4743 O  O   . LYS D 1 96  ? -17.181  57.139  -30.214 1.00 68.44  ? 96  LYS F O   1 
ATOM   4744 C  CB  . LYS D 1 96  ? -15.716  54.909  -28.251 1.00 81.32  ? 96  LYS F CB  1 
ATOM   4745 C  CG  . LYS D 1 96  ? -16.321  53.965  -29.277 1.00 84.02  ? 96  LYS F CG  1 
ATOM   4746 C  CD  . LYS D 1 96  ? -16.676  52.638  -28.629 1.00 88.50  ? 96  LYS F CD  1 
ATOM   4747 C  CE  . LYS D 1 96  ? -17.509  51.773  -29.552 1.00 91.97  ? 96  LYS F CE  1 
ATOM   4748 N  NZ  . LYS D 1 96  ? -17.989  50.521  -28.900 1.00 95.08  ? 96  LYS F NZ  1 
ATOM   4749 N  N   . GLY D 1 97  ? -17.348  57.599  -27.998 1.00 75.87  ? 97  GLY F N   1 
ATOM   4750 C  CA  . GLY D 1 97  ? -18.583  58.387  -28.093 1.00 79.09  ? 97  GLY F CA  1 
ATOM   4751 C  C   . GLY D 1 97  ? -18.467  59.649  -28.936 1.00 80.63  ? 97  GLY F C   1 
ATOM   4752 O  O   . GLY D 1 97  ? -19.402  60.016  -29.646 1.00 82.39  ? 97  GLY F O   1 
ATOM   4753 N  N   . GLN D 1 98  ? -17.319  60.320  -28.841 1.00 78.35  ? 98  GLN F N   1 
ATOM   4754 C  CA  . GLN D 1 98  ? -17.019  61.500  -29.668 1.00 73.77  ? 98  GLN F CA  1 
ATOM   4755 C  C   . GLN D 1 98  ? -16.800  61.129  -31.138 1.00 70.54  ? 98  GLN F C   1 
ATOM   4756 O  O   . GLN D 1 98  ? -17.236  61.853  -32.027 1.00 66.31  ? 98  GLN F O   1 
ATOM   4757 C  CB  . GLN D 1 98  ? -15.795  62.235  -29.129 1.00 72.75  ? 98  GLN F CB  1 
ATOM   4758 C  CG  . GLN D 1 98  ? -15.990  62.881  -27.761 1.00 71.40  ? 98  GLN F CG  1 
ATOM   4759 C  CD  . GLN D 1 98  ? -14.719  63.503  -27.203 1.00 73.26  ? 98  GLN F CD  1 
ATOM   4760 O  OE1 . GLN D 1 98  ? -13.655  63.475  -27.830 1.00 73.90  ? 98  GLN F OE1 1 
ATOM   4761 N  NE2 . GLN D 1 98  ? -14.825  64.075  -26.011 1.00 74.67  ? 98  GLN F NE2 1 
ATOM   4762 N  N   . LEU D 1 99  ? -16.116  60.012  -31.382 1.00 71.15  ? 99  LEU F N   1 
ATOM   4763 C  CA  . LEU D 1 99  ? -15.856  59.531  -32.745 1.00 74.55  ? 99  LEU F CA  1 
ATOM   4764 C  C   . LEU D 1 99  ? -17.139  59.056  -33.435 1.00 77.76  ? 99  LEU F C   1 
ATOM   4765 O  O   . LEU D 1 99  ? -17.353  59.358  -34.617 1.00 72.11  ? 99  LEU F O   1 
ATOM   4766 C  CB  . LEU D 1 99  ? -14.800  58.414  -32.743 1.00 73.53  ? 99  LEU F CB  1 
ATOM   4767 C  CG  . LEU D 1 99  ? -14.350  57.845  -34.105 1.00 72.66  ? 99  LEU F CG  1 
ATOM   4768 C  CD1 . LEU D 1 99  ? -13.793  58.909  -35.039 1.00 70.91  ? 99  LEU F CD1 1 
ATOM   4769 C  CD2 . LEU D 1 99  ? -13.316  56.751  -33.906 1.00 75.05  ? 99  LEU F CD2 1 
ATOM   4770 N  N   . LYS D 1 100 ? -17.984  58.318  -32.707 1.00 85.06  ? 100 LYS F N   1 
ATOM   4771 C  CA  . LYS D 1 100 ? -19.274  57.866  -33.252 1.00 92.05  ? 100 LYS F CA  1 
ATOM   4772 C  C   . LYS D 1 100 ? -20.176  59.041  -33.639 1.00 91.48  ? 100 LYS F C   1 
ATOM   4773 O  O   . LYS D 1 100 ? -20.850  58.981  -34.667 1.00 93.20  ? 100 LYS F O   1 
ATOM   4774 C  CB  . LYS D 1 100 ? -20.026  56.938  -32.282 1.00 96.62  ? 100 LYS F CB  1 
ATOM   4775 C  CG  . LYS D 1 100 ? -19.459  55.531  -32.128 1.00 100.19 ? 100 LYS F CG  1 
ATOM   4776 C  CD  . LYS D 1 100 ? -20.541  54.450  -31.907 1.00 100.87 ? 100 LYS F CD  1 
ATOM   4777 C  CE  . LYS D 1 100 ? -21.529  54.697  -30.753 1.00 98.96  ? 100 LYS F CE  1 
ATOM   4778 N  NZ  . LYS D 1 100 ? -20.908  54.875  -29.410 1.00 97.63  ? 100 LYS F NZ  1 
ATOM   4779 N  N   . GLU D 1 101 ? -20.184  60.099  -32.827 1.00 90.25  ? 101 GLU F N   1 
ATOM   4780 C  CA  . GLU D 1 101 ? -20.930  61.320  -33.164 1.00 97.18  ? 101 GLU F CA  1 
ATOM   4781 C  C   . GLU D 1 101 ? -20.428  61.989  -34.447 1.00 103.38 ? 101 GLU F C   1 
ATOM   4782 O  O   . GLU D 1 101 ? -21.232  62.511  -35.204 1.00 106.72 ? 101 GLU F O   1 
ATOM   4783 C  CB  . GLU D 1 101 ? -20.922  62.325  -32.003 1.00 97.48  ? 101 GLU F CB  1 
ATOM   4784 C  CG  . GLU D 1 101 ? -22.013  62.066  -30.974 1.00 102.09 ? 101 GLU F CG  1 
ATOM   4785 C  CD  . GLU D 1 101 ? -21.799  62.783  -29.654 1.00 106.52 ? 101 GLU F CD  1 
ATOM   4786 O  OE1 . GLU D 1 101 ? -20.970  63.721  -29.565 1.00 108.55 ? 101 GLU F OE1 1 
ATOM   4787 O  OE2 . GLU D 1 101 ? -22.482  62.393  -28.688 1.00 105.04 ? 101 GLU F OE2 1 
ATOM   4788 N  N   . PHE D 1 102 ? -19.114  61.971  -34.679 1.00 109.54 ? 102 PHE F N   1 
ATOM   4789 C  CA  . PHE D 1 102 ? -18.521  62.506  -35.919 1.00 110.08 ? 102 PHE F CA  1 
ATOM   4790 C  C   . PHE D 1 102 ? -18.900  61.661  -37.145 1.00 114.69 ? 102 PHE F C   1 
ATOM   4791 O  O   . PHE D 1 102 ? -19.313  62.215  -38.175 1.00 113.95 ? 102 PHE F O   1 
ATOM   4792 C  CB  . PHE D 1 102 ? -16.983  62.628  -35.803 1.00 106.17 ? 102 PHE F CB  1 
ATOM   4793 C  CG  . PHE D 1 102 ? -16.303  63.023  -37.100 1.00 101.13 ? 102 PHE F CG  1 
ATOM   4794 C  CD1 . PHE D 1 102 ? -16.432  64.317  -37.609 1.00 100.96 ? 102 PHE F CD1 1 
ATOM   4795 C  CD2 . PHE D 1 102 ? -15.544  62.099  -37.824 1.00 96.71  ? 102 PHE F CD2 1 
ATOM   4796 C  CE1 . PHE D 1 102 ? -15.837  64.670  -38.812 1.00 100.08 ? 102 PHE F CE1 1 
ATOM   4797 C  CE2 . PHE D 1 102 ? -14.952  62.452  -39.027 1.00 95.58  ? 102 PHE F CE2 1 
ATOM   4798 C  CZ  . PHE D 1 102 ? -15.097  63.739  -39.526 1.00 96.88  ? 102 PHE F CZ  1 
ATOM   4799 N  N   . LEU D 1 103 ? -18.757  60.336  -37.025 1.00 117.08 ? 103 LEU F N   1 
ATOM   4800 C  CA  . LEU D 1 103 ? -19.042  59.408  -38.129 1.00 121.75 ? 103 LEU F CA  1 
ATOM   4801 C  C   . LEU D 1 103 ? -20.543  59.283  -38.422 1.00 128.49 ? 103 LEU F C   1 
ATOM   4802 O  O   . LEU D 1 103 ? -20.957  59.287  -39.594 1.00 124.74 ? 103 LEU F O   1 
ATOM   4803 C  CB  . LEU D 1 103 ? -18.478  58.017  -37.837 1.00 120.79 ? 103 LEU F CB  1 
ATOM   4804 C  CG  . LEU D 1 103 ? -16.964  57.852  -37.723 1.00 117.41 ? 103 LEU F CG  1 
ATOM   4805 C  CD1 . LEU D 1 103 ? -16.615  56.430  -37.299 1.00 115.07 ? 103 LEU F CD1 1 
ATOM   4806 C  CD2 . LEU D 1 103 ? -16.274  58.200  -39.036 1.00 121.15 ? 103 LEU F CD2 1 
ATOM   4807 N  N   . ASP D 1 104 ? -21.339  59.156  -37.356 1.00 132.73 ? 104 ASP F N   1 
ATOM   4808 C  CA  . ASP D 1 104 ? -22.791  59.020  -37.476 1.00 132.48 ? 104 ASP F CA  1 
ATOM   4809 C  C   . ASP D 1 104 ? -23.457  60.308  -37.988 1.00 129.50 ? 104 ASP F C   1 
ATOM   4810 O  O   . ASP D 1 104 ? -24.451  60.233  -38.708 1.00 135.57 ? 104 ASP F O   1 
ATOM   4811 C  CB  . ASP D 1 104 ? -23.394  58.590  -36.133 1.00 134.64 ? 104 ASP F CB  1 
ATOM   4812 C  CG  . ASP D 1 104 ? -24.837  58.162  -36.242 1.00 143.42 ? 104 ASP F CG  1 
ATOM   4813 O  OD1 . ASP D 1 104 ? -25.137  57.314  -37.107 1.00 152.42 ? 104 ASP F OD1 1 
ATOM   4814 O  OD2 . ASP D 1 104 ? -25.667  58.666  -35.453 1.00 156.32 ? 104 ASP F OD2 1 
ATOM   4815 N  N   . ALA D 1 105 ? -22.917  61.471  -37.618 1.00 122.54 ? 105 ALA F N   1 
ATOM   4816 C  CA  . ALA D 1 105 ? -23.389  62.758  -38.156 1.00 114.14 ? 105 ALA F CA  1 
ATOM   4817 C  C   . ALA D 1 105 ? -23.000  62.949  -39.623 1.00 111.00 ? 105 ALA F C   1 
ATOM   4818 O  O   . ALA D 1 105 ? -23.828  63.370  -40.426 1.00 111.19 ? 105 ALA F O   1 
ATOM   4819 C  CB  . ALA D 1 105 ? -22.873  63.925  -37.323 1.00 110.09 ? 105 ALA F CB  1 
ATOM   4820 N  N   . ASN D 1 106 ? -21.753  62.633  -39.978 1.00 113.82 ? 106 ASN F N   1 
ATOM   4821 C  CA  . ASN D 1 106 ? -21.256  62.873  -41.348 1.00 121.84 ? 106 ASN F CA  1 
ATOM   4822 C  C   . ASN D 1 106 ? -21.735  61.854  -42.396 1.00 118.98 ? 106 ASN F C   1 
ATOM   4823 O  O   . ASN D 1 106 ? -21.893  62.192  -43.570 1.00 119.84 ? 106 ASN F O   1 
ATOM   4824 C  CB  . ASN D 1 106 ? -19.728  62.969  -41.361 1.00 130.14 ? 106 ASN F CB  1 
ATOM   4825 C  CG  . ASN D 1 106 ? -19.197  63.712  -42.570 1.00 136.83 ? 106 ASN F CG  1 
ATOM   4826 O  OD1 . ASN D 1 106 ? -18.543  63.124  -43.423 1.00 141.29 ? 106 ASN F OD1 1 
ATOM   4827 N  ND2 . ASN D 1 106 ? -19.472  65.013  -42.647 1.00 143.90 ? 106 ASN F ND2 1 
ATOM   4828 N  N   . LEU D 1 107 ? -21.975  60.607  -41.990 1.00 114.10 ? 107 LEU F N   1 
ATOM   4829 C  CA  . LEU D 1 107 ? -22.589  59.610  -42.881 1.00 113.67 ? 107 LEU F CA  1 
ATOM   4830 C  C   . LEU D 1 107 ? -24.104  59.759  -42.798 1.00 114.93 ? 107 LEU F C   1 
ATOM   4831 O  O   . LEU D 1 107 ? -24.629  60.045  -41.728 1.00 120.49 ? 107 LEU F O   1 
ATOM   4832 C  CB  . LEU D 1 107 ? -22.155  58.185  -42.509 1.00 112.11 ? 107 LEU F CB  1 
ATOM   4833 C  CG  . LEU D 1 107 ? -20.709  57.798  -42.875 1.00 110.07 ? 107 LEU F CG  1 
ATOM   4834 C  CD1 . LEU D 1 107 ? -20.296  56.513  -42.171 1.00 108.84 ? 107 LEU F CD1 1 
ATOM   4835 C  CD2 . LEU D 1 107 ? -20.536  57.697  -44.389 1.00 108.39 ? 107 LEU F CD2 1 
ATOM   4836 N  N   . ALA D 1 108 ? -24.798  59.612  -43.924 1.00 110.80 ? 108 ALA F N   1 
ATOM   4837 C  CA  . ALA D 1 108 ? -26.281  59.602  -43.932 1.00 105.26 ? 108 ALA F CA  1 
ATOM   4838 C  C   . ALA D 1 108 ? -26.814  58.617  -44.958 1.00 103.52 ? 108 ALA F C   1 
ATOM   4839 O  O   . ALA D 1 108 ? -26.765  58.882  -46.153 1.00 104.33 ? 108 ALA F O   1 
ATOM   4840 C  CB  . ALA D 1 108 ? -26.830  60.995  -44.202 1.00 101.28 ? 108 ALA F CB  1 
ATOM   4841 N  N   . ALA E 2 2   ? -31.679  57.468  -47.676 1.00 89.83  ? 40  ALA B N   1 
ATOM   4842 C  CA  . ALA E 2 2   ? -32.110  56.389  -48.618 1.00 94.84  ? 40  ALA B CA  1 
ATOM   4843 C  C   . ALA E 2 2   ? -31.911  54.994  -48.021 1.00 101.16 ? 40  ALA B C   1 
ATOM   4844 O  O   . ALA E 2 2   ? -32.841  54.181  -47.998 1.00 114.89 ? 40  ALA B O   1 
ATOM   4845 C  CB  . ALA E 2 2   ? -31.375  56.509  -49.943 1.00 92.54  ? 40  ALA B CB  1 
ATOM   4846 N  N   . ALA E 2 3   ? -30.697  54.712  -47.552 1.00 102.02 ? 41  ALA B N   1 
ATOM   4847 C  CA  . ALA E 2 3   ? -30.424  53.489  -46.772 1.00 101.30 ? 41  ALA B CA  1 
ATOM   4848 C  C   . ALA E 2 3   ? -30.901  53.655  -45.313 1.00 101.88 ? 41  ALA B C   1 
ATOM   4849 O  O   . ALA E 2 3   ? -31.070  52.669  -44.612 1.00 103.07 ? 41  ALA B O   1 
ATOM   4850 C  CB  . ALA E 2 3   ? -28.935  53.136  -46.835 1.00 99.91  ? 41  ALA B CB  1 
ATOM   4851 N  N   . LYS E 2 4   ? -31.038  54.902  -44.870 1.00 100.31 ? 42  LYS B N   1 
ATOM   4852 C  CA  . LYS E 2 4   ? -31.523  55.236  -43.531 1.00 100.07 ? 42  LYS B CA  1 
ATOM   4853 C  C   . LYS E 2 4   ? -33.003  54.883  -43.372 1.00 97.80  ? 42  LYS B C   1 
ATOM   4854 O  O   . LYS E 2 4   ? -33.413  54.293  -42.367 1.00 88.61  ? 42  LYS B O   1 
ATOM   4855 C  CB  . LYS E 2 4   ? -31.311  56.741  -43.290 1.00 105.42 ? 42  LYS B CB  1 
ATOM   4856 C  CG  . LYS E 2 4   ? -31.692  57.308  -41.929 1.00 108.55 ? 42  LYS B CG  1 
ATOM   4857 C  CD  . LYS E 2 4   ? -31.965  58.807  -42.068 1.00 110.23 ? 42  LYS B CD  1 
ATOM   4858 C  CE  . LYS E 2 4   ? -32.055  59.536  -40.735 1.00 109.83 ? 42  LYS B CE  1 
ATOM   4859 N  NZ  . LYS E 2 4   ? -30.760  60.156  -40.341 1.00 110.90 ? 42  LYS B NZ  1 
ATOM   4860 N  N   . VAL E 2 5   ? -33.800  55.261  -44.371 1.00 104.43 ? 43  VAL B N   1 
ATOM   4861 C  CA  . VAL E 2 5   ? -35.240  54.951  -44.397 1.00 106.27 ? 43  VAL B CA  1 
ATOM   4862 C  C   . VAL E 2 5   ? -35.449  53.442  -44.600 1.00 103.38 ? 43  VAL B C   1 
ATOM   4863 O  O   . VAL E 2 5   ? -36.333  52.853  -43.977 1.00 107.26 ? 43  VAL B O   1 
ATOM   4864 C  CB  . VAL E 2 5   ? -35.988  55.752  -45.502 1.00 107.96 ? 43  VAL B CB  1 
ATOM   4865 C  CG1 . VAL E 2 5   ? -37.465  55.355  -45.573 1.00 109.34 ? 43  VAL B CG1 1 
ATOM   4866 C  CG2 . VAL E 2 5   ? -35.849  57.256  -45.270 1.00 105.73 ? 43  VAL B CG2 1 
ATOM   4867 N  N   . MET E 2 6   ? -34.635  52.834  -45.471 1.00 96.51  ? 44  MET B N   1 
ATOM   4868 C  CA  . MET E 2 6   ? -34.676  51.394  -45.742 1.00 89.25  ? 44  MET B CA  1 
ATOM   4869 C  C   . MET E 2 6   ? -34.483  50.533  -44.484 1.00 85.98  ? 44  MET B C   1 
ATOM   4870 O  O   . MET E 2 6   ? -35.149  49.519  -44.335 1.00 87.02  ? 44  MET B O   1 
ATOM   4871 C  CB  . MET E 2 6   ? -33.620  51.034  -46.796 1.00 88.68  ? 44  MET B CB  1 
ATOM   4872 C  CG  . MET E 2 6   ? -33.572  49.552  -47.151 1.00 88.86  ? 44  MET B CG  1 
ATOM   4873 S  SD  . MET E 2 6   ? -32.611  49.162  -48.622 1.00 91.86  ? 44  MET B SD  1 
ATOM   4874 C  CE  . MET E 2 6   ? -30.965  49.684  -48.125 1.00 94.29  ? 44  MET B CE  1 
ATOM   4875 N  N   . SER E 2 7   ? -33.572  50.931  -43.597 1.00 85.20  ? 45  SER B N   1 
ATOM   4876 C  CA  . SER E 2 7   ? -33.304  50.180  -42.353 1.00 83.45  ? 45  SER B CA  1 
ATOM   4877 C  C   . SER E 2 7   ? -34.431  50.330  -41.333 1.00 81.41  ? 45  SER B C   1 
ATOM   4878 O  O   . SER E 2 7   ? -34.783  49.369  -40.662 1.00 76.50  ? 45  SER B O   1 
ATOM   4879 C  CB  . SER E 2 7   ? -31.966  50.601  -41.726 1.00 81.95  ? 45  SER B CB  1 
ATOM   4880 O  OG  . SER E 2 7   ? -31.896  52.008  -41.549 1.00 83.06  ? 45  SER B OG  1 
ATOM   4881 N  N   . LEU E 2 8   ? -34.977  51.541  -41.220 1.00 83.29  ? 46  LEU B N   1 
ATOM   4882 C  CA  . LEU E 2 8   ? -36.185  51.813  -40.417 1.00 83.98  ? 46  LEU B CA  1 
ATOM   4883 C  C   . LEU E 2 8   ? -37.390  50.976  -40.877 1.00 80.94  ? 46  LEU B C   1 
ATOM   4884 O  O   . LEU E 2 8   ? -38.215  50.556  -40.066 1.00 79.69  ? 46  LEU B O   1 
ATOM   4885 C  CB  . LEU E 2 8   ? -36.537  53.306  -40.506 1.00 88.93  ? 46  LEU B CB  1 
ATOM   4886 C  CG  . LEU E 2 8   ? -37.769  53.836  -39.764 1.00 91.92  ? 46  LEU B CG  1 
ATOM   4887 C  CD1 . LEU E 2 8   ? -37.523  53.863  -38.259 1.00 93.52  ? 46  LEU B CD1 1 
ATOM   4888 C  CD2 . LEU E 2 8   ? -38.120  55.227  -40.283 1.00 91.16  ? 46  LEU B CD2 1 
ATOM   4889 N  N   . LEU E 2 9   ? -37.481  50.758  -42.185 1.00 77.58  ? 47  LEU B N   1 
ATOM   4890 C  CA  . LEU E 2 9   ? -38.567  49.982  -42.789 1.00 73.09  ? 47  LEU B CA  1 
ATOM   4891 C  C   . LEU E 2 9   ? -38.458  48.471  -42.510 1.00 68.88  ? 47  LEU B C   1 
ATOM   4892 O  O   . LEU E 2 9   ? -39.472  47.782  -42.460 1.00 71.06  ? 47  LEU B O   1 
ATOM   4893 C  CB  . LEU E 2 9   ? -38.629  50.238  -44.300 1.00 74.72  ? 47  LEU B CB  1 
ATOM   4894 C  CG  . LEU E 2 9   ? -40.027  50.560  -44.842 1.00 78.40  ? 47  LEU B CG  1 
ATOM   4895 C  CD1 . LEU E 2 9   ? -40.468  51.964  -44.435 1.00 76.75  ? 47  LEU B CD1 1 
ATOM   4896 C  CD2 . LEU E 2 9   ? -40.049  50.407  -46.356 1.00 81.60  ? 47  LEU B CD2 1 
ATOM   4897 N  N   . MET E 2 10  ? -37.241  47.957  -42.345 1.00 66.00  ? 48  MET B N   1 
ATOM   4898 C  CA  . MET E 2 10  ? -37.035  46.560  -41.925 1.00 64.30  ? 48  MET B CA  1 
ATOM   4899 C  C   . MET E 2 10  ? -37.422  46.375  -40.461 1.00 61.94  ? 48  MET B C   1 
ATOM   4900 O  O   . MET E 2 10  ? -37.986  45.359  -40.091 1.00 61.67  ? 48  MET B O   1 
ATOM   4901 C  CB  . MET E 2 10  ? -35.578  46.128  -42.121 1.00 65.53  ? 48  MET B CB  1 
ATOM   4902 C  CG  . MET E 2 10  ? -35.101  46.133  -43.562 1.00 66.36  ? 48  MET B CG  1 
ATOM   4903 S  SD  . MET E 2 10  ? -33.319  45.891  -43.697 1.00 67.56  ? 48  MET B SD  1 
ATOM   4904 C  CE  . MET E 2 10  ? -33.096  46.125  -45.448 1.00 70.90  ? 48  MET B CE  1 
ATOM   4905 N  N   . ALA E 2 11  ? -37.106  47.362  -39.633 1.00 61.54  ? 49  ALA B N   1 
ATOM   4906 C  CA  . ALA E 2 11  ? -37.418  47.316  -38.208 1.00 62.73  ? 49  ALA B CA  1 
ATOM   4907 C  C   . ALA E 2 11  ? -38.914  47.198  -37.946 1.00 65.59  ? 49  ALA B C   1 
ATOM   4908 O  O   . ALA E 2 11  ? -39.319  46.375  -37.133 1.00 69.99  ? 49  ALA B O   1 
ATOM   4909 C  CB  . ALA E 2 11  ? -36.860  48.540  -37.500 1.00 63.54  ? 49  ALA B CB  1 
ATOM   4910 N  N   . LEU E 2 12  ? -39.735  48.005  -38.618 1.00 66.15  ? 50  LEU B N   1 
ATOM   4911 C  CA  . LEU E 2 12  ? -41.191  47.927  -38.416 1.00 67.43  ? 50  LEU B CA  1 
ATOM   4912 C  C   . LEU E 2 12  ? -41.743  46.600  -38.958 1.00 64.72  ? 50  LEU B C   1 
ATOM   4913 O  O   . LEU E 2 12  ? -42.634  46.010  -38.339 1.00 68.00  ? 50  LEU B O   1 
ATOM   4914 C  CB  . LEU E 2 12  ? -41.943  49.150  -38.981 1.00 70.44  ? 50  LEU B CB  1 
ATOM   4915 C  CG  . LEU E 2 12  ? -42.085  49.372  -40.497 1.00 75.73  ? 50  LEU B CG  1 
ATOM   4916 C  CD1 . LEU E 2 12  ? -43.293  48.652  -41.115 1.00 76.30  ? 50  LEU B CD1 1 
ATOM   4917 C  CD2 . LEU E 2 12  ? -42.179  50.868  -40.789 1.00 77.11  ? 50  LEU B CD2 1 
ATOM   4918 N  N   . VAL E 2 13  ? -41.205  46.124  -40.084 1.00 58.33  ? 51  VAL B N   1 
ATOM   4919 C  CA  . VAL E 2 13  ? -41.621  44.836  -40.656 1.00 54.24  ? 51  VAL B CA  1 
ATOM   4920 C  C   . VAL E 2 13  ? -41.468  43.733  -39.608 1.00 52.26  ? 51  VAL B C   1 
ATOM   4921 O  O   . VAL E 2 13  ? -42.427  43.021  -39.330 1.00 54.67  ? 51  VAL B O   1 
ATOM   4922 C  CB  . VAL E 2 13  ? -40.859  44.489  -41.968 1.00 53.00  ? 51  VAL B CB  1 
ATOM   4923 C  CG1 . VAL E 2 13  ? -40.971  43.004  -42.327 1.00 51.35  ? 51  VAL B CG1 1 
ATOM   4924 C  CG2 . VAL E 2 13  ? -41.373  45.345  -43.117 1.00 53.22  ? 51  VAL B CG2 1 
ATOM   4925 N  N   . VAL E 2 14  ? -40.289  43.621  -39.006 1.00 48.26  ? 52  VAL B N   1 
ATOM   4926 C  CA  . VAL E 2 14  ? -40.060  42.639  -37.939 1.00 47.10  ? 52  VAL B CA  1 
ATOM   4927 C  C   . VAL E 2 14  ? -41.007  42.874  -36.757 1.00 47.09  ? 52  VAL B C   1 
ATOM   4928 O  O   . VAL E 2 14  ? -41.551  41.924  -36.203 1.00 47.83  ? 52  VAL B O   1 
ATOM   4929 C  CB  . VAL E 2 14  ? -38.586  42.647  -37.462 1.00 46.34  ? 52  VAL B CB  1 
ATOM   4930 C  CG1 . VAL E 2 14  ? -38.390  41.862  -36.163 1.00 45.23  ? 52  VAL B CG1 1 
ATOM   4931 C  CG2 . VAL E 2 14  ? -37.682  42.101  -38.565 1.00 47.48  ? 52  VAL B CG2 1 
ATOM   4932 N  N   . LEU E 2 15  ? -41.204  44.133  -36.378 1.00 46.22  ? 53  LEU B N   1 
ATOM   4933 C  CA  . LEU E 2 15  ? -42.074  44.468  -35.247 1.00 46.19  ? 53  LEU B CA  1 
ATOM   4934 C  C   . LEU E 2 15  ? -43.505  44.009  -35.486 1.00 43.95  ? 53  LEU B C   1 
ATOM   4935 O  O   . LEU E 2 15  ? -44.116  43.405  -34.617 1.00 44.55  ? 53  LEU B O   1 
ATOM   4936 C  CB  . LEU E 2 15  ? -42.066  45.972  -34.967 1.00 48.70  ? 53  LEU B CB  1 
ATOM   4937 C  CG  . LEU E 2 15  ? -42.731  46.355  -33.630 1.00 50.16  ? 53  LEU B CG  1 
ATOM   4938 C  CD1 . LEU E 2 15  ? -41.738  46.188  -32.484 1.00 49.96  ? 53  LEU B CD1 1 
ATOM   4939 C  CD2 . LEU E 2 15  ? -43.304  47.763  -33.660 1.00 51.05  ? 53  LEU B CD2 1 
ATOM   4940 N  N   . LEU E 2 16  ? -44.028  44.311  -36.661 1.00 41.17  ? 54  LEU B N   1 
ATOM   4941 C  CA  . LEU E 2 16  ? -45.375  43.892  -37.034 1.00 39.21  ? 54  LEU B CA  1 
ATOM   4942 C  C   . LEU E 2 16  ? -45.516  42.370  -37.070 1.00 38.32  ? 54  LEU B C   1 
ATOM   4943 O  O   . LEU E 2 16  ? -46.486  41.830  -36.545 1.00 38.65  ? 54  LEU B O   1 
ATOM   4944 C  CB  . LEU E 2 16  ? -45.762  44.469  -38.395 1.00 38.48  ? 54  LEU B CB  1 
ATOM   4945 C  CG  . LEU E 2 16  ? -45.946  45.996  -38.424 1.00 38.23  ? 54  LEU B CG  1 
ATOM   4946 C  CD1 . LEU E 2 16  ? -46.078  46.499  -39.856 1.00 38.71  ? 54  LEU B CD1 1 
ATOM   4947 C  CD2 . LEU E 2 16  ? -47.147  46.439  -37.595 1.00 37.54  ? 54  LEU B CD2 1 
ATOM   4948 N  N   . ILE E 2 17  ? -44.555  41.684  -37.685 1.00 36.11  ? 55  ILE B N   1 
ATOM   4949 C  CA  . ILE E 2 17  ? -44.611  40.227  -37.774 1.00 34.77  ? 55  ILE B CA  1 
ATOM   4950 C  C   . ILE E 2 17  ? -44.625  39.599  -36.390 1.00 32.60  ? 55  ILE B C   1 
ATOM   4951 O  O   . ILE E 2 17  ? -45.485  38.779  -36.101 1.00 33.13  ? 55  ILE B O   1 
ATOM   4952 C  CB  . ILE E 2 17  ? -43.448  39.637  -38.600 1.00 36.09  ? 55  ILE B CB  1 
ATOM   4953 C  CG1 . ILE E 2 17  ? -43.615  40.013  -40.074 1.00 36.88  ? 55  ILE B CG1 1 
ATOM   4954 C  CG2 . ILE E 2 17  ? -43.384  38.107  -38.458 1.00 36.79  ? 55  ILE B CG2 1 
ATOM   4955 C  CD1 . ILE E 2 17  ? -42.417  39.675  -40.939 1.00 38.93  ? 55  ILE B CD1 1 
ATOM   4956 N  N   . VAL E 2 18  ? -43.685  39.979  -35.536 1.00 31.86  ? 56  VAL B N   1 
ATOM   4957 C  CA  . VAL E 2 18  ? -43.565  39.315  -34.240 1.00 33.03  ? 56  VAL B CA  1 
ATOM   4958 C  C   . VAL E 2 18  ? -44.745  39.701  -33.368 1.00 34.17  ? 56  VAL B C   1 
ATOM   4959 O  O   . VAL E 2 18  ? -45.368  38.833  -32.774 1.00 36.52  ? 56  VAL B O   1 
ATOM   4960 C  CB  . VAL E 2 18  ? -42.243  39.609  -33.515 1.00 33.39  ? 56  VAL B CB  1 
ATOM   4961 C  CG1 . VAL E 2 18  ? -42.205  38.921  -32.144 1.00 33.37  ? 56  VAL B CG1 1 
ATOM   4962 C  CG2 . VAL E 2 18  ? -41.059  39.158  -34.371 1.00 33.87  ? 56  VAL B CG2 1 
ATOM   4963 N  N   . ALA E 2 19  ? -45.071  40.989  -33.315 1.00 33.36  ? 57  ALA B N   1 
ATOM   4964 C  CA  . ALA E 2 19  ? -46.202  41.456  -32.508 1.00 31.90  ? 57  ALA B CA  1 
ATOM   4965 C  C   . ALA E 2 19  ? -47.475  40.718  -32.888 1.00 31.83  ? 57  ALA B C   1 
ATOM   4966 O  O   . ALA E 2 19  ? -48.037  39.991  -32.073 1.00 31.23  ? 57  ALA B O   1 
ATOM   4967 C  CB  . ALA E 2 19  ? -46.394  42.959  -32.658 1.00 32.04  ? 57  ALA B CB  1 
ATOM   4968 N  N   . GLY E 2 20  ? -47.891  40.874  -34.141 1.00 32.07  ? 58  GLY B N   1 
ATOM   4969 C  CA  . GLY E 2 20  ? -49.100  40.245  -34.658 1.00 31.49  ? 58  GLY B CA  1 
ATOM   4970 C  C   . GLY E 2 20  ? -49.161  38.763  -34.341 1.00 31.31  ? 58  GLY B C   1 
ATOM   4971 O  O   . GLY E 2 20  ? -50.070  38.319  -33.636 1.00 32.12  ? 58  GLY B O   1 
ATOM   4972 N  N   . ASN E 2 21  ? -48.169  38.008  -34.810 1.00 30.09  ? 59  ASN B N   1 
ATOM   4973 C  CA  . ASN E 2 21  ? -48.210  36.552  -34.688 1.00 29.91  ? 59  ASN B CA  1 
ATOM   4974 C  C   . ASN E 2 21  ? -48.151  36.067  -33.234 1.00 30.59  ? 59  ASN B C   1 
ATOM   4975 O  O   . ASN E 2 21  ? -48.816  35.090  -32.891 1.00 31.82  ? 59  ASN B O   1 
ATOM   4976 C  CB  . ASN E 2 21  ? -47.136  35.889  -35.558 1.00 29.70  ? 59  ASN B CB  1 
ATOM   4977 C  CG  . ASN E 2 21  ? -47.494  35.922  -37.043 1.00 29.72  ? 59  ASN B CG  1 
ATOM   4978 O  OD1 . ASN E 2 21  ? -48.465  35.286  -37.479 1.00 29.59  ? 59  ASN B OD1 1 
ATOM   4979 N  ND2 . ASN E 2 21  ? -46.718  36.669  -37.827 1.00 29.33  ? 59  ASN B ND2 1 
ATOM   4980 N  N   . VAL E 2 22  ? -47.392  36.758  -32.381 1.00 30.07  ? 60  VAL B N   1 
ATOM   4981 C  CA  . VAL E 2 22  ? -47.392  36.467  -30.934 1.00 29.86  ? 60  VAL B CA  1 
ATOM   4982 C  C   . VAL E 2 22  ? -48.771  36.712  -30.315 1.00 30.18  ? 60  VAL B C   1 
ATOM   4983 O  O   . VAL E 2 22  ? -49.222  35.981  -29.438 1.00 29.71  ? 60  VAL B O   1 
ATOM   4984 C  CB  . VAL E 2 22  ? -46.320  37.295  -30.192 1.00 30.51  ? 60  VAL B CB  1 
ATOM   4985 C  CG1 . VAL E 2 22  ? -46.519  37.271  -28.675 1.00 30.80  ? 60  VAL B CG1 1 
ATOM   4986 C  CG2 . VAL E 2 22  ? -44.930  36.773  -30.556 1.00 31.19  ? 60  VAL B CG2 1 
ATOM   4987 N  N   . LEU E 2 23  ? -49.438  37.749  -30.785 1.00 30.71  ? 61  LEU B N   1 
ATOM   4988 C  CA  . LEU E 2 23  ? -50.766  38.112  -30.289 1.00 30.83  ? 61  LEU B CA  1 
ATOM   4989 C  C   . LEU E 2 23  ? -51.827  37.074  -30.653 1.00 27.79  ? 61  LEU B C   1 
ATOM   4990 O  O   . LEU E 2 23  ? -52.709  36.792  -29.863 1.00 26.38  ? 61  LEU B O   1 
ATOM   4991 C  CB  . LEU E 2 23  ? -51.144  39.505  -30.820 1.00 34.27  ? 61  LEU B CB  1 
ATOM   4992 C  CG  . LEU E 2 23  ? -51.721  40.537  -29.835 1.00 37.05  ? 61  LEU B CG  1 
ATOM   4993 C  CD1 . LEU E 2 23  ? -51.059  40.548  -28.447 1.00 36.60  ? 61  LEU B CD1 1 
ATOM   4994 C  CD2 . LEU E 2 23  ? -51.599  41.928  -30.480 1.00 37.60  ? 61  LEU B CD2 1 
ATOM   4995 N  N   . VAL E 2 24  ? -51.700  36.491  -31.840 1.00 26.21  ? 62  VAL B N   1 
ATOM   4996 C  CA  . VAL E 2 24  ? -52.584  35.413  -32.314 1.00 25.04  ? 62  VAL B CA  1 
ATOM   4997 C  C   . VAL E 2 24  ? -52.410  34.133  -31.499 1.00 24.99  ? 62  VAL B C   1 
ATOM   4998 O  O   . VAL E 2 24  ? -53.369  33.574  -31.000 1.00 24.26  ? 62  VAL B O   1 
ATOM   4999 C  CB  . VAL E 2 24  ? -52.311  35.068  -33.792 1.00 23.92  ? 62  VAL B CB  1 
ATOM   5000 C  CG1 . VAL E 2 24  ? -53.075  33.821  -34.219 1.00 23.52  ? 62  VAL B CG1 1 
ATOM   5001 C  CG2 . VAL E 2 24  ? -52.657  36.237  -34.692 1.00 23.77  ? 62  VAL B CG2 1 
ATOM   5002 N  N   . ILE E 2 25  ? -51.178  33.666  -31.392 1.00 26.22  ? 63  ILE B N   1 
ATOM   5003 C  CA  . ILE E 2 25  ? -50.883  32.452  -30.633 1.00 27.35  ? 63  ILE B CA  1 
ATOM   5004 C  C   . ILE E 2 25  ? -51.330  32.627  -29.177 1.00 28.21  ? 63  ILE B C   1 
ATOM   5005 O  O   . ILE E 2 25  ? -51.876  31.707  -28.576 1.00 28.42  ? 63  ILE B O   1 
ATOM   5006 C  CB  . ILE E 2 25  ? -49.387  32.103  -30.669 1.00 27.83  ? 63  ILE B CB  1 
ATOM   5007 C  CG1 . ILE E 2 25  ? -48.951  31.772  -32.104 1.00 28.86  ? 63  ILE B CG1 1 
ATOM   5008 C  CG2 . ILE E 2 25  ? -49.090  30.921  -29.760 1.00 27.95  ? 63  ILE B CG2 1 
ATOM   5009 C  CD1 . ILE E 2 25  ? -47.453  31.898  -32.352 1.00 28.95  ? 63  ILE B CD1 1 
ATOM   5010 N  N   . ALA E 2 26  ? -51.088  33.811  -28.624 1.00 28.57  ? 64  ALA B N   1 
ATOM   5011 C  CA  . ALA E 2 26  ? -51.528  34.142  -27.277 1.00 28.68  ? 64  ALA B CA  1 
ATOM   5012 C  C   . ALA E 2 26  ? -53.031  34.022  -27.146 1.00 29.49  ? 64  ALA B C   1 
ATOM   5013 O  O   . ALA E 2 26  ? -53.531  33.374  -26.228 1.00 31.54  ? 64  ALA B O   1 
ATOM   5014 C  CB  . ALA E 2 26  ? -51.103  35.549  -26.914 1.00 29.21  ? 64  ALA B CB  1 
ATOM   5015 N  N   . ALA E 2 27  ? -53.742  34.648  -28.079 1.00 28.86  ? 65  ALA B N   1 
ATOM   5016 C  CA  . ALA E 2 27  ? -55.203  34.658  -28.080 1.00 27.27  ? 65  ALA B CA  1 
ATOM   5017 C  C   . ALA E 2 27  ? -55.743  33.243  -28.084 1.00 26.93  ? 65  ALA B C   1 
ATOM   5018 O  O   . ALA E 2 27  ? -56.589  32.891  -27.276 1.00 28.46  ? 65  ALA B O   1 
ATOM   5019 C  CB  . ALA E 2 27  ? -55.731  35.420  -29.290 1.00 26.95  ? 65  ALA B CB  1 
ATOM   5020 N  N   . ILE E 2 28  ? -55.217  32.428  -28.985 1.00 26.34  ? 66  ILE B N   1 
ATOM   5021 C  CA  . ILE E 2 28  ? -55.697  31.071  -29.172 1.00 26.21  ? 66  ILE B CA  1 
ATOM   5022 C  C   . ILE E 2 28  ? -55.373  30.224  -27.956 1.00 26.38  ? 66  ILE B C   1 
ATOM   5023 O  O   . ILE E 2 28  ? -56.219  29.521  -27.453 1.00 27.18  ? 66  ILE B O   1 
ATOM   5024 C  CB  . ILE E 2 28  ? -55.092  30.449  -30.443 1.00 25.69  ? 66  ILE B CB  1 
ATOM   5025 C  CG1 . ILE E 2 28  ? -55.606  31.197  -31.688 1.00 25.26  ? 66  ILE B CG1 1 
ATOM   5026 C  CG2 . ILE E 2 28  ? -55.415  28.962  -30.542 1.00 25.76  ? 66  ILE B CG2 1 
ATOM   5027 C  CD1 . ILE E 2 28  ? -54.759  30.953  -32.911 1.00 25.90  ? 66  ILE B CD1 1 
ATOM   5028 N  N   . GLY E 2 29  ? -54.150  30.301  -27.481 1.00 28.22  ? 67  GLY B N   1 
ATOM   5029 C  CA  . GLY E 2 29  ? -53.731  29.501  -26.334 1.00 31.16  ? 67  GLY B CA  1 
ATOM   5030 C  C   . GLY E 2 29  ? -54.443  29.826  -25.033 1.00 33.27  ? 67  GLY B C   1 
ATOM   5031 O  O   . GLY E 2 29  ? -54.621  28.950  -24.187 1.00 33.29  ? 67  GLY B O   1 
ATOM   5032 N  N   . SER E 2 30  ? -54.842  31.087  -24.883 1.00 36.52  ? 68  SER B N   1 
ATOM   5033 C  CA  . SER E 2 30  ? -55.436  31.587  -23.647 1.00 38.95  ? 68  SER B CA  1 
ATOM   5034 C  C   . SER E 2 30  ? -56.964  31.485  -23.616 1.00 39.73  ? 68  SER B C   1 
ATOM   5035 O  O   . SER E 2 30  ? -57.549  31.440  -22.542 1.00 40.47  ? 68  SER B O   1 
ATOM   5036 C  CB  . SER E 2 30  ? -55.015  33.041  -23.430 1.00 40.37  ? 68  SER B CB  1 
ATOM   5037 O  OG  . SER E 2 30  ? -55.425  33.861  -24.517 1.00 42.08  ? 68  SER B OG  1 
ATOM   5038 N  N   . THR E 2 31  ? -57.601  31.449  -24.781 1.00 41.71  ? 69  THR B N   1 
ATOM   5039 C  CA  . THR E 2 31  ? -59.056  31.465  -24.882 1.00 44.51  ? 69  THR B CA  1 
ATOM   5040 C  C   . THR E 2 31  ? -59.613  30.107  -25.335 1.00 46.99  ? 69  THR B C   1 
ATOM   5041 O  O   . THR E 2 31  ? -59.333  29.654  -26.444 1.00 45.52  ? 69  THR B O   1 
ATOM   5042 C  CB  . THR E 2 31  ? -59.496  32.552  -25.874 1.00 45.33  ? 69  THR B CB  1 
ATOM   5043 O  OG1 . THR E 2 31  ? -58.896  33.806  -25.508 1.00 44.97  ? 69  THR B OG1 1 
ATOM   5044 C  CG2 . THR E 2 31  ? -61.016  32.691  -25.890 1.00 46.10  ? 69  THR B CG2 1 
ATOM   5045 N  N   . GLN E 2 32  ? -60.434  29.486  -24.490 1.00 52.22  ? 70  GLN B N   1 
ATOM   5046 C  CA  . GLN E 2 32  ? -61.033  28.177  -24.787 1.00 55.72  ? 70  GLN B CA  1 
ATOM   5047 C  C   . GLN E 2 32  ? -61.916  28.265  -26.024 1.00 52.60  ? 70  GLN B C   1 
ATOM   5048 O  O   . GLN E 2 32  ? -61.972  27.343  -26.829 1.00 49.80  ? 70  GLN B O   1 
ATOM   5049 C  CB  . GLN E 2 32  ? -61.867  27.662  -23.598 1.00 62.82  ? 70  GLN B CB  1 
ATOM   5050 C  CG  . GLN E 2 32  ? -62.288  26.183  -23.681 1.00 68.64  ? 70  GLN B CG  1 
ATOM   5051 C  CD  . GLN E 2 32  ? -61.179  25.201  -23.286 1.00 75.32  ? 70  GLN B CD  1 
ATOM   5052 O  OE1 . GLN E 2 32  ? -60.333  25.525  -22.451 1.00 79.99  ? 70  GLN B OE1 1 
ATOM   5053 N  NE2 . GLN E 2 32  ? -61.171  24.009  -23.899 1.00 77.85  ? 70  GLN B NE2 1 
ATOM   5054 N  N   . ARG E 2 33  ? -62.605  29.390  -26.158 1.00 53.06  ? 71  ARG B N   1 
ATOM   5055 C  CA  . ARG E 2 33  ? -63.492  29.631  -27.287 1.00 55.95  ? 71  ARG B CA  1 
ATOM   5056 C  C   . ARG E 2 33  ? -62.767  29.662  -28.647 1.00 50.89  ? 71  ARG B C   1 
ATOM   5057 O  O   . ARG E 2 33  ? -63.366  29.331  -29.672 1.00 49.86  ? 71  ARG B O   1 
ATOM   5058 C  CB  . ARG E 2 33  ? -64.278  30.936  -27.056 1.00 62.54  ? 71  ARG B CB  1 
ATOM   5059 C  CG  . ARG E 2 33  ? -65.316  31.288  -28.126 1.00 70.02  ? 71  ARG B CG  1 
ATOM   5060 C  CD  . ARG E 2 33  ? -66.471  30.292  -28.193 1.00 74.97  ? 71  ARG B CD  1 
ATOM   5061 N  NE  . ARG E 2 33  ? -67.207  30.276  -26.928 1.00 80.32  ? 71  ARG B NE  1 
ATOM   5062 C  CZ  . ARG E 2 33  ? -68.178  31.126  -26.577 1.00 80.16  ? 71  ARG B CZ  1 
ATOM   5063 N  NH1 . ARG E 2 33  ? -68.597  32.092  -27.403 1.00 79.36  ? 71  ARG B NH1 1 
ATOM   5064 N  NH2 . ARG E 2 33  ? -68.750  30.999  -25.379 1.00 79.05  ? 71  ARG B NH2 1 
ATOM   5065 N  N   . LEU E 2 34  ? -61.496  30.065  -28.657 1.00 47.00  ? 72  LEU B N   1 
ATOM   5066 C  CA  . LEU E 2 34  ? -60.724  30.179  -29.910 1.00 42.00  ? 72  LEU B CA  1 
ATOM   5067 C  C   . LEU E 2 34  ? -60.111  28.861  -30.355 1.00 39.62  ? 72  LEU B C   1 
ATOM   5068 O  O   . LEU E 2 34  ? -59.702  28.743  -31.502 1.00 38.23  ? 72  LEU B O   1 
ATOM   5069 C  CB  . LEU E 2 34  ? -59.627  31.255  -29.797 1.00 39.69  ? 72  LEU B CB  1 
ATOM   5070 C  CG  . LEU E 2 34  ? -60.102  32.707  -29.906 1.00 38.61  ? 72  LEU B CG  1 
ATOM   5071 C  CD1 . LEU E 2 34  ? -58.936  33.641  -29.599 1.00 38.46  ? 72  LEU B CD1 1 
ATOM   5072 C  CD2 . LEU E 2 34  ? -60.712  33.002  -31.275 1.00 37.76  ? 72  LEU B CD2 1 
ATOM   5073 N  N   . GLN E 2 35  ? -60.072  27.866  -29.475 1.00 38.75  ? 73  GLN B N   1 
ATOM   5074 C  CA  . GLN E 2 35  ? -59.421  26.600  -29.784 1.00 38.44  ? 73  GLN B CA  1 
ATOM   5075 C  C   . GLN E 2 35  ? -60.312  25.716  -30.645 1.00 38.69  ? 73  GLN B C   1 
ATOM   5076 O  O   . GLN E 2 35  ? -60.730  24.649  -30.216 1.00 36.36  ? 73  GLN B O   1 
ATOM   5077 C  CB  . GLN E 2 35  ? -59.015  25.895  -28.491 1.00 38.37  ? 73  GLN B CB  1 
ATOM   5078 C  CG  . GLN E 2 35  ? -57.982  26.680  -27.695 1.00 39.08  ? 73  GLN B CG  1 
ATOM   5079 C  CD  . GLN E 2 35  ? -57.826  26.206  -26.266 1.00 39.70  ? 73  GLN B CD  1 
ATOM   5080 O  OE1 . GLN E 2 35  ? -58.342  25.154  -25.890 1.00 43.91  ? 73  GLN B OE1 1 
ATOM   5081 N  NE2 . GLN E 2 35  ? -57.106  26.989  -25.454 1.00 37.60  ? 73  GLN B NE2 1 
ATOM   5082 N  N   . THR E 2 36  ? -60.578  26.170  -31.869 1.00 42.08  ? 74  THR B N   1 
ATOM   5083 C  CA  . THR E 2 36  ? -61.372  25.422  -32.848 1.00 47.23  ? 74  THR B CA  1 
ATOM   5084 C  C   . THR E 2 36  ? -60.452  24.662  -33.807 1.00 51.21  ? 74  THR B C   1 
ATOM   5085 O  O   . THR E 2 36  ? -59.228  24.679  -33.645 1.00 56.88  ? 74  THR B O   1 
ATOM   5086 C  CB  . THR E 2 36  ? -62.347  26.342  -33.637 1.00 47.70  ? 74  THR B CB  1 
ATOM   5087 O  OG1 . THR E 2 36  ? -61.642  27.103  -34.623 1.00 47.56  ? 74  THR B OG1 1 
ATOM   5088 C  CG2 . THR E 2 36  ? -63.078  27.279  -32.700 1.00 48.35  ? 74  THR B CG2 1 
ATOM   5089 N  N   . LEU E 2 37  ? -61.051  23.990  -34.791 1.00 54.83  ? 75  LEU B N   1 
ATOM   5090 C  CA  . LEU E 2 37  ? -60.321  23.167  -35.755 1.00 55.72  ? 75  LEU B CA  1 
ATOM   5091 C  C   . LEU E 2 37  ? -59.569  24.057  -36.751 1.00 50.73  ? 75  LEU B C   1 
ATOM   5092 O  O   . LEU E 2 37  ? -58.375  23.852  -36.995 1.00 52.62  ? 75  LEU B O   1 
ATOM   5093 C  CB  . LEU E 2 37  ? -61.287  22.223  -36.481 1.00 62.30  ? 75  LEU B CB  1 
ATOM   5094 C  CG  . LEU E 2 37  ? -60.720  20.894  -36.997 1.00 66.75  ? 75  LEU B CG  1 
ATOM   5095 C  CD1 . LEU E 2 37  ? -61.811  19.870  -37.294 1.00 69.44  ? 75  LEU B CD1 1 
ATOM   5096 C  CD2 . LEU E 2 37  ? -59.885  21.093  -38.247 1.00 68.30  ? 75  LEU B CD2 1 
ATOM   5097 N  N   . THR E 2 38  ? -60.276  25.042  -37.309 1.00 44.75  ? 76  THR B N   1 
ATOM   5098 C  CA  . THR E 2 38  ? -59.679  26.005  -38.229 1.00 42.90  ? 76  THR B CA  1 
ATOM   5099 C  C   . THR E 2 38  ? -58.528  26.743  -37.557 1.00 39.98  ? 76  THR B C   1 
ATOM   5100 O  O   . THR E 2 38  ? -57.443  26.821  -38.117 1.00 41.03  ? 76  THR B O   1 
ATOM   5101 C  CB  . THR E 2 38  ? -60.708  27.032  -38.723 1.00 43.87  ? 76  THR B CB  1 
ATOM   5102 O  OG1 . THR E 2 38  ? -61.708  26.364  -39.495 1.00 44.48  ? 76  THR B OG1 1 
ATOM   5103 C  CG2 . THR E 2 38  ? -60.050  28.123  -39.577 1.00 44.64  ? 76  THR B CG2 1 
ATOM   5104 N  N   . ASN E 2 39  ? -58.765  27.257  -36.356 1.00 36.55  ? 77  ASN B N   1 
ATOM   5105 C  CA  . ASN E 2 39  ? -57.721  27.964  -35.605 1.00 36.13  ? 77  ASN B CA  1 
ATOM   5106 C  C   . ASN E 2 39  ? -56.492  27.111  -35.212 1.00 36.31  ? 77  ASN B C   1 
ATOM   5107 O  O   . ASN E 2 39  ? -55.445  27.651  -34.848 1.00 35.89  ? 77  ASN B O   1 
ATOM   5108 C  CB  . ASN E 2 39  ? -58.308  28.636  -34.362 1.00 35.10  ? 77  ASN B CB  1 
ATOM   5109 C  CG  . ASN E 2 39  ? -59.178  29.841  -34.693 1.00 33.68  ? 77  ASN B CG  1 
ATOM   5110 O  OD1 . ASN E 2 39  ? -59.381  30.203  -35.860 1.00 30.69  ? 77  ASN B OD1 1 
ATOM   5111 N  ND2 . ASN E 2 39  ? -59.698  30.476  -33.647 1.00 34.43  ? 77  ASN B ND2 1 
ATOM   5112 N  N   . LEU E 2 40  ? -56.631  25.792  -35.279 1.00 37.42  ? 78  LEU B N   1 
ATOM   5113 C  CA  . LEU E 2 40  ? -55.485  24.882  -35.197 1.00 38.47  ? 78  LEU B CA  1 
ATOM   5114 C  C   . LEU E 2 40  ? -54.532  25.116  -36.378 1.00 36.00  ? 78  LEU B C   1 
ATOM   5115 O  O   . LEU E 2 40  ? -53.320  25.289  -36.189 1.00 32.97  ? 78  LEU B O   1 
ATOM   5116 C  CB  . LEU E 2 40  ? -55.960  23.425  -35.181 1.00 41.79  ? 78  LEU B CB  1 
ATOM   5117 C  CG  . LEU E 2 40  ? -55.229  22.515  -34.193 1.00 44.46  ? 78  LEU B CG  1 
ATOM   5118 C  CD1 . LEU E 2 40  ? -55.419  22.989  -32.745 1.00 45.42  ? 78  LEU B CD1 1 
ATOM   5119 C  CD2 . LEU E 2 40  ? -55.753  21.095  -34.380 1.00 45.24  ? 78  LEU B CD2 1 
ATOM   5120 N  N   . PHE E 2 41  ? -55.098  25.141  -37.588 1.00 33.91  ? 79  PHE B N   1 
ATOM   5121 C  CA  . PHE E 2 41  ? -54.345  25.501  -38.791 1.00 32.07  ? 79  PHE B CA  1 
ATOM   5122 C  C   . PHE E 2 41  ? -53.812  26.923  -38.698 1.00 31.52  ? 79  PHE B C   1 
ATOM   5123 O  O   . PHE E 2 41  ? -52.653  27.146  -39.012 1.00 34.26  ? 79  PHE B O   1 
ATOM   5124 C  CB  . PHE E 2 41  ? -55.180  25.347  -40.064 1.00 31.09  ? 79  PHE B CB  1 
ATOM   5125 C  CG  . PHE E 2 41  ? -55.666  23.948  -40.302 1.00 31.39  ? 79  PHE B CG  1 
ATOM   5126 C  CD1 . PHE E 2 41  ? -54.780  22.867  -40.279 1.00 31.90  ? 79  PHE B CD1 1 
ATOM   5127 C  CD2 . PHE E 2 41  ? -57.009  23.701  -40.561 1.00 31.52  ? 79  PHE B CD2 1 
ATOM   5128 C  CE1 . PHE E 2 41  ? -55.225  21.576  -40.489 1.00 32.30  ? 79  PHE B CE1 1 
ATOM   5129 C  CE2 . PHE E 2 41  ? -57.463  22.411  -40.787 1.00 31.85  ? 79  PHE B CE2 1 
ATOM   5130 C  CZ  . PHE E 2 41  ? -56.572  21.339  -40.738 1.00 32.41  ? 79  PHE B CZ  1 
ATOM   5131 N  N   . ILE E 2 42  ? -54.632  27.866  -38.232 1.00 28.94  ? 80  ILE B N   1 
ATOM   5132 C  CA  . ILE E 2 42  ? -54.178  29.250  -38.029 1.00 27.37  ? 80  ILE B CA  1 
ATOM   5133 C  C   . ILE E 2 42  ? -52.981  29.292  -37.071 1.00 26.55  ? 80  ILE B C   1 
ATOM   5134 O  O   . ILE E 2 42  ? -52.060  30.096  -37.264 1.00 26.09  ? 80  ILE B O   1 
ATOM   5135 C  CB  . ILE E 2 42  ? -55.270  30.176  -37.457 1.00 27.32  ? 80  ILE B CB  1 
ATOM   5136 C  CG1 . ILE E 2 42  ? -56.537  30.198  -38.334 1.00 29.68  ? 80  ILE B CG1 1 
ATOM   5137 C  CG2 . ILE E 2 42  ? -54.761  31.597  -37.312 1.00 26.81  ? 80  ILE B CG2 1 
ATOM   5138 C  CD1 . ILE E 2 42  ? -56.363  30.765  -39.719 1.00 30.51  ? 80  ILE B CD1 1 
ATOM   5139 N  N   . THR E 2 43  ? -52.999  28.435  -36.051 1.00 25.01  ? 81  THR B N   1 
ATOM   5140 C  CA  . THR E 2 43  ? -51.895  28.367  -35.115 1.00 25.21  ? 81  THR B CA  1 
ATOM   5141 C  C   . THR E 2 43  ? -50.597  27.923  -35.818 1.00 24.97  ? 81  THR B C   1 
ATOM   5142 O  O   . THR E 2 43  ? -49.526  28.450  -35.535 1.00 24.26  ? 81  THR B O   1 
ATOM   5143 C  CB  . THR E 2 43  ? -52.169  27.438  -33.906 1.00 25.76  ? 81  THR B CB  1 
ATOM   5144 O  OG1 . THR E 2 43  ? -53.463  27.679  -33.341 1.00 26.45  ? 81  THR B OG1 1 
ATOM   5145 C  CG2 . THR E 2 43  ? -51.124  27.698  -32.821 1.00 26.58  ? 81  THR B CG2 1 
ATOM   5146 N  N   . SER E 2 44  ? -50.700  26.960  -36.728 1.00 24.82  ? 82  SER B N   1 
ATOM   5147 C  CA  . SER E 2 44  ? -49.540  26.519  -37.526 1.00 24.36  ? 82  SER B CA  1 
ATOM   5148 C  C   . SER E 2 44  ? -48.994  27.664  -38.361 1.00 24.92  ? 82  SER B C   1 
ATOM   5149 O  O   . SER E 2 44  ? -47.786  27.879  -38.421 1.00 25.19  ? 82  SER B O   1 
ATOM   5150 C  CB  . SER E 2 44  ? -49.903  25.338  -38.447 1.00 24.26  ? 82  SER B CB  1 
ATOM   5151 O  OG  . SER E 2 44  ? -48.881  25.047  -39.401 1.00 23.30  ? 82  SER B OG  1 
ATOM   5152 N  N   . LEU E 2 45  ? -49.897  28.388  -39.014 1.00 25.77  ? 83  LEU B N   1 
ATOM   5153 C  CA  . LEU E 2 45  ? -49.543  29.554  -39.813 1.00 26.26  ? 83  LEU B CA  1 
ATOM   5154 C  C   . LEU E 2 45  ? -48.794  30.573  -38.969 1.00 25.87  ? 83  LEU B C   1 
ATOM   5155 O  O   . LEU E 2 45  ? -47.753  31.057  -39.386 1.00 26.12  ? 83  LEU B O   1 
ATOM   5156 C  CB  . LEU E 2 45  ? -50.805  30.188  -40.413 1.00 26.80  ? 83  LEU B CB  1 
ATOM   5157 C  CG  . LEU E 2 45  ? -50.623  31.405  -41.315 1.00 27.19  ? 83  LEU B CG  1 
ATOM   5158 C  CD1 . LEU E 2 45  ? -49.830  31.036  -42.564 1.00 27.48  ? 83  LEU B CD1 1 
ATOM   5159 C  CD2 . LEU E 2 45  ? -51.973  31.985  -41.695 1.00 26.53  ? 83  LEU B CD2 1 
ATOM   5160 N  N   . ALA E 2 46  ? -49.311  30.874  -37.784 1.00 25.73  ? 84  ALA B N   1 
ATOM   5161 C  CA  . ALA E 2 46  ? -48.703  31.889  -36.925 1.00 26.67  ? 84  ALA B CA  1 
ATOM   5162 C  C   . ALA E 2 46  ? -47.323  31.488  -36.406 1.00 26.68  ? 84  ALA B C   1 
ATOM   5163 O  O   . ALA E 2 46  ? -46.454  32.338  -36.243 1.00 25.17  ? 84  ALA B O   1 
ATOM   5164 C  CB  . ALA E 2 46  ? -49.618  32.230  -35.759 1.00 27.00  ? 84  ALA B CB  1 
ATOM   5165 N  N   . CYS E 2 47  ? -47.143  30.201  -36.131 1.00 27.38  ? 85  CYS B N   1 
ATOM   5166 C  CA  . CYS E 2 47  ? -45.837  29.687  -35.766 1.00 29.56  ? 85  CYS B CA  1 
ATOM   5167 C  C   . CYS E 2 47  ? -44.827  29.962  -36.898 1.00 31.04  ? 85  CYS B C   1 
ATOM   5168 O  O   . CYS E 2 47  ? -43.730  30.473  -36.666 1.00 29.82  ? 85  CYS B O   1 
ATOM   5169 C  CB  . CYS E 2 47  ? -45.901  28.183  -35.468 1.00 30.40  ? 85  CYS B CB  1 
ATOM   5170 S  SG  . CYS E 2 47  ? -46.846  27.737  -34.000 1.00 32.49  ? 85  CYS B SG  1 
ATOM   5171 N  N   . ALA E 2 48  ? -45.228  29.648  -38.124 1.00 32.28  ? 86  ALA B N   1 
ATOM   5172 C  CA  . ALA E 2 48  ? -44.351  29.782  -39.277 1.00 33.58  ? 86  ALA B CA  1 
ATOM   5173 C  C   . ALA E 2 48  ? -43.936  31.216  -39.491 1.00 35.04  ? 86  ALA B C   1 
ATOM   5174 O  O   . ALA E 2 48  ? -42.756  31.512  -39.651 1.00 37.72  ? 86  ALA B O   1 
ATOM   5175 C  CB  . ALA E 2 48  ? -45.024  29.229  -40.521 1.00 33.68  ? 86  ALA B CB  1 
ATOM   5176 N  N   . ASP E 2 49  ? -44.909  32.110  -39.465 1.00 36.21  ? 87  ASP B N   1 
ATOM   5177 C  CA  . ASP E 2 49  ? -44.655  33.528  -39.695 1.00 37.60  ? 87  ASP B CA  1 
ATOM   5178 C  C   . ASP E 2 49  ? -43.848  34.147  -38.560 1.00 33.84  ? 87  ASP B C   1 
ATOM   5179 O  O   . ASP E 2 49  ? -43.037  35.036  -38.790 1.00 32.17  ? 87  ASP B O   1 
ATOM   5180 C  CB  . ASP E 2 49  ? -45.986  34.272  -39.876 1.00 44.15  ? 87  ASP B CB  1 
ATOM   5181 C  CG  . ASP E 2 49  ? -46.776  33.806  -41.133 1.00 49.58  ? 87  ASP B CG  1 
ATOM   5182 O  OD1 . ASP E 2 49  ? -46.143  33.342  -42.118 1.00 53.25  ? 87  ASP B OD1 1 
ATOM   5183 O  OD2 . ASP E 2 49  ? -48.036  33.904  -41.118 1.00 52.92  ? 87  ASP B OD2 1 
ATOM   5184 N  N   . LEU E 2 50  ? -44.069  33.666  -37.340 1.00 32.47  ? 88  LEU B N   1 
ATOM   5185 C  CA  . LEU E 2 50  ? -43.317  34.130  -36.173 1.00 31.66  ? 88  LEU B CA  1 
ATOM   5186 C  C   . LEU E 2 50  ? -41.838  33.804  -36.301 1.00 30.68  ? 88  LEU B C   1 
ATOM   5187 O  O   . LEU E 2 50  ? -41.004  34.648  -36.005 1.00 31.31  ? 88  LEU B O   1 
ATOM   5188 C  CB  . LEU E 2 50  ? -43.885  33.520  -34.884 1.00 31.85  ? 88  LEU B CB  1 
ATOM   5189 C  CG  . LEU E 2 50  ? -43.139  33.713  -33.568 1.00 31.28  ? 88  LEU B CG  1 
ATOM   5190 C  CD1 . LEU E 2 50  ? -42.957  35.185  -33.284 1.00 31.55  ? 88  LEU B CD1 1 
ATOM   5191 C  CD2 . LEU E 2 50  ? -43.929  33.026  -32.471 1.00 31.66  ? 88  LEU B CD2 1 
ATOM   5192 N  N   . VAL E 2 51  ? -41.513  32.592  -36.750 1.00 29.38  ? 89  VAL B N   1 
ATOM   5193 C  CA  . VAL E 2 51  ? -40.109  32.194  -36.925 1.00 28.14  ? 89  VAL B CA  1 
ATOM   5194 C  C   . VAL E 2 51  ? -39.477  32.972  -38.079 1.00 27.15  ? 89  VAL B C   1 
ATOM   5195 O  O   . VAL E 2 51  ? -38.265  33.166  -38.087 1.00 25.63  ? 89  VAL B O   1 
ATOM   5196 C  CB  . VAL E 2 51  ? -39.945  30.666  -37.131 1.00 28.12  ? 89  VAL B CB  1 
ATOM   5197 C  CG1 . VAL E 2 51  ? -38.479  30.291  -37.361 1.00 28.13  ? 89  VAL B CG1 1 
ATOM   5198 C  CG2 . VAL E 2 51  ? -40.473  29.899  -35.927 1.00 28.54  ? 89  VAL B CG2 1 
ATOM   5199 N  N   . VAL E 2 52  ? -40.292  33.407  -39.043 1.00 27.39  ? 90  VAL B N   1 
ATOM   5200 C  CA  . VAL E 2 52  ? -39.829  34.313  -40.104 1.00 27.77  ? 90  VAL B CA  1 
ATOM   5201 C  C   . VAL E 2 52  ? -39.361  35.635  -39.488 1.00 26.83  ? 90  VAL B C   1 
ATOM   5202 O  O   . VAL E 2 52  ? -38.262  36.101  -39.786 1.00 26.40  ? 90  VAL B O   1 
ATOM   5203 C  CB  . VAL E 2 52  ? -40.920  34.550  -41.205 1.00 28.11  ? 90  VAL B CB  1 
ATOM   5204 C  CG1 . VAL E 2 52  ? -40.613  35.758  -42.094 1.00 27.96  ? 90  VAL B CG1 1 
ATOM   5205 C  CG2 . VAL E 2 52  ? -41.072  33.304  -42.068 1.00 27.74  ? 90  VAL B CG2 1 
ATOM   5206 N  N   . GLY E 2 53  ? -40.188  36.222  -38.627 1.00 26.24  ? 91  GLY B N   1 
ATOM   5207 C  CA  . GLY E 2 53  ? -39.851  37.483  -37.969 1.00 26.62  ? 91  GLY B CA  1 
ATOM   5208 C  C   . GLY E 2 53  ? -38.707  37.436  -36.946 1.00 26.82  ? 91  GLY B C   1 
ATOM   5209 O  O   . GLY E 2 53  ? -37.939  38.381  -36.849 1.00 25.78  ? 91  GLY B O   1 
ATOM   5210 N  N   . LEU E 2 54  ? -38.608  36.360  -36.168 1.00 27.71  ? 92  LEU B N   1 
ATOM   5211 C  CA  . LEU E 2 54  ? -37.568  36.233  -35.142 1.00 28.94  ? 92  LEU B CA  1 
ATOM   5212 C  C   . LEU E 2 54  ? -36.186  35.926  -35.692 1.00 28.71  ? 92  LEU B C   1 
ATOM   5213 O  O   . LEU E 2 54  ? -35.219  36.420  -35.172 1.00 26.90  ? 92  LEU B O   1 
ATOM   5214 C  CB  . LEU E 2 54  ? -37.910  35.130  -34.138 1.00 30.01  ? 92  LEU B CB  1 
ATOM   5215 C  CG  . LEU E 2 54  ? -39.128  35.347  -33.261 1.00 31.92  ? 92  LEU B CG  1 
ATOM   5216 C  CD1 . LEU E 2 54  ? -39.277  34.135  -32.350 1.00 32.79  ? 92  LEU B CD1 1 
ATOM   5217 C  CD2 . LEU E 2 54  ? -39.046  36.648  -32.462 1.00 33.01  ? 92  LEU B CD2 1 
ATOM   5218 N  N   . LEU E 2 55  ? -36.101  35.082  -36.712 1.00 31.36  ? 93  LEU B N   1 
ATOM   5219 C  CA  . LEU E 2 55  ? -34.814  34.581  -37.208 1.00 33.81  ? 93  LEU B CA  1 
ATOM   5220 C  C   . LEU E 2 55  ? -34.548  34.912  -38.663 1.00 33.64  ? 93  LEU B C   1 
ATOM   5221 O  O   . LEU E 2 55  ? -33.502  35.448  -38.975 1.00 34.68  ? 93  LEU B O   1 
ATOM   5222 C  CB  . LEU E 2 55  ? -34.726  33.067  -37.012 1.00 35.69  ? 93  LEU B CB  1 
ATOM   5223 C  CG  . LEU E 2 55  ? -34.940  32.606  -35.570 1.00 37.79  ? 93  LEU B CG  1 
ATOM   5224 C  CD1 . LEU E 2 55  ? -35.050  31.087  -35.510 1.00 38.27  ? 93  LEU B CD1 1 
ATOM   5225 C  CD2 . LEU E 2 55  ? -33.817  33.129  -34.674 1.00 38.22  ? 93  LEU B CD2 1 
ATOM   5226 N  N   . VAL E 2 56  ? -35.486  34.606  -39.550 1.00 33.47  ? 94  VAL B N   1 
ATOM   5227 C  CA  . VAL E 2 56  ? -35.234  34.703  -40.988 1.00 33.53  ? 94  VAL B CA  1 
ATOM   5228 C  C   . VAL E 2 56  ? -35.034  36.143  -41.441 1.00 34.18  ? 94  VAL B C   1 
ATOM   5229 O  O   . VAL E 2 56  ? -34.052  36.447  -42.127 1.00 35.03  ? 94  VAL B O   1 
ATOM   5230 C  CB  . VAL E 2 56  ? -36.350  34.029  -41.813 1.00 34.05  ? 94  VAL B CB  1 
ATOM   5231 C  CG1 . VAL E 2 56  ? -36.182  34.285  -43.304 1.00 33.29  ? 94  VAL B CG1 1 
ATOM   5232 C  CG2 . VAL E 2 56  ? -36.367  32.527  -41.533 1.00 34.61  ? 94  VAL B CG2 1 
ATOM   5233 N  N   . VAL E 2 57  ? -35.946  37.025  -41.060 1.00 35.19  ? 95  VAL B N   1 
ATOM   5234 C  CA  . VAL E 2 57  ? -35.879  38.412  -41.517 1.00 36.99  ? 95  VAL B CA  1 
ATOM   5235 C  C   . VAL E 2 57  ? -34.715  39.210  -40.890 1.00 38.76  ? 95  VAL B C   1 
ATOM   5236 O  O   . VAL E 2 57  ? -34.076  39.971  -41.614 1.00 38.97  ? 95  VAL B O   1 
ATOM   5237 C  CB  . VAL E 2 57  ? -37.240  39.133  -41.365 1.00 37.12  ? 95  VAL B CB  1 
ATOM   5238 C  CG1 . VAL E 2 57  ? -37.128  40.624  -41.703 1.00 37.22  ? 95  VAL B CG1 1 
ATOM   5239 C  CG2 . VAL E 2 57  ? -38.263  38.471  -42.271 1.00 37.64  ? 95  VAL B CG2 1 
ATOM   5240 N  N   . PRO E 2 58  ? -34.433  39.043  -39.568 1.00 40.50  ? 96  PRO B N   1 
ATOM   5241 C  CA  . PRO E 2 58  ? -33.298  39.741  -38.928 1.00 41.29  ? 96  PRO B CA  1 
ATOM   5242 C  C   . PRO E 2 58  ? -31.917  39.448  -39.539 1.00 43.37  ? 96  PRO B C   1 
ATOM   5243 O  O   . PRO E 2 58  ? -31.183  40.378  -39.871 1.00 42.05  ? 96  PRO B O   1 
ATOM   5244 C  CB  . PRO E 2 58  ? -33.367  39.251  -37.486 1.00 40.42  ? 96  PRO B CB  1 
ATOM   5245 C  CG  . PRO E 2 58  ? -34.819  39.047  -37.270 1.00 40.53  ? 96  PRO B CG  1 
ATOM   5246 C  CD  . PRO E 2 58  ? -35.299  38.427  -38.547 1.00 40.87  ? 96  PRO B CD  1 
ATOM   5247 N  N   . PHE E 2 59  ? -31.598  38.166  -39.709 1.00 44.70  ? 97  PHE B N   1 
ATOM   5248 C  CA  . PHE E 2 59  ? -30.385  37.730  -40.420 1.00 44.29  ? 97  PHE B CA  1 
ATOM   5249 C  C   . PHE E 2 59  ? -30.398  38.248  -41.852 1.00 42.45  ? 97  PHE B C   1 
ATOM   5250 O  O   . PHE E 2 59  ? -29.369  38.595  -42.390 1.00 43.80  ? 97  PHE B O   1 
ATOM   5251 C  CB  . PHE E 2 59  ? -30.255  36.200  -40.434 1.00 45.36  ? 97  PHE B CB  1 
ATOM   5252 C  CG  . PHE E 2 59  ? -29.710  35.595  -39.149 1.00 46.55  ? 97  PHE B CG  1 
ATOM   5253 C  CD1 . PHE E 2 59  ? -30.448  35.628  -37.968 1.00 48.13  ? 97  PHE B CD1 1 
