data_6HXH
# 
_entry.id   6HXH 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.308 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6HXH         
WWPDB D_1200012386 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
SASBDB 'SEC-SAXS for human ACL in HBS buffer'                              SASDE36 'associated SAS data' 
SASBDB 'SEC-SAXS for human ACL in HBS buffer + 50 mM citrate'              SASDE46 'associated SAS data' 
SASBDB 'SEC-SAXS for human ACL in HBS buffer + 50 mM citrate + 2 mM CoASH' SASDE56 'associated SAS data' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6HXH 
_pdbx_database_status.recvd_initial_deposition_date   2018-10-17 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Verstraete, K.'  1 ? 
'Verschueren, K.' 2 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Nature 
_citation.journal_id_ASTM           NATUAS 
_citation.journal_id_CSD            0006 
_citation.journal_id_ISSN           1476-4687 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            568 
_citation.language                  ? 
_citation.page_first                571 
_citation.page_last                 575 
_citation.title                     'Structure of ATP citrate lyase and the origin of citrate synthase in the Krebs cycle.' 
_citation.year                      2019 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/s41586-019-1095-5 
_citation.pdbx_database_id_PubMed   30944476 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Verschueren, K.H.G.' 1  ? 
primary 'Blanchet, C.'        2  ? 
primary 'Felix, J.'           3  ? 
primary 'Dansercoer, A.'      4  ? 
primary 'De Vos, D.'          5  ? 
primary 'Bloch, Y.'           6  ? 
primary 'Van Beeumen, J.'     7  ? 
primary 'Svergun, D.'         8  ? 
primary 'Gutsche, I.'         9  ? 
primary 'Savvides, S.N.'      10 ? 
primary 'Verstraete, K.'      11 ? 
# 
_cell.angle_alpha                  91.53 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   110.04 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  107.46 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6HXH 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     150.364 
_cell.length_a_esd                 ? 
_cell.length_b                     154.011 
_cell.length_b_esd                 ? 
_cell.length_c                     154.087 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6HXH 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'ATP-citrate synthase,Human ATP citrate lyase' 115880.508 8  2.3.3.8 ? ? 
;To enable crystallographic studies, a variant of human ACL was produced that lacked a flexible linker region (residues 426 - 487).,To enable crystallographic studies, a variant of human ACL was produced that lacked a flexible linker region (residues 426 - 487).
;
2 non-polymer syn 'MAGNESIUM ION'                                24.305     16 ?       ? ? ? 
3 non-polymer syn 'PHOSPHATE ION'                                94.971     8  ?       ? ? ? 
4 non-polymer syn 'CITRATE ANION'                                189.100    8  ?       ? ? ? 
5 non-polymer syn 'COENZYME A'                                   767.534    8  ?       ? ? ? 
6 non-polymer syn "ADENOSINE-5'-DIPHOSPHATE"                     427.201    8  ?       ? ? ? 
7 water       nat water                                          18.015     16 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'ATP-citrate (pro-S-)-lyase,ACL,Citrate cleavage enzyme' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MSAKAISEQTGKELLYKFICTTSAIQNRFKYARVTPDTDWARLLQDHPWLLSQNLVVKPDQLIKRRGKLGLVGVNLTLDG
VKSWLKPRLGQEATVGKATGFLKNFLIEPFVPHSQAEEFYVCIYATREGDYVLFHHEGGVDVGDVDAKAQKLLVGVDEKL
NPEDIKKHLLVHAPEDKKEILASFISGLFNFYEDLYFTYLEINPLVVTKDGVYVLDLAAKVDATADYICKVKWGDIEFPP
PFGREAYPEEAYIADLDAKSGASLKLTLLNPKGRIWTMVAGGGASVVYSDTICDLGGVNELANYGEYSGAPSEQQTYDYA
KTILSLMTREKHPDGKILIIGGSIANFTNVAATFKGIVRAIRDYQGPLKEHEVTIFVRRGGPNYQEGLRVMGEVGKTTGI
PIHVFGTETHMTAIVGMALGHRPIPMGKSTTLFSRHTKAIVWGMQTRAVQGMLDFDYVCSRDEPSVAAMVYPFTGDHKQK
FYWGHKEILIPVFKNMADAMRKHPEVDVLINFASLRSAYDSTMETMNYAQIRTIAIIAEGIPEALTRKLIKKADQKGVTI
IGPATVGGIKPGCFKIGNTGGMLDNILASKLYRPGSVAYVSRSGGMSNELNNIISRTTDGVYEGVAIGGDRYPGSTFMDH
VLRYQDTPGVKMIVVLGEIGGTEEYKICRGIKEGRLTKPIVCWCIGTCATMFSSEVQFGHAGACANQASETAVAKNQALK
EAGVFVPRSFDELGEIIQSVYEDLVANGVIVPAQEVPPPTVPMDYSWARELGLIRKPASFMTSICDERGQELIYAGMPIT
EVFKEEMGIGGVLGLLWFQKRLPKYSCQFIEMCLMVTADHGPAVSGAHNTIICARAGKDLVSSLTSGLLTIGDRFGGALD
AAAKMFSKAFDSGIIPMEFVNKMKKEGKLIMGIGHRVKSINNPDMRVQILKDYVRQHFPATPLLDYALEVEKITTSKKPN
LILNVDGLIGVAFVDMLRNCGSFTREEADEYIDIGALNGIFVLGRSMGFIGHYLDQKRLKQGLYRHPWDDISYVLPEHMS
MGGSHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MSAKAISEQTGKELLYKFICTTSAIQNRFKYARVTPDTDWARLLQDHPWLLSQNLVVKPDQLIKRRGKLGLVGVNLTLDG
VKSWLKPRLGQEATVGKATGFLKNFLIEPFVPHSQAEEFYVCIYATREGDYVLFHHEGGVDVGDVDAKAQKLLVGVDEKL
NPEDIKKHLLVHAPEDKKEILASFISGLFNFYEDLYFTYLEINPLVVTKDGVYVLDLAAKVDATADYICKVKWGDIEFPP
PFGREAYPEEAYIADLDAKSGASLKLTLLNPKGRIWTMVAGGGASVVYSDTICDLGGVNELANYGEYSGAPSEQQTYDYA
KTILSLMTREKHPDGKILIIGGSIANFTNVAATFKGIVRAIRDYQGPLKEHEVTIFVRRGGPNYQEGLRVMGEVGKTTGI
PIHVFGTETHMTAIVGMALGHRPIPMGKSTTLFSRHTKAIVWGMQTRAVQGMLDFDYVCSRDEPSVAAMVYPFTGDHKQK
FYWGHKEILIPVFKNMADAMRKHPEVDVLINFASLRSAYDSTMETMNYAQIRTIAIIAEGIPEALTRKLIKKADQKGVTI
IGPATVGGIKPGCFKIGNTGGMLDNILASKLYRPGSVAYVSRSGGMSNELNNIISRTTDGVYEGVAIGGDRYPGSTFMDH
VLRYQDTPGVKMIVVLGEIGGTEEYKICRGIKEGRLTKPIVCWCIGTCATMFSSEVQFGHAGACANQASETAVAKNQALK
EAGVFVPRSFDELGEIIQSVYEDLVANGVIVPAQEVPPPTVPMDYSWARELGLIRKPASFMTSICDERGQELIYAGMPIT
EVFKEEMGIGGVLGLLWFQKRLPKYSCQFIEMCLMVTADHGPAVSGAHNTIICARAGKDLVSSLTSGLLTIGDRFGGALD
AAAKMFSKAFDSGIIPMEFVNKMKKEGKLIMGIGHRVKSINNPDMRVQILKDYVRQHFPATPLLDYALEVEKITTSKKPN
LILNVDGLIGVAFVDMLRNCGSFTREEADEYIDIGALNGIFVLGRSMGFIGHYLDQKRLKQGLYRHPWDDISYVLPEHMS
MGGSHHHHHH
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F,G,H 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    MET n 
1 2    SER n 
1 3    ALA n 
1 4    LYS n 
1 5    ALA n 
1 6    ILE n 
1 7    SER n 
1 8    GLU n 
1 9    GLN n 
1 10   THR n 
1 11   GLY n 
1 12   LYS n 
1 13   GLU n 
1 14   LEU n 
1 15   LEU n 
1 16   TYR n 
1 17   LYS n 
1 18   PHE n 
1 19   ILE n 
1 20   CYS n 
1 21   THR n 
1 22   THR n 
1 23   SER n 
1 24   ALA n 
1 25   ILE n 
1 26   GLN n 
1 27   ASN n 
1 28   ARG n 
1 29   PHE n 
1 30   LYS n 
1 31   TYR n 
1 32   ALA n 
1 33   ARG n 
1 34   VAL n 
1 35   THR n 
1 36   PRO n 
1 37   ASP n 
1 38   THR n 
1 39   ASP n 
1 40   TRP n 
1 41   ALA n 
1 42   ARG n 
1 43   LEU n 
1 44   LEU n 
1 45   GLN n 
1 46   ASP n 
1 47   HIS n 
1 48   PRO n 
1 49   TRP n 
1 50   LEU n 
1 51   LEU n 
1 52   SER n 
1 53   GLN n 
1 54   ASN n 
1 55   LEU n 
1 56   VAL n 
1 57   VAL n 
1 58   LYS n 
1 59   PRO n 
1 60   ASP n 
1 61   GLN n 
1 62   LEU n 
1 63   ILE n 
1 64   LYS n 
1 65   ARG n 
1 66   ARG n 
1 67   GLY n 
1 68   LYS n 
1 69   LEU n 
1 70   GLY n 
1 71   LEU n 
1 72   VAL n 
1 73   GLY n 
1 74   VAL n 
1 75   ASN n 
1 76   LEU n 
1 77   THR n 
1 78   LEU n 
1 79   ASP n 
1 80   GLY n 
1 81   VAL n 
1 82   LYS n 
1 83   SER n 
1 84   TRP n 
1 85   LEU n 
1 86   LYS n 
1 87   PRO n 
1 88   ARG n 
1 89   LEU n 
1 90   GLY n 
1 91   GLN n 
1 92   GLU n 
1 93   ALA n 
1 94   THR n 
1 95   VAL n 
1 96   GLY n 
1 97   LYS n 
1 98   ALA n 
1 99   THR n 
1 100  GLY n 
1 101  PHE n 
1 102  LEU n 
1 103  LYS n 
1 104  ASN n 
1 105  PHE n 
1 106  LEU n 
1 107  ILE n 
1 108  GLU n 
1 109  PRO n 
1 110  PHE n 
1 111  VAL n 
1 112  PRO n 
1 113  HIS n 
1 114  SER n 
1 115  GLN n 
1 116  ALA n 
1 117  GLU n 
1 118  GLU n 
1 119  PHE n 
1 120  TYR n 
1 121  VAL n 
1 122  CYS n 
1 123  ILE n 
1 124  TYR n 
1 125  ALA n 
1 126  THR n 
1 127  ARG n 
1 128  GLU n 
1 129  GLY n 
1 130  ASP n 
1 131  TYR n 
1 132  VAL n 
1 133  LEU n 
1 134  PHE n 
1 135  HIS n 
1 136  HIS n 
1 137  GLU n 
1 138  GLY n 
1 139  GLY n 
1 140  VAL n 
1 141  ASP n 
1 142  VAL n 
1 143  GLY n 
1 144  ASP n 
1 145  VAL n 
1 146  ASP n 
1 147  ALA n 
1 148  LYS n 
1 149  ALA n 
1 150  GLN n 
1 151  LYS n 
1 152  LEU n 
1 153  LEU n 
1 154  VAL n 
1 155  GLY n 
1 156  VAL n 
1 157  ASP n 
1 158  GLU n 
1 159  LYS n 
1 160  LEU n 
1 161  ASN n 
1 162  PRO n 
1 163  GLU n 
1 164  ASP n 
1 165  ILE n 
1 166  LYS n 
1 167  LYS n 
1 168  HIS n 
1 169  LEU n 
1 170  LEU n 
1 171  VAL n 
1 172  HIS n 
1 173  ALA n 
1 174  PRO n 
1 175  GLU n 
1 176  ASP n 
1 177  LYS n 
1 178  LYS n 
1 179  GLU n 
1 180  ILE n 
1 181  LEU n 
1 182  ALA n 
1 183  SER n 
1 184  PHE n 
1 185  ILE n 
1 186  SER n 
1 187  GLY n 
1 188  LEU n 
1 189  PHE n 
1 190  ASN n 
1 191  PHE n 
1 192  TYR n 
1 193  GLU n 
1 194  ASP n 
1 195  LEU n 
1 196  TYR n 
1 197  PHE n 
1 198  THR n 
1 199  TYR n 
1 200  LEU n 
1 201  GLU n 
1 202  ILE n 
1 203  ASN n 
1 204  PRO n 
1 205  LEU n 
1 206  VAL n 
1 207  VAL n 
1 208  THR n 
1 209  LYS n 
1 210  ASP n 
1 211  GLY n 
1 212  VAL n 
1 213  TYR n 
1 214  VAL n 
1 215  LEU n 
1 216  ASP n 
1 217  LEU n 
1 218  ALA n 
1 219  ALA n 
1 220  LYS n 
1 221  VAL n 
1 222  ASP n 
1 223  ALA n 
1 224  THR n 
1 225  ALA n 
1 226  ASP n 
1 227  TYR n 
1 228  ILE n 
1 229  CYS n 
1 230  LYS n 
1 231  VAL n 
1 232  LYS n 
1 233  TRP n 
1 234  GLY n 
1 235  ASP n 
1 236  ILE n 
1 237  GLU n 
1 238  PHE n 
1 239  PRO n 
1 240  PRO n 
1 241  PRO n 
1 242  PHE n 
1 243  GLY n 
1 244  ARG n 
1 245  GLU n 
1 246  ALA n 
1 247  TYR n 
1 248  PRO n 
1 249  GLU n 
1 250  GLU n 
1 251  ALA n 
1 252  TYR n 
1 253  ILE n 
1 254  ALA n 
1 255  ASP n 
1 256  LEU n 
1 257  ASP n 
1 258  ALA n 
1 259  LYS n 
1 260  SER n 
1 261  GLY n 
1 262  ALA n 
1 263  SER n 
1 264  LEU n 
1 265  LYS n 
1 266  LEU n 
1 267  THR n 
1 268  LEU n 
1 269  LEU n 
1 270  ASN n 
1 271  PRO n 
1 272  LYS n 
1 273  GLY n 
1 274  ARG n 
1 275  ILE n 
1 276  TRP n 
1 277  THR n 
1 278  MET n 
1 279  VAL n 
1 280  ALA n 
1 281  GLY n 
1 282  GLY n 
1 283  GLY n 
1 284  ALA n 
1 285  SER n 
1 286  VAL n 
1 287  VAL n 
1 288  TYR n 
1 289  SER n 
1 290  ASP n 
1 291  THR n 
1 292  ILE n 
1 293  CYS n 
1 294  ASP n 
1 295  LEU n 
1 296  GLY n 
1 297  GLY n 
1 298  VAL n 
1 299  ASN n 
1 300  GLU n 
1 301  LEU n 
1 302  ALA n 
1 303  ASN n 
1 304  TYR n 
1 305  GLY n 
1 306  GLU n 
1 307  TYR n 
1 308  SER n 
1 309  GLY n 
1 310  ALA n 
1 311  PRO n 
1 312  SER n 
1 313  GLU n 
1 314  GLN n 
1 315  GLN n 
1 316  THR n 
1 317  TYR n 
1 318  ASP n 
1 319  TYR n 
1 320  ALA n 
1 321  LYS n 
1 322  THR n 
1 323  ILE n 
1 324  LEU n 
1 325  SER n 
1 326  LEU n 
1 327  MET n 
1 328  THR n 
1 329  ARG n 
1 330  GLU n 
1 331  LYS n 
1 332  HIS n 
1 333  PRO n 
1 334  ASP n 
1 335  GLY n 
1 336  LYS n 
1 337  ILE n 
1 338  LEU n 
1 339  ILE n 
1 340  ILE n 
1 341  GLY n 
1 342  GLY n 
1 343  SER n 
1 344  ILE n 
1 345  ALA n 
1 346  ASN n 
1 347  PHE n 
1 348  THR n 
1 349  ASN n 
1 350  VAL n 
1 351  ALA n 
1 352  ALA n 
1 353  THR n 
1 354  PHE n 
1 355  LYS n 
1 356  GLY n 
1 357  ILE n 
1 358  VAL n 
1 359  ARG n 
1 360  ALA n 
1 361  ILE n 
1 362  ARG n 
1 363  ASP n 
1 364  TYR n 
1 365  GLN n 
1 366  GLY n 
1 367  PRO n 
1 368  LEU n 
1 369  LYS n 
1 370  GLU n 
1 371  HIS n 
1 372  GLU n 
1 373  VAL n 
1 374  THR n 
1 375  ILE n 
1 376  PHE n 
1 377  VAL n 
1 378  ARG n 
1 379  ARG n 
1 380  GLY n 
1 381  GLY n 
1 382  PRO n 
1 383  ASN n 
1 384  TYR n 
1 385  GLN n 
1 386  GLU n 
1 387  GLY n 
1 388  LEU n 
1 389  ARG n 
1 390  VAL n 
1 391  MET n 
1 392  GLY n 
1 393  GLU n 
1 394  VAL n 
1 395  GLY n 
1 396  LYS n 
1 397  THR n 
1 398  THR n 
1 399  GLY n 
1 400  ILE n 
1 401  PRO n 
1 402  ILE n 
1 403  HIS n 
1 404  VAL n 
1 405  PHE n 
1 406  GLY n 
1 407  THR n 
1 408  GLU n 
1 409  THR n 
1 410  HIS n 
1 411  MET n 
1 412  THR n 
1 413  ALA n 
1 414  ILE n 
1 415  VAL n 
1 416  GLY n 
1 417  MET n 
1 418  ALA n 
1 419  LEU n 
1 420  GLY n 
1 421  HIS n 
1 422  ARG n 
1 423  PRO n 
1 424  ILE n 
1 425  PRO n 
1 426  MET n 
1 427  GLY n 
1 428  LYS n 
1 429  SER n 
1 430  THR n 
1 431  THR n 
1 432  LEU n 
1 433  PHE n 
1 434  SER n 
1 435  ARG n 
1 436  HIS n 
1 437  THR n 
1 438  LYS n 
1 439  ALA n 
1 440  ILE n 
1 441  VAL n 
1 442  TRP n 
1 443  GLY n 
1 444  MET n 
1 445  GLN n 
1 446  THR n 
1 447  ARG n 
1 448  ALA n 
1 449  VAL n 
1 450  GLN n 
1 451  GLY n 
1 452  MET n 
1 453  LEU n 
1 454  ASP n 
1 455  PHE n 
1 456  ASP n 
1 457  TYR n 
1 458  VAL n 
1 459  CYS n 
1 460  SER n 
1 461  ARG n 
1 462  ASP n 
1 463  GLU n 
1 464  PRO n 
1 465  SER n 
1 466  VAL n 
1 467  ALA n 
1 468  ALA n 
1 469  MET n 
1 470  VAL n 
1 471  TYR n 
1 472  PRO n 
1 473  PHE n 
1 474  THR n 
1 475  GLY n 
1 476  ASP n 
1 477  HIS n 
1 478  LYS n 
1 479  GLN n 
1 480  LYS n 
1 481  PHE n 
1 482  TYR n 
1 483  TRP n 
1 484  GLY n 
1 485  HIS n 
1 486  LYS n 
1 487  GLU n 
1 488  ILE n 
1 489  LEU n 
1 490  ILE n 
1 491  PRO n 
1 492  VAL n 
1 493  PHE n 
1 494  LYS n 
1 495  ASN n 
1 496  MET n 
1 497  ALA n 
1 498  ASP n 
1 499  ALA n 
1 500  MET n 
1 501  ARG n 
1 502  LYS n 
1 503  HIS n 
1 504  PRO n 
1 505  GLU n 
1 506  VAL n 
1 507  ASP n 
1 508  VAL n 
1 509  LEU n 
1 510  ILE n 
1 511  ASN n 
1 512  PHE n 
1 513  ALA n 
1 514  SER n 
1 515  LEU n 
1 516  ARG n 
1 517  SER n 
1 518  ALA n 
1 519  TYR n 
1 520  ASP n 
1 521  SER n 
1 522  THR n 
1 523  MET n 
1 524  GLU n 
1 525  THR n 
1 526  MET n 
1 527  ASN n 
1 528  TYR n 
1 529  ALA n 
1 530  GLN n 
1 531  ILE n 
1 532  ARG n 
1 533  THR n 
1 534  ILE n 
1 535  ALA n 
1 536  ILE n 
1 537  ILE n 
1 538  ALA n 
1 539  GLU n 
1 540  GLY n 
1 541  ILE n 
1 542  PRO n 
1 543  GLU n 
1 544  ALA n 
1 545  LEU n 
1 546  THR n 
1 547  ARG n 
1 548  LYS n 
1 549  LEU n 
1 550  ILE n 
1 551  LYS n 
1 552  LYS n 
1 553  ALA n 
1 554  ASP n 
1 555  GLN n 
1 556  LYS n 
1 557  GLY n 
1 558  VAL n 
1 559  THR n 
1 560  ILE n 
1 561  ILE n 
1 562  GLY n 
1 563  PRO n 
1 564  ALA n 
1 565  THR n 
1 566  VAL n 
1 567  GLY n 
1 568  GLY n 
1 569  ILE n 
1 570  LYS n 
1 571  PRO n 
1 572  GLY n 
1 573  CYS n 
1 574  PHE n 
1 575  LYS n 
1 576  ILE n 
1 577  GLY n 
1 578  ASN n 
1 579  THR n 
1 580  GLY n 
1 581  GLY n 
1 582  MET n 
1 583  LEU n 
1 584  ASP n 
1 585  ASN n 
1 586  ILE n 
1 587  LEU n 
1 588  ALA n 
1 589  SER n 
1 590  LYS n 
1 591  LEU n 
1 592  TYR n 
1 593  ARG n 
1 594  PRO n 
1 595  GLY n 
1 596  SER n 
1 597  VAL n 
1 598  ALA n 
1 599  TYR n 
1 600  VAL n 
1 601  SER n 
1 602  ARG n 
1 603  SER n 
1 604  GLY n 
1 605  GLY n 
1 606  MET n 
1 607  SER n 
1 608  ASN n 
1 609  GLU n 
1 610  LEU n 
1 611  ASN n 
1 612  ASN n 
1 613  ILE n 
1 614  ILE n 
1 615  SER n 
1 616  ARG n 
1 617  THR n 
1 618  THR n 
1 619  ASP n 
1 620  GLY n 
1 621  VAL n 
1 622  TYR n 
1 623  GLU n 
1 624  GLY n 
1 625  VAL n 
1 626  ALA n 
1 627  ILE n 
1 628  GLY n 
1 629  GLY n 
1 630  ASP n 
1 631  ARG n 
1 632  TYR n 
1 633  PRO n 
1 634  GLY n 
1 635  SER n 
1 636  THR n 
1 637  PHE n 
1 638  MET n 
1 639  ASP n 
1 640  HIS n 
1 641  VAL n 
1 642  LEU n 
1 643  ARG n 
1 644  TYR n 
1 645  GLN n 
1 646  ASP n 
1 647  THR n 
1 648  PRO n 
1 649  GLY n 
1 650  VAL n 
1 651  LYS n 
1 652  MET n 
1 653  ILE n 
1 654  VAL n 
1 655  VAL n 
1 656  LEU n 
1 657  GLY n 
1 658  GLU n 
1 659  ILE n 
1 660  GLY n 
1 661  GLY n 
1 662  THR n 
1 663  GLU n 
1 664  GLU n 
1 665  TYR n 
1 666  LYS n 
1 667  ILE n 
1 668  CYS n 
1 669  ARG n 
1 670  GLY n 
1 671  ILE n 
1 672  LYS n 
1 673  GLU n 
1 674  GLY n 
1 675  ARG n 
1 676  LEU n 
1 677  THR n 
1 678  LYS n 
1 679  PRO n 
1 680  ILE n 
1 681  VAL n 
1 682  CYS n 
1 683  TRP n 
1 684  CYS n 
1 685  ILE n 
1 686  GLY n 
1 687  THR n 
1 688  CYS n 
1 689  ALA n 
1 690  THR n 
1 691  MET n 
1 692  PHE n 
1 693  SER n 
1 694  SER n 
1 695  GLU n 
1 696  VAL n 
1 697  GLN n 
1 698  PHE n 
1 699  GLY n 
1 700  HIS n 
1 701  ALA n 
1 702  GLY n 
1 703  ALA n 
1 704  CYS n 
1 705  ALA n 
1 706  ASN n 
1 707  GLN n 
1 708  ALA n 
1 709  SER n 
1 710  GLU n 
1 711  THR n 
1 712  ALA n 
1 713  VAL n 
1 714  ALA n 
1 715  LYS n 
1 716  ASN n 
1 717  GLN n 
1 718  ALA n 
1 719  LEU n 
1 720  LYS n 
1 721  GLU n 
1 722  ALA n 
1 723  GLY n 
1 724  VAL n 
1 725  PHE n 
1 726  VAL n 
1 727  PRO n 
1 728  ARG n 
1 729  SER n 
1 730  PHE n 
1 731  ASP n 
1 732  GLU n 
1 733  LEU n 
1 734  GLY n 
1 735  GLU n 
1 736  ILE n 
1 737  ILE n 
1 738  GLN n 
1 739  SER n 
1 740  VAL n 
1 741  TYR n 
1 742  GLU n 
1 743  ASP n 
1 744  LEU n 
1 745  VAL n 
1 746  ALA n 
1 747  ASN n 
1 748  GLY n 
1 749  VAL n 
1 750  ILE n 
1 751  VAL n 
1 752  PRO n 
1 753  ALA n 
1 754  GLN n 
1 755  GLU n 
1 756  VAL n 
1 757  PRO n 
1 758  PRO n 
1 759  PRO n 
1 760  THR n 
1 761  VAL n 
1 762  PRO n 
1 763  MET n 
1 764  ASP n 
1 765  TYR n 
1 766  SER n 
1 767  TRP n 
1 768  ALA n 
1 769  ARG n 
1 770  GLU n 
1 771  LEU n 
1 772  GLY n 
1 773  LEU n 
1 774  ILE n 
1 775  ARG n 
1 776  LYS n 
1 777  PRO n 
1 778  ALA n 
1 779  SER n 
1 780  PHE n 
1 781  MET n 
1 782  THR n 
1 783  SER n 
1 784  ILE n 
1 785  CYS n 
1 786  ASP n 
1 787  GLU n 
1 788  ARG n 
1 789  GLY n 
1 790  GLN n 
1 791  GLU n 
1 792  LEU n 
1 793  ILE n 
1 794  TYR n 
1 795  ALA n 
1 796  GLY n 
1 797  MET n 
1 798  PRO n 
1 799  ILE n 
1 800  THR n 
1 801  GLU n 
1 802  VAL n 
1 803  PHE n 
1 804  LYS n 
1 805  GLU n 
1 806  GLU n 
1 807  MET n 
1 808  GLY n 
1 809  ILE n 
1 810  GLY n 
1 811  GLY n 
1 812  VAL n 
1 813  LEU n 
1 814  GLY n 
1 815  LEU n 
1 816  LEU n 
1 817  TRP n 
1 818  PHE n 
1 819  GLN n 
1 820  LYS n 
1 821  ARG n 
1 822  LEU n 
1 823  PRO n 
1 824  LYS n 
1 825  TYR n 
1 826  SER n 
1 827  CYS n 
1 828  GLN n 
1 829  PHE n 
1 830  ILE n 
1 831  GLU n 
1 832  MET n 
1 833  CYS n 
1 834  LEU n 
1 835  MET n 
1 836  VAL n 
1 837  THR n 
1 838  ALA n 
1 839  ASP n 
1 840  HIS n 
1 841  GLY n 
1 842  PRO n 
1 843  ALA n 
1 844  VAL n 
1 845  SER n 
1 846  GLY n 
1 847  ALA n 
1 848  HIS n 
1 849  ASN n 
1 850  THR n 
1 851  ILE n 
1 852  ILE n 
1 853  CYS n 
1 854  ALA n 
1 855  ARG n 
1 856  ALA n 
1 857  GLY n 
1 858  LYS n 
1 859  ASP n 
1 860  LEU n 
1 861  VAL n 
1 862  SER n 
1 863  SER n 
1 864  LEU n 
1 865  THR n 
1 866  SER n 
1 867  GLY n 
1 868  LEU n 
1 869  LEU n 
1 870  THR n 
1 871  ILE n 
1 872  GLY n 
1 873  ASP n 
1 874  ARG n 
1 875  PHE n 
1 876  GLY n 
1 877  GLY n 
1 878  ALA n 
1 879  LEU n 
1 880  ASP n 
1 881  ALA n 
1 882  ALA n 
1 883  ALA n 
1 884  LYS n 
1 885  MET n 
1 886  PHE n 
1 887  SER n 
1 888  LYS n 
1 889  ALA n 
1 890  PHE n 
1 891  ASP n 
1 892  SER n 
1 893  GLY n 
1 894  ILE n 
1 895  ILE n 
1 896  PRO n 
1 897  MET n 
1 898  GLU n 
1 899  PHE n 
1 900  VAL n 
1 901  ASN n 
1 902  LYS n 
1 903  MET n 
1 904  LYS n 
1 905  LYS n 
1 906  GLU n 
1 907  GLY n 
1 908  LYS n 
1 909  LEU n 
1 910  ILE n 
1 911  MET n 
1 912  GLY n 
1 913  ILE n 
1 914  GLY n 
1 915  HIS n 
1 916  ARG n 
1 917  VAL n 
1 918  LYS n 
1 919  SER n 
1 920  ILE n 
1 921  ASN n 
1 922  ASN n 
1 923  PRO n 
1 924  ASP n 
1 925  MET n 
1 926  ARG n 
1 927  VAL n 
1 928  GLN n 
1 929  ILE n 
1 930  LEU n 
1 931  LYS n 
1 932  ASP n 
1 933  TYR n 
1 934  VAL n 
1 935  ARG n 
1 936  GLN n 
1 937  HIS n 
1 938  PHE n 
1 939  PRO n 
1 940  ALA n 
1 941  THR n 
1 942  PRO n 
1 943  LEU n 
1 944  LEU n 
1 945  ASP n 
1 946  TYR n 
1 947  ALA n 
1 948  LEU n 
1 949  GLU n 
1 950  VAL n 
1 951  GLU n 
1 952  LYS n 
1 953  ILE n 
1 954  THR n 
1 955  THR n 
1 956  SER n 
1 957  LYS n 
1 958  LYS n 
1 959  PRO n 
1 960  ASN n 
1 961  LEU n 
1 962  ILE n 
1 963  LEU n 
1 964  ASN n 
1 965  VAL n 
1 966  ASP n 
1 967  GLY n 
1 968  LEU n 
1 969  ILE n 
1 970  GLY n 
1 971  VAL n 
1 972  ALA n 
1 973  PHE n 
1 974  VAL n 
1 975  ASP n 
1 976  MET n 
1 977  LEU n 
1 978  ARG n 
1 979  ASN n 
1 980  CYS n 
1 981  GLY n 
1 982  SER n 
1 983  PHE n 
1 984  THR n 
1 985  ARG n 
1 986  GLU n 
1 987  GLU n 
1 988  ALA n 
1 989  ASP n 
1 990  GLU n 
1 991  TYR n 
1 992  ILE n 
1 993  ASP n 
1 994  ILE n 
1 995  GLY n 
1 996  ALA n 
1 997  LEU n 
1 998  ASN n 
1 999  GLY n 
1 1000 ILE n 
1 1001 PHE n 
1 1002 VAL n 
1 1003 LEU n 
1 1004 GLY n 
1 1005 ARG n 
1 1006 SER n 
1 1007 MET n 
1 1008 GLY n 
1 1009 PHE n 
1 1010 ILE n 
1 1011 GLY n 
1 1012 HIS n 
1 1013 TYR n 
1 1014 LEU n 
1 1015 ASP n 
1 1016 GLN n 
1 1017 LYS n 
1 1018 ARG n 
1 1019 LEU n 
1 1020 LYS n 
1 1021 GLN n 
1 1022 GLY n 
1 1023 LEU n 
1 1024 TYR n 
1 1025 ARG n 
1 1026 HIS n 
1 1027 PRO n 
1 1028 TRP n 
1 1029 ASP n 
1 1030 ASP n 
1 1031 ILE n 
1 1032 SER n 
1 1033 TYR n 
1 1034 VAL n 
1 1035 LEU n 
1 1036 PRO n 
1 1037 GLU n 
1 1038 HIS n 
1 1039 MET n 
1 1040 SER n 
1 1041 MET n 
1 1042 GLY n 
1 1043 GLY n 
1 1044 SER n 
1 1045 HIS n 
1 1046 HIS n 
1 1047 HIS n 
1 1048 HIS n 
1 1049 HIS n 
1 1050 HIS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1   424  Human ? ACLY ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? 
? ? ? ? 'BL21 ' DE3 ? ? ? ? ? ? Plasmid ? ? ? pET-DUET ? ? 
1 2 sample 'Biological sequence' 428 1050 ?     ? ?    ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? 
? ? ? ? 'BL21 ' DE3 ? ? ? ? ? ? Plasmid ? ? ? pET-DUET ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP ACLY_HUMAN P53396 ? 1 
;MSAKAISEQTGKELLYKFICTTSAIQNRFKYARVTPDTDWARLLQDHPWLLSQNLVVKPDQLIKRRGKLGLVGVNLTLDG
VKSWLKPRLGQEATVGKATGFLKNFLIEPFVPHSQAEEFYVCIYATREGDYVLFHHEGGVDVGDVDAKAQKLLVGVDEKL
NPEDIKKHLLVHAPEDKKEILASFISGLFNFYEDLYFTYLEINPLVVTKDGVYVLDLAAKVDATADYICKVKWGDIEFPP
PFGREAYPEEAYIADLDAKSGASLKLTLLNPKGRIWTMVAGGGASVVYSDTICDLGGVNELANYGEYSGAPSEQQTYDYA
KTILSLMTREKHPDGKILIIGGSIANFTNVAATFKGIVRAIRDYQGPLKEHEVTIFVRRGGPNYQEGLRVMGEVGKTTGI
PIHVFGTETHMTAIVGMALGHRPI
;
1   
2 PDB 6HXH       6HXH   ? 1 ? 428 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 6HXH A 1   ? 424  ? P53396 1   ? 424  ? 1   424  
2  2 6HXH A 428 ? 1050 ? 6HXH   488 ? 1110 ? 488 1110 
3  1 6HXH B 1   ? 424  ? P53396 1   ? 424  ? 1   424  
4  2 6HXH B 428 ? 1050 ? 6HXH   488 ? 1110 ? 488 1110 
5  1 6HXH C 1   ? 424  ? P53396 1   ? 424  ? 1   424  
6  2 6HXH C 428 ? 1050 ? 6HXH   488 ? 1110 ? 488 1110 
7  1 6HXH D 1   ? 424  ? P53396 1   ? 424  ? 1   424  
8  2 6HXH D 428 ? 1050 ? 6HXH   488 ? 1110 ? 488 1110 
9  1 6HXH E 1   ? 424  ? P53396 1   ? 424  ? 1   424  
10 2 6HXH E 428 ? 1050 ? 6HXH   488 ? 1110 ? 488 1110 
11 1 6HXH F 1   ? 424  ? P53396 1   ? 424  ? 1   424  
12 2 6HXH F 428 ? 1050 ? 6HXH   488 ? 1110 ? 488 1110 
13 1 6HXH G 1   ? 424  ? P53396 1   ? 424  ? 1   424  
14 2 6HXH G 428 ? 1050 ? 6HXH   488 ? 1110 ? 488 1110 
15 1 6HXH H 1   ? 424  ? P53396 1   ? 424  ? 1   424  
16 2 6HXH H 428 ? 1050 ? 6HXH   488 ? 1110 ? 488 1110 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1  6HXH PRO A 425 ? UNP P53396 ? ? linker 485 1  
1  6HXH MET A 426 ? UNP P53396 ? ? linker 486 2  
1  6HXH GLY A 427 ? UNP P53396 ? ? linker 487 3  
3  6HXH PRO B 425 ? UNP P53396 ? ? linker 485 4  
3  6HXH MET B 426 ? UNP P53396 ? ? linker 486 5  
3  6HXH GLY B 427 ? UNP P53396 ? ? linker 487 6  
5  6HXH PRO C 425 ? UNP P53396 ? ? linker 485 7  
5  6HXH MET C 426 ? UNP P53396 ? ? linker 486 8  
5  6HXH GLY C 427 ? UNP P53396 ? ? linker 487 9  
7  6HXH PRO D 425 ? UNP P53396 ? ? linker 485 10 
7  6HXH MET D 426 ? UNP P53396 ? ? linker 486 11 
7  6HXH GLY D 427 ? UNP P53396 ? ? linker 487 12 
9  6HXH PRO E 425 ? UNP P53396 ? ? linker 485 13 
9  6HXH MET E 426 ? UNP P53396 ? ? linker 486 14 
9  6HXH GLY E 427 ? UNP P53396 ? ? linker 487 15 
11 6HXH PRO F 425 ? UNP P53396 ? ? linker 485 16 
11 6HXH MET F 426 ? UNP P53396 ? ? linker 486 17 
11 6HXH GLY F 427 ? UNP P53396 ? ? linker 487 18 
13 6HXH PRO G 425 ? UNP P53396 ? ? linker 485 19 
13 6HXH MET G 426 ? UNP P53396 ? ? linker 486 20 
13 6HXH GLY G 427 ? UNP P53396 ? ? linker 487 21 
15 6HXH PRO H 425 ? UNP P53396 ? ? linker 485 22 
15 6HXH MET H 426 ? UNP P53396 ? ? linker 486 23 
15 6HXH GLY H 427 ? UNP P53396 ? ? linker 487 24 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ADP non-polymer         n "ADENOSINE-5'-DIPHOSPHATE" ? 'C10 H15 N5 O10 P2'   427.201 
ALA 'L-peptide linking' y ALANINE                    ? 'C3 H7 N O2'          89.093  
ARG 'L-peptide linking' y ARGININE                   ? 'C6 H15 N4 O2 1'      175.209 
ASN 'L-peptide linking' y ASPARAGINE                 ? 'C4 H8 N2 O3'         132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'            ? 'C4 H7 N O4'          133.103 
COA non-polymer         . 'COENZYME A'               ? 'C21 H36 N7 O16 P3 S' 767.534 
CYS 'L-peptide linking' y CYSTEINE                   ? 'C3 H7 N O2 S'        121.158 
FLC non-polymer         . 'CITRATE ANION'            ? 'C6 H5 O7 -3'         189.100 
GLN 'L-peptide linking' y GLUTAMINE                  ? 'C5 H10 N2 O3'        146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'            ? 'C5 H9 N O4'          147.129 
GLY 'peptide linking'   y GLYCINE                    ? 'C2 H5 N O2'          75.067  
HIS 'L-peptide linking' y HISTIDINE                  ? 'C6 H10 N3 O2 1'      156.162 
HOH non-polymer         . WATER                      ? 'H2 O'                18.015  
ILE 'L-peptide linking' y ISOLEUCINE                 ? 'C6 H13 N O2'         131.173 
LEU 'L-peptide linking' y LEUCINE                    ? 'C6 H13 N O2'         131.173 
LYS 'L-peptide linking' y LYSINE                     ? 'C6 H15 N2 O2 1'      147.195 
MET 'L-peptide linking' y METHIONINE                 ? 'C5 H11 N O2 S'       149.211 
MG  non-polymer         . 'MAGNESIUM ION'            ? 'Mg 2'                24.305  
PHE 'L-peptide linking' y PHENYLALANINE              ? 'C9 H11 N O2'         165.189 
PO4 non-polymer         . 'PHOSPHATE ION'            ? 'O4 P -3'             94.971  
PRO 'L-peptide linking' y PROLINE                    ? 'C5 H9 N O2'          115.130 
SER 'L-peptide linking' y SERINE                     ? 'C3 H7 N O3'          105.093 
THR 'L-peptide linking' y THREONINE                  ? 'C4 H9 N O3'          119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                 ? 'C11 H12 N2 O2'       204.225 
TYR 'L-peptide linking' y TYROSINE                   ? 'C9 H11 N O3'         181.189 
VAL 'L-peptide linking' y VALINE                     ? 'C5 H11 N O2'         117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6HXH 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.41 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         63.96 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              8.15 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
;13.5% PEG3350
0.2 M Na2HPO4 pH 8.15

Protein sample buffer:
20 mM citrate pH 6.0
10 mM CoASH
50 mM Mg.ADP
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS EIGER X 16M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2017-12-10 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.999977 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SLS BEAMLINE X06SA' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.999977 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   X06SA 
_diffrn_source.pdbx_synchrotron_site       SLS 
# 
_reflns.B_iso_Wilson_estimate            105.25 
_reflns.entry_id                         6HXH 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                3.30 
_reflns.d_resolution_low                 48.46 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       1319341 
_reflns.number_obs                       176777 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             95.4 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  7.5 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            8.38 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.201 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.997 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  3.30 
_reflns_shell.d_res_low                   3.38 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         0.77 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           98495 
_reflns_shell.percent_possible_all        95.7 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             7.6 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             2.80 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.283 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            -4.43020 
_refine.aniso_B[1][2]                            1.82420 
_refine.aniso_B[1][3]                            3.05650 
_refine.aniso_B[2][2]                            16.11180 
_refine.aniso_B[2][3]                            10.91220 
_refine.aniso_B[3][3]                            -11.68160 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               127.40 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               0.960 
_refine.correlation_coeff_Fo_to_Fc_free          0.945 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6HXH 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            3.30 
_refine.ls_d_res_low                             48.46 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     176285 
_refine.ls_number_reflns_R_free                  8667 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    95.6 
_refine.ls_percent_reflns_R_free                 4.920 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.157 
_refine.ls_R_factor_R_free                       0.187 
_refine.ls_R_factor_R_free_error                 0.000 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.156 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      6hxi 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          0.360 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_analyze.entry_id                        6HXH 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_coordinate_error_obs    0.35 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_sigma_a_free_details    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_sigma_a_obs_details     ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.RG_d_res_high                   ? 
_refine_analyze.RG_d_res_low                    ? 
_refine_analyze.RG_free                         ? 
_refine_analyze.RG_work                         ? 
_refine_analyze.RG_free_work_ratio              ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         1 
_refine_hist.pdbx_number_atoms_protein        64032 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         760 
_refine_hist.number_atoms_solvent             16 
_refine_hist.number_atoms_total               64808 
_refine_hist.d_res_high                       3.30 
_refine_hist.d_res_low                        48.46 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.010 ? 66336 ? t_bond_d                  2.00  HARMONIC     
'X-RAY DIFFRACTION' ? 1.16  ? 89984 ? t_angle_deg               2.00  HARMONIC     
'X-RAY DIFFRACTION' ? ?     ? 23080 ? t_dihedral_angle_d        2.00  SINUSOIDAL   
'X-RAY DIFFRACTION' ? ?     ? ?     ? t_incorr_chiral_ct        ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?     ? t_pseud_angle             ?     ?            
'X-RAY DIFFRACTION' ? ?     ? 1440  ? t_trig_c_planes           2.00  HARMONIC     
'X-RAY DIFFRACTION' ? ?     ? 9856  ? t_gen_planes              5.00  HARMONIC     
'X-RAY DIFFRACTION' ? ?     ? 66336 ? t_it                      20.00 HARMONIC     
'X-RAY DIFFRACTION' ? ?     ? 3     ? t_nbd                     5.00  SEMIHARMONIC 
'X-RAY DIFFRACTION' ? 2.83  ? ?     ? t_omega_torsion           ?     ?            
'X-RAY DIFFRACTION' ? 19.32 ? ?     ? t_other_torsion           ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?     ? t_improper_torsion        ?     ?            
'X-RAY DIFFRACTION' ? ?     ? 8616  ? t_chiral_improper_torsion 5.00  SEMIHARMONIC 
'X-RAY DIFFRACTION' ? ?     ? ?     ? t_sum_occupancies         ?     ?            
'X-RAY DIFFRACTION' ? ?     ? 168   ? t_utility_distance        1.00  HARMONIC     
'X-RAY DIFFRACTION' ? ?     ? ?     ? t_utility_angle           ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?     ? t_utility_torsion         ?     ?            
'X-RAY DIFFRACTION' ? ?     ? 77796 ? t_ideal_dist_contact      4.00  SEMIHARMONIC 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       3.30 
_refine_ls_shell.d_res_low                        3.39 
_refine_ls_shell.number_reflns_all                13121 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             617 
_refine_ls_shell.number_reflns_R_work             12504 
_refine_ls_shell.percent_reflns_obs               96.35 
_refine_ls_shell.percent_reflns_R_free            4.70 
_refine_ls_shell.R_factor_all                     0.236 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.259 
_refine_ls_shell.R_factor_R_free_error            0.000 
_refine_ls_shell.R_factor_R_work                  0.234 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
_struct.entry_id                     6HXH 
_struct.title                        
'Structure of the human ATP citrate lyase holoenzyme in complex with citrate, coenzyme A and Mg.ADP' 
_struct.pdbx_descriptor              'ATP-citrate synthase,Human ATP citrate lyase (E.C.2.3.3.8)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6HXH 
_struct_keywords.text            
'ATP citrate lyase, central metabolism, acetyl-Coa, citrate shuttle, rTCA cycle, citryl-CoA, lipogenesis, LYASE' 
_struct_keywords.pdbx_keywords   LYASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 1 ? 
F  N N 1 ? 
G  N N 1 ? 
H  N N 1 ? 
I  N N 2 ? 
J  N N 3 ? 
K  N N 4 ? 
L  N N 5 ? 
M  N N 6 ? 
N  N N 2 ? 
O  N N 5 ? 
P  N N 2 ? 
Q  N N 3 ? 
R  N N 4 ? 
S  N N 6 ? 
T  N N 2 ? 
U  N N 2 ? 
V  N N 3 ? 
W  N N 4 ? 
X  N N 5 ? 
Y  N N 6 ? 
Z  N N 2 ? 
AA N N 2 ? 
BA N N 3 ? 
CA N N 4 ? 
DA N N 5 ? 
EA N N 6 ? 
FA N N 2 ? 
GA N N 2 ? 
HA N N 3 ? 
IA N N 4 ? 
JA N N 5 ? 
KA N N 6 ? 
LA N N 2 ? 
MA N N 2 ? 
NA N N 3 ? 
OA N N 4 ? 
PA N N 5 ? 
QA N N 6 ? 
RA N N 2 ? 
SA N N 2 ? 
TA N N 3 ? 
UA N N 4 ? 
VA N N 5 ? 
WA N N 6 ? 
XA N N 2 ? 
YA N N 2 ? 
ZA N N 3 ? 
AB N N 4 ? 
BB N N 5 ? 
CB N N 6 ? 
DB N N 2 ? 
EB N N 7 ? 
FB N N 7 ? 
GB N N 7 ? 
HB N N 7 ? 
IB N N 7 ? 
JB N N 7 ? 
KB N N 7 ? 
LB N N 7 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 SER A 7    ? ILE A 19   ? SER A 7    ILE A 19   1 ? 13 
HELX_P HELX_P2   AA2 ASP A 39   ? HIS A 47   ? ASP A 39   HIS A 47   1 ? 9  
HELX_P HELX_P3   AA3 PRO A 48   ? SER A 52   ? PRO A 48   SER A 52   5 ? 5  
HELX_P HELX_P4   AA4 ARG A 66   ? GLY A 70   ? ARG A 66   GLY A 70   5 ? 5  
HELX_P HELX_P5   AA5 THR A 77   ? LYS A 86   ? THR A 77   LYS A 86   1 ? 10 
HELX_P HELX_P6   AA6 SER A 114  ? ALA A 116  ? SER A 114  ALA A 116  5 ? 3  
HELX_P HELX_P7   AA7 ASP A 144  ? ALA A 149  ? ASP A 144  ALA A 149  1 ? 6  
HELX_P HELX_P8   AA8 ASN A 161  ? LEU A 169  ? ASN A 161  LEU A 169  1 ? 9  
HELX_P HELX_P9   AA9 PRO A 174  ? ASP A 176  ? PRO A 174  ASP A 176  5 ? 3  
HELX_P HELX_P10  AB1 LYS A 177  ? LEU A 195  ? LYS A 177  LEU A 195  1 ? 19 
HELX_P HELX_P11  AB2 ALA A 225  ? GLY A 234  ? ALA A 225  GLY A 234  1 ? 10 
HELX_P HELX_P12  AB3 TYR A 247  ? LYS A 259  ? TYR A 247  LYS A 259  1 ? 13 
HELX_P HELX_P13  AB4 GLY A 281  ? LEU A 295  ? GLY A 281  LEU A 295  1 ? 15 
HELX_P HELX_P14  AB5 GLY A 297  ? LEU A 301  ? GLY A 297  LEU A 301  5 ? 5  
HELX_P HELX_P15  AB6 SER A 312  ? THR A 328  ? SER A 312  THR A 328  1 ? 17 
HELX_P HELX_P16  AB7 ASN A 349  ? TYR A 364  ? ASN A 349  TYR A 364  1 ? 16 
HELX_P HELX_P17  AB8 TYR A 364  ? HIS A 371  ? TYR A 364  HIS A 371  1 ? 8  
HELX_P HELX_P18  AB9 ASN A 383  ? GLY A 399  ? ASN A 383  GLY A 399  1 ? 17 
HELX_P HELX_P19  AC1 THR A 412  ? LEU A 419  ? THR A 412  LEU A 419  1 ? 8  
HELX_P HELX_P20  AC2 GLN A 445  ? CYS A 459  ? GLN A 505  CYS A 519  1 ? 15 
HELX_P HELX_P21  AC3 ASN A 495  ? HIS A 503  ? ASN A 555  HIS A 563  1 ? 9  
HELX_P HELX_P22  AC4 SER A 514  ? MET A 526  ? SER A 574  MET A 586  1 ? 13 
HELX_P HELX_P23  AC5 PRO A 542  ? GLY A 557  ? PRO A 602  GLY A 617  1 ? 16 
HELX_P HELX_P24  AC6 MET A 582  ? SER A 589  ? MET A 642  SER A 649  1 ? 8  
HELX_P HELX_P25  AC7 SER A 603  ? THR A 618  ? SER A 663  THR A 678  1 ? 16 
HELX_P HELX_P26  AC8 THR A 636  ? ASP A 646  ? THR A 696  ASP A 706  1 ? 11 
HELX_P HELX_P27  AC9 GLU A 664  ? GLU A 673  ? GLU A 724  GLU A 733  1 ? 10 
HELX_P HELX_P28  AD1 GLY A 686  ? PHE A 692  ? GLY A 746  PHE A 752  5 ? 7  
HELX_P HELX_P29  AD2 GLN A 707  ? GLU A 710  ? GLN A 767  GLU A 770  5 ? 4  
HELX_P HELX_P30  AD3 THR A 711  ? GLY A 723  ? THR A 771  GLY A 783  1 ? 13 
HELX_P HELX_P31  AD4 SER A 729  ? ASP A 731  ? SER A 789  ASP A 791  5 ? 3  
HELX_P HELX_P32  AD5 GLU A 732  ? ASN A 747  ? GLU A 792  ASN A 807  1 ? 16 
HELX_P HELX_P33  AD6 TYR A 765  ? LEU A 771  ? TYR A 825  LEU A 831  1 ? 7  
HELX_P HELX_P34  AD7 ILE A 799  ? GLU A 805  ? ILE A 859  GLU A 865  1 ? 7  
HELX_P HELX_P35  AD8 MET A 807  ? GLN A 819  ? MET A 867  GLN A 879  1 ? 13 
HELX_P HELX_P36  AD9 PRO A 823  ? ALA A 838  ? PRO A 883  ALA A 898  1 ? 16 
HELX_P HELX_P37  AE1 VAL A 844  ? ALA A 856  ? VAL A 904  ALA A 916  1 ? 13 
HELX_P HELX_P38  AE2 ASP A 859  ? LEU A 869  ? ASP A 919  LEU A 929  1 ? 11 
HELX_P HELX_P39  AE3 GLY A 877  ? GLY A 893  ? GLY A 937  GLY A 953  1 ? 17 
HELX_P HELX_P40  AE4 ILE A 895  ? GLY A 907  ? ILE A 955  GLY A 967  1 ? 13 
HELX_P HELX_P41  AE5 ASP A 924  ? PHE A 938  ? ASP A 984  PHE A 998  1 ? 15 
HELX_P HELX_P42  AE6 THR A 941  ? THR A 955  ? THR A 1001 THR A 1015 1 ? 15 
HELX_P HELX_P43  AE7 ASN A 964  ? CYS A 980  ? ASN A 1024 CYS A 1040 1 ? 17 
HELX_P HELX_P44  AE8 THR A 984  ? ILE A 994  ? THR A 1044 ILE A 1054 1 ? 11 
HELX_P HELX_P45  AE9 GLY A 995  ? LEU A 1019 ? GLY A 1055 LEU A 1079 1 ? 25 
HELX_P HELX_P46  AF1 PRO A 1027 ? ASP A 1029 ? PRO A 1087 ASP A 1089 5 ? 3  
HELX_P HELX_P47  AF2 SER B 7    ? ILE B 19   ? SER B 7    ILE B 19   1 ? 13 
HELX_P HELX_P48  AF3 ASP B 39   ? HIS B 47   ? ASP B 39   HIS B 47   1 ? 9  
HELX_P HELX_P49  AF4 PRO B 48   ? GLN B 53   ? PRO B 48   GLN B 53   1 ? 6  
HELX_P HELX_P50  AF5 ARG B 66   ? GLY B 70   ? ARG B 66   GLY B 70   5 ? 5  
HELX_P HELX_P51  AF6 THR B 77   ? LEU B 89   ? THR B 77   LEU B 89   1 ? 13 
HELX_P HELX_P52  AF7 SER B 114  ? ALA B 116  ? SER B 114  ALA B 116  5 ? 3  
HELX_P HELX_P53  AF8 ASP B 144  ? ALA B 149  ? ASP B 144  ALA B 149  1 ? 6  
HELX_P HELX_P54  AF9 ASN B 161  ? LEU B 169  ? ASN B 161  LEU B 169  1 ? 9  
HELX_P HELX_P55  AG1 PRO B 174  ? ASP B 176  ? PRO B 174  ASP B 176  5 ? 3  
HELX_P HELX_P56  AG2 LYS B 177  ? LEU B 195  ? LYS B 177  LEU B 195  1 ? 19 
HELX_P HELX_P57  AG3 ALA B 225  ? GLY B 234  ? ALA B 225  GLY B 234  1 ? 10 
HELX_P HELX_P58  AG4 TYR B 247  ? LYS B 259  ? TYR B 247  LYS B 259  1 ? 13 
HELX_P HELX_P59  AG5 GLY B 283  ? LEU B 295  ? GLY B 283  LEU B 295  1 ? 13 
HELX_P HELX_P60  AG6 SER B 312  ? THR B 328  ? SER B 312  THR B 328  1 ? 17 
HELX_P HELX_P61  AG7 ASN B 349  ? TYR B 364  ? ASN B 349  TYR B 364  1 ? 16 
HELX_P HELX_P62  AG8 TYR B 364  ? HIS B 371  ? TYR B 364  HIS B 371  1 ? 8  
HELX_P HELX_P63  AG9 ASN B 383  ? GLY B 399  ? ASN B 383  GLY B 399  1 ? 17 
HELX_P HELX_P64  AH1 THR B 412  ? LEU B 419  ? THR B 412  LEU B 419  1 ? 8  
HELX_P HELX_P65  AH2 GLN B 445  ? CYS B 459  ? GLN B 505  CYS B 519  1 ? 15 
HELX_P HELX_P66  AH3 ASN B 495  ? HIS B 503  ? ASN B 555  HIS B 563  1 ? 9  
HELX_P HELX_P67  AH4 SER B 517  ? MET B 526  ? SER B 577  MET B 586  1 ? 10 
HELX_P HELX_P68  AH5 PRO B 542  ? GLY B 557  ? PRO B 602  GLY B 617  1 ? 16 
HELX_P HELX_P69  AH6 MET B 582  ? SER B 589  ? MET B 642  SER B 649  1 ? 8  
HELX_P HELX_P70  AH7 SER B 603  ? THR B 618  ? SER B 663  THR B 678  1 ? 16 
HELX_P HELX_P71  AH8 THR B 636  ? THR B 647  ? THR B 696  THR B 707  1 ? 12 
HELX_P HELX_P72  AH9 GLU B 664  ? GLU B 673  ? GLU B 724  GLU B 733  1 ? 10 
HELX_P HELX_P73  AI1 GLY B 686  ? PHE B 692  ? GLY B 746  PHE B 752  5 ? 7  
HELX_P HELX_P74  AI2 THR B 711  ? GLY B 723  ? THR B 771  GLY B 783  1 ? 13 
HELX_P HELX_P75  AI3 SER B 729  ? ASP B 731  ? SER B 789  ASP B 791  5 ? 3  
HELX_P HELX_P76  AI4 GLU B 732  ? ASN B 747  ? GLU B 792  ASN B 807  1 ? 16 
HELX_P HELX_P77  AI5 TYR B 765  ? LEU B 771  ? TYR B 825  LEU B 831  1 ? 7  
HELX_P HELX_P78  AI6 ILE B 799  ? GLU B 805  ? ILE B 859  GLU B 865  1 ? 7  
HELX_P HELX_P79  AI7 MET B 807  ? GLN B 819  ? MET B 867  GLN B 879  1 ? 13 
HELX_P HELX_P80  AI8 PRO B 823  ? THR B 837  ? PRO B 883  THR B 897  1 ? 15 
HELX_P HELX_P81  AI9 VAL B 844  ? ALA B 856  ? VAL B 904  ALA B 916  1 ? 13 
HELX_P HELX_P82  AJ1 ASP B 859  ? LEU B 869  ? ASP B 919  LEU B 929  1 ? 11 
HELX_P HELX_P83  AJ2 GLY B 877  ? GLY B 893  ? GLY B 937  GLY B 953  1 ? 17 
HELX_P HELX_P84  AJ3 ILE B 895  ? GLY B 907  ? ILE B 955  GLY B 967  1 ? 13 
HELX_P HELX_P85  AJ4 ASP B 924  ? PHE B 938  ? ASP B 984  PHE B 998  1 ? 15 
HELX_P HELX_P86  AJ5 THR B 941  ? THR B 955  ? THR B 1001 THR B 1015 1 ? 15 
HELX_P HELX_P87  AJ6 ASN B 964  ? CYS B 980  ? ASN B 1024 CYS B 1040 1 ? 17 
HELX_P HELX_P88  AJ7 THR B 984  ? ILE B 994  ? THR B 1044 ILE B 1054 1 ? 11 
HELX_P HELX_P89  AJ8 GLY B 995  ? LEU B 1019 ? GLY B 1055 LEU B 1079 1 ? 25 
HELX_P HELX_P90  AJ9 PRO B 1027 ? ASP B 1029 ? PRO B 1087 ASP B 1089 5 ? 3  
HELX_P HELX_P91  AK1 SER C 7    ? ILE C 19   ? SER C 7    ILE C 19   1 ? 13 
HELX_P HELX_P92  AK2 ASP C 39   ? HIS C 47   ? ASP C 39   HIS C 47   1 ? 9  
HELX_P HELX_P93  AK3 PRO C 48   ? GLN C 53   ? PRO C 48   GLN C 53   1 ? 6  
HELX_P HELX_P94  AK4 THR C 77   ? LEU C 89   ? THR C 77   LEU C 89   1 ? 13 
HELX_P HELX_P95  AK5 SER C 114  ? ALA C 116  ? SER C 114  ALA C 116  5 ? 3  
HELX_P HELX_P96  AK6 ASP C 144  ? ALA C 149  ? ASP C 144  ALA C 149  1 ? 6  
HELX_P HELX_P97  AK7 ASN C 161  ? LEU C 169  ? ASN C 161  LEU C 169  1 ? 9  
HELX_P HELX_P98  AK8 PRO C 174  ? ASP C 176  ? PRO C 174  ASP C 176  5 ? 3  
HELX_P HELX_P99  AK9 LYS C 177  ? LEU C 195  ? LYS C 177  LEU C 195  1 ? 19 
HELX_P HELX_P100 AL1 ALA C 225  ? GLY C 234  ? ALA C 225  GLY C 234  1 ? 10 
HELX_P HELX_P101 AL2 TYR C 247  ? LYS C 259  ? TYR C 247  LYS C 259  1 ? 13 
HELX_P HELX_P102 AL3 GLY C 283  ? LEU C 295  ? GLY C 283  LEU C 295  1 ? 13 
HELX_P HELX_P103 AL4 SER C 312  ? THR C 328  ? SER C 312  THR C 328  1 ? 17 
HELX_P HELX_P104 AL5 ASN C 349  ? TYR C 364  ? ASN C 349  TYR C 364  1 ? 16 
HELX_P HELX_P105 AL6 TYR C 364  ? HIS C 371  ? TYR C 364  HIS C 371  1 ? 8  
HELX_P HELX_P106 AL7 ASN C 383  ? GLY C 399  ? ASN C 383  GLY C 399  1 ? 17 
HELX_P HELX_P107 AL8 THR C 412  ? LEU C 419  ? THR C 412  LEU C 419  1 ? 8  
HELX_P HELX_P108 AL9 GLN C 445  ? CYS C 459  ? GLN C 505  CYS C 519  1 ? 15 
HELX_P HELX_P109 AM1 ASN C 495  ? HIS C 503  ? ASN C 555  HIS C 563  1 ? 9  
HELX_P HELX_P110 AM2 SER C 514  ? MET C 526  ? SER C 574  MET C 586  1 ? 13 
HELX_P HELX_P111 AM3 PRO C 542  ? GLY C 557  ? PRO C 602  GLY C 617  1 ? 16 
HELX_P HELX_P112 AM4 MET C 582  ? SER C 589  ? MET C 642  SER C 649  1 ? 8  
HELX_P HELX_P113 AM5 SER C 603  ? THR C 618  ? SER C 663  THR C 678  1 ? 16 
HELX_P HELX_P114 AM6 THR C 636  ? THR C 647  ? THR C 696  THR C 707  1 ? 12 
HELX_P HELX_P115 AM7 GLU C 664  ? GLU C 673  ? GLU C 724  GLU C 733  1 ? 10 
HELX_P HELX_P116 AM8 GLY C 686  ? PHE C 692  ? GLY C 746  PHE C 752  5 ? 7  
HELX_P HELX_P117 AM9 THR C 711  ? GLY C 723  ? THR C 771  GLY C 783  1 ? 13 
HELX_P HELX_P118 AN1 SER C 729  ? ASP C 731  ? SER C 789  ASP C 791  5 ? 3  
HELX_P HELX_P119 AN2 GLU C 732  ? ASN C 747  ? GLU C 792  ASN C 807  1 ? 16 
HELX_P HELX_P120 AN3 TYR C 765  ? LEU C 771  ? TYR C 825  LEU C 831  1 ? 7  
HELX_P HELX_P121 AN4 ILE C 799  ? GLU C 805  ? ILE C 859  GLU C 865  1 ? 7  
HELX_P HELX_P122 AN5 MET C 807  ? GLN C 819  ? MET C 867  GLN C 879  1 ? 13 
HELX_P HELX_P123 AN6 PRO C 823  ? THR C 837  ? PRO C 883  THR C 897  1 ? 15 
HELX_P HELX_P124 AN7 VAL C 844  ? ALA C 856  ? VAL C 904  ALA C 916  1 ? 13 
HELX_P HELX_P125 AN8 ASP C 859  ? LEU C 869  ? ASP C 919  LEU C 929  1 ? 11 
HELX_P HELX_P126 AN9 GLY C 877  ? GLY C 893  ? GLY C 937  GLY C 953  1 ? 17 
HELX_P HELX_P127 AO1 ILE C 895  ? GLY C 907  ? ILE C 955  GLY C 967  1 ? 13 
HELX_P HELX_P128 AO2 ASP C 924  ? PHE C 938  ? ASP C 984  PHE C 998  1 ? 15 
HELX_P HELX_P129 AO3 THR C 941  ? THR C 955  ? THR C 1001 THR C 1015 1 ? 15 
HELX_P HELX_P130 AO4 ASN C 964  ? CYS C 980  ? ASN C 1024 CYS C 1040 1 ? 17 
HELX_P HELX_P131 AO5 THR C 984  ? ILE C 994  ? THR C 1044 ILE C 1054 1 ? 11 
HELX_P HELX_P132 AO6 GLY C 995  ? LEU C 1019 ? GLY C 1055 LEU C 1079 1 ? 25 
HELX_P HELX_P133 AO7 PRO C 1027 ? ASP C 1029 ? PRO C 1087 ASP C 1089 5 ? 3  
HELX_P HELX_P134 AO8 SER D 7    ? ILE D 19   ? SER D 7    ILE D 19   1 ? 13 
HELX_P HELX_P135 AO9 ASP D 39   ? HIS D 47   ? ASP D 39   HIS D 47   1 ? 9  
HELX_P HELX_P136 AP1 PRO D 48   ? GLN D 53   ? PRO D 48   GLN D 53   1 ? 6  
HELX_P HELX_P137 AP2 ARG D 65   ? GLY D 70   ? ARG D 65   GLY D 70   1 ? 6  
HELX_P HELX_P138 AP3 THR D 77   ? LEU D 89   ? THR D 77   LEU D 89   1 ? 13 
HELX_P HELX_P139 AP4 SER D 114  ? ALA D 116  ? SER D 114  ALA D 116  5 ? 3  
HELX_P HELX_P140 AP5 ASP D 144  ? ALA D 149  ? ASP D 144  ALA D 149  1 ? 6  
HELX_P HELX_P141 AP6 ASN D 161  ? LEU D 169  ? ASN D 161  LEU D 169  1 ? 9  
HELX_P HELX_P142 AP7 PRO D 174  ? ASP D 176  ? PRO D 174  ASP D 176  5 ? 3  
HELX_P HELX_P143 AP8 LYS D 177  ? LEU D 195  ? LYS D 177  LEU D 195  1 ? 19 
HELX_P HELX_P144 AP9 ALA D 225  ? GLY D 234  ? ALA D 225  GLY D 234  1 ? 10 
HELX_P HELX_P145 AQ1 TYR D 247  ? LYS D 259  ? TYR D 247  LYS D 259  1 ? 13 
HELX_P HELX_P146 AQ2 GLY D 283  ? LEU D 295  ? GLY D 283  LEU D 295  1 ? 13 
HELX_P HELX_P147 AQ3 SER D 312  ? THR D 328  ? SER D 312  THR D 328  1 ? 17 
HELX_P HELX_P148 AQ4 ASN D 349  ? TYR D 364  ? ASN D 349  TYR D 364  1 ? 16 
HELX_P HELX_P149 AQ5 TYR D 364  ? HIS D 371  ? TYR D 364  HIS D 371  1 ? 8  
HELX_P HELX_P150 AQ6 ASN D 383  ? GLY D 399  ? ASN D 383  GLY D 399  1 ? 17 
HELX_P HELX_P151 AQ7 THR D 412  ? LEU D 419  ? THR D 412  LEU D 419  1 ? 8  
HELX_P HELX_P152 AQ8 GLN D 445  ? CYS D 459  ? GLN D 505  CYS D 519  1 ? 15 
HELX_P HELX_P153 AQ9 ASN D 495  ? HIS D 503  ? ASN D 555  HIS D 563  1 ? 9  
HELX_P HELX_P154 AR1 SER D 514  ? MET D 526  ? SER D 574  MET D 586  1 ? 13 
HELX_P HELX_P155 AR2 PRO D 542  ? GLY D 557  ? PRO D 602  GLY D 617  1 ? 16 
HELX_P HELX_P156 AR3 MET D 582  ? SER D 589  ? MET D 642  SER D 649  1 ? 8  
HELX_P HELX_P157 AR4 GLY D 604  ? THR D 618  ? GLY D 664  THR D 678  1 ? 15 
HELX_P HELX_P158 AR5 THR D 636  ? THR D 647  ? THR D 696  THR D 707  1 ? 12 
HELX_P HELX_P159 AR6 GLU D 664  ? GLU D 673  ? GLU D 724  GLU D 733  1 ? 10 
HELX_P HELX_P160 AR7 GLY D 686  ? PHE D 692  ? GLY D 746  PHE D 752  5 ? 7  
HELX_P HELX_P161 AR8 THR D 711  ? GLY D 723  ? THR D 771  GLY D 783  1 ? 13 
HELX_P HELX_P162 AR9 SER D 729  ? ASP D 731  ? SER D 789  ASP D 791  5 ? 3  
HELX_P HELX_P163 AS1 GLU D 732  ? ASN D 747  ? GLU D 792  ASN D 807  1 ? 16 
HELX_P HELX_P164 AS2 TYR D 765  ? LEU D 771  ? TYR D 825  LEU D 831  1 ? 7  
HELX_P HELX_P165 AS3 ILE D 799  ? GLU D 805  ? ILE D 859  GLU D 865  1 ? 7  
HELX_P HELX_P166 AS4 MET D 807  ? GLN D 819  ? MET D 867  GLN D 879  1 ? 13 
HELX_P HELX_P167 AS5 PRO D 823  ? THR D 837  ? PRO D 883  THR D 897  1 ? 15 
HELX_P HELX_P168 AS6 VAL D 844  ? ALA D 856  ? VAL D 904  ALA D 916  1 ? 13 
HELX_P HELX_P169 AS7 ASP D 859  ? LEU D 869  ? ASP D 919  LEU D 929  1 ? 11 
HELX_P HELX_P170 AS8 GLY D 877  ? GLY D 893  ? GLY D 937  GLY D 953  1 ? 17 
HELX_P HELX_P171 AS9 ILE D 895  ? GLY D 907  ? ILE D 955  GLY D 967  1 ? 13 
HELX_P HELX_P172 AT1 ASP D 924  ? PHE D 938  ? ASP D 984  PHE D 998  1 ? 15 
HELX_P HELX_P173 AT2 THR D 941  ? THR D 955  ? THR D 1001 THR D 1015 1 ? 15 
HELX_P HELX_P174 AT3 ASN D 964  ? CYS D 980  ? ASN D 1024 CYS D 1040 1 ? 17 
HELX_P HELX_P175 AT4 THR D 984  ? ILE D 994  ? THR D 1044 ILE D 1054 1 ? 11 
HELX_P HELX_P176 AT5 GLY D 995  ? LEU D 1019 ? GLY D 1055 LEU D 1079 1 ? 25 
HELX_P HELX_P177 AT6 PRO D 1027 ? ASP D 1029 ? PRO D 1087 ASP D 1089 5 ? 3  
HELX_P HELX_P178 AT7 SER E 7    ? ILE E 19   ? SER E 7    ILE E 19   1 ? 13 
HELX_P HELX_P179 AT8 ASP E 39   ? HIS E 47   ? ASP E 39   HIS E 47   1 ? 9  
HELX_P HELX_P180 AT9 PRO E 48   ? GLN E 53   ? PRO E 48   GLN E 53   1 ? 6  
HELX_P HELX_P181 AU1 THR E 77   ? LEU E 89   ? THR E 77   LEU E 89   1 ? 13 
HELX_P HELX_P182 AU2 SER E 114  ? ALA E 116  ? SER E 114  ALA E 116  5 ? 3  
HELX_P HELX_P183 AU3 ASP E 144  ? ALA E 149  ? ASP E 144  ALA E 149  1 ? 6  
HELX_P HELX_P184 AU4 ASN E 161  ? LEU E 169  ? ASN E 161  LEU E 169  1 ? 9  
HELX_P HELX_P185 AU5 PRO E 174  ? ASP E 176  ? PRO E 174  ASP E 176  5 ? 3  
HELX_P HELX_P186 AU6 LYS E 177  ? LEU E 195  ? LYS E 177  LEU E 195  1 ? 19 
HELX_P HELX_P187 AU7 ALA E 225  ? GLY E 234  ? ALA E 225  GLY E 234  1 ? 10 
HELX_P HELX_P188 AU8 TYR E 247  ? LYS E 259  ? TYR E 247  LYS E 259  1 ? 13 
HELX_P HELX_P189 AU9 GLY E 283  ? LEU E 295  ? GLY E 283  LEU E 295  1 ? 13 
HELX_P HELX_P190 AV1 SER E 312  ? THR E 328  ? SER E 312  THR E 328  1 ? 17 
HELX_P HELX_P191 AV2 ASN E 349  ? TYR E 364  ? ASN E 349  TYR E 364  1 ? 16 
HELX_P HELX_P192 AV3 TYR E 364  ? HIS E 371  ? TYR E 364  HIS E 371  1 ? 8  
HELX_P HELX_P193 AV4 ASN E 383  ? GLY E 399  ? ASN E 383  GLY E 399  1 ? 17 
HELX_P HELX_P194 AV5 THR E 412  ? LEU E 419  ? THR E 412  LEU E 419  1 ? 8  
HELX_P HELX_P195 AV6 GLN E 445  ? CYS E 459  ? GLN E 505  CYS E 519  1 ? 15 
HELX_P HELX_P196 AV7 ASN E 495  ? HIS E 503  ? ASN E 555  HIS E 563  1 ? 9  
HELX_P HELX_P197 AV8 SER E 517  ? MET E 526  ? SER E 577  MET E 586  1 ? 10 
HELX_P HELX_P198 AV9 PRO E 542  ? GLY E 557  ? PRO E 602  GLY E 617  1 ? 16 
HELX_P HELX_P199 AW1 MET E 582  ? SER E 589  ? MET E 642  SER E 649  1 ? 8  
HELX_P HELX_P200 AW2 SER E 603  ? THR E 618  ? SER E 663  THR E 678  1 ? 16 
HELX_P HELX_P201 AW3 THR E 636  ? ASP E 646  ? THR E 696  ASP E 706  1 ? 11 
HELX_P HELX_P202 AW4 GLU E 664  ? GLU E 673  ? GLU E 724  GLU E 733  1 ? 10 
HELX_P HELX_P203 AW5 GLY E 686  ? PHE E 692  ? GLY E 746  PHE E 752  5 ? 7  
HELX_P HELX_P204 AW6 THR E 711  ? GLY E 723  ? THR E 771  GLY E 783  1 ? 13 
HELX_P HELX_P205 AW7 SER E 729  ? ASP E 731  ? SER E 789  ASP E 791  5 ? 3  
HELX_P HELX_P206 AW8 GLU E 732  ? ASN E 747  ? GLU E 792  ASN E 807  1 ? 16 
HELX_P HELX_P207 AW9 TYR E 765  ? LEU E 771  ? TYR E 825  LEU E 831  1 ? 7  
HELX_P HELX_P208 AX1 ILE E 799  ? GLU E 805  ? ILE E 859  GLU E 865  1 ? 7  
HELX_P HELX_P209 AX2 MET E 807  ? GLN E 819  ? MET E 867  GLN E 879  1 ? 13 
HELX_P HELX_P210 AX3 PRO E 823  ? THR E 837  ? PRO E 883  THR E 897  1 ? 15 
HELX_P HELX_P211 AX4 VAL E 844  ? ALA E 856  ? VAL E 904  ALA E 916  1 ? 13 
HELX_P HELX_P212 AX5 ASP E 859  ? LEU E 869  ? ASP E 919  LEU E 929  1 ? 11 
HELX_P HELX_P213 AX6 GLY E 877  ? SER E 892  ? GLY E 937  SER E 952  1 ? 16 
HELX_P HELX_P214 AX7 ILE E 895  ? GLY E 907  ? ILE E 955  GLY E 967  1 ? 13 
HELX_P HELX_P215 AX8 ASP E 924  ? PHE E 938  ? ASP E 984  PHE E 998  1 ? 15 
HELX_P HELX_P216 AX9 THR E 941  ? THR E 955  ? THR E 1001 THR E 1015 1 ? 15 
HELX_P HELX_P217 AY1 ASN E 964  ? CYS E 980  ? ASN E 1024 CYS E 1040 1 ? 17 
HELX_P HELX_P218 AY2 THR E 984  ? ILE E 994  ? THR E 1044 ILE E 1054 1 ? 11 
HELX_P HELX_P219 AY3 GLY E 995  ? LEU E 1019 ? GLY E 1055 LEU E 1079 1 ? 25 
HELX_P HELX_P220 AY4 PRO E 1027 ? ASP E 1029 ? PRO E 1087 ASP E 1089 5 ? 3  
HELX_P HELX_P221 AY5 SER F 7    ? ILE F 19   ? SER F 7    ILE F 19   1 ? 13 
HELX_P HELX_P222 AY6 ASP F 39   ? HIS F 47   ? ASP F 39   HIS F 47   1 ? 9  
HELX_P HELX_P223 AY7 PRO F 48   ? GLN F 53   ? PRO F 48   GLN F 53   1 ? 6  
HELX_P HELX_P224 AY8 THR F 77   ? LEU F 89   ? THR F 77   LEU F 89   1 ? 13 
HELX_P HELX_P225 AY9 SER F 114  ? ALA F 116  ? SER F 114  ALA F 116  5 ? 3  
HELX_P HELX_P226 AZ1 ASP F 144  ? ALA F 149  ? ASP F 144  ALA F 149  1 ? 6  
HELX_P HELX_P227 AZ2 ASN F 161  ? LEU F 169  ? ASN F 161  LEU F 169  1 ? 9  
HELX_P HELX_P228 AZ3 PRO F 174  ? ASP F 176  ? PRO F 174  ASP F 176  5 ? 3  
HELX_P HELX_P229 AZ4 LYS F 177  ? LEU F 195  ? LYS F 177  LEU F 195  1 ? 19 
HELX_P HELX_P230 AZ5 ALA F 225  ? GLY F 234  ? ALA F 225  GLY F 234  1 ? 10 
HELX_P HELX_P231 AZ6 TYR F 247  ? LYS F 259  ? TYR F 247  LYS F 259  1 ? 13 
HELX_P HELX_P232 AZ7 GLY F 283  ? LEU F 295  ? GLY F 283  LEU F 295  1 ? 13 
HELX_P HELX_P233 AZ8 SER F 312  ? THR F 328  ? SER F 312  THR F 328  1 ? 17 
HELX_P HELX_P234 AZ9 ASN F 349  ? TYR F 364  ? ASN F 349  TYR F 364  1 ? 16 
HELX_P HELX_P235 BA1 TYR F 364  ? HIS F 371  ? TYR F 364  HIS F 371  1 ? 8  
HELX_P HELX_P236 BA2 ASN F 383  ? GLY F 399  ? ASN F 383  GLY F 399  1 ? 17 
HELX_P HELX_P237 BA3 THR F 412  ? LEU F 419  ? THR F 412  LEU F 419  1 ? 8  
HELX_P HELX_P238 BA4 GLN F 445  ? CYS F 459  ? GLN F 505  CYS F 519  1 ? 15 
HELX_P HELX_P239 BA5 ASN F 495  ? HIS F 503  ? ASN F 555  HIS F 563  1 ? 9  
HELX_P HELX_P240 BA6 SER F 517  ? MET F 526  ? SER F 577  MET F 586  1 ? 10 
HELX_P HELX_P241 BA7 PRO F 542  ? GLY F 557  ? PRO F 602  GLY F 617  1 ? 16 
HELX_P HELX_P242 BA8 MET F 582  ? SER F 589  ? MET F 642  SER F 649  1 ? 8  
HELX_P HELX_P243 BA9 SER F 603  ? THR F 618  ? SER F 663  THR F 678  1 ? 16 
HELX_P HELX_P244 BB1 THR F 636  ? ASP F 646  ? THR F 696  ASP F 706  1 ? 11 
HELX_P HELX_P245 BB2 GLU F 664  ? GLU F 673  ? GLU F 724  GLU F 733  1 ? 10 
HELX_P HELX_P246 BB3 GLY F 686  ? PHE F 692  ? GLY F 746  PHE F 752  5 ? 7  
HELX_P HELX_P247 BB4 THR F 711  ? GLY F 723  ? THR F 771  GLY F 783  1 ? 13 
HELX_P HELX_P248 BB5 SER F 729  ? ASP F 731  ? SER F 789  ASP F 791  5 ? 3  
HELX_P HELX_P249 BB6 GLU F 732  ? ASN F 747  ? GLU F 792  ASN F 807  1 ? 16 
HELX_P HELX_P250 BB7 TYR F 765  ? LEU F 771  ? TYR F 825  LEU F 831  1 ? 7  
HELX_P HELX_P251 BB8 ILE F 799  ? GLU F 805  ? ILE F 859  GLU F 865  1 ? 7  
HELX_P HELX_P252 BB9 MET F 807  ? GLN F 819  ? MET F 867  GLN F 879  1 ? 13 
HELX_P HELX_P253 BC1 PRO F 823  ? THR F 837  ? PRO F 883  THR F 897  1 ? 15 
HELX_P HELX_P254 BC2 VAL F 844  ? ALA F 856  ? VAL F 904  ALA F 916  1 ? 13 
HELX_P HELX_P255 BC3 ASP F 859  ? LEU F 869  ? ASP F 919  LEU F 929  1 ? 11 
HELX_P HELX_P256 BC4 GLY F 877  ? GLY F 893  ? GLY F 937  GLY F 953  1 ? 17 
HELX_P HELX_P257 BC5 ILE F 895  ? GLY F 907  ? ILE F 955  GLY F 967  1 ? 13 
HELX_P HELX_P258 BC6 ASP F 924  ? PHE F 938  ? ASP F 984  PHE F 998  1 ? 15 
HELX_P HELX_P259 BC7 THR F 941  ? THR F 955  ? THR F 1001 THR F 1015 1 ? 15 
HELX_P HELX_P260 BC8 ASN F 964  ? CYS F 980  ? ASN F 1024 CYS F 1040 1 ? 17 
HELX_P HELX_P261 BC9 THR F 984  ? ILE F 994  ? THR F 1044 ILE F 1054 1 ? 11 
HELX_P HELX_P262 BD1 GLY F 995  ? LEU F 1019 ? GLY F 1055 LEU F 1079 1 ? 25 
HELX_P HELX_P263 BD2 PRO F 1027 ? ASP F 1029 ? PRO F 1087 ASP F 1089 5 ? 3  
HELX_P HELX_P264 BD3 SER G 7    ? ILE G 19   ? SER G 7    ILE G 19   1 ? 13 
HELX_P HELX_P265 BD4 ASP G 39   ? HIS G 47   ? ASP G 39   HIS G 47   1 ? 9  
HELX_P HELX_P266 BD5 PRO G 48   ? GLN G 53   ? PRO G 48   GLN G 53   1 ? 6  
HELX_P HELX_P267 BD6 THR G 77   ? LEU G 89   ? THR G 77   LEU G 89   1 ? 13 
HELX_P HELX_P268 BD7 SER G 114  ? ALA G 116  ? SER G 114  ALA G 116  5 ? 3  
HELX_P HELX_P269 BD8 ASP G 144  ? ALA G 149  ? ASP G 144  ALA G 149  1 ? 6  
HELX_P HELX_P270 BD9 ASN G 161  ? LEU G 169  ? ASN G 161  LEU G 169  1 ? 9  
HELX_P HELX_P271 BE1 PRO G 174  ? ASP G 176  ? PRO G 174  ASP G 176  5 ? 3  
HELX_P HELX_P272 BE2 LYS G 177  ? LEU G 195  ? LYS G 177  LEU G 195  1 ? 19 
HELX_P HELX_P273 BE3 ALA G 225  ? GLY G 234  ? ALA G 225  GLY G 234  1 ? 10 
HELX_P HELX_P274 BE4 TYR G 247  ? LYS G 259  ? TYR G 247  LYS G 259  1 ? 13 
HELX_P HELX_P275 BE5 GLY G 283  ? LEU G 295  ? GLY G 283  LEU G 295  1 ? 13 
HELX_P HELX_P276 BE6 SER G 312  ? THR G 328  ? SER G 312  THR G 328  1 ? 17 
HELX_P HELX_P277 BE7 ASN G 349  ? TYR G 364  ? ASN G 349  TYR G 364  1 ? 16 
HELX_P HELX_P278 BE8 TYR G 364  ? HIS G 371  ? TYR G 364  HIS G 371  1 ? 8  
HELX_P HELX_P279 BE9 ASN G 383  ? GLY G 399  ? ASN G 383  GLY G 399  1 ? 17 
HELX_P HELX_P280 BF1 THR G 412  ? LEU G 419  ? THR G 412  LEU G 419  1 ? 8  
HELX_P HELX_P281 BF2 GLN G 445  ? CYS G 459  ? GLN G 505  CYS G 519  1 ? 15 
HELX_P HELX_P282 BF3 ASN G 495  ? HIS G 503  ? ASN G 555  HIS G 563  1 ? 9  
HELX_P HELX_P283 BF4 SER G 517  ? MET G 526  ? SER G 577  MET G 586  1 ? 10 
HELX_P HELX_P284 BF5 PRO G 542  ? GLY G 557  ? PRO G 602  GLY G 617  1 ? 16 
HELX_P HELX_P285 BF6 MET G 582  ? SER G 589  ? MET G 642  SER G 649  1 ? 8  
HELX_P HELX_P286 BF7 SER G 603  ? THR G 618  ? SER G 663  THR G 678  1 ? 16 
HELX_P HELX_P287 BF8 THR G 636  ? THR G 647  ? THR G 696  THR G 707  1 ? 12 
HELX_P HELX_P288 BF9 GLU G 664  ? GLU G 673  ? GLU G 724  GLU G 733  1 ? 10 
HELX_P HELX_P289 BG1 GLY G 686  ? PHE G 692  ? GLY G 746  PHE G 752  5 ? 7  
HELX_P HELX_P290 BG2 THR G 711  ? GLY G 723  ? THR G 771  GLY G 783  1 ? 13 
HELX_P HELX_P291 BG3 SER G 729  ? ASP G 731  ? SER G 789  ASP G 791  5 ? 3  
HELX_P HELX_P292 BG4 GLU G 732  ? ASN G 747  ? GLU G 792  ASN G 807  1 ? 16 
HELX_P HELX_P293 BG5 TYR G 765  ? LEU G 771  ? TYR G 825  LEU G 831  1 ? 7  
HELX_P HELX_P294 BG6 ILE G 799  ? GLU G 805  ? ILE G 859  GLU G 865  1 ? 7  
HELX_P HELX_P295 BG7 MET G 807  ? GLN G 819  ? MET G 867  GLN G 879  1 ? 13 
HELX_P HELX_P296 BG8 PRO G 823  ? THR G 837  ? PRO G 883  THR G 897  1 ? 15 
HELX_P HELX_P297 BG9 VAL G 844  ? ALA G 856  ? VAL G 904  ALA G 916  1 ? 13 
HELX_P HELX_P298 BH1 ASP G 859  ? LEU G 869  ? ASP G 919  LEU G 929  1 ? 11 
HELX_P HELX_P299 BH2 GLY G 877  ? GLY G 893  ? GLY G 937  GLY G 953  1 ? 17 
HELX_P HELX_P300 BH3 ILE G 895  ? GLY G 907  ? ILE G 955  GLY G 967  1 ? 13 
HELX_P HELX_P301 BH4 ASP G 924  ? PHE G 938  ? ASP G 984  PHE G 998  1 ? 15 
HELX_P HELX_P302 BH5 THR G 941  ? THR G 955  ? THR G 1001 THR G 1015 1 ? 15 
HELX_P HELX_P303 BH6 ASN G 964  ? CYS G 980  ? ASN G 1024 CYS G 1040 1 ? 17 
HELX_P HELX_P304 BH7 THR G 984  ? ILE G 994  ? THR G 1044 ILE G 1054 1 ? 11 
HELX_P HELX_P305 BH8 GLY G 995  ? LEU G 1019 ? GLY G 1055 LEU G 1079 1 ? 25 
HELX_P HELX_P306 BH9 PRO G 1027 ? ASP G 1029 ? PRO G 1087 ASP G 1089 5 ? 3  
HELX_P HELX_P307 BI1 SER H 7    ? ILE H 19   ? SER H 7    ILE H 19   1 ? 13 
HELX_P HELX_P308 BI2 ASP H 39   ? HIS H 47   ? ASP H 39   HIS H 47   1 ? 9  
HELX_P HELX_P309 BI3 PRO H 48   ? GLN H 53   ? PRO H 48   GLN H 53   1 ? 6  
HELX_P HELX_P310 BI4 THR H 77   ? LEU H 89   ? THR H 77   LEU H 89   1 ? 13 
HELX_P HELX_P311 BI5 SER H 114  ? ALA H 116  ? SER H 114  ALA H 116  5 ? 3  
HELX_P HELX_P312 BI6 ASP H 144  ? ALA H 149  ? ASP H 144  ALA H 149  1 ? 6  
HELX_P HELX_P313 BI7 ASN H 161  ? LEU H 169  ? ASN H 161  LEU H 169  1 ? 9  
HELX_P HELX_P314 BI8 PRO H 174  ? ASP H 176  ? PRO H 174  ASP H 176  5 ? 3  
HELX_P HELX_P315 BI9 LYS H 177  ? LEU H 195  ? LYS H 177  LEU H 195  1 ? 19 
HELX_P HELX_P316 BJ1 ALA H 225  ? GLY H 234  ? ALA H 225  GLY H 234  1 ? 10 
HELX_P HELX_P317 BJ2 TYR H 247  ? LYS H 259  ? TYR H 247  LYS H 259  1 ? 13 
HELX_P HELX_P318 BJ3 GLY H 281  ? LEU H 295  ? GLY H 281  LEU H 295  1 ? 15 
HELX_P HELX_P319 BJ4 SER H 312  ? THR H 328  ? SER H 312  THR H 328  1 ? 17 
HELX_P HELX_P320 BJ5 ASN H 349  ? TYR H 364  ? ASN H 349  TYR H 364  1 ? 16 
HELX_P HELX_P321 BJ6 TYR H 364  ? HIS H 371  ? TYR H 364  HIS H 371  1 ? 8  
HELX_P HELX_P322 BJ7 ASN H 383  ? GLY H 399  ? ASN H 383  GLY H 399  1 ? 17 
HELX_P HELX_P323 BJ8 THR H 412  ? LEU H 419  ? THR H 412  LEU H 419  1 ? 8  
HELX_P HELX_P324 BJ9 GLN H 445  ? CYS H 459  ? GLN H 505  CYS H 519  1 ? 15 
HELX_P HELX_P325 BK1 ASN H 495  ? HIS H 503  ? ASN H 555  HIS H 563  1 ? 9  
HELX_P HELX_P326 BK2 SER H 517  ? MET H 526  ? SER H 577  MET H 586  1 ? 10 
HELX_P HELX_P327 BK3 PRO H 542  ? GLY H 557  ? PRO H 602  GLY H 617  1 ? 16 
HELX_P HELX_P328 BK4 MET H 582  ? SER H 589  ? MET H 642  SER H 649  1 ? 8  
HELX_P HELX_P329 BK5 SER H 603  ? THR H 618  ? SER H 663  THR H 678  1 ? 16 
HELX_P HELX_P330 BK6 THR H 636  ? THR H 647  ? THR H 696  THR H 707  1 ? 12 
HELX_P HELX_P331 BK7 GLU H 664  ? GLU H 673  ? GLU H 724  GLU H 733  1 ? 10 
HELX_P HELX_P332 BK8 GLY H 686  ? PHE H 692  ? GLY H 746  PHE H 752  5 ? 7  
HELX_P HELX_P333 BK9 THR H 711  ? GLY H 723  ? THR H 771  GLY H 783  1 ? 13 
HELX_P HELX_P334 BL1 SER H 729  ? ASP H 731  ? SER H 789  ASP H 791  5 ? 3  
HELX_P HELX_P335 BL2 GLU H 732  ? ASN H 747  ? GLU H 792  ASN H 807  1 ? 16 
HELX_P HELX_P336 BL3 TYR H 765  ? LEU H 771  ? TYR H 825  LEU H 831  1 ? 7  
HELX_P HELX_P337 BL4 ILE H 799  ? GLU H 805  ? ILE H 859  GLU H 865  1 ? 7  
HELX_P HELX_P338 BL5 MET H 807  ? GLN H 819  ? MET H 867  GLN H 879  1 ? 13 
HELX_P HELX_P339 BL6 PRO H 823  ? THR H 837  ? PRO H 883  THR H 897  1 ? 15 
HELX_P HELX_P340 BL7 VAL H 844  ? ALA H 856  ? VAL H 904  ALA H 916  1 ? 13 
HELX_P HELX_P341 BL8 ASP H 859  ? LEU H 869  ? ASP H 919  LEU H 929  1 ? 11 
HELX_P HELX_P342 BL9 GLY H 877  ? GLY H 893  ? GLY H 937  GLY H 953  1 ? 17 
HELX_P HELX_P343 BM1 ILE H 895  ? GLY H 907  ? ILE H 955  GLY H 967  1 ? 13 
HELX_P HELX_P344 BM2 ASP H 924  ? PHE H 938  ? ASP H 984  PHE H 998  1 ? 15 
HELX_P HELX_P345 BM3 THR H 941  ? THR H 955  ? THR H 1001 THR H 1015 1 ? 15 
HELX_P HELX_P346 BM4 ASN H 964  ? CYS H 980  ? ASN H 1024 CYS H 1040 1 ? 17 
HELX_P HELX_P347 BM5 THR H 984  ? ILE H 994  ? THR H 1044 ILE H 1054 1 ? 11 
HELX_P HELX_P348 BM6 GLY H 995  ? LEU H 1019 ? GLY H 1055 LEU H 1079 1 ? 25 
HELX_P HELX_P349 BM7 PRO H 1027 ? ASP H 1029 ? PRO H 1087 ASP H 1089 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A  ASN 203 O   ? ? ? 1_555 N  MG  . MG  ? ? A ASN 203  A MG  1206 1_555 ? ? ? ? ? ? ? 2.168 ? 
metalc2  metalc ? ? A  ASP 216 OD2 ? ? ? 1_555 N  MG  . MG  ? ? A ASP 216  A MG  1206 1_555 ? ? ? ? ? ? ? 2.530 ? 
metalc3  metalc ? ? A  SER 308 OG  ? ? ? 1_555 I  MG  . MG  ? ? A SER 308  A MG  1201 1_555 ? ? ? ? ? ? ? 2.356 ? 
metalc4  metalc ? ? A  GLU 539 OE2 ? ? ? 1_555 I  MG  . MG  ? ? A GLU 599  A MG  1201 1_555 ? ? ? ? ? ? ? 2.732 ? 
metalc5  metalc ? ? B  ASN 203 O   ? ? ? 1_555 T  MG  . MG  ? ? B ASN 203  B MG  1205 1_555 ? ? ? ? ? ? ? 1.956 ? 
metalc6  metalc ? ? B  ASP 216 OD2 ? ? ? 1_555 T  MG  . MG  ? ? B ASP 216  B MG  1205 1_555 ? ? ? ? ? ? ? 2.784 ? 
metalc7  metalc ? ? B  SER 308 OG  ? ? ? 1_555 P  MG  . MG  ? ? B SER 308  B MG  1201 1_555 ? ? ? ? ? ? ? 2.608 ? 
metalc8  metalc ? ? B  GLU 539 OE1 ? ? ? 1_555 P  MG  . MG  ? ? B GLU 599  B MG  1201 1_555 ? ? ? ? ? ? ? 2.677 ? 
metalc9  metalc ? ? C  ASN 203 O   ? ? ? 1_555 Z  MG  . MG  ? ? C ASN 203  C MG  1206 1_555 ? ? ? ? ? ? ? 1.978 ? 
metalc10 metalc ? ? C  ASP 216 OD2 ? ? ? 1_555 Z  MG  . MG  ? ? C ASP 216  C MG  1206 1_555 ? ? ? ? ? ? ? 2.409 ? 
metalc11 metalc ? ? C  SER 308 OG  ? ? ? 1_555 U  MG  . MG  ? ? C SER 308  C MG  1201 1_555 ? ? ? ? ? ? ? 2.063 ? 
metalc12 metalc ? ? C  GLU 539 OE1 ? ? ? 1_555 U  MG  . MG  ? ? C GLU 599  C MG  1201 1_555 ? ? ? ? ? ? ? 2.943 ? 
metalc13 metalc ? ? C  GLU 539 OE2 ? ? ? 1_555 U  MG  . MG  ? ? C GLU 599  C MG  1201 1_555 ? ? ? ? ? ? ? 2.967 ? 
metalc14 metalc ? ? D  ASN 203 O   ? ? ? 1_555 FA MG  . MG  ? ? D ASN 203  D MG  1206 1_555 ? ? ? ? ? ? ? 2.437 ? 
metalc15 metalc ? ? D  ASP 216 OD2 ? ? ? 1_555 FA MG  . MG  ? ? D ASP 216  D MG  1206 1_555 ? ? ? ? ? ? ? 2.330 ? 
metalc16 metalc ? ? D  SER 308 OG  ? ? ? 1_555 AA MG  . MG  ? ? D SER 308  D MG  1201 1_555 ? ? ? ? ? ? ? 2.547 ? 
metalc17 metalc ? ? D  GLU 539 OE1 ? ? ? 1_555 AA MG  . MG  ? ? D GLU 599  D MG  1201 1_555 ? ? ? ? ? ? ? 2.424 ? 
metalc18 metalc ? ? D  GLU 539 OE2 ? ? ? 1_555 AA MG  . MG  ? ? D GLU 599  D MG  1201 1_555 ? ? ? ? ? ? ? 2.993 ? 
metalc19 metalc ? ? E  ASN 203 O   ? ? ? 1_555 LA MG  . MG  ? ? E ASN 203  E MG  1206 1_555 ? ? ? ? ? ? ? 2.343 ? 
metalc20 metalc ? ? E  ASP 216 OD2 ? ? ? 1_555 LA MG  . MG  ? ? E ASP 216  E MG  1206 1_555 ? ? ? ? ? ? ? 2.685 ? 
metalc21 metalc ? ? E  SER 308 OG  ? ? ? 1_555 GA MG  . MG  ? ? E SER 308  E MG  1201 1_555 ? ? ? ? ? ? ? 2.171 ? 
metalc22 metalc ? ? F  ASN 203 O   ? ? ? 1_555 RA MG  . MG  ? ? F ASN 203  F MG  1206 1_555 ? ? ? ? ? ? ? 2.093 ? 
metalc23 metalc ? ? F  ASP 216 OD2 ? ? ? 1_555 RA MG  . MG  ? ? F ASP 216  F MG  1206 1_555 ? ? ? ? ? ? ? 2.461 ? 
metalc24 metalc ? ? F  SER 308 OG  ? ? ? 1_555 MA MG  . MG  ? ? F SER 308  F MG  1201 1_555 ? ? ? ? ? ? ? 2.180 ? 
metalc25 metalc ? ? G  ASN 203 O   ? ? ? 1_555 XA MG  . MG  ? ? G ASN 203  G MG  1206 1_555 ? ? ? ? ? ? ? 2.021 ? 
metalc26 metalc ? ? G  ASP 216 OD2 ? ? ? 1_555 XA MG  . MG  ? ? G ASP 216  G MG  1206 1_555 ? ? ? ? ? ? ? 2.592 ? 
metalc27 metalc ? ? G  SER 308 OG  ? ? ? 1_555 SA MG  . MG  ? ? G SER 308  G MG  1201 1_555 ? ? ? ? ? ? ? 2.507 ? 
metalc28 metalc ? ? G  GLU 539 OE1 ? ? ? 1_555 SA MG  . MG  ? ? G GLU 599  G MG  1201 1_555 ? ? ? ? ? ? ? 2.963 ? 
metalc29 metalc ? ? G  GLU 539 OE2 ? ? ? 1_555 SA MG  . MG  ? ? G GLU 599  G MG  1201 1_555 ? ? ? ? ? ? ? 2.986 ? 
metalc30 metalc ? ? H  ASN 203 O   ? ? ? 1_555 DB MG  . MG  ? ? H ASN 203  H MG  1206 1_555 ? ? ? ? ? ? ? 2.374 ? 
metalc31 metalc ? ? H  ASP 216 OD2 ? ? ? 1_555 DB MG  . MG  ? ? H ASP 216  H MG  1206 1_555 ? ? ? ? ? ? ? 2.871 ? 
metalc32 metalc ? ? H  SER 308 OG  ? ? ? 1_555 YA MG  . MG  ? ? H SER 308  H MG  1201 1_555 ? ? ? ? ? ? ? 2.631 ? 
metalc33 metalc ? ? H  GLU 539 OE1 ? ? ? 1_555 YA MG  . MG  ? ? H GLU 599  H MG  1201 1_555 ? ? ? ? ? ? ? 2.976 ? 
metalc34 metalc ? ? H  GLU 539 OE2 ? ? ? 1_555 YA MG  . MG  ? ? H GLU 599  H MG  1201 1_555 ? ? ? ? ? ? ? 2.816 ? 
metalc35 metalc ? ? I  MG  .   MG  ? ? ? 1_555 J  PO4 . O1  ? ? A MG  1201 A PO4 1202 1_555 ? ? ? ? ? ? ? 2.352 ? 
metalc36 metalc ? ? I  MG  .   MG  ? ? ? 1_555 K  FLC . OG1 ? ? A MG  1201 A FLC 1203 1_555 ? ? ? ? ? ? ? 2.288 ? 
metalc37 metalc ? ? M  ADP .   O1B ? ? ? 1_555 N  MG  . MG  ? ? A ADP 1205 A MG  1206 1_555 ? ? ? ? ? ? ? 1.965 ? 
metalc38 metalc ? ? M  ADP .   O2A ? ? ? 1_555 N  MG  . MG  ? ? A ADP 1205 A MG  1206 1_555 ? ? ? ? ? ? ? 2.167 ? 
metalc39 metalc ? ? N  MG  .   MG  ? ? ? 1_555 EB HOH . O   ? ? A MG  1206 A HOH 1302 1_555 ? ? ? ? ? ? ? 2.269 ? 
metalc40 metalc ? ? P  MG  .   MG  ? ? ? 1_555 Q  PO4 . O1  ? ? B MG  1201 B PO4 1202 1_555 ? ? ? ? ? ? ? 2.386 ? 
metalc41 metalc ? ? P  MG  .   MG  ? ? ? 1_555 R  FLC . OG2 ? ? B MG  1201 B FLC 1203 1_555 ? ? ? ? ? ? ? 2.350 ? 
metalc42 metalc ? ? S  ADP .   O1B ? ? ? 1_555 T  MG  . MG  ? ? B ADP 1204 B MG  1205 1_555 ? ? ? ? ? ? ? 2.398 ? 
metalc43 metalc ? ? S  ADP .   O2A ? ? ? 1_555 T  MG  . MG  ? ? B ADP 1204 B MG  1205 1_555 ? ? ? ? ? ? ? 1.937 ? 
metalc44 metalc ? ? T  MG  .   MG  ? ? ? 1_555 FB HOH . O   ? ? B MG  1205 B HOH 1301 1_555 ? ? ? ? ? ? ? 1.938 ? 
metalc45 metalc ? ? T  MG  .   MG  ? ? ? 1_555 FB HOH . O   ? ? B MG  1205 B HOH 1302 1_555 ? ? ? ? ? ? ? 2.461 ? 
metalc46 metalc ? ? U  MG  .   MG  ? ? ? 1_555 V  PO4 . O2  ? ? C MG  1201 C PO4 1202 1_555 ? ? ? ? ? ? ? 2.381 ? 
metalc47 metalc ? ? U  MG  .   MG  ? ? ? 1_555 W  FLC . OG1 ? ? C MG  1201 C FLC 1203 1_555 ? ? ? ? ? ? ? 2.261 ? 
metalc48 metalc ? ? Y  ADP .   O1B ? ? ? 1_555 Z  MG  . MG  ? ? C ADP 1205 C MG  1206 1_555 ? ? ? ? ? ? ? 2.301 ? 
metalc49 metalc ? ? Y  ADP .   O2A ? ? ? 1_555 Z  MG  . MG  ? ? C ADP 1205 C MG  1206 1_555 ? ? ? ? ? ? ? 2.556 ? 
metalc50 metalc ? ? Z  MG  .   MG  ? ? ? 1_555 GB HOH . O   ? ? C MG  1206 C HOH 1302 1_555 ? ? ? ? ? ? ? 2.881 ? 
metalc51 metalc ? ? Z  MG  .   MG  ? ? ? 1_555 GB HOH . O   ? ? C MG  1206 C HOH 1301 1_555 ? ? ? ? ? ? ? 2.211 ? 
metalc52 metalc ? ? AA MG  .   MG  ? ? ? 1_555 CA FLC . OG2 ? ? D MG  1201 D FLC 1203 1_555 ? ? ? ? ? ? ? 2.642 ? 
metalc53 metalc ? ? AA MG  .   MG  ? ? ? 1_555 BA PO4 . O4  ? ? D MG  1201 D PO4 1202 1_555 ? ? ? ? ? ? ? 2.406 ? 
metalc54 metalc ? ? EA ADP .   O1B ? ? ? 1_555 FA MG  . MG  ? ? D ADP 1205 D MG  1206 1_555 ? ? ? ? ? ? ? 2.245 ? 
metalc55 metalc ? ? EA ADP .   O2A ? ? ? 1_555 FA MG  . MG  ? ? D ADP 1205 D MG  1206 1_555 ? ? ? ? ? ? ? 2.871 ? 
metalc56 metalc ? ? FA MG  .   MG  ? ? ? 1_555 HB HOH . O   ? ? D MG  1206 D HOH 1301 1_555 ? ? ? ? ? ? ? 2.265 ? 
metalc57 metalc ? ? GA MG  .   MG  ? ? ? 1_555 HA PO4 . O1  ? ? E MG  1201 E PO4 1202 1_555 ? ? ? ? ? ? ? 2.199 ? 
metalc58 metalc ? ? GA MG  .   MG  ? ? ? 1_555 IA FLC . OG1 ? ? E MG  1201 E FLC 1203 1_555 ? ? ? ? ? ? ? 2.327 ? 
metalc59 metalc ? ? KA ADP .   O1B ? ? ? 1_555 LA MG  . MG  ? ? E ADP 1205 E MG  1206 1_555 ? ? ? ? ? ? ? 2.000 ? 
metalc60 metalc ? ? KA ADP .   O2A ? ? ? 1_555 LA MG  . MG  ? ? E ADP 1205 E MG  1206 1_555 ? ? ? ? ? ? ? 2.527 ? 
metalc61 metalc ? ? LA MG  .   MG  ? ? ? 1_555 IB HOH . O   ? ? E MG  1206 E HOH 1301 1_555 ? ? ? ? ? ? ? 2.350 ? 
metalc62 metalc ? ? MA MG  .   MG  ? ? ? 1_555 OA FLC . OG1 ? ? F MG  1201 F FLC 1203 1_555 ? ? ? ? ? ? ? 2.217 ? 
metalc63 metalc ? ? MA MG  .   MG  ? ? ? 1_555 NA PO4 . O1  ? ? F MG  1201 F PO4 1202 1_555 ? ? ? ? ? ? ? 2.303 ? 
metalc64 metalc ? ? QA ADP .   O1B ? ? ? 1_555 RA MG  . MG  ? ? F ADP 1205 F MG  1206 1_555 ? ? ? ? ? ? ? 2.215 ? 
metalc65 metalc ? ? QA ADP .   O2A ? ? ? 1_555 RA MG  . MG  ? ? F ADP 1205 F MG  1206 1_555 ? ? ? ? ? ? ? 2.764 ? 
metalc66 metalc ? ? RA MG  .   MG  ? ? ? 1_555 JB HOH . O   ? ? F MG  1206 F HOH 1301 1_555 ? ? ? ? ? ? ? 1.958 ? 
metalc67 metalc ? ? SA MG  .   MG  ? ? ? 1_555 TA PO4 . O2  ? ? G MG  1201 G PO4 1202 1_555 ? ? ? ? ? ? ? 2.351 ? 
metalc68 metalc ? ? SA MG  .   MG  ? ? ? 1_555 UA FLC . OG1 ? ? G MG  1201 G FLC 1203 1_555 ? ? ? ? ? ? ? 2.139 ? 
metalc69 metalc ? ? WA ADP .   O1B ? ? ? 1_555 XA MG  . MG  ? ? G ADP 1205 G MG  1206 1_555 ? ? ? ? ? ? ? 2.219 ? 
metalc70 metalc ? ? WA ADP .   O2A ? ? ? 1_555 XA MG  . MG  ? ? G ADP 1205 G MG  1206 1_555 ? ? ? ? ? ? ? 2.023 ? 
metalc71 metalc ? ? XA MG  .   MG  ? ? ? 1_555 KB HOH . O   ? ? G MG  1206 G HOH 1301 1_555 ? ? ? ? ? ? ? 2.794 ? 
metalc72 metalc ? ? XA MG  .   MG  ? ? ? 1_555 KB HOH . O   ? ? G MG  1206 G HOH 1302 1_555 ? ? ? ? ? ? ? 2.478 ? 
metalc73 metalc ? ? YA MG  .   MG  ? ? ? 1_555 ZA PO4 . O4  ? ? H MG  1201 H PO4 1202 1_555 ? ? ? ? ? ? ? 2.294 ? 
metalc74 metalc ? ? YA MG  .   MG  ? ? ? 1_555 AB FLC . OG2 ? ? H MG  1201 H FLC 1203 1_555 ? ? ? ? ? ? ? 2.518 ? 
metalc75 metalc ? ? CB ADP .   O1B ? ? ? 1_555 DB MG  . MG  ? ? H ADP 1205 H MG  1206 1_555 ? ? ? ? ? ? ? 2.243 ? 
metalc76 metalc ? ? DB MG  .   MG  ? ? ? 1_555 LB HOH . O   ? ? H MG  1206 H HOH 1301 1_555 ? ? ? ? ? ? ? 2.782 ? 
metalc77 metalc ? ? DB MG  .   MG  ? ? ? 1_555 LB HOH . O   ? ? H MG  1206 H HOH 1302 1_555 ? ? ? ? ? ? ? 2.697 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  ASN 203 A . ? ASN 203 A PRO 204 A ? PRO 204 A 1 4.49  
2  GLY 562 A . ? GLY 622 A PRO 563 A ? PRO 623 A 1 0.71  
3  ASN 203 B . ? ASN 203 B PRO 204 B ? PRO 204 B 1 4.89  
4  GLY 562 B . ? GLY 622 B PRO 563 B ? PRO 623 B 1 0.94  
5  ASN 203 C . ? ASN 203 C PRO 204 C ? PRO 204 C 1 2.45  
6  GLY 562 C . ? GLY 622 C PRO 563 C ? PRO 623 C 1 0.58  
7  ASN 203 D . ? ASN 203 D PRO 204 D ? PRO 204 D 1 6.56  
8  GLY 562 D . ? GLY 622 D PRO 563 D ? PRO 623 D 1 -0.01 
9  ASN 203 E . ? ASN 203 E PRO 204 E ? PRO 204 E 1 8.47  
10 GLY 562 E . ? GLY 622 E PRO 563 E ? PRO 623 E 1 1.30  
11 ASN 203 F . ? ASN 203 F PRO 204 F ? PRO 204 F 1 6.22  
12 GLY 562 F . ? GLY 622 F PRO 563 F ? PRO 623 F 1 1.17  
13 ASN 203 G . ? ASN 203 G PRO 204 G ? PRO 204 G 1 5.64  
14 GLY 562 G . ? GLY 622 G PRO 563 G ? PRO 623 G 1 0.19  
15 ASN 203 H . ? ASN 203 H PRO 204 H ? PRO 204 H 1 4.58  
16 GLY 562 H . ? GLY 622 H PRO 563 H ? PRO 623 H 1 1.86  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 6 ? 
AA2 ? 4 ? 