ATOM   5254 C  CD2 . PHE E 2 59  ? -28.470  34.946  -39.132 1.00 45.02  ? 97  PHE B CD2 1 
ATOM   5255 C  CE1 . PHE E 2 59  ? -29.954  35.056  -36.804 1.00 48.45  ? 97  PHE B CE1 1 
ATOM   5256 C  CE2 . PHE E 2 59  ? -27.972  34.378  -37.977 1.00 44.26  ? 97  PHE B CE2 1 
ATOM   5257 C  CZ  . PHE E 2 59  ? -28.708  34.436  -36.812 1.00 46.72  ? 97  PHE B CZ  1 
ATOM   5258 N  N   . GLY E 2 60  ? -31.571  38.288  -42.463 1.00 43.74  ? 98  GLY B N   1 
ATOM   5259 C  CA  . GLY E 2 60  ? -31.746  38.934  -43.761 1.00 45.98  ? 98  GLY B CA  1 
ATOM   5260 C  C   . GLY E 2 60  ? -31.422  40.420  -43.742 1.00 45.38  ? 98  GLY B C   1 
ATOM   5261 O  O   . GLY E 2 60  ? -30.695  40.900  -44.596 1.00 43.19  ? 98  GLY B O   1 
ATOM   5262 N  N   . ALA E 2 61  ? -31.954  41.135  -42.755 1.00 47.92  ? 99  ALA B N   1 
ATOM   5263 C  CA  . ALA E 2 61  ? -31.781  42.590  -42.639 1.00 51.50  ? 99  ALA B CA  1 
ATOM   5264 C  C   . ALA E 2 61  ? -30.317  43.015  -42.560 1.00 54.66  ? 99  ALA B C   1 
ATOM   5265 O  O   . ALA E 2 61  ? -29.951  44.086  -43.061 1.00 56.49  ? 99  ALA B O   1 
ATOM   5266 C  CB  . ALA E 2 61  ? -32.536  43.124  -41.426 1.00 51.26  ? 99  ALA B CB  1 
ATOM   5267 N  N   . THR E 2 62  ? -29.493  42.175  -41.933 1.00 57.20  ? 100 THR B N   1 
ATOM   5268 C  CA  . THR E 2 62  ? -28.063  42.448  -41.783 1.00 58.44  ? 100 THR B CA  1 
ATOM   5269 C  C   . THR E 2 62  ? -27.341  42.336  -43.113 1.00 62.19  ? 100 THR B C   1 
ATOM   5270 O  O   . THR E 2 62  ? -26.522  43.181  -43.442 1.00 64.96  ? 100 THR B O   1 
ATOM   5271 C  CB  . THR E 2 62  ? -27.374  41.483  -40.801 1.00 55.38  ? 100 THR B CB  1 
ATOM   5272 O  OG1 . THR E 2 62  ? -27.502  40.132  -41.269 1.00 51.71  ? 100 THR B OG1 1 
ATOM   5273 C  CG2 . THR E 2 62  ? -27.954  41.617  -39.388 1.00 55.13  ? 100 THR B CG2 1 
ATOM   5274 N  N   . LEU E 2 63  ? -27.658  41.296  -43.873 1.00 65.05  ? 101 LEU B N   1 
ATOM   5275 C  CA  . LEU E 2 63  ? -27.057  41.085  -45.188 1.00 67.37  ? 101 LEU B CA  1 
ATOM   5276 C  C   . LEU E 2 63  ? -27.284  42.269  -46.157 1.00 71.15  ? 101 LEU B C   1 
ATOM   5277 O  O   . LEU E 2 63  ? -26.473  42.487  -47.057 1.00 75.77  ? 101 LEU B O   1 
ATOM   5278 C  CB  . LEU E 2 63  ? -27.566  39.768  -45.780 1.00 67.25  ? 101 LEU B CB  1 
ATOM   5279 C  CG  . LEU E 2 63  ? -26.906  39.190  -47.026 1.00 70.03  ? 101 LEU B CG  1 
ATOM   5280 C  CD1 . LEU E 2 63  ? -25.414  39.008  -46.836 1.00 70.75  ? 101 LEU B CD1 1 
ATOM   5281 C  CD2 . LEU E 2 63  ? -27.551  37.857  -47.373 1.00 73.08  ? 101 LEU B CD2 1 
ATOM   5282 N  N   . VAL E 2 64  ? -28.359  43.039  -45.954 1.00 74.72  ? 102 VAL B N   1 
ATOM   5283 C  CA  . VAL E 2 64  ? -28.594  44.280  -46.710 1.00 75.90  ? 102 VAL B CA  1 
ATOM   5284 C  C   . VAL E 2 64  ? -27.716  45.412  -46.182 1.00 75.25  ? 102 VAL B C   1 
ATOM   5285 O  O   . VAL E 2 64  ? -27.117  46.145  -46.968 1.00 77.35  ? 102 VAL B O   1 
ATOM   5286 C  CB  . VAL E 2 64  ? -30.073  44.758  -46.647 1.00 76.45  ? 102 VAL B CB  1 
ATOM   5287 C  CG1 . VAL E 2 64  ? -30.274  46.019  -47.498 1.00 77.66  ? 102 VAL B CG1 1 
ATOM   5288 C  CG2 . VAL E 2 64  ? -31.027  43.642  -47.077 1.00 77.70  ? 102 VAL B CG2 1 
ATOM   5289 N  N   . VAL E 2 65  ? -27.667  45.553  -44.856 1.00 75.43  ? 103 VAL B N   1 
ATOM   5290 C  CA  . VAL E 2 65  ? -26.937  46.645  -44.190 1.00 81.32  ? 103 VAL B CA  1 
ATOM   5291 C  C   . VAL E 2 65  ? -25.415  46.510  -44.382 1.00 86.43  ? 103 VAL B C   1 
ATOM   5292 O  O   . VAL E 2 65  ? -24.754  47.451  -44.832 1.00 89.37  ? 103 VAL B O   1 
ATOM   5293 C  CB  . VAL E 2 65  ? -27.276  46.715  -42.670 1.00 82.08  ? 103 VAL B CB  1 
ATOM   5294 C  CG1 . VAL E 2 65  ? -26.389  47.733  -41.942 1.00 80.51  ? 103 VAL B CG1 1 
ATOM   5295 C  CG2 . VAL E 2 65  ? -28.757  47.039  -42.451 1.00 81.24  ? 103 VAL B CG2 1 
ATOM   5296 N  N   . ARG E 2 66  ? -24.880  45.338  -44.047 1.00 86.65  ? 104 ARG B N   1 
ATOM   5297 C  CA  . ARG E 2 66  ? -23.440  45.062  -44.144 1.00 83.74  ? 104 ARG B CA  1 
ATOM   5298 C  C   . ARG E 2 66  ? -22.989  44.759  -45.583 1.00 79.65  ? 104 ARG B C   1 
ATOM   5299 O  O   . ARG E 2 66  ? -21.831  44.995  -45.931 1.00 82.91  ? 104 ARG B O   1 
ATOM   5300 C  CB  . ARG E 2 66  ? -23.046  43.881  -43.244 1.00 85.73  ? 104 ARG B CB  1 
ATOM   5301 C  CG  . ARG E 2 66  ? -23.409  44.015  -41.768 1.00 87.36  ? 104 ARG B CG  1 
ATOM   5302 C  CD  . ARG E 2 66  ? -22.666  45.124  -41.072 1.00 91.94  ? 104 ARG B CD  1 
ATOM   5303 N  NE  . ARG E 2 66  ? -23.050  45.248  -39.663 1.00 94.82  ? 104 ARG B NE  1 
ATOM   5304 C  CZ  . ARG E 2 66  ? -22.893  46.349  -38.926 1.00 99.91  ? 104 ARG B CZ  1 
ATOM   5305 N  NH1 . ARG E 2 66  ? -23.288  46.340  -37.661 1.00 99.22  ? 104 ARG B NH1 1 
ATOM   5306 N  NH2 . ARG E 2 66  ? -22.350  47.467  -39.428 1.00 102.94 ? 104 ARG B NH2 1 
ATOM   5307 N  N   . GLY E 2 67  ? -23.889  44.235  -46.413 1.00 72.61  ? 105 GLY B N   1 
ATOM   5308 C  CA  . GLY E 2 67  ? -23.525  43.768  -47.739 1.00 70.51  ? 105 GLY B CA  1 
ATOM   5309 C  C   . GLY E 2 67  ? -22.659  42.513  -47.741 1.00 68.09  ? 105 GLY B C   1 
ATOM   5310 O  O   . GLY E 2 67  ? -21.993  42.240  -48.730 1.00 70.87  ? 105 GLY B O   1 
ATOM   5311 N  N   . THR E 2 68  ? -22.671  41.745  -46.651 1.00 64.13  ? 106 THR B N   1 
ATOM   5312 C  CA  . THR E 2 68  ? -21.927  40.482  -46.575 1.00 63.08  ? 106 THR B CA  1 
ATOM   5313 C  C   . THR E 2 68  ? -22.373  39.621  -45.378 1.00 60.10  ? 106 THR B C   1 
ATOM   5314 O  O   . THR E 2 68  ? -22.889  40.131  -44.372 1.00 59.16  ? 106 THR B O   1 
ATOM   5315 C  CB  . THR E 2 68  ? -20.392  40.709  -46.520 1.00 65.16  ? 106 THR B CB  1 
ATOM   5316 O  OG1 . THR E 2 68  ? -19.708  39.448  -46.568 1.00 63.80  ? 106 THR B OG1 1 
ATOM   5317 C  CG2 . THR E 2 68  ? -19.980  41.464  -45.255 1.00 65.09  ? 106 THR B CG2 1 
ATOM   5318 N  N   . TRP E 2 69  ? -22.158  38.314  -45.504 1.00 54.87  ? 107 TRP B N   1 
ATOM   5319 C  CA  . TRP E 2 69  ? -22.549  37.356  -44.480 1.00 51.26  ? 107 TRP B CA  1 
ATOM   5320 C  C   . TRP E 2 69  ? -21.486  37.273  -43.387 1.00 48.31  ? 107 TRP B C   1 
ATOM   5321 O  O   . TRP E 2 69  ? -20.376  36.798  -43.629 1.00 46.03  ? 107 TRP B O   1 
ATOM   5322 C  CB  . TRP E 2 69  ? -22.768  35.973  -45.101 1.00 51.73  ? 107 TRP B CB  1 
ATOM   5323 C  CG  . TRP E 2 69  ? -23.450  35.023  -44.163 1.00 51.50  ? 107 TRP B CG  1 
ATOM   5324 C  CD1 . TRP E 2 69  ? -22.900  33.944  -43.528 1.00 50.11  ? 107 TRP B CD1 1 
ATOM   5325 C  CD2 . TRP E 2 69  ? -24.812  35.092  -43.738 1.00 51.87  ? 107 TRP B CD2 1 
ATOM   5326 N  NE1 . TRP E 2 69  ? -23.844  33.335  -42.736 1.00 49.62  ? 107 TRP B NE1 1 
ATOM   5327 C  CE2 . TRP E 2 69  ? -25.026  34.018  -42.845 1.00 50.01  ? 107 TRP B CE2 1 
ATOM   5328 C  CE3 . TRP E 2 69  ? -25.878  35.962  -44.024 1.00 52.19  ? 107 TRP B CE3 1 
ATOM   5329 C  CZ2 . TRP E 2 69  ? -26.254  33.788  -42.237 1.00 48.60  ? 107 TRP B CZ2 1 
ATOM   5330 C  CZ3 . TRP E 2 69  ? -27.098  35.733  -43.423 1.00 51.58  ? 107 TRP B CZ3 1 
ATOM   5331 C  CH2 . TRP E 2 69  ? -27.280  34.646  -42.547 1.00 50.44  ? 107 TRP B CH2 1 
ATOM   5332 N  N   . LEU E 2 70  ? -21.841  37.711  -42.184 1.00 46.08  ? 108 LEU B N   1 
ATOM   5333 C  CA  . LEU E 2 70  ? -20.899  37.799  -41.069 1.00 47.25  ? 108 LEU B CA  1 
ATOM   5334 C  C   . LEU E 2 70  ? -20.826  36.561  -40.180 1.00 48.29  ? 108 LEU B C   1 
ATOM   5335 O  O   . LEU E 2 70  ? -20.011  36.553  -39.254 1.00 49.26  ? 108 LEU B O   1 
ATOM   5336 C  CB  . LEU E 2 70  ? -21.225  39.003  -40.184 1.00 48.17  ? 108 LEU B CB  1 
ATOM   5337 C  CG  . LEU E 2 70  ? -21.564  40.352  -40.814 1.00 52.76  ? 108 LEU B CG  1 
ATOM   5338 C  CD1 . LEU E 2 70  ? -21.879  41.375  -39.718 1.00 53.55  ? 108 LEU B CD1 1 
ATOM   5339 C  CD2 . LEU E 2 70  ? -20.428  40.827  -41.709 1.00 55.60  ? 108 LEU B CD2 1 
ATOM   5340 N  N   . TRP E 2 71  ? -21.641  35.526  -40.441 1.00 49.46  ? 109 TRP B N   1 
ATOM   5341 C  CA  . TRP E 2 71  ? -21.769  34.371  -39.510 1.00 50.85  ? 109 TRP B CA  1 
ATOM   5342 C  C   . TRP E 2 71  ? -21.340  33.003  -40.065 1.00 51.03  ? 109 TRP B C   1 
ATOM   5343 O  O   . TRP E 2 71  ? -21.723  31.954  -39.521 1.00 46.33  ? 109 TRP B O   1 
ATOM   5344 C  CB  . TRP E 2 71  ? -23.192  34.306  -38.928 1.00 51.31  ? 109 TRP B CB  1 
ATOM   5345 C  CG  . TRP E 2 71  ? -23.536  35.569  -38.221 1.00 52.32  ? 109 TRP B CG  1 
ATOM   5346 C  CD1 . TRP E 2 71  ? -23.261  35.902  -36.916 1.00 52.33  ? 109 TRP B CD1 1 
ATOM   5347 C  CD2 . TRP E 2 71  ? -24.174  36.699  -38.798 1.00 52.24  ? 109 TRP B CD2 1 
ATOM   5348 N  NE1 . TRP E 2 71  ? -23.690  37.177  -36.662 1.00 52.37  ? 109 TRP B NE1 1 
ATOM   5349 C  CE2 . TRP E 2 71  ? -24.266  37.684  -37.795 1.00 52.11  ? 109 TRP B CE2 1 
ATOM   5350 C  CE3 . TRP E 2 71  ? -24.675  36.978  -40.076 1.00 53.30  ? 109 TRP B CE3 1 
ATOM   5351 C  CZ2 . TRP E 2 71  ? -24.834  38.928  -38.030 1.00 53.85  ? 109 TRP B CZ2 1 
ATOM   5352 C  CZ3 . TRP E 2 71  ? -25.253  38.207  -40.306 1.00 54.66  ? 109 TRP B CZ3 1 
ATOM   5353 C  CH2 . TRP E 2 71  ? -25.330  39.167  -39.285 1.00 55.75  ? 109 TRP B CH2 1 
ATOM   5354 N  N   . GLY E 2 72  ? -20.526  33.009  -41.122 1.00 52.78  ? 110 GLY B N   1 
ATOM   5355 C  CA  . GLY E 2 72  ? -19.888  31.788  -41.603 1.00 56.34  ? 110 GLY B CA  1 
ATOM   5356 C  C   . GLY E 2 72  ? -20.786  30.837  -42.369 1.00 56.43  ? 110 GLY B C   1 
ATOM   5357 O  O   . GLY E 2 72  ? -21.999  30.848  -42.214 1.00 59.06  ? 110 GLY B O   1 
ATOM   5358 N  N   . SER E 2 73  ? -20.159  29.979  -43.172 1.00 56.61  ? 111 SER B N   1 
ATOM   5359 C  CA  . SER E 2 73  ? -20.865  29.141  -44.142 1.00 55.83  ? 111 SER B CA  1 
ATOM   5360 C  C   . SER E 2 73  ? -21.950  28.239  -43.566 1.00 55.30  ? 111 SER B C   1 
ATOM   5361 O  O   . SER E 2 73  ? -22.944  27.976  -44.247 1.00 56.01  ? 111 SER B O   1 
ATOM   5362 C  CB  . SER E 2 73  ? -19.869  28.299  -44.939 1.00 55.97  ? 111 SER B CB  1 
ATOM   5363 O  OG  . SER E 2 73  ? -19.112  29.130  -45.807 1.00 57.55  ? 111 SER B OG  1 
ATOM   5364 N  N   . PHE E 2 74  ? -21.771  27.760  -42.337 1.00 55.78  ? 112 PHE B N   1 
ATOM   5365 C  CA  . PHE E 2 74  ? -22.752  26.855  -41.737 1.00 58.07  ? 112 PHE B CA  1 
ATOM   5366 C  C   . PHE E 2 74  ? -24.057  27.588  -41.449 1.00 56.55  ? 112 PHE B C   1 
ATOM   5367 O  O   . PHE E 2 74  ? -25.125  27.155  -41.885 1.00 54.55  ? 112 PHE B O   1 
ATOM   5368 C  CB  . PHE E 2 74  ? -22.219  26.221  -40.456 1.00 62.27  ? 112 PHE B CB  1 
ATOM   5369 C  CG  . PHE E 2 74  ? -23.192  25.283  -39.801 1.00 64.49  ? 112 PHE B CG  1 
ATOM   5370 C  CD1 . PHE E 2 74  ? -23.243  23.940  -40.160 1.00 66.14  ? 112 PHE B CD1 1 
ATOM   5371 C  CD2 . PHE E 2 74  ? -24.075  25.751  -38.833 1.00 65.38  ? 112 PHE B CD2 1 
ATOM   5372 C  CE1 . PHE E 2 74  ? -24.150  23.083  -39.556 1.00 67.46  ? 112 PHE B CE1 1 
ATOM   5373 C  CE2 . PHE E 2 74  ? -24.978  24.899  -38.223 1.00 66.38  ? 112 PHE B CE2 1 
ATOM   5374 C  CZ  . PHE E 2 74  ? -25.020  23.562  -38.586 1.00 67.44  ? 112 PHE B CZ  1 
ATOM   5375 N  N   . LEU E 2 75  ? -23.968  28.694  -40.718 1.00 53.17  ? 113 LEU B N   1 
ATOM   5376 C  CA  . LEU E 2 75  ? -25.152  29.484  -40.419 1.00 49.44  ? 113 LEU B CA  1 
ATOM   5377 C  C   . LEU E 2 75  ? -25.790  30.106  -41.649 1.00 48.36  ? 113 LEU B C   1 
ATOM   5378 O  O   . LEU E 2 75  ? -26.970  30.434  -41.605 1.00 50.72  ? 113 LEU B O   1 
ATOM   5379 C  CB  . LEU E 2 75  ? -24.861  30.571  -39.378 1.00 48.22  ? 113 LEU B CB  1 
ATOM   5380 C  CG  . LEU E 2 75  ? -24.514  30.129  -37.956 1.00 46.95  ? 113 LEU B CG  1 
ATOM   5381 C  CD1 . LEU E 2 75  ? -24.454  31.354  -37.043 1.00 47.34  ? 113 LEU B CD1 1 
ATOM   5382 C  CD2 . LEU E 2 75  ? -25.509  29.103  -37.425 1.00 46.48  ? 113 LEU B CD2 1 
ATOM   5383 N  N   . CYS E 2 76  ? -25.037  30.280  -42.734 1.00 47.74  ? 114 CYS B N   1 
ATOM   5384 C  CA  . CYS E 2 76  ? -25.648  30.634  -44.014 1.00 50.32  ? 114 CYS B CA  1 
ATOM   5385 C  C   . CYS E 2 76  ? -26.541  29.483  -44.448 1.00 53.04  ? 114 CYS B C   1 
ATOM   5386 O  O   . CYS E 2 76  ? -27.742  29.675  -44.656 1.00 49.39  ? 114 CYS B O   1 
ATOM   5387 C  CB  . CYS E 2 76  ? -24.608  30.934  -45.094 1.00 49.28  ? 114 CYS B CB  1 
ATOM   5388 S  SG  . CYS E 2 76  ? -25.289  31.144  -46.761 1.00 47.76  ? 114 CYS B SG  1 
ATOM   5389 N  N   . GLU E 2 77  ? -25.961  28.288  -44.547 1.00 57.33  ? 115 GLU B N   1 
ATOM   5390 C  CA  . GLU E 2 77  ? -26.721  27.096  -44.956 1.00 61.35  ? 115 GLU B CA  1 
ATOM   5391 C  C   . GLU E 2 77  ? -27.977  26.892  -44.110 1.00 60.41  ? 115 GLU B C   1 
ATOM   5392 O  O   . GLU E 2 77  ? -29.044  26.618  -44.649 1.00 66.20  ? 115 GLU B O   1 
ATOM   5393 C  CB  . GLU E 2 77  ? -25.850  25.823  -44.945 1.00 65.58  ? 115 GLU B CB  1 
ATOM   5394 C  CG  . GLU E 2 77  ? -25.027  25.624  -46.223 1.00 71.39  ? 115 GLU B CG  1 
ATOM   5395 C  CD  . GLU E 2 77  ? -24.516  24.199  -46.392 1.00 75.73  ? 115 GLU B CD  1 
ATOM   5396 O  OE1 . GLU E 2 77  ? -24.339  23.491  -45.372 1.00 78.40  ? 115 GLU B OE1 1 
ATOM   5397 O  OE2 . GLU E 2 77  ? -24.320  23.773  -47.553 1.00 76.19  ? 115 GLU B OE2 1 
ATOM   5398 N  N   . LEU E 2 78  ? -27.850  27.063  -42.802 1.00 55.91  ? 116 LEU B N   1 
ATOM   5399 C  CA  . LEU E 2 78  ? -28.953  26.835  -41.882 1.00 53.30  ? 116 LEU B CA  1 
ATOM   5400 C  C   . LEU E 2 78  ? -30.029  27.907  -42.058 1.00 47.92  ? 116 LEU B C   1 
ATOM   5401 O  O   . LEU E 2 78  ? -31.204  27.583  -42.211 1.00 46.61  ? 116 LEU B O   1 
ATOM   5402 C  CB  . LEU E 2 78  ? -28.425  26.797  -40.452 1.00 57.31  ? 116 LEU B CB  1 
ATOM   5403 C  CG  . LEU E 2 78  ? -29.373  26.285  -39.367 1.00 61.95  ? 116 LEU B CG  1 
ATOM   5404 C  CD1 . LEU E 2 78  ? -28.598  25.455  -38.360 1.00 61.99  ? 116 LEU B CD1 1 
ATOM   5405 C  CD2 . LEU E 2 78  ? -30.130  27.413  -38.663 1.00 64.14  ? 116 LEU B CD2 1 
ATOM   5406 N  N   . TRP E 2 79  ? -29.626  29.174  -42.061 1.00 41.46  ? 117 TRP B N   1 
ATOM   5407 C  CA  . TRP E 2 79  ? -30.548  30.284  -42.295 1.00 39.06  ? 117 TRP B CA  1 
ATOM   5408 C  C   . TRP E 2 79  ? -31.309  30.115  -43.601 1.00 39.86  ? 117 TRP B C   1 
ATOM   5409 O  O   . TRP E 2 79  ? -32.496  30.394  -43.653 1.00 44.50  ? 117 TRP B O   1 
ATOM   5410 C  CB  . TRP E 2 79  ? -29.787  31.599  -42.310 1.00 39.26  ? 117 TRP B CB  1 
ATOM   5411 C  CG  . TRP E 2 79  ? -30.572  32.799  -42.706 1.00 39.32  ? 117 TRP B CG  1 
ATOM   5412 C  CD1 . TRP E 2 79  ? -31.522  33.418  -41.975 1.00 40.11  ? 117 TRP B CD1 1 
ATOM   5413 C  CD2 . TRP E 2 79  ? -30.444  33.550  -43.919 1.00 41.38  ? 117 TRP B CD2 1 
ATOM   5414 N  NE1 . TRP E 2 79  ? -32.014  34.506  -42.651 1.00 40.74  ? 117 TRP B NE1 1 
ATOM   5415 C  CE2 . TRP E 2 79  ? -31.368  34.614  -43.849 1.00 41.53  ? 117 TRP B CE2 1 
ATOM   5416 C  CE3 . TRP E 2 79  ? -29.641  33.426  -45.063 1.00 43.16  ? 117 TRP B CE3 1 
ATOM   5417 C  CZ2 . TRP E 2 79  ? -31.520  35.559  -44.879 1.00 41.99  ? 117 TRP B CZ2 1 
ATOM   5418 C  CZ3 . TRP E 2 79  ? -29.788  34.372  -46.094 1.00 43.07  ? 117 TRP B CZ3 1 
ATOM   5419 C  CH2 . TRP E 2 79  ? -30.728  35.423  -45.990 1.00 42.14  ? 117 TRP B CH2 1 
ATOM   5420 N  N   . THR E 2 80  ? -30.634  29.659  -44.653 1.00 39.27  ? 118 THR B N   1 
ATOM   5421 C  CA  . THR E 2 80  ? -31.287  29.385  -45.940 1.00 37.28  ? 118 THR B CA  1 
ATOM   5422 C  C   . THR E 2 80  ? -32.313  28.266  -45.779 1.00 35.00  ? 118 THR B C   1 
ATOM   5423 O  O   . THR E 2 80  ? -33.441  28.405  -46.231 1.00 34.71  ? 118 THR B O   1 
ATOM   5424 C  CB  . THR E 2 80  ? -30.243  29.028  -47.029 1.00 38.96  ? 118 THR B CB  1 
ATOM   5425 O  OG1 . THR E 2 80  ? -29.316  30.111  -47.168 1.00 39.19  ? 118 THR B OG1 1 
ATOM   5426 C  CG2 . THR E 2 80  ? -30.888  28.769  -48.400 1.00 39.75  ? 118 THR B CG2 1 
ATOM   5427 N  N   . SER E 2 81  ? -31.931  27.180  -45.119 1.00 34.73  ? 119 SER B N   1 
ATOM   5428 C  CA  . SER E 2 81  ? -32.861  26.081  -44.841 1.00 36.74  ? 119 SER B CA  1 
ATOM   5429 C  C   . SER E 2 81  ? -34.050  26.512  -43.971 1.00 37.73  ? 119 SER B C   1 
ATOM   5430 O  O   . SER E 2 81  ? -35.177  26.110  -44.210 1.00 37.22  ? 119 SER B O   1 
ATOM   5431 C  CB  . SER E 2 81  ? -32.141  24.907  -44.171 1.00 36.61  ? 119 SER B CB  1 
ATOM   5432 O  OG  . SER E 2 81  ? -31.144  24.349  -45.006 1.00 36.52  ? 119 SER B OG  1 
ATOM   5433 N  N   . LEU E 2 82  ? -33.790  27.331  -42.965 1.00 38.76  ? 120 LEU B N   1 
ATOM   5434 C  CA  . LEU E 2 82  ? -34.840  27.832  -42.093 1.00 38.77  ? 120 LEU B CA  1 
ATOM   5435 C  C   . LEU E 2 82  ? -35.800  28.758  -42.842 1.00 37.75  ? 120 LEU B C   1 
ATOM   5436 O  O   . LEU E 2 82  ? -36.999  28.759  -42.563 1.00 37.68  ? 120 LEU B O   1 
ATOM   5437 C  CB  . LEU E 2 82  ? -34.229  28.585  -40.918 1.00 41.24  ? 120 LEU B CB  1 
ATOM   5438 C  CG  . LEU E 2 82  ? -35.160  28.713  -39.719 1.00 43.78  ? 120 LEU B CG  1 
ATOM   5439 C  CD1 . LEU E 2 82  ? -35.061  27.460  -38.847 1.00 43.95  ? 120 LEU B CD1 1 
ATOM   5440 C  CD2 . LEU E 2 82  ? -34.833  29.988  -38.948 1.00 45.02  ? 120 LEU B CD2 1 
ATOM   5441 N  N   . ASP E 2 83  ? -35.273  29.541  -43.780 1.00 37.43  ? 121 ASP B N   1 
ATOM   5442 C  CA  . ASP E 2 83  ? -36.096  30.416  -44.613 1.00 38.67  ? 121 ASP B CA  1 
ATOM   5443 C  C   . ASP E 2 83  ? -37.014  29.579  -45.467 1.00 38.77  ? 121 ASP B C   1 
ATOM   5444 O  O   . ASP E 2 83  ? -38.230  29.747  -45.435 1.00 36.28  ? 121 ASP B O   1 
ATOM   5445 C  CB  . ASP E 2 83  ? -35.230  31.303  -45.517 1.00 39.63  ? 121 ASP B CB  1 
ATOM   5446 C  CG  . ASP E 2 83  ? -36.050  32.323  -46.335 1.00 40.59  ? 121 ASP B CG  1 
ATOM   5447 O  OD1 . ASP E 2 83  ? -37.295  32.253  -46.406 1.00 38.72  ? 121 ASP B OD1 1 
ATOM   5448 O  OD2 . ASP E 2 83  ? -35.424  33.219  -46.929 1.00 43.34  ? 121 ASP B OD2 1 
ATOM   5449 N  N   . VAL E 2 84  ? -36.431  28.665  -46.225 1.00 39.71  ? 122 VAL B N   1 
ATOM   5450 C  CA  . VAL E 2 84  ? -37.216  27.858  -47.145 1.00 41.14  ? 122 VAL B CA  1 
ATOM   5451 C  C   . VAL E 2 84  ? -38.304  27.097  -46.378 1.00 40.98  ? 122 VAL B C   1 
ATOM   5452 O  O   . VAL E 2 84  ? -39.469  27.149  -46.768 1.00 41.71  ? 122 VAL B O   1 
ATOM   5453 C  CB  . VAL E 2 84  ? -36.317  26.950  -48.003 1.00 41.77  ? 122 VAL B CB  1 
ATOM   5454 C  CG1 . VAL E 2 84  ? -37.138  25.970  -48.821 1.00 42.95  ? 122 VAL B CG1 1 
ATOM   5455 C  CG2 . VAL E 2 84  ? -35.481  27.816  -48.939 1.00 42.87  ? 122 VAL B CG2 1 
ATOM   5456 N  N   . LEU E 2 85  ? -37.930  26.453  -45.269 1.00 40.99  ? 123 LEU B N   1 
ATOM   5457 C  CA  . LEU E 2 85  ? -38.874  25.737  -44.394 1.00 40.01  ? 123 LEU B CA  1 
ATOM   5458 C  C   . LEU E 2 85  ? -40.047  26.613  -43.984 1.00 39.36  ? 123 LEU B C   1 
ATOM   5459 O  O   . LEU E 2 85  ? -41.188  26.243  -44.205 1.00 38.65  ? 123 LEU B O   1 
ATOM   5460 C  CB  . LEU E 2 85  ? -38.175  25.211  -43.132 1.00 40.53  ? 123 LEU B CB  1 
ATOM   5461 C  CG  . LEU E 2 85  ? -39.022  24.385  -42.148 1.00 40.68  ? 123 LEU B CG  1 
ATOM   5462 C  CD1 . LEU E 2 85  ? -38.327  23.121  -41.660 1.00 40.82  ? 123 LEU B CD1 1 
ATOM   5463 C  CD2 . LEU E 2 85  ? -39.424  25.221  -40.948 1.00 41.40  ? 123 LEU B CD2 1 
ATOM   5464 N  N   . CYS E 2 86  ? -39.767  27.772  -43.398 1.00 37.96  ? 124 CYS B N   1 
ATOM   5465 C  CA  . CYS E 2 86  ? -40.836  28.631  -42.864 1.00 36.87  ? 124 CYS B CA  1 
ATOM   5466 C  C   . CYS E 2 86  ? -41.773  29.199  -43.937 1.00 37.01  ? 124 CYS B C   1 
ATOM   5467 O  O   . CYS E 2 86  ? -42.979  29.325  -43.708 1.00 38.73  ? 124 CYS B O   1 
ATOM   5468 C  CB  . CYS E 2 86  ? -40.266  29.760  -42.006 1.00 35.81  ? 124 CYS B CB  1 
ATOM   5469 S  SG  . CYS E 2 86  ? -39.670  29.161  -40.416 1.00 36.45  ? 124 CYS B SG  1 
ATOM   5470 N  N   . VAL E 2 87  ? -41.221  29.531  -45.094 1.00 37.07  ? 125 VAL B N   1 
ATOM   5471 C  CA  . VAL E 2 87  ? -42.015  30.034  -46.208 1.00 37.98  ? 125 VAL B CA  1 
ATOM   5472 C  C   . VAL E 2 87  ? -42.878  28.914  -46.760 1.00 37.92  ? 125 VAL B C   1 
ATOM   5473 O  O   . VAL E 2 87  ? -44.066  29.115  -46.988 1.00 36.94  ? 125 VAL B O   1 
ATOM   5474 C  CB  . VAL E 2 87  ? -41.121  30.673  -47.296 1.00 39.90  ? 125 VAL B CB  1 
ATOM   5475 C  CG1 . VAL E 2 87  ? -41.868  30.876  -48.607 1.00 40.45  ? 125 VAL B CG1 1 
ATOM   5476 C  CG2 . VAL E 2 87  ? -40.593  32.014  -46.797 1.00 39.79  ? 125 VAL B CG2 1 
ATOM   5477 N  N   . THR E 2 88  ? -42.294  27.741  -46.957 1.00 39.01  ? 126 THR B N   1 
ATOM   5478 C  CA  . THR E 2 88  ? -43.056  26.575  -47.410 1.00 42.29  ? 126 THR B CA  1 
ATOM   5479 C  C   . THR E 2 88  ? -44.178  26.199  -46.450 1.00 43.41  ? 126 THR B C   1 
ATOM   5480 O  O   . THR E 2 88  ? -45.288  25.926  -46.886 1.00 49.21  ? 126 THR B O   1 
ATOM   5481 C  CB  . THR E 2 88  ? -42.141  25.356  -47.612 1.00 45.02  ? 126 THR B CB  1 
ATOM   5482 O  OG1 . THR E 2 88  ? -41.134  25.683  -48.573 1.00 52.68  ? 126 THR B OG1 1 
ATOM   5483 C  CG2 . THR E 2 88  ? -42.923  24.128  -48.097 1.00 44.38  ? 126 THR B CG2 1 
ATOM   5484 N  N   . ALA E 2 89  ? -43.890  26.188  -45.152 1.00 41.66  ? 127 ALA B N   1 
ATOM   5485 C  CA  . ALA E 2 89  ? -44.907  25.896  -44.132 1.00 38.57  ? 127 ALA B CA  1 
ATOM   5486 C  C   . ALA E 2 89  ? -45.992  26.961  -44.096 1.00 37.05  ? 127 ALA B C   1 
ATOM   5487 O  O   . ALA E 2 89  ? -47.158  26.646  -43.962 1.00 36.30  ? 127 ALA B O   1 
ATOM   5488 C  CB  . ALA E 2 89  ? -44.272  25.768  -42.764 1.00 38.43  ? 127 ALA B CB  1 
ATOM   5489 N  N   . SER E 2 90  ? -45.603  28.223  -44.213 1.00 36.15  ? 128 SER B N   1 
ATOM   5490 C  CA  . SER E 2 90  ? -46.568  29.311  -44.219 1.00 36.23  ? 128 SER B CA  1 
ATOM   5491 C  C   . SER E 2 90  ? -47.543  29.183  -45.375 1.00 36.45  ? 128 SER B C   1 
ATOM   5492 O  O   . SER E 2 90  ? -48.745  29.136  -45.165 1.00 34.81  ? 128 SER B O   1 
ATOM   5493 C  CB  . SER E 2 90  ? -45.859  30.660  -44.290 1.00 36.42  ? 128 SER B CB  1 
ATOM   5494 O  OG  . SER E 2 90  ? -46.784  31.708  -44.078 1.00 37.29  ? 128 SER B OG  1 
ATOM   5495 N  N   . ILE E 2 91  ? -47.017  29.090  -46.591 1.00 39.30  ? 129 ILE B N   1 
ATOM   5496 C  CA  . ILE E 2 91  ? -47.857  29.070  -47.799 1.00 42.54  ? 129 ILE B CA  1 
ATOM   5497 C  C   . ILE E 2 91  ? -48.652  27.763  -47.904 1.00 43.14  ? 129 ILE B C   1 
ATOM   5498 O  O   . ILE E 2 91  ? -49.843  27.807  -48.165 1.00 40.73  ? 129 ILE B O   1 
ATOM   5499 C  CB  . ILE E 2 91  ? -47.039  29.321  -49.096 1.00 44.31  ? 129 ILE B CB  1 
ATOM   5500 C  CG1 . ILE E 2 91  ? -46.351  30.700  -49.056 1.00 44.92  ? 129 ILE B CG1 1 
ATOM   5501 C  CG2 . ILE E 2 91  ? -47.929  29.194  -50.338 1.00 44.21  ? 129 ILE B CG2 1 
ATOM   5502 C  CD1 . ILE E 2 91  ? -45.353  30.948  -50.175 1.00 44.11  ? 129 ILE B CD1 1 
ATOM   5503 N  N   . GLU E 2 92  ? -48.015  26.614  -47.691 1.00 43.19  ? 130 GLU B N   1 
ATOM   5504 C  CA  . GLU E 2 92  ? -48.758  25.349  -47.679 1.00 44.32  ? 130 GLU B CA  1 
ATOM   5505 C  C   . GLU E 2 92  ? -49.864  25.336  -46.625 1.00 46.14  ? 130 GLU B C   1 
ATOM   5506 O  O   . GLU E 2 92  ? -50.897  24.745  -46.869 1.00 51.45  ? 130 GLU B O   1 
ATOM   5507 C  CB  . GLU E 2 92  ? -47.849  24.138  -47.464 1.00 44.81  ? 130 GLU B CB  1 
ATOM   5508 C  CG  . GLU E 2 92  ? -47.085  23.745  -48.715 1.00 47.11  ? 130 GLU B CG  1 
ATOM   5509 C  CD  . GLU E 2 92  ? -46.277  22.463  -48.548 1.00 49.03  ? 130 GLU B CD  1 
ATOM   5510 O  OE1 . GLU E 2 92  ? -46.433  21.738  -47.530 1.00 50.59  ? 130 GLU B OE1 1 
ATOM   5511 O  OE2 . GLU E 2 92  ? -45.466  22.178  -49.445 1.00 49.29  ? 130 GLU B OE2 1 
ATOM   5512 N  N   . THR E 2 93  ? -49.651  25.975  -45.471 1.00 45.48  ? 131 THR B N   1 
ATOM   5513 C  CA  . THR E 2 93  ? -50.695  26.101  -44.439 1.00 44.43  ? 131 THR B CA  1 
ATOM   5514 C  C   . THR E 2 93  ? -51.827  27.043  -44.894 1.00 42.31  ? 131 THR B C   1 
ATOM   5515 O  O   . THR E 2 93  ? -52.971  26.810  -44.546 1.00 39.53  ? 131 THR B O   1 
ATOM   5516 C  CB  . THR E 2 93  ? -50.121  26.523  -43.055 1.00 45.06  ? 131 THR B CB  1 
ATOM   5517 O  OG1 . THR E 2 93  ? -49.221  25.515  -42.585 1.00 44.69  ? 131 THR B OG1 1 
ATOM   5518 C  CG2 . THR E 2 93  ? -51.214  26.667  -42.009 1.00 45.24  ? 131 THR B CG2 1 
ATOM   5519 N  N   . LEU E 2 94  ? -51.523  28.080  -45.674 1.00 41.59  ? 132 LEU B N   1 
ATOM   5520 C  CA  . LEU E 2 94  ? -52.573  28.898  -46.295 1.00 42.85  ? 132 LEU B CA  1 
ATOM   5521 C  C   . LEU E 2 94  ? -53.453  28.062  -47.205 1.00 43.59  ? 132 LEU B C   1 
ATOM   5522 O  O   . LEU E 2 94  ? -54.655  28.247  -47.267 1.00 44.46  ? 132 LEU B O   1 
ATOM   5523 C  CB  . LEU E 2 94  ? -51.978  30.037  -47.121 1.00 45.52  ? 132 LEU B CB  1 
ATOM   5524 C  CG  . LEU E 2 94  ? -51.269  31.152  -46.359 1.00 50.20  ? 132 LEU B CG  1 
ATOM   5525 C  CD1 . LEU E 2 94  ? -50.776  32.229  -47.311 1.00 51.13  ? 132 LEU B CD1 1 
ATOM   5526 C  CD2 . LEU E 2 94  ? -52.187  31.775  -45.310 1.00 52.17  ? 132 LEU B CD2 1 
ATOM   5527 N  N   . CYS E 2 95  ? -52.819  27.158  -47.936 1.00 43.91  ? 133 CYS B N   1 
ATOM   5528 C  CA  . CYS E 2 95  ? -53.495  26.202  -48.800 1.00 42.14  ? 133 CYS B CA  1 
ATOM   5529 C  C   . CYS E 2 95  ? -54.399  25.228  -48.040 1.00 38.75  ? 133 CYS B C   1 
ATOM   5530 O  O   . CYS E 2 95  ? -55.469  24.892  -48.531 1.00 40.82  ? 133 CYS B O   1 
ATOM   5531 C  CB  . CYS E 2 95  ? -52.448  25.440  -49.602 1.00 43.36  ? 133 CYS B CB  1 
ATOM   5532 S  SG  . CYS E 2 95  ? -53.110  24.130  -50.628 1.00 51.54  ? 133 CYS B SG  1 
ATOM   5533 N  N   . VAL E 2 96  ? -53.983  24.780  -46.862 1.00 34.65  ? 134 VAL B N   1 
ATOM   5534 C  CA  . VAL E 2 96  ? -54.802  23.881  -46.045 1.00 34.78  ? 134 VAL B CA  1 
ATOM   5535 C  C   . VAL E 2 96  ? -56.015  24.620  -45.475 1.00 34.41  ? 134 VAL B C   1 
ATOM   5536 O  O   . VAL E 2 96  ? -57.114  24.068  -45.442 1.00 33.12  ? 134 VAL B O   1 
ATOM   5537 C  CB  . VAL E 2 96  ? -53.973  23.240  -44.906 1.00 36.16  ? 134 VAL B CB  1 
ATOM   5538 C  CG1 . VAL E 2 96  ? -54.850  22.462  -43.926 1.00 36.46  ? 134 VAL B CG1 1 
ATOM   5539 C  CG2 . VAL E 2 96  ? -52.908  22.314  -45.470 1.00 36.65  ? 134 VAL B CG2 1 
ATOM   5540 N  N   . ILE E 2 97  ? -55.805  25.860  -45.030 1.00 35.68  ? 135 ILE B N   1 
ATOM   5541 C  CA  . ILE E 2 97  ? -56.886  26.741  -44.551 1.00 37.03  ? 135 ILE B CA  1 
ATOM   5542 C  C   . ILE E 2 97  ? -57.935  26.957  -45.634 1.00 40.80  ? 135 ILE B C   1 
ATOM   5543 O  O   . ILE E 2 97  ? -59.111  26.906  -45.340 1.00 47.05  ? 135 ILE B O   1 
ATOM   5544 C  CB  . ILE E 2 97  ? -56.351  28.097  -44.005 1.00 34.93  ? 135 ILE B CB  1 
ATOM   5545 C  CG1 . ILE E 2 97  ? -55.676  27.869  -42.649 1.00 34.66  ? 135 ILE B CG1 1 
ATOM   5546 C  CG2 . ILE E 2 97  ? -57.448  29.139  -43.841 1.00 33.35  ? 135 ILE B CG2 1 
ATOM   5547 C  CD1 . ILE E 2 97  ? -54.638  28.905  -42.304 1.00 34.91  ? 135 ILE B CD1 1 
ATOM   5548 N  N   . ALA E 2 98  ? -57.525  27.179  -46.875 1.00 42.61  ? 136 ALA B N   1 
ATOM   5549 C  CA  . ALA E 2 98  ? -58.486  27.285  -47.983 1.00 45.58  ? 136 ALA B CA  1 
ATOM   5550 C  C   . ALA E 2 98  ? -59.337  26.020  -48.127 1.00 49.34  ? 136 ALA B C   1 
ATOM   5551 O  O   . ALA E 2 98  ? -60.565  26.106  -48.235 1.00 51.65  ? 136 ALA B O   1 
ATOM   5552 C  CB  . ALA E 2 98  ? -57.773  27.585  -49.283 1.00 45.93  ? 136 ALA B CB  1 
ATOM   5553 N  N   . ILE E 2 99  ? -58.690  24.858  -48.104 1.00 51.37  ? 137 ILE B N   1 
ATOM   5554 C  CA  . ILE E 2 99  ? -59.402  23.579  -48.170 1.00 53.36  ? 137 ILE B CA  1 
ATOM   5555 C  C   . ILE E 2 99  ? -60.335  23.439  -46.981 1.00 54.91  ? 137 ILE B C   1 
ATOM   5556 O  O   . ILE E 2 99  ? -61.489  23.070  -47.157 1.00 60.83  ? 137 ILE B O   1 
ATOM   5557 C  CB  . ILE E 2 99  ? -58.435  22.368  -48.190 1.00 54.65  ? 137 ILE B CB  1 
ATOM   5558 C  CG1 . ILE E 2 99  ? -57.651  22.353  -49.508 1.00 54.29  ? 137 ILE B CG1 1 
ATOM   5559 C  CG2 . ILE E 2 99  ? -59.171  21.038  -47.985 1.00 55.31  ? 137 ILE B CG2 1 
ATOM   5560 C  CD1 . ILE E 2 99  ? -56.453  21.419  -49.501 1.00 53.58  ? 137 ILE B CD1 1 
ATOM   5561 N  N   . ASP E 2 100 ? -59.829  23.729  -45.783 1.00 54.78  ? 138 ASP B N   1 
ATOM   5562 C  CA  . ASP E 2 100 ? -60.617  23.626  -44.540 1.00 55.43  ? 138 ASP B CA  1 
ATOM   5563 C  C   . ASP E 2 100 ? -61.907  24.417  -44.642 1.00 53.48  ? 138 ASP B C   1 
ATOM   5564 O  O   . ASP E 2 100 ? -62.986  23.843  -44.490 1.00 54.76  ? 138 ASP B O   1 
ATOM   5565 C  CB  . ASP E 2 100 ? -59.783  24.103  -43.340 1.00 57.18  ? 138 ASP B CB  1 
ATOM   5566 C  CG  . ASP E 2 100 ? -60.602  24.370  -42.104 1.00 57.03  ? 138 ASP B CG  1 
ATOM   5567 O  OD1 . ASP E 2 100 ? -61.343  23.506  -41.650 1.00 62.02  ? 138 ASP B OD1 1 
ATOM   5568 O  OD2 . ASP E 2 100 ? -60.524  25.468  -41.550 1.00 54.50  ? 138 ASP B OD2 1 
ATOM   5569 N  N   . ARG E 2 101 ? -61.788  25.711  -44.927 1.00 51.84  ? 139 ARG B N   1 
ATOM   5570 C  CA  . ARG E 2 101 ? -62.953  26.594  -45.045 1.00 55.27  ? 139 ARG B CA  1 
ATOM   5571 C  C   . ARG E 2 101 ? -63.853  26.232  -46.207 1.00 57.75  ? 139 ARG B C   1 
ATOM   5572 O  O   . ARG E 2 101 ? -65.050  26.444  -46.137 1.00 62.77  ? 139 ARG B O   1 
ATOM   5573 C  CB  . ARG E 2 101 ? -62.541  28.063  -45.189 1.00 55.86  ? 139 ARG B CB  1 
ATOM   5574 C  CG  . ARG E 2 101 ? -61.731  28.616  -44.026 1.00 57.29  ? 139 ARG B CG  1 
ATOM   5575 C  CD  . ARG E 2 101 ? -62.360  28.324  -42.679 1.00 57.81  ? 139 ARG B CD  1 
ATOM   5576 N  NE  . ARG E 2 101 ? -63.732  28.821  -42.627 1.00 58.53  ? 139 ARG B NE  1 
ATOM   5577 C  CZ  . ARG E 2 101 ? -64.717  28.324  -41.879 1.00 58.80  ? 139 ARG B CZ  1 
ATOM   5578 N  NH1 . ARG E 2 101 ? -65.923  28.896  -41.929 1.00 58.70  ? 139 ARG B NH1 1 
ATOM   5579 N  NH2 . ARG E 2 101 ? -64.519  27.259  -41.104 1.00 57.79  ? 139 ARG B NH2 1 
ATOM   5580 N  N   . TYR E 2 102 ? -63.294  25.695  -47.279 1.00 59.99  ? 140 TYR B N   1 
ATOM   5581 C  CA  . TYR E 2 102 ? -64.117  25.232  -48.387 1.00 59.91  ? 140 TYR B CA  1 
ATOM   5582 C  C   . TYR E 2 102 ? -65.074  24.114  -47.980 1.00 56.03  ? 140 TYR B C   1 
ATOM   5583 O  O   . TYR E 2 102 ? -66.258  24.179  -48.300 1.00 53.53  ? 140 TYR B O   1 
ATOM   5584 C  CB  . TYR E 2 102 ? -63.253  24.777  -49.554 1.00 61.03  ? 140 TYR B CB  1 
ATOM   5585 C  CG  . TYR E 2 102 ? -64.027  24.013  -50.587 1.00 62.04  ? 140 TYR B CG  1 
ATOM   5586 C  CD1 . TYR E 2 102 ? -64.831  24.673  -51.515 1.00 62.29  ? 140 TYR B CD1 1 
ATOM   5587 C  CD2 . TYR E 2 102 ? -63.992  22.629  -50.612 1.00 63.80  ? 140 TYR B CD2 1 
ATOM   5588 C  CE1 . TYR E 2 102 ? -65.556  23.972  -52.464 1.00 62.78  ? 140 TYR B CE1 1 
ATOM   5589 C  CE2 . TYR E 2 102 ? -64.708  21.913  -51.565 1.00 65.86  ? 140 TYR B CE2 1 
ATOM   5590 C  CZ  . TYR E 2 102 ? -65.489  22.590  -52.482 1.00 65.22  ? 140 TYR B CZ  1 
ATOM   5591 O  OH  . TYR E 2 102 ? -66.212  21.869  -53.394 1.00 65.93  ? 140 TYR B OH  1 
ATOM   5592 N  N   . LEU E 2 103 ? -64.559  23.097  -47.295 1.00 55.22  ? 141 LEU B N   1 
ATOM   5593 C  CA  . LEU E 2 103 ? -65.398  21.989  -46.830 1.00 57.73  ? 141 LEU B CA  1 
ATOM   5594 C  C   . LEU E 2 103 ? -66.401  22.430  -45.768 1.00 60.93  ? 141 LEU B C   1 
ATOM   5595 O  O   . LEU E 2 103 ? -67.569  22.043  -45.813 1.00 60.33  ? 141 LEU B O   1 
ATOM   5596 C  CB  . LEU E 2 103 ? -64.551  20.853  -46.266 1.00 59.12  ? 141 LEU B CB  1 
ATOM   5597 C  CG  . LEU E 2 103 ? -63.496  20.188  -47.182 1.00 59.67  ? 141 LEU B CG  1 
ATOM   5598 C  CD1 . LEU E 2 103 ? -62.858  18.984  -46.499 1.00 60.92  ? 141 LEU B CD1 1 
ATOM   5599 C  CD2 . LEU E 2 103 ? -64.057  19.761  -48.527 1.00 58.50  ? 141 LEU B CD2 1 
ATOM   5600 N  N   . ALA E 2 104 ? -65.942  23.236  -44.818 1.00 63.59  ? 142 ALA B N   1 
ATOM   5601 C  CA  . ALA E 2 104 ? -66.803  23.736  -43.745 1.00 63.99  ? 142 ALA B CA  1 
ATOM   5602 C  C   . ALA E 2 104 ? -67.957  24.635  -44.232 1.00 65.43  ? 142 ALA B C   1 
ATOM   5603 O  O   . ALA E 2 104 ? -69.000  24.704  -43.580 1.00 71.40  ? 142 ALA B O   1 
ATOM   5604 C  CB  . ALA E 2 104 ? -65.966  24.480  -42.715 1.00 65.18  ? 142 ALA B CB  1 
ATOM   5605 N  N   . ILE E 2 105 ? -67.763  25.326  -45.354 1.00 63.02  ? 143 ILE B N   1 
ATOM   5606 C  CA  . ILE E 2 105 ? -68.769  26.224  -45.930 1.00 66.46  ? 143 ILE B CA  1 
ATOM   5607 C  C   . ILE E 2 105 ? -69.699  25.509  -46.907 1.00 66.97  ? 143 ILE B C   1 
ATOM   5608 O  O   . ILE E 2 105 ? -70.873  25.847  -46.983 1.00 76.27  ? 143 ILE B O   1 
ATOM   5609 C  CB  . ILE E 2 105 ? -68.096  27.386  -46.688 1.00 70.85  ? 143 ILE B CB  1 
ATOM   5610 C  CG1 . ILE E 2 105 ? -67.412  28.334  -45.708 1.00 73.61  ? 143 ILE B CG1 1 
ATOM   5611 C  CG2 . ILE E 2 105 ? -69.102  28.179  -47.511 1.00 72.34  ? 143 ILE B CG2 1 
ATOM   5612 C  CD1 . ILE E 2 105 ? -66.539  29.377  -46.381 1.00 76.82  ? 143 ILE B CD1 1 
ATOM   5613 N  N   . THR E 2 106 ? -69.168  24.575  -47.699 1.00 63.82  ? 144 THR B N   1 
ATOM   5614 C  CA  . THR E 2 106 ? -69.961  23.922  -48.754 1.00 59.34  ? 144 THR B CA  1 
ATOM   5615 C  C   . THR E 2 106 ? -70.525  22.568  -48.342 1.00 59.34  ? 144 THR B C   1 
ATOM   5616 O  O   . THR E 2 106 ? -71.595  22.211  -48.819 1.00 64.36  ? 144 THR B O   1 
ATOM   5617 C  CB  . THR E 2 106 ? -69.179  23.749  -50.077 1.00 54.58  ? 144 THR B CB  1 
ATOM   5618 O  OG1 . THR E 2 106 ? -68.078  22.852  -49.887 1.00 53.61  ? 144 THR B OG1 1 
ATOM   5619 C  CG2 . THR E 2 106 ? -68.683  25.093  -50.588 1.00 53.00  ? 144 THR B CG2 1 
ATOM   5620 N  N   . SER E 2 107 ? -69.816  21.818  -47.488 1.00 56.67  ? 145 SER B N   1 
ATOM   5621 C  CA  . SER E 2 107 ? -70.254  20.475  -47.066 1.00 56.66  ? 145 SER B CA  1 
ATOM   5622 C  C   . SER E 2 107 ? -70.074  20.290  -45.557 1.00 56.11  ? 145 SER B C   1 
ATOM   5623 O  O   . SER E 2 107 ? -69.393  19.347  -45.108 1.00 56.92  ? 145 SER B O   1 
ATOM   5624 C  CB  . SER E 2 107 ? -69.488  19.401  -47.832 1.00 56.28  ? 145 SER B CB  1 
ATOM   5625 O  OG  . SER E 2 107 ? -69.688  19.549  -49.223 1.00 57.54  ? 145 SER B OG  1 
ATOM   5626 N  N   . PRO E 2 108 ? -70.701  21.192  -44.771 1.00 54.00  ? 146 PRO B N   1 
ATOM   5627 C  CA  . PRO E 2 108 ? -70.390  21.313  -43.355 1.00 55.84  ? 146 PRO B CA  1 
ATOM   5628 C  C   . PRO E 2 108 ? -70.604  20.069  -42.524 1.00 59.33  ? 146 PRO B C   1 
ATOM   5629 O  O   . PRO E 2 108 ? -69.861  19.852  -41.563 1.00 59.88  ? 146 PRO B O   1 
ATOM   5630 C  CB  . PRO E 2 108 ? -71.334  22.428  -42.878 1.00 54.29  ? 146 PRO B CB  1 
ATOM   5631 C  CG  . PRO E 2 108 ? -72.390  22.531  -43.902 1.00 52.45  ? 146 PRO B CG  1 
ATOM   5632 C  CD  . PRO E 2 108 ? -71.753  22.147  -45.179 1.00 52.45  ? 146 PRO B CD  1 
ATOM   5633 N  N   . PHE E 2 109 ? -71.602  19.262  -42.880 1.00 64.50  ? 147 PHE B N   1 
ATOM   5634 C  CA  . PHE E 2 109 ? -71.977  18.112  -42.054 1.00 70.06  ? 147 PHE B CA  1 
ATOM   5635 C  C   . PHE E 2 109 ? -71.026  16.955  -42.321 1.00 72.47  ? 147 PHE B C   1 
ATOM   5636 O  O   . PHE E 2 109 ? -70.586  16.275  -41.380 1.00 69.52  ? 147 PHE B O   1 
ATOM   5637 C  CB  . PHE E 2 109 ? -73.441  17.705  -42.290 1.00 71.44  ? 147 PHE B CB  1 
ATOM   5638 C  CG  . PHE E 2 109 ? -74.424  18.831  -42.086 1.00 70.83  ? 147 PHE B CG  1 
ATOM   5639 C  CD1 . PHE E 2 109 ? -74.508  19.476  -40.854 1.00 71.76  ? 147 PHE B CD1 1 
ATOM   5640 C  CD2 . PHE E 2 109 ? -75.255  19.259  -43.122 1.00 70.34  ? 147 PHE B CD2 1 
ATOM   5641 C  CE1 . PHE E 2 109 ? -75.396  20.528  -40.658 1.00 71.00  ? 147 PHE B CE1 1 
ATOM   5642 C  CE2 . PHE E 2 109 ? -76.149  20.302  -42.927 1.00 70.31  ? 147 PHE B CE2 1 
ATOM   5643 C  CZ  . PHE E 2 109 ? -76.216  20.941  -41.697 1.00 71.02  ? 147 PHE B CZ  1 
ATOM   5644 N  N   . ARG E 2 110 ? -70.703  16.750  -43.600 1.00 77.82  ? 148 ARG B N   1 
ATOM   5645 C  CA  . ARG E 2 110 ? -69.693  15.767  -43.983 1.00 84.19  ? 148 ARG B CA  1 
ATOM   5646 C  C   . ARG E 2 110 ? -68.346  16.134  -43.337 1.00 81.35  ? 148 ARG B C   1 
ATOM   5647 O  O   . ARG E 2 110 ? -67.688  15.277  -42.734 1.00 73.94  ? 148 ARG B O   1 
ATOM   5648 C  CB  . ARG E 2 110 ? -69.570  15.673  -45.516 1.00 91.40  ? 148 ARG B CB  1 
ATOM   5649 C  CG  . ARG E 2 110 ? -68.999  14.353  -46.024 1.00 100.45 ? 148 ARG B CG  1 
ATOM   5650 C  CD  . ARG E 2 110 ? -68.876  14.319  -47.545 1.00 106.28 ? 148 ARG B CD  1 
ATOM   5651 N  NE  . ARG E 2 110 ? -68.182  13.105  -48.008 1.00 112.05 ? 148 ARG B NE  1 
ATOM   5652 C  CZ  . ARG E 2 110 ? -67.954  12.774  -49.285 1.00 110.30 ? 148 ARG B CZ  1 
ATOM   5653 N  NH1 . ARG E 2 110 ? -68.359  13.564  -50.285 1.00 111.57 ? 148 ARG B NH1 1 
ATOM   5654 N  NH2 . ARG E 2 110 ? -67.312  11.636  -49.568 1.00 105.38 ? 148 ARG B NH2 1 
ATOM   5655 N  N   . TYR E 2 111 ? -67.984  17.416  -43.432 1.00 81.38  ? 149 TYR B N   1 
ATOM   5656 C  CA  . TYR E 2 111 ? -66.744  17.925  -42.845 1.00 80.60  ? 149 TYR B CA  1 
ATOM   5657 C  C   . TYR E 2 111 ? -66.541  17.600  -41.348 1.00 74.37  ? 149 TYR B C   1 
ATOM   5658 O  O   . TYR E 2 111 ? -65.453  17.192  -40.939 1.00 74.61  ? 149 TYR B O   1 
ATOM   5659 C  CB  . TYR E 2 111 ? -66.611  19.446  -43.072 1.00 85.70  ? 149 TYR B CB  1 
ATOM   5660 C  CG  . TYR E 2 111 ? -65.241  19.951  -42.633 1.00 89.46  ? 149 TYR B CG  1 
ATOM   5661 C  CD1 . TYR E 2 111 ? -64.082  19.523  -43.304 1.00 92.04  ? 149 TYR B CD1 1 
ATOM   5662 C  CD2 . TYR E 2 111 ? -65.087  20.833  -41.552 1.00 88.86  ? 149 TYR B CD2 1 
ATOM   5663 C  CE1 . TYR E 2 111 ? -62.829  19.971  -42.932 1.00 93.84  ? 149 TYR B CE1 1 
ATOM   5664 C  CE2 . TYR E 2 111 ? -63.825  21.266  -41.150 1.00 89.39  ? 149 TYR B CE2 1 
ATOM   5665 C  CZ  . TYR E 2 111 ? -62.699  20.819  -41.843 1.00 95.10  ? 149 TYR B CZ  1 
ATOM   5666 O  OH  . TYR E 2 111 ? -61.423  21.198  -41.482 1.00 94.60  ? 149 TYR B OH  1 
ATOM   5667 N  N   . GLN E 2 112 ? -67.587  17.760  -40.546 1.00 70.13  ? 150 GLN B N   1 
ATOM   5668 C  CA  . GLN E 2 112 ? -67.464  17.580  -39.090 1.00 72.91  ? 150 GLN B CA  1 
ATOM   5669 C  C   . GLN E 2 112 ? -67.079  16.167  -38.675 1.00 76.22  ? 150 GLN B C   1 
ATOM   5670 O  O   . GLN E 2 112 ? -66.229  15.978  -37.801 1.00 76.68  ? 150 GLN B O   1 
ATOM   5671 C  CB  . GLN E 2 112 ? -68.752  17.987  -38.381 1.00 73.10  ? 150 GLN B CB  1 
ATOM   5672 C  CG  . GLN E 2 112 ? -68.903  19.498  -38.302 1.00 74.71  ? 150 GLN B CG  1 
ATOM   5673 C  CD  . GLN E 2 112 ? -70.326  19.936  -38.079 1.00 76.41  ? 150 GLN B CD  1 
ATOM   5674 O  OE1 . GLN E 2 112 ? -71.134  19.194  -37.519 1.00 79.37  ? 150 GLN B OE1 1 
ATOM   5675 N  NE2 . GLN E 2 112 ? -70.643  21.150  -38.508 1.00 76.14  ? 150 GLN B NE2 1 
ATOM   5676 N  N   . SER E 2 113 ? -67.723  15.185  -39.290 1.00 78.45  ? 151 SER B N   1 
ATOM   5677 C  CA  . SER E 2 113 ? -67.394  13.781  -39.057 1.00 77.27  ? 151 SER B CA  1 
ATOM   5678 C  C   . SER E 2 113 ? -66.073  13.395  -39.737 1.00 77.75  ? 151 SER B C   1 
ATOM   5679 O  O   . SER E 2 113 ? -65.285  12.627  -39.166 1.00 74.84  ? 151 SER B O   1 
ATOM   5680 C  CB  . SER E 2 113 ? -68.534  12.893  -39.549 1.00 77.73  ? 151 SER B CB  1 
ATOM   5681 O  OG  . SER E 2 113 ? -68.993  13.343  -40.812 1.00 78.28  ? 151 SER B OG  1 
ATOM   5682 N  N   . LEU E 2 114 ? -65.824  13.944  -40.934 1.00 80.21  ? 152 LEU B N   1 
ATOM   5683 C  CA  . LEU E 2 114 ? -64.614  13.622  -41.709 1.00 81.02  ? 152 LEU B CA  1 
ATOM   5684 C  C   . LEU E 2 114 ? -63.320  14.190  -41.099 1.00 77.77  ? 152 LEU B C   1 
ATOM   5685 O  O   . LEU E 2 114 ? -62.328  13.476  -41.019 1.00 81.93  ? 152 LEU B O   1 
ATOM   5686 C  CB  . LEU E 2 114 ? -64.762  14.098  -43.159 1.00 84.27  ? 152 LEU B CB  1 
ATOM   5687 C  CG  . LEU E 2 114 ? -63.705  13.668  -44.187 1.00 85.63  ? 152 LEU B CG  1 
ATOM   5688 C  CD1 . LEU E 2 114 ? -64.384  13.519  -45.543 1.00 83.92  ? 152 LEU B CD1 1 
ATOM   5689 C  CD2 . LEU E 2 114 ? -62.509  14.617  -44.302 1.00 86.32  ? 152 LEU B CD2 1 
ATOM   5690 N  N   . MET E 2 115 ? -63.330  15.466  -40.708 1.00 72.45  ? 153 MET B N   1 
ATOM   5691 C  CA  . MET E 2 115 ? -62.146  16.113  -40.169 1.00 71.89  ? 153 MET B CA  1 
ATOM   5692 C  C   . MET E 2 115 ? -62.184  16.156  -38.659 1.00 68.63  ? 153 MET B C   1 
ATOM   5693 O  O   . MET E 2 115 ? -62.987  16.874  -38.088 1.00 78.38  ? 153 MET B O   1 
ATOM   5694 C  CB  . MET E 2 115 ? -62.027  17.541  -40.717 1.00 75.01  ? 153 MET B CB  1 
ATOM   5695 C  CG  . MET E 2 115 ? -60.714  18.260  -40.360 1.00 76.83  ? 153 MET B CG  1 
ATOM   5696 S  SD  . MET E 2 115 ? -59.228  17.624  -41.177 1.00 78.15  ? 153 MET B SD  1 
ATOM   5697 C  CE  . MET E 2 115 ? -59.771  17.501  -42.888 1.00 78.60  ? 153 MET B CE  1 
ATOM   5698 N  N   . THR E 2 116 ? -61.308  15.392  -38.017 1.00 63.97  ? 154 THR B N   1 
ATOM   5699 C  CA  . THR E 2 116 ? -61.184  15.422  -36.571 1.00 66.55  ? 154 THR B CA  1 
ATOM   5700 C  C   . THR E 2 116 ? -59.980  16.259  -36.163 1.00 66.85  ? 154 THR B C   1 
ATOM   5701 O  O   . THR E 2 116 ? -59.173  16.654  -36.998 1.00 67.36  ? 154 THR B O   1 
ATOM   5702 C  CB  . THR E 2 116 ? -61.053  14.003  -36.000 1.00 67.17  ? 154 THR B CB  1 
ATOM   5703 O  OG1 . THR E 2 116 ? -59.837  13.399  -36.460 1.00 67.24  ? 154 THR B OG1 1 
ATOM   5704 C  CG2 . THR E 2 116 ? -62.255  13.153  -36.437 1.00 67.88  ? 154 THR B CG2 1 
ATOM   5705 N  N   . ARG E 2 117 ? -59.876  16.530  -34.864 1.00 68.23  ? 155 ARG B N   1 
ATOM   5706 C  CA  . ARG E 2 117 ? -58.715  17.203  -34.288 1.00 70.14  ? 155 ARG B CA  1 
ATOM   5707 C  C   . ARG E 2 117 ? -57.432  16.373  -34.497 1.00 70.24  ? 155 ARG B C   1 
ATOM   5708 O  O   . ARG E 2 117 ? -56.363  16.916  -34.812 1.00 66.96  ? 155 ARG B O   1 
ATOM   5709 C  CB  . ARG E 2 117 ? -58.929  17.452  -32.790 1.00 70.53  ? 155 ARG B CB  1 
ATOM   5710 C  CG  . ARG E 2 117 ? -60.039  18.451  -32.460 1.00 70.28  ? 155 ARG B CG  1 
ATOM   5711 C  CD  . ARG E 2 117 ? -60.037  18.832  -30.985 1.00 69.98  ? 155 ARG B CD  1 
ATOM   5712 N  NE  . ARG E 2 117 ? -59.026  19.849  -30.679 1.00 70.03  ? 155 ARG B NE  1 
ATOM   5713 C  CZ  . ARG E 2 117 ? -59.138  21.155  -30.930 1.00 70.51  ? 155 ARG B CZ  1 
ATOM   5714 N  NH1 . ARG E 2 117 ? -60.232  21.650  -31.504 1.00 69.57  ? 155 ARG B NH1 1 
ATOM   5715 N  NH2 . ARG E 2 117 ? -58.134  21.975  -30.616 1.00 72.42  ? 155 ARG B NH2 1 
ATOM   5716 N  N   . ALA E 2 118 ? -57.547  15.057  -34.324 1.00 69.59  ? 156 ALA B N   1 
ATOM   5717 C  CA  . ALA E 2 118 ? -56.428  14.152  -34.555 1.00 66.30  ? 156 ALA B CA  1 
ATOM   5718 C  C   . ALA E 2 118 ? -55.994  14.154  -36.022 1.00 63.60  ? 156 ALA B C   1 
ATOM   5719 O  O   . ALA E 2 118 ? -54.797  14.071  -36.310 1.00 64.08  ? 156 ALA B O   1 
ATOM   5720 C  CB  . ALA E 2 118 ? -56.787  12.744  -34.099 1.00 67.88  ? 156 ALA B CB  1 
ATOM   5721 N  N   . ARG E 2 119 ? -56.955  14.254  -36.940 1.00 61.12  ? 157 ARG B N   1 
ATOM   5722 C  CA  . ARG E 2 119 ? -56.646  14.303  -38.362 1.00 64.01  ? 157 ARG B CA  1 
ATOM   5723 C  C   . ARG E 2 119 ? -55.964  15.618  -38.738 1.00 63.71  ? 157 ARG B C   1 
ATOM   5724 O  O   . ARG E 2 119 ? -55.023  15.618  -39.529 1.00 65.42  ? 157 ARG B O   1 
ATOM   5725 C  CB  . ARG E 2 119 ? -57.909  14.088  -39.200 1.00 66.48  ? 157 ARG B CB  1 
ATOM   5726 C  CG  . ARG E 2 119 ? -57.662  13.823  -40.679 1.00 71.44  ? 157 ARG B CG  1 
ATOM   5727 C  CD  . ARG E 2 119 ? -58.913  13.325  -41.412 1.00 76.73  ? 157 ARG B CD  1 
ATOM   5728 N  NE  . ARG E 2 119 ? -59.092  11.860  -41.314 1.00 78.30  ? 157 ARG B NE  1 
ATOM   5729 C  CZ  . ARG E 2 119 ? -59.858  11.210  -40.429 1.00 75.46  ? 157 ARG B CZ  1 
ATOM   5730 N  NH1 . ARG E 2 119 ? -60.583  11.856  -39.517 1.00 78.73  ? 157 ARG B NH1 1 
ATOM   5731 N  NH2 . ARG E 2 119 ? -59.901  9.883   -40.457 1.00 71.85  ? 157 ARG B NH2 1 
ATOM   5732 N  N   . ALA E 2 120 ? -56.433  16.727  -38.168 1.00 62.78  ? 158 ALA B N   1 
ATOM   5733 C  CA  . ALA E 2 120 ? -55.838  18.036  -38.431 1.00 60.51  ? 158 ALA B CA  1 
ATOM   5734 C  C   . ALA E 2 120 ? -54.378  18.112  -37.957 1.00 58.91  ? 158 ALA B C   1 
ATOM   5735 O  O   . ALA E 2 120 ? -53.543  18.715  -38.635 1.00 56.99  ? 158 ALA B O   1 
ATOM   5736 C  CB  . ALA E 2 120 ? -56.669  19.140  -37.789 1.00 60.63  ? 158 ALA B CB  1 
ATOM   5737 N  N   . LYS E 2 121 ? -54.077  17.504  -36.804 1.00 58.31  ? 159 LYS B N   1 
ATOM   5738 C  CA  . LYS E 2 121 ? -52.701  17.443  -36.295 1.00 59.53  ? 159 LYS B CA  1 
ATOM   5739 C  C   . LYS E 2 121 ? -51.775  16.719  -37.281 1.00 57.01  ? 159 LYS B C   1 
ATOM   5740 O  O   . LYS E 2 121 ? -50.648  17.157  -37.541 1.00 52.28  ? 159 LYS B O   1 
ATOM   5741 C  CB  . LYS E 2 121 ? -52.632  16.738  -34.940 1.00 64.10  ? 159 LYS B CB  1 
ATOM   5742 C  CG  . LYS E 2 121 ? -53.225  17.517  -33.767 1.00 68.05  ? 159 LYS B CG  1 
ATOM   5743 C  CD  . LYS E 2 121 ? -52.959  16.783  -32.452 1.00 71.65  ? 159 LYS B CD  1 
ATOM   5744 C  CE  . LYS E 2 121 ? -53.437  17.570  -31.241 1.00 72.72  ? 159 LYS B CE  1 
ATOM   5745 N  NZ  . LYS E 2 121 ? -54.912  17.745  -31.244 1.00 74.62  ? 159 LYS B NZ  1 
ATOM   5746 N  N   . VAL E 2 122 ? -52.258  15.609  -37.827 1.00 55.69  ? 160 VAL B N   1 
ATOM   5747 C  CA  . VAL E 2 122 ? -51.490  14.868  -38.817 1.00 53.21  ? 160 VAL B CA  1 
ATOM   5748 C  C   . VAL E 2 122 ? -51.273  15.721  -40.060 1.00 52.12  ? 160 VAL B C   1 
ATOM   5749 O  O   . VAL E 2 122 ? -50.166  15.750  -40.583 1.00 55.92  ? 160 VAL B O   1 
ATOM   5750 C  CB  . VAL E 2 122 ? -52.140  13.514  -39.168 1.00 52.76  ? 160 VAL B CB  1 
ATOM   5751 C  CG1 . VAL E 2 122 ? -51.476  12.868  -40.379 1.00 51.81  ? 160 VAL B CG1 1 
ATOM   5752 C  CG2 . VAL E 2 122 ? -52.056  12.580  -37.959 1.00 52.31  ? 160 VAL B CG2 1 
ATOM   5753 N  N   . ILE E 2 123 ? -52.306  16.425  -40.518 1.00 49.94  ? 161 ILE B N   1 
ATOM   5754 C  CA  . ILE E 2 123 ? -52.162  17.331  -41.674 1.00 49.67  ? 161 ILE B CA  1 
ATOM   5755 C  C   . ILE E 2 123 ? -51.111  18.397  -41.366 1.00 49.85  ? 161 ILE B C   1 
ATOM   5756 O  O   . ILE E 2 123 ? -50.254  18.673  -42.201 1.00 49.82  ? 161 ILE B O   1 
ATOM   5757 C  CB  . ILE E 2 123 ? -53.501  18.014  -42.089 1.00 48.17  ? 161 ILE B CB  1 
ATOM   5758 C  CG1 . ILE E 2 123 ? -54.488  16.977  -42.610 1.00 48.29  ? 161 ILE B CG1 1 
ATOM   5759 C  CG2 . ILE E 2 123 ? -53.294  19.087  -43.176 1.00 46.79  ? 161 ILE B CG2 1 
ATOM   5760 C  CD1 . ILE E 2 123 ? -55.913  17.472  -42.656 1.00 49.47  ? 161 ILE B CD1 1 
ATOM   5761 N  N   . ILE E 2 124 ? -51.161  18.973  -40.169 1.00 49.72  ? 162 ILE B N   1 
ATOM   5762 C  CA  . ILE E 2 124 ? -50.195  20.004  -39.796 1.00 48.94  ? 162 ILE B CA  1 
ATOM   5763 C  C   . ILE E 2 124 ? -48.780  19.421  -39.742 1.00 46.32  ? 162 ILE B C   1 
ATOM   5764 O  O   . ILE E 2 124 ? -47.867  19.993  -40.328 1.00 44.38  ? 162 ILE B O   1 
ATOM   5765 C  CB  . ILE E 2 124 ? -50.571  20.669  -38.461 1.00 50.19  ? 162 ILE B CB  1 