AA3 ? 4 ? 
AA4 ? 2 ? 
AA5 ? 2 ? 
AA6 ? 4 ? 
AA7 ? 7 ? 
AA8 ? 6 ? 
AA9 ? 2 ? 
AB1 ? 2 ? 
AB2 ? 2 ? 
AB3 ? 3 ? 
AB4 ? 2 ? 
AB5 ? 6 ? 
AB6 ? 4 ? 
AB7 ? 4 ? 
AB8 ? 2 ? 
AB9 ? 3 ? 
AC1 ? 4 ? 
AC2 ? 7 ? 
AC3 ? 6 ? 
AC4 ? 2 ? 
AC5 ? 2 ? 
AC6 ? 2 ? 
AC7 ? 3 ? 
AC8 ? 2 ? 
AC9 ? 6 ? 
AD1 ? 4 ? 
AD2 ? 4 ? 
AD3 ? 2 ? 
AD4 ? 3 ? 
AD5 ? 4 ? 
AD6 ? 7 ? 
AD7 ? 6 ? 
AD8 ? 3 ? 
AD9 ? 6 ? 
AE1 ? 4 ? 
AE2 ? 4 ? 
AE3 ? 2 ? 
AE4 ? 3 ? 
AE5 ? 2 ? 
AE6 ? 4 ? 
AE7 ? 7 ? 
AE8 ? 6 ? 
AE9 ? 3 ? 
AF1 ? 6 ? 
AF2 ? 4 ? 
AF3 ? 4 ? 
AF4 ? 2 ? 
AF5 ? 3 ? 
AF6 ? 4 ? 
AF7 ? 7 ? 
AF8 ? 6 ? 
AF9 ? 2 ? 
AG1 ? 2 ? 
AG2 ? 2 ? 
AG3 ? 3 ? 
AG4 ? 2 ? 
AG5 ? 6 ? 
AG6 ? 4 ? 
AG7 ? 4 ? 
AG8 ? 2 ? 
AG9 ? 2 ? 
AH1 ? 4 ? 
AH2 ? 7 ? 
AH3 ? 6 ? 
AH4 ? 2 ? 
AH5 ? 2 ? 
AH6 ? 2 ? 
AH7 ? 3 ? 
AH8 ? 2 ? 
AH9 ? 6 ? 
AI1 ? 4 ? 
AI2 ? 4 ? 
AI3 ? 2 ? 
AI4 ? 3 ? 
AI5 ? 4 ? 
AI6 ? 7 ? 
AI7 ? 6 ? 
AI8 ? 3 ? 
AI9 ? 6 ? 
AJ1 ? 4 ? 
AJ2 ? 4 ? 
AJ3 ? 2 ? 
AJ4 ? 3 ? 
AJ5 ? 4 ? 
AJ6 ? 7 ? 
AJ7 ? 6 ? 
AJ8 ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA1 5 6 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA6 1 2 ? parallel      
AA6 2 3 ? parallel      
AA6 3 4 ? parallel      
AA7 1 2 ? anti-parallel 
AA7 2 3 ? parallel      
AA7 3 4 ? parallel      
AA7 4 5 ? parallel      
AA7 5 6 ? parallel      
AA7 6 7 ? parallel      
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA8 3 4 ? parallel      
AA8 4 5 ? parallel      
AA8 5 6 ? parallel      
AA9 1 2 ? parallel      
AB1 1 2 ? parallel      
AB2 1 2 ? parallel      
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB4 1 2 ? parallel      
AB5 1 2 ? anti-parallel 
AB5 2 3 ? anti-parallel 
AB5 3 4 ? anti-parallel 
AB5 4 5 ? anti-parallel 
AB5 5 6 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB6 2 3 ? anti-parallel 
AB6 3 4 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB7 2 3 ? anti-parallel 
AB7 3 4 ? anti-parallel 
AB8 1 2 ? anti-parallel 
AB9 1 2 ? anti-parallel 
AB9 2 3 ? parallel      
AC1 1 2 ? parallel      
AC1 2 3 ? parallel      
AC1 3 4 ? parallel      
AC2 1 2 ? anti-parallel 
AC2 2 3 ? parallel      
AC2 3 4 ? parallel      
AC2 4 5 ? parallel      
AC2 5 6 ? parallel      
AC2 6 7 ? parallel      
AC3 1 2 ? anti-parallel 
AC3 2 3 ? anti-parallel 
AC3 3 4 ? parallel      
AC3 4 5 ? parallel      
AC3 5 6 ? parallel      
AC4 1 2 ? parallel      
AC5 1 2 ? parallel      
AC6 1 2 ? parallel      
AC7 1 2 ? anti-parallel 
AC7 2 3 ? anti-parallel 
AC8 1 2 ? parallel      
AC9 1 2 ? anti-parallel 
AC9 2 3 ? anti-parallel 
AC9 3 4 ? anti-parallel 
AC9 4 5 ? anti-parallel 
AC9 5 6 ? anti-parallel 
AD1 1 2 ? anti-parallel 
AD1 2 3 ? anti-parallel 
AD1 3 4 ? anti-parallel 
AD2 1 2 ? anti-parallel 
AD2 2 3 ? anti-parallel 
AD2 3 4 ? anti-parallel 
AD3 1 2 ? anti-parallel 
AD4 1 2 ? anti-parallel 
AD4 2 3 ? parallel      
AD5 1 2 ? parallel      
AD5 2 3 ? parallel      
AD5 3 4 ? parallel      
AD6 1 2 ? anti-parallel 
AD6 2 3 ? parallel      
AD6 3 4 ? parallel      
AD6 4 5 ? parallel      
AD6 5 6 ? parallel      
AD6 6 7 ? parallel      
AD7 1 2 ? anti-parallel 
AD7 2 3 ? anti-parallel 
AD7 3 4 ? parallel      
AD7 4 5 ? parallel      
AD7 5 6 ? parallel      
AD8 1 2 ? anti-parallel 
AD8 2 3 ? anti-parallel 
AD9 1 2 ? anti-parallel 
AD9 2 3 ? anti-parallel 
AD9 3 4 ? anti-parallel 
AD9 4 5 ? anti-parallel 
AD9 5 6 ? anti-parallel 
AE1 1 2 ? anti-parallel 
AE1 2 3 ? anti-parallel 
AE1 3 4 ? anti-parallel 
AE2 1 2 ? anti-parallel 
AE2 2 3 ? anti-parallel 
AE2 3 4 ? anti-parallel 
AE3 1 2 ? anti-parallel 
AE4 1 2 ? anti-parallel 
AE4 2 3 ? parallel      
AE5 1 2 ? anti-parallel 
AE6 1 2 ? parallel      
AE6 2 3 ? parallel      
AE6 3 4 ? parallel      
AE7 1 2 ? anti-parallel 
AE7 2 3 ? parallel      
AE7 3 4 ? parallel      
AE7 4 5 ? parallel      
AE7 5 6 ? parallel      
AE7 6 7 ? parallel      
AE8 1 2 ? anti-parallel 
AE8 2 3 ? anti-parallel 
AE8 3 4 ? parallel      
AE8 4 5 ? parallel      
AE8 5 6 ? parallel      
AE9 1 2 ? anti-parallel 
AE9 2 3 ? anti-parallel 
AF1 1 2 ? anti-parallel 
AF1 2 3 ? anti-parallel 
AF1 3 4 ? anti-parallel 
AF1 4 5 ? anti-parallel 
AF1 5 6 ? anti-parallel 
AF2 1 2 ? anti-parallel 
AF2 2 3 ? anti-parallel 
AF2 3 4 ? anti-parallel 
AF3 1 2 ? anti-parallel 
AF3 2 3 ? anti-parallel 
AF3 3 4 ? anti-parallel 
AF4 1 2 ? anti-parallel 
AF5 1 2 ? anti-parallel 
AF5 2 3 ? parallel      
AF6 1 2 ? parallel      
AF6 2 3 ? parallel      
AF6 3 4 ? parallel      
AF7 1 2 ? anti-parallel 
AF7 2 3 ? parallel      
AF7 3 4 ? parallel      
AF7 4 5 ? parallel      
AF7 5 6 ? parallel      
AF7 6 7 ? parallel      
AF8 1 2 ? anti-parallel 
AF8 2 3 ? anti-parallel 
AF8 3 4 ? parallel      
AF8 4 5 ? parallel      
AF8 5 6 ? parallel      
AF9 1 2 ? parallel      
AG1 1 2 ? parallel      
AG2 1 2 ? parallel      
AG3 1 2 ? anti-parallel 
AG3 2 3 ? anti-parallel 
AG4 1 2 ? parallel      
AG5 1 2 ? anti-parallel 
AG5 2 3 ? anti-parallel 
AG5 3 4 ? anti-parallel 
AG5 4 5 ? anti-parallel 
AG5 5 6 ? anti-parallel 
AG6 1 2 ? anti-parallel 
AG6 2 3 ? anti-parallel 
AG6 3 4 ? anti-parallel 
AG7 1 2 ? anti-parallel 
AG7 2 3 ? anti-parallel 
AG7 3 4 ? anti-parallel 
AG8 1 2 ? anti-parallel 
AG9 1 2 ? anti-parallel 
AH1 1 2 ? parallel      
AH1 2 3 ? parallel      
AH1 3 4 ? parallel      
AH2 1 2 ? anti-parallel 
AH2 2 3 ? parallel      
AH2 3 4 ? parallel      
AH2 4 5 ? parallel      
AH2 5 6 ? parallel      
AH2 6 7 ? parallel      
AH3 1 2 ? anti-parallel 
AH3 2 3 ? anti-parallel 
AH3 3 4 ? parallel      
AH3 4 5 ? parallel      
AH3 5 6 ? parallel      
AH4 1 2 ? parallel      
AH5 1 2 ? parallel      
AH6 1 2 ? parallel      
AH7 1 2 ? anti-parallel 
AH7 2 3 ? anti-parallel 
AH8 1 2 ? parallel      
AH9 1 2 ? anti-parallel 
AH9 2 3 ? anti-parallel 
AH9 3 4 ? anti-parallel 
AH9 4 5 ? anti-parallel 
AH9 5 6 ? anti-parallel 
AI1 1 2 ? anti-parallel 
AI1 2 3 ? anti-parallel 
AI1 3 4 ? anti-parallel 
AI2 1 2 ? anti-parallel 
AI2 2 3 ? anti-parallel 
AI2 3 4 ? anti-parallel 
AI3 1 2 ? anti-parallel 
AI4 1 2 ? anti-parallel 
AI4 2 3 ? parallel      
AI5 1 2 ? parallel      
AI5 2 3 ? parallel      
AI5 3 4 ? parallel      
AI6 1 2 ? anti-parallel 
AI6 2 3 ? parallel      
AI6 3 4 ? parallel      
AI6 4 5 ? parallel      
AI6 5 6 ? parallel      
AI6 6 7 ? parallel      
AI7 1 2 ? anti-parallel 
AI7 2 3 ? anti-parallel 
AI7 3 4 ? parallel      
AI7 4 5 ? parallel      
AI7 5 6 ? parallel      
AI8 1 2 ? anti-parallel 
AI8 2 3 ? anti-parallel 
AI9 1 2 ? anti-parallel 
AI9 2 3 ? anti-parallel 
AI9 3 4 ? anti-parallel 
AI9 4 5 ? anti-parallel 
AI9 5 6 ? anti-parallel 
AJ1 1 2 ? anti-parallel 
AJ1 2 3 ? anti-parallel 
AJ1 3 4 ? anti-parallel 
AJ2 1 2 ? anti-parallel 
AJ2 2 3 ? anti-parallel 
AJ2 3 4 ? anti-parallel 
AJ3 1 2 ? anti-parallel 
AJ4 1 2 ? anti-parallel 
AJ4 2 3 ? parallel      
AJ5 1 2 ? parallel      
AJ5 2 3 ? parallel      
AJ5 3 4 ? parallel      
AJ6 1 2 ? anti-parallel 
AJ6 2 3 ? parallel      
AJ6 3 4 ? parallel      
AJ6 4 5 ? parallel      
AJ6 5 6 ? parallel      
AJ6 6 7 ? parallel      
AJ7 1 2 ? anti-parallel 
AJ7 2 3 ? anti-parallel 
AJ7 3 4 ? parallel      
AJ7 4 5 ? parallel      
AJ7 5 6 ? parallel      
AJ8 1 2 ? anti-parallel 
AJ8 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ALA A 3    ? ILE A 6    ? ALA A 3    ILE A 6    
AA1 2 ALA A 218  ? ASP A 222  ? ALA A 218  ASP A 222  
AA1 3 PHE A 197  ? THR A 208  ? PHE A 197  THR A 208  
AA1 4 GLU A 118  ? THR A 126  ? GLU A 118  THR A 126  
AA1 5 GLY A 129  ? HIS A 135  ? GLY A 129  HIS A 135  
AA1 6 GLN A 150  ? GLY A 155  ? GLN A 150  GLY A 155  
AA2 1 ALA A 3    ? ILE A 6    ? ALA A 3    ILE A 6    
AA2 2 ALA A 218  ? ASP A 222  ? ALA A 218  ASP A 222  
AA2 3 PHE A 197  ? THR A 208  ? PHE A 197  THR A 208  
AA2 4 GLY A 211  ? VAL A 214  ? GLY A 211  VAL A 214  
AA3 1 ALA A 32   ? VAL A 34   ? ALA A 32   VAL A 34   
AA3 2 PHE A 105  ? PRO A 109  ? PHE A 105  PRO A 109  
AA3 3 LEU A 55   ? PRO A 59   ? LEU A 55   PRO A 59   
AA3 4 GLY A 73   ? LEU A 76   ? GLY A 73   LEU A 76   
AA4 1 GLU A 92   ? VAL A 95   ? GLU A 92   VAL A 95   
AA4 2 ALA A 98   ? PHE A 101  ? ALA A 98   PHE A 101  
AA5 1 SER A 263  ? LEU A 268  ? SER A 263  LEU A 268  
AA5 2 ASN A 303  ? SER A 308  ? ASN A 303  SER A 308  
AA6 1 ILE A 275  ? THR A 277  ? ILE A 275  THR A 277  
AA6 2 LYS A 336  ? ILE A 340  ? LYS A 336  ILE A 340  
AA6 3 VAL A 373  ? ARG A 378  ? VAL A 373  ARG A 378  
AA6 4 ILE A 402  ? PHE A 405  ? ILE A 402  PHE A 405  
AA7 1 HIS A 477  ? TRP A 483  ? HIS A 537  TRP A 543  
AA7 2 LYS A 486  ? PHE A 493  ? LYS A 546  PHE A 553  
AA7 3 VAL A 466  ? VAL A 470  ? VAL A 526  VAL A 530  
AA7 4 ALA A 439  ? TRP A 442  ? ALA A 499  TRP A 502  
AA7 5 VAL A 508  ? ASN A 511  ? VAL A 568  ASN A 571  
AA7 6 THR A 533  ? ILE A 536  ? THR A 593  ILE A 596  
AA7 7 THR A 559  ? ILE A 561  ? THR A 619  ILE A 621  
AA8 1 PHE A 574  ? LYS A 575  ? PHE A 634  LYS A 635  
AA8 2 GLY A 568  ? LYS A 570  ? GLY A 628  LYS A 630  
AA8 3 VAL A 621  ? ALA A 626  ? VAL A 681  ALA A 686  
AA8 4 VAL A 597  ? SER A 601  ? VAL A 657  SER A 661  
AA8 5 MET A 652  ? GLU A 658  ? MET A 712  GLU A 718  
AA8 6 ILE A 680  ? ILE A 685  ? ILE A 740  ILE A 745  
AA9 1 MET A 763  ? ASP A 764  ? MET A 823  ASP A 824  
AA9 2 ILE D 774  ? ARG D 775  ? ILE D 834  ARG D 835  
AB1 1 ILE A 774  ? ARG A 775  ? ILE A 834  ARG A 835  
AB1 2 MET D 763  ? ASP D 764  ? MET D 823  ASP D 824  
AB2 1 PHE A 780  ? THR A 782  ? PHE A 840  THR A 842  
AB2 2 ILE C 1031 ? TYR C 1033 ? ILE C 1091 TYR C 1093 
AB3 1 CYS A 785  ? ASP A 786  ? CYS A 845  ASP A 846  
AB3 2 ILE A 793  ? TYR A 794  ? ILE A 853  TYR A 854  
AB3 3 MET A 797  ? PRO A 798  ? MET A 857  PRO A 858  
AB4 1 ILE A 1031 ? TYR A 1033 ? ILE A 1091 TYR A 1093 
AB4 2 PHE C 780  ? THR C 782  ? PHE C 840  THR C 842  
AB5 1 ALA B 3    ? ILE B 6    ? ALA B 3    ILE B 6    
AB5 2 ALA B 218  ? ASP B 222  ? ALA B 218  ASP B 222  
AB5 3 PHE B 197  ? THR B 208  ? PHE B 197  THR B 208  
AB5 4 GLU B 118  ? THR B 126  ? GLU B 118  THR B 126  
AB5 5 GLY B 129  ? HIS B 135  ? GLY B 129  HIS B 135  
AB5 6 GLN B 150  ? VAL B 154  ? GLN B 150  VAL B 154  
AB6 1 ALA B 3    ? ILE B 6    ? ALA B 3    ILE B 6    
AB6 2 ALA B 218  ? ASP B 222  ? ALA B 218  ASP B 222  
AB6 3 PHE B 197  ? THR B 208  ? PHE B 197  THR B 208  
AB6 4 GLY B 211  ? VAL B 214  ? GLY B 211  VAL B 214  
AB7 1 ALA B 32   ? VAL B 34   ? ALA B 32   VAL B 34   
AB7 2 PHE B 105  ? PRO B 109  ? PHE B 105  PRO B 109  
AB7 3 LEU B 55   ? PRO B 59   ? LEU B 55   PRO B 59   
AB7 4 GLY B 73   ? LEU B 76   ? GLY B 73   LEU B 76   
AB8 1 GLU B 92   ? VAL B 95   ? GLU B 92   VAL B 95   
AB8 2 ALA B 98   ? PHE B 101  ? ALA B 98   PHE B 101  
AB9 1 SER B 263  ? LEU B 268  ? SER B 263  LEU B 268  
AB9 2 ASN B 303  ? SER B 308  ? ASN B 303  SER B 308  
AB9 3 VAL B 279  ? ALA B 280  ? VAL B 279  ALA B 280  
AC1 1 ILE B 275  ? THR B 277  ? ILE B 275  THR B 277  
AC1 2 LYS B 336  ? ILE B 340  ? LYS B 336  ILE B 340  
AC1 3 VAL B 373  ? ARG B 378  ? VAL B 373  ARG B 378  
AC1 4 ILE B 402  ? PHE B 405  ? ILE B 402  PHE B 405  
AC2 1 HIS B 477  ? TRP B 483  ? HIS B 537  TRP B 543  
AC2 2 LYS B 486  ? PHE B 493  ? LYS B 546  PHE B 553  
AC2 3 VAL B 466  ? VAL B 470  ? VAL B 526  VAL B 530  
AC2 4 LYS B 438  ? TRP B 442  ? LYS B 498  TRP B 502  
AC2 5 VAL B 506  ? ASN B 511  ? VAL B 566  ASN B 571  
AC2 6 THR B 533  ? ILE B 536  ? THR B 593  ILE B 596  
AC2 7 THR B 559  ? ILE B 561  ? THR B 619  ILE B 621  
AC3 1 PHE B 574  ? LYS B 575  ? PHE B 634  LYS B 635  
AC3 2 GLY B 568  ? LYS B 570  ? GLY B 628  LYS B 630  
AC3 3 VAL B 621  ? ALA B 626  ? VAL B 681  ALA B 686  
AC3 4 VAL B 597  ? SER B 601  ? VAL B 657  SER B 661  
AC3 5 MET B 652  ? GLU B 658  ? MET B 712  GLU B 718  
AC3 6 ILE B 680  ? ILE B 685  ? ILE B 740  ILE B 745  
AC4 1 MET B 763  ? ASP B 764  ? MET B 823  ASP B 824  
AC4 2 ILE C 774  ? ARG C 775  ? ILE C 834  ARG C 835  
AC5 1 ILE B 774  ? ARG B 775  ? ILE B 834  ARG B 835  
AC5 2 MET C 763  ? ASP C 764  ? MET C 823  ASP C 824  
AC6 1 PHE B 780  ? THR B 782  ? PHE B 840  THR B 842  
AC6 2 ILE D 1031 ? TYR D 1033 ? ILE D 1091 TYR D 1093 
AC7 1 CYS B 785  ? ASP B 786  ? CYS B 845  ASP B 846  
AC7 2 ILE B 793  ? TYR B 794  ? ILE B 853  TYR B 854  
AC7 3 MET B 797  ? PRO B 798  ? MET B 857  PRO B 858  
AC8 1 ILE B 1031 ? TYR B 1033 ? ILE B 1091 TYR B 1093 
AC8 2 PHE D 780  ? THR D 782  ? PHE D 840  THR D 842  
AC9 1 ALA C 3    ? ILE C 6    ? ALA C 3    ILE C 6    
AC9 2 ALA C 218  ? ASP C 222  ? ALA C 218  ASP C 222  
AC9 3 PHE C 197  ? THR C 208  ? PHE C 197  THR C 208  
AC9 4 GLU C 118  ? THR C 126  ? GLU C 118  THR C 126  
AC9 5 GLY C 129  ? HIS C 135  ? GLY C 129  HIS C 135  
AC9 6 GLN C 150  ? VAL C 154  ? GLN C 150  VAL C 154  
AD1 1 ALA C 3    ? ILE C 6    ? ALA C 3    ILE C 6    
AD1 2 ALA C 218  ? ASP C 222  ? ALA C 218  ASP C 222  
AD1 3 PHE C 197  ? THR C 208  ? PHE C 197  THR C 208  
AD1 4 GLY C 211  ? VAL C 214  ? GLY C 211  VAL C 214  
AD2 1 ALA C 32   ? VAL C 34   ? ALA C 32   VAL C 34   
AD2 2 PHE C 105  ? PRO C 109  ? PHE C 105  PRO C 109  
AD2 3 LEU C 55   ? PRO C 59   ? LEU C 55   PRO C 59   
AD2 4 GLY C 73   ? LEU C 76   ? GLY C 73   LEU C 76   
AD3 1 GLU C 92   ? VAL C 95   ? GLU C 92   VAL C 95   
AD3 2 ALA C 98   ? PHE C 101  ? ALA C 98   PHE C 101  
AD4 1 SER C 263  ? LEU C 268  ? SER C 263  LEU C 268  
AD4 2 ASN C 303  ? SER C 308  ? ASN C 303  SER C 308  
AD4 3 VAL C 279  ? ALA C 280  ? VAL C 279  ALA C 280  
AD5 1 ILE C 275  ? THR C 277  ? ILE C 275  THR C 277  
AD5 2 LYS C 336  ? ILE C 340  ? LYS C 336  ILE C 340  
AD5 3 VAL C 373  ? ARG C 378  ? VAL C 373  ARG C 378  
AD5 4 ILE C 402  ? PHE C 405  ? ILE C 402  PHE C 405  
AD6 1 HIS C 477  ? TRP C 483  ? HIS C 537  TRP C 543  
AD6 2 LYS C 486  ? PHE C 493  ? LYS C 546  PHE C 553  
AD6 3 VAL C 466  ? VAL C 470  ? VAL C 526  VAL C 530  
AD6 4 LYS C 438  ? TRP C 442  ? LYS C 498  TRP C 502  
AD6 5 VAL C 506  ? ASN C 511  ? VAL C 566  ASN C 571  
AD6 6 THR C 533  ? ILE C 536  ? THR C 593  ILE C 596  
AD6 7 THR C 559  ? ILE C 561  ? THR C 619  ILE C 621  
AD7 1 PHE C 574  ? LYS C 575  ? PHE C 634  LYS C 635  
AD7 2 GLY C 568  ? LYS C 570  ? GLY C 628  LYS C 630  
AD7 3 VAL C 621  ? ALA C 626  ? VAL C 681  ALA C 686  
AD7 4 VAL C 597  ? SER C 601  ? VAL C 657  SER C 661  
AD7 5 MET C 652  ? GLU C 658  ? MET C 712  GLU C 718  
AD7 6 ILE C 680  ? ILE C 685  ? ILE C 740  ILE C 745  
AD8 1 CYS C 785  ? ASP C 786  ? CYS C 845  ASP C 846  
AD8 2 ILE C 793  ? TYR C 794  ? ILE C 853  TYR C 854  
AD8 3 MET C 797  ? PRO C 798  ? MET C 857  PRO C 858  
AD9 1 ALA D 3    ? ILE D 6    ? ALA D 3    ILE D 6    
AD9 2 ALA D 218  ? ASP D 222  ? ALA D 218  ASP D 222  
AD9 3 PHE D 197  ? THR D 208  ? PHE D 197  THR D 208  
AD9 4 GLU D 118  ? THR D 126  ? GLU D 118  THR D 126  
AD9 5 GLY D 129  ? HIS D 135  ? GLY D 129  HIS D 135  
AD9 6 GLN D 150  ? GLY D 155  ? GLN D 150  GLY D 155  
AE1 1 ALA D 3    ? ILE D 6    ? ALA D 3    ILE D 6    
AE1 2 ALA D 218  ? ASP D 222  ? ALA D 218  ASP D 222  
AE1 3 PHE D 197  ? THR D 208  ? PHE D 197  THR D 208  
AE1 4 GLY D 211  ? VAL D 214  ? GLY D 211  VAL D 214  
AE2 1 ALA D 32   ? VAL D 34   ? ALA D 32   VAL D 34   
AE2 2 PHE D 105  ? PRO D 109  ? PHE D 105  PRO D 109  
AE2 3 LEU D 55   ? PRO D 59   ? LEU D 55   PRO D 59   
AE2 4 GLY D 73   ? LEU D 76   ? GLY D 73   LEU D 76   
AE3 1 GLU D 92   ? VAL D 95   ? GLU D 92   VAL D 95   
AE3 2 ALA D 98   ? PHE D 101  ? ALA D 98   PHE D 101  
AE4 1 SER D 263  ? LEU D 264  ? SER D 263  LEU D 264  
AE4 2 GLU D 306  ? SER D 308  ? GLU D 306  SER D 308  
AE4 3 VAL D 279  ? ALA D 280  ? VAL D 279  ALA D 280  
AE5 1 THR D 267  ? LEU D 268  ? THR D 267  LEU D 268  
AE5 2 ASN D 303  ? TYR D 304  ? ASN D 303  TYR D 304  
AE6 1 ILE D 275  ? THR D 277  ? ILE D 275  THR D 277  
AE6 2 LYS D 336  ? ILE D 340  ? LYS D 336  ILE D 340  
AE6 3 VAL D 373  ? ARG D 378  ? VAL D 373  ARG D 378  
AE6 4 ILE D 402  ? PHE D 405  ? ILE D 402  PHE D 405  
AE7 1 HIS D 477  ? TRP D 483  ? HIS D 537  TRP D 543  
AE7 2 LYS D 486  ? PHE D 493  ? LYS D 546  PHE D 553  
AE7 3 VAL D 466  ? VAL D 470  ? VAL D 526  VAL D 530  
AE7 4 LYS D 438  ? TRP D 442  ? LYS D 498  TRP D 502  
AE7 5 VAL D 506  ? ASN D 511  ? VAL D 566  ASN D 571  
AE7 6 THR D 533  ? ILE D 536  ? THR D 593  ILE D 596  
AE7 7 THR D 559  ? ILE D 561  ? THR D 619  ILE D 621  
AE8 1 PHE D 574  ? LYS D 575  ? PHE D 634  LYS D 635  
AE8 2 GLY D 568  ? LYS D 570  ? GLY D 628  LYS D 630  
AE8 3 VAL D 621  ? ALA D 626  ? VAL D 681  ALA D 686  
AE8 4 VAL D 597  ? SER D 601  ? VAL D 657  SER D 661  
AE8 5 MET D 652  ? GLU D 658  ? MET D 712  GLU D 718  
AE8 6 ILE D 680  ? ILE D 685  ? ILE D 740  ILE D 745  
AE9 1 CYS D 785  ? ASP D 786  ? CYS D 845  ASP D 846  
AE9 2 ILE D 793  ? TYR D 794  ? ILE D 853  TYR D 854  
AE9 3 MET D 797  ? PRO D 798  ? MET D 857  PRO D 858  
AF1 1 ALA E 3    ? ILE E 6    ? ALA E 3    ILE E 6    
AF1 2 ALA E 218  ? ASP E 222  ? ALA E 218  ASP E 222  
AF1 3 PHE E 197  ? THR E 208  ? PHE E 197  THR E 208  
AF1 4 GLU E 118  ? THR E 126  ? GLU E 118  THR E 126  
AF1 5 GLY E 129  ? HIS E 135  ? GLY E 129  HIS E 135  
AF1 6 GLN E 150  ? VAL E 154  ? GLN E 150  VAL E 154  
AF2 1 ALA E 3    ? ILE E 6    ? ALA E 3    ILE E 6    
AF2 2 ALA E 218  ? ASP E 222  ? ALA E 218  ASP E 222  
AF2 3 PHE E 197  ? THR E 208  ? PHE E 197  THR E 208  
AF2 4 GLY E 211  ? VAL E 214  ? GLY E 211  VAL E 214  
AF3 1 ALA E 32   ? VAL E 34   ? ALA E 32   VAL E 34   
AF3 2 PHE E 105  ? PRO E 109  ? PHE E 105  PRO E 109  
AF3 3 LEU E 55   ? PRO E 59   ? LEU E 55   PRO E 59   
AF3 4 GLY E 73   ? LEU E 76   ? GLY E 73   LEU E 76   
AF4 1 GLU E 92   ? VAL E 95   ? GLU E 92   VAL E 95   
AF4 2 ALA E 98   ? PHE E 101  ? ALA E 98   PHE E 101  
AF5 1 SER E 263  ? LEU E 268  ? SER E 263  LEU E 268  
AF5 2 ASN E 303  ? SER E 308  ? ASN E 303  SER E 308  
AF5 3 VAL E 279  ? ALA E 280  ? VAL E 279  ALA E 280  
AF6 1 ILE E 275  ? THR E 277  ? ILE E 275  THR E 277  
AF6 2 LYS E 336  ? ILE E 340  ? LYS E 336  ILE E 340  
AF6 3 VAL E 373  ? ARG E 378  ? VAL E 373  ARG E 378  
AF6 4 ILE E 402  ? PHE E 405  ? ILE E 402  PHE E 405  
AF7 1 HIS E 477  ? TRP E 483  ? HIS E 537  TRP E 543  
AF7 2 LYS E 486  ? PHE E 493  ? LYS E 546  PHE E 553  
AF7 3 VAL E 466  ? VAL E 470  ? VAL E 526  VAL E 530  
AF7 4 LYS E 438  ? TRP E 442  ? LYS E 498  TRP E 502  
AF7 5 VAL E 506  ? ASN E 511  ? VAL E 566  ASN E 571  
AF7 6 THR E 533  ? ILE E 536  ? THR E 593  ILE E 596  
AF7 7 THR E 559  ? ILE E 561  ? THR E 619  ILE E 621  
AF8 1 PHE E 574  ? LYS E 575  ? PHE E 634  LYS E 635  
AF8 2 GLY E 568  ? LYS E 570  ? GLY E 628  LYS E 630  
AF8 3 VAL E 621  ? ALA E 626  ? VAL E 681  ALA E 686  
AF8 4 VAL E 597  ? SER E 601  ? VAL E 657  SER E 661  
AF8 5 MET E 652  ? GLU E 658  ? MET E 712  GLU E 718  
AF8 6 ILE E 680  ? ILE E 685  ? ILE E 740  ILE E 745  
AF9 1 MET E 763  ? ASP E 764  ? MET E 823  ASP E 824  
AF9 2 ILE H 774  ? ARG H 775  ? ILE H 834  ARG H 835  
AG1 1 ILE E 774  ? ARG E 775  ? ILE E 834  ARG E 835  
AG1 2 MET H 763  ? ASP H 764  ? MET H 823  ASP H 824  
AG2 1 PHE E 780  ? THR E 782  ? PHE E 840  THR E 842  
AG2 2 ILE G 1031 ? TYR G 1033 ? ILE G 1091 TYR G 1093 
AG3 1 CYS E 785  ? ASP E 786  ? CYS E 845  ASP E 846  
AG3 2 ILE E 793  ? TYR E 794  ? ILE E 853  TYR E 854  
AG3 3 MET E 797  ? PRO E 798  ? MET E 857  PRO E 858  
AG4 1 ILE E 1031 ? TYR E 1033 ? ILE E 1091 TYR E 1093 
AG4 2 PHE G 780  ? THR G 782  ? PHE G 840  THR G 842  
AG5 1 ALA F 3    ? ILE F 6    ? ALA F 3    ILE F 6    
AG5 2 ALA F 218  ? ASP F 222  ? ALA F 218  ASP F 222  
AG5 3 PHE F 197  ? THR F 208  ? PHE F 197  THR F 208  
AG5 4 GLU F 118  ? THR F 126  ? GLU F 118  THR F 126  
AG5 5 GLY F 129  ? HIS F 135  ? GLY F 129  HIS F 135  
AG5 6 GLN F 150  ? VAL F 154  ? GLN F 150  VAL F 154  
AG6 1 ALA F 3    ? ILE F 6    ? ALA F 3    ILE F 6    
AG6 2 ALA F 218  ? ASP F 222  ? ALA F 218  ASP F 222  
AG6 3 PHE F 197  ? THR F 208  ? PHE F 197  THR F 208  
AG6 4 GLY F 211  ? VAL F 214  ? GLY F 211  VAL F 214  
AG7 1 ALA F 32   ? VAL F 34   ? ALA F 32   VAL F 34   
AG7 2 PHE F 105  ? PRO F 109  ? PHE F 105  PRO F 109  
AG7 3 LEU F 55   ? PRO F 59   ? LEU F 55   PRO F 59   
AG7 4 GLY F 73   ? LEU F 76   ? GLY F 73   LEU F 76   
AG8 1 GLU F 92   ? VAL F 95   ? GLU F 92   VAL F 95   
AG8 2 ALA F 98   ? PHE F 101  ? ALA F 98   PHE F 101  
AG9 1 SER F 263  ? LEU F 268  ? SER F 263  LEU F 268  
AG9 2 ASN F 303  ? SER F 308  ? ASN F 303  SER F 308  
AH1 1 ILE F 275  ? THR F 277  ? ILE F 275  THR F 277  
AH1 2 LYS F 336  ? ILE F 340  ? LYS F 336  ILE F 340  
AH1 3 VAL F 373  ? ARG F 378  ? VAL F 373  ARG F 378  
AH1 4 ILE F 402  ? PHE F 405  ? ILE F 402  PHE F 405  
AH2 1 HIS F 477  ? TRP F 483  ? HIS F 537  TRP F 543  
AH2 2 LYS F 486  ? PHE F 493  ? LYS F 546  PHE F 553  
AH2 3 VAL F 466  ? VAL F 470  ? VAL F 526  VAL F 530  
AH2 4 LYS F 438  ? TRP F 442  ? LYS F 498  TRP F 502  
AH2 5 VAL F 506  ? ASN F 511  ? VAL F 566  ASN F 571  
AH2 6 THR F 533  ? ILE F 536  ? THR F 593  ILE F 596  
AH2 7 THR F 559  ? ILE F 561  ? THR F 619  ILE F 621  
AH3 1 PHE F 574  ? LYS F 575  ? PHE F 634  LYS F 635  
AH3 2 GLY F 568  ? LYS F 570  ? GLY F 628  LYS F 630  
AH3 3 VAL F 621  ? ALA F 626  ? VAL F 681  ALA F 686  
AH3 4 VAL F 597  ? SER F 601  ? VAL F 657  SER F 661  
AH3 5 MET F 652  ? GLU F 658  ? MET F 712  GLU F 718  
AH3 6 ILE F 680  ? ILE F 685  ? ILE F 740  ILE F 745  
AH4 1 MET F 763  ? ASP F 764  ? MET F 823  ASP F 824  
AH4 2 ILE G 774  ? ARG G 775  ? ILE G 834  ARG G 835  
AH5 1 ILE F 774  ? ARG F 775  ? ILE F 834  ARG F 835  
AH5 2 MET G 763  ? ASP G 764  ? MET G 823  ASP G 824  
AH6 1 PHE F 780  ? THR F 782  ? PHE F 840  THR F 842  
AH6 2 ILE H 1031 ? TYR H 1033 ? ILE H 1091 TYR H 1093 
AH7 1 CYS F 785  ? ASP F 786  ? CYS F 845  ASP F 846  
AH7 2 ILE F 793  ? TYR F 794  ? ILE F 853  TYR F 854  
AH7 3 MET F 797  ? PRO F 798  ? MET F 857  PRO F 858  
AH8 1 ILE F 1031 ? TYR F 1033 ? ILE F 1091 TYR F 1093 
AH8 2 PHE H 780  ? THR H 782  ? PHE H 840  THR H 842  
AH9 1 ALA G 3    ? ILE G 6    ? ALA G 3    ILE G 6    
AH9 2 ALA G 218  ? ASP G 222  ? ALA G 218  ASP G 222  
AH9 3 PHE G 197  ? THR G 208  ? PHE G 197  THR G 208  
AH9 4 GLU G 118  ? THR G 126  ? GLU G 118  THR G 126  
AH9 5 GLY G 129  ? HIS G 135  ? GLY G 129  HIS G 135  
AH9 6 GLN G 150  ? VAL G 154  ? GLN G 150  VAL G 154  
AI1 1 ALA G 3    ? ILE G 6    ? ALA G 3    ILE G 6    
AI1 2 ALA G 218  ? ASP G 222  ? ALA G 218  ASP G 222  
AI1 3 PHE G 197  ? THR G 208  ? PHE G 197  THR G 208  
AI1 4 GLY G 211  ? VAL G 214  ? GLY G 211  VAL G 214  
AI2 1 ALA G 32   ? VAL G 34   ? ALA G 32   VAL G 34   
AI2 2 PHE G 105  ? PRO G 109  ? PHE G 105  PRO G 109  
AI2 3 LEU G 55   ? PRO G 59   ? LEU G 55   PRO G 59   
AI2 4 GLY G 73   ? LEU G 76   ? GLY G 73   LEU G 76   
AI3 1 GLU G 92   ? VAL G 95   ? GLU G 92   VAL G 95   
AI3 2 ALA G 98   ? PHE G 101  ? ALA G 98   PHE G 101  
AI4 1 SER G 263  ? LEU G 268  ? SER G 263  LEU G 268  
AI4 2 ASN G 303  ? SER G 308  ? ASN G 303  SER G 308  
AI4 3 VAL G 279  ? ALA G 280  ? VAL G 279  ALA G 280  
AI5 1 ILE G 275  ? THR G 277  ? ILE G 275  THR G 277  
AI5 2 LYS G 336  ? ILE G 340  ? LYS G 336  ILE G 340  
AI5 3 VAL G 373  ? ARG G 378  ? VAL G 373  ARG G 378  
AI5 4 ILE G 402  ? PHE G 405  ? ILE G 402  PHE G 405  
AI6 1 HIS G 477  ? TRP G 483  ? HIS G 537  TRP G 543  
AI6 2 LYS G 486  ? PHE G 493  ? LYS G 546  PHE G 553  
AI6 3 VAL G 466  ? VAL G 470  ? VAL G 526  VAL G 530  
AI6 4 LYS G 438  ? TRP G 442  ? LYS G 498  TRP G 502  
AI6 5 VAL G 506  ? ASN G 511  ? VAL G 566  ASN G 571  
AI6 6 THR G 533  ? ILE G 536  ? THR G 593  ILE G 596  
AI6 7 THR G 559  ? ILE G 561  ? THR G 619  ILE G 621  
AI7 1 PHE G 574  ? LYS G 575  ? PHE G 634  LYS G 635  
AI7 2 GLY G 568  ? LYS G 570  ? GLY G 628  LYS G 630  
AI7 3 VAL G 621  ? ALA G 626  ? VAL G 681  ALA G 686  
AI7 4 VAL G 597  ? SER G 601  ? VAL G 657  SER G 661  
AI7 5 MET G 652  ? GLU G 658  ? MET G 712  GLU G 718  
AI7 6 ILE G 680  ? ILE G 685  ? ILE G 740  ILE G 745  
AI8 1 CYS G 785  ? ASP G 786  ? CYS G 845  ASP G 846  
AI8 2 ILE G 793  ? TYR G 794  ? ILE G 853  TYR G 854  
AI8 3 MET G 797  ? PRO G 798  ? MET G 857  PRO G 858  
AI9 1 ALA H 3    ? ILE H 6    ? ALA H 3    ILE H 6    
AI9 2 ALA H 218  ? ASP H 222  ? ALA H 218  ASP H 222  
AI9 3 PHE H 197  ? THR H 208  ? PHE H 197  THR H 208  
AI9 4 GLU H 118  ? THR H 126  ? GLU H 118  THR H 126  
AI9 5 GLY H 129  ? HIS H 135  ? GLY H 129  HIS H 135  
AI9 6 GLN H 150  ? VAL H 154  ? GLN H 150  VAL H 154  
AJ1 1 ALA H 3    ? ILE H 6    ? ALA H 3    ILE H 6    
AJ1 2 ALA H 218  ? ASP H 222  ? ALA H 218  ASP H 222  
AJ1 3 PHE H 197  ? THR H 208  ? PHE H 197  THR H 208  
AJ1 4 GLY H 211  ? VAL H 214  ? GLY H 211  VAL H 214  
AJ2 1 ALA H 32   ? VAL H 34   ? ALA H 32   VAL H 34   
AJ2 2 PHE H 105  ? PRO H 109  ? PHE H 105  PRO H 109  
AJ2 3 LEU H 55   ? PRO H 59   ? LEU H 55   PRO H 59   
AJ2 4 GLY H 73   ? LEU H 76   ? GLY H 73   LEU H 76   
AJ3 1 GLU H 92   ? VAL H 95   ? GLU H 92   VAL H 95   
AJ3 2 ALA H 98   ? PHE H 101  ? ALA H 98   PHE H 101  
AJ4 1 SER H 263  ? LEU H 268  ? SER H 263  LEU H 268  
AJ4 2 ASN H 303  ? SER H 308  ? ASN H 303  SER H 308  
AJ4 3 VAL H 279  ? ALA H 280  ? VAL H 279  ALA H 280  
AJ5 1 ILE H 275  ? THR H 277  ? ILE H 275  THR H 277  
AJ5 2 LYS H 336  ? ILE H 340  ? LYS H 336  ILE H 340  
AJ5 3 VAL H 373  ? ARG H 378  ? VAL H 373  ARG H 378  
AJ5 4 ILE H 402  ? PHE H 405  ? ILE H 402  PHE H 405  
AJ6 1 HIS H 477  ? TRP H 483  ? HIS H 537  TRP H 543  
AJ6 2 LYS H 486  ? PHE H 493  ? LYS H 546  PHE H 553  
AJ6 3 VAL H 466  ? VAL H 470  ? VAL H 526  VAL H 530  
AJ6 4 LYS H 438  ? TRP H 442  ? LYS H 498  TRP H 502  
AJ6 5 VAL H 506  ? ASN H 511  ? VAL H 566  ASN H 571  
AJ6 6 THR H 533  ? ILE H 536  ? THR H 593  ILE H 596  
AJ6 7 THR H 559  ? ILE H 561  ? THR H 619  ILE H 621  
AJ7 1 PHE H 574  ? LYS H 575  ? PHE H 634  LYS H 635  
AJ7 2 GLY H 568  ? LYS H 570  ? GLY H 628  LYS H 630  
AJ7 3 VAL H 621  ? ALA H 626  ? VAL H 681  ALA H 686  
AJ7 4 VAL H 597  ? SER H 601  ? VAL H 657  SER H 661  
AJ7 5 MET H 652  ? GLU H 658  ? MET H 712  GLU H 718  
AJ7 6 ILE H 680  ? ILE H 685  ? ILE H 740  ILE H 745  
AJ8 1 CYS H 785  ? ASP H 786  ? CYS H 845  ASP H 846  
AJ8 2 ILE H 793  ? TYR H 794  ? ILE H 853  TYR H 854  
AJ8 3 MET H 797  ? PRO H 798  ? MET H 857  PRO H 858  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N LYS A 4    ? N LYS A 4    O VAL A 221  ? O VAL A 221  
AA1 2 3 O ALA A 218  ? O ALA A 218  N GLU A 201  ? N GLU A 201  
AA1 3 4 O ILE A 202  ? O ILE A 202  N VAL A 121  ? N VAL A 121  
AA1 4 5 N CYS A 122  ? N CYS A 122  O LEU A 133  ? O LEU A 133  
AA1 5 6 N ASP A 130  ? N ASP A 130  O VAL A 154  ? O VAL A 154  
AA2 1 2 N LYS A 4    ? N LYS A 4    O VAL A 221  ? O VAL A 221  
AA2 2 3 O ALA A 218  ? O ALA A 218  N GLU A 201  ? N GLU A 201  
AA2 3 4 N VAL A 206  ? N VAL A 206  O TYR A 213  ? O TYR A 213  
AA3 1 2 N VAL A 34   ? N VAL A 34   O PHE A 105  ? O PHE A 105  
AA3 2 3 O LEU A 106  ? O LEU A 106  N LYS A 58   ? N LYS A 58   
AA3 3 4 N LEU A 55   ? N LEU A 55   O LEU A 76   ? O LEU A 76   
AA4 1 2 N ALA A 93   ? N ALA A 93   O GLY A 100  ? O GLY A 100  
AA5 1 2 N LYS A 265  ? N LYS A 265  O GLU A 306  ? O GLU A 306  
AA6 1 2 N TRP A 276  ? N TRP A 276  O ILE A 337  ? O ILE A 337  
AA6 2 3 N ILE A 340  ? N ILE A 340  O PHE A 376  ? O PHE A 376  
AA6 3 4 N VAL A 377  ? N VAL A 377  O HIS A 403  ? O HIS A 403  
AA7 1 2 N HIS A 477  ? N HIS A 537  O VAL A 492  ? O VAL A 552  
AA7 2 3 O PHE A 493  ? O PHE A 553  N MET A 469  ? N MET A 529  
AA7 3 4 O ALA A 467  ? O ALA A 527  N ALA A 439  ? N ALA A 499  
AA7 4 5 N TRP A 442  ? N TRP A 502  O ILE A 510  ? O ILE A 570  
AA7 5 6 N ASN A 511  ? N ASN A 571  O ALA A 535  ? O ALA A 595  
AA7 6 7 N ILE A 536  ? N ILE A 596  O ILE A 561  ? O ILE A 621  
AA8 1 2 O PHE A 574  ? O PHE A 634  N LYS A 570  ? N LYS A 630  
AA8 2 3 N ILE A 569  ? N ILE A 629  O GLY A 624  ? O GLY A 684  
AA8 3 4 O TYR A 622  ? O TYR A 682  N VAL A 597  ? N VAL A 657  
AA8 4 5 N ALA A 598  ? N ALA A 658  O VAL A 654  ? O VAL A 714  
AA8 5 6 N ILE A 653  ? N ILE A 713  O VAL A 681  ? O VAL A 741  
AA9 1 2 N MET A 763  ? N MET A 823  O ARG D 775  ? O ARG D 835  
AB1 1 2 N ARG A 775  ? N ARG A 835  O MET D 763  ? O MET D 823  
AB2 1 2 N THR A 782  ? N THR A 842  O SER C 1032 ? O SER C 1092 
AB3 1 2 N ASP A 786  ? N ASP A 846  O ILE A 793  ? O ILE A 853  
AB3 2 3 N TYR A 794  ? N TYR A 854  O MET A 797  ? O MET A 857  
AB4 1 2 N SER A 1032 ? N SER A 1092 O PHE C 780  ? O PHE C 840  
AB5 1 2 N LYS B 4    ? N LYS B 4    O VAL B 221  ? O VAL B 221  
AB5 2 3 O LYS B 220  ? O LYS B 220  N THR B 198  ? N THR B 198  
AB5 3 4 O LEU B 200  ? O LEU B 200  N ILE B 123  ? N ILE B 123  
AB5 4 5 N CYS B 122  ? N CYS B 122  O LEU B 133  ? O LEU B 133  
AB5 5 6 N ASP B 130  ? N ASP B 130  O VAL B 154  ? O VAL B 154  
AB6 1 2 N LYS B 4    ? N LYS B 4    O VAL B 221  ? O VAL B 221  
AB6 2 3 O LYS B 220  ? O LYS B 220  N THR B 198  ? N THR B 198  
AB6 3 4 N VAL B 206  ? N VAL B 206  O TYR B 213  ? O TYR B 213  
AB7 1 2 N VAL B 34   ? N VAL B 34   O PHE B 105  ? O PHE B 105  
AB7 2 3 O LEU B 106  ? O LEU B 106  N LYS B 58   ? N LYS B 58   
AB7 3 4 N LEU B 55   ? N LEU B 55   O LEU B 76   ? O LEU B 76   
AB8 1 2 N ALA B 93   ? N ALA B 93   O GLY B 100  ? O GLY B 100  
AB9 1 2 N THR B 267  ? N THR B 267  O TYR B 304  ? O TYR B 304  
AB9 2 3 O GLY B 305  ? O GLY B 305  N VAL B 279  ? N VAL B 279  
AC1 1 2 N TRP B 276  ? N TRP B 276  O ILE B 339  ? O ILE B 339  
AC1 2 3 N ILE B 340  ? N ILE B 340  O PHE B 376  ? O PHE B 376  
AC1 3 4 N VAL B 377  ? N VAL B 377  O HIS B 403  ? O HIS B 403  
AC2 1 2 N HIS B 477  ? N HIS B 537  O VAL B 492  ? O VAL B 552  
AC2 2 3 O PRO B 491  ? O PRO B 551  N MET B 469  ? N MET B 529  
AC2 3 4 O ALA B 467  ? O ALA B 527  N ALA B 439  ? N ALA B 499  
AC2 4 5 N TRP B 442  ? N TRP B 502  O ILE B 510  ? O ILE B 570  
AC2 5 6 N ASN B 511  ? N ASN B 571  O ALA B 535  ? O ALA B 595  
AC2 6 7 N ILE B 534  ? N ILE B 594  O THR B 559  ? O THR B 619  
AC3 1 2 O PHE B 574  ? O PHE B 634  N LYS B 570  ? N LYS B 630  
AC3 2 3 N ILE B 569  ? N ILE B 629  O GLY B 624  ? O GLY B 684  
AC3 3 4 O TYR B 622  ? O TYR B 682  N VAL B 597  ? N VAL B 657  
AC3 4 5 N ALA B 598  ? N ALA B 658  O VAL B 654  ? O VAL B 714  
AC3 5 6 N ILE B 653  ? N ILE B 713  O VAL B 681  ? O VAL B 741  
AC4 1 2 N MET B 763  ? N MET B 823  O ARG C 775  ? O ARG C 835  
AC5 1 2 N ARG B 775  ? N ARG B 835  O MET C 763  ? O MET C 823  
AC6 1 2 N THR B 782  ? N THR B 842  O SER D 1032 ? O SER D 1092 
AC7 1 2 N ASP B 786  ? N ASP B 846  O ILE B 793  ? O ILE B 853  
AC7 2 3 N TYR B 794  ? N TYR B 854  O MET B 797  ? O MET B 857  
AC8 1 2 N SER B 1032 ? N SER B 1092 O THR D 782  ? O THR D 842  
AC9 1 2 N LYS C 4    ? N LYS C 4    O VAL C 221  ? O VAL C 221  
AC9 2 3 O LYS C 220  ? O LYS C 220  N THR C 198  ? N THR C 198  
AC9 3 4 O THR C 198  ? O THR C 198  N ALA C 125  ? N ALA C 125  
AC9 4 5 N CYS C 122  ? N CYS C 122  O LEU C 133  ? O LEU C 133  
AC9 5 6 N ASP C 130  ? N ASP C 130  O VAL C 154  ? O VAL C 154  
AD1 1 2 N LYS C 4    ? N LYS C 4    O VAL C 221  ? O VAL C 221  
AD1 2 3 O LYS C 220  ? O LYS C 220  N THR C 198  ? N THR C 198  
AD1 3 4 N VAL C 206  ? N VAL C 206  O TYR C 213  ? O TYR C 213  
AD2 1 2 N VAL C 34   ? N VAL C 34   O PHE C 105  ? O PHE C 105  
AD2 2 3 O LEU C 106  ? O LEU C 106  N LYS C 58   ? N LYS C 58   
AD2 3 4 N VAL C 57   ? N VAL C 57   O GLY C 73   ? O GLY C 73   
AD3 1 2 N ALA C 93   ? N ALA C 93   O GLY C 100  ? O GLY C 100  
AD4 1 2 N THR C 267  ? N THR C 267  O TYR C 304  ? O TYR C 304  
AD4 2 3 O TYR C 307  ? O TYR C 307  N VAL C 279  ? N VAL C 279  
AD5 1 2 N TRP C 276  ? N TRP C 276  O ILE C 339  ? O ILE C 339  
AD5 2 3 N LEU C 338  ? N LEU C 338  O PHE C 376  ? O PHE C 376  
AD5 3 4 N VAL C 377  ? N VAL C 377  O HIS C 403  ? O HIS C 403  
AD6 1 2 N HIS C 477  ? N HIS C 537  O VAL C 492  ? O VAL C 552  
AD6 2 3 O PRO C 491  ? O PRO C 551  N MET C 469  ? N MET C 529  
AD6 3 4 O ALA C 467  ? O ALA C 527  N ALA C 439  ? N ALA C 499  
AD6 4 5 N TRP C 442  ? N TRP C 502  O ILE C 510  ? O ILE C 570  
AD6 5 6 N ASN C 511  ? N ASN C 571  O ALA C 535  ? O ALA C 595  
AD6 6 7 N ILE C 534  ? N ILE C 594  O THR C 559  ? O THR C 619  
AD7 1 2 O PHE C 574  ? O PHE C 634  N LYS C 570  ? N LYS C 630  
AD7 2 3 N ILE C 569  ? N ILE C 629  O GLY C 624  ? O GLY C 684  
AD7 3 4 O TYR C 622  ? O TYR C 682  N VAL C 597  ? N VAL C 657  
AD7 4 5 N ALA C 598  ? N ALA C 658  O VAL C 654  ? O VAL C 714  
AD7 5 6 N ILE C 653  ? N ILE C 713  O VAL C 681  ? O VAL C 741  
AD8 1 2 N ASP C 786  ? N ASP C 846  O ILE C 793  ? O ILE C 853  
AD8 2 3 N TYR C 794  ? N TYR C 854  O MET C 797  ? O MET C 857  
AD9 1 2 N LYS D 4    ? N LYS D 4    O VAL D 221  ? O VAL D 221  
AD9 2 3 O LYS D 220  ? O LYS D 220  N THR D 198  ? N THR D 198  
AD9 3 4 O THR D 198  ? O THR D 198  N ALA D 125  ? N ALA D 125  
AD9 4 5 N CYS D 122  ? N CYS D 122  O LEU D 133  ? O LEU D 133  
AD9 5 6 N ASP D 130  ? N ASP D 130  O VAL D 154  ? O VAL D 154  
AE1 1 2 N LYS D 4    ? N LYS D 4    O VAL D 221  ? O VAL D 221  
AE1 2 3 O LYS D 220  ? O LYS D 220  N THR D 198  ? N THR D 198  
AE1 3 4 N VAL D 206  ? N VAL D 206  O TYR D 213  ? O TYR D 213  
AE2 1 2 N VAL D 34   ? N VAL D 34   O PHE D 105  ? O PHE D 105  
AE2 2 3 O LEU D 106  ? O LEU D 106  N LYS D 58   ? N LYS D 58   
AE2 3 4 N VAL D 57   ? N VAL D 57   O GLY D 73   ? O GLY D 73   
AE3 1 2 N ALA D 93   ? N ALA D 93   O GLY D 100  ? O GLY D 100  
AE4 1 2 N SER D 263  ? N SER D 263  O SER D 308  ? O SER D 308  
AE4 2 3 N TYR D 307  ? N TYR D 307  O VAL D 279  ? O VAL D 279  
AE5 1 2 N THR D 267  ? N THR D 267  O TYR D 304  ? O TYR D 304  
AE6 1 2 N TRP D 276  ? N TRP D 276  O ILE D 339  ? O ILE D 339  
AE6 2 3 N ILE D 340  ? N ILE D 340  O PHE D 376  ? O PHE D 376  
AE6 3 4 N VAL D 377  ? N VAL D 377  O HIS D 403  ? O HIS D 403  
AE7 1 2 N HIS D 477  ? N HIS D 537  O VAL D 492  ? O VAL D 552  
AE7 2 3 O PRO D 491  ? O PRO D 551  N MET D 469  ? N MET D 529  
AE7 3 4 O ALA D 467  ? O ALA D 527  N ALA D 439  ? N ALA D 499  
AE7 4 5 N TRP D 442  ? N TRP D 502  O ILE D 510  ? O ILE D 570  
AE7 5 6 N ASN D 511  ? N ASN D 571  O ALA D 535  ? O ALA D 595  
AE7 6 7 N ILE D 534  ? N ILE D 594  O THR D 559  ? O THR D 619  
AE8 1 2 O PHE D 574  ? O PHE D 634  N LYS D 570  ? N LYS D 630  
AE8 2 3 N ILE D 569  ? N ILE D 629  O GLY D 624  ? O GLY D 684  
AE8 3 4 O TYR D 622  ? O TYR D 682  N VAL D 597  ? N VAL D 657  
AE8 4 5 N ALA D 598  ? N ALA D 658  O VAL D 654  ? O VAL D 714  
AE8 5 6 N ILE D 653  ? N ILE D 713  O VAL D 681  ? O VAL D 741  
AE9 1 2 N ASP D 786  ? N ASP D 846  O ILE D 793  ? O ILE D 853  
AE9 2 3 N TYR D 794  ? N TYR D 854  O MET D 797  ? O MET D 857  
AF1 1 2 N LYS E 4    ? N LYS E 4    O VAL E 221  ? O VAL E 221  
AF1 2 3 O LYS E 220  ? O LYS E 220  N THR E 198  ? N THR E 198  
AF1 3 4 O THR E 198  ? O THR E 198  N ALA E 125  ? N ALA E 125  
AF1 4 5 N CYS E 122  ? N CYS E 122  O LEU E 133  ? O LEU E 133  
AF1 5 6 N ASP E 130  ? N ASP E 130  O VAL E 154  ? O VAL E 154  
AF2 1 2 N LYS E 4    ? N LYS E 4    O VAL E 221  ? O VAL E 221  
AF2 2 3 O LYS E 220  ? O LYS E 220  N THR E 198  ? N THR E 198  
AF2 3 4 N VAL E 206  ? N VAL E 206  O TYR E 213  ? O TYR E 213  
AF3 1 2 N VAL E 34   ? N VAL E 34   O PHE E 105  ? O PHE E 105  
AF3 2 3 O LEU E 106  ? O LEU E 106  N LYS E 58   ? N LYS E 58   
AF3 3 4 N LEU E 55   ? N LEU E 55   O LEU E 76   ? O LEU E 76   
AF4 1 2 N ALA E 93   ? N ALA E 93   O GLY E 100  ? O GLY E 100  
AF5 1 2 N THR E 267  ? N THR E 267  O TYR E 304  ? O TYR E 304  
AF5 2 3 O GLY E 305  ? O GLY E 305  N VAL E 279  ? N VAL E 279  
AF6 1 2 N TRP E 276  ? N TRP E 276  O ILE E 339  ? O ILE E 339  
AF6 2 3 N LEU E 338  ? N LEU E 338  O PHE E 376  ? O PHE E 376  
AF6 3 4 N VAL E 377  ? N VAL E 377  O HIS E 403  ? O HIS E 403  
AF7 1 2 N HIS E 477  ? N HIS E 537  O VAL E 492  ? O VAL E 552  
AF7 2 3 O PRO E 491  ? O PRO E 551  N MET E 469  ? N MET E 529  
AF7 3 4 O ALA E 467  ? O ALA E 527  N ALA E 439  ? N ALA E 499  
AF7 4 5 N TRP E 442  ? N TRP E 502  O ILE E 510  ? O ILE E 570  
AF7 5 6 N ASN E 511  ? N ASN E 571  O ALA E 535  ? O ALA E 595  
AF7 6 7 N ILE E 534  ? N ILE E 594  O THR E 559  ? O THR E 619  
AF8 1 2 O PHE E 574  ? O PHE E 634  N LYS E 570  ? N LYS E 630  
AF8 2 3 N ILE E 569  ? N ILE E 629  O GLY E 624  ? O GLY E 684  
AF8 3 4 O TYR E 622  ? O TYR E 682  N VAL E 597  ? N VAL E 657  
AF8 4 5 N ALA E 598  ? N ALA E 658  O VAL E 654  ? O VAL E 714  
AF8 5 6 N ILE E 653  ? N ILE E 713  O VAL E 681  ? O VAL E 741  
AF9 1 2 N MET E 763  ? N MET E 823  O ARG H 775  ? O ARG H 835  
AG1 1 2 N ARG E 775  ? N ARG E 835  O MET H 763  ? O MET H 823  
AG2 1 2 N THR E 782  ? N THR E 842  O SER G 1032 ? O SER G 1092 
AG3 1 2 N ASP E 786  ? N ASP E 846  O ILE E 793  ? O ILE E 853  
AG3 2 3 N TYR E 794  ? N TYR E 854  O MET E 797  ? O MET E 857  
AG4 1 2 N SER E 1032 ? N SER E 1092 O THR G 782  ? O THR G 842  
AG5 1 2 N LYS F 4    ? N LYS F 4    O VAL F 221  ? O VAL F 221  
AG5 2 3 O LYS F 220  ? O LYS F 220  N THR F 198  ? N THR F 198  
AG5 3 4 O THR F 198  ? O THR F 198  N ALA F 125  ? N ALA F 125  
AG5 4 5 N CYS F 122  ? N CYS F 122  O LEU F 133  ? O LEU F 133  
AG5 5 6 N ASP F 130  ? N ASP F 130  O VAL F 154  ? O VAL F 154  
AG6 1 2 N LYS F 4    ? N LYS F 4    O VAL F 221  ? O VAL F 221  
AG6 2 3 O LYS F 220  ? O LYS F 220  N THR F 198  ? N THR F 198  
AG6 3 4 N VAL F 206  ? N VAL F 206  O TYR F 213  ? O TYR F 213  
AG7 1 2 N VAL F 34   ? N VAL F 34   O PHE F 105  ? O PHE F 105  
AG7 2 3 O LEU F 106  ? O LEU F 106  N LYS F 58   ? N LYS F 58   
AG7 3 4 N LEU F 55   ? N LEU F 55   O LEU F 76   ? O LEU F 76   
AG8 1 2 N ALA F 93   ? N ALA F 93   O GLY F 100  ? O GLY F 100  
AG9 1 2 N THR F 267  ? N THR F 267  O TYR F 304  ? O TYR F 304  
AH1 1 2 N TRP F 276  ? N TRP F 276  O ILE F 339  ? O ILE F 339  
AH1 2 3 N LEU F 338  ? N LEU F 338  O PHE F 376  ? O PHE F 376  
AH1 3 4 N VAL F 377  ? N VAL F 377  O HIS F 403  ? O HIS F 403  
AH2 1 2 N HIS F 477  ? N HIS F 537  O VAL F 492  ? O VAL F 552  
AH2 2 3 O PRO F 491  ? O PRO F 551  N MET F 469  ? N MET F 529  
AH2 3 4 O ALA F 467  ? O ALA F 527  N ALA F 439  ? N ALA F 499  
AH2 4 5 N TRP F 442  ? N TRP F 502  O ILE F 510  ? O ILE F 570  
AH2 5 6 N ASN F 511  ? N ASN F 571  O ALA F 535  ? O ALA F 595  
AH2 6 7 N ILE F 534  ? N ILE F 594  O THR F 559  ? O THR F 619  
AH3 1 2 O PHE F 574  ? O PHE F 634  N LYS F 570  ? N LYS F 630  
AH3 2 3 N ILE F 569  ? N ILE F 629  O GLY F 624  ? O GLY F 684  
AH3 3 4 O TYR F 622  ? O TYR F 682  N VAL F 597  ? N VAL F 657  
AH3 4 5 N ALA F 598  ? N ALA F 658  O VAL F 654  ? O VAL F 714  
AH3 5 6 N ILE F 653  ? N ILE F 713  O VAL F 681  ? O VAL F 741  
AH4 1 2 N MET F 763  ? N MET F 823  O ARG G 775  ? O ARG G 835  
AH5 1 2 N ARG F 775  ? N ARG F 835  O MET G 763  ? O MET G 823  
AH6 1 2 N THR F 782  ? N THR F 842  O SER H 1032 ? O SER H 1092 
AH7 1 2 N ASP F 786  ? N ASP F 846  O ILE F 793  ? O ILE F 853  
AH7 2 3 N TYR F 794  ? N TYR F 854  O MET F 797  ? O MET F 857  
AH8 1 2 N SER F 1032 ? N SER F 1092 O THR H 782  ? O THR H 842  
AH9 1 2 N LYS G 4    ? N LYS G 4    O VAL G 221  ? O VAL G 221  
AH9 2 3 O LYS G 220  ? O LYS G 220  N THR G 198  ? N THR G 198  
AH9 3 4 O THR G 198  ? O THR G 198  N ALA G 125  ? N ALA G 125  
AH9 4 5 N CYS G 122  ? N CYS G 122  O LEU G 133  ? O LEU G 133  
AH9 5 6 N ASP G 130  ? N ASP G 130  O VAL G 154  ? O VAL G 154  
AI1 1 2 N LYS G 4    ? N LYS G 4    O VAL G 221  ? O VAL G 221  
AI1 2 3 O LYS G 220  ? O LYS G 220  N THR G 198  ? N THR G 198  
AI1 3 4 N VAL G 206  ? N VAL G 206  O TYR G 213  ? O TYR G 213  
AI2 1 2 N ALA G 32   ? N ALA G 32   O ILE G 107  ? O ILE G 107  
AI2 2 3 O LEU G 106  ? O LEU G 106  N LYS G 58   ? N LYS G 58   
AI2 3 4 N LEU G 55   ? N LEU G 55   O LEU G 76   ? O LEU G 76   
AI3 1 2 N ALA G 93   ? N ALA G 93   O GLY G 100  ? O GLY G 100  
AI4 1 2 N THR G 267  ? N THR G 267  O TYR G 304  ? O TYR G 304  
AI4 2 3 O GLY G 305  ? O GLY G 305  N VAL G 279  ? N VAL G 279  
AI5 1 2 N TRP G 276  ? N TRP G 276  O ILE G 339  ? O ILE G 339  
AI5 2 3 N LEU G 338  ? N LEU G 338  O PHE G 376  ? O PHE G 376  
AI5 3 4 N VAL G 377  ? N VAL G 377  O HIS G 403  ? O HIS G 403  
AI6 1 2 N HIS G 477  ? N HIS G 537  O VAL G 492  ? O VAL G 552  
AI6 2 3 O PRO G 491  ? O PRO G 551  N MET G 469  ? N MET G 529  
AI6 3 4 O ALA G 467  ? O ALA G 527  N ALA G 439  ? N ALA G 499  
AI6 4 5 N TRP G 442  ? N TRP G 502  O ILE G 510  ? O ILE G 570  
AI6 5 6 N ASN G 511  ? N ASN G 571  O ALA G 535  ? O ALA G 595  
AI6 6 7 N ILE G 534  ? N ILE G 594  O THR G 559  ? O THR G 619  
AI7 1 2 O PHE G 574  ? O PHE G 634  N LYS G 570  ? N LYS G 630  
AI7 2 3 N ILE G 569  ? N ILE G 629  O GLY G 624  ? O GLY G 684  
AI7 3 4 O TYR G 622  ? O TYR G 682  N VAL G 597  ? N VAL G 657  
AI7 4 5 N ALA G 598  ? N ALA G 658  O VAL G 654  ? O VAL G 714  
AI7 5 6 N ILE G 653  ? N ILE G 713  O VAL G 681  ? O VAL G 741  
AI8 1 2 N ASP G 786  ? N ASP G 846  O ILE G 793  ? O ILE G 853  
AI8 2 3 N TYR G 794  ? N TYR G 854  O MET G 797  ? O MET G 857  
AI9 1 2 N LYS H 4    ? N LYS H 4    O VAL H 221  ? O VAL H 221  
AI9 2 3 O LYS H 220  ? O LYS H 220  N THR H 198  ? N THR H 198  
AI9 3 4 O THR H 198  ? O THR H 198  N ALA H 125  ? N ALA H 125  
AI9 4 5 N CYS H 122  ? N CYS H 122  O LEU H 133  ? O LEU H 133  
AI9 5 6 N ASP H 130  ? N ASP H 130  O VAL H 154  ? O VAL H 154  
AJ1 1 2 N LYS H 4    ? N LYS H 4    O VAL H 221  ? O VAL H 221  
AJ1 2 3 O LYS H 220  ? O LYS H 220  N THR H 198  ? N THR H 198  
AJ1 3 4 N VAL H 206  ? N VAL H 206  O TYR H 213  ? O TYR H 213  
AJ2 1 2 N ALA H 32   ? N ALA H 32   O ILE H 107  ? O ILE H 107  
AJ2 2 3 O LEU H 106  ? O LEU H 106  N LYS H 58   ? N LYS H 58   
AJ2 3 4 N LEU H 55   ? N LEU H 55   O LEU H 76   ? O LEU H 76   
AJ3 1 2 N ALA H 93   ? N ALA H 93   O GLY H 100  ? O GLY H 100  
AJ4 1 2 N LYS H 265  ? N LYS H 265  O GLU H 306  ? O GLU H 306  
AJ4 2 3 O TYR H 307  ? O TYR H 307  N VAL H 279  ? N VAL H 279  
AJ5 1 2 N TRP H 276  ? N TRP H 276  O ILE H 339  ? O ILE H 339  
AJ5 2 3 N LEU H 338  ? N LEU H 338  O PHE H 376  ? O PHE H 376  
AJ5 3 4 N VAL H 377  ? N VAL H 377  O HIS H 403  ? O HIS H 403  
AJ6 1 2 N HIS H 477  ? N HIS H 537  O VAL H 492  ? O VAL H 552  
AJ6 2 3 O PRO H 491  ? O PRO H 551  N MET H 469  ? N MET H 529  
AJ6 3 4 O ALA H 467  ? O ALA H 527  N ALA H 439  ? N ALA H 499  
AJ6 4 5 N TRP H 442  ? N TRP H 502  O ILE H 510  ? O ILE H 570  
AJ6 5 6 N ASN H 511  ? N ASN H 571  O ALA H 535  ? O ALA H 595  
AJ6 6 7 N ILE H 534  ? N ILE H 594  O THR H 559  ? O THR H 619  
AJ7 1 2 O PHE H 574  ? O PHE H 634  N LYS H 570  ? N LYS H 630  
AJ7 2 3 N ILE H 569  ? N ILE H 629  O GLY H 624  ? O GLY H 684  
AJ7 3 4 O TYR H 622  ? O TYR H 682  N VAL H 597  ? N VAL H 657  
AJ7 4 5 N ALA H 598  ? N ALA H 658  O VAL H 654  ? O VAL H 714  
AJ7 5 6 N ILE H 653  ? N ILE H 713  O VAL H 681  ? O VAL H 741  
AJ8 1 2 N ASP H 786  ? N ASP H 846  O ILE H 793  ? O ILE H 853  
AJ8 2 3 N TYR H 794  ? N TYR H 854  O MET H 797  ? O MET H 857  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A MG  1201 ? 4  'binding site for residue MG A 1201'  
AC2 Software A PO4 1202 ? 11 'binding site for residue PO4 A 1202' 
AC3 Software A FLC 1203 ? 11 'binding site for residue FLC A 1203' 
AC4 Software A COA 1204 ? 20 'binding site for residue COA A 1204' 
AC5 Software A ADP 1205 ? 17 'binding site for residue ADP A 1205' 
AC6 Software A MG  1206 ? 4  'binding site for residue MG A 1206'  
AC7 Software A COA 1207 ? 20 'binding site for residue COA A 1207' 
AC8 Software B MG  1201 ? 4  'binding site for residue MG B 1201'  
AC9 Software B PO4 1202 ? 10 'binding site for residue PO4 B 1202' 
AD1 Software B FLC 1203 ? 11 'binding site for residue FLC B 1203' 
AD2 Software B ADP 1204 ? 18 'binding site for residue ADP B 1204' 
AD3 Software B MG  1205 ? 5  'binding site for residue MG B 1205'  
AD4 Software C MG  1201 ? 4  'binding site for residue MG C 1201'  
AD5 Software C PO4 1202 ? 11 'binding site for residue PO4 C 1202' 
AD6 Software C FLC 1203 ? 11 'binding site for residue FLC C 1203' 
AD7 Software C COA 1204 ? 21 'binding site for residue COA C 1204' 
AD8 Software C ADP 1205 ? 19 'binding site for residue ADP C 1205' 
AD9 Software C MG  1206 ? 5  'binding site for residue MG C 1206'  
AE1 Software D MG  1201 ? 4  'binding site for residue MG D 1201'  
AE2 Software D PO4 1202 ? 10 'binding site for residue PO4 D 1202' 
AE3 Software D FLC 1203 ? 12 'binding site for residue FLC D 1203' 
AE4 Software D COA 1204 ? 20 'binding site for residue COA D 1204' 
AE5 Software D ADP 1205 ? 18 'binding site for residue ADP D 1205' 
AE6 Software D MG  1206 ? 4  'binding site for residue MG D 1206'  
AE7 Software E MG  1201 ? 4  'binding site for residue MG E 1201'  
AE8 Software E PO4 1202 ? 9  'binding site for residue PO4 E 1202' 
AE9 Software E FLC 1203 ? 11 'binding site for residue FLC E 1203' 
AF1 Software E COA 1204 ? 19 'binding site for residue COA E 1204' 
AF2 Software E ADP 1205 ? 16 'binding site for residue ADP E 1205' 
AF3 Software E MG  1206 ? 4  'binding site for residue MG E 1206'  
AF4 Software F MG  1201 ? 4  'binding site for residue MG F 1201'  
AF5 Software F PO4 1202 ? 10 'binding site for residue PO4 F 1202' 
AF6 Software F FLC 1203 ? 10 'binding site for residue FLC F 1203' 
AF7 Software F COA 1204 ? 19 'binding site for residue COA F 1204' 
AF8 Software F ADP 1205 ? 16 'binding site for residue ADP F 1205' 
AF9 Software F MG  1206 ? 4  'binding site for residue MG F 1206'  
AG1 Software G MG  1201 ? 4  'binding site for residue MG G 1201'  
AG2 Software G PO4 1202 ? 10 'binding site for residue PO4 G 1202' 
AG3 Software G FLC 1203 ? 11 'binding site for residue FLC G 1203' 
AG4 Software G COA 1204 ? 19 'binding site for residue COA G 1204' 
AG5 Software G ADP 1205 ? 17 'binding site for residue ADP G 1205' 
AG6 Software G MG  1206 ? 5  'binding site for residue MG G 1206'  
AG7 Software H MG  1201 ? 4  'binding site for residue MG H 1201'  
AG8 Software H PO4 1202 ? 11 'binding site for residue PO4 H 1202' 
AG9 Software H FLC 1203 ? 12 'binding site for residue FLC H 1203' 
AH1 Software H COA 1204 ? 20 'binding site for residue COA H 1204' 
AH2 Software H ADP 1205 ? 19 'binding site for residue ADP H 1205' 
AH3 Software H MG  1206 ? 5  'binding site for residue MG H 1206'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 4  SER A  308 ? SER A 308  . ? 1_555 ? 