ATOM   5766 C  CG1 . ILE E 2 124 ? -51.854  21.482  -38.639 1.00 51.58  ? 162 ILE B CG1 1 
ATOM   5767 C  CG2 . ILE E 2 124 ? -49.442  21.568  -37.960 1.00 50.37  ? 162 ILE B CG2 1 
ATOM   5768 C  CD1 . ILE E 2 124 ? -52.611  21.693  -37.351 1.00 53.43  ? 162 ILE B CD1 1 
ATOM   5769 N  N   . CYS E 2 125 ? -48.616  18.285  -39.063 1.00 44.60  ? 163 CYS B N   1 
ATOM   5770 C  CA  . CYS E 2 125 ? -47.314  17.637  -38.964 1.00 45.30  ? 163 CYS B CA  1 
ATOM   5771 C  C   . CYS E 2 125 ? -46.736  17.289  -40.343 1.00 46.52  ? 163 CYS B C   1 
ATOM   5772 O  O   . CYS E 2 125 ? -45.540  17.468  -40.588 1.00 48.79  ? 163 CYS B O   1 
ATOM   5773 C  CB  . CYS E 2 125 ? -47.400  16.400  -38.078 1.00 45.64  ? 163 CYS B CB  1 
ATOM   5774 S  SG  . CYS E 2 125 ? -47.373  16.816  -36.311 1.00 44.65  ? 163 CYS B SG  1 
ATOM   5775 N  N   . THR E 2 126 ? -47.601  16.800  -41.228 1.00 45.59  ? 164 THR B N   1 
ATOM   5776 C  CA  . THR E 2 126 ? -47.242  16.551  -42.624 1.00 47.14  ? 164 THR B CA  1 
ATOM   5777 C  C   . THR E 2 126 ? -46.720  17.799  -43.321 1.00 47.75  ? 164 THR B C   1 
ATOM   5778 O  O   . THR E 2 126 ? -45.677  17.748  -43.971 1.00 51.02  ? 164 THR B O   1 
ATOM   5779 C  CB  . THR E 2 126 ? -48.446  16.035  -43.425 1.00 48.96  ? 164 THR B CB  1 
ATOM   5780 O  OG1 . THR E 2 126 ? -48.926  14.839  -42.808 1.00 52.24  ? 164 THR B OG1 1 
ATOM   5781 C  CG2 . THR E 2 126 ? -48.092  15.762  -44.884 1.00 48.56  ? 164 THR B CG2 1 
ATOM   5782 N  N   . VAL E 2 127 ? -47.435  18.914  -43.183 1.00 47.19  ? 165 VAL B N   1 
ATOM   5783 C  CA  . VAL E 2 127 ? -47.033  20.168  -43.836 1.00 48.26  ? 165 VAL B CA  1 
ATOM   5784 C  C   . VAL E 2 127 ? -45.611  20.540  -43.421 1.00 46.12  ? 165 VAL B C   1 
ATOM   5785 O  O   . VAL E 2 127 ? -44.801  20.863  -44.277 1.00 44.00  ? 165 VAL B O   1 
ATOM   5786 C  CB  . VAL E 2 127 ? -47.993  21.349  -43.535 1.00 50.19  ? 165 VAL B CB  1 
ATOM   5787 C  CG1 . VAL E 2 127 ? -47.409  22.665  -44.053 1.00 51.01  ? 165 VAL B CG1 1 
ATOM   5788 C  CG2 . VAL E 2 127 ? -49.366  21.111  -44.155 1.00 50.79  ? 165 VAL B CG2 1 
ATOM   5789 N  N   . TRP E 2 128 ? -45.313  20.477  -42.125 1.00 45.50  ? 166 TRP B N   1 
ATOM   5790 C  CA  . TRP E 2 128 ? -43.975  20.802  -41.636 1.00 46.67  ? 166 TRP B CA  1 
ATOM   5791 C  C   . TRP E 2 128 ? -42.922  19.775  -42.052 1.00 48.39  ? 166 TRP B C   1 
ATOM   5792 O  O   . TRP E 2 128 ? -41.785  20.146  -42.326 1.00 48.65  ? 166 TRP B O   1 
ATOM   5793 C  CB  . TRP E 2 128 ? -43.963  20.991  -40.113 1.00 45.98  ? 166 TRP B CB  1 
ATOM   5794 C  CG  . TRP E 2 128 ? -44.642  22.243  -39.692 1.00 44.02  ? 166 TRP B CG  1 
ATOM   5795 C  CD1 . TRP E 2 128 ? -45.957  22.397  -39.424 1.00 44.17  ? 166 TRP B CD1 1 
ATOM   5796 C  CD2 . TRP E 2 128 ? -44.048  23.539  -39.527 1.00 43.25  ? 166 TRP B CD2 1 
ATOM   5797 N  NE1 . TRP E 2 128 ? -46.232  23.698  -39.085 1.00 44.30  ? 166 TRP B NE1 1 
ATOM   5798 C  CE2 . TRP E 2 128 ? -45.076  24.422  -39.147 1.00 42.32  ? 166 TRP B CE2 1 
ATOM   5799 C  CE3 . TRP E 2 128 ? -42.745  24.037  -39.657 1.00 43.22  ? 166 TRP B CE3 1 
ATOM   5800 C  CZ2 . TRP E 2 128 ? -44.850  25.764  -38.888 1.00 42.06  ? 166 TRP B CZ2 1 
ATOM   5801 C  CZ3 . TRP E 2 128 ? -42.521  25.390  -39.403 1.00 42.55  ? 166 TRP B CZ3 1 
ATOM   5802 C  CH2 . TRP E 2 128 ? -43.566  26.230  -39.024 1.00 41.93  ? 166 TRP B CH2 1 
ATOM   5803 N  N   . ALA E 2 129 ? -43.295  18.499  -42.105 1.00 49.76  ? 167 ALA B N   1 
ATOM   5804 C  CA  . ALA E 2 129 ? -42.372  17.464  -42.575 1.00 49.37  ? 167 ALA B CA  1 
ATOM   5805 C  C   . ALA E 2 129 ? -41.997  17.670  -44.049 1.00 47.95  ? 167 ALA B C   1 
ATOM   5806 O  O   . ALA E 2 129 ? -40.853  17.450  -44.428 1.00 47.37  ? 167 ALA B O   1 
ATOM   5807 C  CB  . ALA E 2 129 ? -42.960  16.080  -42.367 1.00 49.72  ? 167 ALA B CB  1 
ATOM   5808 N  N   . ILE E 2 130 ? -42.963  18.096  -44.864 1.00 46.89  ? 168 ILE B N   1 
ATOM   5809 C  CA  . ILE E 2 130 ? -42.710  18.432  -46.274 1.00 47.13  ? 168 ILE B CA  1 
ATOM   5810 C  C   . ILE E 2 130 ? -41.825  19.677  -46.395 1.00 48.08  ? 168 ILE B C   1 
ATOM   5811 O  O   . ILE E 2 130 ? -40.915  19.717  -47.219 1.00 50.41  ? 168 ILE B O   1 
ATOM   5812 C  CB  . ILE E 2 130 ? -44.021  18.677  -47.062 1.00 47.35  ? 168 ILE B CB  1 
ATOM   5813 C  CG1 . ILE E 2 130 ? -44.841  17.392  -47.168 1.00 48.95  ? 168 ILE B CG1 1 
ATOM   5814 C  CG2 . ILE E 2 130 ? -43.743  19.214  -48.473 1.00 46.59  ? 168 ILE B CG2 1 
ATOM   5815 C  CD1 . ILE E 2 130 ? -46.321  17.637  -47.396 1.00 48.61  ? 168 ILE B CD1 1 
ATOM   5816 N  N   . SER E 2 131 ? -42.111  20.699  -45.594 1.00 49.82  ? 169 SER B N   1 
ATOM   5817 C  CA  . SER E 2 131 ? -41.272  21.903  -45.542 1.00 50.25  ? 169 SER B CA  1 
ATOM   5818 C  C   . SER E 2 131 ? -39.812  21.558  -45.219 1.00 47.94  ? 169 SER B C   1 
ATOM   5819 O  O   . SER E 2 131 ? -38.899  22.012  -45.903 1.00 47.35  ? 169 SER B O   1 
ATOM   5820 C  CB  . SER E 2 131 ? -41.809  22.887  -44.502 1.00 49.95  ? 169 SER B CB  1 
ATOM   5821 O  OG  . SER E 2 131 ? -43.127  23.300  -44.820 1.00 50.20  ? 169 SER B OG  1 
ATOM   5822 N  N   . ALA E 2 132 ? -39.619  20.742  -44.186 1.00 45.53  ? 170 ALA B N   1 
ATOM   5823 C  CA  . ALA E 2 132 ? -38.296  20.272  -43.782 1.00 45.86  ? 170 ALA B CA  1 
ATOM   5824 C  C   . ALA E 2 132 ? -37.554  19.527  -44.897 1.00 48.59  ? 170 ALA B C   1 
ATOM   5825 O  O   . ALA E 2 132 ? -36.384  19.812  -45.180 1.00 48.41  ? 170 ALA B O   1 
ATOM   5826 C  CB  . ALA E 2 132 ? -38.418  19.387  -42.557 1.00 44.66  ? 170 ALA B CB  1 
ATOM   5827 N  N   . LEU E 2 133 ? -38.243  18.589  -45.533 1.00 50.51  ? 171 LEU B N   1 
ATOM   5828 C  CA  . LEU E 2 133 ? -37.637  17.769  -46.582 1.00 50.48  ? 171 LEU B CA  1 
ATOM   5829 C  C   . LEU E 2 133 ? -37.330  18.523  -47.879 1.00 50.61  ? 171 LEU B C   1 
ATOM   5830 O  O   . LEU E 2 133 ? -36.523  18.058  -48.663 1.00 55.16  ? 171 LEU B O   1 
ATOM   5831 C  CB  . LEU E 2 133 ? -38.513  16.547  -46.876 1.00 49.47  ? 171 LEU B CB  1 
ATOM   5832 C  CG  . LEU E 2 133 ? -38.618  15.557  -45.703 1.00 48.41  ? 171 LEU B CG  1 
ATOM   5833 C  CD1 . LEU E 2 133 ? -39.686  14.517  -45.993 1.00 47.81  ? 171 LEU B CD1 1 
ATOM   5834 C  CD2 . LEU E 2 133 ? -37.274  14.896  -45.405 1.00 46.97  ? 171 LEU B CD2 1 
ATOM   5835 N  N   . VAL E 2 134 ? -37.975  19.659  -48.113 1.00 50.18  ? 172 VAL B N   1 
ATOM   5836 C  CA  . VAL E 2 134 ? -37.678  20.493  -49.277 1.00 50.79  ? 172 VAL B CA  1 
ATOM   5837 C  C   . VAL E 2 134 ? -36.592  21.518  -48.957 1.00 51.90  ? 172 VAL B C   1 
ATOM   5838 O  O   . VAL E 2 134 ? -35.910  21.995  -49.866 1.00 53.32  ? 172 VAL B O   1 
ATOM   5839 C  CB  . VAL E 2 134 ? -38.944  21.221  -49.768 1.00 54.28  ? 172 VAL B CB  1 
ATOM   5840 C  CG1 . VAL E 2 134 ? -38.647  22.212  -50.899 1.00 55.02  ? 172 VAL B CG1 1 
ATOM   5841 C  CG2 . VAL E 2 134 ? -39.968  20.202  -50.230 1.00 57.96  ? 172 VAL B CG2 1 
ATOM   5842 N  N   . SER E 2 135 ? -36.430  21.859  -47.676 1.00 52.17  ? 173 SER B N   1 
ATOM   5843 C  CA  . SER E 2 135 ? -35.464  22.873  -47.258 1.00 52.13  ? 173 SER B CA  1 
ATOM   5844 C  C   . SER E 2 135 ? -34.176  22.265  -46.691 1.00 53.56  ? 173 SER B C   1 
ATOM   5845 O  O   . SER E 2 135 ? -33.122  22.341  -47.320 1.00 54.14  ? 173 SER B O   1 
ATOM   5846 C  CB  . SER E 2 135 ? -36.097  23.797  -46.226 1.00 50.85  ? 173 SER B CB  1 
ATOM   5847 O  OG  . SER E 2 135 ? -36.222  23.141  -44.976 1.00 52.78  ? 173 SER B OG  1 
ATOM   5848 N  N   . PHE E 2 136 ? -34.262  21.663  -45.508 1.00 55.18  ? 174 PHE B N   1 
ATOM   5849 C  CA  . PHE E 2 136 ? -33.064  21.232  -44.790 1.00 57.14  ? 174 PHE B CA  1 
ATOM   5850 C  C   . PHE E 2 136 ? -32.371  20.105  -45.526 1.00 57.87  ? 174 PHE B C   1 
ATOM   5851 O  O   . PHE E 2 136 ? -31.179  20.196  -45.780 1.00 60.77  ? 174 PHE B O   1 
ATOM   5852 C  CB  . PHE E 2 136 ? -33.363  20.840  -43.332 1.00 57.85  ? 174 PHE B CB  1 
ATOM   5853 C  CG  . PHE E 2 136 ? -33.427  22.017  -42.401 1.00 56.62  ? 174 PHE B CG  1 
ATOM   5854 C  CD1 . PHE E 2 136 ? -32.275  22.485  -41.780 1.00 56.17  ? 174 PHE B CD1 1 
ATOM   5855 C  CD2 . PHE E 2 136 ? -34.625  22.695  -42.188 1.00 56.27  ? 174 PHE B CD2 1 
ATOM   5856 C  CE1 . PHE E 2 136 ? -32.323  23.595  -40.942 1.00 56.92  ? 174 PHE B CE1 1 
ATOM   5857 C  CE2 . PHE E 2 136 ? -34.676  23.805  -41.354 1.00 56.93  ? 174 PHE B CE2 1 
ATOM   5858 C  CZ  . PHE E 2 136 ? -33.527  24.260  -40.730 1.00 56.78  ? 174 PHE B CZ  1 
ATOM   5859 N  N   . LEU E 2 137 ? -33.111  19.072  -45.902 1.00 57.65  ? 175 LEU B N   1 
ATOM   5860 C  CA  . LEU E 2 137 ? -32.487  17.918  -46.546 1.00 58.00  ? 175 LEU B CA  1 
ATOM   5861 C  C   . LEU E 2 137 ? -31.671  18.293  -47.806 1.00 58.22  ? 175 LEU B C   1 
ATOM   5862 O  O   . LEU E 2 137 ? -30.503  17.938  -47.891 1.00 55.11  ? 175 LEU B O   1 
ATOM   5863 C  CB  . LEU E 2 137 ? -33.516  16.811  -46.846 1.00 58.63  ? 175 LEU B CB  1 
ATOM   5864 C  CG  . LEU E 2 137 ? -32.994  15.527  -47.503 1.00 56.50  ? 175 LEU B CG  1 
ATOM   5865 C  CD1 . LEU E 2 137 ? -31.950  14.862  -46.619 1.00 55.63  ? 175 LEU B CD1 1 
ATOM   5866 C  CD2 . LEU E 2 137 ? -34.145  14.578  -47.778 1.00 55.61  ? 175 LEU B CD2 1 
ATOM   5867 N  N   . PRO E 2 138 ? -32.266  19.036  -48.762 1.00 58.52  ? 176 PRO B N   1 
ATOM   5868 C  CA  . PRO E 2 138 ? -31.475  19.334  -49.962 1.00 60.89  ? 176 PRO B CA  1 
ATOM   5869 C  C   . PRO E 2 138 ? -30.390  20.398  -49.774 1.00 63.30  ? 176 PRO B C   1 
ATOM   5870 O  O   . PRO E 2 138 ? -29.360  20.353  -50.461 1.00 71.47  ? 176 PRO B O   1 
ATOM   5871 C  CB  . PRO E 2 138 ? -32.530  19.822  -50.959 1.00 59.11  ? 176 PRO B CB  1 
ATOM   5872 C  CG  . PRO E 2 138 ? -33.842  19.382  -50.388 1.00 58.14  ? 176 PRO B CG  1 
ATOM   5873 C  CD  . PRO E 2 138 ? -33.640  19.536  -48.921 1.00 57.68  ? 176 PRO B CD  1 
ATOM   5874 N  N   . ILE E 2 139 ? -30.603  21.346  -48.866 1.00 61.06  ? 177 ILE B N   1 
ATOM   5875 C  CA  . ILE E 2 139 ? -29.649  22.444  -48.704 1.00 61.04  ? 177 ILE B CA  1 
ATOM   5876 C  C   . ILE E 2 139 ? -28.430  22.011  -47.884 1.00 60.70  ? 177 ILE B C   1 
ATOM   5877 O  O   . ILE E 2 139 ? -27.304  22.325  -48.257 1.00 58.63  ? 177 ILE B O   1 
ATOM   5878 C  CB  . ILE E 2 139 ? -30.312  23.708  -48.118 1.00 63.02  ? 177 ILE B CB  1 
ATOM   5879 C  CG1 . ILE E 2 139 ? -31.353  24.245  -49.109 1.00 65.09  ? 177 ILE B CG1 1 
ATOM   5880 C  CG2 . ILE E 2 139 ? -29.270  24.789  -47.838 1.00 62.72  ? 177 ILE B CG2 1 
ATOM   5881 C  CD1 . ILE E 2 139 ? -32.325  25.249  -48.524 1.00 65.34  ? 177 ILE B CD1 1 
ATOM   5882 N  N   . MET E 2 140 ? -28.659  21.291  -46.786 1.00 62.07  ? 178 MET B N   1 
ATOM   5883 C  CA  . MET E 2 140 ? -27.561  20.759  -45.975 1.00 62.31  ? 178 MET B CA  1 
ATOM   5884 C  C   . MET E 2 140 ? -26.766  19.719  -46.772 1.00 62.87  ? 178 MET B C   1 
ATOM   5885 O  O   . MET E 2 140 ? -25.550  19.813  -46.838 1.00 65.92  ? 178 MET B O   1 
ATOM   5886 C  CB  . MET E 2 140 ? -28.045  20.167  -44.638 1.00 60.41  ? 178 MET B CB  1 
ATOM   5887 C  CG  . MET E 2 140 ? -28.867  21.109  -43.760 1.00 60.47  ? 178 MET B CG  1 
ATOM   5888 S  SD  . MET E 2 140 ? -28.072  22.635  -43.299 1.00 58.81  ? 178 MET B SD  1 
ATOM   5889 C  CE  . MET E 2 140 ? -27.296  22.002  -41.821 1.00 58.84  ? 178 MET B CE  1 
ATOM   5890 N  N   . MET E 2 141 ? -27.440  18.774  -47.428 1.00 62.93  ? 179 MET B N   1 
ATOM   5891 C  CA  . MET E 2 141 ? -26.753  17.774  -48.262 1.00 64.45  ? 179 MET B CA  1 
ATOM   5892 C  C   . MET E 2 141 ? -26.132  18.310  -49.571 1.00 67.47  ? 179 MET B C   1 
ATOM   5893 O  O   . MET E 2 141 ? -25.610  17.521  -50.363 1.00 68.35  ? 179 MET B O   1 
ATOM   5894 C  CB  . MET E 2 141 ? -27.714  16.633  -48.623 1.00 64.10  ? 179 MET B CB  1 
ATOM   5895 C  CG  . MET E 2 141 ? -28.210  15.813  -47.460 1.00 64.20  ? 179 MET B CG  1 
ATOM   5896 S  SD  . MET E 2 141 ? -26.909  14.712  -46.914 1.00 63.49  ? 179 MET B SD  1 
ATOM   5897 C  CE  . MET E 2 141 ? -26.910  13.457  -48.198 1.00 62.94  ? 179 MET B CE  1 
ATOM   5898 N  N   . HIS E 2 142 ? -26.216  19.626  -49.805 1.00 66.64  ? 180 HIS B N   1 
ATOM   5899 C  CA  . HIS E 2 142 ? -25.654  20.290  -50.990 1.00 61.22  ? 180 HIS B CA  1 
ATOM   5900 C  C   . HIS E 2 142 ? -26.358  19.918  -52.302 1.00 56.65  ? 180 HIS B C   1 
ATOM   5901 O  O   . HIS E 2 142 ? -25.798  20.146  -53.370 1.00 58.09  ? 180 HIS B O   1 
ATOM   5902 C  CB  . HIS E 2 142 ? -24.133  20.043  -51.118 1.00 62.74  ? 180 HIS B CB  1 
ATOM   5903 C  CG  . HIS E 2 142 ? -23.347  20.383  -49.890 1.00 63.45  ? 180 HIS B CG  1 
ATOM   5904 N  ND1 . HIS E 2 142 ? -22.753  21.612  -49.709 1.00 63.82  ? 180 HIS B ND1 1 
ATOM   5905 C  CD2 . HIS E 2 142 ? -23.034  19.646  -48.798 1.00 63.68  ? 180 HIS B CD2 1 
ATOM   5906 C  CE1 . HIS E 2 142 ? -22.128  21.629  -48.544 1.00 64.82  ? 180 HIS B CE1 1 
ATOM   5907 N  NE2 . HIS E 2 142 ? -22.284  20.448  -47.971 1.00 65.30  ? 180 HIS B NE2 1 
ATOM   5908 N  N   . TRP E 2 143 ? -27.574  19.365  -52.239 1.00 52.02  ? 181 TRP B N   1 
ATOM   5909 C  CA  . TRP E 2 143 ? -28.315  18.995  -53.452 1.00 48.83  ? 181 TRP B CA  1 
ATOM   5910 C  C   . TRP E 2 143 ? -28.782  20.237  -54.194 1.00 46.68  ? 181 TRP B C   1 
ATOM   5911 O  O   . TRP E 2 143 ? -28.899  20.223  -55.406 1.00 44.60  ? 181 TRP B O   1 
ATOM   5912 C  CB  . TRP E 2 143 ? -29.524  18.109  -53.128 1.00 50.18  ? 181 TRP B CB  1 
ATOM   5913 C  CG  . TRP E 2 143 ? -29.194  16.812  -52.481 1.00 53.99  ? 181 TRP B CG  1 
ATOM   5914 C  CD1 . TRP E 2 143 ? -27.953  16.274  -52.281 1.00 57.03  ? 181 TRP B CD1 1 
ATOM   5915 C  CD2 . TRP E 2 143 ? -30.131  15.867  -51.947 1.00 58.26  ? 181 TRP B CD2 1 
ATOM   5916 N  NE1 . TRP E 2 143 ? -28.062  15.057  -51.649 1.00 60.37  ? 181 TRP B NE1 1 
ATOM   5917 C  CE2 . TRP E 2 143 ? -29.386  14.781  -51.436 1.00 59.80  ? 181 TRP B CE2 1 
ATOM   5918 C  CE3 . TRP E 2 143 ? -31.528  15.837  -51.846 1.00 59.54  ? 181 TRP B CE3 1 
ATOM   5919 C  CZ2 . TRP E 2 143 ? -29.990  13.684  -50.808 1.00 59.40  ? 181 TRP B CZ2 1 
ATOM   5920 C  CZ3 . TRP E 2 143 ? -32.133  14.738  -51.235 1.00 61.63  ? 181 TRP B CZ3 1 
ATOM   5921 C  CH2 . TRP E 2 143 ? -31.363  13.685  -50.707 1.00 60.70  ? 181 TRP B CH2 1 
ATOM   5922 N  N   . TRP E 2 144 ? -29.058  21.306  -53.455 1.00 48.66  ? 182 TRP B N   1 
ATOM   5923 C  CA  . TRP E 2 144 ? -29.433  22.595  -54.050 1.00 50.16  ? 182 TRP B CA  1 
ATOM   5924 C  C   . TRP E 2 144 ? -28.345  23.280  -54.890 1.00 54.01  ? 182 TRP B C   1 
ATOM   5925 O  O   . TRP E 2 144 ? -28.663  24.167  -55.681 1.00 50.08  ? 182 TRP B O   1 
ATOM   5926 C  CB  . TRP E 2 144 ? -29.931  23.550  -52.952 1.00 47.66  ? 182 TRP B CB  1 
ATOM   5927 C  CG  . TRP E 2 144 ? -28.847  24.196  -52.189 1.00 45.52  ? 182 TRP B CG  1 
ATOM   5928 C  CD1 . TRP E 2 144 ? -27.895  23.575  -51.434 1.00 44.36  ? 182 TRP B CD1 1 
ATOM   5929 C  CD2 . TRP E 2 144 ? -28.572  25.596  -52.118 1.00 43.72  ? 182 TRP B CD2 1 
ATOM   5930 N  NE1 . TRP E 2 144 ? -27.056  24.506  -50.875 1.00 44.95  ? 182 TRP B NE1 1 
ATOM   5931 C  CE2 . TRP E 2 144 ? -27.445  25.757  -51.282 1.00 43.35  ? 182 TRP B CE2 1 
ATOM   5932 C  CE3 . TRP E 2 144 ? -29.169  26.728  -52.675 1.00 42.64  ? 182 TRP B CE3 1 
ATOM   5933 C  CZ2 . TRP E 2 144 ? -26.893  27.011  -51.004 1.00 41.84  ? 182 TRP B CZ2 1 
ATOM   5934 C  CZ3 . TRP E 2 144 ? -28.631  27.977  -52.393 1.00 42.16  ? 182 TRP B CZ3 1 
ATOM   5935 C  CH2 . TRP E 2 144 ? -27.501  28.107  -51.566 1.00 41.25  ? 182 TRP B CH2 1 
ATOM   5936 N  N   . ARG E 2 145 ? -27.086  22.859  -54.715 1.00 64.18  ? 183 ARG B N   1 
ATOM   5937 C  CA  . ARG E 2 145 ? -25.896  23.474  -55.357 1.00 71.70  ? 183 ARG B CA  1 
ATOM   5938 C  C   . ARG E 2 145 ? -25.896  23.432  -56.889 1.00 75.81  ? 183 ARG B C   1 
ATOM   5939 O  O   . ARG E 2 145 ? -26.158  22.381  -57.477 1.00 79.46  ? 183 ARG B O   1 
ATOM   5940 C  CB  . ARG E 2 145 ? -24.604  22.763  -54.895 1.00 74.47  ? 183 ARG B CB  1 
ATOM   5941 C  CG  . ARG E 2 145 ? -24.257  22.859  -53.419 1.00 75.98  ? 183 ARG B CG  1 
ATOM   5942 C  CD  . ARG E 2 145 ? -23.765  24.235  -53.083 1.00 79.33  ? 183 ARG B CD  1 
ATOM   5943 N  NE  . ARG E 2 145 ? -23.572  24.457  -51.657 1.00 86.19  ? 183 ARG B NE  1 
ATOM   5944 C  CZ  . ARG E 2 145 ? -22.450  24.228  -50.974 1.00 88.63  ? 183 ARG B CZ  1 
ATOM   5945 N  NH1 . ARG E 2 145 ? -21.360  23.724  -51.554 1.00 84.28  ? 183 ARG B NH1 1 
ATOM   5946 N  NH2 . ARG E 2 145 ? -22.435  24.493  -49.667 1.00 97.29  ? 183 ARG B NH2 1 
ATOM   5947 N  N   . ASP E 2 146 ? -25.567  24.563  -57.513 1.00 78.09  ? 184 ASP B N   1 
ATOM   5948 C  CA  . ASP E 2 146 ? -25.321  24.651  -58.957 1.00 82.09  ? 184 ASP B CA  1 
ATOM   5949 C  C   . ASP E 2 146 ? -23.856  24.314  -59.283 1.00 86.86  ? 184 ASP B C   1 
ATOM   5950 O  O   . ASP E 2 146 ? -22.957  24.627  -58.502 1.00 87.67  ? 184 ASP B O   1 
ATOM   5951 C  CB  . ASP E 2 146 ? -25.647  26.076  -59.443 1.00 80.84  ? 184 ASP B CB  1 
ATOM   5952 C  CG  . ASP E 2 146 ? -25.741  26.193  -60.962 1.00 81.02  ? 184 ASP B CG  1 
ATOM   5953 O  OD1 . ASP E 2 146 ? -25.984  25.174  -61.644 1.00 81.30  ? 184 ASP B OD1 1 
ATOM   5954 O  OD2 . ASP E 2 146 ? -25.591  27.327  -61.471 1.00 78.27  ? 184 ASP B OD2 1 
ATOM   5955 N  N   . GLU E 2 147 ? -23.628  23.674  -60.435 1.00 91.82  ? 185 GLU B N   1 
ATOM   5956 C  CA  . GLU E 2 147 ? -22.272  23.325  -60.910 1.00 88.28  ? 185 GLU B CA  1 
ATOM   5957 C  C   . GLU E 2 147 ? -21.458  24.539  -61.369 1.00 87.74  ? 185 GLU B C   1 
ATOM   5958 O  O   . GLU E 2 147 ? -20.235  24.566  -61.192 1.00 88.41  ? 185 GLU B O   1 
ATOM   5959 C  CB  . GLU E 2 147 ? -22.346  22.323  -62.073 1.00 87.06  ? 185 GLU B CB  1 
ATOM   5960 C  CG  . GLU E 2 147 ? -22.850  20.940  -61.691 1.00 89.48  ? 185 GLU B CG  1 
ATOM   5961 C  CD  . GLU E 2 147 ? -21.753  20.020  -61.179 1.00 93.10  ? 185 GLU B CD  1 
ATOM   5962 O  OE1 . GLU E 2 147 ? -21.814  18.798  -61.468 1.00 94.47  ? 185 GLU B OE1 1 
ATOM   5963 O  OE2 . GLU E 2 147 ? -20.824  20.511  -60.493 1.00 97.49  ? 185 GLU B OE2 1 
ATOM   5964 N  N   . ASP E 2 148 ? -22.148  25.516  -61.969 1.00 87.33  ? 186 ASP B N   1 
ATOM   5965 C  CA  . ASP E 2 148 ? -21.568  26.768  -62.473 1.00 89.86  ? 186 ASP B CA  1 
ATOM   5966 C  C   . ASP E 2 148 ? -20.398  27.284  -61.620 1.00 96.43  ? 186 ASP B C   1 
ATOM   5967 O  O   . ASP E 2 148 ? -20.495  27.287  -60.390 1.00 97.53  ? 186 ASP B O   1 
ATOM   5968 C  CB  . ASP E 2 148 ? -22.658  27.849  -62.549 1.00 87.08  ? 186 ASP B CB  1 
ATOM   5969 C  CG  . ASP E 2 148 ? -22.197  29.100  -63.260 1.00 90.38  ? 186 ASP B CG  1 
ATOM   5970 O  OD1 . ASP E 2 148 ? -22.278  29.127  -64.497 1.00 99.30  ? 186 ASP B OD1 1 
ATOM   5971 O  OD2 . ASP E 2 148 ? -21.753  30.054  -62.597 1.00 90.65  ? 186 ASP B OD2 1 
ATOM   5972 N  N   . PRO E 2 149 ? -19.290  27.717  -62.265 1.00 106.39 ? 187 PRO B N   1 
ATOM   5973 C  CA  . PRO E 2 149 ? -18.122  28.155  -61.481 1.00 110.51 ? 187 PRO B CA  1 
ATOM   5974 C  C   . PRO E 2 149 ? -18.343  29.438  -60.660 1.00 116.00 ? 187 PRO B C   1 
ATOM   5975 O  O   . PRO E 2 149 ? -17.866  29.509  -59.523 1.00 115.14 ? 187 PRO B O   1 
ATOM   5976 C  CB  . PRO E 2 149 ? -17.029  28.349  -62.542 1.00 109.03 ? 187 PRO B CB  1 
ATOM   5977 C  CG  . PRO E 2 149 ? -17.766  28.581  -63.811 1.00 110.00 ? 187 PRO B CG  1 
ATOM   5978 C  CD  . PRO E 2 149 ? -19.014  27.749  -63.714 1.00 109.19 ? 187 PRO B CD  1 
ATOM   5979 N  N   . GLN E 2 150 ? -19.052  30.429  -61.218 1.00 117.06 ? 188 GLN B N   1 
ATOM   5980 C  CA  . GLN E 2 150 ? -19.357  31.682  -60.486 1.00 113.86 ? 188 GLN B CA  1 
ATOM   5981 C  C   . GLN E 2 150 ? -20.264  31.453  -59.265 1.00 110.56 ? 188 GLN B C   1 
ATOM   5982 O  O   . GLN E 2 150 ? -20.102  32.112  -58.231 1.00 105.54 ? 188 GLN B O   1 
ATOM   5983 C  CB  . GLN E 2 150 ? -19.971  32.735  -61.417 1.00 112.57 ? 188 GLN B CB  1 
ATOM   5984 C  CG  . GLN E 2 150 ? -20.509  33.977  -60.705 1.00 112.27 ? 188 GLN B CG  1 
ATOM   5985 C  CD  . GLN E 2 150 ? -21.168  34.964  -61.650 1.00 115.19 ? 188 GLN B CD  1 
ATOM   5986 O  OE1 . GLN E 2 150 ? -20.780  35.082  -62.822 1.00 124.36 ? 188 GLN B OE1 1 
ATOM   5987 N  NE2 . GLN E 2 150 ? -22.176  35.687  -61.141 1.00 113.87 ? 188 GLN B NE2 1 
ATOM   5988 N  N   . ALA E 2 151 ? -21.221  30.535  -59.403 1.00 108.14 ? 189 ALA B N   1 
ATOM   5989 C  CA  . ALA E 2 151 ? -22.030  30.057  -58.274 1.00 100.16 ? 189 ALA B CA  1 
ATOM   5990 C  C   . ALA E 2 151 ? -21.149  29.356  -57.243 1.00 92.14  ? 189 ALA B C   1 
ATOM   5991 O  O   . ALA E 2 151 ? -21.259  29.611  -56.046 1.00 86.05  ? 189 ALA B O   1 
ATOM   5992 C  CB  . ALA E 2 151 ? -23.119  29.106  -58.764 1.00 100.11 ? 189 ALA B CB  1 
ATOM   5993 N  N   . LEU E 2 152 ? -20.269  28.487  -57.737 1.00 90.25  ? 190 LEU B N   1 
ATOM   5994 C  CA  . LEU E 2 152 ? -19.312  27.743  -56.912 1.00 87.91  ? 190 LEU B CA  1 
ATOM   5995 C  C   . LEU E 2 152 ? -18.284  28.647  -56.204 1.00 84.26  ? 190 LEU B C   1 
ATOM   5996 O  O   . LEU E 2 152 ? -17.695  28.235  -55.208 1.00 73.80  ? 190 LEU B O   1 
ATOM   5997 C  CB  . LEU E 2 152 ? -18.622  26.657  -57.762 1.00 87.45  ? 190 LEU B CB  1 
ATOM   5998 C  CG  . LEU E 2 152 ? -17.738  25.588  -57.096 1.00 86.16  ? 190 LEU B CG  1 
ATOM   5999 C  CD1 . LEU E 2 152 ? -18.405  24.873  -55.927 1.00 84.02  ? 190 LEU B CD1 1 
ATOM   6000 C  CD2 . LEU E 2 152 ? -17.304  24.573  -58.149 1.00 84.57  ? 190 LEU B CD2 1 
ATOM   6001 N  N   . LYS E 2 153 ? -18.082  29.869  -56.710 1.00 87.70  ? 191 LYS B N   1 
ATOM   6002 C  CA  . LYS E 2 153 ? -17.315  30.907  -55.992 1.00 95.21  ? 191 LYS B CA  1 
ATOM   6003 C  C   . LYS E 2 153 ? -18.043  31.435  -54.742 1.00 95.18  ? 191 LYS B C   1 
ATOM   6004 O  O   . LYS E 2 153 ? -17.394  31.728  -53.732 1.00 99.22  ? 191 LYS B O   1 
ATOM   6005 C  CB  . LYS E 2 153 ? -16.937  32.083  -56.914 1.00 98.35  ? 191 LYS B CB  1 
ATOM   6006 C  CG  . LYS E 2 153 ? -16.026  33.112  -56.245 1.00 99.18  ? 191 LYS B CG  1 
ATOM   6007 C  CD  . LYS E 2 153 ? -15.525  34.185  -57.194 1.00 97.61  ? 191 LYS B CD  1 
ATOM   6008 C  CE  . LYS E 2 153 ? -14.528  35.088  -56.483 1.00 99.12  ? 191 LYS B CE  1 
ATOM   6009 N  NZ  . LYS E 2 153 ? -13.877  36.063  -57.400 1.00 100.75 ? 191 LYS B NZ  1 
ATOM   6010 N  N   . CYS E 2 154 ? -19.369  31.572  -54.820 1.00 87.52  ? 192 CYS B N   1 
ATOM   6011 C  CA  . CYS E 2 154 ? -20.190  31.976  -53.664 1.00 78.30  ? 192 CYS B CA  1 
ATOM   6012 C  C   . CYS E 2 154 ? -20.306  30.894  -52.579 1.00 71.67  ? 192 CYS B C   1 
ATOM   6013 O  O   . CYS E 2 154 ? -20.429  31.189  -51.381 1.00 73.30  ? 192 CYS B O   1 
ATOM   6014 C  CB  . CYS E 2 154 ? -21.589  32.393  -54.128 1.00 75.28  ? 192 CYS B CB  1 
ATOM   6015 S  SG  . CYS E 2 154 ? -22.631  33.050  -52.812 1.00 71.10  ? 192 CYS B SG  1 
ATOM   6016 N  N   . TYR E 2 155 ? -20.286  29.637  -52.998 1.00 67.49  ? 193 TYR B N   1 
ATOM   6017 C  CA  . TYR E 2 155 ? -20.297  28.521  -52.049 1.00 68.22  ? 193 TYR B CA  1 
ATOM   6018 C  C   . TYR E 2 155 ? -18.973  28.415  -51.273 1.00 68.17  ? 193 TYR B C   1 
ATOM   6019 O  O   . TYR E 2 155 ? -18.978  28.022  -50.109 1.00 63.62  ? 193 TYR B O   1 
ATOM   6020 C  CB  . TYR E 2 155 ? -20.637  27.198  -52.748 1.00 67.44  ? 193 TYR B CB  1 
ATOM   6021 C  CG  . TYR E 2 155 ? -21.943  27.187  -53.548 1.00 68.74  ? 193 TYR B CG  1 
ATOM   6022 C  CD1 . TYR E 2 155 ? -23.071  27.927  -53.147 1.00 68.69  ? 193 TYR B CD1 1 
ATOM   6023 C  CD2 . TYR E 2 155 ? -22.053  26.427  -54.709 1.00 69.89  ? 193 TYR B CD2 1 
ATOM   6024 C  CE1 . TYR E 2 155 ? -24.254  27.904  -53.887 1.00 66.54  ? 193 TYR B CE1 1 
ATOM   6025 C  CE2 . TYR E 2 155 ? -23.233  26.404  -55.445 1.00 69.46  ? 193 TYR B CE2 1 
ATOM   6026 C  CZ  . TYR E 2 155 ? -24.333  27.139  -55.028 1.00 65.45  ? 193 TYR B CZ  1 
ATOM   6027 O  OH  . TYR E 2 155 ? -25.499  27.103  -55.763 1.00 60.51  ? 193 TYR B OH  1 
ATOM   6028 N  N   . GLN E 2 156 ? -17.859  28.777  -51.917 1.00 72.91  ? 194 GLN B N   1 
ATOM   6029 C  CA  . GLN E 2 156 ? -16.529  28.769  -51.280 1.00 75.16  ? 194 GLN B CA  1 
ATOM   6030 C  C   . GLN E 2 156 ? -16.278  29.998  -50.386 1.00 69.63  ? 194 GLN B C   1 
ATOM   6031 O  O   . GLN E 2 156 ? -15.616  29.868  -49.356 1.00 66.75  ? 194 GLN B O   1 
ATOM   6032 C  CB  . GLN E 2 156 ? -15.416  28.710  -52.327 1.00 81.52  ? 194 GLN B CB  1 
ATOM   6033 C  CG  . GLN E 2 156 ? -15.332  27.454  -53.161 1.00 84.51  ? 194 GLN B CG  1 
ATOM   6034 C  CD  . GLN E 2 156 ? -14.465  27.639  -54.420 1.00 86.38  ? 194 GLN B CD  1 
ATOM   6035 O  OE1 . GLN E 2 156 ? -14.221  28.764  -54.884 1.00 85.59  ? 194 GLN B OE1 1 
ATOM   6036 N  NE2 . GLN E 2 156 ? -14.005  26.524  -54.986 1.00 87.47  ? 194 GLN B NE2 1 
ATOM   6037 N  N   . ASP E 2 157 ? -16.770  31.176  -50.799 1.00 63.74  ? 195 ASP B N   1 
ATOM   6038 C  CA  . ASP E 2 157 ? -16.717  32.404  -49.984 1.00 61.06  ? 195 ASP B CA  1 
ATOM   6039 C  C   . ASP E 2 157 ? -17.706  32.301  -48.794 1.00 65.76  ? 195 ASP B C   1 
ATOM   6040 O  O   . ASP E 2 157 ? -18.927  32.173  -49.015 1.00 67.40  ? 195 ASP B O   1 
ATOM   6041 C  CB  . ASP E 2 157 ? -17.050  33.631  -50.857 1.00 56.32  ? 195 ASP B CB  1 
ATOM   6042 C  CG  . ASP E 2 157 ? -16.827  34.975  -50.141 1.00 53.53  ? 195 ASP B CG  1 
ATOM   6043 O  OD1 . ASP E 2 157 ? -16.555  35.015  -48.918 1.00 50.33  ? 195 ASP B OD1 1 
ATOM   6044 O  OD2 . ASP E 2 157 ? -16.934  36.016  -50.823 1.00 50.33  ? 195 ASP B OD2 1 
ATOM   6045 N  N   . PRO E 2 158 ? -17.198  32.350  -47.532 1.00 65.75  ? 196 PRO B N   1 
ATOM   6046 C  CA  . PRO E 2 158 ? -18.112  32.383  -46.372 1.00 64.42  ? 196 PRO B CA  1 
ATOM   6047 C  C   . PRO E 2 158 ? -18.847  33.717  -46.172 1.00 64.92  ? 196 PRO B C   1 
ATOM   6048 O  O   . PRO E 2 158 ? -19.857  33.762  -45.460 1.00 69.57  ? 196 PRO B O   1 
ATOM   6049 C  CB  . PRO E 2 158 ? -17.190  32.079  -45.180 1.00 64.14  ? 196 PRO B CB  1 
ATOM   6050 C  CG  . PRO E 2 158 ? -15.958  31.486  -45.781 1.00 64.94  ? 196 PRO B CG  1 
ATOM   6051 C  CD  . PRO E 2 158 ? -15.801  32.219  -47.078 1.00 65.35  ? 196 PRO B CD  1 
ATOM   6052 N  N   . GLY E 2 159 ? -18.326  34.785  -46.776 1.00 63.25  ? 197 GLY B N   1 
ATOM   6053 C  CA  . GLY E 2 159 ? -18.991  36.077  -46.807 1.00 60.14  ? 197 GLY B CA  1 
ATOM   6054 C  C   . GLY E 2 159 ? -20.115  36.156  -47.818 1.00 57.92  ? 197 GLY B C   1 
ATOM   6055 O  O   . GLY E 2 159 ? -20.928  37.077  -47.740 1.00 56.65  ? 197 GLY B O   1 
ATOM   6056 N  N   . CYS E 2 160 ? -20.151  35.222  -48.775 1.00 56.89  ? 198 CYS B N   1 
ATOM   6057 C  CA  . CYS E 2 160 ? -21.245  35.126  -49.749 1.00 58.29  ? 198 CYS B CA  1 
ATOM   6058 C  C   . CYS E 2 160 ? -22.312  34.114  -49.297 1.00 57.95  ? 198 CYS B C   1 
ATOM   6059 O  O   . CYS E 2 160 ? -22.008  32.955  -48.960 1.00 55.52  ? 198 CYS B O   1 
ATOM   6060 C  CB  . CYS E 2 160 ? -20.724  34.759  -51.140 1.00 60.78  ? 198 CYS B CB  1 
ATOM   6061 S  SG  . CYS E 2 160 ? -21.937  34.945  -52.475 1.00 63.52  ? 198 CYS B SG  1 
ATOM   6062 N  N   . CYS E 2 161 ? -23.561  34.592  -49.284 1.00 56.61  ? 199 CYS B N   1 
ATOM   6063 C  CA  . CYS E 2 161 ? -24.740  33.803  -48.924 1.00 55.04  ? 199 CYS B CA  1 
ATOM   6064 C  C   . CYS E 2 161 ? -25.872  34.166  -49.875 1.00 55.47  ? 199 CYS B C   1 
ATOM   6065 O  O   . CYS E 2 161 ? -27.007  34.370  -49.453 1.00 58.01  ? 199 CYS B O   1 
ATOM   6066 C  CB  . CYS E 2 161 ? -25.128  34.087  -47.463 1.00 52.79  ? 199 CYS B CB  1 
ATOM   6067 S  SG  . CYS E 2 161 ? -26.278  32.916  -46.705 1.00 49.00  ? 199 CYS B SG  1 
ATOM   6068 N  N   . ASP E 2 162 ? -25.546  34.264  -51.165 1.00 58.88  ? 200 ASP B N   1 
ATOM   6069 C  CA  . ASP E 2 162 ? -26.553  34.457  -52.207 1.00 61.56  ? 200 ASP B CA  1 
ATOM   6070 C  C   . ASP E 2 162 ? -27.321  33.168  -52.397 1.00 61.12  ? 200 ASP B C   1 
ATOM   6071 O  O   . ASP E 2 162 ? -26.818  32.071  -52.098 1.00 59.56  ? 200 ASP B O   1 
ATOM   6072 C  CB  . ASP E 2 162 ? -25.925  34.849  -53.552 1.00 67.47  ? 200 ASP B CB  1 
ATOM   6073 C  CG  . ASP E 2 162 ? -25.337  36.248  -53.549 1.00 73.33  ? 200 ASP B CG  1 
ATOM   6074 O  OD1 . ASP E 2 162 ? -25.754  37.075  -52.705 1.00 78.53  ? 200 ASP B OD1 1 
ATOM   6075 O  OD2 . ASP E 2 162 ? -24.464  36.520  -54.411 1.00 76.00  ? 200 ASP B OD2 1 
ATOM   6076 N  N   . PHE E 2 163 ? -28.541  33.319  -52.897 1.00 60.18  ? 201 PHE B N   1 
ATOM   6077 C  CA  . PHE E 2 163 ? -29.409  32.190  -53.156 1.00 59.50  ? 201 PHE B CA  1 
ATOM   6078 C  C   . PHE E 2 163 ? -29.249  31.792  -54.617 1.00 58.83  ? 201 PHE B C   1 
ATOM   6079 O  O   . PHE E 2 163 ? -29.842  32.398  -55.510 1.00 58.13  ? 201 PHE B O   1 
ATOM   6080 C  CB  . PHE E 2 163 ? -30.867  32.530  -52.805 1.00 59.01  ? 201 PHE B CB  1 
ATOM   6081 C  CG  . PHE E 2 163 ? -31.753  31.324  -52.746 1.00 56.48  ? 201 PHE B CG  1 
ATOM   6082 C  CD1 . PHE E 2 163 ? -31.541  30.341  -51.774 1.00 56.48  ? 201 PHE B CD1 1 
ATOM   6083 C  CD2 . PHE E 2 163 ? -32.777  31.146  -53.670 1.00 52.79  ? 201 PHE B CD2 1 
ATOM   6084 C  CE1 . PHE E 2 163 ? -32.341  29.210  -51.730 1.00 56.66  ? 201 PHE B CE1 1 
ATOM   6085 C  CE2 . PHE E 2 163 ? -33.568  30.011  -53.636 1.00 52.25  ? 201 PHE B CE2 1 
ATOM   6086 C  CZ  . PHE E 2 163 ? -33.357  29.045  -52.664 1.00 54.99  ? 201 PHE B CZ  1 
ATOM   6087 N  N   . VAL E 2 164 ? -28.408  30.792  -54.845 1.00 57.85  ? 202 VAL B N   1 
ATOM   6088 C  CA  . VAL E 2 164 ? -28.117  30.299  -56.182 1.00 57.69  ? 202 VAL B CA  1 
ATOM   6089 C  C   . VAL E 2 164 ? -28.320  28.785  -56.169 1.00 57.87  ? 202 VAL B C   1 
ATOM   6090 O  O   . VAL E 2 164 ? -27.713  28.074  -55.362 1.00 59.35  ? 202 VAL B O   1 
ATOM   6091 C  CB  . VAL E 2 164 ? -26.672  30.665  -56.601 1.00 57.35  ? 202 VAL B CB  1 
ATOM   6092 C  CG1 . VAL E 2 164 ? -26.387  30.195  -58.023 1.00 59.88  ? 202 VAL B CG1 1 
ATOM   6093 C  CG2 . VAL E 2 164 ? -26.441  32.177  -56.474 1.00 53.85  ? 202 VAL B CG2 1 
ATOM   6094 N  N   . THR E 2 165 ? -29.175  28.302  -57.060 1.00 58.66  ? 203 THR B N   1 
ATOM   6095 C  CA  . THR E 2 165 ? -29.585  26.904  -57.082 1.00 61.12  ? 203 THR B CA  1 
ATOM   6096 C  C   . THR E 2 165 ? -29.410  26.308  -58.460 1.00 62.64  ? 203 THR B C   1 
ATOM   6097 O  O   . THR E 2 165 ? -29.373  27.040  -59.459 1.00 61.62  ? 203 THR B O   1 
ATOM   6098 C  CB  . THR E 2 165 ? -31.083  26.789  -56.795 1.00 61.63  ? 203 THR B CB  1 
ATOM   6099 O  OG1 . THR E 2 165 ? -31.776  27.708  -57.650 1.00 59.36  ? 203 THR B OG1 1 
ATOM   6100 C  CG2 . THR E 2 165 ? -31.384  27.104  -55.354 1.00 61.89  ? 203 THR B CG2 1 
ATOM   6101 N  N   . ASN E 2 166 ? -29.363  24.978  -58.520 1.00 62.74  ? 204 ASN B N   1 
ATOM   6102 C  CA  . ASN E 2 166 ? -29.516  24.281  -59.797 1.00 67.36  ? 204 ASN B CA  1 
ATOM   6103 C  C   . ASN E 2 166 ? -30.939  24.462  -60.355 1.00 74.31  ? 204 ASN B C   1 
ATOM   6104 O  O   . ASN E 2 166 ? -31.803  25.059  -59.711 1.00 74.15  ? 204 ASN B O   1 
ATOM   6105 C  CB  . ASN E 2 166 ? -29.107  22.797  -59.699 1.00 66.86  ? 204 ASN B CB  1 
ATOM   6106 C  CG  . ASN E 2 166 ? -29.893  22.025  -58.660 1.00 67.94  ? 204 ASN B CG  1 
ATOM   6107 O  OD1 . ASN E 2 166 ? -31.111  22.013  -58.662 1.00 76.13  ? 204 ASN B OD1 1 
ATOM   6108 N  ND2 . ASN E 2 166 ? -29.187  21.364  -57.769 1.00 69.05  ? 204 ASN B ND2 1 
ATOM   6109 N  N   . ARG E 2 167 ? -31.162  23.970  -61.567 1.00 82.97  ? 205 ARG B N   1 
ATOM   6110 C  CA  . ARG E 2 167 ? -32.480  24.010  -62.203 1.00 83.29  ? 205 ARG B CA  1 
ATOM   6111 C  C   . ARG E 2 167 ? -33.522  23.256  -61.368 1.00 78.96  ? 205 ARG B C   1 
ATOM   6112 O  O   . ARG E 2 167 ? -34.503  23.848  -60.907 1.00 72.19  ? 205 ARG B O   1 
ATOM   6113 C  CB  . ARG E 2 167 ? -32.374  23.441  -63.639 1.00 91.47  ? 205 ARG B CB  1 
ATOM   6114 C  CG  . ARG E 2 167 ? -33.661  23.448  -64.461 1.00 96.15  ? 205 ARG B CG  1 
ATOM   6115 C  CD  . ARG E 2 167 ? -33.446  23.274  -65.963 1.00 98.84  ? 205 ARG B CD  1 
ATOM   6116 N  NE  . ARG E 2 167 ? -32.709  24.369  -66.613 1.00 99.98  ? 205 ARG B NE  1 
ATOM   6117 C  CZ  . ARG E 2 167 ? -31.469  24.309  -67.111 1.00 103.37 ? 205 ARG B CZ  1 
ATOM   6118 N  NH1 . ARG E 2 167 ? -30.715  23.209  -67.009 1.00 109.49 ? 205 ARG B NH1 1 
ATOM   6119 N  NH2 . ARG E 2 167 ? -30.963  25.392  -67.695 1.00 101.89 ? 205 ARG B NH2 1 
ATOM   6120 N  N   . ALA E 2 168 ? -33.249  21.968  -61.138 1.00 78.66  ? 206 ALA B N   1 
ATOM   6121 C  CA  . ALA E 2 168 ? -34.170  21.029  -60.475 1.00 77.46  ? 206 ALA B CA  1 
ATOM   6122 C  C   . ALA E 2 168 ? -34.709  21.548  -59.156 1.00 80.48  ? 206 ALA B C   1 
ATOM   6123 O  O   . ALA E 2 168 ? -35.919  21.503  -58.911 1.00 90.43  ? 206 ALA B O   1 
ATOM   6124 C  CB  . ALA E 2 168 ? -33.484  19.691  -60.238 1.00 73.51  ? 206 ALA B CB  1 
ATOM   6125 N  N   . TYR E 2 169 ? -33.806  22.031  -58.308 1.00 76.89  ? 207 TYR B N   1 
ATOM   6126 C  CA  . TYR E 2 169 ? -34.196  22.485  -56.980 1.00 70.80  ? 207 TYR B CA  1 
ATOM   6127 C  C   . TYR E 2 169 ? -35.068  23.719  -57.056 1.00 67.57  ? 207 TYR B C   1 
ATOM   6128 O  O   . TYR E 2 169 ? -36.059  23.782  -56.350 1.00 73.42  ? 207 TYR B O   1 
ATOM   6129 C  CB  . TYR E 2 169 ? -32.991  22.761  -56.074 1.00 68.40  ? 207 TYR B CB  1 
ATOM   6130 C  CG  . TYR E 2 169 ? -33.404  23.166  -54.673 1.00 62.33  ? 207 TYR B CG  1 
ATOM   6131 C  CD1 . TYR E 2 169 ? -33.673  22.203  -53.704 1.00 58.25  ? 207 TYR B CD1 1 
ATOM   6132 C  CD2 . TYR E 2 169 ? -33.555  24.512  -54.333 1.00 59.00  ? 207 TYR B CD2 1 
ATOM   6133 C  CE1 . TYR E 2 169 ? -34.060  22.568  -52.431 1.00 57.11  ? 207 TYR B CE1 1 
ATOM   6134 C  CE2 . TYR E 2 169 ? -33.943  24.885  -53.059 1.00 57.53  ? 207 TYR B CE2 1 
ATOM   6135 C  CZ  . TYR E 2 169 ? -34.194  23.901  -52.112 1.00 58.01  ? 207 TYR B CZ  1 
ATOM   6136 O  OH  . TYR E 2 169 ? -34.591  24.231  -50.847 1.00 58.36  ? 207 TYR B OH  1 
ATOM   6137 N  N   . ALA E 2 170 ? -34.722  24.695  -57.887 1.00 63.58  ? 208 ALA B N   1 
ATOM   6138 C  CA  . ALA E 2 170 ? -35.502  25.939  -57.922 1.00 66.32  ? 208 ALA B CA  1 
ATOM   6139 C  C   . ALA E 2 170 ? -36.880  25.715  -58.481 1.00 70.58  ? 208 ALA B C   1 
ATOM   6140 O  O   . ALA E 2 170 ? -37.826  26.358  -58.037 1.00 79.17  ? 208 ALA B O   1 
ATOM   6141 C  CB  . ALA E 2 170 ? -34.813  27.021  -58.717 1.00 66.29  ? 208 ALA B CB  1 
ATOM   6142 N  N   . ILE E 2 171 ? -36.993  24.815  -59.458 1.00 71.34  ? 209 ILE B N   1 
ATOM   6143 C  CA  . ILE E 2 171 ? -38.301  24.411  -59.994 1.00 70.26  ? 209 ILE B CA  1 
ATOM   6144 C  C   . ILE E 2 171 ? -39.090  23.667  -58.913 1.00 65.53  ? 209 ILE B C   1 
ATOM   6145 O  O   . ILE E 2 171 ? -40.158  24.126  -58.520 1.00 63.02  ? 209 ILE B O   1 
ATOM   6146 C  CB  . ILE E 2 171 ? -38.165  23.553  -61.281 1.00 74.52  ? 209 ILE B CB  1 
ATOM   6147 C  CG1 . ILE E 2 171 ? -37.583  24.401  -62.425 1.00 77.04  ? 209 ILE B CG1 1 
ATOM   6148 C  CG2 . ILE E 2 171 ? -39.514  22.981  -61.705 1.00 73.10  ? 209 ILE B CG2 1 
ATOM   6149 C  CD1 . ILE E 2 171 ? -37.106  23.595  -63.614 1.00 77.92  ? 209 ILE B CD1 1 
ATOM   6150 N  N   . ALA E 2 172 ? -38.542  22.554  -58.425 1.00 62.41  ? 210 ALA B N   1 
ATOM   6151 C  CA  . ALA E 2 172 ? -39.197  21.708  -57.408 1.00 62.12  ? 210 ALA B CA  1 
ATOM   6152 C  C   . ALA E 2 172 ? -39.600  22.468  -56.134 1.00 63.39  ? 210 ALA B C   1 
ATOM   6153 O  O   . ALA E 2 172 ? -40.736  22.356  -55.674 1.00 59.15  ? 210 ALA B O   1 
ATOM   6154 C  CB  . ALA E 2 172 ? -38.306  20.524  -57.049 1.00 60.59  ? 210 ALA B CB  1 
ATOM   6155 N  N   . SER E 2 173 ? -38.671  23.242  -55.575 1.00 67.78  ? 211 SER B N   1 
ATOM   6156 C  CA  . SER E 2 173 ? -38.935  24.015  -54.353 1.00 67.45  ? 211 SER B CA  1 
ATOM   6157 C  C   . SER E 2 173 ? -39.997  25.076  -54.587 1.00 67.64  ? 211 SER B C   1 
ATOM   6158 O  O   . SER E 2 173 ? -40.808  25.312  -53.695 1.00 77.39  ? 211 SER B O   1 
ATOM   6159 C  CB  . SER E 2 173 ? -37.664  24.673  -53.783 1.00 66.11  ? 211 SER B CB  1 
ATOM   6160 O  OG  . SER E 2 173 ? -37.319  25.888  -54.454 1.00 64.67  ? 211 SER B OG  1 
ATOM   6161 N  N   . SER E 2 174 ? -40.002  25.704  -55.765 1.00 61.07  ? 212 SER B N   1 
ATOM   6162 C  CA  . SER E 2 174 ? -41.007  26.731  -56.085 1.00 61.29  ? 212 SER B CA  1 
ATOM   6163 C  C   . SER E 2 174 ? -42.389  26.119  -56.294 1.00 62.50  ? 212 SER B C   1 
ATOM   6164 O  O   . SER E 2 174 ? -43.395  26.692  -55.877 1.00 61.30  ? 212 SER B O   1 
ATOM   6165 C  CB  . SER E 2 174 ? -40.599  27.543  -57.317 1.00 62.29  ? 212 SER B CB  1 
ATOM   6166 O  OG  . SER E 2 174 ? -39.432  28.314  -57.056 1.00 65.41  ? 212 SER B OG  1 
ATOM   6167 N  N   . ILE E 2 175 ? -42.436  24.959  -56.943 1.00 64.36  ? 213 ILE B N   1 
ATOM   6168 C  CA  . ILE E 2 175 ? -43.685  24.212  -57.118 1.00 62.61  ? 213 ILE B CA  1 
ATOM   6169 C  C   . ILE E 2 175 ? -44.242  23.768  -55.759 1.00 58.56  ? 213 ILE B C   1 
ATOM   6170 O  O   . ILE E 2 175 ? -45.417  23.986  -55.484 1.00 56.67  ? 213 ILE B O   1 
ATOM   6171 C  CB  . ILE E 2 175 ? -43.508  23.029  -58.119 1.00 64.42  ? 213 ILE B CB  1 
ATOM   6172 C  CG1 . ILE E 2 175 ? -43.406  23.592  -59.545 1.00 64.05  ? 213 ILE B CG1 1 
ATOM   6173 C  CG2 . ILE E 2 175 ? -44.643  22.017  -58.039 1.00 65.46  ? 213 ILE B CG2 1 
ATOM   6174 C  CD1 . ILE E 2 175 ? -42.968  22.582  -60.584 1.00 63.61  ? 213 ILE B CD1 1 
ATOM   6175 N  N   . ILE E 2 176 ? -43.399  23.178  -54.919 1.00 54.49  ? 214 ILE B N   1 
ATOM   6176 C  CA  . ILE E 2 176 ? -43.845  22.637  -53.636 1.00 50.54  ? 214 ILE B CA  1 
ATOM   6177 C  C   . ILE E 2 176 ? -44.182  23.754  -52.642 1.00 47.65  ? 214 ILE B C   1 
ATOM   6178 O  O   . ILE E 2 176 ? -45.178  23.682  -51.942 1.00 47.01  ? 214 ILE B O   1 
ATOM   6179 C  CB  . ILE E 2 176 ? -42.838  21.606  -53.079 1.00 48.60  ? 214 ILE B CB  1 
ATOM   6180 C  CG1 . ILE E 2 176 ? -42.808  20.392  -54.011 1.00 50.64  ? 214 ILE B CG1 1 
ATOM   6181 C  CG2 . ILE E 2 176 ? -43.248  21.133  -51.696 1.00 47.04  ? 214 ILE B CG2 1 
ATOM   6182 C  CD1 . ILE E 2 176 ? -41.729  19.372  -53.707 1.00 51.79  ? 214 ILE B CD1 1 
ATOM   6183 N  N   . SER E 2 177 ? -43.391  24.812  -52.616 1.00 44.84  ? 215 SER B N   1 
ATOM   6184 C  CA  . SER E 2 177 ? -43.664  25.912  -51.691 1.00 43.04  ? 215 SER B CA  1 
ATOM   6185 C  C   . SER E 2 177 ? -44.776  26.850  -52.145 1.00 41.33  ? 215 SER B C   1 
ATOM   6186 O  O   . SER E 2 177 ? -45.472  27.400  -51.306 1.00 38.85  ? 215 SER B O   1 
ATOM   6187 C  CB  . SER E 2 177 ? -42.396  26.728  -51.443 1.00 43.16  ? 215 SER B CB  1 
ATOM   6188 O  OG  . SER E 2 177 ? -41.311  25.872  -51.117 1.00 45.53  ? 215 SER B OG  1 
ATOM   6189 N  N   . PHE E 2 178 ? -44.935  27.054  -53.449 1.00 42.44  ? 216 PHE B N   1 
ATOM   6190 C  CA  . PHE E 2 178 ? -45.814  28.123  -53.941 1.00 45.42  ? 216 PHE B CA  1 
ATOM   6191 C  C   . PHE E 2 178 ? -46.848  27.723  -54.989 1.00 50.48  ? 216 PHE B C   1 
ATOM   6192 O  O   . PHE E 2 178 ? -48.020  28.048  -54.838 1.00 55.02  ? 216 PHE B O   1 
ATOM   6193 C  CB  . PHE E 2 178 ? -44.985  29.263  -54.502 1.00 45.01  ? 216 PHE B CB  1 
ATOM   6194 C  CG  . PHE E 2 178 ? -45.804  30.406  -55.020 1.00 44.15  ? 216 PHE B CG  1 
ATOM   6195 C  CD1 . PHE E 2 178 ? -46.490  31.221  -54.148 1.00 42.81  ? 216 PHE B CD1 1 
ATOM   6196 C  CD2 . PHE E 2 178 ? -45.892  30.668  -56.386 1.00 45.50  ? 216 PHE B CD2 1 
ATOM   6197 C  CE1 . PHE E 2 178 ? -47.242  32.287  -54.613 1.00 42.92  ? 216 PHE B CE1 1 
ATOM   6198 C  CE2 . PHE E 2 178 ? -46.642  31.740  -56.861 1.00 44.80  ? 216 PHE B CE2 1 
ATOM   6199 C  CZ  . PHE E 2 178 ? -47.324  32.545  -55.971 1.00 43.41  ? 216 PHE B CZ  1 
ATOM   6200 N  N   . TYR E 2 179 ? -46.429  27.065  -56.066 1.00 53.33  ? 217 TYR B N   1 
ATOM   6201 C  CA  . TYR E 2 179 ? -47.323  26.853  -57.215 1.00 54.04  ? 217 TYR B CA  1 
ATOM   6202 C  C   . TYR E 2 179 ? -48.425  25.835  -56.966 1.00 53.72  ? 217 TYR B C   1 
ATOM   6203 O  O   . TYR E 2 179 ? -49.563  26.134  -57.277 1.00 53.15  ? 217 TYR B O   1 
ATOM   6204 C  CB  . TYR E 2 179 ? -46.548  26.533  -58.499 1.00 55.75  ? 217 TYR B CB  1 
ATOM   6205 C  CG  . TYR E 2 179 ? -45.774  27.722  -59.003 1.00 58.00  ? 217 TYR B CG  1 
ATOM   6206 C  CD1 . TYR E 2 179 ? -46.445  28.878  -59.423 1.00 57.78  ? 217 TYR B CD1 1 
ATOM   6207 C  CD2 . TYR E 2 179 ? -44.379  27.715  -59.034 1.00 61.06  ? 217 TYR B CD2 1 
ATOM   6208 C  CE1 . TYR E 2 179 ? -45.754  29.988  -59.879 1.00 59.34  ? 217 TYR B CE1 1 
ATOM   6209 C  CE2 . TYR E 2 179 ? -43.679  28.825  -59.496 1.00 63.23  ? 217 TYR B CE2 1 
ATOM   6210 C  CZ  . TYR E 2 179 ? -44.371  29.962  -59.919 1.00 62.32  ? 217 TYR B CZ  1 
ATOM   6211 O  OH  . TYR E 2 179 ? -43.689  31.077  -60.369 1.00 62.22  ? 217 TYR B OH  1 
ATOM   6212 N  N   . ILE E 2 180 ? -48.120  24.663  -56.409 1.00 51.93  ? 218 ILE B N   1 
ATOM   6213 C  CA  . ILE E 2 180 ? -49.173  23.704  -56.038 1.00 50.84  ? 218 ILE B CA  1 
ATOM   6214 C  C   . ILE E 2 180 ? -50.146  24.329  -55.019 1.00 52.31  ? 218 ILE B C   1 
ATOM   6215 O  O   . ILE E 2 180 ? -51.363  24.260  -55.239 1.00 49.59  ? 218 ILE B O   1 
ATOM   6216 C  CB  . ILE E 2 180 ? -48.610  22.350  -55.536 1.00 50.23  ? 218 ILE B CB  1 
ATOM   6217 C  CG1 . ILE E 2 180 ? -48.130  21.523  -56.715 1.00 50.03  ? 218 ILE B CG1 1 
ATOM   6218 C  CG2 . ILE E 2 180 ? -49.657  21.558  -54.744 1.00 50.38  ? 218 ILE B CG2 1 
ATOM   6219 C  CD1 . ILE E 2 180 ? -47.222  20.371  -56.319 1.00 51.65  ? 218 ILE B CD1 1 
ATOM   6220 N  N   . PRO E 2 181 ? -49.628  24.933  -53.915 1.00 52.90  ? 219 PRO B N   1 
ATOM   6221 C  CA  . PRO E 2 181 ? -50.495  25.695  -53.018 1.00 52.69  ? 219 PRO B CA  1 
ATOM   6222 C  C   . PRO E 2 181 ? -51.386  26.724  -53.704 1.00 52.19  ? 219 PRO B C   1 
ATOM   6223 O  O   . PRO E 2 181 ? -52.588  26.768  -53.443 1.00 55.95  ? 219 PRO B O   1 
ATOM   6224 C  CB  . PRO E 2 181 ? -49.500  26.380  -52.080 1.00 52.01  ? 219 PRO B CB  1 
ATOM   6225 C  CG  . PRO E 2 181 ? -48.429  25.376  -51.935 1.00 52.35  ? 219 PRO B CG  1 
ATOM   6226 C  CD  . PRO E 2 181 ? -48.303  24.729  -53.296 1.00 52.70  ? 219 PRO B CD  1 
ATOM   6227 N  N   . LEU E 2 182 ? -50.796  27.518  -54.587 1.00 48.90  ? 220 LEU B N   1 
ATOM   6228 C  CA  . LEU E 2 182 ? -51.537  28.527  -55.325 1.00 47.35  ? 220 LEU B CA  1 
ATOM   6229 C  C   . LEU E 2 182 ? -52.624  27.892  -56.153 1.00 49.49  ? 220 LEU B C   1 
ATOM   6230 O  O   . LEU E 2 182 ? -53.755  28.332  -56.093 1.00 54.37  ? 220 LEU B O   1 
ATOM   6231 C  CB  . LEU E 2 182 ? -50.620  29.321  -56.240 1.00 46.98  ? 220 LEU B CB  1 
ATOM   6232 C  CG  . LEU E 2 182 ? -51.313  30.325  -57.156 1.00 46.07  ? 220 LEU B CG  1 
ATOM   6233 C  CD1 . LEU E 2 182 ? -51.989  31.452  -56.388 1.00 43.96  ? 220 LEU B CD1 1 
ATOM   6234 C  CD2 . LEU E 2 182 ? -50.309  30.872  -58.142 1.00 46.72  ? 220 LEU B CD2 1 
ATOM   6235 N  N   . LEU E 2 183 ? -52.299  26.865  -56.931 1.00 52.34  ? 221 LEU B N   1 
ATOM   6236 C  CA  . LEU E 2 183 ? -53.316  26.199  -57.759 1.00 54.29  ? 221 LEU B CA  1 
ATOM   6237 C  C   . LEU E 2 183 ? -54.463  25.650  -56.939 1.00 53.66  ? 221 LEU B C   1 
ATOM   6238 O  O   . LEU E 2 183 ? -55.619  25.828  -57.307 1.00 54.97  ? 221 LEU B O   1 
ATOM   6239 C  CB  . LEU E 2 183 ? -52.719  25.067  -58.601 1.00 55.48  ? 221 LEU B CB  1 
ATOM   6240 C  CG  . LEU E 2 183 ? -51.870  25.478  -59.807 1.00 57.20  ? 221 LEU B CG  1 
ATOM   6241 C  CD1 . LEU E 2 183 ? -51.660  24.245  -60.680 1.00 57.31  ? 221 LEU B CD1 1 
ATOM   6242 C  CD2 . LEU E 2 183 ? -52.469  26.626  -60.625 1.00 56.54  ? 221 LEU B CD2 1 
ATOM   6243 N  N   . ILE E 2 184 ? -54.145  25.000  -55.827 1.00 52.84  ? 222 ILE B N   1 
ATOM   6244 C  CA  . ILE E 2 184 ? -55.175  24.469  -54.943 1.00 51.69  ? 222 ILE B CA  1 
ATOM   6245 C  C   . ILE E 2 184 ? -56.016  25.626  -54.397 1.00 51.16  ? 222 ILE B C   1 
ATOM   6246 O  O   . ILE E 2 184 ? -57.234  25.559  -54.439 1.00 49.33  ? 222 ILE B O   1 
ATOM   6247 C  CB  . ILE E 2 184 ? -54.576  23.602  -53.813 1.00 51.67  ? 222 ILE B CB  1 
ATOM   6248 C  CG1 . ILE E 2 184 ? -53.960  22.325  -54.402 1.00 51.88  ? 222 ILE B CG1 1 
ATOM   6249 C  CG2 . ILE E 2 184 ? -55.639  23.215  -52.799 1.00 51.98  ? 222 ILE B CG2 1 
ATOM   6250 C  CD1 . ILE E 2 184 ? -53.113  21.541  -53.421 1.00 51.94  ? 222 ILE B CD1 1 
ATOM   6251 N  N   . MET E 2 185 ? -55.377  26.694  -53.929 1.00 51.26  ? 223 MET B N   1 
ATOM   6252 C  CA  . MET E 2 185 ? -56.116  27.864  -53.437 1.00 52.41  ? 223 MET B CA  1 
ATOM   6253 C  C   . MET E 2 185 ? -57.033  28.496  -54.488 1.00 52.64  ? 223 MET B C   1 
ATOM   6254 O  O   . MET E 2 185 ? -58.119  28.930  -54.153 1.00 53.40  ? 223 MET B O   1 
ATOM   6255 C  CB  . MET E 2 185 ? -55.163  28.919  -52.882 1.00 54.12  ? 223 MET B CB  1 
ATOM   6256 C  CG  . MET E 2 185 ? -54.491  28.513  -51.575 1.00 56.81  ? 223 MET B CG  1 
ATOM   6257 S  SD  . MET E 2 185 ? -53.161  29.645  -51.103 1.00 56.59  ? 223 MET B SD  1 
ATOM   6258 C  CE  . MET E 2 185 ? -54.122  31.102  -50.698 1.00 58.59  ? 223 MET B CE  1 
ATOM   6259 N  N   . ILE E 2 186 ? -56.611  28.540  -55.750 1.00 53.91  ? 224 ILE B N   1 
ATOM   6260 C  CA  . ILE E 2 186 ? -57.440  29.102  -56.827 1.00 56.35  ? 224 ILE B CA  1 
ATOM   6261 C  C   . ILE E 2 186 ? -58.625  28.190  -57.094 1.00 59.78  ? 224 ILE B C   1 
ATOM   6262 O  O   . ILE E 2 186 ? -59.763  28.642  -57.105 1.00 57.12  ? 224 ILE B O   1 
ATOM   6263 C  CB  . ILE E 2 186 ? -56.670  29.256  -58.156 1.00 55.03  ? 224 ILE B CB  1 
ATOM   6264 C  CG1 . ILE E 2 186 ? -55.493  30.227  -58.014 1.00 54.88  ? 224 ILE B CG1 1 
ATOM   6265 C  CG2 . ILE E 2 186 ? -57.602  29.747  -59.270 1.00 52.85  ? 224 ILE B CG2 1 
ATOM   6266 C  CD1 . ILE E 2 186 ? -54.368  29.892  -58.976 1.00 55.07  ? 224 ILE B CD1 1 
ATOM   6267 N  N   . PHE E 2 187 ? -58.343  26.914  -57.326 1.00 61.98  ? 225 PHE B N   1 
ATOM   6268 C  CA  . PHE E 2 187 ? -59.376  25.910  -57.598 1.00 63.83  ? 225 PHE B CA  1 
ATOM   6269 C  C   . PHE E 2 187 ? -60.442  25.856  -56.498 1.00 62.48  ? 225 PHE B C   1 
ATOM   6270 O  O   . PHE E 2 187 ? -61.638  25.896  -56.784 1.00 61.59  ? 225 PHE B O   1 
ATOM   6271 C  CB  . PHE E 2 187 ? -58.720  24.535  -57.786 1.00 65.58  ? 225 PHE B CB  1 
ATOM   6272 C  CG  . PHE E 2 187 ? -59.690  23.393  -57.820 1.00 71.05  ? 225 PHE B CG  1 
ATOM   6273 C  CD1 . PHE E 2 187 ? -60.604  23.273  -58.869 1.00 76.15  ? 225 PHE B CD1 1 
ATOM   6274 C  CD2 . PHE E 2 187 ? -59.694  22.429  -56.811 1.00 73.63  ? 225 PHE B CD2 1 
ATOM   6275 C  CE1 . PHE E 2 187 ? -61.503  22.218  -58.911 1.00 77.11  ? 225 PHE B CE1 1 
ATOM   6276 C  CE2 . PHE E 2 187 ? -60.591  21.369  -56.847 1.00 76.19  ? 225 PHE B CE2 1 
ATOM   6277 C  CZ  . PHE E 2 187 ? -61.493  21.263  -57.902 1.00 77.93  ? 225 PHE B CZ  1 
ATOM   6278 N  N   . VAL E 2 188 ? -59.986  25.790  -55.247 1.00 60.26  ? 226 VAL B N   1 
ATOM   6279 C  CA  . VAL E 2 188 ? -60.857  25.647  -54.075 1.00 54.50  ? 226 VAL B CA  1 
ATOM   6280 C  C   . VAL E 2 188 ? -61.729  26.887  -53.905 1.00 51.32  ? 226 VAL B C   1 
ATOM   6281 O  O   . VAL E 2 188 ? -62.944  26.783  -53.922 1.00 47.25  ? 226 VAL B O   1 
ATOM   6282 C  CB  . VAL E 2 188 ? -60.005  25.358  -52.803 1.00 55.46  ? 226 VAL B CB  1 
ATOM   6283 C  CG1 . VAL E 2 188 ? -60.718  25.671  -51.512 1.00 57.33  ? 226 VAL B CG1 1 
ATOM   6284 C  CG2 . VAL E 2 188 ? -59.550  23.905  -52.792 1.00 56.47  ? 226 VAL B CG2 1 
ATOM   6285 N  N   . TYR E 2 189 ? -61.112  28.058  -53.762 1.00 51.09  ? 227 TYR B N   1 
ATOM   6286 C  CA  . TYR E 2 189 ? -61.874  29.301  -53.563 1.00 51.99  ? 227 TYR B CA  1 
ATOM   6287 C  C   . TYR E 2 189 ? -62.709  29.679  -54.774 1.00 52.37  ? 227 TYR B C   1 
ATOM   6288 O  O   . TYR E 2 189 ? -63.605  30.495  -54.646 1.00 52.08  ? 227 TYR B O   1 
ATOM   6289 C  CB  . TYR E 2 189 ? -60.966  30.483  -53.198 1.00 53.80  ? 227 TYR B CB  1 
ATOM   6290 C  CG  . TYR E 2 189 ? -60.471  30.502  -51.770 1.00 56.44  ? 227 TYR B CG  1 
ATOM   6291 C  CD1 . TYR E 2 189 ? -61.352  30.494  -50.694 1.00 55.88  ? 227 TYR B CD1 1 
ATOM   6292 C  CD2 . TYR E 2 189 ? -59.113  30.553  -51.495 1.00 58.22  ? 227 TYR B CD2 1 
ATOM   6293 C  CE1 . TYR E 2 189 ? -60.889  30.516  -49.393 1.00 55.62  ? 227 TYR B CE1 1 
ATOM   6294 C  CE2 . TYR E 2 189 ? -58.641  30.600  -50.187 1.00 56.82  ? 227 TYR B CE2 1 
ATOM   6295 C  CZ  . TYR E 2 189 ? -59.535  30.584  -49.143 1.00 55.91  ? 227 TYR B CZ  1 
ATOM   6296 O  OH  . TYR E 2 189 ? -59.078  30.612  -47.849 1.00 53.95  ? 227 TYR B OH  1 
ATOM   6297 N  N   . LEU E 2 190 ? -62.397  29.124  -55.946 1.00 56.15  ? 228 LEU B N   1 
ATOM   6298 C  CA  . LEU E 2 190 ? -63.245  29.292  -57.124 1.00 60.58  ? 228 LEU B CA  1 
ATOM   6299 C  C   . LEU E 2 190 ? -64.552  28.512  -56.964 1.00 60.44  ? 228 LEU B C   1 
ATOM   6300 O  O   . LEU E 2 190 ? -65.628  29.050  -57.264 1.00 56.86  ? 228 LEU B O   1 
ATOM   6301 C  CB  . LEU E 2 190 ? -62.513  28.845  -58.390 1.00 62.72  ? 228 LEU B CB  1 
ATOM   6302 C  CG  . LEU E 2 190 ? -63.141  29.154  -59.742 1.00 64.83  ? 228 LEU B CG  1 
ATOM   6303 C  CD1 . LEU E 2 190 ? -63.340  30.663  -59.895 1.00 64.00  ? 228 LEU B CD1 1 
ATOM   6304 C  CD2 . LEU E 2 190 ? -62.259  28.546  -60.830 1.00 65.26  ? 228 LEU B CD2 1 
ATOM   6305 N  N   . ARG E 2 191 ? -64.458  27.264  -56.487 1.00 61.02  ? 229 ARG B N   1 
ATOM   6306 C  CA  . ARG E 2 191 ? -65.647  26.474  -56.192 1.00 62.57  ? 229 ARG B CA  1 
ATOM   6307 C  C   . ARG E 2 191 ? -66.543  27.136  -55.126 1.00 63.19  ? 229 ARG B C   1 
ATOM   6308 O  O   . ARG E 2 191 ? -67.759  27.039  -55.247 1.00 64.07  ? 229 ARG B O   1 
ATOM   6309 C  CB  . ARG E 2 191 ? -65.305  25.021  -55.831 1.00 63.77  ? 229 ARG B CB  1 
ATOM   6310 C  CG  . ARG E 2 191 ? -65.027  24.155  -57.056 1.00 67.89  ? 229 ARG B CG  1 
ATOM   6311 C  CD  . ARG E 2 191 ? -64.449  22.776  -56.725 1.00 74.13  ? 229 ARG B CD  1 
ATOM   6312 N  NE  . ARG E 2 191 ? -65.472  21.770  -56.385 1.00 82.89  ? 229 ARG B NE  1 
ATOM   6313 C  CZ  . ARG E 2 191 ? -65.236  20.520  -55.954 1.00 90.99  ? 229 ARG B CZ  1 
ATOM   6314 N  NH1 . ARG E 2 191 ? -63.997  20.065  -55.775 1.00 96.58  ? 229 ARG B NH1 1 
ATOM   6315 N  NH2 . ARG E 2 191 ? -66.262  19.712  -55.676 1.00 93.70  ? 229 ARG B NH2 1 
ATOM   6316 N  N   . VAL E 2 192 ? -65.968  27.832  -54.130 1.00 63.87  ? 230 VAL B N   1 
ATOM   6317 C  CA  . VAL E 2 192 ? -66.769  28.623  -53.173 1.00 61.71  ? 230 VAL B CA  1 
ATOM   6318 C  C   . VAL E 2 192 ? -67.530  29.725  -53.895 1.00 62.08  ? 230 VAL B C   1 
ATOM   6319 O  O   . VAL E 2 192 ? -68.711  29.912  -53.654 1.00 64.65  ? 230 VAL B O   1 
ATOM   6320 C  CB  . VAL E 2 192 ? -65.924  29.298  -52.047 1.00 60.87  ? 230 VAL B CB  1 
ATOM   6321 C  CG1 . VAL E 2 192 ? -66.770  30.267  -51.205 1.00 61.09  ? 230 VAL B CG1 1 
ATOM   6322 C  CG2 . VAL E 2 192 ? -65.283  28.260  -51.139 1.00 60.19  ? 230 VAL B CG2 1 
ATOM   6323 N  N   . TYR E 2 193 ? -66.845  30.466  -54.755 1.00 64.25  ? 231 TYR B N   1 
ATOM   6324 C  CA  . TYR E 2 193 ? -67.490  31.533  -55.505 1.00 68.62  ? 231 TYR B CA  1 
ATOM   6325 C  C   . TYR E 2 193 ? -68.578  30.984  -56.405 1.00 74.11  ? 231 TYR B C   1 
ATOM   6326 O  O   . TYR E 2 193 ? -69.675  31.529  -56.436 1.00 72.87  ? 231 TYR B O   1 
ATOM   6327 C  CB  . TYR E 2 193 ? -66.483  32.284  -56.365 1.00 68.18  ? 231 TYR B CB  1 
ATOM   6328 C  CG  . TYR E 2 193 ? -67.122  33.298  -57.280 1.00 68.49  ? 231 TYR B CG  1 
ATOM   6329 C  CD1 . TYR E 2 193 ? -67.582  34.520  -56.782 1.00 67.91  ? 231 TYR B CD1 1 
ATOM   6330 C  CD2 . TYR E 2 193 ? -67.286  33.035  -58.642 1.00 68.18  ? 231 TYR B CD2 1 
ATOM   6331 C  CE1 . TYR E 2 193 ? -68.177  35.455  -57.618 1.00 66.23  ? 231 TYR B CE1 1 
ATOM   6332 C  CE2 . TYR E 2 193 ? -67.874  33.972  -59.486 1.00 68.34  ? 231 TYR B CE2 1 
ATOM   6333 C  CZ  . TYR E 2 193 ? -68.311  35.182  -58.963 1.00 66.44  ? 231 TYR B CZ  1 
ATOM   6334 O  OH  . TYR E 2 193 ? -68.896  36.121  -59.774 1.00 64.65  ? 231 TYR B OH  1 
ATOM   6335 N  N   . ARG E 2 194 ? -68.259  29.925  -57.145 1.00 80.98  ? 232 ARG B N   1 
ATOM   6336 C  CA  . ARG E 2 194 ? -69.243  29.271  -58.018 1.00 83.53  ? 232 ARG B CA  1 
ATOM   6337 C  C   . ARG E 2 194 ? -70.458  28.754  -57.238 1.00 80.35  ? 232 ARG B C   1 
ATOM   6338 O  O   . ARG E 2 194 ? -71.608  28.974  -57.653 1.00 79.49  ? 232 ARG B O   1 
ATOM   6339 C  CB  . ARG E 2 194 ? -68.611  28.121  -58.825 1.00 87.88  ? 232 ARG B CB  1 
ATOM   6340 C  CG  . ARG E 2 194 ? -67.740  28.569  -59.994 1.00 89.44  ? 232 ARG B CG  1 
ATOM   6341 C  CD  . ARG E 2 194 ? -67.197  27.378  -60.771 1.00 90.60  ? 232 ARG B CD  1 
ATOM   6342 N  NE  . ARG E 2 194 ? -66.263  27.788  -61.821 1.00 92.62  ? 232 ARG B NE  1 
ATOM   6343 C  CZ  . ARG E 2 194 ? -65.608  26.957  -62.637 1.00 93.72  ? 232 ARG B CZ  1 
ATOM   6344 N  NH1 . ARG E 2 194 ? -65.759  25.634  -62.548 1.00 95.32  ? 232 ARG B NH1 1 
ATOM   6345 N  NH2 . ARG E 2 194 ? -64.786  27.457  -63.559 1.00 94.25  ? 232 ARG B NH2 1 
ATOM   6346 N  N   . GLU E 2 195 ? -70.192  28.094  -56.111 1.00 72.11  ? 233 GLU B N   1 
ATOM   6347 C  CA  . GLU E 2 195 ? -71.259  27.525  -55.280 1.00 66.38  ? 233 GLU B CA  1 
ATOM   6348 C  C   . GLU E 2 195 ? -72.193  28.624  -54.770 1.00 62.80  ? 233 GLU B C   1 
ATOM   6349 O  O   . GLU E 2 195 ? -73.411  28.466  -54.788 1.00 60.90  ? 233 GLU B O   1 
ATOM   6350 C  CB  . GLU E 2 195 ? -70.671  26.781  -54.083 1.00 66.39  ? 233 GLU B CB  1 
ATOM   6351 C  CG  . GLU E 2 195 ? -71.569  25.684  -53.549 1.00 66.46  ? 233 GLU B CG  1 
ATOM   6352 C  CD  . GLU E 2 195 ? -71.417  24.388  -54.323 1.00 66.31  ? 233 GLU B CD  1 
ATOM   6353 O  OE1 . GLU E 2 195 ? -71.755  23.319  -53.761 1.00 67.41  ? 233 GLU B OE1 1 
ATOM   6354 O  OE2 . GLU E 2 195 ? -70.946  24.407  -55.479 1.00 66.53  ? 233 GLU B OE2 1 
ATOM   6355 N  N   . ALA E 2 196 ? -71.600  29.727  -54.316 1.00 63.47  ? 234 ALA B N   1 
ATOM   6356 C  CA  . ALA E 2 196 ? -72.347  30.883  -53.811 1.00 66.15  ? 234 ALA B CA  1 
ATOM   6357 C  C   . ALA E 2 196 ? -73.134  31.585  -54.898 1.00 68.83  ? 234 ALA B C   1 
ATOM   6358 O  O   . ALA E 2 196 ? -74.275  31.948  -54.680 1.00 66.81  ? 234 ALA B O   1 
ATOM   6359 C  CB  . ALA E 2 196 ? -71.407  31.877  -53.141 1.00 65.77  ? 234 ALA B CB  1 
ATOM   6360 N  N   . LYS E 2 197 ? -72.526  31.783  -56.064 1.00 75.41  ? 235 LYS B N   1 
ATOM   6361 C  CA  . LYS E 2 197 ? -73.229  32.387  -57.196 1.00 78.68  ? 235 LYS B CA  1 
ATOM   6362 C  C   . LYS E 2 197 ? -74.342  31.475  -57.711 1.00 80.66  ? 235 LYS B C   1 
ATOM   6363 O  O   . LYS E 2 197 ? -75.419  31.968  -58.064 1.00 74.67  ? 235 LYS B O   1 
ATOM   6364 C  CB  . LYS E 2 197 ? -72.271  32.726  -58.340 1.00 78.94  ? 235 LYS B CB  1 
ATOM   6365 C  CG  . LYS E 2 197 ? -72.922  33.610  -59.395 1.00 79.09  ? 235 LYS B CG  1 
ATOM   6366 C  CD  . LYS E 2 197 ? -71.937  34.170  -60.397 1.00 76.63  ? 235 LYS B CD  1 
ATOM   6367 C  CE  . LYS E 2 197 ? -72.634  35.146  -61.327 1.00 75.97  ? 235 LYS B CE  1 
ATOM   6368 N  NZ  . LYS E 2 197 ? -71.669  35.894  -62.168 1.00 76.57  ? 235 LYS B NZ  1 
ATOM   6369 N  N   . GLU E 2 198 ? -74.079  30.162  -57.753 1.00 84.26  ? 236 GLU B N   1 
ATOM   6370 C  CA  . GLU E 2 198 ? -75.075  29.188  -58.204 1.00 85.62  ? 236 GLU B CA  1 
ATOM   6371 C  C   . GLU E 2 198 ? -76.252  29.073  -57.243 1.00 87.74  ? 236 GLU B C   1 
ATOM   6372 O  O   . GLU E 2 198 ? -77.364  28.778  -57.671 1.00 93.10  ? 236 GLU B O   1 
ATOM   6373 C  CB  . GLU E 2 198 ? -74.446  27.807  -58.378 1.00 89.62  ? 236 GLU B CB  1 
ATOM   6374 C  CG  . GLU E 2 198 ? -75.327  26.786  -59.088 1.00 93.38  ? 236 GLU B CG  1 
ATOM   6375 C  CD  . GLU E 2 198 ? -75.026  25.348  -58.694 1.00 101.33 ? 236 GLU B CD  1 
ATOM   6376 O  OE1 . GLU E 2 198 ? -73.981  25.070  -58.054 1.00 109.22 ? 236 GLU B OE1 1 
ATOM   6377 O  OE2 . GLU E 2 198 ? -75.856  24.489  -59.035 1.00 106.81 ? 236 GLU B OE2 1 
ATOM   6378 N  N   . GLN E 2 199 ? -75.998  29.275  -55.952 1.00 90.75  ? 237 GLN B N   1 
ATOM   6379 C  CA  . GLN E 2 199 ? -77.059  29.252  -54.949 1.00 89.10  ? 237 GLN B CA  1 
ATOM   6380 C  C   . GLN E 2 199 ? -77.932  30.504  -55.022 1.00 82.06  ? 237 GLN B C   1 
ATOM   6381 O  O   . GLN E 2 199 ? -79.145  30.399  -54.868 1.00 82.51  ? 237 GLN B O   1 
ATOM   6382 C  CB  . GLN E 2 199 ? -76.472  29.081  -53.539 1.00 95.49  ? 237 GLN B CB  1 
ATOM   6383 C  CG  . GLN E 2 199 ? -77.491  28.964  -52.405 1.00 100.20 ? 237 GLN B CG  1 
ATOM   6384 C  CD  . GLN E 2 199 ? -78.484  27.824  -52.592 1.00 101.74 ? 237 GLN B CD  1 
ATOM   6385 O  OE1 . GLN E 2 199 ? -78.170  26.797  -53.195 1.00 103.70 ? 237 GLN B OE1 1 
ATOM   6386 N  NE2 . GLN E 2 199 ? -79.688  28.002  -52.066 1.00 98.43  ? 237 GLN B NE2 1 
ATOM   6387 N  N   . ILE E 2 200 ? -77.323  31.674  -55.251 1.00 78.73  ? 238 ILE B N   1 
ATOM   6388 C  CA  . ILE E 2 200 ? -78.074  32.926  -55.447 1.00 80.26  ? 238 ILE B CA  1 
ATOM   6389 C  C   . ILE E 2 200 ? -78.970  32.816  -56.681 1.00 87.62  ? 238 ILE B C   1 
ATOM   6390 O  O   . ILE E 2 200 ? -80.082  33.357  -56.691 1.00 88.60  ? 238 ILE B O   1 
ATOM   6391 C  CB  . ILE E 2 200 ? -77.150  34.170  -55.604 1.00 75.70  ? 238 ILE B CB  1 
ATOM   6392 C  CG1 . ILE E 2 200 ? -76.413  34.482  -54.308 1.00 74.05  ? 238 ILE B CG1 1 
ATOM   6393 C  CG2 . ILE E 2 200 ? -77.938  35.416  -56.015 1.00 74.30  ? 238 ILE B CG2 1 
ATOM   6394 C  CD1 . ILE E 2 200 ? -75.264  35.463  -54.469 1.00 73.83  ? 238 ILE B CD1 1 
ATOM   6395 N  N   . ARG E 2 201 ? -78.481  32.118  -57.706 1.00 95.41  ? 239 ARG B N   1 
ATOM   6396 C  CA  . ARG E 2 201 ? -79.257  31.856  -58.917 1.00 99.39  ? 239 ARG B CA  1 
ATOM   6397 C  C   . ARG E 2 201 ? -80.514  31.014  -58.611 1.00 101.50 ? 239 ARG B C   1 
ATOM   6398 O  O   . ARG E 2 201 ? -81.602  31.339  -59.089 1.00 111.22 ? 239 ARG B O   1 
ATOM   6399 C  CB  . ARG E 2 201 ? -78.369  31.166  -59.971 1.00 100.06 ? 239 ARG B CB  1 
ATOM   6400 C  CG  . ARG E 2 201 ? -78.924  31.181  -61.387 1.00 100.88 ? 239 ARG B CG  1 
ATOM   6401 C  CD  . ARG E 2 201 ? -78.109  30.271  -62.297 1.00 108.64 ? 239 ARG B CD  1 
ATOM   6402 N  NE  . ARG E 2 201 ? -78.238  28.867  -61.896 1.00 116.78 ? 239 ARG B NE  1 
ATOM   6403 C  CZ  . ARG E 2 201 ? -79.281  28.074  -62.163 1.00 124.44 ? 239 ARG B CZ  1 
ATOM   6404 N  NH1 . ARG E 2 201 ? -80.334  28.517  -62.855 1.00 128.28 ? 239 ARG B NH1 1 
ATOM   6405 N  NH2 . ARG E 2 201 ? -79.275  26.813  -61.730 1.00 128.04 ? 239 ARG B NH2 1 
ATOM   6406 N  N   . LYS E 2 202 ? -80.369  29.966  -57.799 1.00 96.15  ? 240 LYS B N   1 
ATOM   6407 C  CA  . LYS E 2 202 ? -81.513  29.120  -57.415 1.00 92.12  ? 240 LYS B CA  1 
ATOM   6408 C  C   . LYS E 2 202 ? -82.548  29.840  -56.553 1.00 95.78  ? 240 LYS B C   1 
ATOM   6409 O  O   . LYS E 2 202 ? -83.724  29.517  -56.639 1.00 99.85  ? 240 LYS B O   1 
ATOM   6410 C  CB  . LYS E 2 202 ? -81.052  27.828  -56.729 1.00 90.64  ? 240 LYS B CB  1 
ATOM   6411 C  CG  . LYS E 2 202 ? -80.447  26.841  -57.711 1.00 93.18  ? 240 LYS B CG  1 
ATOM   6412 C  CD  . LYS E 2 202 ? -79.769  25.677  -57.012 1.00 96.95  ? 240 LYS B CD  1 
ATOM   6413 C  CE  . LYS E 2 202 ? -78.839  24.931  -57.958 1.00 100.47 ? 240 LYS B CE  1 
ATOM   6414 N  NZ  . LYS E 2 202 ? -77.837  24.115  -57.216 1.00 104.26 ? 240 LYS B NZ  1 
ATOM   6415 N  N   . ILE E 2 203 ? -82.114  30.802  -55.734 1.00 101.74 ? 241 ILE B N   1 
ATOM   6416 C  CA  . ILE E 2 203 ? -83.032  31.645  -54.925 1.00 101.68 ? 241 ILE B CA  1 
ATOM   6417 C  C   . ILE E 2 203 ? -83.905  32.536  -55.816 1.00 103.60 ? 241 ILE B C   1 
ATOM   6418 O  O   . ILE E 2 203 ? -85.073  32.765  -55.496 1.00 111.65 ? 241 ILE B O   1 
ATOM   6419 C  CB  . ILE E 2 203 ? -82.265  32.516  -53.884 1.00 97.72  ? 241 ILE B CB  1 
ATOM   6420 C  CG1 . ILE E 2 203 ? -81.680  31.621  -52.783 1.00 99.48  ? 241 ILE B CG1 1 
ATOM   6421 C  CG2 . ILE E 2 203 ? -83.165  33.569  -53.239 1.00 92.88  ? 241 ILE B CG2 1 
ATOM   6422 C  CD1 . ILE E 2 203 ? -80.656  32.308  -51.897 1.00 100.00 ? 241 ILE B CD1 1 
ATOM   6423 N  N   . ASP E 2 204 ? -83.340  33.033  -56.917 1.00 102.16 ? 242 ASP B N   1 
ATOM   6424 C  CA  . ASP E 2 204 ? -84.084  33.899  -57.842 1.00 103.27 ? 242 ASP B CA  1 
ATOM   6425 C  C   . ASP E 2 204 ? -85.088  33.114  -58.694 1.00 103.78 ? 242 ASP B C   1 
ATOM   6426 O  O   . ASP E 2 204 ? -86.162  33.616  -59.021 1.00 95.72  ? 242 ASP B O   1 
ATOM   6427 C  CB  . ASP E 2 204 ? -83.119  34.681  -58.735 1.00 101.80 ? 242 ASP B CB  1 
ATOM   6428 C  CG  . ASP E 2 204 ? -82.199  35.596  -57.940 1.00 99.98  ? 242 ASP B CG  1 
ATOM   6429 O  OD1 . ASP E 2 204 ? -82.611  36.068  -56.851 1.00 96.24  ? 242 ASP B OD1 1 
ATOM   6430 O  OD2 . ASP E 2 204 ? -81.065  35.840  -58.412 1.00 93.28  ? 242 ASP B OD2 1 
ATOM   6431 N  N   . ARG E 2 205 ? -84.718  31.884  -59.051 1.00 108.35 ? 243 ARG B N   1 
ATOM   6432 C  CA  . ARG E 2 205 ? -85.624  30.929  -59.699 1.00 112.14 ? 243 ARG B CA  1 
ATOM   6433 C  C   . ARG E 2 205 ? -86.794  30.512  -58.804 1.00 114.75 ? 243 ARG B C   1 
ATOM   6434 O  O   . ARG E 2 205 ? -87.875  30.212  -59.296 1.00 116.75 ? 243 ARG B O   1 
ATOM   6435 C  CB  . ARG E 2 205 ? -84.813  29.704  -60.115 1.00 114.58 ? 243 ARG B CB  1 
ATOM   6436 C  CG  . ARG E 2 205 ? -85.561  28.480  -60.599 1.00 118.50 ? 243 ARG B CG  1 
ATOM   6437 C  CD  . ARG E 2 205 ? -84.496  27.439  -60.903 1.00 120.79 ? 243 ARG B CD  1 
ATOM   6438 N  NE  . ARG E 2 205 ? -85.020  26.199  -61.457 1.00 126.78 ? 243 ARG B NE  1 
ATOM   6439 C  CZ  . ARG E 2 205 ? -84.276  25.278  -62.063 1.00 133.65 ? 243 ARG B CZ  1 
ATOM   6440 N  NH1 . ARG E 2 205 ? -82.957  25.419  -62.212 1.00 137.26 ? 243 ARG B NH1 1 
ATOM   6441 N  NH2 . ARG E 2 205 ? -84.857  24.185  -62.542 1.00 140.33 ? 243 ARG B NH2 1 
ATOM   6442 N  N   . ALA E 2 206 ? -86.568  30.484  -57.491 1.00 117.92 ? 272 ALA B N   1 
ATOM   6443 C  CA  . ALA E 2 206 ? -87.625  30.199  -56.514 1.00 114.40 ? 272 ALA B CA  1 
ATOM   6444 C  C   . ALA E 2 206 ? -88.685  31.306  -56.458 1.00 108.02 ? 272 ALA B C   1 
ATOM   6445 O  O   . ALA E 2 206 ? -89.867  31.002  -56.326 1.00 110.06 ? 272 ALA B O   1 
ATOM   6446 C  CB  . ALA E 2 206 ? -87.020  29.970  -55.132 1.00 120.19 ? 272 ALA B CB  1 
ATOM   6447 N  N   . SER E 2 207 ? -88.245  32.570  -56.542 1.00 97.20  ? 273 SER B N   1 
ATOM   6448 C  CA  . SER E 2 207 ? -89.140  33.737  -56.630 1.00 91.32  ? 273 SER B CA  1 
ATOM   6449 C  C   . SER E 2 207 ? -90.023  33.665  -57.869 1.00 96.91  ? 273 SER B C   1 
ATOM   6450 O  O   . SER E 2 207 ? -90.858  34.537  -58.099 1.00 106.16 ? 273 SER B O   1 
ATOM   6451 C  CB  . SER E 2 207 ? -88.341  35.042  -56.677 1.00 85.18  ? 273 SER B CB  1 
ATOM   6452 O  OG  . SER E 2 207 ? -87.756  35.303  -55.433 1.00 85.04  ? 273 SER B OG  1 
ATOM   6453 N  N   . MET E 2 215 ? -76.686  42.981  -55.169 1.00 98.12  ? 281 MET B N   1 
ATOM   6454 C  CA  . MET E 2 215 ? -76.067  42.095  -54.200 1.00 97.32  ? 281 MET B CA  1 
ATOM   6455 C  C   . MET E 2 215 ? -76.327  42.646  -52.814 1.00 96.26  ? 281 MET B C   1 
ATOM   6456 O  O   . MET E 2 215 ? -76.375  43.865  -52.648 1.00 93.97  ? 281 MET B O   1 
ATOM   6457 C  CB  . MET E 2 215 ? -74.560  42.023  -54.438 1.00 98.96  ? 281 MET B CB  1 
ATOM   6458 C  CG  . MET E 2 215 ? -74.161  41.298  -55.717 1.00 99.74  ? 281 MET B CG  1 
ATOM   6459 S  SD  . MET E 2 215 ? -72.583  40.427  -55.584 1.00 100.21 ? 281 MET B SD  1 
ATOM   6460 C  CE  . MET E 2 215 ? -71.459  41.776  -55.249 1.00 94.67  ? 281 MET B CE  1 
ATOM   6461 N  N   . ALA E 2 216 ? -76.465  41.759  -51.830 1.00 98.01  ? 282 ALA B N   1 
ATOM   6462 C  CA  . ALA E 2 216 ? -76.692  42.175  -50.446 1.00 101.39 ? 282 ALA B CA  1 
ATOM   6463 C  C   . ALA E 2 216 ? -75.368  42.511  -49.765 1.00 105.05 ? 282 ALA B C   1 
ATOM   6464 O  O   . ALA E 2 216 ? -74.293  42.308  -50.336 1.00 109.10 ? 282 ALA B O   1 
ATOM   6465 C  CB  . ALA E 2 216 ? -77.462  41.121  -49.664 1.00 99.99  ? 282 ALA B CB  1 
ATOM   6466 N  N   . MET E 2 217 ? -75.475  43.063  -48.560 1.00 104.60 ? 283 MET B N   1 
ATOM   6467 C  CA  . MET E 2 217 ? -74.323  43.401  -47.706 1.00 97.04  ? 283 MET B CA  1 
ATOM   6468 C  C   . MET E 2 217 ? -73.342  42.235  -47.584 1.00 91.02  ? 283 MET B C   1 
ATOM   6469 O  O   . MET E 2 217 ? -72.140  42.404  -47.815 1.00 87.37  ? 283 MET B O   1 
ATOM   6470 C  CB  . MET E 2 217 ? -74.827  43.821  -46.310 1.00 96.82  ? 283 MET B CB  1 
ATOM   6471 C  CG  . MET E 2 217 ? -73.774  44.173  -45.270 1.00 96.15  ? 283 MET B CG  1 
ATOM   6472 S  SD  . MET E 2 217 ? -72.854  45.665  -45.654 1.00 94.98  ? 283 MET B SD  1 
ATOM   6473 C  CE  . MET E 2 217 ? -71.498  45.494  -44.488 1.00 91.38  ? 283 MET B CE  1 
ATOM   6474 N  N   . LYS E 2 218 ? -73.865  41.058  -47.238 1.00 87.59  ? 284 LYS B N   1 
ATOM   6475 C  CA  . LYS E 2 218 ? -73.034  39.874  -47.008 1.00 85.76  ? 284 LYS B CA  1 
ATOM   6476 C  C   . LYS E 2 218 ? -72.296  39.418  -48.268 1.00 84.19  ? 284 LYS B C   1 
ATOM   6477 O  O   . LYS E 2 218 ? -71.171  38.943  -48.165 1.00 86.08  ? 284 LYS B O   1 
ATOM   6478 C  CB  . LYS E 2 218 ? -73.861  38.698  -46.430 1.00 81.52  ? 284 LYS B CB  1 
ATOM   6479 C  CG  . LYS E 2 218 ? -74.480  38.952  -45.059 1.00 75.94  ? 284 LYS B CG  1 
ATOM   6480 C  CD  . LYS E 2 218 ? -73.432  39.033  -43.962 1.00 73.41  ? 284 LYS B CD  1 
ATOM   6481 C  CE  . LYS E 2 218 ? -74.045  39.546  -42.670 1.00 72.34  ? 284 LYS B CE  1 
ATOM   6482 N  NZ  . LYS E 2 218 ? -75.117  38.647  -42.144 1.00 69.71  ? 284 LYS B NZ  1 
ATOM   6483 N  N   . GLU E 2 219 ? -72.920  39.560  -49.435 1.00 83.34  ? 285 GLU B N   1 
ATOM   6484 C  CA  . GLU E 2 219 ? -72.309  39.109  -50.687 1.00 83.36  ? 285 GLU B CA  1 
ATOM   6485 C  C   . GLU E 2 219 ? -71.200  40.060  -51.174 1.00 81.56  ? 285 GLU B C   1 
ATOM   6486 O  O   . GLU E 2 219 ? -70.197  39.588  -51.728 1.00 79.66  ? 285 GLU B O   1 
ATOM   6487 C  CB  . GLU E 2 219 ? -73.363  38.885  -51.781 1.00 83.70  ? 285 GLU B CB  1 
ATOM   6488 C  CG  . GLU E 2 219 ? -74.112  37.554  -51.672 1.00 84.63  ? 285 GLU B CG  1 
ATOM   6489 C  CD  . GLU E 2 219 ? -75.290  37.568  -50.711 1.00 85.71  ? 285 GLU B CD  1 
ATOM   6490 O  OE1 . GLU E 2 219 ? -75.405  38.481  -49.876 1.00 86.26  ? 285 GLU B OE1 1 
ATOM   6491 O  OE2 . GLU E 2 219 ? -76.120  36.648  -50.797 1.00 84.81  ? 285 GLU B OE2 1 
ATOM   6492 N  N   . HIS E 2 220 ? -71.368  41.373  -50.968 1.00 79.81  ? 286 HIS B N   1 
ATOM   6493 C  CA  . HIS E 2 220 ? -70.299  42.332  -51.270 1.00 82.18  ? 286 HIS B CA  1 
ATOM   6494 C  C   . HIS E 2 220 ? -69.071  42.063  -50.387 1.00 75.67  ? 286 HIS B C   1 
ATOM   6495 O  O   . HIS E 2 220 ? -67.937  41.977  -50.882 1.00 70.58  ? 286 HIS B O   1 
ATOM   6496 C  CB  . HIS E 2 220 ? -70.735  43.781  -51.014 1.00 91.88  ? 286 HIS B CB  1 
ATOM   6497 C  CG  . HIS E 2 220 ? -71.731  44.319  -51.991 1.00 103.83 ? 286 HIS B CG  1 
ATOM   6498 N  ND1 . HIS E 2 220 ? -72.989  44.749  -51.620 1.00 109.09 ? 286 HIS B ND1 1 
ATOM   6499 C  CD2 . HIS E 2 220 ? -71.633  44.548  -53.318 1.00 107.46 ? 286 HIS B CD2 1 
ATOM   6500 C  CE1 . HIS E 2 220 ? -73.630  45.202  -52.684 1.00 106.80 ? 286 HIS B CE1 1 
ATOM   6501 N  NE2 . HIS E 2 220 ? -72.835  45.075  -53.731 1.00 109.46 ? 286 HIS B NE2 1 
ATOM   6502 N  N   . LYS E 2 221 ? -69.324  41.934  -49.080 1.00 73.63  ? 287 LYS B N   1 
ATOM   6503 C  CA  . LYS E 2 221 ? -68.271  41.703  -48.091 1.00 72.20  ? 287 LYS B CA  1 
ATOM   6504 C  C   . LYS E 2 221 ? -67.481  40.407  -48.328 1.00 67.56  ? 287 LYS B C   1 
ATOM   6505 O  O   . LYS E 2 221 ? -66.263  40.396  -48.155 1.00 69.37  ? 287 LYS B O   1 
ATOM   6506 C  CB  . LYS E 2 221 ? -68.867  41.711  -46.671 1.00 78.67  ? 287 LYS B CB  1 
ATOM   6507 C  CG  . LYS E 2 221 ? -67.889  41.373  -45.536 1.00 85.56  ? 287 LYS B CG  1 
ATOM   6508 C  CD  . LYS E 2 221 ? -68.515  41.529  -44.153 1.00 89.92  ? 287 LYS B CD  1 
ATOM   6509 C  CE  . LYS E 2 221 ? -69.696  40.586  -43.903 1.00 91.66  ? 287 LYS B CE  1 
ATOM   6510 N  NZ  . LYS E 2 221 ? -69.461  39.136  -44.200 1.00 88.72  ? 287 LYS B NZ  1 
ATOM   6511 N  N   . ALA E 2 222 ? -68.177  39.328  -48.699 1.00 65.20  ? 288 ALA B N   1 
ATOM   6512 C  CA  . ALA E 2 222 ? -67.548  38.021  -48.948 1.00 64.07  ? 288 ALA B CA  1 
ATOM   6513 C  C   . ALA E 2 222 ? -66.666  38.049  -50.169 1.00 63.67  ? 288 ALA B C   1 
ATOM   6514 O  O   . ALA E 2 222 ? -65.657  37.340  -50.228 1.00 65.46  ? 288 ALA B O   1 
ATOM   6515 C  CB  . ALA E 2 222 ? -68.603  36.946  -49.140 1.00 63.01  ? 288 ALA B CB  1 
ATOM   6516 N  N   . LEU E 2 223 ? -67.061  38.860  -51.145 1.00 63.00  ? 289 LEU B N   1 
ATOM   6517 C  CA  . LEU E 2 223 ? -66.324  38.988  -52.380 1.00 63.95  ? 289 LEU B CA  1 
ATOM   6518 C  C   . LEU E 2 223 ? -65.062  39.847  -52.186 1.00 64.04  ? 289 LEU B C   1 
ATOM   6519 O  O   . LEU E 2 223 ? -64.011  39.562  -52.787 1.00 65.59  ? 289 LEU B O   1 
ATOM   6520 C  CB  . LEU E 2 223 ? -67.243  39.552  -53.467 1.00 65.15  ? 289 LEU B CB  1 
ATOM   6521 C  CG  . LEU E 2 223 ? -66.910  39.187  -54.917 1.00 65.31  ? 289 LEU B CG  1 
ATOM   6522 C  CD1 . LEU E 2 223 ? -67.063  37.699  -55.167 1.00 64.65  ? 289 LEU B CD1 1 
ATOM   6523 C  CD2 . LEU E 2 223 ? -67.781  39.975  -55.878 1.00 67.32  ? 289 LEU B CD2 1 
ATOM   6524 N  N   . LYS E 2 224 ? -65.173  40.888  -51.357 1.00 63.28  ? 290 LYS B N   1 
ATOM   6525 C  CA  . LYS E 2 224 ? -64.003  41.681  -50.944 1.00 65.38  ? 290 LYS B CA  1 
ATOM   6526 C  C   . LYS E 2 224 ? -62.979  40.800  -50.185 1.00 60.66  ? 290 LYS B C   1 
ATOM   6527 O  O   . LYS E 2 224 ? -61.774  40.803  -50.481 1.00 53.62  ? 290 LYS B O   1 
ATOM   6528 C  CB  . LYS E 2 224 ? -64.471  42.882  -50.109 1.00 72.26  ? 290 LYS B CB  1 
ATOM   6529 C  CG  . LYS E 2 224 ? -63.420  43.593  -49.240 1.00 78.45  ? 290 LYS B CG  1 
ATOM   6530 C  CD  . LYS E 2 224 ? -64.066  44.567  -48.235 1.00 83.97  ? 290 LYS B CD  1 
ATOM   6531 C  CE  . LYS E 2 224 ? -63.703  44.285  -46.761 1.00 87.36  ? 290 LYS B CE  1 
ATOM   6532 N  NZ  . LYS E 2 224 ? -64.277  42.990  -46.266 1.00 85.83  ? 290 LYS B NZ  1 
ATOM   6533 N  N   . THR E 2 225 ? -63.491  40.042  -49.217 1.00 58.95  ? 291 THR B N   1 
ATOM   6534 C  CA  . THR E 2 225 ? -62.686  39.101  -48.437 1.00 58.29  ? 291 THR B CA  1 
ATOM   6535 C  C   . THR E 2 225 ? -61.946  38.111  -49.336 1.00 58.91  ? 291 THR B C   1 
ATOM   6536 O  O   . THR E 2 225 ? -60.752  37.919  -49.176 1.00 63.58  ? 291 THR B O   1 
ATOM   6537 C  CB  . THR E 2 225 ? -63.562  38.359  -47.400 1.00 56.39  ? 291 THR B CB  1 
ATOM   6538 O  OG1 . THR E 2 225 ? -64.012  39.310  -46.422 1.00 52.94  ? 291 THR B OG1 1 
ATOM   6539 C  CG2 . THR E 2 225 ? -62.806  37.235  -46.691 1.00 56.93  ? 291 THR B CG2 1 
ATOM   6540 N  N   . LEU E 2 226 ? -62.656  37.505  -50.282 1.00 58.18  ? 292 LEU B N   1 
ATOM   6541 C  CA  . LEU E 2 226 ? -62.042  36.604  -51.263 1.00 58.65  ? 292 LEU B CA  1 
ATOM   6542 C  C   . LEU E 2 226 ? -60.966  37.297  -52.104 1.00 55.09  ? 292 LEU B C   1 
ATOM   6543 O  O   . LEU E 2 226 ? -59.964  36.671  -52.516 1.00 48.17  ? 292 LEU B O   1 
ATOM   6544 C  CB  . LEU E 2 226 ? -63.110  36.032  -52.189 1.00 61.49  ? 292 LEU B CB  1 
ATOM   6545 C  CG  . LEU E 2 226 ? -62.689  34.757  -52.903 1.00 66.29  ? 292 LEU B CG  1 
ATOM   6546 C  CD1 . LEU E 2 226 ? -62.333  33.667  -51.899 1.00 67.39  ? 292 LEU B CD1 1 
ATOM   6547 C  CD2 . LEU E 2 226 ? -63.792  34.285  -53.836 1.00 68.73  ? 292 LEU B CD2 1 
ATOM   6548 N  N   . GLY E 2 227 ? -61.190  38.582  -52.365 1.00 54.70  ? 293 GLY B N   1 
ATOM   6549 C  CA  . GLY E 2 227 ? -60.220  39.405  -53.048 1.00 53.75  ? 293 GLY B CA  1 
ATOM   6550 C  C   . GLY E 2 227 ? -58.961  39.609  -52.248 1.00 52.59  ? 293 GLY B C   1 
ATOM   6551 O  O   . GLY E 2 227 ? -57.866  39.416  -52.764 1.00 53.33  ? 293 GLY B O   1 
ATOM   6552 N  N   . ILE E 2 228 ? -59.122  39.999  -50.988 1.00 50.66  ? 294 ILE B N   1 
ATOM   6553 C  CA  . ILE E 2 228 ? -57.975  40.238  -50.117 1.00 49.82  ? 294 ILE B CA  1 
ATOM   6554 C  C   . ILE E 2 228 ? -57.183  38.951  -49.876 1.00 51.29  ? 294 ILE B C   1 
ATOM   6555 O  O   . ILE E 2 228 ? -55.951  38.988  -49.868 1.00 55.40  ? 294 ILE B O   1 
ATOM   6556 C  CB  . ILE E 2 228 ? -58.397  40.852  -48.771 1.00 48.81  ? 294 ILE B CB  1 
ATOM   6557 C  CG1 . ILE E 2 228 ? -58.977  42.254  -49.002 1.00 50.64  ? 294 ILE B CG1 1 
ATOM   6558 C  CG2 . ILE E 2 228 ? -57.223  40.940  -47.797 1.00 47.40  ? 294 ILE B CG2 1 
ATOM   6559 C  CD1 . ILE E 2 228 ? -59.592  42.878  -47.762 1.00 52.36  ? 294 ILE B CD1 1 
ATOM   6560 N  N   . ILE E 2 229 ? -57.880  37.831  -49.680 1.00 50.44  ? 295 ILE B N   1 
ATOM   6561 C  CA  . ILE E 2 229 ? -57.226  36.536  -49.433 1.00 50.53  ? 295 ILE B CA  1 
ATOM   6562 C  C   . ILE E 2 229 ? -56.302  36.176  -50.601 1.00 50.24  ? 295 ILE B C   1 
ATOM   6563 O  O   . ILE E 2 229 ? -55.089  36.008  -50.397 1.00 50.61  ? 295 ILE B O   1 
ATOM   6564 C  CB  . ILE E 2 229 ? -58.252  35.404  -49.147 1.00 50.52  ? 295 ILE B CB  1 
ATOM   6565 C  CG1 . ILE E 2 229 ? -58.889  35.622  -47.771 1.00 49.83  ? 295 ILE B CG1 1 
ATOM   6566 C  CG2 . ILE E 2 229 ? -57.610  34.002  -49.204 1.00 49.96  ? 295 ILE B CG2 1 
ATOM   6567 C  CD1 . ILE E 2 229 ? -60.207  34.903  -47.586 1.00 51.81  ? 295 ILE B CD1 1 
ATOM   6568 N  N   . MET E 2 230 ? -56.867  36.099  -51.809 1.00 48.71  ? 296 MET B N   1 
ATOM   6569 C  CA  . MET E 2 230 ? -56.093  35.759  -53.009 1.00 49.64  ? 296 MET B CA  1 
ATOM   6570 C  C   . MET E 2 230 ? -55.194  36.890  -53.504 1.00 48.90  ? 296 MET B C   1 
ATOM   6571 O  O   . MET E 2 230 ? -54.124  36.641  -54.061 1.00 48.35  ? 296 MET B O   1 
ATOM   6572 C  CB  . MET E 2 230 ? -57.021  35.309  -54.132 1.00 50.63  ? 296 MET B CB  1 
ATOM   6573 C  CG  . MET E 2 230 ? -57.724  33.990  -53.841 1.00 53.18  ? 296 MET B CG  1 
ATOM   6574 S  SD  . MET E 2 230 ? -56.580  32.598  -53.594 1.00 54.67  ? 296 MET B SD  1 
ATOM   6575 C  CE  . MET E 2 230 ? -55.784  32.530  -55.190 1.00 56.30  ? 296 MET B CE  1 
ATOM   6576 N  N   . GLY E 2 231 ? -55.628  38.127  -53.303 1.00 49.45  ? 297 GLY B N   1 
ATOM   6577 C  CA  . GLY E 2 231 ? -54.874  39.293  -53.765 1.00 51.96  ? 297 GLY B CA  1 
ATOM   6578 C  C   . GLY E 2 231 ? -53.551  39.504  -53.053 1.00 54.34  ? 297 GLY B C   1 
ATOM   6579 O  O   . GLY E 2 231 ? -52.500  39.583  -53.701 1.00 56.21  ? 297 GLY B O   1 
ATOM   6580 N  N   . VAL E 2 232 ? -53.608  39.573  -51.721 1.00 53.00  ? 298 VAL B N   1 
ATOM   6581 C  CA  . VAL E 2 232 ? -52.438  39.866  -50.894 1.00 48.56  ? 298 VAL B CA  1 
ATOM   6582 C  C   . VAL E 2 232 ? -51.454  38.698  -50.928 1.00 47.61  ? 298 VAL B C   1 
ATOM   6583 O  O   . VAL E 2 232 ? -50.249  38.923  -51.063 1.00 47.36  ? 298 VAL B O   1 
ATOM   6584 C  CB  . VAL E 2 232 ? -52.842  40.220  -49.444 1.00 47.30  ? 298 VAL B CB  1 
ATOM   6585 C  CG1 . VAL E 2 232 ? -51.610  40.380  -48.540 1.00 48.29  ? 298 VAL B CG1 1 
ATOM   6586 C  CG2 . VAL E 2 232 ? -53.685  41.490  -49.433 1.00 44.93  ? 298 VAL B CG2 1 
ATOM   6587 N  N   . PHE E 2 233 ? -51.958  37.463  -50.827 1.00 47.72  ? 299 PHE B N   1 
ATOM   6588 C  CA  . PHE E 2 233 ? -51.112  36.269  -51.010 1.00 48.50  ? 299 PHE B CA  1 
ATOM   6589 C  C   . PHE E 2 233 ? -50.360  36.300  -52.334 1.00 48.89  ? 299 PHE B C   1 
ATOM   6590 O  O   . PHE E 2 233 ? -49.157  36.049  -52.359 1.00 47.95  ? 299 PHE B O   1 
ATOM   6591 C  CB  . PHE E 2 233 ? -51.917  34.961  -50.921 1.00 48.86  ? 299 PHE B CB  1 
ATOM   6592 C  CG  . PHE E 2 233 ? -51.150  33.731  -51.383 1.00 47.24  ? 299 PHE B CG  1 
ATOM   6593 C  CD1 . PHE E 2 233 ? -49.990  33.328  -50.738 1.00 48.18  ? 299 PHE B CD1 1 
ATOM   6594 C  CD2 . PHE E 2 233 ? -51.595  32.975  -52.458 1.00 47.69  ? 299 PHE B CD2 1 
ATOM   6595 C  CE1 . PHE E 2 233 ? -49.289  32.205  -51.159 1.00 48.35  ? 299 PHE B CE1 1 
ATOM   6596 C  CE2 . PHE E 2 233 ? -50.899  31.853  -52.887 1.00 47.99  ? 299 PHE B CE2 1 
ATOM   6597 C  CZ  . PHE E 2 233 ? -49.748  31.466  -52.233 1.00 48.25  ? 299 PHE B CZ  1 
ATOM   6598 N  N   . THR E 2 234 ? -51.065  36.607  -53.425 1.00 52.34  ? 300 THR B N   1 
ATOM   6599 C  CA  . THR E 2 234 ? -50.462  36.552  -54.759 1.00 55.02  ? 300 THR B CA  1 
ATOM   6600 C  C   . THR E 2 234 ? -49.557  37.766  -55.013 1.00 54.27  ? 300 THR B C   1 
ATOM   6601 O  O   . THR E 2 234 ? -48.415  37.598  -55.445 1.00 50.99  ? 300 THR B O   1 
ATOM   6602 C  CB  . THR E 2 234 ? -51.524  36.381  -55.861 1.00 57.32  ? 300 THR B CB  1 
ATOM   6603 O  OG1 . THR E 2 234 ? -52.329  35.240  -55.557 1.00 56.40  ? 300 THR B OG1 1 
ATOM   6604 C  CG2 . THR E 2 234 ? -50.876  36.137  -57.212 1.00 60.57  ? 300 THR B CG2 1 
ATOM   6605 N  N   . LEU E 2 235 ? -50.047  38.972  -54.726 1.00 54.90  ? 301 LEU B N   1 
ATOM   6606 C  CA  . LEU E 2 235 ? -49.207  40.172  -54.801 1.00 57.80  ? 301 LEU B CA  1 
ATOM   6607 C  C   . LEU E 2 235 ? -47.871  39.957  -54.075 1.00 61.03  ? 301 LEU B C   1 
ATOM   6608 O  O   . LEU E 2 235 ? -46.821  40.268  -54.624 1.00 66.49  ? 301 LEU B O   1 
ATOM   6609 C  CB  . LEU E 2 235 ? -49.916  41.406  -54.223 1.00 58.98  ? 301 LEU B CB  1 
ATOM   6610 C  CG  . LEU E 2 235 ? -49.043  42.656  -53.980 1.00 61.50  ? 301 LEU B CG  1 
ATOM   6611 C  CD1 . LEU E 2 235 ? -48.409  43.133  -55.281 1.00 62.61  ? 301 LEU B CD1 1 
ATOM   6612 C  CD2 . LEU E 2 235 ? -49.840  43.781  -53.325 1.00 61.62  ? 301 LEU B CD2 1 
ATOM   6613 N  N   . CYS E 2 236 ? -47.913  39.417  -52.857 1.00 60.04  ? 302 CYS B N   1 
ATOM   6614 C  CA  . CYS E 2 236 ? -46.695  39.250  -52.040 1.00 57.86  ? 302 CYS B CA  1 
ATOM   6615 C  C   . CYS E 2 236 ? -45.697  38.180  -52.531 1.00 55.52  ? 302 CYS B C   1 
ATOM   6616 O  O   . CYS E 2 236 ? -44.484  38.423  -52.542 1.00 55.28  ? 302 CYS B O   1 
ATOM   6617 C  CB  . CYS E 2 236 ? -47.051  38.984  -50.576 1.00 57.17  ? 302 CYS B CB  1 
ATOM   6618 S  SG  . CYS E 2 236 ? -47.709  40.415  -49.682 1.00 52.04  ? 302 CYS B SG  1 
ATOM   6619 N  N   . TRP E 2 237 ? -46.200  37.006  -52.916 1.00 52.86  ? 303 TRP B N   1 
ATOM   6620 C  CA  . TRP E 2 237 ? -45.333  35.872  -53.254 1.00 54.24  ? 303 TRP B CA  1 
ATOM   6621 C  C   . TRP E 2 237 ? -45.207  35.551  -54.743 1.00 58.47  ? 303 TRP B C   1 
ATOM   6622 O  O   . TRP E 2 237 ? -44.250  34.868  -55.114 1.00 60.78  ? 303 TRP B O   1 
ATOM   6623 C  CB  . TRP E 2 237 ? -45.744  34.606  -52.485 1.00 52.53  ? 303 TRP B CB  1 
ATOM   6624 C  CG  . TRP E 2 237 ? -45.238  34.571  -51.086 1.00 50.50  ? 303 TRP B CG  1 
ATOM   6625 C  CD1 . TRP E 2 237 ? -45.983  34.521  -49.960 1.00 51.03  ? 303 TRP B CD1 1 
ATOM   6626 C  CD2 . TRP E 2 237 ? -43.876  34.598  -50.668 1.00 50.76  ? 303 TRP B CD2 1 
ATOM   6627 N  NE1 . TRP E 2 237 ? -45.177  34.517  -48.854 1.00 51.37  ? 303 TRP B NE1 1 
ATOM   6628 C  CE2 . TRP E 2 237 ? -43.873  34.560  -49.260 1.00 51.48  ? 303 TRP B CE2 1 
ATOM   6629 C  CE3 . TRP E 2 237 ? -42.654  34.653  -51.345 1.00 52.16  ? 303 TRP B CE3 1 
ATOM   6630 C  CZ2 . TRP E 2 237 ? -42.693  34.565  -48.508 1.00 52.51  ? 303 TRP B CZ2 1 
ATOM   6631 C  CZ3 . TRP E 2 237 ? -41.478  34.660  -50.599 1.00 52.02  ? 303 TRP B CZ3 1 
ATOM   6632 C  CH2 . TRP E 2 237 ? -41.509  34.619  -49.192 1.00 51.62  ? 303 TRP B CH2 1 
ATOM   6633 N  N   . LEU E 2 238 ? -46.130  36.012  -55.595 1.00 61.61  ? 304 LEU B N   1 
ATOM   6634 C  CA  . LEU E 2 238 ? -46.033  35.712  -57.043 1.00 61.20  ? 304 LEU B CA  1 
ATOM   6635 C  C   . LEU E 2 238 ? -44.816  36.340  -57.725 1.00 61.16  ? 304 LEU B C   1 
ATOM   6636 O  O   . LEU E 2 238 ? -44.149  35.652  -58.503 1.00 60.63  ? 304 LEU B O   1 
ATOM   6637 C  CB  . LEU E 2 238 ? -47.302  36.089  -57.818 1.00 59.52  ? 304 LEU B CB  1 
ATOM   6638 C  CG  . LEU E 2 238 ? -47.305  35.764  -59.320 1.00 56.58  ? 304 LEU B CG  1 
ATOM   6639 C  CD1 . LEU E 2 238 ? -47.219  34.259  -59.571 1.00 54.53  ? 304 LEU B CD1 1 
ATOM   6640 C  CD2 . LEU E 2 238 ? -48.538  36.365  -59.969 1.00 55.25  ? 304 LEU B CD2 1 
ATOM   6641 N  N   . PRO E 2 239 ? -44.529  37.636  -57.455 1.00 58.65  ? 305 PRO B N   1 
ATOM   6642 C  CA  . PRO E 2 239 ? -43.352  38.254  -58.076 1.00 58.30  ? 305 PRO B CA  1 
ATOM   6643 C  C   . PRO E 2 239 ? -42.060  37.475  -57.811 1.00 57.85  ? 305 PRO B C   1 
ATOM   6644 O  O   . PRO E 2 239 ? -41.403  37.053  -58.755 1.00 56.82  ? 305 PRO B O   1 
ATOM   6645 C  CB  . PRO E 2 239 ? -43.307  39.655  -57.445 1.00 56.48  ? 305 PRO B CB  1 
ATOM   6646 C  CG  . PRO E 2 239 ? -44.710  39.928  -57.067 1.00 56.74  ? 305 PRO B CG  1 
ATOM   6647 C  CD  . PRO E 2 239 ? -45.257  38.603  -56.619 1.00 57.55  ? 305 PRO B CD  1 
ATOM   6648 N  N   . PHE E 2 240 ? -41.743  37.247  -56.541 1.00 57.39  ? 306 PHE B N   1 
ATOM   6649 C  CA  . PHE E 2 240 ? -40.527  36.526  -56.166 1.00 57.43  ? 306 PHE B CA  1 
ATOM   6650 C  C   . PHE E 2 240 ? -40.432  35.129  -56.798 1.00 55.85  ? 306 PHE B C   1 
ATOM   6651 O  O   . PHE E 2 240 ? -39.392  34.767  -57.338 1.00 58.31  ? 306 PHE B O   1 
ATOM   6652 C  CB  . PHE E 2 240 ? -40.411  36.402  -54.639 1.00 58.80  ? 306 PHE B CB  1 
ATOM   6653 C  CG  . PHE E 2 240 ? -39.331  35.464  -54.201 1.00 60.41  ? 306 PHE B CG  1 
ATOM   6654 C  CD1 . PHE E 2 240 ? -38.030  35.909  -54.067 1.00 62.49  ? 306 PHE B CD1 1 
ATOM   6655 C  CD2 . PHE E 2 240 ? -39.609  34.117  -53.967 1.00 63.02  ? 306 PHE B CD2 1 
ATOM   6656 C  CE1 . PHE E 2 240 ? -37.019  35.034  -53.691 1.00 64.49  ? 306 PHE B CE1 1 
ATOM   6657 C  CE2 . PHE E 2 240 ? -38.608  33.233  -53.595 1.00 64.92  ? 306 PHE B CE2 1 
ATOM   6658 C  CZ  . PHE E 2 240 ? -37.309  33.694  -53.454 1.00 66.11  ? 306 PHE B CZ  1 
ATOM   6659 N  N   . PHE E 2 241 ? -41.502  34.347  -56.703 1.00 55.56  ? 307 PHE B N   1 
ATOM   6660 C  CA  . PHE E 2 241 ? -41.489  32.949  -57.178 1.00 58.11  ? 307 PHE B CA  1 
ATOM   6661 C  C   . PHE E 2 241 ? -41.535  32.819  -58.702 1.00 59.54  ? 307 PHE B C   1 
ATOM   6662 O  O   . PHE E 2 241 ? -41.152  31.782  -59.260 1.00 60.41  ? 307 PHE B O   1 
ATOM   6663 C  CB  . PHE E 2 241 ? -42.613  32.128  -56.538 1.00 59.78  ? 307 PHE B CB  1 
ATOM   6664 C  CG  . PHE E 2 241 ? -42.249  31.557  -55.205 1.00 60.14  ? 307 PHE B CG  1 
ATOM   6665 C  CD1 . PHE E 2 241 ? -41.420  30.446  -55.131 1.00 61.48  ? 307 PHE B CD1 1 
ATOM   6666 C  CD2 . PHE E 2 241 ? -42.711  32.131  -54.025 1.00 58.95  ? 307 PHE B CD2 1 
ATOM   6667 C  CE1 . PHE E 2 241 ? -41.061  29.911  -53.901 1.00 61.75  ? 307 PHE B CE1 1 
ATOM   6668 C  CE2 . PHE E 2 241 ? -42.358  31.599  -52.792 1.00 59.28  ? 307 PHE B CE2 1 
ATOM   6669 C  CZ  . PHE E 2 241 ? -41.531  30.485  -52.730 1.00 59.91  ? 307 PHE B CZ  1 
ATOM   6670 N  N   . LEU E 2 242 ? -42.012  33.868  -59.362 1.00 57.86  ? 308 LEU B N   1 
ATOM   6671 C  CA  . LEU E 2 242 ? -41.938  33.980  -60.819 1.00 55.03  ? 308 LEU B CA  1 
ATOM   6672 C  C   . LEU E 2 242 ? -40.455  34.184  -61.204 1.00 53.40  ? 308 LEU B C   1 
ATOM   6673 O  O   . LEU E 2 242 ? -39.880  33.400  -61.975 1.00 48.49  ? 308 LEU B O   1 
ATOM   6674 C  CB  . LEU E 2 242 ? -42.802  35.164  -61.284 1.00 54.42  ? 308 LEU B CB  1 
ATOM   6675 C  CG  . LEU E 2 242 ? -43.570  35.114  -62.596 1.00 53.77  ? 308 LEU B CG  1 
ATOM   6676 C  CD1 . LEU E 2 242 ? -44.455  33.869  -62.656 1.00 53.52  ? 308 LEU B CD1 1 
ATOM   6677 C  CD2 . LEU E 2 242 ? -44.380  36.403  -62.731 1.00 51.12  ? 308 LEU B CD2 1 
ATOM   6678 N  N   . VAL E 2 243 ? -39.845  35.207  -60.601 1.00 51.51  ? 309 VAL B N   1 
ATOM   6679 C  CA  . VAL E 2 243 ? -38.437  35.564  -60.808 1.00 49.11  ? 309 VAL B CA  1 
ATOM   6680 C  C   . VAL E 2 243 ? -37.476  34.420  -60.440 1.00 49.54  ? 309 VAL B C   1 
ATOM   6681 O  O   . VAL E 2 243 ? -36.460  34.220  -61.087 1.00 48.98  ? 309 VAL B O   1 
ATOM   6682 C  CB  . VAL E 2 243 ? -38.076  36.847  -60.014 1.00 47.04  ? 309 VAL B CB  1 
ATOM   6683 C  CG1 . VAL E 2 243 ? -36.590  37.150  -60.101 1.00 48.47  ? 309 VAL B CG1 1 
ATOM   6684 C  CG2 . VAL E 2 243 ? -38.857  38.048  -60.544 1.00 45.49  ? 309 VAL B CG2 1 
ATOM   6685 N  N   . ASN E 2 244 ? -37.813  33.677  -59.400 1.00 54.37  ? 310 ASN B N   1 
ATOM   6686 C  CA  . ASN E 2 244 ? -37.010  32.537  -58.942 1.00 59.58  ? 310 ASN B CA  1 
ATOM   6687 C  C   . ASN E 2 244 ? -36.878  31.415  -59.996 1.00 61.44  ? 310 ASN B C   1 
ATOM   6688 O  O   . ASN E 2 244 ? -35.850  30.749  -60.050 1.00 62.26  ? 310 ASN B O   1 
ATOM   6689 C  CB  . ASN E 2 244 ? -37.597  31.969  -57.626 1.00 62.60  ? 310 ASN B CB  1 
ATOM   6690 C  CG  . ASN E 2 244 ? -36.588  31.197  -56.805 1.00 64.83  ? 310 ASN B CG  1 
ATOM   6691 O  OD1 . ASN E 2 244 ? -35.419  31.599  -56.705 1.00 66.11  ? 310 ASN B OD1 1 
ATOM   6692 N  ND2 . ASN E 2 244 ? -37.039  30.099  -56.183 1.00 62.61  ? 310 ASN B ND2 1 
ATOM   6693 N  N   . ILE E 2 245 ? -37.907  31.203  -60.819 1.00 65.41  ? 311 ILE B N   1 
ATOM   6694 C  CA  . ILE E 2 245 ? -37.828  30.254  -61.945 1.00 71.57  ? 311 ILE B CA  1 
ATOM   6695 C  C   . ILE E 2 245 ? -37.103  30.882  -63.141 1.00 73.16  ? 311 ILE B C   1 
ATOM   6696 O  O   . ILE E 2 245 ? -36.337  30.196  -63.845 1.00 69.41  ? 311 ILE B O   1 
ATOM   6697 C  CB  . ILE E 2 245 ? -39.220  29.768  -62.397 1.00 75.09  ? 311 ILE B CB  1 
ATOM   6698 C  CG1 . ILE E 2 245 ? -39.926  29.025  -61.252 1.00 78.51  ? 311 ILE B CG1 1 
ATOM   6699 C  CG2 . ILE E 2 245 ? -39.113  28.852  -63.623 1.00 76.49  ? 311 ILE B CG2 1 
ATOM   6700 C  CD1 . ILE E 2 245 ? -39.255  27.735  -60.802 1.00 77.80  ? 311 ILE B CD1 1 
ATOM   6701 N  N   . VAL E 2 246 ? -37.372  32.170  -63.377 1.00 74.02  ? 312 VAL B N   1 
ATOM   6702 C  CA  . VAL E 2 246 ? -36.696  32.959  -64.423 1.00 75.11  ? 312 VAL B CA  1 
ATOM   6703 C  C   . VAL E 2 246 ? -35.164  32.873  -64.287 1.00 80.38  ? 312 VAL B C   1 
ATOM   6704 O  O   . VAL E 2 246 ? -34.472  32.627  -65.271 1.00 84.45  ? 312 VAL B O   1 
ATOM   6705 C  CB  . VAL E 2 246 ? -37.195  34.436  -64.420 1.00 71.63  ? 312 VAL B CB  1 
ATOM   6706 C  CG1 . VAL E 2 246 ? -36.236  35.396  -65.126 1.00 69.72  ? 312 VAL B CG1 1 
ATOM   6707 C  CG2 . VAL E 2 246 ? -38.598  34.522  -65.011 1.00 71.60  ? 312 VAL B CG2 1 
ATOM   6708 N  N   . ASN E 2 247 ? -34.652  33.047  -63.068 1.00 82.10  ? 313 ASN B N   1 
ATOM   6709 C  CA  . ASN E 2 247 ? -33.211  32.978  -62.798 1.00 78.08  ? 313 ASN B CA  1 
ATOM   6710 C  C   . ASN E 2 247 ? -32.540  31.681  -63.244 1.00 78.29  ? 313 ASN B C   1 
ATOM   6711 O  O   . ASN E 2 247 ? -31.402  31.723  -63.729 1.00 87.55  ? 313 ASN B O   1 
ATOM   6712 C  CB  . ASN E 2 247 ? -32.923  33.216  -61.311 1.00 76.78  ? 313 ASN B CB  1 
ATOM   6713 C  CG  . ASN E 2 247 ? -33.192  34.654  -60.883 1.00 78.13  ? 313 ASN B CG  1 
ATOM   6714 O  OD1 . ASN E 2 247 ? -33.500  35.528  -61.702 1.00 79.26  ? 313 ASN B OD1 1 
ATOM   6715 N  ND2 . ASN E 2 247 ? -33.078  34.905  -59.594 1.00 78.33  ? 313 ASN B ND2 1 
ATOM   6716 N  N   . VAL E 2 248 ? -33.233  30.553  -63.097 1.00 77.81  ? 314 VAL B N   1 
ATOM   6717 C  CA  . VAL E 2 248 ? -32.696  29.239  -63.506 1.00 83.19  ? 314 VAL B CA  1 
ATOM   6718 C  C   . VAL E 2 248 ? -32.419  29.130  -65.014 1.00 93.99  ? 314 VAL B C   1 
ATOM   6719 O  O   . VAL E 2 248 ? -31.516  28.387  -65.431 1.00 103.48 ? 314 VAL B O   1 
ATOM   6720 C  CB  . VAL E 2 248 ? -33.602  28.071  -63.010 1.00 77.66  ? 314 VAL B CB  1 
ATOM   6721 C  CG1 . VAL E 2 248 ? -33.641  26.880  -63.964 1.00 76.26  ? 314 VAL B CG1 1 
ATOM   6722 C  CG2 . VAL E 2 248 ? -33.152  27.612  -61.639 1.00 74.87  ? 314 VAL B CG2 1 
ATOM   6723 N  N   . PHE E 2 249 ? -33.192  29.855  -65.826 1.00 96.60  ? 315 PHE B N   1 
ATOM   6724 C  CA  . PHE E 2 249 ? -32.969  29.873  -67.271 1.00 90.74  ? 315 PHE B CA  1 
ATOM   6725 C  C   . PHE E 2 249 ? -32.099  31.086  -67.675 1.00 91.85  ? 315 PHE B C   1 
ATOM   6726 O  O   . PHE E 2 249 ? -30.879  30.937  -67.774 1.00 94.95  ? 315 PHE B O   1 
ATOM   6727 C  CB  . PHE E 2 249 ? -34.306  29.767  -68.004 1.00 85.97  ? 315 PHE B CB  1 
ATOM   6728 C  CG  . PHE E 2 249 ? -35.065  28.501  -67.684 1.00 83.46  ? 315 PHE B CG  1 
ATOM   6729 C  CD1 . PHE E 2 249 ? -34.584  27.255  -68.095 1.00 81.81  ? 315 PHE B CD1 1 
ATOM   6730 C  CD2 . PHE E 2 249 ? -36.248  28.548  -66.940 1.00 84.52  ? 315 PHE B CD2 1 
ATOM   6731 C  CE1 . PHE E 2 249 ? -35.285  26.093  -67.800 1.00 82.56  ? 315 PHE B CE1 1 
ATOM   6732 C  CE2 . PHE E 2 249 ? -36.945  27.384  -66.639 1.00 85.22  ? 315 PHE B CE2 1 
ATOM   6733 C  CZ  . PHE E 2 249 ? -36.458  26.153  -67.065 1.00 84.01  ? 315 PHE B CZ  1 
ATOM   6734 N  N   . ASN E 2 250 ? -32.689  32.276  -67.875 1.00 91.57  ? 316 ASN B N   1 
ATOM   6735 C  CA  . ASN E 2 250 ? -31.928  33.465  -68.318 1.00 95.45  ? 316 ASN B CA  1 
ATOM   6736 C  C   . ASN E 2 250 ? -31.527  34.336  -67.125 1.00 92.41  ? 316 ASN B C   1 
ATOM   6737 O  O   . ASN E 2 250 ? -32.274  35.237  -66.733 1.00 87.80  ? 316 ASN B O   1 
ATOM   6738 C  CB  . ASN E 2 250 ? -32.734  34.299  -69.332 1.00 100.29 ? 316 ASN B CB  1 
ATOM   6739 C  CG  . ASN E 2 250 ? -32.763  33.677  -70.736 1.00 108.39 ? 316 ASN B CG  1 
ATOM   6740 O  OD1 . ASN E 2 250 ? -32.463  32.500  -70.926 1.00 118.24 ? 316 ASN B OD1 1 
ATOM   6741 N  ND2 . ASN E 2 250 ? -33.127  34.485  -71.733 1.00 111.94 ? 316 ASN B ND2 1 
ATOM   6742 N  N   . ARG E 2 251 ? -30.340  34.081  -66.576 1.00 95.06  ? 317 ARG B N   1 
ATOM   6743 C  CA  . ARG E 2 251 ? -29.929  34.631  -65.274 1.00 101.04 ? 317 ARG B CA  1 
ATOM   6744 C  C   . ARG E 2 251 ? -29.754  36.167  -65.212 1.00 96.10  ? 317 ARG B C   1 
ATOM   6745 O  O   . ARG E 2 251 ? -29.930  36.743  -64.141 1.00 94.81  ? 317 ARG B O   1 
ATOM   6746 C  CB  . ARG E 2 251 ? -28.646  33.910  -64.786 1.00 111.92 ? 317 ARG B CB  1 
ATOM   6747 C  CG  . ARG E 2 251 ? -28.143  34.282  -63.386 1.00 120.01 ? 317 ARG B CG  1 
ATOM   6748 C  CD  . ARG E 2 251 ? -26.743  33.741  -63.099 1.00 124.31 ? 317 ARG B CD  1 
ATOM   6749 N  NE  . ARG E 2 251 ? -26.677  32.272  -62.999 1.00 128.61 ? 317 ARG B NE  1 
ATOM   6750 C  CZ  . ARG E 2 251 ? -25.959  31.443  -63.777 1.00 127.96 ? 317 ARG B CZ  1 
ATOM   6751 N  NH1 . ARG E 2 251 ? -25.188  31.878  -64.778 1.00 123.63 ? 317 ARG B NH1 1 
ATOM   6752 N  NH2 . ARG E 2 251 ? -25.998  30.132  -63.542 1.00 127.95 ? 317 ARG B NH2 1 
ATOM   6753 N  N   . ASP E 2 252 ? -29.421  36.827  -66.327 1.00 94.28  ? 318 ASP B N   1 
ATOM   6754 C  CA  . ASP E 2 252 ? -29.139  38.277  -66.320 1.00 93.90  ? 318 ASP B CA  1 
ATOM   6755 C  C   . ASP E 2 252 ? -30.371  39.167  -66.336 1.00 93.17  ? 318 ASP B C   1 
ATOM   6756 O  O   . ASP E 2 252 ? -30.303  40.300  -65.836 1.00 89.97  ? 318 ASP B O   1 
ATOM   6757 C  CB  . ASP E 2 252 ? -28.259  38.684  -67.520 1.00 98.06  ? 318 ASP B CB  1 
ATOM   6758 C  CG  . ASP E 2 252 ? -26.788  38.349  -67.330 1.00 99.45  ? 318 ASP B CG  1 
ATOM   6759 O  OD1 . ASP E 2 252 ? -26.274  38.429  -66.192 1.00 102.23 ? 318 ASP B OD1 1 
ATOM   6760 O  OD2 . ASP E 2 252 ? -26.139  38.008  -68.338 1.00 95.65  ? 318 ASP B OD2 1 
ATOM   6761 N  N   . LEU E 2 253 ? -31.471  38.662  -66.913 1.00 94.41  ? 319 LEU B N   1 
ATOM   6762 C  CA  . LEU E 2 253 ? -32.691  39.454  -67.170 1.00 95.55  ? 319 LEU B CA  1 
ATOM   6763 C  C   . LEU E 2 253 ? -33.125  40.348  -65.987 1.00 91.63  ? 319 LEU B C   1 
ATOM   6764 O  O   . LEU E 2 253 ? -33.373  41.544  -66.165 1.00 84.39  ? 319 LEU B O   1 
ATOM   6765 C  CB  . LEU E 2 253 ? -33.838  38.514  -67.609 1.00 102.07 ? 319 LEU B CB  1 
ATOM   6766 C  CG  . LEU E 2 253 ? -35.207  39.105  -68.018 1.00 107.11 ? 319 LEU B CG  1 
ATOM   6767 C  CD1 . LEU E 2 253 ? -35.085  40.122  -69.147 1.00 107.13 ? 319 LEU B CD1 1 
ATOM   6768 C  CD2 . LEU E 2 253 ? -36.183  37.993  -68.387 1.00 107.71 ? 319 LEU B CD2 1 
ATOM   6769 N  N   . VAL E 2 254 ? -33.175  39.762  -64.788 1.00 90.77  ? 320 VAL B N   1 
ATOM   6770 C  CA  . VAL E 2 254 ? -33.634  40.451  -63.583 1.00 91.43  ? 320 VAL B CA  1 
ATOM   6771 C  C   . VAL E 2 254 ? -32.444  40.809  -62.684 1.00 86.75  ? 320 VAL B C   1 
ATOM   6772 O  O   . VAL E 2 254 ? -31.622  39.943  -62.394 1.00 79.75  ? 320 VAL B O   1 
ATOM   6773 C  CB  . VAL E 2 254 ? -34.614  39.561  -62.775 1.00 97.25  ? 320 VAL B CB  1 
ATOM   6774 C  CG1 . VAL E 2 254 ? -35.244  40.357  -61.631 1.00 99.42  ? 320 VAL B CG1 1 
ATOM   6775 C  CG2 . VAL E 2 254 ? -35.686  38.956  -63.692 1.00 96.06  ? 320 VAL B CG2 1 
ATOM   6776 N  N   . PRO E 2 255 ? -32.355  42.076  -62.213 1.00 86.75  ? 321 PRO B N   1 
ATOM   6777 C  CA  . PRO E 2 255 ? -31.252  42.419  -61.286 1.00 88.96  ? 321 PRO B CA  1 
ATOM   6778 C  C   . PRO E 2 255 ? -31.325  41.723  -59.920 1.00 95.62  ? 321 PRO B C   1 
ATOM   6779 O  O   . PRO E 2 255 ? -32.369  41.175  -59.551 1.00 104.26 ? 321 PRO B O   1 
ATOM   6780 C  CB  . PRO E 2 255 ? -31.381  43.941  -61.113 1.00 84.47  ? 321 PRO B CB  1 
ATOM   6781 C  CG  . PRO E 2 255 ? -32.746  44.286  -61.560 1.00 83.05  ? 321 PRO B CG  1 
ATOM   6782 C  CD  . PRO E 2 255 ? -33.150  43.266  -62.580 1.00 84.91  ? 321 PRO B CD  1 
ATOM   6783 N  N   . ASP E 2 256 ? -30.219  41.754  -59.182 1.00 100.12 ? 322 ASP B N   1 
ATOM   6784 C  CA  . ASP E 2 256 ? -30.156  41.141  -57.854 1.00 104.63 ? 322 ASP B CA  1 
ATOM   6785 C  C   . ASP E 2 256 ? -30.908  41.964  -56.801 1.00 101.78 ? 322 ASP B C   1 
ATOM   6786 O  O   . ASP E 2 256 ? -31.565  41.386  -55.932 1.00 102.99 ? 322 ASP B O   1 
ATOM   6787 C  CB  . ASP E 2 256 ? -28.700  40.937  -57.415 1.00 110.58 ? 322 ASP B CB  1 