2   AC1 4  GLU A  539 ? GLU A 599  . ? 1_555 ? 
3   AC1 4  PO4 J  .   ? PO4 A 1202 . ? 1_555 ? 
4   AC1 4  FLC K  .   ? FLC A 1203 . ? 1_555 ? 
5   AC2 11 GLY A  281 ? GLY A 281  . ? 1_555 ? 
6   AC2 11 GLY A  282 ? GLY A 282  . ? 1_555 ? 
7   AC2 11 GLY A  283 ? GLY A 283  . ? 1_555 ? 
8   AC2 11 SER A  308 ? SER A 308  . ? 1_555 ? 
9   AC2 11 SER A  603 ? SER A 663  . ? 1_555 ? 
10  AC2 11 GLY A  604 ? GLY A 664  . ? 1_555 ? 
11  AC2 11 GLY A  605 ? GLY A 665  . ? 1_555 ? 
12  AC2 11 HIS A  700 ? HIS A 760  . ? 1_555 ? 
13  AC2 11 MG  I  .   ? MG  A 1201 . ? 1_555 ? 
14  AC2 11 FLC K  .   ? FLC A 1203 . ? 1_555 ? 
15  AC2 11 COA L  .   ? COA A 1204 . ? 1_555 ? 
16  AC3 11 SER A  308 ? SER A 308  . ? 1_555 ? 
17  AC3 11 GLY A  309 ? GLY A 309  . ? 1_555 ? 
18  AC3 11 SER A  343 ? SER A 343  . ? 1_555 ? 
19  AC3 11 ALA A  345 ? ALA A 345  . ? 1_555 ? 
20  AC3 11 ASN A  346 ? ASN A 346  . ? 1_555 ? 
21  AC3 11 PHE A  347 ? PHE A 347  . ? 1_555 ? 
22  AC3 11 THR A  348 ? THR A 348  . ? 1_555 ? 
23  AC3 11 ARG A  379 ? ARG A 379  . ? 1_555 ? 
24  AC3 11 MG  I  .   ? MG  A 1201 . ? 1_555 ? 
25  AC3 11 PO4 J  .   ? PO4 A 1202 . ? 1_555 ? 
26  AC3 11 COA L  .   ? COA A 1204 . ? 1_555 ? 
27  AC4 20 GLY A  261 ? GLY A 261  . ? 1_555 ? 
28  AC4 20 PHE A  473 ? PHE A 533  . ? 1_555 ? 
29  AC4 20 PHE A  512 ? PHE A 572  . ? 1_555 ? 
30  AC4 20 SER A  514 ? SER A 574  . ? 1_555 ? 
31  AC4 20 ARG A  516 ? ARG A 576  . ? 1_555 ? 
32  AC4 20 SER A  517 ? SER A 577  . ? 1_555 ? 
33  AC4 20 ILE A  537 ? ILE A 597  . ? 1_555 ? 
34  AC4 20 GLU A  539 ? GLU A 599  . ? 1_555 ? 
35  AC4 20 ALA A  564 ? ALA A 624  . ? 1_555 ? 
36  AC4 20 THR A  565 ? THR A 625  . ? 1_555 ? 
37  AC4 20 VAL A  566 ? VAL A 626  . ? 1_555 ? 
38  AC4 20 PO4 J  .   ? PO4 A 1202 . ? 1_555 ? 
39  AC4 20 FLC K  .   ? FLC A 1203 . ? 1_555 ? 
40  AC4 20 LYS B  904 ? LYS B 964  . ? 1_555 ? 
41  AC4 20 LEU B  909 ? LEU B 969  . ? 1_555 ? 
42  AC4 20 ILE B  910 ? ILE B 970  . ? 1_555 ? 
43  AC4 20 ILE B  913 ? ILE B 973  . ? 1_555 ? 
44  AC4 20 LYS B  957 ? LYS B 1017 . ? 1_555 ? 
45  AC4 20 LYS B  958 ? LYS B 1018 . ? 1_555 ? 
46  AC4 20 LEU B  961 ? LEU B 1021 . ? 1_555 ? 
47  AC5 17 VAL A  56  ? VAL A 56   . ? 1_555 ? 
48  AC5 17 LYS A  58  ? LYS A 58   . ? 1_555 ? 
49  AC5 17 ARG A  65  ? ARG A 65   . ? 1_555 ? 
50  AC5 17 ARG A  66  ? ARG A 66   . ? 1_555 ? 
51  AC5 17 GLY A  67  ? GLY A 67   . ? 1_555 ? 
52  AC5 17 PRO A  109 ? PRO A 109  . ? 1_555 ? 
53  AC5 17 PHE A  110 ? PHE A 110  . ? 1_555 ? 
54  AC5 17 VAL A  111 ? VAL A 111  . ? 1_555 ? 
55  AC5 17 HIS A  113 ? HIS A 113  . ? 1_555 ? 
56  AC5 17 GLU A  118 ? GLU A 118  . ? 1_555 ? 
57  AC5 17 VAL A  140 ? VAL A 140  . ? 1_555 ? 
58  AC5 17 ASN A  203 ? ASN A 203  . ? 1_555 ? 
59  AC5 17 PRO A  204 ? PRO A 204  . ? 1_555 ? 
60  AC5 17 LEU A  215 ? LEU A 215  . ? 1_555 ? 
61  AC5 17 ASP A  216 ? ASP A 216  . ? 1_555 ? 
62  AC5 17 MG  N  .   ? MG  A 1206 . ? 1_555 ? 
63  AC5 17 HOH EB .   ? HOH A 1302 . ? 1_555 ? 
64  AC6 4  ASN A  203 ? ASN A 203  . ? 1_555 ? 
65  AC6 4  ASP A  216 ? ASP A 216  . ? 1_555 ? 
66  AC6 4  ADP M  .   ? ADP A 1205 . ? 1_555 ? 
67  AC6 4  HOH EB .   ? HOH A 1302 . ? 1_555 ? 
68  AC7 20 LYS A  904 ? LYS A 964  . ? 1_555 ? 
69  AC7 20 LEU A  909 ? LEU A 969  . ? 1_555 ? 
70  AC7 20 ILE A  910 ? ILE A 970  . ? 1_555 ? 
71  AC7 20 ILE A  913 ? ILE A 973  . ? 1_555 ? 
72  AC7 20 LYS A  957 ? LYS A 1017 . ? 1_555 ? 
73  AC7 20 LYS A  958 ? LYS A 1018 . ? 1_555 ? 
74  AC7 20 LEU A  961 ? LEU A 1021 . ? 1_555 ? 
75  AC7 20 GLY B  261 ? GLY B 261  . ? 1_555 ? 
76  AC7 20 PHE B  347 ? PHE B 347  . ? 1_555 ? 
77  AC7 20 PHE B  473 ? PHE B 533  . ? 1_555 ? 
78  AC7 20 PHE B  512 ? PHE B 572  . ? 1_555 ? 
79  AC7 20 ALA B  513 ? ALA B 573  . ? 1_555 ? 
80  AC7 20 SER B  514 ? SER B 574  . ? 1_555 ? 
81  AC7 20 ARG B  516 ? ARG B 576  . ? 1_555 ? 
82  AC7 20 SER B  517 ? SER B 577  . ? 1_555 ? 
83  AC7 20 ILE B  537 ? ILE B 597  . ? 1_555 ? 
84  AC7 20 ALA B  564 ? ALA B 624  . ? 1_555 ? 
85  AC7 20 THR B  565 ? THR B 625  . ? 1_555 ? 
86  AC7 20 VAL B  566 ? VAL B 626  . ? 1_555 ? 
87  AC7 20 FLC R  .   ? FLC B 1203 . ? 1_555 ? 
88  AC8 4  SER B  308 ? SER B 308  . ? 1_555 ? 
89  AC8 4  GLU B  539 ? GLU B 599  . ? 1_555 ? 
90  AC8 4  PO4 Q  .   ? PO4 B 1202 . ? 1_555 ? 
91  AC8 4  FLC R  .   ? FLC B 1203 . ? 1_555 ? 
92  AC9 10 GLY B  281 ? GLY B 281  . ? 1_555 ? 
93  AC9 10 GLY B  282 ? GLY B 282  . ? 1_555 ? 
94  AC9 10 GLY B  283 ? GLY B 283  . ? 1_555 ? 
95  AC9 10 SER B  308 ? SER B 308  . ? 1_555 ? 
96  AC9 10 SER B  603 ? SER B 663  . ? 1_555 ? 
97  AC9 10 GLY B  604 ? GLY B 664  . ? 1_555 ? 
98  AC9 10 GLY B  605 ? GLY B 665  . ? 1_555 ? 
99  AC9 10 HIS B  700 ? HIS B 760  . ? 1_555 ? 
100 AC9 10 MG  P  .   ? MG  B 1201 . ? 1_555 ? 
101 AC9 10 FLC R  .   ? FLC B 1203 . ? 1_555 ? 
102 AD1 11 COA O  .   ? COA A 1207 . ? 1_555 ? 
103 AD1 11 SER B  308 ? SER B 308  . ? 1_555 ? 
104 AD1 11 GLY B  309 ? GLY B 309  . ? 1_555 ? 
105 AD1 11 SER B  343 ? SER B 343  . ? 1_555 ? 
106 AD1 11 ALA B  345 ? ALA B 345  . ? 1_555 ? 
107 AD1 11 ASN B  346 ? ASN B 346  . ? 1_555 ? 
108 AD1 11 PHE B  347 ? PHE B 347  . ? 1_555 ? 
109 AD1 11 THR B  348 ? THR B 348  . ? 1_555 ? 
110 AD1 11 ARG B  379 ? ARG B 379  . ? 1_555 ? 
111 AD1 11 MG  P  .   ? MG  B 1201 . ? 1_555 ? 
112 AD1 11 PO4 Q  .   ? PO4 B 1202 . ? 1_555 ? 
113 AD2 18 VAL B  56  ? VAL B 56   . ? 1_555 ? 
114 AD2 18 LYS B  58  ? LYS B 58   . ? 1_555 ? 
115 AD2 18 ARG B  65  ? ARG B 65   . ? 1_555 ? 
116 AD2 18 ARG B  66  ? ARG B 66   . ? 1_555 ? 
117 AD2 18 GLY B  67  ? GLY B 67   . ? 1_555 ? 
118 AD2 18 PRO B  109 ? PRO B 109  . ? 1_555 ? 
119 AD2 18 PHE B  110 ? PHE B 110  . ? 1_555 ? 
120 AD2 18 VAL B  111 ? VAL B 111  . ? 1_555 ? 
121 AD2 18 HIS B  113 ? HIS B 113  . ? 1_555 ? 
122 AD2 18 GLU B  118 ? GLU B 118  . ? 1_555 ? 
123 AD2 18 VAL B  140 ? VAL B 140  . ? 1_555 ? 
124 AD2 18 ASN B  203 ? ASN B 203  . ? 1_555 ? 
125 AD2 18 PRO B  204 ? PRO B 204  . ? 1_555 ? 
126 AD2 18 LEU B  215 ? LEU B 215  . ? 1_555 ? 
127 AD2 18 ASP B  216 ? ASP B 216  . ? 1_555 ? 
128 AD2 18 MG  T  .   ? MG  B 1205 . ? 1_555 ? 
129 AD2 18 HOH FB .   ? HOH B 1301 . ? 1_555 ? 
130 AD2 18 HOH FB .   ? HOH B 1302 . ? 1_555 ? 
131 AD3 5  ASN B  203 ? ASN B 203  . ? 1_555 ? 
132 AD3 5  ASP B  216 ? ASP B 216  . ? 1_555 ? 
133 AD3 5  ADP S  .   ? ADP B 1204 . ? 1_555 ? 
134 AD3 5  HOH FB .   ? HOH B 1301 . ? 1_555 ? 
135 AD3 5  HOH FB .   ? HOH B 1302 . ? 1_555 ? 
136 AD4 4  SER C  308 ? SER C 308  . ? 1_555 ? 
137 AD4 4  GLU C  539 ? GLU C 599  . ? 1_555 ? 
138 AD4 4  PO4 V  .   ? PO4 C 1202 . ? 1_555 ? 
139 AD4 4  FLC W  .   ? FLC C 1203 . ? 1_555 ? 
140 AD5 11 GLY C  281 ? GLY C 281  . ? 1_555 ? 
141 AD5 11 GLY C  282 ? GLY C 282  . ? 1_555 ? 
142 AD5 11 GLY C  283 ? GLY C 283  . ? 1_555 ? 
143 AD5 11 SER C  308 ? SER C 308  . ? 1_555 ? 
144 AD5 11 SER C  603 ? SER C 663  . ? 1_555 ? 
145 AD5 11 GLY C  604 ? GLY C 664  . ? 1_555 ? 
146 AD5 11 GLY C  605 ? GLY C 665  . ? 1_555 ? 
147 AD5 11 HIS C  700 ? HIS C 760  . ? 1_555 ? 
148 AD5 11 MG  U  .   ? MG  C 1201 . ? 1_555 ? 
149 AD5 11 FLC W  .   ? FLC C 1203 . ? 1_555 ? 
150 AD5 11 COA X  .   ? COA C 1204 . ? 1_555 ? 
151 AD6 11 SER C  308 ? SER C 308  . ? 1_555 ? 
152 AD6 11 GLY C  309 ? GLY C 309  . ? 1_555 ? 
153 AD6 11 SER C  343 ? SER C 343  . ? 1_555 ? 
154 AD6 11 ALA C  345 ? ALA C 345  . ? 1_555 ? 
155 AD6 11 ASN C  346 ? ASN C 346  . ? 1_555 ? 
156 AD6 11 PHE C  347 ? PHE C 347  . ? 1_555 ? 
157 AD6 11 THR C  348 ? THR C 348  . ? 1_555 ? 
158 AD6 11 ARG C  379 ? ARG C 379  . ? 1_555 ? 
159 AD6 11 MG  U  .   ? MG  C 1201 . ? 1_555 ? 
160 AD6 11 PO4 V  .   ? PO4 C 1202 . ? 1_555 ? 
161 AD6 11 COA X  .   ? COA C 1204 . ? 1_555 ? 
162 AD7 21 GLY C  261 ? GLY C 261  . ? 1_555 ? 
163 AD7 21 PHE C  473 ? PHE C 533  . ? 1_555 ? 
164 AD7 21 PHE C  512 ? PHE C 572  . ? 1_555 ? 
165 AD7 21 SER C  514 ? SER C 574  . ? 1_555 ? 
166 AD7 21 ARG C  516 ? ARG C 576  . ? 1_555 ? 
167 AD7 21 SER C  517 ? SER C 577  . ? 1_555 ? 
168 AD7 21 ILE C  537 ? ILE C 597  . ? 1_555 ? 
169 AD7 21 GLU C  539 ? GLU C 599  . ? 1_555 ? 
170 AD7 21 ALA C  564 ? ALA C 624  . ? 1_555 ? 
171 AD7 21 THR C  565 ? THR C 625  . ? 1_555 ? 
172 AD7 21 VAL C  566 ? VAL C 626  . ? 1_555 ? 
173 AD7 21 GLY C  604 ? GLY C 664  . ? 1_555 ? 
174 AD7 21 PO4 V  .   ? PO4 C 1202 . ? 1_555 ? 
175 AD7 21 FLC W  .   ? FLC C 1203 . ? 1_555 ? 
176 AD7 21 LYS D  904 ? LYS D 964  . ? 1_555 ? 
177 AD7 21 LEU D  909 ? LEU D 969  . ? 1_555 ? 
178 AD7 21 ILE D  910 ? ILE D 970  . ? 1_555 ? 
179 AD7 21 ILE D  913 ? ILE D 973  . ? 1_555 ? 
180 AD7 21 LYS D  957 ? LYS D 1017 . ? 1_555 ? 
181 AD7 21 LYS D  958 ? LYS D 1018 . ? 1_555 ? 
182 AD7 21 LEU D  961 ? LEU D 1021 . ? 1_555 ? 
183 AD8 19 VAL C  56  ? VAL C 56   . ? 1_555 ? 
184 AD8 19 LYS C  58  ? LYS C 58   . ? 1_555 ? 
185 AD8 19 ARG C  65  ? ARG C 65   . ? 1_555 ? 
186 AD8 19 ARG C  66  ? ARG C 66   . ? 1_555 ? 
187 AD8 19 GLY C  67  ? GLY C 67   . ? 1_555 ? 
188 AD8 19 VAL C  72  ? VAL C 72   . ? 1_555 ? 
189 AD8 19 PHE C  110 ? PHE C 110  . ? 1_555 ? 
190 AD8 19 VAL C  111 ? VAL C 111  . ? 1_555 ? 
191 AD8 19 HIS C  113 ? HIS C 113  . ? 1_555 ? 
192 AD8 19 GLU C  118 ? GLU C 118  . ? 1_555 ? 
193 AD8 19 GLY C  139 ? GLY C 139  . ? 1_555 ? 
194 AD8 19 VAL C  140 ? VAL C 140  . ? 1_555 ? 
195 AD8 19 ASN C  203 ? ASN C 203  . ? 1_555 ? 
196 AD8 19 PRO C  204 ? PRO C 204  . ? 1_555 ? 
197 AD8 19 LEU C  215 ? LEU C 215  . ? 1_555 ? 
198 AD8 19 ASP C  216 ? ASP C 216  . ? 1_555 ? 
199 AD8 19 MG  Z  .   ? MG  C 1206 . ? 1_555 ? 
200 AD8 19 HOH GB .   ? HOH C 1301 . ? 1_555 ? 
201 AD8 19 HOH GB .   ? HOH C 1302 . ? 1_555 ? 
202 AD9 5  ASN C  203 ? ASN C 203  . ? 1_555 ? 
203 AD9 5  ASP C  216 ? ASP C 216  . ? 1_555 ? 
204 AD9 5  ADP Y  .   ? ADP C 1205 . ? 1_555 ? 
205 AD9 5  HOH GB .   ? HOH C 1301 . ? 1_555 ? 
206 AD9 5  HOH GB .   ? HOH C 1302 . ? 1_555 ? 
207 AE1 4  SER D  308 ? SER D 308  . ? 1_555 ? 
208 AE1 4  GLU D  539 ? GLU D 599  . ? 1_555 ? 
209 AE1 4  PO4 BA .   ? PO4 D 1202 . ? 1_555 ? 
210 AE1 4  FLC CA .   ? FLC D 1203 . ? 1_555 ? 
211 AE2 10 GLY D  281 ? GLY D 281  . ? 1_555 ? 
212 AE2 10 GLY D  282 ? GLY D 282  . ? 1_555 ? 
213 AE2 10 GLY D  283 ? GLY D 283  . ? 1_555 ? 
214 AE2 10 SER D  308 ? SER D 308  . ? 1_555 ? 
215 AE2 10 SER D  603 ? SER D 663  . ? 1_555 ? 
216 AE2 10 GLY D  604 ? GLY D 664  . ? 1_555 ? 
217 AE2 10 GLY D  605 ? GLY D 665  . ? 1_555 ? 
218 AE2 10 HIS D  700 ? HIS D 760  . ? 1_555 ? 
219 AE2 10 MG  AA .   ? MG  D 1201 . ? 1_555 ? 
220 AE2 10 FLC CA .   ? FLC D 1203 . ? 1_555 ? 
221 AE3 12 ALA D  280 ? ALA D 280  . ? 1_555 ? 
222 AE3 12 SER D  308 ? SER D 308  . ? 1_555 ? 
223 AE3 12 GLY D  309 ? GLY D 309  . ? 1_555 ? 
224 AE3 12 SER D  343 ? SER D 343  . ? 1_555 ? 
225 AE3 12 ALA D  345 ? ALA D 345  . ? 1_555 ? 
226 AE3 12 ASN D  346 ? ASN D 346  . ? 1_555 ? 
227 AE3 12 PHE D  347 ? PHE D 347  . ? 1_555 ? 
228 AE3 12 THR D  348 ? THR D 348  . ? 1_555 ? 
229 AE3 12 ARG D  379 ? ARG D 379  . ? 1_555 ? 
230 AE3 12 MG  AA .   ? MG  D 1201 . ? 1_555 ? 
231 AE3 12 PO4 BA .   ? PO4 D 1202 . ? 1_555 ? 
232 AE3 12 COA DA .   ? COA D 1204 . ? 1_555 ? 
233 AE4 20 LYS C  904 ? LYS C 964  . ? 1_555 ? 
234 AE4 20 LEU C  909 ? LEU C 969  . ? 1_555 ? 
235 AE4 20 ILE C  910 ? ILE C 970  . ? 1_555 ? 
236 AE4 20 ILE C  913 ? ILE C 973  . ? 1_555 ? 
237 AE4 20 LYS C  957 ? LYS C 1017 . ? 1_555 ? 
238 AE4 20 LYS C  958 ? LYS C 1018 . ? 1_555 ? 
239 AE4 20 LEU C  961 ? LEU C 1021 . ? 1_555 ? 
240 AE4 20 GLY D  261 ? GLY D 261  . ? 1_555 ? 
241 AE4 20 PHE D  473 ? PHE D 533  . ? 1_555 ? 
242 AE4 20 PHE D  512 ? PHE D 572  . ? 1_555 ? 
243 AE4 20 SER D  514 ? SER D 574  . ? 1_555 ? 
244 AE4 20 ARG D  516 ? ARG D 576  . ? 1_555 ? 
245 AE4 20 SER D  517 ? SER D 577  . ? 1_555 ? 
246 AE4 20 ILE D  537 ? ILE D 597  . ? 1_555 ? 
247 AE4 20 GLU D  539 ? GLU D 599  . ? 1_555 ? 
248 AE4 20 ALA D  564 ? ALA D 624  . ? 1_555 ? 
249 AE4 20 THR D  565 ? THR D 625  . ? 1_555 ? 
250 AE4 20 VAL D  566 ? VAL D 626  . ? 1_555 ? 
251 AE4 20 GLY D  604 ? GLY D 664  . ? 1_555 ? 
252 AE4 20 FLC CA .   ? FLC D 1203 . ? 1_555 ? 
253 AE5 18 VAL D  56  ? VAL D 56   . ? 1_555 ? 
254 AE5 18 LYS D  58  ? LYS D 58   . ? 1_555 ? 
255 AE5 18 ARG D  65  ? ARG D 65   . ? 1_555 ? 
256 AE5 18 ARG D  66  ? ARG D 66   . ? 1_555 ? 
257 AE5 18 GLY D  67  ? GLY D 67   . ? 1_555 ? 
258 AE5 18 PRO D  109 ? PRO D 109  . ? 1_555 ? 
259 AE5 18 PHE D  110 ? PHE D 110  . ? 1_555 ? 
260 AE5 18 VAL D  111 ? VAL D 111  . ? 1_555 ? 
261 AE5 18 HIS D  113 ? HIS D 113  . ? 1_555 ? 
262 AE5 18 GLU D  118 ? GLU D 118  . ? 1_555 ? 
263 AE5 18 VAL D  140 ? VAL D 140  . ? 1_555 ? 
264 AE5 18 ASN D  203 ? ASN D 203  . ? 1_555 ? 
265 AE5 18 PRO D  204 ? PRO D 204  . ? 1_555 ? 
266 AE5 18 LEU D  215 ? LEU D 215  . ? 1_555 ? 
267 AE5 18 ASP D  216 ? ASP D 216  . ? 1_555 ? 
268 AE5 18 MG  FA .   ? MG  D 1206 . ? 1_555 ? 
269 AE5 18 HOH HB .   ? HOH D 1301 . ? 1_555 ? 
270 AE5 18 HOH HB .   ? HOH D 1302 . ? 1_555 ? 
271 AE6 4  ASN D  203 ? ASN D 203  . ? 1_555 ? 
272 AE6 4  ASP D  216 ? ASP D 216  . ? 1_555 ? 
273 AE6 4  ADP EA .   ? ADP D 1205 . ? 1_555 ? 
274 AE6 4  HOH HB .   ? HOH D 1301 . ? 1_555 ? 
275 AE7 4  SER E  308 ? SER E 308  . ? 1_555 ? 
276 AE7 4  GLU E  539 ? GLU E 599  . ? 1_555 ? 
277 AE7 4  PO4 HA .   ? PO4 E 1202 . ? 1_555 ? 
278 AE7 4  FLC IA .   ? FLC E 1203 . ? 1_555 ? 
279 AE8 9  GLY E  282 ? GLY E 282  . ? 1_555 ? 
280 AE8 9  GLY E  283 ? GLY E 283  . ? 1_555 ? 
281 AE8 9  SER E  308 ? SER E 308  . ? 1_555 ? 
282 AE8 9  SER E  603 ? SER E 663  . ? 1_555 ? 
283 AE8 9  GLY E  604 ? GLY E 664  . ? 1_555 ? 
284 AE8 9  GLY E  605 ? GLY E 665  . ? 1_555 ? 
285 AE8 9  HIS E  700 ? HIS E 760  . ? 1_555 ? 
286 AE8 9  MG  GA .   ? MG  E 1201 . ? 1_555 ? 
287 AE8 9  FLC IA .   ? FLC E 1203 . ? 1_555 ? 
288 AE9 11 SER E  308 ? SER E 308  . ? 1_555 ? 
289 AE9 11 GLY E  309 ? GLY E 309  . ? 1_555 ? 
290 AE9 11 SER E  343 ? SER E 343  . ? 1_555 ? 
291 AE9 11 ALA E  345 ? ALA E 345  . ? 1_555 ? 
292 AE9 11 ASN E  346 ? ASN E 346  . ? 1_555 ? 
293 AE9 11 PHE E  347 ? PHE E 347  . ? 1_555 ? 
294 AE9 11 THR E  348 ? THR E 348  . ? 1_555 ? 
295 AE9 11 ARG E  379 ? ARG E 379  . ? 1_555 ? 
296 AE9 11 MG  GA .   ? MG  E 1201 . ? 1_555 ? 
297 AE9 11 PO4 HA .   ? PO4 E 1202 . ? 1_555 ? 
298 AE9 11 COA JA .   ? COA E 1204 . ? 1_555 ? 
299 AF1 19 GLY E  261 ? GLY E 261  . ? 1_555 ? 
300 AF1 19 PHE E  473 ? PHE E 533  . ? 1_555 ? 
301 AF1 19 PHE E  512 ? PHE E 572  . ? 1_555 ? 
302 AF1 19 SER E  514 ? SER E 574  . ? 1_555 ? 
303 AF1 19 ARG E  516 ? ARG E 576  . ? 1_555 ? 
304 AF1 19 SER E  517 ? SER E 577  . ? 1_555 ? 
305 AF1 19 ILE E  537 ? ILE E 597  . ? 1_555 ? 
306 AF1 19 GLU E  539 ? GLU E 599  . ? 1_555 ? 
307 AF1 19 ALA E  564 ? ALA E 624  . ? 1_555 ? 
308 AF1 19 THR E  565 ? THR E 625  . ? 1_555 ? 
309 AF1 19 VAL E  566 ? VAL E 626  . ? 1_555 ? 
310 AF1 19 FLC IA .   ? FLC E 1203 . ? 1_555 ? 
311 AF1 19 LYS F  904 ? LYS F 964  . ? 1_555 ? 
312 AF1 19 LEU F  909 ? LEU F 969  . ? 1_555 ? 
313 AF1 19 ILE F  910 ? ILE F 970  . ? 1_555 ? 
314 AF1 19 ILE F  913 ? ILE F 973  . ? 1_555 ? 
315 AF1 19 LYS F  957 ? LYS F 1017 . ? 1_555 ? 
316 AF1 19 LYS F  958 ? LYS F 1018 . ? 1_555 ? 
317 AF1 19 LEU F  961 ? LEU F 1021 . ? 1_555 ? 
318 AF2 16 VAL E  56  ? VAL E 56   . ? 1_555 ? 
319 AF2 16 LYS E  58  ? LYS E 58   . ? 1_555 ? 
320 AF2 16 ARG E  65  ? ARG E 65   . ? 1_555 ? 
321 AF2 16 ARG E  66  ? ARG E 66   . ? 1_555 ? 
322 AF2 16 GLY E  67  ? GLY E 67   . ? 1_555 ? 
323 AF2 16 PRO E  109 ? PRO E 109  . ? 1_555 ? 
324 AF2 16 VAL E  111 ? VAL E 111  . ? 1_555 ? 
325 AF2 16 HIS E  113 ? HIS E 113  . ? 1_555 ? 
326 AF2 16 GLU E  118 ? GLU E 118  . ? 1_555 ? 
327 AF2 16 VAL E  140 ? VAL E 140  . ? 1_555 ? 
328 AF2 16 ASN E  203 ? ASN E 203  . ? 1_555 ? 
329 AF2 16 PRO E  204 ? PRO E 204  . ? 1_555 ? 
330 AF2 16 LEU E  215 ? LEU E 215  . ? 1_555 ? 
331 AF2 16 ASP E  216 ? ASP E 216  . ? 1_555 ? 
332 AF2 16 MG  LA .   ? MG  E 1206 . ? 1_555 ? 
333 AF2 16 HOH IB .   ? HOH E 1301 . ? 1_555 ? 
334 AF3 4  ASN E  203 ? ASN E 203  . ? 1_555 ? 
335 AF3 4  ASP E  216 ? ASP E 216  . ? 1_555 ? 
336 AF3 4  ADP KA .   ? ADP E 1205 . ? 1_555 ? 
337 AF3 4  HOH IB .   ? HOH E 1301 . ? 1_555 ? 
338 AF4 4  SER F  308 ? SER F 308  . ? 1_555 ? 
339 AF4 4  GLU F  539 ? GLU F 599  . ? 1_555 ? 
340 AF4 4  PO4 NA .   ? PO4 F 1202 . ? 1_555 ? 
341 AF4 4  FLC OA .   ? FLC F 1203 . ? 1_555 ? 
342 AF5 10 GLY F  281 ? GLY F 281  . ? 1_555 ? 
343 AF5 10 GLY F  282 ? GLY F 282  . ? 1_555 ? 
344 AF5 10 GLY F  283 ? GLY F 283  . ? 1_555 ? 
345 AF5 10 SER F  308 ? SER F 308  . ? 1_555 ? 
346 AF5 10 SER F  603 ? SER F 663  . ? 1_555 ? 
347 AF5 10 GLY F  604 ? GLY F 664  . ? 1_555 ? 
348 AF5 10 GLY F  605 ? GLY F 665  . ? 1_555 ? 
349 AF5 10 HIS F  700 ? HIS F 760  . ? 1_555 ? 
350 AF5 10 MG  MA .   ? MG  F 1201 . ? 1_555 ? 
351 AF5 10 FLC OA .   ? FLC F 1203 . ? 1_555 ? 
352 AF6 10 SER F  308 ? SER F 308  . ? 1_555 ? 
353 AF6 10 GLY F  309 ? GLY F 309  . ? 1_555 ? 
354 AF6 10 ALA F  345 ? ALA F 345  . ? 1_555 ? 
355 AF6 10 ASN F  346 ? ASN F 346  . ? 1_555 ? 
356 AF6 10 PHE F  347 ? PHE F 347  . ? 1_555 ? 
357 AF6 10 THR F  348 ? THR F 348  . ? 1_555 ? 
358 AF6 10 ARG F  379 ? ARG F 379  . ? 1_555 ? 
359 AF6 10 MG  MA .   ? MG  F 1201 . ? 1_555 ? 
360 AF6 10 PO4 NA .   ? PO4 F 1202 . ? 1_555 ? 
361 AF6 10 COA PA .   ? COA F 1204 . ? 1_555 ? 
362 AF7 19 LYS E  904 ? LYS E 964  . ? 1_555 ? 
363 AF7 19 LEU E  909 ? LEU E 969  . ? 1_555 ? 
364 AF7 19 ILE E  910 ? ILE E 970  . ? 1_555 ? 
365 AF7 19 ILE E  913 ? ILE E 973  . ? 1_555 ? 
366 AF7 19 LYS E  957 ? LYS E 1017 . ? 1_555 ? 
367 AF7 19 LYS E  958 ? LYS E 1018 . ? 1_555 ? 
368 AF7 19 LEU E  961 ? LEU E 1021 . ? 1_555 ? 
369 AF7 19 GLY F  261 ? GLY F 261  . ? 1_555 ? 
370 AF7 19 PHE F  473 ? PHE F 533  . ? 1_555 ? 
371 AF7 19 PHE F  512 ? PHE F 572  . ? 1_555 ? 
372 AF7 19 SER F  514 ? SER F 574  . ? 1_555 ? 
373 AF7 19 ARG F  516 ? ARG F 576  . ? 1_555 ? 
374 AF7 19 SER F  517 ? SER F 577  . ? 1_555 ? 
375 AF7 19 ILE F  537 ? ILE F 597  . ? 1_555 ? 
376 AF7 19 GLU F  539 ? GLU F 599  . ? 1_555 ? 
377 AF7 19 ALA F  564 ? ALA F 624  . ? 1_555 ? 
378 AF7 19 THR F  565 ? THR F 625  . ? 1_555 ? 
379 AF7 19 VAL F  566 ? VAL F 626  . ? 1_555 ? 
380 AF7 19 FLC OA .   ? FLC F 1203 . ? 1_555 ? 
381 AF8 16 VAL F  56  ? VAL F 56   . ? 1_555 ? 
382 AF8 16 LYS F  58  ? LYS F 58   . ? 1_555 ? 
383 AF8 16 ARG F  65  ? ARG F 65   . ? 1_555 ? 
384 AF8 16 ARG F  66  ? ARG F 66   . ? 1_555 ? 
385 AF8 16 GLY F  67  ? GLY F 67   . ? 1_555 ? 
386 AF8 16 PRO F  109 ? PRO F 109  . ? 1_555 ? 
387 AF8 16 VAL F  111 ? VAL F 111  . ? 1_555 ? 
388 AF8 16 HIS F  113 ? HIS F 113  . ? 1_555 ? 
389 AF8 16 GLU F  118 ? GLU F 118  . ? 1_555 ? 
390 AF8 16 VAL F  140 ? VAL F 140  . ? 1_555 ? 
391 AF8 16 ASN F  203 ? ASN F 203  . ? 1_555 ? 
392 AF8 16 PRO F  204 ? PRO F 204  . ? 1_555 ? 
393 AF8 16 LEU F  215 ? LEU F 215  . ? 1_555 ? 
394 AF8 16 ASP F  216 ? ASP F 216  . ? 1_555 ? 
395 AF8 16 MG  RA .   ? MG  F 1206 . ? 1_555 ? 
396 AF8 16 HOH JB .   ? HOH F 1301 . ? 1_555 ? 
397 AF9 4  ASN F  203 ? ASN F 203  . ? 1_555 ? 
398 AF9 4  ASP F  216 ? ASP F 216  . ? 1_555 ? 
399 AF9 4  ADP QA .   ? ADP F 1205 . ? 1_555 ? 
400 AF9 4  HOH JB .   ? HOH F 1301 . ? 1_555 ? 
401 AG1 4  SER G  308 ? SER G 308  . ? 1_555 ? 
402 AG1 4  GLU G  539 ? GLU G 599  . ? 1_555 ? 
403 AG1 4  PO4 TA .   ? PO4 G 1202 . ? 1_555 ? 
404 AG1 4  FLC UA .   ? FLC G 1203 . ? 1_555 ? 
405 AG2 10 GLY G  281 ? GLY G 281  . ? 1_555 ? 
406 AG2 10 GLY G  282 ? GLY G 282  . ? 1_555 ? 
407 AG2 10 GLY G  283 ? GLY G 283  . ? 1_555 ? 
408 AG2 10 SER G  308 ? SER G 308  . ? 1_555 ? 
409 AG2 10 SER G  603 ? SER G 663  . ? 1_555 ? 
410 AG2 10 GLY G  604 ? GLY G 664  . ? 1_555 ? 
411 AG2 10 GLY G  605 ? GLY G 665  . ? 1_555 ? 
412 AG2 10 HIS G  700 ? HIS G 760  . ? 1_555 ? 
413 AG2 10 MG  SA .   ? MG  G 1201 . ? 1_555 ? 
414 AG2 10 FLC UA .   ? FLC G 1203 . ? 1_555 ? 
415 AG3 11 SER G  308 ? SER G 308  . ? 1_555 ? 
416 AG3 11 GLY G  309 ? GLY G 309  . ? 1_555 ? 
417 AG3 11 SER G  343 ? SER G 343  . ? 1_555 ? 
418 AG3 11 ALA G  345 ? ALA G 345  . ? 1_555 ? 
419 AG3 11 ASN G  346 ? ASN G 346  . ? 1_555 ? 
420 AG3 11 PHE G  347 ? PHE G 347  . ? 1_555 ? 
421 AG3 11 THR G  348 ? THR G 348  . ? 1_555 ? 
422 AG3 11 ARG G  379 ? ARG G 379  . ? 1_555 ? 
423 AG3 11 MG  SA .   ? MG  G 1201 . ? 1_555 ? 
424 AG3 11 PO4 TA .   ? PO4 G 1202 . ? 1_555 ? 
425 AG3 11 COA VA .   ? COA G 1204 . ? 1_555 ? 
426 AG4 19 GLY G  261 ? GLY G 261  . ? 1_555 ? 
427 AG4 19 PHE G  473 ? PHE G 533  . ? 1_555 ? 
428 AG4 19 PHE G  512 ? PHE G 572  . ? 1_555 ? 
429 AG4 19 SER G  514 ? SER G 574  . ? 1_555 ? 
430 AG4 19 ARG G  516 ? ARG G 576  . ? 1_555 ? 
431 AG4 19 SER G  517 ? SER G 577  . ? 1_555 ? 
432 AG4 19 ILE G  537 ? ILE G 597  . ? 1_555 ? 
433 AG4 19 GLU G  539 ? GLU G 599  . ? 1_555 ? 
434 AG4 19 ALA G  564 ? ALA G 624  . ? 1_555 ? 
435 AG4 19 THR G  565 ? THR G 625  . ? 1_555 ? 
436 AG4 19 VAL G  566 ? VAL G 626  . ? 1_555 ? 
437 AG4 19 FLC UA .   ? FLC G 1203 . ? 1_555 ? 
438 AG4 19 LYS H  904 ? LYS H 964  . ? 1_555 ? 
439 AG4 19 LEU H  909 ? LEU H 969  . ? 1_555 ? 
440 AG4 19 ILE H  910 ? ILE H 970  . ? 1_555 ? 
441 AG4 19 ILE H  913 ? ILE H 973  . ? 1_555 ? 
442 AG4 19 LYS H  957 ? LYS H 1017 . ? 1_555 ? 
443 AG4 19 LYS H  958 ? LYS H 1018 . ? 1_555 ? 
444 AG4 19 LEU H  961 ? LEU H 1021 . ? 1_555 ? 
445 AG5 17 VAL G  56  ? VAL G 56   . ? 1_555 ? 
446 AG5 17 LYS G  58  ? LYS G 58   . ? 1_555 ? 
447 AG5 17 ARG G  65  ? ARG G 65   . ? 1_555 ? 
448 AG5 17 ARG G  66  ? ARG G 66   . ? 1_555 ? 
449 AG5 17 GLY G  67  ? GLY G 67   . ? 1_555 ? 
450 AG5 17 PRO G  109 ? PRO G 109  . ? 1_555 ? 
451 AG5 17 PHE G  110 ? PHE G 110  . ? 1_555 ? 
452 AG5 17 VAL G  111 ? VAL G 111  . ? 1_555 ? 
453 AG5 17 HIS G  113 ? HIS G 113  . ? 1_555 ? 
454 AG5 17 GLU G  118 ? GLU G 118  . ? 1_555 ? 
455 AG5 17 VAL G  140 ? VAL G 140  . ? 1_555 ? 
456 AG5 17 ASN G  203 ? ASN G 203  . ? 1_555 ? 
457 AG5 17 PRO G  204 ? PRO G 204  . ? 1_555 ? 
458 AG5 17 LEU G  215 ? LEU G 215  . ? 1_555 ? 
459 AG5 17 ASP G  216 ? ASP G 216  . ? 1_555 ? 
460 AG5 17 MG  XA .   ? MG  G 1206 . ? 1_555 ? 
461 AG5 17 HOH KB .   ? HOH G 1302 . ? 1_555 ? 
462 AG6 5  ASN G  203 ? ASN G 203  . ? 1_555 ? 
463 AG6 5  ASP G  216 ? ASP G 216  . ? 1_555 ? 
464 AG6 5  ADP WA .   ? ADP G 1205 . ? 1_555 ? 
465 AG6 5  HOH KB .   ? HOH G 1301 . ? 1_555 ? 
466 AG6 5  HOH KB .   ? HOH G 1302 . ? 1_555 ? 
467 AG7 4  SER H  308 ? SER H 308  . ? 1_555 ? 
468 AG7 4  GLU H  539 ? GLU H 599  . ? 1_555 ? 
469 AG7 4  PO4 ZA .   ? PO4 H 1202 . ? 1_555 ? 
470 AG7 4  FLC AB .   ? FLC H 1203 . ? 1_555 ? 
471 AG8 11 GLY H  281 ? GLY H 281  . ? 1_555 ? 
472 AG8 11 GLY H  282 ? GLY H 282  . ? 1_555 ? 
473 AG8 11 GLY H  283 ? GLY H 283  . ? 1_555 ? 
474 AG8 11 SER H  308 ? SER H 308  . ? 1_555 ? 
475 AG8 11 SER H  603 ? SER H 663  . ? 1_555 ? 
476 AG8 11 GLY H  604 ? GLY H 664  . ? 1_555 ? 
477 AG8 11 GLY H  605 ? GLY H 665  . ? 1_555 ? 
478 AG8 11 HIS H  700 ? HIS H 760  . ? 1_555 ? 
479 AG8 11 MG  YA .   ? MG  H 1201 . ? 1_555 ? 
480 AG8 11 FLC AB .   ? FLC H 1203 . ? 1_555 ? 
481 AG8 11 COA BB .   ? COA H 1204 . ? 1_555 ? 
482 AG9 12 ALA H  280 ? ALA H 280  . ? 1_555 ? 
483 AG9 12 SER H  308 ? SER H 308  . ? 1_555 ? 
484 AG9 12 GLY H  309 ? GLY H 309  . ? 1_555 ? 
485 AG9 12 SER H  343 ? SER H 343  . ? 1_555 ? 
486 AG9 12 ALA H  345 ? ALA H 345  . ? 1_555 ? 
487 AG9 12 ASN H  346 ? ASN H 346  . ? 1_555 ? 
488 AG9 12 PHE H  347 ? PHE H 347  . ? 1_555 ? 
489 AG9 12 THR H  348 ? THR H 348  . ? 1_555 ? 
490 AG9 12 ARG H  379 ? ARG H 379  . ? 1_555 ? 
491 AG9 12 MG  YA .   ? MG  H 1201 . ? 1_555 ? 
492 AG9 12 PO4 ZA .   ? PO4 H 1202 . ? 1_555 ? 
493 AG9 12 COA BB .   ? COA H 1204 . ? 1_555 ? 
494 AH1 20 LYS G  904 ? LYS G 964  . ? 1_555 ? 
495 AH1 20 LEU G  909 ? LEU G 969  . ? 1_555 ? 
496 AH1 20 ILE G  910 ? ILE G 970  . ? 1_555 ? 
497 AH1 20 ILE G  913 ? ILE G 973  . ? 1_555 ? 
498 AH1 20 LYS G  957 ? LYS G 1017 . ? 1_555 ? 
499 AH1 20 LYS G  958 ? LYS G 1018 . ? 1_555 ? 
500 AH1 20 LEU G  961 ? LEU G 1021 . ? 1_555 ? 
501 AH1 20 GLY H  261 ? GLY H 261  . ? 1_555 ? 
502 AH1 20 PHE H  473 ? PHE H 533  . ? 1_555 ? 
503 AH1 20 PHE H  512 ? PHE H 572  . ? 1_555 ? 
504 AH1 20 SER H  514 ? SER H 574  . ? 1_555 ? 
505 AH1 20 ARG H  516 ? ARG H 576  . ? 1_555 ? 
506 AH1 20 SER H  517 ? SER H 577  . ? 1_555 ? 
507 AH1 20 ILE H  537 ? ILE H 597  . ? 1_555 ? 
508 AH1 20 GLU H  539 ? GLU H 599  . ? 1_555 ? 
509 AH1 20 ALA H  564 ? ALA H 624  . ? 1_555 ? 
510 AH1 20 THR H  565 ? THR H 625  . ? 1_555 ? 
511 AH1 20 GLY H  604 ? GLY H 664  . ? 1_555 ? 
512 AH1 20 PO4 ZA .   ? PO4 H 1202 . ? 1_555 ? 
513 AH1 20 FLC AB .   ? FLC H 1203 . ? 1_555 ? 
514 AH2 19 VAL H  56  ? VAL H 56   . ? 1_555 ? 
515 AH2 19 LYS H  58  ? LYS H 58   . ? 1_555 ? 
516 AH2 19 LYS H  64  ? LYS H 64   . ? 1_555 ? 
517 AH2 19 ARG H  65  ? ARG H 65   . ? 1_555 ? 
518 AH2 19 ARG H  66  ? ARG H 66   . ? 1_555 ? 
519 AH2 19 GLY H  67  ? GLY H 67   . ? 1_555 ? 
520 AH2 19 PRO H  109 ? PRO H 109  . ? 1_555 ? 
521 AH2 19 VAL H  111 ? VAL H 111  . ? 1_555 ? 
522 AH2 19 HIS H  113 ? HIS H 113  . ? 1_555 ? 
523 AH2 19 GLU H  118 ? GLU H 118  . ? 1_555 ? 
524 AH2 19 GLY H  139 ? GLY H 139  . ? 1_555 ? 
525 AH2 19 VAL H  140 ? VAL H 140  . ? 1_555 ? 
526 AH2 19 ASN H  203 ? ASN H 203  . ? 1_555 ? 
527 AH2 19 PRO H  204 ? PRO H 204  . ? 1_555 ? 
528 AH2 19 LEU H  215 ? LEU H 215  . ? 1_555 ? 
529 AH2 19 ASP H  216 ? ASP H 216  . ? 1_555 ? 
530 AH2 19 MG  DB .   ? MG  H 1206 . ? 1_555 ? 
531 AH2 19 HOH LB .   ? HOH H 1301 . ? 1_555 ? 
532 AH2 19 HOH LB .   ? HOH H 1302 . ? 1_555 ? 
533 AH3 5  ASN H  203 ? ASN H 203  . ? 1_555 ? 
534 AH3 5  ASP H  216 ? ASP H 216  . ? 1_555 ? 
535 AH3 5  ADP CB .   ? ADP H 1205 . ? 1_555 ? 
536 AH3 5  HOH LB .   ? HOH H 1301 . ? 1_555 ? 
537 AH3 5  HOH LB .   ? HOH H 1302 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6HXH 
_atom_sites.fract_transf_matrix[1][1]   0.006651 
_atom_sites.fract_transf_matrix[1][2]   0.002092 
_atom_sites.fract_transf_matrix[1][3]   0.002757 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006807 
_atom_sites.fract_transf_matrix[2][3]   0.000994 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006981 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
H  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N      . SER A  1 2    ? 59.233  111.103 -7.004  1.00 124.04 ?  2    SER A N      1 
ATOM   2     C  CA     . SER A  1 2    ? 60.275  111.719 -7.791  1.00 123.90 ?  2    SER A CA     1 
ATOM   3     C  C      . SER A  1 2    ? 59.799  111.993 -9.204  1.00 126.04 ?  2    SER A C      1 
ATOM   4     O  O      . SER A  1 2    ? 58.836  111.394 -9.683  1.00 125.01 ?  2    SER A O      1 
ATOM   5     C  CB     . SER A  1 2    ? 61.488  110.797 -7.839  1.00 131.04 ?  2    SER A CB     1 
ATOM   6     O  OG     . SER A  1 2    ? 61.209  109.600 -8.550  1.00 145.07 ?  2    SER A OG     1 
ATOM   7     N  N      . ALA A  1 3    ? 60.504  112.891 -9.882  1.00 122.99 ?  3    ALA A N      1 
ATOM   8     C  CA     . ALA A  1 3    ? 60.238  113.203 -11.280 1.00 122.13 ?  3    ALA A CA     1 
ATOM   9     C  C      . ALA A  1 3    ? 60.815  112.072 -12.119 1.00 123.59 ?  3    ALA A C      1 
ATOM   10    O  O      . ALA A  1 3    ? 61.964  111.672 -11.915 1.00 125.27 ?  3    ALA A O      1 
ATOM   11    C  CB     . ALA A  1 3    ? 60.874  114.535 -11.661 1.00 123.07 ?  3    ALA A CB     1 
ATOM   12    N  N      . LYS A  1 4    ? 59.989  111.509 -12.998 1.00 116.59 ?  4    LYS A N      1 
ATOM   13    C  CA     . LYS A  1 4    ? 60.374  110.381 -13.827 1.00 116.43 ?  4    LYS A CA     1 
ATOM   14    C  C      . LYS A  1 4    ? 60.208  110.696 -15.285 1.00 121.05 ?  4    LYS A C      1 
ATOM   15    O  O      . LYS A  1 4    ? 59.210  111.290 -15.680 1.00 120.09 ?  4    LYS A O      1 
ATOM   16    C  CB     . LYS A  1 4    ? 59.554  109.138 -13.460 1.00 117.33 ?  4    LYS A CB     1 
ATOM   17    C  CG     . LYS A  1 4    ? 59.838  108.600 -12.069 1.00 111.97 ?  4    LYS A CG     1 
ATOM   18    C  CD     . LYS A  1 4    ? 59.161  107.273 -11.868 1.00 112.50 ?  4    LYS A CD     1 
ATOM   19    C  CE     . LYS A  1 4    ? 59.283  106.750 -10.462 1.00 113.47 ?  4    LYS A CE     1 
ATOM   20    N  NZ     . LYS A  1 4    ? 58.862  105.318 -10.380 1.00 116.48 1  4    LYS A NZ     1 
ATOM   21    N  N      . ALA A  1 5    ? 61.177  110.276 -16.090 1.00 119.20 ?  5    ALA A N      1 
ATOM   22    C  CA     . ALA A  1 5    ? 61.116  110.473 -17.528 1.00 119.28 ?  5    ALA A CA     1 
ATOM   23    C  C      . ALA A  1 5    ? 60.087  109.525 -18.141 1.00 121.96 ?  5    ALA A C      1 
ATOM   24    O  O      . ALA A  1 5    ? 59.939  108.377 -17.693 1.00 122.49 ?  5    ALA A O      1 
ATOM   25    C  CB     . ALA A  1 5    ? 62.483  110.222 -18.157 1.00 121.62 ?  5    ALA A CB     1 
ATOM   26    N  N      . ILE A  1 6    ? 59.391  110.020 -19.175 1.00 115.59 ?  6    ILE A N      1 
ATOM   27    C  CA     . ILE A  1 6    ? 58.432  109.263 -19.971 1.00 114.66 ?  6    ILE A CA     1 
ATOM   28    C  C      . ILE A  1 6    ? 58.929  109.202 -21.405 1.00 118.34 ?  6    ILE A C      1 
ATOM   29    O  O      . ILE A  1 6    ? 59.685  110.091 -21.839 1.00 118.63 ?  6    ILE A O      1 
ATOM   30    C  CB     . ILE A  1 6    ? 57.010  109.855 -19.902 1.00 115.81 ?  6    ILE A CB     1 
ATOM   31    C  CG1    . ILE A  1 6    ? 56.975  111.340 -20.350 1.00 113.46 ?  6    ILE A CG1    1 
ATOM   32    C  CG2    . ILE A  1 6    ? 56.436  109.652 -18.512 1.00 115.94 ?  6    ILE A CG2    1 
ATOM   33    C  CD1    . ILE A  1 6    ? 55.635  111.898 -20.711 1.00 113.50 ?  6    ILE A CD1    1 
ATOM   34    N  N      . SER A  1 7    ? 58.460  108.191 -22.151 1.00 113.29 ?  7    SER A N      1 
ATOM   35    C  CA     . SER A  1 7    ? 58.846  108.052 -23.542 1.00 113.27 ?  7    SER A CA     1 
ATOM   36    C  C      . SER A  1 7    ? 58.275  109.193 -24.385 1.00 113.75 ?  7    SER A C      1 
ATOM   37    O  O      . SER A  1 7    ? 57.289  109.830 -23.998 1.00 109.90 ?  7    SER A O      1 
ATOM   38    C  CB     . SER A  1 7    ? 58.413  106.698 -24.097 1.00 119.16 ?  7    SER A CB     1 
ATOM   39    O  OG     . SER A  1 7    ? 57.015  106.670 -24.315 1.00 130.16 ?  7    SER A OG     1 
ATOM   40    N  N      . GLU A  1 8    ? 58.908  109.439 -25.547 1.00 111.98 ?  8    GLU A N      1 
ATOM   41    C  CA     . GLU A  1 8    ? 58.450  110.416 -26.519 1.00 111.97 ?  8    GLU A CA     1 
ATOM   42    C  C      . GLU A  1 8    ? 57.022  110.065 -26.959 1.00 117.99 ?  8    GLU A C      1 
ATOM   43    O  O      . GLU A  1 8    ? 56.180  110.964 -27.050 1.00 117.48 ?  8    GLU A O      1 
ATOM   44    C  CB     . GLU A  1 8    ? 59.383  110.426 -27.724 1.00 114.70 ?  8    GLU A CB     1 
ATOM   45    C  CG     . GLU A  1 8    ? 58.969  111.416 -28.792 1.00 130.88 ?  8    GLU A CG     1 
ATOM   46    C  CD     . GLU A  1 8    ? 59.999  111.636 -29.877 1.00 159.97 ?  8    GLU A CD     1 
ATOM   47    O  OE1    . GLU A  1 8    ? 61.167  111.220 -29.697 1.00 149.09 ?  8    GLU A OE1    1 
ATOM   48    O  OE2    . GLU A  1 8    ? 59.640  112.260 -30.901 1.00 161.42 -1 8    GLU A OE2    1 
ATOM   49    N  N      . GLN A  1 9    ? 56.740  108.758 -27.200 1.00 115.39 ?  9    GLN A N      1 
ATOM   50    C  CA     . GLN A  1 9    ? 55.398  108.320 -27.577 1.00 115.88 ?  9    GLN A CA     1 
ATOM   51    C  C      . GLN A  1 9    ? 54.379  108.661 -26.504 1.00 115.84 ?  9    GLN A C      1 
ATOM   52    O  O      . GLN A  1 9    ? 53.321  109.190 -26.835 1.00 116.38 ?  9    GLN A O      1 
ATOM   53    C  CB     . GLN A  1 9    ? 55.364  106.832 -27.883 1.00 120.04 ?  9    GLN A CB     1 
ATOM   54    C  CG     . GLN A  1 9    ? 53.994  106.401 -28.428 1.00 142.89 ?  9    GLN A CG     1 
ATOM   55    C  CD     . GLN A  1 9    ? 53.936  104.929 -28.667 1.00 165.28 ?  9    GLN A CD     1 
ATOM   56    O  OE1    . GLN A  1 9    ? 54.958  104.300 -28.935 1.00 162.36 ?  9    GLN A OE1    1 
ATOM   57    N  NE2    . GLN A  1 9    ? 52.748  104.349 -28.572 1.00 159.46 ?  9    GLN A NE2    1 
ATOM   58    N  N      . THR A  1 10   ? 54.705  108.378 -25.228 1.00 109.01 ?  10   THR A N      1 
ATOM   59    C  CA     . THR A  1 10   ? 53.845  108.677 -24.092 1.00 107.10 ?  10   THR A CA     1 
ATOM   60    C  C      . THR A  1 10   ? 53.519  110.170 -24.071 1.00 111.17 ?  10   THR A C      1 
ATOM   61    O  O      . THR A  1 10   ? 52.334  110.527 -24.003 1.00 112.08 ?  10   THR A O      1 
ATOM   62    C  CB     . THR A  1 10   ? 54.497  108.224 -22.768 1.00 105.85 ?  10   THR A CB     1 
ATOM   63    O  OG1    . THR A  1 10   ? 54.613  106.808 -22.718 1.00 106.20 ?  10   THR A OG1    1 
ATOM   64    C  CG2    . THR A  1 10   ? 53.723  108.678 -21.551 1.00 100.29 ?  10   THR A CG2    1 
ATOM   65    N  N      . GLY A  1 11   ? 54.556  111.015 -24.135 1.00 105.95 ?  11   GLY A N      1 
ATOM   66    C  CA     . GLY A  1 11   ? 54.380  112.461 -24.104 1.00 104.50 ?  11   GLY A CA     1 
ATOM   67    C  C      . GLY A  1 11   ? 53.532  112.992 -25.247 1.00 110.04 ?  11   GLY A C      1 
ATOM   68    O  O      . GLY A  1 11   ? 52.619  113.803 -25.037 1.00 109.33 ?  11   GLY A O      1 
ATOM   69    N  N      . LYS A  1 12   ? 53.802  112.514 -26.470 1.00 108.15 ?  12   LYS A N      1 
ATOM   70    C  CA     . LYS A  1 12   ? 53.051  112.959 -27.645 1.00 109.72 ?  12   LYS A CA     1 
ATOM   71    C  C      . LYS A  1 12   ? 51.602  112.535 -27.565 1.00 116.21 ?  12   LYS A C      1 
ATOM   72    O  O      . LYS A  1 12   ? 50.727  113.331 -27.892 1.00 117.07 ?  12   LYS A O      1 
ATOM   73    C  CB     . LYS A  1 12   ? 53.698  112.454 -28.941 1.00 113.27 ?  12   LYS A CB     1 
ATOM   74    C  CG     . LYS A  1 12   ? 54.942  113.227 -29.330 1.00 116.21 ?  12   LYS A CG     1 
ATOM   75    C  CD     . LYS A  1 12   ? 55.488  112.788 -30.660 1.00 123.26 ?  12   LYS A CD     1 
ATOM   76    C  CE     . LYS A  1 12   ? 56.558  113.749 -31.102 1.00 137.38 ?  12   LYS A CE     1 
ATOM   77    N  NZ     . LYS A  1 12   ? 57.390  113.204 -32.205 1.00 151.59 1  12   LYS A NZ     1 
ATOM   78    N  N      . GLU A  1 13   ? 51.341  111.298 -27.112 1.00 114.09 ?  13   GLU A N      1 
ATOM   79    C  CA     . GLU A  1 13   ? 49.982  110.787 -26.969 1.00 116.76 ?  13   GLU A CA     1 
ATOM   80    C  C      . GLU A  1 13   ? 49.209  111.663 -26.017 1.00 120.63 ?  13   GLU A C      1 
ATOM   81    O  O      . GLU A  1 13   ? 48.088  112.055 -26.335 1.00 122.78 ?  13   GLU A O      1 
ATOM   82    C  CB     . GLU A  1 13   ? 50.028  109.373 -26.413 1.00 119.26 ?  13   GLU A CB     1 
ATOM   83    C  CG     . GLU A  1 13   ? 48.871  108.476 -26.781 1.00 139.55 ?  13   GLU A CG     1 
ATOM   84    C  CD     . GLU A  1 13   ? 49.338  107.027 -26.776 1.00 182.18 ?  13   GLU A CD     1 
ATOM   85    O  OE1    . GLU A  1 13   ? 50.172  106.657 -27.638 1.00 182.92 ?  13   GLU A OE1    1 
ATOM   86    O  OE2    . GLU A  1 13   ? 48.943  106.286 -25.848 1.00 190.13 -1 13   GLU A OE2    1 
ATOM   87    N  N      . LEU A  1 14   ? 49.816  112.000 -24.865 1.00 113.80 ?  14   LEU A N      1 
ATOM   88    C  CA     . LEU A  1 14   ? 49.176  112.868 -23.891 1.00 112.76 ?  14   LEU A CA     1 
ATOM   89    C  C      . LEU A  1 14   ? 48.953  114.258 -24.470 1.00 118.61 ?  14   LEU A C      1 
ATOM   90    O  O      . LEU A  1 14   ? 47.858  114.799 -24.339 1.00 119.75 ?  14   LEU A O      1 
ATOM   91    C  CB     . LEU A  1 14   ? 49.997  112.954 -22.597 1.00 109.60 ?  14   LEU A CB     1 
ATOM   92    C  CG     . LEU A  1 14   ? 50.116  111.675 -21.805 1.00 113.27 ?  14   LEU A CG     1 
ATOM   93    C  CD1    . LEU A  1 14   ? 51.167  111.816 -20.751 1.00 110.15 ?  14   LEU A CD1    1 
ATOM   94    C  CD2    . LEU A  1 14   ? 48.776  111.243 -21.185 1.00 117.23 ?  14   LEU A CD2    1 
ATOM   95    N  N      . LEU A  1 15   ? 49.974  114.830 -25.123 1.00 115.51 ?  15   LEU A N      1 
ATOM   96    C  CA     . LEU A  1 15   ? 49.858  116.161 -25.710 1.00 116.53 ?  15   LEU A CA     1 
ATOM   97    C  C      . LEU A  1 15   ? 48.702  116.218 -26.709 1.00 123.18 ?  15   LEU A C      1 
ATOM   98    O  O      . LEU A  1 15   ? 47.810  117.055 -26.570 1.00 123.14 ?  15   LEU A O      1 
ATOM   99    C  CB     . LEU A  1 15   ? 51.188  116.585 -26.360 1.00 115.28 ?  15   LEU A CB     1 
ATOM   100   C  CG     . LEU A  1 15   ? 51.289  118.046 -26.806 1.00 119.48 ?  15   LEU A CG     1 
ATOM   101   C  CD1    . LEU A  1 15   ? 52.689  118.513 -26.702 1.00 117.44 ?  15   LEU A CD1    1 
ATOM   102   C  CD2    . LEU A  1 15   ? 50.778  118.237 -28.226 1.00 123.72 ?  15   LEU A CD2    1 
ATOM   103   N  N      . TYR A  1 16   ? 48.711  115.314 -27.690 1.00 121.57 ?  16   TYR A N      1 
ATOM   104   C  CA     . TYR A  1 16   ? 47.664  115.254 -28.692 1.00 125.13 ?  16   TYR A CA     1 
ATOM   105   C  C      . TYR A  1 16   ? 46.278  115.078 -28.040 1.00 131.53 ?  16   TYR A C      1 
ATOM   106   O  O      . TYR A  1 16   ? 45.326  115.764 -28.420 1.00 133.39 ?  16   TYR A O      1 
ATOM   107   C  CB     . TYR A  1 16   ? 47.947  114.129 -29.688 1.00 127.82 ?  16   TYR A CB     1 
ATOM   108   C  CG     . TYR A  1 16   ? 49.181  114.312 -30.538 1.00 129.47 ?  16   TYR A CG     1 
ATOM   109   C  CD1    . TYR A  1 16   ? 49.555  115.568 -30.999 1.00 132.21 ?  16   TYR A CD1    1 
ATOM   110   C  CD2    . TYR A  1 16   ? 49.938  113.218 -30.944 1.00 130.20 ?  16   TYR A CD2    1 
ATOM   111   C  CE1    . TYR A  1 16   ? 50.676  115.737 -31.821 1.00 134.88 ?  16   TYR A CE1    1 
ATOM   112   C  CE2    . TYR A  1 16   ? 51.050  113.369 -31.779 1.00 130.78 ?  16   TYR A CE2    1 
ATOM   113   C  CZ     . TYR A  1 16   ? 51.420  114.635 -32.214 1.00 139.43 ?  16   TYR A CZ     1 
ATOM   114   O  OH     . TYR A  1 16   ? 52.513  114.824 -33.040 1.00 137.30 ?  16   TYR A OH     1 
ATOM   115   N  N      . LYS A  1 17   ? 46.188  114.204 -27.021 1.00 126.69 ?  17   LYS A N      1 
ATOM   116   C  CA     . LYS A  1 17   ? 44.947  113.942 -26.300 1.00 127.75 ?  17   LYS A CA     1 
ATOM   117   C  C      . LYS A  1 17   ? 44.424  115.149 -25.556 1.00 130.22 ?  17   LYS A C      1 
ATOM   118   O  O      . LYS A  1 17   ? 43.218  115.352 -25.550 1.00 133.60 ?  17   LYS A O      1 
ATOM   119   C  CB     . LYS A  1 17   ? 45.163  112.832 -25.249 1.00 128.75 ?  17   LYS A CB     1 
ATOM   120   C  CG     . LYS A  1 17   ? 44.649  111.441 -25.586 1.00 142.02 ?  17   LYS A CG     1 
ATOM   121   C  CD     . LYS A  1 17   ? 44.969  110.449 -24.440 1.00 147.00 ?  17   LYS A CD     1 
ATOM   122   C  CE     . LYS A  1 17   ? 43.914  110.085 -23.411 1.00 149.65 ?  17   LYS A CE     1 
ATOM   123   N  NZ     . LYS A  1 17   ? 44.500  109.245 -22.316 1.00 145.11 1  17   LYS A NZ     1 
ATOM   124   N  N      . PHE A  1 18   ? 45.297  115.908 -24.874 1.00 122.43 ?  18   PHE A N      1 
ATOM   125   C  CA     . PHE A  1 18   ? 44.851  116.907 -23.919 1.00 121.30 ?  18   PHE A CA     1 
ATOM   126   C  C      . PHE A  1 18   ? 45.152  118.381 -24.192 1.00 127.32 ?  18   PHE A C      1 
ATOM   127   O  O      . PHE A  1 18   ? 44.478  119.204 -23.597 1.00 128.95 ?  18   PHE A O      1 
ATOM   128   C  CB     . PHE A  1 18   ? 45.410  116.539 -22.542 1.00 119.17 ?  18   PHE A CB     1 
ATOM   129   C  CG     . PHE A  1 18   ? 44.868  115.236 -21.994 1.00 120.25 ?  18   PHE A CG     1 
ATOM   130   C  CD1    . PHE A  1 18   ? 43.589  115.162 -21.481 1.00 125.16 ?  18   PHE A CD1    1 
ATOM   131   C  CD2    . PHE A  1 18   ? 45.661  114.098 -21.942 1.00 120.41 ?  18   PHE A CD2    1 
ATOM   132   C  CE1    . PHE A  1 18   ? 43.101  113.967 -20.964 1.00 127.05 ?  18   PHE A CE1    1 
ATOM   133   C  CE2    . PHE A  1 18   ? 45.167  112.894 -21.439 1.00 123.83 ?  18   PHE A CE2    1 
ATOM   134   C  CZ     . PHE A  1 18   ? 43.892  112.838 -20.956 1.00 124.48 ?  18   PHE A CZ     1 
ATOM   135   N  N      . ILE A  1 19   ? 46.116  118.737 -25.041 1.00 124.24 ?  19   ILE A N      1 
ATOM   136   C  CA     . ILE A  1 19   ? 46.415  120.148 -25.284 1.00 125.43 ?  19   ILE A CA     1 
ATOM   137   C  C      . ILE A  1 19   ? 45.202  120.901 -25.824 1.00 137.21 ?  19   ILE A C      1 
ATOM   138   O  O      . ILE A  1 19   ? 44.422  120.361 -26.605 1.00 138.45 ?  19   ILE A O      1 
ATOM   139   C  CB     . ILE A  1 19   ? 47.681  120.364 -26.155 1.00 127.15 ?  19   ILE A CB     1 
ATOM   140   C  CG1    . ILE A  1 19   ? 48.269  121.784 -25.941 1.00 127.21 ?  19   ILE A CG1    1 
ATOM   141   C  CG2    . ILE A  1 19   ? 47.400  120.091 -27.621 1.00 130.10 ?  19   ILE A CG2    1 
ATOM   142   C  CD1    . ILE A  1 19   ? 49.573  122.086 -26.653 1.00 133.07 ?  19   ILE A CD1    1 
ATOM   143   N  N      . CYS A  1 20   ? 45.043  122.144 -25.383 1.00 139.63 ?  20   CYS A N      1 
ATOM   144   C  CA     . CYS A  1 20   ? 43.939  123.001 -25.808 1.00 146.47 ?  20   CYS A CA     1 
ATOM   145   C  C      . CYS A  1 20   ? 44.521  124.228 -26.457 1.00 153.89 ?  20   CYS A C      1 
ATOM   146   O  O      . CYS A  1 20   ? 45.162  125.013 -25.763 1.00 152.88 ?  20   CYS A O      1 
ATOM   147   C  CB     . CYS A  1 20   ? 43.074  123.373 -24.606 1.00 149.18 ?  20   CYS A CB     1 
ATOM   148   S  SG     . CYS A  1 20   ? 41.328  123.640 -25.000 1.00 159.36 ?  20   CYS A SG     1 
ATOM   149   N  N      . THR A  1 21   ? 44.342  124.396 -27.774 1.00 154.27 ?  21   THR A N      1 
ATOM   150   C  CA     . THR A  1 21   ? 44.914  125.535 -28.494 1.00 155.82 ?  21   THR A CA     1 
ATOM   151   C  C      . THR A  1 21   ? 44.012  125.906 -29.644 1.00 166.87 ?  21   THR A C      1 
ATOM   152   O  O      . THR A  1 21   ? 43.206  125.091 -30.098 1.00 168.82 ?  21   THR A O      1 
ATOM   153   C  CB     . THR A  1 21   ? 46.407  125.242 -28.870 1.00 157.03 ?  21   THR A CB     1 
ATOM   154   O  OG1    . THR A  1 21   ? 47.049  126.390 -29.401 1.00 161.73 ?  21   THR A OG1    1 
ATOM   155   C  CG2    . THR A  1 21   ? 46.607  124.027 -29.767 1.00 151.02 ?  21   THR A CG2    1 
ATOM   156   N  N      . THR A  1 22   ? 44.117  127.154 -30.082 1.00 166.73 ?  22   THR A N      1 
ATOM   157   C  CA     . THR A  1 22   ? 43.447  127.665 -31.277 1.00 171.37 ?  22   THR A CA     1 
ATOM   158   C  C      . THR A  1 22   ? 44.255  127.165 -32.479 1.00 176.68 ?  22   THR A C      1 
ATOM   159   O  O      . THR A  1 22   ? 43.686  126.967 -33.553 1.00 178.79 ?  22   THR A O      1 
ATOM   160   C  CB     . THR A  1 22   ? 43.427  129.191 -31.273 1.00 177.74 ?  22   THR A CB     1 
ATOM   161   O  OG1    . THR A  1 22   ? 42.711  129.665 -30.136 1.00 175.54 ?  22   THR A OG1    1 
ATOM   162   C  CG2    . THR A  1 22   ? 42.837  129.762 -32.533 1.00 182.32 ?  22   THR A CG2    1 
ATOM   163   N  N      . SER A  1 23   ? 45.592  126.967 -32.281 1.00 172.12 ?  23   SER A N      1 
ATOM   164   C  CA     . SER A  1 23   ? 46.568  126.469 -33.264 1.00 171.68 ?  23   SER A CA     1 
ATOM   165   C  C      . SER A  1 23   ? 46.166  125.084 -33.738 1.00 177.18 ?  23   SER A C      1 
ATOM   166   O  O      . SER A  1 23   ? 45.860  124.199 -32.926 1.00 176.27 ?  23   SER A O      1 
ATOM   167   C  CB     . SER A  1 23   ? 47.975  126.385 -32.664 1.00 171.30 ?  23   SER A CB     1 
ATOM   168   O  OG     . SER A  1 23   ? 48.373  127.586 -32.035 1.00 181.28 ?  23   SER A OG     1 
ATOM   169   N  N      . ALA A  1 24   ? 46.164  124.891 -35.056 1.00 175.09 ?  24   ALA A N      1 
ATOM   170   C  CA     . ALA A  1 24   ? 45.846  123.585 -35.600 1.00 174.64 ?  24   ALA A CA     1 
ATOM   171   C  C      . ALA A  1 24   ? 47.120  122.732 -35.513 1.00 170.77 ?  24   ALA A C      1 
ATOM   172   O  O      . ALA A  1 24   ? 48.114  123.008 -36.203 1.00 170.58 ?  24   ALA A O      1 
ATOM   173   C  CB     . ALA A  1 24   ? 45.345  123.711 -37.034 1.00 179.84 ?  24   ALA A CB     1 
ATOM   174   N  N      . ILE A  1 25   ? 47.122  121.756 -34.586 1.00 159.53 ?  25   ILE A N      1 
ATOM   175   C  CA     . ILE A  1 25   ? 48.250  120.846 -34.454 1.00 153.13 ?  25   ILE A CA     1 
ATOM   176   C  C      . ILE A  1 25   ? 48.047  119.753 -35.485 1.00 158.57 ?  25   ILE A C      1 
ATOM   177   O  O      . ILE A  1 25   ? 46.988  119.116 -35.542 1.00 160.58 ?  25   ILE A O      1 
ATOM   178   C  CB     . ILE A  1 25   ? 48.439  120.308 -33.030 1.00 151.00 ?  25   ILE A CB     1 
ATOM   179   C  CG1    . ILE A  1 25   ? 48.765  121.467 -32.079 1.00 148.29 ?  25   ILE A CG1    1 
ATOM   180   C  CG2    . ILE A  1 25   ? 49.531  119.232 -33.023 1.00 148.33 ?  25   ILE A CG2    1 
ATOM   181   C  CD1    . ILE A  1 25   ? 48.857  121.140 -30.707 1.00 147.06 ?  25   ILE A CD1    1 
ATOM   182   N  N      . GLN A  1 26   ? 49.038  119.600 -36.342 1.00 146.95 ?  26   GLN A N      1 
ATOM   183   C  CA     . GLN A  1 26   ? 48.999  118.650 -37.428 1.00 147.20 ?  26   GLN A CA     1 
ATOM   184   C  C      . GLN A  1 26   ? 49.578  117.316 -36.992 1.00 149.38 ?  26   GLN A C      1 
ATOM   185   O  O      . GLN A  1 26   ? 50.294  117.230 -35.982 1.00 146.64 ?  26   GLN A O      1 
ATOM   186   C  CB     . GLN A  1 26   ? 49.764  119.201 -38.649 1.00 149.51 ?  26   GLN A CB     1 
ATOM   187   C  CG     . GLN A  1 26   ? 49.390  120.607 -39.082 1.00 160.43 ?  26   GLN A CG     1 
ATOM   188   C  CD     . GLN A  1 26   ? 47.977  120.707 -39.557 1.00 180.48 ?  26   GLN A CD     1 
ATOM   189   O  OE1    . GLN A  1 26   ? 47.535  119.967 -40.434 1.00 179.10 ?  26   GLN A OE1    1 
ATOM   190   N  NE2    . GLN A  1 26   ? 47.270  121.679 -39.031 1.00 172.66 ?  26   GLN A NE2    1 
ATOM   191   N  N      . ASN A  1 27   ? 49.258  116.266 -37.779 1.00 146.46 ?  27   ASN A N      1 
ATOM   192   C  CA     . ASN A  1 27   ? 49.734  114.894 -37.605 1.00 143.43 ?  27   ASN A CA     1 
ATOM   193   C  C      . ASN A  1 27   ? 49.412  114.320 -36.233 1.00 142.53 ?  27   ASN A C      1 
ATOM   194   O  O      . ASN A  1 27   ? 50.167  113.498 -35.710 1.00 139.86 ?  27   ASN A O      1 
ATOM   195   C  CB     . ASN A  1 27   ? 51.227  114.798 -37.928 1.00 143.97 ?  27   ASN A CB     1 
ATOM   196   C  CG     . ASN A  1 27   ? 51.564  114.997 -39.386 1.00 169.92 ?  27   ASN A CG     1 
ATOM   197   O  OD1    . ASN A  1 27   ? 50.727  114.870 -40.292 1.00 167.05 ?  27   ASN A OD1    1 
ATOM   198   N  ND2    . ASN A  1 27   ? 52.825  115.285 -39.641 1.00 159.48 ?  27   ASN A ND2    1 
ATOM   199   N  N      . ARG A  1 28   ? 48.268  114.726 -35.664 1.00 138.25 ?  28   ARG A N      1 
ATOM   200   C  CA     . ARG A  1 28   ? 47.833  114.227 -34.369 1.00 135.96 ?  28   ARG A CA     1 
ATOM   201   C  C      . ARG A  1 28   ? 47.655  112.714 -34.426 1.00 138.19 ?  28   ARG A C      1 
ATOM   202   O  O      . ARG A  1 28   ? 47.032  112.195 -35.354 1.00 138.53 ?  28   ARG A O      1 
ATOM   203   C  CB     . ARG A  1 28   ? 46.554  114.933 -33.906 1.00 136.43 ?  28   ARG A CB     1 
ATOM   204   C  CG     . ARG A  1 28   ? 46.796  116.387 -33.510 1.00 143.08 ?  28   ARG A CG     1 
ATOM   205   C  CD     . ARG A  1 28   ? 45.531  117.136 -33.127 1.00 150.06 ?  28   ARG A CD     1 
ATOM   206   N  NE     . ARG A  1 28   ? 45.002  116.718 -31.825 1.00 147.63 ?  28   ARG A NE     1 
ATOM   207   C  CZ     . ARG A  1 28   ? 43.935  115.945 -31.668 1.00 161.15 ?  28   ARG A CZ     1 
ATOM   208   N  NH1    . ARG A  1 28   ? 43.523  115.612 -30.452 1.00 143.38 1  28   ARG A NH1    1 
ATOM   209   N  NH2    . ARG A  1 28   ? 43.264  115.504 -32.725 1.00 155.43 ?  28   ARG A NH2    1 
ATOM   210   N  N      . PHE A  1 29   ? 48.309  112.013 -33.482 1.00 132.85 ?  29   PHE A N      1 
ATOM   211   C  CA     . PHE A  1 29   ? 48.318  110.553 -33.298 1.00 131.59 ?  29   PHE A CA     1 
ATOM   212   C  C      . PHE A  1 29   ? 48.948  109.782 -34.441 1.00 133.53 ?  29   PHE A C      1 
ATOM   213   O  O      . PHE A  1 29   ? 48.815  108.556 -34.510 1.00 132.26 ?  29   PHE A O      1 
ATOM   214   C  CB     . PHE A  1 29   ? 46.916  110.026 -33.001 1.00 135.28 ?  29   PHE A CB     1 
ATOM   215   C  CG     . PHE A  1 29   ? 46.248  110.732 -31.855 1.00 137.54 ?  29   PHE A CG     1 
ATOM   216   C  CD1    . PHE A  1 29   ? 46.648  110.487 -30.544 1.00 139.72 ?  29   PHE A CD1    1 
ATOM   217   C  CD2    . PHE A  1 29   ? 45.230  111.654 -32.085 1.00 142.00 ?  29   PHE A CD2    1 
ATOM   218   C  CE1    . PHE A  1 29   ? 46.033  111.141 -29.483 1.00 141.56 ?  29   PHE A CE1    1 
ATOM   219   C  CE2    . PHE A  1 29   ? 44.610  112.307 -31.028 1.00 145.90 ?  29   PHE A CE2    1 
ATOM   220   C  CZ     . PHE A  1 29   ? 45.007  112.042 -29.734 1.00 142.81 ?  29   PHE A CZ     1 
ATOM   221   N  N      . LYS A  1 30   ? 49.667  110.488 -35.310 1.00 130.18 ?  30   LYS A N      1 
ATOM   222   C  CA     . LYS A  1 30   ? 50.346  109.849 -36.420 1.00 129.82 ?  30   LYS A CA     1 
ATOM   223   C  C      . LYS A  1 30   ? 51.745  109.371 -36.029 1.00 130.36 ?  30   LYS A C      1 
ATOM   224   O  O      . LYS A  1 30   ? 52.748  109.992 -36.353 1.00 126.99 ?  30   LYS A O      1 
ATOM   225   C  CB     . LYS A  1 30   ? 50.338  110.734 -37.676 1.00 133.11 ?  30   LYS A CB     1 
ATOM   226   C  CG     . LYS A  1 30   ? 48.975  110.794 -38.338 1.00 137.95 ?  30   LYS A CG     1 
ATOM   227   C  CD     . LYS A  1 30   ? 49.081  111.036 -39.810 1.00 141.86 ?  30   LYS A CD     1 
ATOM   228   C  CE     . LYS A  1 30   ? 47.712  111.151 -40.425 1.00 153.87 ?  30   LYS A CE     1 
ATOM   229   N  NZ     . LYS A  1 30   ? 47.736  111.881 -41.726 1.00 161.98 1  30   LYS A NZ     1 
ATOM   230   N  N      . TYR A  1 31   ? 51.790  108.266 -35.305 1.00 128.44 ?  31   TYR A N      1 
ATOM   231   C  CA     . TYR A  1 31   ? 53.020  107.592 -34.923 1.00 128.27 ?  31   TYR A CA     1 
ATOM   232   C  C      . TYR A  1 31   ? 52.751  106.106 -34.847 1.00 131.91 ?  31   TYR A C      1 
ATOM   233   O  O      . TYR A  1 31   ? 51.638  105.687 -34.515 1.00 132.15 ?  31   TYR A O      1 
ATOM   234   C  CB     . TYR A  1 31   ? 53.636  108.114 -33.600 1.00 129.24 ?  31   TYR A CB     1 
ATOM   235   C  CG     . TYR A  1 31   ? 52.633  108.277 -32.493 1.00 133.28 ?  31   TYR A CG     1 
ATOM   236   C  CD1    . TYR A  1 31   ? 52.157  107.173 -31.787 1.00 135.64 ?  31   TYR A CD1    1 
ATOM   237   C  CD2    . TYR A  1 31   ? 52.124  109.527 -32.174 1.00 135.25 ?  31   TYR A CD2    1 
ATOM   238   C  CE1    . TYR A  1 31   ? 51.177  107.307 -30.813 1.00 137.52 ?  31   TYR A CE1    1 
ATOM   239   C  CE2    . TYR A  1 31   ? 51.157  109.678 -31.188 1.00 137.24 ?  31   TYR A CE2    1 
ATOM   240   C  CZ     . TYR A  1 31   ? 50.683  108.564 -30.514 1.00 147.09 ?  31   TYR A CZ     1 
ATOM   241   O  OH     . TYR A  1 31   ? 49.719  108.732 -29.564 1.00 151.37 ?  31   TYR A OH     1 
ATOM   242   N  N      . ALA A  1 32   ? 53.763  105.309 -35.165 1.00 127.46 ?  32   ALA A N      1 
ATOM   243   C  CA     . ALA A  1 32   ? 53.683  103.857 -35.091 1.00 127.09 ?  32   ALA A CA     1 
ATOM   244   C  C      . ALA A  1 32   ? 54.928  103.379 -34.354 1.00 128.54 ?  32   ALA A C      1 
ATOM   245   O  O      . ALA A  1 32   ? 56.038  103.844 -34.624 1.00 127.42 ?  32   ALA A O      1 
ATOM   246   C  CB     . ALA A  1 32   ? 53.598  103.249 -36.485 1.00 129.56 ?  32   ALA A CB     1 
ATOM   247   N  N      . ARG A  1 33   ? 54.733  102.493 -33.386 1.00 123.90 ?  33   ARG A N      1 
ATOM   248   C  CA     . ARG A  1 33   ? 55.810  101.959 -32.561 1.00 122.18 ?  33   ARG A CA     1 
ATOM   249   C  C      . ARG A  1 33   ? 56.240  100.616 -33.100 1.00 127.61 ?  33   ARG A C      1 
ATOM   250   O  O      . ARG A  1 33   ? 55.395  99.743  -33.364 1.00 128.93 ?  33   ARG A O      1 
ATOM   251   C  CB     . ARG A  1 33   ? 55.324  101.840 -31.115 1.00 121.17 ?  33   ARG A CB     1 
ATOM   252   C  CG     . ARG A  1 33   ? 56.271  101.200 -30.114 1.00 125.29 ?  33   ARG A CG     1 
ATOM   253   C  CD     . ARG A  1 33   ? 55.518  101.021 -28.813 1.00 126.07 ?  33   ARG A CD     1 
ATOM   254   N  NE     . ARG A  1 33   ? 56.367  100.491 -27.759 1.00 134.55 ?  33   ARG A NE     1 
ATOM   255   C  CZ     . ARG A  1 33   ? 56.045  100.503 -26.474 1.00 152.45 ?  33   ARG A CZ     1 
ATOM   256   N  NH1    . ARG A  1 33   ? 54.883  101.018 -26.077 1.00 137.46 1  33   ARG A NH1    1 
ATOM   257   N  NH2    . ARG A  1 33   ? 56.871  99.980  -25.572 1.00 140.92 ?  33   ARG A NH2    1 
ATOM   258   N  N      . VAL A  1 34   ? 57.559  100.445 -33.246 1.00 123.08 ?  34   VAL A N      1 
ATOM   259   C  CA     . VAL A  1 34   ? 58.135  99.216  -33.769 1.00 123.87 ?  34   VAL A CA     1 
ATOM   260   C  C      . VAL A  1 34   ? 59.114  98.622  -32.772 1.00 130.13 ?  34   VAL A C      1 
ATOM   261   O  O      . VAL A  1 34   ? 59.955  99.336  -32.227 1.00 128.87 ?  34   VAL A O      1 
ATOM   262   C  CB     . VAL A  1 34   ? 58.741  99.424  -35.166 1.00 126.78 ?  34   VAL A CB     1 
ATOM   263   C  CG1    . VAL A  1 34   ? 59.570  98.221  -35.586 1.00 127.87 ?  34   VAL A CG1    1 
ATOM   264   C  CG2    . VAL A  1 34   ? 57.644  99.696  -36.191 1.00 127.36 ?  34   VAL A CG2    1 
ATOM   265   N  N      . THR A  1 35   ? 58.948  97.318  -32.498 1.00 129.66 ?  35   THR A N      1 
ATOM   266   C  CA     . THR A  1 35   ? 59.794  96.530  -31.610 1.00 130.35 ?  35   THR A CA     1 
ATOM   267   C  C      . THR A  1 35   ? 60.236  95.284  -32.373 1.00 138.94 ?  35   THR A C      1 
ATOM   268   O  O      . THR A  1 35   ? 59.693  95.023  -33.455 1.00 140.05 ?  35   THR A O      1 
ATOM   269   C  CB     . THR A  1 35   ? 59.059  96.148  -30.308 1.00 137.85 ?  35   THR A CB     1 
ATOM   270   O  OG1    . THR A  1 35   ? 58.076  95.143  -30.560 1.00 138.17 ?  35   THR A OG1    1 
ATOM   271   C  CG2    . THR A  1 35   ? 58.447  97.337  -29.596 1.00 135.36 ?  35   THR A CG2    1 
ATOM   272   N  N      . PRO A  1 36   ? 61.172  94.463  -31.838 1.00 138.05 ?  36   PRO A N      1 
ATOM   273   C  CA     . PRO A  1 36   ? 61.571  93.253  -32.568 1.00 141.23 ?  36   PRO A CA     1 
ATOM   274   C  C      . PRO A  1 36   ? 60.442  92.223  -32.746 1.00 149.65 ?  36   PRO A C      1 
ATOM   275   O  O      . PRO A  1 36   ? 60.566  91.315  -33.573 1.00 153.34 ?  36   PRO A O      1 
ATOM   276   C  CB     . PRO A  1 36   ? 62.733  92.717  -31.734 1.00 143.38 ?  36   PRO A CB     1 
ATOM   277   C  CG     . PRO A  1 36   ? 63.224  93.912  -30.948 1.00 145.07 ?  36   PRO A CG     1 
ATOM   278   C  CD     . PRO A  1 36   ? 61.964  94.603  -30.599 1.00 138.85 ?  36   PRO A CD     1 
ATOM   279   N  N      . ASP A  1 37   ? 59.322  92.393  -32.019 1.00 145.42 ?  37   ASP A N      1 
ATOM   280   C  CA     . ASP A  1 37   ? 58.151  91.504  -32.065 1.00 147.09 ?  37   ASP A CA     1 
ATOM   281   C  C      . ASP A  1 37   ? 57.004  92.061  -32.908 1.00 148.79 ?  37   ASP A C      1 
ATOM   282   O  O      . ASP A  1 37   ? 55.912  91.499  -32.897 1.00 148.99 ?  37   ASP A O      1 
ATOM   283   C  CB     . ASP A  1 37   ? 57.660  91.235  -30.626 1.00 149.36 ?  37   ASP A CB     1 
ATOM   284   C  CG     . ASP A  1 37   ? 58.791  90.999  -29.632 1.00 169.99 ?  37   ASP A CG     1 
ATOM   285   O  OD1    . ASP A  1 37   ? 59.684  90.169  -29.935 1.00 173.61 ?  37   ASP A OD1    1 
ATOM   286   O  OD2    . ASP A  1 37   ? 58.843  91.727  -28.599 1.00 178.01 -1 37   ASP A OD2    1 
ATOM   287   N  N      . THR A  1 38   ? 57.236  93.162  -33.630 1.00 144.02 ?  38   THR A N      1 
ATOM   288   C  CA     . THR A  1 38   ? 56.173  93.785  -34.403 1.00 143.73 ?  38   THR A CA     1 
ATOM   289   C  C      . THR A  1 38   ? 55.617  92.886  -35.489 1.00 150.69 ?  38   THR A C      1 
ATOM   290   O  O      . THR A  1 38   ? 56.387  92.297  -36.253 1.00 151.96 ?  38   THR A O      1 
ATOM   291   C  CB     . THR A  1 38   ? 56.605  95.146  -34.976 1.00 147.75 ?  38   THR A CB     1 
ATOM   292   O  OG1    . THR A  1 38   ? 56.821  96.056  -33.901 1.00 145.09 ?  38   THR A OG1    1 
ATOM   293   C  CG2    . THR A  1 38   ? 55.543  95.752  -35.906 1.00 146.53 ?  38   THR A CG2    1 
ATOM   294   N  N      . ASP A  1 39   ? 54.263  92.806  -35.558 1.00 147.75 ?  39   ASP A N      1 
ATOM   295   C  CA     . ASP A  1 39   ? 53.547  92.142  -36.644 1.00 149.60 ?  39   ASP A CA     1 
ATOM   296   C  C      . ASP A  1 39   ? 53.281  93.266  -37.637 1.00 151.83 ?  39   ASP A C      1 
ATOM   297   O  O      . ASP A  1 39   ? 52.369  94.070  -37.435 1.00 150.02 ?  39   ASP A O      1 
ATOM   298   C  CB     . ASP A  1 39   ? 52.228  91.493  -36.180 1.00 152.20 ?  39   ASP A CB     1 
ATOM   299   C  CG     . ASP A  1 39   ? 51.360  90.922  -37.301 1.00 160.61 ?  39   ASP A CG     1 
ATOM   300   O  OD1    . ASP A  1 39   ? 51.810  90.914  -38.475 1.00 161.90 ?  39   ASP A OD1    1 
ATOM   301   O  OD2    . ASP A  1 39   ? 50.248  90.461  -37.005 1.00 166.24 -1 39   ASP A OD2    1 
ATOM   302   N  N      . TRP A  1 40   ? 54.095  93.326  -38.694 1.00 148.62 ?  40   TRP A N      1 
ATOM   303   C  CA     . TRP A  1 40   ? 54.038  94.382  -39.689 1.00 148.31 ?  40   TRP A CA     1 
ATOM   304   C  C      . TRP A  1 40   ? 52.729  94.441  -40.436 1.00 151.94 ?  40   TRP A C      1 
ATOM   305   O  O      . TRP A  1 40   ? 52.270  95.540  -40.748 1.00 150.87 ?  40   TRP A O      1 
ATOM   306   C  CB     . TRP A  1 40   ? 55.222  94.290  -40.628 1.00 149.18 ?  40   TRP A CB     1 
ATOM   307   C  CG     . TRP A  1 40   ? 56.456  94.782  -39.957 1.00 149.26 ?  40   TRP A CG     1 
ATOM   308   C  CD1    . TRP A  1 40   ? 57.238  94.097  -39.070 1.00 152.17 ?  40   TRP A CD1    1 
ATOM   309   C  CD2    . TRP A  1 40   ? 56.977  96.116  -40.007 1.00 147.62 ?  40   TRP A CD2    1 
ATOM   310   N  NE1    . TRP A  1 40   ? 58.251  94.909  -38.604 1.00 150.20 ?  40   TRP A NE1    1 
ATOM   311   C  CE2    . TRP A  1 40   ? 58.111  96.157  -39.162 1.00 150.98 ?  40   TRP A CE2    1 
ATOM   312   C  CE3    . TRP A  1 40   ? 56.614  97.281  -40.708 1.00 148.82 ?  40   TRP A CE3    1 
ATOM   313   C  CZ2    . TRP A  1 40   ? 58.894  97.313  -39.016 1.00 148.65 ?  40   TRP A CZ2    1 
ATOM   314   C  CZ3    . TRP A  1 40   ? 57.375  98.430  -40.541 1.00 148.79 ?  40   TRP A CZ3    1 
ATOM   315   C  CH2    . TRP A  1 40   ? 58.492  98.443  -39.696 1.00 148.02 ?  40   TRP A CH2    1 
ATOM   316   N  N      . ALA A  1 41   ? 52.096  93.282  -40.675 1.00 149.93 ?  41   ALA A N      1 
ATOM   317   C  CA     . ALA A  1 41   ? 50.787  93.209  -41.325 1.00 151.63 ?  41   ALA A CA     1 
ATOM   318   C  C      . ALA A  1 41   ? 49.754  93.945  -40.472 1.00 152.76 ?  41   ALA A C      1 
ATOM   319   O  O      . ALA A  1 41   ? 48.987  94.762  -40.996 1.00 153.26 ?  41   ALA A O      1 
ATOM   320   C  CB     . ALA A  1 41   ? 50.374  91.757  -41.510 1.00 155.64 ?  41   ALA A CB     1 
ATOM   321   N  N      . ARG A  1 42   ? 49.778  93.695  -39.152 1.00 146.02 ?  42   ARG A N      1 
ATOM   322   C  CA     . ARG A  1 42   ? 48.865  94.333  -38.225 1.00 144.28 ?  42   ARG A CA     1 
ATOM   323   C  C      . ARG A  1 42   ? 49.182  95.804  -38.063 1.00 148.78 ?  42   ARG A C      1 
ATOM   324   O  O      . ARG A  1 42   ? 48.262  96.614  -38.003 1.00 148.86 ?  42   ARG A O      1 
ATOM   325   C  CB     . ARG A  1 42   ? 48.878  93.627  -36.869 1.00 142.60 ?  42   ARG A CB     1 
ATOM   326   C  CG     . ARG A  1 42   ? 47.492  93.633  -36.196 1.00 155.68 ?  42   ARG A CG     1 
ATOM   327   C  CD     . ARG A  1 42   ? 47.463  93.140  -34.753 1.00 173.97 ?  42   ARG A CD     1 
ATOM   328   N  NE     . ARG A  1 42   ? 48.230  91.910  -34.511 1.00 197.55 ?  42   ARG A NE     1 
ATOM   329   C  CZ     . ARG A  1 42   ? 47.796  90.666  -34.733 1.00 223.56 ?  42   ARG A CZ     1 
ATOM   330   N  NH1    . ARG A  1 42   ? 48.580  89.627  -34.472 1.00 213.96 1  42   ARG A NH1    1 
ATOM   331   N  NH2    . ARG A  1 42   ? 46.581  90.455  -35.233 1.00 215.79 ?  42   ARG A NH2    1 
ATOM   332   N  N      . LEU A  1 43   ? 50.476  96.167  -38.013 1.00 145.68 ?  43   LEU A N      1 
ATOM   333   C  CA     . LEU A  1 43   ? 50.911  97.565  -37.888 1.00 143.04 ?  43   LEU A CA     1 
ATOM   334   C  C      . LEU A  1 43   ? 50.337  98.391  -39.042 1.00 146.02 ?  43   LEU A C      1 
ATOM   335   O  O      . LEU A  1 43   ? 49.792  99.469  -38.815 1.00 144.68 ?  43   LEU A O      1 
ATOM   336   C  CB     . LEU A  1 43   ? 52.451  97.641  -37.884 1.00 141.69 ?  43   LEU A CB     1 
ATOM   337   C  CG     . LEU A  1 43   ? 53.074  99.010  -37.647 1.00 144.29 ?  43   LEU A CG     1 
ATOM   338   C  CD1    . LEU A  1 43   ? 53.175  99.302  -36.187 1.00 143.29 ?  43   LEU A CD1    1 
ATOM   339   C  CD2    . LEU A  1 43   ? 54.460  99.076  -38.218 1.00 145.66 ?  43   LEU A CD2    1 
ATOM   340   N  N      . LEU A  1 44   ? 50.437  97.857  -40.270 1.00 143.25 ?  44   LEU A N      1 
ATOM   341   C  CA     . LEU A  1 44   ? 49.963  98.527  -41.467 1.00 144.09 ?  44   LEU A CA     1 
ATOM   342   C  C      . LEU A  1 44   ? 48.487  98.602  -41.513 1.00 148.83 ?  44   LEU A C      1 
ATOM   343   O  O      . LEU A  1 44   ? 47.957  99.601  -41.995 1.00 148.05 ?  44   LEU A O      1 
ATOM   344   C  CB     . LEU A  1 44   ? 50.524  97.870  -42.714 1.00 146.61 ?  44   LEU A CB     1 
ATOM   345   C  CG     . LEU A  1 44   ? 52.026  98.006  -42.816 1.00 150.90 ?  44   LEU A CG     1 
ATOM   346   C  CD1    . LEU A  1 44   ? 52.553  97.222  -43.981 1.00 151.89 ?  44   LEU A CD1    1 
ATOM   347   C  CD2    . LEU A  1 44   ? 52.448  99.454  -42.756 1.00 156.63 ?  44   LEU A CD2    1 
ATOM   348   N  N      . GLN A  1 45   ? 47.805  97.588  -40.987 1.00 147.71 ?  45   GLN A N      1 
ATOM   349   C  CA     . GLN A  1 45   ? 46.350  97.669  -40.937 1.00 149.75 ?  45   GLN A CA     1 
ATOM   350   C  C      . GLN A  1 45   ? 45.876  98.787  -39.998 1.00 154.47 ?  45   GLN A C      1 
ATOM   351   O  O      . GLN A  1 45   ? 44.946  99.506  -40.341 1.00 155.72 ?  45   GLN A O      1 
ATOM   352   C  CB     . GLN A  1 45   ? 45.717  96.324  -40.603 1.00 152.34 ?  45   GLN A CB     1 
ATOM   353   C  CG     . GLN A  1 45   ? 45.738  95.335  -41.791 1.00 158.36 ?  45   GLN A CG     1 
ATOM   354   C  CD     . GLN A  1 45   ? 45.248  95.852  -43.139 1.00 174.74 ?  45   GLN A CD     1 
ATOM   355   O  OE1    . GLN A  1 45   ? 46.004  96.473  -43.897 1.00 167.15 ?  45   GLN A OE1    1 
ATOM   356   N  NE2    . GLN A  1 45   ? 44.015  95.497  -43.530 1.00 169.24 ?  45   GLN A NE2    1 
ATOM   357   N  N      . ASP A  1 46   ? 46.569  98.983  -38.869 1.00 149.16 ?  46   ASP A N      1 
ATOM   358   C  CA     . ASP A  1 46   ? 46.236  100.009 -37.886 1.00 147.05 ?  46   ASP A CA     1 
ATOM   359   C  C      . ASP A  1 46   ? 46.729  101.391 -38.283 1.00 152.27 ?  46   ASP A C      1 
ATOM   360   O  O      . ASP A  1 46   ? 46.160  102.393 -37.843 1.00 151.76 ?  46   ASP A O      1 
ATOM   361   C  CB     . ASP A  1 46   ? 46.810  99.633  -36.518 1.00 145.93 ?  46   ASP A CB     1 
ATOM   362   C  CG     . ASP A  1 46   ? 46.322  98.320  -35.937 1.00 157.30 ?  46   ASP A CG     1 
ATOM   363   O  OD1    . ASP A  1 46   ? 45.177  97.905  -36.260 1.00 160.91 ?  46   ASP A OD1    1 
ATOM   364   O  OD2    . ASP A  1 46   ? 47.069  97.716  -35.138 1.00 162.36 -1 46   ASP A OD2    1 
ATOM   365   N  N      . HIS A  1 47   ? 47.784  101.456 -39.104 1.00 150.25 ?  47   HIS A N      1 
ATOM   366   C  CA     . HIS A  1 47   ? 48.376  102.726 -39.499 1.00 149.54 ?  47   HIS A CA     1 
ATOM   367   C  C      . HIS A  1 47   ? 48.514  102.819 -41.000 1.00 152.91 ?  47   HIS A C      1 
ATOM   368   O  O      . HIS A  1 47   ? 49.636  102.835 -41.512 1.00 151.80 ?  47   HIS A O      1 
ATOM   369   C  CB     . HIS A  1 47   ? 49.727  102.904 -38.811 1.00 148.57 ?  47   HIS A CB     1 
ATOM   370   C  CG     . HIS A  1 47   ? 49.643  102.828 -37.323 1.00 151.12 ?  47   HIS A CG     1 
ATOM   371   N  ND1    . HIS A  1 47   ? 50.006  101.679 -36.636 1.00 152.84 ?  47   HIS A ND1    1 
ATOM   372   C  CD2    . HIS A  1 47   ? 49.193  103.744 -36.435 1.00 152.62 ?  47   HIS A CD2    1 
ATOM   373   C  CE1    . HIS A  1 47   ? 49.801  101.942 -35.356 1.00 151.16 ?  47   HIS A CE1    1 
ATOM   374   N  NE2    . HIS A  1 47   ? 49.312  103.173 -35.184 1.00 151.29 ?  47   HIS A NE2    1 
ATOM   375   N  N      . PRO A  1 48   ? 47.380  102.909 -41.726 1.00 150.42 ?  48   PRO A N      1 
ATOM   376   C  CA     . PRO A  1 48   ? 47.450  102.997 -43.192 1.00 152.88 ?  48   PRO A CA     1 
ATOM   377   C  C      . PRO A  1 48   ? 48.156  104.248 -43.715 1.00 157.48 ?  48   PRO A C      1 
ATOM   378   O  O      . PRO A  1 48   ? 48.691  104.220 -44.831 1.00 158.91 ?  48   PRO A O      1 
ATOM   379   C  CB     . PRO A  1 48   ? 45.988  102.940 -43.618 1.00 157.31 ?  48   PRO A CB     1 
ATOM   380   C  CG     . PRO A  1 48   ? 45.241  103.412 -42.438 1.00 160.18 ?  48   PRO A CG     1 
ATOM   381   C  CD     . PRO A  1 48   ? 45.981  102.902 -41.265 1.00 152.59 ?  48   PRO A CD     1 
ATOM   382   N  N      . TRP A  1 49   ? 48.201  105.326 -42.901 1.00 151.99 ?  49   TRP A N      1 
ATOM   383   C  CA     . TRP A  1 49   ? 48.900  106.564 -43.262 1.00 151.13 ?  49   TRP A CA     1 
ATOM   384   C  C      . TRP A  1 49   ? 50.378  106.327 -43.522 1.00 150.94 ?  49   TRP A C      1 
ATOM   385   O  O      . TRP A  1 49   ? 51.026  107.182 -44.111 1.00 150.03 ?  49   TRP A O      1 
ATOM   386   C  CB     . TRP A  1 49   ? 48.726  107.635 -42.186 1.00 148.75 ?  49   TRP A CB     1 
ATOM   387   C  CG     . TRP A  1 49   ? 49.136  107.183 -40.818 1.00 147.66 ?  49   TRP A CG     1 
ATOM   388   C  CD1    . TRP A  1 49   ? 48.321  106.679 -39.849 1.00 150.39 ?  49   TRP A CD1    1 
ATOM   389   C  CD2    . TRP A  1 49   ? 50.466  107.169 -40.271 1.00 145.30 ?  49   TRP A CD2    1 
ATOM   390   N  NE1    . TRP A  1 49   ? 49.054  106.350 -38.735 1.00 147.60 ?  49   TRP A NE1    1 
ATOM   391   C  CE2    . TRP A  1 49   ? 50.376  106.638 -38.966 1.00 147.69 ?  49   TRP A CE2    1 
ATOM   392   C  CE3    . TRP A  1 49   ? 51.732  107.548 -40.758 1.00 145.97 ?  49   TRP A CE3    1 
ATOM   393   C  CZ2    . TRP A  1 49   ? 51.499  106.491 -38.135 1.00 144.50 ?  49   TRP A CZ2    1 
ATOM   394   C  CZ3    . TRP A  1 49   ? 52.840  107.407 -39.930 1.00 145.02 ?  49   TRP A CZ3    1 
ATOM   395   C  CH2    . TRP A  1 49   ? 52.717  106.881 -38.637 1.00 143.92 ?  49   TRP A CH2    1 
ATOM   396   N  N      . LEU A  1 50   ? 50.915  105.181 -43.081 1.00 145.71 ?  50   LEU A N      1 
ATOM   397   C  CA     . LEU A  1 50   ? 52.308  104.827 -43.306 1.00 144.61 ?  50   LEU A CA     1 
ATOM   398   C  C      . LEU A  1 50   ? 52.638  104.764 -44.788 1.00 151.47 ?  50   LEU A C      1 
ATOM   399   O  O      . LEU A  1 50   ? 53.805  104.913 -45.149 1.00 151.98 ?  50   LEU A O      1 
ATOM   400   C  CB     . LEU A  1 50   ? 52.658  103.495 -42.637 1.00 143.76 ?  50   LEU A CB     1 
ATOM   401   C  CG     . LEU A  1 50   ? 52.848  103.525 -41.130 1.00 145.91 ?  50   LEU A CG     1 
ATOM   402   C  CD1    . LEU A  1 50   ? 52.813  102.143 -40.582 1.00 145.92 ?  50   LEU A CD1    1 
ATOM   403   C  CD2    . LEU A  1 50   ? 54.171  104.203 -40.733 1.00 147.84 ?  50   LEU A CD2    1 
ATOM   404   N  N      . LEU A  1 51   ? 51.631  104.537 -45.644 1.00 149.58 ?  51   LEU A N      1 
ATOM   405   C  CA     . LEU A  1 51   ? 51.838  104.468 -47.093 1.00 151.86 ?  51   LEU A CA     1 
ATOM   406   C  C      . LEU A  1 51   ? 51.510  105.780 -47.831 1.00 158.31 ?  51   LEU A C      1 
ATOM   407   O  O      . LEU A  1 51   ? 51.791  105.898 -49.027 1.00 159.49 ?  51   LEU A O      1 
ATOM   408   C  CB     . LEU A  1 51   ? 51.002  103.321 -47.674 1.00 154.27 ?  51   LEU A CB     1 
ATOM   409   C  CG     . LEU A  1 51   ? 51.237  101.937 -47.071 1.00 157.62 ?  51   LEU A CG     1 
ATOM   410   C  CD1    . LEU A  1 51   ? 50.349  100.905 -47.699 1.00 161.06 ?  51   LEU A CD1    1 
ATOM   411   C  CD2    . LEU A  1 51   ? 52.648  101.509 -47.257 1.00 159.09 ?  51   LEU A CD2    1 
ATOM   412   N  N      . SER A  1 52   ? 50.936  106.765 -47.117 1.00 154.84 ?  52   SER A N      1 
ATOM   413   C  CA     . SER A  1 52   ? 50.439  108.021 -47.683 1.00 155.91 ?  52   SER A CA     1 
ATOM   414   C  C      . SER A  1 52   ? 51.504  109.070 -48.038 1.00 158.45 ?  52   SER A C      1 
ATOM   415   O  O      . SER A  1 52   ? 51.238  109.930 -48.879 1.00 160.27 ?  52   SER A O      1 
ATOM   416   C  CB     . SER A  1 52   ? 49.400  108.625 -46.748 1.00 157.98 ?  52   SER A CB     1 
ATOM   417   O  OG     . SER A  1 52   ? 48.392  107.667 -46.469 1.00 166.25 ?  52   SER A OG     1 
ATOM   418   N  N      . GLN A  1 53   ? 52.685  109.007 -47.404 1.00 151.13 ?  53   GLN A N      1 
ATOM   419   C  CA     . GLN A  1 53   ? 53.783  109.951 -47.600 1.00 149.30 ?  53   GLN A CA     1 
ATOM   420   C  C      . GLN A  1 53   ? 55.047  109.351 -47.019 1.00 148.26 ?  53   GLN A C      1 
ATOM   421   O  O      . GLN A  1 53   ? 55.000  108.289 -46.395 1.00 146.54 ?  53   GLN A O      1 
ATOM   422   C  CB     . GLN A  1 53   ? 53.466  111.326 -46.927 1.00 149.35 ?  53   GLN A CB     1 
ATOM   423   C  CG     . GLN A  1 53   ? 53.545  111.385 -45.381 1.00 140.20 ?  53   GLN A CG     1 
ATOM   424   C  CD     . GLN A  1 53   ? 52.494  110.547 -44.715 1.00 141.79 ?  53   GLN A CD     1 
ATOM   425   O  OE1    . GLN A  1 53   ? 51.331  110.913 -44.663 1.00 133.82 ?  53   GLN A OE1    1 
ATOM   426   N  NE2    . GLN A  1 53   ? 52.876  109.377 -44.250 1.00 132.78 ?  53   GLN A NE2    1 
ATOM   427   N  N      . ASN A  1 54   ? 56.172  110.059 -47.185 1.00 141.82 ?  54   ASN A N      1 
ATOM   428   C  CA     . ASN A  1 54   ? 57.429  109.621 -46.617 1.00 138.11 ?  54   ASN A CA     1 
ATOM   429   C  C      . ASN A  1 54   ? 57.441  109.777 -45.091 1.00 137.91 ?  54   ASN A C      1 
ATOM   430   O  O      . ASN A  1 54   ? 56.590  110.450 -44.503 1.00 135.84 ?  54   ASN A O      1 
ATOM   431   C  CB     . ASN A  1 54   ? 58.610  110.268 -47.302 1.00 133.80 ?  54   ASN A CB     1 
ATOM   432   C  CG     . ASN A  1 54   ? 58.954  109.615 -48.601 1.00 143.22 ?  54   ASN A CG     1 
ATOM   433   O  OD1    . ASN A  1 54   ? 58.226  108.763 -49.121 1.00 146.94 ?  54   ASN A OD1    1 
ATOM   434   N  ND2    . ASN A  1 54   ? 60.077  109.996 -49.150 1.00 129.84 ?  54   ASN A ND2    1 
ATOM   435   N  N      . LEU A  1 55   ? 58.394  109.098 -44.460 1.00 132.48 ?  55   LEU A N      1 
ATOM   436   C  CA     . LEU A  1 55   ? 58.459  108.910 -43.030 1.00 128.55 ?  55   LEU A CA     1 
ATOM   437   C  C      . LEU A  1 55   ? 59.788  109.272 -42.394 1.00 130.21 ?  55   LEU A C      1 
ATOM   438   O  O      . LEU A  1 55   ? 60.801  109.472 -43.069 1.00 130.10 ?  55   LEU A O      1 
ATOM   439   C  CB     . LEU A  1 55   ? 58.163  107.406 -42.767 1.00 127.99 ?  55   LEU A CB     1 
ATOM   440   C  CG     . LEU A  1 55   ? 56.945  106.802 -43.479 1.00 133.78 ?  55   LEU A CG     1 
ATOM   441   C  CD1    . LEU A  1 55   ? 56.948  105.297 -43.418 1.00 133.80 ?  55   LEU A CD1    1 
ATOM   442   C  CD2    . LEU A  1 55   ? 55.679  107.361 -42.909 1.00 135.81 ?  55   LEU A CD2    1 
ATOM   443   N  N      . VAL A  1 56   ? 59.770  109.311 -41.063 1.00 125.02 ?  56   VAL A N      1 
ATOM   444   C  CA     . VAL A  1 56   ? 60.931  109.491 -40.194 1.00 123.70 ?  56   VAL A CA     1 
ATOM   445   C  C      . VAL A  1 56   ? 60.886  108.363 -39.150 1.00 128.35 ?  56   VAL A C      1 
ATOM   446   O  O      . VAL A  1 56   ? 59.819  108.062 -38.617 1.00 126.69 ?  56   VAL A O      1 
ATOM   447   C  CB     . VAL A  1 56   ? 60.970  110.889 -39.546 1.00 126.24 ?  56   VAL A CB     1 
ATOM   448   C  CG1    . VAL A  1 56   ? 62.189  111.063 -38.651 1.00 124.20 ?  56   VAL A CG1    1 
ATOM   449   C  CG2    . VAL A  1 56   ? 60.962  111.950 -40.615 1.00 127.92 ?  56   VAL A CG2    1 
ATOM   450   N  N      . VAL A  1 57   ? 62.030  107.742 -38.872 1.00 126.58 ?  57   VAL A N      1 
ATOM   451   C  CA     . VAL A  1 57   ? 62.120  106.662 -37.901 1.00 126.45 ?  57   VAL A CA     1 
ATOM   452   C  C      . VAL A  1 57   ? 63.271  106.948 -36.922 1.00 132.51 ?  57   VAL A C      1 
ATOM   453   O  O      . VAL A  1 57   ? 64.343  107.400 -37.340 1.00 134.00 ?  57   VAL A O      1 
ATOM   454   C  CB     . VAL A  1 57   ? 62.249  105.287 -38.599 1.00 130.96 ?  57   VAL A CB     1 
ATOM   455   C  CG1    . VAL A  1 57   ? 63.417  105.268 -39.565 1.00 131.73 ?  57   VAL A CG1    1 
ATOM   456   C  CG2    . VAL A  1 57   ? 62.363  104.151 -37.591 1.00 129.93 ?  57   VAL A CG2    1 
ATOM   457   N  N      . LYS A  1 58   ? 63.054  106.670 -35.629 1.00 126.55 ?  58   LYS A N      1 
ATOM   458   C  CA     . LYS A  1 58   ? 64.072  106.910 -34.620 1.00 123.74 ?  58   LYS A CA     1 
ATOM   459   C  C      . LYS A  1 58   ? 63.781  106.074 -33.383 1.00 126.44 ?  58   LYS A C      1 
ATOM   460   O  O      . LYS A  1 58   ? 62.619  105.738 -33.149 1.00 125.09 ?  58   LYS A O      1 
ATOM   461   C  CB     . LYS A  1 58   ? 64.150  108.425 -34.282 1.00 123.51 ?  58   LYS A CB     1 
ATOM   462   C  CG     . LYS A  1 58   ? 62.846  109.034 -33.810 1.00 117.88 ?  58   LYS A CG     1 
ATOM   463   C  CD     . LYS A  1 58   ? 62.868  110.540 -33.811 1.00 115.84 ?  58   LYS A CD     1 
ATOM   464   C  CE     . LYS A  1 58   ? 61.556  111.020 -33.246 1.00 130.68 ?  58   LYS A CE     1 
ATOM   465   N  NZ     . LYS A  1 58   ? 61.437  112.497 -33.218 1.00 143.69 1  58   LYS A NZ     1 
ATOM   466   N  N      . PRO A  1 59   ? 64.804  105.737 -32.570 1.00 123.59 ?  59   PRO A N      1 
ATOM   467   C  CA     . PRO A  1 59   ? 64.530  105.008 -31.328 1.00 123.18 ?  59   PRO A CA     1 
ATOM   468   C  C      . PRO A  1 59   ? 63.876  105.924 -30.292 1.00 127.13 ?  59   PRO A C      1 
ATOM   469   O  O      . PRO A  1 59   ? 64.148  107.128 -30.236 1.00 125.44 ?  59   PRO A O      1 
ATOM   470   C  CB     . PRO A  1 59   ? 65.921  104.580 -30.858 1.00 124.92 ?  59   PRO A CB     1 
ATOM   471   C  CG     . PRO A  1 59   ? 66.834  105.611 -31.397 1.00 129.21 ?  59   PRO A CG     1 
ATOM   472   C  CD     . PRO A  1 59   ? 66.246  106.039 -32.706 1.00 125.34 ?  59   PRO A CD     1 
ATOM   473   N  N      . ASP A  1 60   ? 63.029  105.336 -29.459 1.00 125.04 ?  60   ASP A N      1 
ATOM   474   C  CA     . ASP A  1 60   ? 62.350  106.021 -28.372 1.00 124.97 ?  60   ASP A CA     1 
ATOM   475   C  C      . ASP A  1 60   ? 62.766  105.311 -27.094 1.00 128.99 ?  60   ASP A C      1 
ATOM   476   O  O      . ASP A  1 60   ? 62.029  104.476 -26.559 1.00 128.34 ?  60   ASP A O      1 
ATOM   477   C  CB     . ASP A  1 60   ? 60.825  105.984 -28.596 1.00 128.01 ?  60   ASP A CB     1 
ATOM   478   C  CG     . ASP A  1 60   ? 60.030  106.783 -27.580 1.00 141.06 ?  60   ASP A CG     1 
ATOM   479   O  OD1    . ASP A  1 60   ? 60.669  107.504 -26.753 1.00 141.65 ?  60   ASP A OD1    1 
ATOM   480   O  OD2    . ASP A  1 60   ? 58.760  106.681 -27.597 1.00 143.61 -1 60   ASP A OD2    1 
ATOM   481   N  N      . GLN A  1 61   ? 64.009  105.584 -26.656 1.00 126.48 ?  61   GLN A N      1 
ATOM   482   C  CA     . GLN A  1 61   ? 64.602  104.880 -25.506 1.00 126.17 ?  61   GLN A CA     1 
ATOM   483   C  C      . GLN A  1 61   ? 65.350  105.776 -24.549 1.00 127.67 ?  61   GLN A C      1 
ATOM   484   O  O      . GLN A  1 61   ? 66.197  105.301 -23.767 1.00 128.04 ?  61   GLN A O      1 
ATOM   485   C  CB     . GLN A  1 61   ? 65.502  103.729 -25.980 1.00 128.36 ?  61   GLN A CB     1 
ATOM   486   C  CG     . GLN A  1 61   ? 64.692  102.530 -26.475 1.00 136.22 ?  61   GLN A CG     1 
ATOM   487   C  CD     . GLN A  1 61   ? 65.565  101.444 -27.010 1.00 141.19 ?  61   GLN A CD     1 
ATOM   488   O  OE1    . GLN A  1 61   ? 65.441  101.038 -28.161 1.00 135.31 ?  61   GLN A OE1    1 
ATOM   489   N  NE2    . GLN A  1 61   ? 66.473  100.954 -26.190 1.00 130.53 ?  61   GLN A NE2    1 
ATOM   490   N  N      . LEU A  1 62   ? 64.955  107.066 -24.547 1.00 120.82 ?  62   LEU A N      1 
ATOM   491   C  CA     . LEU A  1 62   ? 65.525  108.112 -23.701 1.00 118.43 ?  62   LEU A CA     1 
ATOM   492   C  C      . LEU A  1 62   ? 66.980  108.364 -24.106 1.00 122.66 ?  62   LEU A C      1 