ATOM   6788 C  CG  . ASP E 2 256 ? -28.566  40.022  -56.190 1.00 112.86 ? 322 ASP B CG  1 
ATOM   6789 O  OD1 . ASP E 2 256 ? -28.710  38.784  -56.343 1.00 116.93 ? 322 ASP B OD1 1 
ATOM   6790 O  OD2 . ASP E 2 256 ? -28.293  40.550  -55.086 1.00 108.12 ? 322 ASP B OD2 1 
ATOM   6791 N  N   . TRP E 2 257 ? -30.796  43.294  -56.864 1.00 98.55  ? 323 TRP B N   1 
ATOM   6792 C  CA  . TRP E 2 257 ? -31.525  44.172  -55.933 1.00 96.53  ? 323 TRP B CA  1 
ATOM   6793 C  C   . TRP E 2 257 ? -33.054  43.991  -56.012 1.00 93.89  ? 323 TRP B C   1 
ATOM   6794 O  O   . TRP E 2 257 ? -33.731  44.128  -54.994 1.00 94.58  ? 323 TRP B O   1 
ATOM   6795 C  CB  . TRP E 2 257 ? -31.149  45.654  -56.136 1.00 96.46  ? 323 TRP B CB  1 
ATOM   6796 C  CG  . TRP E 2 257 ? -31.651  46.219  -57.423 1.00 97.65  ? 323 TRP B CG  1 
ATOM   6797 C  CD1 . TRP E 2 257 ? -31.010  46.210  -58.624 1.00 94.21  ? 323 TRP B CD1 1 
ATOM   6798 C  CD2 . TRP E 2 257 ? -32.917  46.852  -57.645 1.00 98.89  ? 323 TRP B CD2 1 
ATOM   6799 N  NE1 . TRP E 2 257 ? -31.796  46.792  -59.588 1.00 95.64  ? 323 TRP B NE1 1 
ATOM   6800 C  CE2 . TRP E 2 257 ? -32.973  47.200  -59.014 1.00 98.92  ? 323 TRP B CE2 1 
ATOM   6801 C  CE3 . TRP E 2 257 ? -34.012  47.155  -56.819 1.00 93.57  ? 323 TRP B CE3 1 
ATOM   6802 C  CZ2 . TRP E 2 257 ? -34.079  47.848  -59.578 1.00 97.42  ? 323 TRP B CZ2 1 
ATOM   6803 C  CZ3 . TRP E 2 257 ? -35.111  47.792  -57.379 1.00 93.92  ? 323 TRP B CZ3 1 
ATOM   6804 C  CH2 . TRP E 2 257 ? -35.135  48.135  -58.747 1.00 96.36  ? 323 TRP B CH2 1 
ATOM   6805 N  N   . LEU E 2 258 ? -33.585  43.696  -57.208 1.00 90.57  ? 324 LEU B N   1 
ATOM   6806 C  CA  . LEU E 2 258 ? -35.027  43.450  -57.391 1.00 87.44  ? 324 LEU B CA  1 
ATOM   6807 C  C   . LEU E 2 258 ? -35.417  42.090  -56.810 1.00 82.82  ? 324 LEU B C   1 
ATOM   6808 O  O   . LEU E 2 258 ? -36.344  42.008  -56.000 1.00 87.77  ? 324 LEU B O   1 
ATOM   6809 C  CB  . LEU E 2 258 ? -35.449  43.533  -58.869 1.00 86.26  ? 324 LEU B CB  1 
ATOM   6810 C  CG  . LEU E 2 258 ? -36.963  43.545  -59.158 1.00 84.98  ? 324 LEU B CG  1 
ATOM   6811 C  CD1 . LEU E 2 258 ? -37.614  44.823  -58.639 1.00 85.52  ? 324 LEU B CD1 1 
ATOM   6812 C  CD2 . LEU E 2 258 ? -37.254  43.384  -60.641 1.00 83.98  ? 324 LEU B CD2 1 
ATOM   6813 N  N   . PHE E 2 259 ? -34.700  41.042  -57.216 1.00 74.96  ? 325 PHE B N   1 
ATOM   6814 C  CA  . PHE E 2 259 ? -34.918  39.683  -56.700 1.00 71.02  ? 325 PHE B CA  1 
ATOM   6815 C  C   . PHE E 2 259 ? -35.032  39.663  -55.176 1.00 70.57  ? 325 PHE B C   1 
ATOM   6816 O  O   . PHE E 2 259 ? -35.989  39.106  -54.631 1.00 70.50  ? 325 PHE B O   1 
ATOM   6817 C  CB  . PHE E 2 259 ? -33.780  38.761  -57.129 1.00 68.80  ? 325 PHE B CB  1 
ATOM   6818 C  CG  . PHE E 2 259 ? -33.953  37.320  -56.705 1.00 65.73  ? 325 PHE B CG  1 
ATOM   6819 C  CD1 . PHE E 2 259 ? -35.044  36.577  -57.136 1.00 64.51  ? 325 PHE B CD1 1 
ATOM   6820 C  CD2 . PHE E 2 259 ? -33.004  36.692  -55.900 1.00 64.94  ? 325 PHE B CD2 1 
ATOM   6821 C  CE1 . PHE E 2 259 ? -35.201  35.239  -56.770 1.00 63.70  ? 325 PHE B CE1 1 
ATOM   6822 C  CE2 . PHE E 2 259 ? -33.156  35.363  -55.521 1.00 64.74  ? 325 PHE B CE2 1 
ATOM   6823 C  CZ  . PHE E 2 259 ? -34.250  34.633  -55.965 1.00 63.87  ? 325 PHE B CZ  1 
ATOM   6824 N  N   . VAL E 2 260 ? -34.067  40.286  -54.501 1.00 67.16  ? 326 VAL B N   1 
ATOM   6825 C  CA  . VAL E 2 260 ? -34.083  40.374  -53.039 1.00 65.07  ? 326 VAL B CA  1 
ATOM   6826 C  C   . VAL E 2 260 ? -35.270  41.223  -52.570 1.00 62.05  ? 326 VAL B C   1 
ATOM   6827 O  O   . VAL E 2 260 ? -35.939  40.856  -51.611 1.00 61.22  ? 326 VAL B O   1 
ATOM   6828 C  CB  . VAL E 2 260 ? -32.743  40.904  -52.466 1.00 68.18  ? 326 VAL B CB  1 
ATOM   6829 C  CG1 . VAL E 2 260 ? -32.831  41.171  -50.965 1.00 71.04  ? 326 VAL B CG1 1 
ATOM   6830 C  CG2 . VAL E 2 260 ? -31.619  39.914  -52.749 1.00 67.80  ? 326 VAL B CG2 1 
ATOM   6831 N  N   . ALA E 2 261 ? -35.545  42.333  -53.249 1.00 62.05  ? 327 ALA B N   1 
ATOM   6832 C  CA  . ALA E 2 261 ? -36.692  43.183  -52.897 1.00 64.53  ? 327 ALA B CA  1 
ATOM   6833 C  C   . ALA E 2 261 ? -38.039  42.464  -53.048 1.00 66.25  ? 327 ALA B C   1 
ATOM   6834 O  O   . ALA E 2 261 ? -38.946  42.707  -52.253 1.00 66.75  ? 327 ALA B O   1 
ATOM   6835 C  CB  . ALA E 2 261 ? -36.689  44.471  -53.707 1.00 64.33  ? 327 ALA B CB  1 
ATOM   6836 N  N   . PHE E 2 262 ? -38.167  41.592  -54.052 1.00 66.99  ? 328 PHE B N   1 
ATOM   6837 C  CA  . PHE E 2 262 ? -39.357  40.732  -54.177 1.00 69.79  ? 328 PHE B CA  1 
ATOM   6838 C  C   . PHE E 2 262 ? -39.442  39.685  -53.061 1.00 69.12  ? 328 PHE B C   1 
ATOM   6839 O  O   . PHE E 2 262 ? -40.550  39.336  -52.646 1.00 71.44  ? 328 PHE B O   1 
ATOM   6840 C  CB  . PHE E 2 262 ? -39.450  40.032  -55.552 1.00 72.38  ? 328 PHE B CB  1 
ATOM   6841 C  CG  . PHE E 2 262 ? -39.829  40.942  -56.714 1.00 74.97  ? 328 PHE B CG  1 
ATOM   6842 C  CD1 . PHE E 2 262 ? -40.521  42.161  -56.535 1.00 73.81  ? 328 PHE B CD1 1 
ATOM   6843 C  CD2 . PHE E 2 262 ? -39.523  40.544  -58.019 1.00 76.58  ? 328 PHE B CD2 1 
ATOM   6844 C  CE1 . PHE E 2 262 ? -40.859  42.952  -57.622 1.00 73.09  ? 328 PHE B CE1 1 
ATOM   6845 C  CE2 . PHE E 2 262 ? -39.858  41.338  -59.109 1.00 78.27  ? 328 PHE B CE2 1 
ATOM   6846 C  CZ  . PHE E 2 262 ? -40.533  42.542  -58.908 1.00 77.56  ? 328 PHE B CZ  1 
ATOM   6847 N  N   . ASN E 2 263 ? -38.299  39.177  -52.592 1.00 65.10  ? 329 ASN B N   1 
ATOM   6848 C  CA  . ASN E 2 263 ? -38.281  38.278  -51.428 1.00 61.03  ? 329 ASN B CA  1 
ATOM   6849 C  C   . ASN E 2 263 ? -38.711  39.006  -50.155 1.00 57.44  ? 329 ASN B C   1 
ATOM   6850 O  O   . ASN E 2 263 ? -39.360  38.405  -49.307 1.00 58.33  ? 329 ASN B O   1 
ATOM   6851 C  CB  . ASN E 2 263 ? -36.900  37.631  -51.220 1.00 60.56  ? 329 ASN B CB  1 
ATOM   6852 C  CG  . ASN E 2 263 ? -36.965  36.303  -50.455 1.00 58.65  ? 329 ASN B CG  1 
ATOM   6853 O  OD1 . ASN E 2 263 ? -36.176  35.395  -50.710 1.00 56.58  ? 329 ASN B OD1 1 
ATOM   6854 N  ND2 . ASN E 2 263 ? -37.897  36.186  -49.525 1.00 54.72  ? 329 ASN B ND2 1 
ATOM   6855 N  N   . TRP E 2 264 ? -38.355  40.282  -50.014 1.00 55.36  ? 330 TRP B N   1 
ATOM   6856 C  CA  . TRP E 2 264 ? -38.807  41.069  -48.854 1.00 57.05  ? 330 TRP B CA  1 
ATOM   6857 C  C   . TRP E 2 264 ? -40.331  41.269  -48.874 1.00 57.25  ? 330 TRP B C   1 
ATOM   6858 O  O   . TRP E 2 264 ? -40.980  41.243  -47.833 1.00 58.95  ? 330 TRP B O   1 
ATOM   6859 C  CB  . TRP E 2 264 ? -38.060  42.413  -48.736 1.00 57.79  ? 330 TRP B CB  1 
ATOM   6860 C  CG  . TRP E 2 264 ? -36.740  42.273  -48.009 1.00 59.07  ? 330 TRP B CG  1 
ATOM   6861 C  CD1 . TRP E 2 264 ? -35.544  41.896  -48.548 1.00 59.32  ? 330 TRP B CD1 1 
ATOM   6862 C  CD2 . TRP E 2 264 ? -36.498  42.478  -46.613 1.00 60.25  ? 330 TRP B CD2 1 
ATOM   6863 N  NE1 . TRP E 2 264 ? -34.570  41.854  -47.577 1.00 59.59  ? 330 TRP B NE1 1 
ATOM   6864 C  CE2 . TRP E 2 264 ? -35.127  42.212  -46.380 1.00 60.28  ? 330 TRP B CE2 1 
ATOM   6865 C  CE3 . TRP E 2 264 ? -37.304  42.857  -45.533 1.00 61.80  ? 330 TRP B CE3 1 
ATOM   6866 C  CZ2 . TRP E 2 264 ? -34.544  42.307  -45.110 1.00 60.60  ? 330 TRP B CZ2 1 
ATOM   6867 C  CZ3 . TRP E 2 264 ? -36.722  42.958  -44.264 1.00 61.66  ? 330 TRP B CZ3 1 
ATOM   6868 C  CH2 . TRP E 2 264 ? -35.359  42.672  -44.068 1.00 62.45  ? 330 TRP B CH2 1 
ATOM   6869 N  N   . LEU E 2 265 ? -40.891  41.435  -50.066 1.00 56.61  ? 331 LEU B N   1 
ATOM   6870 C  CA  . LEU E 2 265 ? -42.335  41.547  -50.237 1.00 53.81  ? 331 LEU B CA  1 
ATOM   6871 C  C   . LEU E 2 265 ? -43.061  40.283  -49.759 1.00 50.76  ? 331 LEU B C   1 
ATOM   6872 O  O   . LEU E 2 265 ? -44.119  40.375  -49.145 1.00 48.35  ? 331 LEU B O   1 
ATOM   6873 C  CB  . LEU E 2 265 ? -42.649  41.816  -51.707 1.00 55.98  ? 331 LEU B CB  1 
ATOM   6874 C  CG  . LEU E 2 265 ? -44.086  42.095  -52.093 1.00 57.80  ? 331 LEU B CG  1 
ATOM   6875 C  CD1 . LEU E 2 265 ? -44.613  43.328  -51.370 1.00 57.99  ? 331 LEU B CD1 1 
ATOM   6876 C  CD2 . LEU E 2 265 ? -44.171  42.214  -53.614 1.00 57.95  ? 331 LEU B CD2 1 
ATOM   6877 N  N   . GLY E 2 266 ? -42.480  39.114  -50.031 1.00 48.10  ? 332 GLY B N   1 
ATOM   6878 C  CA  . GLY E 2 266 ? -42.981  37.845  -49.510 1.00 46.07  ? 332 GLY B CA  1 
ATOM   6879 C  C   . GLY E 2 266 ? -42.978  37.750  -47.984 1.00 44.48  ? 332 GLY B C   1 
ATOM   6880 O  O   . GLY E 2 266 ? -43.941  37.260  -47.379 1.00 41.89  ? 332 GLY B O   1 
ATOM   6881 N  N   . TYR E 2 267 ? -41.906  38.220  -47.351 1.00 42.70  ? 333 TYR B N   1 
ATOM   6882 C  CA  . TYR E 2 267 ? -41.872  38.273  -45.883 1.00 41.92  ? 333 TYR B CA  1 
ATOM   6883 C  C   . TYR E 2 267 ? -42.951  39.202  -45.330 1.00 41.21  ? 333 TYR B C   1 
ATOM   6884 O  O   . TYR E 2 267 ? -43.376  39.031  -44.198 1.00 41.24  ? 333 TYR B O   1 
ATOM   6885 C  CB  . TYR E 2 267 ? -40.496  38.708  -45.338 1.00 40.61  ? 333 TYR B CB  1 
ATOM   6886 C  CG  . TYR E 2 267 ? -39.318  37.835  -45.742 1.00 40.05  ? 333 TYR B CG  1 
ATOM   6887 C  CD1 . TYR E 2 267 ? -39.421  36.439  -45.789 1.00 40.32  ? 333 TYR B CD1 1 
ATOM   6888 C  CD2 . TYR E 2 267 ? -38.090  38.406  -46.058 1.00 40.25  ? 333 TYR B CD2 1 
ATOM   6889 C  CE1 . TYR E 2 267 ? -38.340  35.648  -46.156 1.00 40.03  ? 333 TYR B CE1 1 
ATOM   6890 C  CE2 . TYR E 2 267 ? -37.006  37.622  -46.425 1.00 40.25  ? 333 TYR B CE2 1 
ATOM   6891 C  CZ  . TYR E 2 267 ? -37.137  36.249  -46.471 1.00 39.68  ? 333 TYR B CZ  1 
ATOM   6892 O  OH  . TYR E 2 267 ? -36.065  35.492  -46.843 1.00 38.41  ? 333 TYR B OH  1 
ATOM   6893 N  N   . ALA E 2 268 ? -43.373  40.192  -46.117 1.00 41.27  ? 334 ALA B N   1 
ATOM   6894 C  CA  . ALA E 2 268 ? -44.445  41.109  -45.712 1.00 41.49  ? 334 ALA B CA  1 
ATOM   6895 C  C   . ALA E 2 268 ? -45.776  40.388  -45.494 1.00 40.64  ? 334 ALA B C   1 
ATOM   6896 O  O   . ALA E 2 268 ? -46.519  40.731  -44.564 1.00 40.02  ? 334 ALA B O   1 
ATOM   6897 C  CB  . ALA E 2 268 ? -44.609  42.236  -46.725 1.00 42.10  ? 334 ALA B CB  1 
ATOM   6898 N  N   . ASN E 2 269 ? -46.059  39.387  -46.334 1.00 40.17  ? 335 ASN B N   1 
ATOM   6899 C  CA  . ASN E 2 269 ? -47.246  38.529  -46.185 1.00 40.72  ? 335 ASN B CA  1 
ATOM   6900 C  C   . ASN E 2 269 ? -47.349  37.935  -44.771 1.00 40.93  ? 335 ASN B C   1 
ATOM   6901 O  O   . ASN E 2 269 ? -48.448  37.814  -44.239 1.00 46.09  ? 335 ASN B O   1 
ATOM   6902 C  CB  . ASN E 2 269 ? -47.234  37.397  -47.232 1.00 40.81  ? 335 ASN B CB  1 
ATOM   6903 C  CG  . ASN E 2 269 ? -48.535  36.583  -47.279 1.00 41.32  ? 335 ASN B CG  1 
ATOM   6904 O  OD1 . ASN E 2 269 ? -48.483  35.368  -47.422 1.00 42.80  ? 335 ASN B OD1 1 
ATOM   6905 N  ND2 . ASN E 2 269 ? -49.694  37.242  -47.182 1.00 41.92  ? 335 ASN B ND2 1 
ATOM   6906 N  N   . SER E 2 270 ? -46.219  37.589  -44.160 1.00 38.62  ? 336 SER B N   1 
ATOM   6907 C  CA  . SER E 2 270 ? -46.203  37.067  -42.789 1.00 36.67  ? 336 SER B CA  1 
ATOM   6908 C  C   . SER E 2 270 ? -46.740  38.062  -41.750 1.00 34.70  ? 336 SER B C   1 
ATOM   6909 O  O   . SER E 2 270 ? -47.221  37.642  -40.704 1.00 32.03  ? 336 SER B O   1 
ATOM   6910 C  CB  . SER E 2 270 ? -44.783  36.602  -42.401 1.00 38.09  ? 336 SER B CB  1 
ATOM   6911 O  OG  . SER E 2 270 ? -44.351  35.509  -43.209 1.00 38.22  ? 336 SER B OG  1 
ATOM   6912 N  N   . ALA E 2 271 ? -46.649  39.362  -42.032 1.00 35.26  ? 337 ALA B N   1 
ATOM   6913 C  CA  . ALA E 2 271 ? -47.272  40.399  -41.187 1.00 36.87  ? 337 ALA B CA  1 
ATOM   6914 C  C   . ALA E 2 271 ? -48.742  40.597  -41.518 1.00 37.48  ? 337 ALA B C   1 
ATOM   6915 O  O   . ALA E 2 271 ? -49.541  40.957  -40.648 1.00 35.29  ? 337 ALA B O   1 
ATOM   6916 C  CB  . ALA E 2 271 ? -46.537  41.724  -41.327 1.00 37.46  ? 337 ALA B CB  1 
ATOM   6917 N  N   . MET E 2 272 ? -49.077  40.396  -42.787 1.00 39.74  ? 338 MET B N   1 
ATOM   6918 C  CA  . MET E 2 272 ? -50.454  40.503  -43.263 1.00 41.17  ? 338 MET B CA  1 
ATOM   6919 C  C   . MET E 2 272 ? -51.377  39.395  -42.757 1.00 39.00  ? 338 MET B C   1 
ATOM   6920 O  O   . MET E 2 272 ? -52.550  39.661  -42.493 1.00 39.73  ? 338 MET B O   1 
ATOM   6921 C  CB  . MET E 2 272 ? -50.494  40.529  -44.806 1.00 44.13  ? 338 MET B CB  1 
ATOM   6922 C  CG  . MET E 2 272 ? -49.821  41.736  -45.451 1.00 46.38  ? 338 MET B CG  1 
ATOM   6923 S  SD  . MET E 2 272 ? -50.374  43.340  -44.789 1.00 50.16  ? 338 MET B SD  1 
ATOM   6924 C  CE  . MET E 2 272 ? -52.127  43.279  -45.185 1.00 50.29  ? 338 MET B CE  1 
ATOM   6925 N  N   . ASN E 2 273 ? -50.867  38.171  -42.629 1.00 36.19  ? 339 ASN B N   1 
ATOM   6926 C  CA  . ASN E 2 273 ? -51.725  37.021  -42.314 1.00 36.45  ? 339 ASN B CA  1 
ATOM   6927 C  C   . ASN E 2 273 ? -52.578  37.144  -41.032 1.00 38.01  ? 339 ASN B C   1 
ATOM   6928 O  O   . ASN E 2 273 ? -53.765  36.845  -41.081 1.00 37.55  ? 339 ASN B O   1 
ATOM   6929 C  CB  . ASN E 2 273 ? -50.929  35.706  -42.317 1.00 35.62  ? 339 ASN B CB  1 
ATOM   6930 C  CG  . ASN E 2 273 ? -50.596  35.214  -43.725 1.00 35.83  ? 339 ASN B CG  1 
ATOM   6931 O  OD1 . ASN E 2 273 ? -51.240  35.579  -44.721 1.00 35.25  ? 339 ASN B OD1 1 
ATOM   6932 N  ND2 . ASN E 2 273 ? -49.577  34.368  -43.809 1.00 35.43  ? 339 ASN B ND2 1 
ATOM   6933 N  N   . PRO E 2 274 ? -51.994  37.586  -39.896 1.00 40.80  ? 340 PRO B N   1 
ATOM   6934 C  CA  . PRO E 2 274 ? -52.834  37.829  -38.707 1.00 40.64  ? 340 PRO B CA  1 
ATOM   6935 C  C   . PRO E 2 274 ? -54.024  38.767  -38.962 1.00 40.57  ? 340 PRO B C   1 
ATOM   6936 O  O   . PRO E 2 274 ? -55.121  38.524  -38.472 1.00 39.52  ? 340 PRO B O   1 
ATOM   6937 C  CB  . PRO E 2 274 ? -51.862  38.472  -37.707 1.00 40.81  ? 340 PRO B CB  1 
ATOM   6938 C  CG  . PRO E 2 274 ? -50.523  37.966  -38.093 1.00 41.25  ? 340 PRO B CG  1 
ATOM   6939 C  CD  . PRO E 2 274 ? -50.559  37.747  -39.592 1.00 41.43  ? 340 PRO B CD  1 
ATOM   6940 N  N   . ILE E 2 275 ? -53.799  39.809  -39.753 1.00 40.98  ? 341 ILE B N   1 
ATOM   6941 C  CA  . ILE E 2 275 ? -54.827  40.801  -40.055 1.00 41.89  ? 341 ILE B CA  1 
ATOM   6942 C  C   . ILE E 2 275 ? -55.961  40.183  -40.885 1.00 40.75  ? 341 ILE B C   1 
ATOM   6943 O  O   . ILE E 2 275 ? -57.115  40.537  -40.698 1.00 42.66  ? 341 ILE B O   1 
ATOM   6944 C  CB  . ILE E 2 275 ? -54.241  42.027  -40.821 1.00 44.26  ? 341 ILE B CB  1 
ATOM   6945 C  CG1 . ILE E 2 275 ? -53.052  42.658  -40.074 1.00 43.50  ? 341 ILE B CG1 1 
ATOM   6946 C  CG2 . ILE E 2 275 ? -55.313  43.075  -41.091 1.00 45.47  ? 341 ILE B CG2 1 
ATOM   6947 C  CD1 . ILE E 2 275 ? -53.317  42.953  -38.608 1.00 44.32  ? 341 ILE B CD1 1 
ATOM   6948 N  N   . ILE E 2 276 ? -55.627  39.272  -41.796 1.00 39.59  ? 342 ILE B N   1 
ATOM   6949 C  CA  . ILE E 2 276 ? -56.605  38.658  -42.699 1.00 39.21  ? 342 ILE B CA  1 
ATOM   6950 C  C   . ILE E 2 276 ? -57.391  37.563  -41.993 1.00 38.77  ? 342 ILE B C   1 
ATOM   6951 O  O   . ILE E 2 276 ? -58.626  37.583  -41.964 1.00 40.39  ? 342 ILE B O   1 
ATOM   6952 C  CB  . ILE E 2 276 ? -55.904  38.047  -43.937 1.00 39.76  ? 342 ILE B CB  1 
ATOM   6953 C  CG1 . ILE E 2 276 ? -55.183  39.143  -44.742 1.00 40.70  ? 342 ILE B CG1 1 
ATOM   6954 C  CG2 . ILE E 2 276 ? -56.894  37.299  -44.827 1.00 39.46  ? 342 ILE B CG2 1 
ATOM   6955 C  CD1 . ILE E 2 276 ? -54.120  38.613  -45.690 1.00 41.56  ? 342 ILE B CD1 1 
ATOM   6956 N  N   . TYR E 2 277 ? -56.662  36.613  -41.424 1.00 39.30  ? 343 TYR B N   1 
ATOM   6957 C  CA  . TYR E 2 277 ? -57.238  35.356  -40.954 1.00 40.11  ? 343 TYR B CA  1 
ATOM   6958 C  C   . TYR E 2 277 ? -57.617  35.316  -39.465 1.00 40.99  ? 343 TYR B C   1 
ATOM   6959 O  O   . TYR E 2 277 ? -57.954  34.248  -38.959 1.00 41.63  ? 343 TYR B O   1 
ATOM   6960 C  CB  . TYR E 2 277 ? -56.271  34.200  -41.246 1.00 39.81  ? 343 TYR B CB  1 
ATOM   6961 C  CG  . TYR E 2 277 ? -56.013  33.941  -42.709 1.00 40.00  ? 343 TYR B CG  1 
ATOM   6962 C  CD1 . TYR E 2 277 ? -54.961  34.545  -43.357 1.00 41.33  ? 343 TYR B CD1 1 
ATOM   6963 C  CD2 . TYR E 2 277 ? -56.798  33.058  -43.431 1.00 40.55  ? 343 TYR B CD2 1 
ATOM   6964 C  CE1 . TYR E 2 277 ? -54.704  34.310  -44.697 1.00 43.21  ? 343 TYR B CE1 1 
ATOM   6965 C  CE2 . TYR E 2 277 ? -56.553  32.805  -44.770 1.00 42.12  ? 343 TYR B CE2 1 
ATOM   6966 C  CZ  . TYR E 2 277 ? -55.500  33.448  -45.403 1.00 43.51  ? 343 TYR B CZ  1 
ATOM   6967 O  OH  . TYR E 2 277 ? -55.194  33.237  -46.731 1.00 44.00  ? 343 TYR B OH  1 
ATOM   6968 N  N   . CYS E 2 278 ? -57.578  36.449  -38.759 1.00 40.87  ? 344 CYS B N   1 
ATOM   6969 C  CA  . CYS E 2 278 ? -57.978  36.481  -37.346 1.00 39.86  ? 344 CYS B CA  1 
ATOM   6970 C  C   . CYS E 2 278 ? -58.910  37.638  -37.034 1.00 42.89  ? 344 CYS B C   1 
ATOM   6971 O  O   . CYS E 2 278 ? -58.756  38.302  -36.013 1.00 42.71  ? 344 CYS B O   1 
ATOM   6972 C  CB  . CYS E 2 278 ? -56.739  36.520  -36.450 1.00 37.90  ? 344 CYS B CB  1 
ATOM   6973 S  SG  . CYS E 2 278 ? -55.507  35.260  -36.857 1.00 33.62  ? 344 CYS B SG  1 
ATOM   6974 N  N   . ARG E 2 279 ? -59.894  37.854  -37.914 1.00 47.83  ? 345 ARG B N   1 
ATOM   6975 C  CA  . ARG E 2 279 ? -60.870  38.941  -37.766 1.00 50.63  ? 345 ARG B CA  1 
ATOM   6976 C  C   . ARG E 2 279 ? -62.155  38.527  -37.041 1.00 47.21  ? 345 ARG B C   1 
ATOM   6977 O  O   . ARG E 2 279 ? -63.054  39.354  -36.866 1.00 45.42  ? 345 ARG B O   1 
ATOM   6978 C  CB  . ARG E 2 279 ? -61.253  39.500  -39.139 1.00 56.94  ? 345 ARG B CB  1 
ATOM   6979 C  CG  . ARG E 2 279 ? -60.159  40.248  -39.875 1.00 60.14  ? 345 ARG B CG  1 
ATOM   6980 C  CD  . ARG E 2 279 ? -60.785  41.171  -40.908 1.00 66.49  ? 345 ARG B CD  1 
ATOM   6981 N  NE  . ARG E 2 279 ? -59.868  42.212  -41.340 1.00 77.67  ? 345 ARG B NE  1 
ATOM   6982 C  CZ  . ARG E 2 279 ? -59.488  43.267  -40.607 1.00 85.78  ? 345 ARG B CZ  1 
ATOM   6983 N  NH1 . ARG E 2 279 ? -59.911  43.444  -39.354 1.00 84.02  ? 345 ARG B NH1 1 
ATOM   6984 N  NH2 . ARG E 2 279 ? -58.664  44.173  -41.138 1.00 91.07  ? 345 ARG B NH2 1 
ATOM   6985 N  N   . SER E 2 280 ? -62.257  37.268  -36.618 1.00 46.40  ? 346 SER B N   1 
ATOM   6986 C  CA  . SER E 2 280 ? -63.500  36.774  -35.997 1.00 46.44  ? 346 SER B CA  1 
ATOM   6987 C  C   . SER E 2 280 ? -63.845  37.597  -34.749 1.00 47.25  ? 346 SER B C   1 
ATOM   6988 O  O   . SER E 2 280 ? -62.941  38.112  -34.092 1.00 46.47  ? 346 SER B O   1 
ATOM   6989 C  CB  . SER E 2 280 ? -63.424  35.261  -35.670 1.00 45.13  ? 346 SER B CB  1 
ATOM   6990 O  OG  . SER E 2 280 ? -62.709  34.971  -34.479 1.00 43.33  ? 346 SER B OG  1 
ATOM   6991 N  N   . PRO E 2 281 ? -65.148  37.729  -34.425 1.00 49.39  ? 347 PRO B N   1 
ATOM   6992 C  CA  . PRO E 2 281 ? -65.534  38.483  -33.231 1.00 49.79  ? 347 PRO B CA  1 
ATOM   6993 C  C   . PRO E 2 281 ? -64.920  37.920  -31.960 1.00 50.36  ? 347 PRO B C   1 
ATOM   6994 O  O   . PRO E 2 281 ? -64.607  38.702  -31.069 1.00 53.27  ? 347 PRO B O   1 
ATOM   6995 C  CB  . PRO E 2 281 ? -67.054  38.342  -33.190 1.00 50.45  ? 347 PRO B CB  1 
ATOM   6996 C  CG  . PRO E 2 281 ? -67.327  37.077  -33.918 1.00 51.37  ? 347 PRO B CG  1 
ATOM   6997 C  CD  . PRO E 2 281 ? -66.311  37.050  -35.020 1.00 50.63  ? 347 PRO B CD  1 
ATOM   6998 N  N   . ASP E 2 282 ? -64.746  36.597  -31.881 1.00 49.85  ? 348 ASP B N   1 
ATOM   6999 C  CA  . ASP E 2 282 ? -63.986  35.983  -30.777 1.00 51.07  ? 348 ASP B CA  1 
ATOM   7000 C  C   . ASP E 2 282 ? -62.500  36.387  -30.749 1.00 50.09  ? 348 ASP B C   1 
ATOM   7001 O  O   . ASP E 2 282 ? -61.941  36.583  -29.665 1.00 50.76  ? 348 ASP B O   1 
ATOM   7002 C  CB  . ASP E 2 282 ? -64.084  34.450  -30.811 1.00 51.84  ? 348 ASP B CB  1 
ATOM   7003 C  CG  . ASP E 2 282 ? -65.389  33.929  -30.298 1.00 53.08  ? 348 ASP B CG  1 
ATOM   7004 O  OD1 . ASP E 2 282 ? -65.903  34.466  -29.289 1.00 55.36  ? 348 ASP B OD1 1 
ATOM   7005 O  OD2 . ASP E 2 282 ? -65.883  32.948  -30.892 1.00 57.12  ? 348 ASP B OD2 1 
ATOM   7006 N  N   . PHE E 2 283 ? -61.862  36.485  -31.917 1.00 47.75  ? 349 PHE B N   1 
ATOM   7007 C  CA  . PHE E 2 283 ? -60.493  37.018  -31.989 1.00 47.77  ? 349 PHE B CA  1 
ATOM   7008 C  C   . PHE E 2 283 ? -60.457  38.480  -31.531 1.00 50.33  ? 349 PHE B C   1 
ATOM   7009 O  O   . PHE E 2 283 ? -59.614  38.840  -30.724 1.00 51.70  ? 349 PHE B O   1 
ATOM   7010 C  CB  . PHE E 2 283 ? -59.868  36.888  -33.398 1.00 45.07  ? 349 PHE B CB  1 
ATOM   7011 C  CG  . PHE E 2 283 ? -59.003  35.664  -33.584 1.00 42.94  ? 349 PHE B CG  1 
ATOM   7012 C  CD1 . PHE E 2 283 ? -57.857  35.481  -32.819 1.00 42.53  ? 349 PHE B CD1 1 
ATOM   7013 C  CD2 . PHE E 2 283 ? -59.311  34.711  -34.549 1.00 43.14  ? 349 PHE B CD2 1 
ATOM   7014 C  CE1 . PHE E 2 283 ? -57.053  34.365  -32.995 1.00 43.19  ? 349 PHE B CE1 1 
ATOM   7015 C  CE2 . PHE E 2 283 ? -58.510  33.597  -34.730 1.00 43.15  ? 349 PHE B CE2 1 
ATOM   7016 C  CZ  . PHE E 2 283 ? -57.381  33.422  -33.950 1.00 43.56  ? 349 PHE B CZ  1 
ATOM   7017 N  N   . ARG E 2 284 ? -61.380  39.303  -32.024 1.00 54.38  ? 350 ARG B N   1 
ATOM   7018 C  CA  . ARG E 2 284 ? -61.425  40.729  -31.660 1.00 58.10  ? 350 ARG B CA  1 
ATOM   7019 C  C   . ARG E 2 284 ? -61.585  40.940  -30.157 1.00 55.73  ? 350 ARG B C   1 
ATOM   7020 O  O   . ARG E 2 284 ? -61.036  41.888  -29.616 1.00 55.37  ? 350 ARG B O   1 
ATOM   7021 C  CB  . ARG E 2 284 ? -62.564  41.456  -32.375 1.00 66.08  ? 350 ARG B CB  1 
ATOM   7022 C  CG  . ARG E 2 284 ? -62.441  41.555  -33.891 1.00 73.75  ? 350 ARG B CG  1 
ATOM   7023 C  CD  . ARG E 2 284 ? -63.722  42.149  -34.470 1.00 82.27  ? 350 ARG B CD  1 
ATOM   7024 N  NE  . ARG E 2 284 ? -63.669  42.343  -35.921 1.00 87.69  ? 350 ARG B NE  1 
ATOM   7025 C  CZ  . ARG E 2 284 ? -63.010  43.321  -36.554 1.00 90.42  ? 350 ARG B CZ  1 
ATOM   7026 N  NH1 . ARG E 2 284 ? -62.303  44.240  -35.890 1.00 89.91  ? 350 ARG B NH1 1 
ATOM   7027 N  NH2 . ARG E 2 284 ? -63.059  43.383  -37.884 1.00 93.59  ? 350 ARG B NH2 1 
ATOM   7028 N  N   . LYS E 2 285 ? -62.348  40.070  -29.497 1.00 56.09  ? 351 LYS B N   1 
ATOM   7029 C  CA  . LYS E 2 285 ? -62.502  40.113  -28.038 1.00 59.26  ? 351 LYS B CA  1 
ATOM   7030 C  C   . LYS E 2 285 ? -61.221  39.721  -27.328 1.00 55.14  ? 351 LYS B C   1 
ATOM   7031 O  O   . LYS E 2 285 ? -60.770  40.424  -26.423 1.00 55.50  ? 351 LYS B O   1 
ATOM   7032 C  CB  . LYS E 2 285 ? -63.635  39.196  -27.564 1.00 66.84  ? 351 LYS B CB  1 
ATOM   7033 C  CG  . LYS E 2 285 ? -65.021  39.749  -27.859 1.00 75.59  ? 351 LYS B CG  1 
ATOM   7034 C  CD  . LYS E 2 285 ? -66.126  38.733  -27.567 1.00 80.34  ? 351 LYS B CD  1 
ATOM   7035 C  CE  . LYS E 2 285 ? -67.430  39.102  -28.265 1.00 82.13  ? 351 LYS B CE  1 
ATOM   7036 N  NZ  . LYS E 2 285 ? -68.366  37.944  -28.348 1.00 84.43  ? 351 LYS B NZ  1 
ATOM   7037 N  N   . ALA E 2 286 ? -60.645  38.595  -27.738 1.00 51.17  ? 352 ALA B N   1 
ATOM   7038 C  CA  . ALA E 2 286 ? -59.416  38.086  -27.129 1.00 48.18  ? 352 ALA B CA  1 
ATOM   7039 C  C   . ALA E 2 286 ? -58.268  39.091  -27.227 1.00 47.65  ? 352 ALA B C   1 
ATOM   7040 O  O   . ALA E 2 286 ? -57.512  39.246  -26.272 1.00 51.38  ? 352 ALA B O   1 
ATOM   7041 C  CB  . ALA E 2 286 ? -59.011  36.754  -27.751 1.00 46.21  ? 352 ALA B CB  1 
ATOM   7042 N  N   . PHE E 2 287 ? -58.154  39.786  -28.361 1.00 44.60  ? 353 PHE B N   1 
ATOM   7043 C  CA  . PHE E 2 287 ? -57.095  40.786  -28.557 1.00 43.53  ? 353 PHE B CA  1 
ATOM   7044 C  C   . PHE E 2 287 ? -57.242  41.989  -27.621 1.00 47.53  ? 353 PHE B C   1 
ATOM   7045 O  O   . PHE E 2 287 ? -56.246  42.498  -27.110 1.00 52.09  ? 353 PHE B O   1 
ATOM   7046 C  CB  . PHE E 2 287 ? -57.038  41.274  -30.014 1.00 40.06  ? 353 PHE B CB  1 
ATOM   7047 C  CG  . PHE E 2 287 ? -56.619  40.222  -31.021 1.00 37.58  ? 353 PHE B CG  1 
ATOM   7048 C  CD1 . PHE E 2 287 ? -55.569  39.329  -30.762 1.00 36.94  ? 353 PHE B CD1 1 
ATOM   7049 C  CD2 . PHE E 2 287 ? -57.241  40.163  -32.268 1.00 35.20  ? 353 PHE B CD2 1 
ATOM   7050 C  CE1 . PHE E 2 287 ? -55.186  38.392  -31.711 1.00 35.65  ? 353 PHE B CE1 1 
ATOM   7051 C  CE2 . PHE E 2 287 ? -56.858  39.234  -33.212 1.00 33.90  ? 353 PHE B CE2 1 
ATOM   7052 C  CZ  . PHE E 2 287 ? -55.835  38.349  -32.936 1.00 33.60  ? 353 PHE B CZ  1 
ATOM   7053 N  N   . LYS E 2 288 ? -58.468  42.447  -27.398 1.00 53.22  ? 354 LYS B N   1 
ATOM   7054 C  CA  . LYS E 2 288 ? -58.707  43.523  -26.429 1.00 58.18  ? 354 LYS B CA  1 
ATOM   7055 C  C   . LYS E 2 288 ? -58.355  43.038  -25.029 1.00 57.76  ? 354 LYS B C   1 
ATOM   7056 O  O   . LYS E 2 288 ? -57.610  43.711  -24.310 1.00 57.66  ? 354 LYS B O   1 
ATOM   7057 C  CB  . LYS E 2 288 ? -60.147  44.056  -26.512 1.00 62.77  ? 354 LYS B CB  1 
ATOM   7058 C  CG  . LYS E 2 288 ? -60.355  44.924  -27.751 1.00 68.05  ? 354 LYS B CG  1 
ATOM   7059 C  CD  . LYS E 2 288 ? -61.747  45.531  -27.849 1.00 72.19  ? 354 LYS B CD  1 
ATOM   7060 C  CE  . LYS E 2 288 ? -61.838  46.488  -29.033 1.00 73.75  ? 354 LYS B CE  1 
ATOM   7061 N  NZ  . LYS E 2 288 ? -63.239  46.923  -29.302 1.00 74.46  ? 354 LYS B NZ  1 
ATOM   7062 N  N   . ARG E 2 289 ? -58.851  41.851  -24.679 1.00 57.01  ? 355 ARG B N   1 
ATOM   7063 C  CA  . ARG E 2 289 ? -58.538  41.217  -23.400 1.00 57.59  ? 355 ARG B CA  1 
ATOM   7064 C  C   . ARG E 2 289 ? -57.035  41.067  -23.178 1.00 56.76  ? 355 ARG B C   1 
ATOM   7065 O  O   . ARG E 2 289 ? -56.564  41.276  -22.064 1.00 60.26  ? 355 ARG B O   1 
ATOM   7066 C  CB  . ARG E 2 289 ? -59.217  39.845  -23.296 1.00 60.12  ? 355 ARG B CB  1 
ATOM   7067 C  CG  . ARG E 2 289 ? -59.118  39.180  -21.927 1.00 62.93  ? 355 ARG B CG  1 
ATOM   7068 C  CD  . ARG E 2 289 ? -59.828  37.829  -21.907 1.00 64.85  ? 355 ARG B CD  1 
ATOM   7069 N  NE  . ARG E 2 289 ? -59.268  36.903  -22.894 1.00 66.67  ? 355 ARG B NE  1 
ATOM   7070 C  CZ  . ARG E 2 289 ? -58.103  36.264  -22.773 1.00 69.12  ? 355 ARG B CZ  1 
ATOM   7071 N  NH1 . ARG E 2 289 ? -57.702  35.451  -23.751 1.00 69.13  ? 355 ARG B NH1 1 
ATOM   7072 N  NH2 . ARG E 2 289 ? -57.334  36.415  -21.690 1.00 70.49  ? 355 ARG B NH2 1 
ATOM   7073 N  N   . LEU E 2 290 ? -56.291  40.708  -24.224 1.00 52.93  ? 356 LEU B N   1 
ATOM   7074 C  CA  . LEU E 2 290 ? -54.830  40.551  -24.116 1.00 50.84  ? 356 LEU B CA  1 
ATOM   7075 C  C   . LEU E 2 290 ? -54.062  41.868  -23.999 1.00 49.29  ? 356 LEU B C   1 
ATOM   7076 O  O   . LEU E 2 290 ? -52.999  41.894  -23.387 1.00 50.62  ? 356 LEU B O   1 
ATOM   7077 C  CB  . LEU E 2 290 ? -54.253  39.772  -25.303 1.00 50.77  ? 356 LEU B CB  1 
ATOM   7078 C  CG  . LEU E 2 290 ? -54.558  38.286  -25.489 1.00 50.65  ? 356 LEU B CG  1 
ATOM   7079 C  CD1 . LEU E 2 290 ? -53.853  37.839  -26.752 1.00 49.77  ? 356 LEU B CD1 1 
ATOM   7080 C  CD2 . LEU E 2 290 ? -54.153  37.411  -24.313 1.00 50.25  ? 356 LEU B CD2 1 
ATOM   7081 N  N   . LEU E 2 291 ? -54.574  42.945  -24.590 1.00 48.71  ? 357 LEU B N   1 
ATOM   7082 C  CA  . LEU E 2 291 ? -53.906  44.249  -24.534 1.00 49.33  ? 357 LEU B CA  1 
ATOM   7083 C  C   . LEU E 2 291 ? -54.548  45.149  -23.460 1.00 54.03  ? 357 LEU B C   1 
ATOM   7084 O  O   . LEU E 2 291 ? -54.691  46.351  -23.673 1.00 55.78  ? 357 LEU B O   1 
ATOM   7085 C  CB  . LEU E 2 291 ? -53.966  44.910  -25.914 1.00 47.19  ? 357 LEU B CB  1 
ATOM   7086 C  CG  . LEU E 2 291 ? -53.318  44.148  -27.070 1.00 47.63  ? 357 LEU B CG  1 
ATOM   7087 C  CD1 . LEU E 2 291 ? -53.708  44.755  -28.419 1.00 46.35  ? 357 LEU B CD1 1 
ATOM   7088 C  CD2 . LEU E 2 291 ? -51.804  44.119  -26.898 1.00 47.76  ? 357 LEU B CD2 1 
ATOM   7089 N  N   . ALA E 2 292 ? -54.907  44.563  -22.310 1.00 59.90  ? 358 ALA B N   1 
ATOM   7090 C  CA  . ALA E 2 292 ? -55.881  45.180  -21.380 1.00 64.84  ? 358 ALA B CA  1 
ATOM   7091 C  C   . ALA E 2 292 ? -55.251  46.258  -20.495 1.00 71.42  ? 358 ALA B C   1 
ATOM   7092 O  O   . ALA E 2 292 ? -55.497  47.451  -20.695 1.00 82.23  ? 358 ALA B O   1 
ATOM   7093 C  CB  . ALA E 2 292 ? -56.584  44.119  -20.531 1.00 63.82  ? 358 ALA B CB  1 
ATOM   7094 N  N   . PHE E 2 293 ? -54.428  45.841  -19.537 1.00 70.72  ? 359 PHE B N   1 
ATOM   7095 C  CA  . PHE E 2 293 ? -53.912  46.739  -18.494 1.00 69.10  ? 359 PHE B CA  1 
ATOM   7096 C  C   . PHE E 2 293 ? -53.060  47.887  -19.083 1.00 68.77  ? 359 PHE B C   1 
ATOM   7097 O  O   . PHE E 2 293 ? -51.922  48.149  -18.678 1.00 65.99  ? 359 PHE B O   1 
ATOM   7098 C  CB  . PHE E 2 293 ? -53.145  45.929  -17.434 1.00 68.83  ? 359 PHE B CB  1 
ATOM   7099 C  CG  . PHE E 2 293 ? -54.031  45.065  -16.576 1.00 68.55  ? 359 PHE B CG  1 
ATOM   7100 C  CD1 . PHE E 2 293 ? -54.491  45.529  -15.348 1.00 69.45  ? 359 PHE B CD1 1 
ATOM   7101 C  CD2 . PHE E 2 293 ? -54.414  43.793  -16.991 1.00 66.54  ? 359 PHE B CD2 1 
ATOM   7102 C  CE1 . PHE E 2 293 ? -55.314  44.745  -14.553 1.00 68.80  ? 359 PHE B CE1 1 
ATOM   7103 C  CE2 . PHE E 2 293 ? -55.232  43.005  -16.197 1.00 65.06  ? 359 PHE B CE2 1 
ATOM   7104 C  CZ  . PHE E 2 293 ? -55.683  43.481  -14.979 1.00 66.51  ? 359 PHE B CZ  1 
ATOM   7105 N  N   . GLN F 3 2   ? -79.919  45.099  -40.404 1.00 90.87  ? 1   GLN D N   1 
ATOM   7106 C  CA  . GLN F 3 2   ? -79.775  44.210  -39.210 1.00 89.28  ? 1   GLN D CA  1 
ATOM   7107 C  C   . GLN F 3 2   ? -80.595  42.918  -39.386 1.00 84.03  ? 1   GLN D C   1 
ATOM   7108 O  O   . GLN F 3 2   ? -81.719  42.962  -39.881 1.00 88.11  ? 1   GLN D O   1 
ATOM   7109 C  CB  . GLN F 3 2   ? -80.222  44.960  -37.945 1.00 90.71  ? 1   GLN D CB  1 
ATOM   7110 C  CG  . GLN F 3 2   ? -79.898  44.268  -36.619 1.00 93.40  ? 1   GLN D CG  1 
ATOM   7111 C  CD  . GLN F 3 2   ? -78.409  44.217  -36.299 1.00 92.69  ? 1   GLN D CD  1 
ATOM   7112 O  OE1 . GLN F 3 2   ? -77.692  45.206  -36.456 1.00 95.74  ? 1   GLN D OE1 1 
ATOM   7113 N  NE2 . GLN F 3 2   ? -77.943  43.060  -35.831 1.00 88.20  ? 1   GLN D NE2 1 
ATOM   7114 N  N   . VAL F 3 3   ? -80.022  41.788  -38.968 1.00 75.81  ? 2   VAL D N   1 
ATOM   7115 C  CA  . VAL F 3 3   ? -80.681  40.483  -39.012 1.00 70.64  ? 2   VAL D CA  1 
ATOM   7116 C  C   . VAL F 3 3   ? -81.524  40.306  -37.758 1.00 70.05  ? 2   VAL D C   1 
ATOM   7117 O  O   . VAL F 3 3   ? -81.092  40.645  -36.655 1.00 71.41  ? 2   VAL D O   1 
ATOM   7118 C  CB  . VAL F 3 3   ? -79.648  39.323  -39.063 1.00 67.77  ? 2   VAL D CB  1 
ATOM   7119 C  CG1 . VAL F 3 3   ? -80.332  37.952  -39.047 1.00 66.28  ? 2   VAL D CG1 1 
ATOM   7120 C  CG2 . VAL F 3 3   ? -78.776  39.456  -40.305 1.00 68.59  ? 2   VAL D CG2 1 
ATOM   7121 N  N   . GLN F 3 4   ? -82.738  39.781  -37.935 1.00 68.59  ? 3   GLN D N   1 
ATOM   7122 C  CA  . GLN F 3 4   ? -83.550  39.280  -36.813 1.00 66.02  ? 3   GLN D CA  1 
ATOM   7123 C  C   . GLN F 3 4   ? -84.158  37.926  -37.158 1.00 58.33  ? 3   GLN D C   1 
ATOM   7124 O  O   . GLN F 3 4   ? -84.501  37.677  -38.314 1.00 57.03  ? 3   GLN D O   1 
ATOM   7125 C  CB  . GLN F 3 4   ? -84.671  40.238  -36.466 1.00 68.09  ? 3   GLN D CB  1 
ATOM   7126 C  CG  . GLN F 3 4   ? -84.285  41.633  -36.034 1.00 70.82  ? 3   GLN D CG  1 
ATOM   7127 C  CD  . GLN F 3 4   ? -85.456  42.609  -36.137 1.00 74.34  ? 3   GLN D CD  1 
ATOM   7128 O  OE1 . GLN F 3 4   ? -86.306  42.506  -37.031 1.00 73.48  ? 3   GLN D OE1 1 
ATOM   7129 N  NE2 . GLN F 3 4   ? -85.500  43.577  -35.221 1.00 78.00  ? 3   GLN D NE2 1 
ATOM   7130 N  N   . LEU F 3 5   ? -84.303  37.077  -36.149 1.00 52.49  ? 4   LEU D N   1 
ATOM   7131 C  CA  . LEU F 3 5   ? -84.904  35.767  -36.309 1.00 53.50  ? 4   LEU D CA  1 
ATOM   7132 C  C   . LEU F 3 5   ? -86.202  35.706  -35.525 1.00 54.01  ? 4   LEU D C   1 
ATOM   7133 O  O   . LEU F 3 5   ? -86.199  35.880  -34.307 1.00 60.61  ? 4   LEU D O   1 
ATOM   7134 C  CB  . LEU F 3 5   ? -83.949  34.700  -35.780 1.00 54.24  ? 4   LEU D CB  1 
ATOM   7135 C  CG  . LEU F 3 5   ? -82.535  34.719  -36.339 1.00 54.69  ? 4   LEU D CG  1 
ATOM   7136 C  CD1 . LEU F 3 5   ? -81.797  33.490  -35.804 1.00 53.56  ? 4   LEU D CD1 1 
ATOM   7137 C  CD2 . LEU F 3 5   ? -82.550  34.729  -37.857 1.00 57.00  ? 4   LEU D CD2 1 
ATOM   7138 N  N   . GLN F 3 6   ? -87.311  35.468  -36.223 1.00 52.14  ? 5   GLN D N   1 
ATOM   7139 C  CA  . GLN F 3 6   ? -88.647  35.493  -35.622 1.00 48.05  ? 5   GLN D CA  1 
ATOM   7140 C  C   . GLN F 3 6   ? -89.203  34.070  -35.558 1.00 47.19  ? 5   GLN D C   1 
ATOM   7141 O  O   . GLN F 3 6   ? -89.489  33.471  -36.589 1.00 42.23  ? 5   GLN D O   1 
ATOM   7142 C  CB  . GLN F 3 6   ? -89.566  36.392  -36.449 1.00 47.68  ? 5   GLN D CB  1 
ATOM   7143 C  CG  . GLN F 3 6   ? -89.138  37.855  -36.491 1.00 48.40  ? 5   GLN D CG  1 
ATOM   7144 C  CD  . GLN F 3 6   ? -89.693  38.613  -37.687 1.00 50.99  ? 5   GLN D CD  1 
ATOM   7145 O  OE1 . GLN F 3 6   ? -89.414  38.278  -38.857 1.00 50.65  ? 5   GLN D OE1 1 
ATOM   7146 N  NE2 . GLN F 3 6   ? -90.483  39.646  -37.401 1.00 49.91  ? 5   GLN D NE2 1 
ATOM   7147 N  N   . GLU F 3 7   ? -89.358  33.545  -34.340 1.00 49.57  ? 6   GLU D N   1 
ATOM   7148 C  CA  . GLU F 3 7   ? -89.857  32.177  -34.109 1.00 50.03  ? 6   GLU D CA  1 
ATOM   7149 C  C   . GLU F 3 7   ? -91.375  32.143  -33.887 1.00 48.84  ? 6   GLU D C   1 
ATOM   7150 O  O   . GLU F 3 7   ? -91.953  33.006  -33.221 1.00 49.04  ? 6   GLU D O   1 
ATOM   7151 C  CB  . GLU F 3 7   ? -89.145  31.543  -32.906 1.00 51.56  ? 6   GLU D CB  1 
ATOM   7152 C  CG  . GLU F 3 7   ? -87.686  31.185  -33.180 1.00 53.21  ? 6   GLU D CG  1 
ATOM   7153 C  CD  . GLU F 3 7   ? -86.708  31.748  -32.160 1.00 53.54  ? 6   GLU D CD  1 
ATOM   7154 O  OE1 . GLU F 3 7   ? -85.727  31.049  -31.833 1.00 50.54  ? 6   GLU D OE1 1 
ATOM   7155 O  OE2 . GLU F 3 7   ? -86.910  32.893  -31.688 1.00 55.13  ? 6   GLU D OE2 1 
ATOM   7156 N  N   . SER F 3 8   ? -92.014  31.128  -34.449 1.00 46.92  ? 7   SER D N   1 
ATOM   7157 C  CA  . SER F 3 8   ? -93.439  30.933  -34.268 1.00 46.92  ? 7   SER D CA  1 
ATOM   7158 C  C   . SER F 3 8   ? -93.783  29.460  -34.426 1.00 46.71  ? 7   SER D C   1 
ATOM   7159 O  O   . SER F 3 8   ? -92.990  28.680  -34.976 1.00 44.58  ? 7   SER D O   1 
ATOM   7160 C  CB  . SER F 3 8   ? -94.213  31.783  -35.271 1.00 46.27  ? 7   SER D CB  1 
ATOM   7161 O  OG  . SER F 3 8   ? -93.672  31.652  -36.571 1.00 47.43  ? 7   SER D OG  1 
ATOM   7162 N  N   . GLY F 3 9   ? -94.957  29.090  -33.919 1.00 45.27  ? 8   GLY D N   1 
ATOM   7163 C  CA  . GLY F 3 9   ? -95.478  27.734  -34.065 1.00 45.06  ? 8   GLY D CA  1 
ATOM   7164 C  C   . GLY F 3 9   ? -95.395  26.899  -32.812 1.00 44.79  ? 8   GLY D C   1 
ATOM   7165 O  O   . GLY F 3 9   ? -95.921  25.782  -32.780 1.00 44.00  ? 8   GLY D O   1 
ATOM   7166 N  N   . GLY F 3 10  ? -94.730  27.421  -31.783 1.00 45.58  ? 9   GLY D N   1 
ATOM   7167 C  CA  . GLY F 3 10  ? -94.603  26.705  -30.521 1.00 47.26  ? 9   GLY D CA  1 
ATOM   7168 C  C   . GLY F 3 10  ? -95.845  26.779  -29.658 1.00 47.26  ? 9   GLY D C   1 
ATOM   7169 O  O   . GLY F 3 10  ? -96.752  27.560  -29.934 1.00 52.18  ? 9   GLY D O   1 
ATOM   7170 N  N   . GLY F 3 11  ? -95.879  25.953  -28.614 1.00 46.53  ? 10  GLY D N   1 
ATOM   7171 C  CA  . GLY F 3 11  ? -96.919  26.036  -27.591 1.00 46.98  ? 10  GLY D CA  1 
ATOM   7172 C  C   . GLY F 3 11  ? -97.205  24.739  -26.864 1.00 46.43  ? 10  GLY D C   1 
ATOM   7173 O  O   . GLY F 3 11  ? -96.339  23.860  -26.775 1.00 44.19  ? 10  GLY D O   1 
ATOM   7174 N  N   . LEU F 3 12  ? -98.425  24.648  -26.327 1.00 46.61  ? 11  LEU D N   1 
ATOM   7175 C  CA  . LEU F 3 12  ? -98.930  23.428  -25.709 1.00 47.35  ? 11  LEU D CA  1 
ATOM   7176 C  C   . LEU F 3 12  ? -99.519  22.500  -26.766 1.00 46.66  ? 11  LEU D C   1 
ATOM   7177 O  O   . LEU F 3 12  ? -100.123 22.947  -27.753 1.00 44.84  ? 11  LEU D O   1 
ATOM   7178 C  CB  . LEU F 3 12  ? -100.021 23.741  -24.691 1.00 49.89  ? 11  LEU D CB  1 
ATOM   7179 C  CG  . LEU F 3 12  ? -99.675  24.607  -23.486 1.00 52.50  ? 11  LEU D CG  1 
ATOM   7180 C  CD1 . LEU F 3 12  ? -100.961 25.038  -22.769 1.00 53.95  ? 11  LEU D CD1 1 
ATOM   7181 C  CD2 . LEU F 3 12  ? -98.743  23.858  -22.537 1.00 54.70  ? 11  LEU D CD2 1 
ATOM   7182 N  N   . VAL F 3 13  ? -99.352  21.204  -26.533 1.00 46.83  ? 12  VAL D N   1 
ATOM   7183 C  CA  . VAL F 3 13  ? -99.846  20.179  -27.438 1.00 48.33  ? 12  VAL D CA  1 
ATOM   7184 C  C   . VAL F 3 13  ? -99.846  18.838  -26.707 1.00 51.74  ? 12  VAL D C   1 
ATOM   7185 O  O   . VAL F 3 13  ? -98.979  18.561  -25.868 1.00 47.76  ? 12  VAL D O   1 
ATOM   7186 C  CB  . VAL F 3 13  ? -99.018  20.114  -28.750 1.00 48.07  ? 12  VAL D CB  1 
ATOM   7187 C  CG1 . VAL F 3 13  ? -97.584  19.653  -28.486 1.00 49.21  ? 12  VAL D CG1 1 
ATOM   7188 C  CG2 . VAL F 3 13  ? -99.699  19.237  -29.791 1.00 47.25  ? 12  VAL D CG2 1 
ATOM   7189 N  N   . GLN F 3 14  ? -100.849 18.026  -27.026 1.00 60.30  ? 13  GLN D N   1 
ATOM   7190 C  CA  . GLN F 3 14  ? -101.012 16.703  -26.433 1.00 65.13  ? 13  GLN D CA  1 
ATOM   7191 C  C   . GLN F 3 14  ? -99.954  15.757  -26.996 1.00 58.77  ? 13  GLN D C   1 
ATOM   7192 O  O   . GLN F 3 14  ? -99.629  15.824  -28.185 1.00 57.25  ? 13  GLN D O   1 
ATOM   7193 C  CB  . GLN F 3 14  ? -102.427 16.168  -26.736 1.00 74.13  ? 13  GLN D CB  1 
ATOM   7194 C  CG  . GLN F 3 14  ? -102.823 14.896  -25.986 1.00 80.59  ? 13  GLN D CG  1 
ATOM   7195 C  CD  . GLN F 3 14  ? -103.094 15.139  -24.505 1.00 84.51  ? 13  GLN D CD  1 
ATOM   7196 O  OE1 . GLN F 3 14  ? -104.171 15.621  -24.125 1.00 88.96  ? 13  GLN D OE1 1 
ATOM   7197 N  NE2 . GLN F 3 14  ? -102.120 14.790  -23.658 1.00 83.91  ? 13  GLN D NE2 1 
ATOM   7198 N  N   . ALA F 3 15  ? -99.420  14.881  -26.146 1.00 53.13  ? 14  ALA D N   1 
ATOM   7199 C  CA  . ALA F 3 15  ? -98.504  13.833  -26.603 1.00 49.89  ? 14  ALA D CA  1 
ATOM   7200 C  C   . ALA F 3 15  ? -99.145  12.988  -27.709 1.00 47.08  ? 14  ALA D C   1 
ATOM   7201 O  O   . ALA F 3 15  ? -100.357 12.747  -27.705 1.00 46.41  ? 14  ALA D O   1 
ATOM   7202 C  CB  . ALA F 3 15  ? -98.073  12.956  -25.443 1.00 49.81  ? 14  ALA D CB  1 
ATOM   7203 N  N   . GLY F 3 16  ? -98.322  12.571  -28.664 1.00 45.11  ? 15  GLY D N   1 
ATOM   7204 C  CA  . GLY F 3 16  ? -98.794  11.920  -29.881 1.00 45.40  ? 15  GLY D CA  1 
ATOM   7205 C  C   . GLY F 3 16  ? -99.137  12.888  -31.003 1.00 46.65  ? 15  GLY D C   1 
ATOM   7206 O  O   . GLY F 3 16  ? -99.325  12.451  -32.142 1.00 46.54  ? 15  GLY D O   1 
ATOM   7207 N  N   . GLY F 3 17  ? -99.208  14.190  -30.703 1.00 48.91  ? 16  GLY D N   1 
ATOM   7208 C  CA  . GLY F 3 17  ? -99.638  15.202  -31.678 1.00 50.66  ? 16  GLY D CA  1 
ATOM   7209 C  C   . GLY F 3 17  ? -98.494  15.772  -32.496 1.00 50.67  ? 16  GLY D C   1 
ATOM   7210 O  O   . GLY F 3 17  ? -97.418  15.174  -32.579 1.00 53.11  ? 16  GLY D O   1 
ATOM   7211 N  N   . SER F 3 18  ? -98.721  16.949  -33.072 1.00 49.37  ? 17  SER D N   1 
ATOM   7212 C  CA  . SER F 3 18  ? -97.744  17.563  -33.955 1.00 48.94  ? 17  SER D CA  1 
ATOM   7213 C  C   . SER F 3 18  ? -97.746  19.096  -33.893 1.00 48.71  ? 17  SER D C   1 
ATOM   7214 O  O   . SER F 3 18  ? -98.796  19.713  -33.692 1.00 48.96  ? 17  SER D O   1 
ATOM   7215 C  CB  . SER F 3 18  ? -97.969  17.083  -35.402 1.00 49.28  ? 17  SER D CB  1 
ATOM   7216 O  OG  . SER F 3 18  ? -98.829  17.942  -36.142 1.00 49.87  ? 17  SER D OG  1 
ATOM   7217 N  N   . LEU F 3 19  ? -96.557  19.686  -34.057 1.00 45.72  ? 18  LEU D N   1 
ATOM   7218 C  CA  . LEU F 3 19  ? -96.387  21.124  -34.248 1.00 41.64  ? 18  LEU D CA  1 
ATOM   7219 C  C   . LEU F 3 19  ? -95.538  21.390  -35.474 1.00 38.64  ? 18  LEU D C   1 
ATOM   7220 O  O   . LEU F 3 19  ? -94.908  20.486  -36.028 1.00 34.83  ? 18  LEU D O   1 
ATOM   7221 C  CB  . LEU F 3 19  ? -95.702  21.737  -33.040 1.00 42.05  ? 18  LEU D CB  1 
ATOM   7222 C  CG  . LEU F 3 19  ? -96.467  21.661  -31.726 1.00 43.11  ? 18  LEU D CG  1 
ATOM   7223 C  CD1 . LEU F 3 19  ? -95.583  22.179  -30.597 1.00 43.40  ? 18  LEU D CD1 1 
ATOM   7224 C  CD2 . LEU F 3 19  ? -97.765  22.450  -31.816 1.00 43.63  ? 18  LEU D CD2 1 
ATOM   7225 N  N   . ARG F 3 20  ? -95.539  22.647  -35.894 1.00 39.90  ? 19  ARG D N   1 
ATOM   7226 C  CA  . ARG F 3 20  ? -94.739  23.096  -37.021 1.00 41.12  ? 19  ARG D CA  1 
ATOM   7227 C  C   . ARG F 3 20  ? -94.127  24.451  -36.704 1.00 41.89  ? 19  ARG D C   1 
ATOM   7228 O  O   . ARG F 3 20  ? -94.766  25.505  -36.897 1.00 38.23  ? 19  ARG D O   1 
ATOM   7229 C  CB  . ARG F 3 20  ? -95.559  23.174  -38.308 1.00 43.21  ? 19  ARG D CB  1 
ATOM   7230 C  CG  . ARG F 3 20  ? -94.733  23.477  -39.546 1.00 45.54  ? 19  ARG D CG  1 
ATOM   7231 C  CD  . ARG F 3 20  ? -95.586  23.550  -40.792 1.00 48.14  ? 19  ARG D CD  1 
ATOM   7232 N  NE  . ARG F 3 20  ? -94.775  23.592  -42.015 1.00 51.38  ? 19  ARG D NE  1 
ATOM   7233 C  CZ  . ARG F 3 20  ? -94.734  24.594  -42.912 1.00 54.71  ? 19  ARG D CZ  1 
ATOM   7234 N  NH1 . ARG F 3 20  ? -95.472  25.713  -42.781 1.00 54.01  ? 19  ARG D NH1 1 
ATOM   7235 N  NH2 . ARG F 3 20  ? -93.941  24.466  -43.985 1.00 54.86  ? 19  ARG D NH2 1 
ATOM   7236 N  N   . LEU F 3 21  ? -92.868  24.405  -36.250 1.00 42.99  ? 20  LEU D N   1 
ATOM   7237 C  CA  . LEU F 3 21  ? -92.091  25.609  -35.988 1.00 41.02  ? 20  LEU D CA  1 
ATOM   7238 C  C   . LEU F 3 21  ? -91.701  26.271  -37.297 1.00 39.25  ? 20  LEU D C   1 
ATOM   7239 O  O   . LEU F 3 21  ? -91.665  25.635  -38.355 1.00 33.26  ? 20  LEU D O   1 
ATOM   7240 C  CB  . LEU F 3 21  ? -90.841  25.299  -35.167 1.00 42.05  ? 20  LEU D CB  1 
ATOM   7241 C  CG  . LEU F 3 21  ? -91.031  24.528  -33.860 1.00 41.92  ? 20  LEU D CG  1 
ATOM   7242 C  CD1 . LEU F 3 21  ? -89.746  24.513  -33.035 1.00 42.08  ? 20  LEU D CD1 1 
ATOM   7243 C  CD2 . LEU F 3 21  ? -92.167  25.135  -33.054 1.00 42.68  ? 20  LEU D CD2 1 
ATOM   7244 N  N   . SER F 3 22  ? -91.430  27.563  -37.206 1.00 41.63  ? 21  SER D N   1 
ATOM   7245 C  CA  . SER F 3 22  ? -91.124  28.373  -38.370 1.00 45.94  ? 21  SER D CA  1 
ATOM   7246 C  C   . SER F 3 22  ? -90.299  29.574  -37.941 1.00 50.99  ? 21  SER D C   1 
ATOM   7247 O  O   . SER F 3 22  ? -90.761  30.375  -37.123 1.00 56.97  ? 21  SER D O   1 
ATOM   7248 C  CB  . SER F 3 22  ? -92.415  28.839  -39.040 1.00 44.91  ? 21  SER D CB  1 
ATOM   7249 O  OG  . SER F 3 22  ? -92.179  29.816  -40.051 1.00 42.95  ? 21  SER D OG  1 
ATOM   7250 N  N   . CYS F 3 23  ? -89.090  29.693  -38.498 1.00 50.69  ? 22  CYS D N   1 
ATOM   7251 C  CA  . CYS F 3 23  ? -88.194  30.798  -38.184 1.00 49.10  ? 22  CYS D CA  1 
ATOM   7252 C  C   . CYS F 3 23  ? -87.921  31.615  -39.429 1.00 47.37  ? 22  CYS D C   1 
ATOM   7253 O  O   . CYS F 3 23  ? -87.311  31.108  -40.347 1.00 46.64  ? 22  CYS D O   1 
ATOM   7254 C  CB  . CYS F 3 23  ? -86.886  30.257  -37.633 1.00 49.56  ? 22  CYS D CB  1 
ATOM   7255 S  SG  . CYS F 3 23  ? -85.652  31.521  -37.278 1.00 50.27  ? 22  CYS D SG  1 
ATOM   7256 N  N   . ALA F 3 24  ? -88.374  32.871  -39.447 1.00 46.77  ? 23  ALA D N   1 
ATOM   7257 C  CA  . ALA F 3 24  ? -88.175  33.773  -40.575 1.00 47.92  ? 23  ALA D CA  1 
ATOM   7258 C  C   . ALA F 3 24  ? -87.076  34.775  -40.260 1.00 51.15  ? 23  ALA D C   1 
ATOM   7259 O  O   . ALA F 3 24  ? -87.247  35.650  -39.399 1.00 52.27  ? 23  ALA D O   1 
ATOM   7260 C  CB  . ALA F 3 24  ? -89.460  34.503  -40.898 1.00 46.53  ? 23  ALA D CB  1 
ATOM   7261 N  N   . ALA F 3 25  ? -85.954  34.651  -40.971 1.00 52.98  ? 24  ALA D N   1 
ATOM   7262 C  CA  . ALA F 3 25  ? -84.801  35.521  -40.786 1.00 52.01  ? 24  ALA D CA  1 
ATOM   7263 C  C   . ALA F 3 25  ? -84.896  36.753  -41.698 1.00 52.89  ? 24  ALA D C   1 
ATOM   7264 O  O   . ALA F 3 25  ? -84.707  36.647  -42.904 1.00 54.25  ? 24  ALA D O   1 
ATOM   7265 C  CB  . ALA F 3 25  ? -83.531  34.746  -41.061 1.00 51.42  ? 24  ALA D CB  1 
ATOM   7266 N  N   . SER F 3 26  ? -85.197  37.908  -41.108 1.00 53.14  ? 25  SER D N   1 
ATOM   7267 C  CA  . SER F 3 26  ? -85.337  39.163  -41.839 1.00 52.74  ? 25  SER D CA  1 
ATOM   7268 C  C   . SER F 3 26  ? -84.052  39.948  -41.707 1.00 53.03  ? 25  SER D C   1 
ATOM   7269 O  O   . SER F 3 26  ? -83.731  40.442  -40.617 1.00 54.30  ? 25  SER D O   1 
ATOM   7270 C  CB  . SER F 3 26  ? -86.480  39.998  -41.276 1.00 55.22  ? 25  SER D CB  1 
ATOM   7271 O  OG  . SER F 3 26  ? -86.234  40.352  -39.924 1.00 57.61  ? 25  SER D OG  1 
ATOM   7272 N  N   . GLY F 3 27  ? -83.320  40.052  -42.820 1.00 54.00  ? 26  GLY D N   1 
ATOM   7273 C  CA  . GLY F 3 27  ? -82.022  40.712  -42.858 1.00 55.91  ? 26  GLY D CA  1 
ATOM   7274 C  C   . GLY F 3 27  ? -81.080  40.042  -43.847 1.00 58.12  ? 26  GLY D C   1 
ATOM   7275 O  O   . GLY F 3 27  ? -81.417  39.015  -44.439 1.00 58.19  ? 26  GLY D O   1 
ATOM   7276 N  N   . SER F 3 28  ? -79.896  40.631  -44.003 1.00 60.11  ? 27  SER D N   1 
ATOM   7277 C  CA  . SER F 3 28  ? -78.928  40.185  -45.008 1.00 61.14  ? 27  SER D CA  1 
ATOM   7278 C  C   . SER F 3 28  ? -78.164  38.949  -44.554 1.00 58.85  ? 27  SER D C   1 
ATOM   7279 O  O   . SER F 3 28  ? -77.393  39.010  -43.587 1.00 62.77  ? 27  SER D O   1 
ATOM   7280 C  CB  . SER F 3 28  ? -77.928  41.296  -45.328 1.00 63.75  ? 27  SER D CB  1 
ATOM   7281 O  OG  . SER F 3 28  ? -77.065  40.908  -46.390 1.00 67.69  ? 27  SER D OG  1 
ATOM   7282 N  N   . ILE F 3 29  ? -78.380  37.840  -45.262 1.00 54.44  ? 28  ILE D N   1 
ATOM   7283 C  CA  . ILE F 3 29  ? -77.657  36.597  -45.014 1.00 53.53  ? 28  ILE D CA  1 
ATOM   7284 C  C   . ILE F 3 29  ? -76.896  36.206  -46.289 1.00 52.11  ? 28  ILE D C   1 
ATOM   7285 O  O   . ILE F 3 29  ? -77.343  36.495  -47.398 1.00 52.89  ? 28  ILE D O   1 
ATOM   7286 C  CB  . ILE F 3 29  ? -78.627  35.510  -44.487 1.00 52.52  ? 28  ILE D CB  1 
ATOM   7287 C  CG1 . ILE F 3 29  ? -79.116  35.910  -43.091 1.00 54.84  ? 28  ILE D CG1 1 
ATOM   7288 C  CG2 . ILE F 3 29  ? -77.973  34.148  -44.386 1.00 50.34  ? 28  ILE D CG2 1 
ATOM   7289 C  CD1 . ILE F 3 29  ? -80.352  35.193  -42.629 1.00 57.62  ? 28  ILE D CD1 1 
ATOM   7290 N  N   . PHE F 3 30  ? -75.722  35.600  -46.109 1.00 50.61  ? 29  PHE D N   1 
ATOM   7291 C  CA  . PHE F 3 30  ? -74.899  35.128  -47.221 1.00 49.54  ? 29  PHE D CA  1 
ATOM   7292 C  C   . PHE F 3 30  ? -75.586  33.907  -47.815 1.00 48.59  ? 29  PHE D C   1 
ATOM   7293 O  O   . PHE F 3 30  ? -76.205  33.135  -47.103 1.00 45.48  ? 29  PHE D O   1 
ATOM   7294 C  CB  . PHE F 3 30  ? -73.465  34.797  -46.742 1.00 48.68  ? 29  PHE D CB  1 
ATOM   7295 C  CG  . PHE F 3 30  ? -72.478  34.475  -47.855 1.00 46.52  ? 29  PHE D CG  1 
ATOM   7296 C  CD1 . PHE F 3 30  ? -72.209  35.410  -48.861 1.00 43.68  ? 29  PHE D CD1 1 
ATOM   7297 C  CD2 . PHE F 3 30  ? -71.776  33.257  -47.868 1.00 45.71  ? 29  PHE D CD2 1 
ATOM   7298 C  CE1 . PHE F 3 30  ? -71.308  35.110  -49.872 1.00 42.79  ? 29  PHE D CE1 1 
ATOM   7299 C  CE2 . PHE F 3 30  ? -70.876  32.966  -48.883 1.00 43.85  ? 29  PHE D CE2 1 
ATOM   7300 C  CZ  . PHE F 3 30  ? -70.634  33.896  -49.874 1.00 43.08  ? 29  PHE D CZ  1 
ATOM   7301 N  N   . ALA F 3 31  ? -75.491  33.764  -49.127 1.00 50.78  ? 30  ALA D N   1 
ATOM   7302 C  CA  . ALA F 3 31  ? -76.072  32.634  -49.837 1.00 53.61  ? 30  ALA D CA  1 
ATOM   7303 C  C   . ALA F 3 31  ? -75.701  31.281  -49.233 1.00 53.12  ? 30  ALA D C   1 
ATOM   7304 O  O   . ALA F 3 31  ? -76.539  30.389  -49.155 1.00 52.76  ? 30  ALA D O   1 
ATOM   7305 C  CB  . ALA F 3 31  ? -75.652  32.677  -51.297 1.00 56.29  ? 30  ALA D CB  1 
ATOM   7306 N  N   . LEU F 3 32  ? -74.446  31.135  -48.832 1.00 53.48  ? 31  LEU D N   1 
ATOM   7307 C  CA  . LEU F 3 32  ? -73.982  29.928  -48.142 1.00 56.57  ? 31  LEU D CA  1 
ATOM   7308 C  C   . LEU F 3 32  ? -74.180  30.062  -46.635 1.00 53.45  ? 31  LEU D C   1 
ATOM   7309 O  O   . LEU F 3 32  ? -73.605  30.962  -46.012 1.00 49.74  ? 31  LEU D O   1 
ATOM   7310 C  CB  . LEU F 3 32  ? -72.505  29.652  -48.469 1.00 59.74  ? 31  LEU D CB  1 
ATOM   7311 C  CG  . LEU F 3 32  ? -72.206  29.442  -49.956 1.00 61.96  ? 31  LEU D CG  1 
ATOM   7312 C  CD1 . LEU F 3 32  ? -70.710  29.290  -50.192 1.00 63.62  ? 31  LEU D CD1 1 
ATOM   7313 C  CD2 . LEU F 3 32  ? -72.943  28.219  -50.498 1.00 62.87  ? 31  LEU D CD2 1 
ATOM   7314 N  N   . ASN F 3 33  ? -75.001  29.171  -46.071 1.00 52.17  ? 32  ASN D N   1 
ATOM   7315 C  CA  . ASN F 3 33  ? -75.377  29.229  -44.656 1.00 50.64  ? 32  ASN D CA  1 
ATOM   7316 C  C   . ASN F 3 33  ? -76.029  27.942  -44.159 1.00 46.86  ? 32  ASN D C   1 
ATOM   7317 O  O   . ASN F 3 33  ? -76.413  27.089  -44.953 1.00 45.58  ? 32  ASN D O   1 
ATOM   7318 C  CB  . ASN F 3 33  ? -76.324  30.408  -44.397 1.00 50.59  ? 32  ASN D CB  1 
ATOM   7319 C  CG  . ASN F 3 33  ? -77.609  30.317  -45.190 1.00 49.08  ? 32  ASN D CG  1 
ATOM   7320 O  OD1 . ASN F 3 33  ? -78.323  29.324  -45.129 1.00 47.39  ? 32  ASN D OD1 1 
ATOM   7321 N  ND2 . ASN F 3 33  ? -77.922  31.372  -45.923 1.00 49.57  ? 32  ASN D ND2 1 
ATOM   7322 N  N   . ILE F 3 34  ? -76.160  27.834  -42.841 1.00 45.19  ? 33  ILE D N   1 
ATOM   7323 C  CA  . ILE F 3 34  ? -76.944  26.778  -42.207 1.00 47.80  ? 33  ILE D CA  1 
ATOM   7324 C  C   . ILE F 3 34  ? -78.034  27.409  -41.348 1.00 48.12  ? 33  ILE D C   1 
ATOM   7325 O  O   . ILE F 3 34  ? -77.729  28.227  -40.477 1.00 46.98  ? 33  ILE D O   1 
ATOM   7326 C  CB  . ILE F 3 34  ? -76.098  25.875  -41.284 1.00 50.02  ? 33  ILE D CB  1 
ATOM   7327 C  CG1 . ILE F 3 34  ? -74.990  25.188  -42.074 1.00 49.70  ? 33  ILE D CG1 1 
ATOM   7328 C  CG2 . ILE F 3 34  ? -76.980  24.828  -40.576 1.00 50.66  ? 33  ILE D CG2 1 
ATOM   7329 C  CD1 . ILE F 3 34  ? -74.017  24.421  -41.202 1.00 49.76  ? 33  ILE D CD1 1 
ATOM   7330 N  N   . MET F 3 35  ? -79.288  27.010  -41.593 1.00 48.87  ? 34  MET D N   1 
ATOM   7331 C  CA  . MET F 3 35  ? -80.419  27.329  -40.710 1.00 46.57  ? 34  MET D CA  1 
ATOM   7332 C  C   . MET F 3 35  ? -80.782  26.082  -39.905 1.00 44.18  ? 34  MET D C   1 
ATOM   7333 O  O   . MET F 3 35  ? -80.853  24.976  -40.452 1.00 44.92  ? 34  MET D O   1 
ATOM   7334 C  CB  . MET F 3 35  ? -81.607  27.821  -41.519 1.00 46.72  ? 34  MET D CB  1 
ATOM   7335 C  CG  . MET F 3 35  ? -81.293  29.072  -42.311 1.00 47.87  ? 34  MET D CG  1 
ATOM   7336 S  SD  . MET F 3 35  ? -82.746  29.831  -43.044 1.00 51.66  ? 34  MET D SD  1 
ATOM   7337 C  CE  . MET F 3 35  ? -83.338  30.838  -41.681 1.00 49.23  ? 34  MET D CE  1 
ATOM   7338 N  N   . GLY F 3 36  ? -80.989  26.262  -38.607 1.00 41.38  ? 35  GLY D N   1 
ATOM   7339 C  CA  . GLY F 3 36  ? -81.175  25.140  -37.700 1.00 41.00  ? 35  GLY D CA  1 
ATOM   7340 C  C   . GLY F 3 36  ? -82.071  25.425  -36.509 1.00 40.87  ? 35  GLY D C   1 
ATOM   7341 O  O   . GLY F 3 36  ? -82.452  26.577  -36.234 1.00 38.95  ? 35  GLY D O   1 
ATOM   7342 N  N   . TRP F 3 37  ? -82.416  24.340  -35.822 1.00 40.27  ? 36  TRP D N   1 
ATOM   7343 C  CA  . TRP F 3 37  ? -83.178  24.386  -34.591 1.00 41.72  ? 36  TRP D CA  1 
ATOM   7344 C  C   . TRP F 3 37  ? -82.380  23.675  -33.522 1.00 41.62  ? 36  TRP D C   1 
ATOM   7345 O  O   . TRP F 3 37  ? -81.897  22.566  -33.737 1.00 39.43  ? 36  TRP D O   1 
ATOM   7346 C  CB  . TRP F 3 37  ? -84.549  23.715  -34.764 1.00 43.11  ? 36  TRP D CB  1 
ATOM   7347 C  CG  . TRP F 3 37  ? -85.487  24.517  -35.600 1.00 44.09  ? 36  TRP D CG  1 
ATOM   7348 C  CD1 . TRP F 3 37  ? -85.735  24.370  -36.936 1.00 44.72  ? 36  TRP D CD1 1 
ATOM   7349 C  CD2 . TRP F 3 37  ? -86.280  25.615  -35.162 1.00 45.37  ? 36  TRP D CD2 1 
ATOM   7350 N  NE1 . TRP F 3 37  ? -86.654  25.305  -37.354 1.00 45.48  ? 36  TRP D NE1 1 
ATOM   7351 C  CE2 . TRP F 3 37  ? -86.997  26.088  -36.285 1.00 45.61  ? 36  TRP D CE2 1 
ATOM   7352 C  CE3 . TRP F 3 37  ? -86.448  26.256  -33.927 1.00 46.91  ? 36  TRP D CE3 1 
ATOM   7353 C  CZ2 . TRP F 3 37  ? -87.880  27.159  -36.208 1.00 46.27  ? 36  TRP D CZ2 1 
ATOM   7354 C  CZ3 . TRP F 3 37  ? -87.328  27.327  -33.846 1.00 47.08  ? 36  TRP D CZ3 1 
ATOM   7355 C  CH2 . TRP F 3 37  ? -88.035  27.770  -34.983 1.00 47.81  ? 36  TRP D CH2 1 
ATOM   7356 N  N   . TYR F 3 38  ? -82.220  24.346  -32.389 1.00 43.98  ? 37  TYR D N   1 
ATOM   7357 C  CA  . TYR F 3 38  ? -81.627  23.783  -31.192 1.00 46.73  ? 37  TYR D CA  1 
ATOM   7358 C  C   . TYR F 3 38  ? -82.671  23.859  -30.087 1.00 49.23  ? 37  TYR D C   1 
ATOM   7359 O  O   . TYR F 3 38  ? -83.638  24.612  -30.197 1.00 50.47  ? 37  TYR D O   1 
ATOM   7360 C  CB  . TYR F 3 38  ? -80.397  24.592  -30.790 1.00 48.11  ? 37  TYR D CB  1 
ATOM   7361 C  CG  . TYR F 3 38  ? -79.219  24.490  -31.740 1.00 48.15  ? 37  TYR D CG  1 
ATOM   7362 C  CD1 . TYR F 3 38  ? -79.217  25.169  -32.962 1.00 49.39  ? 37  TYR D CD1 1 
ATOM   7363 C  CD2 . TYR F 3 38  ? -78.091  23.738  -31.407 1.00 48.39  ? 37  TYR D CD2 1 
ATOM   7364 C  CE1 . TYR F 3 38  ? -78.134  25.085  -33.835 1.00 49.86  ? 37  TYR D CE1 1 
ATOM   7365 C  CE2 . TYR F 3 38  ? -77.004  23.648  -32.273 1.00 49.14  ? 37  TYR D CE2 1 
ATOM   7366 C  CZ  . TYR F 3 38  ? -77.029  24.325  -33.485 1.00 49.20  ? 37  TYR D CZ  1 
ATOM   7367 O  OH  . TYR F 3 38  ? -75.961  24.253  -34.347 1.00 47.08  ? 37  TYR D OH  1 
ATOM   7368 N  N   . ARG F 3 39  ? -82.472  23.094  -29.019 1.00 53.82  ? 38  ARG D N   1 
ATOM   7369 C  CA  . ARG F 3 39  ? -83.382  23.111  -27.877 1.00 58.24  ? 38  ARG D CA  1 
ATOM   7370 C  C   . ARG F 3 39  ? -82.654  22.933  -26.551 1.00 62.13  ? 38  ARG D C   1 
ATOM   7371 O  O   . ARG F 3 39  ? -81.580  22.342  -26.505 1.00 67.78  ? 38  ARG D O   1 
ATOM   7372 C  CB  . ARG F 3 39  ? -84.444  22.021  -28.039 1.00 59.45  ? 38  ARG D CB  1 
ATOM   7373 C  CG  . ARG F 3 39  ? -83.942  20.593  -27.880 1.00 59.86  ? 38  ARG D CG  1 
ATOM   7374 C  CD  . ARG F 3 39  ? -85.087  19.625  -28.078 1.00 61.67  ? 38  ARG D CD  1 
ATOM   7375 N  NE  . ARG F 3 39  ? -84.660  18.236  -27.993 1.00 63.95  ? 38  ARG D NE  1 
ATOM   7376 C  CZ  . ARG F 3 39  ? -85.459  17.191  -28.189 1.00 67.22  ? 38  ARG D CZ  1 
ATOM   7377 N  NH1 . ARG F 3 39  ? -86.749  17.357  -28.482 1.00 68.55  ? 38  ARG D NH1 1 
ATOM   7378 N  NH2 . ARG F 3 39  ? -84.966  15.963  -28.085 1.00 68.90  ? 38  ARG D NH2 1 
ATOM   7379 N  N   . GLN F 3 40  ? -83.261  23.423  -25.477 1.00 67.31  ? 39  GLN D N   1 
ATOM   7380 C  CA  . GLN F 3 40  ? -82.693  23.312  -24.138 1.00 69.36  ? 39  GLN D CA  1 
ATOM   7381 C  C   . GLN F 3 40  ? -83.783  22.944  -23.142 1.00 71.12  ? 39  GLN D C   1 
ATOM   7382 O  O   . GLN F 3 40  ? -84.578  23.799  -22.753 1.00 68.46  ? 39  GLN D O   1 
ATOM   7383 C  CB  . GLN F 3 40  ? -82.032  24.633  -23.754 1.00 71.60  ? 39  GLN D CB  1 
ATOM   7384 C  CG  . GLN F 3 40  ? -81.293  24.594  -22.434 1.00 75.00  ? 39  GLN D CG  1 
ATOM   7385 C  CD  . GLN F 3 40  ? -80.384  25.796  -22.227 1.00 81.39  ? 39  GLN D CD  1 
ATOM   7386 O  OE1 . GLN F 3 40  ? -80.625  26.873  -22.760 1.00 84.57  ? 39  GLN D OE1 1 
ATOM   7387 N  NE2 . GLN F 3 40  ? -79.331  25.613  -21.432 1.00 88.02  ? 39  GLN D NE2 1 
ATOM   7388 N  N   . ALA F 3 41  ? -83.831  21.668  -22.749 1.00 75.21  ? 40  ALA D N   1 
ATOM   7389 C  CA  . ALA F 3 41  ? -84.748  21.195  -21.683 1.00 78.51  ? 40  ALA D CA  1 
ATOM   7390 C  C   . ALA F 3 41  ? -84.341  21.811  -20.321 1.00 82.71  ? 40  ALA D C   1 
ATOM   7391 O  O   . ALA F 3 41  ? -83.160  22.117  -20.118 1.00 86.52  ? 40  ALA D O   1 
ATOM   7392 C  CB  . ALA F 3 41  ? -84.734  19.677  -21.592 1.00 76.15  ? 40  ALA D CB  1 
ATOM   7393 N  N   . PRO F 3 42  ? -85.312  21.997  -19.393 1.00 85.61  ? 41  PRO D N   1 
ATOM   7394 C  CA  . PRO F 3 42  ? -84.967  22.744  -18.179 1.00 84.81  ? 41  PRO D CA  1 
ATOM   7395 C  C   . PRO F 3 42  ? -83.904  22.014  -17.366 1.00 85.72  ? 41  PRO D C   1 
ATOM   7396 O  O   . PRO F 3 42  ? -84.004  20.795  -17.180 1.00 87.23  ? 41  PRO D O   1 
ATOM   7397 C  CB  . PRO F 3 42  ? -86.296  22.828  -17.408 1.00 85.27  ? 41  PRO D CB  1 
ATOM   7398 C  CG  . PRO F 3 42  ? -87.360  22.457  -18.383 1.00 86.63  ? 41  PRO D CG  1 
ATOM   7399 C  CD  . PRO F 3 42  ? -86.710  21.527  -19.365 1.00 88.18  ? 41  PRO D CD  1 
ATOM   7400 N  N   . GLY F 3 43  ? -82.884  22.753  -16.930 1.00 87.66  ? 42  GLY D N   1 
ATOM   7401 C  CA  . GLY F 3 43  ? -81.746  22.178  -16.211 1.00 89.25  ? 42  GLY D CA  1 
ATOM   7402 C  C   . GLY F 3 43  ? -80.935  21.158  -17.003 1.00 88.18  ? 42  GLY D C   1 
ATOM   7403 O  O   . GLY F 3 43  ? -80.404  20.207  -16.436 1.00 90.65  ? 42  GLY D O   1 
ATOM   7404 N  N   . LYS F 3 44  ? -80.857  21.355  -18.320 1.00 83.62  ? 43  LYS D N   1 
ATOM   7405 C  CA  . LYS F 3 44  ? -80.003  20.552  -19.203 1.00 79.03  ? 43  LYS D CA  1 
ATOM   7406 C  C   . LYS F 3 44  ? -79.274  21.491  -20.151 1.00 78.35  ? 43  LYS D C   1 
ATOM   7407 O  O   . LYS F 3 44  ? -79.515  22.703  -20.134 1.00 76.15  ? 43  LYS D O   1 
ATOM   7408 C  CB  . LYS F 3 44  ? -80.825  19.513  -19.978 1.00 75.84  ? 43  LYS D CB  1 
ATOM   7409 C  CG  . LYS F 3 44  ? -81.628  18.591  -19.069 1.00 75.81  ? 43  LYS D CG  1 
ATOM   7410 C  CD  . LYS F 3 44  ? -81.812  17.184  -19.610 1.00 76.11  ? 43  LYS D CD  1 
ATOM   7411 C  CE  . LYS F 3 44  ? -82.331  16.291  -18.489 1.00 78.12  ? 43  LYS D CE  1 
ATOM   7412 N  NZ  . LYS F 3 44  ? -82.557  14.878  -18.899 1.00 79.70  ? 43  LYS D NZ  1 
ATOM   7413 N  N   . GLN F 3 45  ? -78.359  20.940  -20.942 1.00 79.14  ? 44  GLN D N   1 
ATOM   7414 C  CA  . GLN F 3 45  ? -77.613  21.737  -21.905 1.00 80.43  ? 44  GLN D CA  1 
ATOM   7415 C  C   . GLN F 3 45  ? -78.349  21.786  -23.230 1.00 75.14  ? 44  GLN D C   1 
ATOM   7416 O  O   . GLN F 3 45  ? -79.163  20.914  -23.531 1.00 73.33  ? 44  GLN D O   1 
ATOM   7417 C  CB  . GLN F 3 45  ? -76.203  21.178  -22.108 1.00 84.07  ? 44  GLN D CB  1 
ATOM   7418 C  CG  . GLN F 3 45  ? -75.317  21.302  -20.874 1.00 83.83  ? 44  GLN D CG  1 
ATOM   7419 C  CD  . GLN F 3 45  ? -73.830  21.162  -21.176 1.00 85.66  ? 44  GLN D CD  1 
ATOM   7420 O  OE1 . GLN F 3 45  ? -73.366  21.449  -22.282 1.00 83.75  ? 44  GLN D OE1 1 
ATOM   7421 N  NE2 . GLN F 3 45  ? -73.073  20.729  -20.177 1.00 88.70  ? 44  GLN D NE2 1 
ATOM   7422 N  N   . ARG F 3 46  ? -78.038  22.814  -24.013 1.00 73.34  ? 45  ARG D N   1 
ATOM   7423 C  CA  . ARG F 3 46  ? -78.605  22.998  -25.348 1.00 71.96  ? 45  ARG D CA  1 
ATOM   7424 C  C   . ARG F 3 46  ? -78.090  21.905  -26.271 1.00 68.48  ? 45  ARG D C   1 
ATOM   7425 O  O   . ARG F 3 46  ? -76.912  21.551  -26.221 1.00 78.19  ? 45  ARG D O   1 
ATOM   7426 C  CB  . ARG F 3 46  ? -78.203  24.369  -25.890 1.00 73.99  ? 45  ARG D CB  1 
ATOM   7427 C  CG  . ARG F 3 46  ? -78.673  24.712  -27.293 1.00 73.04  ? 45  ARG D CG  1 
ATOM   7428 C  CD  . ARG F 3 46  ? -78.059  26.040  -27.729 1.00 75.64  ? 45  ARG D CD  1 
ATOM   7429 N  NE  . ARG F 3 46  ? -78.750  27.203  -27.151 1.00 75.83  ? 45  ARG D NE  1 
ATOM   7430 C  CZ  . ARG F 3 46  ? -78.303  28.463  -27.197 1.00 75.08  ? 45  ARG D CZ  1 
ATOM   7431 N  NH1 . ARG F 3 46  ? -77.134  28.767  -27.785 1.00 76.50  ? 45  ARG D NH1 1 
ATOM   7432 N  NH2 . ARG F 3 46  ? -79.031  29.436  -26.649 1.00 68.68  ? 45  ARG D NH2 1 
ATOM   7433 N  N   . GLU F 3 47  ? -78.969  21.379  -27.112 1.00 62.36  ? 46  GLU D N   1 
ATOM   7434 C  CA  . GLU F 3 47  ? -78.621  20.317  -28.055 1.00 64.47  ? 46  GLU D CA  1 
ATOM   7435 C  C   . GLU F 3 47  ? -79.178  20.645  -29.431 1.00 62.75  ? 46  GLU D C   1 
ATOM   7436 O  O   . GLU F 3 47  ? -80.185  21.333  -29.551 1.00 65.85  ? 46  GLU D O   1 
ATOM   7437 C  CB  . GLU F 3 47  ? -79.163  18.968  -27.576 1.00 68.70  ? 46  GLU D CB  1 
ATOM   7438 C  CG  . GLU F 3 47  ? -80.674  18.934  -27.365 1.00 76.34  ? 46  GLU D CG  1 
ATOM   7439 C  CD  . GLU F 3 47  ? -81.223  17.559  -27.006 1.00 81.75  ? 46  GLU D CD  1 
ATOM   7440 O  OE1 . GLU F 3 47  ? -80.618  16.529  -27.397 1.00 84.98  ? 46  GLU D OE1 1 
ATOM   7441 O  OE2 . GLU F 3 47  ? -82.274  17.499  -26.328 1.00 87.09  ? 46  GLU D OE2 1 
ATOM   7442 N  N   . LEU F 3 48  ? -78.529  20.140  -30.470 1.00 61.25  ? 47  LEU D N   1 
ATOM   7443 C  CA  . LEU F 3 48  ? -79.032  20.314  -31.826 1.00 59.66  ? 47  LEU D CA  1 
ATOM   7444 C  C   . LEU F 3 48  ? -80.217  19.392  -32.025 1.00 58.00  ? 47  LEU D C   1 
ATOM   7445 O  O   . LEU F 3 48  ? -80.142  18.215  -31.691 1.00 56.03  ? 47  LEU D O   1 
ATOM   7446 C  CB  . LEU F 3 48  ? -77.956  19.989  -32.864 1.00 60.06  ? 47  LEU D CB  1 
ATOM   7447 C  CG  . LEU F 3 48  ? -78.393  20.077  -34.333 1.00 61.44  ? 47  LEU D CG  1 
ATOM   7448 C  CD1 . LEU F 3 48  ? -78.529  21.523  -34.783 1.00 61.09  ? 47  LEU D CD1 1 
ATOM   7449 C  CD2 . LEU F 3 48  ? -77.394  19.355  -35.220 1.00 62.79  ? 47  LEU D CD2 1 
ATOM   7450 N  N   . VAL F 3 49  ? -81.296  19.944  -32.573 1.00 57.40  ? 48  VAL D N   1 
ATOM   7451 C  CA  . VAL F 3 49  ? -82.473  19.177  -32.962 1.00 54.92  ? 48  VAL D CA  1 
ATOM   7452 C  C   . VAL F 3 49  ? -82.308  18.791  -34.421 1.00 51.05  ? 48  VAL D C   1 
ATOM   7453 O  O   . VAL F 3 49  ? -82.244  17.609  -34.749 1.00 48.78  ? 48  VAL D O   1 
ATOM   7454 C  CB  . VAL F 3 49  ? -83.769  19.996  -32.761 1.00 56.19  ? 48  VAL D CB  1 
ATOM   7455 C  CG1 . VAL F 3 49  ? -84.991  19.190  -33.163 1.00 57.82  ? 48  VAL D CG1 1 
ATOM   7456 C  CG2 . VAL F 3 49  ? -83.877  20.475  -31.317 1.00 55.78  ? 48  VAL D CG2 1 
ATOM   7457 N  N   . ALA F 3 50  ? -82.215  19.798  -35.286 1.00 49.38  ? 49  ALA D N   1 
ATOM   7458 C  CA  . ALA F 3 50  ? -82.096  19.585  -36.726 1.00 49.99  ? 49  ALA D CA  1 
ATOM   7459 C  C   . ALA F 3 50  ? -81.583  20.822  -37.455 1.00 50.44  ? 49  ALA D C   1 
ATOM   7460 O  O   . ALA F 3 50  ? -81.785  21.952  -37.002 1.00 50.14  ? 49  ALA D O   1 
ATOM   7461 C  CB  . ALA F 3 50  ? -83.428  19.157  -37.310 1.00 50.15  ? 49  ALA D CB  1 
ATOM   7462 N  N   . ALA F 3 51  ? -80.938  20.586  -38.596 1.00 50.89  ? 50  ALA D N   1 
ATOM   7463 C  CA  . ALA F 3 51  ? -80.277  21.637  -39.365 1.00 51.24  ? 50  ALA D CA  1 
ATOM   7464 C  C   . ALA F 3 51  ? -80.303  21.364  -40.865 1.00 50.74  ? 50  ALA D C   1 
ATOM   7465 O  O   . ALA F 3 51  ? -80.211  20.217  -41.296 1.00 48.66  ? 50  ALA D O   1 
ATOM   7466 C  CB  . ALA F 3 51  ? -78.840  21.771  -38.904 1.00 53.41  ? 50  ALA D CB  1 
ATOM   7467 N  N   . ILE F 3 52  ? -80.400  22.436  -41.646 1.00 52.89  ? 51  ILE D N   1 
ATOM   7468 C  CA  . ILE F 3 52  ? -80.398  22.345  -43.094 1.00 58.06  ? 51  ILE D CA  1 
ATOM   7469 C  C   . ILE F 3 52  ? -79.476  23.407  -43.693 1.00 61.29  ? 51  ILE D C   1 
ATOM   7470 O  O   . ILE F 3 52  ? -79.588  24.599  -43.377 1.00 57.85  ? 51  ILE D O   1 
ATOM   7471 C  CB  . ILE F 3 52  ? -81.831  22.439  -43.680 1.00 61.03  ? 51  ILE D CB  1 
ATOM   7472 C  CG1 . ILE F 3 52  ? -81.799  22.300  -45.210 1.00 62.40  ? 51  ILE D CG1 1 
ATOM   7473 C  CG2 . ILE F 3 52  ? -82.534  23.737  -43.285 1.00 61.77  ? 51  ILE D CG2 1 
ATOM   7474 C  CD1 . ILE F 3 52  ? -83.129  21.921  -45.816 1.00 61.35  ? 51  ILE D CD1 1 
ATOM   7475 N  N   . HIS F 3 53  ? -78.567  22.947  -44.555 1.00 68.20  ? 52  HIS D N   1 
ATOM   7476 C  CA  . HIS F 3 53  ? -77.625  23.806  -45.283 1.00 73.53  ? 52  HIS D CA  1 
ATOM   7477 C  C   . HIS F 3 53  ? -78.313  24.457  -46.487 1.00 73.94  ? 52  HIS D C   1 
ATOM   7478 O  O   . HIS F 3 53  ? -79.358  23.981  -46.935 1.00 78.12  ? 52  HIS D O   1 
ATOM   7479 C  CB  . HIS F 3 53  ? -76.438  22.955  -45.744 1.00 76.58  ? 52  HIS D CB  1 
ATOM   7480 C  CG  . HIS F 3 53  ? -75.301  23.742  -46.319 1.00 81.19  ? 52  HIS D CG  1 
ATOM   7481 N  ND1 . HIS F 3 53  ? -74.898  23.599  -47.630 1.00 80.96  ? 52  HIS D ND1 1 
ATOM   7482 C  CD2 . HIS F 3 53  ? -74.490  24.684  -45.774 1.00 82.97  ? 52  HIS D CD2 1 
ATOM   7483 C  CE1 . HIS F 3 53  ? -73.879  24.409  -47.866 1.00 80.32  ? 52  HIS D CE1 1 
ATOM   7484 N  NE2 . HIS F 3 53  ? -73.618  25.083  -46.758 1.00 81.36  ? 52  HIS D NE2 1 
ATOM   7485 N  N   . SER F 3 54  ? -77.744  25.553  -46.992 1.00 73.24  ? 53  SER D N   1 
ATOM   7486 C  CA  . SER F 3 54  ? -78.261  26.248  -48.187 1.00 71.88  ? 53  SER D CA  1 
ATOM   7487 C  C   . SER F 3 54  ? -78.367  25.339  -49.415 1.00 74.55  ? 53  SER D C   1 
ATOM   7488 O  O   . SER F 3 54  ? -79.306  25.467  -50.207 1.00 71.91  ? 53  SER D O   1 
ATOM   7489 C  CB  . SER F 3 54  ? -77.360  27.434  -48.536 1.00 69.58  ? 53  SER D CB  1 
ATOM   7490 O  OG  . SER F 3 54  ? -76.024  27.016  -48.797 1.00 67.65  ? 53  SER D OG  1 
ATOM   7491 N  N   . GLY F 3 55  ? -77.379  24.453  -49.573 1.00 78.38  ? 54  GLY D N   1 
ATOM   7492 C  CA  . GLY F 3 55  ? -77.394  23.405  -50.591 1.00 81.13  ? 54  GLY D CA  1 
ATOM   7493 C  C   . GLY F 3 55  ? -78.598  22.470  -50.543 1.00 81.37  ? 54  GLY D C   1 
ATOM   7494 O  O   . GLY F 3 55  ? -79.157  22.126  -51.587 1.00 82.81  ? 54  GLY D O   1 
ATOM   7495 N  N   . GLY F 3 56  ? -78.995  22.068  -49.335 1.00 78.17  ? 55  GLY D N   1 
ATOM   7496 C  CA  . GLY F 3 56  ? -80.131  21.154  -49.140 1.00 75.81  ? 55  GLY D CA  1 
ATOM   7497 C  C   . GLY F 3 56  ? -79.857  19.937  -48.273 1.00 74.42  ? 55  GLY D C   1 
ATOM   7498 O  O   . GLY F 3 56  ? -80.801  19.261  -47.845 1.00 72.66  ? 55  GLY D O   1 
ATOM   7499 N  N   . THR F 3 57  ? -78.579  19.647  -48.022 1.00 75.36  ? 56  THR D N   1 
ATOM   7500 C  CA  . THR F 3 57  ? -78.195  18.586  -47.092 1.00 76.48  ? 56  THR D CA  1 
ATOM   7501 C  C   . THR F 3 57  ? -78.728  18.900  -45.686 1.00 74.41  ? 56  THR D C   1 
ATOM   7502 O  O   . THR F 3 57  ? -78.879  20.070  -45.317 1.00 71.67  ? 56  THR D O   1 
ATOM   7503 C  CB  . THR F 3 57  ? -76.655  18.373  -47.063 1.00 77.19  ? 56  THR D CB  1 
ATOM   7504 O  OG1 . THR F 3 57  ? -75.973  19.630  -46.918 1.00 78.82  ? 56  THR D OG1 1 
ATOM   7505 C  CG2 . THR F 3 57  ? -76.193  17.721  -48.345 1.00 76.86  ? 56  THR D CG2 1 
ATOM   7506 N  N   . THR F 3 58  ? -79.028  17.849  -44.927 1.00 72.64  ? 57  THR D N   1 
ATOM   7507 C  CA  . THR F 3 58  ? -79.616  17.984  -43.598 1.00 72.51  ? 57  THR D CA  1 
ATOM   7508 C  C   . THR F 3 58  ? -78.900  17.136  -42.552 1.00 74.27  ? 57  THR D C   1 
ATOM   7509 O  O   . THR F 3 58  ? -78.086  16.269  -42.874 1.00 79.02  ? 57  THR D O   1 
ATOM   7510 C  CB  . THR F 3 58  ? -81.096  17.588  -43.621 1.00 71.09  ? 57  THR D CB  1 
ATOM   7511 O  OG1 . THR F 3 58  ? -81.217  16.272  -44.171 1.00 69.23  ? 57  THR D OG1 1 
ATOM   7512 C  CG2 . THR F 3 58  ? -81.894  18.572  -44.465 1.00 69.29  ? 57  THR D CG2 1 
ATOM   7513 N  N   . ASN F 3 59  ? -79.212  17.412  -41.292 1.00 73.92  ? 58  ASN D N   1 
ATOM   7514 C  CA  . ASN F 3 59  ? -78.567  16.752  -40.163 1.00 72.31  ? 58  ASN D CA  1 
ATOM   7515 C  C   . ASN F 3 59  ? -79.563  16.755  -39.012 1.00 72.78  ? 58  ASN D C   1 
ATOM   7516 O  O   . ASN F 3 59  ? -80.105  17.806  -38.681 1.00 77.19  ? 58  ASN D O   1 
ATOM   7517 C  CB  . ASN F 3 59  ? -77.292  17.518  -39.792 1.00 71.74  ? 58  ASN D CB  1 
ATOM   7518 C  CG  . ASN F 3 59  ? -76.420  16.779  -38.792 1.00 74.76  ? 58  ASN D CG  1 
ATOM   7519 O  OD1 . ASN F 3 59  ? -76.428  15.550  -38.723 1.00 80.63  ? 58  ASN D OD1 1 
ATOM   7520 N  ND2 . ASN F 3 59  ? -75.644  17.531  -38.017 1.00 73.08  ? 58  ASN D ND2 1 
ATOM   7521 N  N   . TYR F 3 60  ? -79.809  15.580  -38.427 1.00 69.14  ? 59  TYR D N   1 
ATOM   7522 C  CA  . TYR F 3 60  ? -80.809  15.402  -37.362 1.00 64.87  ? 59  TYR D CA  1 
ATOM   7523 C  C   . TYR F 3 60  ? -80.204  14.726  -36.139 1.00 65.37  ? 59  TYR D C   1 
ATOM   7524 O  O   . TYR F 3 60  ? -79.383  13.831  -36.279 1.00 65.89  ? 59  TYR D O   1 
ATOM   7525 C  CB  . TYR F 3 60  ? -81.941  14.500  -37.850 1.00 61.44  ? 59  TYR D CB  1 
ATOM   7526 C  CG  . TYR F 3 60  ? -82.825  15.073  -38.929 1.00 60.57  ? 59  TYR D CG  1 
ATOM   7527 C  CD1 . TYR F 3 60  ? -83.959  15.815  -38.605 1.00 59.22  ? 59  TYR D CD1 1 
ATOM   7528 C  CD2 . TYR F 3 60  ? -82.549  14.851  -40.275 1.00 59.46  ? 59  TYR D CD2 1 
ATOM   7529 C  CE1 . TYR F 3 60  ? -84.783  16.330  -39.592 1.00 56.53  ? 59  TYR D CE1 1 
ATOM   7530 C  CE2 . TYR F 3 60  ? -83.370  15.366  -41.266 1.00 57.88  ? 59  TYR D CE2 1 
ATOM   7531 C  CZ  . TYR F 3 60  ? -84.484  16.102  -40.919 1.00 54.88  ? 59  TYR D CZ  1 
ATOM   7532 O  OH  . TYR F 3 60  ? -85.286  16.611  -41.908 1.00 51.28  ? 59  TYR D OH  1 
ATOM   7533 N  N   . ALA F 3 61  ? -80.634  15.128  -34.942 1.00 67.99  ? 60  ALA D N   1 
ATOM   7534 C  CA  . ALA F 3 61  ? -80.319  14.378  -33.709 1.00 69.61  ? 60  ALA D CA  1 
ATOM   7535 C  C   . ALA F 3 61  ? -81.021  13.014  -33.697 1.00 73.43  ? 60  ALA D C   1 
ATOM   7536 O  O   . ALA F 3 61  ? -82.073  12.844  -34.313 1.00 75.79  ? 60  ALA D O   1 
ATOM   7537 C  CB  . ALA F 3 61  ? -80.708  15.169  -32.474 1.00 67.33  ? 60  ALA D CB  1 
ATOM   7538 N  N   . ASN F 3 62  ? -80.438  12.052  -32.990 1.00 76.61  ? 61  ASN D N   1 
ATOM   7539 C  CA  . ASN F 3 62  ? -80.960  10.683  -32.968 1.00 79.13  ? 61  ASN D CA  1 
ATOM   7540 C  C   . ASN F 3 62  ? -82.339  10.582  -32.311 1.00 83.06  ? 61  ASN D C   1 
ATOM   7541 O  O   . ASN F 3 62  ? -83.204  9.850   -32.798 1.00 88.12  ? 61  ASN D O   1 
ATOM   7542 C  CB  . ASN F 3 62  ? -79.974  9.730   -32.275 1.00 79.89  ? 61  ASN D CB  1 
ATOM   7543 C  CG  . ASN F 3 62  ? -78.812  9.344   -33.166 1.00 78.24  ? 61  ASN D CG  1 
ATOM   7544 O  OD1 . ASN F 3 62  ? -78.994  8.665   -34.176 1.00 73.77  ? 61  ASN D OD1 1 
ATOM   7545 N  ND2 . ASN F 3 62  ? -77.610  9.766   -32.790 1.00 78.42  ? 61  ASN D ND2 1 
ATOM   7546 N  N   . SER F 3 63  ? -82.548  11.320  -31.222 1.00 83.69  ? 62  SER D N   1 
ATOM   7547 C  CA  . SER F 3 63  ? -83.838  11.303  -30.522 1.00 85.39  ? 62  SER D CA  1 
ATOM   7548 C  C   . SER F 3 63  ? -85.027  11.723  -31.406 1.00 84.22  ? 62  SER D C   1 
ATOM   7549 O  O   . SER F 3 63  ? -86.126  11.197  -31.232 1.00 86.72  ? 62  SER D O   1 
ATOM   7550 C  CB  . SER F 3 63  ? -83.784  12.170  -29.263 1.00 87.59  ? 62  SER D CB  1 
ATOM   7551 O  OG  . SER F 3 63  ? -83.374  13.491  -29.575 1.00 92.91  ? 62  SER D OG  1 
ATOM   7552 N  N   . VAL F 3 64  ? -84.801  12.636  -32.357 1.00 81.75  ? 63  VAL D N   1 
ATOM   7553 C  CA  . VAL F 3 64  ? -85.872  13.138  -33.245 1.00 79.14  ? 63  VAL D CA  1 
ATOM   7554 C  C   . VAL F 3 64  ? -85.927  12.515  -34.650 1.00 77.17  ? 63  VAL D C   1 
ATOM   7555 O  O   . VAL F 3 64  ? -86.784  12.899  -35.454 1.00 71.82  ? 63  VAL D O   1 
ATOM   7556 C  CB  . VAL F 3 64  ? -85.828  14.685  -33.381 1.00 77.97  ? 63  VAL D CB  1 
ATOM   7557 C  CG1 . VAL F 3 64  ? -85.589  15.343  -32.021 1.00 78.03  ? 63  VAL D CG1 1 
ATOM   7558 C  CG2 . VAL F 3 64  ? -84.790  15.147  -34.397 1.00 77.95  ? 63  VAL D CG2 1 
ATOM   7559 N  N   . LYS F 3 65  ? -85.016  11.584  -34.949 1.00 80.36  ? 64  LYS D N   1 
ATOM   7560 C  CA  . LYS F 3 65  ? -84.976  10.950  -36.275 1.00 84.23  ? 64  LYS D CA  1 
ATOM   7561 C  C   . LYS F 3 65  ? -86.257  10.173  -36.544 1.00 81.70  ? 64  LYS D C   1 
ATOM   7562 O  O   . LYS F 3 65  ? -86.791  9.517   -35.645 1.00 80.05  ? 64  LYS D O   1 
ATOM   7563 C  CB  . LYS F 3 65  ? -83.763  10.021  -36.434 1.00 87.28  ? 64  LYS D CB  1 
ATOM   7564 C  CG  . LYS F 3 65  ? -82.512  10.722  -36.936 1.00 91.45  ? 64  LYS D CG  1 
ATOM   7565 C  CD  . LYS F 3 65  ? -81.295  9.810   -36.924 1.00 93.61  ? 64  LYS D CD  1 
ATOM   7566 C  CE  . LYS F 3 65  ? -80.008  10.604  -37.086 1.00 89.53  ? 64  LYS D CE  1 
ATOM   7567 N  NZ  . LYS F 3 65  ? -78.825  9.716   -37.186 1.00 87.73  ? 64  LYS D NZ  1 
ATOM   7568 N  N   . GLY F 3 66  ? -86.752  10.282  -37.779 1.00 78.49  ? 65  GLY D N   1 
ATOM   7569 C  CA  . GLY F 3 66  ? -88.007  9.656   -38.173 1.00 77.85  ? 65  GLY D CA  1 
ATOM   7570 C  C   . GLY F 3 66  ? -89.275  10.369  -37.719 1.00 72.33  ? 65  GLY D C   1 
ATOM   7571 O  O   . GLY F 3 66  ? -90.369  9.984   -38.128 1.00 69.74  ? 65  GLY D O   1 
ATOM   7572 N  N   . ARG F 3 67  ? -89.135  11.407  -36.890 1.00 67.03  ? 66  ARG D N   1 
ATOM   7573 C  CA  . ARG F 3 67  ? -90.269  12.151  -36.353 1.00 64.87  ? 66  ARG D CA  1 
ATOM   7574 C  C   . ARG F 3 67  ? -90.270  13.586  -36.852 1.00 63.46  ? 66  ARG D C   1 
ATOM   7575 O  O   . ARG F 3 67  ? -91.249  14.034  -37.462 1.00 64.76  ? 66  ARG D O   1 
ATOM   7576 C  CB  . ARG F 3 67  ? -90.218  12.123  -34.836 1.00 64.49  ? 66  ARG D CB  1 
ATOM   7577 C  CG  . ARG F 3 67  ? -90.341  10.720  -34.289 1.00 67.20  ? 66  ARG D CG  1 
ATOM   7578 C  CD  . ARG F 3 67  ? -90.626  10.724  -32.804 1.00 71.14  ? 66  ARG D CD  1 
ATOM   7579 N  NE  . ARG F 3 67  ? -89.545  11.364  -32.049 1.00 74.61  ? 66  ARG D NE  1 
ATOM   7580 C  CZ  . ARG F 3 67  ? -89.691  12.329  -31.133 1.00 80.64  ? 66  ARG D CZ  1 
ATOM   7581 N  NH1 . ARG F 3 67  ? -90.892  12.816  -30.792 1.00 82.31  ? 66  ARG D NH1 1 
ATOM   7582 N  NH2 . ARG F 3 67  ? -88.606  12.812  -30.533 1.00 84.03  ? 66  ARG D NH2 1 
ATOM   7583 N  N   . PHE F 3 68  ? -89.172  14.299  -36.593 1.00 58.69  ? 67  PHE D N   1 
ATOM   7584 C  CA  . PHE F 3 68  ? -89.047  15.704  -36.980 1.00 53.20  ? 67  PHE D CA  1 
ATOM   7585 C  C   . PHE F 3 68  ? -88.492  15.780  -38.397 1.00 51.31  ? 67  PHE D C   1 
ATOM   7586 O  O   . PHE F 3 68  ? -87.751  14.895  -38.821 1.00 54.33  ? 67  PHE D O   1 
ATOM   7587 C  CB  . PHE F 3 68  ? -88.136  16.465  -36.013 1.00 51.04  ? 67  PHE D CB  1 
ATOM   7588 C  CG  . PHE F 3 68  ? -88.678  16.604  -34.603 1.00 50.93  ? 67  PHE D CG  1 
ATOM   7589 C  CD1 . PHE F 3 68  ? -89.811  15.913  -34.153 1.00 52.58  ? 67  PHE D CD1 1 
ATOM   7590 C  CD2 . PHE F 3 68  ? -88.006  17.409  -33.692 1.00 49.44  ? 67  PHE D CD2 1 
ATOM   7591 C  CE1 . PHE F 3 68  ? -90.260  16.058  -32.849 1.00 52.52  ? 67  PHE D CE1 1 
ATOM   7592 C  CE2 . PHE F 3 68  ? -88.448  17.546  -32.385 1.00 48.48  ? 67  PHE D CE2 1 
ATOM   7593 C  CZ  . PHE F 3 68  ? -89.576  16.870  -31.963 1.00 49.83  ? 67  PHE D CZ  1 
ATOM   7594 N  N   . THR F 3 69  ? -88.878  16.826  -39.123 1.00 49.53  ? 68  THR D N   1 
ATOM   7595 C  CA  . THR F 3 69  ? -88.424  17.071  -40.492 1.00 50.42  ? 68  THR D CA  1 
ATOM   7596 C  C   . THR F 3 69  ? -88.163  18.563  -40.696 1.00 53.63  ? 68  THR D C   1 
ATOM   7597 O  O   . THR F 3 69  ? -89.044  19.402  -40.468 1.00 54.85  ? 68  THR D O   1 
ATOM   7598 C  CB  . THR F 3 69  ? -89.448  16.564  -41.521 1.00 50.20  ? 68  THR D CB  1 
ATOM   7599 O  OG1 . THR F 3 69  ? -89.521  15.141  -41.417 1.00 50.83  ? 68  THR D OG1 1 
ATOM   7600 C  CG2 . THR F 3 69  ? -89.057  16.930  -42.951 1.00 49.16  ? 68  THR D CG2 1 
ATOM   7601 N  N   . ILE F 3 70  ? -86.951  18.876  -41.152 1.00 55.21  ? 69  ILE D N   1 
ATOM   7602 C  CA  . ILE F 3 70  ? -86.523  20.258  -41.370 1.00 51.99  ? 69  ILE D CA  1 
ATOM   7603 C  C   . ILE F 3 70  ? -86.499  20.536  -42.867 1.00 48.49  ? 69  ILE D C   1 
ATOM   7604 O  O   . ILE F 3 70  ? -86.116  19.688  -43.660 1.00 46.01  ? 69  ILE D O   1 
ATOM   7605 C  CB  . ILE F 3 70  ? -85.173  20.574  -40.672 1.00 52.60  ? 69  ILE D CB  1 
ATOM   7606 C  CG1 . ILE F 3 70  ? -84.891  22.079  -40.686 1.00 52.06  ? 69  ILE D CG1 1 
ATOM   7607 C  CG2 . ILE F 3 70  ? -84.010  19.812  -41.296 1.00 54.23  ? 69  ILE D CG2 1 
ATOM   7608 C  CD1 . ILE F 3 70  ? -83.806  22.498  -39.705 1.00 50.45  ? 69  ILE D CD1 1 
ATOM   7609 N  N   . SER F 3 71  ? -86.944  21.721  -43.233 1.00 47.50  ? 70  SER D N   1 
ATOM   7610 C  CA  . SER F 3 71  ? -87.050  22.112  -44.621 1.00 50.79  ? 70  SER D CA  1 
ATOM   7611 C  C   . SER F 3 71  ? -86.985  23.606  -44.624 1.00 52.79  ? 70  SER D C   1 
ATOM   7612 O  O   . SER F 3 71  ? -87.237  24.221  -43.587 1.00 51.29  ? 70  SER D O   1 
ATOM   7613 C  CB  . SER F 3 71  ? -88.385  21.656  -45.198 1.00 53.29  ? 70  SER D CB  1 
ATOM   7614 O  OG  . SER F 3 71  ? -89.486  22.190  -44.466 1.00 56.23  ? 70  SER D OG  1 
ATOM   7615 N  N   . ARG F 3 72  ? -86.642  24.196  -45.760 1.00 59.45  ? 71  ARG D N   1 
ATOM   7616 C  CA  . ARG F 3 72  ? -86.514  25.640  -45.822 1.00 67.98  ? 71  ARG D CA  1 
ATOM   7617 C  C   . ARG F 3 72  ? -87.220  26.205  -47.025 1.00 70.87  ? 71  ARG D C   1 
ATOM   7618 O  O   . ARG F 3 72  ? -87.355  25.539  -48.046 1.00 65.44  ? 71  ARG D O   1 
ATOM   7619 C  CB  . ARG F 3 72  ? -85.034  26.085  -45.789 1.00 74.05  ? 71  ARG D CB  1 
ATOM   7620 C  CG  . ARG F 3 72  ? -84.152  25.669  -46.967 1.00 76.33  ? 71  ARG D CG  1 
ATOM   7621 C  CD  . ARG F 3 72  ? -82.694  26.066  -46.734 1.00 75.42  ? 71  ARG D CD  1 
ATOM   7622 N  NE  . ARG F 3 72  ? -82.547  27.525  -46.626 1.00 75.31  ? 71  ARG D NE  1 
ATOM   7623 C  CZ  . ARG F 3 72  ? -81.511  28.169  -46.082 1.00 76.12  ? 71  ARG D CZ  1 
ATOM   7624 N  NH1 . ARG F 3 72  ? -81.534  29.504  -46.050 1.00 72.89  ? 71  ARG D NH1 1 
ATOM   7625 N  NH2 . ARG F 3 72  ? -80.459  27.500  -45.564 1.00 78.84  ? 71  ARG D NH2 1 
ATOM   7626 N  N   . ASP F 3 73  ? -87.685  27.443  -46.869 1.00 81.79  ? 72  ASP D N   1 
ATOM   7627 C  CA  . ASP F 3 73  ? -88.318  28.179  -47.947 1.00 90.48  ? 72  ASP D CA  1 
ATOM   7628 C  C   . ASP F 3 73  ? -87.250  28.475  -49.000 1.00 96.75  ? 72  ASP D C   1 
ATOM   7629 O  O   . ASP F 3 73  ? -86.180  29.008  -48.682 1.00 105.73 ? 72  ASP D O   1 
ATOM   7630 C  CB  . ASP F 3 73  ? -88.954  29.476  -47.420 1.00 94.40  ? 72  ASP D CB  1 
ATOM   7631 C  CG  . ASP F 3 73  ? -89.893  30.142  -48.436 1.00 100.16 ? 72  ASP D CG  1 
ATOM   7632 O  OD1 . ASP F 3 73  ? -90.100  29.603  -49.549 1.00 106.55 ? 72  ASP D OD1 1 
ATOM   7633 O  OD2 . ASP F 3 73  ? -90.438  31.220  -48.114 1.00 102.97 ? 72  ASP D OD2 1 
ATOM   7634 N  N   . ASN F 3 74  ? -87.542  28.081  -50.232 1.00 98.51  ? 73  ASN D N   1 
ATOM   7635 C  CA  . ASN F 3 74  ? -86.635  28.302  -51.376 1.00 95.47  ? 73  ASN D CA  1 
ATOM   7636 C  C   . ASN F 3 74  ? -86.403  29.797  -51.683 1.00 96.88  ? 73  ASN D C   1 
ATOM   7637 O  O   . ASN F 3 74  ? -85.273  30.202  -51.965 1.00 97.75  ? 73  ASN D O   1 
ATOM   7638 C  CB  . ASN F 3 74  ? -87.142  27.527  -52.615 1.00 88.42  ? 73  ASN D CB  1 
ATOM   7639 C  CG  . ASN F 3 74  ? -88.655  27.608  -52.792 1.00 83.21  ? 73  ASN D CG  1 
ATOM   7640 O  OD1 . ASN F 3 74  ? -89.310  28.519  -52.292 1.00 75.21  ? 73  ASN D OD1 1 
ATOM   7641 N  ND2 . ASN F 3 74  ? -89.211  26.646  -53.500 1.00 84.63  ? 73  ASN D ND2 1 
ATOM   7642 N  N   . ALA F 3 75  ? -87.464  30.602  -51.599 1.00 93.19  ? 74  ALA D N   1 
ATOM   7643 C  CA  . ALA F 3 75  ? -87.371  32.058  -51.817 1.00 85.68  ? 74  ALA D CA  1 
ATOM   7644 C  C   . ALA F 3 75  ? -86.777  32.751  -50.596 1.00 82.60  ? 74  ALA D C   1 
ATOM   7645 O  O   . ALA F 3 75  ? -85.604  33.127  -50.610 1.00 76.33  ? 74  ALA D O   1 
ATOM   7646 C  CB  . ALA F 3 75  ? -88.734  32.652  -52.188 1.00 81.51  ? 74  ALA D CB  1 
ATOM   7647 N  N   . ALA F 3 76  ? -87.575  32.872  -49.528 1.00 84.72  ? 75  ALA D N   1 
ATOM   7648 C  CA  . ALA F 3 76  ? -87.186  33.638  -48.327 1.00 81.49  ? 75  ALA D CA  1 
ATOM   7649 C  C   . ALA F 3 76  ? -86.242  32.872  -47.400 1.00 76.23  ? 75  ALA D C   1 
ATOM   7650 O  O   . ALA F 3 76  ? -86.079  31.660  -47.500 1.00 76.62  ? 75  ALA D O   1 
ATOM   7651 C  CB  . ALA F 3 76  ? -88.428  34.071  -47.556 1.00 82.55  ? 75  ALA D CB  1 
ATOM   7652 N  N   . ASN F 3 77  ? -85.609  33.617  -46.499 1.00 70.73  ? 76  ASN D N   1 
ATOM   7653 C  CA  . ASN F 3 77  ? -84.809  33.034  -45.425 1.00 67.58  ? 76  ASN D CA  1 
ATOM   7654 C  C   . ASN F 3 77  ? -85.737  32.581  -44.309 1.00 64.78  ? 76  ASN D C   1 
ATOM   7655 O  O   . ASN F 3 77  ? -85.846  33.250  -43.271 1.00 63.71  ? 76  ASN D O   1 
ATOM   7656 C  CB  . ASN F 3 77  ? -83.801  34.054  -44.881 1.00 67.83  ? 76  ASN D CB  1 
ATOM   7657 C  CG  . ASN F 3 77  ? -82.700  34.370  -45.866 1.00 66.07  ? 76  ASN D CG  1 
ATOM   7658 O  OD1 . ASN F 3 77  ? -82.208  33.479  -46.556 1.00 67.10  ? 76  ASN D OD1 1 
ATOM   7659 N  ND2 . ASN F 3 77  ? -82.281  35.633  -45.907 1.00 63.68  ? 76  ASN D ND2 1 
ATOM   7660 N  N   . THR F 3 78  ? -86.415  31.453  -44.530 1.00 60.90  ? 77  THR D N   1 
ATOM   7661 C  CA  . THR F 3 78  ? -87.322  30.879  -43.528 1.00 56.13  ? 77  THR D CA  1 
ATOM   7662 C  C   . THR F 3 78  ? -87.136  29.371  -43.450 1.00 50.84  ? 77  THR D C   1 
ATOM   7663 O  O   . THR F 3 78  ? -87.104  28.701  -44.474 1.00 51.04  ? 77  THR D O   1 
ATOM   7664 C  CB  . THR F 3 78  ? -88.798  31.211  -43.833 1.00 57.69  ? 77  THR D CB  1 
ATOM   7665 O  OG1 . THR F 3 78  ? -88.970  32.637  -43.906 1.00 56.08  ? 77  THR D OG1 1 
ATOM   7666 C  CG2 . THR F 3 78  ? -89.709  30.663  -42.739 1.00 58.72  ? 77  THR D CG2 1 
ATOM   7667 N  N   . VAL F 3 79  ? -87.033  28.853  -42.231 1.00 46.67  ? 78  VAL D N   1 
ATOM   7668 C  CA  . VAL F 3 79  ? -86.786  27.436  -42.003 1.00 45.84  ? 78  VAL D CA  1 
ATOM   7669 C  C   . VAL F 3 79  ? -87.907  26.882  -41.134 1.00 45.17  ? 78  VAL D C   1 
ATOM   7670 O  O   . VAL F 3 79  ? -88.318  27.527  -40.159 1.00 42.30  ? 78  VAL D O   1 
ATOM   7671 C  CB  . VAL F 3 79  ? -85.394  27.187  -41.374 1.00 46.14  ? 78  VAL D CB  1 
ATOM   7672 C  CG1 . VAL F 3 79  ? -85.243  27.858  -40.012 1.00 47.78  ? 78  VAL D CG1 1 
ATOM   7673 C  CG2 . VAL F 3 79  ? -85.113  25.701  -41.246 1.00 45.79  ? 78  VAL D CG2 1 
ATOM   7674 N  N   . TYR F 3 80  ? -88.386  25.693  -41.505 1.00 46.26  ? 79  TYR D N   1 
ATOM   7675 C  CA  . TYR F 3 80  ? -89.532  25.045  -40.871 1.00 46.12  ? 79  TYR D CA  1 
ATOM   7676 C  C   . TYR F 3 80  ? -89.113  23.730  -40.228 1.00 45.22  ? 79  TYR D C   1 
ATOM   7677 O  O   . TYR F 3 80  ? -88.442  22.930  -40.866 1.00 41.72  ? 79  TYR D O   1 
ATOM   7678 C  CB  . TYR F 3 80  ? -90.614  24.736  -41.915 1.00 47.36  ? 79  TYR D CB  1 
ATOM   7679 C  CG  . TYR F 3 80  ? -91.121  25.928  -42.709 1.00 48.50  ? 79  TYR D CG  1 
ATOM   7680 C  CD1 . TYR F 3 80  ? -91.983  26.870  -42.127 1.00 49.26  ? 79  TYR D CD1 1 
ATOM   7681 C  CD2 . TYR F 3 80  ? -90.769  26.099  -44.050 1.00 48.51  ? 79  TYR D CD2 1 
ATOM   7682 C  CE1 . TYR F 3 80  ? -92.465  27.956  -42.854 1.00 49.23  ? 79  TYR D CE1 1 
ATOM   7683 C  CE2 . TYR F 3 80  ? -91.235  27.183  -44.789 1.00 49.61  ? 79  TYR D CE2 1 
ATOM   7684 C  CZ  . TYR F 3 80  ? -92.084  28.114  -44.191 1.00 50.19  ? 79  TYR D CZ  1 
ATOM   7685 O  OH  . TYR F 3 80  ? -92.547  29.195  -44.917 1.00 51.46  ? 79  TYR D OH  1 
ATOM   7686 N  N   . LEU F 3 81  ? -89.523  23.506  -38.980 1.00 47.81  ? 80  LEU D N   1 
ATOM   7687 C  CA  . LEU F 3 81  ? -89.381  22.198  -38.333 1.00 49.62  ? 80  LEU D CA  1 
ATOM   7688 C  C   . LEU F 3 81  ? -90.764  21.602  -38.091 1.00 52.27  ? 80  LEU D C   1 
ATOM   7689 O  O   . LEU F 3 81  ? -91.515  22.083  -37.240 1.00 53.58  ? 80  LEU D O   1 
ATOM   7690 C  CB  . LEU F 3 81  ? -88.646  22.311  -37.005 1.00 48.31  ? 80  LEU D CB  1 
ATOM   7691 C  CG  . LEU F 3 81  ? -88.302  20.991  -36.312 1.00 47.85  ? 80  LEU D CG  1 
ATOM   7692 C  CD1 . LEU F 3 81  ? -87.208  20.272  -37.095 1.00 47.65  ? 80  LEU D CD1 1 
ATOM   7693 C  CD2 . LEU F 3 81  ? -87.897  21.228  -34.861 1.00 46.84  ? 80  LEU D CD2 1 
ATOM   7694 N  N   . GLN F 3 82  ? -91.079  20.549  -38.837 1.00 52.46  ? 81  GLN D N   1 
ATOM   7695 C  CA  . GLN F 3 82  ? -92.336  19.835  -38.712 1.00 51.67  ? 81  GLN D CA  1 
ATOM   7696 C  C   . GLN F 3 82  ? -92.171  18.734  -37.674 1.00 52.74  ? 81  GLN D C   1 
ATOM   7697 O  O   . GLN F 3 82  ? -91.598  17.692  -37.984 1.00 55.01  ? 81  GLN D O   1 
ATOM   7698 C  CB  . GLN F 3 82  ? -92.709  19.241  -40.078 1.00 52.76  ? 81  GLN D CB  1 
ATOM   7699 C  CG  . GLN F 3 82  ? -93.966  18.386  -40.105 1.00 55.18  ? 81  GLN D CG  1 
ATOM   7700 C  CD  . GLN F 3 82  ? -95.207  19.173  -39.745 1.00 54.41  ? 81  GLN D CD  1 
ATOM   7701 O  OE1 . GLN F 3 82  ? -95.478  20.238  -40.329 1.00 53.92  ? 81  GLN D OE1 1 
ATOM   7702 N  NE2 . GLN F 3 82  ? -95.970  18.658  -38.786 1.00 53.61  ? 81  GLN D NE2 1 
ATOM   7703 N  N   . MET F 3 83  ? -92.675  18.960  -36.461 1.00 52.55  ? 82  MET D N   1 
ATOM   7704 C  CA  . MET F 3 83  ? -92.516  18.009  -35.349 1.00 52.93  ? 82  MET D CA  1 
ATOM   7705 C  C   . MET F 3 83  ? -93.747  17.116  -35.204 1.00 55.67  ? 82  MET D C   1 
ATOM   7706 O  O   . MET F 3 83  ? -94.791  17.600  -34.793 1.00 59.90  ? 82  MET D O   1 
ATOM   7707 C  CB  . MET F 3 83  ? -92.299  18.766  -34.040 1.00 50.99  ? 82  MET D CB  1 
ATOM   7708 C  CG  . MET F 3 83  ? -91.075  19.640  -34.036 1.00 50.37  ? 82  MET D CG  1 
ATOM   7709 S  SD  . MET F 3 83  ? -90.802  20.358  -32.405 1.00 51.60  ? 82  MET D SD  1 
ATOM   7710 C  CE  . MET F 3 83  ? -92.065  21.607  -32.398 1.00 51.85  ? 82  MET D CE  1 
ATOM   7711 N  N   . ASN F 3 84  ? -93.622  15.830  -35.542 1.00 56.14  ? 83  ASN D N   1 
ATOM   7712 C  CA  . ASN F 3 84  ? -94.709  14.836  -35.391 1.00 54.87  ? 83  ASN D CA  1 
ATOM   7713 C  C   . ASN F 3 84  ? -94.368  13.818  -34.306 1.00 56.94  ? 83  ASN D C   1 
ATOM   7714 O  O   . ASN F 3 84  ? -93.216  13.729  -33.883 1.00 66.28  ? 83  ASN D O   1 
ATOM   7715 C  CB  . ASN F 3 84  ? -94.957  14.108  -36.712 1.00 51.33  ? 83  ASN D CB  1 
ATOM   7716 C  CG  . ASN F 3 84  ? -95.333  15.053  -37.833 1.00 50.43  ? 83  ASN D CG  1 
ATOM   7717 O  OD1 . ASN F 3 84  ? -95.601  16.230  -37.616 1.00 47.15  ? 83  ASN D OD1 1 
ATOM   7718 N  ND2 . ASN F 3 84  ? -95.344  14.539  -39.046 1.00 53.28  ? 83  ASN D ND2 1 
ATOM   7719 N  N   . SER F 3 85  ? -95.371  13.055  -33.870 1.00 56.48  ? 84  SER D N   1 
ATOM   7720 C  CA  . SER F 3 85  ? -95.222  12.007  -32.833 1.00 57.64  ? 84  SER D CA  1 
ATOM   7721 C  C   . SER F 3 85  ? -94.586  12.533  -31.540 1.00 57.72  ? 84  SER D C   1 
ATOM   7722 O  O   . SER F 3 85  ? -93.732  11.871  -30.935 1.00 54.94  ? 84  SER D O   1 
ATOM   7723 C  CB  . SER F 3 85  ? -94.426  10.804  -33.368 1.00 58.56  ? 84  SER D CB  1 
ATOM   7724 O  OG  . SER F 3 85  ? -95.045  10.227  -34.504 1.00 58.58  ? 84  SER D OG  1 
ATOM   7725 N  N   . LEU F 3 86  ? -95.019  13.721  -31.123 1.00 59.21  ? 85  LEU D N   1 
ATOM   7726 C  CA  . LEU F 3 86  ? -94.401  14.413  -29.994 1.00 63.30  ? 85  LEU D CA  1 
ATOM   7727 C  C   . LEU F 3 86  ? -94.516  13.622  -28.696 1.00 65.44  ? 85  LEU D C   1 
ATOM   7728 O  O   . LEU F 3 86  ? -95.462  12.867  -28.511 1.00 70.98  ? 85  LEU D O   1 
ATOM   7729 C  CB  . LEU F 3 86  ? -95.010  15.806  -29.817 1.00 63.50  ? 85  LEU D CB  1 
ATOM   7730 C  CG  . LEU F 3 86  ? -94.557  16.858  -30.840 1.00 64.78  ? 85  LEU D CG  1 
ATOM   7731 C  CD1 . LEU F 3 86  ? -95.407  18.112  -30.709 1.00 65.99  ? 85  LEU D CD1 1 
ATOM   7732 C  CD2 . LEU F 3 86  ? -93.081  17.200  -30.671 1.00 64.34  ? 85  LEU D CD2 1 
ATOM   7733 N  N   . LYS F 3 87  ? -93.534  13.798  -27.818 1.00 69.07  ? 86  LYS D N   1 
ATOM   7734 C  CA  . LYS F 3 87  ? -93.469  13.109  -26.531 1.00 71.54  ? 86  LYS D CA  1 
ATOM   7735 C  C   . LYS F 3 87  ? -93.148  14.127  -25.459 1.00 69.99  ? 86  LYS D C   1 
ATOM   7736 O  O   . LYS F 3 87  ? -92.594  15.173  -25.767 1.00 66.36  ? 86  LYS D O   1 
ATOM   7737 C  CB  . LYS F 3 87  ? -92.370  12.051  -26.563 1.00 78.84  ? 86  LYS D CB  1 
ATOM   7738 C  CG  . LYS F 3 87  ? -92.488  11.079  -27.724 1.00 84.36  ? 86  LYS D CG  1 
ATOM   7739 C  CD  . LYS F 3 87  ? -91.467  9.960   -27.569 1.00 88.64  ? 86  LYS D CD  1 
ATOM   7740 C  CE  . LYS F 3 87  ? -91.443  9.027   -28.763 1.00 92.02  ? 86  LYS D CE  1 
ATOM   7741 N  NZ  . LYS F 3 87  ? -90.533  7.881   -28.501 1.00 93.05  ? 86  LYS D NZ  1 
ATOM   7742 N  N   . PRO F 3 88  ? -93.470  13.828  -24.190 1.00 75.43  ? 87  PRO D N   1 
ATOM   7743 C  CA  . PRO F 3 88  ? -93.119  14.778  -23.119 1.00 80.36  ? 87  PRO D CA  1 
ATOM   7744 C  C   . PRO F 3 88  ? -91.609  15.055  -22.981 1.00 80.66  ? 87  PRO D C   1 
ATOM   7745 O  O   . PRO F 3 88  ? -91.219  16.117  -22.485 1.00 78.75  ? 87  PRO D O   1 
ATOM   7746 C  CB  . PRO F 3 88  ? -93.687  14.115  -21.852 1.00 82.06  ? 87  PRO D CB  1 
ATOM   7747 C  CG  . PRO F 3 88  ? -93.877  12.679  -22.206 1.00 81.35  ? 87  PRO D CG  1 
ATOM   7748 C  CD  . PRO F 3 88  ? -94.208  12.665  -23.666 1.00 78.96  ? 87  PRO D CD  1 
ATOM   7749 N  N   . GLU F 3 89  ? -90.786  14.109  -23.436 1.00 81.28  ? 88  GLU D N   1 
ATOM   7750 C  CA  . GLU F 3 89  ? -89.333  14.271  -23.460 1.00 81.25  ? 88  GLU D CA  1 
ATOM   7751 C  C   . GLU F 3 89  ? -88.874  15.455  -24.333 1.00 74.35  ? 88  GLU D C   1 
ATOM   7752 O  O   . GLU F 3 89  ? -87.874  16.093  -24.012 1.00 73.58  ? 88  GLU D O   1 
ATOM   7753 C  CB  . GLU F 3 89  ? -88.677  12.986  -23.932 1.00 90.90  ? 88  GLU D CB  1 
ATOM   7754 C  CG  . GLU F 3 89  ? -88.936  11.802  -23.001 1.00 99.63  ? 88  GLU D CG  1 
ATOM   7755 C  CD  . GLU F 3 89  ? -89.077  10.473  -23.717 1.00 108.68 ? 88  GLU D CD  1 
ATOM   7756 O  OE1 . GLU F 3 89  ? -89.395  10.393  -24.932 1.00 112.28 ? 88  GLU D OE1 1 
ATOM   7757 O  OE2 . GLU F 3 89  ? -88.864  9.452   -23.038 1.00 115.71 ? 88  GLU D OE2 1 
ATOM   7758 N  N   . ASP F 3 90  ? -89.616  15.758  -25.401 1.00 68.14  ? 89  ASP D N   1 
ATOM   7759 C  CA  . ASP F 3 90  ? -89.290  16.882  -26.308 1.00 62.65  ? 89  ASP D CA  1 
ATOM   7760 C  C   . ASP F 3 90  ? -89.553  18.282  -25.735 1.00 54.85  ? 89  ASP D C   1 
ATOM   7761 O  O   . ASP F 3 90  ? -89.217  19.282  -26.364 1.00 49.10  ? 89  ASP D O   1 
ATOM   7762 C  CB  . ASP F 3 90  ? -90.073  16.768  -27.626 1.00 63.54  ? 89  ASP D CB  1 
ATOM   7763 C  CG  . ASP F 3 90  ? -89.794  15.480  -28.373 1.00 64.74  ? 89  ASP D CG  1 
ATOM   7764 O  OD1 . ASP F 3 90  ? -88.602  15.143  -28.566 1.00 61.76  ? 89  ASP D OD1 1 
ATOM   7765 O  OD2 . ASP F 3 90  ? -90.776  14.819  -28.786 1.00 64.53  ? 89  ASP D OD2 1 
ATOM   7766 N  N   . THR F 3 91  ? -90.194  18.356  -24.574 1.00 51.88  ? 90  THR D N   1 
ATOM   7767 C  CA  . THR F 3 91  ? -90.470  19.631  -23.930 1.00 52.18  ? 90  THR D CA  1 
ATOM   7768 C  C   . THR F 3 91  ? -89.180  20.410  -23.680 1.00 52.79  ? 90  THR D C   1 
ATOM   7769 O  O   . THR F 3 91  ? -88.298  19.960  -22.938 1.00 54.20  ? 90  THR D O   1 
ATOM   7770 C  CB  . THR F 3 91  ? -91.215  19.426  -22.598 1.00 52.70  ? 90  THR D CB  1 
ATOM   7771 O  OG1 . THR F 3 91  ? -92.424  18.688  -22.836 1.00 54.19  ? 90  THR D OG1 1 
ATOM   7772 C  CG2 . THR F 3 91  ? -91.539  20.769  -21.922 1.00 52.63  ? 90  THR D CG2 1 
ATOM   7773 N  N   . ALA F 3 92  ? -89.078  21.570  -24.318 1.00 52.65  ? 91  ALA D N   1 
ATOM   7774 C  CA  . ALA F 3 92  ? -87.939  22.467  -24.133 1.00 52.64  ? 91  ALA D CA  1 
ATOM   7775 C  C   . ALA F 3 92  ? -88.199  23.840  -24.763 1.00 50.85  ? 91  ALA D C   1 
ATOM   7776 O  O   . ALA F 3 92  ? -89.195  24.043  -25.464 1.00 54.74  ? 91  ALA D O   1 
ATOM   7777 C  CB  . ALA F 3 92  ? -86.681  21.840  -24.731 1.00 53.62  ? 91  ALA D CB  1 
ATOM   7778 N  N   . VAL F 3 93  ? -87.291  24.775  -24.506 1.00 46.79  ? 92  VAL D N   1 
ATOM   7779 C  CA  . VAL F 3 93  ? -87.253  26.041  -25.227 1.00 44.67  ? 92  VAL D CA  1 
ATOM   7780 C  C   . VAL F 3 93  ? -86.497  25.763  -26.524 1.00 44.08  ? 92  VAL D C   1 
ATOM   7781 O  O   . VAL F 3 93  ? -85.354  25.319  -26.475 1.00 47.67  ? 92  VAL D O   1 
ATOM   7782 C  CB  . VAL F 3 93  ? -86.544  27.142  -24.410 1.00 42.49  ? 92  VAL D CB  1 
ATOM   7783 C  CG1 . VAL F 3 93  ? -86.564  28.473  -25.152 1.00 42.12  ? 92  VAL D CG1 1 
ATOM   7784 C  CG2 . VAL F 3 93  ? -87.214  27.295  -23.051 1.00 41.73  ? 92  VAL D CG2 1 
ATOM   7785 N  N   . TYR F 3 94  ? -87.141  25.992  -27.668 1.00 42.23  ? 93  TYR D N   1 
ATOM   7786 C  CA  . TYR F 3 94  ? -86.521  25.767  -28.979 1.00 40.69  ? 93  TYR D CA  1 
ATOM   7787 C  C   . TYR F 3 94  ? -86.001  27.083  -29.538 1.00 40.72  ? 93  TYR D C   1 
ATOM   7788 O  O   . TYR F 3 94  ? -86.753  28.068  -29.601 1.00 38.64  ? 93  TYR D O   1 
ATOM   7789 C  CB  . TYR F 3 94  ? -87.517  25.166  -29.965 1.00 39.37  ? 93  TYR D CB  1 
ATOM   7790 C  CG  . TYR F 3 94  ? -87.789  23.703  -29.753 1.00 38.46  ? 93  TYR D CG  1 
ATOM   7791 C  CD1 . TYR F 3 94  ? -88.538  23.260  -28.672 1.00 38.31  ? 93  TYR D CD1 1 
ATOM   7792 C  CD2 . TYR F 3 94  ? -87.311  22.758  -30.641 1.00 39.06  ? 93  TYR D CD2 1 
ATOM   7793 C  CE1 . TYR F 3 94  ? -88.802  21.914  -28.485 1.00 38.55  ? 93  TYR D CE1 1 
ATOM   7794 C  CE2 . TYR F 3 94  ? -87.572  21.407  -30.466 1.00 39.48  ? 93  TYR D CE2 1 
ATOM   7795 C  CZ  . TYR F 3 94  ? -88.321  20.996  -29.390 1.00 39.16  ? 93  TYR D CZ  1 
ATOM   7796 O  OH  . TYR F 3 94  ? -88.571  19.660  -29.222 1.00 40.54  ? 93  TYR D OH  1 
ATOM   7797 N  N   . TYR F 3 95  ? -84.723  27.081  -29.947 1.00 39.27  ? 94  TYR D N   1 
ATOM   7798 C  CA  . TYR F 3 95  ? -84.053  28.254  -30.520 1.00 37.99  ? 94  TYR D CA  1 
ATOM   7799 C  C   . TYR F 3 95  ? -83.724  28.056  -32.004 1.00 38.58  ? 94  TYR D C   1 
ATOM   7800 O  O   . TYR F 3 95  ? -83.276  26.990  -32.418 1.00 36.83  ? 94  TYR D O   1 
ATOM   7801 C  CB  . TYR F 3 95  ? -82.758  28.558  -29.759 1.00 36.81  ? 94  TYR D CB  1 
ATOM   7802 C  CG  . TYR F 3 95  ? -82.922  28.824  -28.280 1.00 34.88  ? 94  TYR D CG  1 
ATOM   7803 C  CD1 . TYR F 3 95  ? -82.877  27.776  -27.363 1.00 34.23  ? 94  TYR D CD1 1 
ATOM   7804 C  CD2 . TYR F 3 95  ? -83.103  30.123  -27.796 1.00 34.39  ? 94  TYR D CD2 1 
ATOM   7805 C  CE1 . TYR F 3 95  ? -83.020  28.010  -26.009 1.00 34.98  ? 94  TYR D CE1 1 
ATOM   7806 C  CE2 . TYR F 3 95  ? -83.257  30.364  -26.440 1.00 35.40  ? 94  TYR D CE2 1 
ATOM   7807 C  CZ  . TYR F 3 95  ? -83.210  29.304  -25.552 1.00 35.82  ? 94  TYR D CZ  1 
ATOM   7808 O  OH  . TYR F 3 95  ? -83.357  29.534  -24.209 1.00 36.84  ? 94  TYR D OH  1 
ATOM   7809 N  N   . CYS F 3 96  ? -83.938  29.105  -32.787 1.00 42.12  ? 95  CYS D N   1 
ATOM   7810 C  CA  . CYS F 3 96  ? -83.587  29.121  -34.203 1.00 46.28  ? 95  CYS D CA  1 