ATOM   493   O  O      . LEU A  1 62   ? 67.838  108.628 -23.247 1.00 122.83 ?  62   LEU A O      1 
ATOM   494   C  CB     . LEU A  1 62   ? 65.355  107.832 -22.178 1.00 117.13 ?  62   LEU A CB     1 
ATOM   495   C  CG     . LEU A  1 62   ? 63.951  107.425 -21.675 1.00 118.53 ?  62   LEU A CG     1 
ATOM   496   C  CD1    . LEU A  1 62   ? 63.985  107.029 -20.246 1.00 118.47 ?  62   LEU A CD1    1 
ATOM   497   C  CD2    . LEU A  1 62   ? 62.948  108.508 -21.846 1.00 116.97 ?  62   LEU A CD2    1 
ATOM   498   N  N      . ILE A  1 63   ? 67.239  108.278 -25.445 1.00 118.10 ?  63   ILE A N      1 
ATOM   499   C  CA     . ILE A  1 63   ? 68.542  108.561 -26.060 1.00 117.92 ?  63   ILE A CA     1 
ATOM   500   C  C      . ILE A  1 63   ? 68.497  109.985 -26.561 1.00 121.82 ?  63   ILE A C      1 
ATOM   501   O  O      . ILE A  1 63   ? 67.619  110.342 -27.356 1.00 120.09 ?  63   ILE A O      1 
ATOM   502   C  CB     . ILE A  1 63   ? 68.939  107.569 -27.196 1.00 121.48 ?  63   ILE A CB     1 
ATOM   503   C  CG1    . ILE A  1 63   ? 69.029  106.124 -26.680 1.00 122.53 ?  63   ILE A CG1    1 
ATOM   504   C  CG2    . ILE A  1 63   ? 70.251  108.003 -27.893 1.00 121.39 ?  63   ILE A CG2    1 
ATOM   505   C  CD1    . ILE A  1 63   ? 68.704  105.053 -27.700 1.00 132.42 ?  63   ILE A CD1    1 
ATOM   506   N  N      . LYS A  1 64   ? 69.424  110.808 -26.069 1.00 121.22 ?  64   LYS A N      1 
ATOM   507   C  CA     . LYS A  1 64   ? 69.510  112.213 -26.477 1.00 122.25 ?  64   LYS A CA     1 
ATOM   508   C  C      . LYS A  1 64   ? 70.428  112.321 -27.686 1.00 129.46 ?  64   LYS A C      1 
ATOM   509   O  O      . LYS A  1 64   ? 71.295  111.456 -27.880 1.00 131.39 ?  64   LYS A O      1 
ATOM   510   C  CB     . LYS A  1 64   ? 70.027  113.088 -25.312 1.00 124.31 ?  64   LYS A CB     1 
ATOM   511   C  CG     . LYS A  1 64   ? 69.023  113.175 -24.176 1.00 134.03 ?  64   LYS A CG     1 
ATOM   512   C  CD     . LYS A  1 64   ? 69.479  113.977 -22.985 1.00 146.96 ?  64   LYS A CD     1 
ATOM   513   C  CE     . LYS A  1 64   ? 68.394  113.993 -21.909 1.00 161.34 ?  64   LYS A CE     1 
ATOM   514   N  NZ     . LYS A  1 64   ? 68.800  114.739 -20.677 1.00 168.26 1  64   LYS A NZ     1 
ATOM   515   N  N      . ARG A  1 65   ? 70.247  113.377 -28.498 1.00 125.27 ?  65   ARG A N      1 
ATOM   516   C  CA     . ARG A  1 65   ? 71.079  113.672 -29.670 1.00 125.94 ?  65   ARG A CA     1 
ATOM   517   C  C      . ARG A  1 65   ? 71.111  112.540 -30.716 1.00 127.83 ?  65   ARG A C      1 
ATOM   518   O  O      . ARG A  1 65   ? 72.158  112.274 -31.317 1.00 128.27 ?  65   ARG A O      1 
ATOM   519   C  CB     . ARG A  1 65   ? 72.510  114.056 -29.243 1.00 129.95 ?  65   ARG A CB     1 
ATOM   520   C  CG     . ARG A  1 65   ? 72.624  115.130 -28.135 1.00 150.93 ?  65   ARG A CG     1 
ATOM   521   C  CD     . ARG A  1 65   ? 74.076  115.590 -27.949 1.00 175.09 ?  65   ARG A CD     1 
ATOM   522   N  NE     . ARG A  1 65   ? 74.452  115.827 -26.547 1.00 190.13 ?  65   ARG A NE     1 
ATOM   523   C  CZ     . ARG A  1 65   ? 75.702  115.837 -26.079 1.00 206.71 ?  65   ARG A CZ     1 
ATOM   524   N  NH1    . ARG A  1 65   ? 76.729  115.618 -26.894 1.00 194.18 1  65   ARG A NH1    1 
ATOM   525   N  NH2    . ARG A  1 65   ? 75.932  116.057 -24.792 1.00 195.01 ?  65   ARG A NH2    1 
ATOM   526   N  N      . ARG A  1 66   ? 69.948  111.906 -30.957 1.00 121.91 ?  66   ARG A N      1 
ATOM   527   C  CA     . ARG A  1 66   ? 69.817  110.797 -31.915 1.00 120.83 ?  66   ARG A CA     1 
ATOM   528   C  C      . ARG A  1 66   ? 70.308  111.127 -33.323 1.00 124.00 ?  66   ARG A C      1 
ATOM   529   O  O      . ARG A  1 66   ? 70.986  110.315 -33.953 1.00 124.45 ?  66   ARG A O      1 
ATOM   530   C  CB     . ARG A  1 66   ? 68.387  110.281 -31.985 1.00 117.41 ?  66   ARG A CB     1 
ATOM   531   C  CG     . ARG A  1 66   ? 67.914  109.717 -30.677 1.00 119.58 ?  66   ARG A CG     1 
ATOM   532   C  CD     . ARG A  1 66   ? 66.425  109.518 -30.713 1.00 125.14 ?  66   ARG A CD     1 
ATOM   533   N  NE     . ARG A  1 66   ? 65.741  110.804 -30.659 1.00 134.28 ?  66   ARG A NE     1 
ATOM   534   C  CZ     . ARG A  1 66   ? 64.447  110.958 -30.411 1.00 155.25 ?  66   ARG A CZ     1 
ATOM   535   N  NH1    . ARG A  1 66   ? 63.675  109.903 -30.180 1.00 143.43 1  66   ARG A NH1    1 
ATOM   536   N  NH2    . ARG A  1 66   ? 63.916  112.167 -30.371 1.00 149.14 ?  66   ARG A NH2    1 
ATOM   537   N  N      . GLY A  1 67   ? 69.958  112.306 -33.812 1.00 119.07 ?  67   GLY A N      1 
ATOM   538   C  CA     . GLY A  1 67   ? 70.357  112.719 -35.148 1.00 119.25 ?  67   GLY A CA     1 
ATOM   539   C  C      . GLY A  1 67   ? 71.853  112.710 -35.312 1.00 120.79 ?  67   GLY A C      1 
ATOM   540   O  O      . GLY A  1 67   ? 72.359  112.154 -36.288 1.00 121.18 ?  67   GLY A O      1 
ATOM   541   N  N      . LYS A  1 68   ? 72.561  113.264 -34.306 1.00 114.71 ?  68   LYS A N      1 
ATOM   542   C  CA     . LYS A  1 68   ? 74.020  113.298 -34.274 1.00 114.57 ?  68   LYS A CA     1 
ATOM   543   C  C      . LYS A  1 68   ? 74.647  111.904 -34.146 1.00 118.52 ?  68   LYS A C      1 
ATOM   544   O  O      . LYS A  1 68   ? 75.847  111.741 -34.386 1.00 120.48 ?  68   LYS A O      1 
ATOM   545   C  CB     . LYS A  1 68   ? 74.514  114.225 -33.176 1.00 115.46 ?  68   LYS A CB     1 
ATOM   546   C  CG     . LYS A  1 68   ? 74.031  115.677 -33.335 1.00 120.93 ?  68   LYS A CG     1 
ATOM   547   C  CD     . LYS A  1 68   ? 74.463  116.406 -34.659 1.00 125.10 ?  68   LYS A CD     1 
ATOM   548   C  CE     . LYS A  1 68   ? 75.437  117.562 -34.497 1.00 126.91 ?  68   LYS A CE     1 
ATOM   549   N  NZ     . LYS A  1 68   ? 75.033  118.536 -33.438 1.00 132.64 1  68   LYS A NZ     1 
ATOM   550   N  N      . LEU A  1 69   ? 73.840  110.902 -33.782 1.00 112.17 ?  69   LEU A N      1 
ATOM   551   C  CA     . LEU A  1 69   ? 74.267  109.510 -33.695 1.00 111.55 ?  69   LEU A CA     1 
ATOM   552   C  C      . LEU A  1 69   ? 73.882  108.667 -34.951 1.00 118.27 ?  69   LEU A C      1 
ATOM   553   O  O      . LEU A  1 69   ? 74.094  107.460 -34.962 1.00 117.72 ?  69   LEU A O      1 
ATOM   554   C  CB     . LEU A  1 69   ? 73.661  108.883 -32.422 1.00 109.09 ?  69   LEU A CB     1 
ATOM   555   C  CG     . LEU A  1 69   ? 74.155  109.462 -31.129 1.00 110.81 ?  69   LEU A CG     1 
ATOM   556   C  CD1    . LEU A  1 69   ? 73.328  109.011 -29.990 1.00 109.33 ?  69   LEU A CD1    1 
ATOM   557   C  CD2    . LEU A  1 69   ? 75.494  108.982 -30.866 1.00 113.51 ?  69   LEU A CD2    1 
ATOM   558   N  N      . GLY A  1 70   ? 73.297  109.287 -35.972 1.00 117.61 ?  70   GLY A N      1 
ATOM   559   C  CA     . GLY A  1 70   ? 72.822  108.569 -37.154 1.00 119.90 ?  70   GLY A CA     1 
ATOM   560   C  C      . GLY A  1 70   ? 71.612  107.687 -36.868 1.00 126.26 ?  70   GLY A C      1 
ATOM   561   O  O      . GLY A  1 70   ? 71.327  106.702 -37.585 1.00 127.66 ?  70   GLY A O      1 
ATOM   562   N  N      . LEU A  1 71   ? 70.895  108.052 -35.783 1.00 121.69 ?  71   LEU A N      1 
ATOM   563   C  CA     . LEU A  1 71   ? 69.745  107.303 -35.291 1.00 120.03 ?  71   LEU A CA     1 
ATOM   564   C  C      . LEU A  1 71   ? 68.404  107.921 -35.664 1.00 126.59 ?  71   LEU A C      1 
ATOM   565   O  O      . LEU A  1 71   ? 67.372  107.513 -35.130 1.00 126.77 ?  71   LEU A O      1 
ATOM   566   C  CB     . LEU A  1 71   ? 69.854  107.058 -33.780 1.00 117.44 ?  71   LEU A CB     1 
ATOM   567   C  CG     . LEU A  1 71   ? 70.884  106.030 -33.338 1.00 120.49 ?  71   LEU A CG     1 
ATOM   568   C  CD1    . LEU A  1 71   ? 70.997  106.010 -31.833 1.00 119.00 ?  71   LEU A CD1    1 
ATOM   569   C  CD2    . LEU A  1 71   ? 70.552  104.638 -33.870 1.00 122.80 ?  71   LEU A CD2    1 
ATOM   570   N  N      . VAL A  1 72   ? 68.409  108.866 -36.610 1.00 124.13 ?  72   VAL A N      1 
ATOM   571   C  CA     . VAL A  1 72   ? 67.173  109.424 -37.136 1.00 124.02 ?  72   VAL A CA     1 
ATOM   572   C  C      . VAL A  1 72   ? 67.233  109.206 -38.657 1.00 130.27 ?  72   VAL A C      1 
ATOM   573   O  O      . VAL A  1 72   ? 68.097  109.794 -39.317 1.00 130.03 ?  72   VAL A O      1 
ATOM   574   C  CB     . VAL A  1 72   ? 66.898  110.918 -36.748 1.00 126.87 ?  72   VAL A CB     1 
ATOM   575   C  CG1    . VAL A  1 72   ? 65.553  111.377 -37.270 1.00 127.08 ?  72   VAL A CG1    1 
ATOM   576   C  CG2    . VAL A  1 72   ? 66.968  111.151 -35.234 1.00 124.77 ?  72   VAL A CG2    1 
ATOM   577   N  N      . GLY A  1 73   ? 66.338  108.346 -39.171 1.00 128.17 ?  73   GLY A N      1 
ATOM   578   C  CA     . GLY A  1 73   ? 66.163  108.071 -40.598 1.00 129.52 ?  73   GLY A CA     1 
ATOM   579   C  C      . GLY A  1 73   ? 65.094  109.004 -41.129 1.00 132.28 ?  73   GLY A C      1 
ATOM   580   O  O      . GLY A  1 73   ? 63.933  108.895 -40.740 1.00 130.61 ?  73   GLY A O      1 
ATOM   581   N  N      . VAL A  1 74   ? 65.485  109.964 -41.969 1.00 129.18 ?  74   VAL A N      1 
ATOM   582   C  CA     . VAL A  1 74   ? 64.602  111.028 -42.422 1.00 128.59 ?  74   VAL A CA     1 
ATOM   583   C  C      . VAL A  1 74   ? 64.187  110.897 -43.876 1.00 135.75 ?  74   VAL A C      1 
ATOM   584   O  O      . VAL A  1 74   ? 65.036  110.650 -44.742 1.00 137.98 ?  74   VAL A O      1 
ATOM   585   C  CB     . VAL A  1 74   ? 65.281  112.395 -42.146 1.00 130.70 ?  74   VAL A CB     1 
ATOM   586   C  CG1    . VAL A  1 74   ? 64.444  113.553 -42.637 1.00 131.26 ?  74   VAL A CG1    1 
ATOM   587   C  CG2    . VAL A  1 74   ? 65.589  112.567 -40.670 1.00 128.11 ?  74   VAL A CG2    1 
ATOM   588   N  N      . ASN A  1 75   ? 62.881  111.121 -44.142 1.00 132.00 ?  75   ASN A N      1 
ATOM   589   C  CA     . ASN A  1 75   ? 62.302  111.197 -45.476 1.00 134.11 ?  75   ASN A CA     1 
ATOM   590   C  C      . ASN A  1 75   ? 62.494  109.891 -46.232 1.00 139.74 ?  75   ASN A C      1 
ATOM   591   O  O      . ASN A  1 75   ? 63.111  109.834 -47.306 1.00 141.43 ?  75   ASN A O      1 
ATOM   592   C  CB     . ASN A  1 75   ? 62.884  112.407 -46.217 1.00 134.08 ?  75   ASN A CB     1 
ATOM   593   C  CG     . ASN A  1 75   ? 62.167  112.781 -47.478 1.00 144.32 ?  75   ASN A CG     1 
ATOM   594   O  OD1    . ASN A  1 75   ? 61.034  112.366 -47.743 1.00 126.13 ?  75   ASN A OD1    1 
ATOM   595   N  ND2    . ASN A  1 75   ? 62.829  113.585 -48.288 1.00 143.27 ?  75   ASN A ND2    1 
ATOM   596   N  N      . LEU A  1 76   ? 61.952  108.835 -45.641 1.00 135.73 ?  76   LEU A N      1 
ATOM   597   C  CA     . LEU A  1 76   ? 62.053  107.486 -46.168 1.00 137.40 ?  76   LEU A CA     1 
ATOM   598   C  C      . LEU A  1 76   ? 60.684  106.912 -46.530 1.00 143.24 ?  76   LEU A C      1 
ATOM   599   O  O      . LEU A  1 76   ? 59.688  107.192 -45.866 1.00 140.13 ?  76   LEU A O      1 
ATOM   600   C  CB     . LEU A  1 76   ? 62.721  106.561 -45.116 1.00 135.30 ?  76   LEU A CB     1 
ATOM   601   C  CG     . LEU A  1 76   ? 64.138  106.876 -44.650 1.00 137.73 ?  76   LEU A CG     1 
ATOM   602   C  CD1    . LEU A  1 76   ? 64.526  105.987 -43.474 1.00 135.09 ?  76   LEU A CD1    1 
ATOM   603   C  CD2    . LEU A  1 76   ? 65.128  106.697 -45.776 1.00 142.54 ?  76   LEU A CD2    1 
ATOM   604   N  N      . THR A  1 77   ? 60.650  106.043 -47.539 1.00 143.92 ?  77   THR A N      1 
ATOM   605   C  CA     . THR A  1 77   ? 59.427  105.320 -47.843 1.00 145.89 ?  77   THR A CA     1 
ATOM   606   C  C      . THR A  1 77   ? 59.324  104.217 -46.803 1.00 150.09 ?  77   THR A C      1 
ATOM   607   O  O      . THR A  1 77   ? 60.297  103.932 -46.092 1.00 148.75 ?  77   THR A O      1 
ATOM   608   C  CB     . THR A  1 77   ? 59.517  104.667 -49.206 1.00 161.49 ?  77   THR A CB     1 
ATOM   609   O  OG1    . THR A  1 77   ? 60.628  103.771 -49.209 1.00 161.30 ?  77   THR A OG1    1 
ATOM   610   C  CG2    . THR A  1 77   ? 59.650  105.677 -50.322 1.00 167.44 ?  77   THR A CG2    1 
ATOM   611   N  N      . LEU A  1 78   ? 58.177  103.548 -46.744 1.00 148.07 ?  78   LEU A N      1 
ATOM   612   C  CA     . LEU A  1 78   ? 58.055  102.440 -45.813 1.00 146.76 ?  78   LEU A CA     1 
ATOM   613   C  C      . LEU A  1 78   ? 59.153  101.401 -46.073 1.00 150.00 ?  78   LEU A C      1 
ATOM   614   O  O      . LEU A  1 78   ? 59.748  100.886 -45.124 1.00 148.12 ?  78   LEU A O      1 
ATOM   615   C  CB     . LEU A  1 78   ? 56.677  101.798 -45.896 1.00 148.38 ?  78   LEU A CB     1 
ATOM   616   C  CG     . LEU A  1 78   ? 56.458  100.671 -44.892 1.00 152.33 ?  78   LEU A CG     1 
ATOM   617   C  CD1    . LEU A  1 78   ? 56.619  101.164 -43.464 1.00 148.76 ?  78   LEU A CD1    1 
ATOM   618   C  CD2    . LEU A  1 78   ? 55.143  99.990  -45.109 1.00 157.08 ?  78   LEU A CD2    1 
ATOM   619   N  N      . ASP A  1 79   ? 59.444  101.128 -47.348 1.00 147.78 ?  79   ASP A N      1 
ATOM   620   C  CA     . ASP A  1 79   ? 60.499  100.201 -47.715 1.00 148.87 ?  79   ASP A CA     1 
ATOM   621   C  C      . ASP A  1 79   ? 61.829  100.698 -47.190 1.00 149.03 ?  79   ASP A C      1 
ATOM   622   O  O      . ASP A  1 79   ? 62.593  99.903  -46.648 1.00 147.49 ?  79   ASP A O      1 
ATOM   623   C  CB     . ASP A  1 79   ? 60.517  100.016 -49.229 1.00 155.40 ?  79   ASP A CB     1 
ATOM   624   C  CG     . ASP A  1 79   ? 59.136  99.657  -49.762 1.00 176.43 ?  79   ASP A CG     1 
ATOM   625   O  OD1    . ASP A  1 79   ? 58.564  98.643  -49.288 1.00 179.49 ?  79   ASP A OD1    1 
ATOM   626   O  OD2    . ASP A  1 79   ? 58.574  100.459 -50.555 1.00 184.24 -1 79   ASP A OD2    1 
ATOM   627   N  N      . GLY A  1 80   ? 62.071  102.005 -47.309 1.00 144.64 ?  80   GLY A N      1 
ATOM   628   C  CA     . GLY A  1 80   ? 63.287  102.630 -46.801 1.00 143.04 ?  80   GLY A CA     1 
ATOM   629   C  C      . GLY A  1 80   ? 63.417  102.516 -45.292 1.00 143.77 ?  80   GLY A C      1 
ATOM   630   O  O      . GLY A  1 80   ? 64.519  102.287 -44.780 1.00 143.25 ?  80   GLY A O      1 
ATOM   631   N  N      . VAL A  1 81   ? 62.283  102.667 -44.567 1.00 136.63 ?  81   VAL A N      1 
ATOM   632   C  CA     . VAL A  1 81   ? 62.233  102.518 -43.113 1.00 132.11 ?  81   VAL A CA     1 
ATOM   633   C  C      . VAL A  1 81   ? 62.587  101.084 -42.720 1.00 135.81 ?  81   VAL A C      1 
ATOM   634   O  O      . VAL A  1 81   ? 63.388  100.880 -41.805 1.00 134.57 ?  81   VAL A O      1 
ATOM   635   C  CB     . VAL A  1 81   ? 60.862  102.912 -42.562 1.00 133.70 ?  81   VAL A CB     1 
ATOM   636   C  CG1    . VAL A  1 81   ? 60.728  102.505 -41.107 1.00 131.41 ?  81   VAL A CG1    1 
ATOM   637   C  CG2    . VAL A  1 81   ? 60.643  104.397 -42.704 1.00 132.49 ?  81   VAL A CG2    1 
ATOM   638   N  N      . LYS A  1 82   ? 62.000  100.092 -43.407 1.00 133.61 ?  82   LYS A N      1 
ATOM   639   C  CA     . LYS A  1 82   ? 62.289  98.693  -43.108 1.00 134.00 ?  82   LYS A CA     1 
ATOM   640   C  C      . LYS A  1 82   ? 63.762  98.392  -43.335 1.00 137.84 ?  82   LYS A C      1 
ATOM   641   O  O      . LYS A  1 82   ? 64.369  97.720  -42.500 1.00 135.55 ?  82   LYS A O      1 
ATOM   642   C  CB     . LYS A  1 82   ? 61.415  97.750  -43.945 1.00 138.90 ?  82   LYS A CB     1 
ATOM   643   C  CG     . LYS A  1 82   ? 59.939  97.779  -43.608 1.00 142.46 ?  82   LYS A CG     1 
ATOM   644   C  CD     . LYS A  1 82   ? 59.185  96.759  -44.462 1.00 152.75 ?  82   LYS A CD     1 
ATOM   645   C  CE     . LYS A  1 82   ? 57.728  96.675  -44.103 1.00 157.28 ?  82   LYS A CE     1 
ATOM   646   N  NZ     . LYS A  1 82   ? 57.037  95.652  -44.920 1.00 166.13 1  82   LYS A NZ     1 
ATOM   647   N  N      . SER A  1 83   ? 64.343  98.919  -44.438 1.00 136.85 ?  83   SER A N      1 
ATOM   648   C  CA     . SER A  1 83   ? 65.758  98.725  -44.732 1.00 138.56 ?  83   SER A CA     1 
ATOM   649   C  C      . SER A  1 83   ? 66.616  99.394  -43.682 1.00 140.61 ?  83   SER A C      1 
ATOM   650   O  O      . SER A  1 83   ? 67.619  98.818  -43.277 1.00 140.51 ?  83   SER A O      1 
ATOM   651   C  CB     . SER A  1 83   ? 66.106  99.241  -46.120 1.00 145.94 ?  83   SER A CB     1 
ATOM   652   O  OG     . SER A  1 83   ? 65.369  98.533  -47.106 1.00 162.07 ?  83   SER A OG     1 
ATOM   653   N  N      . TRP A  1 84   ? 66.211  100.588 -43.215 1.00 135.74 ?  84   TRP A N      1 
ATOM   654   C  CA     . TRP A  1 84   ? 66.921  101.346 -42.179 1.00 133.59 ?  84   TRP A CA     1 
ATOM   655   C  C      . TRP A  1 84   ? 66.907  100.607 -40.850 1.00 133.29 ?  84   TRP A C      1 
ATOM   656   O  O      . TRP A  1 84   ? 67.917  100.604 -40.151 1.00 132.78 ?  84   TRP A O      1 
ATOM   657   C  CB     . TRP A  1 84   ? 66.303  102.737 -42.038 1.00 131.52 ?  84   TRP A CB     1 
ATOM   658   C  CG     . TRP A  1 84   ? 67.051  103.690 -41.147 1.00 131.24 ?  84   TRP A CG     1 
ATOM   659   C  CD1    . TRP A  1 84   ? 67.983  104.617 -41.526 1.00 134.63 ?  84   TRP A CD1    1 
ATOM   660   C  CD2    . TRP A  1 84   ? 66.872  103.857 -39.737 1.00 128.88 ?  84   TRP A CD2    1 
ATOM   661   N  NE1    . TRP A  1 84   ? 68.390  105.360 -40.436 1.00 132.04 ?  84   TRP A NE1    1 
ATOM   662   C  CE2    . TRP A  1 84   ? 67.740  104.902 -39.320 1.00 131.97 ?  84   TRP A CE2    1 
ATOM   663   C  CE3    . TRP A  1 84   ? 66.071  103.218 -38.780 1.00 128.92 ?  84   TRP A CE3    1 
ATOM   664   C  CZ2    . TRP A  1 84   ? 67.810  105.338 -37.989 1.00 129.29 ?  84   TRP A CZ2    1 
ATOM   665   C  CZ3    . TRP A  1 84   ? 66.138  103.655 -37.464 1.00 128.30 ?  84   TRP A CZ3    1 
ATOM   666   C  CH2    . TRP A  1 84   ? 66.998  104.704 -37.078 1.00 127.99 ?  84   TRP A CH2    1 
ATOM   667   N  N      . LEU A  1 85   ? 65.787  99.959  -40.520 1.00 127.54 ?  85   LEU A N      1 
ATOM   668   C  CA     . LEU A  1 85   ? 65.651  99.191  -39.280 1.00 125.71 ?  85   LEU A CA     1 
ATOM   669   C  C      . LEU A  1 85   ? 66.388  97.868  -39.268 1.00 131.07 ?  85   LEU A C      1 
ATOM   670   O  O      . LEU A  1 85   ? 66.775  97.418  -38.182 1.00 129.32 ?  85   LEU A O      1 
ATOM   671   C  CB     . LEU A  1 85   ? 64.179  98.910  -38.958 1.00 125.04 ?  85   LEU A CB     1 
ATOM   672   C  CG     . LEU A  1 85   ? 63.351  100.090 -38.506 1.00 126.42 ?  85   LEU A CG     1 
ATOM   673   C  CD1    . LEU A  1 85   ? 61.890  99.763  -38.623 1.00 125.47 ?  85   LEU A CD1    1 
ATOM   674   C  CD2    . LEU A  1 85   ? 63.757  100.533 -37.090 1.00 126.96 ?  85   LEU A CD2    1 
ATOM   675   N  N      . LYS A  1 86   ? 66.513  97.196  -40.435 1.00 130.36 ?  86   LYS A N      1 
ATOM   676   C  CA     . LYS A  1 86   ? 67.158  95.877  -40.543 1.00 132.50 ?  86   LYS A CA     1 
ATOM   677   C  C      . LYS A  1 86   ? 68.488  95.796  -39.741 1.00 137.72 ?  86   LYS A C      1 
ATOM   678   O  O      . LYS A  1 86   ? 68.585  94.943  -38.846 1.00 137.24 ?  86   LYS A O      1 
ATOM   679   C  CB     . LYS A  1 86   ? 67.318  95.479  -42.017 1.00 137.22 ?  86   LYS A CB     1 
ATOM   680   C  CG     . LYS A  1 86   ? 68.146  94.229  -42.312 1.00 148.73 ?  86   LYS A CG     1 
ATOM   681   C  CD     . LYS A  1 86   ? 68.017  93.826  -43.806 1.00 153.50 ?  86   LYS A CD     1 
ATOM   682   C  CE     . LYS A  1 86   ? 69.231  93.132  -44.379 1.00 152.66 ?  86   LYS A CE     1 
ATOM   683   N  NZ     . LYS A  1 86   ? 69.229  93.151  -45.865 1.00 154.29 1  86   LYS A NZ     1 
ATOM   684   N  N      . PRO A  1 87   ? 69.480  96.701  -39.989 1.00 134.70 ?  87   PRO A N      1 
ATOM   685   C  CA     . PRO A  1 87   ? 70.735  96.631  -39.235 1.00 134.24 ?  87   PRO A CA     1 
ATOM   686   C  C      . PRO A  1 87   ? 70.712  97.272  -37.849 1.00 133.01 ?  87   PRO A C      1 
ATOM   687   O  O      . PRO A  1 87   ? 71.745  97.244  -37.187 1.00 132.66 ?  87   PRO A O      1 
ATOM   688   C  CB     . PRO A  1 87   ? 71.685  97.416  -40.136 1.00 137.09 ?  87   PRO A CB     1 
ATOM   689   C  CG     . PRO A  1 87   ? 70.822  98.488  -40.703 1.00 139.82 ?  87   PRO A CG     1 
ATOM   690   C  CD     . PRO A  1 87   ? 69.555  97.771  -41.012 1.00 136.00 ?  87   PRO A CD     1 
ATOM   691   N  N      . ARG A  1 88   ? 69.581  97.864  -37.423 1.00 125.99 ?  88   ARG A N      1 
ATOM   692   C  CA     . ARG A  1 88   ? 69.512  98.592  -36.157 1.00 122.90 ?  88   ARG A CA     1 
ATOM   693   C  C      . ARG A  1 88   ? 68.636  97.959  -35.110 1.00 127.81 ?  88   ARG A C      1 
ATOM   694   O  O      . ARG A  1 88   ? 69.028  97.872  -33.940 1.00 125.28 ?  88   ARG A O      1 
ATOM   695   C  CB     . ARG A  1 88   ? 69.085  100.028 -36.398 1.00 117.94 ?  88   ARG A CB     1 
ATOM   696   C  CG     . ARG A  1 88   ? 70.147  100.878 -37.066 1.00 115.52 ?  88   ARG A CG     1 
ATOM   697   C  CD     . ARG A  1 88   ? 69.550  102.205 -37.452 1.00 110.37 ?  88   ARG A CD     1 
ATOM   698   N  NE     . ARG A  1 88   ? 70.528  103.133 -38.006 1.00 119.45 ?  88   ARG A NE     1 
ATOM   699   C  CZ     . ARG A  1 88   ? 70.842  103.211 -39.297 1.00 134.07 ?  88   ARG A CZ     1 
ATOM   700   N  NH1    . ARG A  1 88   ? 70.262  102.397 -40.184 1.00 109.83 1  88   ARG A NH1    1 
ATOM   701   N  NH2    . ARG A  1 88   ? 71.750  104.088 -39.712 1.00 127.30 ?  88   ARG A NH2    1 
ATOM   702   N  N      . LEU A  1 89   ? 67.443  97.519  -35.526 1.00 127.83 ?  89   LEU A N      1 
ATOM   703   C  CA     . LEU A  1 89   ? 66.500  96.878  -34.628 1.00 128.73 ?  89   LEU A CA     1 
ATOM   704   C  C      . LEU A  1 89   ? 67.102  95.564  -34.062 1.00 137.07 ?  89   LEU A C      1 
ATOM   705   O  O      . LEU A  1 89   ? 67.504  94.661  -34.811 1.00 138.76 ?  89   LEU A O      1 
ATOM   706   C  CB     . LEU A  1 89   ? 65.142  96.670  -35.320 1.00 129.05 ?  89   LEU A CB     1 
ATOM   707   C  CG     . LEU A  1 89   ? 64.000  96.075  -34.474 1.00 132.30 ?  89   LEU A CG     1 
ATOM   708   C  CD1    . LEU A  1 89   ? 63.692  96.925  -33.252 1.00 129.27 ?  89   LEU A CD1    1 
ATOM   709   C  CD2    . LEU A  1 89   ? 62.776  95.936  -35.313 1.00 135.09 ?  89   LEU A CD2    1 
ATOM   710   N  N      . GLY A  1 90   ? 67.226  95.540  -32.742 1.00 133.31 ?  90   GLY A N      1 
ATOM   711   C  CA     . GLY A  1 90   ? 67.803  94.429  -32.005 1.00 134.13 ?  90   GLY A CA     1 
ATOM   712   C  C      . GLY A  1 90   ? 69.268  94.607  -31.676 1.00 136.53 ?  90   GLY A C      1 
ATOM   713   O  O      . GLY A  1 90   ? 69.767  93.956  -30.745 1.00 137.49 ?  90   GLY A O      1 
ATOM   714   N  N      . GLN A  1 91   ? 69.938  95.568  -32.357 1.00 130.46 ?  91   GLN A N      1 
ATOM   715   C  CA     . GLN A  1 91   ? 71.370  95.807  -32.214 1.00 130.60 ?  91   GLN A CA     1 
ATOM   716   C  C      . GLN A  1 91   ? 71.788  96.459  -30.918 1.00 133.83 ?  91   GLN A C      1 
ATOM   717   O  O      . GLN A  1 91   ? 71.099  97.333  -30.411 1.00 131.79 ?  91   GLN A O      1 
ATOM   718   C  CB     . GLN A  1 91   ? 71.926  96.626  -33.398 1.00 131.61 ?  91   GLN A CB     1 
ATOM   719   C  CG     . GLN A  1 91   ? 71.703  98.150  -33.282 1.00 129.43 ?  91   GLN A CG     1 
ATOM   720   C  CD     . GLN A  1 91   ? 72.766  99.070  -33.870 1.00 132.40 ?  91   GLN A CD     1 
ATOM   721   O  OE1    . GLN A  1 91   ? 72.921  99.217  -35.083 1.00 129.52 ?  91   GLN A OE1    1 
ATOM   722   N  NE2    . GLN A  1 91   ? 73.458  99.789  -33.021 1.00 111.62 ?  91   GLN A NE2    1 
ATOM   723   N  N      . GLU A  1 92   ? 72.971  96.112  -30.446 1.00 132.22 ?  92   GLU A N      1 
ATOM   724   C  CA     . GLU A  1 92   ? 73.535  96.784  -29.288 1.00 131.01 ?  92   GLU A CA     1 
ATOM   725   C  C      . GLU A  1 92   ? 74.034  98.164  -29.727 1.00 131.77 ?  92   GLU A C      1 
ATOM   726   O  O      . GLU A  1 92   ? 74.402  98.361  -30.879 1.00 132.57 ?  92   GLU A O      1 
ATOM   727   C  CB     . GLU A  1 92   ? 74.683  95.957  -28.727 1.00 134.91 ?  92   GLU A CB     1 
ATOM   728   C  CG     . GLU A  1 92   ? 75.013  96.272  -27.290 1.00 144.99 ?  92   GLU A CG     1 
ATOM   729   C  CD     . GLU A  1 92   ? 75.994  95.281  -26.705 1.00 171.07 ?  92   GLU A CD     1 
ATOM   730   O  OE1    . GLU A  1 92   ? 77.188  95.324  -27.090 1.00 155.04 ?  92   GLU A OE1    1 
ATOM   731   O  OE2    . GLU A  1 92   ? 75.552  94.424  -25.903 1.00 175.32 -1 92   GLU A OE2    1 
ATOM   732   N  N      . ALA A  1 93   ? 73.997  99.121  -28.818 1.00 124.69 ?  93   ALA A N      1 
ATOM   733   C  CA     . ALA A  1 93   ? 74.460  100.474 -29.051 1.00 123.14 ?  93   ALA A CA     1 
ATOM   734   C  C      . ALA A  1 93   ? 75.144  101.017 -27.795 1.00 126.99 ?  93   ALA A C      1 
ATOM   735   O  O      . ALA A  1 93   ? 74.706  100.735 -26.686 1.00 127.36 ?  93   ALA A O      1 
ATOM   736   C  CB     . ALA A  1 93   ? 73.292  101.367 -29.443 1.00 121.82 ?  93   ALA A CB     1 
ATOM   737   N  N      . THR A  1 94   ? 76.209  101.791 -27.965 1.00 122.85 ?  94   THR A N      1 
ATOM   738   C  CA     . THR A  1 94   ? 76.895  102.427 -26.853 1.00 122.31 ?  94   THR A CA     1 
ATOM   739   C  C      . THR A  1 94   ? 76.837  103.932 -27.040 1.00 126.24 ?  94   THR A C      1 
ATOM   740   O  O      . THR A  1 94   ? 77.500  104.493 -27.924 1.00 126.51 ?  94   THR A O      1 
ATOM   741   C  CB     . THR A  1 94   ? 78.307  101.884 -26.669 1.00 131.30 ?  94   THR A CB     1 
ATOM   742   O  OG1    . THR A  1 94   ? 78.243  100.464 -26.552 1.00 133.04 ?  94   THR A OG1    1 
ATOM   743   C  CG2    . THR A  1 94   ? 79.000  102.474 -25.434 1.00 129.95 ?  94   THR A CG2    1 
ATOM   744   N  N      . VAL A  1 95   ? 76.043  104.587 -26.194 1.00 121.81 ?  95   VAL A N      1 
ATOM   745   C  CA     . VAL A  1 95   ? 75.864  106.036 -26.220 1.00 120.32 ?  95   VAL A CA     1 
ATOM   746   C  C      . VAL A  1 95   ? 76.489  106.522 -24.904 1.00 122.66 ?  95   VAL A C      1 
ATOM   747   O  O      . VAL A  1 95   ? 75.909  106.339 -23.816 1.00 122.85 ?  95   VAL A O      1 
ATOM   748   C  CB     . VAL A  1 95   ? 74.344  106.394 -26.348 1.00 123.38 ?  95   VAL A CB     1 
ATOM   749   C  CG1    . VAL A  1 95   ? 74.107  107.902 -26.328 1.00 122.90 ?  95   VAL A CG1    1 
ATOM   750   C  CG2    . VAL A  1 95   ? 73.710  105.771 -27.589 1.00 123.03 ?  95   VAL A CG2    1 
ATOM   751   N  N      . GLY A  1 96   ? 77.694  107.059 -25.001 1.00 117.55 ?  96   GLY A N      1 
ATOM   752   C  CA     . GLY A  1 96   ? 78.414  107.509 -23.820 1.00 117.68 ?  96   GLY A CA     1 
ATOM   753   C  C      . GLY A  1 96   ? 78.845  106.326 -22.984 1.00 122.19 ?  96   GLY A C      1 
ATOM   754   O  O      . GLY A  1 96   ? 79.339  105.339 -23.529 1.00 121.93 ?  96   GLY A O      1 
ATOM   755   N  N      . LYS A  1 97   ? 78.611  106.375 -21.663 1.00 120.85 ?  97   LYS A N      1 
ATOM   756   C  CA     . LYS A  1 97   ? 78.997  105.247 -20.805 1.00 123.28 ?  97   LYS A CA     1 
ATOM   757   C  C      . LYS A  1 97   ? 77.858  104.203 -20.658 1.00 128.49 ?  97   LYS A C      1 
ATOM   758   O  O      . LYS A  1 97   ? 78.008  103.207 -19.934 1.00 129.27 ?  97   LYS A O      1 
ATOM   759   C  CB     . LYS A  1 97   ? 79.588  105.697 -19.454 1.00 127.32 ?  97   LYS A CB     1 
ATOM   760   C  CG     . LYS A  1 97   ? 78.770  106.661 -18.571 1.00 147.93 ?  97   LYS A CG     1 
ATOM   761   C  CD     . LYS A  1 97   ? 79.592  107.046 -17.307 1.00 160.17 ?  97   LYS A CD     1 
ATOM   762   C  CE     . LYS A  1 97   ? 78.894  107.969 -16.321 1.00 159.96 ?  97   LYS A CE     1 
ATOM   763   N  NZ     . LYS A  1 97   ? 79.630  108.093 -15.024 1.00 158.49 1  97   LYS A NZ     1 
ATOM   764   N  N      . ALA A  1 98   ? 76.778  104.378 -21.453 1.00 123.99 ?  98   ALA A N      1 
ATOM   765   C  CA     . ALA A  1 98   ? 75.667  103.451 -21.433 1.00 123.26 ?  98   ALA A CA     1 
ATOM   766   C  C      . ALA A  1 98   ? 75.682  102.564 -22.653 1.00 128.27 ?  98   ALA A C      1 
ATOM   767   O  O      . ALA A  1 98   ? 75.904  103.018 -23.779 1.00 128.75 ?  98   ALA A O      1 
ATOM   768   C  CB     . ALA A  1 98   ? 74.346  104.195 -21.318 1.00 122.06 ?  98   ALA A CB     1 
ATOM   769   N  N      . THR A  1 99   ? 75.463  101.281 -22.414 1.00 124.67 ?  99   THR A N      1 
ATOM   770   C  CA     . THR A  1 99   ? 75.382  100.288 -23.467 1.00 124.51 ?  99   THR A CA     1 
ATOM   771   C  C      . THR A  1 99   ? 74.097  99.511  -23.290 1.00 126.53 ?  99   THR A C      1 
ATOM   772   O  O      . THR A  1 99   ? 73.877  98.921  -22.231 1.00 127.11 ?  99   THR A O      1 
ATOM   773   C  CB     . THR A  1 99   ? 76.584  99.377  -23.448 1.00 135.08 ?  99   THR A CB     1 
ATOM   774   O  OG1    . THR A  1 99   ? 77.784  100.162 -23.386 1.00 134.05 ?  99   THR A OG1    1 
ATOM   775   C  CG2    . THR A  1 99   ? 76.597  98.457  -24.658 1.00 136.50 ?  99   THR A CG2    1 
ATOM   776   N  N      . GLY A  1 100  ? 73.265  99.530  -24.316 1.00 121.48 ?  100  GLY A N      1 
ATOM   777   C  CA     . GLY A  1 100  ? 71.992  98.826  -24.337 1.00 121.10 ?  100  GLY A CA     1 
ATOM   778   C  C      . GLY A  1 100  ? 71.621  98.370  -25.735 1.00 125.25 ?  100  GLY A C      1 
ATOM   779   O  O      . GLY A  1 100  ? 72.373  98.592  -26.683 1.00 124.27 ?  100  GLY A O      1 
ATOM   780   N  N      . PHE A  1 101  ? 70.438  97.768  -25.878 1.00 122.80 ?  101  PHE A N      1 
ATOM   781   C  CA     . PHE A  1 101  ? 69.960  97.317  -27.179 1.00 123.51 ?  101  PHE A CA     1 
ATOM   782   C  C      . PHE A  1 101  ? 68.897  98.232  -27.719 1.00 125.82 ?  101  PHE A C      1 
ATOM   783   O  O      . PHE A  1 101  ? 68.028  98.660  -26.969 1.00 123.94 ?  101  PHE A O      1 
ATOM   784   C  CB     . PHE A  1 101  ? 69.435  95.878  -27.114 1.00 127.26 ?  101  PHE A CB     1 
ATOM   785   C  CG     . PHE A  1 101  ? 70.468  94.891  -26.635 1.00 131.22 ?  101  PHE A CG     1 
ATOM   786   C  CD1    . PHE A  1 101  ? 71.512  94.501  -27.456 1.00 136.14 ?  101  PHE A CD1    1 
ATOM   787   C  CD2    . PHE A  1 101  ? 70.412  94.377  -25.350 1.00 134.62 ?  101  PHE A CD2    1 
ATOM   788   C  CE1    . PHE A  1 101  ? 72.484  93.615  -26.998 1.00 139.95 ?  101  PHE A CE1    1 
ATOM   789   C  CE2    . PHE A  1 101  ? 71.383  93.483  -24.894 1.00 139.98 ?  101  PHE A CE2    1 
ATOM   790   C  CZ     . PHE A  1 101  ? 72.420  93.114  -25.720 1.00 139.74 ?  101  PHE A CZ     1 
ATOM   791   N  N      . LEU A  1 102  ? 68.942  98.503  -29.027 1.00 123.26 ?  102  LEU A N      1 
ATOM   792   C  CA     . LEU A  1 102  ? 67.934  99.305  -29.737 1.00 121.87 ?  102  LEU A CA     1 
ATOM   793   C  C      . LEU A  1 102  ? 66.726  98.387  -30.022 1.00 127.83 ?  102  LEU A C      1 
ATOM   794   O  O      . LEU A  1 102  ? 66.790  97.510  -30.878 1.00 129.85 ?  102  LEU A O      1 
ATOM   795   C  CB     . LEU A  1 102  ? 68.513  99.913  -31.041 1.00 121.59 ?  102  LEU A CB     1 
ATOM   796   C  CG     . LEU A  1 102  ? 69.720  100.835 -30.870 1.00 123.83 ?  102  LEU A CG     1 
ATOM   797   C  CD1    . LEU A  1 102  ? 70.255  101.240 -32.206 1.00 124.05 ?  102  LEU A CD1    1 
ATOM   798   C  CD2    . LEU A  1 102  ? 69.377  102.049 -30.067 1.00 122.42 ?  102  LEU A CD2    1 
ATOM   799   N  N      . LYS A  1 103  ? 65.671  98.517  -29.227 1.00 123.39 ?  103  LYS A N      1 
ATOM   800   C  CA     . LYS A  1 103  ? 64.517  97.638  -29.334 1.00 124.43 ?  103  LYS A CA     1 
ATOM   801   C  C      . LYS A  1 103  ? 63.161  98.373  -29.462 1.00 128.45 ?  103  LYS A C      1 
ATOM   802   O  O      . LYS A  1 103  ? 62.148  97.705  -29.641 1.00 129.59 ?  103  LYS A O      1 
ATOM   803   C  CB     . LYS A  1 103  ? 64.472  96.701  -28.105 1.00 127.69 ?  103  LYS A CB     1 
ATOM   804   C  CG     . LYS A  1 103  ? 65.628  95.733  -27.860 1.00 142.11 ?  103  LYS A CG     1 
ATOM   805   C  CD     . LYS A  1 103  ? 65.754  95.349  -26.356 1.00 150.02 ?  103  LYS A CD     1 
ATOM   806   C  CE     . LYS A  1 103  ? 66.471  94.034  -26.194 1.00 157.04 ?  103  LYS A CE     1 
ATOM   807   N  NZ     . LYS A  1 103  ? 66.902  93.784  -24.800 1.00 163.23 1  103  LYS A NZ     1 
ATOM   808   N  N      . ASN A  1 104  ? 63.119  99.716  -29.373 1.00 123.46 ?  104  ASN A N      1 
ATOM   809   C  CA     . ASN A  1 104  ? 61.859  100.477 -29.411 1.00 122.05 ?  104  ASN A CA     1 
ATOM   810   C  C      . ASN A  1 104  ? 62.002  101.710 -30.268 1.00 124.89 ?  104  ASN A C      1 
ATOM   811   O  O      . ASN A  1 104  ? 62.752  102.622 -29.920 1.00 122.48 ?  104  ASN A O      1 
ATOM   812   C  CB     . ASN A  1 104  ? 61.397  100.843 -27.992 1.00 120.76 ?  104  ASN A CB     1 
ATOM   813   C  CG     . ASN A  1 104  ? 59.971  101.328 -27.941 1.00 139.73 ?  104  ASN A CG     1 
ATOM   814   O  OD1    . ASN A  1 104  ? 59.036  100.572 -28.190 1.00 149.38 ?  104  ASN A OD1    1 
ATOM   815   N  ND2    . ASN A  1 104  ? 59.766  102.608 -27.671 1.00 115.78 ?  104  ASN A ND2    1 
ATOM   816   N  N      . PHE A  1 105  ? 61.296  101.722 -31.408 1.00 123.83 ?  105  PHE A N      1 
ATOM   817   C  CA     . PHE A  1 105  ? 61.365  102.808 -32.381 1.00 124.23 ?  105  PHE A CA     1 
ATOM   818   C  C      . PHE A  1 105  ? 60.014  103.401 -32.703 1.00 126.42 ?  105  PHE A C      1 
ATOM   819   O  O      . PHE A  1 105  ? 58.984  102.711 -32.667 1.00 124.98 ?  105  PHE A O      1 
ATOM   820   C  CB     . PHE A  1 105  ? 61.971  102.316 -33.688 1.00 128.22 ?  105  PHE A CB     1 
ATOM   821   C  CG     . PHE A  1 105  ? 63.411  101.902 -33.610 1.00 130.87 ?  105  PHE A CG     1 
ATOM   822   C  CD1    . PHE A  1 105  ? 63.773  100.676 -33.054 1.00 134.79 ?  105  PHE A CD1    1 
ATOM   823   C  CD2    . PHE A  1 105  ? 64.402  102.699 -34.157 1.00 133.74 ?  105  PHE A CD2    1 
ATOM   824   C  CE1    . PHE A  1 105  ? 65.100  100.287 -32.998 1.00 136.24 ?  105  PHE A CE1    1 
ATOM   825   C  CE2    . PHE A  1 105  ? 65.727  102.293 -34.129 1.00 137.08 ?  105  PHE A CE2    1 
ATOM   826   C  CZ     . PHE A  1 105  ? 66.066  101.093 -33.545 1.00 135.54 ?  105  PHE A CZ     1 
ATOM   827   N  N      . LEU A  1 106  ? 60.047  104.685 -33.085 1.00 122.07 ?  106  LEU A N      1 
ATOM   828   C  CA     . LEU A  1 106  ? 58.881  105.436 -33.484 1.00 122.02 ?  106  LEU A CA     1 
ATOM   829   C  C      . LEU A  1 106  ? 58.997  105.791 -34.965 1.00 127.79 ?  106  LEU A C      1 
ATOM   830   O  O      . LEU A  1 106  ? 60.070  106.221 -35.407 1.00 126.68 ?  106  LEU A O      1 
ATOM   831   C  CB     . LEU A  1 106  ? 58.820  106.701 -32.638 1.00 120.74 ?  106  LEU A CB     1 
ATOM   832   C  CG     . LEU A  1 106  ? 57.471  107.288 -32.253 1.00 126.29 ?  106  LEU A CG     1 
ATOM   833   C  CD1    . LEU A  1 106  ? 56.516  106.239 -31.671 1.00 127.01 ?  106  LEU A CD1    1 
ATOM   834   C  CD2    . LEU A  1 106  ? 57.692  108.375 -31.239 1.00 129.56 ?  106  LEU A CD2    1 
ATOM   835   N  N      . ILE A  1 107  ? 57.888  105.598 -35.727 1.00 125.52 ?  107  ILE A N      1 
ATOM   836   C  CA     . ILE A  1 107  ? 57.761  105.969 -37.142 1.00 126.42 ?  107  ILE A CA     1 
ATOM   837   C  C      . ILE A  1 107  ? 56.699  107.051 -37.217 1.00 131.71 ?  107  ILE A C      1 
ATOM   838   O  O      . ILE A  1 107  ? 55.610  106.861 -36.693 1.00 131.27 ?  107  ILE A O      1 
ATOM   839   C  CB     . ILE A  1 107  ? 57.401  104.803 -38.084 1.00 130.54 ?  107  ILE A CB     1 
ATOM   840   C  CG1    . ILE A  1 107  ? 58.334  103.620 -37.903 1.00 130.49 ?  107  ILE A CG1    1 
ATOM   841   C  CG2    . ILE A  1 107  ? 57.399  105.283 -39.540 1.00 132.74 ?  107  ILE A CG2    1 
ATOM   842   C  CD1    . ILE A  1 107  ? 57.833  102.342 -38.626 1.00 140.80 ?  107  ILE A CD1    1 
ATOM   843   N  N      . GLU A  1 108  ? 57.004  108.168 -37.870 1.00 129.62 ?  108  GLU A N      1 
ATOM   844   C  CA     . GLU A  1 108  ? 56.094  109.290 -37.999 1.00 130.87 ?  108  GLU A CA     1 
ATOM   845   C  C      . GLU A  1 108  ? 56.162  109.856 -39.412 1.00 138.56 ?  108  GLU A C      1 
ATOM   846   O  O      . GLU A  1 108  ? 57.157  109.621 -40.109 1.00 138.83 ?  108  GLU A O      1 
ATOM   847   C  CB     . GLU A  1 108  ? 56.477  110.377 -36.978 1.00 131.02 ?  108  GLU A CB     1 
ATOM   848   C  CG     . GLU A  1 108  ? 56.225  109.968 -35.540 1.00 145.85 ?  108  GLU A CG     1 
ATOM   849   C  CD     . GLU A  1 108  ? 56.767  110.899 -34.475 1.00 179.86 ?  108  GLU A CD     1 
ATOM   850   O  OE1    . GLU A  1 108  ? 58.008  111.036 -34.365 1.00 171.29 ?  108  GLU A OE1    1 
ATOM   851   O  OE2    . GLU A  1 108  ? 55.939  111.459 -33.718 1.00 183.16 -1 108  GLU A OE2    1 
ATOM   852   N  N      . PRO A  1 109  ? 55.155  110.642 -39.860 1.00 136.98 ?  109  PRO A N      1 
ATOM   853   C  CA     . PRO A  1 109  ? 55.240  111.242 -41.196 1.00 138.64 ?  109  PRO A CA     1 
ATOM   854   C  C      . PRO A  1 109  ? 56.339  112.277 -41.290 1.00 138.60 ?  109  PRO A C      1 
ATOM   855   O  O      . PRO A  1 109  ? 56.570  113.048 -40.344 1.00 135.77 ?  109  PRO A O      1 
ATOM   856   C  CB     . PRO A  1 109  ? 53.885  111.930 -41.373 1.00 142.20 ?  109  PRO A CB     1 
ATOM   857   C  CG     . PRO A  1 109  ? 53.018  111.298 -40.385 1.00 145.46 ?  109  PRO A CG     1 
ATOM   858   C  CD     . PRO A  1 109  ? 53.888  111.012 -39.215 1.00 138.42 ?  109  PRO A CD     1 
ATOM   859   N  N      . PHE A  1 110  ? 56.995  112.302 -42.449 1.00 134.44 ?  110  PHE A N      1 
ATOM   860   C  CA     . PHE A  1 110  ? 57.981  113.314 -42.727 1.00 133.74 ?  110  PHE A CA     1 
ATOM   861   C  C      . PHE A  1 110  ? 57.253  114.646 -42.947 1.00 138.74 ?  110  PHE A C      1 
ATOM   862   O  O      . PHE A  1 110  ? 56.212  114.696 -43.616 1.00 139.26 ?  110  PHE A O      1 
ATOM   863   C  CB     . PHE A  1 110  ? 58.840  112.910 -43.922 1.00 136.54 ?  110  PHE A CB     1 
ATOM   864   C  CG     . PHE A  1 110  ? 59.799  113.975 -44.381 1.00 138.38 ?  110  PHE A CG     1 
ATOM   865   C  CD1    . PHE A  1 110  ? 60.936  114.272 -43.644 1.00 139.35 ?  110  PHE A CD1    1 
ATOM   866   C  CD2    . PHE A  1 110  ? 59.559  114.688 -45.546 1.00 143.21 ?  110  PHE A CD2    1 
ATOM   867   C  CE1    . PHE A  1 110  ? 61.817  115.263 -44.068 1.00 141.57 ?  110  PHE A CE1    1 
ATOM   868   C  CE2    . PHE A  1 110  ? 60.440  115.675 -45.970 1.00 147.11 ?  110  PHE A CE2    1 
ATOM   869   C  CZ     . PHE A  1 110  ? 61.567  115.954 -45.230 1.00 143.59 ?  110  PHE A CZ     1 
ATOM   870   N  N      . VAL A  1 111  ? 57.784  115.700 -42.308 1.00 135.39 ?  111  VAL A N      1 
ATOM   871   C  CA     . VAL A  1 111  ? 57.259  117.054 -42.352 1.00 137.09 ?  111  VAL A CA     1 
ATOM   872   C  C      . VAL A  1 111  ? 58.252  117.921 -43.087 1.00 142.57 ?  111  VAL A C      1 
ATOM   873   O  O      . VAL A  1 111  ? 59.237  118.332 -42.488 1.00 141.20 ?  111  VAL A O      1 
ATOM   874   C  CB     . VAL A  1 111  ? 56.959  117.637 -40.943 1.00 139.73 ?  111  VAL A CB     1 
ATOM   875   C  CG1    . VAL A  1 111  ? 56.384  119.047 -41.056 1.00 141.69 ?  111  VAL A CG1    1 
ATOM   876   C  CG2    . VAL A  1 111  ? 56.013  116.736 -40.158 1.00 138.32 ?  111  VAL A CG2    1 
ATOM   877   N  N      . PRO A  1 112  ? 58.030  118.224 -44.375 1.00 141.99 ?  112  PRO A N      1 
ATOM   878   C  CA     . PRO A  1 112  ? 58.970  119.109 -45.077 1.00 143.34 ?  112  PRO A CA     1 
ATOM   879   C  C      . PRO A  1 112  ? 58.918  120.486 -44.457 1.00 146.41 ?  112  PRO A C      1 
ATOM   880   O  O      . PRO A  1 112  ? 57.837  120.980 -44.157 1.00 146.02 ?  112  PRO A O      1 
ATOM   881   C  CB     . PRO A  1 112  ? 58.453  119.125 -46.521 1.00 148.70 ?  112  PRO A CB     1 
ATOM   882   C  CG     . PRO A  1 112  ? 57.496  117.990 -46.614 1.00 153.19 ?  112  PRO A CG     1 
ATOM   883   C  CD     . PRO A  1 112  ? 56.921  117.806 -45.249 1.00 145.99 ?  112  PRO A CD     1 
ATOM   884   N  N      . HIS A  1 113  ? 60.077  121.069 -44.208 1.00 143.79 ?  113  HIS A N      1 
ATOM   885   C  CA     . HIS A  1 113  ? 60.153  122.394 -43.628 1.00 145.77 ?  113  HIS A CA     1 
ATOM   886   C  C      . HIS A  1 113  ? 61.527  122.964 -43.833 1.00 152.30 ?  113  HIS A C      1 
ATOM   887   O  O      . HIS A  1 113  ? 62.476  122.224 -44.117 1.00 150.64 ?  113  HIS A O      1 
ATOM   888   C  CB     . HIS A  1 113  ? 59.810  122.365 -42.129 1.00 144.71 ?  113  HIS A CB     1 
ATOM   889   C  CG     . HIS A  1 113  ? 60.784  121.583 -41.304 1.00 145.89 ?  113  HIS A CG     1 
ATOM   890   N  ND1    . HIS A  1 113  ? 60.729  120.206 -41.238 1.00 146.30 ?  113  HIS A ND1    1 
ATOM   891   C  CD2    . HIS A  1 113  ? 61.813  122.010 -40.537 1.00 147.11 ?  113  HIS A CD2    1 
ATOM   892   C  CE1    . HIS A  1 113  ? 61.728  119.834 -40.451 1.00 143.76 ?  113  HIS A CE1    1 
ATOM   893   N  NE2    . HIS A  1 113  ? 62.412  120.884 -40.011 1.00 144.55 ?  113  HIS A NE2    1 
ATOM   894   N  N      . SER A  1 114  ? 61.642  124.284 -43.674 1.00 152.63 ?  114  SER A N      1 
ATOM   895   C  CA     . SER A  1 114  ? 62.931  124.958 -43.763 1.00 154.14 ?  114  SER A CA     1 
ATOM   896   C  C      . SER A  1 114  ? 63.533  125.084 -42.375 1.00 156.14 ?  114  SER A C      1 
ATOM   897   O  O      . SER A  1 114  ? 62.810  125.054 -41.375 1.00 155.27 ?  114  SER A O      1 
ATOM   898   C  CB     . SER A  1 114  ? 62.787  126.336 -44.400 1.00 162.27 ?  114  SER A CB     1 
ATOM   899   O  OG     . SER A  1 114  ? 61.947  127.177 -43.630 1.00 173.80 ?  114  SER A OG     1 
ATOM   900   N  N      . GLN A  1 115  ? 64.852  125.257 -42.309 1.00 151.82 ?  115  GLN A N      1 
ATOM   901   C  CA     . GLN A  1 115  ? 65.521  125.442 -41.031 1.00 149.78 ?  115  GLN A CA     1 
ATOM   902   C  C      . GLN A  1 115  ? 64.939  126.661 -40.266 1.00 154.60 ?  115  GLN A C      1 
ATOM   903   O  O      . GLN A  1 115  ? 64.876  126.645 -39.028 1.00 152.95 ?  115  GLN A O      1 
ATOM   904   C  CB     . GLN A  1 115  ? 67.023  125.567 -41.250 1.00 151.61 ?  115  GLN A CB     1 
ATOM   905   C  CG     . GLN A  1 115  ? 67.850  125.593 -39.971 1.00 157.66 ?  115  GLN A CG     1 
ATOM   906   C  CD     . GLN A  1 115  ? 67.801  124.332 -39.137 1.00 154.07 ?  115  GLN A CD     1 
ATOM   907   O  OE1    . GLN A  1 115  ? 67.229  124.328 -38.042 1.00 144.60 ?  115  GLN A OE1    1 
ATOM   908   N  NE2    . GLN A  1 115  ? 68.480  123.279 -39.591 1.00 136.78 ?  115  GLN A NE2    1 
ATOM   909   N  N      . ALA A  1 116  ? 64.446  127.674 -41.011 1.00 155.17 ?  116  ALA A N      1 
ATOM   910   C  CA     . ALA A  1 116  ? 63.822  128.853 -40.424 1.00 154.43 ?  116  ALA A CA     1 
ATOM   911   C  C      . ALA A  1 116  ? 62.476  128.532 -39.742 1.00 154.33 ?  116  ALA A C      1 
ATOM   912   O  O      . ALA A  1 116  ? 62.010  129.316 -38.912 1.00 153.62 ?  116  ALA A O      1 
ATOM   913   C  CB     . ALA A  1 116  ? 63.630  129.907 -41.490 1.00 158.56 ?  116  ALA A CB     1 
ATOM   914   N  N      . GLU A  1 117  ? 61.859  127.388 -40.089 1.00 148.50 ?  117  GLU A N      1 
ATOM   915   C  CA     . GLU A  1 117  ? 60.578  126.949 -39.531 1.00 146.35 ?  117  GLU A CA     1 
ATOM   916   C  C      . GLU A  1 117  ? 60.743  126.063 -38.298 1.00 146.78 ?  117  GLU A C      1 
ATOM   917   O  O      . GLU A  1 117  ? 59.742  125.572 -37.768 1.00 144.49 ?  117  GLU A O      1 
ATOM   918   C  CB     . GLU A  1 117  ? 59.726  126.264 -40.603 1.00 148.97 ?  117  GLU A CB     1 
ATOM   919   C  CG     . GLU A  1 117  ? 59.285  127.210 -41.710 1.00 163.86 ?  117  GLU A CG     1 
ATOM   920   C  CD     . GLU A  1 117  ? 58.543  126.576 -42.875 1.00 177.85 ?  117  GLU A CD     1 
ATOM   921   O  OE1    . GLU A  1 117  ? 58.967  125.488 -43.337 1.00 175.46 ?  117  GLU A OE1    1 
ATOM   922   O  OE2    . GLU A  1 117  ? 57.547  127.183 -43.337 1.00 154.86 -1 117  GLU A OE2    1 
ATOM   923   N  N      . GLU A  1 118  ? 62.001  125.874 -37.829 1.00 142.61 ?  118  GLU A N      1 
ATOM   924   C  CA     . GLU A  1 118  ? 62.314  125.118 -36.617 1.00 139.68 ?  118  GLU A CA     1 
ATOM   925   C  C      . GLU A  1 118  ? 62.450  126.073 -35.428 1.00 144.32 ?  118  GLU A C      1 
ATOM   926   O  O      . GLU A  1 118  ? 63.172  127.071 -35.509 1.00 145.60 ?  118  GLU A O      1 
ATOM   927   C  CB     . GLU A  1 118  ? 63.598  124.307 -36.776 1.00 140.52 ?  118  GLU A CB     1 
ATOM   928   C  CG     . GLU A  1 118  ? 63.486  123.129 -37.731 1.00 150.39 ?  118  GLU A CG     1 
ATOM   929   C  CD     . GLU A  1 118  ? 64.569  122.070 -37.588 1.00 166.29 ?  118  GLU A CD     1 
ATOM   930   O  OE1    . GLU A  1 118  ? 65.552  122.311 -36.854 1.00 170.60 ?  118  GLU A OE1    1 
ATOM   931   O  OE2    . GLU A  1 118  ? 64.443  120.999 -38.220 1.00 151.92 -1 118  GLU A OE2    1 
ATOM   932   N  N      . PHE A  1 119  ? 61.736  125.762 -34.336 1.00 139.37 ?  119  PHE A N      1 
ATOM   933   C  CA     . PHE A  1 119  ? 61.711  126.511 -33.081 1.00 138.13 ?  119  PHE A CA     1 
ATOM   934   C  C      . PHE A  1 119  ? 62.035  125.594 -31.921 1.00 137.13 ?  119  PHE A C      1 
ATOM   935   O  O      . PHE A  1 119  ? 61.914  124.374 -32.035 1.00 135.00 ?  119  PHE A O      1 
ATOM   936   C  CB     . PHE A  1 119  ? 60.338  127.165 -32.857 1.00 140.84 ?  119  PHE A CB     1 
ATOM   937   C  CG     . PHE A  1 119  ? 59.942  128.090 -33.972 1.00 146.04 ?  119  PHE A CG     1 
ATOM   938   C  CD1    . PHE A  1 119  ? 59.230  127.621 -35.064 1.00 150.86 ?  119  PHE A CD1    1 
ATOM   939   C  CD2    . PHE A  1 119  ? 60.335  129.418 -33.963 1.00 151.45 ?  119  PHE A CD2    1 
ATOM   940   C  CE1    . PHE A  1 119  ? 58.906  128.469 -36.121 1.00 155.55 ?  119  PHE A CE1    1 
ATOM   941   C  CE2    . PHE A  1 119  ? 60.005  130.266 -35.016 1.00 158.01 ?  119  PHE A CE2    1 
ATOM   942   C  CZ     . PHE A  1 119  ? 59.291  129.787 -36.090 1.00 157.18 ?  119  PHE A CZ     1 
ATOM   943   N  N      . TYR A  1 120  ? 62.443  126.193 -30.799 1.00 131.58 ?  120  TYR A N      1 
ATOM   944   C  CA     . TYR A  1 120  ? 62.758  125.480 -29.569 1.00 128.58 ?  120  TYR A CA     1 
ATOM   945   C  C      . TYR A  1 120  ? 61.820  125.977 -28.484 1.00 133.14 ?  120  TYR A C      1 
ATOM   946   O  O      . TYR A  1 120  ? 61.680  127.189 -28.330 1.00 134.55 ?  120  TYR A O      1 
ATOM   947   C  CB     . TYR A  1 120  ? 64.223  125.732 -29.151 1.00 129.07 ?  120  TYR A CB     1 
ATOM   948   C  CG     . TYR A  1 120  ? 64.558  125.149 -27.792 1.00 126.70 ?  120  TYR A CG     1 
ATOM   949   C  CD1    . TYR A  1 120  ? 65.031  123.853 -27.670 1.00 126.43 ?  120  TYR A CD1    1 
ATOM   950   C  CD2    . TYR A  1 120  ? 64.394  125.897 -26.625 1.00 127.25 ?  120  TYR A CD2    1 
ATOM   951   C  CE1    . TYR A  1 120  ? 65.336  123.308 -26.426 1.00 124.62 ?  120  TYR A CE1    1 
ATOM   952   C  CE2    . TYR A  1 120  ? 64.686  125.358 -25.370 1.00 126.63 ?  120  TYR A CE2    1 
ATOM   953   C  CZ     . TYR A  1 120  ? 65.155  124.061 -25.274 1.00 128.73 ?  120  TYR A CZ     1 
ATOM   954   O  OH     . TYR A  1 120  ? 65.466  123.535 -24.037 1.00 124.52 ?  120  TYR A OH     1 
ATOM   955   N  N      . VAL A  1 121  ? 61.171  125.061 -27.740 1.00 128.24 ?  121  VAL A N      1 
ATOM   956   C  CA     . VAL A  1 121  ? 60.311  125.418 -26.594 1.00 127.28 ?  121  VAL A CA     1 
ATOM   957   C  C      . VAL A  1 121  ? 60.632  124.465 -25.476 1.00 130.50 ?  121  VAL A C      1 
ATOM   958   O  O      . VAL A  1 121  ? 60.772  123.261 -25.717 1.00 129.16 ?  121  VAL A O      1 
ATOM   959   C  CB     . VAL A  1 121  ? 58.764  125.504 -26.817 1.00 130.41 ?  121  VAL A CB     1 
ATOM   960   C  CG1    . VAL A  1 121  ? 58.078  126.035 -25.561 1.00 129.42 ?  121  VAL A CG1    1 
ATOM   961   C  CG2    . VAL A  1 121  ? 58.400  126.395 -28.003 1.00 132.55 ?  121  VAL A CG2    1 
ATOM   962   N  N      . CYS A  1 122  ? 60.749  125.003 -24.252 1.00 126.96 ?  122  CYS A N      1 
ATOM   963   C  CA     . CYS A  1 122  ? 60.980  124.202 -23.066 1.00 124.85 ?  122  CYS A CA     1 
ATOM   964   C  C      . CYS A  1 122  ? 60.313  124.797 -21.832 1.00 127.27 ?  122  CYS A C      1 
ATOM   965   O  O      . CYS A  1 122  ? 60.337  126.008 -21.652 1.00 129.44 ?  122  CYS A O      1 
ATOM   966   C  CB     . CYS A  1 122  ? 62.464  123.982 -22.832 1.00 125.45 ?  122  CYS A CB     1 
ATOM   967   S  SG     . CYS A  1 122  ? 62.803  122.828 -21.491 1.00 127.91 ?  122  CYS A SG     1 
ATOM   968   N  N      . ILE A  1 123  ? 59.724  123.943 -20.985 1.00 118.93 ?  123  ILE A N      1 
ATOM   969   C  CA     . ILE A  1 123  ? 59.130  124.347 -19.711 1.00 116.47 ?  123  ILE A CA     1 
ATOM   970   C  C      . ILE A  1 123  ? 59.768  123.468 -18.650 1.00 118.97 ?  123  ILE A C      1 
ATOM   971   O  O      . ILE A  1 123  ? 59.826  122.251 -18.822 1.00 118.22 ?  123  ILE A O      1 
ATOM   972   C  CB     . ILE A  1 123  ? 57.580  124.248 -19.655 1.00 118.12 ?  123  ILE A CB     1 
ATOM   973   C  CG1    . ILE A  1 123  ? 56.907  124.861 -20.892 1.00 119.74 ?  123  ILE A CG1    1 
ATOM   974   C  CG2    . ILE A  1 123  ? 57.042  124.903 -18.373 1.00 117.70 ?  123  ILE A CG2    1 
ATOM   975   C  CD1    . ILE A  1 123  ? 55.430  124.552 -21.011 1.00 128.64 ?  123  ILE A CD1    1 
ATOM   976   N  N      . TYR A  1 124  ? 60.265  124.060 -17.570 1.00 114.96 ?  124  TYR A N      1 
ATOM   977   C  CA     . TYR A  1 124  ? 60.829  123.251 -16.507 1.00 113.99 ?  124  TYR A CA     1 
ATOM   978   C  C      . TYR A  1 124  ? 60.538  123.844 -15.138 1.00 120.03 ?  124  TYR A C      1 
ATOM   979   O  O      . TYR A  1 124  ? 60.477  125.070 -14.985 1.00 122.47 ?  124  TYR A O      1 
ATOM   980   C  CB     . TYR A  1 124  ? 62.314  123.005 -16.727 1.00 116.26 ?  124  TYR A CB     1 
ATOM   981   C  CG     . TYR A  1 124  ? 63.187  124.239 -16.564 1.00 121.46 ?  124  TYR A CG     1 
ATOM   982   C  CD1    . TYR A  1 124  ? 63.511  125.042 -17.653 1.00 125.43 ?  124  TYR A CD1    1 
ATOM   983   C  CD2    . TYR A  1 124  ? 63.692  124.606 -15.318 1.00 123.64 ?  124  TYR A CD2    1 
ATOM   984   C  CE1    . TYR A  1 124  ? 64.349  126.155 -17.514 1.00 129.11 ?  124  TYR A CE1    1 
ATOM   985   C  CE2    . TYR A  1 124  ? 64.492  125.742 -15.162 1.00 127.63 ?  124  TYR A CE2    1 
ATOM   986   C  CZ     . TYR A  1 124  ? 64.847  126.494 -16.267 1.00 137.61 ?  124  TYR A CZ     1 
ATOM   987   O  OH     . TYR A  1 124  ? 65.654  127.604 -16.114 1.00 142.83 ?  124  TYR A OH     1 
ATOM   988   N  N      . ALA A  1 125  ? 60.373  122.972 -14.141 1.00 115.38 ?  125  ALA A N      1 
ATOM   989   C  CA     . ALA A  1 125  ? 60.047  123.369 -12.777 1.00 115.21 ?  125  ALA A CA     1 
ATOM   990   C  C      . ALA A  1 125  ? 61.271  123.731 -11.944 1.00 119.19 ?  125  ALA A C      1 
ATOM   991   O  O      . ALA A  1 125  ? 62.346  123.143 -12.110 1.00 118.50 ?  125  ALA A O      1 
ATOM   992   C  CB     . ALA A  1 125  ? 59.286  122.251 -12.100 1.00 114.50 ?  125  ALA A CB     1 
ATOM   993   N  N      . THR A  1 126  ? 61.096  124.718 -11.053 1.00 116.20 ?  126  THR A N      1 
ATOM   994   C  CA     . THR A  1 126  ? 62.078  125.156 -10.043 1.00 117.16 ?  126  THR A CA     1 
ATOM   995   C  C      . THR A  1 126  ? 61.290  125.506 -8.793  1.00 120.68 ?  126  THR A C      1 
ATOM   996   O  O      . THR A  1 126  ? 60.053  125.575 -8.845  1.00 120.30 ?  126  THR A O      1 
ATOM   997   C  CB     . THR A  1 126  ? 62.890  126.361 -10.458 1.00 122.20 ?  126  THR A CB     1 
ATOM   998   O  OG1    . THR A  1 126  ? 62.006  127.460 -10.626 1.00 121.72 ?  126  THR A OG1    1 
ATOM   999   C  CG2    . THR A  1 126  ? 63.680  126.114 -11.698 1.00 118.83 ?  126  THR A CG2    1 
ATOM   1000  N  N      . ARG A  1 127  ? 61.984  125.731 -7.668  1.00 115.60 ?  127  ARG A N      1 
ATOM   1001  C  CA     . ARG A  1 127  ? 61.295  126.073 -6.423  1.00 113.89 ?  127  ARG A CA     1 
ATOM   1002  C  C      . ARG A  1 127  ? 60.351  127.239 -6.574  1.00 118.41 ?  127  ARG A C      1 
ATOM   1003  O  O      . ARG A  1 127  ? 59.228  127.187 -6.100  1.00 114.68 ?  127  ARG A O      1 
ATOM   1004  C  CB     . ARG A  1 127  ? 62.307  126.382 -5.333  1.00 111.52 ?  127  ARG A CB     1 
ATOM   1005  C  CG     . ARG A  1 127  ? 61.687  126.610 -3.971  1.00 104.67 ?  127  ARG A CG     1 
ATOM   1006  C  CD     . ARG A  1 127  ? 62.761  126.491 -2.935  1.00 101.90 ?  127  ARG A CD     1 
ATOM   1007  N  NE     . ARG A  1 127  ? 62.303  126.861 -1.602  1.00 101.47 ?  127  ARG A NE     1 
ATOM   1008  C  CZ     . ARG A  1 127  ? 61.913  125.979 -0.698  1.00 111.71 ?  127  ARG A CZ     1 
ATOM   1009  N  NH1    . ARG A  1 127  ? 61.898  124.684 -0.990  1.00 89.24  1  127  ARG A NH1    1 
ATOM   1010  N  NH2    . ARG A  1 127  ? 61.531  126.383 0.510   1.00 103.88 ?  127  ARG A NH2    1 
ATOM   1011  N  N      . GLU A  1 128  ? 60.820  128.278 -7.249  1.00 121.61 ?  128  GLU A N      1 
ATOM   1012  C  CA     . GLU A  1 128  ? 60.154  129.564 -7.431  1.00 125.53 ?  128  GLU A CA     1 
ATOM   1013  C  C      . GLU A  1 128  ? 59.076  129.606 -8.533  1.00 131.00 ?  128  GLU A C      1 
ATOM   1014  O  O      . GLU A  1 128  ? 58.431  130.650 -8.706  1.00 132.63 ?  128  GLU A O      1 
ATOM   1015  C  CB     . GLU A  1 128  ? 61.204  130.665 -7.662  1.00 130.20 ?  128  GLU A CB     1 
ATOM   1016  C  CG     . GLU A  1 128  ? 62.046  130.482 -8.920  1.00 144.11 ?  128  GLU A CG     1 
ATOM   1017  C  CD     . GLU A  1 128  ? 63.317  129.657 -8.796  1.00 172.21 ?  128  GLU A CD     1 
ATOM   1018  O  OE1    . GLU A  1 128  ? 63.492  128.945 -7.778  1.00 169.05 ?  128  GLU A OE1    1 
ATOM   1019  O  OE2    . GLU A  1 128  ? 64.122  129.688 -9.755  1.00 173.13 -1 128  GLU A OE2    1 
ATOM   1020  N  N      . GLY A  1 129  ? 58.918  128.507 -9.266  1.00 125.77 ?  129  GLY A N      1 
ATOM   1021  C  CA     . GLY A  1 129  ? 57.935  128.415 -10.331 1.00 125.19 ?  129  GLY A CA     1 
ATOM   1022  C  C      . GLY A  1 129  ? 58.455  127.695 -11.544 1.00 128.79 ?  129  GLY A C      1 
ATOM   1023  O  O      . GLY A  1 129  ? 59.467  126.995 -11.468 1.00 127.95 ?  129  GLY A O      1 
ATOM   1024  N  N      . ASP A  1 130  ? 57.755  127.866 -12.664 1.00 125.60 ?  130  ASP A N      1 
ATOM   1025  C  CA     . ASP A  1 130  ? 58.122  127.185 -13.893 1.00 124.40 ?  130  ASP A CA     1 
ATOM   1026  C  C      . ASP A  1 130  ? 58.613  128.155 -14.930 1.00 126.73 ?  130  ASP A C      1 
ATOM   1027  O  O      . ASP A  1 130  ? 57.919  129.126 -15.255 1.00 126.58 ?  130  ASP A O      1 
ATOM   1028  C  CB     . ASP A  1 130  ? 56.950  126.339 -14.433 1.00 125.94 ?  130  ASP A CB     1 
ATOM   1029  C  CG     . ASP A  1 130  ? 56.338  125.416 -13.396 1.00 137.99 ?  130  ASP A CG     1 
ATOM   1030  O  OD1    . ASP A  1 130  ? 56.920  124.337 -13.146 1.00 138.06 ?  130  ASP A OD1    1 
ATOM   1031  O  OD2    . ASP A  1 130  ? 55.289  125.787 -12.815 1.00 142.69 -1 130  ASP A OD2    1 
ATOM   1032  N  N      . TYR A  1 131  ? 59.816  127.896 -15.447 1.00 122.69 ?  131  TYR A N      1 
ATOM   1033  C  CA     . TYR A  1 131  ? 60.407  128.708 -16.505 1.00 124.22 ?  131  TYR A CA     1 
ATOM   1034  C  C      . TYR A  1 131  ? 59.996  128.209 -17.867 1.00 125.20 ?  131  TYR A C      1 
ATOM   1035  O  O      . TYR A  1 131  ? 59.985  126.998 -18.113 1.00 123.21 ?  131  TYR A O      1 
ATOM   1036  C  CB     . TYR A  1 131  ? 61.929  128.721 -16.421 1.00 126.82 ?  131  TYR A CB     1 
ATOM   1037  C  CG     . TYR A  1 131  ? 62.450  129.491 -15.242 1.00 131.73 ?  131  TYR A CG     1 
ATOM   1038  C  CD1    . TYR A  1 131  ? 62.627  128.877 -14.014 1.00 132.86 ?  131  TYR A CD1    1 
ATOM   1039  C  CD2    . TYR A  1 131  ? 62.793  130.834 -15.357 1.00 136.45 ?  131  TYR A CD2    1 
ATOM   1040  C  CE1    . TYR A  1 131  ? 63.114  129.582 -12.917 1.00 137.16 ?  131  TYR A CE1    1 
ATOM   1041  C  CE2    . TYR A  1 131  ? 63.307  131.545 -14.275 1.00 140.23 ?  131  TYR A CE2    1 
ATOM   1042  C  CZ     . TYR A  1 131  ? 63.447  130.921 -13.049 1.00 148.86 ?  131  TYR A CZ     1 
ATOM   1043  O  OH     . TYR A  1 131  ? 63.942  131.623 -11.970 1.00 154.18 ?  131  TYR A OH     1 
ATOM   1044  N  N      . VAL A  1 132  ? 59.669  129.150 -18.754 1.00 121.19 ?  132  VAL A N      1 
ATOM   1045  C  CA     . VAL A  1 132  ? 59.296  128.870 -20.135 1.00 119.90 ?  132  VAL A CA     1 
ATOM   1046  C  C      . VAL A  1 132  ? 60.390  129.463 -21.029 1.00 127.71 ?  132  VAL A C      1 
ATOM   1047  O  O      . VAL A  1 132  ? 60.710  130.642 -20.919 1.00 130.92 ?  132  VAL A O      1 
ATOM   1048  C  CB     . VAL A  1 132  ? 57.881  129.392 -20.480 1.00 122.96 ?  132  VAL A CB     1 
ATOM   1049  C  CG1    . VAL A  1 132  ? 57.463  128.961 -21.880 1.00 122.15 ?  132  VAL A CG1    1 
ATOM   1050  C  CG2    . VAL A  1 132  ? 56.853  128.952 -19.432 1.00 121.35 ?  132  VAL A CG2    1 
ATOM   1051  N  N      . LEU A  1 133  ? 60.992  128.626 -21.869 1.00 124.13 ?  133  LEU A N      1 
ATOM   1052  C  CA     . LEU A  1 133  ? 62.088  128.986 -22.765 1.00 125.96 ?  133  LEU A CA     1 
ATOM   1053  C  C      . LEU A  1 133  ? 61.658  128.894 -24.209 1.00 130.74 ?  133  LEU A C      1 
ATOM   1054  O  O      . LEU A  1 133  ? 60.942  127.956 -24.598 1.00 126.81 ?  133  LEU A O      1 
ATOM   1055  C  CB     . LEU A  1 133  ? 63.280  128.039 -22.567 1.00 124.95 ?  133  LEU A CB     1 
ATOM   1056  C  CG     . LEU A  1 133  ? 64.159  128.251 -21.369 1.00 129.04 ?  133  LEU A CG     1 
ATOM   1057  C  CD1    . LEU A  1 133  ? 63.443  127.897 -20.098 1.00 127.21 ?  133  LEU A CD1    1 
ATOM   1058  C  CD2    . LEU A  1 133  ? 65.383  127.405 -21.510 1.00 129.33 ?  133  LEU A CD2    1 
ATOM   1059  N  N      . PHE A  1 134  ? 62.124  129.847 -25.009 1.00 131.71 ?  134  PHE A N      1 
ATOM   1060  C  CA     . PHE A  1 134  ? 61.847  129.869 -26.428 1.00 133.55 ?  134  PHE A CA     1 
ATOM   1061  C  C      . PHE A  1 134  ? 63.081  130.300 -27.176 1.00 141.48 ?  134  PHE A C      1 
ATOM   1062  O  O      . PHE A  1 134  ? 63.780  131.191 -26.708 1.00 144.38 ?  134  PHE A O      1 
ATOM   1063  C  CB     . PHE A  1 134  ? 60.677  130.817 -26.747 1.00 137.44 ?  134  PHE A CB     1 
ATOM   1064  C  CG     . PHE A  1 134  ? 60.425  130.948 -28.224 1.00 141.32 ?  134  PHE A CG     1 
ATOM   1065  C  CD1    . PHE A  1 134  ? 59.658  130.013 -28.900 1.00 143.42 ?  134  PHE A CD1    1 
ATOM   1066  C  CD2    . PHE A  1 134  ? 60.997  131.985 -28.951 1.00 148.60 ?  134  PHE A CD2    1 
ATOM   1067  C  CE1    . PHE A  1 134  ? 59.452  130.124 -30.273 1.00 147.12 ?  134  PHE A CE1    1 
ATOM   1068  C  CE2    . PHE A  1 134  ? 60.803  132.088 -30.327 1.00 153.81 ?  134  PHE A CE2    1 
ATOM   1069  C  CZ     . PHE A  1 134  ? 60.024  131.164 -30.978 1.00 150.45 ?  134  PHE A CZ     1 
ATOM   1070  N  N      . HIS A  1 135  ? 63.332  129.702 -28.354 1.00 137.42 ?  135  HIS A N      1 
ATOM   1071  C  CA     . HIS A  1 135  ? 64.378  130.118 -29.289 1.00 138.80 ?  135  HIS A CA     1 
ATOM   1072  C  C      . HIS A  1 135  ? 63.907  129.962 -30.723 1.00 146.58 ?  135  HIS A C      1 
ATOM   1073  O  O      . HIS A  1 135  ? 63.271  128.958 -31.056 1.00 145.69 ?  135  HIS A O      1 
ATOM   1074  C  CB     . HIS A  1 135  ? 65.692  129.399 -29.079 1.00 137.97 ?  135  HIS A CB     1 
ATOM   1075  C  CG     . HIS A  1 135  ? 66.838  130.238 -29.535 1.00 143.62 ?  135  HIS A CG     1 
ATOM   1076  N  ND1    . HIS A  1 135  ? 67.505  129.967 -30.701 1.00 146.36 ?  135  HIS A ND1    1 
ATOM   1077  C  CD2    . HIS A  1 135  ? 67.372  131.348 -28.973 1.00 146.95 ?  135  HIS A CD2    1 
ATOM   1078  C  CE1    . HIS A  1 135  ? 68.443  130.889 -30.799 1.00 148.45 ?  135  HIS A CE1    1 
ATOM   1079  N  NE2    . HIS A  1 135  ? 68.401  131.741 -29.782 1.00 149.48 ?  135  HIS A NE2    1 
ATOM   1080  N  N      . HIS A  1 136  ? 64.189  130.953 -31.570 1.00 146.63 ?  136  HIS A N      1 
ATOM   1081  C  CA     . HIS A  1 136  ? 63.767  130.911 -32.983 1.00 147.78 ?  136  HIS A CA     1 
ATOM   1082  C  C      . HIS A  1 136  ? 64.676  130.065 -33.878 1.00 153.33 ?  136  HIS A C      1 
ATOM   1083  O  O      . HIS A  1 136  ? 64.319  129.722 -35.011 1.00 152.73 ?  136  HIS A O      1 
ATOM   1084  C  CB     . HIS A  1 136  ? 63.676  132.316 -33.548 1.00 151.57 ?  136  HIS A CB     1 
ATOM   1085  C  CG     . HIS A  1 136  ? 64.955  133.062 -33.394 1.00 156.46 ?  136  HIS A CG     1 
ATOM   1086  N  ND1    . HIS A  1 136  ? 65.332  133.575 -32.173 1.00 158.12 ?  136  HIS A ND1    1 
ATOM   1087  C  CD2    . HIS A  1 136  ? 65.948  133.267 -34.287 1.00 159.75 ?  136  HIS A CD2    1 
ATOM   1088  C  CE1    . HIS A  1 136  ? 66.525  134.108 -32.368 1.00 159.76 ?  136  HIS A CE1    1 
ATOM   1089  N  NE2    . HIS A  1 136  ? 66.937  133.943 -33.626 1.00 161.26 ?  136  HIS A NE2    1 
ATOM   1090  N  N      . GLU A  1 137  ? 65.846  129.743 -33.372 1.00 151.70 ?  137  GLU A N      1 
ATOM   1091  C  CA     . GLU A  1 137  ? 66.787  128.884 -34.058 1.00 152.61 ?  137  GLU A CA     1 
ATOM   1092  C  C      . GLU A  1 137  ? 66.784  127.546 -33.319 1.00 156.45 ?  137  GLU A C      1 
ATOM   1093  O  O      . GLU A  1 137  ? 67.658  127.290 -32.482 1.00 156.62 ?  137  GLU A O      1 
ATOM   1094  C  CB     . GLU A  1 137  ? 68.184  129.524 -34.097 1.00 156.57 ?  137  GLU A CB     1 
ATOM   1095  C  CG     . GLU A  1 137  ? 68.282  130.735 -35.017 1.00 169.83 ?  137  GLU A CG     1 
ATOM   1096  C  CD     . GLU A  1 137  ? 69.477  131.649 -34.806 1.00 188.42 ?  137  GLU A CD     1 
ATOM   1097  O  OE1    . GLU A  1 137  ? 69.774  132.458 -35.716 1.00 169.94 ?  137  GLU A OE1    1 
ATOM   1098  O  OE2    . GLU A  1 137  ? 70.105  131.569 -33.724 1.00 185.69 -1 137  GLU A OE2    1 
ATOM   1099  N  N      . GLY A  1 138  ? 65.773  126.725 -33.606 1.00 152.07 ?  138  GLY A N      1 
ATOM   1100  C  CA     . GLY A  1 138  ? 65.618  125.416 -32.981 1.00 150.21 ?  138  GLY A CA     1 
ATOM   1101  C  C      . GLY A  1 138  ? 66.341  124.308 -33.728 1.00 156.85 ?  138  GLY A C      1 
ATOM   1102  O  O      . GLY A  1 138  ? 67.030  124.554 -34.727 1.00 158.53 ?  138  GLY A O      1 
ATOM   1103  N  N      . GLY A  1 139  ? 66.200  123.082 -33.232 1.00 152.81 ?  139  GLY A N      1 
ATOM   1104  C  CA     . GLY A  1 139  ? 66.756  121.905 -33.895 1.00 153.07 ?  139  GLY A CA     1 
ATOM   1105  C  C      . GLY A  1 139  ? 67.931  121.171 -33.300 1.00 155.93 ?  139  GLY A C      1 
ATOM   1106  O  O      . GLY A  1 139  ? 68.147  121.209 -32.088 1.00 154.70 ?  139  GLY A O      1 
ATOM   1107  N  N      . VAL A  1 140  ? 68.616  120.374 -34.137 1.00 152.43 ?  140  VAL A N      1 
ATOM   1108  C  CA     . VAL A  1 140  ? 69.693  119.536 -33.620 1.00 152.08 ?  140  VAL A CA     1 
ATOM   1109  C  C      . VAL A  1 140  ? 70.950  120.379 -33.262 1.00 156.86 ?  140  VAL A C      1 
ATOM   1110  O  O      . VAL A  1 140  ? 71.862  119.875 -32.606 1.00 156.94 ?  140  VAL A O      1 
ATOM   1111  C  CB     . VAL A  1 140  ? 69.973  118.316 -34.533 1.00 156.32 ?  140  VAL A CB     1 
ATOM   1112  C  CG1    . VAL A  1 140  ? 70.950  118.651 -35.652 1.00 158.66 ?  140  VAL A CG1    1 
ATOM   1113  C  CG2    . VAL A  1 140  ? 70.430  117.102 -33.720 1.00 155.83 ?  140  VAL A CG2    1 
ATOM   1114  N  N      . ASP A  1 141  ? 70.942  121.669 -33.612 1.00 153.97 ?  141  ASP A N      1 
ATOM   1115  C  CA     . ASP A  1 141  ? 72.046  122.564 -33.306 1.00 155.94 ?  141  ASP A CA     1 
ATOM   1116  C  C      . ASP A  1 141  ? 71.561  123.833 -32.582 1.00 157.48 ?  141  ASP A C      1 
ATOM   1117  O  O      . ASP A  1 141  ? 71.611  124.941 -33.129 1.00 158.84 ?  141  ASP A O      1 
ATOM   1118  C  CB     . ASP A  1 141  ? 72.865  122.890 -34.580 1.00 161.28 ?  141  ASP A CB     1 
ATOM   1119  C  CG     . ASP A  1 141  ? 73.545  121.711 -35.263 1.00 171.69 ?  141  ASP A CG     1 
ATOM   1120  O  OD1    . ASP A  1 141  ? 73.504  121.643 -36.506 1.00 172.93 ?  141  ASP A OD1    1 
ATOM   1121  O  OD2    . ASP A  1 141  ? 74.180  120.904 -34.560 1.00 178.76 -1 141  ASP A OD2    1 
ATOM   1122  N  N      . VAL A  1 142  ? 71.089  123.670 -31.349 1.00 150.85 ?  142  VAL A N      1 
ATOM   1123  C  CA     . VAL A  1 142  ? 70.651  124.837 -30.585 1.00 150.79 ?  142  VAL A CA     1 
ATOM   1124  C  C      . VAL A  1 142  ? 71.761  125.287 -29.649 1.00 157.46 ?  142  VAL A C      1 
ATOM   1125  O  O      . VAL A  1 142  ? 71.958  126.488 -29.463 1.00 159.07 ?  142  VAL A O      1 
ATOM   1126  C  CB     . VAL A  1 142  ? 69.302  124.672 -29.842 1.00 151.90 ?  142  VAL A CB     1 
ATOM   1127  C  CG1    . VAL A  1 142  ? 68.666  126.032 -29.554 1.00 151.95 ?  142  VAL A CG1    1 
ATOM   1128  C  CG2    . VAL A  1 142  ? 68.340  123.827 -30.648 1.00 150.47 ?  142  VAL A CG2    1 
ATOM   1129  N  N      . GLY A  1 143  ? 72.483  124.326 -29.085 1.00 154.56 ?  143  GLY A N      1 
ATOM   1130  C  CA     . GLY A  1 143  ? 73.579  124.607 -28.166 1.00 157.10 ?  143  GLY A CA     1 
ATOM   1131  C  C      . GLY A  1 143  ? 73.068  125.001 -26.801 1.00 161.89 ?  143  GLY A C      1 
ATOM   1132  O  O      . GLY A  1 143  ? 72.065  124.444 -26.327 1.00 158.84 ?  143  GLY A O      1 
ATOM   1133  N  N      . ASP A  1 144  ? 73.742  125.972 -26.153 1.00 162.25 ?  144  ASP A N      1 
ATOM   1134  C  CA     . ASP A  1 144  ? 73.318  126.400 -24.813 1.00 161.36 ?  144  ASP A CA     1 
ATOM   1135  C  C      . ASP A  1 144  ? 72.036  127.223 -24.863 1.00 162.37 ?  144  ASP A C      1 
ATOM   1136  O  O      . ASP A  1 144  ? 72.051  128.422 -25.157 1.00 163.39 ?  144  ASP A O      1 
ATOM   1137  C  CB     . ASP A  1 144  ? 74.433  127.101 -24.008 1.00 166.80 ?  144  ASP A CB     1 
ATOM   1138  C  CG     . ASP A  1 144  ? 74.098  127.266 -22.538 1.00 173.47 ?  144  ASP A CG     1 
ATOM   1139  O  OD1    . ASP A  1 144  ? 73.305  126.448 -22.011 1.00 169.97 -1 144  ASP A OD1    1 
ATOM   1140  O  OD2    . ASP A  1 144  ? 74.641  128.194 -21.911 1.00 182.55 -1 144  ASP A OD2    1 
ATOM   1141  N  N      . VAL A  1 145  ? 70.923  126.538 -24.588 1.00 154.99 ?  145  VAL A N      1 
ATOM   1142  C  CA     . VAL A  1 145  ? 69.579  127.107 -24.579 1.00 152.53 ?  145  VAL A CA     1 
ATOM   1143  C  C      . VAL A  1 145  ? 69.365  128.066 -23.417 1.00 156.77 ?  145  VAL A C      1 
ATOM   1144  O  O      . VAL A  1 145  ? 68.679  129.073 -23.570 1.00 156.12 ?  145  VAL A O      1 
ATOM   1145  C  CB     . VAL A  1 145  ? 68.483  126.020 -24.647 1.00 152.73 ?  145  VAL A CB     1 
ATOM   1146  C  CG1    . VAL A  1 145  ? 68.377  125.466 -26.055 1.00 152.20 ?  145  VAL A CG1    1 
ATOM   1147  C  CG2    . VAL A  1 145  ? 68.733  124.890 -23.647 1.00 151.16 ?  145  VAL A CG2    1 
ATOM   1148  N  N      . ASP A  1 146  ? 69.976  127.767 -22.268 1.00 154.97 ?  146  ASP A N      1 
ATOM   1149  C  CA     . ASP A  1 146  ? 69.866  128.584 -21.063 1.00 156.82 ?  146  ASP A CA     1 
ATOM   1150  C  C      . ASP A  1 146  ? 70.394  129.997 -21.300 1.00 162.79 ?  146  ASP A C      1 
ATOM   1151  O  O      . ASP A  1 146  ? 69.731  130.968 -20.922 1.00 164.83 ?  146  ASP A O      1 
ATOM   1152  C  CB     . ASP A  1 146  ? 70.568  127.902 -19.875 1.00 160.26 ?  146  ASP A CB     1 
ATOM   1153  C  CG     . ASP A  1 146  ? 70.192  126.438 -19.749 1.00 176.04 ?  146  ASP A CG     1 
ATOM   1154  O  OD1    . ASP A  1 146  ? 69.167  126.140 -19.095 1.00 174.83 -1 146  ASP A OD1    1 
ATOM   1155  O  OD2    . ASP A  1 146  ? 70.854  125.603 -20.400 1.00 186.68 -1 146  ASP A OD2    1 
ATOM   1156  N  N      . ALA A  1 147  ? 71.543  130.114 -21.980 1.00 157.86 ?  147  ALA A N      1 
ATOM   1157  C  CA     . ALA A  1 147  ? 72.118  131.407 -22.296 1.00 159.74 ?  147  ALA A CA     1 
ATOM   1158  C  C      . ALA A  1 147  ? 71.367  132.078 -23.460 1.00 159.55 ?  147  ALA A C      1 
ATOM   1159  O  O      . ALA A  1 147  ? 70.879  133.199 -23.300 1.00 160.44 ?  147  ALA A O      1 
ATOM   1160  C  CB     . ALA A  1 147  ? 73.591  131.253 -22.625 1.00 163.68 ?  147  ALA A CB     1 
ATOM   1161  N  N      . LYS A  1 148  ? 71.242  131.372 -24.607 1.00 151.92 ?  148  LYS A N      1 
ATOM   1162  C  CA     . LYS A  1 148  ? 70.617  131.868 -25.840 1.00 150.91 ?  148  LYS A CA     1 
ATOM   1163  C  C      . LYS A  1 148  ? 69.123  132.244 -25.725 1.00 152.06 ?  148  LYS A C      1 
ATOM   1164  O  O      . LYS A  1 148  ? 68.751  133.398 -25.972 1.00 154.30 ?  148  LYS A O      1 
ATOM   1165  C  CB     . LYS A  1 148  ? 70.811  130.863 -27.005 1.00 151.37 ?  148  LYS A CB     1 
ATOM   1166  C  CG     . LYS A  1 148  ? 72.228  130.757 -27.583 1.00 163.23 ?  148  LYS A CG     1 
ATOM   1167  C  CD     . LYS A  1 148  ? 72.350  129.669 -28.682 1.00 166.74 ?  148  LYS A CD     1 
ATOM   1168  C  CE     . LYS A  1 148  ? 71.893  130.105 -30.065 1.00 170.14 ?  148  LYS A CE     1 
ATOM   1169  N  NZ     . LYS A  1 148  ? 71.440  128.957 -30.908 1.00 171.08 1  148  LYS A NZ     1 
ATOM   1170  N  N      . ALA A  1 149  ? 68.279  131.261 -25.377 1.00 143.40 ?  149  ALA A N      1 
ATOM   1171  C  CA     . ALA A  1 149  ? 66.825  131.366 -25.347 1.00 140.12 ?  149  ALA A CA     1 
ATOM   1172  C  C      . ALA A  1 149  ? 66.256  132.407 -24.428 1.00 139.60 ?  149  ALA A C      1 
ATOM   1173  O  O      . ALA A  1 149  ? 66.818  132.673 -23.366 1.00 138.10 ?  149  ALA A O      1 
ATOM   1174  C  CB     . ALA A  1 149  ? 66.208  130.003 -25.015 1.00 137.55 ?  149  ALA A CB     1 
ATOM   1175  N  N      . GLN A  1 150  ? 65.105  132.967 -24.850 1.00 134.91 ?  150  GLN A N      1 
ATOM   1176  C  CA     . GLN A  1 150  ? 64.276  133.886 -24.086 1.00 135.45 ?  150  GLN A CA     1 
ATOM   1177  C  C      . GLN A  1 150  ? 63.635  133.034 -22.995 1.00 137.28 ?  150  GLN A C      1 
ATOM   1178  O  O      . GLN A  1 150  ? 63.148  131.930 -23.272 1.00 134.55 ?  150  GLN A O      1 
ATOM   1179  C  CB     . GLN A  1 150  ? 63.197  134.528 -24.971 1.00 137.71 ?  150  GLN A CB     1 
ATOM   1180  C  CG     . GLN A  1 150  ? 63.733  135.243 -26.191 1.00 152.56 ?  150  GLN A CG     1 
ATOM   1181  C  CD     . GLN A  1 150  ? 64.654  136.367 -25.829 1.00 178.71 ?  150  GLN A CD     1 
ATOM   1182  O  OE1    . GLN A  1 150  ? 64.213  137.434 -25.392 1.00 174.26 ?  150  GLN A OE1    1 
ATOM   1183  N  NE2    . GLN A  1 150  ? 65.953  136.155 -26.044 1.00 179.14 ?  150  GLN A NE2    1 
ATOM   1184  N  N      . LYS A  1 151  ? 63.659  133.538 -21.759 1.00 134.02 ?  151  LYS A N      1 
ATOM   1185  C  CA     . LYS A  1 151  ? 63.195  132.826 -20.581 1.00 131.08 ?  151  LYS A CA     1 
ATOM   1186  C  C      . LYS A  1 151  ? 62.166  133.674 -19.848 1.00 136.58 ?  151  LYS A C      1 
ATOM   1187  O  O      . LYS A  1 151  ? 62.264  134.905 -19.838 1.00 138.89 ?  151  LYS A O      1 
ATOM   1188  C  CB     . LYS A  1 151  ? 64.406  132.574 -19.672 1.00 133.38 ?  151  LYS A CB     1 
ATOM   1189  C  CG     . LYS A  1 151  ? 64.367  131.299 -18.855 1.00 136.93 ?  151  LYS A CG     1 
ATOM   1190  C  CD     . LYS A  1 151  ? 65.780  130.960 -18.345 1.00 140.29 ?  151  LYS A CD     1 
ATOM   1191  C  CE     . LYS A  1 151  ? 66.103  131.433 -16.936 1.00 136.29 ?  151  LYS A CE     1 
ATOM   1192  N  NZ     . LYS A  1 151  ? 67.260  130.697 -16.354 1.00 140.21 1  151  LYS A NZ     1 
ATOM   1193  N  N      . LEU A  1 152  ? 61.166  133.011 -19.243 1.00 131.49 ?  152  LEU A N      1 
ATOM   1194  C  CA     . LEU A  1 152  ? 60.060  133.656 -18.523 1.00 131.68 ?  152  LEU A CA     1 
ATOM   1195  C  C      . LEU A  1 152  ? 59.618  132.821 -17.334 1.00 132.78 ?  152  LEU A C      1 
ATOM   1196  O  O      . LEU A  1 152  ? 59.301  131.646 -17.507 1.00 128.15 ?  152  LEU A O      1 
ATOM   1197  C  CB     . LEU A  1 152  ? 58.886  133.824 -19.510 1.00 131.69 ?  152  LEU A CB     1 
ATOM   1198  C  CG     . LEU A  1 152  ? 57.733  134.696 -19.108 1.00 137.99 ?  152  LEU A CG     1 
ATOM   1199  C  CD1    . LEU A  1 152  ? 58.178  136.114 -18.882 1.00 142.58 ?  152  LEU A CD1    1 
ATOM   1200  C  CD2    . LEU A  1 152  ? 56.661  134.663 -20.154 1.00 139.47 ?  152  LEU A CD2    1 
ATOM   1201  N  N      . LEU A  1 153  ? 59.595  133.411 -16.133 1.00 131.97 ?  153  LEU A N      1 
ATOM   1202  C  CA     . LEU A  1 153  ? 59.166  132.667 -14.938 1.00 130.17 ?  153  LEU A CA     1 
ATOM   1203  C  C      . LEU A  1 153  ? 57.684  132.823 -14.626 1.00 137.74 ?  153  LEU A C      1 
ATOM   1204  O  O      . LEU A  1 153  ? 57.215  133.933 -14.297 1.00 141.35 ?  153  LEU A O      1 
ATOM   1205  C  CB     . LEU A  1 153  ? 60.004  133.025 -13.682 1.00 130.52 ?  153  LEU A CB     1 
ATOM   1206  C  CG     . LEU A  1 153  ? 59.535  132.462 -12.332 1.00 130.73 ?  153  LEU A CG     1 
ATOM   1207  C  CD1    . LEU A  1 153  ? 59.764  130.992 -12.255 1.00 126.36 ?  153  LEU A CD1    1 
ATOM   1208  C  CD2    . LEU A  1 153  ? 60.256  133.111 -11.208 1.00 133.24 ?  153  LEU A CD2    1 
ATOM   1209  N  N      . VAL A  1 154  ? 56.962  131.697 -14.640 1.00 132.13 ?  154  VAL A N      1 
ATOM   1210  C  CA     . VAL A  1 154  ? 55.564  131.694 -14.204 1.00 132.23 ?  154  VAL A CA     1 
ATOM   1211  C  C      . VAL A  1 154  ? 55.590  131.298 -12.715 1.00 136.30 ?  154  VAL A C      1 
ATOM   1212  O  O      . VAL A  1 154  ? 55.937  130.160 -12.379 1.00 132.18 ?  154  VAL A O      1 
ATOM   1213  C  CB     . VAL A  1 154  ? 54.639  130.764 -15.023 1.00 133.44 ?  154  VAL A CB     1 
ATOM   1214  C  CG1    . VAL A  1 154  ? 53.168  131.060 -14.718 1.00 134.19 ?  154  VAL A CG1    1 
ATOM   1215  C  CG2    . VAL A  1 154  ? 54.913  130.862 -16.526 1.00 133.53 ?  154  VAL A CG2    1 
ATOM   1216  N  N      . GLY A  1 155  ? 55.256  132.251 -11.850 1.00 137.03 ?  155  GLY A N      1 
ATOM   1217  C  CA     . GLY A  1 155  ? 55.260  132.088 -10.397 1.00 137.29 ?  155  GLY A CA     1 
ATOM   1218  C  C      . GLY A  1 155  ? 54.415  130.944 -9.898  1.00 138.74 ?  155  GLY A C      1 
ATOM   1219  O  O      . GLY A  1 155  ? 53.551  130.445 -10.631 1.00 137.99 ?  155  GLY A O      1 
ATOM   1220  N  N      . VAL A  1 156  ? 54.638  130.549 -8.634  1.00 133.67 ?  156  VAL A N      1 
ATOM   1221  C  CA     . VAL A  1 156  ? 53.975  129.396 -8.040  1.00 131.15 ?  156  VAL A CA     1 
ATOM   1222  C  C      . VAL A  1 156  ? 52.433  129.438 -8.185  1.00 135.83 ?  156  VAL A C      1 
ATOM   1223  O  O      . VAL A  1 156  ? 51.870  128.465 -8.719  1.00 134.87 ?  156  VAL A O      1 
ATOM   1224  C  CB     . VAL A  1 156  ? 54.446  129.126 -6.612  1.00 134.40 ?  156  VAL A CB     1 
ATOM   1225  C  CG1    . VAL A  1 156  ? 53.546  128.109 -5.917  1.00 132.39 ?  156  VAL A CG1    1 
ATOM   1226  C  CG2    . VAL A  1 156  ? 55.894  128.633 -6.624  1.00 133.05 ?  156  VAL A CG2    1 
ATOM   1227  N  N      . ASP A  1 157  ? 51.748  130.519 -7.809  1.00 133.75 ?  157  ASP A N      1 
ATOM   1228  C  CA     . ASP A  1 157  ? 50.333  130.366 -8.144  1.00 134.40 ?  157  ASP A CA     1 
ATOM   1229  C  C      . ASP A  1 157  ? 49.896  131.243 -9.320  1.00 140.66 ?  157  ASP A C      1 
ATOM   1230  O  O      . ASP A  1 157  ? 48.710  131.346 -9.615  1.00 141.94 ?  157  ASP A O      1 
ATOM   1231  C  CB     . ASP A  1 157  ? 49.394  130.505 -6.950  1.00 138.48 ?  157  ASP A CB     1 
ATOM   1232  C  CG     . ASP A  1 157  ? 48.268  129.467 -6.954  1.00 151.77 ?  157  ASP A CG     1 
ATOM   1233  O  OD1    . ASP A  1 157  ? 48.402  128.444 -7.665  1.00 149.58 ?  157  ASP A OD1    1 
ATOM   1234  O  OD2    . ASP A  1 157  ? 47.257  129.678 -6.237  1.00 161.46 -1 157  ASP A OD2    1 
ATOM   1235  N  N      . GLU A  1 158  ? 50.861  131.757 -10.060 1.00 138.33 ?  158  GLU A N      1 
ATOM   1236  C  CA     . GLU A  1 158  ? 50.652  132.630 -11.209 1.00 140.67 ?  158  GLU A CA     1 
ATOM   1237  C  C      . GLU A  1 158  ? 50.188  131.907 -12.480 1.00 140.97 ?  158  GLU A C      1 
ATOM   1238  O  O      . GLU A  1 158  ? 50.362  130.693 -12.653 1.00 136.33 ?  158  GLU A O      1 
ATOM   1239  C  CB     . GLU A  1 158  ? 51.915  133.461 -11.504 1.00 143.47 ?  158  GLU A CB     1 
ATOM   1240  C  CG     . GLU A  1 158  ? 52.218  134.536 -10.471 1.00 156.91 ?  158  GLU A CG     1 
ATOM   1241  C  CD     . GLU A  1 158  ? 53.568  135.236 -10.591 1.00 178.78 ?  158  GLU A CD     1 
ATOM   1242  O  OE1    . GLU A  1 158  ? 54.194  135.469 -9.532  1.00 176.27 ?  158  GLU A OE1    1 