ATOM   7811 C  C   . CYS F 3 96  ? -82.172  29.649  -34.332 1.00 49.60  ? 95  CYS D C   1 
ATOM   7812 O  O   . CYS F 3 96  ? -81.852  30.670  -33.722 1.00 50.94  ? 95  CYS D O   1 
ATOM   7813 C  CB  . CYS F 3 96  ? -84.533  30.050  -34.952 1.00 47.27  ? 95  CYS D CB  1 
ATOM   7814 S  SG  . CYS F 3 96  ? -84.069  30.387  -36.654 1.00 47.85  ? 95  CYS D SG  1 
ATOM   7815 N  N   . ASN F 3 97  ? -81.339  28.972  -35.131 1.00 51.55  ? 96  ASN D N   1 
ATOM   7816 C  CA  . ASN F 3 97  ? -79.934  29.375  -35.339 1.00 51.29  ? 96  ASN D CA  1 
ATOM   7817 C  C   . ASN F 3 97  ? -79.630  29.567  -36.821 1.00 50.61  ? 96  ASN D C   1 
ATOM   7818 O  O   . ASN F 3 97  ? -80.089  28.788  -37.649 1.00 51.48  ? 96  ASN D O   1 
ATOM   7819 C  CB  . ASN F 3 97  ? -78.978  28.322  -34.747 1.00 51.20  ? 96  ASN D CB  1 
ATOM   7820 C  CG  . ASN F 3 97  ? -77.503  28.672  -34.938 1.00 51.67  ? 96  ASN D CG  1 
ATOM   7821 O  OD1 . ASN F 3 97  ? -76.702  27.808  -35.304 1.00 53.03  ? 96  ASN D OD1 1 
ATOM   7822 N  ND2 . ASN F 3 97  ? -77.140  29.938  -34.688 1.00 51.84  ? 96  ASN D ND2 1 
ATOM   7823 N  N   . VAL F 3 98  ? -78.860  30.605  -37.142 1.00 49.84  ? 97  VAL D N   1 
ATOM   7824 C  CA  . VAL F 3 98  ? -78.331  30.819  -38.489 1.00 49.76  ? 97  VAL D CA  1 
ATOM   7825 C  C   . VAL F 3 98  ? -76.812  30.953  -38.400 1.00 49.77  ? 97  VAL D C   1 
ATOM   7826 O  O   . VAL F 3 98  ? -76.324  31.816  -37.682 1.00 47.03  ? 97  VAL D O   1 
ATOM   7827 C  CB  . VAL F 3 98  ? -78.911  32.096  -39.139 1.00 48.42  ? 97  VAL D CB  1 
ATOM   7828 C  CG1 . VAL F 3 98  ? -78.316  32.325  -40.524 1.00 47.65  ? 97  VAL D CG1 1 
ATOM   7829 C  CG2 . VAL F 3 98  ? -80.421  32.015  -39.206 1.00 48.85  ? 97  VAL D CG2 1 
ATOM   7830 N  N   . LYS F 3 99  ? -76.083  30.084  -39.107 1.00 50.00  ? 98  LYS D N   1 
ATOM   7831 C  CA  . LYS F 3 99  ? -74.638  30.245  -39.326 1.00 48.60  ? 98  LYS D CA  1 
ATOM   7832 C  C   . LYS F 3 99  ? -74.413  30.865  -40.691 1.00 46.54  ? 98  LYS D C   1 
ATOM   7833 O  O   . LYS F 3 99  ? -74.685  30.244  -41.708 1.00 43.95  ? 98  LYS D O   1 
ATOM   7834 C  CB  . LYS F 3 99  ? -73.905  28.906  -39.251 1.00 49.63  ? 98  LYS D CB  1 
ATOM   7835 C  CG  . LYS F 3 99  ? -73.986  28.273  -37.879 1.00 52.04  ? 98  LYS D CG  1 
ATOM   7836 C  CD  . LYS F 3 99  ? -72.969  27.165  -37.673 1.00 53.10  ? 98  LYS D CD  1 
ATOM   7837 C  CE  . LYS F 3 99  ? -73.393  26.270  -36.509 1.00 54.28  ? 98  LYS D CE  1 
ATOM   7838 N  NZ  . LYS F 3 99  ? -73.763  27.045  -35.279 1.00 54.76  ? 98  LYS D NZ  1 
ATOM   7839 N  N   . ASP F 3 100 ? -73.916  32.095  -40.691 1.00 47.87  ? 99  ASP D N   1 
ATOM   7840 C  CA  . ASP F 3 100 ? -73.591  32.843  -41.904 1.00 48.76  ? 99  ASP D CA  1 
ATOM   7841 C  C   . ASP F 3 100 ? -72.098  32.628  -42.248 1.00 48.70  ? 99  ASP D C   1 
ATOM   7842 O  O   . ASP F 3 100 ? -71.226  32.926  -41.435 1.00 49.64  ? 99  ASP D O   1 
ATOM   7843 C  CB  . ASP F 3 100 ? -73.881  34.324  -41.623 1.00 48.62  ? 99  ASP D CB  1 
ATOM   7844 C  CG  . ASP F 3 100 ? -73.776  35.206  -42.849 1.00 48.72  ? 99  ASP D CG  1 
ATOM   7845 O  OD1 . ASP F 3 100 ? -72.838  35.028  -43.658 1.00 48.84  ? 99  ASP D OD1 1 
ATOM   7846 O  OD2 . ASP F 3 100 ? -74.632  36.117  -42.983 1.00 47.39  ? 99  ASP D OD2 1 
ATOM   7847 N  N   . PHE F 3 101 ? -71.805  32.127  -43.446 1.00 47.86  ? 100 PHE D N   1 
ATOM   7848 C  CA  . PHE F 3 101 ? -70.419  31.905  -43.893 1.00 47.17  ? 100 PHE D CA  1 
ATOM   7849 C  C   . PHE F 3 101 ? -69.836  33.073  -44.711 1.00 47.53  ? 100 PHE D C   1 
ATOM   7850 O  O   . PHE F 3 101 ? -68.868  32.889  -45.457 1.00 44.49  ? 100 PHE D O   1 
ATOM   7851 C  CB  . PHE F 3 101 ? -70.333  30.616  -44.731 1.00 45.75  ? 100 PHE D CB  1 
ATOM   7852 C  CG  . PHE F 3 101 ? -70.731  29.361  -43.993 1.00 43.92  ? 100 PHE D CG  1 
ATOM   7853 C  CD1 . PHE F 3 101 ? -70.258  29.100  -42.714 1.00 43.28  ? 100 PHE D CD1 1 
ATOM   7854 C  CD2 . PHE F 3 101 ? -71.538  28.413  -44.608 1.00 43.96  ? 100 PHE D CD2 1 
ATOM   7855 C  CE1 . PHE F 3 101 ? -70.606  27.939  -42.050 1.00 44.20  ? 100 PHE D CE1 1 
ATOM   7856 C  CE2 . PHE F 3 101 ? -71.900  27.248  -43.949 1.00 44.21  ? 100 PHE D CE2 1 
ATOM   7857 C  CZ  . PHE F 3 101 ? -71.426  27.009  -42.669 1.00 44.39  ? 100 PHE D CZ  1 
ATOM   7858 N  N   . GLY F 3 102 ? -70.370  34.280  -44.538 1.00 49.65  ? 101 GLY D N   1 
ATOM   7859 C  CA  . GLY F 3 102 ? -69.986  35.422  -45.367 1.00 51.28  ? 101 GLY D CA  1 
ATOM   7860 C  C   . GLY F 3 102 ? -68.571  35.959  -45.188 1.00 52.61  ? 101 GLY D C   1 
ATOM   7861 O  O   . GLY F 3 102 ? -68.080  36.721  -46.023 1.00 51.67  ? 101 GLY D O   1 
ATOM   7862 N  N   . ALA F 3 103 ? -67.916  35.585  -44.090 1.00 54.05  ? 102 ALA D N   1 
ATOM   7863 C  CA  . ALA F 3 103 ? -66.540  36.006  -43.833 1.00 50.67  ? 102 ALA D CA  1 
ATOM   7864 C  C   . ALA F 3 103 ? -65.513  34.993  -44.328 1.00 49.40  ? 102 ALA D C   1 
ATOM   7865 O  O   . ALA F 3 103 ? -64.318  35.278  -44.312 1.00 47.95  ? 102 ALA D O   1 
ATOM   7866 C  CB  . ALA F 3 103 ? -66.348  36.268  -42.352 1.00 50.19  ? 102 ALA D CB  1 
ATOM   7867 N  N   . ILE F 3 104 ? -65.973  33.813  -44.751 1.00 46.94  ? 103 ILE D N   1 
ATOM   7868 C  CA  . ILE F 3 104 ? -65.122  32.744  -45.289 1.00 44.09  ? 103 ILE D CA  1 
ATOM   7869 C  C   . ILE F 3 104 ? -64.285  32.042  -44.220 1.00 41.35  ? 103 ILE D C   1 
ATOM   7870 O  O   . ILE F 3 104 ? -64.334  30.820  -44.106 1.00 39.99  ? 103 ILE D O   1 
ATOM   7871 C  CB  . ILE F 3 104 ? -64.172  33.224  -46.418 1.00 43.37  ? 103 ILE D CB  1 
ATOM   7872 C  CG1 . ILE F 3 104 ? -64.895  34.127  -47.424 1.00 43.47  ? 103 ILE D CG1 1 
ATOM   7873 C  CG2 . ILE F 3 104 ? -63.538  32.016  -47.112 1.00 43.96  ? 103 ILE D CG2 1 
ATOM   7874 C  CD1 . ILE F 3 104 ? -66.167  33.530  -47.987 1.00 45.35  ? 103 ILE D CD1 1 
ATOM   7875 N  N   . ILE F 3 105 ? -63.508  32.801  -43.459 1.00 39.25  ? 104 ILE D N   1 
ATOM   7876 C  CA  . ILE F 3 105 ? -62.550  32.222  -42.520 1.00 38.93  ? 104 ILE D CA  1 
ATOM   7877 C  C   . ILE F 3 105 ? -63.256  31.792  -41.237 1.00 38.56  ? 104 ILE D C   1 
ATOM   7878 O  O   . ILE F 3 105 ? -62.899  30.789  -40.625 1.00 39.43  ? 104 ILE D O   1 
ATOM   7879 C  CB  . ILE F 3 105 ? -61.378  33.211  -42.217 1.00 38.79  ? 104 ILE D CB  1 
ATOM   7880 C  CG1 . ILE F 3 105 ? -60.777  33.799  -43.516 1.00 36.88  ? 104 ILE D CG1 1 
ATOM   7881 C  CG2 . ILE F 3 105 ? -60.294  32.532  -41.382 1.00 38.66  ? 104 ILE D CG2 1 
ATOM   7882 C  CD1 . ILE F 3 105 ? -60.425  32.772  -44.572 1.00 35.88  ? 104 ILE D CD1 1 
ATOM   7883 N  N   . TYR F 3 106 ? -64.266  32.558  -40.847 1.00 40.59  ? 105 TYR D N   1 
ATOM   7884 C  CA  . TYR F 3 106 ? -65.085  32.261  -39.673 1.00 40.57  ? 105 TYR D CA  1 
ATOM   7885 C  C   . TYR F 3 106 ? -66.574  32.378  -39.998 1.00 42.93  ? 105 TYR D C   1 
ATOM   7886 O  O   . TYR F 3 106 ? -66.988  33.001  -41.003 1.00 43.34  ? 105 TYR D O   1 
ATOM   7887 C  CB  . TYR F 3 106 ? -64.730  33.208  -38.539 1.00 37.35  ? 105 TYR D CB  1 
ATOM   7888 C  CG  . TYR F 3 106 ? -64.948  34.680  -38.840 1.00 35.44  ? 105 TYR D CG  1 
ATOM   7889 C  CD1 . TYR F 3 106 ? -63.951  35.450  -39.438 1.00 35.04  ? 105 TYR D CD1 1 
ATOM   7890 C  CD2 . TYR F 3 106 ? -66.144  35.307  -38.510 1.00 35.40  ? 105 TYR D CD2 1 
ATOM   7891 C  CE1 . TYR F 3 106 ? -64.144  36.800  -39.698 1.00 35.29  ? 105 TYR D CE1 1 
ATOM   7892 C  CE2 . TYR F 3 106 ? -66.344  36.658  -38.760 1.00 35.15  ? 105 TYR D CE2 1 
ATOM   7893 C  CZ  . TYR F 3 106 ? -65.344  37.398  -39.350 1.00 35.19  ? 105 TYR D CZ  1 
ATOM   7894 O  OH  . TYR F 3 106 ? -65.550  38.733  -39.588 1.00 36.07  ? 105 TYR D OH  1 
ATOM   7895 N  N   . ASP F 3 107 ? -67.368  31.782  -39.119 1.00 44.98  ? 106 ASP D N   1 
ATOM   7896 C  CA  . ASP F 3 107 ? -68.822  31.830  -39.246 1.00 46.60  ? 106 ASP D CA  1 
ATOM   7897 C  C   . ASP F 3 107 ? -69.345  32.782  -38.193 1.00 46.47  ? 106 ASP D C   1 
ATOM   7898 O  O   . ASP F 3 107 ? -68.861  32.773  -37.054 1.00 45.87  ? 106 ASP D O   1 
ATOM   7899 C  CB  . ASP F 3 107 ? -69.531  30.452  -39.175 1.00 47.06  ? 106 ASP D CB  1 
ATOM   7900 C  CG  . ASP F 3 107 ? -68.627  29.291  -38.716 1.00 47.45  ? 106 ASP D CG  1 
ATOM   7901 O  OD1 . ASP F 3 107 ? -67.398  29.466  -38.542 1.00 49.75  ? 106 ASP D OD1 1 
ATOM   7902 O  OD2 . ASP F 3 107 ? -69.165  28.177  -38.538 1.00 47.32  ? 106 ASP D OD2 1 
ATOM   7903 N  N   . TYR F 3 108 ? -70.300  33.627  -38.596 1.00 48.48  ? 107 TYR D N   1 
ATOM   7904 C  CA  . TYR F 3 108 ? -71.024  34.495  -37.678 1.00 52.07  ? 107 TYR D CA  1 
ATOM   7905 C  C   . TYR F 3 108 ? -72.357  33.835  -37.333 1.00 49.41  ? 107 TYR D C   1 
ATOM   7906 O  O   . TYR F 3 108 ? -73.072  33.376  -38.229 1.00 44.72  ? 107 TYR D O   1 
ATOM   7907 C  CB  . TYR F 3 108 ? -71.255  35.880  -38.286 1.00 57.25  ? 107 TYR D CB  1 
ATOM   7908 C  CG  . TYR F 3 108 ? -71.639  36.914  -37.246 1.00 62.78  ? 107 TYR D CG  1 
ATOM   7909 C  CD1 . TYR F 3 108 ? -70.677  37.490  -36.427 1.00 66.86  ? 107 TYR D CD1 1 
ATOM   7910 C  CD2 . TYR F 3 108 ? -72.965  37.296  -37.059 1.00 65.16  ? 107 TYR D CD2 1 
ATOM   7911 C  CE1 . TYR F 3 108 ? -71.021  38.424  -35.456 1.00 69.61  ? 107 TYR D CE1 1 
ATOM   7912 C  CE2 . TYR F 3 108 ? -73.318  38.231  -36.095 1.00 66.05  ? 107 TYR D CE2 1 
ATOM   7913 C  CZ  . TYR F 3 108 ? -72.344  38.791  -35.296 1.00 68.28  ? 107 TYR D CZ  1 
ATOM   7914 O  OH  . TYR F 3 108 ? -72.683  39.721  -34.339 1.00 71.54  ? 107 TYR D OH  1 
ATOM   7915 N  N   . ASP F 3 109 ? -72.670  33.788  -36.029 1.00 50.17  ? 108 ASP D N   1 
ATOM   7916 C  CA  . ASP F 3 109 ? -73.890  33.145  -35.524 1.00 51.38  ? 108 ASP D CA  1 
ATOM   7917 C  C   . ASP F 3 109 ? -74.989  34.138  -35.124 1.00 51.72  ? 108 ASP D C   1 
ATOM   7918 O  O   . ASP F 3 109 ? -74.730  35.175  -34.486 1.00 49.98  ? 108 ASP D O   1 
ATOM   7919 C  CB  . ASP F 3 109 ? -73.584  32.233  -34.336 1.00 50.22  ? 108 ASP D CB  1 
ATOM   7920 C  CG  . ASP F 3 109 ? -73.156  30.842  -34.766 1.00 49.10  ? 108 ASP D CG  1 
ATOM   7921 O  OD1 . ASP F 3 109 ? -72.580  30.679  -35.865 1.00 45.99  ? 108 ASP D OD1 1 
ATOM   7922 O  OD2 . ASP F 3 109 ? -73.414  29.894  -33.998 1.00 50.14  ? 108 ASP D OD2 1 
ATOM   7923 N  N   . TYR F 3 110 ? -76.221  33.801  -35.521 1.00 52.72  ? 109 TYR D N   1 
ATOM   7924 C  CA  . TYR F 3 110 ? -77.424  34.500  -35.080 1.00 50.41  ? 109 TYR D CA  1 
ATOM   7925 C  C   . TYR F 3 110 ? -78.280  33.505  -34.305 1.00 47.41  ? 109 TYR D C   1 
ATOM   7926 O  O   . TYR F 3 110 ? -78.475  32.379  -34.758 1.00 44.59  ? 109 TYR D O   1 
ATOM   7927 C  CB  . TYR F 3 110 ? -78.194  35.036  -36.274 1.00 49.55  ? 109 TYR D CB  1 
ATOM   7928 C  CG  . TYR F 3 110 ? -77.416  36.009  -37.118 1.00 47.98  ? 109 TYR D CG  1 
ATOM   7929 C  CD1 . TYR F 3 110 ? -77.292  37.332  -36.730 1.00 47.51  ? 109 TYR D CD1 1 
ATOM   7930 C  CD2 . TYR F 3 110 ? -76.809  35.609  -38.308 1.00 48.00  ? 109 TYR D CD2 1 
ATOM   7931 C  CE1 . TYR F 3 110 ? -76.589  38.245  -37.500 1.00 49.03  ? 109 TYR D CE1 1 
ATOM   7932 C  CE2 . TYR F 3 110 ? -76.099  36.509  -39.094 1.00 49.54  ? 109 TYR D CE2 1 
ATOM   7933 C  CZ  . TYR F 3 110 ? -75.990  37.830  -38.685 1.00 49.91  ? 109 TYR D CZ  1 
ATOM   7934 O  OH  . TYR F 3 110 ? -75.279  38.737  -39.446 1.00 48.60  ? 109 TYR D OH  1 
ATOM   7935 N  N   . TRP F 3 111 ? -78.762  33.923  -33.133 1.00 44.40  ? 110 TRP D N   1 
ATOM   7936 C  CA  . TRP F 3 111 ? -79.693  33.123  -32.349 1.00 44.38  ? 110 TRP D CA  1 
ATOM   7937 C  C   . TRP F 3 111 ? -81.024  33.847  -32.139 1.00 46.33  ? 110 TRP D C   1 
ATOM   7938 O  O   . TRP F 3 111 ? -81.051  35.061  -31.910 1.00 46.69  ? 110 TRP D O   1 
ATOM   7939 C  CB  . TRP F 3 111 ? -79.081  32.780  -31.015 1.00 41.99  ? 110 TRP D CB  1 
ATOM   7940 C  CG  . TRP F 3 111 ? -77.989  31.839  -31.162 1.00 43.53  ? 110 TRP D CG  1 
ATOM   7941 C  CD1 . TRP F 3 111 ? -76.689  32.140  -31.396 1.00 44.69  ? 110 TRP D CD1 1 
ATOM   7942 C  CD2 . TRP F 3 111 ? -78.073  30.413  -31.113 1.00 45.47  ? 110 TRP D CD2 1 
ATOM   7943 N  NE1 . TRP F 3 111 ? -75.942  30.992  -31.483 1.00 45.08  ? 110 TRP D NE1 1 
ATOM   7944 C  CE2 . TRP F 3 111 ? -76.765  29.912  -31.307 1.00 45.35  ? 110 TRP D CE2 1 
ATOM   7945 C  CE3 . TRP F 3 111 ? -79.120  29.507  -30.910 1.00 45.54  ? 110 TRP D CE3 1 
ATOM   7946 C  CZ2 . TRP F 3 111 ? -76.472  28.536  -31.312 1.00 45.14  ? 110 TRP D CZ2 1 
ATOM   7947 C  CZ3 . TRP F 3 111 ? -78.831  28.127  -30.917 1.00 45.37  ? 110 TRP D CZ3 1 
ATOM   7948 C  CH2 . TRP F 3 111 ? -77.512  27.662  -31.115 1.00 45.16  ? 110 TRP D CH2 1 
ATOM   7949 N  N   . GLY F 3 112 ? -82.120  33.094  -32.222 1.00 46.80  ? 111 GLY D N   1 
ATOM   7950 C  CA  . GLY F 3 112 ? -83.431  33.612  -31.862 1.00 49.47  ? 111 GLY D CA  1 
ATOM   7951 C  C   . GLY F 3 112 ? -83.638  33.700  -30.345 1.00 50.88  ? 111 GLY D C   1 
ATOM   7952 O  O   . GLY F 3 112 ? -82.909  33.071  -29.558 1.00 48.42  ? 111 GLY D O   1 
ATOM   7953 N  N   . GLN F 3 113 ? -84.628  34.497  -29.939 1.00 52.93  ? 112 GLN D N   1 
ATOM   7954 C  CA  . GLN F 3 113 ? -84.996  34.631  -28.522 1.00 55.16  ? 112 GLN D CA  1 
ATOM   7955 C  C   . GLN F 3 113 ? -85.446  33.301  -27.915 1.00 52.88  ? 112 GLN D C   1 
ATOM   7956 O  O   . GLN F 3 113 ? -85.197  33.028  -26.738 1.00 50.50  ? 112 GLN D O   1 
ATOM   7957 C  CB  . GLN F 3 113 ? -86.096  35.697  -28.340 1.00 59.38  ? 112 GLN D CB  1 
ATOM   7958 C  CG  . GLN F 3 113 ? -85.613  37.135  -28.513 1.00 63.13  ? 112 GLN D CG  1 
ATOM   7959 C  CD  . GLN F 3 113 ? -84.611  37.563  -27.438 1.00 67.80  ? 112 GLN D CD  1 
ATOM   7960 O  OE1 . GLN F 3 113 ? -84.674  37.101  -26.293 1.00 71.37  ? 112 GLN D OE1 1 
ATOM   7961 N  NE2 . GLN F 3 113 ? -83.681  38.456  -27.802 1.00 67.45  ? 112 GLN D NE2 1 
ATOM   7962 N  N   . GLY F 3 114 ? -86.114  32.495  -28.735 1.00 51.29  ? 113 GLY D N   1 
ATOM   7963 C  CA  . GLY F 3 114 ? -86.570  31.166  -28.360 1.00 49.99  ? 113 GLY D CA  1 
ATOM   7964 C  C   . GLY F 3 114 ? -88.083  31.139  -28.320 1.00 50.13  ? 113 GLY D C   1 
ATOM   7965 O  O   . GLY F 3 114 ? -88.737  32.186  -28.189 1.00 48.97  ? 113 GLY D O   1 
ATOM   7966 N  N   . THR F 3 115 ? -88.636  29.937  -28.447 1.00 50.11  ? 114 THR D N   1 
ATOM   7967 C  CA  . THR F 3 115 ? -90.075  29.722  -28.315 1.00 49.13  ? 114 THR D CA  1 
ATOM   7968 C  C   . THR F 3 115 ? -90.322  28.428  -27.534 1.00 47.13  ? 114 THR D C   1 
ATOM   7969 O  O   . THR F 3 115 ? -89.653  27.419  -27.744 1.00 45.90  ? 114 THR D O   1 
ATOM   7970 C  CB  . THR F 3 115 ? -90.780  29.735  -29.695 1.00 50.81  ? 114 THR D CB  1 
ATOM   7971 O  OG1 . THR F 3 115 ? -92.193  29.878  -29.514 1.00 54.31  ? 114 THR D OG1 1 
ATOM   7972 C  CG2 . THR F 3 115 ? -90.483  28.480  -30.503 1.00 51.79  ? 114 THR D CG2 1 
ATOM   7973 N  N   . GLN F 3 116 ? -91.278  28.481  -26.614 1.00 47.59  ? 115 GLN D N   1 
ATOM   7974 C  CA  . GLN F 3 116 ? -91.539  27.381  -25.688 1.00 46.18  ? 115 GLN D CA  1 
ATOM   7975 C  C   . GLN F 3 116 ? -92.400  26.334  -26.366 1.00 41.55  ? 115 GLN D C   1 
ATOM   7976 O  O   . GLN F 3 116 ? -93.359  26.666  -27.053 1.00 38.92  ? 115 GLN D O   1 
ATOM   7977 C  CB  . GLN F 3 116 ? -92.244  27.902  -24.422 1.00 48.20  ? 115 GLN D CB  1 
ATOM   7978 C  CG  . GLN F 3 116 ? -92.656  26.843  -23.409 1.00 47.84  ? 115 GLN D CG  1 
ATOM   7979 C  CD  . GLN F 3 116 ? -91.479  26.112  -22.806 1.00 48.76  ? 115 GLN D CD  1 
ATOM   7980 O  OE1 . GLN F 3 116 ? -90.582  26.727  -22.234 1.00 52.39  ? 115 GLN D OE1 1 
ATOM   7981 N  NE2 . GLN F 3 116 ? -91.483  24.790  -22.917 1.00 47.76  ? 115 GLN D NE2 1 
ATOM   7982 N  N   . VAL F 3 117 ? -92.043  25.077  -26.152 1.00 38.91  ? 116 VAL D N   1 
ATOM   7983 C  CA  . VAL F 3 117 ? -92.818  23.945  -26.607 1.00 38.67  ? 116 VAL D CA  1 
ATOM   7984 C  C   . VAL F 3 117 ? -92.991  23.034  -25.406 1.00 40.06  ? 116 VAL D C   1 
ATOM   7985 O  O   . VAL F 3 117 ? -92.001  22.584  -24.833 1.00 40.44  ? 116 VAL D O   1 
ATOM   7986 C  CB  . VAL F 3 117 ? -92.087  23.201  -27.732 1.00 38.57  ? 116 VAL D CB  1 
ATOM   7987 C  CG1 . VAL F 3 117 ? -92.822  21.918  -28.119 1.00 38.74  ? 116 VAL D CG1 1 
ATOM   7988 C  CG2 . VAL F 3 117 ? -91.908  24.121  -28.937 1.00 38.52  ? 116 VAL D CG2 1 
ATOM   7989 N  N   . THR F 3 118 ? -94.242  22.783  -25.016 1.00 42.89  ? 117 THR D N   1 
ATOM   7990 C  CA  . THR F 3 118 ? -94.548  21.913  -23.888 1.00 44.14  ? 117 THR D CA  1 
ATOM   7991 C  C   . THR F 3 118 ? -95.465  20.803  -24.346 1.00 47.09  ? 117 THR D C   1 
ATOM   7992 O  O   . THR F 3 118 ? -96.551  21.070  -24.846 1.00 48.66  ? 117 THR D O   1 
ATOM   7993 C  CB  . THR F 3 118 ? -95.242  22.685  -22.770 1.00 42.92  ? 117 THR D CB  1 
ATOM   7994 O  OG1 . THR F 3 118 ? -94.446  23.810  -22.412 1.00 45.69  ? 117 THR D OG1 1 
ATOM   7995 C  CG2 . THR F 3 118 ? -95.433  21.811  -21.546 1.00 43.35  ? 117 THR D CG2 1 
ATOM   7996 N  N   . VAL F 3 119 ? -95.023  19.562  -24.174 1.00 52.14  ? 118 VAL D N   1 
ATOM   7997 C  CA  . VAL F 3 119 ? -95.824  18.406  -24.533 1.00 59.61  ? 118 VAL D CA  1 
ATOM   7998 C  C   . VAL F 3 119 ? -96.280  17.709  -23.253 1.00 66.86  ? 118 VAL D C   1 
ATOM   7999 O  O   . VAL F 3 119 ? -95.444  17.247  -22.469 1.00 68.03  ? 118 VAL D O   1 
ATOM   8000 C  CB  . VAL F 3 119 ? -95.026  17.442  -25.418 1.00 63.84  ? 118 VAL D CB  1 
ATOM   8001 C  CG1 . VAL F 3 119 ? -95.852  16.196  -25.743 1.00 66.37  ? 118 VAL D CG1 1 
ATOM   8002 C  CG2 . VAL F 3 119 ? -94.575  18.150  -26.698 1.00 65.24  ? 118 VAL D CG2 1 
ATOM   8003 N  N   . SER F 3 120 ? -97.601  17.652  -23.046 1.00 74.33  ? 119 SER D N   1 
ATOM   8004 C  CA  . SER F 3 120 ? -98.203  17.027  -21.864 1.00 75.57  ? 119 SER D CA  1 
ATOM   8005 C  C   . SER F 3 120 ? -98.585  15.578  -22.183 1.00 78.77  ? 119 SER D C   1 
ATOM   8006 O  O   . SER F 3 120 ? -98.861  15.243  -23.343 1.00 75.27  ? 119 SER D O   1 
ATOM   8007 C  CB  . SER F 3 120 ? -99.426  17.819  -21.411 1.00 74.74  ? 119 SER D CB  1 
ATOM   8008 O  OG  . SER F 3 120 ? -100.333 17.995  -22.484 1.00 78.38  ? 119 SER D OG  1 
ATOM   8009 N  N   . SER F 3 121 ? -98.614  14.743  -21.143 1.00 82.06  ? 120 SER D N   1 
ATOM   8010 C  CA  . SER F 3 121 ? -98.766  13.289  -21.273 1.00 81.56  ? 120 SER D CA  1 
ATOM   8011 C  C   . SER F 3 121 ? -100.141 12.878  -21.793 1.00 80.58  ? 120 SER D C   1 
ATOM   8012 O  O   . SER F 3 121 ? -101.162 13.395  -21.343 1.00 83.93  ? 120 SER D O   1 
ATOM   8013 C  CB  . SER F 3 121 ? -98.524  12.608  -19.915 1.00 81.39  ? 120 SER D CB  1 
ATOM   8014 O  OG  . SER F 3 121 ? -97.349  13.082  -19.284 1.00 82.24  ? 120 SER D OG  1 
HETATM 8015 C  C30 . 2CV G 4 .   ? -49.269  -0.657  27.365  1.00 98.32  ? 201 2CV E C30 1 
HETATM 8016 N  N33 . 2CV G 4 .   ? -49.067  -1.885  26.850  1.00 99.70  ? 201 2CV E N33 1 
HETATM 8017 O  O34 . 2CV G 4 .   ? -49.155  -0.371  28.553  1.00 93.84  ? 201 2CV E O34 1 
HETATM 8018 C  C35 . 2CV G 4 .   ? -47.857  -2.299  26.100  1.00 96.58  ? 201 2CV E C35 1 
HETATM 8019 C  C36 . 2CV G 4 .   ? -50.095  -2.931  27.024  1.00 100.27 ? 201 2CV E C36 1 
HETATM 8020 C  C37 . 2CV G 4 .   ? -50.507  -3.556  25.674  1.00 100.13 ? 201 2CV E C37 1 
HETATM 8021 C  C40 . 2CV G 4 .   ? -51.906  -4.210  25.748  1.00 95.45  ? 201 2CV E C40 1 
HETATM 8022 C  C41 . 2CV G 4 .   ? -52.060  -5.412  24.791  1.00 87.48  ? 201 2CV E C41 1 
HETATM 8023 C  C42 . 2CV G 4 .   ? -53.448  -6.054  24.607  1.00 74.78  ? 201 2CV E C42 1 
HETATM 8024 C  C43 . 2CV G 4 .   ? -53.458  -6.832  23.303  1.00 67.37  ? 201 2CV E C43 1 
HETATM 8025 O  O44 . 2CV G 4 .   ? -54.729  -7.438  23.166  1.00 62.05  ? 201 2CV E O44 1 
HETATM 8026 O  O47 . 2CV G 4 .   ? -49.515  -4.509  25.238  1.00 101.04 ? 201 2CV E O47 1 
HETATM 8027 O  O49 . 2CV G 4 .   ? -52.885  -3.195  25.480  1.00 98.54  ? 201 2CV E O49 1 
HETATM 8028 O  O51 . 2CV G 4 .   ? -51.227  -6.469  25.289  1.00 91.88  ? 201 2CV E O51 1 
HETATM 8029 O  O53 . 2CV G 4 .   ? -54.534  -5.129  24.560  1.00 70.48  ? 201 2CV E O53 1 
HETATM 8030 C  C60 . 2CV G 4 .   ? -46.645  -1.389  26.315  1.00 93.42  ? 201 2CV E C60 1 
HETATM 8031 O  O63 . 2CV G 4 .   ? -46.176  -1.483  27.665  1.00 90.00  ? 201 2CV E O63 1 
HETATM 8032 NA NA  . NA  H 5 .   ? -53.738  33.308  -6.383  1.00 42.78  ? 401 NA  A NA  1 
HETATM 8033 C  C9  . 2CV I 4 .   ? -37.607  39.451  -28.791 1.00 42.44  ? 402 2CV A C9  1 
HETATM 8034 C  C12 . 2CV I 4 .   ? -38.580  38.319  -29.115 1.00 43.86  ? 402 2CV A C12 1 
HETATM 8035 C  C15 . 2CV I 4 .   ? -39.776  38.444  -28.161 1.00 45.74  ? 402 2CV A C15 1 
HETATM 8036 C  C18 . 2CV I 4 .   ? -40.892  37.438  -28.375 1.00 45.94  ? 402 2CV A C18 1 
HETATM 8037 C  C21 . 2CV I 4 .   ? -40.515  36.121  -27.707 1.00 47.76  ? 402 2CV A C21 1 
HETATM 8038 C  C24 . 2CV I 4 .   ? -41.142  34.934  -28.421 1.00 50.27  ? 402 2CV A C24 1 
HETATM 8039 C  C27 . 2CV I 4 .   ? -42.661  35.013  -28.463 1.00 54.01  ? 402 2CV A C27 1 
HETATM 8040 C  C30 . 2CV I 4 .   ? -43.206  34.657  -27.097 1.00 57.77  ? 402 2CV A C30 1 
HETATM 8041 N  N33 . 2CV I 4 .   ? -43.809  33.466  -26.856 1.00 57.41  ? 402 2CV A N33 1 
HETATM 8042 O  O34 . 2CV I 4 .   ? -43.045  35.501  -26.220 1.00 61.70  ? 402 2CV A O34 1 
HETATM 8043 C  C35 . 2CV I 4 .   ? -44.158  32.472  -27.885 1.00 56.73  ? 402 2CV A C35 1 
HETATM 8044 C  C36 . 2CV I 4 .   ? -44.083  33.045  -25.469 1.00 54.40  ? 402 2CV A C36 1 
HETATM 8045 C  C37 . 2CV I 4 .   ? -45.397  33.624  -24.964 1.00 50.53  ? 402 2CV A C37 1 
HETATM 8046 C  C40 . 2CV I 4 .   ? -46.647  32.994  -25.581 1.00 51.18  ? 402 2CV A C40 1 
HETATM 8047 C  C41 . 2CV I 4 .   ? -47.850  33.173  -24.654 1.00 50.86  ? 402 2CV A C41 1 
HETATM 8048 C  C42 . 2CV I 4 .   ? -49.028  32.274  -25.007 1.00 49.90  ? 402 2CV A C42 1 
HETATM 8049 C  C43 . 2CV I 4 .   ? -50.281  32.652  -24.204 1.00 53.00  ? 402 2CV A C43 1 
HETATM 8050 O  O44 . 2CV I 4 .   ? -51.455  31.940  -24.624 1.00 54.39  ? 402 2CV A O44 1 
HETATM 8051 O  O47 . 2CV I 4 .   ? -45.431  35.029  -25.227 1.00 47.99  ? 402 2CV A O47 1 
HETATM 8052 O  O49 . 2CV I 4 .   ? -46.463  31.610  -25.903 1.00 51.18  ? 402 2CV A O49 1 
HETATM 8053 O  O51 . 2CV I 4 .   ? -48.232  34.553  -24.741 1.00 51.46  ? 402 2CV A O51 1 
HETATM 8054 O  O53 . 2CV I 4 .   ? -48.656  30.930  -24.719 1.00 45.02  ? 402 2CV A O53 1 
HETATM 8055 C  C60 . 2CV I 4 .   ? -45.364  32.957  -28.672 1.00 57.72  ? 402 2CV A C60 1 
HETATM 8056 O  O63 . 2CV I 4 .   ? -46.471  32.074  -28.430 1.00 59.94  ? 402 2CV A O63 1 
HETATM 8057 C  C1  . 2CV I 4 .   ? -36.261  39.363  -29.495 1.00 41.03  ? 402 2CV A C1  1 
HETATM 8058 C  C0  . 2CV I 4 .   ? -35.260  40.238  -28.762 1.00 40.03  ? 402 2CV A C0  1 
HETATM 8059 C  C9  . 2CV J 4 .   ? -30.902  31.689  -27.705 1.00 57.68  ? 403 2CV A C9  1 
HETATM 8060 C  C12 . 2CV J 4 .   ? -29.598  32.233  -27.127 1.00 61.40  ? 403 2CV A C12 1 
HETATM 8061 C  C15 . 2CV J 4 .   ? -29.486  33.760  -27.182 1.00 65.89  ? 403 2CV A C15 1 
HETATM 8062 C  C18 . 2CV J 4 .   ? -29.066  34.317  -28.549 1.00 69.69  ? 403 2CV A C18 1 
HETATM 8063 C  C21 . 2CV J 4 .   ? -29.546  35.768  -28.760 1.00 72.65  ? 403 2CV A C21 1 
HETATM 8064 C  C24 . 2CV J 4 .   ? -28.482  36.764  -29.251 1.00 75.64  ? 403 2CV A C24 1 
HETATM 8065 C  C27 . 2CV J 4 .   ? -28.554  37.053  -30.757 1.00 77.48  ? 403 2CV A C27 1 
HETATM 8066 C  C30 . 2CV J 4 .   ? -27.725  38.279  -31.168 1.00 80.70  ? 403 2CV A C30 1 
HETATM 8067 N  N33 . 2CV J 4 .   ? -26.856  38.281  -32.224 1.00 84.60  ? 403 2CV A N33 1 
HETATM 8068 O  O34 . 2CV J 4 .   ? -27.892  39.293  -30.503 1.00 81.37  ? 403 2CV A O34 1 
HETATM 8069 C  C35 . 2CV J 4 .   ? -26.796  37.215  -33.260 1.00 81.60  ? 403 2CV A C35 1 
HETATM 8070 C  C36 . 2CV J 4 .   ? -25.895  39.405  -32.405 1.00 86.90  ? 403 2CV A C36 1 
HETATM 8071 C  C37 . 2CV J 4 .   ? -26.088  40.096  -33.773 1.00 90.90  ? 403 2CV A C37 1 
HETATM 8072 C  C40 . 2CV J 4 .   ? -25.059  41.210  -34.030 1.00 92.00  ? 403 2CV A C40 1 
HETATM 8073 C  C41 . 2CV J 4 .   ? -25.538  42.638  -33.732 1.00 87.94  ? 403 2CV A C41 1 
HETATM 8074 C  C42 . 2CV J 4 .   ? -24.479  43.719  -33.937 1.00 84.82  ? 403 2CV A C42 1 
HETATM 8075 C  C43 . 2CV J 4 .   ? -24.459  44.245  -35.365 1.00 85.85  ? 403 2CV A C43 1 
HETATM 8076 O  O44 . 2CV J 4 .   ? -23.317  45.096  -35.515 1.00 85.86  ? 403 2CV A O44 1 
HETATM 8077 O  O47 . 2CV J 4 .   ? -27.429  40.596  -33.899 1.00 95.15  ? 403 2CV A O47 1 
HETATM 8078 O  O49 . 2CV J 4 .   ? -24.671  41.151  -35.407 1.00 97.13  ? 403 2CV A O49 1 
HETATM 8079 O  O51 . 2CV J 4 .   ? -25.941  42.700  -32.369 1.00 86.99  ? 403 2CV A O51 1 
HETATM 8080 O  O53 . 2CV J 4 .   ? -23.178  43.228  -33.598 1.00 82.11  ? 403 2CV A O53 1 
HETATM 8081 C  C60 . 2CV J 4 .   ? -25.369  36.675  -33.364 1.00 75.84  ? 403 2CV A C60 1 
HETATM 8082 O  O63 . 2CV J 4 .   ? -25.377  35.375  -33.961 1.00 70.92  ? 403 2CV A O63 1 
HETATM 8083 C  C1  . 2CV J 4 .   ? -32.136  32.130  -26.925 1.00 56.28  ? 403 2CV A C1  1 
HETATM 8084 C  C0  . 2CV J 4 .   ? -33.347  31.260  -27.211 1.00 54.86  ? 403 2CV A C0  1 
HETATM 8085 C  C9  . 2CV K 4 .   ? -15.046  11.494  -18.879 1.00 51.78  ? 404 2CV A C9  1 
HETATM 8086 C  C12 . 2CV K 4 .   ? -16.579  11.541  -18.895 1.00 49.15  ? 404 2CV A C12 1 
HETATM 8087 C  C15 . 2CV K 4 .   ? -17.172  11.093  -20.233 1.00 47.95  ? 404 2CV A C15 1 
HETATM 8088 C  C18 . 2CV K 4 .   ? -18.420  11.878  -20.611 1.00 46.29  ? 404 2CV A C18 1 
HETATM 8089 C  C21 . 2CV K 4 .   ? -19.496  11.667  -19.553 1.00 47.74  ? 404 2CV A C21 1 
HETATM 8090 C  C24 . 2CV K 4 .   ? -20.845  11.431  -20.199 1.00 50.67  ? 404 2CV A C24 1 
HETATM 8091 C  C27 . 2CV K 4 .   ? -21.336  12.698  -20.878 1.00 54.12  ? 404 2CV A C27 1 
HETATM 8092 C  C30 . 2CV K 4 .   ? -22.783  12.563  -21.301 1.00 58.62  ? 404 2CV A C30 1 
HETATM 8093 N  N33 . 2CV K 4 .   ? -23.851  12.970  -20.562 1.00 64.07  ? 404 2CV A N33 1 
HETATM 8094 O  O34 . 2CV K 4 .   ? -22.921  12.060  -22.396 1.00 60.45  ? 404 2CV A O34 1 
HETATM 8095 C  C35 . 2CV K 4 .   ? -23.744  13.528  -19.219 1.00 72.42  ? 404 2CV A C35 1 
HETATM 8096 C  C36 . 2CV K 4 .   ? -25.252  12.869  -21.035 1.00 59.22  ? 404 2CV A C36 1 
HETATM 8097 C  C37 . 2CV K 4 .   ? -25.479  14.007  -22.029 1.00 59.34  ? 404 2CV A C37 1 
HETATM 8098 C  C40 . 2CV K 4 .   ? -26.797  14.014  -22.795 1.00 61.52  ? 404 2CV A C40 1 
HETATM 8099 C  C41 . 2CV K 4 .   ? -28.036  14.099  -21.919 1.00 67.10  ? 404 2CV A C41 1 
HETATM 8100 C  C42 . 2CV K 4 .   ? -29.372  14.006  -22.718 1.00 69.35  ? 404 2CV A C42 1 
HETATM 8101 C  C43 . 2CV K 4 .   ? -29.757  15.210  -23.576 1.00 65.93  ? 404 2CV A C43 1 
HETATM 8102 O  O44 . 2CV K 4 .   ? -31.117  15.013  -24.011 1.00 58.57  ? 404 2CV A O44 1 
HETATM 8103 O  O47 . 2CV K 4 .   ? -24.515  13.917  -23.073 1.00 59.47  ? 404 2CV A O47 1 
HETATM 8104 O  O49 . 2CV K 4 .   ? -26.848  12.846  -23.603 1.00 60.71  ? 404 2CV A O49 1 
HETATM 8105 O  O51 . 2CV K 4 .   ? -27.883  15.325  -21.195 1.00 73.14  ? 404 2CV A O51 1 
HETATM 8106 O  O53 . 2CV K 4 .   ? -30.511  13.786  -21.862 1.00 72.09  ? 404 2CV A O53 1 
HETATM 8107 C  C60 . 2CV K 4 .   ? -23.780  12.337  -18.258 1.00 79.57  ? 404 2CV A C60 1 
HETATM 8108 O  O63 . 2CV K 4 .   ? -22.546  12.290  -17.512 1.00 87.33  ? 404 2CV A O63 1 
HETATM 8109 C  C1  . 2CV K 4 .   ? -14.420  10.124  -18.603 1.00 53.21  ? 404 2CV A C1  1 
HETATM 8110 C  C0  . 2CV K 4 .   ? -12.894  10.184  -18.646 1.00 53.12  ? 404 2CV A C0  1 
HETATM 8111 C  C9  . 2CV L 4 .   ? -32.631  42.099  -12.969 1.00 47.46  ? 405 2CV A C9  1 
HETATM 8112 C  C12 . 2CV L 4 .   ? -31.121  41.994  -13.215 1.00 47.93  ? 405 2CV A C12 1 
HETATM 8113 C  C15 . 2CV L 4 .   ? -30.709  42.654  -14.527 1.00 48.03  ? 405 2CV A C15 1 
HETATM 8114 C  C18 . 2CV L 4 .   ? -29.255  42.338  -14.876 1.00 48.26  ? 405 2CV A C18 1 
HETATM 8115 C  C21 . 2CV L 4 .   ? -28.916  42.914  -16.245 1.00 48.40  ? 405 2CV A C21 1 
HETATM 8116 C  C24 . 2CV L 4 .   ? -27.675  42.256  -16.807 1.00 49.31  ? 405 2CV A C24 1 
HETATM 8117 C  C27 . 2CV L 4 .   ? -26.452  42.764  -16.081 1.00 53.62  ? 405 2CV A C27 1 
HETATM 8118 C  C30 . 2CV L 4 .   ? -25.215  42.370  -16.860 1.00 60.09  ? 405 2CV A C30 1 
HETATM 8119 N  N33 . 2CV L 4 .   ? -24.721  43.138  -17.894 1.00 64.66  ? 405 2CV A N33 1 
HETATM 8120 O  O34 . 2CV L 4 .   ? -24.699  41.323  -16.469 1.00 61.84  ? 405 2CV A O34 1 
HETATM 8121 C  C35 . 2CV L 4 .   ? -25.371  44.344  -18.475 1.00 61.66  ? 405 2CV A C35 1 
HETATM 8122 C  C36 . 2CV L 4 .   ? -23.415  42.809  -18.510 1.00 67.78  ? 405 2CV A C36 1 
HETATM 8123 C  C37 . 2CV L 4 .   ? -22.346  43.712  -17.904 1.00 70.13  ? 405 2CV A C37 1 
HETATM 8124 C  C40 . 2CV L 4 .   ? -20.971  43.288  -18.387 1.00 70.01  ? 405 2CV A C40 1 
HETATM 8125 O  O47 . 2CV L 4 .   ? -22.325  43.600  -16.474 1.00 73.05  ? 405 2CV A O47 1 
HETATM 8126 C  C60 . 2CV L 4 .   ? -25.366  44.338  -20.010 1.00 58.70  ? 405 2CV A C60 1 
HETATM 8127 C  C1  . 2CV L 4 .   ? -33.059  41.256  -11.763 1.00 46.42  ? 405 2CV A C1  1 
HETATM 8128 C  C0  . 2CV L 4 .   ? -34.294  41.808  -11.085 1.00 45.33  ? 405 2CV A C0  1 
HETATM 8129 O  O3  . Y00 M 6 .   ? -42.022  25.883  -2.861  1.00 67.27  ? 406 Y00 A O3  1 
HETATM 8130 C  C16 . Y00 M 6 .   ? -42.235  26.108  -4.177  1.00 66.14  ? 406 Y00 A C16 1 
HETATM 8131 C  C15 . Y00 M 6 .   ? -43.526  26.006  -4.699  1.00 67.95  ? 406 Y00 A C15 1 
HETATM 8132 C  C14 . Y00 M 6 .   ? -43.746  26.232  -6.056  1.00 66.10  ? 406 Y00 A C14 1 
HETATM 8133 C  C17 . Y00 M 6 .   ? -41.161  26.438  -4.992  1.00 65.10  ? 406 Y00 A C17 1 
HETATM 8134 C  C18 . Y00 M 6 .   ? -41.374  26.647  -6.349  1.00 65.89  ? 406 Y00 A C18 1 
HETATM 8135 C  C13 . Y00 M 6 .   ? -42.670  26.554  -6.884  1.00 66.39  ? 406 Y00 A C13 1 
HETATM 8136 C  C12 . Y00 M 6 .   ? -42.911  26.793  -8.358  1.00 64.76  ? 406 Y00 A C12 1 
HETATM 8137 C  C11 . Y00 M 6 .   ? -42.843  28.293  -8.624  1.00 63.19  ? 406 Y00 A C11 1 
HETATM 8138 C  C9  . Y00 M 6 .   ? -42.899  28.626  -10.114 1.00 59.25  ? 406 Y00 A C9  1 
HETATM 8139 C  C10 . Y00 M 6 .   ? -43.094  30.135  -10.266 1.00 58.88  ? 406 Y00 A C10 1 
HETATM 8140 N  N1  . Y00 M 6 .   ? -41.711  28.151  -10.823 1.00 52.06  ? 406 Y00 A N1  1 
HETATM 8141 C  C8  . Y00 M 6 .   ? -41.723  28.003  -12.267 1.00 46.25  ? 406 Y00 A C8  1 
HETATM 8142 C  C1  . Y00 M 6 .   ? -40.382  27.611  -12.879 1.00 43.49  ? 406 Y00 A C1  1 
HETATM 8143 C  C2  . Y00 M 6 .   ? -40.397  27.866  -14.381 1.00 41.60  ? 406 Y00 A C2  1 
HETATM 8144 C  C7  . Y00 M 6 .   ? -41.426  27.342  -15.191 1.00 40.19  ? 406 Y00 A C7  1 
HETATM 8145 C  C6  . Y00 M 6 .   ? -41.444  27.581  -16.564 1.00 38.17  ? 406 Y00 A C6  1 
HETATM 8146 O  O1  . Y00 M 6 .   ? -42.434  27.079  -17.356 1.00 36.14  ? 406 Y00 A O1  1 
HETATM 8147 C  C5  . Y00 M 6 .   ? -40.357  28.396  -17.156 1.00 37.30  ? 406 Y00 A C5  1 
HETATM 8148 O  O2  . Y00 M 6 .   ? -40.356  28.644  -18.492 1.00 36.91  ? 406 Y00 A O2  1 
HETATM 8149 C  C4  . Y00 M 6 .   ? -39.361  28.900  -16.325 1.00 37.99  ? 406 Y00 A C4  1 
HETATM 8150 C  C3  . Y00 M 6 .   ? -39.378  28.634  -14.956 1.00 39.49  ? 406 Y00 A C3  1 
HETATM 8151 C  C9  . 2CV N 4 .   ? -40.798  25.696  -35.672 1.00 50.73  ? 407 2CV A C9  1 
HETATM 8152 C  C12 . 2CV N 4 .   ? -40.786  24.193  -35.443 1.00 49.54  ? 407 2CV A C12 1 
HETATM 8153 C  C15 . 2CV N 4 .   ? -41.953  23.515  -36.116 1.00 47.94  ? 407 2CV A C15 1 
HETATM 8154 C  C18 . 2CV N 4 .   ? -43.042  23.131  -35.145 1.00 46.18  ? 407 2CV A C18 1 
HETATM 8155 C  C21 . 2CV N 4 .   ? -44.147  22.597  -36.039 1.00 47.07  ? 407 2CV A C21 1 
HETATM 8156 C  C24 . 2CV N 4 .   ? -45.246  21.993  -35.235 1.00 44.98  ? 407 2CV A C24 1 
HETATM 8157 C  C27 . 2CV N 4 .   ? -46.212  23.086  -34.860 1.00 44.22  ? 407 2CV A C27 1 
HETATM 8158 C  C30 . 2CV N 4 .   ? -47.002  22.401  -33.803 1.00 49.28  ? 407 2CV A C30 1 
HETATM 8159 N  N33 . 2CV N 4 .   ? -48.269  22.695  -33.537 1.00 57.25  ? 407 2CV A N33 1 
HETATM 8160 O  O34 . 2CV N 4 .   ? -46.419  21.541  -33.189 1.00 50.04  ? 407 2CV A O34 1 
HETATM 8161 C  C35 . 2CV N 4 .   ? -49.059  23.464  -34.496 1.00 65.06  ? 407 2CV A C35 1 
HETATM 8162 C  C36 . 2CV N 4 .   ? -48.846  22.226  -32.264 1.00 56.01  ? 407 2CV A C36 1 
HETATM 8163 C  C37 . 2CV N 4 .   ? -49.706  21.004  -32.557 1.00 55.31  ? 407 2CV A C37 1 
HETATM 8164 C  C40 . 2CV N 4 .   ? -50.396  20.465  -31.297 1.00 57.82  ? 407 2CV A C40 1 
HETATM 8165 C  C41 . 2CV N 4 .   ? -51.683  21.250  -30.988 1.00 60.84  ? 407 2CV A C41 1 
HETATM 8166 C  C42 . 2CV N 4 .   ? -52.366  20.935  -29.637 1.00 61.14  ? 407 2CV A C42 1 
HETATM 8167 C  C43 . 2CV N 4 .   ? -53.402  21.991  -29.226 1.00 60.38  ? 407 2CV A C43 1 
HETATM 8168 O  O44 . 2CV N 4 .   ? -54.292  21.481  -28.220 1.00 57.52  ? 407 2CV A O44 1 
HETATM 8169 O  O47 . 2CV N 4 .   ? -48.869  20.019  -33.153 1.00 55.02  ? 407 2CV A O47 1 
HETATM 8170 O  O49 . 2CV N 4 .   ? -49.487  20.471  -30.183 1.00 55.62  ? 407 2CV A O49 1 
HETATM 8171 O  O51 . 2CV N 4 .   ? -52.605  20.961  -32.051 1.00 65.93  ? 407 2CV A O51 1 
HETATM 8172 O  O53 . 2CV N 4 .   ? -51.408  20.808  -28.583 1.00 59.22  ? 407 2CV A O53 1 
HETATM 8173 C  C60 . 2CV N 4 .   ? -50.508  23.763  -34.097 1.00 73.81  ? 407 2CV A C60 1 
HETATM 8174 O  O63 . 2CV N 4 .   ? -50.641  24.325  -32.781 1.00 80.86  ? 407 2CV A O63 1 
HETATM 8175 C  C1  . 2CV N 4 .   ? -39.371  26.200  -35.476 1.00 52.24  ? 407 2CV A C1  1 
HETATM 8176 C  C0  . 2CV N 4 .   ? -38.544  26.136  -36.745 1.00 51.34  ? 407 2CV A C0  1 
HETATM 8177 NA NA  . NA  O 5 .   ? -20.988  30.777  -48.834 1.00 39.33  ? 401 NA  B NA  1 
HETATM 8178 C  C9  . 2CV P 4 .   ? -36.785  29.847  -32.737 1.00 44.06  ? 402 2CV B C9  1 
HETATM 8179 C  C12 . 2CV P 4 .   ? -38.305  29.976  -32.828 1.00 41.72  ? 402 2CV B C12 1 
HETATM 8180 C  C15 . 2CV P 4 .   ? -38.955  29.500  -31.544 1.00 40.61  ? 402 2CV B C15 1 
HETATM 8181 C  C18 . 2CV P 4 .   ? -40.428  29.138  -31.700 1.00 39.13  ? 402 2CV B C18 1 
HETATM 8182 C  C21 . 2CV P 4 .   ? -40.718  27.961  -30.779 1.00 38.92  ? 402 2CV B C21 1 
HETATM 8183 C  C24 . 2CV P 4 .   ? -42.117  28.002  -30.279 1.00 39.19  ? 402 2CV B C24 1 
HETATM 8184 C  C27 . 2CV P 4 .   ? -42.990  27.718  -31.467 1.00 42.41  ? 402 2CV B C27 1 
HETATM 8185 C  C30 . 2CV P 4 .   ? -44.361  27.719  -30.898 1.00 46.58  ? 402 2CV B C30 1 
HETATM 8186 N  N33 . 2CV P 4 .   ? -44.947  26.574  -30.528 1.00 52.37  ? 402 2CV B N33 1 
HETATM 8187 O  O34 . 2CV P 4 .   ? -44.867  28.817  -30.773 1.00 47.44  ? 402 2CV B O34 1 
HETATM 8188 C  C35 . 2CV P 4 .   ? -44.165  25.429  -30.016 1.00 58.02  ? 402 2CV B C35 1 
HETATM 8189 C  C36 . 2CV P 4 .   ? -46.425  26.478  -30.582 1.00 49.94  ? 402 2CV B C36 1 
HETATM 8190 C  C37 . 2CV P 4 .   ? -46.984  26.539  -29.154 1.00 48.11  ? 402 2CV B C37 1 
HETATM 8191 C  C40 . 2CV P 4 .   ? -48.508  26.424  -29.097 1.00 48.02  ? 402 2CV B C40 1 
HETATM 8192 C  C41 . 2CV P 4 .   ? -49.059  25.062  -29.511 1.00 46.37  ? 402 2CV B C41 1 
HETATM 8193 C  C42 . 2CV P 4 .   ? -50.543  24.833  -29.167 1.00 43.82  ? 402 2CV B C42 1 
HETATM 8194 C  C43 . 2CV P 4 .   ? -51.524  25.749  -29.876 1.00 42.90  ? 402 2CV B C43 1 
HETATM 8195 O  O44 . 2CV P 4 .   ? -52.814  25.140  -29.999 1.00 41.92  ? 402 2CV B O44 1 
HETATM 8196 O  O47 . 2CV P 4 .   ? -46.667  27.792  -28.562 1.00 48.05  ? 402 2CV B O47 1 
HETATM 8197 O  O49 . 2CV P 4 .   ? -49.083  27.427  -29.941 1.00 50.71  ? 402 2CV B O49 1 
HETATM 8198 O  O51 . 2CV P 4 .   ? -48.269  24.063  -28.856 1.00 47.41  ? 402 2CV B O51 1 
HETATM 8199 O  O53 . 2CV P 4 .   ? -50.761  25.032  -27.785 1.00 44.97  ? 402 2CV B O53 1 
HETATM 8200 C  C60 . 2CV P 4 .   ? -44.780  24.084  -30.401 1.00 64.94  ? 402 2CV B C60 1 
HETATM 8201 O  O63 . 2CV P 4 .   ? -45.861  23.729  -29.524 1.00 66.80  ? 402 2CV B O63 1 
HETATM 8202 C  C1  . 2CV P 4 .   ? -36.288  28.613  -33.504 1.00 44.73  ? 402 2CV B C1  1 
HETATM 8203 C  C0  . 2CV P 4 .   ? -34.824  28.306  -33.259 1.00 45.29  ? 402 2CV B C0  1 
HETATM 8204 C  C18 . 2CV Q 4 .   ? -55.602  35.908  -58.324 1.00 49.17  ? 403 2CV B C18 1 
HETATM 8205 C  C21 . 2CV Q 4 .   ? -55.245  37.390  -58.227 1.00 50.92  ? 403 2CV B C21 1 
HETATM 8206 C  C24 . 2CV Q 4 .   ? -56.459  38.293  -58.445 1.00 53.95  ? 403 2CV B C24 1 
HETATM 8207 C  C27 . 2CV Q 4 .   ? -57.261  38.458  -57.158 1.00 58.06  ? 403 2CV B C27 1 
HETATM 8208 C  C30 . 2CV Q 4 .   ? -58.430  39.422  -57.315 1.00 61.86  ? 403 2CV B C30 1 
HETATM 8209 N  N33 . 2CV Q 4 .   ? -59.664  39.013  -57.733 1.00 65.09  ? 403 2CV B N33 1 
HETATM 8210 O  O34 . 2CV Q 4 .   ? -58.189  40.588  -57.023 1.00 62.33  ? 403 2CV B O34 1 
HETATM 8211 C  C35 . 2CV Q 4 .   ? -59.977  37.624  -58.119 1.00 65.43  ? 403 2CV B C35 1 
HETATM 8212 C  C36 . 2CV Q 4 .   ? -60.818  39.948  -57.883 1.00 64.27  ? 403 2CV B C36 1 
HETATM 8213 C  C37 . 2CV Q 4 .   ? -61.480  40.340  -56.548 1.00 62.54  ? 403 2CV B C37 1 
HETATM 8214 C  C40 . 2CV Q 4 .   ? -62.638  41.320  -56.700 1.00 60.05  ? 403 2CV B C40 1 
HETATM 8215 O  O47 . 2CV Q 4 .   ? -60.548  41.030  -55.717 1.00 65.71  ? 403 2CV B O47 1 
HETATM 8216 O  O49 . 2CV Q 4 .   ? -63.745  40.718  -57.362 1.00 59.36  ? 403 2CV B O49 1 
HETATM 8217 C  C60 . 2CV Q 4 .   ? -60.633  36.917  -56.929 1.00 66.30  ? 403 2CV B C60 1 
HETATM 8218 O  O63 . 2CV Q 4 .   ? -62.020  36.648  -57.194 1.00 62.09  ? 403 2CV B O63 1 
HETATM 8219 C  C9  . 2CV R 4 .   ? -43.540  16.109  -37.736 1.00 96.64  ? 404 2CV B C9  1 
HETATM 8220 C  C12 . 2CV R 4 .   ? -42.541  17.067  -37.090 1.00 91.05  ? 404 2CV B C12 1 
HETATM 8221 C  C15 . 2CV R 4 .   ? -41.903  18.018  -38.100 1.00 88.49  ? 404 2CV B C15 1 
HETATM 8222 C  C18 . 2CV R 4 .   ? -40.965  18.966  -37.367 1.00 89.43  ? 404 2CV B C18 1 
HETATM 8223 C  C21 . 2CV R 4 .   ? -40.002  19.698  -38.291 1.00 91.33  ? 404 2CV B C21 1 
HETATM 8224 C  C24 . 2CV R 4 .   ? -38.968  20.441  -37.452 1.00 96.67  ? 404 2CV B C24 1 
HETATM 8225 C  C27 . 2CV R 4 .   ? -37.971  21.213  -38.312 1.00 106.53 ? 404 2CV B C27 1 
HETATM 8226 C  C30 . 2CV R 4 .   ? -36.712  21.552  -37.520 1.00 115.99 ? 404 2CV B C30 1 
HETATM 8227 N  N33 . 2CV R 4 .   ? -35.631  20.725  -37.483 1.00 120.45 ? 404 2CV B N33 1 
HETATM 8228 O  O34 . 2CV R 4 .   ? -36.741  22.619  -36.923 1.00 124.75 ? 404 2CV B O34 1 
HETATM 8229 C  C35 . 2CV R 4 .   ? -35.601  19.396  -38.112 1.00 121.87 ? 404 2CV B C35 1 
HETATM 8230 C  C36 . 2CV R 4 .   ? -34.380  21.090  -36.786 1.00 122.97 ? 404 2CV B C36 1 
HETATM 8231 C  C37 . 2CV R 4 .   ? -33.522  21.937  -37.740 1.00 127.41 ? 404 2CV B C37 1 
HETATM 8232 C  C40 . 2CV R 4 .   ? -32.028  22.037  -37.388 1.00 123.64 ? 404 2CV B C40 1 
HETATM 8233 C  C41 . 2CV R 4 .   ? -31.220  20.736  -37.526 1.00 118.89 ? 404 2CV B C41 1 
HETATM 8234 C  C42 . 2CV R 4 .   ? -29.705  20.966  -37.317 1.00 112.61 ? 404 2CV B C42 1 
HETATM 8235 C  C43 . 2CV R 4 .   ? -28.806  20.583  -38.495 1.00 104.29 ? 404 2CV B C43 1 
HETATM 8236 O  O44 . 2CV R 4 .   ? -27.426  20.624  -38.101 1.00 93.90  ? 404 2CV B O44 1 
HETATM 8237 O  O47 . 2CV R 4 .   ? -34.037  23.271  -37.737 1.00 139.78 ? 404 2CV B O47 1 
HETATM 8238 O  O49 . 2CV R 4 .   ? -31.919  22.529  -36.048 1.00 126.76 ? 404 2CV B O49 1 
HETATM 8239 O  O51 . 2CV R 4 .   ? -31.497  20.150  -38.804 1.00 119.02 ? 404 2CV B O51 1 
HETATM 8240 O  O53 . 2CV R 4 .   ? -29.267  20.217  -36.175 1.00 118.30 ? 404 2CV B O53 1 
HETATM 8241 C  C60 . 2CV R 4 .   ? -35.260  19.575  -39.591 1.00 123.28 ? 404 2CV B C60 1 
HETATM 8242 O  O63 . 2CV R 4 .   ? -33.887  19.238  -39.824 1.00 124.99 ? 404 2CV B O63 1 
HETATM 8243 C  C1  . 2CV R 4 .   ? -42.891  14.816  -38.241 1.00 98.92  ? 404 2CV B C1  1 
HETATM 8244 C  C0  . 2CV R 4 .   ? -43.887  13.905  -38.942 1.00 97.19  ? 404 2CV B C0  1 
HETATM 8245 O  O3  . Y00 S 6 .   ? -31.481  40.558  -47.365 1.00 69.93  ? 405 Y00 B O3  1 
HETATM 8246 C  C16 . Y00 S 6 .   ? -31.822  39.372  -47.929 1.00 67.85  ? 405 Y00 B C16 1 
HETATM 8247 C  C15 . Y00 S 6 .   ? -30.949  38.764  -48.832 1.00 66.04  ? 405 Y00 B C15 1 
HETATM 8248 C  C14 . Y00 S 6 .   ? -31.286  37.540  -49.406 1.00 66.19  ? 405 Y00 B C14 1 
HETATM 8249 C  C17 . Y00 S 6 .   ? -33.038  38.768  -47.598 1.00 66.56  ? 405 Y00 B C17 1 
HETATM 8250 C  C18 . Y00 S 6 .   ? -33.366  37.537  -48.171 1.00 66.64  ? 405 Y00 B C18 1 
HETATM 8251 C  C13 . Y00 S 6 .   ? -32.497  36.925  -49.082 1.00 64.99  ? 405 Y00 B C13 1 
HETATM 8252 C  C12 . Y00 S 6 .   ? -32.863  35.602  -49.721 1.00 60.92  ? 405 Y00 B C12 1 
HETATM 8253 C  C11 . Y00 S 6 .   ? -32.650  34.476  -48.730 1.00 58.65  ? 405 Y00 B C11 1 
HETATM 8254 C  C9  . Y00 S 6 .   ? -33.143  33.125  -49.223 1.00 58.95  ? 405 Y00 B C9  1 
HETATM 8255 C  C10 . Y00 S 6 .   ? -32.662  32.044  -48.250 1.00 59.32  ? 405 Y00 B C10 1 
HETATM 8256 N  N1  . Y00 S 6 .   ? -34.597  33.093  -49.394 1.00 61.00  ? 405 Y00 B N1  1 
HETATM 8257 C  C8  . Y00 S 6 .   ? -35.238  32.073  -50.216 1.00 60.61  ? 405 Y00 B C8  1 
HETATM 8258 C  C1  . Y00 S 6 .   ? -36.767  32.108  -50.208 1.00 60.50  ? 405 Y00 B C1  1 
HETATM 8259 C  C2  . Y00 S 6 .   ? -37.335  30.800  -50.742 1.00 61.28  ? 405 Y00 B C2  1 
HETATM 8260 C  C7  . Y00 S 6 .   ? -36.938  30.305  -51.991 1.00 61.20  ? 405 Y00 B C7  1 
HETATM 8261 C  C6  . Y00 S 6 .   ? -37.442  29.099  -52.486 1.00 59.91  ? 405 Y00 B C6  1 
HETATM 8262 O  O1  . Y00 S 6 .   ? -37.054  28.605  -53.699 1.00 60.72  ? 405 Y00 B O1  1 
HETATM 8263 C  C5  . Y00 S 6 .   ? -38.421  28.355  -51.663 1.00 58.73  ? 405 Y00 B C5  1 
HETATM 8264 O  O2  . Y00 S 6 .   ? -38.925  27.181  -52.121 1.00 56.42  ? 405 Y00 B O2  1 
HETATM 8265 C  C4  . Y00 S 6 .   ? -38.807  28.880  -50.433 1.00 59.13  ? 405 Y00 B C4  1 
HETATM 8266 C  C3  . Y00 S 6 .   ? -38.266  30.086  -49.979 1.00 60.90  ? 405 Y00 B C3  1 
HETATM 8267 O  O   . HOH T 7 .   ? -35.805  19.026  -12.364 1.00 35.77  ? 501 HOH A O   1 
HETATM 8268 O  O   . HOH T 7 .   ? -45.389  31.031  1.848   1.00 42.04  ? 502 HOH A O   1 
HETATM 8269 O  O   . HOH T 7 .   ? -24.092  23.830  -16.480 1.00 31.18  ? 503 HOH A O   1 
HETATM 8270 O  O   . HOH T 7 .   ? -22.586  25.689  -20.778 1.00 11.92  ? 504 HOH A O   1 
HETATM 8271 O  O   . HOH T 7 .   ? -13.016  35.278  -23.001 1.00 21.84  ? 505 HOH A O   1 
HETATM 8272 O  O   . HOH T 7 .   ? -13.725  28.868  -14.909 1.00 34.63  ? 506 HOH A O   1 
HETATM 8273 O  O   . HOH U 7 .   ? 1.790    19.835  -32.557 1.00 24.19  ? 201 HOH C O   1 
HETATM 8274 O  O   . HOH U 7 .   ? -6.304   24.157  -14.724 1.00 22.32  ? 202 HOH C O   1 
HETATM 8275 O  O   . HOH U 7 .   ? -9.904   32.423  -24.246 1.00 17.17  ? 203 HOH C O   1 
HETATM 8276 O  O   . HOH U 7 .   ? 18.056   28.317  -36.628 1.00 0.50   ? 204 HOH C O   1 
HETATM 8277 O  O   . HOH U 7 .   ? 14.573   24.745  -36.611 1.00 26.14  ? 205 HOH C O   1 
HETATM 8278 O  O   . HOH V 7 .   ? -56.032  30.802  -47.641 1.00 24.65  ? 501 HOH B O   1 
HETATM 8279 O  O   . HOH W 7 .   ? -89.801  20.099  -42.719 1.00 19.85  ? 201 HOH D O   1 
HETATM 8280 O  O   . HOH W 7 .   ? -91.698  33.331  -30.167 1.00 17.71  ? 202 HOH D O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   1   ?   ?   ?   E . n 
A 1 2   ASP 2   2   ?   ?   ?   E . n 
A 1 3   LYS 3   3   3   LYS LYS E . n 
A 1 4   ILE 4   4   4   ILE ILE E . n 
A 1 5   ILE 5   5   5   ILE ILE E . n 
A 1 6   HIS 6   6   6   HIS HIS E . n 
A 1 7   LEU 7   7   7   LEU LEU E . n 
A 1 8   THR 8   8   8   THR THR E . n 
A 1 9   ASP 9   9   9   ASP ASP E . n 
A 1 10  ASP 10  10  10  ASP ASP E . n 
A 1 11  SER 11  11  11  SER SER E . n 
A 1 12  PHE 12  12  12  PHE PHE E . n 
A 1 13  ASP 13  13  13  ASP ASP E . n 
A 1 14  THR 14  14  14  THR THR E . n 
A 1 15  ASP 15  15  15  ASP ASP E . n 
A 1 16  VAL 16  16  16  VAL VAL E . n 
A 1 17  LEU 17  17  17  LEU LEU E . n 
A 1 18  LYS 18  18  18  LYS LYS E . n 
A 1 19  ALA 19  19  19  ALA ALA E . n 
A 1 20  ASP 20  20  20  ASP ASP E . n 
A 1 21  GLY 21  21  21  GLY GLY E . n 
A 1 22  ALA 22  22  22  ALA ALA E . n 
A 1 23  ILE 23  23  23  ILE ILE E . n 
A 1 24  LEU 24  24  24  LEU LEU E . n 
A 1 25  VAL 25  25  25  VAL VAL E . n 
A 1 26  ASP 26  26  26  ASP ASP E . n 
A 1 27  PHE 27  27  27  PHE PHE E . n 
A 1 28  TRP 28  28  28  TRP TRP E . n 
A 1 29  ALA 29  29  29  ALA ALA E . n 
A 1 30  GLU 30  30  30  GLU GLU E . n 
A 1 31  TRP 31  31  31  TRP TRP E . n 
A 1 32  SER 32  32  32  SER SER E . n 
A 1 33  GLY 33  33  33  GLY GLY E . n 
A 1 34  PRO 34  34  34  PRO PRO E . n 
A 1 35  SER 35  35  35  SER SER E . n 
A 1 36  LYS 36  36  36  LYS LYS E . n 
A 1 37  MET 37  37  37  MET MET E . n 
A 1 38  ILE 38  38  38  ILE ILE E . n 
A 1 39  ALA 39  39  39  ALA ALA E . n 
A 1 40  PRO 40  40  40  PRO PRO E . n 
A 1 41  ILE 41  41  41  ILE ILE E . n 
A 1 42  LEU 42  42  42  LEU LEU E . n 
A 1 43  ASP 43  43  43  ASP ASP E . n 
A 1 44  GLU 44  44  44  GLU GLU E . n 
A 1 45  ILE 45  45  45  ILE ILE E . n 
A 1 46  ALA 46  46  46  ALA ALA E . n 
A 1 47  ASP 47  47  47  ASP ASP E . n 
A 1 48  GLU 48  48  48  GLU GLU E . n 
A 1 49  TYR 49  49  49  TYR TYR E . n 
A 1 50  GLN 50  50  50  GLN GLN E . n 
A 1 51  GLY 51  51  51  GLY GLY E . n 
A 1 52  LYS 52  52  52  LYS LYS E . n 
A 1 53  LEU 53  53  53  LEU LEU E . n 
A 1 54  THR 54  54  54  THR THR E . n 
A 1 55  VAL 55  55  55  VAL VAL E . n 
A 1 56  ALA 56  56  56  ALA ALA E . n 
A 1 57  LYS 57  57  57  LYS LYS E . n 
A 1 58  LEU 58  58  58  LEU LEU E . n 
A 1 59  ASN 59  59  59  ASN ASN E . n 
A 1 60  ILE 60  60  60  ILE ILE E . n 
A 1 61  ASP 61  61  61  ASP ASP E . n 
A 1 62  GLN 62  62  62  GLN GLN E . n 
A 1 63  ASN 63  63  63  ASN ASN E . n 
A 1 64  PRO 64  64  64  PRO PRO E . n 
A 1 65  GLY 65  65  65  GLY GLY E . n 
A 1 66  THR 66  66  66  THR THR E . n 
A 1 67  ALA 67  67  67  ALA ALA E . n 
A 1 68  PRO 68  68  68  PRO PRO E . n 
A 1 69  LYS 69  69  69  LYS LYS E . n 
A 1 70  TYR 70  70  70  TYR TYR E . n 
A 1 71  GLY 71  71  71  GLY GLY E . n 
A 1 72  ILE 72  72  72  ILE ILE E . n 
A 1 73  ARG 73  73  73  ARG ARG E . n 
A 1 74  GLY 74  74  74  GLY GLY E . n 
A 1 75  ILE 75  75  75  ILE ILE E . n 
A 1 76  PRO 76  76  76  PRO PRO E . n 
A 1 77  THR 77  77  77  THR THR E . n 
A 1 78  LEU 78  78  78  LEU LEU E . n 
A 1 79  LEU 79  79  79  LEU LEU E . n 
A 1 80  LEU 80  80  80  LEU LEU E . n 
A 1 81  PHE 81  81  81  PHE PHE E . n 
A 1 82  LYS 82  82  82  LYS LYS E . n 
A 1 83  ASN 83  83  83  ASN ASN E . n 
A 1 84  GLY 84  84  84  GLY GLY E . n 
A 1 85  GLU 85  85  85  GLU GLU E . n 
A 1 86  VAL 86  86  86  VAL VAL E . n 
A 1 87  ALA 87  87  87  ALA ALA E . n 
A 1 88  ALA 88  88  88  ALA ALA E . n 
A 1 89  THR 89  89  89  THR THR E . n 
A 1 90  LYS 90  90  90  LYS LYS E . n 
A 1 91  VAL 91  91  91  VAL VAL E . n 
A 1 92  GLY 92  92  92  GLY GLY E . n 
A 1 93  ALA 93  93  93  ALA ALA E . n 
A 1 94  LEU 94  94  94  LEU LEU E . n 
A 1 95  SER 95  95  95  SER SER E . n 