ATOM   1243  O  OE2    . GLU A  1 158  ? 54.029  135.508 -11.724 1.00 169.11 -1 158  GLU A OE2    1 
ATOM   1244  N  N      . LYS A  1 159  ? 49.590  132.711 -13.364 1.00 139.42 ?  159  LYS A N      1 
ATOM   1245  C  CA     . LYS A  1 159  ? 49.072  132.364 -14.679 1.00 138.56 ?  159  LYS A CA     1 
ATOM   1246  C  C      . LYS A  1 159  ? 50.038  132.958 -15.727 1.00 143.28 ?  159  LYS A C      1 
ATOM   1247  O  O      . LYS A  1 159  ? 50.584  134.052 -15.526 1.00 144.87 ?  159  LYS A O      1 
ATOM   1248  C  CB     . LYS A  1 159  ? 47.661  132.978 -14.866 1.00 143.20 ?  159  LYS A CB     1 
ATOM   1249  C  CG     . LYS A  1 159  ? 46.592  132.436 -13.924 1.00 148.40 ?  159  LYS A CG     1 
ATOM   1250  C  CD     . LYS A  1 159  ? 45.716  133.539 -13.278 1.00 158.61 ?  159  LYS A CD     1 
ATOM   1251  C  CE     . LYS A  1 159  ? 45.005  133.058 -12.022 1.00 157.26 ?  159  LYS A CE     1 
ATOM   1252  N  NZ     . LYS A  1 159  ? 44.259  134.145 -11.350 1.00 159.49 1  159  LYS A NZ     1 
ATOM   1253  N  N      . LEU A  1 160  ? 50.233  132.255 -16.856 1.00 138.00 ?  160  LEU A N      1 
ATOM   1254  C  CA     . LEU A  1 160  ? 51.088  132.719 -17.957 1.00 137.95 ?  160  LEU A CA     1 
ATOM   1255  C  C      . LEU A  1 160  ? 50.316  133.708 -18.870 1.00 150.07 ?  160  LEU A C      1 
ATOM   1256  O  O      . LEU A  1 160  ? 49.418  133.299 -19.626 1.00 151.58 ?  160  LEU A O      1 
ATOM   1257  C  CB     . LEU A  1 160  ? 51.656  131.523 -18.762 1.00 133.57 ?  160  LEU A CB     1 
ATOM   1258  C  CG     . LEU A  1 160  ? 52.386  131.821 -20.072 1.00 135.79 ?  160  LEU A CG     1 
ATOM   1259  C  CD1    . LEU A  1 160  ? 53.645  132.554 -19.826 1.00 135.68 ?  160  LEU A CD1    1 
ATOM   1260  C  CD2    . LEU A  1 160  ? 52.712  130.574 -20.784 1.00 132.63 ?  160  LEU A CD2    1 
ATOM   1261  N  N      . ASN A  1 161  ? 50.679  135.003 -18.795 1.00 150.80 ?  161  ASN A N      1 
ATOM   1262  C  CA     . ASN A  1 161  ? 50.041  136.061 -19.578 1.00 155.25 ?  161  ASN A CA     1 
ATOM   1263  C  C      . ASN A  1 161  ? 50.409  135.950 -21.070 1.00 161.46 ?  161  ASN A C      1 
ATOM   1264  O  O      . ASN A  1 161  ? 51.602  135.994 -21.401 1.00 160.15 ?  161  ASN A O      1 
ATOM   1265  C  CB     . ASN A  1 161  ? 50.412  137.419 -19.016 1.00 157.46 ?  161  ASN A CB     1 
ATOM   1266  C  CG     . ASN A  1 161  ? 49.485  138.515 -19.430 1.00 182.75 ?  161  ASN A CG     1 
ATOM   1267  O  OD1    . ASN A  1 161  ? 49.764  139.253 -20.368 1.00 181.42 ?  161  ASN A OD1    1 
ATOM   1268  N  ND2    . ASN A  1 161  ? 48.359  138.647 -18.748 1.00 174.58 ?  161  ASN A ND2    1 
ATOM   1269  N  N      . PRO A  1 162  ? 49.409  135.770 -21.980 1.00 160.88 ?  162  PRO A N      1 
ATOM   1270  C  CA     . PRO A  1 162  ? 49.739  135.629 -23.417 1.00 161.23 ?  162  PRO A CA     1 
ATOM   1271  C  C      . PRO A  1 162  ? 50.443  136.850 -24.009 1.00 167.59 ?  162  PRO A C      1 
ATOM   1272  O  O      . PRO A  1 162  ? 51.261  136.713 -24.931 1.00 166.14 ?  162  PRO A O      1 
ATOM   1273  C  CB     . PRO A  1 162  ? 48.388  135.343 -24.068 1.00 165.18 ?  162  PRO A CB     1 
ATOM   1274  C  CG     . PRO A  1 162  ? 47.507  134.872 -22.943 1.00 168.90 ?  162  PRO A CG     1 
ATOM   1275  C  CD     . PRO A  1 162  ? 47.953  135.657 -21.757 1.00 164.48 ?  162  PRO A CD     1 
ATOM   1276  N  N      . GLU A  1 163  ? 50.156  138.047 -23.457 1.00 167.20 ?  163  GLU A N      1 
ATOM   1277  C  CA     . GLU A  1 163  ? 50.826  139.257 -23.902 1.00 169.96 ?  163  GLU A CA     1 
ATOM   1278  C  C      . GLU A  1 163  ? 52.303  139.209 -23.522 1.00 169.98 ?  163  GLU A C      1 
ATOM   1279  O  O      . GLU A  1 163  ? 53.136  139.626 -24.314 1.00 170.07 ?  163  GLU A O      1 
ATOM   1280  C  CB     . GLU A  1 163  ? 50.107  140.504 -23.385 1.00 176.39 ?  163  GLU A CB     1 
ATOM   1281  C  CG     . GLU A  1 163  ? 48.898  140.883 -24.237 1.00 194.78 ?  163  GLU A CG     1 
ATOM   1282  C  CD     . GLU A  1 163  ? 49.194  141.174 -25.701 1.00 219.14 ?  163  GLU A CD     1 
ATOM   1283  O  OE1    . GLU A  1 163  ? 50.178  141.902 -25.978 1.00 227.12 ?  163  GLU A OE1    1 
ATOM   1284  O  OE2    . GLU A  1 163  ? 48.460  140.653 -26.575 1.00 216.36 -1 163  GLU A OE2    1 
ATOM   1285  N  N      . ASP A  1 164  ? 52.629  138.611 -22.361 1.00 162.98 ?  164  ASP A N      1 
ATOM   1286  C  CA     . ASP A  1 164  ? 54.007  138.416 -21.915 1.00 160.20 ?  164  ASP A CA     1 
ATOM   1287  C  C      . ASP A  1 164  ? 54.753  137.435 -22.797 1.00 157.96 ?  164  ASP A C      1 
ATOM   1288  O  O      . ASP A  1 164  ? 55.962  137.597 -22.975 1.00 156.34 ?  164  ASP A O      1 
ATOM   1289  C  CB     . ASP A  1 164  ? 54.074  137.980 -20.456 1.00 160.71 ?  164  ASP A CB     1 
ATOM   1290  C  CG     . ASP A  1 164  ? 53.977  139.145 -19.484 1.00 185.44 ?  164  ASP A CG     1 
ATOM   1291  O  OD1    . ASP A  1 164  ? 54.651  140.182 -19.717 1.00 191.73 ?  164  ASP A OD1    1 
ATOM   1292  O  OD2    . ASP A  1 164  ? 53.248  139.019 -18.479 1.00 193.50 -1 164  ASP A OD2    1 
ATOM   1293  N  N      . ILE A  1 165  ? 54.043  136.432 -23.360 1.00 151.66 ?  165  ILE A N      1 
ATOM   1294  C  CA     . ILE A  1 165  ? 54.631  135.452 -24.282 1.00 148.40 ?  165  ILE A CA     1 
ATOM   1295  C  C      . ILE A  1 165  ? 55.153  136.228 -25.496 1.00 157.25 ?  165  ILE A C      1 
ATOM   1296  O  O      . ILE A  1 165  ? 56.318  136.081 -25.866 1.00 156.82 ?  165  ILE A O      1 
ATOM   1297  C  CB     . ILE A  1 165  ? 53.648  134.319 -24.724 1.00 148.57 ?  165  ILE A CB     1 
ATOM   1298  C  CG1    . ILE A  1 165  ? 53.091  133.506 -23.540 1.00 145.78 ?  165  ILE A CG1    1 
ATOM   1299  C  CG2    . ILE A  1 165  ? 54.328  133.416 -25.766 1.00 147.04 ?  165  ILE A CG2    1 
ATOM   1300  C  CD1    . ILE A  1 165  ? 51.872  132.606 -23.847 1.00 148.72 ?  165  ILE A CD1    1 
ATOM   1301  N  N      . LYS A  1 166  ? 54.304  137.077 -26.085 1.00 157.09 ?  166  LYS A N      1 
ATOM   1302  C  CA     . LYS A  1 166  ? 54.659  137.885 -27.247 1.00 159.41 ?  166  LYS A CA     1 
ATOM   1303  C  C      . LYS A  1 166  ? 55.753  138.924 -26.906 1.00 165.69 ?  166  LYS A C      1 
ATOM   1304  O  O      . LYS A  1 166  ? 56.728  139.067 -27.645 1.00 164.77 ?  166  LYS A O      1 
ATOM   1305  C  CB     . LYS A  1 166  ? 53.397  138.561 -27.792 1.00 164.54 ?  166  LYS A CB     1 
ATOM   1306  C  CG     . LYS A  1 166  ? 52.279  137.587 -28.166 1.00 164.64 ?  166  LYS A CG     1 
ATOM   1307  C  CD     . LYS A  1 166  ? 50.977  138.326 -28.347 1.00 172.63 ?  166  LYS A CD     1 
ATOM   1308  C  CE     . LYS A  1 166  ? 49.748  137.488 -28.147 1.00 176.27 ?  166  LYS A CE     1 
ATOM   1309  N  NZ     . LYS A  1 166  ? 48.530  138.283 -28.441 1.00 186.35 1  166  LYS A NZ     1 
ATOM   1310  N  N      . LYS A  1 167  ? 55.608  139.609 -25.775 1.00 165.68 ?  167  LYS A N      1 
ATOM   1311  C  CA     . LYS A  1 167  ? 56.532  140.650 -25.326 1.00 169.72 ?  167  LYS A CA     1 
ATOM   1312  C  C      . LYS A  1 167  ? 57.936  140.146 -24.997 1.00 174.06 ?  167  LYS A C      1 
ATOM   1313  O  O      . LYS A  1 167  ? 58.904  140.720 -25.491 1.00 175.12 ?  167  LYS A O      1 
ATOM   1314  C  CB     . LYS A  1 167  ? 55.920  141.396 -24.120 1.00 174.91 ?  167  LYS A CB     1 
ATOM   1315  C  CG     . LYS A  1 167  ? 56.798  142.438 -23.417 1.00 192.33 ?  167  LYS A CG     1 
ATOM   1316  C  CD     . LYS A  1 167  ? 56.256  142.663 -21.987 1.00 202.52 ?  167  LYS A CD     1 
ATOM   1317  C  CE     . LYS A  1 167  ? 57.003  143.689 -21.176 1.00 207.34 ?  167  LYS A CE     1 
ATOM   1318  N  NZ     . LYS A  1 167  ? 56.715  143.526 -19.721 1.00 207.82 1  167  LYS A NZ     1 
ATOM   1319  N  N      . HIS A  1 168  ? 58.048  139.115 -24.133 1.00 169.57 ?  168  HIS A N      1 
ATOM   1320  C  CA     . HIS A  1 168  ? 59.336  138.607 -23.643 1.00 168.30 ?  168  HIS A CA     1 
ATOM   1321  C  C      . HIS A  1 168  ? 59.902  137.452 -24.419 1.00 166.51 ?  168  HIS A C      1 
ATOM   1322  O  O      . HIS A  1 168  ? 61.130  137.368 -24.563 1.00 166.61 ?  168  HIS A O      1 
ATOM   1323  C  CB     . HIS A  1 168  ? 59.237  138.171 -22.167 1.00 168.31 ?  168  HIS A CB     1 
ATOM   1324  C  CG     . HIS A  1 168  ? 58.795  139.230 -21.197 1.00 176.47 ?  168  HIS A CG     1 
ATOM   1325  N  ND1    . HIS A  1 168  ? 59.553  140.372 -20.972 1.00 183.10 ?  168  HIS A ND1    1 
ATOM   1326  C  CD2    . HIS A  1 168  ? 57.722  139.252 -20.364 1.00 179.18 ?  168  HIS A CD2    1 
ATOM   1327  C  CE1    . HIS A  1 168  ? 58.903  141.062 -20.043 1.00 185.11 ?  168  HIS A CE1    1 
ATOM   1328  N  NE2    . HIS A  1 168  ? 57.795  140.431 -19.647 1.00 183.10 ?  168  HIS A NE2    1 
ATOM   1329  N  N      . LEU A  1 169  ? 59.028  136.531 -24.866 1.00 157.62 ?  169  LEU A N      1 
ATOM   1330  C  CA     . LEU A  1 169  ? 59.527  135.319 -25.485 1.00 152.69 ?  169  LEU A CA     1 
ATOM   1331  C  C      . LEU A  1 169  ? 59.653  135.346 -26.984 1.00 156.46 ?  169  LEU A C      1 
ATOM   1332  O  O      . LEU A  1 169  ? 60.631  134.822 -27.498 1.00 154.31 ?  169  LEU A O      1 
ATOM   1333  C  CB     . LEU A  1 169  ? 58.723  134.079 -25.066 1.00 148.43 ?  169  LEU A CB     1 
ATOM   1334  C  CG     . LEU A  1 169  ? 58.671  133.713 -23.585 1.00 149.35 ?  169  LEU A CG     1 
ATOM   1335  C  CD1    . LEU A  1 169  ? 57.841  132.480 -23.371 1.00 145.16 ?  169  LEU A CD1    1 
ATOM   1336  C  CD2    . LEU A  1 169  ? 60.049  133.469 -23.037 1.00 150.22 ?  169  LEU A CD2    1 
ATOM   1337  N  N      . LEU A  1 170  ? 58.703  135.955 -27.677 1.00 155.43 ?  170  LEU A N      1 
ATOM   1338  C  CA     . LEU A  1 170  ? 58.666  135.939 -29.123 1.00 156.60 ?  170  LEU A CA     1 
ATOM   1339  C  C      . LEU A  1 170  ? 59.296  137.151 -29.791 1.00 165.95 ?  170  LEU A C      1 
ATOM   1340  O  O      . LEU A  1 170  ? 59.028  137.400 -30.962 1.00 167.20 ?  170  LEU A O      1 
ATOM   1341  C  CB     . LEU A  1 170  ? 57.203  135.754 -29.547 1.00 156.72 ?  170  LEU A CB     1 
ATOM   1342  C  CG     . LEU A  1 170  ? 56.524  134.509 -28.987 1.00 156.57 ?  170  LEU A CG     1 
ATOM   1343  C  CD1    . LEU A  1 170  ? 55.123  134.385 -29.511 1.00 157.66 ?  170  LEU A CD1    1 
ATOM   1344  C  CD2    . LEU A  1 170  ? 57.331  133.260 -29.321 1.00 154.87 ?  170  LEU A CD2    1 
ATOM   1345  N  N      . VAL A  1 171  ? 60.165  137.867 -29.070 1.00 165.19 ?  171  VAL A N      1 
ATOM   1346  C  CA     . VAL A  1 171  ? 60.823  139.092 -29.525 1.00 169.93 ?  171  VAL A CA     1 
ATOM   1347  C  C      . VAL A  1 171  ? 61.456  138.896 -30.912 1.00 177.28 ?  171  VAL A C      1 
ATOM   1348  O  O      . VAL A  1 171  ? 61.271  139.734 -31.805 1.00 181.29 ?  171  VAL A O      1 
ATOM   1349  C  CB     . VAL A  1 171  ? 61.884  139.585 -28.499 1.00 174.32 ?  171  VAL A CB     1 
ATOM   1350  C  CG1    . VAL A  1 171  ? 62.369  140.983 -28.838 1.00 179.25 ?  171  VAL A CG1    1 
ATOM   1351  C  CG2    . VAL A  1 171  ? 61.377  139.523 -27.065 1.00 172.74 ?  171  VAL A CG2    1 
ATOM   1352  N  N      . HIS A  1 172  ? 62.193  137.783 -31.082 1.00 171.46 ?  172  HIS A N      1 
ATOM   1353  C  CA     . HIS A  1 172  ? 62.915  137.466 -32.316 1.00 171.93 ?  172  HIS A CA     1 
ATOM   1354  C  C      . HIS A  1 172  ? 62.167  136.518 -33.239 1.00 172.41 ?  172  HIS A C      1 
ATOM   1355  O  O      . HIS A  1 172  ? 62.716  136.115 -34.269 1.00 171.34 ?  172  HIS A O      1 
ATOM   1356  C  CB     . HIS A  1 172  ? 64.295  136.885 -31.981 1.00 171.79 ?  172  HIS A CB     1 
ATOM   1357  C  CG     . HIS A  1 172  ? 65.093  137.719 -31.033 1.00 177.74 ?  172  HIS A CG     1 
ATOM   1358  N  ND1    . HIS A  1 172  ? 64.758  137.806 -29.691 1.00 178.63 ?  172  HIS A ND1    1 
ATOM   1359  C  CD2    . HIS A  1 172  ? 66.183  138.483 -31.264 1.00 183.24 ?  172  HIS A CD2    1 
ATOM   1360  C  CE1    . HIS A  1 172  ? 65.651  138.618 -29.153 1.00 181.08 ?  172  HIS A CE1    1 
ATOM   1361  N  NE2    . HIS A  1 172  ? 66.528  139.049 -30.062 1.00 184.34 ?  172  HIS A NE2    1 
ATOM   1362  N  N      . ALA A  1 173  ? 60.924  136.175 -32.898 1.00 167.54 ?  173  ALA A N      1 
ATOM   1363  C  CA     . ALA A  1 173  ? 60.165  135.261 -33.726 1.00 166.10 ?  173  ALA A CA     1 
ATOM   1364  C  C      . ALA A  1 173  ? 59.589  135.967 -34.937 1.00 175.04 ?  173  ALA A C      1 
ATOM   1365  O  O      . ALA A  1 173  ? 59.180  137.125 -34.830 1.00 179.12 ?  173  ALA A O      1 
ATOM   1366  C  CB     . ALA A  1 173  ? 59.045  134.635 -32.921 1.00 164.44 ?  173  ALA A CB     1 
ATOM   1367  N  N      . PRO A  1 174  ? 59.532  135.291 -36.099 1.00 171.23 ?  174  PRO A N      1 
ATOM   1368  C  CA     . PRO A  1 174  ? 58.928  135.923 -37.287 1.00 174.47 ?  174  PRO A CA     1 
ATOM   1369  C  C      . PRO A  1 174  ? 57.537  136.459 -36.971 1.00 179.55 ?  174  PRO A C      1 
ATOM   1370  O  O      . PRO A  1 174  ? 56.751  135.803 -36.280 1.00 177.55 ?  174  PRO A O      1 
ATOM   1371  C  CB     . PRO A  1 174  ? 58.889  134.798 -38.322 1.00 174.82 ?  174  PRO A CB     1 
ATOM   1372  C  CG     . PRO A  1 174  ? 59.260  133.550 -37.594 1.00 174.63 ?  174  PRO A CG     1 
ATOM   1373  C  CD     . PRO A  1 174  ? 60.019  133.932 -36.389 1.00 169.22 ?  174  PRO A CD     1 
ATOM   1374  N  N      . GLU A  1 175  ? 57.268  137.675 -37.417 1.00 179.65 ?  175  GLU A N      1 
ATOM   1375  C  CA     . GLU A  1 175  ? 56.025  138.367 -37.127 1.00 182.55 ?  175  GLU A CA     1 
ATOM   1376  C  C      . GLU A  1 175  ? 54.761  137.573 -37.480 1.00 185.90 ?  175  GLU A C      1 
ATOM   1377  O  O      . GLU A  1 175  ? 53.813  137.547 -36.684 1.00 185.33 ?  175  GLU A O      1 
ATOM   1378  C  CB     . GLU A  1 175  ? 56.042  139.734 -37.811 1.00 189.42 ?  175  GLU A CB     1 
ATOM   1379  C  CG     . GLU A  1 175  ? 54.943  140.684 -37.375 1.00 201.95 ?  175  GLU A CG     1 
ATOM   1380  C  CD     . GLU A  1 175  ? 54.917  141.057 -35.907 1.00 216.96 ?  175  GLU A CD     1 
ATOM   1381  O  OE1    . GLU A  1 175  ? 56.003  141.259 -35.313 1.00 210.96 ?  175  GLU A OE1    1 
ATOM   1382  O  OE2    . GLU A  1 175  ? 53.799  141.139 -35.348 1.00 216.86 -1 175  GLU A OE2    1 
ATOM   1383  N  N      . ASP A  1 176  ? 54.756  136.915 -38.650 1.00 182.03 ?  176  ASP A N      1 
ATOM   1384  C  CA     . ASP A  1 176  ? 53.599  136.166 -39.119 1.00 181.79 ?  176  ASP A CA     1 
ATOM   1385  C  C      . ASP A  1 176  ? 53.337  134.903 -38.302 1.00 177.73 ?  176  ASP A C      1 
ATOM   1386  O  O      . ASP A  1 176  ? 52.314  134.273 -38.513 1.00 177.49 ?  176  ASP A O      1 
ATOM   1387  C  CB     . ASP A  1 176  ? 53.756  135.840 -40.619 1.00 186.19 ?  176  ASP A CB     1 
ATOM   1388  C  CG     . ASP A  1 176  ? 54.897  134.886 -40.946 1.00 203.07 ?  176  ASP A CG     1 
ATOM   1389  O  OD1    . ASP A  1 176  ? 55.917  134.891 -40.217 1.00 202.66 ?  176  ASP A OD1    1 
ATOM   1390  O  OD2    . ASP A  1 176  ? 54.767  134.126 -41.920 1.00 212.67 -1 176  ASP A OD2    1 
ATOM   1391  N  N      . LYS A  1 177  ? 54.244  134.531 -37.388 1.00 168.00 ?  177  LYS A N      1 
ATOM   1392  C  CA     . LYS A  1 177  ? 54.107  133.305 -36.601 1.00 162.17 ?  177  LYS A CA     1 
ATOM   1393  C  C      . LYS A  1 177  ? 53.866  133.537 -35.124 1.00 162.27 ?  177  LYS A C      1 
ATOM   1394  O  O      . LYS A  1 177  ? 53.608  132.582 -34.391 1.00 158.64 ?  177  LYS A O      1 
ATOM   1395  C  CB     . LYS A  1 177  ? 55.333  132.414 -36.817 1.00 160.34 ?  177  LYS A CB     1 
ATOM   1396  C  CG     . LYS A  1 177  ? 55.461  132.024 -38.264 1.00 163.23 ?  177  LYS A CG     1 
ATOM   1397  C  CD     . LYS A  1 177  ? 56.398  130.893 -38.477 1.00 166.52 ?  177  LYS A CD     1 
ATOM   1398  C  CE     . LYS A  1 177  ? 56.321  130.431 -39.904 1.00 182.33 ?  177  LYS A CE     1 
ATOM   1399  N  NZ     . LYS A  1 177  ? 54.976  129.930 -40.283 1.00 195.75 1  177  LYS A NZ     1 
ATOM   1400  N  N      . LYS A  1 178  ? 53.923  134.792 -34.682 1.00 159.20 ?  178  LYS A N      1 
ATOM   1401  C  CA     . LYS A  1 178  ? 53.761  135.107 -33.275 1.00 156.91 ?  178  LYS A CA     1 
ATOM   1402  C  C      . LYS A  1 178  ? 52.417  134.709 -32.739 1.00 160.51 ?  178  LYS A C      1 
ATOM   1403  O  O      . LYS A  1 178  ? 52.336  134.177 -31.630 1.00 157.05 ?  178  LYS A O      1 
ATOM   1404  C  CB     . LYS A  1 178  ? 54.021  136.587 -33.027 1.00 161.34 ?  178  LYS A CB     1 
ATOM   1405  C  CG     . LYS A  1 178  ? 55.456  136.981 -33.270 1.00 157.44 ?  178  LYS A CG     1 
ATOM   1406  C  CD     . LYS A  1 178  ? 55.697  138.391 -32.791 1.00 164.24 ?  178  LYS A CD     1 
ATOM   1407  C  CE     . LYS A  1 178  ? 57.094  138.854 -33.083 1.00 163.58 ?  178  LYS A CE     1 
ATOM   1408  N  NZ     . LYS A  1 178  ? 57.394  140.126 -32.380 1.00 162.37 1  178  LYS A NZ     1 
ATOM   1409  N  N      . GLU A  1 179  ? 51.363  134.925 -33.528 1.00 160.89 ?  179  GLU A N      1 
ATOM   1410  C  CA     . GLU A  1 179  ? 50.033  134.621 -33.009 1.00 162.14 ?  179  GLU A CA     1 
ATOM   1411  C  C      . GLU A  1 179  ? 49.824  133.148 -32.738 1.00 160.54 ?  179  GLU A C      1 
ATOM   1412  O  O      . GLU A  1 179  ? 49.329  132.780 -31.661 1.00 157.28 ?  179  GLU A O      1 
ATOM   1413  C  CB     . GLU A  1 179  ? 48.921  135.202 -33.889 1.00 169.27 ?  179  GLU A CB     1 
ATOM   1414  C  CG     . GLU A  1 179  ? 47.732  135.735 -33.084 1.00 189.50 ?  179  GLU A CG     1 
ATOM   1415  C  CD     . GLU A  1 179  ? 47.995  136.777 -32.000 1.00 212.53 ?  179  GLU A CD     1 
ATOM   1416  O  OE1    . GLU A  1 179  ? 48.148  136.370 -30.822 1.00 219.75 ?  179  GLU A OE1    1 
ATOM   1417  O  OE2    . GLU A  1 179  ? 48.015  137.991 -32.319 1.00 200.12 -1 179  GLU A OE2    1 
ATOM   1418  N  N      . ILE A  1 180  ? 50.248  132.312 -33.695 1.00 155.20 ?  180  ILE A N      1 
ATOM   1419  C  CA     . ILE A  1 180  ? 50.119  130.862 -33.577 1.00 150.84 ?  180  ILE A CA     1 
ATOM   1420  C  C      . ILE A  1 180  ? 51.074  130.297 -32.494 1.00 148.62 ?  180  ILE A C      1 
ATOM   1421  O  O      . ILE A  1 180  ? 50.675  129.427 -31.717 1.00 145.95 ?  180  ILE A O      1 
ATOM   1422  C  CB     . ILE A  1 180  ? 50.251  130.174 -34.951 1.00 153.78 ?  180  ILE A CB     1 
ATOM   1423  C  CG1    . ILE A  1 180  ? 49.790  128.713 -34.869 1.00 151.98 ?  180  ILE A CG1    1 
ATOM   1424  C  CG2    . ILE A  1 180  ? 51.667  130.312 -35.510 1.00 152.38 ?  180  ILE A CG2    1 
ATOM   1425  C  CD1    . ILE A  1 180  ? 49.535  128.014 -36.163 1.00 158.54 ?  180  ILE A CD1    1 
ATOM   1426  N  N      . LEU A  1 181  ? 52.304  130.815 -32.412 1.00 142.26 ?  181  LEU A N      1 
ATOM   1427  C  CA     . LEU A  1 181  ? 53.240  130.357 -31.393 1.00 137.07 ?  181  LEU A CA     1 
ATOM   1428  C  C      . LEU A  1 181  ? 52.726  130.721 -30.012 1.00 139.50 ?  181  LEU A C      1 
ATOM   1429  O  O      . LEU A  1 181  ? 52.777  129.880 -29.124 1.00 135.84 ?  181  LEU A O      1 
ATOM   1430  C  CB     . LEU A  1 181  ? 54.636  130.966 -31.601 1.00 136.60 ?  181  LEU A CB     1 
ATOM   1431  C  CG     . LEU A  1 181  ? 55.525  130.429 -32.742 1.00 139.30 ?  181  LEU A CG     1 
ATOM   1432  C  CD1    . LEU A  1 181  ? 56.677  131.370 -33.004 1.00 140.26 ?  181  LEU A CD1    1 
ATOM   1433  C  CD2    . LEU A  1 181  ? 56.071  129.054 -32.436 1.00 134.86 ?  181  LEU A CD2    1 
ATOM   1434  N  N      . ALA A  1 182  ? 52.202  131.956 -29.833 1.00 139.43 ?  182  ALA A N      1 
ATOM   1435  C  CA     . ALA A  1 182  ? 51.699  132.409 -28.528 1.00 139.34 ?  182  ALA A CA     1 
ATOM   1436  C  C      . ALA A  1 182  ? 50.514  131.550 -28.077 1.00 142.15 ?  182  ALA A C      1 
ATOM   1437  O  O      . ALA A  1 182  ? 50.457  131.153 -26.906 1.00 139.52 ?  182  ALA A O      1 
ATOM   1438  C  CB     . ALA A  1 182  ? 51.338  133.890 -28.567 1.00 144.12 ?  182  ALA A CB     1 
ATOM   1439  N  N      . SER A  1 183  ? 49.620  131.192 -29.025 1.00 139.92 ?  183  SER A N      1 
ATOM   1440  C  CA     . SER A  1 183  ? 48.479  130.324 -28.733 1.00 139.52 ?  183  SER A CA     1 
ATOM   1441  C  C      . SER A  1 183  ? 48.938  128.915 -28.321 1.00 139.84 ?  183  SER A C      1 
ATOM   1442  O  O      . SER A  1 183  ? 48.452  128.369 -27.325 1.00 138.91 ?  183  SER A O      1 
ATOM   1443  C  CB     . SER A  1 183  ? 47.545  130.264 -29.932 1.00 146.72 ?  183  SER A CB     1 
ATOM   1444  O  OG     . SER A  1 183  ? 46.385  129.515 -29.617 1.00 160.75 ?  183  SER A OG     1 
ATOM   1445  N  N      . PHE A  1 184  ? 49.889  128.336 -29.076 1.00 134.04 ?  184  PHE A N      1 
ATOM   1446  C  CA     . PHE A  1 184  ? 50.413  127.004 -28.788 1.00 129.64 ?  184  PHE A CA     1 
ATOM   1447  C  C      . PHE A  1 184  ? 51.109  126.963 -27.431 1.00 131.94 ?  184  PHE A C      1 
ATOM   1448  O  O      . PHE A  1 184  ? 50.803  126.094 -26.616 1.00 129.76 ?  184  PHE A O      1 
ATOM   1449  C  CB     . PHE A  1 184  ? 51.362  126.543 -29.899 1.00 130.14 ?  184  PHE A CB     1 
ATOM   1450  C  CG     . PHE A  1 184  ? 52.027  125.224 -29.594 1.00 128.30 ?  184  PHE A CG     1 
ATOM   1451  C  CD1    . PHE A  1 184  ? 51.388  124.026 -29.873 1.00 131.22 ?  184  PHE A CD1    1 
ATOM   1452  C  CD2    . PHE A  1 184  ? 53.280  125.179 -28.993 1.00 127.70 ?  184  PHE A CD2    1 
ATOM   1453  C  CE1    . PHE A  1 184  ? 51.992  122.804 -29.559 1.00 129.56 ?  184  PHE A CE1    1 
ATOM   1454  C  CE2    . PHE A  1 184  ? 53.878  123.957 -28.677 1.00 128.38 ?  184  PHE A CE2    1 
ATOM   1455  C  CZ     . PHE A  1 184  ? 53.229  122.778 -28.960 1.00 126.37 ?  184  PHE A CZ     1 
ATOM   1456  N  N      . ILE A  1 185  ? 52.021  127.913 -27.182 1.00 129.57 ?  185  ILE A N      1 
ATOM   1457  C  CA     . ILE A  1 185  ? 52.769  127.985 -25.923 1.00 127.21 ?  185  ILE A CA     1 
ATOM   1458  C  C      . ILE A  1 185  ? 51.829  128.108 -24.734 1.00 132.37 ?  185  ILE A C      1 
ATOM   1459  O  O      . ILE A  1 185  ? 52.022  127.427 -23.730 1.00 131.15 ?  185  ILE A O      1 
ATOM   1460  C  CB     . ILE A  1 185  ? 53.831  129.102 -25.997 1.00 130.60 ?  185  ILE A CB     1 
ATOM   1461  C  CG1    . ILE A  1 185  ? 54.938  128.656 -26.975 1.00 130.41 ?  185  ILE A CG1    1 
ATOM   1462  C  CG2    . ILE A  1 185  ? 54.367  129.483 -24.614 1.00 129.10 ?  185  ILE A CG2    1 
ATOM   1463  C  CD1    . ILE A  1 185  ? 55.859  129.728 -27.490 1.00 141.05 ?  185  ILE A CD1    1 
ATOM   1464  N  N      . SER A  1 186  ? 50.792  128.936 -24.861 1.00 130.32 ?  186  SER A N      1 
ATOM   1465  C  CA     . SER A  1 186  ? 49.792  129.119 -23.818 1.00 130.07 ?  186  SER A CA     1 
ATOM   1466  C  C      . SER A  1 186  ? 49.119  127.769 -23.489 1.00 132.73 ?  186  SER A C      1 
ATOM   1467  O  O      . SER A  1 186  ? 49.060  127.392 -22.307 1.00 130.63 ?  186  SER A O      1 
ATOM   1468  C  CB     . SER A  1 186  ? 48.775  130.181 -24.245 1.00 135.35 ?  186  SER A CB     1 
ATOM   1469  O  OG     . SER A  1 186  ? 47.732  130.395 -23.306 1.00 139.13 ?  186  SER A OG     1 
ATOM   1470  N  N      . GLY A  1 187  ? 48.701  127.029 -24.534 1.00 130.59 ?  187  GLY A N      1 
ATOM   1471  C  CA     . GLY A  1 187  ? 48.060  125.720 -24.373 1.00 130.13 ?  187  GLY A CA     1 
ATOM   1472  C  C      . GLY A  1 187  ? 48.988  124.671 -23.795 1.00 131.44 ?  187  GLY A C      1 
ATOM   1473  O  O      . GLY A  1 187  ? 48.590  123.875 -22.922 1.00 129.40 ?  187  GLY A O      1 
ATOM   1474  N  N      . LEU A  1 188  ? 50.254  124.711 -24.259 1.00 126.47 ?  188  LEU A N      1 
ATOM   1475  C  CA     . LEU A  1 188  ? 51.309  123.821 -23.808 1.00 123.18 ?  188  LEU A CA     1 
ATOM   1476  C  C      . LEU A  1 188  ? 51.560  123.976 -22.311 1.00 126.93 ?  188  LEU A C      1 
ATOM   1477  O  O      . LEU A  1 188  ? 51.754  122.977 -21.601 1.00 125.97 ?  188  LEU A O      1 
ATOM   1478  C  CB     . LEU A  1 188  ? 52.600  124.088 -24.581 1.00 122.68 ?  188  LEU A CB     1 
ATOM   1479  C  CG     . LEU A  1 188  ? 53.706  123.053 -24.302 1.00 125.71 ?  188  LEU A CG     1 
ATOM   1480  C  CD1    . LEU A  1 188  ? 53.388  121.719 -24.940 1.00 126.33 ?  188  LEU A CD1    1 
ATOM   1481  C  CD2    . LEU A  1 188  ? 55.075  123.538 -24.743 1.00 126.79 ?  188  LEU A CD2    1 
ATOM   1482  N  N      . PHE A  1 189  ? 51.560  125.232 -21.833 1.00 123.32 ?  189  PHE A N      1 
ATOM   1483  C  CA     . PHE A  1 189  ? 51.782  125.513 -20.425 1.00 121.19 ?  189  PHE A CA     1 
ATOM   1484  C  C      . PHE A  1 189  ? 50.672  124.956 -19.571 1.00 124.11 ?  189  PHE A C      1 
ATOM   1485  O  O      . PHE A  1 189  ? 50.949  124.341 -18.535 1.00 120.77 ?  189  PHE A O      1 
ATOM   1486  C  CB     . PHE A  1 189  ? 51.968  127.009 -20.177 1.00 124.79 ?  189  PHE A CB     1 
ATOM   1487  C  CG     . PHE A  1 189  ? 52.354  127.258 -18.750 1.00 126.48 ?  189  PHE A CG     1 
ATOM   1488  C  CD1    . PHE A  1 189  ? 53.665  127.047 -18.318 1.00 129.18 ?  189  PHE A CD1    1 
ATOM   1489  C  CD2    . PHE A  1 189  ? 51.400  127.635 -17.818 1.00 131.64 ?  189  PHE A CD2    1 
ATOM   1490  C  CE1    . PHE A  1 189  ? 54.011  127.221 -16.982 1.00 130.64 ?  189  PHE A CE1    1 
ATOM   1491  C  CE2    . PHE A  1 189  ? 51.748  127.833 -16.487 1.00 135.27 ?  189  PHE A CE2    1 
ATOM   1492  C  CZ     . PHE A  1 189  ? 53.052  127.618 -16.075 1.00 132.07 ?  189  PHE A CZ     1 
ATOM   1493  N  N      . ASN A  1 190  ? 49.413  125.157 -20.005 1.00 124.08 ?  190  ASN A N      1 
ATOM   1494  C  CA     . ASN A  1 190  ? 48.256  124.615 -19.291 1.00 124.75 ?  190  ASN A CA     1 
ATOM   1495  C  C      . ASN A  1 190  ? 48.300  123.092 -19.261 1.00 127.39 ?  190  ASN A C      1 
ATOM   1496  O  O      . ASN A  1 190  ? 48.016  122.485 -18.222 1.00 126.83 ?  190  ASN A O      1 
ATOM   1497  C  CB     . ASN A  1 190  ? 46.968  125.132 -19.888 1.00 129.13 ?  190  ASN A CB     1 
ATOM   1498  C  CG     . ASN A  1 190  ? 46.816  126.625 -19.693 1.00 164.85 ?  190  ASN A CG     1 
ATOM   1499  O  OD1    . ASN A  1 190  ? 47.177  127.191 -18.655 1.00 159.38 ?  190  ASN A OD1    1 
ATOM   1500  N  ND2    . ASN A  1 190  ? 46.332  127.314 -20.709 1.00 164.00 ?  190  ASN A ND2    1 
ATOM   1501  N  N      . PHE A  1 191  ? 48.716  122.479 -20.374 1.00 122.53 ?  191  PHE A N      1 
ATOM   1502  C  CA     . PHE A  1 191  ? 48.894  121.031 -20.453 1.00 120.39 ?  191  PHE A CA     1 
ATOM   1503  C  C      . PHE A  1 191  ? 49.963  120.544 -19.446 1.00 122.23 ?  191  PHE A C      1 
ATOM   1504  O  O      . PHE A  1 191  ? 49.728  119.602 -18.676 1.00 120.54 ?  191  PHE A O      1 
ATOM   1505  C  CB     . PHE A  1 191  ? 49.256  120.639 -21.883 1.00 122.01 ?  191  PHE A CB     1 
ATOM   1506  C  CG     . PHE A  1 191  ? 49.819  119.255 -22.043 1.00 121.15 ?  191  PHE A CG     1 
ATOM   1507  C  CD1    . PHE A  1 191  ? 48.982  118.134 -22.005 1.00 124.29 ?  191  PHE A CD1    1 
ATOM   1508  C  CD2    . PHE A  1 191  ? 51.172  119.068 -22.264 1.00 120.51 ?  191  PHE A CD2    1 
ATOM   1509  C  CE1    . PHE A  1 191  ? 49.499  116.854 -22.168 1.00 123.89 ?  191  PHE A CE1    1 
ATOM   1510  C  CE2    . PHE A  1 191  ? 51.686  117.789 -22.451 1.00 122.61 ?  191  PHE A CE2    1 
ATOM   1511  C  CZ     . PHE A  1 191  ? 50.848  116.689 -22.397 1.00 121.54 ?  191  PHE A CZ     1 
ATOM   1512  N  N      . TYR A  1 192  ? 51.116  121.214 -19.439 1.00 119.15 ?  192  TYR A N      1 
ATOM   1513  C  CA     . TYR A  1 192  ? 52.215  120.937 -18.522 1.00 117.61 ?  192  TYR A CA     1 
ATOM   1514  C  C      . TYR A  1 192  ? 51.717  120.947 -17.063 1.00 120.38 ?  192  TYR A C      1 
ATOM   1515  O  O      . TYR A  1 192  ? 51.975  120.005 -16.309 1.00 117.78 ?  192  TYR A O      1 
ATOM   1516  C  CB     . TYR A  1 192  ? 53.313  121.986 -18.768 1.00 119.26 ?  192  TYR A CB     1 
ATOM   1517  C  CG     . TYR A  1 192  ? 54.413  122.065 -17.739 1.00 120.88 ?  192  TYR A CG     1 
ATOM   1518  C  CD1    . TYR A  1 192  ? 54.272  122.852 -16.603 1.00 124.23 ?  192  TYR A CD1    1 
ATOM   1519  C  CD2    . TYR A  1 192  ? 55.645  121.462 -17.964 1.00 120.59 ?  192  TYR A CD2    1 
ATOM   1520  C  CE1    . TYR A  1 192  ? 55.302  122.962 -15.668 1.00 126.53 ?  192  TYR A CE1    1 
ATOM   1521  C  CE2    . TYR A  1 192  ? 56.684  121.570 -17.044 1.00 120.98 ?  192  TYR A CE2    1 
ATOM   1522  C  CZ     . TYR A  1 192  ? 56.511  122.321 -15.895 1.00 130.33 ?  192  TYR A CZ     1 
ATOM   1523  O  OH     . TYR A  1 192  ? 57.552  122.423 -14.998 1.00 129.55 ?  192  TYR A OH     1 
ATOM   1524  N  N      . GLU A  1 193  ? 50.956  121.978 -16.690 1.00 119.21 ?  193  GLU A N      1 
ATOM   1525  C  CA     . GLU A  1 193  ? 50.435  122.077 -15.333 1.00 119.68 ?  193  GLU A CA     1 
ATOM   1526  C  C      . GLU A  1 193  ? 49.444  120.990 -14.996 1.00 122.13 ?  193  GLU A C      1 
ATOM   1527  O  O      . GLU A  1 193  ? 49.584  120.328 -13.955 1.00 119.21 ?  193  GLU A O      1 
ATOM   1528  C  CB     . GLU A  1 193  ? 49.737  123.417 -15.123 1.00 123.63 ?  193  GLU A CB     1 
ATOM   1529  C  CG     . GLU A  1 193  ? 50.643  124.616 -15.166 1.00 140.58 ?  193  GLU A CG     1 
ATOM   1530  C  CD     . GLU A  1 193  ? 50.012  125.785 -14.432 1.00 173.58 ?  193  GLU A CD     1 
ATOM   1531  O  OE1    . GLU A  1 193  ? 48.887  126.192 -14.807 1.00 164.06 ?  193  GLU A OE1    1 
ATOM   1532  O  OE2    . GLU A  1 193  ? 50.622  126.261 -13.446 1.00 176.14 -1 193  GLU A OE2    1 
ATOM   1533  N  N      . ASP A  1 194  ? 48.416  120.850 -15.857 1.00 120.85 ?  194  ASP A N      1 
ATOM   1534  C  CA     . ASP A  1 194  ? 47.311  119.931 -15.625 1.00 122.52 ?  194  ASP A CA     1 
ATOM   1535  C  C      . ASP A  1 194  ? 47.710  118.474 -15.488 1.00 123.25 ?  194  ASP A C      1 
ATOM   1536  O  O      . ASP A  1 194  ? 47.024  117.725 -14.774 1.00 122.11 ?  194  ASP A O      1 
ATOM   1537  C  CB     . ASP A  1 194  ? 46.240  120.099 -16.699 1.00 128.40 ?  194  ASP A CB     1 
ATOM   1538  C  CG     . ASP A  1 194  ? 45.545  121.460 -16.698 1.00 152.82 ?  194  ASP A CG     1 
ATOM   1539  O  OD1    . ASP A  1 194  ? 45.701  122.213 -15.704 1.00 154.80 ?  194  ASP A OD1    1 
ATOM   1540  O  OD2    . ASP A  1 194  ? 44.871  121.788 -17.706 1.00 166.29 -1 194  ASP A OD2    1 
ATOM   1541  N  N      . LEU A  1 195  ? 48.795  118.070 -16.165 1.00 117.72 ?  195  LEU A N      1 
ATOM   1542  C  CA     . LEU A  1 195  ? 49.256  116.692 -16.112 1.00 116.19 ?  195  LEU A CA     1 
ATOM   1543  C  C      . LEU A  1 195  ? 50.487  116.501 -15.262 1.00 120.13 ?  195  LEU A C      1 
ATOM   1544  O  O      . LEU A  1 195  ? 51.121  115.441 -15.306 1.00 120.01 ?  195  LEU A O      1 
ATOM   1545  C  CB     . LEU A  1 195  ? 49.436  116.132 -17.512 1.00 116.19 ?  195  LEU A CB     1 
ATOM   1546  C  CG     . LEU A  1 195  ? 48.182  115.496 -18.072 1.00 121.41 ?  195  LEU A CG     1 
ATOM   1547  C  CD1    . LEU A  1 195  ? 47.221  116.539 -18.564 1.00 123.06 ?  195  LEU A CD1    1 
ATOM   1548  C  CD2    . LEU A  1 195  ? 48.524  114.567 -19.168 1.00 123.16 ?  195  LEU A CD2    1 
ATOM   1549  N  N      . TYR A  1 196  ? 50.807  117.508 -14.453 1.00 117.11 ?  196  TYR A N      1 
ATOM   1550  C  CA     . TYR A  1 196  ? 51.882  117.420 -13.476 1.00 115.66 ?  196  TYR A CA     1 
ATOM   1551  C  C      . TYR A  1 196  ? 53.255  117.083 -14.080 1.00 116.03 ?  196  TYR A C      1 
ATOM   1552  O  O      . TYR A  1 196  ? 53.979  116.218 -13.583 1.00 113.83 ?  196  TYR A O      1 
ATOM   1553  C  CB     . TYR A  1 196  ? 51.484  116.437 -12.353 1.00 116.44 ?  196  TYR A CB     1 
ATOM   1554  C  CG     . TYR A  1 196  ? 50.563  117.061 -11.329 1.00 117.43 ?  196  TYR A CG     1 
ATOM   1555  C  CD1    . TYR A  1 196  ? 49.237  117.353 -11.640 1.00 119.60 ?  196  TYR A CD1    1 
ATOM   1556  C  CD2    . TYR A  1 196  ? 51.026  117.388 -10.056 1.00 118.16 ?  196  TYR A CD2    1 
ATOM   1557  C  CE1    . TYR A  1 196  ? 48.388  117.931 -10.699 1.00 120.91 ?  196  TYR A CE1    1 
ATOM   1558  C  CE2    . TYR A  1 196  ? 50.190  117.971 -9.108  1.00 119.72 ?  196  TYR A CE2    1 
ATOM   1559  C  CZ     . TYR A  1 196  ? 48.868  118.234 -9.430  1.00 127.33 ?  196  TYR A CZ     1 
ATOM   1560  O  OH     . TYR A  1 196  ? 48.054  118.818 -8.491  1.00 127.15 ?  196  TYR A OH     1 
ATOM   1561  N  N      . PHE A  1 197  ? 53.603  117.797 -15.147 1.00 112.06 ?  197  PHE A N      1 
ATOM   1562  C  CA     . PHE A  1 197  ? 54.925  117.693 -15.723 1.00 111.74 ?  197  PHE A CA     1 
ATOM   1563  C  C      . PHE A  1 197  ? 55.873  118.528 -14.884 1.00 116.27 ?  197  PHE A C      1 
ATOM   1564  O  O      . PHE A  1 197  ? 55.448  119.495 -14.238 1.00 116.03 ?  197  PHE A O      1 
ATOM   1565  C  CB     . PHE A  1 197  ? 54.940  118.244 -17.146 1.00 114.66 ?  197  PHE A CB     1 
ATOM   1566  C  CG     . PHE A  1 197  ? 54.418  117.295 -18.193 1.00 117.29 ?  197  PHE A CG     1 
ATOM   1567  C  CD1    . PHE A  1 197  ? 53.049  117.098 -18.357 1.00 121.16 ?  197  PHE A CD1    1 
ATOM   1568  C  CD2    . PHE A  1 197  ? 55.291  116.613 -19.034 1.00 118.91 ?  197  PHE A CD2    1 
ATOM   1569  C  CE1    . PHE A  1 197  ? 52.570  116.211 -19.318 1.00 122.47 ?  197  PHE A CE1    1 
ATOM   1570  C  CE2    . PHE A  1 197  ? 54.807  115.734 -19.995 1.00 122.10 ?  197  PHE A CE2    1 
ATOM   1571  C  CZ     . PHE A  1 197  ? 53.452  115.541 -20.131 1.00 121.22 ?  197  PHE A CZ     1 
ATOM   1572  N  N      . THR A  1 198  ? 57.176  118.163 -14.914 1.00 113.02 ?  198  THR A N      1 
ATOM   1573  C  CA     . THR A  1 198  ? 58.258  118.919 -14.258 1.00 112.44 ?  198  THR A CA     1 
ATOM   1574  C  C      . THR A  1 198  ? 59.280  119.373 -15.284 1.00 116.93 ?  198  THR A C      1 
ATOM   1575  O  O      . THR A  1 198  ? 60.151  120.186 -14.962 1.00 117.10 ?  198  THR A O      1 
ATOM   1576  C  CB     . THR A  1 198  ? 58.976  118.113 -13.186 1.00 112.26 ?  198  THR A CB     1 
ATOM   1577  O  OG1    . THR A  1 198  ? 59.645  117.021 -13.800 1.00 110.84 ?  198  THR A OG1    1 
ATOM   1578  C  CG2    . THR A  1 198  ? 58.059  117.630 -12.110 1.00 106.41 ?  198  THR A CG2    1 
ATOM   1579  N  N      . TYR A  1 199  ? 59.203  118.802 -16.503 1.00 113.66 ?  199  TYR A N      1 
ATOM   1580  C  CA     . TYR A  1 199  ? 60.098  119.092 -17.611 1.00 114.10 ?  199  TYR A CA     1 
ATOM   1581  C  C      . TYR A  1 199  ? 59.430  118.711 -18.911 1.00 118.51 ?  199  TYR A C      1 
ATOM   1582  O  O      . TYR A  1 199  ? 58.917  117.599 -19.031 1.00 117.40 ?  199  TYR A O      1 
ATOM   1583  C  CB     . TYR A  1 199  ? 61.377  118.305 -17.453 1.00 115.39 ?  199  TYR A CB     1 
ATOM   1584  C  CG     . TYR A  1 199  ? 62.343  118.586 -18.561 1.00 117.96 ?  199  TYR A CG     1 
ATOM   1585  C  CD1    . TYR A  1 199  ? 63.171  119.697 -18.517 1.00 121.02 ?  199  TYR A CD1    1 
ATOM   1586  C  CD2    . TYR A  1 199  ? 62.449  117.730 -19.651 1.00 118.91 ?  199  TYR A CD2    1 
ATOM   1587  C  CE1    . TYR A  1 199  ? 64.093  119.945 -19.522 1.00 123.26 ?  199  TYR A CE1    1 
ATOM   1588  C  CE2    . TYR A  1 199  ? 63.353  117.980 -20.675 1.00 120.77 ?  199  TYR A CE2    1 
ATOM   1589  C  CZ     . TYR A  1 199  ? 64.177  119.088 -20.603 1.00 126.90 ?  199  TYR A CZ     1 
ATOM   1590  O  OH     . TYR A  1 199  ? 65.090  119.341 -21.590 1.00 127.72 ?  199  TYR A OH     1 
ATOM   1591  N  N      . LEU A  1 200  ? 59.416  119.632 -19.881 1.00 116.35 ?  200  LEU A N      1 
ATOM   1592  C  CA     . LEU A  1 200  ? 58.778  119.398 -21.187 1.00 115.89 ?  200  LEU A CA     1 
ATOM   1593  C  C      . LEU A  1 200  ? 59.510  120.205 -22.242 1.00 120.95 ?  200  LEU A C      1 
ATOM   1594  O  O      . LEU A  1 200  ? 59.442  121.439 -22.244 1.00 120.90 ?  200  LEU A O      1 
ATOM   1595  C  CB     . LEU A  1 200  ? 57.271  119.758 -21.137 1.00 115.06 ?  200  LEU A CB     1 
ATOM   1596  C  CG     . LEU A  1 200  ? 56.422  119.538 -22.387 1.00 118.34 ?  200  LEU A CG     1 
ATOM   1597  C  CD1    . LEU A  1 200  ? 56.587  118.146 -22.916 1.00 117.33 ?  200  LEU A CD1    1 
ATOM   1598  C  CD2    . LEU A  1 200  ? 54.960  119.827 -22.087 1.00 119.96 ?  200  LEU A CD2    1 
ATOM   1599  N  N      . GLU A  1 201  ? 60.218  119.501 -23.123 1.00 117.81 ?  201  GLU A N      1 
ATOM   1600  C  CA     . GLU A  1 201  ? 61.019  120.112 -24.161 1.00 119.28 ?  201  GLU A CA     1 
ATOM   1601  C  C      . GLU A  1 201  ? 60.560  119.636 -25.533 1.00 126.26 ?  201  GLU A C      1 
ATOM   1602  O  O      . GLU A  1 201  ? 60.418  118.425 -25.764 1.00 126.50 ?  201  GLU A O      1 
ATOM   1603  C  CB     . GLU A  1 201  ? 62.499  119.769 -23.945 1.00 120.73 ?  201  GLU A CB     1 
ATOM   1604  C  CG     . GLU A  1 201  ? 63.426  120.390 -24.972 1.00 129.22 ?  201  GLU A CG     1 
ATOM   1605  C  CD     . GLU A  1 201  ? 64.858  119.919 -24.866 1.00 148.69 ?  201  GLU A CD     1 
ATOM   1606  O  OE1    . GLU A  1 201  ? 65.137  118.755 -25.239 1.00 141.40 ?  201  GLU A OE1    1 
ATOM   1607  O  OE2    . GLU A  1 201  ? 65.701  120.714 -24.391 1.00 147.59 -1 201  GLU A OE2    1 
ATOM   1608  N  N      . ILE A  1 202  ? 60.347  120.594 -26.446 1.00 123.49 ?  202  ILE A N      1 
ATOM   1609  C  CA     . ILE A  1 202  ? 59.981  120.292 -27.824 1.00 123.80 ?  202  ILE A CA     1 
ATOM   1610  C  C      . ILE A  1 202  ? 61.065  120.914 -28.688 1.00 125.85 ?  202  ILE A C      1 
ATOM   1611  O  O      . ILE A  1 202  ? 61.128  122.139 -28.813 1.00 125.73 ?  202  ILE A O      1 
ATOM   1612  C  CB     . ILE A  1 202  ? 58.543  120.757 -28.199 1.00 127.63 ?  202  ILE A CB     1 
ATOM   1613  C  CG1    . ILE A  1 202  ? 57.459  120.054 -27.346 1.00 126.25 ?  202  ILE A CG1    1 
ATOM   1614  C  CG2    . ILE A  1 202  ? 58.288  120.512 -29.685 1.00 130.80 ?  202  ILE A CG2    1 
ATOM   1615  C  CD1    . ILE A  1 202  ? 56.079  120.677 -27.489 1.00 124.23 ?  202  ILE A CD1    1 
ATOM   1616  N  N      . ASN A  1 203  ? 61.944  120.070 -29.240 1.00 121.46 ?  203  ASN A N      1 
ATOM   1617  C  CA     . ASN A  1 203  ? 63.065  120.535 -30.034 1.00 122.89 ?  203  ASN A CA     1 
ATOM   1618  C  C      . ASN A  1 203  ? 63.354  119.607 -31.216 1.00 129.74 ?  203  ASN A C      1 
ATOM   1619  O  O      . ASN A  1 203  ? 64.015  118.581 -31.046 1.00 130.61 ?  203  ASN A O      1 
ATOM   1620  C  CB     . ASN A  1 203  ? 64.309  120.711 -29.169 1.00 120.88 ?  203  ASN A CB     1 
ATOM   1621  C  CG     . ASN A  1 203  ? 65.464  121.278 -29.946 1.00 138.80 ?  203  ASN A CG     1 
ATOM   1622  O  OD1    . ASN A  1 203  ? 65.276  122.009 -30.920 1.00 126.23 ?  203  ASN A OD1    1 
ATOM   1623  N  ND2    . ASN A  1 203  ? 66.675  120.924 -29.554 1.00 134.41 ?  203  ASN A ND2    1 
ATOM   1624  N  N      . PRO A  1 204  ? 62.901  119.948 -32.432 1.00 126.70 ?  204  PRO A N      1 
ATOM   1625  C  CA     . PRO A  1 204  ? 62.214  121.175 -32.823 1.00 127.30 ?  204  PRO A CA     1 
ATOM   1626  C  C      . PRO A  1 204  ? 60.695  121.160 -32.803 1.00 134.05 ?  204  PRO A C      1 
ATOM   1627  O  O      . PRO A  1 204  ? 60.056  120.121 -33.011 1.00 135.54 ?  204  PRO A O      1 
ATOM   1628  C  CB     . PRO A  1 204  ? 62.698  121.352 -34.261 1.00 130.42 ?  204  PRO A CB     1 
ATOM   1629  C  CG     . PRO A  1 204  ? 62.800  119.955 -34.775 1.00 134.31 ?  204  PRO A CG     1 
ATOM   1630  C  CD     . PRO A  1 204  ? 63.207  119.111 -33.606 1.00 128.56 ?  204  PRO A CD     1 
ATOM   1631  N  N      . LEU A  1 205  ? 60.124  122.344 -32.567 1.00 130.31 ?  205  LEU A N      1 
ATOM   1632  C  CA     . LEU A  1 205  ? 58.720  122.644 -32.792 1.00 130.79 ?  205  LEU A CA     1 
ATOM   1633  C  C      . LEU A  1 205  ? 58.737  123.284 -34.190 1.00 137.27 ?  205  LEU A C      1 
ATOM   1634  O  O      . LEU A  1 205  ? 59.509  124.216 -34.419 1.00 138.80 ?  205  LEU A O      1 
ATOM   1635  C  CB     . LEU A  1 205  ? 58.168  123.637 -31.760 1.00 130.23 ?  205  LEU A CB     1 
ATOM   1636  C  CG     . LEU A  1 205  ? 56.714  124.082 -31.937 1.00 136.27 ?  205  LEU A CG     1 
ATOM   1637  C  CD1    . LEU A  1 205  ? 55.745  122.984 -31.559 1.00 136.06 ?  205  LEU A CD1    1 
ATOM   1638  C  CD2    . LEU A  1 205  ? 56.436  125.288 -31.094 1.00 138.89 ?  205  LEU A CD2    1 
ATOM   1639  N  N      . VAL A  1 206  ? 57.940  122.766 -35.126 1.00 133.56 ?  206  VAL A N      1 
ATOM   1640  C  CA     . VAL A  1 206  ? 57.911  123.295 -36.486 1.00 135.17 ?  206  VAL A CA     1 
ATOM   1641  C  C      . VAL A  1 206  ? 56.603  124.002 -36.761 1.00 141.57 ?  206  VAL A C      1 
ATOM   1642  O  O      . VAL A  1 206  ? 55.539  123.492 -36.413 1.00 142.54 ?  206  VAL A O      1 
ATOM   1643  C  CB     . VAL A  1 206  ? 58.222  122.191 -37.527 1.00 139.07 ?  206  VAL A CB     1 
ATOM   1644  C  CG1    . VAL A  1 206  ? 57.912  122.645 -38.947 1.00 141.96 ?  206  VAL A CG1    1 
ATOM   1645  C  CG2    . VAL A  1 206  ? 59.674  121.777 -37.421 1.00 137.61 ?  206  VAL A CG2    1 
ATOM   1646  N  N      . VAL A  1 207  ? 56.678  125.184 -37.369 1.00 138.99 ?  207  VAL A N      1 
ATOM   1647  C  CA     . VAL A  1 207  ? 55.492  125.925 -37.775 1.00 140.83 ?  207  VAL A CA     1 
ATOM   1648  C  C      . VAL A  1 207  ? 55.651  126.272 -39.248 1.00 150.96 ?  207  VAL A C      1 
ATOM   1649  O  O      . VAL A  1 207  ? 56.586  126.995 -39.612 1.00 152.50 ?  207  VAL A O      1 
ATOM   1650  C  CB     . VAL A  1 207  ? 55.223  127.180 -36.930 1.00 143.07 ?  207  VAL A CB     1 
ATOM   1651  C  CG1    . VAL A  1 207  ? 53.898  127.816 -37.325 1.00 145.56 ?  207  VAL A CG1    1 
ATOM   1652  C  CG2    . VAL A  1 207  ? 55.242  126.855 -35.449 1.00 139.48 ?  207  VAL A CG2    1 
ATOM   1653  N  N      . THR A  1 208  ? 54.770  125.729 -40.098 1.00 149.83 ?  208  THR A N      1 
ATOM   1654  C  CA     . THR A  1 208  ? 54.779  126.023 -41.534 1.00 152.70 ?  208  THR A CA     1 
ATOM   1655  C  C      . THR A  1 208  ? 53.487  126.764 -41.860 1.00 159.78 ?  208  THR A C      1 
ATOM   1656  O  O      . THR A  1 208  ? 52.681  127.050 -40.956 1.00 159.20 ?  208  THR A O      1 
ATOM   1657  C  CB     . THR A  1 208  ? 54.860  124.740 -42.363 1.00 159.38 ?  208  THR A CB     1 
ATOM   1658  O  OG1    . THR A  1 208  ? 53.620  124.048 -42.242 1.00 161.71 ?  208  THR A OG1    1 
ATOM   1659  C  CG2    . THR A  1 208  ? 55.995  123.838 -41.943 1.00 154.60 ?  208  THR A CG2    1 
ATOM   1660  N  N      . LYS A  1 209  ? 53.244  126.992 -43.167 1.00 158.39 ?  209  LYS A N      1 
ATOM   1661  C  CA     . LYS A  1 209  ? 52.008  127.618 -43.644 1.00 161.06 ?  209  LYS A CA     1 
ATOM   1662  C  C      . LYS A  1 209  ? 50.785  126.813 -43.201 1.00 163.38 ?  209  LYS A C      1 
ATOM   1663  O  O      . LYS A  1 209  ? 49.712  127.384 -43.020 1.00 164.52 ?  209  LYS A O      1 
ATOM   1664  C  CB     . LYS A  1 209  ? 52.025  127.756 -45.176 1.00 166.91 ?  209  LYS A CB     1 
ATOM   1665  C  CG     . LYS A  1 209  ? 52.197  126.443 -45.963 1.00 171.64 ?  209  LYS A CG     1 
ATOM   1666  C  CD     . LYS A  1 209  ? 51.838  126.625 -47.444 1.00 175.21 ?  209  LYS A CD     1 
ATOM   1667  C  CE     . LYS A  1 209  ? 51.909  125.346 -48.236 1.00 170.62 ?  209  LYS A CE     1 
ATOM   1668  N  NZ     . LYS A  1 209  ? 50.705  124.505 -48.053 1.00 172.47 1  209  LYS A NZ     1 
ATOM   1669  N  N      . ASP A  1 210  ? 50.977  125.493 -42.993 1.00 157.87 ?  210  ASP A N      1 
ATOM   1670  C  CA     . ASP A  1 210  ? 49.944  124.518 -42.658 1.00 158.20 ?  210  ASP A CA     1 
ATOM   1671  C  C      . ASP A  1 210  ? 49.632  124.370 -41.177 1.00 158.44 ?  210  ASP A C      1 
ATOM   1672  O  O      . ASP A  1 210  ? 48.604  123.776 -40.848 1.00 159.81 ?  210  ASP A O      1 
ATOM   1673  C  CB     . ASP A  1 210  ? 50.295  123.138 -43.252 1.00 159.95 ?  210  ASP A CB     1 
ATOM   1674  C  CG     . ASP A  1 210  ? 50.701  123.153 -44.711 1.00 174.28 ?  210  ASP A CG     1 
ATOM   1675  O  OD1    . ASP A  1 210  ? 49.872  123.550 -45.550 1.00 178.56 -1 210  ASP A OD1    1 
ATOM   1676  O  OD2    . ASP A  1 210  ? 51.851  122.752 -45.013 1.00 179.52 -1 210  ASP A OD2    1 
ATOM   1677  N  N      . GLY A  1 211  ? 50.493  124.864 -40.298 1.00 150.26 ?  211  GLY A N      1 
ATOM   1678  C  CA     . GLY A  1 211  ? 50.226  124.738 -38.875 1.00 147.11 ?  211  GLY A CA     1 
ATOM   1679  C  C      . GLY A  1 211  ? 51.405  124.287 -38.053 1.00 145.78 ?  211  GLY A C      1 
ATOM   1680  O  O      . GLY A  1 211  ? 52.555  124.417 -38.480 1.00 143.80 ?  211  GLY A O      1 
ATOM   1681  N  N      . VAL A  1 212  ? 51.107  123.735 -36.870 1.00 139.98 ?  212  VAL A N      1 
ATOM   1682  C  CA     . VAL A  1 212  ? 52.099  123.341 -35.882 1.00 135.71 ?  212  VAL A CA     1 
ATOM   1683  C  C      . VAL A  1 212  ? 52.377  121.837 -35.877 1.00 139.91 ?  212  VAL A C      1 
ATOM   1684  O  O      . VAL A  1 212  ? 51.443  121.038 -35.861 1.00 140.81 ?  212  VAL A O      1 
ATOM   1685  C  CB     . VAL A  1 212  ? 51.664  123.829 -34.494 1.00 137.21 ?  212  VAL A CB     1 
ATOM   1686  C  CG1    . VAL A  1 212  ? 52.755  123.560 -33.469 1.00 133.24 ?  212  VAL A CG1    1 
ATOM   1687  C  CG2    . VAL A  1 212  ? 51.302  125.303 -34.524 1.00 138.84 ?  212  VAL A CG2    1 
ATOM   1688  N  N      . TYR A  1 213  ? 53.661  121.464 -35.825 1.00 135.21 ?  213  TYR A N      1 
ATOM   1689  C  CA     . TYR A  1 213  ? 54.114  120.082 -35.812 1.00 134.28 ?  213  TYR A CA     1 
ATOM   1690  C  C      . TYR A  1 213  ? 55.056  119.885 -34.639 1.00 137.73 ?  213  TYR A C      1 
ATOM   1691  O  O      . TYR A  1 213  ? 56.021  120.641 -34.471 1.00 136.83 ?  213  TYR A O      1 
ATOM   1692  C  CB     . TYR A  1 213  ? 54.853  119.746 -37.121 1.00 136.69 ?  213  TYR A CB     1 
ATOM   1693  C  CG     . TYR A  1 213  ? 54.033  119.915 -38.387 1.00 141.16 ?  213  TYR A CG     1 
ATOM   1694  C  CD1    . TYR A  1 213  ? 53.923  121.158 -39.012 1.00 144.26 ?  213  TYR A CD1    1 
ATOM   1695  C  CD2    . TYR A  1 213  ? 53.407  118.827 -38.987 1.00 143.56 ?  213  TYR A CD2    1 
ATOM   1696  C  CE1    . TYR A  1 213  ? 53.182  121.319 -40.183 1.00 147.17 ?  213  TYR A CE1    1 
ATOM   1697  C  CE2    . TYR A  1 213  ? 52.692  118.969 -40.178 1.00 147.80 ?  213  TYR A CE2    1 
ATOM   1698  C  CZ     . TYR A  1 213  ? 52.569  120.221 -40.764 1.00 155.22 ?  213  TYR A CZ     1 
ATOM   1699  O  OH     . TYR A  1 213  ? 51.847  120.384 -41.926 1.00 157.60 ?  213  TYR A OH     1 
ATOM   1700  N  N      . VAL A  1 214  ? 54.780  118.866 -33.830 1.00 134.48 ?  214  VAL A N      1 
ATOM   1701  C  CA     . VAL A  1 214  ? 55.627  118.519 -32.679 1.00 131.96 ?  214  VAL A CA     1 
ATOM   1702  C  C      . VAL A  1 214  ? 56.564  117.395 -33.136 1.00 137.95 ?  214  VAL A C      1 
ATOM   1703  O  O      . VAL A  1 214  ? 56.209  116.217 -33.061 1.00 138.45 ?  214  VAL A O      1 
ATOM   1704  C  CB     . VAL A  1 214  ? 54.785  118.107 -31.463 1.00 133.74 ?  214  VAL A CB     1 
ATOM   1705  C  CG1    . VAL A  1 214  ? 55.678  117.818 -30.264 1.00 130.66 ?  214  VAL A CG1    1 
ATOM   1706  C  CG2    . VAL A  1 214  ? 53.742  119.171 -31.139 1.00 134.07 ?  214  VAL A CG2    1 
ATOM   1707  N  N      . LEU A  1 215  ? 57.741  117.758 -33.647 1.00 134.60 ?  215  LEU A N      1 
ATOM   1708  C  CA     . LEU A  1 215  ? 58.672  116.782 -34.209 1.00 134.46 ?  215  LEU A CA     1 
ATOM   1709  C  C      . LEU A  1 215  ? 59.384  115.926 -33.198 1.00 137.21 ?  215  LEU A C      1 
ATOM   1710  O  O      . LEU A  1 215  ? 59.667  114.767 -33.484 1.00 136.70 ?  215  LEU A O      1 
ATOM   1711  C  CB     . LEU A  1 215  ? 59.677  117.477 -35.106 1.00 135.20 ?  215  LEU A CB     1 
ATOM   1712  C  CG     . LEU A  1 215  ? 59.345  117.493 -36.583 1.00 142.35 ?  215  LEU A CG     1 
ATOM   1713  C  CD1    . LEU A  1 215  ? 57.926  117.982 -36.861 1.00 143.32 ?  215  LEU A CD1    1 
ATOM   1714  C  CD2    . LEU A  1 215  ? 60.340  118.328 -37.318 1.00 147.10 ?  215  LEU A CD2    1 
ATOM   1715  N  N      . ASP A  1 216  ? 59.702  116.495 -32.037 1.00 133.85 ?  216  ASP A N      1 
ATOM   1716  C  CA     . ASP A  1 216  ? 60.399  115.804 -30.961 1.00 133.14 ?  216  ASP A CA     1 
ATOM   1717  C  C      . ASP A  1 216  ? 59.805  116.213 -29.636 1.00 133.73 ?  216  ASP A C      1 
ATOM   1718  O  O      . ASP A  1 216  ? 59.299  117.328 -29.502 1.00 134.08 ?  216  ASP A O      1 
ATOM   1719  C  CB     . ASP A  1 216  ? 61.903  116.137 -30.981 1.00 136.07 ?  216  ASP A CB     1 
ATOM   1720  C  CG     . ASP A  1 216  ? 62.772  115.331 -30.003 1.00 152.92 ?  216  ASP A CG     1 
ATOM   1721  O  OD1    . ASP A  1 216  ? 62.282  114.299 -29.463 1.00 152.01 ?  216  ASP A OD1    1 
ATOM   1722  O  OD2    . ASP A  1 216  ? 63.956  115.714 -29.800 1.00 165.39 -1 216  ASP A OD2    1 
ATOM   1723  N  N      . LEU A  1 217  ? 59.840  115.312 -28.663 1.00 126.06 ?  217  LEU A N      1 
ATOM   1724  C  CA     . LEU A  1 217  ? 59.348  115.621 -27.338 1.00 122.39 ?  217  LEU A CA     1 
ATOM   1725  C  C      . LEU A  1 217  ? 60.137  114.823 -26.312 1.00 124.41 ?  217  LEU A C      1 
ATOM   1726  O  O      . LEU A  1 217  ? 60.349  113.617 -26.483 1.00 125.86 ?  217  LEU A O      1 
ATOM   1727  C  CB     . LEU A  1 217  ? 57.841  115.354 -27.234 1.00 121.60 ?  217  LEU A CB     1 
ATOM   1728  C  CG     . LEU A  1 217  ? 57.165  115.768 -25.942 1.00 123.56 ?  217  LEU A CG     1 
ATOM   1729  C  CD1    . LEU A  1 217  ? 55.705  116.026 -26.167 1.00 124.97 ?  217  LEU A CD1    1 
ATOM   1730  C  CD2    . LEU A  1 217  ? 57.328  114.702 -24.882 1.00 122.75 ?  217  LEU A CD2    1 
ATOM   1731  N  N      . ALA A  1 218  ? 60.604  115.526 -25.266 1.00 116.48 ?  218  ALA A N      1 
ATOM   1732  C  CA     . ALA A  1 218  ? 61.275  114.941 -24.120 1.00 113.93 ?  218  ALA A CA     1 
ATOM   1733  C  C      . ALA A  1 218  ? 60.595  115.518 -22.909 1.00 113.89 ?  218  ALA A C      1 
ATOM   1734  O  O      . ALA A  1 218  ? 60.277  116.708 -22.888 1.00 112.47 ?  218  ALA A O      1 
ATOM   1735  C  CB     . ALA A  1 218  ? 62.743  115.283 -24.119 1.00 115.20 ?  218  ALA A CB     1 
ATOM   1736  N  N      . ALA A  1 219  ? 60.309  114.674 -21.921 1.00 109.37 ?  219  ALA A N      1 
ATOM   1737  C  CA     . ALA A  1 219  ? 59.576  115.120 -20.758 1.00 107.50 ?  219  ALA A CA     1 
ATOM   1738  C  C      . ALA A  1 219  ? 59.817  114.249 -19.553 1.00 114.78 ?  219  ALA A C      1 
ATOM   1739  O  O      . ALA A  1 219  ? 60.232  113.083 -19.676 1.00 117.40 ?  219  ALA A O      1 
ATOM   1740  C  CB     . ALA A  1 219  ? 58.089  115.127 -21.080 1.00 107.54 ?  219  ALA A CB     1 
ATOM   1741  N  N      . LYS A  1 220  ? 59.540  114.832 -18.374 1.00 109.71 ?  220  LYS A N      1 
ATOM   1742  C  CA     . LYS A  1 220  ? 59.481  114.153 -17.082 1.00 108.07 ?  220  LYS A CA     1 
ATOM   1743  C  C      . LYS A  1 220  ? 58.164  114.571 -16.402 1.00 109.80 ?  220  LYS A C      1 
ATOM   1744  O  O      . LYS A  1 220  ? 57.738  115.737 -16.478 1.00 108.27 ?  220  LYS A O      1 
ATOM   1745  C  CB     . LYS A  1 220  ? 60.649  114.509 -16.157 1.00 109.52 ?  220  LYS A CB     1 
ATOM   1746  C  CG     . LYS A  1 220  ? 62.028  114.235 -16.706 1.00 111.50 ?  220  LYS A CG     1 
ATOM   1747  C  CD     . LYS A  1 220  ? 63.120  114.576 -15.662 1.00 119.48 ?  220  LYS A CD     1 
ATOM   1748  C  CE     . LYS A  1 220  ? 63.350  113.507 -14.589 1.00 123.51 ?  220  LYS A CE     1 
ATOM   1749  N  NZ     . LYS A  1 220  ? 64.690  113.616 -13.907 1.00 126.84 1  220  LYS A NZ     1 
ATOM   1750  N  N      . VAL A  1 221  ? 57.531  113.616 -15.733 1.00 105.19 ?  221  VAL A N      1 
ATOM   1751  C  CA     . VAL A  1 221  ? 56.343  113.909 -14.944 1.00 103.48 ?  221  VAL A CA     1 
ATOM   1752  C  C      . VAL A  1 221  ? 56.658  113.633 -13.459 1.00 106.74 ?  221  VAL A C      1 
ATOM   1753  O  O      . VAL A  1 221  ? 57.554  112.844 -13.140 1.00 106.12 ?  221  VAL A O      1 
ATOM   1754  C  CB     . VAL A  1 221  ? 55.047  113.187 -15.414 1.00 106.76 ?  221  VAL A CB     1 
ATOM   1755  C  CG1    . VAL A  1 221  ? 54.719  113.510 -16.858 1.00 106.11 ?  221  VAL A CG1    1 
ATOM   1756  C  CG2    . VAL A  1 221  ? 55.122  111.686 -15.198 1.00 107.63 ?  221  VAL A CG2    1 
ATOM   1757  N  N      . ASP A  1 222  ? 55.893  114.258 -12.562 1.00 103.16 ?  222  ASP A N      1 
ATOM   1758  C  CA     . ASP A  1 222  ? 56.036  114.013 -11.143 1.00 102.83 ?  222  ASP A CA     1 
ATOM   1759  C  C      . ASP A  1 222  ? 55.245  112.755 -10.838 1.00 109.72 ?  222  ASP A C      1 
ATOM   1760  O  O      . ASP A  1 222  ? 54.028  112.812 -10.639 1.00 108.83 ?  222  ASP A O      1 
ATOM   1761  C  CB     . ASP A  1 222  ? 55.511  115.192 -10.344 1.00 103.66 ?  222  ASP A CB     1 
ATOM   1762  C  CG     . ASP A  1 222  ? 55.746  115.104 -8.852  1.00 116.74 ?  222  ASP A CG     1 
ATOM   1763  O  OD1    . ASP A  1 222  ? 56.366  114.098 -8.388  1.00 117.35 ?  222  ASP A OD1    1 
ATOM   1764  O  OD2    . ASP A  1 222  ? 55.343  116.047 -8.144  1.00 126.38 -1 222  ASP A OD2    1 
ATOM   1765  N  N      . ALA A  1 223  ? 55.939  111.610 -10.832 1.00 109.27 ?  223  ALA A N      1 
ATOM   1766  C  CA     . ALA A  1 223  ? 55.321  110.316 -10.611 1.00 111.14 ?  223  ALA A CA     1 
ATOM   1767  C  C      . ALA A  1 223  ? 54.495  110.234 -9.343  1.00 116.67 ?  223  ALA A C      1 
ATOM   1768  O  O      . ALA A  1 223  ? 53.553  109.444 -9.315  1.00 119.27 ?  223  ALA A O      1 
ATOM   1769  C  CB     . ALA A  1 223  ? 56.371  109.228 -10.623 1.00 113.28 ?  223  ALA A CB     1 
ATOM   1770  N  N      . THR A  1 224  ? 54.802  111.059 -8.314  1.00 111.85 ?  224  THR A N      1 
ATOM   1771  C  CA     . THR A  1 224  ? 54.072  111.092 -7.028  1.00 111.60 ?  224  THR A CA     1 
ATOM   1772  C  C      . THR A  1 224  ? 52.626  111.565 -7.169  1.00 112.89 ?  224  THR A C      1 
ATOM   1773  O  O      . THR A  1 224  ? 51.829  111.359 -6.237  1.00 111.53 ?  224  THR A O      1 
ATOM   1774  C  CB     . THR A  1 224  ? 54.830  111.919 -5.973  1.00 125.76 ?  224  THR A CB     1 
ATOM   1775  O  OG1    . THR A  1 224  ? 54.856  113.294 -6.345  1.00 125.66 ?  224  THR A OG1    1 
ATOM   1776  C  CG2    . THR A  1 224  ? 56.242  111.462 -5.787  1.00 128.36 ?  224  THR A CG2    1 
ATOM   1777  N  N      . ALA A  1 225  ? 52.301  112.188 -8.350  1.00 108.69 ?  225  ALA A N      1 
ATOM   1778  C  CA     . ALA A  1 225  ? 50.979  112.739 -8.688  1.00 108.54 ?  225  ALA A CA     1 
ATOM   1779  C  C      . ALA A  1 225  ? 50.048  111.723 -9.300  1.00 112.51 ?  225  ALA A C      1 
ATOM   1780  O  O      . ALA A  1 225  ? 48.982  112.084 -9.808  1.00 111.37 ?  225  ALA A O      1 
ATOM   1781  C  CB     . ALA A  1 225  ? 51.115  113.923 -9.622  1.00 108.70 ?  225  ALA A CB     1 
ATOM   1782  N  N      . ASP A  1 226  ? 50.425  110.446 -9.217  1.00 111.14 ?  226  ASP A N      1 
ATOM   1783  C  CA     . ASP A  1 226  ? 49.622  109.379 -9.766  1.00 113.85 ?  226  ASP A CA     1 
ATOM   1784  C  C      . ASP A  1 226  ? 48.217  109.402 -9.216  1.00 115.68 ?  226  ASP A C      1 
ATOM   1785  O  O      . ASP A  1 226  ? 47.264  109.361 -9.984  1.00 116.68 ?  226  ASP A O      1 
ATOM   1786  C  CB     . ASP A  1 226  ? 50.266  108.021 -9.518  1.00 118.97 ?  226  ASP A CB     1 
ATOM   1787  C  CG     . ASP A  1 226  ? 49.515  106.923 -10.269 1.00 155.58 ?  226  ASP A CG     1 
ATOM   1788  O  OD1    . ASP A  1 226  ? 49.622  106.875 -11.546 1.00 159.66 ?  226  ASP A OD1    1 
ATOM   1789  O  OD2    . ASP A  1 226  ? 48.748  106.163 -9.605  1.00 169.04 -1 226  ASP A OD2    1 
ATOM   1790  N  N      . TYR A  1 227  ? 48.084  109.551 -7.906  1.00 109.86 ?  227  TYR A N      1 
ATOM   1791  C  CA     . TYR A  1 227  ? 46.774  109.590 -7.259  1.00 110.13 ?  227  TYR A CA     1 
ATOM   1792  C  C      . TYR A  1 227  ? 45.846  110.679 -7.795  1.00 111.91 ?  227  TYR A C      1 
ATOM   1793  O  O      . TYR A  1 227  ? 44.630  110.556 -7.684  1.00 113.64 ?  227  TYR A O      1 
ATOM   1794  C  CB     . TYR A  1 227  ? 46.932  109.688 -5.741  1.00 110.54 ?  227  TYR A CB     1 
ATOM   1795  C  CG     . TYR A  1 227  ? 47.325  111.044 -5.204  1.00 109.04 ?  227  TYR A CG     1 
ATOM   1796  C  CD1    . TYR A  1 227  ? 48.657  111.468 -5.220  1.00 108.85 ?  227  TYR A CD1    1 
ATOM   1797  C  CD2    . TYR A  1 227  ? 46.399  111.838 -4.549  1.00 109.89 ?  227  TYR A CD2    1 
ATOM   1798  C  CE1    . TYR A  1 227  ? 49.031  112.692 -4.675  1.00 107.92 ?  227  TYR A CE1    1 
ATOM   1799  C  CE2    . TYR A  1 227  ? 46.761  113.049 -3.988  1.00 109.92 ?  227  TYR A CE2    1 
ATOM   1800  C  CZ     . TYR A  1 227  ? 48.074  113.476 -4.056  1.00 115.01 ?  227  TYR A CZ     1 
ATOM   1801  O  OH     . TYR A  1 227  ? 48.365  114.677 -3.472  1.00 115.02 ?  227  TYR A OH     1 
ATOM   1802  N  N      . ILE A  1 228  ? 46.423  111.710 -8.413  1.00 105.02 ?  228  ILE A N      1 
ATOM   1803  C  CA     . ILE A  1 228  ? 45.686  112.800 -9.021  1.00 103.95 ?  228  ILE A CA     1 
ATOM   1804  C  C      . ILE A  1 228  ? 45.382  112.463 -10.496 1.00 114.32 ?  228  ILE A C      1 
ATOM   1805  O  O      . ILE A  1 228  ? 44.222  112.287 -10.887 1.00 117.38 ?  228  ILE A O      1 
ATOM   1806  C  CB     . ILE A  1 228  ? 46.497  114.111 -8.868  1.00 102.38 ?  228  ILE A CB     1 
ATOM   1807  C  CG1    . ILE A  1 228  ? 46.680  114.455 -7.404  1.00 99.79  ?  228  ILE A CG1    1 
ATOM   1808  C  CG2    . ILE A  1 228  ? 45.842  115.244 -9.619  1.00 103.98 ?  228  ILE A CG2    1 
ATOM   1809  C  CD1    . ILE A  1 228  ? 47.746  115.359 -7.118  1.00 93.62  ?  228  ILE A CD1    1 
ATOM   1810  N  N      . CYS A  1 229  ? 46.444  112.251 -11.269 1.00 112.07 ?  229  CYS A N      1 
ATOM   1811  C  CA     . CYS A  1 229  ? 46.427  112.109 -12.707 1.00 113.85 ?  229  CYS A CA     1 
ATOM   1812  C  C      . CYS A  1 229  ? 46.097  110.735 -13.288 1.00 120.48 ?  229  CYS A C      1 
ATOM   1813  O  O      . CYS A  1 229  ? 45.978  110.650 -14.510 1.00 121.57 ?  229  CYS A O      1 
ATOM   1814  C  CB     . CYS A  1 229  ? 47.759  112.592 -13.249 1.00 112.89 ?  229  CYS A CB     1 
ATOM   1815  S  SG     . CYS A  1 229  ? 48.178  114.277 -12.769 1.00 116.17 ?  229  CYS A SG     1 
ATOM   1816  N  N      . LYS A  1 230  ? 45.988  109.675 -12.470 1.00 118.13 ?  230  LYS A N      1 
ATOM   1817  C  CA     . LYS A  1 230  ? 45.752  108.278 -12.894 1.00 120.49 ?  230  LYS A CA     1 
ATOM   1818  C  C      . LYS A  1 230  ? 44.839  108.145 -14.102 1.00 127.13 ?  230  LYS A C      1 
ATOM   1819  O  O      . LYS A  1 230  ? 45.153  107.427 -15.045 1.00 128.06 ?  230  LYS A O      1 
ATOM   1820  C  CB     . LYS A  1 230  ? 45.189  107.446 -11.716 1.00 125.14 ?  230  LYS A CB     1 
ATOM   1821  C  CG     . LYS A  1 230  ? 44.033  108.152 -10.952 1.00 152.71 ?  230  LYS A CG     1 
ATOM   1822  C  CD     . LYS A  1 230  ? 43.436  107.376 -9.767  1.00 164.28 ?  230  LYS A CD     1 
ATOM   1823  C  CE     . LYS A  1 230  ? 42.125  107.960 -9.271  1.00 162.11 ?  230  LYS A CE     1 
ATOM   1824  N  NZ     . LYS A  1 230  ? 42.287  109.217 -8.487  1.00 159.33 1  230  LYS A NZ     1 
ATOM   1825  N  N      . VAL A  1 231  ? 43.719  108.874 -14.070 1.00 124.97 ?  231  VAL A N      1 
ATOM   1826  C  CA     . VAL A  1 231  ? 42.659  108.914 -15.074 1.00 127.36 ?  231  VAL A CA     1 
ATOM   1827  C  C      . VAL A  1 231  ? 43.159  109.381 -16.416 1.00 129.94 ?  231  VAL A C      1 
ATOM   1828  O  O      . VAL A  1 231  ? 42.874  108.738 -17.417 1.00 130.69 ?  231  VAL A O      1 
ATOM   1829  C  CB     . VAL A  1 231  ? 41.492  109.797 -14.603 1.00 132.54 ?  231  VAL A CB     1 
ATOM   1830  C  CG1    . VAL A  1 231  ? 40.854  109.184 -13.365 1.00 136.90 ?  231  VAL A CG1    1 
ATOM   1831  C  CG2    . VAL A  1 231  ? 41.928  111.265 -14.374 1.00 130.01 ?  231  VAL A CG2    1 
ATOM   1832  N  N      . LYS A  1 232  ? 43.890  110.515 -16.433 1.00 124.22 ?  232  LYS A N      1 
ATOM   1833  C  CA     . LYS A  1 232  ? 44.436  111.111 -17.646 1.00 123.12 ?  232  LYS A CA     1 
ATOM   1834  C  C      . LYS A  1 232  ? 45.661  110.351 -18.143 1.00 127.18 ?  232  LYS A C      1 
ATOM   1835  O  O      . LYS A  1 232  ? 45.730  110.016 -19.334 1.00 128.12 ?  232  LYS A O      1 
ATOM   1836  C  CB     . LYS A  1 232  ? 44.733  112.612 -17.460 1.00 121.98 ?  232  LYS A CB     1 
ATOM   1837  C  CG     . LYS A  1 232  ? 43.482  113.467 -17.286 1.00 126.25 ?  232  LYS A CG     1 
ATOM   1838  C  CD     . LYS A  1 232  ? 43.767  114.966 -17.375 1.00 128.41 ?  232  LYS A CD     1 
ATOM   1839  C  CE     . LYS A  1 232  ? 42.800  115.820 -16.586 1.00 130.97 ?  232  LYS A CE     1 
ATOM   1840  N  NZ     . LYS A  1 232  ? 43.315  116.111 -15.212 1.00 128.98 1  232  LYS A NZ     1 
ATOM   1841  N  N      . TRP A  1 233  ? 46.604  110.057 -17.229 1.00 122.60 ?  233  TRP A N      1 
ATOM   1842  C  CA     . TRP A  1 233  ? 47.841  109.355 -17.532 1.00 122.71 ?  233  TRP A CA     1 
ATOM   1843  C  C      . TRP A  1 233  ? 47.598  107.985 -18.066 1.00 131.61 ?  233  TRP A C      1 
ATOM   1844  O  O      . TRP A  1 233  ? 48.345  107.534 -18.940 1.00 132.60 ?  233  TRP A O      1 
ATOM   1845  C  CB     . TRP A  1 233  ? 48.683  109.200 -16.272 1.00 119.94 ?  233  TRP A CB     1 
ATOM   1846  C  CG     . TRP A  1 233  ? 49.389  110.433 -15.815 1.00 119.05 ?  233  TRP A CG     1 
ATOM   1847  C  CD1    . TRP A  1 233  ? 49.362  111.675 -16.392 1.00 121.54 ?  233  TRP A CD1    1 
ATOM   1848  C  CD2    . TRP A  1 233  ? 50.248  110.534 -14.680 1.00 117.36 ?  233  TRP A CD2    1 
ATOM   1849  N  NE1    . TRP A  1 233  ? 50.160  112.542 -15.687 1.00 119.17 ?  233  TRP A NE1    1 
ATOM   1850  C  CE2    . TRP A  1 233  ? 50.725  111.869 -14.633 1.00 119.87 ?  233  TRP A CE2    1 
ATOM   1851  C  CE3    . TRP A  1 233  ? 50.662  109.623 -13.688 1.00 118.65 ?  233  TRP A CE3    1 
ATOM   1852  C  CZ2    . TRP A  1 233  ? 51.571  112.323 -13.618 1.00 117.68 ?  233  TRP A CZ2    1 
ATOM   1853  C  CZ3    . TRP A  1 233  ? 51.517  110.071 -12.698 1.00 118.82 ?  233  TRP A CZ3    1 
ATOM   1854  C  CH2    . TRP A  1 233  ? 51.956  111.408 -12.665 1.00 118.08 ?  233  TRP A CH2    1 
ATOM   1855  N  N      . GLY A  1 234  ? 46.610  107.303 -17.496 1.00 131.16 ?  234  GLY A N      1 
ATOM   1856  C  CA     . GLY A  1 234  ? 46.330  105.921 -17.854 1.00 134.93 ?  234  GLY A CA     1 
ATOM   1857  C  C      . GLY A  1 234  ? 47.464  105.037 -17.396 1.00 139.51 ?  234  GLY A C      1 
ATOM   1858  O  O      . GLY A  1 234  ? 48.097  105.339 -16.372 1.00 135.65 ?  234  GLY A O      1 
ATOM   1859  N  N      . ASP A  1 235  ? 47.757  103.964 -18.163 1.00 140.94 ?  235  ASP A N      1 
ATOM   1860  C  CA     . ASP A  1 235  ? 48.848  103.099 -17.760 1.00 142.38 ?  235  ASP A CA     1 
ATOM   1861  C  C      . ASP A  1 235  ? 50.160  103.627 -18.306 1.00 143.45 ?  235  ASP A C      1 
ATOM   1862  O  O      . ASP A  1 235  ? 50.755  103.084 -19.247 1.00 145.75 ?  235  ASP A O      1 
ATOM   1863  C  CB     . ASP A  1 235  ? 48.628  101.606 -18.031 1.00 150.24 ?  235  ASP A CB     1 
ATOM   1864  C  CG     . ASP A  1 235  ? 49.616  100.797 -17.188 1.00 178.51 ?  235  ASP A CG     1 
ATOM   1865  O  OD1    . ASP A  1 235  ? 49.406  100.707 -15.943 1.00 180.19 ?  235  ASP A OD1    1 
ATOM   1866  O  OD2    . ASP A  1 235  ? 50.716  100.464 -17.717 1.00 191.62 -1 235  ASP A OD2    1 
ATOM   1867  N  N      . ILE A  1 236  ? 50.598  104.722 -17.685 1.00 129.03 ?  236  ILE A N      1 
ATOM   1868  C  CA     . ILE A  1 236  ? 51.831  105.421 -17.992 1.00 126.00 ?  236  ILE A CA     1 
ATOM   1869  C  C      . ILE A  1 236  ? 53.015  104.546 -17.607 1.00 129.09 ?  236  ILE A C      1 
ATOM   1870  O  O      . ILE A  1 236  ? 52.999  103.895 -16.556 1.00 130.16 ?  236  ILE A O      1 
ATOM   1871  C  CB     . ILE A  1 236  ? 51.830  106.811 -17.320 1.00 127.57 ?  236  ILE A CB     1 
ATOM   1872  C  CG1    . ILE A  1 236  ? 52.904  107.705 -17.893 1.00 126.36 ?  236  ILE A CG1    1 
ATOM   1873  C  CG2    . ILE A  1 236  ? 51.915  106.733 -15.806 1.00 128.95 ?  236  ILE A CG2    1 
ATOM   1874  C  CD1    . ILE A  1 236  ? 52.616  109.131 -17.771 1.00 133.84 ?  236  ILE A CD1    1 
ATOM   1875  N  N      . GLU A  1 237  ? 54.005  104.481 -18.494 1.00 123.57 ?  237  GLU A N      1 
ATOM   1876  C  CA     . GLU A  1 237  ? 55.203  103.677 -18.284 1.00 123.62 ?  237  GLU A CA     1 
ATOM   1877  C  C      . GLU A  1 237  ? 56.411  104.590 -18.150 1.00 125.48 ?  237  GLU A C      1 
ATOM   1878  O  O      . GLU A  1 237  ? 56.590  105.493 -18.978 1.00 123.84 ?  237  GLU A O      1 
ATOM   1879  C  CB     . GLU A  1 237  ? 55.397  102.697 -19.445 1.00 125.71 ?  237  GLU A CB     1 
ATOM   1880  C  CG     . GLU A  1 237  ? 54.278  101.662 -19.574 1.00 146.71 ?  237  GLU A CG     1 
ATOM   1881  C  CD     . GLU A  1 237  ? 54.110  100.911 -20.893 1.00 176.32 ?  237  GLU A CD     1 
ATOM   1882  O  OE1    . GLU A  1 237  ? 55.021  100.991 -21.750 1.00 165.95 ?  237  GLU A OE1    1 
ATOM   1883  O  OE2    . GLU A  1 237  ? 53.062  100.241 -21.065 1.00 174.14 -1 237  GLU A OE2    1 
ATOM   1884  N  N      . PHE A  1 238  ? 57.239  104.354 -17.110 1.00 121.56 ?  238  PHE A N      1 
ATOM   1885  C  CA     . PHE A  1 238  ? 58.451  105.133 -16.855 1.00 120.88 ?  238  PHE A CA     1 
ATOM   1886  C  C      . PHE A  1 238  ? 59.682  104.316 -17.216 1.00 125.02 ?  238  PHE A C      1 
ATOM   1887  O  O      . PHE A  1 238  ? 60.090  103.420 -16.471 1.00 125.31 ?  238  PHE A O      1 
ATOM   1888  C  CB     . PHE A  1 238  ? 58.517  105.613 -15.415 1.00 122.91 ?  238  PHE A CB     1 
ATOM   1889  C  CG     . PHE A  1 238  ? 57.297  106.371 -14.998 1.00 124.43 ?  238  PHE A CG     1 
ATOM   1890  C  CD1    . PHE A  1 238  ? 57.046  107.634 -15.493 1.00 127.32 ?  238  PHE A CD1    1 
ATOM   1891  C  CD2    . PHE A  1 238  ? 56.397  105.823 -14.113 1.00 127.45 ?  238  PHE A CD2    1 
ATOM   1892  C  CE1    . PHE A  1 238  ? 55.921  108.341 -15.101 1.00 128.39 ?  238  PHE A CE1    1 
ATOM   1893  C  CE2    . PHE A  1 238  ? 55.266  106.527 -13.730 1.00 130.87 ?  238  PHE A CE2    1 
ATOM   1894  C  CZ     . PHE A  1 238  ? 55.040  107.787 -14.222 1.00 128.30 ?  238  PHE A CZ     1 
ATOM   1895  N  N      . PRO A  1 239  ? 60.264  104.588 -18.393 1.00 120.85 ?  239  PRO A N      1 
ATOM   1896  C  CA     . PRO A  1 239  ? 61.396  103.775 -18.841 1.00 120.78 ?  239  PRO A CA     1 
ATOM   1897  C  C      . PRO A  1 239  ? 62.701  103.935 -18.050 1.00 125.95 ?  239  PRO A C      1 
ATOM   1898  O  O      . PRO A  1 239  ? 62.973  105.040 -17.536 1.00 125.48 ?  239  PRO A O      1 
ATOM   1899  C  CB     . PRO A  1 239  ? 61.576  104.202 -20.301 1.00 121.94 ?  239  PRO A CB     1 
ATOM   1900  C  CG     . PRO A  1 239  ? 60.372  105.013 -20.650 1.00 125.62 ?  239  PRO A CG     1 
ATOM   1901  C  CD     . PRO A  1 239  ? 59.879  105.596 -19.404 1.00 121.51 ?  239  PRO A CD     1 
ATOM   1902  N  N      . PRO A  1 240  ? 63.536  102.846 -17.986 1.00 122.19 ?  240  PRO A N      1 
ATOM   1903  C  CA     . PRO A  1 240  ? 64.863  102.966 -17.360 1.00 121.89 ?  240  PRO A CA     1 
ATOM   1904  C  C      . PRO A  1 240  ? 65.778  103.808 -18.264 1.00 126.89 ?  240  PRO A C      1 
ATOM   1905  O  O      . PRO A  1 240  ? 65.560  103.847 -19.489 1.00 126.40 ?  240  PRO A O      1 
ATOM   1906  C  CB     . PRO A  1 240  ? 65.357  101.512 -17.284 1.00 123.40 ?  240  PRO A CB     1 
ATOM   1907  C  CG     . PRO A  1 240  ? 64.691  100.834 -18.386 1.00 127.76 ?  240  PRO A CG     1 
ATOM   1908  C  CD     . PRO A  1 240  ? 63.349  101.499 -18.562 1.00 123.37 ?  240  PRO A CD     1 
ATOM   1909  N  N      . PRO A  1 241  ? 66.797  104.495 -17.703 1.00 123.91 ?  241  PRO A N      1 
ATOM   1910  C  CA     . PRO A  1 241  ? 67.716  105.272 -18.555 1.00 124.66 ?  241  PRO A CA     1 
ATOM   1911  C  C      . PRO A  1 241  ? 68.399  104.381 -19.590 1.00 130.40 ?  241  PRO A C      1 
ATOM   1912  O  O      . PRO A  1 241  ? 68.623  103.197 -19.306 1.00 131.11 ?  241  PRO A O      1 
ATOM   1913  C  CB     . PRO A  1 241  ? 68.754  105.805 -17.554 1.00 126.38 ?  241  PRO A CB     1 
ATOM   1914  C  CG     . PRO A  1 241  ? 68.648  104.920 -16.374 1.00 130.12 ?  241  PRO A CG     1 
ATOM   1915  C  CD     . PRO A  1 241  ? 67.203  104.560 -16.289 1.00 125.11 ?  241  PRO A CD     1 
ATOM   1916  N  N      . PHE A  1 242  ? 68.743  104.918 -20.777 1.00 126.09 ?  242  PHE A N      1 
ATOM   1917  C  CA     . PHE A  1 242  ? 69.435  104.062 -21.742 1.00 125.19 ?  242  PHE A CA     1 
ATOM   1918  C  C      . PHE A  1 242  ? 70.717  103.500 -21.100 1.00 133.40 ?  242  PHE A C      1 
ATOM   1919  O  O      . PHE A  1 242  ? 71.401  104.186 -20.337 1.00 133.48 ?  242  PHE A O      1 
ATOM   1920  C  CB     . PHE A  1 242  ? 69.720  104.774 -23.062 1.00 125.85 ?  242  PHE A CB     1 
ATOM   1921  C  CG     . PHE A  1 242  ? 70.422  103.893 -24.068 1.00 126.41 ?  242  PHE A CG     1 
ATOM   1922  C  CD1    . PHE A  1 242  ? 69.728  102.901 -24.747 1.00 129.33 ?  242  PHE A CD1    1 
ATOM   1923  C  CD2    . PHE A  1 242  ? 71.789  104.027 -24.302 1.00 127.82 ?  242  PHE A CD2    1 
ATOM   1924  C  CE1    . PHE A  1 242  ? 70.381  102.076 -25.668 1.00 130.04 ?  242  PHE A CE1    1 
ATOM   1925  C  CE2    . PHE A  1 242  ? 72.445  103.191 -25.207 1.00 130.68 ?  242  PHE A CE2    1 
ATOM   1926  C  CZ     . PHE A  1 242  ? 71.734  102.228 -25.891 1.00 128.69 ?  242  PHE A CZ     1 
ATOM   1927  N  N      . GLY A  1 243  ? 70.946  102.221 -21.312 1.00 132.72 ?  243  GLY A N      1 
ATOM   1928  C  CA     . GLY A  1 243  ? 72.084  101.536 -20.715 1.00 134.17 ?  243  GLY A CA     1 
ATOM   1929  C  C      . GLY A  1 243  ? 71.677  100.583 -19.616 1.00 140.26 ?  243  GLY A C      1 
ATOM   1930  O  O      . GLY A  1 243  ? 72.412  99.624  -19.330 1.00 140.15 ?  243  GLY A O      1 
ATOM   1931  N  N      . ARG A  1 244  ? 70.491  100.819 -19.035 1.00 137.06 ?  244  ARG A N      1 
ATOM   1932  C  CA     . ARG A  1 244  ? 69.921  99.952  -18.017 1.00 136.57 ?  244  ARG A CA     1 
ATOM   1933  C  C      . ARG A  1 244  ? 68.727  99.215  -18.564 1.00 140.63 ?  244  ARG A C      1 
ATOM   1934  O  O      . ARG A  1 244  ? 67.999  99.723  -19.423 1.00 140.38 ?  244  ARG A O      1 
ATOM   1935  C  CB     . ARG A  1 244  ? 69.479  100.752 -16.792 1.00 136.94 ?  244  ARG A CB     1 
ATOM   1936  C  CG     . ARG A  1 244  ? 70.590  101.058 -15.815 1.00 145.62 ?  244  ARG A CG     1 
ATOM   1937  C  CD     . ARG A  1 244  ? 70.195  100.767 -14.372 1.00 144.40 ?  244  ARG A CD     1 
ATOM   1938  N  NE     . ARG A  1 244  ? 69.014  101.516 -13.949 1.00 138.62 ?  244  ARG A NE     1 
ATOM   1939  C  CZ     . ARG A  1 244  ? 69.040  102.781 -13.541 1.00 154.75 ?  244  ARG A CZ     1 
ATOM   1940  N  NH1    . ARG A  1 244  ? 70.184  103.454 -13.512 1.00 135.36 1  244  ARG A NH1    1 
ATOM   1941  N  NH2    . ARG A  1 244  ? 67.922  103.384 -13.154 1.00 148.31 ?  244  ARG A NH2    1 
ATOM   1942  N  N      . GLU A  1 245  ? 68.521  98.018  -18.062 1.00 137.39 ?  245  GLU A N      1 
ATOM   1943  C  CA     . GLU A  1 245  ? 67.373  97.224  -18.448 1.00 137.80 ?  245  GLU A CA     1 
ATOM   1944  C  C      . GLU A  1 245  ? 66.306  97.360  -17.377 1.00 141.10 ?  245  GLU A C      1 
ATOM   1945  O  O      . GLU A  1 245  ? 66.605  97.723  -16.225 1.00 140.60 ?  245  GLU A O      1 
ATOM   1946  C  CB     . GLU A  1 245  ? 67.768  95.744  -18.604 1.00 139.85 ?  245  GLU A CB     1 
ATOM   1947  C  CG     . GLU A  1 245  ? 68.127  95.325  -20.019 1.00 156.53 ?  245  GLU A CG     1 
ATOM   1948  C  CD     . GLU A  1 245  ? 67.026  95.350  -21.078 1.00 196.69 ?  245  GLU A CD     1 
ATOM   1949  O  OE1    . GLU A  1 245  ? 65.846  95.603  -20.728 1.00 195.20 ?  245  GLU A OE1    1 
ATOM   1950  O  OE2    . GLU A  1 245  ? 67.350  95.119  -22.269 1.00 200.93 -1 245  GLU A OE2    1 
ATOM   1951  N  N      . ALA A  1 246  ? 65.067  97.055  -17.751 1.00 137.79 ?  246  ALA A N      1 
ATOM   1952  C  CA     . ALA A  1 246  ? 63.982  97.038  -16.790 1.00 138.56 ?  246  ALA A CA     1 
ATOM   1953  C  C      . ALA A  1 246  ? 63.768  95.587  -16.392 1.00 143.15 ?  246  ALA A C      1 
ATOM   1954  O  O      . ALA A  1 246  ? 63.785  94.704  -17.253 1.00 144.33 ?  246  ALA A O      1 
ATOM   1955  C  CB     . ALA A  1 246  ? 62.723  97.611  -17.404 1.00 139.85 ?  246  ALA A CB     1 
ATOM   1956  N  N      . TYR A  1 247  ? 63.617  95.330  -15.095 1.00 138.80 ?  247  TYR A N      1 
ATOM   1957  C  CA     . TYR A  1 247  ? 63.439  93.971  -14.607 1.00 139.09 ?  247  TYR A CA     1 
ATOM   1958  C  C      . TYR A  1 247  ? 62.089  93.830  -13.933 1.00 141.90 ?  247  TYR A C      1 
ATOM   1959  O  O      . TYR A  1 247  ? 61.609  94.796  -13.329 1.00 142.86 ?  247  TYR A O      1 
ATOM   1960  C  CB     . TYR A  1 247  ? 64.581  93.568  -13.669 1.00 140.33 ?  247  TYR A CB     1 
ATOM   1961  C  CG     . TYR A  1 247  ? 65.949  93.706  -14.293 1.00 143.06 ?  247  TYR A CG     1 
ATOM   1962  C  CD1    . TYR A  1 247  ? 66.445  92.736  -15.157 1.00 145.28 ?  247  TYR A CD1    1 
ATOM   1963  C  CD2    . TYR A  1 247  ? 66.741  94.823  -14.044 1.00 143.80 ?  247  TYR A CD2    1 
ATOM   1964  C  CE1    . TYR A  1 247  ? 67.700  92.870  -15.749 1.00 145.16 ?  247  TYR A CE1    1 
ATOM   1965  C  CE2    . TYR A  1 247  ? 67.999  94.966  -14.630 1.00 144.44 ?  247  TYR A CE2    1 
ATOM   1966  C  CZ     . TYR A  1 247  ? 68.484  93.974  -15.461 1.00 149.34 ?  247  TYR A CZ     1 
ATOM   1967  O  OH     . TYR A  1 247  ? 69.726  94.126  -16.021 1.00 147.08 ?  247  TYR A OH     1 
ATOM   1968  N  N      . PRO A  1 248  ? 61.442  92.650  -14.035 1.00 135.88 ?  248  PRO A N      1 
ATOM   1969  C  CA     . PRO A  1 248  ? 60.128  92.472  -13.392 1.00 135.83 ?  248  PRO A CA     1 
ATOM   1970  C  C      . PRO A  1 248  ? 60.151  92.601  -11.871 1.00 136.76 ?  248  PRO A C      1 
ATOM   1971  O  O      . PRO A  1 248  ? 59.159  93.042  -11.288 1.00 135.74 ?  248  PRO A O      1 
ATOM   1972  C  CB     . PRO A  1 248  ? 59.707  91.078  -13.835 1.00 139.22 ?  248  PRO A CB     1 
ATOM   1973  C  CG     . PRO A  1 248  ? 60.982  90.386  -14.137 1.00 143.47 ?  248  PRO A CG     1 
ATOM   1974  C  CD     . PRO A  1 248  ? 61.869  91.421  -14.726 1.00 137.56 ?  248  PRO A CD     1 
ATOM   1975  N  N      . GLU A  1 249  ? 61.292  92.250  -11.237 1.00 132.27 ?  249  GLU A N      1 
ATOM   1976  C  CA     . GLU A  1 249  ? 61.500  92.389  -9.790  1.00 128.87 ?  249  GLU A CA     1 
ATOM   1977  C  C      . GLU A  1 249  ? 61.450  93.864  -9.399  1.00 131.02 ?  249  GLU A C      1 
ATOM   1978  O  O      . GLU A  1 249  ? 60.903  94.192  -8.344  1.00 129.36 ?  249  GLU A O      1 
ATOM   1979  C  CB     . GLU A  1 249  ? 62.833  91.766  -9.353  1.00 130.24 ?  249  GLU A CB     1 
ATOM   1980  C  CG     . GLU A  1 249  ? 62.920  90.270  -9.570  1.00 140.29 ?  249  GLU A CG     1 
ATOM   1981  C  CD     . GLU A  1 249  ? 63.296  89.816  -10.971 1.00 167.96 ?  249  GLU A CD     1 
ATOM   1982  O  OE1    . GLU A  1 249  ? 63.634  90.673  -11.821 1.00 167.64 ?  249  GLU A OE1    1 
ATOM   1983  O  OE2    . GLU A  1 249  ? 63.257  88.591  -11.221 1.00 165.96 -1 249  GLU A OE2    1 
ATOM   1984  N  N      . GLU A  1 250  ? 61.976  94.754  -10.276 1.00 127.33 ?  250  GLU A N      1 
ATOM   1985  C  CA     . GLU A  1 250  ? 61.917  96.194  -10.043 1.00 124.65 ?  250  GLU A CA     1 
ATOM   1986  C  C      . GLU A  1 250  ? 60.478  96.674  -10.094 1.00 126.48 ?  250  GLU A C      1 
ATOM   1987  O  O      . GLU A  1 250  ? 60.082  97.458  -9.229  1.00 123.42 ?  250  GLU A O      1 
ATOM   1988  C  CB     . GLU A  1 250  ? 62.724  96.952  -11.083 1.00 127.52 ?  250  GLU A CB     1 
ATOM   1989  C  CG     . GLU A  1 250  ? 64.221  96.807  -10.957 1.00 138.03 ?  250  GLU A CG     1 
ATOM   1990  C  CD     . GLU A  1 250  ? 64.961  97.446  -12.119 1.00 163.01 ?  250  GLU A CD     1 
ATOM   1991  O  OE1    . GLU A  1 250  ? 64.357  97.583  -13.207 1.00 159.60 ?  250  GLU A OE1    1 
ATOM   1992  O  OE2    . GLU A  1 250  ? 66.154  97.785  -11.953 1.00 160.38 -1 250  GLU A OE2    1 
ATOM   1993  N  N      . ALA A  1 251  ? 59.699  96.201  -11.097 1.00 124.33 ?  251  ALA A N      1 