A 1 96  LYS 96  96  96  LYS LYS E . n 
A 1 97  GLY 97  97  97  GLY GLY E . n 
A 1 98  GLN 98  98  98  GLN GLN E . n 
A 1 99  LEU 99  99  99  LEU LEU E . n 
A 1 100 LYS 100 100 100 LYS LYS E . n 
A 1 101 GLU 101 101 101 GLU GLU E . n 
A 1 102 PHE 102 102 102 PHE PHE E . n 
A 1 103 LEU 103 103 103 LEU LEU E . n 
A 1 104 ASP 104 104 104 ASP ASP E . n 
A 1 105 ALA 105 105 105 ALA ALA E . n 
A 1 106 ASN 106 106 106 ASN ASN E . n 
A 1 107 LEU 107 107 107 LEU LEU E . n 
A 1 108 ALA 108 108 108 ALA ALA E . n 
A 1 109 GLU 109 109 109 GLU GLU E . n 
B 2 1   ALA 1   39  ?   ?   ?   A . n 
B 2 2   ALA 2   40  40  ALA ALA A . n 
B 2 3   ALA 3   41  41  ALA ALA A . n 
B 2 4   LYS 4   42  42  LYS LYS A . n 
B 2 5   VAL 5   43  43  VAL VAL A . n 
B 2 6   MET 6   44  44  MET MET A . n 
B 2 7   SER 7   45  45  SER SER A . n 
B 2 8   LEU 8   46  46  LEU LEU A . n 
B 2 9   LEU 9   47  47  LEU LEU A . n 
B 2 10  MET 10  48  48  MET MET A . n 
B 2 11  ALA 11  49  49  ALA ALA A . n 
B 2 12  LEU 12  50  50  LEU LEU A . n 
B 2 13  VAL 13  51  51  VAL VAL A . n 
B 2 14  VAL 14  52  52  VAL VAL A . n 
B 2 15  LEU 15  53  53  LEU LEU A . n 
B 2 16  LEU 16  54  54  LEU LEU A . n 
B 2 17  ILE 17  55  55  ILE ILE A . n 
B 2 18  VAL 18  56  56  VAL VAL A . n 
B 2 19  ALA 19  57  57  ALA ALA A . n 
B 2 20  GLY 20  58  58  GLY GLY A . n 
B 2 21  ASN 21  59  59  ASN ASN A . n 
B 2 22  VAL 22  60  60  VAL VAL A . n 
B 2 23  LEU 23  61  61  LEU LEU A . n 
B 2 24  VAL 24  62  62  VAL VAL A . n 
B 2 25  ILE 25  63  63  ILE ILE A . n 
B 2 26  ALA 26  64  64  ALA ALA A . n 
B 2 27  ALA 27  65  65  ALA ALA A . n 
B 2 28  ILE 28  66  66  ILE ILE A . n 
B 2 29  GLY 29  67  67  GLY GLY A . n 
B 2 30  SER 30  68  68  SER SER A . n 
B 2 31  THR 31  69  69  THR THR A . n 
B 2 32  GLN 32  70  70  GLN GLN A . n 
B 2 33  ARG 33  71  71  ARG ARG A . n 
B 2 34  LEU 34  72  72  LEU LEU A . n 
B 2 35  GLN 35  73  73  GLN GLN A . n 
B 2 36  THR 36  74  74  THR THR A . n 
B 2 37  LEU 37  75  75  LEU LEU A . n 
B 2 38  THR 38  76  76  THR THR A . n 
B 2 39  ASN 39  77  77  ASN ASN A . n 
B 2 40  LEU 40  78  78  LEU LEU A . n 
B 2 41  PHE 41  79  79  PHE PHE A . n 
B 2 42  ILE 42  80  80  ILE ILE A . n 
B 2 43  THR 43  81  81  THR THR A . n 
B 2 44  SER 44  82  82  SER SER A . n 
B 2 45  LEU 45  83  83  LEU LEU A . n 
B 2 46  ALA 46  84  84  ALA ALA A . n 
B 2 47  CYS 47  85  85  CYS CYS A . n 
B 2 48  ALA 48  86  86  ALA ALA A . n 
B 2 49  ASP 49  87  87  ASP ASP A . n 
B 2 50  LEU 50  88  88  LEU LEU A . n 
B 2 51  VAL 51  89  89  VAL VAL A . n 
B 2 52  VAL 52  90  90  VAL VAL A . n 
B 2 53  GLY 53  91  91  GLY GLY A . n 
B 2 54  LEU 54  92  92  LEU LEU A . n 
B 2 55  LEU 55  93  93  LEU LEU A . n 
B 2 56  VAL 56  94  94  VAL VAL A . n 
B 2 57  VAL 57  95  95  VAL VAL A . n 
B 2 58  PRO 58  96  96  PRO PRO A . n 
B 2 59  PHE 59  97  97  PHE PHE A . n 
B 2 60  GLY 60  98  98  GLY GLY A . n 
B 2 61  ALA 61  99  99  ALA ALA A . n 
B 2 62  THR 62  100 100 THR THR A . n 
B 2 63  LEU 63  101 101 LEU LEU A . n 
B 2 64  VAL 64  102 102 VAL VAL A . n 
B 2 65  VAL 65  103 103 VAL VAL A . n 
B 2 66  ARG 66  104 104 ARG ARG A . n 
B 2 67  GLY 67  105 105 GLY GLY A . n 
B 2 68  THR 68  106 106 THR THR A . n 
B 2 69  TRP 69  107 107 TRP TRP A . n 
B 2 70  LEU 70  108 108 LEU LEU A . n 
B 2 71  TRP 71  109 109 TRP TRP A . n 
B 2 72  GLY 72  110 110 GLY GLY A . n 
B 2 73  SER 73  111 111 SER SER A . n 
B 2 74  PHE 74  112 112 PHE PHE A . n 
B 2 75  LEU 75  113 113 LEU LEU A . n 
B 2 76  CYS 76  114 114 CYS CYS A . n 
B 2 77  GLU 77  115 115 GLU GLU A . n 
B 2 78  LEU 78  116 116 LEU LEU A . n 
B 2 79  TRP 79  117 117 TRP TRP A . n 
B 2 80  THR 80  118 118 THR THR A . n 
B 2 81  SER 81  119 119 SER SER A . n 
B 2 82  LEU 82  120 120 LEU LEU A . n 
B 2 83  ASP 83  121 121 ASP ASP A . n 
B 2 84  VAL 84  122 122 VAL VAL A . n 
B 2 85  LEU 85  123 123 LEU LEU A . n 
B 2 86  CYS 86  124 124 CYS CYS A . n 
B 2 87  VAL 87  125 125 VAL VAL A . n 
B 2 88  THR 88  126 126 THR THR A . n 
B 2 89  ALA 89  127 127 ALA ALA A . n 
B 2 90  SER 90  128 128 SER SER A . n 
B 2 91  ILE 91  129 129 ILE ILE A . n 
B 2 92  GLU 92  130 130 GLU GLU A . n 
B 2 93  THR 93  131 131 THR THR A . n 
B 2 94  LEU 94  132 132 LEU LEU A . n 
B 2 95  CYS 95  133 133 CYS CYS A . n 
B 2 96  VAL 96  134 134 VAL VAL A . n 
B 2 97  ILE 97  135 135 ILE ILE A . n 
B 2 98  ALA 98  136 136 ALA ALA A . n 
B 2 99  ILE 99  137 137 ILE ILE A . n 
B 2 100 ASP 100 138 138 ASP ASP A . n 
B 2 101 ARG 101 139 139 ARG ARG A . n 
B 2 102 TYR 102 140 140 TYR TYR A . n 
B 2 103 LEU 103 141 141 LEU LEU A . n 
B 2 104 ALA 104 142 142 ALA ALA A . n 
B 2 105 ILE 105 143 143 ILE ILE A . n 
B 2 106 THR 106 144 144 THR THR A . n 
B 2 107 SER 107 145 145 SER SER A . n 
B 2 108 PRO 108 146 146 PRO PRO A . n 
B 2 109 PHE 109 147 147 PHE PHE A . n 
B 2 110 ARG 110 148 148 ARG ARG A . n 
B 2 111 TYR 111 149 149 TYR TYR A . n 
B 2 112 GLN 112 150 150 GLN GLN A . n 
B 2 113 SER 113 151 151 SER SER A . n 
B 2 114 LEU 114 152 152 LEU LEU A . n 
B 2 115 MET 115 153 153 MET MET A . n 
B 2 116 THR 116 154 154 THR THR A . n 
B 2 117 ARG 117 155 155 ARG ARG A . n 
B 2 118 ALA 118 156 156 ALA ALA A . n 
B 2 119 ARG 119 157 157 ARG ARG A . n 
B 2 120 ALA 120 158 158 ALA ALA A . n 
B 2 121 LYS 121 159 159 LYS LYS A . n 
B 2 122 VAL 122 160 160 VAL VAL A . n 
B 2 123 ILE 123 161 161 ILE ILE A . n 
B 2 124 ILE 124 162 162 ILE ILE A . n 
B 2 125 CYS 125 163 163 CYS CYS A . n 
B 2 126 THR 126 164 164 THR THR A . n 
B 2 127 VAL 127 165 165 VAL VAL A . n 
B 2 128 TRP 128 166 166 TRP TRP A . n 
B 2 129 ALA 129 167 167 ALA ALA A . n 
B 2 130 ILE 130 168 168 ILE ILE A . n 
B 2 131 SER 131 169 169 SER SER A . n 
B 2 132 ALA 132 170 170 ALA ALA A . n 
B 2 133 LEU 133 171 171 LEU LEU A . n 
B 2 134 VAL 134 172 172 VAL VAL A . n 
B 2 135 SER 135 173 173 SER SER A . n 
B 2 136 PHE 136 174 174 PHE PHE A . n 
B 2 137 LEU 137 175 175 LEU LEU A . n 
B 2 138 PRO 138 176 176 PRO PRO A . n 
B 2 139 ILE 139 177 177 ILE ILE A . n 
B 2 140 MET 140 178 178 MET MET A . n 
B 2 141 MET 141 179 179 MET MET A . n 
B 2 142 HIS 142 180 180 HIS HIS A . n 
B 2 143 TRP 143 181 181 TRP TRP A . n 
B 2 144 TRP 144 182 182 TRP TRP A . n 
B 2 145 ARG 145 183 183 ARG ARG A . n 
B 2 146 ASP 146 184 184 ASP ASP A . n 
B 2 147 GLU 147 185 185 GLU GLU A . n 
B 2 148 ASP 148 186 186 ASP ASP A . n 
B 2 149 PRO 149 187 187 PRO PRO A . n 
B 2 150 GLN 150 188 188 GLN GLN A . n 
B 2 151 ALA 151 189 189 ALA ALA A . n 
B 2 152 LEU 152 190 190 LEU LEU A . n 
B 2 153 LYS 153 191 191 LYS LYS A . n 
B 2 154 CYS 154 192 192 CYS CYS A . n 
B 2 155 TYR 155 193 193 TYR TYR A . n 
B 2 156 GLN 156 194 194 GLN GLN A . n 
B 2 157 ASP 157 195 195 ASP ASP A . n 
B 2 158 PRO 158 196 196 PRO PRO A . n 
B 2 159 GLY 159 197 197 GLY GLY A . n 
B 2 160 CYS 160 198 198 CYS CYS A . n 
B 2 161 CYS 161 199 199 CYS CYS A . n 
B 2 162 ASP 162 200 200 ASP ASP A . n 
B 2 163 PHE 163 201 201 PHE PHE A . n 
B 2 164 VAL 164 202 202 VAL VAL A . n 
B 2 165 THR 165 203 203 THR THR A . n 
B 2 166 ASN 166 204 204 ASN ASN A . n 
B 2 167 ARG 167 205 205 ARG ARG A . n 
B 2 168 ALA 168 206 206 ALA ALA A . n 
B 2 169 TYR 169 207 207 TYR TYR A . n 
B 2 170 ALA 170 208 208 ALA ALA A . n 
B 2 171 ILE 171 209 209 ILE ILE A . n 
B 2 172 ALA 172 210 210 ALA ALA A . n 
B 2 173 SER 173 211 211 SER SER A . n 
B 2 174 SER 174 212 212 SER SER A . n 
B 2 175 ILE 175 213 213 ILE ILE A . n 
B 2 176 ILE 176 214 214 ILE ILE A . n 
B 2 177 SER 177 215 215 SER SER A . n 
B 2 178 PHE 178 216 216 PHE PHE A . n 
B 2 179 TYR 179 217 217 TYR TYR A . n 
B 2 180 ILE 180 218 218 ILE ILE A . n 
B 2 181 PRO 181 219 219 PRO PRO A . n 
B 2 182 LEU 182 220 220 LEU LEU A . n 
B 2 183 LEU 183 221 221 LEU LEU A . n 
B 2 184 ILE 184 222 222 ILE ILE A . n 
B 2 185 MET 185 223 223 MET MET A . n 
B 2 186 ILE 186 224 224 ILE ILE A . n 
B 2 187 PHE 187 225 225 PHE PHE A . n 
B 2 188 VAL 188 226 226 VAL VAL A . n 
B 2 189 TYR 189 227 227 TYR TYR A . n 
B 2 190 LEU 190 228 228 LEU LEU A . n 
B 2 191 ARG 191 229 229 ARG ARG A . n 
B 2 192 VAL 192 230 230 VAL VAL A . n 
B 2 193 TYR 193 231 231 TYR TYR A . n 
B 2 194 ARG 194 232 232 ARG ARG A . n 
B 2 195 GLU 195 233 233 GLU GLU A . n 
B 2 196 ALA 196 234 234 ALA ALA A . n 
B 2 197 LYS 197 235 235 LYS LYS A . n 
B 2 198 GLU 198 236 236 GLU GLU A . n 
B 2 199 GLN 199 237 237 GLN GLN A . n 
B 2 200 ILE 200 238 238 ILE ILE A . n 
B 2 201 ARG 201 239 239 ARG ARG A . n 
B 2 202 LYS 202 240 240 LYS LYS A . n 
B 2 203 ILE 203 241 241 ILE ILE A . n 
B 2 204 ASP 204 242 242 ASP ASP A . n 
B 2 205 ARG 205 243 243 ARG ARG A . n 
B 2 206 ALA 206 272 272 ALA ALA A . n 
B 2 207 SER 207 273 273 SER SER A . n 
B 2 208 LYS 208 274 274 LYS LYS A . n 
B 2 209 ARG 209 275 275 ARG ARG A . n 
B 2 210 LYS 210 276 276 LYS LYS A . n 
B 2 211 THR 211 277 277 THR THR A . n 
B 2 212 SER 212 278 278 SER SER A . n 
B 2 213 ARG 213 279 279 ARG ARG A . n 
B 2 214 VAL 214 280 280 VAL VAL A . n 
B 2 215 MET 215 281 281 MET MET A . n 
B 2 216 ALA 216 282 282 ALA ALA A . n 
B 2 217 MET 217 283 283 MET MET A . n 
B 2 218 LYS 218 284 284 LYS LYS A . n 
B 2 219 GLU 219 285 285 GLU GLU A . n 
B 2 220 HIS 220 286 286 HIS HIS A . n 
B 2 221 LYS 221 287 287 LYS LYS A . n 
B 2 222 ALA 222 288 288 ALA ALA A . n 
B 2 223 LEU 223 289 289 LEU LEU A . n 
B 2 224 LYS 224 290 290 LYS LYS A . n 
B 2 225 THR 225 291 291 THR THR A . n 
B 2 226 LEU 226 292 292 LEU LEU A . n 
B 2 227 GLY 227 293 293 GLY GLY A . n 
B 2 228 ILE 228 294 294 ILE ILE A . n 
B 2 229 ILE 229 295 295 ILE ILE A . n 
B 2 230 MET 230 296 296 MET MET A . n 
B 2 231 GLY 231 297 297 GLY GLY A . n 
B 2 232 VAL 232 298 298 VAL VAL A . n 
B 2 233 PHE 233 299 299 PHE PHE A . n 
B 2 234 THR 234 300 300 THR THR A . n 
B 2 235 LEU 235 301 301 LEU LEU A . n 
B 2 236 CYS 236 302 302 CYS CYS A . n 
B 2 237 TRP 237 303 303 TRP TRP A . n 
B 2 238 LEU 238 304 304 LEU LEU A . n 
B 2 239 PRO 239 305 305 PRO PRO A . n 
B 2 240 PHE 240 306 306 PHE PHE A . n 
B 2 241 PHE 241 307 307 PHE PHE A . n 
B 2 242 LEU 242 308 308 LEU LEU A . n 
B 2 243 VAL 243 309 309 VAL VAL A . n 
B 2 244 ASN 244 310 310 ASN ASN A . n 
B 2 245 ILE 245 311 311 ILE ILE A . n 
B 2 246 VAL 246 312 312 VAL VAL A . n 
B 2 247 ASN 247 313 313 ASN ASN A . n 
B 2 248 VAL 248 314 314 VAL VAL A . n 
B 2 249 PHE 249 315 315 PHE PHE A . n 
B 2 250 ASN 250 316 316 ASN ASN A . n 
B 2 251 ARG 251 317 317 ARG ARG A . n 
B 2 252 ASP 252 318 318 ASP ASP A . n 
B 2 253 LEU 253 319 319 LEU LEU A . n 
B 2 254 VAL 254 320 320 VAL VAL A . n 
B 2 255 PRO 255 321 321 PRO PRO A . n 
B 2 256 ASP 256 322 322 ASP ASP A . n 
B 2 257 TRP 257 323 323 TRP TRP A . n 
B 2 258 LEU 258 324 324 LEU LEU A . n 
B 2 259 PHE 259 325 325 PHE PHE A . n 
B 2 260 VAL 260 326 326 VAL VAL A . n 
B 2 261 ALA 261 327 327 ALA ALA A . n 
B 2 262 PHE 262 328 328 PHE PHE A . n 
B 2 263 ASN 263 329 329 ASN ASN A . n 
B 2 264 TRP 264 330 330 TRP TRP A . n 
B 2 265 LEU 265 331 331 LEU LEU A . n 
B 2 266 GLY 266 332 332 GLY GLY A . n 
B 2 267 TYR 267 333 333 TYR TYR A . n 
B 2 268 ALA 268 334 334 ALA ALA A . n 
B 2 269 ASN 269 335 335 ASN ASN A . n 
B 2 270 SER 270 336 336 SER SER A . n 
B 2 271 ALA 271 337 337 ALA ALA A . n 
B 2 272 MET 272 338 338 MET MET A . n 
B 2 273 ASN 273 339 339 ASN ASN A . n 
B 2 274 PRO 274 340 340 PRO PRO A . n 
B 2 275 ILE 275 341 341 ILE ILE A . n 
B 2 276 ILE 276 342 342 ILE ILE A . n 
B 2 277 TYR 277 343 343 TYR TYR A . n 
B 2 278 CYS 278 344 344 CYS CYS A . n 
B 2 279 ARG 279 345 345 ARG ARG A . n 
B 2 280 SER 280 346 346 SER SER A . n 
B 2 281 PRO 281 347 347 PRO PRO A . n 
B 2 282 ASP 282 348 348 ASP ASP A . n 
B 2 283 PHE 283 349 349 PHE PHE A . n 
B 2 284 ARG 284 350 350 ARG ARG A . n 
B 2 285 LYS 285 351 351 LYS LYS A . n 
B 2 286 ALA 286 352 352 ALA ALA A . n 
B 2 287 PHE 287 353 353 PHE PHE A . n 
B 2 288 LYS 288 354 354 LYS LYS A . n 
B 2 289 ARG 289 355 355 ARG ARG A . n 
B 2 290 LEU 290 356 356 LEU LEU A . n 
B 2 291 LEU 291 357 357 LEU LEU A . n 
B 2 292 ALA 292 358 358 ALA ALA A . n 
B 2 293 PHE 293 359 ?   ?   ?   A . n 
B 2 294 PRO 294 360 ?   ?   ?   A . n 
B 2 295 ARG 295 361 ?   ?   ?   A . n 
B 2 296 LYS 296 362 ?   ?   ?   A . n 
B 2 297 ALA 297 363 ?   ?   ?   A . n 
B 2 298 ASP 298 364 ?   ?   ?   A . n 
B 2 299 ARG 299 365 ?   ?   ?   A . n 
B 2 300 ARG 300 366 ?   ?   ?   A . n 
B 2 301 LEU 301 367 ?   ?   ?   A . n 
B 2 302 HIS 302 368 ?   ?   ?   A . n 
B 2 303 HIS 303 369 ?   ?   ?   A . n 
B 2 304 HIS 304 370 ?   ?   ?   A . n 
B 2 305 HIS 305 371 ?   ?   ?   A . n 
B 2 306 HIS 306 372 ?   ?   ?   A . n 
B 2 307 HIS 307 373 ?   ?   ?   A . n 
C 3 1   SER 1   0   ?   ?   ?   C . n 
C 3 2   GLN 2   1   1   GLN GLN C . n 
C 3 3   VAL 3   2   2   VAL VAL C . n 
C 3 4   GLN 4   3   3   GLN GLN C . n 
C 3 5   LEU 5   4   4   LEU LEU C . n 
C 3 6   GLN 6   5   5   GLN GLN C . n 
C 3 7   GLU 7   6   6   GLU GLU C . n 
C 3 8   SER 8   7   7   SER SER C . n 
C 3 9   GLY 9   8   8   GLY GLY C . n 
C 3 10  GLY 10  9   9   GLY GLY C . n 
C 3 11  GLY 11  10  10  GLY GLY C . n 
C 3 12  LEU 12  11  11  LEU LEU C . n 
C 3 13  VAL 13  12  12  VAL VAL C . n 
C 3 14  GLN 14  13  13  GLN GLN C . n 
C 3 15  ALA 15  14  14  ALA ALA C . n 
C 3 16  GLY 16  15  15  GLY GLY C . n 
C 3 17  GLY 17  16  16  GLY GLY C . n 
C 3 18  SER 18  17  17  SER SER C . n 
C 3 19  LEU 19  18  18  LEU LEU C . n 
C 3 20  ARG 20  19  19  ARG ARG C . n 
C 3 21  LEU 21  20  20  LEU LEU C . n 
C 3 22  SER 22  21  21  SER SER C . n 
C 3 23  CYS 23  22  22  CYS CYS C . n 
C 3 24  ALA 24  23  23  ALA ALA C . n 
C 3 25  ALA 25  24  24  ALA ALA C . n 
C 3 26  SER 26  25  25  SER SER C . n 
C 3 27  GLY 27  26  26  GLY GLY C . n 
C 3 28  SER 28  27  27  SER SER C . n 
C 3 29  ILE 29  28  28  ILE ILE C . n 
C 3 30  PHE 30  29  29  PHE PHE C . n 
C 3 31  ALA 31  30  30  ALA ALA C . n 
C 3 32  LEU 32  31  31  LEU LEU C . n 
C 3 33  ASN 33  32  32  ASN ASN C . n 
C 3 34  ILE 34  33  33  ILE ILE C . n 
C 3 35  MET 35  34  34  MET MET C . n 
C 3 36  GLY 36  35  35  GLY GLY C . n 
C 3 37  TRP 37  36  36  TRP TRP C . n 
C 3 38  TYR 38  37  37  TYR TYR C . n 
C 3 39  ARG 39  38  38  ARG ARG C . n 
C 3 40  GLN 40  39  39  GLN GLN C . n 
C 3 41  ALA 41  40  40  ALA ALA C . n 
C 3 42  PRO 42  41  41  PRO PRO C . n 
C 3 43  GLY 43  42  42  GLY GLY C . n 
C 3 44  LYS 44  43  43  LYS LYS C . n 
C 3 45  GLN 45  44  44  GLN GLN C . n 
C 3 46  ARG 46  45  45  ARG ARG C . n 
C 3 47  GLU 47  46  46  GLU GLU C . n 
C 3 48  LEU 48  47  47  LEU LEU C . n 
C 3 49  VAL 49  48  48  VAL VAL C . n 
C 3 50  ALA 50  49  49  ALA ALA C . n 
C 3 51  ALA 51  50  50  ALA ALA C . n 
C 3 52  ILE 52  51  51  ILE ILE C . n 
C 3 53  HIS 53  52  52  HIS HIS C . n 
C 3 54  SER 54  53  53  SER SER C . n 
C 3 55  GLY 55  54  54  GLY GLY C . n 
C 3 56  GLY 56  55  55  GLY GLY C . n 
C 3 57  THR 57  56  56  THR THR C . n 
C 3 58  THR 58  57  57  THR THR C . n 
C 3 59  ASN 59  58  58  ASN ASN C . n 
C 3 60  TYR 60  59  59  TYR TYR C . n 
C 3 61  ALA 61  60  60  ALA ALA C . n 
C 3 62  ASN 62  61  61  ASN ASN C . n 
C 3 63  SER 63  62  62  SER SER C . n 
C 3 64  VAL 64  63  63  VAL VAL C . n 
C 3 65  LYS 65  64  64  LYS LYS C . n 
C 3 66  GLY 66  65  65  GLY GLY C . n 
C 3 67  ARG 67  66  66  ARG ARG C . n 
C 3 68  PHE 68  67  67  PHE PHE C . n 
C 3 69  THR 69  68  68  THR THR C . n 
C 3 70  ILE 70  69  69  ILE ILE C . n 
C 3 71  SER 71  70  70  SER SER C . n 
C 3 72  ARG 72  71  71  ARG ARG C . n 
C 3 73  ASP 73  72  72  ASP ASP C . n 
C 3 74  ASN 74  73  73  ASN ASN C . n 
C 3 75  ALA 75  74  74  ALA ALA C . n 
C 3 76  ALA 76  75  75  ALA ALA C . n 
C 3 77  ASN 77  76  76  ASN ASN C . n 
C 3 78  THR 78  77  77  THR THR C . n 
C 3 79  VAL 79  78  78  VAL VAL C . n 
C 3 80  TYR 80  79  79  TYR TYR C . n 
C 3 81  LEU 81  80  80  LEU LEU C . n 
C 3 82  GLN 82  81  81  GLN GLN C . n 
C 3 83  MET 83  82  82  MET MET C . n 
C 3 84  ASN 84  83  83  ASN ASN C . n 
C 3 85  SER 85  84  84  SER SER C . n 
C 3 86  LEU 86  85  85  LEU LEU C . n 
C 3 87  LYS 87  86  86  LYS LYS C . n 
C 3 88  PRO 88  87  87  PRO PRO C . n 
C 3 89  GLU 89  88  88  GLU GLU C . n 
C 3 90  ASP 90  89  89  ASP ASP C . n 
C 3 91  THR 91  90  90  THR THR C . n 
C 3 92  ALA 92  91  91  ALA ALA C . n 
C 3 93  VAL 93  92  92  VAL VAL C . n 
C 3 94  TYR 94  93  93  TYR TYR C . n 
C 3 95  TYR 95  94  94  TYR TYR C . n 
C 3 96  CYS 96  95  95  CYS CYS C . n 
C 3 97  ASN 97  96  96  ASN ASN C . n 
C 3 98  VAL 98  97  97  VAL VAL C . n 
C 3 99  LYS 99  98  98  LYS LYS C . n 
C 3 100 ASP 100 99  99  ASP ASP C . n 
C 3 101 PHE 101 100 100 PHE PHE C . n 
C 3 102 GLY 102 101 101 GLY GLY C . n 
C 3 103 ALA 103 102 102 ALA ALA C . n 
C 3 104 ILE 104 103 103 ILE ILE C . n 
C 3 105 ILE 105 104 104 ILE ILE C . n 
C 3 106 TYR 106 105 105 TYR TYR C . n 
C 3 107 ASP 107 106 106 ASP ASP C . n 
C 3 108 TYR 108 107 107 TYR TYR C . n 
C 3 109 ASP 109 108 108 ASP ASP C . n 
C 3 110 TYR 110 109 109 TYR TYR C . n 
C 3 111 TRP 111 110 110 TRP TRP C . n 
C 3 112 GLY 112 111 111 GLY GLY C . n 
C 3 113 GLN 113 112 112 GLN GLN C . n 
C 3 114 GLY 114 113 113 GLY GLY C . n 
C 3 115 THR 115 114 114 THR THR C . n 
C 3 116 GLN 116 115 115 GLN GLN C . n 
C 3 117 VAL 117 116 116 VAL VAL C . n 
C 3 118 THR 118 117 117 THR THR C . n 
C 3 119 VAL 119 118 118 VAL VAL C . n 
C 3 120 SER 120 119 119 SER SER C . n 
C 3 121 SER 121 120 120 SER SER C . n 
D 1 1   SER 1   1   ?   ?   ?   F . n 
D 1 2   ASP 2   2   2   ASP ASP F . n 
D 1 3   LYS 3   3   3   LYS LYS F . n 
D 1 4   ILE 4   4   4   ILE ILE F . n 
D 1 5   ILE 5   5   5   ILE ILE F . n 
D 1 6   HIS 6   6   6   HIS HIS F . n 
D 1 7   LEU 7   7   7   LEU LEU F . n 
D 1 8   THR 8   8   8   THR THR F . n 
D 1 9   ASP 9   9   9   ASP ASP F . n 
D 1 10  ASP 10  10  10  ASP ASP F . n 
D 1 11  SER 11  11  11  SER SER F . n 
D 1 12  PHE 12  12  12  PHE PHE F . n 
D 1 13  ASP 13  13  13  ASP ASP F . n 
D 1 14  THR 14  14  14  THR THR F . n 
D 1 15  ASP 15  15  15  ASP ASP F . n 
D 1 16  VAL 16  16  16  VAL VAL F . n 
D 1 17  LEU 17  17  17  LEU LEU F . n 
D 1 18  LYS 18  18  18  LYS LYS F . n 
D 1 19  ALA 19  19  19  ALA ALA F . n 
D 1 20  ASP 20  20  20  ASP ASP F . n 
D 1 21  GLY 21  21  21  GLY GLY F . n 
D 1 22  ALA 22  22  22  ALA ALA F . n 
D 1 23  ILE 23  23  23  ILE ILE F . n 
D 1 24  LEU 24  24  24  LEU LEU F . n 
D 1 25  VAL 25  25  25  VAL VAL F . n 
D 1 26  ASP 26  26  26  ASP ASP F . n 
D 1 27  PHE 27  27  27  PHE PHE F . n 
D 1 28  TRP 28  28  28  TRP TRP F . n 
D 1 29  ALA 29  29  29  ALA ALA F . n 
D 1 30  GLU 30  30  30  GLU GLU F . n 
D 1 31  TRP 31  31  31  TRP TRP F . n 
D 1 32  SER 32  32  32  SER SER F . n 
D 1 33  GLY 33  33  33  GLY GLY F . n 
D 1 34  PRO 34  34  34  PRO PRO F . n 
D 1 35  SER 35  35  35  SER SER F . n 
D 1 36  LYS 36  36  36  LYS LYS F . n 
D 1 37  MET 37  37  37  MET MET F . n 
D 1 38  ILE 38  38  38  ILE ILE F . n 
D 1 39  ALA 39  39  39  ALA ALA F . n 
D 1 40  PRO 40  40  40  PRO PRO F . n 
D 1 41  ILE 41  41  41  ILE ILE F . n 
D 1 42  LEU 42  42  42  LEU LEU F . n 
D 1 43  ASP 43  43  43  ASP ASP F . n 
D 1 44  GLU 44  44  44  GLU GLU F . n 
D 1 45  ILE 45  45  45  ILE ILE F . n 
D 1 46  ALA 46  46  46  ALA ALA F . n 
D 1 47  ASP 47  47  47  ASP ASP F . n 
D 1 48  GLU 48  48  48  GLU GLU F . n 
D 1 49  TYR 49  49  49  TYR TYR F . n 
D 1 50  GLN 50  50  50  GLN GLN F . n 
D 1 51  GLY 51  51  51  GLY GLY F . n 
D 1 52  LYS 52  52  52  LYS LYS F . n 
D 1 53  LEU 53  53  53  LEU LEU F . n 
D 1 54  THR 54  54  54  THR THR F . n 
D 1 55  VAL 55  55  55  VAL VAL F . n 
D 1 56  ALA 56  56  56  ALA ALA F . n 
D 1 57  LYS 57  57  57  LYS LYS F . n 
D 1 58  LEU 58  58  58  LEU LEU F . n 
D 1 59  ASN 59  59  59  ASN ASN F . n 
D 1 60  ILE 60  60  60  ILE ILE F . n 
D 1 61  ASP 61  61  61  ASP ASP F . n 
D 1 62  GLN 62  62  62  GLN GLN F . n 
D 1 63  ASN 63  63  63  ASN ASN F . n 
D 1 64  PRO 64  64  64  PRO PRO F . n 
D 1 65  GLY 65  65  65  GLY GLY F . n 
D 1 66  THR 66  66  66  THR THR F . n 
D 1 67  ALA 67  67  67  ALA ALA F . n 
D 1 68  PRO 68  68  68  PRO PRO F . n 
D 1 69  LYS 69  69  69  LYS LYS F . n 
D 1 70  TYR 70  70  70  TYR TYR F . n 
D 1 71  GLY 71  71  71  GLY GLY F . n 
D 1 72  ILE 72  72  72  ILE ILE F . n 
D 1 73  ARG 73  73  73  ARG ARG F . n 
D 1 74  GLY 74  74  74  GLY GLY F . n 
D 1 75  ILE 75  75  75  ILE ILE F . n 
D 1 76  PRO 76  76  76  PRO PRO F . n 
D 1 77  THR 77  77  77  THR THR F . n 
D 1 78  LEU 78  78  78  LEU LEU F . n 
D 1 79  LEU 79  79  79  LEU LEU F . n 
D 1 80  LEU 80  80  80  LEU LEU F . n 
D 1 81  PHE 81  81  81  PHE PHE F . n 
D 1 82  LYS 82  82  82  LYS LYS F . n 
D 1 83  ASN 83  83  83  ASN ASN F . n 
D 1 84  GLY 84  84  84  GLY GLY F . n 
D 1 85  GLU 85  85  85  GLU GLU F . n 
D 1 86  VAL 86  86  86  VAL VAL F . n 
D 1 87  ALA 87  87  87  ALA ALA F . n 
D 1 88  ALA 88  88  88  ALA ALA F . n 
D 1 89  THR 89  89  89  THR THR F . n 
D 1 90  LYS 90  90  90  LYS LYS F . n 
D 1 91  VAL 91  91  91  VAL VAL F . n 
D 1 92  GLY 92  92  92  GLY GLY F . n 
D 1 93  ALA 93  93  93  ALA ALA F . n 
D 1 94  LEU 94  94  94  LEU LEU F . n 
D 1 95  SER 95  95  95  SER SER F . n 
D 1 96  LYS 96  96  96  LYS LYS F . n 
D 1 97  GLY 97  97  97  GLY GLY F . n 
D 1 98  GLN 98  98  98  GLN GLN F . n 
D 1 99  LEU 99  99  99  LEU LEU F . n 
D 1 100 LYS 100 100 100 LYS LYS F . n 
D 1 101 GLU 101 101 101 GLU GLU F . n 
D 1 102 PHE 102 102 102 PHE PHE F . n 
D 1 103 LEU 103 103 103 LEU LEU F . n 
D 1 104 ASP 104 104 104 ASP ASP F . n 
D 1 105 ALA 105 105 105 ALA ALA F . n 
D 1 106 ASN 106 106 106 ASN ASN F . n 
D 1 107 LEU 107 107 107 LEU LEU F . n 
D 1 108 ALA 108 108 108 ALA ALA F . n 
D 1 109 GLU 109 109 ?   ?   ?   F . n 
E 2 1   ALA 1   39  ?   ?   ?   B . n 
E 2 2   ALA 2   40  40  ALA ALA B . n 
E 2 3   ALA 3   41  41  ALA ALA B . n 
E 2 4   LYS 4   42  42  LYS LYS B . n 
E 2 5   VAL 5   43  43  VAL VAL B . n 
E 2 6   MET 6   44  44  MET MET B . n 
E 2 7   SER 7   45  45  SER SER B . n 
E 2 8   LEU 8   46  46  LEU LEU B . n 
E 2 9   LEU 9   47  47  LEU LEU B . n 
E 2 10  MET 10  48  48  MET MET B . n 
E 2 11  ALA 11  49  49  ALA ALA B . n 
E 2 12  LEU 12  50  50  LEU LEU B . n 
E 2 13  VAL 13  51  51  VAL VAL B . n 
E 2 14  VAL 14  52  52  VAL VAL B . n 
E 2 15  LEU 15  53  53  LEU LEU B . n 
E 2 16  LEU 16  54  54  LEU LEU B . n 
E 2 17  ILE 17  55  55  ILE ILE B . n 
E 2 18  VAL 18  56  56  VAL VAL B . n 
E 2 19  ALA 19  57  57  ALA ALA B . n 
E 2 20  GLY 20  58  58  GLY GLY B . n 
E 2 21  ASN 21  59  59  ASN ASN B . n 
E 2 22  VAL 22  60  60  VAL VAL B . n 
E 2 23  LEU 23  61  61  LEU LEU B . n 
E 2 24  VAL 24  62  62  VAL VAL B . n 
E 2 25  ILE 25  63  63  ILE ILE B . n 
E 2 26  ALA 26  64  64  ALA ALA B . n 
E 2 27  ALA 27  65  65  ALA ALA B . n 
E 2 28  ILE 28  66  66  ILE ILE B . n 
E 2 29  GLY 29  67  67  GLY GLY B . n 
E 2 30  SER 30  68  68  SER SER B . n 
E 2 31  THR 31  69  69  THR THR B . n 
E 2 32  GLN 32  70  70  GLN GLN B . n 
E 2 33  ARG 33  71  71  ARG ARG B . n 
E 2 34  LEU 34  72  72  LEU LEU B . n 
E 2 35  GLN 35  73  73  GLN GLN B . n 
E 2 36  THR 36  74  74  THR THR B . n 
E 2 37  LEU 37  75  75  LEU LEU B . n 
E 2 38  THR 38  76  76  THR THR B . n 
E 2 39  ASN 39  77  77  ASN ASN B . n 
E 2 40  LEU 40  78  78  LEU LEU B . n 
E 2 41  PHE 41  79  79  PHE PHE B . n 
E 2 42  ILE 42  80  80  ILE ILE B . n 
E 2 43  THR 43  81  81  THR THR B . n 
E 2 44  SER 44  82  82  SER SER B . n 
E 2 45  LEU 45  83  83  LEU LEU B . n 
E 2 46  ALA 46  84  84  ALA ALA B . n 
E 2 47  CYS 47  85  85  CYS CYS B . n 
E 2 48  ALA 48  86  86  ALA ALA B . n 
E 2 49  ASP 49  87  87  ASP ASP B . n 
E 2 50  LEU 50  88  88  LEU LEU B . n 
E 2 51  VAL 51  89  89  VAL VAL B . n 
E 2 52  VAL 52  90  90  VAL VAL B . n 
E 2 53  GLY 53  91  91  GLY GLY B . n 
E 2 54  LEU 54  92  92  LEU LEU B . n 
E 2 55  LEU 55  93  93  LEU LEU B . n 
E 2 56  VAL 56  94  94  VAL VAL B . n 
E 2 57  VAL 57  95  95  VAL VAL B . n 
E 2 58  PRO 58  96  96  PRO PRO B . n 
E 2 59  PHE 59  97  97  PHE PHE B . n 
E 2 60  GLY 60  98  98  GLY GLY B . n 
E 2 61  ALA 61  99  99  ALA ALA B . n 
E 2 62  THR 62  100 100 THR THR B . n 
E 2 63  LEU 63  101 101 LEU LEU B . n 
E 2 64  VAL 64  102 102 VAL VAL B . n 
E 2 65  VAL 65  103 103 VAL VAL B . n 
E 2 66  ARG 66  104 104 ARG ARG B . n 
E 2 67  GLY 67  105 105 GLY GLY B . n 
E 2 68  THR 68  106 106 THR THR B . n 
E 2 69  TRP 69  107 107 TRP TRP B . n 
E 2 70  LEU 70  108 108 LEU LEU B . n 
E 2 71  TRP 71  109 109 TRP TRP B . n 
E 2 72  GLY 72  110 110 GLY GLY B . n 
E 2 73  SER 73  111 111 SER SER B . n 
E 2 74  PHE 74  112 112 PHE PHE B . n 
E 2 75  LEU 75  113 113 LEU LEU B . n 
E 2 76  CYS 76  114 114 CYS CYS B . n 
E 2 77  GLU 77  115 115 GLU GLU B . n 
E 2 78  LEU 78  116 116 LEU LEU B . n 
E 2 79  TRP 79  117 117 TRP TRP B . n 
E 2 80  THR 80  118 118 THR THR B . n 
E 2 81  SER 81  119 119 SER SER B . n 
E 2 82  LEU 82  120 120 LEU LEU B . n 
E 2 83  ASP 83  121 121 ASP ASP B . n 
E 2 84  VAL 84  122 122 VAL VAL B . n 
E 2 85  LEU 85  123 123 LEU LEU B . n 
E 2 86  CYS 86  124 124 CYS CYS B . n 
E 2 87  VAL 87  125 125 VAL VAL B . n 
E 2 88  THR 88  126 126 THR THR B . n 
E 2 89  ALA 89  127 127 ALA ALA B . n 
E 2 90  SER 90  128 128 SER SER B . n 
E 2 91  ILE 91  129 129 ILE ILE B . n 
E 2 92  GLU 92  130 130 GLU GLU B . n 
E 2 93  THR 93  131 131 THR THR B . n 
E 2 94  LEU 94  132 132 LEU LEU B . n 
E 2 95  CYS 95  133 133 CYS CYS B . n 
E 2 96  VAL 96  134 134 VAL VAL B . n 
E 2 97  ILE 97  135 135 ILE ILE B . n 
E 2 98  ALA 98  136 136 ALA ALA B . n 
E 2 99  ILE 99  137 137 ILE ILE B . n 
E 2 100 ASP 100 138 138 ASP ASP B . n 
E 2 101 ARG 101 139 139 ARG ARG B . n 
E 2 102 TYR 102 140 140 TYR TYR B . n 
E 2 103 LEU 103 141 141 LEU LEU B . n 
E 2 104 ALA 104 142 142 ALA ALA B . n 
E 2 105 ILE 105 143 143 ILE ILE B . n 
E 2 106 THR 106 144 144 THR THR B . n 
E 2 107 SER 107 145 145 SER SER B . n 
E 2 108 PRO 108 146 146 PRO PRO B . n 
E 2 109 PHE 109 147 147 PHE PHE B . n 
E 2 110 ARG 110 148 148 ARG ARG B . n 
E 2 111 TYR 111 149 149 TYR TYR B . n 
E 2 112 GLN 112 150 150 GLN GLN B . n 
E 2 113 SER 113 151 151 SER SER B . n 
E 2 114 LEU 114 152 152 LEU LEU B . n 
E 2 115 MET 115 153 153 MET MET B . n 
E 2 116 THR 116 154 154 THR THR B . n 
E 2 117 ARG 117 155 155 ARG ARG B . n 
E 2 118 ALA 118 156 156 ALA ALA B . n 
E 2 119 ARG 119 157 157 ARG ARG B . n 
E 2 120 ALA 120 158 158 ALA ALA B . n 
E 2 121 LYS 121 159 159 LYS LYS B . n 
E 2 122 VAL 122 160 160 VAL VAL B . n 
E 2 123 ILE 123 161 161 ILE ILE B . n 
E 2 124 ILE 124 162 162 ILE ILE B . n 
E 2 125 CYS 125 163 163 CYS CYS B . n 
E 2 126 THR 126 164 164 THR THR B . n 
E 2 127 VAL 127 165 165 VAL VAL B . n 
E 2 128 TRP 128 166 166 TRP TRP B . n 
E 2 129 ALA 129 167 167 ALA ALA B . n 
E 2 130 ILE 130 168 168 ILE ILE B . n 
E 2 131 SER 131 169 169 SER SER B . n 
E 2 132 ALA 132 170 170 ALA ALA B . n 
E 2 133 LEU 133 171 171 LEU LEU B . n 
E 2 134 VAL 134 172 172 VAL VAL B . n 
E 2 135 SER 135 173 173 SER SER B . n 
E 2 136 PHE 136 174 174 PHE PHE B . n 
E 2 137 LEU 137 175 175 LEU LEU B . n 
E 2 138 PRO 138 176 176 PRO PRO B . n 
E 2 139 ILE 139 177 177 ILE ILE B . n 
E 2 140 MET 140 178 178 MET MET B . n 
E 2 141 MET 141 179 179 MET MET B . n 
E 2 142 HIS 142 180 180 HIS HIS B . n 
E 2 143 TRP 143 181 181 TRP TRP B . n 
E 2 144 TRP 144 182 182 TRP TRP B . n 
E 2 145 ARG 145 183 183 ARG ARG B . n 
E 2 146 ASP 146 184 184 ASP ASP B . n 
E 2 147 GLU 147 185 185 GLU GLU B . n 
E 2 148 ASP 148 186 186 ASP ASP B . n 
E 2 149 PRO 149 187 187 PRO PRO B . n 
E 2 150 GLN 150 188 188 GLN GLN B . n 
E 2 151 ALA 151 189 189 ALA ALA B . n 
E 2 152 LEU 152 190 190 LEU LEU B . n 
E 2 153 LYS 153 191 191 LYS LYS B . n 
E 2 154 CYS 154 192 192 CYS CYS B . n 
E 2 155 TYR 155 193 193 TYR TYR B . n 
E 2 156 GLN 156 194 194 GLN GLN B . n 
E 2 157 ASP 157 195 195 ASP ASP B . n 
E 2 158 PRO 158 196 196 PRO PRO B . n 
E 2 159 GLY 159 197 197 GLY GLY B . n 
E 2 160 CYS 160 198 198 CYS CYS B . n 
E 2 161 CYS 161 199 199 CYS CYS B . n 
E 2 162 ASP 162 200 200 ASP ASP B . n 
E 2 163 PHE 163 201 201 PHE PHE B . n 
E 2 164 VAL 164 202 202 VAL VAL B . n 
E 2 165 THR 165 203 203 THR THR B . n 
E 2 166 ASN 166 204 204 ASN ASN B . n 
E 2 167 ARG 167 205 205 ARG ARG B . n 
E 2 168 ALA 168 206 206 ALA ALA B . n 
E 2 169 TYR 169 207 207 TYR TYR B . n 
E 2 170 ALA 170 208 208 ALA ALA B . n 
E 2 171 ILE 171 209 209 ILE ILE B . n 
E 2 172 ALA 172 210 210 ALA ALA B . n 
E 2 173 SER 173 211 211 SER SER B . n 
E 2 174 SER 174 212 212 SER SER B . n 
E 2 175 ILE 175 213 213 ILE ILE B . n 
E 2 176 ILE 176 214 214 ILE ILE B . n 
E 2 177 SER 177 215 215 SER SER B . n 
E 2 178 PHE 178 216 216 PHE PHE B . n 
E 2 179 TYR 179 217 217 TYR TYR B . n 
E 2 180 ILE 180 218 218 ILE ILE B . n 
E 2 181 PRO 181 219 219 PRO PRO B . n 
E 2 182 LEU 182 220 220 LEU LEU B . n 
E 2 183 LEU 183 221 221 LEU LEU B . n 
E 2 184 ILE 184 222 222 ILE ILE B . n 
E 2 185 MET 185 223 223 MET MET B . n 
E 2 186 ILE 186 224 224 ILE ILE B . n 
E 2 187 PHE 187 225 225 PHE PHE B . n 
E 2 188 VAL 188 226 226 VAL VAL B . n 
E 2 189 TYR 189 227 227 TYR TYR B . n 
E 2 190 LEU 190 228 228 LEU LEU B . n 
E 2 191 ARG 191 229 229 ARG ARG B . n 
E 2 192 VAL 192 230 230 VAL VAL B . n 
E 2 193 TYR 193 231 231 TYR TYR B . n 
E 2 194 ARG 194 232 232 ARG ARG B . n 
E 2 195 GLU 195 233 233 GLU GLU B . n 
E 2 196 ALA 196 234 234 ALA ALA B . n 
E 2 197 LYS 197 235 235 LYS LYS B . n 
E 2 198 GLU 198 236 236 GLU GLU B . n 
E 2 199 GLN 199 237 237 GLN GLN B . n 
E 2 200 ILE 200 238 238 ILE ILE B . n 
E 2 201 ARG 201 239 239 ARG ARG B . n 
E 2 202 LYS 202 240 240 LYS LYS B . n 
E 2 203 ILE 203 241 241 ILE ILE B . n 
E 2 204 ASP 204 242 242 ASP ASP B . n 
E 2 205 ARG 205 243 243 ARG ARG B . n 
E 2 206 ALA 206 272 272 ALA ALA B . n 
E 2 207 SER 207 273 273 SER SER B . n 
E 2 208 LYS 208 274 ?   ?   ?   B . n 
E 2 209 ARG 209 275 ?   ?   ?   B . n 
E 2 210 LYS 210 276 ?   ?   ?   B . n 
E 2 211 THR 211 277 ?   ?   ?   B . n 
E 2 212 SER 212 278 ?   ?   ?   B . n 
E 2 213 ARG 213 279 ?   ?   ?   B . n 
E 2 214 VAL 214 280 ?   ?   ?   B . n 
E 2 215 MET 215 281 281 MET MET B . n 
E 2 216 ALA 216 282 282 ALA ALA B . n 
E 2 217 MET 217 283 283 MET MET B . n 
E 2 218 LYS 218 284 284 LYS LYS B . n 
E 2 219 GLU 219 285 285 GLU GLU B . n 
E 2 220 HIS 220 286 286 HIS HIS B . n 
E 2 221 LYS 221 287 287 LYS LYS B . n 
E 2 222 ALA 222 288 288 ALA ALA B . n 
E 2 223 LEU 223 289 289 LEU LEU B . n 
E 2 224 LYS 224 290 290 LYS LYS B . n 
E 2 225 THR 225 291 291 THR THR B . n 
E 2 226 LEU 226 292 292 LEU LEU B . n 
E 2 227 GLY 227 293 293 GLY GLY B . n 
E 2 228 ILE 228 294 294 ILE ILE B . n 
E 2 229 ILE 229 295 295 ILE ILE B . n 
E 2 230 MET 230 296 296 MET MET B . n 
E 2 231 GLY 231 297 297 GLY GLY B . n 
E 2 232 VAL 232 298 298 VAL VAL B . n 
E 2 233 PHE 233 299 299 PHE PHE B . n 
E 2 234 THR 234 300 300 THR THR B . n 
E 2 235 LEU 235 301 301 LEU LEU B . n 
E 2 236 CYS 236 302 302 CYS CYS B . n 
E 2 237 TRP 237 303 303 TRP TRP B . n 
E 2 238 LEU 238 304 304 LEU LEU B . n 
E 2 239 PRO 239 305 305 PRO PRO B . n 
E 2 240 PHE 240 306 306 PHE PHE B . n 
E 2 241 PHE 241 307 307 PHE PHE B . n 
E 2 242 LEU 242 308 308 LEU LEU B . n 
E 2 243 VAL 243 309 309 VAL VAL B . n 
E 2 244 ASN 244 310 310 ASN ASN B . n 
E 2 245 ILE 245 311 311 ILE ILE B . n 
E 2 246 VAL 246 312 312 VAL VAL B . n 
E 2 247 ASN 247 313 313 ASN ASN B . n 
E 2 248 VAL 248 314 314 VAL VAL B . n 
E 2 249 PHE 249 315 315 PHE PHE B . n 
E 2 250 ASN 250 316 316 ASN ASN B . n 
E 2 251 ARG 251 317 317 ARG ARG B . n 
E 2 252 ASP 252 318 318 ASP ASP B . n 
E 2 253 LEU 253 319 319 LEU LEU B . n 
E 2 254 VAL 254 320 320 VAL VAL B . n 
E 2 255 PRO 255 321 321 PRO PRO B . n 
E 2 256 ASP 256 322 322 ASP ASP B . n 
E 2 257 TRP 257 323 323 TRP TRP B . n 
E 2 258 LEU 258 324 324 LEU LEU B . n 
E 2 259 PHE 259 325 325 PHE PHE B . n 
E 2 260 VAL 260 326 326 VAL VAL B . n 
E 2 261 ALA 261 327 327 ALA ALA B . n 
E 2 262 PHE 262 328 328 PHE PHE B . n 
E 2 263 ASN 263 329 329 ASN ASN B . n 
E 2 264 TRP 264 330 330 TRP TRP B . n 
E 2 265 LEU 265 331 331 LEU LEU B . n 
E 2 266 GLY 266 332 332 GLY GLY B . n 
E 2 267 TYR 267 333 333 TYR TYR B . n 
E 2 268 ALA 268 334 334 ALA ALA B . n 
E 2 269 ASN 269 335 335 ASN ASN B . n 
E 2 270 SER 270 336 336 SER SER B . n 
E 2 271 ALA 271 337 337 ALA ALA B . n 
E 2 272 MET 272 338 338 MET MET B . n 
E 2 273 ASN 273 339 339 ASN ASN B . n 
E 2 274 PRO 274 340 340 PRO PRO B . n 
E 2 275 ILE 275 341 341 ILE ILE B . n 
E 2 276 ILE 276 342 342 ILE ILE B . n 
E 2 277 TYR 277 343 343 TYR TYR B . n 
E 2 278 CYS 278 344 344 CYS CYS B . n 
E 2 279 ARG 279 345 345 ARG ARG B . n 
E 2 280 SER 280 346 346 SER SER B . n 
E 2 281 PRO 281 347 347 PRO PRO B . n 
E 2 282 ASP 282 348 348 ASP ASP B . n 
E 2 283 PHE 283 349 349 PHE PHE B . n 
E 2 284 ARG 284 350 350 ARG ARG B . n 
E 2 285 LYS 285 351 351 LYS LYS B . n 
E 2 286 ALA 286 352 352 ALA ALA B . n 
E 2 287 PHE 287 353 353 PHE PHE B . n 
E 2 288 LYS 288 354 354 LYS LYS B . n 
E 2 289 ARG 289 355 355 ARG ARG B . n 
E 2 290 LEU 290 356 356 LEU LEU B . n 
E 2 291 LEU 291 357 357 LEU LEU B . n 
E 2 292 ALA 292 358 358 ALA ALA B . n 
E 2 293 PHE 293 359 359 PHE PHE B . n 
E 2 294 PRO 294 360 ?   ?   ?   B . n 
E 2 295 ARG 295 361 ?   ?   ?   B . n 
E 2 296 LYS 296 362 ?   ?   ?   B . n 
E 2 297 ALA 297 363 ?   ?   ?   B . n 
E 2 298 ASP 298 364 ?   ?   ?   B . n 
E 2 299 ARG 299 365 ?   ?   ?   B . n 
E 2 300 ARG 300 366 ?   ?   ?   B . n 
E 2 301 LEU 301 367 ?   ?   ?   B . n 
E 2 302 HIS 302 368 ?   ?   ?   B . n 
E 2 303 HIS 303 369 ?   ?   ?   B . n 
E 2 304 HIS 304 370 ?   ?   ?   B . n 
E 2 305 HIS 305 371 ?   ?   ?   B . n 
E 2 306 HIS 306 372 ?   ?   ?   B . n 
E 2 307 HIS 307 373 ?   ?   ?   B . n 
F 3 1   SER 1   0   ?   ?   ?   D . n 
F 3 2   GLN 2   1   1   GLN GLN D . n 
F 3 3   VAL 3   2   2   VAL VAL D . n 
F 3 4   GLN 4   3   3   GLN GLN D . n 
F 3 5   LEU 5   4   4   LEU LEU D . n 
F 3 6   GLN 6   5   5   GLN GLN D . n 
F 3 7   GLU 7   6   6   GLU GLU D . n 
F 3 8   SER 8   7   7   SER SER D . n 
F 3 9   GLY 9   8   8   GLY GLY D . n 
F 3 10  GLY 10  9   9   GLY GLY D . n 
F 3 11  GLY 11  10  10  GLY GLY D . n 
F 3 12  LEU 12  11  11  LEU LEU D . n 
F 3 13  VAL 13  12  12  VAL VAL D . n 
F 3 14  GLN 14  13  13  GLN GLN D . n 
F 3 15  ALA 15  14  14  ALA ALA D . n 
F 3 16  GLY 16  15  15  GLY GLY D . n 
F 3 17  GLY 17  16  16  GLY GLY D . n 
F 3 18  SER 18  17  17  SER SER D . n 
F 3 19  LEU 19  18  18  LEU LEU D . n 
F 3 20  ARG 20  19  19  ARG ARG D . n 
F 3 21  LEU 21  20  20  LEU LEU D . n 
F 3 22  SER 22  21  21  SER SER D . n 
F 3 23  CYS 23  22  22  CYS CYS D . n 
F 3 24  ALA 24  23  23  ALA ALA D . n 
F 3 25  ALA 25  24  24  ALA ALA D . n 
F 3 26  SER 26  25  25  SER SER D . n 
F 3 27  GLY 27  26  26  GLY GLY D . n 
F 3 28  SER 28  27  27  SER SER D . n 
F 3 29  ILE 29  28  28  ILE ILE D . n 
F 3 30  PHE 30  29  29  PHE PHE D . n 
F 3 31  ALA 31  30  30  ALA ALA D . n 
F 3 32  LEU 32  31  31  LEU LEU D . n 
F 3 33  ASN 33  32  32  ASN ASN D . n 
F 3 34  ILE 34  33  33  ILE ILE D . n 
F 3 35  MET 35  34  34  MET MET D . n 
F 3 36  GLY 36  35  35  GLY GLY D . n 
F 3 37  TRP 37  36  36  TRP TRP D . n 
F 3 38  TYR 38  37  37  TYR TYR D . n 
F 3 39  ARG 39  38  38  ARG ARG D . n 
F 3 40  GLN 40  39  39  GLN GLN D . n 
F 3 41  ALA 41  40  40  ALA ALA D . n 
F 3 42  PRO 42  41  41  PRO PRO D . n 
F 3 43  GLY 43  42  42  GLY GLY D . n 
F 3 44  LYS 44  43  43  LYS LYS D . n 
F 3 45  GLN 45  44  44  GLN GLN D . n 
F 3 46  ARG 46  45  45  ARG ARG D . n 
F 3 47  GLU 47  46  46  GLU GLU D . n 
F 3 48  LEU 48  47  47  LEU LEU D . n 
F 3 49  VAL 49  48  48  VAL VAL D . n 
F 3 50  ALA 50  49  49  ALA ALA D . n 
F 3 51  ALA 51  50  50  ALA ALA D . n 
F 3 52  ILE 52  51  51  ILE ILE D . n 
F 3 53  HIS 53  52  52  HIS HIS D . n 
F 3 54  SER 54  53  53  SER SER D . n 
F 3 55  GLY 55  54  54  GLY GLY D . n 
F 3 56  GLY 56  55  55  GLY GLY D . n 
F 3 57  THR 57  56  56  THR THR D . n 
F 3 58  THR 58  57  57  THR THR D . n 
F 3 59  ASN 59  58  58  ASN ASN D . n 
F 3 60  TYR 60  59  59  TYR TYR D . n 
F 3 61  ALA 61  60  60  ALA ALA D . n 
F 3 62  ASN 62  61  61  ASN ASN D . n 
F 3 63  SER 63  62  62  SER SER D . n 
F 3 64  VAL 64  63  63  VAL VAL D . n 
F 3 65  LYS 65  64  64  LYS LYS D . n 
F 3 66  GLY 66  65  65  GLY GLY D . n 
F 3 67  ARG 67  66  66  ARG ARG D . n 
F 3 68  PHE 68  67  67  PHE PHE D . n 
F 3 69  THR 69  68  68  THR THR D . n 
F 3 70  ILE 70  69  69  ILE ILE D . n 
F 3 71  SER 71  70  70  SER SER D . n 
F 3 72  ARG 72  71  71  ARG ARG D . n 
F 3 73  ASP 73  72  72  ASP ASP D . n 
F 3 74  ASN 74  73  73  ASN ASN D . n 
F 3 75  ALA 75  74  74  ALA ALA D . n 
F 3 76  ALA 76  75  75  ALA ALA D . n 
F 3 77  ASN 77  76  76  ASN ASN D . n 
F 3 78  THR 78  77  77  THR THR D . n 
F 3 79  VAL 79  78  78  VAL VAL D . n 
F 3 80  TYR 80  79  79  TYR TYR D . n 
F 3 81  LEU 81  80  80  LEU LEU D . n 
F 3 82  GLN 82  81  81  GLN GLN D . n 
F 3 83  MET 83  82  82  MET MET D . n 
F 3 84  ASN 84  83  83  ASN ASN D . n 
F 3 85  SER 85  84  84  SER SER D . n 
F 3 86  LEU 86  85  85  LEU LEU D . n 
F 3 87  LYS 87  86  86  LYS LYS D . n 
F 3 88  PRO 88  87  87  PRO PRO D . n 
F 3 89  GLU 89  88  88  GLU GLU D . n 
F 3 90  ASP 90  89  89  ASP ASP D . n 
F 3 91  THR 91  90  90  THR THR D . n 
F 3 92  ALA 92  91  91  ALA ALA D . n 
F 3 93  VAL 93  92  92  VAL VAL D . n 
F 3 94  TYR 94  93  93  TYR TYR D . n 
F 3 95  TYR 95  94  94  TYR TYR D . n 
F 3 96  CYS 96  95  95  CYS CYS D . n 
F 3 97  ASN 97  96  96  ASN ASN D . n 
F 3 98  VAL 98  97  97  VAL VAL D . n 
F 3 99  LYS 99  98  98  LYS LYS D . n 
F 3 100 ASP 100 99  99  ASP ASP D . n 
F 3 101 PHE 101 100 100 PHE PHE D . n 
F 3 102 GLY 102 101 101 GLY GLY D . n 
F 3 103 ALA 103 102 102 ALA ALA D . n 
F 3 104 ILE 104 103 103 ILE ILE D . n 
F 3 105 ILE 105 104 104 ILE ILE D . n 
F 3 106 TYR 106 105 105 TYR TYR D . n 
F 3 107 ASP 107 106 106 ASP ASP D . n 
F 3 108 TYR 108 107 107 TYR TYR D . n 
F 3 109 ASP 109 108 108 ASP ASP D . n 
F 3 110 TYR 110 109 109 TYR TYR D . n 
F 3 111 TRP 111 110 110 TRP TRP D . n 
F 3 112 GLY 112 111 111 GLY GLY D . n 
F 3 113 GLN 113 112 112 GLN GLN D . n 
F 3 114 GLY 114 113 113 GLY GLY D . n 
F 3 115 THR 115 114 114 THR THR D . n 
F 3 116 GLN 116 115 115 GLN GLN D . n 
F 3 117 VAL 117 116 116 VAL VAL D . n 
F 3 118 THR 118 117 117 THR THR D . n 
F 3 119 VAL 119 118 118 VAL VAL D . n 
F 3 120 SER 120 119 119 SER SER D . n 
F 3 121 SER 121 120 120 SER SER D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
G 4 2CV 1 201 505 2CV 2CV E . 
H 5 NA  1 401 402 NA  NA  A . 
I 4 2CV 1 402 501 2CV 2CV A . 
J 4 2CV 1 403 502 2CV 2CV A . 
K 4 2CV 1 404 503 2CV 2CV A . 
L 4 2CV 1 405 504 2CV 2CV A . 
M 6 Y00 1 406 601 Y00 Y00 A . 
N 4 2CV 1 407 502 2CV 2CV A . 
O 5 NA  1 401 402 NA  NA  B . 
P 4 2CV 1 402 501 2CV 2CV B . 
Q 4 2CV 1 403 503 2CV 2CV B . 
R 4 2CV 1 404 504 2CV 2CV B . 
S 6 Y00 1 405 601 Y00 Y00 B . 
T 7 HOH 1 501 1   HOH HOH A . 
T 7 HOH 2 502 2   HOH HOH A . 
T 7 HOH 3 503 12  HOH HOH A . 
T 7 HOH 4 504 19  HOH HOH A . 
T 7 HOH 5 505 3   HOH HOH A . 
T 7 HOH 6 506 22  HOH HOH A . 
U 7 HOH 1 201 4   HOH HOH C . 
U 7 HOH 2 202 29  HOH HOH C . 
U 7 HOH 3 203 15  HOH HOH C . 
U 7 HOH 4 204 30  HOH HOH C . 
U 7 HOH 5 205 18  HOH HOH C . 
V 7 HOH 1 501 10  HOH HOH B . 
W 7 HOH 1 201 23  HOH HOH D . 
W 7 HOH 2 202 28  HOH HOH D . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? trimeric 3 
2 author_defined_assembly ? trimeric 3 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,C,G,H,I,J,K,L,M,N,T,U 
2 1 D,E,F,O,P,Q,R,S,V,W       
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 O ? B CYS 154 ? A CYS 192 ? 1_555 NA ? H NA . ? A NA 401 ? 1_555 O ? B ASP 157 ? A ASP 195 ? 1_555 71.3 ? 
2 O ? B CYS 154 ? A CYS 192 ? 1_555 NA ? H NA . ? A NA 401 ? 1_555 O ? B CYS 160 ? A CYS 198 ? 1_555 85.4 ? 
3 O ? B ASP 157 ? A ASP 195 ? 1_555 NA ? H NA . ? A NA 401 ? 1_555 O ? B CYS 160 ? A CYS 198 ? 1_555 81.0 ? 
4 O ? E CYS 154 ? B CYS 192 ? 1_555 NA ? O NA . ? B NA 401 ? 1_555 O ? E ASP 157 ? B ASP 195 ? 1_555 70.6 ? 
5 O ? E CYS 154 ? B CYS 192 ? 1_555 NA ? O NA . ? B NA 401 ? 1_555 O ? E CYS 160 ? B CYS 198 ? 1_555 84.1 ? 
6 O ? E ASP 157 ? B ASP 195 ? 1_555 NA ? O NA . ? B NA 401 ? 1_555 O ? E CYS 160 ? B CYS 198 ? 1_555 80.8 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2018-10-17 
2 'Structure model' 1 1 2018-10-24 
3 'Structure model' 1 2 2019-05-22 
4 'Structure model' 1 3 2019-06-05 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Data collection'      
2 2 'Structure model' 'Derived calculations' 
3 2 'Structure model' 'Structure summary'    
4 3 'Structure model' 'Data collection'      
5 3 'Structure model' 'Database references'  
6 4 'Structure model' 'Data collection'      
7 4 'Structure model' 'Database references'  
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  2 'Structure model' audit_author              
2  2 'Structure model' pdbx_struct_assembly      
3  2 'Structure model' pdbx_struct_assembly_gen  
4  2 'Structure model' pdbx_struct_assembly_prop 
5  3 'Structure model' citation                  
6  3 'Structure model' database_PDB_rev          
7  3 'Structure model' database_PDB_rev_record   
8  3 'Structure model' pdbx_database_proc        
9  4 'Structure model' citation                  
10 4 'Structure model' citation_author           
11 4 'Structure model' pdbx_database_proc        
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_audit_author.name'                
2  3 'Structure model' '_citation.journal_abbrev'          
3  3 'Structure model' '_citation.journal_id_ASTM'         
4  3 'Structure model' '_citation.journal_id_CSD'          
5  3 'Structure model' '_citation.journal_id_ISSN'         
6  3 'Structure model' '_citation.pdbx_database_id_DOI'    
7  3 'Structure model' '_citation.pdbx_database_id_PubMed' 
8  3 'Structure model' '_citation.title'                   
9  3 'Structure model' '_citation.year'                    
10 4 'Structure model' '_citation.journal_volume'          
11 4 'Structure model' '_citation.page_first'              
12 4 'Structure model' '_citation.page_last'               
13 4 'Structure model' '_citation_author.identifier_ORCID' 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? REFMAC  ? ? ? 5.8.0174 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? MOSFLM  ? ? ? .        2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? .        3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER  ? ? ? .        4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 VAL E 16  ? ? -121.81 -54.58 
2  1 ALA E 108 ? ? -71.66  22.51  
3  1 LEU A 93  ? ? -120.62 -51.47 
4  1 SER A 173 ? ? -100.57 -70.46 
5  1 ASP A 186 ? ? -34.20  135.32 
6  1 PHE A 216 ? ? -128.65 -51.63 
7  1 SER A 273 ? ? -68.42  0.63   
8  1 PHE A 315 ? ? -93.17  -80.97 
9  1 LEU A 357 ? ? -98.57  42.91  
10 1 VAL C 48  ? ? -92.41  -60.90 
11 1 ALA C 74  ? ? -75.78  -75.32 
12 1 ILE C 103 ? ? 73.72   -55.54 
13 1 VAL F 16  ? ? -122.09 -54.84 
14 1 LEU B 93  ? ? -120.69 -51.45 
15 1 SER B 173 ? ? -101.09 -70.26 
16 1 ASP B 186 ? ? -34.14  135.04 
17 1 PHE B 216 ? ? -129.26 -51.85 
18 1 PHE B 315 ? ? -95.41  -84.31 
19 1 LEU B 357 ? ? -99.83  39.73  
20 1 ALA B 358 ? ? -80.59  -71.67 
21 1 VAL D 48  ? ? -92.65  -61.06 
22 1 ALA D 74  ? ? -77.16  -74.37 
23 1 ILE D 103 ? ? 72.75   -54.92 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 E LYS 3   ? CG  ? A LYS 3  CG  
2  1 Y 1 E LYS 3   ? CD  ? A LYS 3  CD  
3  1 Y 1 E LYS 3   ? CE  ? A LYS 3  CE  
4  1 Y 1 E LYS 3   ? NZ  ? A LYS 3  NZ  
5  1 Y 1 E MET 37  ? CG  ? A MET 37 CG  
6  1 Y 1 E MET 37  ? SD  ? A MET 37 SD  
7  1 Y 1 E MET 37  ? CE  ? A MET 37 CE  
8  1 Y 1 E LYS 90  ? CG  ? A LYS 90 CG  
9  1 Y 1 E LYS 90  ? CD  ? A LYS 90 CD  
10 1 Y 1 E LYS 90  ? CE  ? A LYS 90 CE  
11 1 Y 1 E LYS 90  ? NZ  ? A LYS 90 NZ  
12 1 Y 1 F MET 37  ? CG  ? D MET 37 CG  
13 1 Y 1 F MET 37  ? SD  ? D MET 37 SD  
14 1 Y 1 F MET 37  ? CE  ? D MET 37 CE  
15 1 N 1 E 2CV 201 ? C9  ? G 2CV 1  C9  
16 1 N 1 E 2CV 201 ? C12 ? G 2CV 1  C12 
17 1 N 1 E 2CV 201 ? C15 ? G 2CV 1  C15 
18 1 N 1 E 2CV 201 ? C18 ? G 2CV 1  C18 
19 1 N 1 E 2CV 201 ? C21 ? G 2CV 1  C21 
20 1 N 1 E 2CV 201 ? C24 ? G 2CV 1  C24 
21 1 N 1 E 2CV 201 ? C27 ? G 2CV 1  C27 
22 1 N 1 E 2CV 201 ? C1  ? G 2CV 1  C1  
23 1 N 1 E 2CV 201 ? C0  ? G 2CV 1  C0  
24 1 N 1 A 2CV 405 ? C41 ? L 2CV 1  C41 
25 1 N 1 A 2CV 405 ? C42 ? L 2CV 1  C42 
26 1 N 1 A 2CV 405 ? C43 ? L 2CV 1  C43 
27 1 N 1 A 2CV 405 ? O44 ? L 2CV 1  O44 
28 1 N 1 A 2CV 405 ? O49 ? L 2CV 1  O49 
29 1 N 1 A 2CV 405 ? O51 ? L 2CV 1  O51 
30 1 N 1 A 2CV 405 ? O53 ? L 2CV 1  O53 
31 1 N 1 A 2CV 405 ? O63 ? L 2CV 1  O63 
32 1 N 1 B 2CV 403 ? C9  ? Q 2CV 1  C9  
33 1 N 1 B 2CV 403 ? C12 ? Q 2CV 1  C12 
34 1 N 1 B 2CV 403 ? C15 ? Q 2CV 1  C15 
35 1 N 1 B 2CV 403 ? C41 ? Q 2CV 1  C41 
36 1 N 1 B 2CV 403 ? C42 ? Q 2CV 1  C42 
37 1 N 1 B 2CV 403 ? C43 ? Q 2CV 1  C43 
38 1 N 1 B 2CV 403 ? O44 ? Q 2CV 1  O44 
39 1 N 1 B 2CV 403 ? O51 ? Q 2CV 1  O51 
40 1 N 1 B 2CV 403 ? O53 ? Q 2CV 1  O53 
41 1 N 1 B 2CV 403 ? C1  ? Q 2CV 1  C1  
42 1 N 1 B 2CV 403 ? C0  ? Q 2CV 1  C0  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 E SER 1   ? A SER 1   
2  1 Y 1 E ASP 2   ? A ASP 2   
3  1 Y 1 A ALA 39  ? B ALA 1   
4  1 Y 1 A PHE 359 ? B PHE 293 
5  1 Y 1 A PRO 360 ? B PRO 294 
6  1 Y 1 A ARG 361 ? B ARG 295 
7  1 Y 1 A LYS 362 ? B LYS 296 
8  1 Y 1 A ALA 363 ? B ALA 297 
9  1 Y 1 A ASP 364 ? B ASP 298 
10 1 Y 1 A ARG 365 ? B ARG 299 
11 1 Y 1 A ARG 366 ? B ARG 300 
12 1 Y 1 A LEU 367 ? B LEU 301 
13 1 Y 1 A HIS 368 ? B HIS 302 
14 1 Y 1 A HIS 369 ? B HIS 303 
15 1 Y 1 A HIS 370 ? B HIS 304 
16 1 Y 1 A HIS 371 ? B HIS 305 
17 1 Y 1 A HIS 372 ? B HIS 306 
18 1 Y 1 A HIS 373 ? B HIS 307 
19 1 Y 1 C SER 0   ? C SER 1   
20 1 Y 1 F SER 1   ? D SER 1   
21 1 Y 1 F GLU 109 ? D GLU 109 
22 1 Y 1 B ALA 39  ? E ALA 1   
23 1 Y 1 B LYS 274 ? E LYS 208 
24 1 Y 1 B ARG 275 ? E ARG 209 
25 1 Y 1 B LYS 276 ? E LYS 210 
26 1 Y 1 B THR 277 ? E THR 211 
27 1 Y 1 B SER 278 ? E SER 212 
28 1 Y 1 B ARG 279 ? E ARG 213 
29 1 Y 1 B VAL 280 ? E VAL 214 
30 1 Y 1 B PRO 360 ? E PRO 294 
31 1 Y 1 B ARG 361 ? E ARG 295 
32 1 Y 1 B LYS 362 ? E LYS 296 
33 1 Y 1 B ALA 363 ? E ALA 297 
34 1 Y 1 B ASP 364 ? E ASP 298 
35 1 Y 1 B ARG 365 ? E ARG 299 
36 1 Y 1 B ARG 366 ? E ARG 300 
37 1 Y 1 B LEU 367 ? E LEU 301 
38 1 Y 1 B HIS 368 ? E HIS 302 
39 1 Y 1 B HIS 369 ? E HIS 303 
40 1 Y 1 B HIS 370 ? E HIS 304 
41 1 Y 1 B HIS 371 ? E HIS 305 
42 1 Y 1 B HIS 372 ? E HIS 306 
43 1 Y 1 B HIS 373 ? E HIS 307 
44 1 Y 1 D SER 0   ? F SER 1   
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 HEGA-10      2CV 
5 'SODIUM ION' NA  
6 DOBUTAMINE   Y00 
7 water        HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'gel filtration' 
_pdbx_struct_assembly_auth_evidence.details                ? 
#