ATOM   1994  C  CA     . ALA A  1 251  ? 58.308  96.590  -11.255 1.00 124.24 ?  251  ALA A CA     1 
ATOM   1995  C  C      . ALA A  1 251  ? 57.464  96.106  -10.091 1.00 127.80 ?  251  ALA A C      1 
ATOM   1996  O  O      . ALA A  1 251  ? 56.561  96.831  -9.654  1.00 126.15 ?  251  ALA A O      1 
ATOM   1997  C  CB     . ALA A  1 251  ? 57.766  96.061  -12.558 1.00 128.47 ?  251  ALA A CB     1 
ATOM   1998  N  N      . TYR A  1 252  ? 57.773  94.898  -9.575  1.00 125.85 ?  252  TYR A N      1 
ATOM   1999  C  CA     . TYR A  1 252  ? 57.077  94.306  -8.436  1.00 125.09 ?  252  TYR A CA     1 
ATOM   2000  C  C      . TYR A  1 252  ? 57.272  95.163  -7.194  1.00 125.15 ?  252  TYR A C      1 
ATOM   2001  O  O      . TYR A  1 252  ? 56.288  95.513  -6.539  1.00 123.63 ?  252  TYR A O      1 
ATOM   2002  C  CB     . TYR A  1 252  ? 57.564  92.874  -8.213  1.00 128.50 ?  252  TYR A CB     1 
ATOM   2003  C  CG     . TYR A  1 252  ? 57.015  92.236  -6.965  1.00 131.27 ?  252  TYR A CG     1 
ATOM   2004  C  CD1    . TYR A  1 252  ? 55.661  91.931  -6.853  1.00 134.53 ?  252  TYR A CD1    1 
ATOM   2005  C  CD2    . TYR A  1 252  ? 57.848  91.924  -5.894  1.00 131.43 ?  252  TYR A CD2    1 
ATOM   2006  C  CE1    . TYR A  1 252  ? 55.146  91.335  -5.701  1.00 136.33 ?  252  TYR A CE1    1 
ATOM   2007  C  CE2    . TYR A  1 252  ? 57.348  91.323  -4.739  1.00 132.42 ?  252  TYR A CE2    1 
ATOM   2008  C  CZ     . TYR A  1 252  ? 55.993  91.025  -4.647  1.00 143.69 ?  252  TYR A CZ     1 
ATOM   2009  O  OH     . TYR A  1 252  ? 55.473  90.425  -3.518  1.00 146.50 ?  252  TYR A OH     1 
ATOM   2010  N  N      . ILE A  1 253  ? 58.525  95.544  -6.896  1.00 120.12 ?  253  ILE A N      1 
ATOM   2011  C  CA     . ILE A  1 253  ? 58.829  96.413  -5.756  1.00 117.04 ?  253  ILE A CA     1 
ATOM   2012  C  C      . ILE A  1 253  ? 58.176  97.781  -5.934  1.00 121.78 ?  253  ILE A C      1 
ATOM   2013  O  O      . ILE A  1 253  ? 57.635  98.342  -4.976  1.00 119.49 ?  253  ILE A O      1 
ATOM   2014  C  CB     . ILE A  1 253  ? 60.351  96.521  -5.505  1.00 118.69 ?  253  ILE A CB     1 
ATOM   2015  C  CG1    . ILE A  1 253  ? 60.970  95.140  -5.195  1.00 118.71 ?  253  ILE A CG1    1 
ATOM   2016  C  CG2    . ILE A  1 253  ? 60.677  97.557  -4.410  1.00 117.73 ?  253  ILE A CG2    1 
ATOM   2017  C  CD1    . ILE A  1 253  ? 60.330  94.351  -4.044  1.00 118.85 ?  253  ILE A CD1    1 
ATOM   2018  N  N      . ALA A  1 254  ? 58.215  98.312  -7.158  1.00 121.12 ?  254  ALA A N      1 
ATOM   2019  C  CA     . ALA A  1 254  ? 57.587  99.600  -7.448  1.00 121.28 ?  254  ALA A CA     1 
ATOM   2020  C  C      . ALA A  1 254  ? 56.090  99.567  -7.185  1.00 123.31 ?  254  ALA A C      1 
ATOM   2021  O  O      . ALA A  1 254  ? 55.554  100.551 -6.675  1.00 122.03 ?  254  ALA A O      1 
ATOM   2022  C  CB     . ALA A  1 254  ? 57.855  100.007 -8.884  1.00 124.51 ?  254  ALA A CB     1 
ATOM   2023  N  N      . ASP A  1 255  ? 55.427  98.448  -7.512  1.00 119.86 ?  255  ASP A N      1 
ATOM   2024  C  CA     . ASP A  1 255  ? 54.012  98.302  -7.247  1.00 120.44 ?  255  ASP A CA     1 
ATOM   2025  C  C      . ASP A  1 255  ? 53.772  98.263  -5.733  1.00 120.78 ?  255  ASP A C      1 
ATOM   2026  O  O      . ASP A  1 255  ? 52.830  98.916  -5.273  1.00 121.17 ?  255  ASP A O      1 
ATOM   2027  C  CB     . ASP A  1 255  ? 53.465  97.067  -7.958  1.00 126.01 ?  255  ASP A CB     1 
ATOM   2028  C  CG     . ASP A  1 255  ? 52.142  96.538  -7.433  1.00 144.39 ?  255  ASP A CG     1 
ATOM   2029  O  OD1    . ASP A  1 255  ? 51.081  97.126  -7.782  1.00 145.77 ?  255  ASP A OD1    1 
ATOM   2030  O  OD2    . ASP A  1 255  ? 52.166  95.521  -6.682  1.00 152.36 -1 255  ASP A OD2    1 
ATOM   2031  N  N      . LEU A  1 256  ? 54.617  97.535  -4.954  1.00 113.22 ?  256  LEU A N      1 
ATOM   2032  C  CA     . LEU A  1 256  ? 54.505  97.520  -3.487  1.00 109.94 ?  256  LEU A CA     1 
ATOM   2033  C  C      . LEU A  1 256  ? 54.683  98.957  -2.934  1.00 113.22 ?  256  LEU A C      1 
ATOM   2034  O  O      . LEU A  1 256  ? 53.918  99.383  -2.065  1.00 111.84 ?  256  LEU A O      1 
ATOM   2035  C  CB     . LEU A  1 256  ? 55.571  96.597  -2.859  1.00 108.17 ?  256  LEU A CB     1 
ATOM   2036  C  CG     . LEU A  1 256  ? 55.543  95.094  -3.139  1.00 111.02 ?  256  LEU A CG     1 
ATOM   2037  C  CD1    . LEU A  1 256  ? 56.572  94.391  -2.297  1.00 109.99 ?  256  LEU A CD1    1 
ATOM   2038  C  CD2    . LEU A  1 256  ? 54.212  94.498  -2.843  1.00 111.17 ?  256  LEU A CD2    1 
ATOM   2039  N  N      . ASP A  1 257  ? 55.689  99.694  -3.447  1.00 109.50 ?  257  ASP A N      1 
ATOM   2040  C  CA     . ASP A  1 257  ? 55.947  101.070 -3.046  1.00 108.66 ?  257  ASP A CA     1 
ATOM   2041  C  C      . ASP A  1 257  ? 54.731  101.961 -3.212  1.00 110.56 ?  257  ASP A C      1 
ATOM   2042  O  O      . ASP A  1 257  ? 54.435  102.774 -2.328  1.00 108.88 ?  257  ASP A O      1 
ATOM   2043  C  CB     . ASP A  1 257  ? 57.123  101.656 -3.853  1.00 111.93 ?  257  ASP A CB     1 
ATOM   2044  C  CG     . ASP A  1 257  ? 57.678  102.987 -3.315  1.00 131.31 ?  257  ASP A CG     1 
ATOM   2045  O  OD1    . ASP A  1 257  ? 57.642  103.206 -2.053  1.00 133.20 ?  257  ASP A OD1    1 
ATOM   2046  O  OD2    . ASP A  1 257  ? 58.172  103.800 -4.139  1.00 136.50 -1 257  ASP A OD2    1 
ATOM   2047  N  N      . ALA A  1 258  ? 54.064  101.824 -4.358  1.00 107.67 ?  258  ALA A N      1 
ATOM   2048  C  CA     . ALA A  1 258  ? 52.922  102.613 -4.759  1.00 108.45 ?  258  ALA A CA     1 
ATOM   2049  C  C      . ALA A  1 258  ? 51.693  102.392 -3.910  1.00 115.70 ?  258  ALA A C      1 
ATOM   2050  O  O      . ALA A  1 258  ? 50.864  103.307 -3.794  1.00 115.59 ?  258  ALA A O      1 
ATOM   2051  C  CB     . ALA A  1 258  ? 52.611  102.341 -6.215  1.00 111.17 ?  258  ALA A CB     1 
ATOM   2052  N  N      . LYS A  1 259  ? 51.559  101.193 -3.319  1.00 115.11 ?  259  LYS A N      1 
ATOM   2053  C  CA     . LYS A  1 259  ? 50.371  100.828 -2.549  1.00 116.84 ?  259  LYS A CA     1 
ATOM   2054  C  C      . LYS A  1 259  ? 50.498  101.080 -1.034  1.00 123.21 ?  259  LYS A C      1 
ATOM   2055  O  O      . LYS A  1 259  ? 49.658  100.600 -0.266  1.00 122.18 ?  259  LYS A O      1 
ATOM   2056  C  CB     . LYS A  1 259  ? 49.986  99.365  -2.867  1.00 120.30 ?  259  LYS A CB     1 
ATOM   2057  C  CG     . LYS A  1 259  ? 49.404  99.206  -4.284  1.00 129.72 ?  259  LYS A CG     1 
ATOM   2058  C  CD     . LYS A  1 259  ? 49.565  97.823  -4.847  1.00 139.31 ?  259  LYS A CD     1 
ATOM   2059  C  CE     . LYS A  1 259  ? 48.375  97.425  -5.700  1.00 153.73 ?  259  LYS A CE     1 
ATOM   2060  N  NZ     . LYS A  1 259  ? 48.395  95.971  -6.050  1.00 163.48 1  259  LYS A NZ     1 
ATOM   2061  N  N      . SER A  1 260  ? 51.500  101.872 -0.606  1.00 122.95 ?  260  SER A N      1 
ATOM   2062  C  CA     . SER A  1 260  ? 51.745  102.133 0.809   1.00 123.54 ?  260  SER A CA     1 
ATOM   2063  C  C      . SER A  1 260  ? 52.481  103.447 1.106   1.00 131.17 ?  260  SER A C      1 
ATOM   2064  O  O      . SER A  1 260  ? 53.308  103.913 0.293   1.00 131.83 ?  260  SER A O      1 
ATOM   2065  C  CB     . SER A  1 260  ? 52.564  100.978 1.381   1.00 125.76 ?  260  SER A CB     1 
ATOM   2066  O  OG     . SER A  1 260  ? 52.913  101.171 2.741   1.00 134.65 ?  260  SER A OG     1 
ATOM   2067  N  N      . GLY A  1 261  ? 52.252  103.962 2.324   1.00 128.10 ?  261  GLY A N      1 
ATOM   2068  C  CA     . GLY A  1 261  ? 52.987  105.103 2.875   1.00 127.30 ?  261  GLY A CA     1 
ATOM   2069  C  C      . GLY A  1 261  ? 54.476  104.800 3.046   1.00 129.27 ?  261  GLY A C      1 
ATOM   2070  O  O      . GLY A  1 261  ? 55.330  105.702 2.982   1.00 128.23 ?  261  GLY A O      1 
ATOM   2071  N  N      . ALA A  1 262  ? 54.793  103.500 3.257   1.00 125.07 ?  262  ALA A N      1 
ATOM   2072  C  CA     . ALA A  1 262  ? 56.162  103.022 3.397   1.00 123.52 ?  262  ALA A CA     1 
ATOM   2073  C  C      . ALA A  1 262  ? 56.877  103.158 2.050   1.00 125.27 ?  262  ALA A C      1 
ATOM   2074  O  O      . ALA A  1 262  ? 56.252  103.183 0.964   1.00 124.94 ?  262  ALA A O      1 
ATOM   2075  C  CB     . ALA A  1 262  ? 56.201  101.574 3.891   1.00 124.57 ?  262  ALA A CB     1 
ATOM   2076  N  N      . SER A  1 263  ? 58.194  103.331 2.148   1.00 118.57 ?  263  SER A N      1 
ATOM   2077  C  CA     . SER A  1 263  ? 59.060  103.479 1.003   1.00 115.82 ?  263  SER A CA     1 
ATOM   2078  C  C      . SER A  1 263  ? 59.752  102.161 0.743   1.00 113.83 ?  263  SER A C      1 
ATOM   2079  O  O      . SER A  1 263  ? 60.383  101.604 1.640   1.00 111.86 ?  263  SER A O      1 
ATOM   2080  C  CB     . SER A  1 263  ? 60.080  104.575 1.261   1.00 119.46 ?  263  SER A CB     1 
ATOM   2081  O  OG     . SER A  1 263  ? 60.955  104.677 0.154   1.00 129.64 ?  263  SER A OG     1 
ATOM   2082  N  N      . LEU A  1 264  ? 59.600  101.643 -0.480  1.00 109.45 ?  264  LEU A N      1 
ATOM   2083  C  CA     . LEU A  1 264  ? 60.205  100.376 -0.932  1.00 109.64 ?  264  LEU A CA     1 
ATOM   2084  C  C      . LEU A  1 264  ? 60.807  100.594 -2.316  1.00 113.72 ?  264  LEU A C      1 
ATOM   2085  O  O      . LEU A  1 264  ? 60.090  100.781 -3.302  1.00 113.81 ?  264  LEU A O      1 
ATOM   2086  C  CB     . LEU A  1 264  ? 59.184  99.222  -0.941  1.00 110.03 ?  264  LEU A CB     1 
ATOM   2087  C  CG     . LEU A  1 264  ? 58.411  98.993  0.343   1.00 114.01 ?  264  LEU A CG     1 
ATOM   2088  C  CD1    . LEU A  1 264  ? 57.198  98.162  0.085   1.00 115.27 ?  264  LEU A CD1    1 
ATOM   2089  C  CD2    . LEU A  1 264  ? 59.284  98.344  1.399   1.00 115.36 ?  264  LEU A CD2    1 
ATOM   2090  N  N      . LYS A  1 265  ? 62.132  100.626 -2.383  1.00 110.39 ?  265  LYS A N      1 
ATOM   2091  C  CA     . LYS A  1 265  ? 62.824  100.953 -3.624  1.00 111.22 ?  265  LYS A CA     1 
ATOM   2092  C  C      . LYS A  1 265  ? 63.844  99.902  -4.024  1.00 118.45 ?  265  LYS A C      1 
ATOM   2093  O  O      . LYS A  1 265  ? 64.584  99.392  -3.176  1.00 117.58 ?  265  LYS A O      1 
ATOM   2094  C  CB     . LYS A  1 265  ? 63.500  102.331 -3.510  1.00 111.35 ?  265  LYS A CB     1 
ATOM   2095  C  CG     . LYS A  1 265  ? 62.656  103.433 -2.857  1.00 104.59 ?  265  LYS A CG     1 
ATOM   2096  C  CD     . LYS A  1 265  ? 61.745  104.139 -3.831  1.00 112.51 ?  265  LYS A CD     1 
ATOM   2097  C  CE     . LYS A  1 265  ? 61.353  105.511 -3.338  1.00 118.36 ?  265  LYS A CE     1 
ATOM   2098  N  NZ     . LYS A  1 265  ? 60.245  105.449 -2.360  1.00 118.67 1  265  LYS A NZ     1 
ATOM   2099  N  N      . LEU A  1 266  ? 63.885  99.587  -5.325  1.00 117.40 ?  266  LEU A N      1 
ATOM   2100  C  CA     . LEU A  1 266  ? 64.826  98.617  -5.849  1.00 119.04 ?  266  LEU A CA     1 
ATOM   2101  C  C      . LEU A  1 266  ? 65.195  98.910  -7.283  1.00 124.81 ?  266  LEU A C      1 
ATOM   2102  O  O      . LEU A  1 266  ? 64.325  99.010  -8.153  1.00 125.40 ?  266  LEU A O      1 
ATOM   2103  C  CB     . LEU A  1 266  ? 64.335  97.166  -5.707  1.00 119.69 ?  266  LEU A CB     1 
ATOM   2104  C  CG     . LEU A  1 266  ? 65.285  96.099  -6.290  1.00 126.59 ?  266  LEU A CG     1 
ATOM   2105  C  CD1    . LEU A  1 266  ? 66.615  96.073  -5.546  1.00 126.54 ?  266  LEU A CD1    1 
ATOM   2106  C  CD2    . LEU A  1 266  ? 64.637  94.721  -6.310  1.00 130.45 ?  266  LEU A CD2    1 
ATOM   2107  N  N      . THR A  1 267  ? 66.507  99.019  -7.517  1.00 121.24 ?  267  THR A N      1 
ATOM   2108  C  CA     . THR A  1 267  ? 67.098  99.224  -8.821  1.00 122.38 ?  267  THR A CA     1 
ATOM   2109  C  C      . THR A  1 267  ? 68.235  98.224  -8.973  1.00 128.73 ?  267  THR A C      1 
ATOM   2110  O  O      . THR A  1 267  ? 69.147  98.186  -8.150  1.00 128.54 ?  267  THR A O      1 
ATOM   2111  C  CB     . THR A  1 267  ? 67.628  100.642 -8.966  1.00 123.47 ?  267  THR A CB     1 
ATOM   2112  O  OG1    . THR A  1 267  ? 66.573  101.579 -8.831  1.00 113.42 ?  267  THR A OG1    1 
ATOM   2113  C  CG2    . THR A  1 267  ? 68.306  100.842 -10.292 1.00 127.35 ?  267  THR A CG2    1 
ATOM   2114  N  N      . LEU A  1 268  ? 68.209  97.436  -10.038 1.00 127.61 ?  268  LEU A N      1 
ATOM   2115  C  CA     . LEU A  1 268  ? 69.295  96.492  -10.287 1.00 128.51 ?  268  LEU A CA     1 
ATOM   2116  C  C      . LEU A  1 268  ? 70.384  97.195  -11.062 1.00 134.75 ?  268  LEU A C      1 
ATOM   2117  O  O      . LEU A  1 268  ? 70.106  97.853  -12.071 1.00 136.75 ?  268  LEU A O      1 
ATOM   2118  C  CB     . LEU A  1 268  ? 68.813  95.224  -11.020 1.00 129.84 ?  268  LEU A CB     1 
ATOM   2119  C  CG     . LEU A  1 268  ? 67.753  94.389  -10.300 1.00 132.36 ?  268  LEU A CG     1 
ATOM   2120  C  CD1    . LEU A  1 268  ? 67.575  93.053  -10.970 1.00 135.28 ?  268  LEU A CD1    1 
ATOM   2121  C  CD2    . LEU A  1 268  ? 68.065  94.209  -8.808  1.00 131.94 ?  268  LEU A CD2    1 
ATOM   2122  N  N      . LEU A  1 269  ? 71.613  97.097  -10.567 1.00 130.70 ?  269  LEU A N      1 
ATOM   2123  C  CA     . LEU A  1 269  ? 72.781  97.669  -11.231 1.00 132.55 ?  269  LEU A CA     1 
ATOM   2124  C  C      . LEU A  1 269  ? 73.530  96.596  -12.023 1.00 142.00 ?  269  LEU A C      1 
ATOM   2125  O  O      . LEU A  1 269  ? 73.900  96.805  -13.186 1.00 142.90 ?  269  LEU A O      1 
ATOM   2126  C  CB     . LEU A  1 269  ? 73.707  98.315  -10.197 1.00 130.77 ?  269  LEU A CB     1 
ATOM   2127  C  CG     . LEU A  1 269  ? 73.063  99.370  -9.313  1.00 131.00 ?  269  LEU A CG     1 
ATOM   2128  C  CD1    . LEU A  1 269  ? 74.031  99.825  -8.226  1.00 130.61 ?  269  LEU A CD1    1 
ATOM   2129  C  CD2    . LEU A  1 269  ? 72.506  100.536 -10.149 1.00 130.62 ?  269  LEU A CD2    1 
ATOM   2130  N  N      . ASN A  1 270  ? 73.735  95.441  -11.383 1.00 142.10 ?  270  ASN A N      1 
ATOM   2131  C  CA     . ASN A  1 270  ? 74.431  94.304  -11.962 1.00 146.50 ?  270  ASN A CA     1 
ATOM   2132  C  C      . ASN A  1 270  ? 73.844  93.009  -11.382 1.00 151.33 ?  270  ASN A C      1 
ATOM   2133  O  O      . ASN A  1 270  ? 74.293  92.546  -10.331 1.00 150.64 ?  270  ASN A O      1 
ATOM   2134  C  CB     . ASN A  1 270  ? 75.932  94.406  -11.713 1.00 148.41 ?  270  ASN A CB     1 
ATOM   2135  C  CG     . ASN A  1 270  ? 76.690  93.199  -12.183 1.00 173.71 ?  270  ASN A CG     1 
ATOM   2136  O  OD1    . ASN A  1 270  ? 76.158  92.320  -12.881 1.00 166.67 ?  270  ASN A OD1    1 
ATOM   2137  N  ND2    . ASN A  1 270  ? 77.947  93.123  -11.786 1.00 171.30 ?  270  ASN A ND2    1 
ATOM   2138  N  N      . PRO A  1 271  ? 72.863  92.394  -12.076 1.00 148.66 ?  271  PRO A N      1 
ATOM   2139  C  CA     . PRO A  1 271  ? 72.258  91.160  -11.558 1.00 148.64 ?  271  PRO A CA     1 
ATOM   2140  C  C      . PRO A  1 271  ? 73.255  90.053  -11.187 1.00 156.52 ?  271  PRO A C      1 
ATOM   2141  O  O      . PRO A  1 271  ? 72.969  89.229  -10.312 1.00 155.53 ?  271  PRO A O      1 
ATOM   2142  C  CB     . PRO A  1 271  ? 71.320  90.747  -12.692 1.00 152.05 ?  271  PRO A CB     1 
ATOM   2143  C  CG     . PRO A  1 271  ? 70.960  92.033  -13.353 1.00 155.19 ?  271  PRO A CG     1 
ATOM   2144  C  CD     . PRO A  1 271  ? 72.223  92.808  -13.342 1.00 151.31 ?  271  PRO A CD     1 
ATOM   2145  N  N      . LYS A  1 272  ? 74.435  90.052  -11.818 1.00 156.57 ?  272  LYS A N      1 
ATOM   2146  C  CA     . LYS A  1 272  ? 75.454  89.035  -11.580 1.00 159.27 ?  272  LYS A CA     1 
ATOM   2147  C  C      . LYS A  1 272  ? 76.474  89.405  -10.478 1.00 163.85 ?  272  LYS A C      1 
ATOM   2148  O  O      . LYS A  1 272  ? 77.370  88.600  -10.173 1.00 166.45 ?  272  LYS A O      1 
ATOM   2149  C  CB     . LYS A  1 272  ? 76.152  88.675  -12.897 1.00 164.96 ?  272  LYS A CB     1 
ATOM   2150  C  CG     . LYS A  1 272  ? 75.288  87.839  -13.829 1.00 164.44 ?  272  LYS A CG     1 
ATOM   2151  C  CD     . LYS A  1 272  ? 75.970  87.623  -15.181 1.00 171.14 ?  272  LYS A CD     1 
ATOM   2152  C  CE     . LYS A  1 272  ? 75.312  86.578  -16.041 1.00 173.87 ?  272  LYS A CE     1 
ATOM   2153  N  NZ     . LYS A  1 272  ? 73.873  86.865  -16.260 1.00 180.07 1  272  LYS A NZ     1 
ATOM   2154  N  N      . GLY A  1 273  ? 76.327  90.589  -9.881  1.00 157.61 ?  273  GLY A N      1 
ATOM   2155  C  CA     . GLY A  1 273  ? 77.221  91.039  -8.820  1.00 157.08 ?  273  GLY A CA     1 
ATOM   2156  C  C      . GLY A  1 273  ? 77.132  90.181  -7.572  1.00 161.12 ?  273  GLY A C      1 
ATOM   2157  O  O      . GLY A  1 273  ? 76.078  89.597  -7.296  1.00 159.47 ?  273  GLY A O      1 
ATOM   2158  N  N      . ARG A  1 274  ? 78.231  90.109  -6.797  1.00 158.71 ?  274  ARG A N      1 
ATOM   2159  C  CA     . ARG A  1 274  ? 78.251  89.316  -5.571  1.00 158.24 ?  274  ARG A CA     1 
ATOM   2160  C  C      . ARG A  1 274  ? 77.922  90.110  -4.318  1.00 160.09 ?  274  ARG A C      1 
ATOM   2161  O  O      . ARG A  1 274  ? 77.807  89.511  -3.251  1.00 159.84 ?  274  ARG A O      1 
ATOM   2162  C  CB     . ARG A  1 274  ? 79.572  88.568  -5.416  1.00 159.96 ?  274  ARG A CB     1 
ATOM   2163  C  CG     . ARG A  1 274  ? 80.794  89.445  -5.152  1.00 160.71 ?  274  ARG A CG     1 
ATOM   2164  C  CD     . ARG A  1 274  ? 82.053  88.592  -4.968  1.00 159.89 ?  274  ARG A CD     1 
ATOM   2165  N  NE     . ARG A  1 274  ? 81.945  87.674  -3.832  1.00 151.75 ?  274  ARG A NE     1 
ATOM   2166  C  CZ     . ARG A  1 274  ? 82.293  87.975  -2.586  1.00 151.91 ?  274  ARG A CZ     1 
ATOM   2167  N  NH1    . ARG A  1 274  ? 82.792  89.172  -2.298  1.00 133.20 1  274  ARG A NH1    1 
ATOM   2168  N  NH2    . ARG A  1 274  ? 82.139  87.087  -1.617  1.00 130.70 ?  274  ARG A NH2    1 
ATOM   2169  N  N      . ILE A  1 275  ? 77.766  91.438  -4.431  1.00 154.81 ?  275  ILE A N      1 
ATOM   2170  C  CA     . ILE A  1 275  ? 77.445  92.287  -3.285  1.00 151.69 ?  275  ILE A CA     1 
ATOM   2171  C  C      . ILE A  1 275  ? 76.022  92.784  -3.408  1.00 153.87 ?  275  ILE A C      1 
ATOM   2172  O  O      . ILE A  1 275  ? 75.706  93.580  -4.298  1.00 152.26 ?  275  ILE A O      1 
ATOM   2173  C  CB     . ILE A  1 275  ? 78.441  93.464  -3.082  1.00 154.44 ?  275  ILE A CB     1 
ATOM   2174  C  CG1    . ILE A  1 275  ? 79.899  92.995  -3.127  1.00 158.38 ?  275  ILE A CG1    1 
ATOM   2175  C  CG2    . ILE A  1 275  ? 78.148  94.196  -1.769  1.00 152.04 ?  275  ILE A CG2    1 
ATOM   2176  C  CD1    . ILE A  1 275  ? 80.914  94.131  -3.221  1.00 163.54 ?  275  ILE A CD1    1 
ATOM   2177  N  N      . TRP A  1 276  ? 75.179  92.341  -2.484  1.00 150.62 ?  276  TRP A N      1 
ATOM   2178  C  CA     . TRP A  1 276  ? 73.786  92.736  -2.422  1.00 148.52 ?  276  TRP A CA     1 
ATOM   2179  C  C      . TRP A  1 276  ? 73.533  93.467  -1.141  1.00 151.56 ?  276  TRP A C      1 
ATOM   2180  O  O      . TRP A  1 276  ? 74.146  93.149  -0.125  1.00 153.30 ?  276  TRP A O      1 
ATOM   2181  C  CB     . TRP A  1 276  ? 72.886  91.512  -2.503  1.00 148.07 ?  276  TRP A CB     1 
ATOM   2182  C  CG     . TRP A  1 276  ? 72.855  90.917  -3.872  1.00 151.43 ?  276  TRP A CG     1 
ATOM   2183  C  CD1    . TRP A  1 276  ? 73.779  90.083  -4.427  1.00 157.55 ?  276  TRP A CD1    1 
ATOM   2184  C  CD2    . TRP A  1 276  ? 71.856  91.138  -4.876  1.00 150.85 ?  276  TRP A CD2    1 
ATOM   2185  N  NE1    . TRP A  1 276  ? 73.408  89.751  -5.710  1.00 158.50 ?  276  TRP A NE1    1 
ATOM   2186  C  CE2    . TRP A  1 276  ? 72.225  90.378  -6.009  1.00 157.71 ?  276  TRP A CE2    1 
ATOM   2187  C  CE3    . TRP A  1 276  ? 70.678  91.910  -4.930  1.00 149.62 ?  276  TRP A CE3    1 
ATOM   2188  C  CZ2    . TRP A  1 276  ? 71.459  90.363  -7.185  1.00 157.48 ?  276  TRP A CZ2    1 
ATOM   2189  C  CZ3    . TRP A  1 276  ? 69.924  91.895  -6.096  1.00 151.52 ?  276  TRP A CZ3    1 
ATOM   2190  C  CH2    . TRP A  1 276  ? 70.323  91.138  -7.209  1.00 155.09 ?  276  TRP A CH2    1 
ATOM   2191  N  N      . THR A  1 277  ? 72.649  94.461  -1.186  1.00 145.40 ?  277  THR A N      1 
ATOM   2192  C  CA     . THR A  1 277  ? 72.268  95.222  -0.001  1.00 143.30 ?  277  THR A CA     1 
ATOM   2193  C  C      . THR A  1 277  ? 70.767  95.144  0.224   1.00 144.69 ?  277  THR A C      1 
ATOM   2194  O  O      . THR A  1 277  ? 69.984  95.024  -0.719  1.00 144.05 ?  277  THR A O      1 
ATOM   2195  C  CB     . THR A  1 277  ? 72.700  96.716  -0.075  1.00 151.53 ?  277  THR A CB     1 
ATOM   2196  O  OG1    . THR A  1 277  ? 71.983  97.401  -1.099  1.00 150.85 ?  277  THR A OG1    1 
ATOM   2197  C  CG2    . THR A  1 277  ? 74.168  96.890  -0.299  1.00 152.39 ?  277  THR A CG2    1 
ATOM   2198  N  N      . MET A  1 278  ? 70.374  95.242  1.486   1.00 139.37 ?  278  MET A N      1 
ATOM   2199  C  CA     . MET A  1 278  ? 68.995  95.382  1.907   1.00 136.05 ?  278  MET A CA     1 
ATOM   2200  C  C      . MET A  1 278  ? 69.032  96.307  3.139   1.00 138.63 ?  278  MET A C      1 
ATOM   2201  O  O      . MET A  1 278  ? 68.968  95.870  4.301   1.00 138.11 ?  278  MET A O      1 
ATOM   2202  C  CB     . MET A  1 278  ? 68.326  94.046  2.157   1.00 138.45 ?  278  MET A CB     1 
ATOM   2203  C  CG     . MET A  1 278  ? 66.906  94.233  2.501   1.00 139.95 ?  278  MET A CG     1 
ATOM   2204  S  SD     . MET A  1 278  ? 65.990  92.727  2.586   1.00 145.26 ?  278  MET A SD     1 
ATOM   2205  C  CE     . MET A  1 278  ? 67.057  91.756  3.487   1.00 144.57 ?  278  MET A CE     1 
ATOM   2206  N  N      . VAL A  1 279  ? 69.198  97.602  2.854   1.00 134.18 ?  279  VAL A N      1 
ATOM   2207  C  CA     . VAL A  1 279  ? 69.400  98.645  3.852   1.00 133.53 ?  279  VAL A CA     1 
ATOM   2208  C  C      . VAL A  1 279  ? 68.158  99.479  4.063   1.00 138.91 ?  279  VAL A C      1 
ATOM   2209  O  O      . VAL A  1 279  ? 67.461  99.796  3.107   1.00 137.94 ?  279  VAL A O      1 
ATOM   2210  C  CB     . VAL A  1 279  ? 70.618  99.519  3.449   1.00 136.62 ?  279  VAL A CB     1 
ATOM   2211  C  CG1    . VAL A  1 279  ? 70.766  100.759 4.340   1.00 135.41 ?  279  VAL A CG1    1 
ATOM   2212  C  CG2    . VAL A  1 279  ? 71.911  98.695  3.425   1.00 138.45 ?  279  VAL A CG2    1 
ATOM   2213  N  N      . ALA A  1 280  ? 67.893  99.849  5.312   1.00 137.54 ?  280  ALA A N      1 
ATOM   2214  C  CA     . ALA A  1 280  ? 66.793  100.737 5.627   1.00 137.35 ?  280  ALA A CA     1 
ATOM   2215  C  C      . ALA A  1 280  ? 67.215  102.225 5.466   1.00 144.63 ?  280  ALA A C      1 
ATOM   2216  O  O      . ALA A  1 280  ? 68.292  102.632 5.923   1.00 145.53 ?  280  ALA A O      1 
ATOM   2217  C  CB     . ALA A  1 280  ? 66.317  100.487 7.040   1.00 138.60 ?  280  ALA A CB     1 
ATOM   2218  N  N      . GLY A  1 281  ? 66.348  103.010 4.824   1.00 141.63 ?  281  GLY A N      1 
ATOM   2219  C  CA     . GLY A  1 281  ? 66.519  104.454 4.660   1.00 141.68 ?  281  GLY A CA     1 
ATOM   2220  C  C      . GLY A  1 281  ? 67.115  104.943 3.356   1.00 145.01 ?  281  GLY A C      1 
ATOM   2221  O  O      . GLY A  1 281  ? 68.076  104.351 2.865   1.00 145.01 ?  281  GLY A O      1 
ATOM   2222  N  N      . GLY A  1 282  ? 66.563  106.050 2.826   1.00 140.67 ?  282  GLY A N      1 
ATOM   2223  C  CA     . GLY A  1 282  ? 67.063  106.713 1.621   1.00 140.71 ?  282  GLY A CA     1 
ATOM   2224  C  C      . GLY A  1 282  ? 68.469  107.248 1.823   1.00 144.83 ?  282  GLY A C      1 
ATOM   2225  O  O      . GLY A  1 282  ? 69.301  107.206 0.908   1.00 145.71 ?  282  GLY A O      1 
ATOM   2226  N  N      . GLY A  1 283  ? 68.727  107.728 3.038   1.00 139.98 ?  283  GLY A N      1 
ATOM   2227  C  CA     . GLY A  1 283  ? 70.035  108.222 3.433   1.00 140.20 ?  283  GLY A CA     1 
ATOM   2228  C  C      . GLY A  1 283  ? 71.039  107.108 3.652   1.00 141.41 ?  283  GLY A C      1 
ATOM   2229  O  O      . GLY A  1 283  ? 72.072  107.060 2.974   1.00 142.53 ?  283  GLY A O      1 
ATOM   2230  N  N      . ALA A  1 284  ? 70.748  106.204 4.602   1.00 134.47 ?  284  ALA A N      1 
ATOM   2231  C  CA     . ALA A  1 284  ? 71.688  105.129 4.917   1.00 134.34 ?  284  ALA A CA     1 
ATOM   2232  C  C      . ALA A  1 284  ? 72.023  104.269 3.708   1.00 134.01 ?  284  ALA A C      1 
ATOM   2233  O  O      . ALA A  1 284  ? 73.184  103.908 3.535   1.00 134.09 ?  284  ALA A O      1 
ATOM   2234  C  CB     . ALA A  1 284  ? 71.171  104.273 6.068   1.00 135.34 ?  284  ALA A CB     1 
ATOM   2235  N  N      . SER A  1 285  ? 71.028  103.969 2.852   1.00 127.10 ?  285  SER A N      1 
ATOM   2236  C  CA     . SER A  1 285  ? 71.277  103.131 1.677   1.00 125.71 ?  285  SER A CA     1 
ATOM   2237  C  C      . SER A  1 285  ? 72.338  103.719 0.764   1.00 124.39 ?  285  SER A C      1 
ATOM   2238  O  O      . SER A  1 285  ? 73.180  102.990 0.255   1.00 122.72 ?  285  SER A O      1 
ATOM   2239  C  CB     . SER A  1 285  ? 69.987  102.832 0.925   1.00 128.71 ?  285  SER A CB     1 
ATOM   2240  O  OG     . SER A  1 285  ? 69.334  104.009 0.477   1.00 136.45 ?  285  SER A OG     1 
ATOM   2241  N  N      . VAL A  1 286  ? 72.323  105.035 0.599   1.00 119.97 ?  286  VAL A N      1 
ATOM   2242  C  CA     . VAL A  1 286  ? 73.316  105.728 -0.200  1.00 121.48 ?  286  VAL A CA     1 
ATOM   2243  C  C      . VAL A  1 286  ? 74.676  105.671 0.494   1.00 131.81 ?  286  VAL A C      1 
ATOM   2244  O  O      . VAL A  1 286  ? 75.683  105.425 -0.171  1.00 135.20 ?  286  VAL A O      1 
ATOM   2245  C  CB     . VAL A  1 286  ? 72.907  107.172 -0.498  1.00 123.85 ?  286  VAL A CB     1 
ATOM   2246  C  CG1    . VAL A  1 286  ? 74.023  107.915 -1.214  1.00 125.39 ?  286  VAL A CG1    1 
ATOM   2247  C  CG2    . VAL A  1 286  ? 71.635  107.195 -1.319  1.00 122.42 ?  286  VAL A CG2    1 
ATOM   2248  N  N      . VAL A  1 287  ? 74.718  105.904 1.816   1.00 128.37 ?  287  VAL A N      1 
ATOM   2249  C  CA     . VAL A  1 287  ? 75.967  105.851 2.581   1.00 129.44 ?  287  VAL A CA     1 
ATOM   2250  C  C      . VAL A  1 287  ? 76.609  104.465 2.469   1.00 136.32 ?  287  VAL A C      1 
ATOM   2251  O  O      . VAL A  1 287  ? 77.818  104.372 2.252   1.00 138.30 ?  287  VAL A O      1 
ATOM   2252  C  CB     . VAL A  1 287  ? 75.741  106.265 4.042   1.00 131.56 ?  287  VAL A CB     1 
ATOM   2253  C  CG1    . VAL A  1 287  ? 77.011  106.105 4.853   1.00 133.40 ?  287  VAL A CG1    1 
ATOM   2254  C  CG2    . VAL A  1 287  ? 75.246  107.701 4.116   1.00 130.54 ?  287  VAL A CG2    1 
ATOM   2255  N  N      . TYR A  1 288  ? 75.809  103.393 2.602   1.00 132.96 ?  288  TYR A N      1 
ATOM   2256  C  CA     . TYR A  1 288  ? 76.332  102.038 2.463   1.00 134.51 ?  288  TYR A CA     1 
ATOM   2257  C  C      . TYR A  1 288  ? 76.851  101.812 1.049   1.00 138.91 ?  288  TYR A C      1 
ATOM   2258  O  O      . TYR A  1 288  ? 77.914  101.229 0.885   1.00 140.43 ?  288  TYR A O      1 
ATOM   2259  C  CB     . TYR A  1 288  ? 75.272  101.003 2.818   1.00 135.03 ?  288  TYR A CB     1 
ATOM   2260  C  CG     . TYR A  1 288  ? 75.163  100.697 4.295   1.00 138.66 ?  288  TYR A CG     1 
ATOM   2261  C  CD1    . TYR A  1 288  ? 74.434  101.520 5.148   1.00 139.54 ?  288  TYR A CD1    1 
ATOM   2262  C  CD2    . TYR A  1 288  ? 75.720  99.543  4.826   1.00 142.10 ?  288  TYR A CD2    1 
ATOM   2263  C  CE1    . TYR A  1 288  ? 74.287  101.214 6.500   1.00 141.74 ?  288  TYR A CE1    1 
ATOM   2264  C  CE2    . TYR A  1 288  ? 75.578  99.223  6.177   1.00 144.13 ?  288  TYR A CE2    1 
ATOM   2265  C  CZ     . TYR A  1 288  ? 74.868  100.068 7.014   1.00 151.01 ?  288  TYR A CZ     1 
ATOM   2266  O  OH     . TYR A  1 288  ? 74.692  99.751  8.344   1.00 152.98 ?  288  TYR A OH     1 
ATOM   2267  N  N      . SER A  1 289  ? 76.137  102.304 0.036   1.00 135.13 ?  289  SER A N      1 
ATOM   2268  C  CA     . SER A  1 289  ? 76.584  102.178 -1.347  1.00 137.07 ?  289  SER A CA     1 
ATOM   2269  C  C      . SER A  1 289  ? 77.897  102.936 -1.545  1.00 146.06 ?  289  SER A C      1 
ATOM   2270  O  O      . SER A  1 289  ? 78.823  102.392 -2.153  1.00 148.95 ?  289  SER A O      1 
ATOM   2271  C  CB     . SER A  1 289  ? 75.511  102.672 -2.307  1.00 139.16 ?  289  SER A CB     1 
ATOM   2272  O  OG     . SER A  1 289  ? 74.332  101.891 -2.177  1.00 147.60 ?  289  SER A OG     1 
ATOM   2273  N  N      . ASP A  1 290  ? 78.011  104.150 -0.964  1.00 143.18 ?  290  ASP A N      1 
ATOM   2274  C  CA     . ASP A  1 290  ? 79.238  104.953 -1.010  1.00 145.80 ?  290  ASP A CA     1 
ATOM   2275  C  C      . ASP A  1 290  ? 80.402  104.211 -0.425  1.00 150.08 ?  290  ASP A C      1 
ATOM   2276  O  O      . ASP A  1 290  ? 81.472  104.223 -1.021  1.00 152.07 ?  290  ASP A O      1 
ATOM   2277  C  CB     . ASP A  1 290  ? 79.062  106.260 -0.245  1.00 147.95 ?  290  ASP A CB     1 
ATOM   2278  C  CG     . ASP A  1 290  ? 78.108  107.253 -0.887  1.00 160.26 ?  290  ASP A CG     1 
ATOM   2279  O  OD1    . ASP A  1 290  ? 77.733  107.053 -2.071  1.00 161.30 ?  290  ASP A OD1    1 
ATOM   2280  O  OD2    . ASP A  1 290  ? 77.755  108.243 -0.221  1.00 164.41 -1 290  ASP A OD2    1 
ATOM   2281  N  N      . THR A  1 291  ? 80.200  103.575 0.738   1.00 145.12 ?  291  THR A N      1 
ATOM   2282  C  CA     . THR A  1 291  ? 81.236  102.820 1.427   1.00 147.20 ?  291  THR A CA     1 
ATOM   2283  C  C      . THR A  1 291  ? 81.704  101.624 0.596   1.00 153.92 ?  291  THR A C      1 
ATOM   2284  O  O      . THR A  1 291  ? 82.915  101.398 0.466   1.00 156.39 ?  291  THR A O      1 
ATOM   2285  C  CB     . THR A  1 291  ? 80.754  102.432 2.808   1.00 147.96 ?  291  THR A CB     1 
ATOM   2286  O  OG1    . THR A  1 291  ? 80.302  103.615 3.466   1.00 138.22 ?  291  THR A OG1    1 
ATOM   2287  C  CG2    . THR A  1 291  ? 81.838  101.787 3.632   1.00 152.28 ?  291  THR A CG2    1 
ATOM   2288  N  N      . ILE A  1 292  ? 80.747  100.871 0.036   1.00 149.59 ?  292  ILE A N      1 
ATOM   2289  C  CA     . ILE A  1 292  ? 81.040  99.727  -0.814  1.00 151.53 ?  292  ILE A CA     1 
ATOM   2290  C  C      . ILE A  1 292  ? 81.902  100.173 -1.988  1.00 160.27 ?  292  ILE A C      1 
ATOM   2291  O  O      . ILE A  1 292  ? 82.916  99.530  -2.281  1.00 163.70 ?  292  ILE A O      1 
ATOM   2292  C  CB     . ILE A  1 292  ? 79.743  99.035  -1.269  1.00 152.18 ?  292  ILE A CB     1 
ATOM   2293  C  CG1    . ILE A  1 292  ? 79.042  98.369  -0.076  1.00 151.04 ?  292  ILE A CG1    1 
ATOM   2294  C  CG2    . ILE A  1 292  ? 80.027  98.010  -2.376  1.00 154.93 ?  292  ILE A CG2    1 
ATOM   2295  C  CD1    . ILE A  1 292  ? 77.639  97.960  -0.316  1.00 154.90 ?  292  ILE A CD1    1 
ATOM   2296  N  N      . CYS A  1 293  ? 81.528  101.287 -2.638  1.00 156.72 ?  293  CYS A N      1 
ATOM   2297  C  CA     . CYS A  1 293  ? 82.281  101.802 -3.777  1.00 159.25 ?  293  CYS A CA     1 
ATOM   2298  C  C      . CYS A  1 293  ? 83.642  102.345 -3.381  1.00 164.30 ?  293  CYS A C      1 
ATOM   2299  O  O      . CYS A  1 293  ? 84.603  102.139 -4.118  1.00 167.01 ?  293  CYS A O      1 
ATOM   2300  C  CB     . CYS A  1 293  ? 81.467  102.826 -4.556  1.00 158.43 ?  293  CYS A CB     1 
ATOM   2301  S  SG     . CYS A  1 293  ? 80.071  102.122 -5.469  1.00 160.57 ?  293  CYS A SG     1 
ATOM   2302  N  N      . ASP A  1 294  ? 83.746  102.976 -2.202  1.00 159.08 ?  294  ASP A N      1 
ATOM   2303  C  CA     . ASP A  1 294  ? 85.023  103.459 -1.683  1.00 161.73 ?  294  ASP A CA     1 
ATOM   2304  C  C      . ASP A  1 294  ? 85.993  102.326 -1.414  1.00 168.22 ?  294  ASP A C      1 
ATOM   2305  O  O      . ASP A  1 294  ? 87.213  102.518 -1.522  1.00 172.50 ?  294  ASP A O      1 
ATOM   2306  C  CB     . ASP A  1 294  ? 84.808  104.254 -0.416  1.00 162.59 ?  294  ASP A CB     1 
ATOM   2307  C  CG     . ASP A  1 294  ? 86.103  104.833 0.067   1.00 177.41 ?  294  ASP A CG     1 
ATOM   2308  O  OD1    . ASP A  1 294  ? 87.129  104.611 -0.614  1.00 180.32 -1 294  ASP A OD1    1 
ATOM   2309  O  OD2    . ASP A  1 294  ? 86.082  105.631 1.048   1.00 182.94 -1 294  ASP A OD2    1 
ATOM   2310  N  N      . LEU A  1 295  ? 85.453  101.139 -1.098  1.00 161.27 ?  295  LEU A N      1 
ATOM   2311  C  CA     . LEU A  1 295  ? 86.252  99.953  -0.841  1.00 162.61 ?  295  LEU A CA     1 
ATOM   2312  C  C      . LEU A  1 295  ? 86.468  99.080  -2.088  1.00 165.51 ?  295  LEU A C      1 
ATOM   2313  O  O      . LEU A  1 295  ? 86.920  97.942  -1.970  1.00 166.74 ?  295  LEU A O      1 
ATOM   2314  C  CB     . LEU A  1 295  ? 85.666  99.169  0.326   1.00 161.07 ?  295  LEU A CB     1 
ATOM   2315  C  CG     . LEU A  1 295  ? 85.617  99.907  1.666   1.00 164.62 ?  295  LEU A CG     1 
ATOM   2316  C  CD1    . LEU A  1 295  ? 85.159  98.994  2.742   1.00 164.21 ?  295  LEU A CD1    1 
ATOM   2317  C  CD2    . LEU A  1 295  ? 86.955  100.481 2.056   1.00 171.29 ?  295  LEU A CD2    1 
ATOM   2318  N  N      . GLY A  1 296  ? 86.201  99.652  -3.263  1.00 160.62 ?  296  GLY A N      1 
ATOM   2319  C  CA     . GLY A  1 296  ? 86.441  99.039  -4.566  1.00 162.64 ?  296  GLY A CA     1 
ATOM   2320  C  C      . GLY A  1 296  ? 85.425  98.030  -5.039  1.00 164.90 ?  296  GLY A C      1 
ATOM   2321  O  O      . GLY A  1 296  ? 85.688  97.288  -5.994  1.00 166.73 ?  296  GLY A O      1 
ATOM   2322  N  N      . GLY A  1 297  ? 84.257  98.029  -4.418  1.00 158.09 ?  297  GLY A N      1 
ATOM   2323  C  CA     . GLY A  1 297  ? 83.220  97.069  -4.772  1.00 156.73 ?  297  GLY A CA     1 
ATOM   2324  C  C      . GLY A  1 297  ? 82.249  97.464  -5.859  1.00 159.19 ?  297  GLY A C      1 
ATOM   2325  O  O      . GLY A  1 297  ? 81.276  96.736  -6.075  1.00 157.77 ?  297  GLY A O      1 
ATOM   2326  N  N      . VAL A  1 298  ? 82.492  98.589  -6.560  1.00 155.59 ?  298  VAL A N      1 
ATOM   2327  C  CA     . VAL A  1 298  ? 81.563  99.102  -7.571  1.00 153.74 ?  298  VAL A CA     1 
ATOM   2328  C  C      . VAL A  1 298  ? 81.145  98.046  -8.615  1.00 159.26 ?  298  VAL A C      1 
ATOM   2329  O  O      . VAL A  1 298  ? 79.952  97.913  -8.924  1.00 157.03 ?  298  VAL A O      1 
ATOM   2330  C  CB     . VAL A  1 298  ? 82.079  100.397 -8.236  1.00 158.03 ?  298  VAL A CB     1 
ATOM   2331  C  CG1    . VAL A  1 298  ? 83.294  100.136 -9.120  1.00 162.14 ?  298  VAL A CG1    1 
ATOM   2332  C  CG2    . VAL A  1 298  ? 80.974  101.070 -9.021  1.00 156.11 ?  298  VAL A CG2    1 
ATOM   2333  N  N      . ASN A  1 299  ? 82.119  97.305  -9.139  1.00 158.68 ?  299  ASN A N      1 
ATOM   2334  C  CA     . ASN A  1 299  ? 81.874  96.318  -10.180 1.00 160.21 ?  299  ASN A CA     1 
ATOM   2335  C  C      . ASN A  1 299  ? 81.034  95.143  -9.720  1.00 162.36 ?  299  ASN A C      1 
ATOM   2336  O  O      . ASN A  1 299  ? 80.359  94.514  -10.542 1.00 162.88 ?  299  ASN A O      1 
ATOM   2337  C  CB     . ASN A  1 299  ? 83.186  95.861  -10.780 1.00 164.15 ?  299  ASN A CB     1 
ATOM   2338  C  CG     . ASN A  1 299  ? 84.046  97.030  -11.175 1.00 184.74 ?  299  ASN A CG     1 
ATOM   2339  O  OD1    . ASN A  1 299  ? 83.677  97.840  -12.040 1.00 174.69 ?  299  ASN A OD1    1 
ATOM   2340  N  ND2    . ASN A  1 299  ? 85.057  97.294  -10.355 1.00 178.58 ?  299  ASN A ND2    1 
ATOM   2341  N  N      . GLU A  1 300  ? 81.066  94.853  -8.408  1.00 156.06 ?  300  GLU A N      1 
ATOM   2342  C  CA     . GLU A  1 300  ? 80.327  93.737  -7.824  1.00 153.44 ?  300  GLU A CA     1 
ATOM   2343  C  C      . GLU A  1 300  ? 79.043  94.147  -7.122  1.00 150.45 ?  300  GLU A C      1 
ATOM   2344  O  O      . GLU A  1 300  ? 78.302  93.261  -6.701  1.00 149.60 ?  300  GLU A O      1 
ATOM   2345  C  CB     . GLU A  1 300  ? 81.223  92.896  -6.895  1.00 156.52 ?  300  GLU A CB     1 
ATOM   2346  C  CG     . GLU A  1 300  ? 82.250  92.038  -7.639  1.00 170.89 ?  300  GLU A CG     1 
ATOM   2347  C  CD     . GLU A  1 300  ? 81.741  90.894  -8.515  1.00 186.53 ?  300  GLU A CD     1 
ATOM   2348  O  OE1    . GLU A  1 300  ? 80.561  90.497  -8.370  1.00 157.95 ?  300  GLU A OE1    1 
ATOM   2349  O  OE2    . GLU A  1 300  ? 82.533  90.380  -9.340  1.00 188.11 -1 300  GLU A OE2    1 
ATOM   2350  N  N      . LEU A  1 301  ? 78.759  95.461  -6.987  1.00 142.52 ?  301  LEU A N      1 
ATOM   2351  C  CA     . LEU A  1 301  ? 77.521  95.920  -6.349  1.00 137.52 ?  301  LEU A CA     1 
ATOM   2352  C  C      . LEU A  1 301  ? 76.335  95.638  -7.271  1.00 139.81 ?  301  LEU A C      1 
ATOM   2353  O  O      . LEU A  1 301  ? 76.226  96.210  -8.369  1.00 139.74 ?  301  LEU A O      1 
ATOM   2354  C  CB     . LEU A  1 301  ? 77.594  97.401  -5.964  1.00 135.22 ?  301  LEU A CB     1 
ATOM   2355  C  CG     . LEU A  1 301  ? 76.349  97.978  -5.306  1.00 135.05 ?  301  LEU A CG     1 
ATOM   2356  C  CD1    . LEU A  1 301  ? 76.042  97.269  -4.024  1.00 133.46 ?  301  LEU A CD1    1 
ATOM   2357  C  CD2    . LEU A  1 301  ? 76.509  99.447  -5.055  1.00 134.20 ?  301  LEU A CD2    1 
ATOM   2358  N  N      . ALA A  1 302  ? 75.466  94.733  -6.824  1.00 134.51 ?  302  ALA A N      1 
ATOM   2359  C  CA     . ALA A  1 302  ? 74.353  94.277  -7.631  1.00 134.14 ?  302  ALA A CA     1 
ATOM   2360  C  C      . ALA A  1 302  ? 73.170  95.204  -7.676  1.00 138.35 ?  302  ALA A C      1 
ATOM   2361  O  O      . ALA A  1 302  ? 72.457  95.232  -8.679  1.00 139.29 ?  302  ALA A O      1 
ATOM   2362  C  CB     . ALA A  1 302  ? 73.914  92.912  -7.157  1.00 134.91 ?  302  ALA A CB     1 
ATOM   2363  N  N      . ASN A  1 303  ? 72.915  95.933  -6.591  1.00 133.51 ?  303  ASN A N      1 
ATOM   2364  C  CA     . ASN A  1 303  ? 71.705  96.720  -6.507  1.00 131.03 ?  303  ASN A CA     1 
ATOM   2365  C  C      . ASN A  1 303  ? 71.859  97.986  -5.703  1.00 135.45 ?  303  ASN A C      1 
ATOM   2366  O  O      . ASN A  1 303  ? 72.814  98.171  -4.946  1.00 135.03 ?  303  ASN A O      1 
ATOM   2367  C  CB     . ASN A  1 303  ? 70.595  95.840  -5.856  1.00 128.26 ?  303  ASN A CB     1 
ATOM   2368  C  CG     . ASN A  1 303  ? 70.840  95.506  -4.396  1.00 152.46 ?  303  ASN A CG     1 
ATOM   2369  O  OD1    . ASN A  1 303  ? 71.926  95.056  -4.009  1.00 155.40 ?  303  ASN A OD1    1 
ATOM   2370  N  ND2    . ASN A  1 303  ? 69.846  95.763  -3.551  1.00 138.90 ?  303  ASN A ND2    1 
ATOM   2371  N  N      . TYR A  1 304  ? 70.893  98.862  -5.891  1.00 133.56 ?  304  TYR A N      1 
ATOM   2372  C  CA     . TYR A  1 304  ? 70.639  99.994  -5.045  1.00 133.02 ?  304  TYR A CA     1 
ATOM   2373  C  C      . TYR A  1 304  ? 69.175  99.902  -4.652  1.00 132.67 ?  304  TYR A C      1 
ATOM   2374  O  O      . TYR A  1 304  ? 68.308  99.758  -5.513  1.00 130.84 ?  304  TYR A O      1 
ATOM   2375  C  CB     . TYR A  1 304  ? 70.929  101.371 -5.662  1.00 137.08 ?  304  TYR A CB     1 
ATOM   2376  C  CG     . TYR A  1 304  ? 70.351  102.430 -4.742  1.00 140.73 ?  304  TYR A CG     1 
ATOM   2377  C  CD1    . TYR A  1 304  ? 70.987  102.759 -3.543  1.00 143.06 ?  304  TYR A CD1    1 
ATOM   2378  C  CD2    . TYR A  1 304  ? 69.070  102.944 -4.958  1.00 141.18 ?  304  TYR A CD2    1 
ATOM   2379  C  CE1    . TYR A  1 304  ? 70.402  103.628 -2.624  1.00 143.06 ?  304  TYR A CE1    1 
ATOM   2380  C  CE2    . TYR A  1 304  ? 68.473  103.810 -4.041  1.00 140.92 ?  304  TYR A CE2    1 
ATOM   2381  C  CZ     . TYR A  1 304  ? 69.147  104.152 -2.878  1.00 149.26 ?  304  TYR A CZ     1 
ATOM   2382  O  OH     . TYR A  1 304  ? 68.578  105.010 -1.969  1.00 149.50 ?  304  TYR A OH     1 
ATOM   2383  N  N      . GLY A  1 305  ? 68.910  100.059 -3.369  1.00 128.40 ?  305  GLY A N      1 
ATOM   2384  C  CA     . GLY A  1 305  ? 67.549  100.055 -2.879  1.00 126.71 ?  305  GLY A CA     1 
ATOM   2385  C  C      . GLY A  1 305  ? 67.421  100.439 -1.434  1.00 128.10 ?  305  GLY A C      1 
ATOM   2386  O  O      . GLY A  1 305  ? 68.417  100.544 -0.720  1.00 127.91 ?  305  GLY A O      1 
ATOM   2387  N  N      . GLU A  1 306  ? 66.190  100.673 -1.010  1.00 122.56 ?  306  GLU A N      1 
ATOM   2388  C  CA     . GLU A  1 306  ? 65.852  100.969 0.361   1.00 121.18 ?  306  GLU A CA     1 
ATOM   2389  C  C      . GLU A  1 306  ? 64.471  100.571 0.794   1.00 123.20 ?  306  GLU A C      1 
ATOM   2390  O  O      . GLU A  1 306  ? 63.590  100.426 -0.048  1.00 123.14 ?  306  GLU A O      1 
ATOM   2391  C  CB     . GLU A  1 306  ? 65.980  102.499 0.545   1.00 121.99 ?  306  GLU A CB     1 
ATOM   2392  C  CG     . GLU A  1 306  ? 64.868  103.320 -0.086  1.00 131.64 ?  306  GLU A CG     1 
ATOM   2393  C  CD     . GLU A  1 306  ? 64.014  104.129 0.880   1.00 155.00 ?  306  GLU A CD     1 
ATOM   2394  O  OE1    . GLU A  1 306  ? 64.170  103.957 2.110   1.00 163.44 ?  306  GLU A OE1    1 
ATOM   2395  O  OE2    . GLU A  1 306  ? 63.203  104.957 0.411   1.00 139.54 -1 306  GLU A OE2    1 
ATOM   2396  N  N      . TYR A  1 307  ? 64.279  100.367 2.086   1.00 118.33 ?  307  TYR A N      1 
ATOM   2397  C  CA     . TYR A  1 307  ? 62.977  100.168 2.659   1.00 118.42 ?  307  TYR A CA     1 
ATOM   2398  C  C      . TYR A  1 307  ? 62.961  101.110 3.863   1.00 124.62 ?  307  TYR A C      1 
ATOM   2399  O  O      . TYR A  1 307  ? 63.972  101.234 4.559   1.00 124.51 ?  307  TYR A O      1 
ATOM   2400  C  CB     . TYR A  1 307  ? 62.604  98.728  3.014   1.00 121.12 ?  307  TYR A CB     1 
ATOM   2401  C  CG     . TYR A  1 307  ? 63.403  98.158  4.159   1.00 126.22 ?  307  TYR A CG     1 
ATOM   2402  C  CD1    . TYR A  1 307  ? 64.680  97.638  3.959   1.00 128.94 ?  307  TYR A CD1    1 
ATOM   2403  C  CD2    . TYR A  1 307  ? 62.903  98.170  5.455   1.00 128.69 ?  307  TYR A CD2    1 
ATOM   2404  C  CE1    . TYR A  1 307  ? 65.441  97.143  5.025   1.00 130.35 ?  307  TYR A CE1    1 
ATOM   2405  C  CE2    . TYR A  1 307  ? 63.657  97.687  6.530   1.00 131.49 ?  307  TYR A CE2    1 
ATOM   2406  C  CZ     . TYR A  1 307  ? 64.923  97.165  6.310   1.00 138.56 ?  307  TYR A CZ     1 
ATOM   2407  O  OH     . TYR A  1 307  ? 65.659  96.674  7.367   1.00 140.38 ?  307  TYR A OH     1 
ATOM   2408  N  N      . SER A  1 308  ? 61.857  101.815 4.092   1.00 122.52 ?  308  SER A N      1 
ATOM   2409  C  CA     . SER A  1 308  ? 61.749  102.748 5.230   1.00 122.45 ?  308  SER A CA     1 
ATOM   2410  C  C      . SER A  1 308  ? 60.290  103.180 5.413   1.00 125.96 ?  308  SER A C      1 
ATOM   2411  O  O      . SER A  1 308  ? 59.412  102.757 4.656   1.00 126.69 ?  308  SER A O      1 
ATOM   2412  C  CB     . SER A  1 308  ? 62.675  103.960 5.054   1.00 125.19 ?  308  SER A CB     1 
ATOM   2413  O  OG     . SER A  1 308  ? 62.449  104.703 3.866   1.00 133.54 ?  308  SER A OG     1 
ATOM   2414  N  N      . GLY A  1 309  ? 60.031  104.002 6.408   1.00 121.38 ?  309  GLY A N      1 
ATOM   2415  C  CA     . GLY A  1 309  ? 58.678  104.469 6.669   1.00 121.50 ?  309  GLY A CA     1 
ATOM   2416  C  C      . GLY A  1 309  ? 57.802  103.419 7.313   1.00 126.85 ?  309  GLY A C      1 
ATOM   2417  O  O      . GLY A  1 309  ? 56.610  103.343 7.024   1.00 125.87 ?  309  GLY A O      1 
ATOM   2418  N  N      . ALA A  1 310  ? 58.397  102.599 8.190   1.00 125.83 ?  310  ALA A N      1 
ATOM   2419  C  CA     . ALA A  1 310  ? 57.734  101.550 8.958   1.00 126.59 ?  310  ALA A CA     1 
ATOM   2420  C  C      . ALA A  1 310  ? 56.935  100.553 8.097   1.00 127.56 ?  310  ALA A C      1 
ATOM   2421  O  O      . ALA A  1 310  ? 55.721  100.412 8.283   1.00 127.43 ?  310  ALA A O      1 
ATOM   2422  C  CB     . ALA A  1 310  ? 56.867  102.160 10.055  1.00 128.65 ?  310  ALA A CB     1 
ATOM   2423  N  N      . PRO A  1 311  ? 57.592  99.834  7.153   1.00 121.98 ?  311  PRO A N      1 
ATOM   2424  C  CA     . PRO A  1 311  ? 56.869  98.772  6.437   1.00 121.44 ?  311  PRO A CA     1 
ATOM   2425  C  C      . PRO A  1 311  ? 56.506  97.639  7.407   1.00 125.16 ?  311  PRO A C      1 
ATOM   2426  O  O      . PRO A  1 311  ? 57.146  97.463  8.453   1.00 126.40 ?  311  PRO A O      1 
ATOM   2427  C  CB     . PRO A  1 311  ? 57.876  98.281  5.400   1.00 123.00 ?  311  PRO A CB     1 
ATOM   2428  C  CG     . PRO A  1 311  ? 59.211  98.641  5.950   1.00 127.69 ?  311  PRO A CG     1 
ATOM   2429  C  CD     . PRO A  1 311  ? 59.023  99.876  6.772   1.00 123.03 ?  311  PRO A CD     1 
ATOM   2430  N  N      . SER A  1 312  ? 55.480  96.874  7.064   1.00 120.04 ?  312  SER A N      1 
ATOM   2431  C  CA     . SER A  1 312  ? 55.031  95.759  7.889   1.00 120.93 ?  312  SER A CA     1 
ATOM   2432  C  C      . SER A  1 312  ? 55.932  94.563  7.723   1.00 123.78 ?  312  SER A C      1 
ATOM   2433  O  O      . SER A  1 312  ? 56.769  94.520  6.819   1.00 122.58 ?  312  SER A O      1 
ATOM   2434  C  CB     . SER A  1 312  ? 53.618  95.350  7.501   1.00 126.34 ?  312  SER A CB     1 
ATOM   2435  O  OG     . SER A  1 312  ? 53.590  94.857  6.172   1.00 136.50 ?  312  SER A OG     1 
ATOM   2436  N  N      . GLU A  1 313  ? 55.717  93.550  8.564   1.00 121.17 ?  313  GLU A N      1 
ATOM   2437  C  CA     . GLU A  1 313  ? 56.473  92.304  8.477   1.00 121.66 ?  313  GLU A CA     1 
ATOM   2438  C  C      . GLU A  1 313  ? 56.276  91.704  7.092   1.00 120.94 ?  313  GLU A C      1 
ATOM   2439  O  O      . GLU A  1 313  ? 57.228  91.198  6.502   1.00 119.55 ?  313  GLU A O      1 
ATOM   2440  C  CB     . GLU A  1 313  ? 55.994  91.321  9.569   1.00 126.00 ?  313  GLU A CB     1 
ATOM   2441  C  CG     . GLU A  1 313  ? 56.802  90.031  9.695   1.00 139.64 ?  313  GLU A CG     1 
ATOM   2442  C  CD     . GLU A  1 313  ? 56.370  88.845  8.848   1.00 174.67 ?  313  GLU A CD     1 
ATOM   2443  O  OE1    . GLU A  1 313  ? 55.337  88.940  8.141   1.00 188.94 ?  313  GLU A OE1    1 
ATOM   2444  O  OE2    . GLU A  1 313  ? 57.067  87.806  8.906   1.00 169.11 -1 313  GLU A OE2    1 
ATOM   2445  N  N      . GLN A  1 314  ? 55.031  91.762  6.586   1.00 115.75 ?  314  GLN A N      1 
ATOM   2446  C  CA     . GLN A  1 314  ? 54.665  91.196  5.290   1.00 115.04 ?  314  GLN A CA     1 
ATOM   2447  C  C      . GLN A  1 314  ? 55.319  91.938  4.155   1.00 114.52 ?  314  GLN A C      1 
ATOM   2448  O  O      . GLN A  1 314  ? 55.831  91.297  3.240   1.00 114.15 ?  314  GLN A O      1 
ATOM   2449  C  CB     . GLN A  1 314  ? 53.139  91.150  5.119   1.00 117.21 ?  314  GLN A CB     1 
ATOM   2450  C  CG     . GLN A  1 314  ? 52.645  90.469  3.843   1.00 119.15 ?  314  GLN A CG     1 
ATOM   2451  C  CD     . GLN A  1 314  ? 53.056  89.026  3.758   1.00 125.30 ?  314  GLN A CD     1 
ATOM   2452  O  OE1    . GLN A  1 314  ? 52.969  88.267  4.733   1.00 122.73 ?  314  GLN A OE1    1 
ATOM   2453  N  NE2    . GLN A  1 314  ? 53.525  88.628  2.586   1.00 110.23 ?  314  GLN A NE2    1 
ATOM   2454  N  N      . GLN A  1 315  ? 55.312  93.278  4.197   1.00 108.93 ?  315  GLN A N      1 
ATOM   2455  C  CA     . GLN A  1 315  ? 55.973  94.088  3.169   1.00 107.19 ?  315  GLN A CA     1 
ATOM   2456  C  C      . GLN A  1 315  ? 57.470  93.782  3.134   1.00 114.38 ?  315  GLN A C      1 
ATOM   2457  O  O      . GLN A  1 315  ? 58.036  93.625  2.054   1.00 113.91 ?  315  GLN A O      1 
ATOM   2458  C  CB     . GLN A  1 315  ? 55.765  95.585  3.413   1.00 106.10 ?  315  GLN A CB     1 
ATOM   2459  C  CG     . GLN A  1 315  ? 54.361  96.061  3.124   1.00 109.44 ?  315  GLN A CG     1 
ATOM   2460  C  CD     . GLN A  1 315  ? 54.170  97.505  3.505   1.00 127.19 ?  315  GLN A CD     1 
ATOM   2461  O  OE1    . GLN A  1 315  ? 54.190  97.872  4.681   1.00 125.59 ?  315  GLN A OE1    1 
ATOM   2462  N  NE2    . GLN A  1 315  ? 53.924  98.351  2.519   1.00 115.86 ?  315  GLN A NE2    1 
ATOM   2463  N  N      . THR A  1 316  ? 58.102  93.667  4.317   1.00 113.90 ?  316  THR A N      1 
ATOM   2464  C  CA     . THR A  1 316  ? 59.530  93.381  4.423   1.00 114.56 ?  316  THR A CA     1 
ATOM   2465  C  C      . THR A  1 316  ? 59.851  91.966  3.927   1.00 120.41 ?  316  THR A C      1 
ATOM   2466  O  O      . THR A  1 316  ? 60.885  91.760  3.281   1.00 119.94 ?  316  THR A O      1 
ATOM   2467  C  CB     . THR A  1 316  ? 60.031  93.659  5.819   1.00 122.88 ?  316  THR A CB     1 
ATOM   2468  O  OG1    . THR A  1 316  ? 59.525  94.920  6.268   1.00 124.16 ?  316  THR A OG1    1 
ATOM   2469  C  CG2    . THR A  1 316  ? 61.521  93.702  5.851   1.00 122.05 ?  316  THR A CG2    1 
ATOM   2470  N  N      . TYR A  1 317  ? 58.950  91.012  4.202   1.00 118.30 ?  317  TYR A N      1 
ATOM   2471  C  CA     . TYR A  1 317  ? 59.067  89.658  3.696   1.00 120.23 ?  317  TYR A CA     1 
ATOM   2472  C  C      . TYR A  1 317  ? 59.033  89.668  2.157   1.00 122.63 ?  317  TYR A C      1 
ATOM   2473  O  O      . TYR A  1 317  ? 59.908  89.046  1.531   1.00 124.57 ?  317  TYR A O      1 
ATOM   2474  C  CB     . TYR A  1 317  ? 57.934  88.775  4.249   1.00 123.77 ?  317  TYR A CB     1 
ATOM   2475  C  CG     . TYR A  1 317  ? 57.885  87.404  3.604   1.00 129.09 ?  317  TYR A CG     1 
ATOM   2476  C  CD1    . TYR A  1 317  ? 58.767  86.398  3.989   1.00 133.07 ?  317  TYR A CD1    1 
ATOM   2477  C  CD2    . TYR A  1 317  ? 57.008  87.134  2.555   1.00 130.98 ?  317  TYR A CD2    1 
ATOM   2478  C  CE1    . TYR A  1 317  ? 58.755  85.147  3.369   1.00 136.64 ?  317  TYR A CE1    1 
ATOM   2479  C  CE2    . TYR A  1 317  ? 56.994  85.889  1.922   1.00 134.44 ?  317  TYR A CE2    1 
ATOM   2480  C  CZ     . TYR A  1 317  ? 57.863  84.897  2.340   1.00 142.89 ?  317  TYR A CZ     1 
ATOM   2481  O  OH     . TYR A  1 317  ? 57.815  83.671  1.732   1.00 146.65 ?  317  TYR A OH     1 
ATOM   2482  N  N      . ASP A  1 318  ? 58.030  90.358  1.552   1.00 114.84 ?  318  ASP A N      1 
ATOM   2483  C  CA     . ASP A  1 318  ? 57.895  90.407  0.098   1.00 114.04 ?  318  ASP A CA     1 
ATOM   2484  C  C      . ASP A  1 318  ? 59.080  91.092  -0.549  1.00 116.97 ?  318  ASP A C      1 
ATOM   2485  O  O      . ASP A  1 318  ? 59.528  90.677  -1.620  1.00 117.87 ?  318  ASP A O      1 
ATOM   2486  C  CB     . ASP A  1 318  ? 56.569  91.044  -0.314  1.00 115.05 ?  318  ASP A CB     1 
ATOM   2487  C  CG     . ASP A  1 318  ? 55.329  90.217  0.012   1.00 124.71 ?  318  ASP A CG     1 
ATOM   2488  O  OD1    . ASP A  1 318  ? 55.397  88.970  -0.068  1.00 129.08 ?  318  ASP A OD1    1 
ATOM   2489  O  OD2    . ASP A  1 318  ? 54.286  90.816  0.312   1.00 123.91 -1 318  ASP A OD2    1 
ATOM   2490  N  N      . TYR A  1 319  ? 59.627  92.108  0.124   1.00 112.09 ?  319  TYR A N      1 
ATOM   2491  C  CA     . TYR A  1 319  ? 60.825  92.795  -0.339  1.00 111.69 ?  319  TYR A CA     1 
ATOM   2492  C  C      . TYR A  1 319  ? 62.041  91.841  -0.290  1.00 114.27 ?  319  TYR A C      1 
ATOM   2493  O  O      . TYR A  1 319  ? 62.727  91.672  -1.299  1.00 112.14 ?  319  TYR A O      1 
ATOM   2494  C  CB     . TYR A  1 319  ? 61.089  94.046  0.529   1.00 112.65 ?  319  TYR A CB     1 
ATOM   2495  C  CG     . TYR A  1 319  ? 62.166  94.955  -0.023  1.00 115.94 ?  319  TYR A CG     1 
ATOM   2496  C  CD1    . TYR A  1 319  ? 63.515  94.659  0.153   1.00 119.16 ?  319  TYR A CD1    1 
ATOM   2497  C  CD2    . TYR A  1 319  ? 61.837  96.111  -0.730  1.00 116.21 ?  319  TYR A CD2    1 
ATOM   2498  C  CE1    . TYR A  1 319  ? 64.511  95.462  -0.397  1.00 120.15 ?  319  TYR A CE1    1 
ATOM   2499  C  CE2    . TYR A  1 319  ? 62.826  96.935  -1.267  1.00 117.32 ?  319  TYR A CE2    1 
ATOM   2500  C  CZ     . TYR A  1 319  ? 64.163  96.607  -1.097  1.00 127.16 ?  319  TYR A CZ     1 
ATOM   2501  O  OH     . TYR A  1 319  ? 65.153  97.404  -1.626  1.00 128.17 ?  319  TYR A OH     1 
ATOM   2502  N  N      . ALA A  1 320  ? 62.302  91.227  0.883   1.00 112.46 ?  320  ALA A N      1 
ATOM   2503  C  CA     . ALA A  1 320  ? 63.459  90.350  1.082   1.00 114.40 ?  320  ALA A CA     1 
ATOM   2504  C  C      . ALA A  1 320  ? 63.463  89.147  0.166   1.00 121.49 ?  320  ALA A C      1 
ATOM   2505  O  O      . ALA A  1 320  ? 64.518  88.835  -0.394  1.00 123.15 ?  320  ALA A O      1 
ATOM   2506  C  CB     . ALA A  1 320  ? 63.558  89.913  2.536   1.00 115.69 ?  320  ALA A CB     1 
ATOM   2507  N  N      . LYS A  1 321  ? 62.300  88.470  0.003   1.00 118.10 ?  321  LYS A N      1 
ATOM   2508  C  CA     . LYS A  1 321  ? 62.210  87.299  -0.872  1.00 120.21 ?  321  LYS A CA     1 
ATOM   2509  C  C      . LYS A  1 321  ? 62.610  87.648  -2.320  1.00 124.53 ?  321  LYS A C      1 
ATOM   2510  O  O      . LYS A  1 321  ? 63.213  86.818  -2.999  1.00 124.06 ?  321  LYS A O      1 
ATOM   2511  C  CB     . LYS A  1 321  ? 60.812  86.677  -0.805  1.00 123.36 ?  321  LYS A CB     1 
ATOM   2512  C  CG     . LYS A  1 321  ? 59.747  87.491  -1.520  1.00 131.11 ?  321  LYS A CG     1 
ATOM   2513  C  CD     . LYS A  1 321  ? 58.346  86.894  -1.476  1.00 134.92 ?  321  LYS A CD     1 
ATOM   2514  C  CE     . LYS A  1 321  ? 57.545  87.439  -2.646  1.00 142.26 ?  321  LYS A CE     1 
ATOM   2515  N  NZ     . LYS A  1 321  ? 56.135  87.753  -2.307  1.00 148.16 1  321  LYS A NZ     1 
ATOM   2516  N  N      . THR A  1 322  ? 62.300  88.889  -2.770  1.00 121.58 ?  322  THR A N      1 
ATOM   2517  C  CA     . THR A  1 322  ? 62.669  89.382  -4.101  1.00 122.36 ?  322  THR A CA     1 
ATOM   2518  C  C      . THR A  1 322  ? 64.193  89.417  -4.218  1.00 128.13 ?  322  THR A C      1 
ATOM   2519  O  O      . THR A  1 322  ? 64.735  88.899  -5.192  1.00 131.23 ?  322  THR A O      1 
ATOM   2520  C  CB     . THR A  1 322  ? 62.059  90.767  -4.362  1.00 127.15 ?  322  THR A CB     1 
ATOM   2521  O  OG1    . THR A  1 322  ? 60.637  90.695  -4.211  1.00 126.98 ?  322  THR A OG1    1 
ATOM   2522  C  CG2    . THR A  1 322  ? 62.429  91.336  -5.748  1.00 124.72 ?  322  THR A CG2    1 
ATOM   2523  N  N      . ILE A  1 323  ? 64.878  90.015  -3.227  1.00 121.88 ?  323  ILE A N      1 
ATOM   2524  C  CA     . ILE A  1 323  ? 66.335  90.078  -3.203  1.00 121.72 ?  323  ILE A CA     1 
ATOM   2525  C  C      . ILE A  1 323  ? 66.940  88.688  -3.159  1.00 124.12 ?  323  ILE A C      1 
ATOM   2526  O  O      . ILE A  1 323  ? 67.890  88.413  -3.891  1.00 125.02 ?  323  ILE A O      1 
ATOM   2527  C  CB     . ILE A  1 323  ? 66.824  90.904  -1.999  1.00 123.87 ?  323  ILE A CB     1 
ATOM   2528  C  CG1    . ILE A  1 323  ? 66.264  92.349  -2.013  1.00 122.06 ?  323  ILE A CG1    1 
ATOM   2529  C  CG2    . ILE A  1 323  ? 68.367  90.873  -1.895  1.00 126.48 ?  323  ILE A CG2    1 
ATOM   2530  C  CD1    . ILE A  1 323  ? 66.782  93.199  -3.075  1.00 134.88 ?  323  ILE A CD1    1 
ATOM   2531  N  N      . LEU A  1 324  ? 66.440  87.837  -2.263  1.00 118.94 ?  324  LEU A N      1 
ATOM   2532  C  CA     . LEU A  1 324  ? 66.999  86.502  -2.111  1.00 121.04 ?  324  LEU A CA     1 
ATOM   2533  C  C      . LEU A  1 324  ? 66.867  85.682  -3.382  1.00 127.81 ?  324  LEU A C      1 
ATOM   2534  O  O      . LEU A  1 324  ? 67.823  84.995  -3.766  1.00 128.44 ?  324  LEU A O      1 
ATOM   2535  C  CB     . LEU A  1 324  ? 66.406  85.781  -0.897  1.00 120.74 ?  324  LEU A CB     1 
ATOM   2536  C  CG     . LEU A  1 324  ? 66.579  86.460  0.458   1.00 121.86 ?  324  LEU A CG     1 
ATOM   2537  C  CD1    . LEU A  1 324  ? 66.053  85.567  1.557   1.00 122.70 ?  324  LEU A CD1    1 
ATOM   2538  C  CD2    . LEU A  1 324  ? 68.034  86.834  0.733   1.00 122.19 ?  324  LEU A CD2    1 
ATOM   2539  N  N      . SER A  1 325  ? 65.704  85.792  -4.059  1.00 125.65 ?  325  SER A N      1 
ATOM   2540  C  CA     . SER A  1 325  ? 65.493  85.153  -5.355  1.00 128.93 ?  325  SER A CA     1 
ATOM   2541  C  C      . SER A  1 325  ? 66.515  85.697  -6.343  1.00 136.51 ?  325  SER A C      1 
ATOM   2542  O  O      . SER A  1 325  ? 67.181  84.910  -7.018  1.00 140.96 ?  325  SER A O      1 
ATOM   2543  C  CB     . SER A  1 325  ? 64.086  85.424  -5.868  1.00 131.05 ?  325  SER A CB     1 
ATOM   2544  O  OG     . SER A  1 325  ? 63.938  85.000  -7.212  1.00 140.74 ?  325  SER A OG     1 
ATOM   2545  N  N      . LEU A  1 326  ? 66.673  87.033  -6.400  1.00 130.75 ?  326  LEU A N      1 
ATOM   2546  C  CA     . LEU A  1 326  ? 67.631  87.664  -7.314  1.00 131.11 ?  326  LEU A CA     1 
ATOM   2547  C  C      . LEU A  1 326  ? 69.085  87.236  -7.093  1.00 141.23 ?  326  LEU A C      1 
ATOM   2548  O  O      . LEU A  1 326  ? 69.848  87.169  -8.061  1.00 143.58 ?  326  LEU A O      1 
ATOM   2549  C  CB     . LEU A  1 326  ? 67.530  89.190  -7.254  1.00 126.82 ?  326  LEU A CB     1 
ATOM   2550  C  CG     . LEU A  1 326  ? 66.355  89.798  -7.977  1.00 128.45 ?  326  LEU A CG     1 
ATOM   2551  C  CD1    . LEU A  1 326  ? 66.149  91.208  -7.551  1.00 124.91 ?  326  LEU A CD1    1 
ATOM   2552  C  CD2    . LEU A  1 326  ? 66.535  89.728  -9.469  1.00 131.99 ?  326  LEU A CD2    1 
ATOM   2553  N  N      . MET A  1 327  ? 69.480  86.946  -5.841  1.00 138.91 ?  327  MET A N      1 
ATOM   2554  C  CA     . MET A  1 327  ? 70.877  86.623  -5.602  1.00 140.96 ?  327  MET A CA     1 
ATOM   2555  C  C      . MET A  1 327  ? 71.197  85.117  -5.690  1.00 148.26 ?  327  MET A C      1 
ATOM   2556  O  O      . MET A  1 327  ? 72.355  84.737  -5.546  1.00 149.88 ?  327  MET A O      1 
ATOM   2557  C  CB     . MET A  1 327  ? 71.379  87.265  -4.297  1.00 141.38 ?  327  MET A CB     1 
ATOM   2558  C  CG     . MET A  1 327  ? 70.867  86.683  -2.998  1.00 144.76 ?  327  MET A CG     1 
ATOM   2559  S  SD     . MET A  1 327  ? 71.338  87.795  -1.618  1.00 146.93 ?  327  MET A SD     1 
ATOM   2560  C  CE     . MET A  1 327  ? 73.117  87.668  -1.633  1.00 146.32 ?  327  MET A CE     1 
ATOM   2561  N  N      . THR A  1 328  ? 70.203  84.283  -5.992  1.00 146.11 ?  328  THR A N      1 
ATOM   2562  C  CA     . THR A  1 328  ? 70.388  82.839  -6.091  1.00 150.12 ?  328  THR A CA     1 
ATOM   2563  C  C      . THR A  1 328  ? 70.004  82.364  -7.474  1.00 158.32 ?  328  THR A C      1 
ATOM   2564  O  O      . THR A  1 328  ? 69.427  81.278  -7.626  1.00 161.27 ?  328  THR A O      1 
ATOM   2565  C  CB     . THR A  1 328  ? 69.649  82.093  -4.955  1.00 154.55 ?  328  THR A CB     1 
ATOM   2566  O  OG1    . THR A  1 328  ? 68.262  82.408  -5.003  1.00 146.93 ?  328  THR A OG1    1 
ATOM   2567  C  CG2    . THR A  1 328  ? 70.211  82.407  -3.581  1.00 152.69 ?  328  THR A CG2    1 
ATOM   2568  N  N      . ARG A  1 329  ? 70.344  83.174  -8.491  1.00 154.77 ?  329  ARG A N      1 
ATOM   2569  C  CA     . ARG A  1 329  ? 70.048  82.854  -9.891  1.00 157.93 ?  329  ARG A CA     1 
ATOM   2570  C  C      . ARG A  1 329  ? 71.211  82.100  -10.560 1.00 168.51 ?  329  ARG A C      1 
ATOM   2571  O  O      . ARG A  1 329  ? 71.005  81.247  -11.434 1.00 171.40 ?  329  ARG A O      1 
ATOM   2572  C  CB     . ARG A  1 329  ? 69.714  84.131  -10.676 1.00 154.29 ?  329  ARG A CB     1 
ATOM   2573  C  CG     . ARG A  1 329  ? 68.517  84.894  -10.149 1.00 156.31 ?  329  ARG A CG     1 
ATOM   2574  C  CD     . ARG A  1 329  ? 67.200  84.352  -10.654 1.00 159.67 ?  329  ARG A CD     1 
ATOM   2575  N  NE     . ARG A  1 329  ? 66.080  84.981  -9.965  1.00 155.69 ?  329  ARG A NE     1 
ATOM   2576  C  CZ     . ARG A  1 329  ? 65.435  86.041  -10.426 1.00 165.25 ?  329  ARG A CZ     1 
ATOM   2577  N  NH1    . ARG A  1 329  ? 65.785  86.588  -11.585 1.00 148.31 1  329  ARG A NH1    1 
ATOM   2578  N  NH2    . ARG A  1 329  ? 64.430  86.562  -9.737  1.00 155.41 ?  329  ARG A NH2    1 
ATOM   2579  N  N      . GLU A  1 330  ? 72.433  82.437  -10.151 1.00 166.04 ?  330  GLU A N      1 
ATOM   2580  C  CA     . GLU A  1 330  ? 73.655  81.830  -10.662 1.00 169.85 ?  330  GLU A CA     1 
ATOM   2581  C  C      . GLU A  1 330  ? 74.740  81.991  -9.627  1.00 172.59 ?  330  GLU A C      1 
ATOM   2582  O  O      . GLU A  1 330  ? 74.784  82.983  -8.891  1.00 168.86 ?  330  GLU A O      1 
ATOM   2583  C  CB     . GLU A  1 330  ? 74.074  82.417  -12.026 1.00 172.93 ?  330  GLU A CB     1 
ATOM   2584  C  CG     . GLU A  1 330  ? 74.664  83.816  -11.964 1.00 182.68 ?  330  GLU A CG     1 
ATOM   2585  C  CD     . GLU A  1 330  ? 73.677  84.926  -11.644 1.00 208.35 ?  330  GLU A CD     1 
ATOM   2586  O  OE1    . GLU A  1 330  ? 72.641  85.014  -12.342 1.00 208.79 ?  330  GLU A OE1    1 
ATOM   2587  O  OE2    . GLU A  1 330  ? 73.934  85.710  -10.699 1.00 201.98 -1 330  GLU A OE2    1 
ATOM   2588  N  N      . LYS A  1 331  ? 75.606  81.008  -9.570  1.00 171.61 ?  331  LYS A N      1 
ATOM   2589  C  CA     . LYS A  1 331  ? 76.673  80.960  -8.596  1.00 170.79 ?  331  LYS A CA     1 
ATOM   2590  C  C      . LYS A  1 331  ? 77.853  81.848  -8.960  1.00 173.33 ?  331  LYS A C      1 
ATOM   2591  O  O      . LYS A  1 331  ? 78.189  82.004  -10.135 1.00 174.23 ?  331  LYS A O      1 
ATOM   2592  C  CB     . LYS A  1 331  ? 77.151  79.513  -8.453  1.00 177.22 ?  331  LYS A CB     1 
ATOM   2593  C  CG     . LYS A  1 331  ? 76.224  78.588  -7.687  1.00 173.53 ?  331  LYS A CG     1 
ATOM   2594  C  CD     . LYS A  1 331  ? 77.028  77.380  -7.210  1.00 177.67 ?  331  LYS A CD     1 
ATOM   2595  C  CE     . LYS A  1 331  ? 76.197  76.275  -6.644  1.00 174.13 ?  331  LYS A CE     1 
ATOM   2596  N  NZ     . LYS A  1 331  ? 77.062  75.238  -5.997  1.00 181.08 1  331  LYS A NZ     1 
ATOM   2597  N  N      . HIS A  1 332  ? 78.491  82.410  -7.935  1.00 168.08 ?  332  HIS A N      1 
ATOM   2598  C  CA     . HIS A  1 332  ? 79.714  83.190  -8.064  1.00 168.99 ?  332  HIS A CA     1 
ATOM   2599  C  C      . HIS A  1 332  ? 80.807  82.361  -7.389  1.00 177.98 ?  332  HIS A C      1 
ATOM   2600  O  O      . HIS A  1 332  ? 80.567  81.792  -6.318  1.00 177.23 ?  332  HIS A O      1 
ATOM   2601  C  CB     . HIS A  1 332  ? 79.600  84.572  -7.401  1.00 165.03 ?  332  HIS A CB     1 
ATOM   2602  C  CG     . HIS A  1 332  ? 80.766  85.476  -7.688  1.00 168.95 ?  332  HIS A CG     1 
ATOM   2603  N  ND1    . HIS A  1 332  ? 81.980  85.315  -7.048  1.00 172.77 ?  332  HIS A ND1    1 
ATOM   2604  C  CD2    . HIS A  1 332  ? 80.854  86.537  -8.522  1.00 169.66 ?  332  HIS A CD2    1 
ATOM   2605  C  CE1    . HIS A  1 332  ? 82.770  86.258  -7.526  1.00 172.57 ?  332  HIS A CE1    1 
ATOM   2606  N  NE2    . HIS A  1 332  ? 82.136  87.024  -8.409  1.00 171.06 ?  332  HIS A NE2    1 
ATOM   2607  N  N      . PRO A  1 333  ? 82.006  82.267  -7.996  1.00 179.47 ?  333  PRO A N      1 
ATOM   2608  C  CA     . PRO A  1 333  ? 83.068  81.428  -7.407  1.00 183.71 ?  333  PRO A CA     1 
ATOM   2609  C  C      . PRO A  1 333  ? 83.463  81.760  -5.969  1.00 186.50 ?  333  PRO A C      1 
ATOM   2610  O  O      . PRO A  1 333  ? 83.786  80.853  -5.198  1.00 188.44 ?  333  PRO A O      1 
ATOM   2611  C  CB     . PRO A  1 333  ? 84.250  81.635  -8.356  1.00 189.41 ?  333  PRO A CB     1 
ATOM   2612  C  CG     . PRO A  1 333  ? 83.655  82.117  -9.620  1.00 192.83 ?  333  PRO A CG     1 
ATOM   2613  C  CD     . PRO A  1 333  ? 82.435  82.874  -9.271  1.00 182.56 ?  333  PRO A CD     1 
ATOM   2614  N  N      . ASP A  1 334  ? 83.423  83.050  -5.611  1.00 180.07 ?  334  ASP A N      1 
ATOM   2615  C  CA     . ASP A  1 334  ? 83.803  83.530  -4.286  1.00 178.84 ?  334  ASP A CA     1 
ATOM   2616  C  C      . ASP A  1 334  ? 82.615  83.708  -3.371  1.00 177.54 ?  334  ASP A C      1 
ATOM   2617  O  O      . ASP A  1 334  ? 82.730  84.415  -2.374  1.00 175.02 ?  334  ASP A O      1 
ATOM   2618  C  CB     . ASP A  1 334  ? 84.579  84.854  -4.404  1.00 180.45 ?  334  ASP A CB     1 
ATOM   2619  C  CG     . ASP A  1 334  ? 85.737  84.771  -5.376  1.00 201.60 ?  334  ASP A CG     1 
ATOM   2620  O  OD1    . ASP A  1 334  ? 85.594  85.265  -6.502  1.00 203.94 -1 334  ASP A OD1    1 
ATOM   2621  O  OD2    . ASP A  1 334  ? 86.802  84.209  -4.998  1.00 212.17 -1 334  ASP A OD2    1 
ATOM   2622  N  N      . GLY A  1 335  ? 81.489  83.081  -3.708  1.00 172.96 ?  335  GLY A N      1 
ATOM   2623  C  CA     . GLY A  1 335  ? 80.255  83.211  -2.941  1.00 168.98 ?  335  GLY A CA     1 
ATOM   2624  C  C      . GLY A  1 335  ? 79.698  84.620  -3.035  1.00 167.51 ?  335  GLY A C      1 
ATOM   2625  O  O      . GLY A  1 335  ? 80.168  85.429  -3.844  1.00 167.68 ?  335  GLY A O      1 
ATOM   2626  N  N      . LYS A  1 336  ? 78.695  84.929  -2.204  1.00 158.58 ?  336  LYS A N      1 
ATOM   2627  C  CA     . LYS A  1 336  ? 78.059  86.248  -2.217  1.00 153.04 ?  336  LYS A CA     1 
ATOM   2628  C  C      . LYS A  1 336  ? 77.895  86.798  -0.815  1.00 153.63 ?  336  LYS A C      1 
ATOM   2629  O  O      . LYS A  1 336  ? 78.001  86.057  0.163   1.00 154.44 ?  336  LYS A O      1 
ATOM   2630  C  CB     . LYS A  1 336  ? 76.701  86.205  -2.941  1.00 152.55 ?  336  LYS A CB     1 
ATOM   2631  C  CG     . LYS A  1 336  ? 76.814  85.783  -4.403  1.00 163.73 ?  336  LYS A CG     1 
ATOM   2632  C  CD     . LYS A  1 336  ? 75.497  85.829  -5.178  1.00 164.01 ?  336  LYS A CD     1 
ATOM   2633  C  CE     . LYS A  1 336  ? 75.656  85.232  -6.568  1.00 160.67 ?  336  LYS A CE     1 
ATOM   2634  N  NZ     . LYS A  1 336  ? 74.391  85.242  -7.360  1.00 152.73 1  336  LYS A NZ     1 
ATOM   2635  N  N      . ILE A  1 337  ? 77.649  88.113  -0.728  1.00 146.39 ?  337  ILE A N      1 
ATOM   2636  C  CA     . ILE A  1 337  ? 77.460  88.862  0.513   1.00 143.74 ?  337  ILE A CA     1 
ATOM   2637  C  C      . ILE A  1 337  ? 76.119  89.581  0.487   1.00 147.85 ?  337  ILE A C      1 
ATOM   2638  O  O      . ILE A  1 337  ? 75.753  90.169  -0.534  1.00 147.26 ?  337  ILE A O      1 
ATOM   2639  C  CB     . ILE A  1 337  ? 78.604  89.890  0.694   1.00 146.21 ?  337  ILE A CB     1 
ATOM   2640  C  CG1    . ILE A  1 337  ? 79.901  89.204  1.069   1.00 150.81 ?  337  ILE A CG1    1 
ATOM   2641  C  CG2    . ILE A  1 337  ? 78.250  90.950  1.731   1.00 143.13 ?  337  ILE A CG2    1 
ATOM   2642  C  CD1    . ILE A  1 337  ? 81.136  90.054  0.803   1.00 159.61 ?  337  ILE A CD1    1 
ATOM   2643  N  N      . LEU A  1 338  ? 75.412  89.587  1.622   1.00 144.10 ?  338  LEU A N      1 
ATOM   2644  C  CA     . LEU A  1 338  ? 74.181  90.362  1.785   1.00 140.31 ?  338  LEU A CA     1 
ATOM   2645  C  C      . LEU A  1 338  ? 74.383  91.314  2.977   1.00 145.15 ?  338  LEU A C      1 
ATOM   2646  O  O      . LEU A  1 338  ? 74.690  90.867  4.081   1.00 146.59 ?  338  LEU A O      1 
ATOM   2647  C  CB     . LEU A  1 338  ? 72.942  89.471  1.966   1.00 139.16 ?  338  LEU A CB     1 
ATOM   2648  C  CG     . LEU A  1 338  ? 71.609  90.173  2.230   1.00 138.80 ?  338  LEU A CG     1 
ATOM   2649  C  CD1    . LEU A  1 338  ? 71.216  91.074  1.084   1.00 136.67 ?  338  LEU A CD1    1 
ATOM   2650  C  CD2    . LEU A  1 338  ? 70.525  89.165  2.477   1.00 139.17 ?  338  LEU A CD2    1 
ATOM   2651  N  N      . ILE A  1 339  ? 74.263  92.619  2.729   1.00 140.24 ?  339  ILE A N      1 
ATOM   2652  C  CA     . ILE A  1 339  ? 74.448  93.665  3.727   1.00 138.89 ?  339  ILE A CA     1 
ATOM   2653  C  C      . ILE A  1 339  ? 73.078  94.143  4.171   1.00 141.52 ?  339  ILE A C      1 
ATOM   2654  O  O      . ILE A  1 339  ? 72.393  94.813  3.406   1.00 139.11 ?  339  ILE A O      1 
ATOM   2655  C  CB     . ILE A  1 339  ? 75.317  94.828  3.155   1.00 141.41 ?  339  ILE A CB     1 
ATOM   2656  C  CG1    . ILE A  1 339  ? 76.716  94.359  2.707   1.00 143.86 ?  339  ILE A CG1    1 
ATOM   2657  C  CG2    . ILE A  1 339  ? 75.410  95.996  4.143   1.00 142.10 ?  339  ILE A CG2    1 
ATOM   2658  C  CD1    . ILE A  1 339  ? 77.615  93.978  3.804   1.00 152.49 ?  339  ILE A CD1    1 
ATOM   2659  N  N      . ILE A  1 340  ? 72.674  93.796  5.392   1.00 140.05 ?  340  ILE A N      1 
ATOM   2660  C  CA     . ILE A  1 340  ? 71.391  94.204  5.960   1.00 138.82 ?  340  ILE A CA     1 
ATOM   2661  C  C      . ILE A  1 340  ? 71.727  95.283  6.985   1.00 145.40 ?  340  ILE A C      1 
ATOM   2662  O  O      . ILE A  1 340  ? 72.066  94.981  8.123   1.00 146.21 ?  340  ILE A O      1 
ATOM   2663  C  CB     . ILE A  1 340  ? 70.609  93.013  6.578   1.00 142.77 ?  340  ILE A CB     1 
ATOM   2664  C  CG1    . ILE A  1 340  ? 70.489  91.843  5.583   1.00 143.93 ?  340  ILE A CG1    1 
ATOM   2665  C  CG2    . ILE A  1 340  ? 69.223  93.470  7.079   1.00 141.71 ?  340  ILE A CG2    1 
ATOM   2666  C  CD1    . ILE A  1 340  ? 69.732  90.643  6.126   1.00 149.61 ?  340  ILE A CD1    1 
ATOM   2667  N  N      . GLY A  1 341  ? 71.703  96.530  6.552   1.00 143.48 ?  341  GLY A N      1 
ATOM   2668  C  CA     . GLY A  1 341  ? 72.094  97.635  7.414   1.00 144.60 ?  341  GLY A CA     1 
ATOM   2669  C  C      . GLY A  1 341  ? 71.034  98.686  7.647   1.00 148.35 ?  341  GLY A C      1 
ATOM   2670  O  O      . GLY A  1 341  ? 69.879  98.557  7.213   1.00 147.47 ?  341  GLY A O      1 
ATOM   2671  N  N      . GLY A  1 342  ? 71.444  99.728  8.344   1.00 144.68 ?  342  GLY A N      1 
ATOM   2672  C  CA     . GLY A  1 342  ? 70.555  100.835 8.611   1.00 142.69 ?  342  GLY A CA     1 
ATOM   2673  C  C      . GLY A  1 342  ? 71.050  101.716 9.717   1.00 146.02 ?  342  GLY A C      1 
ATOM   2674  O  O      . GLY A  1 342  ? 71.994  101.378 10.442  1.00 147.11 ?  342  GLY A O      1 
ATOM   2675  N  N      . SER A  1 343  ? 70.396  102.863 9.835   1.00 140.34 ?  343  SER A N      1 
ATOM   2676  C  CA     . SER A  1 343  ? 70.638  103.800 10.909  1.00 140.74 ?  343  SER A CA     1 
ATOM   2677  C  C      . SER A  1 343  ? 69.980  103.213 12.159  1.00 142.64 ?  343  SER A C      1 
ATOM   2678  O  O      . SER A  1 343  ? 69.376  102.126 12.147  1.00 142.24 ?  343  SER A O      1 
ATOM   2679  C  CB     . SER A  1 343  ? 69.970  105.142 10.576  1.00 143.95 ?  343  SER A CB     1 
ATOM   2680  O  OG     . SER A  1 343  ? 68.548  105.106 10.634  1.00 153.37 ?  343  SER A OG     1 
ATOM   2681  N  N      . ILE A  1 344  ? 70.055  103.974 13.227  1.00 138.29 ?  344  ILE A N      1 
ATOM   2682  C  CA     . ILE A  1 344  ? 69.231  103.727 14.380  1.00 138.41 ?  344  ILE A CA     1 
ATOM   2683  C  C      . ILE A  1 344  ? 67.860  104.335 13.956  1.00 140.17 ?  344  ILE A C      1 
ATOM   2684  O  O      . ILE A  1 344  ? 67.730  105.560 13.820  1.00 140.51 ?  344  ILE A O      1 
ATOM   2685  C  CB     . ILE A  1 344  ? 69.777  104.396 15.638  1.00 143.57 ?  344  ILE A CB     1 
ATOM   2686  C  CG1    . ILE A  1 344  ? 71.173  103.857 15.949  1.00 144.62 ?  344  ILE A CG1    1 
ATOM   2687  C  CG2    . ILE A  1 344  ? 68.789  104.161 16.800  1.00 146.09 ?  344  ILE A CG2    1 
ATOM   2688  C  CD1    . ILE A  1 344  ? 71.842  104.544 17.026  1.00 147.54 ?  344  ILE A CD1    1 
ATOM   2689  N  N      . ALA A  1 345  ? 66.865  103.479 13.698  1.00 133.24 ?  345  ALA A N      1 
ATOM   2690  C  CA     . ALA A  1 345  ? 65.555  103.944 13.260  1.00 129.88 ?  345  ALA A CA     1 
ATOM   2691  C  C      . ALA A  1 345  ? 64.855  104.839 14.288  1.00 133.05 ?  345  ALA A C      1 
ATOM   2692  O  O      . ALA A  1 345  ? 65.049  104.669 15.488  1.00 134.38 ?  345  ALA A O      1 
ATOM   2693  C  CB     . ALA A  1 345  ? 64.675  102.757 12.930  1.00 129.32 ?  345  ALA A CB     1 
ATOM   2694  N  N      . ASN A  1 346  ? 64.038  105.788 13.799  1.00 127.38 ?  346  ASN A N      1 
ATOM   2695  C  CA     . ASN A  1 346  ? 63.209  106.668 14.631  1.00 127.63 ?  346  ASN A CA     1 
ATOM   2696  C  C      . ASN A  1 346  ? 61.906  105.964 15.029  1.00 127.48 ?  346  ASN A C      1 
ATOM   2697  O  O      . ASN A  1 346  ? 61.449  106.128 16.149  1.00 128.13 ?  346  ASN A O      1 
ATOM   2698  C  CB     . ASN A  1 346  ? 62.843  107.958 13.888  1.00 131.23 ?  346  ASN A CB     1 
ATOM   2699  C  CG     . ASN A  1 346  ? 63.985  108.865 13.544  1.00 159.34 ?  346  ASN A CG     1 
ATOM   2700  O  OD1    . ASN A  1 346  ? 64.414  109.671 14.369  1.00 151.34 ?  346  ASN A OD1    1 
ATOM   2701  N  ND2    . ASN A  1 346  ? 64.470  108.770 12.309  1.00 153.49 ?  346  ASN A ND2    1 
ATOM   2702  N  N      . PHE A  1 347  ? 61.274  105.232 14.102  1.00 120.99 ?  347  PHE A N      1 
ATOM   2703  C  CA     . PHE A  1 347  ? 59.984  104.621 14.382  1.00 120.52 ?  347  PHE A CA     1 
ATOM   2704  C  C      . PHE A  1 347  ? 59.711  103.279 13.647  1.00 121.01 ?  347  PHE A C      1 
ATOM   2705  O  O      . PHE A  1 347  ? 58.775  102.571 14.039  1.00 120.74 ?  347  PHE A O      1 
ATOM   2706  C  CB     . PHE A  1 347  ? 58.867  105.646 14.122  1.00 122.21 ?  347  PHE A CB     1 
ATOM   2707  C  CG     . PHE A  1 347  ? 58.617  106.026 12.684  1.00 121.83 ?  347  PHE A CG     1 
ATOM   2708  C  CD1    . PHE A  1 347  ? 59.388  106.996 12.058  1.00 123.46 ?  347  PHE A CD1    1 
ATOM   2709  C  CD2    . PHE A  1 347  ? 57.581  105.439 11.966  1.00 124.03 ?  347  PHE A CD2    1 
ATOM   2710  C  CE1    . PHE A  1 347  ? 59.169  107.331 10.722  1.00 122.84 ?  347  PHE A CE1    1 
ATOM   2711  C  CE2    . PHE A  1 347  ? 57.356  105.775 10.631  1.00 125.14 ?  347  PHE A CE2    1 
ATOM   2712  C  CZ     . PHE A  1 347  ? 58.152  106.718 10.016  1.00 122.28 ?  347  PHE A CZ     1 
ATOM   2713  N  N      . THR A  1 348  ? 60.511  102.916 12.620  1.00 114.80 ?  348  THR A N      1 
ATOM   2714  C  CA     . THR A  1 348  ? 60.364  101.616 11.970  1.00 113.68 ?  348  THR A CA     1 
ATOM   2715  C  C      . THR A  1 348  ? 60.578  100.541 13.050  1.00 119.80 ?  348  THR A C      1 
ATOM   2716  O  O      . THR A  1 348  ? 61.537  100.625 13.823  1.00 120.20 ?  348  THR A O      1 
ATOM   2717  C  CB     . THR A  1 348  ? 61.372  101.449 10.819  1.00 118.70 ?  348  THR A CB     1 
ATOM   2718  O  OG1    . THR A  1 348  ? 61.014  102.335 9.773   1.00 113.16 ?  348  THR A OG1    1 
ATOM   2719  C  CG2    . THR A  1 348  ? 61.410  100.024 10.253  1.00 117.01 ?  348  THR A CG2    1 
ATOM   2720  N  N      . ASN A  1 349  ? 59.660  99.556  13.114  1.00 117.16 ?  349  ASN A N      1 
ATOM   2721  C  CA     . ASN A  1 349  ? 59.738  98.469  14.086  1.00 118.56 ?  349  ASN A CA     1 
ATOM   2722  C  C      . ASN A  1 349  ? 60.768  97.466  13.590  1.00 121.77 ?  349  ASN A C      1 
ATOM   2723  O  O      . ASN A  1 349  ? 60.511  96.737  12.628  1.00 121.38 ?  349  ASN A O      1 
ATOM   2724  C  CB     . ASN A  1 349  ? 58.379  97.820  14.283  1.00 118.10 ?  349  ASN A CB     1 
ATOM   2725  C  CG     . ASN A  1 349  ? 58.359  96.757  15.343  1.00 138.31 ?  349  ASN A CG     1 
ATOM   2726  O  OD1    . ASN A  1 349  ? 59.388  96.213  15.717  1.00 129.32 ?  349  ASN A OD1    1 
ATOM   2727  N  ND2    . ASN A  1 349  ? 57.182  96.415  15.839  1.00 137.08 ?  349  ASN A ND2    1 
ATOM   2728  N  N      . VAL A  1 350  ? 61.934  97.438  14.243  1.00 117.60 ?  350  VAL A N      1 
ATOM   2729  C  CA     . VAL A  1 350  ? 63.046  96.586  13.830  1.00 116.57 ?  350  VAL A CA     1 
ATOM   2730  C  C      . VAL A  1 350  ? 62.729  95.100  14.025  1.00 121.05 ?  350  VAL A C      1 
ATOM   2731  O  O      . VAL A  1 350  ? 63.141  94.272  13.211  1.00 120.08 ?  350  VAL A O      1 
ATOM   2732  C  CB     . VAL A  1 350  ? 64.368  97.020  14.499  1.00 121.09 ?  350  VAL A CB     1 
ATOM   2733  C  CG1    . VAL A  1 350  ? 65.510  96.106  14.081  1.00 121.81 ?  350  VAL A CG1    1 
ATOM   2734  C  CG2    . VAL A  1 350  ? 64.694  98.475  14.169  1.00 119.08 ?  350  VAL A CG2    1 
ATOM   2735  N  N      . ALA A  1 351  ? 61.980  94.760  15.066  1.00 119.43 ?  351  ALA A N      1 
ATOM   2736  C  CA     . ALA A  1 351  ? 61.619  93.366  15.268  1.00 121.37 ?  351  ALA A CA     1 
ATOM   2737  C  C      . ALA A  1 351  ? 60.689  92.887  14.166  1.00 124.53 ?  351  ALA A C      1 
ATOM   2738  O  O      . ALA A  1 351  ? 60.935  91.824  13.594  1.00 124.88 ?  351  ALA A O      1 
ATOM   2739  C  CB     . ALA A  1 351  ? 60.965  93.186  16.617  1.00 125.06 ?  351  ALA A CB     1 
ATOM   2740  N  N      . ALA A  1 352  ? 59.648  93.685  13.837  1.00 120.30 ?  352  ALA A N      1 
ATOM   2741  C  CA     . ALA A  1 352  ? 58.677  93.331  12.797  1.00 119.33 ?  352  ALA A CA     1 
ATOM   2742  C  C      . ALA A  1 352  ? 59.335  93.193  11.420  1.00 122.08 ?  352  ALA A C      1 
ATOM   2743  O  O      . ALA A  1 352  ? 59.133  92.187  10.731  1.00 122.37 ?  352  ALA A O      1 
ATOM   2744  C  CB     . ALA A  1 352  ? 57.560  94.354  12.751  1.00 118.74 ?  352  ALA A CB     1 
ATOM   2745  N  N      . THR A  1 353  ? 60.142  94.186  11.033  1.00 116.75 ?  353  THR A N      1 
ATOM   2746  C  CA     . THR A  1 353  ? 60.839  94.138  9.756   1.00 114.93 ?  353  THR A CA     1 
ATOM   2747  C  C      . THR A  1 353  ? 61.849  92.990  9.708   1.00 122.05 ?  353  THR A C      1 
ATOM   2748  O  O      . THR A  1 353  ? 61.903  92.265  8.713   1.00 121.70 ?  353  THR A O      1 
ATOM   2749  C  CB     . THR A  1 353  ? 61.457  95.496  9.416   1.00 117.00 ?  353  THR A CB     1 
ATOM   2750  O  OG1    . THR A  1 353  ? 62.407  95.880  10.415  1.00 117.07 ?  353  THR A OG1    1 
ATOM   2751  C  CG2    . THR A  1 353  ? 60.399  96.581  9.194   1.00 111.89 ?  353  THR A CG2    1 
ATOM   2752  N  N      . PHE A  1 354  ? 62.623  92.788  10.786  1.00 121.75 ?  354  PHE A N      1 
ATOM   2753  C  CA     . PHE A  1 354  ? 63.606  91.702  10.786  1.00 123.83 ?  354  PHE A CA     1 
ATOM   2754  C  C      . PHE A  1 354  ? 62.961  90.317  10.824  1.00 126.03 ?  354  PHE A C      1 
ATOM   2755  O  O      . PHE A  1 354  ? 63.515  89.377  10.249  1.00 126.20 ?  354  PHE A O      1 
ATOM   2756  C  CB     . PHE A  1 354  ? 64.645  91.895  11.887  1.00 128.24 ?  354  PHE A CB     1 
ATOM   2757  C  CG     . PHE A  1 354  ? 65.776  92.817  11.491  1.00 130.38 ?  354  PHE A CG     1 
ATOM   2758  C  CD1    . PHE A  1 354  ? 65.665  93.658  10.381  1.00 132.60 ?  354  PHE A CD1    1 
ATOM   2759  C  CD2    . PHE A  1 354  ? 66.955  92.840  12.217  1.00 136.20 ?  354  PHE A CD2    1 
ATOM   2760  C  CE1    . PHE A  1 354  ? 66.720  94.492  10.005  1.00 134.03 ?  354  PHE A CE1    1 
ATOM   2761  C  CE2    . PHE A  1 354  ? 68.006  93.683  11.849  1.00 139.53 ?  354  PHE A CE2    1 
ATOM   2762  C  CZ     . PHE A  1 354  ? 67.887  94.495  10.739  1.00 135.64 ?  354  PHE A CZ     1 
ATOM   2763  N  N      . LYS A  1 355  ? 61.754  90.210  11.399  1.00 120.54 ?  355  LYS A N      1 
ATOM   2764  C  CA     . LYS A  1 355  ? 61.030  88.945  11.382  1.00 121.58 ?  355  LYS A CA     1 
ATOM   2765  C  C      . LYS A  1 355  ? 60.602  88.592  9.955   1.00 124.48 ?  355  LYS A C      1 
ATOM   2766  O  O      . LYS A  1 355  ? 60.646  87.415  9.580   1.00 126.28 ?  355  LYS A O      1 
ATOM   2767  C  CB     . LYS A  1 355  ? 59.831  88.985  12.319  1.00 124.34 ?  355  LYS A CB     1 
ATOM   2768  C  CG     . LYS A  1 355  ? 60.218  88.792  13.767  1.00 132.06 ?  355  LYS A CG     1 
ATOM   2769  C  CD     . LYS A  1 355  ? 59.060  89.091  14.711  1.00 136.00 ?  355  LYS A CD     1 
ATOM   2770  C  CE     . LYS A  1 355  ? 59.458  88.901  16.159  1.00 139.55 ?  355  LYS A CE     1 
ATOM   2771  N  NZ     . LYS A  1 355  ? 58.383  89.322  17.091  1.00 150.77 1  355  LYS A NZ     1 
ATOM   2772  N  N      . GLY A  1 356  ? 60.231  89.609  9.168   1.00 117.54 ?  356  GLY A N      1 
ATOM   2773  C  CA     . GLY A  1 356  ? 59.901  89.438  7.756   1.00 115.75 ?  356  GLY A CA     1 
ATOM   2774  C  C      . GLY A  1 356  ? 61.095  88.942  6.967   1.00 120.00 ?  356  GLY A C      1 
ATOM   2775  O  O      . GLY A  1 356  ? 60.970  87.989  6.194   1.00 120.46 ?  356  GLY A O      1 
ATOM   2776  N  N      . ILE A  1 357  ? 62.284  89.558  7.187   1.00 115.91 ?  357  ILE A N      1 
ATOM   2777  C  CA     . ILE A  1 357  ? 63.519  89.165  6.500   1.00 115.03 ?  357  ILE A CA     1 
ATOM   2778  C  C      . ILE A  1 357  ? 63.889  87.730  6.870   1.00 125.80 ?  357  ILE A C      1 
ATOM   2779  O  O      . ILE A  1 357  ? 64.218  86.931  5.986   1.00 126.48 ?  357  ILE A O      1 
ATOM   2780  C  CB     . ILE A  1 357  ? 64.660  90.145  6.808   1.00 115.10 ?  357  ILE A CB     1 
ATOM   2781  C  CG1    . ILE A  1 357  ? 64.296  91.554  6.388   1.00 111.39 ?  357  ILE A CG1    1 
ATOM   2782  C  CG2    . ILE A  1 357  ? 65.923  89.689  6.121   1.00 116.34 ?  357  ILE A CG2    1 
ATOM   2783  C  CD1    . ILE A  1 357  ? 65.305  92.618  6.705   1.00 116.15 ?  357  ILE A CD1    1 
ATOM   2784  N  N      . VAL A  1 358  ? 63.817  87.409  8.178   1.00 126.40 ?  358  VAL A N      1 
ATOM   2785  C  CA     . VAL A  1 358  ? 64.143  86.085  8.705   1.00 130.07 ?  358  VAL A CA     1 
ATOM   2786  C  C      . VAL A  1 358  ? 63.261  84.997  8.066   1.00 135.79 ?  358  VAL A C      1 
ATOM   2787  O  O      . VAL A  1 358  ? 63.745  83.905  7.737   1.00 138.28 ?  358  VAL A O      1 
ATOM   2788  C  CB     . VAL A  1 358  ? 64.066  86.103  10.242  1.00 135.37 ?  358  VAL A CB     1 
ATOM   2789  C  CG1    . VAL A  1 358  ? 63.902  84.700  10.808  1.00 139.15 ?  358  VAL A CG1    1 
ATOM   2790  C  CG2    . VAL A  1 358  ? 65.293  86.782  10.828  1.00 135.01 ?  358  VAL A CG2    1 
ATOM   2791  N  N      . ARG A  1 359  ? 61.975  85.306  7.879   1.00 130.28 ?  359  ARG A N      1 
ATOM   2792  C  CA     . ARG A  1 359  ? 61.058  84.368  7.259   1.00 131.09 ?  359  ARG A CA     1 
ATOM   2793  C  C      . ARG A  1 359  ? 61.494  84.100  5.811   1.00 135.51 ?  359  ARG A C      1 
ATOM   2794  O  O      . ARG A  1 359  ? 61.462  82.946  5.366   1.00 137.67 ?  359  ARG A O      1 
ATOM   2795  C  CB     . ARG A  1 359  ? 59.632  84.910  7.337   1.00 127.68 ?  359  ARG A CB     1 
ATOM   2796  C  CG     . ARG A  1 359  ? 58.562  83.932  6.860   1.00 135.50 ?  359  ARG A CG     1 
ATOM   2797  C  CD     . ARG A  1 359  ? 57.202  84.192  7.484   1.00 144.24 ?  359  ARG A CD     1 
ATOM   2798  N  NE     . ARG A  1 359  ? 56.636  85.512  7.171   1.00 149.89 ?  359  ARG A NE     1 
ATOM   2799  C  CZ     . ARG A  1 359  ? 55.956  85.800  6.064   1.00 158.70 ?  359  ARG A CZ     1 
ATOM   2800  N  NH1    . ARG A  1 359  ? 55.466  87.022  5.875   1.00 139.33 1  359  ARG A NH1    1 
ATOM   2801  N  NH2    . ARG A  1 359  ? 55.773  84.874  5.129   1.00 145.32 ?  359  ARG A NH2    1 
ATOM   2802  N  N      . ALA A  1 360  ? 61.932  85.156  5.092   1.00 129.16 ?  360  ALA A N      1 
ATOM   2803  C  CA     . ALA A  1 360  ? 62.426  84.994  3.727   1.00 128.62 ?  360  ALA A CA     1 
ATOM   2804  C  C      . ALA A  1 360  ? 63.710  84.167  3.726   1.00 134.99 ?  360  ALA A C      1 
ATOM   2805  O  O      . ALA A  1 360  ? 63.855  83.268  2.896   1.00 137.28 ?  360  ALA A O      1 
ATOM   2806  C  CB     . ALA A  1 360  ? 62.658  86.348  3.077   1.00 126.24 ?  360  ALA A CB     1 
ATOM   2807  N  N      . ILE A  1 361  ? 64.632  84.439  4.669   1.00 130.65 ?  361  ILE A N      1 
ATOM   2808  C  CA     . ILE A  1 361  ? 65.887  83.674  4.783   1.00 131.95 ?  361  ILE A CA     1 
ATOM   2809  C  C      . ILE A  1 361  ? 65.583  82.184  4.969   1.00 139.29 ?  361  ILE A C      1 
ATOM   2810  O  O      . ILE A  1 361  ? 66.192  81.345  4.308   1.00 140.12 ?  361  ILE A O      1 
ATOM   2811  C  CB     . ILE A  1 361  ? 66.802  84.236  5.899   1.00 133.80 ?  361  ILE A CB     1 
ATOM   2812  C  CG1    . ILE A  1 361  ? 67.313  85.635  5.537   1.00 130.38 ?  361  ILE A CG1    1 
ATOM   2813  C  CG2    . ILE A  1 361  ? 67.967  83.305  6.162   1.00 137.15 ?  361  ILE A CG2    1 
ATOM   2814  C  CD1    . ILE A  1 361  ? 67.980  86.363  6.693   1.00 132.18 ?  361  ILE A CD1    1 
ATOM   2815  N  N      . ARG A  1 362  ? 64.621  81.864  5.842   1.00 138.62 ?  362  ARG A N      1 
ATOM   2816  C  CA     . ARG A  1 362  ? 64.225  80.476  6.081   1.00 143.02 ?  362  ARG A CA     1 
ATOM   2817  C  C      . ARG A  1 362  ? 63.724  79.831  4.792   1.00 150.20 ?  362  ARG A C      1 
ATOM   2818  O  O      . ARG A  1 362  ? 64.130  78.713  4.467   1.00 151.72 ?  362  ARG A O      1 
ATOM   2819  C  CB     . ARG A  1 362  ? 63.146  80.383  7.184   1.00 143.30 ?  362  ARG A CB     1 
ATOM   2820  C  CG     . ARG A  1 362  ? 63.693  80.610  8.569   1.00 155.76 ?  362  ARG A CG     1 
ATOM   2821  C  CD     . ARG A  1 362  ? 62.665  80.570  9.677   1.00 170.19 ?  362  ARG A CD     1 
ATOM   2822  N  NE     . ARG A  1 362  ? 63.246  81.052  10.938  1.00 188.07 ?  362  ARG A NE     1 
ATOM   2823  C  CZ     . ARG A  1 362  ? 64.002  80.321  11.761  1.00 211.38 ?  362  ARG A CZ     1 
ATOM   2824  N  NH1    . ARG A  1 362  ? 64.493  80.856  12.871  1.00 196.72 1  362  ARG A NH1    1 
ATOM   2825  N  NH2    . ARG A  1 362  ? 64.276  79.053  11.475  1.00 207.25 ?  362  ARG A NH2    1 
ATOM   2826  N  N      . ASP A  1 363  ? 62.864  80.552  4.046   1.00 146.77 ?  363  ASP A N      1 
ATOM   2827  C  CA     . ASP A  1 363  ? 62.285  80.052  2.804   1.00 148.11 ?  363  ASP A CA     1 
ATOM   2828  C  C      . ASP A  1 363  ? 63.329  79.824  1.713   1.00 154.34 ?  363  ASP A C      1 
ATOM   2829  O  O      . ASP A  1 363  ? 63.148  78.946  0.868   1.00 156.41 ?  363  ASP A O      1 
ATOM   2830  C  CB     . ASP A  1 363  ? 61.141  80.968  2.342   1.00 147.05 ?  363  ASP A CB     1 
ATOM   2831  C  CG     . ASP A  1 363  ? 59.938  80.966  3.291   1.00 157.58 ?  363  ASP A CG     1 
ATOM   2832  O  OD1    . ASP A  1 363  ? 59.929  80.162  4.249   1.00 159.97 ?  363  ASP A OD1    1 
ATOM   2833  O  OD2    . ASP A  1 363  ? 59.000  81.752  3.064   1.00 162.99 -1 363  ASP A OD2    1 
ATOM   2834  N  N      . TYR A  1 364  ? 64.434  80.573  1.753   1.00 150.49 ?  364  TYR A N      1 
ATOM   2835  C  CA     . TYR A  1 364  ? 65.494  80.445  0.757   1.00 152.03 ?  364  TYR A CA     1 
ATOM   2836  C  C      . TYR A  1 364  ? 66.779  79.825  1.312   1.00 157.99 ?  364  TYR A C      1 
ATOM   2837  O  O      . TYR A  1 364  ? 67.817  79.932  0.665   1.00 157.81 ?  364  TYR A O      1 
ATOM   2838  C  CB     . TYR A  1 364  ? 65.791  81.824  0.144   1.00 150.77 ?  364  TYR A CB     1 
ATOM   2839  C  CG     . TYR A  1 364  ? 64.796  82.228  -0.917  1.00 153.07 ?  364  TYR A CG     1 
ATOM   2840  C  CD1    . TYR A  1 364  ? 63.588  82.828  -0.577  1.00 153.88 ?  364  TYR A CD1    1 
ATOM   2841  C  CD2    . TYR A  1 364  ? 65.054  82.003  -2.267  1.00 155.27 ?  364  TYR A CD2    1 
ATOM   2842  C  CE1    . TYR A  1 364  ? 62.652  83.180  -1.555  1.00 154.54 ?  364  TYR A CE1    1 
ATOM   2843  C  CE2    . TYR A  1 364  ? 64.131  82.358  -3.254  1.00 155.24 ?  364  TYR A CE2    1 
ATOM   2844  C  CZ     . TYR A  1 364  ? 62.928  82.940  -2.895  1.00 157.87 ?  364  TYR A CZ     1 
ATOM   2845  O  OH     . TYR A  1 364  ? 62.030  83.278  -3.879  1.00 153.02 ?  364  TYR A OH     1 
ATOM   2846  N  N      . GLN A  1 365  ? 66.728  79.158  2.475   1.00 156.11 ?  365  GLN A N      1 
ATOM   2847  C  CA     . GLN A  1 365  ? 67.948  78.641  3.091   1.00 158.09 ?  365  GLN A CA     1 
ATOM   2848  C  C      . GLN A  1 365  ? 68.753  77.667  2.190   1.00 165.09 ?  365  GLN A C      1 
ATOM   2849  O  O      . GLN A  1 365  ? 69.985  77.735  2.184   1.00 165.91 ?  365  GLN A O      1 
ATOM   2850  C  CB     . GLN A  1 365  ? 67.673  78.041  4.471   1.00 160.86 ?  365  GLN A CB     1 
ATOM   2851  C  CG     . GLN A  1 365  ? 66.801  76.807  4.461   1.00 167.91 ?  365  GLN A CG     1 
ATOM   2852  C  CD     . GLN A  1 365  ? 66.561  76.341  5.861   1.00 178.87 ?  365  GLN A CD     1 
ATOM   2853  O  OE1    . GLN A  1 365  ? 67.421  75.731  6.509   1.00 170.36 ?  365  GLN A OE1    1 
ATOM   2854  N  NE2    . GLN A  1 365  ? 65.384  76.638  6.363   1.00 176.47 ?  365  GLN A NE2    1 
ATOM   2855  N  N      . GLY A  1 366  ? 68.074  76.782  1.461   1.00 162.69 ?  366  GLY A N      1 
ATOM   2856  C  CA     . GLY A  1 366  ? 68.746  75.845  0.565   1.00 165.91 ?  366  GLY A CA     1 
ATOM   2857  C  C      . GLY A  1 366  ? 69.549  76.591  -0.483  1.00 167.95 ?  366  GLY A C      1 
ATOM   2858  O  O      . GLY A  1 366  ? 70.781  76.494  -0.513  1.00 169.26 ?  366  GLY A O      1 
ATOM   2859  N  N      . PRO A  1 367  ? 68.866  77.410  -1.311  1.00 161.28 ?  367  PRO A N      1 
ATOM   2860  C  CA     . PRO A  1 367  ? 69.577  78.215  -2.317  1.00 160.03 ?  367  PRO A CA     1 
ATOM   2861  C  C      . PRO A  1 367  ? 70.652  79.126  -1.737  1.00 162.91 ?  367  PRO A C      1 
ATOM   2862  O  O      . PRO A  1 367  ? 71.718  79.229  -2.336  1.00 163.93 ?  367  PRO A O      1 
ATOM   2863  C  CB     . PRO A  1 367  ? 68.458  79.032  -2.951  1.00 158.59 ?  367  PRO A CB     1 
ATOM   2864  C  CG     . PRO A  1 367  ? 67.275  78.166  -2.803  1.00 164.54 ?  367  PRO A CG     1 
ATOM   2865  C  CD     . PRO A  1 367  ? 67.407  77.577  -1.448  1.00 161.01 ?  367  PRO A CD     1 
ATOM   2866  N  N      . LEU A  1 368  ? 70.400  79.773  -0.581  1.00 157.48 ?  368  LEU A N      1 
ATOM   2867  C  CA     . LEU A  1 368  ? 71.413  80.635  0.048   1.00 155.83 ?  368  LEU A CA     1 
ATOM   2868  C  C      . LEU A  1 368  ? 72.662  79.859  0.420   1.00 161.07 ?  368  LEU A C      1 
ATOM   2869  O  O      . LEU A  1 368  ? 73.764  80.375  0.253   1.00 160.53 ?  368  LEU A O      1 
ATOM   2870  C  CB     . LEU A  1 368  ? 70.858  81.355  1.272   1.00 153.22 ?  368  LEU A CB     1 
ATOM   2871  C  CG     . LEU A  1 368  ? 69.793  82.380  0.961   1.00 154.91 ?  368  LEU A CG     1 
ATOM   2872  C  CD1    . LEU A  1 368  ? 69.137  82.882  2.235   1.00 153.90 ?  368  LEU A CD1    1 
ATOM   2873  C  CD2    . LEU A  1 368  ? 70.348  83.528  0.088   1.00 155.36 ?  368  LEU A CD2    1 
ATOM   2874  N  N      . LYS A  1 369  ? 72.496  78.612  0.896   1.00 159.50 ?  369  LYS A N      1 
ATOM   2875  C  CA     . LYS A  1 369  ? 73.637  77.770  1.236   1.00 162.78 ?  369  LYS A CA     1 
ATOM   2876  C  C      . LYS A  1 369  ? 74.351  77.324  -0.029  1.00 170.00 ?  369  LYS A C      1 
ATOM   2877  O  O      . LYS A  1 369  ? 75.578  77.430  -0.120  1.00 171.55 ?  369  LYS A O      1 
ATOM   2878  C  CB     . LYS A  1 369  ? 73.217  76.600  2.130   1.00 166.31 ?  369  LYS A CB     1 
ATOM   2879  C  CG     . LYS A  1 369  ? 73.096  77.037  3.596   1.00 163.24 ?  369  LYS A CG     1 
ATOM   2880  C  CD     . LYS A  1 369  ? 72.772  75.914  4.534   1.00 169.14 ?  369  LYS A CD     1 
ATOM   2881  C  CE     . LYS A  1 369  ? 71.349  75.460  4.371   1.00 174.96 ?  369  LYS A CE     1 
ATOM   2882  N  NZ     . LYS A  1 369  ? 70.924  74.571  5.481   1.00 184.69 1  369  LYS A NZ     1 
ATOM   2883  N  N      . GLU A  1 370  ? 73.569  76.940  -1.037  1.00 166.49 ?  370  GLU A N      1 
ATOM   2884  C  CA     . GLU A  1 370  ? 74.087  76.559  -2.339  1.00 168.67 ?  370  GLU A CA     1 
ATOM   2885  C  C      . GLU A  1 370  ? 74.907  77.677  -2.983  1.00 171.63 ?  370  GLU A C      1 
ATOM   2886  O  O      . GLU A  1 370  ? 75.913  77.391  -3.618  1.00 175.25 ?  370  GLU A O      1 
ATOM   2887  C  CB     . GLU A  1 370  ? 72.934  76.148  -3.254  1.00 169.87 ?  370  GLU A CB     1 
ATOM   2888  C  CG     . GLU A  1 370  ? 72.800  74.649  -3.327  1.00 186.04 ?  370  GLU A CG     1 
ATOM   2889  C  CD     . GLU A  1 370  ? 73.837  74.041  -4.262  1.00 217.82 ?  370  GLU A CD     1 
ATOM   2890  O  OE1    . GLU A  1 370  ? 73.744  74.309  -5.481  1.00 215.17 ?  370  GLU A OE1    1 
ATOM   2891  O  OE2    . GLU A  1 370  ? 74.770  73.354  -3.782  1.00 218.11 -1 370  GLU A OE2    1 
ATOM   2892  N  N      . HIS A  1 371  ? 74.508  78.947  -2.780  1.00 162.83 ?  371  HIS A N      1 
ATOM   2893  C  CA     . HIS A  1 371  ? 75.188  80.092  -3.375  1.00 160.09 ?  371  HIS A CA     1 
ATOM   2894  C  C      . HIS A  1 371  ? 76.232  80.722  -2.459  1.00 162.82 ?  371  HIS A C      1 
ATOM   2895  O  O      . HIS A  1 371  ? 76.780  81.779  -2.798  1.00 159.89 ?  371  HIS A O      1 
ATOM   2896  C  CB     . HIS A  1 371  ? 74.163  81.109  -3.877  1.00 156.16 ?  371  HIS A CB     1 
ATOM   2897  C  CG     . HIS A  1 371  ? 73.445  80.650  -5.120  1.00 160.33 ?  371  HIS A CG     1 
ATOM   2898  N  ND1    . HIS A  1 371  ? 72.409  79.729  -5.065  1.00 162.68 ?  371  HIS A ND1    1 
ATOM   2899  C  CD2    . HIS A  1 371  ? 73.648  80.986  -6.415  1.00 162.38 ?  371  HIS A CD2    1 
ATOM   2900  C  CE1    . HIS A  1 371  ? 72.011  79.549  -6.315  1.00 163.02 ?  371  HIS A CE1    1 
ATOM   2901  N  NE2    . HIS A  1 371  ? 72.729  80.276  -7.161  1.00 163.42 ?  371  HIS A NE2    1 
ATOM   2902  N  N      . GLU A  1 372  ? 76.552  80.042  -1.332  1.00 161.68 ?  372  GLU A N      1 
ATOM   2903  C  CA     . GLU A  1 372  ? 77.587  80.459  -0.378  1.00 162.36 ?  372  GLU A CA     1 
ATOM   2904  C  C      . GLU A  1 372  ? 77.442  81.931  0.021   1.00 163.84 ?  372  GLU A C      1 
ATOM   2905  O  O      . GLU A  1 372  ? 78.351  82.747  -0.152  1.00 162.28 ?  372  GLU A O      1 
ATOM   2906  C  CB     . GLU A  1 372  ? 78.984  80.197  -0.948  1.00 167.52 ?  372  GLU A CB     1 
ATOM   2907  C  CG     . GLU A  1 372  ? 79.344  78.736  -1.110  1.00 182.44 ?  372  GLU A CG     1 
ATOM   2908  C  CD     . GLU A  1 372  ? 80.692  78.501  -1.764  1.00 203.80 ?  372  GLU A CD     1 
ATOM   2909  O  OE1    . GLU A  1 372  ? 81.097  79.312  -2.630  1.00 205.07 ?  372  GLU A OE1    1 
ATOM   2910  O  OE2    . GLU A  1 372  ? 81.311  77.458  -1.455  1.00 192.17 -1 372  GLU A OE2    1 
ATOM   2911  N  N      . VAL A  1 373  ? 76.268  82.264  0.528   1.00 159.65 ?  373  VAL A N      1 
ATOM   2912  C  CA     . VAL A  1 373  ? 75.936  83.618  0.956   1.00 155.65 ?  373  VAL A CA     1 
ATOM   2913  C  C      . VAL A  1 373  ? 76.319  83.809  2.423   1.00 161.51 ?  373  VAL A C      1 
ATOM   2914  O  O      . VAL A  1 373  ? 76.026  82.952  3.264   1.00 162.64 ?  373  VAL A O      1 
ATOM   2915  C  CB     . VAL A  1 373  ? 74.433  83.928  0.699   1.00 154.99 ?  373  VAL A CB     1 
ATOM   2916  C  CG1    . VAL A  1 373  ? 74.026  85.291  1.264   1.00 150.66 ?  373  VAL A CG1    1 
ATOM   2917  C  CG2    . VAL A  1 373  ? 74.112  83.839  -0.789  1.00 154.61 ?  373  VAL A CG2    1 
ATOM   2918  N  N      . THR A  1 374  ? 77.003  84.924  2.709   1.00 157.59 ?  374  THR A N      1 
ATOM   2919  C  CA     . THR A  1 374  ? 77.314  85.364  4.062   1.00 157.43 ?  374  THR A CA     1 
ATOM   2920  C  C      . THR A  1 374  ? 76.532  86.664  4.285   1.00 157.97 ?  374  THR A C      1 
ATOM   2921  O  O      . THR A  1 374  ? 76.499  87.530  3.404   1.00 156.00 ?  374  THR A O      1 
ATOM   2922  C  CB     . THR A  1 374  ? 78.804  85.515  4.303   1.00 165.40 ?  374  THR A CB     1 
ATOM   2923  O  OG1    . THR A  1 374  ? 79.444  84.267  4.040   1.00 168.00 ?  374  THR A OG1    1 
ATOM   2924  C  CG2    . THR A  1 374  ? 79.102  85.921  5.732   1.00 163.70 ?  374  THR A CG2    1 
ATOM   2925  N  N      . ILE A  1 375  ? 75.873  86.779  5.444   1.00 152.60 ?  375  ILE A N      1 
ATOM   2926  C  CA     . ILE A  1 375  ? 75.023  87.919  5.766   1.00 147.60 ?  375  ILE A CA     1 
ATOM   2927  C  C      . ILE A  1 375  ? 75.634  88.749  6.880   1.00 151.43 ?  375  ILE A C      1 
ATOM   2928  O  O      . ILE A  1 375  ? 76.101  88.192  7.870   1.00 154.49 ?  375  ILE A O      1 
ATOM   2929  C  CB     . ILE A  1 375  ? 73.595  87.432  6.127   1.00 148.68 ?  375  ILE A CB     1 
ATOM   2930  C  CG1    . ILE A  1 375  ? 73.009  86.556  4.993   1.00 149.04 ?  375  ILE A CG1    1 
ATOM   2931  C  CG2    . ILE A  1 375  ? 72.675  88.616  6.465   1.00 145.45 ?  375  ILE A CG2    1 
ATOM   2932  C  CD1    . ILE A  1 375  ? 71.672  85.919  5.261   1.00 156.18 ?  375  ILE A CD1    1 
ATOM   2933  N  N      . PHE A  1 376  ? 75.629  90.081  6.720   1.00 144.13 ?  376  PHE A N      1 
ATOM   2934  C  CA     . PHE A  1 376  ? 76.104  91.025  7.734   1.00 143.17 ?  376  PHE A CA     1 
ATOM   2935  C  C      . PHE A  1 376  ? 74.964  91.947  8.096   1.00 141.76 ?  376  PHE A C      1 
ATOM   2936  O  O      . PHE A  1 376  ? 74.298  92.465  7.210   1.00 138.61 ?  376  PHE A O      1 
ATOM   2937  C  CB     . PHE A  1 376  ? 77.329  91.813  7.258   1.00 145.49 ?  376  PHE A CB     1 
ATOM   2938  C  CG     . PHE A  1 376  ? 78.554  90.954  7.110   1.00 150.58 ?  376  PHE A CG     1 
ATOM   2939  C  CD1    . PHE A  1 376  ? 78.723  90.148  5.992   1.00 154.52 ?  376  PHE A CD1    1 
ATOM   2940  C  CD2    . PHE A  1 376  ? 79.534  90.940  8.094   1.00 155.74 ?  376  PHE A CD2    1 
ATOM   2941  C  CE1    . PHE A  1 376  ? 79.853  89.352  5.854   1.00 159.40 ?  376  PHE A CE1    1 
ATOM   2942  C  CE2    . PHE A  1 376  ? 80.668  90.140  7.957   1.00 162.51 ?  376  PHE A CE2    1 
ATOM   2943  C  CZ     . PHE A  1 376  ? 80.822  89.355  6.836   1.00 161.47 ?  376  PHE A CZ     1 
ATOM   2944  N  N      . VAL A  1 377  ? 74.716  92.118  9.394   1.00 137.99 ?  377  VAL A N      1 
ATOM   2945  C  CA     . VAL A  1 377  ? 73.600  92.896  9.911   1.00 135.21 ?  377  VAL A CA     1 
ATOM   2946  C  C      . VAL A  1 377  ? 74.089  94.000  10.855  1.00 139.39 ?  377  VAL A C      1 
ATOM   2947  O  O      . VAL A  1 377  ? 74.907  93.731  11.738  1.00 142.87 ?  377  VAL A O      1 
ATOM   2948  C  CB     . VAL A  1 377  ? 72.569  91.962  10.641  1.00 139.26 ?  377  VAL A CB     1 
ATOM   2949  C  CG1    . VAL A  1 377  ? 71.370  92.743  11.177  1.00 136.56 ?  377  VAL A CG1    1 
ATOM   2950  C  CG2    . VAL A  1 377  ? 72.105  90.805  9.753   1.00 138.97 ?  377  VAL A CG2    1 
ATOM   2951  N  N      . ARG A  1 378  ? 73.558  95.224  10.696  1.00 131.28 ?  378  ARG A N      1 
ATOM   2952  C  CA     . ARG A  1 378  ? 73.774  96.322  11.637  1.00 130.22 ?  378  ARG A CA     1 
ATOM   2953  C  C      . ARG A  1 378  ? 72.503  97.129  11.680  1.00 131.01 ?  378  ARG A C      1 
ATOM   2954  O  O      . ARG A  1 378  ? 72.085  97.663  10.650  1.00 127.99 ?  378  ARG A O      1 
ATOM   2955  C  CB     . ARG A  1 378  ? 74.992  97.211  11.310  1.00 127.37 ?  378  ARG A CB     1 
ATOM   2956  C  CG     . ARG A  1 378  ? 75.356  98.204  12.433  1.00 126.25 ?  378  ARG A CG     1 
ATOM   2957  C  CD     . ARG A  1 378  ? 74.515  99.478  12.438  1.00 123.90 ?  378  ARG A CD     1 
ATOM   2958  N  NE     . ARG A  1 378  ? 75.016  100.441 13.418  1.00 132.49 ?  378  ARG A NE     1 
ATOM   2959  C  CZ     . ARG A  1 378  ? 74.584  101.693 13.562  1.00 145.73 ?  378  ARG A CZ     1 
ATOM   2960  N  NH1    . ARG A  1 378  ? 73.601  102.160 12.794  1.00 133.47 1  378  ARG A NH1    1 
ATOM   2961  N  NH2    . ARG A  1 378  ? 75.133  102.488 14.475  1.00 126.80 ?  378  ARG A NH2    1 
ATOM   2962  N  N      . ARG A  1 379  ? 71.906  97.256  12.870  1.00 128.63 ?  379  ARG A N      1 
ATOM   2963  C  CA     . ARG A  1 379  ? 70.672  98.009  13.015  1.00 126.87 ?  379  ARG A CA     1 
ATOM   2964  C  C      . ARG A  1 379  ? 70.405  98.422  14.445  1.00 133.14 ?  379  ARG A C      1 
ATOM   2965  O  O      . ARG A  1 379  ? 70.732  97.681  15.373  1.00 134.71 ?  379  ARG A O      1 
ATOM   2966  C  CB     . ARG A  1 379  ? 69.489  97.156  12.505  1.00 125.14 ?  379  ARG A CB     1 
ATOM   2967  C  CG     . ARG A  1 379  ? 68.155  97.886  12.368  1.00 132.91 ?  379  ARG A CG     1 
ATOM   2968  C  CD     . ARG A  1 379  ? 68.135  99.009  11.327  1.00 137.62 ?  379  ARG A CD     1 
ATOM   2969  N  NE     . ARG A  1 379  ? 66.766  99.220  10.869  1.00 140.91 ?  379  ARG A NE     1 
ATOM   2970  C  CZ     . ARG A  1 379  ? 66.257  100.376 10.469  1.00 142.87 ?  379  ARG A CZ     1 
ATOM   2971  N  NH1    . ARG A  1 379  ? 67.005  101.472 10.465  1.00 124.86 1  379  ARG A NH1    1 
ATOM   2972  N  NH2    . ARG A  1 379  ? 64.991  100.447 10.079  1.00 122.08 ?  379  ARG A NH2    1 
ATOM   2973  N  N      . GLY A  1 380  ? 69.786  99.588  14.592  1.00 129.65 ?  380  GLY A N      1 
ATOM   2974  C  CA     . GLY A  1 380  ? 69.249  100.095 15.843  1.00 131.88 ?  380  GLY A CA     1 
ATOM   2975  C  C      . GLY A  1 380  ? 67.827  100.568 15.609  1.00 136.65 ?  380  GLY A C      1 
ATOM   2976  O  O      . GLY A  1 380  ? 67.369  100.641 14.457  1.00 134.61 ?  380  GLY A O      1 
ATOM   2977  N  N      . GLY A  1 381  ? 67.140  100.914 16.694  1.00 135.65 ?  381  GLY A N      1 
ATOM   2978  C  CA     . GLY A  1 381  ? 65.782  101.430 16.622  1.00 134.67 ?  381  GLY A CA     1 
ATOM   2979  C  C      . GLY A  1 381  ? 64.785  100.665 17.462  1.00 142.47 ?  381  GLY A C      1 
ATOM   2980  O  O      . GLY A  1 381  ? 65.179  99.810  18.266  1.00 146.24 ?  381  GLY A O      1 
ATOM   2981  N  N      . PRO A  1 382  ? 63.469  100.969 17.290  1.00 137.77 ?  382  PRO A N      1 
ATOM   2982  C  CA     . PRO A  1 382  ? 62.434  100.296 18.103  1.00 139.14 ?  382  PRO A CA     1 
ATOM   2983  C  C      . PRO A  1 382  ? 62.466  98.772  18.058  1.00 143.86 ?  382  PRO A C      1 
ATOM   2984  O  O      . PRO A  1 382  ? 62.357  98.188  16.976  1.00 142.70 ?  382  PRO A O      1 
ATOM   2985  C  CB     . PRO A  1 382  ? 61.121  100.849 17.543  1.00 138.67 ?  382  PRO A CB     1 
ATOM   2986  C  CG     . PRO A  1 382  ? 61.480  102.166 16.985  1.00 141.74 ?  382  PRO A CG     1 
ATOM   2987  C  CD     . PRO A  1 382  ? 62.869  102.010 16.426  1.00 136.82 ?  382  PRO A CD     1 
ATOM   2988  N  N      . ASN A  1 383  ? 62.621  98.131  19.241  1.00 141.20 ?  383  ASN A N      1 
ATOM   2989  C  CA     . ASN A  1 383  ? 62.661  96.672  19.388  1.00 140.98 ?  383  ASN A CA     1 
ATOM   2990  C  C      . ASN A  1 383  ? 63.827  96.032  18.639  1.00 142.56 ?  383  ASN A C      1 
ATOM   2991  O  O      . ASN A  1 383  ? 63.724  94.863  18.245  1.00 142.41 ?  383  ASN A O      1 
ATOM   2992  C  CB     . ASN A  1 383  ? 61.345  96.036  18.925  1.00 136.62 ?  383  ASN A CB     1 
ATOM   2993  C  CG     . ASN A  1 383  ? 60.124  96.585  19.591  1.00 158.79 ?  383  ASN A CG     1 
ATOM   2994  O  OD1    . ASN A  1 383  ? 60.077  96.799  20.811  1.00 150.44 ?  383  ASN A OD1    1 
ATOM   2995  N  ND2    . ASN A  1 383  ? 59.106  96.833  18.789  1.00 152.53 ?  383  ASN A ND2    1 
ATOM   2996  N  N      . TYR A  1 384  ? 64.953  96.764  18.468  1.00 136.63 ?  384  TYR A N      1 
ATOM   2997  C  CA     . TYR A  1 384  ? 66.109  96.241  17.744  1.00 134.68 ?  384  TYR A CA     1 
ATOM   2998  C  C      . TYR A  1 384  ? 66.729  95.011  18.414  1.00 139.53 ?  384  TYR A C      1 
ATOM   2999  O  O      . TYR A  1 384  ? 67.260  94.146  17.729  1.00 138.33 ?  384  TYR A O      1 
ATOM   3000  C  CB     . TYR A  1 384  ? 67.150  97.340  17.493  1.00 135.11 ?  384  TYR A CB     1 
ATOM   3001  C  CG     . TYR A  1 384  ? 68.094  97.591  18.649  1.00 140.65 ?  384  TYR A CG     1 
ATOM   3002  C  CD1    . TYR A  1 384  ? 67.708  98.371  19.733  1.00 144.21 ?  384  TYR A CD1    1 
ATOM   3003  C  CD2    . TYR A  1 384  ? 69.386  97.069  18.648  1.00 143.99 ?  384  TYR A CD2    1 
ATOM   3004  C  CE1    . TYR A  1 384  ? 68.580  98.609  20.799  1.00 148.90 ?  384  TYR A CE1    1 
ATOM   3005  C  CE2    . TYR A  1 384  ? 70.269  97.307  19.702  1.00 148.86 ?  384  TYR A CE2    1 
ATOM   3006  C  CZ     . TYR A  1 384  ? 69.861  98.071  20.782  1.00 157.66 ?  384  TYR A CZ     1 
ATOM   3007  O  OH     . TYR A  1 384  ? 70.746  98.276  21.823  1.00 161.50 ?  384  TYR A OH     1 
ATOM   3008  N  N      . GLN A  1 385  ? 66.631  94.922  19.744  1.00 138.05 ?  385  GLN A N      1 
ATOM   3009  C  CA     . GLN A  1 385  ? 67.158  93.819  20.541  1.00 140.58 ?  385  GLN A CA     1 
ATOM   3010  C  C      . GLN A  1 385  ? 66.573  92.499  20.042  1.00 142.29 ?  385  GLN A C      1 
ATOM   3011  O  O      . GLN A  1 385  ? 67.306  91.553  19.735  1.00 141.42 ?  385  GLN A O      1 
ATOM   3012  C  CB     . GLN A  1 385  ? 66.825  94.060  22.039  1.00 145.33 ?  385  GLN A CB     1 
ATOM   3013  C  CG     . GLN A  1 385  ? 67.324  95.396  22.616  1.00 153.11 ?  385  GLN A CG     1 
ATOM   3014  C  CD     . GLN A  1 385  ? 66.338  96.552  22.557  1.00 167.24 ?  385  GLN A CD     1 
ATOM   3015  O  OE1    . GLN A  1 385  ? 65.459  96.659  21.685  1.00 157.17 ?  385  GLN A OE1    1 
ATOM   3016  N  NE2    . GLN A  1 385  ? 66.508  97.498  23.463  1.00 163.97 ?  385  GLN A NE2    1 
ATOM   3017  N  N      . GLU A  1 386  ? 65.246  92.460  19.929  1.00 138.64 ?  386  GLU A N      1 
ATOM   3018  C  CA     . GLU A  1 386  ? 64.533  91.296  19.429  1.00 138.96 ?  386  GLU A CA     1 
ATOM   3019  C  C      . GLU A  1 386  ? 64.846  91.051  17.944  1.00 139.86 ?  386  GLU A C      1 
ATOM   3020  O  O      . GLU A  1 386  ? 65.008  89.903  17.529  1.00 140.04 ?  386  GLU A O      1 
ATOM   3021  C  CB     . GLU A  1 386  ? 63.020  91.436  19.702  1.00 139.96 ?  386  GLU A CB     1 
ATOM   3022  C  CG     . GLU A  1 386  ? 62.163  90.275  19.239  1.00 154.23 ?  386  GLU A CG     1 
ATOM   3023  C  CD     . GLU A  1 386  ? 62.524  88.895  19.766  1.00 208.58 ?  386  GLU A CD     1 
ATOM   3024  O  OE1    . GLU A  1 386  ? 63.357  88.781  20.698  1.00 222.82 ?  386  GLU A OE1    1 
ATOM   3025  O  OE2    . GLU A  1 386  ? 61.937  87.917  19.250  1.00 216.41 -1 386  GLU A OE2    1 
ATOM   3026  N  N      . GLY A  1 387  ? 64.954  92.124  17.168  1.00 133.38 ?  387  GLY A N      1 
ATOM   3027  C  CA     . GLY A  1 387  ? 65.312  92.013  15.761  1.00 130.82 ?  387  GLY A CA     1 
ATOM   3028  C  C      . GLY A  1 387  ? 66.647  91.321  15.581  1.00 137.50 ?  387  GLY A C      1 
ATOM   3029  O  O      . GLY A  1 387  ? 66.776  90.397  14.768  1.00 136.67 ?  387  GLY A O      1 
ATOM   3030  N  N      . LEU A  1 388  ? 67.645  91.735  16.376  1.00 136.88 ?  388  LEU A N      1 
ATOM   3031  C  CA     . LEU A  1 388  ? 68.977  91.145  16.309  1.00 138.83 ?  388  LEU A CA     1 
ATOM   3032  C  C      . LEU A  1 388  ? 68.959  89.695  16.757  1.00 145.13 ?  388  LEU A C      1 
ATOM   3033  O  O      . LEU A  1 388  ? 69.630  88.866  16.139  1.00 144.94 ?  388  LEU A O      1 
ATOM   3034  C  CB     . LEU A  1 388  ? 69.988  91.965  17.122  1.00 140.69 ?  388  LEU A CB     1 
ATOM   3035  C  CG     . LEU A  1 388  ? 70.223  93.448  16.709  1.00 142.75 ?  388  LEU A CG     1 
ATOM   3036  C  CD1    . LEU A  1 388  ? 71.412  94.017  17.438  1.00 146.05 ?  388  LEU A CD1    1 
ATOM   3037  C  CD2    . LEU A  1 388  ? 70.423  93.631  15.185  1.00 140.39 ?  388  LEU A CD2    1 
ATOM   3038  N  N      . ARG A  1 389  ? 68.159  89.377  17.797  1.00 143.39 ?  389  ARG A N      1 
ATOM   3039  C  CA     . ARG A  1 389  ? 68.033  88.003  18.302  1.00 145.63 ?  389  ARG A CA     1 
ATOM   3040  C  C      . ARG A  1 389  ? 67.529  87.047  17.227  1.00 149.23 ?  389  ARG A C      1 
ATOM   3041  O  O      . ARG A  1 389  ? 68.098  85.971  17.056  1.00 150.16 ?  389  ARG A O      1 
ATOM   3042  C  CB     . ARG A  1 389  ? 67.121  87.938  19.536  1.00 143.92 ?  389  ARG A CB     1 
ATOM   3043  C  CG     . ARG A  1 389  ? 67.173  86.585  20.229  1.00 151.31 ?  389  ARG A CG     1 
ATOM   3044  C  CD     . ARG A  1 389  ? 66.114  86.414  21.304  1.00 164.26 ?  389  ARG A CD     1 
ATOM   3045  N  NE     . ARG A  1 389  ? 64.766  86.330  20.740  1.00 168.40 ?  389  ARG A NE     1 
ATOM   3046  C  CZ     . ARG A  1 389  ? 64.228  85.232  20.213  1.00 179.16 ?  389  ARG A CZ     1 
ATOM   3047  N  NH1    . ARG A  1 389  ? 64.915  84.095  20.182  1.00 167.72 1  389  ARG A NH1    1 
ATOM   3048  N  NH2    . ARG A  1 389  ? 63.001  85.265  19.708  1.00 159.74 ?  389  ARG A NH2    1 
ATOM   3049  N  N      . VAL A  1 390  ? 66.466  87.432  16.505  1.00 144.90 ?  390  VAL A N      1 
ATOM   3050  C  CA     . VAL A  1 390  ? 65.891  86.552  15.482  1.00 144.58 ?  390  VAL A CA     1 
ATOM   3051  C  C      . VAL A  1 390  ? 66.844  86.353  14.310  1.00 151.13 ?  390  VAL A C      1 
ATOM   3052  O  O      . VAL A  1 390  ? 66.838  85.281  13.704  1.00 151.47 ?  390  VAL A O      1 
ATOM   3053  C  CB     . VAL A  1 390  ? 64.468  86.951  15.028  1.00 144.98 ?  390  VAL A CB     1 
ATOM   3054  C  CG1    . VAL A  1 390  ? 63.485  86.896  16.188  1.00 146.48 ?  390  VAL A CG1    1 
ATOM   3055  C  CG2    . VAL A  1 390  ? 64.435  88.319  14.370  1.00 140.88 ?  390  VAL A CG2    1 
ATOM   3056  N  N      . MET A  1 391  ? 67.681  87.366  14.012  1.00 149.20 ?  391  MET A N      1 
ATOM   3057  C  CA     . MET A  1 391  ? 68.686  87.266  12.958  1.00 149.73 ?  391  MET A CA     1 
ATOM   3058  C  C      . MET A  1 391  ? 69.752  86.267  13.335  1.00 158.52 ?  391  MET A C      1 
ATOM   3059  O  O      . MET A  1 391  ? 70.112  85.407  12.525  1.00 158.68 ?  391  MET A O      1 
ATOM   3060  C  CB     . MET A  1 391  ? 69.310  88.628  12.686  1.00 150.27 ?  391  MET A CB     1 
ATOM   3061  C  CG     . MET A  1 391  ? 68.442  89.491  11.833  1.00 150.99 ?  391  MET A CG     1 
ATOM   3062  S  SD     . MET A  1 391  ? 68.389  88.979  10.094  1.00 154.55 ?  391  MET A SD     1 
ATOM   3063  C  CE     . MET A  1 391  ? 67.332  90.190  9.471   1.00 147.49 ?  391  MET A CE     1 
ATOM   3064  N  N      . GLY A  1 392  ? 70.236  86.376  14.567  1.00 159.41 ?  392  GLY A N      1 
ATOM   3065  C  CA     . GLY A  1 392  ? 71.231  85.456  15.098  1.00 164.20 ?  392  GLY A CA     1 
ATOM   3066  C  C      . GLY A  1 392  ? 70.710  84.035  15.136  1.00 171.30 ?  392  GLY A C      1 
ATOM   3067  O  O      . GLY A  1 392  ? 71.424  83.099  14.765  1.00 173.14 ?  392  GLY A O      1 
ATOM   3068  N  N      . GLU A  1 393  ? 69.441  83.874  15.534  1.00 168.28 ?  393  GLU A N      1 
ATOM   3069  C  CA     . GLU A  1 393  ? 68.810  82.566  15.642  1.00 171.09 ?  393  GLU A CA     1 
ATOM   3070  C  C      . GLU A  1 393  ? 68.639  81.874  14.295  1.00 175.24 ?  393  GLU A C      1 
ATOM   3071  O  O      . GLU A  1 393  ? 68.934  80.679  14.185  1.00 178.24 ?  393  GLU A O      1 
ATOM   3072  C  CB     . GLU A  1 393  ? 67.475  82.675  16.386  1.00 172.12 ?  393  GLU A CB     1 
ATOM   3073  C  CG     . GLU A  1 393  ? 67.123  81.414  17.146  1.00 188.86 ?  393  GLU A CG     1 
ATOM   3074  C  CD     . GLU A  1 393  ? 68.082  81.006  18.252  1.00 219.23 ?  393  GLU A CD     1 
ATOM   3075  O  OE1    . GLU A  1 393  ? 68.130  79.796  18.573  1.00 219.40 ?  393  GLU A OE1    1 
ATOM   3076  O  OE2    . GLU A  1 393  ? 68.790  81.888  18.794  1.00 215.18 -1 393  GLU A OE2    1 
ATOM   3077  N  N      . VAL A  1 394  ? 68.192  82.617  13.268  1.00 168.27 ?  394  VAL A N      1 
ATOM   3078  C  CA     . VAL A  1 394  ? 68.012  82.028  11.943  1.00 167.23 ?  394  VAL A CA     1 
ATOM   3079  C  C      . VAL A  1 394  ? 69.347  81.537  11.372  1.00 171.80 ?  394  VAL A C      1 
ATOM   3080  O  O      . VAL A  1 394  ? 69.370  80.536  10.662  1.00 173.72 ?  394  VAL A O      1 
ATOM   3081  C  CB     . VAL A  1 394  ? 67.225  82.921  10.955  1.00 166.98 ?  394  VAL A CB     1 
ATOM   3082  C  CG1    . VAL A  1 394  ? 68.087  84.022  10.340  1.00 164.12 ?  394  VAL A CG1    1 
ATOM   3083  C  CG2    . VAL A  1 394  ? 66.611  82.073  9.865   1.00 167.13 ?  394  VAL A CG2    1 
ATOM   3084  N  N      . GLY A  1 395  ? 70.438  82.223  11.704  1.00 166.32 ?  395  GLY A N      1 
ATOM   3085  C  CA     . GLY A  1 395  ? 71.762  81.793  11.285  1.00 167.38 ?  395  GLY A CA     1 
ATOM   3086  C  C      . GLY A  1 395  ? 72.104  80.457  11.909  1.00 173.16 ?  395  GLY A C      1 
ATOM   3087  O  O      . GLY A  1 395  ? 72.542  79.535  11.216  1.00 174.48 ?  395  GLY A O      1 
ATOM   3088  N  N      . LYS A  1 396  ? 71.846  80.329  13.217  1.00 170.19 ?  396  LYS A N      1 
ATOM   3089  C  CA     . LYS A  1 396  ? 72.108  79.090  13.944  1.00 174.59 ?  396  LYS A CA     1 
ATOM   3090  C  C      . LYS A  1 396  ? 71.307  77.919  13.388  1.00 178.28 ?  396  LYS A C      1 
ATOM   3091  O  O      . LYS A  1 396  ? 71.877  76.858  13.131  1.00 180.76 ?  396  LYS A O      1 
ATOM   3092  C  CB     . LYS A  1 396  ? 71.836  79.271  15.447  1.00 178.75 ?  396  LYS A CB     1 
ATOM   3093  C  CG     . LYS A  1 396  ? 72.834  80.198  16.146  1.00 189.21 ?  396  LYS A CG     1 
ATOM   3094  C  CD     . LYS A  1 396  ? 72.252  80.801  17.414  1.00 192.85 ?  396  LYS A CD     1 
ATOM   3095  C  CE     . LYS A  1 396  ? 73.038  82.002  17.886  1.00 191.21 ?  396  LYS A CE     1 
ATOM   3096  N  NZ     . LYS A  1 396  ? 72.255  82.825  18.845  1.00 192.67 1  396  LYS A NZ     1 
ATOM   3097  N  N      . THR A  1 397  ? 70.004  78.117  13.177  1.00 171.88 ?  397  THR A N      1 
ATOM   3098  C  CA     . THR A  1 397  ? 69.120  77.042  12.723  1.00 172.99 ?  397  THR A CA     1 
ATOM   3099  C  C      . THR A  1 397  ? 69.355  76.612  11.285  1.00 175.88 ?  397  THR A C      1 
ATOM   3100  O  O      . THR A  1 397  ? 69.200  75.435  10.967  1.00 177.93 ?  397  THR A O      1 
ATOM   3101  C  CB     . THR A  1 397  ? 67.657  77.404  12.954  1.00 179.77 ?  397  THR A CB     1 
ATOM   3102  O  OG1    . THR A  1 397  ? 67.331  78.570  12.191  1.00 178.59 ?  397  THR A OG1    1 
ATOM   3103  C  CG2    . THR A  1 397  ? 67.345  77.626  14.418  1.00 178.10 ?  397  THR A CG2    1 
ATOM   3104  N  N      . THR A  1 398  ? 69.692  77.554  10.408  1.00 169.22 ?  398  THR A N      1 
ATOM   3105  C  CA     . THR A  1 398  ? 69.891  77.225  8.997   1.00 168.55 ?  398  THR A CA     1 
ATOM   3106  C  C      . THR A  1 398  ? 71.314  76.835  8.667   1.00 173.29 ?  398  THR A C      1 
ATOM   3107  O  O      . THR A  1 398  ? 71.541  76.198  7.639   1.00 174.20 ?  398  THR A O      1 
ATOM   3108  C  CB     . THR A  1 398  ? 69.511  78.408  8.105   1.00 173.84 ?  398  THR A CB     1 
ATOM   3109  O  OG1    . THR A  1 398  ? 70.427  79.482  8.344   1.00 173.45 ?  398  THR A OG1    1 
ATOM   3110  C  CG2    . THR A  1 398  ? 68.092  78.861  8.323   1.00 169.34 ?  398  THR A CG2    1 
ATOM   3111  N  N      . GLY A  1 399  ? 72.262  77.293  9.476   1.00 168.83 ?  399  GLY A N      1 
ATOM   3112  C  CA     . GLY A  1 399  ? 73.672  77.090  9.187   1.00 170.49 ?  399  GLY A CA     1 
ATOM   3113  C  C      . GLY A  1 399  ? 74.239  78.145  8.254   1.00 169.17 ?  399  GLY A C      1 
ATOM   3114  O  O      . GLY A  1 399  ? 75.393  78.035  7.835   1.00 170.00 ?  399  GLY A O      1 
ATOM   3115  N  N      . ILE A  1 400  ? 73.447  79.178  7.920   1.00 160.83 ?  400  ILE A N      1 
ATOM   3116  C  CA     . ILE A  1 400  ? 73.930  80.288  7.098   1.00 157.51 ?  400  ILE A CA     1 
ATOM   3117  C  C      . ILE A  1 400  ? 74.779  81.190  7.995   1.00 161.73 ?  400  ILE A C      1 
ATOM   3118  O  O      . ILE A  1 400  ? 74.311  81.568  9.077   1.00 160.56 ?  400  ILE A O      1 
ATOM   3119  C  CB     . ILE A  1 400  ? 72.769  81.085  6.458   1.00 155.92 ?  400  ILE A CB     1 
ATOM   3120  C  CG1    . ILE A  1 400  ? 72.009  80.214  5.458   1.00 156.28 ?  400  ILE A CG1    1 
ATOM   3121  C  CG2    . ILE A  1 400  ? 73.278  82.389  5.784   1.00 154.85 ?  400  ILE A CG2    1 
ATOM   3122  C  CD1    . ILE A  1 400  ? 70.597  80.642  5.228   1.00 156.13 ?  400  ILE A CD1    1 
ATOM   3123  N  N      . PRO A  1 401  ? 76.008  81.571  7.575   1.00 159.40 ?  401  PRO A N      1 
ATOM   3124  C  CA     . PRO A  1 401  ? 76.794  82.490  8.412   1.00 159.30 ?  401  PRO A CA     1 
ATOM   3125  C  C      . PRO A  1 401  ? 76.164  83.887  8.424   1.00 158.75 ?  401  PRO A C      1 
ATOM   3126  O  O      . PRO A  1 401  ? 75.962  84.483  7.368   1.00 156.48 ?  401  PRO A O      1 
ATOM   3127  C  CB     . PRO A  1 401  ? 78.187  82.488  7.762   1.00 163.03 ?  401  PRO A CB     1 
ATOM   3128  C  CG     . PRO A  1 401  ? 78.127  81.515  6.642   1.00 168.52 ?  401  PRO A CG     1 
ATOM   3129  C  CD     . PRO A  1 401  ? 76.711  81.250  6.315   1.00 161.72 ?  401  PRO A CD     1 
ATOM   3130  N  N      . ILE A  1 402  ? 75.798  84.375  9.615   1.00 153.44 ?  402  ILE A N      1 
ATOM   3131  C  CA     . ILE A  1 402  ? 75.189  85.691  9.807   1.00 148.86 ?  402  ILE A CA     1 
ATOM   3132  C  C      . ILE A  1 402  ? 75.903  86.389  10.960  1.00 157.62 ?  402  ILE A C      1 
ATOM   3133  O  O      . ILE A  1 402  ? 75.981  85.834  12.058  1.00 161.29 ?  402  ILE A O      1 
ATOM   3134  C  CB     . ILE A  1 402  ? 73.659  85.604  10.034  1.00 148.56 ?  402  ILE A CB     1 
ATOM   3135  C  CG1    . ILE A  1 402  ? 72.980  84.772  8.932   1.00 147.48 ?  402  ILE A CG1    1 
ATOM   3136  C  CG2    . ILE A  1 402  ? 73.035  87.013  10.156  1.00 145.30 ?  402  ILE A CG2    1 
ATOM   3137  C  CD1    . ILE A  1 402  ? 71.494  84.639  9.040   1.00 147.25 ?  402  ILE A CD1    1 
ATOM   3138  N  N      . HIS A  1 403  ? 76.426  87.597  10.709  1.00 154.09 ?  403  HIS A N      1 
ATOM   3139  C  CA     . HIS A  1 403  ? 77.163  88.393  11.693  1.00 156.49 ?  403  HIS A CA     1 
ATOM   3140  C  C      . HIS A  1 403  ? 76.320  89.600  12.054  1.00 157.57 ?  403  HIS A C      1 
ATOM   3141  O  O      . HIS A  1 403  ? 76.090  90.463  11.215  1.00 153.24 ?  403  HIS A O      1 
ATOM   3142  C  CB     . HIS A  1 403  ? 78.514  88.803  11.118  1.00 159.40 ?  403  HIS A CB     1 
ATOM   3143  C  CG     . HIS A  1 403  ? 79.321  87.643  10.628  1.00 166.83 ?  403  HIS A CG     1 
ATOM   3144  N  ND1    . HIS A  1 403  ? 80.115  86.911  11.486  1.00 173.50 ?  403  HIS A ND1    1 
ATOM   3145  C  CD2    . HIS A  1 403  ? 79.415  87.113  9.385   1.00 168.67 ?  403  HIS A CD2    1 
ATOM   3146  C  CE1    . HIS A  1 403  ? 80.675  85.968  10.744  1.00 175.37 ?  403  HIS A CE1    1 
ATOM   3147  N  NE2    . HIS A  1 403  ? 80.283  86.050  9.472   1.00 172.91 ?  403  HIS A NE2    1 
ATOM   3148  N  N      . VAL A  1 404  ? 75.835  89.640  13.296  1.00 157.08 ?  404  VAL A N      1 
ATOM   3149  C  CA     . VAL A  1 404  ? 74.837  90.587  13.773  1.00 155.16 ?  404  VAL A CA     1 
ATOM   3150  C  C      . VAL A  1 404  ? 75.387  91.611  14.732  1.00 159.46 ?  404  VAL A C      1 
ATOM   3151  O  O      . VAL A  1 404  ? 75.936  91.255  15.774  1.00 162.38 ?  404  VAL A O      1 
ATOM   3152  C  CB     . VAL A  1 404  ? 73.637  89.813  14.385  1.00 161.00 ?  404  VAL A CB     1 
ATOM   3153  C  CG1    . VAL A  1 404  ? 72.528  90.762  14.807  1.00 158.88 ?  404  VAL A CG1    1 
ATOM   3154  C  CG2    . VAL A  1 404  ? 73.091  88.768  13.410  1.00 160.27 ?  404  VAL A CG2    1 
ATOM   3155  N  N      . PHE A  1 405  ? 75.161  92.886  14.409  1.00 154.01 ?  405  PHE A N      1 
ATOM   3156  C  CA     . PHE A  1 405  ? 75.646  94.012  15.195  1.00 156.08 ?  405  PHE A CA     1 
ATOM   3157  C  C      . PHE A  1 405  ? 74.563  95.011  15.472  1.00 160.59 ?  405  PHE A C      1 
ATOM   3158  O  O      . PHE A  1 405  ? 73.597  95.094  14.713  1.00 157.64 ?  405  PHE A O      1 
ATOM   3159  C  CB     . PHE A  1 405  ? 76.796  94.704  14.462  1.00 158.17 ?  405  PHE A CB     1 
ATOM   3160  C  CG     . PHE A  1 405  ? 77.950  93.783  14.196  1.00 163.00 ?  405  PHE A CG     1 
ATOM   3161  C  CD1    . PHE A  1 405  ? 78.912  93.557  15.170  1.00 171.18 ?  405  PHE A CD1    1 
ATOM   3162  C  CD2    . PHE A  1 405  ? 78.045  93.094  12.992  1.00 163.93 ?  405  PHE A CD2    1 
ATOM   3163  C  CE1    . PHE A  1 405  ? 79.953  92.669  14.944  1.00 175.65 ?  405  PHE A CE1    1 
ATOM   3164  C  CE2    . PHE A  1 405  ? 79.090  92.215  12.759  1.00 170.40 ?  405  PHE A CE2    1 
ATOM   3165  C  CZ     . PHE A  1 405  ? 80.043  92.012  13.734  1.00 173.40 ?  405  PHE A CZ     1 
ATOM   3166  N  N      . GLY A  1 406  ? 74.745  95.782  16.541  1.00 161.11 ?  406  GLY A N      1 
ATOM   3167  C  CA     . GLY A  1 406  ? 73.795  96.808  16.952  1.00 160.42 ?  406  GLY A CA     1 
ATOM   3168  C  C      . GLY A  1 406  ? 74.343  98.224  16.948  1.00 166.52 ?  406  GLY A C      1 
ATOM   3169  O  O      . GLY A  1 406  ? 75.237  98.568  16.158  1.00 165.66 ?  406  GLY A O      1 
ATOM   3170  N  N      . THR A  1 407  ? 73.815  99.050  17.869  1.00 164.39 ?  407  THR A N      1 
ATOM   3171  C  CA     . THR A  1 407  ? 74.141  100.473 18.041  1.00 163.64 ?  407  THR A CA     1 
ATOM   3172  C  C      . THR A  1 407  ? 75.608  100.765 18.395  1.00 167.52 ?  407  THR A C      1 
ATOM   3173  O  O      . THR A  1 407  ? 76.082  101.878 18.173  1.00 165.88 ?  407  THR A O      1 
ATOM   3174  C  CB     . THR A  1 407  ? 73.204  101.072 19.104  1.00 173.04 ?  407  THR A CB     1 
ATOM   3175  O  OG1    . THR A  1 407  ? 73.444  100.442 20.373  1.00 177.07 ?  407  THR A OG1    1 
ATOM   3176  C  CG2    . THR A  1 407  ? 71.732  100.949 18.714  1.00 166.77 ?  407  THR A CG2    1 
ATOM   3177  N  N      . GLU A  1 408  ? 76.312  99.780  18.956  1.00 165.64 ?  408  GLU A N      1 
ATOM   3178  C  CA     . GLU A  1 408  ? 77.684  99.960  19.406  1.00 168.43 ?  408  GLU A CA     1 
ATOM   3179  C  C      . GLU A  1 408  ? 78.694  99.851  18.286  1.00 170.25 ?  408  GLU A C      1 
ATOM   3180  O  O      . GLU A  1 408  ? 79.850  100.265 18.441  1.00 171.73 ?  408  GLU A O      1 
ATOM   3181  C  CB     . GLU A  1 408  ? 78.001  99.012  20.566  1.00 174.26 ?  408  GLU A CB     1 
ATOM   3182  C  CG     . GLU A  1 408  ? 77.146  99.273  21.795  1.00 189.14 ?  408  GLU A CG     1 
ATOM   3183  C  CD     . GLU A  1 408  ? 76.992  100.728 22.201  1.00 211.15 ?  408  GLU A CD     1 
ATOM   3184  O  OE1    . GLU A  1 408  ? 78.000  101.348 22.616  1.00 197.02 ?  408  GLU A OE1    1 
ATOM   3185  O  OE2    . GLU A  1 408  ? 75.864  101.257 22.070  1.00 204.62 -1 408  GLU A OE2    1 
ATOM   3186  N  N      . THR A  1 409  ? 78.246  99.341  17.136  1.00 163.81 ?  409  THR A N      1 
ATOM   3187  C  CA     . THR A  1 409  ? 79.072  99.198  15.949  1.00 163.11 ?  409  THR A CA     1 
ATOM   3188  C  C      . THR A  1 409  ? 78.781  100.381 15.027  1.00 165.11 ?  409  THR A C      1 
ATOM   3189  O  O      . THR A  1 409  ? 77.612  100.731 14.843  1.00 163.28 ?  409  THR A O      1 
ATOM   3190  C  CB     . THR A  1 409  ? 78.787  97.845  15.284  1.00 168.04 ?  409  THR A CB     1 
ATOM   3191  O  OG1    . THR A  1 409  ? 79.168  96.799  16.177  1.00 172.06 ?  409  THR A OG1    1 
ATOM   3192  C  CG2    . THR A  1 409  ? 79.528  97.669  13.986  1.00 165.07 ?  409  THR A CG2    1 
ATOM   3193  N  N      . HIS A  1 410  ? 79.826  101.001 14.453  1.00 161.64 ?  410  HIS A N      1 
ATOM   3194  C  CA     . HIS A  1 410  ? 79.640  102.104 13.515  1.00 158.68 ?  410  HIS A CA     1 
ATOM   3195  C  C      . HIS A  1 410  ? 78.841  101.617 12.365  1.00 156.96 ?  410  HIS A C      1 
ATOM   3196  O  O      . HIS A  1 410  ? 79.027  100.484 11.922  1.00 155.87 ?  410  HIS A O      1 
ATOM   3197  C  CB     . HIS A  1 410  ? 80.978  102.688 13.092  1.00 162.42 ?  410  HIS A CB     1 
ATOM   3198  C  CG     . HIS A  1 410  ? 81.629  103.334 14.266  1.00 170.20 ?  410  HIS A CG     1 
ATOM   3199  N  ND1    . HIS A  1 410  ? 81.305  104.623 14.632  1.00 172.01 ?  410  HIS A ND1    1 
ATOM   3200  C  CD2    . HIS A  1 410  ? 82.394  102.779 15.240  1.00 176.57 ?  410  HIS A CD2    1 
ATOM   3201  C  CE1    . HIS A  1 410  ? 81.943  104.839 15.771  1.00 175.61 ?  410  HIS A CE1    1 
ATOM   3202  N  NE2    . HIS A  1 410  ? 82.614  103.757 16.175  1.00 178.72 ?  410  HIS A NE2    1 
ATOM   3203  N  N      . MET A  1 411  ? 77.897  102.436 11.923  1.00 151.03 ?  411  MET A N      1 
ATOM   3204  C  CA     . MET A  1 411  ? 76.945  102.051 10.895  1.00 148.11 ?  411  MET A CA     1 
ATOM   3205  C  C      . MET A  1 411  ? 77.552  101.267 9.729   1.00 154.34 ?  411  MET A C      1 
ATOM   3206  O  O      . MET A  1 411  ? 77.057  100.194 9.394   1.00 153.57 ?  411  MET A O      1 
ATOM   3207  C  CB     . MET A  1 411  ? 76.168  103.268 10.389  1.00 147.77 ?  411  MET A CB     1 
ATOM   3208  C  CG     . MET A  1 411  ? 75.042  102.898 9.480   1.00 148.47 ?  411  MET A CG     1 
ATOM   3209  S  SD     . MET A  1 411  ? 74.078  104.310 8.924   1.00 150.34 ?  411  MET A SD     1 
ATOM   3210  C  CE     . MET A  1 411  ? 74.969  104.793 7.493   1.00 146.96 ?  411  MET A CE     1 
ATOM   3211  N  N      . THR A  1 412  ? 78.620  101.792 9.130   1.00 153.15 ?  412  THR A N      1 
ATOM   3212  C  CA     . THR A  1 412  ? 79.220  101.211 7.932   1.00 153.08 ?  412  THR A CA     1 
ATOM   3213  C  C      . THR A  1 412  ? 80.316  100.182 8.183   1.00 160.74 ?  412  THR A C      1 
ATOM   3214  O  O      . THR A  1 412  ? 80.858  99.651  7.213   1.00 160.92 ?  412  THR A O      1 
ATOM   3215  C  CB     . THR A  1 412  ? 79.729  102.332 7.023   1.00 153.25 ?  412  THR A CB     1 
ATOM   3216  O  OG1    . THR A  1 412  ? 80.827  103.005 7.661   1.00 147.48 ?  412  THR A OG1    1 
ATOM   3217  C  CG2    . THR A  1 412  ? 78.612  103.301 6.627   1.00 146.11 ?  412  THR A CG2    1 
ATOM   3218  N  N      . ALA A  1 413  ? 80.637  99.883  9.455   1.00 159.64 ?  413  ALA A N      1 
ATOM   3219  C  CA     . ALA A  1 413  ? 81.698  98.927  9.778   1.00 162.27 ?  413  ALA A CA     1 
ATOM   3220  C  C      . ALA A  1 413  ? 81.519  97.560  9.144   1.00 164.37 ?  413  ALA A C      1 
ATOM   3221  O  O      . ALA A  1 413  ? 82.518  96.948  8.765   1.00 166.16 ?  413  ALA A O      1 
ATOM   3222  C  CB     . ALA A  1 413  ? 81.873  98.790  11.274  1.00 165.40 ?  413  ALA A CB     1 
ATOM   3223  N  N      . ILE A  1 414  ? 80.267  97.088  9.001   1.00 157.48 ?  414  ILE A N      1 
ATOM   3224  C  CA     . ILE A  1 414  ? 79.994  95.772  8.410   1.00 157.02 ?  414  ILE A CA     1 
ATOM   3225  C  C      . ILE A  1 414  ? 80.433  95.669  6.945   1.00 162.00 ?  414  ILE A C      1 
ATOM   3226  O  O      . ILE A  1 414  ? 80.649  94.557  6.451   1.00 163.68 ?  414  ILE A O      1 
ATOM   3227  C  CB     . ILE A  1 414  ? 78.537  95.315  8.600   1.00 156.96 ?  414  ILE A CB     1 
ATOM   3228  C  CG1    . ILE A  1 414  ? 77.531  96.329  8.035   1.00 153.47 ?  414  ILE A CG1    1 
ATOM   3229  C  CG2    . ILE A  1 414  ? 78.263  95.011  10.059  1.00 158.50 ?  414  ILE A CG2    1 
ATOM   3230  C  CD1    . ILE A  1 414  ? 76.127  95.748  7.865   1.00 157.00 ?  414  ILE A CD1    1 
ATOM   3231  N  N      . VAL A  1 415  ? 80.574  96.809  6.253   1.00 156.69 ?  415  VAL A N      1 
ATOM   3232  C  CA     . VAL A  1 415  ? 81.029  96.786  4.865   1.00 156.16 ?  415  VAL A CA     1 
ATOM   3233  C  C      . VAL A  1 415  ? 82.489  96.315  4.792   1.00 163.25 ?  415  VAL A C      1 
ATOM   3234  O  O      . VAL A  1 415  ? 82.806  95.393  4.033   1.00 164.71 ?  415  VAL A O      1 
ATOM   3235  C  CB     . VAL A  1 415  ? 80.823  98.142  4.171   1.00 157.57 ?  415  VAL A CB     1 
ATOM   3236  C  CG1    . VAL A  1 415  ? 81.369  98.099  2.753   1.00 158.25 ?  415  VAL A CG1    1 
ATOM   3237  C  CG2    . VAL A  1 415  ? 79.352  98.535  4.179   1.00 153.61 ?  415  VAL A CG2    1 
ATOM   3238  N  N      . GLY A  1 416  ? 83.349  96.943  5.589   1.00 160.64 ?  416  GLY A N      1 
ATOM   3239  C  CA     . GLY A  1 416  ? 84.752  96.572  5.658   1.00 164.52 ?  416  GLY A CA     1 
ATOM   3240  C  C      . GLY A  1 416  ? 84.928  95.130  6.085   1.00 170.66 ?  416  GLY A C      1 
ATOM   3241  O  O      . GLY A  1 416  ? 85.809  94.435  5.572   1.00 173.69 ?  416  GLY A O      1 
ATOM   3242  N  N      . MET A  1 417  ? 84.085  94.670  7.025   1.00 165.41 ?  417  MET A N      1 
ATOM   3243  C  CA     . MET A  1 417  ? 84.101  93.287  7.486   1.00 167.16 ?  417  MET A CA     1 
ATOM   3244  C  C      . MET A  1 417  ? 83.768  92.358  6.325   1.00 171.95 ?  417  MET A C      1 
ATOM   3245  O  O      . MET A  1 417  ? 84.499  91.394  6.079   1.00 174.45 ?  417  MET A O      1 
ATOM   3246  C  CB     . MET A  1 417  ? 83.067  93.059  8.599   1.00 167.92 ?  417  MET A CB     1 
ATOM   3247  C  CG     . MET A  1 417  ? 83.315  93.824  9.863   1.00 172.39 ?  417  MET A CG     1 
ATOM   3248  S  SD     . MET A  1 417  ? 82.018  93.388  11.027  1.00 175.19 ?  417  MET A SD     1 
ATOM   3249  C  CE     . MET A  1 417  ? 82.017  94.827  12.061  1.00 171.59 ?  417  MET A CE     1 
ATOM   3250  N  N      . ALA A  1 418  ? 82.665  92.645  5.615   1.00 166.42 ?  418  ALA A N      1 
ATOM   3251  C  CA     . ALA A  1 418  ? 82.184  91.792  4.529   1.00 166.26 ?  418  ALA A CA     1 
ATOM   3252  C  C      . ALA A  1 418  ? 83.172  91.672  3.389   1.00 173.50 ?  418  ALA A C      1 
ATOM   3253  O  O      . ALA A  1 418  ? 83.297  90.596  2.798   1.00 175.38 ?  418  ALA A O      1 
ATOM   3254  C  CB     . ALA A  1 418  ? 80.845  92.287  4.018   1.00 162.81 ?  418  ALA A CB     1 
ATOM   3255  N  N      . LEU A  1 419  ? 83.914  92.760  3.118   1.00 169.87 ?  419  LEU A N      1 
ATOM   3256  C  CA     . LEU A  1 419  ? 84.869  92.819  2.022   1.00 171.02 ?  419  LEU A CA     1 
ATOM   3257  C  C      . LEU A  1 419  ? 86.285  92.412  2.407   1.00 178.86 ?  419  LEU A C      1 
ATOM   3258  O  O      . LEU A  1 419  ? 87.165  92.396  1.549   1.00 181.06 ?  419  LEU A O      1 
ATOM   3259  C  CB     . LEU A  1 419  ? 84.831  94.204  1.374   1.00 168.68 ?  419  LEU A CB     1 
ATOM   3260  C  CG     . LEU A  1 419  ? 83.509  94.547  0.698   1.00 169.21 ?  419  LEU A CG     1 
ATOM   3261  C  CD1    . LEU A  1 419  ? 83.526  95.956  0.162   1.00 167.54 ?  419  LEU A CD1    1 
ATOM   3262  C  CD2    . LEU A  1 419  ? 83.176  93.545  -0.399  1.00 173.35 ?  419  LEU A CD2    1 
ATOM   3263  N  N      . GLY A  1 420  ? 86.484  92.039  3.666   1.00 176.62 ?  420  GLY A N      1 
ATOM   3264  C  CA     . GLY A  1 420  ? 87.768  91.553  4.156   1.00 180.95 ?  420  GLY A CA     1 
ATOM   3265  C  C      . GLY A  1 420  ? 88.817  92.604  4.430   1.00 184.98 ?  420  GLY A C      1 
ATOM   3266  O  O      . GLY A  1 420  ? 90.000  92.271  4.515   1.00 188.05 ?  420  GLY A O      1 
ATOM   3267  N  N      . HIS A  1 421  ? 88.395  93.860  4.609   1.00 178.65 ?  421  HIS A N      1 
ATOM   3268  C  CA     . HIS A  1 421  ? 89.301  94.968  4.896   1.00 180.69 ?  421  HIS A CA     1 
ATOM   3269  C  C      . HIS A  1 421  ? 89.614  95.078  6.373   1.00 186.91 ?  421  HIS A C      1 
ATOM   3270  O  O      . HIS A  1 421  ? 90.688  95.572  6.744   1.00 189.29 ?  421  HIS A O      1 
ATOM   3271  C  CB     . HIS A  1 421  ? 88.729  96.276  4.369   1.00 178.32 ?  421  HIS A CB     1 
ATOM   3272  C  CG     . HIS A  1 421  ? 88.767  96.373  2.880   1.00 181.80 ?  421  HIS A CG     1 
ATOM   3273  N  ND1    . HIS A  1 421  ? 87.655  96.084  2.111   1.00 180.71 ?  421  HIS A ND1    1 
ATOM   3274  C  CD2    . HIS A  1 421  ? 89.783  96.732  2.064   1.00 186.94 ?  421  HIS A CD2    1 
ATOM   3275  C  CE1    . HIS A  1 421  ? 88.030  96.274  0.854   1.00 181.41 ?  421  HIS A CE1    1 
ATOM   3276  N  NE2    . HIS A  1 421  ? 89.306  96.651  0.776   1.00 185.34 ?  421  HIS A NE2    1 
ATOM   3277  N  N      . ARG A  1 422  ? 88.679  94.607  7.214   1.00 181.84 ?  422  ARG A N      1 
ATOM   3278  C  CA     . ARG A  1 422  ? 88.829  94.606  8.662   1.00 183.61 ?  422  ARG A CA     1 
ATOM   3279  C  C      . ARG A  1 422  ? 88.328  93.292  9.264   1.00 188.24 ?  422  ARG A C      1 
ATOM   3280  O  O      . ARG A  1 422  ? 87.390  92.700  8.713   1.00 185.28 ?  422  ARG A O      1 
ATOM   3281  C  CB     . ARG A  1 422  ? 88.134  95.835  9.286   1.00 179.00 ?  422  ARG A CB     1 
ATOM   3282  C  CG     . ARG A  1 422  ? 86.740  95.631  9.869   1.00 178.96 ?  422  ARG A CG     1 
ATOM   3283  C  CD     . ARG A  1 422  ? 86.152  96.947  10.300  1.00 183.59 ?  422  ARG A CD     1 
ATOM   3284  N  NE     . ARG A  1 422  ? 85.575  97.644  9.152   1.00 194.38 ?  422  ARG A NE     1 
ATOM   3285  C  CZ     . ARG A  1 422  ? 85.104  98.886  9.182   1.00 208.97 ?  422  ARG A CZ     1 
ATOM   3286  N  NH1    . ARG A  1 422  ? 85.133  99.587  10.309  1.00 201.17 1  422  ARG A NH1    1 
ATOM   3287  N  NH2    . ARG A  1 422  ? 84.587  99.433  8.088   1.00 189.05 ?  422  ARG A NH2    1 
ATOM   3288  N  N      . PRO A  1 423  ? 88.909  92.818  10.387  1.00 187.47 ?  423  PRO A N      1 
ATOM   3289  C  CA     . PRO A  1 423  ? 88.389  91.583  10.998  1.00 187.45 ?  423  PRO A CA     1 
ATOM   3290  C  C      . PRO A  1 423  ? 86.985  91.771  11.597  1.00 185.07 ?  423  PRO A C      1 
ATOM   3291  O  O      . PRO A  1 423  ? 86.541  92.899  11.817  1.00 182.02 ?  423  PRO A O      1 
ATOM   3292  C  CB     . PRO A  1 423  ? 89.433  91.269  12.068  1.00 194.93 ?  423  PRO A CB     1 
ATOM   3293  C  CG     . PRO A  1 423  ? 89.994  92.596  12.431  1.00 199.73 ?  423  PRO A CG     1 
ATOM   3294  C  CD     . PRO A  1 423  ? 90.044  93.368  11.160  1.00 192.29 ?  423  PRO A CD     1 
ATOM   3295  N  N      . ILE A  1 424  ? 86.293  90.665  11.873  1.00 179.42 ?  424  ILE A N      1 
ATOM   3296  C  CA     . ILE A  1 424  ? 84.953  90.697  12.454  1.00 159.74 ?  424  ILE A CA     1 
ATOM   3297  C  C      . ILE A  1 424  ? 85.022  90.865  13.998  1.00 165.19 ?  424  ILE A C      1 
ATOM   3298  O  O      . ILE A  1 424  ? 85.311  89.931  14.748  1.00 126.57 ?  424  ILE A O      1 
ATOM   3299  C  CB     . ILE A  1 424  ? 84.121  89.470  11.969  1.00 161.07 ?  424  ILE A CB     1 
ATOM   3300  C  CG1    . ILE A  1 424  ? 83.912  89.496  10.447  1.00 157.29 ?  424  ILE A CG1    1 
ATOM   3301  C  CG2    . ILE A  1 424  ? 82.775  89.392  12.672  1.00 159.93 ?  424  ILE A CG2    1 
ATOM   3302  C  CD1    . ILE A  1 424  ? 84.671  88.502  9.709   1.00 161.44 ?  424  ILE A CD1    1 
ATOM   3303  N  N      . LYS A  1 428  ? 62.530  134.535 8.652   1.00 154.09 ?  488  LYS A N      1 
ATOM   3304  C  CA     . LYS A  1 428  ? 61.561  133.991 9.601   1.00 152.84 ?  488  LYS A CA     1 
ATOM   3305  C  C      . LYS A  1 428  ? 62.135  133.957 11.047  1.00 157.64 ?  488  LYS A C      1 
ATOM   3306  O  O      . LYS A  1 428  ? 63.153  134.609 11.318  1.00 157.80 ?  488  LYS A O      1 
ATOM   3307  C  CB     . LYS A  1 428  ? 60.983  132.606 9.133   1.00 151.82 ?  488  LYS A CB     1 
ATOM   3308  C  CG     . LYS A  1 428  ? 59.913  132.649 8.029   1.00 159.49 ?  488  LYS A CG     1 
ATOM   3309  C  CD     . LYS A  1 428  ? 59.438  131.247 7.591   1.00 162.83 ?  488  LYS A CD     1 
ATOM   3310  C  CE     . LYS A  1 428  ? 58.901  131.203 6.164   1.00 166.10 ?  488  LYS A CE     1 
ATOM   3311  N  NZ     . LYS A  1 428  ? 58.508  129.823 5.685   1.00 163.49 1  488  LYS A NZ     1 
ATOM   3312  N  N      . SER A  1 429  ? 61.420  133.235 11.966  1.00 153.39 ?  489  SER A N      1 
ATOM   3313  C  CA     . SER A  1 429  ? 61.683  133.007 13.401  1.00 153.35 ?  489  SER A CA     1 
ATOM   3314  C  C      . SER A  1 429  ? 63.018  132.273 13.664  1.00 154.77 ?  489  SER A C      1 
ATOM   3315  O  O      . SER A  1 429  ? 63.278  131.245 13.031  1.00 152.36 ?  489  SER A O      1 
ATOM   3316  C  CB     . SER A  1 429  ? 60.519  132.233 14.033  1.00 155.34 ?  489  SER A CB     1 
ATOM   3317  O  OG     . SER A  1 429  ? 59.291  132.955 14.041  1.00 162.01 ?  489  SER A OG     1 
ATOM   3318  N  N      . THR A  1 430  ? 63.859  132.796 14.597  1.00 151.15 ?  490  THR A N      1 
ATOM   3319  C  CA     . THR A  1 430  ? 65.149  132.171 14.940  1.00 149.50 ?  490  THR A CA     1 
ATOM   3320  C  C      . THR A  1 430  ? 64.944  130.966 15.853  1.00 150.94 ?  490  THR A C      1 
ATOM   3321  O  O      . THR A  1 430  ? 65.628  129.950 15.691  1.00 149.65 ?  490  THR A O      1 
ATOM   3322  C  CB     . THR A  1 430  ? 66.140  133.200 15.473  1.00 145.57 ?  490  THR A CB     1 
ATOM   3323  O  OG1    . THR A  1 430  ? 66.665  133.894 14.339  1.00 138.24 ?  490  THR A OG1    1 
ATOM   3324  C  CG2    . THR A  1 430  ? 67.302  132.563 16.225  1.00 142.39 ?  490  THR A CG2    1 
ATOM   3325  N  N      . THR A  1 431  ? 64.007  131.077 16.800  1.00 146.39 ?  491  THR A N      1 
ATOM   3326  C  CA     . THR A  1 431  ? 63.696  130.003 17.735  1.00 143.59 ?  491  THR A CA     1 
ATOM   3327  C  C      . THR A  1 431  ? 62.328  129.414 17.432  1.00 142.28 ?  491  THR A C      1 
ATOM   3328  O  O      . THR A  1 431  ? 61.335  130.137 17.384  1.00 140.63 ?  491  THR A O      1 
ATOM   3329  C  CB     . THR A  1 431  ? 63.817  130.492 19.166  1.00 151.54 ?  491  THR A CB     1 
ATOM   3330  O  OG1    . THR A  1 431  ? 65.015  131.256 19.305  1.00 149.84 ?  491  THR A OG1    1 
ATOM   3331  C  CG2    . THR A  1 431  ? 63.794  129.352 20.157  1.00 149.16 ?  491  THR A CG2    1 
ATOM   3332  N  N      . LEU A  1 432  ? 62.284  128.103 17.237  1.00 137.17 ?  492  LEU A N      1 
ATOM   3333  C  CA     . LEU A  1 432  ? 61.049  127.416 16.908  1.00 135.47 ?  492  LEU A CA     1 
ATOM   3334  C  C      . LEU A  1 432  ? 60.414  126.755 18.116  1.00 142.63 ?  492  LEU A C      1 
ATOM   3335  O  O      . LEU A  1 432  ? 59.171  126.750 18.251  1.00 141.83 ?  492  LEU A O      1 
ATOM   3336  C  CB     . LEU A  1 432  ? 61.311  126.359 15.829  1.00 133.16 ?  492  LEU A CB     1 
ATOM   3337  C  CG     . LEU A  1 432  ? 61.936  126.847 14.540  1.00 138.07 ?  492  LEU A CG     1 
ATOM   3338  C  CD1    . LEU A  1 432  ? 62.151  125.701 13.605  1.00 135.50 ?  492  LEU A CD1    1 
ATOM   3339  C  CD2    . LEU A  1 432  ? 61.094  127.960 13.874  1.00 142.10 ?  492  LEU A CD2    1 
ATOM   3340  N  N      . PHE A  1 433  ? 61.263  126.160 18.981  1.00 140.74 ?  493  PHE A N      1 
ATOM   3341  C  CA     . PHE A  1 433  ? 60.793  125.420 20.150  1.00 139.74 ?  493  PHE A CA     1 
ATOM   3342  C  C      . PHE A  1 433  ? 61.472  125.867 21.426  1.00 142.73 ?  493  PHE A C      1 
ATOM   3343  O  O      . PHE A  1 433  ? 62.621  126.314 21.394  1.00 142.59 ?  493  PHE A O      1 
ATOM   3344  C  CB     . PHE A  1 433  ? 60.992  123.907 19.939  1.00 139.81 ?  493  PHE A CB     1 
ATOM   3345  C  CG     . PHE A  1 433  ? 60.672  123.433 18.540  1.00 139.80 ?  493  PHE A CG     1 
ATOM   3346  C  CD1    . PHE A  1 433  ? 59.370  123.488 18.050  1.00 141.88 ?  493  PHE A CD1    1 
ATOM   3347  C  CD2    . PHE A  1 433  ? 61.677  122.957 17.702  1.00 141.94 ?  493  PHE A CD2    1 
ATOM   3348  C  CE1    . PHE A  1 433  ? 59.078  123.073 16.752  1.00 141.14 ?  493  PHE A CE1    1 
ATOM   3349  C  CE2    . PHE A  1 433  ? 61.382  122.529 16.408  1.00 143.02 ?  493  PHE A CE2    1 
ATOM   3350  C  CZ     . PHE A  1 433  ? 60.084  122.593 15.942  1.00 139.79 ?  493  PHE A CZ     1 
ATOM   3351  N  N      . SER A  1 434  ? 60.760  125.707 22.553  1.00 138.28 ?  494  SER A N      1 
ATOM   3352  C  CA     . SER A  1 434  ? 61.225  126.011 23.902  1.00 140.09 ?  494  SER A CA     1 
ATOM   3353  C  C      . SER A  1 434  ? 60.686  124.945 24.847  1.00 143.42 ?  494  SER A C      1 
ATOM   3354  O  O      . SER A  1 434  ? 59.912  124.085 24.417  1.00 140.14 ?  494  SER A O      1 
ATOM   3355  C  CB     . SER A  1 434  ? 60.747  127.391 24.347  1.00 143.15 ?  494  SER A CB     1 
ATOM   3356  O  OG     . SER A  1 434  ? 59.385  127.377 24.742  1.00 142.09 ?  494  SER A OG     1 
ATOM   3357  N  N      . ARG A  1 435  ? 61.032  125.044 26.147  1.00 141.80 ?  495  ARG A N      1 
ATOM   3358  C  CA     . ARG A  1 435  ? 60.545  124.097 27.130  1.00 140.51 ?  495  ARG A CA     1 
ATOM   3359  C  C      . ARG A  1 435  ? 59.033  124.325 27.410  1.00 145.14 ?  495  ARG A C      1 
ATOM   3360  O  O      . ARG A  1 435  ? 58.411  123.540 28.138  1.00 145.59 ?  495  ARG A O      1 
ATOM   3361  C  CB     . ARG A  1 435  ? 61.423  124.118 28.398  1.00 141.28 ?  495  ARG A CB     1 
ATOM   3362  C  CG     . ARG A  1 435  ? 61.128  125.225 29.386  1.00 154.79 ?  495  ARG A CG     1 
ATOM   3363  C  CD     . ARG A  1 435  ? 61.588  124.855 30.815  1.00 170.96 ?  495  ARG A CD     1 
ATOM   3364  N  NE     . ARG A  1 435  ? 60.989  125.715 31.856  1.00 186.92 ?  495  ARG A NE     1 
ATOM   3365  C  CZ     . ARG A  1 435  ? 61.413  126.941 32.186  1.00 200.54 ?  495  ARG A CZ     1 
ATOM   3366  N  NH1    . ARG A  1 435  ? 62.473  127.473 31.586  1.00 183.17 1  495  ARG A NH1    1 
ATOM   3367  N  NH2    . ARG A  1 435  ? 60.786  127.634 33.128  1.00 186.18 ?  495  ARG A NH2    1 
ATOM   3368  N  N      . HIS A  1 436  ? 58.454  125.386 26.811  1.00 140.81 ?  496  HIS A N      1 
ATOM   3369  C  CA     . HIS A  1 436  ? 57.052  125.765 26.947  1.00 139.76 ?  496  HIS A CA     1 
ATOM   3370  C  C      . HIS A  1 436  ? 56.197  125.418 25.744  1.00 139.39 ?  496  HIS A C      1 
ATOM   3371  O  O      . HIS A  1 436  ? 54.967  125.529 25.827  1.00 138.28 ?  496  HIS A O      1 
ATOM   3372  C  CB     . HIS A  1 436  ? 56.960  127.265 27.219  1.00 143.77 ?  496  HIS A CB     1 
ATOM   3373  C  CG     . HIS A  1 436  ? 57.694  127.666 28.442  1.00 150.96 ?  496  HIS A CG     1 
ATOM   3374  N  ND1    . HIS A  1 436  ? 57.412  127.087 29.662  1.00 153.62 ?  496  HIS A ND1    1 
ATOM   3375  C  CD2    . HIS A  1 436  ? 58.681  128.576 28.602  1.00 156.68 ?  496  HIS A CD2    1 
ATOM   3376  C  CE1    . HIS A  1 436  ? 58.224  127.665 30.532  1.00 156.78 ?  496  HIS A CE1    1 
ATOM   3377  N  NE2    . HIS A  1 436  ? 59.011  128.568 29.941  1.00 158.93 ?  496  HIS A NE2    1 
ATOM   3378  N  N      . THR A  1 437  ? 56.833  125.002 24.631  1.00 133.15 ?  497  THR A N      1 
ATOM   3379  C  CA     . THR A  1 437  ? 56.117  124.693 23.399  1.00 129.87 ?  497  THR A CA     1 
ATOM   3380  C  C      . THR A  1 437  ? 54.948  123.754 23.623  1.00 129.46 ?  497  THR A C      1 
ATOM   3381  O  O      . THR A  1 437  ? 55.104  122.725 24.283  1.00 128.42 ?  497  THR A O      1 
ATOM   3382  C  CB     . THR A  1 437  ? 57.061  124.109 22.339  1.00 137.20 ?  497  THR A CB     1 
ATOM   3383  O  OG1    . THR A  1 437  ? 58.010  125.090 21.921  1.00 133.36 ?  497  THR A OG1    1 
ATOM   3384  C  CG2    . THR A  1 437  ? 56.304  123.603 21.119  1.00 137.85 ?  497  THR A CG2    1 
ATOM   3385  N  N      . LYS A  1 438  ? 53.790  124.102 23.045  1.00 122.98 ?  498  LYS A N      1 
ATOM   3386  C  CA     . LYS A  1 438  ? 52.629  123.225 23.019  1.00 119.66 ?  498  LYS A CA     1 
ATOM   3387  C  C      . LYS A  1 438  ? 52.248  122.947 21.560  1.00 120.67 ?  498  LYS A C      1 
ATOM   3388  O  O      . LYS A  1 438  ? 52.263  123.852 20.721  1.00 123.38 ?  498  LYS A O      1 
ATOM   3389  C  CB     . LYS A  1 438  ? 51.456  123.810 23.793  1.00 121.63 ?  498  LYS A CB     1 
ATOM   3390  C  CG     . LYS A  1 438  ? 51.734  123.999 25.275  1.00 121.12 ?  498  LYS A CG     1 
ATOM   3391  C  CD     . LYS A  1 438  ? 51.794  122.673 26.013  1.00 116.51 ?  498  LYS A CD     1 
ATOM   3392  C  CE     . LYS A  1 438  ? 51.262  122.689 27.437  1.00 112.92 ?  498  LYS A CE     1 
ATOM   3393  N  NZ     . LYS A  1 438  ? 49.765  122.676 27.557  1.00 97.89  1  498  LYS A NZ     1 
ATOM   3394  N  N      . ALA A  1 439  ? 51.906  121.700 21.268  1.00 110.90 ?  499  ALA A N      1 
ATOM   3395  C  CA     . ALA A  1 439  ? 51.567  121.270 19.932  1.00 107.57 ?  499  ALA A CA     1 
ATOM   3396  C  C      . ALA A  1 439  ? 50.208  120.556 19.840  1.00 107.81 ?  499  ALA A C      1 
ATOM   3397  O  O      . ALA A  1 439  ? 49.696  119.980 20.809  1.00 106.18 ?  499  ALA A O      1 
ATOM   3398  C  CB     . ALA A  1 439  ? 52.662  120.357 19.397  1.00 106.97 ?  499  ALA A CB     1 
ATOM   3399  N  N      . ILE A  1 440  ? 49.639  120.605 18.644  1.00 101.97 ?  500  ILE A N      1 
ATOM   3400  C  CA     . ILE A  1 440  ? 48.475  119.859 18.251  1.00 99.99  ?  500  ILE A CA     1 
ATOM   3401  C  C      . ILE A  1 440  ? 49.011  118.812 17.297  1.00 103.68 ?  500  ILE A C      1 
ATOM   3402  O  O      . ILE A  1 440  ? 49.811  119.132 16.416  1.00 103.73 ?  500  ILE A O      1 
ATOM   3403  C  CB     . ILE A  1 440  ? 47.406  120.728 17.558  1.00 103.76 ?  500  ILE A CB     1 
ATOM   3404  C  CG1    . ILE A  1 440  ? 46.629  121.550 18.590  1.00 105.01 ?  500  ILE A CG1    1 
ATOM   3405  C  CG2    . ILE A  1 440  ? 46.447  119.850 16.702  1.00 104.45 ?  500  ILE A CG2    1 
ATOM   3406  C  CD1    . ILE A  1 440  ? 45.719  122.645 17.984  1.00 108.15 ?  500  ILE A CD1    1 
ATOM   3407  N  N      . VAL A  1 441  ? 48.558  117.569 17.453  1.00 100.05 ?  501  VAL A N      1 
ATOM   3408  C  CA     . VAL A  1 441  ? 48.937  116.480 16.574  1.00 99.66  ?  501  VAL A CA     1 
ATOM   3409  C  C      . VAL A  1 441  ? 47.740  116.146 15.703  1.00 105.46 ?  501  VAL A C      1 
ATOM   3410  O  O      . VAL A  1 441  ? 46.685  115.802 16.240  1.00 105.53 ?  501  VAL A O      1 
ATOM   3411  C  CB     . VAL A  1 441  ? 49.446  115.250 17.376  1.00 103.44 ?  501  VAL A CB     1 
ATOM   3412  C  CG1    . VAL A  1 441  ? 49.602  114.026 16.478  1.00 102.83 ?  501  VAL A CG1    1 
ATOM   3413  C  CG2    . VAL A  1 441  ? 50.769  115.562 18.055  1.00 104.04 ?  501  VAL A CG2    1 
ATOM   3414  N  N      . TRP A  1 442  ? 47.903  116.246 14.364  1.00 103.64 ?  502  TRP A N      1 
ATOM   3415  C  CA     . TRP A  1 442  ? 46.858  115.887 13.412  1.00 104.77 ?  502  TRP A CA     1 
ATOM   3416  C  C      . TRP A  1 442  ? 47.064  114.426 13.063  1.00 109.95 ?  502  TRP A C      1 
ATOM   3417  O  O      . TRP A  1 442  ? 48.114  114.079 12.525  1.00 110.03 ?  502  TRP A O      1 
ATOM   3418  C  CB     . TRP A  1 442  ? 46.941  116.762 12.148  1.00 104.68 ?  502  TRP A CB     1 
ATOM   3419  C  CG     . TRP A  1 442  ? 45.675  116.810 11.328  1.00 106.31 ?  502  TRP A CG     1 
ATOM   3420  C  CD1    . TRP A  1 442  ? 44.823  117.863 11.211  1.00 109.85 ?  502  TRP A CD1    1 
ATOM   3421  C  CD2    . TRP A  1 442  ? 45.141  115.773 10.496  1.00 106.50 ?  502  TRP A CD2    1 
ATOM   3422  N  NE1    . TRP A  1 442  ? 43.780  117.548 10.375  1.00 109.36 ?  502  TRP A NE1    1 
ATOM   3423  C  CE2    . TRP A  1 442  ? 43.935  116.264 9.935   1.00 110.82 ?  502  TRP A CE2    1 
ATOM   3424  C  CE3    . TRP A  1 442  ? 45.540  114.460 10.193  1.00 107.98 ?  502  TRP A CE3    1 
ATOM   3425  C  CZ2    . TRP A  1 442  ? 43.123  115.493 9.079   1.00 110.69 ?  502  TRP A CZ2    1 
ATOM   3426  C  CZ3    . TRP A  1 442  ? 44.746  113.704 9.329   1.00 110.10 ?  502  TRP A CZ3    1 
ATOM   3427  C  CH2    . TRP A  1 442  ? 43.548  114.220 8.787   1.00 111.22 ?  502  TRP A CH2    1 
ATOM   3428  N  N      . GLY A  1 443  ? 46.078  113.589 13.386  1.00 107.81 ?  503  GLY A N      1 
ATOM   3429  C  CA     . GLY A  1 443  ? 46.101  112.154 13.120  1.00 108.84 ?  503  GLY A CA     1 
ATOM   3430  C  C      . GLY A  1 443  ? 46.062  111.328 14.394  1.00 115.89 ?  503  GLY A C      1 
ATOM   3431  O  O      . GLY A  1 443  ? 46.428  111.809 15.461  1.00 115.99 ?  503  GLY A O      1 
ATOM   3432  N  N      . MET A  1 444  ? 45.651  110.086 14.299  1.00 114.64 ?  504  MET A N      1 
ATOM   3433  C  CA     . MET A  1 444  ? 45.522  109.210 15.456  1.00 115.97 ?  504  MET A CA     1 
ATOM   3434  C  C      . MET A  1 444  ? 46.853  108.465 15.721  1.00 120.20 ?  504  MET A C      1 
ATOM   3435  O  O      . MET A  1 444  ? 47.028  107.294 15.397  1.00 120.21 ?  504  MET A O      1 
ATOM   3436  C  CB     . MET A  1 444  ? 44.323  108.273 15.208  1.00 119.28 ?  504  MET A CB     1 
ATOM   3437  C  CG     . MET A  1 444  ? 43.895  107.475 16.395  1.00 123.79 ?  504  MET A CG     1 
ATOM   3438  S  SD     . MET A  1 444  ? 43.701  108.474 17.857  1.00 129.22 ?  504  MET A SD     1 
ATOM   3439  C  CE     . MET A  1 444  ? 42.134  109.297 17.532  1.00 125.40 ?  504  MET A CE     1 
ATOM   3440  N  N      . GLN A  1 445  ? 47.788  109.167 16.314  1.00 117.59 ?  505  GLN A N      1 
ATOM   3441  C  CA     . GLN A  1 445  ? 49.156  108.679 16.508  1.00 117.77 ?  505  GLN A CA     1 
ATOM   3442  C  C      . GLN A  1 445  ? 49.526  108.605 17.965  1.00 124.51 ?  505  GLN A C      1 
ATOM   3443  O  O      . GLN A  1 445  ? 50.409  109.325 18.447  1.00 125.60 ?  505  GLN A O      1 
ATOM   3444  C  CB     . GLN A  1 445  ? 50.106  109.622 15.768  1.00 118.63 ?  505  GLN A CB     1 
ATOM   3445  C  CG     . GLN A  1 445  ? 49.874  109.654 14.279  1.00 110.67 ?  505  GLN A CG     1 
ATOM   3446  C  CD     . GLN A  1 445  ? 50.495  108.466 13.625  1.00 115.45 ?  505  GLN A CD     1 
ATOM   3447  O  OE1    . GLN A  1 445  ? 51.453  107.879 14.149  1.00 113.36 ?  505  GLN A OE1    1 
ATOM   3448  N  NE2    . GLN A  1 445  ? 49.963  108.081 12.471  1.00 101.54 ?  505  GLN A NE2    1 
ATOM   3449  N  N      . THR A  1 446  ? 48.837  107.727 18.678  1.00 121.54 ?  506  THR A N      1 
ATOM   3450  C  CA     . THR A  1 446  ? 48.995  107.627 20.129  1.00 121.72 ?  506  THR A CA     1 
ATOM   3451  C  C      . THR A  1 446  ? 50.415  107.234 20.566  1.00 126.68 ?  506  THR A C      1 
ATOM   3452  O  O      . THR A  1 446  ? 50.922  107.799 21.550  1.00 126.83 ?  506  THR A O      1 
ATOM   3453  C  CB     . THR A  1 446  ? 47.926  106.725 20.693  1.00 121.66 ?  506  THR A CB     1 
ATOM   3454  O  OG1    . THR A  1 446  ? 48.013  105.488 20.007  1.00 123.46 ?  506  THR A OG1    1 
ATOM   3455  C  CG2    . THR A  1 446  ? 46.531  107.312 20.507  1.00 115.17 ?  506  THR A CG2    1 
ATOM   3456  N  N      . ARG A  1 447  ? 51.074  106.326 19.810  1.00 122.40 ?  507  ARG A N      1 
ATOM   3457  C  CA     . ARG A  1 447  ? 52.438  105.941 20.140  1.00 122.18 ?  507  ARG A CA     1 
ATOM   3458  C  C      . ARG A  1 447  ? 53.403  107.118 20.062  1.00 123.99 ?  507  ARG A C      1 
ATOM   3459  O  O      . ARG A  1 447  ? 54.187  107.320 21.003  1.00 123.44 ?  507  ARG A O      1 
ATOM   3460  C  CB     . ARG A  1 447  ? 52.910  104.771 19.287  1.00 123.10 ?  507  ARG A CB     1 
ATOM   3461  C  CG     . ARG A  1 447  ? 53.300  103.574 20.147  1.00 137.35 ?  507  ARG A CG     1 
ATOM   3462  C  CD     . ARG A  1 447  ? 53.376  102.262 19.372  1.00 148.13 ?  507  ARG A CD     1 
ATOM   3463  N  NE     . ARG A  1 447  ? 52.428  101.261 19.866  1.00 150.91 ?  507  ARG A NE     1 
ATOM   3464  C  CZ     . ARG A  1 447  ? 51.230  101.030 19.332  1.00 166.59 ?  507  ARG A CZ     1 
ATOM   3465  N  NH1    . ARG A  1 447  ? 50.441  100.090 19.836  1.00 166.01 1  507  ARG A NH1    1 
ATOM   3466  N  NH2    . ARG A  1 447  ? 50.808  101.745 18.291  1.00 143.40 ?  507  ARG A NH2    1 
ATOM   3467  N  N      . ALA A  1 448  ? 53.331  107.907 18.960  1.00 119.42 ?  508  ALA A N      1 
ATOM   3468  C  CA     . ALA A  1 448  ? 54.224  109.064 18.792  1.00 119.29 ?  508  ALA A CA     1 
ATOM   3469  C  C      . ALA A  1 448  ? 54.010  110.091 19.904  1.00 122.73 ?  508  ALA A C      1 
ATOM   3470  O  O      . ALA A  1 448  ? 54.990  110.617 20.438  1.00 124.89 ?  508  ALA A O      1 
ATOM   3471  C  CB     . ALA A  1 448  ? 54.037  109.702 17.430  1.00 119.30 ?  508  ALA A CB     1 
ATOM   3472  N  N      . VAL A  1 449  ? 52.740  110.342 20.286  1.00 115.66 ?  509  VAL A N      1 
ATOM   3473  C  CA     . VAL A  1 449  ? 52.401  111.276 21.363  1.00 113.90 ?  509  VAL A CA     1 
ATOM   3474  C  C      . VAL A  1 449  ? 52.999  110.807 22.701  1.00 115.86 ?  509  VAL A C      1 
ATOM   3475  O  O      . VAL A  1 449  ? 53.644  111.596 23.403  1.00 115.47 ?  509  VAL A O      1 
ATOM   3476  C  CB     . VAL A  1 449  ? 50.882  111.507 21.441  1.00 115.87 ?  509  VAL A CB     1 
ATOM   3477  C  CG1    . VAL A  1 449  ? 50.512  112.272 22.698  1.00 115.88 ?  509  VAL A CG1    1 
ATOM   3478  C  CG2    . VAL A  1 449  ? 50.403  112.267 20.210  1.00 115.38 ?  509  VAL A CG2    1 
ATOM   3479  N  N      . GLN A  1 450  ? 52.833  109.514 23.025  1.00 110.44 ?  510  GLN A N      1 
ATOM   3480  C  CA     . GLN A  1 450  ? 53.388  108.978 24.262  1.00 110.19 ?  510  GLN A CA     1 
ATOM   3481  C  C      . GLN A  1 450  ? 54.897  109.093 24.310  1.00 114.84 ?  510  GLN A C      1 
ATOM   3482  O  O      . GLN A  1 450  ? 55.453  109.407 25.366  1.00 115.57 ?  510  GLN A O      1 
ATOM   3483  C  CB     . GLN A  1 450  ? 52.935  107.544 24.504  1.00 110.58 ?  510  GLN A CB     1 
ATOM   3484  C  CG     . GLN A  1 450  ? 53.300  107.028 25.902  1.00 116.48 ?  510  GLN A CG     1 
ATOM   3485  C  CD     . GLN A  1 450  ? 52.718  107.845 27.040  1.00 126.12 ?  510  GLN A CD     1 
ATOM   3486  O  OE1    . GLN A  1 450  ? 51.508  107.878 27.242  1.00 118.74 ?  510  GLN A OE1    1 
ATOM   3487  N  NE2    . GLN A  1 450  ? 53.563  108.543 27.787  1.00 116.73 ?  510  GLN A NE2    1 
ATOM   3488  N  N      . GLY A  1 451  ? 55.544  108.885 23.174  1.00 111.79 ?  511  GLY A N      1 
ATOM   3489  C  CA     . GLY A  1 451  ? 56.993  109.052 23.084  1.00 113.38 ?  511  GLY A CA     1 
ATOM   3490  C  C      . GLY A  1 451  ? 57.443  110.477 23.358  1.00 116.78 ?  511  GLY A C      1 
ATOM   3491  O  O      . GLY A  1 451  ? 58.440  110.706 24.061  1.00 116.47 ?  511  GLY A O      1 
ATOM   3492  N  N      . MET A  1 452  ? 56.686  111.445 22.824  1.00 112.58 ?  512  MET A N      1 
ATOM   3493  C  CA     . MET A  1 452  ? 56.946  112.846 23.084  1.00 113.88 ?  512  MET A CA     1 
ATOM   3494  C  C      . MET A  1 452  ? 56.811  113.136 24.583  1.00 119.52 ?  512  MET A C      1 
ATOM   3495  O  O      . MET A  1 452  ? 57.680  113.778 25.162  1.00 120.58 ?  512  MET A O      1 
ATOM   3496  C  CB     . MET A  1 452  ? 55.989  113.725 22.278  1.00 115.38 ?  512  MET A CB     1 
ATOM   3497  C  CG     . MET A  1 452  ? 56.288  113.727 20.794  1.00 118.66 ?  512  MET A CG     1 
ATOM   3498  S  SD     . MET A  1 452  ? 55.027  114.609 19.849  1.00 122.17 ?  512  MET A SD     1 
ATOM   3499  C  CE     . MET A  1 452  ? 55.253  116.302 20.482  1.00 120.22 ?  512  MET A CE     1 
ATOM   3500  N  N      . LEU A  1 453  ? 55.759  112.625 25.212  1.00 116.98 ?  513  LEU A N      1 
ATOM   3501  C  CA     . LEU A  1 453  ? 55.518  112.834 26.637  1.00 119.10 ?  513  LEU A CA     1 
ATOM   3502  C  C      . LEU A  1 453  ? 56.613  112.204 27.511  1.00 126.83 ?  513  LEU A C      1 
ATOM   3503  O  O      . LEU A  1 453  ? 57.049  112.821 28.497  1.00 128.51 ?  513  LEU A O      1 
ATOM   3504  C  CB     . LEU A  1 453  ? 54.132  112.290 27.004  1.00 118.18 ?  513  LEU A CB     1 
ATOM   3505  C  CG     . LEU A  1 453  ? 52.938  113.244 26.934  1.00 122.03 ?  513  LEU A CG     1 
ATOM   3506  C  CD1    . LEU A  1 453  ? 52.972  114.135 25.718  1.00 121.61 ?  513  LEU A CD1    1 
ATOM   3507  C  CD2    . LEU A  1 453  ? 51.664  112.452 26.933  1.00 121.49 ?  513  LEU A CD2    1 
ATOM   3508  N  N      . ASP A  1 454  ? 57.095  111.007 27.127  1.00 123.58 ?  514  ASP A N      1 
ATOM   3509  C  CA     . ASP A  1 454  ? 58.196  110.365 27.842  1.00 124.93 ?  514  ASP A CA     1 
ATOM   3510  C  C      . ASP A  1 454  ? 59.457  111.238 27.773  1.00 129.64 ?  514  ASP A C      1 
ATOM   3511  O  O      . ASP A  1 454  ? 60.153  111.403 28.771  1.00 131.21 ?  514  ASP A O      1 
ATOM   3512  C  CB     . ASP A  1 454  ? 58.453  108.969 27.278  1.00 126.31 ?  514  ASP A CB     1 
ATOM   3513  C  CG     . ASP A  1 454  ? 57.387  107.943 27.639  1.00 133.88 ?  514  ASP A CG     1 
ATOM   3514  O  OD1    . ASP A  1 454  ? 56.523  108.252 28.488  1.00 132.94 ?  514  ASP A OD1    1 
ATOM   3515  O  OD2    . ASP A  1 454  ? 57.437  106.818 27.094  1.00 138.73 -1 514  ASP A OD2    1 
ATOM   3516  N  N      . PHE A  1 455  ? 59.706  111.848 26.613  1.00 125.08 ?  515  PHE A N      1 
ATOM   3517  C  CA     . PHE A  1 455  ? 60.816  112.767 26.415  1.00 125.97 ?  515  PHE A CA     1 
ATOM   3518  C  C      . PHE A  1 455  ? 60.612  114.008 27.271  1.00 129.06 ?  515  PHE A C      1 
ATOM   3519  O  O      . PHE A  1 455  ? 61.545  114.429 27.935  1.00 130.07 ?  515  PHE A O      1 
ATOM   3520  C  CB     . PHE A  1 455  ? 60.923  113.135 24.937  1.00 127.01 ?  515  PHE A CB     1 
ATOM   3521  C  CG     . PHE A  1 455  ? 61.800  114.322 24.626  1.00 130.94 ?  515  PHE A CG     1 
ATOM   3522  C  CD1    . PHE A  1 455  ? 61.256  115.601 24.498  1.00 135.27 ?  515  PHE A CD1    1 
ATOM   3523  C  CD2    . PHE A  1 455  ? 63.165  114.164 24.425  1.00 135.32 ?  515  PHE A CD2    1 
ATOM   3524  C  CE1    . PHE A  1 455  ? 62.074  116.706 24.202  1.00 138.05 ?  515  PHE A CE1    1 
ATOM   3525  C  CE2    . PHE A  1 455  ? 63.975  115.265 24.097  1.00 139.74 ?  515  PHE A CE2    1 
ATOM   3526  C  CZ     . PHE A  1 455  ? 63.419  116.525 23.976  1.00 137.94 ?  515  PHE A CZ     1 
ATOM   3527  N  N      . ASP A  1 456  ? 59.405  114.591 27.257  1.00 124.64 ?  516  ASP A N      1 
ATOM   3528  C  CA     . ASP A  1 456  ? 59.108  115.796 28.024  1.00 126.15 ?  516  ASP A CA     1 
ATOM   3529  C  C      . ASP A  1 456  ? 59.362  115.572 29.496  1.00 130.33 ?  516  ASP A C      1 
ATOM   3530  O  O      . ASP A  1 456  ? 59.949  116.434 30.151  1.00 131.90 ?  516  ASP A O      1 
ATOM   3531  C  CB     . ASP A  1 456  ? 57.656  116.235 27.811  1.00 127.91 ?  516  ASP A CB     1 
ATOM   3532  C  CG     . ASP A  1 456  ? 57.270  116.532 26.371  1.00 145.32 ?  516  ASP A CG     1 
ATOM   3533  O  OD1    . ASP A  1 456  ? 58.156  116.964 25.590  1.00 145.15 ?  516  ASP A OD1    1 
ATOM   3534  O  OD2    . ASP A  1 456  ? 56.081  116.331 26.024  1.00 155.73 -1 516  ASP A OD2    1 
ATOM   3535  N  N      . TYR A  1 457  ? 58.963  114.396 30.008  1.00 125.74 ?  517  TYR A N      1 
ATOM   3536  C  CA     . TYR A  1 457  ? 59.136  114.072 31.423  1.00 126.95 ?  517  TYR A CA     1 
ATOM   3537  C  C      . TYR A  1 457  ? 60.617  113.987 31.833  1.00 129.07 ?  517  TYR A C      1 
ATOM   3538  O  O      . TYR A  1 457  ? 60.994  114.598 32.844  1.00 128.65 ?  517  TYR A O      1 
ATOM   3539  C  CB     . TYR A  1 457  ? 58.348  112.814 31.786  1.00 127.52 ?  517  TYR A CB     1 
ATOM   3540  C  CG     . TYR A  1 457  ? 58.394  112.416 33.255  1.00 133.01 ?  517  TYR A CG     1 
ATOM   3541  C  CD1    . TYR A  1 457  ? 57.464  112.907 34.167  1.00 136.17 ?  517  TYR A CD1    1 
ATOM   3542  C  CD2    . TYR A  1 457  ? 59.326  111.491 33.719  1.00 135.89 ?  517  TYR A CD2    1 
ATOM   3543  C  CE1    . TYR A  1 457  ? 57.480  112.505 35.516  1.00 140.17 ?  517  TYR A CE1    1 
ATOM   3544  C  CE2    . TYR A  1 457  ? 59.345  111.075 35.056  1.00 139.45 ?  517  TYR A CE2    1 
ATOM   3545  C  CZ     . TYR A  1 457  ? 58.419  111.581 35.954  1.00 147.81 ?  517  TYR A CZ     1 
ATOM   3546  O  OH     . TYR A  1 457  ? 58.466  111.141 37.262  1.00 147.53 ?  517  TYR A OH     1 
ATOM   3547  N  N      . VAL A  1 458  ? 61.448  113.256 31.049  1.00 125.07 ?  518  VAL A N      1 
ATOM   3548  C  CA     . VAL A  1 458  ? 62.879  113.111 31.343  1.00 127.85 ?  518  VAL A CA     1 
ATOM   3549  C  C      . VAL A  1 458  ? 63.639  114.442 31.137  1.00 138.26 ?  518  VAL A C      1 
ATOM   3550  O  O      . VAL A  1 458  ? 64.699  114.653 31.741  1.00 141.19 ?  518  VAL A O      1 
ATOM   3551  C  CB     . VAL A  1 458  ? 63.566  111.923 30.633  1.00 130.02 ?  518  VAL A CB     1 
ATOM   3552  C  CG1    . VAL A  1 458  ? 63.050  110.586 31.142  1.00 128.79 ?  518  VAL A CG1    1 
ATOM   3553  C  CG2    . VAL A  1 458  ? 63.444  112.020 29.127  1.00 127.82 ?  518  VAL A CG2    1 
ATOM   3554  N  N      . CYS A  1 459  ? 63.085  115.341 30.301  1.00 135.39 ?  519  CYS A N      1 
ATOM   3555  C  CA     . CYS A  1 459  ? 63.633  116.678 30.074  1.00 136.93 ?  519  CYS A CA     1 
ATOM   3556  C  C      . CYS A  1 459  ? 63.282  117.598 31.220  1.00 142.39 ?  519  CYS A C      1 
ATOM   3557  O  O      . CYS A  1 459  ? 63.722  118.756 31.244  1.00 143.93 ?  519  CYS A O      1 
ATOM   3558  C  CB     . CYS A  1 459  ? 63.134  117.245 28.754  1.00 135.47 ?  519  CYS A CB     1 
ATOM   3559  S  SG     . CYS A  1 459  ? 63.958  116.542 27.317  1.00 138.38 ?  519  CYS A SG     1 
ATOM   3560  N  N      . SER A  1 460  ? 62.455  117.091 32.152  1.00 138.06 ?  520  SER A N      1 
ATOM   3561  C  CA     . SER A  1 460  ? 61.992  117.803 33.333  1.00 138.73 ?  520  SER A CA     1 
ATOM   3562  C  C      . SER A  1 460  ? 61.147  119.043 32.931  1.00 142.29 ?  520  SER A C      1 
ATOM   3563  O  O      . SER A  1 460  ? 61.237  120.109 33.552  1.00 144.19 ?  520  SER A O      1 
ATOM   3564  C  CB     . SER A  1 460  ? 63.164  118.139 34.259  1.00 141.47 ?  520  SER A CB     1 
ATOM   3565  O  OG     . SER A  1 460  ? 64.098  117.072 34.352  1.00 137.98 ?  520  SER A OG     1 
ATOM   3566  N  N      . ARG A  1 461  ? 60.332  118.890 31.866  1.00 135.26 ?  521  ARG A N      1 
ATOM   3567  C  CA     . ARG A  1 461  ? 59.414  119.938 31.422  1.00 134.10 ?  521  ARG A CA     1 
ATOM   3568  C  C      . ARG A  1 461  ? 58.305  120.026 32.449  1.00 140.75 ?  521  ARG A C      1 
ATOM   3569  O  O      . ARG A  1 461  ? 57.979  119.025 33.109  1.00 140.72 ?  521  ARG A O      1 
ATOM   3570  C  CB     . ARG A  1 461  ? 58.796  119.600 30.068  1.00 128.68 ?  521  ARG A CB     1 
ATOM   3571  C  CG     . ARG A  1 461  ? 59.556  120.155 28.889  1.00 127.22 ?  521  ARG A CG     1 
ATOM   3572  C  CD     . ARG A  1 461  ? 58.865  119.838 27.576  1.00 117.68 ?  521  ARG A CD     1 
ATOM   3573  N  NE     . ARG A  1 461  ? 57.494  120.344 27.556  1.00 122.46 ?  521  ARG A NE     1 
ATOM   3574  C  CZ     . ARG A  1 461  ? 56.984  121.163 26.643  1.00 140.77 ?  521  ARG A CZ     1 
ATOM   3575  N  NH1    . ARG A  1 461  ? 57.737  121.608 25.644  1.00 127.56 1  521  ARG A NH1    1 
ATOM   3576  N  NH2    . ARG A  1 461  ? 55.720  121.550 26.727  1.00 134.57 ?  521  ARG A NH2    1 
ATOM   3577  N  N      . ASP A  1 462  ? 57.726  121.220 32.590  1.00 138.91 ?  522  ASP A N      1 
ATOM   3578  C  CA     . ASP A  1 462  ? 56.646  121.445 33.534  1.00 139.43 ?  522  ASP A CA     1 
ATOM   3579  C  C      . ASP A  1 462  ? 55.363  120.798 33.033  1.00 138.47 ?  522  ASP A C      1 
ATOM   3580  O  O      . ASP A  1 462  ? 54.599  120.253 33.821  1.00 137.28 ?  522  ASP A O      1 
ATOM   3581  C  CB     . ASP A  1 462  ? 56.463  122.955 33.778  1.00 144.53 ?  522  ASP A CB     1 
ATOM   3582  C  CG     . ASP A  1 462  ? 57.708  123.655 34.322  1.00 167.35 ?  522  ASP A CG     1 
ATOM   3583  O  OD1    . ASP A  1 462  ? 58.118  123.339 35.466  1.00 171.06 ?  522  ASP A OD1    1 
ATOM   3584  O  OD2    . ASP A  1 462  ? 58.279  124.520 33.599  1.00 177.21 -1 522  ASP A OD2    1 
ATOM   3585  N  N      . GLU A  1 463  ? 55.129  120.845 31.728  1.00 132.82 ?  523  GLU A N      1 
ATOM   3586  C  CA     . GLU A  1 463  ? 53.895  120.302 31.165  1.00 130.11 ?  523  GLU A CA     1 
ATOM   3587  C  C      . GLU A  1 463  ? 54.130  119.482 29.893  1.00 129.38 ?  523  GLU A C      1 
ATOM   3588  O  O      . GLU A  1 463  ? 55.121  119.718 29.186  1.00 129.90 ?  523  GLU A O      1 
ATOM   3589  C  CB     . GLU A  1 463  ? 52.913  121.438 30.842  1.00 132.17 ?  523  GLU A CB     1 
ATOM   3590  C  CG     . GLU A  1 463  ? 52.364  122.220 32.024  1.00 149.72 ?  523  GLU A CG     1 
ATOM   3591  C  CD     . GLU A  1 463  ? 51.438  123.358 31.620  1.00 183.99 ?  523  GLU A CD     1 
ATOM   3592  O  OE1    . GLU A  1 463  ? 50.581  123.131 30.733  1.00 190.05 ?  523  GLU A OE1    1 
ATOM   3593  O  OE2    . GLU A  1 463  ? 51.566  124.475 32.178  1.00 178.42 -1 523  GLU A OE2    1 
ATOM   3594  N  N      . PRO A  1 464  ? 53.203  118.532 29.582  1.00 120.70 ?  524  PRO A N      1 
ATOM   3595  C  CA     . PRO A  1 464  ? 53.291  117.796 28.307  1.00 118.00 ?  524  PRO A CA     1 
ATOM   3596  C  C      . PRO A  1 464  ? 53.358  118.731 27.102  1.00 121.26 ?  524  PRO A C      1 
ATOM   3597  O  O      . PRO A  1 464  ? 52.705  119.762 27.086  1.00 121.34 ?  524  PRO A O      1 
ATOM   3598  C  CB     . PRO A  1 464  ? 51.975  117.008 28.277  1.00 117.66 ?  524  PRO A CB     1 
ATOM   3599  C  CG     . PRO A  1 464  ? 51.610  116.844 29.684  1.00 122.43 ?  524  PRO A CG     1 
ATOM   3600  C  CD     . PRO A  1 464  ? 52.010  118.119 30.347  1.00 120.41 ?  524  PRO A CD     1 
ATOM   3601  N  N      . SER A  1 465  ? 54.116  118.350 26.088  1.00 117.47 ?  525  SER A N      1 
ATOM   3602  C  CA     . SER A  1 465  ? 54.241  119.132 24.869  1.00 117.87 ?  525  SER A CA     1 
ATOM   3603  C  C      . SER A  1 465  ? 53.045  118.976 23.908  1.00 120.60 ?  525  SER A C      1 
ATOM   3604  O  O      . SER A  1 465  ? 52.925  119.769 22.974  1.00 121.03 ?  525  SER A O      1 
ATOM   3605  C  CB     . SER A  1 465  ? 55.529  118.764 24.148  1.00 123.38 ?  525  SER A CB     1 
ATOM   3606  O  OG     . SER A  1 465  ? 55.472  117.426 23.681  1.00 134.70 ?  525  SER A OG     1 
ATOM   3607  N  N      . VAL A  1 466  ? 52.189  117.956 24.102  1.00 115.05 ?  526  VAL A N      1 
ATOM   3608  C  CA     . VAL A  1 466  ? 51.000  117.766 23.266  1.00 112.80 ?  526  VAL A CA     1 
ATOM   3609  C  C      . VAL A  1 466  ? 49.771  118.259 23.997  1.00 121.50 ?  526  VAL A C      1 
ATOM   3610  O  O      . VAL A  1 466  ? 49.398  117.694 25.027  1.00 122.71 ?  526  VAL A O      1 
ATOM   3611  C  CB     . VAL A  1 466  ? 50.836  116.325 22.805  1.00 112.73 ?  526  VAL A CB     1 
ATOM   3612  C  CG1    . VAL A  1 466  ? 49.614  116.185 21.899  1.00 110.50 ?  526  VAL A CG1    1 
ATOM   3613  C  CG2    . VAL A  1 466  ? 52.086  115.886 22.087  1.00 112.44 ?  526  VAL A CG2    1 
ATOM   3614  N  N      . ALA A  1 467  ? 49.147  119.321 23.477  1.00 119.72 ?  527  ALA A N      1 
ATOM   3615  C  CA     . ALA A  1 467  ? 47.964  119.885 24.117  1.00 121.02 ?  527  ALA A CA     1 
ATOM   3616  C  C      . ALA A  1 467  ? 46.671  119.232 23.635  1.00 124.29 ?  527  ALA A C      1 
ATOM   3617  O  O      . ALA A  1 467  ? 45.695  119.187 24.402  1.00 125.27 ?  527  ALA A O      1 
ATOM   3618  C  CB     . ALA A  1 467  ? 47.906  121.391 23.907  1.00 123.30 ?  527  ALA A CB     1 
ATOM   3619  N  N      . ALA A  1 468  ? 46.650  118.750 22.371  1.00 117.40 ?  528  ALA A N      1 
ATOM   3620  C  CA     . ALA A  1 468  ? 45.450  118.184 21.770  1.00 115.48 ?  528  ALA A CA     1 
ATOM   3621  C  C      . ALA A  1 468  ? 45.778  117.443 20.517  1.00 118.29 ?  528  ALA A C      1 
ATOM   3622  O  O      . ALA A  1 468  ? 46.836  117.671 19.932  1.00 118.35 ?  528  ALA A O      1 
ATOM   3623  C  CB     . ALA A  1 468  ? 44.459  119.297 21.431  1.00 117.01 ?  528  ALA A CB     1 
ATOM   3624  N  N      . MET A  1 469  ? 44.846  116.574 20.081  1.00 112.96 ?  529  MET A N      1 
ATOM   3625  C  CA     . MET A  1 469  ? 44.927  115.841 18.815  1.00 110.21 ?  529  MET A CA     1 
ATOM   3626  C  C      . MET A  1 469  ? 43.699  116.153 17.955  1.00 111.52 ?  529  MET A C      1 
ATOM   3627  O  O      . MET A  1 469  ? 42.640  116.481 18.494  1.00 112.39 ?  529  MET A O      1 
ATOM   3628  C  CB     . MET A  1 469  ? 45.053  114.344 19.043  1.00 111.19 ?  529  MET A CB     1 
ATOM   3629  C  CG     . MET A  1 469  ? 46.218  113.966 19.934  1.00 114.95 ?  529  MET A CG     1 
ATOM   3630  S  SD     . MET A  1 469  ? 46.225  112.197 20.325  1.00 118.75 ?  529  MET A SD     1 
ATOM   3631  C  CE     . MET A  1 469  ? 46.640  111.482 18.755  1.00 113.85 ?  529  MET A CE     1 
ATOM   3632  N  N      . VAL A  1 470  ? 43.854  116.108 16.629  1.00 104.33 ?  530  VAL A N      1 
ATOM   3633  C  CA     . VAL A  1 470  ? 42.770  116.354 15.680  1.00 102.83 ?  530  VAL A CA     1 
ATOM   3634  C  C      . VAL A  1 470  ? 42.668  115.098 14.855  1.00 107.27 ?  530  VAL A C      1 
ATOM   3635  O  O      . VAL A  1 470  ? 43.671  114.678 14.282  1.00 104.86 ?  530  VAL A O      1 
ATOM   3636  C  CB     . VAL A  1 470  ? 42.994  117.599 14.781  1.00 106.05 ?  530  VAL A CB     1 
ATOM   3637  C  CG1    . VAL A  1 470  ? 41.988  117.633 13.655  1.00 106.63 ?  530  VAL A CG1    1 
ATOM   3638  C  CG2    . VAL A  1 470  ? 42.917  118.889 15.565  1.00 106.51 ?  530  VAL A CG2    1 
ATOM   3639  N  N      . TYR A  1 471  ? 41.470  114.480 14.814  1.00 108.37 ?  531  TYR A N      1 
ATOM   3640  C  CA     . TYR A  1 471  ? 41.178  113.254 14.044  1.00 109.72 ?  531  TYR A CA     1 
ATOM   3641  C  C      . TYR A  1 471  ? 39.719  113.312 13.583  1.00 113.03 ?  531  TYR A C      1 
ATOM   3642  O  O      . TYR A  1 471  ? 38.785  113.217 14.398  1.00 114.62 ?  531  TYR A O      1 
ATOM   3643  C  CB     . TYR A  1 471  ? 41.529  111.959 14.813  1.00 111.83 ?  531  TYR A CB     1 
ATOM   3644  C  CG     . TYR A  1 471  ? 41.315  110.698 14.008  1.00 115.07 ?  531  TYR A CG     1 
ATOM   3645  C  CD1    . TYR A  1 471  ? 42.053  110.446 12.855  1.00 116.98 ?  531  TYR A CD1    1 
ATOM   3646  C  CD2    . TYR A  1 471  ? 40.362  109.757 14.393  1.00 117.06 ?  531  TYR A CD2    1 
ATOM   3647  C  CE1    . TYR A  1 471  ? 41.833  109.289 12.091  1.00 119.29 ?  531  TYR A CE1    1 
ATOM   3648  C  CE2    . TYR A  1 471  ? 40.126  108.604 13.640  1.00 118.77 ?  531  TYR A CE2    1 
ATOM   3649  C  CZ     . TYR A  1 471  ? 40.856  108.373 12.484  1.00 129.11 ?  531  TYR A CZ     1 
ATOM   3650  O  OH     . TYR A  1 471  ? 40.593  107.222 11.762  1.00 131.33 ?  531  TYR A OH     1 
ATOM   3651  N  N      . PRO A  1 472  ? 39.544  113.536 12.271  1.00 105.98 ?  532  PRO A N      1 
ATOM   3652  C  CA     . PRO A  1 472  ? 38.204  113.785 11.732  1.00 106.32 ?  532  PRO A CA     1 
ATOM   3653  C  C      . PRO A  1 472  ? 37.250  112.616 11.647  1.00 111.13 ?  532  PRO A C      1 
ATOM   3654  O  O      . PRO A  1 472  ? 36.072  112.840 11.335  1.00 110.64 ?  532  PRO A O      1 
ATOM   3655  C  CB     . PRO A  1 472  ? 38.510  114.310 10.341  1.00 108.57 ?  532  PRO A CB     1 
ATOM   3656  C  CG     . PRO A  1 472  ? 39.828  113.629 9.977   1.00 111.71 ?  532  PRO A CG     1 
ATOM   3657  C  CD     . PRO A  1 472  ? 40.586  113.704 11.237  1.00 106.16 ?  532  PRO A CD     1 
ATOM   3658  N  N      . PHE A  1 473  ? 37.733  111.383 11.857  1.00 109.00 ?  533  PHE A N      1 
ATOM   3659  C  CA     . PHE A  1 473  ? 36.851  110.234 11.717  1.00 110.02 ?  533  PHE A CA     1 
ATOM   3660  C  C      . PHE A  1 473  ? 36.080  109.894 12.966  1.00 119.68 ?  533  PHE A C      1 
ATOM   3661  O  O      . PHE A  1 473  ? 34.972  109.368 12.851  1.00 121.30 ?  533  PHE A O      1 
ATOM   3662  C  CB     . PHE A  1 473  ? 37.602  109.030 11.164  1.00 110.58 ?  533  PHE A CB     1 
ATOM   3663  C  CG     . PHE A  1 473  ? 37.933  109.260 9.715   1.00 112.09 ?  533  PHE A CG     1 
ATOM   3664  C  CD1    . PHE A  1 473  ? 36.986  109.013 8.721   1.00 116.14 ?  533  PHE A CD1    1 
ATOM   3665  C  CD2    . PHE A  1 473  ? 39.156  109.806 9.344   1.00 113.88 ?  533  PHE A CD2    1 
ATOM   3666  C  CE1    . PHE A  1 473  ? 37.271  109.267 7.382   1.00 117.73 ?  533  PHE A CE1    1 
ATOM   3667  C  CE2    . PHE A  1 473  ? 39.445  110.066 8.005   1.00 117.43 ?  533  PHE A CE2    1 
ATOM   3668  C  CZ     . PHE A  1 473  ? 38.503  109.783 7.032   1.00 116.95 ?  533  PHE A CZ     1 
ATOM   3669  N  N      . THR A  1 474  ? 36.620  110.236 14.141  1.00 118.99 ?  534  THR A N      1 
ATOM   3670  C  CA     . THR A  1 474  ? 35.960  110.023 15.431  1.00 120.44 ?  534  THR A CA     1 
ATOM   3671  C  C      . THR A  1 474  ? 35.321  111.316 15.912  1.00 123.93 ?  534  THR A C      1 
ATOM   3672  O  O      . THR A  1 474  ? 35.731  112.412 15.503  1.00 123.91 ?  534  THR A O      1 
ATOM   3673  C  CB     . THR A  1 474  ? 37.007  109.595 16.500  1.00 141.30 ?  534  THR A CB     1 
ATOM   3674  O  OG1    . THR A  1 474  ? 38.054  110.589 16.620  1.00 144.88 ?  534  THR A OG1    1 
ATOM   3675  C  CG2    . THR A  1 474  ? 37.586  108.197 16.244  1.00 140.65 ?  534  THR A CG2    1 
ATOM   3676  N  N      . GLY A  1 475  ? 34.395  111.173 16.851  1.00 120.41 ?  535  GLY A N      1 
ATOM   3677  C  CA     . GLY A  1 475  ? 33.815  112.315 17.535  1.00 121.50 ?  535  GLY A CA     1 
ATOM   3678  C  C      . GLY A  1 475  ? 34.793  112.859 18.569  1.00 124.57 ?  535  GLY A C      1 
ATOM   3679  O  O      . GLY A  1 475  ? 35.819  112.226 18.863  1.00 124.40 ?  535  GLY A O      1 
ATOM   3680  N  N      . ASP A  1 476  ? 34.494  114.037 19.140  1.00 119.87 ?  536  ASP A N      1 
ATOM   3681  C  CA     . ASP A  1 476  ? 35.368  114.608 20.161  1.00 119.04 ?  536  ASP A CA     1 
ATOM   3682  C  C      . ASP A  1 476  ? 35.391  113.676 21.364  1.00 116.89 ?  536  ASP A C      1 
ATOM   3683  O  O      . ASP A  1 476  ? 34.359  113.121 21.723  1.00 116.18 ?  536  ASP A O      1 
ATOM   3684  C  CB     . ASP A  1 476  ? 34.947  116.043 20.568  1.00 124.40 ?  536  ASP A CB     1 
ATOM   3685  C  CG     . ASP A  1 476  ? 34.921  117.051 19.405  1.00 151.87 ?  536  ASP A CG     1 
ATOM   3686  O  OD1    . ASP A  1 476  ? 33.995  116.970 18.575  1.00 158.55 ?  536  ASP A OD1    1 
ATOM   3687  O  OD2    . ASP A  1 476  ? 35.876  117.871 19.282  1.00 156.88 -1 536  ASP A OD2    1 
ATOM   3688  N  N      . HIS A  1 477  ? 36.574  113.459 21.941  1.00 110.46 ?  537  HIS A N      1 
ATOM   3689  C  CA     . HIS A  1 477  ? 36.773  112.606 23.111  1.00 109.00 ?  537  HIS A CA     1 
ATOM   3690  C  C      . HIS A  1 477  ? 38.139  112.884 23.755  1.00 113.12 ?  537  HIS A C      1 
ATOM   3691  O  O      . HIS A  1 477  ? 38.919  113.687 23.238  1.00 112.39 ?  537  HIS A O      1 
ATOM   3692  C  CB     . HIS A  1 477  ? 36.659  111.129 22.717  1.00 108.16 ?  537  HIS A CB     1 
ATOM   3693  C  CG     . HIS A  1 477  ? 37.754  110.656 21.816  1.00 110.02 ?  537  HIS A CG     1 
ATOM   3694  N  ND1    . HIS A  1 477  ? 37.727  110.902 20.450  1.00 111.30 ?  537  HIS A ND1    1 
ATOM   3695  C  CD2    . HIS A  1 477  ? 38.879  109.963 22.115  1.00 111.08 ?  537  HIS A CD2    1 
ATOM   3696  C  CE1    . HIS A  1 477  ? 38.826  110.350 19.962  1.00 110.08 ?  537  HIS A CE1    1 
ATOM   3697  N  NE2    . HIS A  1 477  ? 39.564  109.786 20.931  1.00 110.25 ?  537  HIS A NE2    1 
ATOM   3698  N  N      . LYS A  1 478  ? 38.417  112.224 24.886  1.00 109.35 ?  538  LYS A N      1 
ATOM   3699  C  CA     . LYS A  1 478  ? 39.710  112.324 25.552  1.00 108.42 ?  538  LYS A CA     1 
ATOM   3700  C  C      . LYS A  1 478  ? 40.409  110.977 25.457  1.00 114.37 ?  538  LYS A C      1 
ATOM   3701  O  O      . LYS A  1 478  ? 39.755  109.914 25.473  1.00 114.58 ?  538  LYS A O      1 
ATOM   3702  C  CB     . LYS A  1 478  ? 39.578  112.796 26.995  1.00 110.49 ?  538  LYS A CB     1 
ATOM   3703  C  CG     . LYS A  1 478  ? 39.229  114.273 27.097  1.00 118.88 ?  538  LYS A CG     1 
ATOM   3704  C  CD     . LYS A  1 478  ? 39.168  114.748 28.543  1.00 125.37 ?  538  LYS A CD     1 
ATOM   3705  C  CE     . LYS A  1 478  ? 38.810  116.210 28.699  1.00 134.45 ?  538  LYS A CE     1 
ATOM   3706  N  NZ     . LYS A  1 478  ? 39.727  116.903 29.673  1.00 141.95 1  538  LYS A NZ     1 
ATOM   3707  N  N      . GLN A  1 479  ? 41.722  111.025 25.240  1.00 111.20 ?  539  GLN A N      1 
ATOM   3708  C  CA     . GLN A  1 479  ? 42.566  109.838 25.132  1.00 110.84 ?  539  GLN A CA     1 
ATOM   3709  C  C      . GLN A  1 479  ? 43.502  109.769 26.349  1.00 116.34 ?  539  GLN A C      1 
ATOM   3710  O  O      . GLN A  1 479  ? 44.054  110.797 26.757  1.00 116.73 ?  539  GLN A O      1 
ATOM   3711  C  CB     . GLN A  1 479  ? 43.368  109.882 23.828  1.00 111.58 ?  539  GLN A CB     1 
ATOM   3712  C  CG     . GLN A  1 479  ? 44.459  108.829 23.710  1.00 129.69 ?  539  GLN A CG     1 
ATOM   3713  C  CD     . GLN A  1 479  ? 43.880  107.473 23.545  1.00 156.26 ?  539  GLN A CD     1 
ATOM   3714  O  OE1    . GLN A  1 479  ? 44.170  106.558 24.332  1.00 159.81 ?  539  GLN A OE1    1 
ATOM   3715  N  NE2    . GLN A  1 479  ? 43.033  107.334 22.516  1.00 139.52 ?  539  GLN A NE2    1 
ATOM   3716  N  N      . LYS A  1 480  ? 43.670  108.562 26.931  1.00 112.90 ?  540  LYS A N      1 
ATOM   3717  C  CA     . LYS A  1 480  ? 44.536  108.320 28.098  1.00 112.72 ?  540  LYS A CA     1 
ATOM   3718  C  C      . LYS A  1 480  ? 45.998  108.219 27.679  1.00 115.27 ?  540  LYS A C      1 
ATOM   3719  O  O      . LYS A  1 480  ? 46.329  107.539 26.690  1.00 114.52 ?  540  LYS A O      1 
ATOM   3720  C  CB     . LYS A  1 480  ? 44.123  107.026 28.809  1.00 115.09 ?  540  LYS A CB     1 
ATOM   3721  C  CG     . LYS A  1 480  ? 43.922  107.113 30.328  1.00 126.95 ?  540  LYS A CG     1 
ATOM   3722  C  CD     . LYS A  1 480  ? 43.595  105.737 30.999  1.00 133.32 ?  540  LYS A CD     1 
ATOM   3723  C  CE     . LYS A  1 480  ? 42.165  105.265 30.868  1.00 133.09 ?  540  LYS A CE     1 
ATOM   3724  N  NZ     . LYS A  1 480  ? 41.717  104.461 32.032  1.00 138.80 1  540  LYS A NZ     1 
ATOM   3725  N  N      . PHE A  1 481  ? 46.864  108.910 28.434  1.00 111.11 ?  541  PHE A N      1 
ATOM   3726  C  CA     . PHE A  1 481  ? 48.316  108.924 28.277  1.00 111.20 ?  541  PHE A CA     1 
ATOM   3727  C  C      . PHE A  1 481  ? 49.000  108.909 29.639  1.00 118.35 ?  541  PHE A C      1 
ATOM   3728  O  O      . PHE A  1 481  ? 48.325  108.953 30.655  1.00 119.44 ?  541  PHE A O      1 
ATOM   3729  C  CB     . PHE A  1 481  ? 48.787  110.107 27.440  1.00 112.73 ?  541  PHE A CB     1 
ATOM   3730  C  CG     . PHE A  1 481  ? 48.439  110.022 25.968  1.00 112.98 ?  541  PHE A CG     1 
ATOM   3731  C  CD1    . PHE A  1 481  ? 49.181  109.221 25.101  1.00 114.48 ?  541  PHE A CD1    1 
ATOM   3732  C  CD2    . PHE A  1 481  ? 47.398  110.777 25.440  1.00 114.74 ?  541  PHE A CD2    1 
ATOM   3733  C  CE1    . PHE A  1 481  ? 48.878  109.172 23.740  1.00 114.03 ?  541  PHE A CE1    1 
ATOM   3734  C  CE2    . PHE A  1 481  ? 47.109  110.735 24.077  1.00 115.95 ?  541  PHE A CE2    1 
ATOM   3735  C  CZ     . PHE A  1 481  ? 47.837  109.917 23.241  1.00 113.09 ?  541  PHE A CZ     1 
ATOM   3736  N  N      . TYR A  1 482  ? 50.333  108.825 29.664  1.00 116.93 ?  542  TYR A N      1 
ATOM   3737  C  CA     . TYR A  1 482  ? 51.121  108.740 30.889  1.00 119.61 ?  542  TYR A CA     1 
ATOM   3738  C  C      . TYR A  1 482  ? 52.098  109.911 31.009  1.00 128.79 ?  542  TYR A C      1 
ATOM   3739  O  O      . TYR A  1 482  ? 52.837  110.216 30.068  1.00 129.92 ?  542  TYR A O      1 
ATOM   3740  C  CB     . TYR A  1 482  ? 51.938  107.448 30.873  1.00 120.72 ?  542  TYR A CB     1 
ATOM   3741  C  CG     . TYR A  1 482  ? 51.313  106.273 31.567  1.00 123.25 ?  542  TYR A CG     1 
ATOM   3742  C  CD1    . TYR A  1 482  ? 51.394  106.139 32.942  1.00 128.19 ?  542  TYR A CD1    1 
ATOM   3743  C  CD2    . TYR A  1 482  ? 50.802  105.203 30.841  1.00 122.89 ?  542  TYR A CD2    1 
ATOM   3744  C  CE1    . TYR A  1 482  ? 50.881  105.019 33.594  1.00 131.41 ?  542  TYR A CE1    1 
ATOM   3745  C  CE2    . TYR A  1 482  ? 50.290  104.071 31.477  1.00 124.32 ?  542  TYR A CE2    1 
ATOM   3746  C  CZ     . TYR A  1 482  ? 50.338  103.979 32.857  1.00 135.90 ?  542  TYR A CZ     1 
ATOM   3747  O  OH     . TYR A  1 482  ? 49.824  102.884 33.516  1.00 137.97 ?  542  TYR A OH     1 
ATOM   3748  N  N      . TRP A  1 483  ? 52.125  110.534 32.173  1.00 127.38 ?  543  TRP A N      1 
ATOM   3749  C  CA     . TRP A  1 483  ? 53.059  111.599 32.523  1.00 129.90 ?  543  TRP A CA     1 
ATOM   3750  C  C      . TRP A  1 483  ? 53.861  111.043 33.703  1.00 140.51 ?  543  TRP A C      1 
ATOM   3751  O  O      . TRP A  1 483  ? 53.473  111.182 34.869  1.00 142.25 ?  543  TRP A O      1 
ATOM   3752  C  CB     . TRP A  1 483  ? 52.292  112.869 32.897  1.00 128.64 ?  543  TRP A CB     1 
ATOM   3753  C  CG     . TRP A  1 483  ? 53.165  114.043 33.209  1.00 131.08 ?  543  TRP A CG     1 
ATOM   3754  C  CD1    . TRP A  1 483  ? 53.271  114.679 34.403  1.00 136.33 ?  543  TRP A CD1    1 
ATOM   3755  C  CD2    . TRP A  1 483  ? 54.045  114.732 32.309  1.00 130.81 ?  543  TRP A CD2    1 
ATOM   3756  N  NE1    . TRP A  1 483  ? 54.140  115.744 34.298  1.00 137.40 ?  543  TRP A NE1    1 
ATOM   3757  C  CE2    . TRP A  1 483  ? 54.640  115.790 33.029  1.00 137.07 ?  543  TRP A CE2    1 
ATOM   3758  C  CE3    . TRP A  1 483  ? 54.378  114.569 30.957  1.00 130.54 ?  543  TRP A CE3    1 
ATOM   3759  C  CZ2    . TRP A  1 483  ? 55.554  116.672 32.451  1.00 137.19 ?  543  TRP A CZ2    1 
ATOM   3760  C  CZ3    . TRP A  1 483  ? 55.292  115.438 30.390  1.00 132.76 ?  543  TRP A CZ3    1 
ATOM   3761  C  CH2    . TRP A  1 483  ? 55.869  116.476 31.133  1.00 135.63 ?  543  TRP A CH2    1 
ATOM   3762  N  N      . GLY A  1 484  ? 54.973  110.397 33.397  1.00 138.90 ?  544  GLY A N      1 
ATOM   3763  C  CA     . GLY A  1 484  ? 55.674  109.625 34.403  1.00 140.85 ?  544  GLY A CA     1 
ATOM   3764  C  C      . GLY A  1 484  ? 54.968  108.314 34.688  1.00 145.66 ?  544  GLY A C      1 
ATOM   3765  O  O      . GLY A  1 484  ? 54.876  107.445 33.816  1.00 143.69 ?  544  GLY A O      1 
ATOM   3766  N  N      . HIS A  1 485  ? 54.375  108.231 35.875  1.00 144.60 ?  545  HIS A N      1 
ATOM   3767  C  CA     . HIS A  1 485  ? 53.584  107.038 36.266  1.00 144.54 ?  545  HIS A CA     1 
ATOM   3768  C  C      . HIS A  1 485  ? 52.120  107.467 36.362  1.00 141.25 ?  545  HIS A C      1 
ATOM   3769  O  O      . HIS A  1 485  ? 51.262  106.603 36.567  1.00 138.86 ?  545  HIS A O      1 
ATOM   3770  C  CB     . HIS A  1 485  ? 54.097  106.472 37.591  1.00 149.83 ?  545  HIS A CB     1 
ATOM   3771  C  CG     . HIS A  1 485  ? 55.086  107.357 38.268  1.00 157.26 ?  545  HIS A CG     1 
ATOM   3772  N  ND1    . HIS A  1 485  ? 56.237  106.866 38.846  1.00 161.33 ?  545  HIS A ND1    1 
ATOM   3773  C  CD2    . HIS A  1 485  ? 55.102  108.692 38.462  1.00 161.69 ?  545  HIS A CD2    1 
ATOM   3774  C  CE1    . HIS A  1 485  ? 56.921  107.862 39.366  1.00 163.63 ?  545  HIS A CE1    1 
ATOM   3775  N  NE2    . HIS A  1 485  ? 56.246  108.993 39.143  1.00 163.99 ?  545  HIS A NE2    1 
ATOM   3776  N  N      . LYS A  1 486  ? 51.872  108.767 36.210  1.00 135.03 ?  546  LYS A N      1 
ATOM   3777  C  CA     . LYS A  1 486  ? 50.531  109.326 36.299  1.00 133.39 ?  546  LYS A CA     1 
ATOM   3778  C  C      . LYS A  1 486  ? 49.751  109.224 35.003  1.00 134.58 ?  546  LYS A C      1 
ATOM   3779  O  O      . LYS A  1 486  ? 50.245  109.616 33.946  1.00 133.92 ?  546  LYS A O      1 
ATOM   3780  C  CB     . LYS A  1 486  ? 50.628  110.792 36.761  1.00 136.85 ?  546  LYS A CB     1 
ATOM   3781  C  CG     . LYS A  1 486  ? 49.294  111.544 36.844  1.00 149.61 ?  546  LYS A CG     1 
ATOM   3782  C  CD     . LYS A  1 486  ? 49.465  113.067 37.036  1.00 162.77 ?  546  LYS A CD     1 
ATOM   3783  C  CE     . LYS A  1 486  ? 48.115  113.697 37.382  1.00 168.77 ?  546  LYS A CE     1 
ATOM   3784  N  NZ     . LYS A  1 486  ? 48.238  115.010 38.069  1.00 174.36 1  546  LYS A NZ     1 
ATOM   3785  N  N      . GLU A  1 487  ? 48.514  108.735 35.084  1.00 129.26 ?  547  GLU A N      1 
ATOM   3786  C  CA     . GLU A  1 487  ? 47.694  108.702 33.876  1.00 127.15 ?  547  GLU A CA     1 
ATOM   3787  C  C      . GLU A  1 487  ? 47.038  110.050 33.700  1.00 127.64 ?  547  GLU A C      1 
ATOM   3788  O  O      . GLU A  1 487  ? 46.527  110.616 34.665  1.00 128.77 ?  547  GLU A O      1 
ATOM   3789  C  CB     . GLU A  1 487  ? 46.660  107.565 33.871  1.00 128.68 ?  547  GLU A CB     1 
ATOM   3790  C  CG     . GLU A  1 487  ? 47.294  106.194 33.735  1.00 145.02 ?  547  GLU A CG     1 
ATOM   3791  C  CD     . GLU A  1 487  ? 46.504  105.152 32.973  1.00 164.53 ?  547  GLU A CD     1 
ATOM   3792  O  OE1    . GLU A  1 487  ? 46.664  105.078 31.732  1.00 163.45 ?  547  GLU A OE1    1 
ATOM   3793  O  OE2    . GLU A  1 487  ? 45.770  104.375 33.625  1.00 153.56 -1 547  GLU A OE2    1 
ATOM   3794  N  N      . ILE A  1 488  ? 47.131  110.600 32.493  1.00 120.40 ?  548  ILE A N      1 
ATOM   3795  C  CA     . ILE A  1 488  ? 46.561  111.900 32.118  1.00 118.74 ?  548  ILE A CA     1 
ATOM   3796  C  C      . ILE A  1 488  ? 45.658  111.751 30.873  1.00 122.81 ?  548  ILE A C      1 
ATOM   3797  O  O      . ILE A  1 488  ? 45.679  110.707 30.189  1.00 122.49 ?  548  ILE A O      1 
ATOM   3798  C  CB     . ILE A  1 488  ? 47.651  112.974 31.911  1.00 120.67 ?  548  ILE A CB     1 
ATOM   3799  C  CG1    . ILE A  1 488  ? 48.572  112.610 30.753  1.00 118.11 ?  548  ILE A CG1    1 
ATOM   3800  C  CG2    . ILE A  1 488  ? 48.446  113.159 33.174  1.00 123.12 ?  548  ILE A CG2    1 
ATOM   3801  C  CD1    . ILE A  1 488  ? 49.267  113.747 30.214  1.00 114.57 ?  548  ILE A CD1    1 
ATOM   3802  N  N      . LEU A  1 489  ? 44.870  112.804 30.586  1.00 117.33 ?  549  LEU A N      1 
ATOM   3803  C  CA     . LEU A  1 489  ? 43.971  112.812 29.441  1.00 114.10 ?  549  LEU A CA     1 
ATOM   3804  C  C      . LEU A  1 489  ? 44.290  113.929 28.493  1.00 116.15 ?  549  LEU A C      1 
ATOM   3805  O  O      . LEU A  1 489  ? 44.448  115.065 28.924  1.00 117.16 ?  549  LEU A O      1 
ATOM   3806  C  CB     . LEU A  1 489  ? 42.507  112.897 29.881  1.00 113.95 ?  549  LEU A CB     1 
ATOM   3807  C  CG     . LEU A  1 489  ? 41.931  111.722 30.673  1.00 116.87 ?  549  LEU A CG     1 
ATOM   3808  C  CD1    . LEU A  1 489  ? 40.482  111.940 30.951  1.00 117.35 ?  549  LEU A CD1    1 
ATOM   3809  C  CD2    . LEU A  1 489  ? 42.110  110.417 29.955  1.00 114.17 ?  549  LEU A CD2    1 
ATOM   3810  N  N      . ILE A  1 490  ? 44.379  113.606 27.199  1.00 110.40 ?  550  ILE A N      1 
ATOM   3811  C  CA     . ILE A  1 490  ? 44.619  114.582 26.147  1.00 110.20 ?  550  ILE A CA     1 
ATOM   3812  C  C      . ILE A  1 490  ? 43.388  114.661 25.257  1.00 113.68 ?  550  ILE A C      1 
ATOM   3813  O  O      . ILE A  1 490  ? 42.925  113.616 24.803  1.00 113.57 ?  550  ILE A O      1 
ATOM   3814  C  CB     . ILE A  1 490  ? 45.914  114.298 25.361  1.00 112.55 ?  550  ILE A CB     1 
ATOM   3815  C  CG1    . ILE A  1 490  ? 47.117  114.467 26.301  1.00 114.22 ?  550  ILE A CG1    1 
ATOM   3816  C  CG2    . ILE A  1 490  ? 46.037  115.234 24.131  1.00 113.29 ?  550  ILE A CG2    1 
ATOM   3817  C  CD1    . ILE A  1 490  ? 48.456  114.149 25.711  1.00 123.87 ?  550  ILE A CD1    1 
ATOM   3818  N  N      . PRO A  1 491  ? 42.836  115.866 24.996  1.00 109.67 ?  551  PRO A N      1 
ATOM   3819  C  CA     . PRO A  1 491  ? 41.637  115.955 24.166  1.00 109.33 ?  551  PRO A CA     1 
ATOM   3820  C  C      . PRO A  1 491  ? 41.885  115.687 22.688  1.00 113.86 ?  551  PRO A C      1 
ATOM   3821  O  O      . PRO A  1 491  ? 42.909  116.105 22.139  1.00 113.60 ?  551  PRO A O      1 
ATOM   3822  C  CB     . PRO A  1 491  ? 41.183  117.394 24.375  1.00 112.49 ?  551  PRO A CB     1 
ATOM   3823  C  CG     . PRO A  1 491  ? 42.394  118.129 24.681  1.00 117.31 ?  551  PRO A CG     1 
ATOM   3824  C  CD     . PRO A  1 491  ? 43.237  117.197 25.481  1.00 112.75 ?  551  PRO A CD     1 
ATOM   3825  N  N      . VAL A  1 492  ? 40.930  114.990 22.049  1.00 109.25 ?  552  VAL A N      1 
ATOM   3826  C  CA     . VAL A  1 492  ? 40.939  114.697 20.623  1.00 107.16 ?  552  VAL A CA     1 
ATOM   3827  C  C      . VAL A  1 492  ? 39.728  115.393 20.021  1.00 112.79 ?  552  VAL A C      1 
ATOM   3828  O  O      . VAL A  1 492  ? 38.623  115.227 20.523  1.00 112.40 ?  552  VAL A O      1 
ATOM   3829  C  CB     . VAL A  1 492  ? 40.947  113.188 20.318  1.00 108.80 ?  552  VAL A CB     1 
ATOM   3830  C  CG1    . VAL A  1 492  ? 41.082  112.939 18.814  1.00 108.32 ?  552  VAL A CG1    1 
ATOM   3831  C  CG2    . VAL A  1 492  ? 42.055  112.477 21.078  1.00 107.66 ?  552  VAL A CG2    1 
ATOM   3832  N  N      . PHE A  1 493  ? 39.940  116.182 18.973  1.00 112.15 ?  553  PHE A N      1 
ATOM   3833  C  CA     . PHE A  1 493  ? 38.887  116.944 18.316  1.00 115.03 ?  553  PHE A CA     1 
ATOM   3834  C  C      . PHE A  1 493  ? 38.569  116.456 16.928  1.00 120.74 ?  553  PHE A C      1 
ATOM   3835  O  O      . PHE A  1 493  ? 39.486  116.109 16.170  1.00 119.58 ?  553  PHE A O      1 
ATOM   3836  C  CB     . PHE A  1 493  ? 39.295  118.412 18.223  1.00 118.93 ?  553  PHE A CB     1 
ATOM   3837  C  CG     . PHE A  1 493  ? 39.419  119.101 19.555  1.00 122.27 ?  553  PHE A CG     1 
ATOM   3838  C  CD1    . PHE A  1 493  ? 40.623  119.106 20.246  1.00 124.78 ?  553  PHE A CD1    1 
ATOM   3839  C  CD2    . PHE A  1 493  ? 38.328  119.748 20.122  1.00 126.50 ?  553  PHE A CD2    1 
ATOM   3840  C  CE1    . PHE A  1 493  ? 40.732  119.751 21.477  1.00 126.79 ?  553  PHE A CE1    1 
ATOM   3841  C  CE2    . PHE A  1 493  ? 38.430  120.374 21.357  1.00 129.86 ?  553  PHE A CE2    1 
ATOM   3842  C  CZ     . PHE A  1 493  ? 39.631  120.375 22.026  1.00 127.46 ?  553  PHE A CZ     1 
ATOM   3843  N  N      . LYS A  1 494  ? 37.261  116.493 16.566  1.00 119.33 ?  554  LYS A N      1 
ATOM   3844  C  CA     . LYS A  1 494  ? 36.846  116.117 15.216  1.00 119.85 ?  554  LYS A CA     1 
ATOM   3845  C  C      . LYS A  1 494  ? 37.246  117.245 14.262  1.00 128.83 ?  554  LYS A C      1 
ATOM   3846  O  O      . LYS A  1 494  ? 37.731  116.970 13.148  1.00 129.22 ?  554  LYS A O      1 
ATOM   3847  C  CB     . LYS A  1 494  ? 35.336  115.841 15.134  1.00 121.18 ?  554  LYS A CB     1 
ATOM   3848  C  CG     . LYS A  1 494  ? 34.874  115.303 13.777  1.00 112.07 ?  554  LYS A CG     1 
ATOM   3849  C  CD     . LYS A  1 494  ? 33.385  115.010 13.760  1.00 122.09 ?  554  LYS A CD     1 
ATOM   3850  C  CE     . LYS A  1 494  ? 32.945  114.110 12.614  1.00 142.70 ?  554  LYS A CE     1 
ATOM   3851  N  NZ     . LYS A  1 494  ? 33.155  112.641 12.855  1.00 147.85 1  554  LYS A NZ     1 
ATOM   3852  N  N      . ASN A  1 495  ? 37.078  118.510 14.712  1.00 127.91 ?  555  ASN A N      1 
ATOM   3853  C  CA     . ASN A  1 495  ? 37.384  119.684 13.885  1.00 129.81 ?  555  ASN A CA     1 
ATOM   3854  C  C      . ASN A  1 495  ? 38.574  120.467 14.369  1.00 134.61 ?  555  ASN A C      1 
ATOM   3855  O  O      . ASN A  1 495  ? 38.659  120.758 15.563  1.00 135.64 ?  555  ASN A O      1 
ATOM   3856  C  CB     . ASN A  1 495  ? 36.178  120.623 13.788  1.00 134.94 ?  555  ASN A CB     1 
ATOM   3857  C  CG     . ASN A  1 495  ? 34.933  119.950 13.269  1.00 170.70 ?  555  ASN A CG     1 
ATOM   3858  O  OD1    . ASN A  1 495  ? 34.912  119.324 12.204  1.00 161.98 ?  555  ASN A OD1    1 
ATOM   3859  N  ND2    . ASN A  1 495  ? 33.865  120.041 14.033  1.00 170.94 ?  555  ASN A ND2    1 
ATOM   3860  N  N      . MET A  1 496  ? 39.445  120.891 13.434  1.00 130.39 ?  556  MET A N      1 
ATOM   3861  C  CA     . MET A  1 496  ? 40.634  121.679 13.764  1.00 130.17 ?  556  MET A CA     1 
ATOM   3862  C  C      . MET A  1 496  ? 40.264  123.010 14.412  1.00 133.94 ?  556  MET A C      1 
ATOM   3863  O  O      . MET A  1 496  ? 40.949  123.467 15.333  1.00 132.87 ?  556  MET A O      1 
ATOM   3864  C  CB     . MET A  1 496  ? 41.475  121.931 12.517  1.00 132.76 ?  556  MET A CB     1 
ATOM   3865  C  CG     . MET A  1 496  ? 42.762  122.688 12.808  1.00 137.50 ?  556  MET A CG     1 
ATOM   3866  S  SD     . MET A  1 496  ? 43.810  122.982 11.365  1.00 142.42 ?  556  MET A SD     1 
ATOM   3867  C  CE     . MET A  1 496  ? 44.278  121.345 10.966  1.00 136.71 ?  556  MET A CE     1 
ATOM   3868  N  N      . ALA A  1 497  ? 39.182  123.632 13.945  1.00 131.32 ?  557  ALA A N      1 
ATOM   3869  C  CA     . ALA A  1 497  ? 38.771  124.902 14.513  1.00 133.16 ?  557  ALA A CA     1 
ATOM   3870  C  C      . ALA A  1 497  ? 38.515  124.806 16.008  1.00 138.97 ?  557  ALA A C      1 
ATOM   3871  O  O      . ALA A  1 497  ? 38.859  125.741 16.722  1.00 141.98 ?  557  ALA A O      1 
ATOM   3872  C  CB     . ALA A  1 497  ? 37.550  125.428 13.793  1.00 135.56 ?  557  ALA A CB     1 
ATOM   3873  N  N      . ASP A  1 498  ? 37.965  123.677 16.493  1.00 133.35 ?  558  ASP A N      1 
ATOM   3874  C  CA     . ASP A  1 498  ? 37.693  123.493 17.919  1.00 132.74 ?  558  ASP A CA     1 
ATOM   3875  C  C      . ASP A  1 498  ? 38.963  123.341 18.718  1.00 132.05 ?  558  ASP A C      1 
ATOM   3876  O  O      . ASP A  1 498  ? 39.095  123.955 19.782  1.00 132.39 ?  558  ASP A O      1 
ATOM   3877  C  CB     . ASP A  1 498  ? 36.744  122.322 18.139  1.00 134.37 ?  558  ASP A CB     1 
ATOM   3878  C  CG     . ASP A  1 498  ? 35.356  122.584 17.570  1.00 152.58 ?  558  ASP A CG     1 
ATOM   3879  O  OD1    . ASP A  1 498  ? 34.900  123.759 17.613  1.00 155.87 ?  558  ASP A OD1    1 
ATOM   3880  O  OD2    . ASP A  1 498  ? 34.725  121.625 17.087  1.00 159.57 -1 558  ASP A OD2    1 
ATOM   3881  N  N      . ALA A  1 499  ? 39.916  122.565 18.189  1.00 124.69 ?  559  ALA A N      1 
ATOM   3882  C  CA     . ALA A  1 499  ? 41.208  122.383 18.844  1.00 123.22 ?  559  ALA A CA     1 
ATOM   3883  C  C      . ALA A  1 499  ? 41.952  123.711 18.986  1.00 127.37 ?  559  ALA A C      1 
ATOM   3884  O  O      . ALA A  1 499  ? 42.468  124.010 20.064  1.00 127.70 ?  559  ALA A O      1 
ATOM   3885  C  CB     . ALA A  1 499  ? 42.056  121.394 18.075  1.00 121.87 ?  559  ALA A CB     1 
ATOM   3886  N  N      . MET A  1 500  ? 41.983  124.515 17.915  1.00 122.73 ?  560  MET A N      1 
ATOM   3887  C  CA     . MET A  1 500  ? 42.696  125.793 17.945  1.00 122.66 ?  560  MET A CA     1 
ATOM   3888  C  C      . MET A  1 500  ? 42.062  126.759 18.915  1.00 127.16 ?  560  MET A C      1 
ATOM   3889  O  O      . MET A  1 500  ? 42.762  127.412 19.696  1.00 128.02 ?  560  MET A O      1 
ATOM   3890  C  CB     . MET A  1 500  ? 42.739  126.413 16.552  1.00 124.91 ?  560  MET A CB     1 
ATOM   3891  C  CG     . MET A  1 500  ? 43.449  125.576 15.551  1.00 125.52 ?  560  MET A CG     1 
ATOM   3892  S  SD     . MET A  1 500  ? 45.216  125.671 15.701  1.00 128.11 ?  560  MET A SD     1 
ATOM   3893  C  CE     . MET A  1 500  ? 45.631  124.519 14.446  1.00 122.43 ?  560  MET A CE     1 
ATOM   3894  N  N      . ARG A  1 501  ? 40.738  126.852 18.852  1.00 123.74 ?  561  ARG A N      1 
ATOM   3895  C  CA     . ARG A  1 501  ? 39.980  127.742 19.696  1.00 126.33 ?  561  ARG A CA     1 
ATOM   3896  C  C      . ARG A  1 501  ? 40.234  127.426 21.169  1.00 129.60 ?  561  ARG A C      1 
ATOM   3897  O  O      . ARG A  1 501  ? 40.464  128.341 21.957  1.00 130.92 ?  561  ARG A O      1 
ATOM   3898  C  CB     . ARG A  1 501  ? 38.484  127.640 19.352  1.00 129.36 ?  561  ARG A CB     1 
ATOM   3899  C  CG     . ARG A  1 501  ? 37.588  128.567 20.173  1.00 150.76 ?  561  ARG A CG     1 
ATOM   3900  C  CD     . ARG A  1 501  ? 36.123  128.448 19.800  1.00 167.68 ?  561  ARG A CD     1 
ATOM   3901  N  NE     . ARG A  1 501  ? 35.636  127.064 19.824  1.00 174.44 ?  561  ARG A NE     1 
ATOM   3902  C  CZ     . ARG A  1 501  ? 35.193  126.436 20.910  1.00 189.59 ?  561  ARG A CZ     1 
ATOM   3903  N  NH1    . ARG A  1 501  ? 35.188  127.050 22.086  1.00 189.26 1  561  ARG A NH1    1 
ATOM   3904  N  NH2    . ARG A  1 501  ? 34.766  125.184 20.831  1.00 163.89 ?  561  ARG A NH2    1 
ATOM   3905  N  N      . LYS A  1 502  ? 40.230  126.132 21.522  1.00 123.08 ?  562  LYS A N      1 
ATOM   3906  C  CA     . LYS A  1 502  ? 40.385  125.701 22.908  1.00 121.88 ?  562  LYS A CA     1 
ATOM   3907  C  C      . LYS A  1 502  ? 41.819  125.710 23.396  1.00 124.68 ?  562  LYS A C      1 
ATOM   3908  O  O      . LYS A  1 502  ? 42.065  125.598 24.598  1.00 124.17 ?  562  LYS A O      1 
ATOM   3909  C  CB     . LYS A  1 502  ? 39.725  124.332 23.107  1.00 120.39 ?  562  LYS A CB     1 
ATOM   3910  C  CG     . LYS A  1 502  ? 38.223  124.421 22.916  1.00 119.17 ?  562  LYS A CG     1 
ATOM   3911  C  CD     . LYS A  1 502  ? 37.538  123.200 23.397  1.00 130.95 ?  562  LYS A CD     1 
ATOM   3912  C  CE     . LYS A  1 502  ? 36.257  123.533 24.102  1.00 150.38 ?  562  LYS A CE     1 
ATOM   3913  N  NZ     . LYS A  1 502  ? 36.513  124.180 25.417  1.00 169.35 1  562  LYS A NZ     1 
ATOM   3914  N  N      . HIS A  1 503  ? 42.767  125.855 22.481  1.00 121.31 ?  563  HIS A N      1 
ATOM   3915  C  CA     . HIS A  1 503  ? 44.164  125.809 22.846  1.00 121.93 ?  563  HIS A CA     1 
ATOM   3916  C  C      . HIS A  1 503  ? 44.948  126.909 22.185  1.00 126.97 ?  563  HIS A C      1 
ATOM   3917  O  O      . HIS A  1 503  ? 45.791  126.658 21.312  1.00 125.23 ?  563  HIS A O      1 
ATOM   3918  C  CB     . HIS A  1 503  ? 44.744  124.415 22.585  1.00 121.13 ?  563  HIS A CB     1 
ATOM   3919  C  CG     . HIS A  1 503  ? 44.082  123.372 23.422  1.00 124.44 ?  563  HIS A CG     1 
ATOM   3920  N  ND1    . HIS A  1 503  ? 44.470  123.157 24.722  1.00 127.40 ?  563  HIS A ND1    1 
ATOM   3921  C  CD2    . HIS A  1 503  ? 42.995  122.607 23.158  1.00 125.34 ?  563  HIS A CD2    1 
ATOM   3922  C  CE1    . HIS A  1 503  ? 43.654  122.228 25.191  1.00 126.05 ?  563  HIS A CE1    1 
ATOM   3923  N  NE2    . HIS A  1 503  ? 42.742  121.876 24.288  1.00 125.10 ?  563  HIS A NE2    1 
ATOM   3924  N  N      . PRO A  1 504  ? 44.693  128.159 22.630  1.00 126.10 ?  564  PRO A N      1 
ATOM   3925  C  CA     . PRO A  1 504  ? 45.431  129.310 22.082  1.00 127.48 ?  564  PRO A CA     1 
ATOM   3926  C  C      . PRO A  1 504  ? 46.928  129.297 22.405  1.00 131.51 ?  564  PRO A C      1 
ATOM   3927  O  O      . PRO A  1 504  ? 47.699  130.017 21.768  1.00 132.26 ?  564  PRO A O      1 
ATOM   3928  C  CB     . PRO A  1 504  ? 44.728  130.495 22.724  1.00 131.95 ?  564  PRO A CB     1 
ATOM   3929  C  CG     . PRO A  1 504  ? 44.158  129.959 23.974  1.00 135.92 ?  564  PRO A CG     1 
ATOM   3930  C  CD     . PRO A  1 504  ? 43.705  128.596 23.632  1.00 128.81 ?  564  PRO A CD     1 
ATOM   3931  N  N      . GLU A  1 505  ? 47.337  128.478 23.381  1.00 127.49 ?  565  GLU A N      1 
ATOM   3932  C  CA     . GLU A  1 505  ? 48.737  128.310 23.760  1.00 128.29 ?  565  GLU A CA     1 
ATOM   3933  C  C      . GLU A  1 505  ? 49.574  127.494 22.722  1.00 131.87 ?  565  GLU A C      1 
ATOM   3934  O  O      . GLU A  1 505  ? 50.808  127.444 22.808  1.00 132.82 ?  565  GLU A O      1 
ATOM   3935  C  CB     . GLU A  1 505  ? 48.832  127.683 25.165  1.00 129.87 ?  565  GLU A CB     1 
ATOM   3936  C  CG     . GLU A  1 505  ? 48.536  126.193 25.229  1.00 140.57 ?  565  GLU A CG     1 
ATOM   3937  C  CD     . GLU A  1 505  ? 47.077  125.780 25.333  1.00 165.69 ?  565  GLU A CD     1 
ATOM   3938  O  OE1    . GLU A  1 505  ? 46.186  126.651 25.199  1.00 159.06 ?  565  GLU A OE1    1 
ATOM   3939  O  OE2    . GLU A  1 505  ? 46.825  124.571 25.551  1.00 158.44 -1 565  GLU A OE2    1 
ATOM   3940  N  N      . VAL A  1 506  ? 48.906  126.835 21.778  1.00 126.38 ?  566  VAL A N      1 
ATOM   3941  C  CA     . VAL A  1 506  ? 49.575  126.016 20.781  1.00 124.06 ?  566  VAL A CA     1 
ATOM   3942  C  C      . VAL A  1 506  ? 50.117  126.891 19.660  1.00 131.45 ?  566  VAL A C      1 
ATOM   3943  O  O      . VAL A  1 506  ? 49.369  127.680 19.084  1.00 131.58 ?  566  VAL A O      1 
ATOM   3944  C  CB     . VAL A  1 506  ? 48.625  124.918 20.240  1.00 124.33 ?  566  VAL A CB     1 
ATOM   3945  C  CG1    . VAL A  1 506  ? 49.189  124.258 18.996  1.00 122.06 ?  566  VAL A CG1    1 
ATOM   3946  C  CG2    . VAL A  1 506  ? 48.341  123.870 21.300  1.00 122.91 ?  566  VAL A CG2    1 
ATOM   3947  N  N      . ASP A  1 507  ? 51.409  126.733 19.331  1.00 129.82 ?  567  ASP A N      1 
ATOM   3948  C  CA     . ASP A  1 507  ? 52.004  127.418 18.185  1.00 130.32 ?  567  ASP A CA     1 
ATOM   3949  C  C      . ASP A  1 507  ? 52.627  126.418 17.196  1.00 129.73 ?  567  ASP A C      1 
ATOM   3950  O  O      . ASP A  1 507  ? 53.202  126.836 16.196  1.00 129.62 ?  567  ASP A O      1 
ATOM   3951  C  CB     . ASP A  1 507  ? 53.016  128.493 18.618  1.00 135.42 ?  567  ASP A CB     1 
ATOM   3952  C  CG     . ASP A  1 507  ? 54.419  127.971 18.920  1.00 150.72 ?  567  ASP A CG     1 
ATOM   3953  O  OD1    . ASP A  1 507  ? 54.536  127.007 19.713  1.00 151.38 ?  567  ASP A OD1    1 
ATOM   3954  O  OD2    . ASP A  1 507  ? 55.405  128.550 18.385  1.00 156.22 -1 567  ASP A OD2    1 
ATOM   3955  N  N      . VAL A  1 508  ? 52.506  125.114 17.471  1.00 122.59 ?  568  VAL A N      1 
ATOM   3956  C  CA     . VAL A  1 508  ? 53.078  124.069 16.636  1.00 120.29 ?  568  VAL A CA     1 
ATOM   3957  C  C      . VAL A  1 508  ? 52.013  123.062 16.283  1.00 122.62 ?  568  VAL A C      1 
ATOM   3958  O  O      . VAL A  1 508  ? 51.235  122.660 17.139  1.00 122.37 ?  568  VAL A O      1 
ATOM   3959  C  CB     . VAL A  1 508  ? 54.295  123.372 17.338  1.00 123.53 ?  568  VAL A CB     1 
ATOM   3960  C  CG1    . VAL A  1 508  ? 54.818  122.187 16.532  1.00 121.43 ?  568  VAL A CG1    1 
ATOM   3961  C  CG2    . VAL A  1 508  ? 55.422  124.355 17.588  1.00 125.54 ?  568  VAL A CG2    1 
ATOM   3962  N  N      . LEU A  1 509  ? 52.004  122.620 15.034  1.00 117.73 ?  569  LEU A N      1 
ATOM   3963  C  CA     . LEU A  1 509  ? 51.161  121.511 14.618  1.00 115.53 ?  569  LEU A CA     1 
ATOM   3964  C  C      . LEU A  1 509  ? 52.048  120.481 13.932  1.00 119.35 ?  569  LEU A C      1 
ATOM   3965  O  O      . LEU A  1 509  ? 52.826  120.831 13.034  1.00 120.32 ?  569  LEU A O      1 
ATOM   3966  C  CB     . LEU A  1 509  ? 49.957  121.910 13.727  1.00 114.67 ?  569  LEU A CB     1 
ATOM   3967  C  CG     . LEU A  1 509  ? 49.019  120.768 13.319  1.00 114.92 ?  569  LEU A CG     1 
ATOM   3968  C  CD1    . LEU A  1 509  ? 47.588  121.199 13.295  1.00 114.22 ?  569  LEU A CD1    1 
ATOM   3969  C  CD2    . LEU A  1 509  ? 49.415  120.219 11.991  1.00 114.03 ?  569  LEU A CD2    1 
ATOM   3970  N  N      . ILE A  1 510  ? 51.912  119.212 14.369  1.00 113.40 ?  570  ILE A N      1 
ATOM   3971  C  CA     . ILE A  1 510  ? 52.599  118.063 13.808  1.00 112.01 ?  570  ILE A CA     1 
ATOM   3972  C  C      . ILE A  1 510  ? 51.552  117.318 12.988  1.00 115.88 ?  570  ILE A C      1 
ATOM   3973  O  O      . ILE A  1 510  ? 50.583  116.777 13.538  1.00 115.02 ?  570  ILE A O      1 
ATOM   3974  C  CB     . ILE A  1 510  ? 53.248  117.186 14.881  1.00 114.61 ?  570  ILE A CB     1 
ATOM   3975  C  CG1    . ILE A  1 510  ? 54.186  118.007 15.755  1.00 115.93 ?  570  ILE A CG1    1 
ATOM   3976  C  CG2    . ILE A  1 510  ? 54.017  116.065 14.206  1.00 116.39 ?  570  ILE A CG2    1 
ATOM   3977  C  CD1    . ILE A  1 510  ? 54.711  117.253 16.939  1.00 122.55 ?  570  ILE A CD1    1 
ATOM   3978  N  N      . ASN A  1 511  ? 51.727  117.332 11.663  1.00 111.85 ?  571  ASN A N      1 
ATOM   3979  C  CA     . ASN A  1 511  ? 50.745  116.781 10.766  1.00 110.27 ?  571  ASN A CA     1 
ATOM   3980  C  C      . ASN A  1 511  ? 51.107  115.390 10.303  1.00 115.34 ?  571  ASN A C      1 
ATOM   3981  O  O      . ASN A  1 511  ? 51.989  115.224 9.432   1.00 117.64 ?  571  ASN A O      1 
ATOM   3982  C  CB     . ASN A  1 511  ? 50.529  117.733 9.577   1.00 105.18 ?  571  ASN A CB     1 
ATOM   3983  C  CG     . ASN A  1 511  ? 49.294  117.414 8.790   1.00 110.56 ?  571  ASN A CG     1 
ATOM   3984  O  OD1    . ASN A  1 511  ? 48.576  116.430 9.073   1.00 106.96 ?  571  ASN A OD1    1 
ATOM   3985  N  ND2    . ASN A  1 511  ? 49.014  118.242 7.788   1.00 89.88  ?  571  ASN A ND2    1 
ATOM   3986  N  N      . PHE A  1 512  ? 50.373  114.383 10.836  1.00 108.57 ?  572  PHE A N      1 
ATOM   3987  C  CA     . PHE A  1 512  ? 50.535  112.987 10.410  1.00 106.08 ?  572  PHE A CA     1 
ATOM   3988  C  C      . PHE A  1 512  ? 49.523  112.578 9.355   1.00 110.05 ?  572  PHE A C      1 
ATOM   3989  O  O      . PHE A  1 512  ? 49.311  111.375 9.165   1.00 110.30 ?  572  PHE A O      1 
ATOM   3990  C  CB     . PHE A  1 512  ? 50.438  112.019 11.573  1.00 105.90 ?  572  PHE A CB     1 
ATOM   3991  C  CG     . PHE A  1 512  ? 51.615  112.028 12.489  1.00 106.61 ?  572  PHE A CG     1 
ATOM   3992  C  CD1    . PHE A  1 512  ? 52.648  111.121 12.321  1.00 108.88 ?  572  PHE A CD1    1 
ATOM   3993  C  CD2    . PHE A  1 512  ? 51.648  112.874 13.591  1.00 108.19 ?  572  PHE A CD2    1 
ATOM   3994  C  CE1    . PHE A  1 512  ? 53.713  111.085 13.217  1.00 110.07 ?  572  PHE A CE1    1 
ATOM   3995  C  CE2    . PHE A  1 512  ? 52.719  112.847 14.481  1.00 110.73 ?  572  PHE A CE2    1 
ATOM   3996  C  CZ     . PHE A  1 512  ? 53.756  111.970 14.278  1.00 108.87 ?  572  PHE A CZ     1 
ATOM   3997  N  N      . ALA A  1 513  ? 48.891  113.554 8.665   1.00 106.23 ?  573  ALA A N      1 
ATOM   3998  C  CA     . ALA A  1 513  ? 47.982  113.226 7.567   1.00 105.97 ?  573  ALA A CA     1 
ATOM   3999  C  C      . ALA A  1 513  ? 48.754  112.447 6.467   1.00 108.55 ?  573  ALA A C      1 
ATOM   4000  O  O      . ALA A  1 513  ? 49.928  112.751 6.174   1.00 106.63 ?  573  ALA A O      1 
ATOM   4001  C  CB     . ALA A  1 513  ? 47.392  114.492 6.966   1.00 107.19 ?  573  ALA A CB     1 
ATOM   4002  N  N      . SER A  1 514  ? 48.076  111.463 5.845   1.00 105.41 ?  574  SER A N      1 
ATOM   4003  C  CA     . SER A  1 514  ? 48.660  110.722 4.728   1.00 105.64 ?  574  SER A CA     1 
ATOM   4004  C  C      . SER A  1 514  ? 48.975  111.683 3.576   1.00 110.54 ?  574  SER A C      1 
ATOM   4005  O  O      . SER A  1 514  ? 48.482  112.818 3.584   1.00 113.11 ?  574  SER A O      1 
ATOM   4006  C  CB     . SER A  1 514  ? 47.677  109.678 4.238   1.00 109.28 ?  574  SER A CB     1 
ATOM   4007  O  OG     . SER A  1 514  ? 46.779  110.285 3.329   1.00 116.77 ?  574  SER A OG     1 
ATOM   4008  N  N      . LEU A  1 515  ? 49.757  111.229 2.568   1.00 103.93 ?  575  LEU A N      1 
ATOM   4009  C  CA     . LEU A  1 515  ? 50.096  112.088 1.421   1.00 102.29 ?  575  LEU A CA     1 
ATOM   4010  C  C      . LEU A  1 515  ? 48.868  112.649 0.688   1.00 105.67 ?  575  LEU A C      1 
ATOM   4011  O  O      . LEU A  1 515  ? 48.903  113.764 0.169   1.00 105.86 ?  575  LEU A O      1 
ATOM   4012  C  CB     . LEU A  1 515  ? 51.014  111.373 0.435   1.00 101.89 ?  575  LEU A CB     1 
ATOM   4013  C  CG     . LEU A  1 515  ? 50.451  110.255 -0.379  1.00 104.76 ?  575  LEU A CG     1 
ATOM   4014  C  CD1    . LEU A  1 515  ? 49.925  110.761 -1.700  1.00 105.53 ?  575  LEU A CD1    1 
ATOM   4015  C  CD2    . LEU A  1 515  ? 51.495  109.240 -0.631  1.00 106.09 ?  575  LEU A CD2    1 
ATOM   4016  N  N      . ARG A  1 516  ? 47.794  111.874 0.660   1.00 101.40 ?  576  ARG A N      1 
ATOM   4017  C  CA     . ARG A  1 516  ? 46.568  112.266 -0.002  1.00 102.33 ?  576  ARG A CA     1 
ATOM   4018  C  C      . ARG A  1 516  ? 45.938  113.539 0.601   1.00 110.12 ?  576  ARG A C      1 
ATOM   4019  O  O      . ARG A  1 516  ? 45.442  114.390 -0.138  1.00 111.74 ?  576  ARG A O      1 
ATOM   4020  C  CB     . ARG A  1 516  ? 45.570  111.087 -0.029  1.00 98.56  ?  576  ARG A CB     1 
ATOM   4021  C  CG     . ARG A  1 516  ? 45.965  109.956 -0.990  1.00 90.87  ?  576  ARG A CG     1 
ATOM   4022  C  CD     . ARG A  1 516  ? 45.409  108.588 -0.632  1.00 92.20  ?  576  ARG A CD     1 
ATOM   4023  N  NE     . ARG A  1 516  ? 45.930  108.067 0.636   1.00 106.90 ?  576  ARG A NE     1 
ATOM   4024  C  CZ     . ARG A  1 516  ? 46.993  107.271 0.781   1.00 126.92 ?  576  ARG A CZ     1 
ATOM   4025  N  NH1    . ARG A  1 516  ? 47.384  106.888 1.994   1.00 105.74 1  576  ARG A NH1    1 
ATOM   4026  N  NH2    . ARG A  1 516  ? 47.680  106.863 -0.283  1.00 120.01 ?  576  ARG A NH2    1 
ATOM   4027  N  N      . SER A  1 517  ? 46.004  113.708 1.905   1.00 107.88 ?  577  SER A N      1 
ATOM   4028  C  CA     . SER A  1 517  ? 45.335  114.850 2.500   1.00 110.04 ?  577  SER A CA     1 
ATOM   4029  C  C      . SER A  1 517  ? 46.245  115.824 3.272   1.00 112.49 ?  577  SER A C      1 
ATOM   4030  O  O      . SER A  1 517  ? 45.769  116.792 3.880   1.00 112.27 ?  577  SER A O      1 
ATOM   4031  C  CB     . SER A  1 517  ? 44.196  114.343 3.381   1.00 117.67 ?  577  SER A CB     1 
ATOM   4032  O  OG     . SER A  1 517  ? 44.684  113.415 4.336   1.00 132.39 ?  577  SER A OG     1 
ATOM   4033  N  N      . ALA A  1 518  ? 47.544  115.598 3.221   1.00 108.00 ?  578  ALA A N      1 
ATOM   4034  C  CA     . ALA A  1 518  ? 48.484  116.477 3.926   1.00 107.35 ?  578  ALA A CA     1 
ATOM   4035  C  C      . ALA A  1 518  ? 48.443  117.915 3.393   1.00 110.66 ?  578  ALA A C      1 
ATOM   4036  O  O      . ALA A  1 518  ? 48.588  118.864 4.162   1.00 108.29 ?  578  ALA A O      1 
ATOM   4037  C  CB     . ALA A  1 518  ? 49.902  115.923 3.829   1.00 107.72 ?  578  ALA A CB     1 
ATOM   4038  N  N      . TYR A  1 519  ? 48.230  118.072 2.074   1.00 108.45 ?  579  TYR A N      1 
ATOM   4039  C  CA     . TYR A  1 519  ? 48.204  119.389 1.467   1.00 108.40 ?  579  TYR A CA     1 
ATOM   4040  C  C      . TYR A  1 519  ? 47.084  120.214 2.036   1.00 112.60 ?  579  TYR A C      1 
ATOM   4041  O  O      . TYR A  1 519  ? 47.332  121.320 2.525   1.00 111.78 ?  579  TYR A O      1 
ATOM   4042  C  CB     . TYR A  1 519  ? 48.097  119.276 -0.059  1.00 109.37 ?  579  TYR A CB     1 
ATOM   4043  C  CG     . TYR A  1 519  ? 47.901  120.612 -0.741  1.00 110.95 ?  579  TYR A CG     1 
ATOM   4044  C  CD1    . TYR A  1 519  ? 48.972  121.466 -0.969  1.00 113.60 ?  579  TYR A CD1    1 
ATOM   4045  C  CD2    . TYR A  1 519  ? 46.645  121.027 -1.147  1.00 112.27 ?  579  TYR A CD2    1 
ATOM   4046  C  CE1    . TYR A  1 519  ? 48.791  122.708 -1.572  1.00 115.22 ?  579  TYR A CE1    1 
ATOM   4047  C  CE2    . TYR A  1 519  ? 46.453  122.261 -1.756  1.00 114.74 ?  579  TYR A CE2    1 
ATOM   4048  C  CZ     . TYR A  1 519  ? 47.526  123.100 -1.966  1.00 120.97 ?  579  TYR A CZ     1 
ATOM   4049  O  OH     . TYR A  1 519  ? 47.330  124.306 -2.590  1.00 123.74 ?  579  TYR A OH     1 
ATOM   4050  N  N      . ASP A  1 520  ? 45.848  119.675 1.975   1.00 109.15 ?  580  ASP A N      1 
ATOM   4051  C  CA     . ASP A  1 520  ? 44.679  120.407 2.440   1.00 109.42 ?  580  ASP A CA     1 
ATOM   4052  C  C      . ASP A  1 520  ? 44.715  120.696 3.922   1.00 109.27 ?  580  ASP A C      1 
ATOM   4053  O  O      . ASP A  1 520  ? 44.328  121.790 4.316   1.00 108.94 ?  580  ASP A O      1 
ATOM   4054  C  CB     . ASP A  1 520  ? 43.401  119.687 2.056   1.00 112.89 ?  580  ASP A CB     1 
ATOM   4055  C  CG     . ASP A  1 520  ? 43.343  119.360 0.587   1.00 136.40 ?  580  ASP A CG     1 
ATOM   4056  O  OD1    . ASP A  1 520  ? 44.096  118.454 0.164   1.00 139.33 -1 580  ASP A OD1    1 
ATOM   4057  O  OD2    . ASP A  1 520  ? 42.676  120.117 -0.170  1.00 148.00 -1 580  ASP A OD2    1 
ATOM   4058  N  N      . SER A  1 521  ? 45.181  119.732 4.747   1.00 102.99 ?  581  SER A N      1 
ATOM   4059  C  CA     . SER A  1 521  ? 45.242  119.956 6.189   1.00 101.47 ?  581  SER A CA     1 
ATOM   4060  C  C      . SER A  1 521  ? 46.336  120.936 6.566   1.00 105.51 ?  581  SER A C      1 
ATOM   4061  O  O      . SER A  1 521  ? 46.158  121.702 7.517   1.00 105.70 ?  581  SER A O      1 
ATOM   4062  C  CB     . SER A  1 521  ? 45.362  118.654 6.958   1.00 102.31 ?  581  SER A CB     1 
ATOM   4063  O  OG     . SER A  1 521  ? 46.439  117.866 6.489   1.00 108.79 ?  581  SER A OG     1 
ATOM   4064  N  N      . THR A  1 522  ? 47.434  120.984 5.795   1.00 102.00 ?  582  THR A N      1 
ATOM   4065  C  CA     . THR A  1 522  ? 48.484  121.975 6.054   1.00 102.00 ?  582  THR A CA     1 
ATOM   4066  C  C      . THR A  1 522  ? 47.995  123.362 5.663   1.00 107.98 ?  582  THR A C      1 
ATOM   4067  O  O      . THR A  1 522  ? 48.199  124.297 6.437   1.00 109.48 ?  582  THR A O      1 
ATOM   4068  C  CB     . THR A  1 522  ? 49.790  121.601 5.381   1.00 101.77 ?  582  THR A CB     1 
ATOM   4069  O  OG1    . THR A  1 522  ? 50.169  120.298 5.824   1.00 106.24 ?  582  THR A OG1    1 
ATOM   4070  C  CG2    . THR A  1 522  ? 50.892  122.579 5.691   1.00 89.51  ?  582  THR A CG2    1 
ATOM   4071  N  N      . MET A  1 523  ? 47.326  123.498 4.489   1.00 103.47 ?  583  MET A N      1 
ATOM   4072  C  CA     . MET A  1 523  ? 46.744  124.774 4.068   1.00 103.94 ?  583  MET A CA     1 
ATOM   4073  C  C      . MET A  1 523  ? 45.720  125.254 5.104   1.00 106.99 ?  583  MET A C      1 
ATOM   4074  O  O      . MET A  1 523  ? 45.684  126.440 5.415   1.00 106.04 ?  583  MET A O      1 
ATOM   4075  C  CB     . MET A  1 523  ? 46.093  124.654 2.689   1.00 107.04 ?  583  MET A CB     1 
ATOM   4076  C  CG     . MET A  1 523  ? 47.074  124.468 1.539   1.00 111.27 ?  583  MET A CG     1 
ATOM   4077  S  SD     . MET A  1 523  ? 48.231  125.833 1.431   1.00 117.98 ?  583  MET A SD     1 
ATOM   4078  C  CE     . MET A  1 523  ? 48.314  126.154 -0.335  1.00 115.64 ?  583  MET A CE     1 
ATOM   4079  N  N      . GLU A  1 524  ? 44.920  124.319 5.674   1.00 104.59 ?  584  GLU A N      1 
ATOM   4080  C  CA     . GLU A  1 524  ? 43.914  124.616 6.702   1.00 105.25 ?  584  GLU A CA     1 
ATOM   4081  C  C      . GLU A  1 524  ? 44.573  125.166 7.946   1.00 109.47 ?  584  GLU A C      1 
ATOM   4082  O  O      . GLU A  1 524  ? 44.084  126.162 8.495   1.00 111.00 ?  584  GLU A O      1 
ATOM   4083  C  CB     . GLU A  1 524  ? 43.093  123.369 7.049   1.00 105.31 ?  584  GLU A CB     1 
ATOM   4084  C  CG     . GLU A  1 524  ? 41.925  123.635 7.990   1.00 123.36 ?  584  GLU A CG     1 
ATOM   4085  C  CD     . GLU A  1 524  ? 41.279  122.388 8.563   1.00 166.69 ?  584  GLU A CD     1 
ATOM   4086  O  OE1    . GLU A  1 524  ? 41.733  121.267 8.226   1.00 167.66 ?  584  GLU A OE1    1 
ATOM   4087  O  OE2    . GLU A  1 524  ? 40.315  122.533 9.352   1.00 174.28 -1 584  GLU A OE2    1 
ATOM   4088  N  N      . THR A  1 525  ? 45.683  124.527 8.388   1.00 103.44 ?  585  THR A N      1 
ATOM   4089  C  CA     . THR A  1 525  ? 46.421  124.940 9.577   1.00 102.89 ?  585  THR A CA     1 
ATOM   4090  C  C      . THR A  1 525  ? 46.889  126.369 9.465   1.00 109.34 ?  585  THR A C      1 
ATOM   4091  O  O      . THR A  1 525  ? 46.831  127.122 10.445  1.00 108.32 ?  585  THR A O      1 
ATOM   4092  C  CB     . THR A  1 525  ? 47.588  124.012 9.801   1.00 108.52 ?  585  THR A CB     1 
ATOM   4093  O  OG1    . THR A  1 525  ? 47.090  122.683 9.962   1.00 104.09 ?  585  THR A OG1    1 
ATOM   4094  C  CG2    . THR A  1 525  ? 48.383  124.386 11.029  1.00 111.64 ?  585  THR A CG2    1 
ATOM   4095  N  N      . MET A  1 526  ? 47.321  126.757 8.256   1.00 109.95 ?  586  MET A N      1 
ATOM   4096  C  CA     . MET A  1 526  ? 47.844  128.099 8.004   1.00 113.06 ?  586  MET A CA     1 
ATOM   4097  C  C      . MET A  1 526  ? 46.757  129.175 8.001   1.00 122.46 ?  586  MET A C      1 
ATOM   4098  O  O      . MET A  1 526  ? 47.077  130.355 7.885   1.00 125.02 ?  586  MET A O      1 
ATOM   4099  C  CB     . MET A  1 526  ? 48.728  128.136 6.757   1.00 115.10 ?  586  MET A CB     1 
ATOM   4100  C  CG     . MET A  1 526  ? 50.038  127.410 6.986   1.00 117.34 ?  586  MET A CG     1 
ATOM   4101  S  SD     . MET A  1 526  ? 51.280  127.586 5.697   1.00 122.63 ?  586  MET A SD     1 
ATOM   4102  C  CE     . MET A  1 526  ? 50.672  126.508 4.441   1.00 117.96 ?  586  MET A CE     1 
ATOM   4103  N  N      . ASN A  1 527  ? 45.499  128.802 8.228   1.00 120.10 ?  587  ASN A N      1 
ATOM   4104  C  CA     . ASN A  1 527  ? 44.470  129.813 8.412   1.00 122.74 ?  587  ASN A CA     1 
ATOM   4105  C  C      . ASN A  1 527  ? 44.411  130.230 9.896   1.00 128.45 ?  587  ASN A C      1 
ATOM   4106  O  O      . ASN A  1 527  ? 43.660  131.150 10.234  1.00 130.21 ?  587  ASN A O      1 
ATOM   4107  C  CB     . ASN A  1 527  ? 43.124  129.318 7.919   1.00 124.54 ?  587  ASN A CB     1 
ATOM   4108  C  CG     . ASN A  1 527  ? 43.115  129.066 6.442   1.00 149.51 ?  587  ASN A CG     1 
ATOM   4109  O  OD1    . ASN A  1 527  ? 43.789  129.759 5.665   1.00 142.32 ?  587  ASN A OD1    1 
ATOM   4110  N  ND2    . ASN A  1 527  ? 42.365  128.049 6.033   1.00 141.87 ?  587  ASN A ND2    1 
ATOM   4111  N  N      . TYR A  1 528  ? 45.215  129.560 10.777  1.00 124.00 ?  588  TYR A N      1 
ATOM   4112  C  CA     . TYR A  1 528  ? 45.278  129.847 12.220  1.00 124.44 ?  588  TYR A CA     1 
ATOM   4113  C  C      . TYR A  1 528  ? 46.567  130.543 12.540  1.00 131.53 ?  588  TYR A C      1 
ATOM   4114  O  O      . TYR A  1 528  ? 47.641  129.922 12.486  1.00 131.28 ?  588  TYR A O      1 
ATOM   4115  C  CB     . TYR A  1 528  ? 45.100  128.584 13.046  1.00 122.36 ?  588  TYR A CB     1 
ATOM   4116  C  CG     . TYR A  1 528  ? 43.753  127.965 12.791  1.00 122.88 ?  588  TYR A CG     1 
ATOM   4117  C  CD1    . TYR A  1 528  ? 42.629  128.386 13.491  1.00 125.97 ?  588  TYR A CD1    1 
ATOM   4118  C  CD2    . TYR A  1 528  ? 43.580  127.013 11.792  1.00 122.55 ?  588  TYR A CD2    1 
ATOM   4119  C  CE1    . TYR A  1 528  ? 41.366  127.855 13.223  1.00 126.51 ?  588  TYR A CE1    1 
ATOM   4120  C  CE2    . TYR A  1 528  ? 42.324  126.480 11.510  1.00 123.84 ?  588  TYR A CE2    1 
ATOM   4121  C  CZ     . TYR A  1 528  ? 41.216  126.908 12.223  1.00 133.28 ?  588  TYR A CZ     1 
ATOM   4122  O  OH     . TYR A  1 528  ? 39.985  126.360 11.937  1.00 133.11 ?  588  TYR A OH     1 
ATOM   4123  N  N      . ALA A  1 529  ? 46.471  131.856 12.813  1.00 129.06 ?  589  ALA A N      1 
ATOM   4124  C  CA     . ALA A  1 529  ? 47.621  132.706 13.051  1.00 129.84 ?  589  ALA A CA     1 
ATOM   4125  C  C      . ALA A  1 529  ? 48.505  132.244 14.187  1.00 130.46 ?  589  ALA A C      1 
ATOM   4126  O  O      . ALA A  1 529  ? 49.716  132.497 14.149  1.00 130.34 ?  589  ALA A O      1 
ATOM   4127  C  CB     . ALA A  1 529  ? 47.164  134.119 13.292  1.00 134.41 ?  589  ALA A CB     1 
ATOM   4128  N  N      . GLN A  1 530  ? 47.908  131.553 15.188  1.00 124.27 ?  590  GLN A N      1 
ATOM   4129  C  CA     . GLN A  1 530  ? 48.640  131.053 16.353  1.00 122.78 ?  590  GLN A CA     1 
ATOM   4130  C  C      . GLN A  1 530  ? 49.760  130.085 15.991  1.00 124.03 ?  590  GLN A C      1 
ATOM   4131  O  O      . GLN A  1 530  ? 50.749  130.001 16.715  1.00 122.80 ?  590  GLN A O      1 
ATOM   4132  C  CB     . GLN A  1 530  ? 47.679  130.411 17.356  1.00 123.08 ?  590  GLN A CB     1 
ATOM   4133  C  CG     . GLN A  1 530  ? 47.112  129.068 16.940  1.00 129.58 ?  590  GLN A CG     1 
ATOM   4134  C  CD     . GLN A  1 530  ? 45.936  128.697 17.787  1.00 142.95 ?  590  GLN A CD     1 
ATOM   4135  O  OE1    . GLN A  1 530  ? 44.823  129.170 17.549  1.00 143.12 ?  590  GLN A OE1    1 
ATOM   4136  N  NE2    . GLN A  1 530  ? 46.161  127.857 18.799  1.00 124.50 ?  590  GLN A NE2    1 
ATOM   4137  N  N      . ILE A  1 531  ? 49.592  129.355 14.870  1.00 119.70 ?  591  ILE A N      1 
ATOM   4138  C  CA     . ILE A  1 531  ? 50.516  128.326 14.400  1.00 116.64 ?  591  ILE A CA     1 
ATOM   4139  C  C      . ILE A  1 531  ? 51.659  128.955 13.670  1.00 121.90 ?  591  ILE A C      1 
ATOM   4140  O  O      . ILE A  1 531  ? 51.466  129.529 12.596  1.00 120.89 ?  591  ILE A O      1 
ATOM   4141  C  CB     . ILE A  1 531  ? 49.817  127.228 13.562  1.00 116.00 ?  591  ILE A CB     1 
ATOM   4142  C  CG1    . ILE A  1 531  ? 48.670  126.560 14.322  1.00 114.16 ?  591  ILE A CG1    1 
ATOM   4143  C  CG2    . ILE A  1 531  ? 50.829  126.192 13.127  1.00 114.15 ?  591  ILE A CG2    1 
ATOM   4144  C  CD1    . ILE A  1 531  ? 49.067  125.871 15.625  1.00 116.79 ?  591  ILE A CD1    1 
ATOM   4145  N  N      . ARG A  1 532  ? 52.855  128.818 14.238  1.00 120.24 ?  592  ARG A N      1 
ATOM   4146  C  CA     . ARG A  1 532  ? 54.063  129.414 13.680  1.00 121.42 ?  592  ARG A CA     1 
ATOM   4147  C  C      . ARG A  1 532  ? 55.038  128.408 13.086  1.00 125.50 ?  592  ARG A C      1 
ATOM   4148  O  O      . ARG A  1 532  ? 55.924  128.810 12.328  1.00 127.14 ?  592  ARG A O      1 
ATOM   4149  C  CB     . ARG A  1 532  ? 54.737  130.304 14.723  1.00 120.47 ?  592  ARG A CB     1 
ATOM   4150  C  CG     . ARG A  1 532  ? 53.763  131.336 15.325  1.00 124.94 ?  592  ARG A CG     1 
ATOM   4151  C  CD     . ARG A  1 532  ? 52.906  132.071 14.297  1.00 122.60 ?  592  ARG A CD     1 
ATOM   4152  N  NE     . ARG A  1 532  ? 53.727  132.733 13.287  1.00 134.50 ?  592  ARG A NE     1 
ATOM   4153  C  CZ     . ARG A  1 532  ? 53.267  133.242 12.154  1.00 150.10 ?  592  ARG A CZ     1 
ATOM   4154  N  NH1    . ARG A  1 532  ? 51.973  133.170 11.863  1.00 128.52 1  592  ARG A NH1    1 
ATOM   4155  N  NH2    . ARG A  1 532  ? 54.095  133.840 11.307  1.00 144.96 ?  592  ARG A NH2    1 
ATOM   4156  N  N      . THR A  1 533  ? 54.880  127.112 13.433  1.00 118.90 ?  593  THR A N      1 
ATOM   4157  C  CA     . THR A  1 533  ? 55.692  126.010 12.926  1.00 116.32 ?  593  THR A CA     1 
ATOM   4158  C  C      . THR A  1 533  ? 54.798  124.812 12.654  1.00 114.30 ?  593  THR A C      1 
ATOM   4159  O  O      . THR A  1 533  ? 53.982  124.435 13.491  1.00 113.00 ?  593  THR A O      1 
ATOM   4160  C  CB     . THR A  1 533  ? 56.833  125.626 13.905  1.00 129.21 ?  593  THR A CB     1 
ATOM   4161  O  OG1    . THR A  1 533  ? 57.583  126.784 14.263  1.00 136.48 ?  593  THR A OG1    1 
ATOM   4162  C  CG2    . THR A  1 533  ? 57.775  124.573 13.327  1.00 126.23 ?  593  THR A CG2    1 
ATOM   4163  N  N      . ILE A  1 534  ? 54.965  124.211 11.489  1.00 107.55 ?  594  ILE A N      1 
ATOM   4164  C  CA     . ILE A  1 534  ? 54.228  123.015 11.081  1.00 104.04 ?  594  ILE A CA     1 
ATOM   4165  C  C      . ILE A  1 534  ? 55.233  121.975 10.615  1.00 109.75 ?  594  ILE A C      1 
ATOM   4166  O  O      . ILE A  1 534  ? 56.075  122.261 9.746   1.00 111.22 ?  594  ILE A O      1 
ATOM   4167  C  CB     . ILE A  1 534  ? 53.194  123.271 9.948   1.00 104.60 ?  594  ILE A CB     1 
ATOM   4168  C  CG1    . ILE A  1 534  ? 52.193  124.371 10.324  1.00 104.31 ?  594  ILE A CG1    1 
ATOM   4169  C  CG2    . ILE A  1 534  ? 52.485  121.971 9.562   1.00 101.41 ?  594  ILE A CG2    1 
ATOM   4170  C  CD1    . ILE A  1 534  ? 51.463  124.998 9.176   1.00 93.43  ?  594  ILE A CD1    1 
ATOM   4171  N  N      . ALA A  1 535  ? 55.136  120.770 11.182  1.00 104.01 ?  595  ALA A N      1 
ATOM   4172  C  CA     . ALA A  1 535  ? 55.933  119.655 10.740  1.00 102.61 ?  595  ALA A CA     1 
ATOM   4173  C  C      . ALA A  1 535  ? 55.004  118.791 9.873   1.00 107.49 ?  595  ALA A C      1 
ATOM   4174  O  O      . ALA A  1 535  ? 53.874  118.487 10.284  1.00 106.43 ?  595  ALA A O      1 
ATOM   4175  C  CB     . ALA A  1 535  ? 56.457  118.877 11.929  1.00 102.89 ?  595  ALA A CB     1 
ATOM   4176  N  N      . ILE A  1 536  ? 55.451  118.471 8.638   1.00 105.35 ?  596  ILE A N      1 
ATOM   4177  C  CA     . ILE A  1 536  ? 54.695  117.637 7.696   1.00 104.82 ?  596  ILE A CA     1 
ATOM   4178  C  C      . ILE A  1 536  ? 55.453  116.320 7.542   1.00 110.13 ?  596  ILE A C      1 
ATOM   4179  O  O      . ILE A  1 536  ? 56.563  116.293 7.011   1.00 109.85 ?  596  ILE A O      1 
ATOM   4180  C  CB     . ILE A  1 536  ? 54.466  118.319 6.337   1.00 108.36 ?  596  ILE A CB     1 
ATOM   4181  C  CG1    . ILE A  1 536  ? 53.884  119.711 6.479   1.00 108.78 ?  596  ILE A CG1    1 
ATOM   4182  C  CG2    . ILE A  1 536  ? 53.585  117.446 5.464   1.00 110.07 ?  596  ILE A CG2    1 
ATOM   4183  C  CD1    . ILE A  1 536  ? 53.847  120.457 5.198   1.00 110.84 ?  596  ILE A CD1    1 
ATOM   4184  N  N      . ILE A  1 537  ? 54.844  115.233 7.983   1.00 107.52 ?  597  ILE A N      1 
ATOM   4185  C  CA     . ILE A  1 537  ? 55.518  113.949 8.007   1.00 107.39 ?  597  ILE A CA     1 
ATOM   4186  C  C      . ILE A  1 537  ? 55.533  113.224 6.679   1.00 115.70 ?  597  ILE A C      1 
ATOM   4187  O  O      . ILE A  1 537  ? 56.554  112.621 6.328   1.00 116.68 ?  597  ILE A O      1 
ATOM   4188  C  CB     . ILE A  1 537  ? 54.892  113.071 9.137   1.00 108.29 ?  597  ILE A CB     1 
ATOM   4189  C  CG1    . ILE A  1 537  ? 54.883  113.815 10.487  1.00 107.84 ?  597  ILE A CG1    1 
ATOM   4190  C  CG2    . ILE A  1 537  ? 55.571  111.709 9.242   1.00 107.33 ?  597  ILE A CG2    1 
ATOM   4191  C  CD1    . ILE A  1 537  ? 56.223  114.403 10.879  1.00 112.36 ?  597  ILE A CD1    1 
ATOM   4192  N  N      . ALA A  1 538  ? 54.390  113.214 5.984   1.00 113.41 ?  598  ALA A N      1 
ATOM   4193  C  CA     . ALA A  1 538  ? 54.175  112.393 4.803   1.00 113.79 ?  598  ALA A CA     1 
ATOM   4194  C  C      . ALA A  1 538  ? 55.192  112.515 3.680   1.00 119.81 ?  598  ALA A C      1 
ATOM   4195  O  O      . ALA A  1 538  ? 55.555  113.609 3.257   1.00 120.23 ?  598  ALA A O      1 
ATOM   4196  C  CB     . ALA A  1 538  ? 52.795  112.640 4.251   1.00 114.25 ?  598  ALA A CB     1 
ATOM   4197  N  N      . GLU A  1 539  ? 55.594  111.363 3.165   1.00 117.36 ?  599  GLU A N      1 
ATOM   4198  C  CA     . GLU A  1 539  ? 56.461  111.200 2.000   1.00 118.71 ?  599  GLU A CA     1 
ATOM   4199  C  C      . GLU A  1 539  ? 55.531  111.077 0.785   1.00 121.00 ?  599  GLU A C      1 
ATOM   4200  O  O      . GLU A  1 539  ? 54.523  110.370 0.887   1.00 121.23 ?  599  GLU A O      1 
ATOM   4201  C  CB     . GLU A  1 539  ? 57.229  109.868 2.163   1.00 121.28 ?  599  GLU A CB     1 
ATOM   4202  C  CG     . GLU A  1 539  ? 58.689  109.816 1.702   1.00 141.00 ?  599  GLU A CG     1 
ATOM   4203  C  CD     . GLU A  1 539  ? 59.442  108.563 2.147   1.00 178.37 ?  599  GLU A CD     1 
ATOM   4204  O  OE1    . GLU A  1 539  ? 58.812  107.477 2.155   1.00 192.60 ?  599  GLU A OE1    1 
ATOM   4205  O  OE2    . GLU A  1 539  ? 60.637  108.674 2.529   1.00 162.52 -1 599  GLU A OE2    1 
ATOM   4206  N  N      . GLY A  1 540  ? 55.862  111.720 -0.341  1.00 115.13 ?  600  GLY A N      1 
ATOM   4207  C  CA     . GLY A  1 540  ? 55.070  111.538 -1.558  1.00 113.88 ?  600  GLY A CA     1 
ATOM   4208  C  C      . GLY A  1 540  ? 54.046  112.584 -1.915  1.00 112.84 ?  600  GLY A C      1 
ATOM   4209  O  O      . GLY A  1 540  ? 53.118  112.319 -2.698  1.00 111.58 ?  600  GLY A O      1 
ATOM   4210  N  N      . ILE A  1 541  ? 54.196  113.770 -1.334  1.00 106.92 ?  601  ILE A N      1 
ATOM   4211  C  CA     . ILE A  1 541  ? 53.302  114.856 -1.712  1.00 105.35 ?  601  ILE A CA     1 
ATOM   4212  C  C      . ILE A  1 541  ? 53.835  115.426 -3.044  1.00 107.13 ?  601  ILE A C      1 
ATOM   4213  O  O      . ILE A  1 541  ? 55.030  115.760 -3.091  1.00 107.34 ?  601  ILE A O      1 
ATOM   4214  C  CB     . ILE A  1 541  ? 53.220  115.950 -0.626  1.00 107.16 ?  601  ILE A CB     1 
ATOM   4215  C  CG1    . ILE A  1 541  ? 52.655  115.400 0.680   1.00 105.96 ?  601  ILE A CG1    1 
ATOM   4216  C  CG2    . ILE A  1 541  ? 52.447  117.183 -1.122  1.00 106.98 ?  601  ILE A CG2    1 
ATOM   4217  C  CD1    . ILE A  1 541  ? 52.893  116.304 1.854   1.00 112.20 ?  601  ILE A CD1    1 
ATOM   4218  N  N      . PRO A  1 542  ? 52.989  115.562 -4.113  1.00 99.86  ?  602  PRO A N      1 
ATOM   4219  C  CA     . PRO A  1 542  ? 53.469  116.150 -5.369  1.00 100.31 ?  602  PRO A CA     1 
ATOM   4220  C  C      . PRO A  1 542  ? 54.198  117.490 -5.161  1.00 106.19 ?  602  PRO A C      1 
ATOM   4221  O  O      . PRO A  1 542  ? 53.811  118.330 -4.342  1.00 105.03 ?  602  PRO A O      1 
ATOM   4222  C  CB     . PRO A  1 542  ? 52.199  116.280 -6.205  1.00 101.62 ?  602  PRO A CB     1 
ATOM   4223  C  CG     . PRO A  1 542  ? 51.350  115.204 -5.717  1.00 103.55 ?  602  PRO A CG     1 
ATOM   4224  C  CD     . PRO A  1 542  ? 51.579  115.154 -4.244  1.00 98.62  ?  602  PRO A CD     1 
ATOM   4225  N  N      . GLU A  1 543  ? 55.288  117.658 -5.879  1.00 105.17 ?  603  GLU A N      1 
ATOM   4226  C  CA     . GLU A  1 543  ? 56.143  118.818 -5.787  1.00 106.66 ?  603  GLU A CA     1 
ATOM   4227  C  C      . GLU A  1 543  ? 55.382  120.103 -6.020  1.00 111.92 ?  603  GLU A C      1 
ATOM   4228  O  O      . GLU A  1 543  ? 55.579  121.069 -5.274  1.00 110.32 ?  603  GLU A O      1 
ATOM   4229  C  CB     . GLU A  1 543  ? 57.319  118.655 -6.756  1.00 109.56 ?  603  GLU A CB     1 
ATOM   4230  C  CG     . GLU A  1 543  ? 58.249  117.531 -6.322  1.00 123.74 ?  603  GLU A CG     1 
ATOM   4231  C  CD     . GLU A  1 543  ? 59.299  117.065 -7.308  1.00 158.04 ?  603  GLU A CD     1 
ATOM   4232  O  OE1    . GLU A  1 543  ? 59.600  117.806 -8.275  1.00 164.16 ?  603  GLU A OE1    1 
ATOM   4233  O  OE2    . GLU A  1 543  ? 59.835  115.953 -7.097  1.00 146.98 -1 603  GLU A OE2    1 
ATOM   4234  N  N      . ALA A  1 544  ? 54.467  120.094 -7.008  1.00 110.83 ?  604  ALA A N      1 
ATOM   4235  C  CA     . ALA A  1 544  ? 53.671  121.273 -7.337  1.00 112.57 ?  604  ALA A CA     1 
ATOM   4236  C  C      . ALA A  1 544  ? 52.810  121.741 -6.161  1.00 114.37 ?  604  ALA A C      1 
ATOM   4237  O  O      . ALA A  1 544  ? 52.598  122.948 -5.998  1.00 116.05 ?  604  ALA A O      1 
ATOM   4238  C  CB     . ALA A  1 544  ? 52.808  120.999 -8.560  1.00 114.91 ?  604  ALA A CB     1 
ATOM   4239  N  N      . LEU A  1 545  ? 52.352  120.794 -5.334  1.00 105.79 ?  605  LEU A N      1 
ATOM   4240  C  CA     . LEU A  1 545  ? 51.561  121.096 -4.152  1.00 102.64 ?  605  LEU A CA     1 
ATOM   4241  C  C      . LEU A  1 545  ? 52.452  121.641 -3.035  1.00 108.33 ?  605  LEU A C      1 
ATOM   4242  O  O      . LEU A  1 545  ? 52.082  122.630 -2.388  1.00 108.73 ?  605  LEU A O      1 
ATOM   4243  C  CB     . LEU A  1 545  ? 50.800  119.856 -3.701  1.00 99.52  ?  605  LEU A CB     1 
ATOM   4244  C  CG     . LEU A  1 545  ? 49.758  119.379 -4.639  1.00 102.67 ?  605  LEU A CG     1 
ATOM   4245  C  CD1    . LEU A  1 545  ? 49.217  118.104 -4.189  1.00 100.92 ?  605  LEU A CD1    1 
ATOM   4246  C  CD2    . LEU A  1 545  ? 48.672  120.359 -4.787  1.00 108.47 ?  605  LEU A CD2    1 
ATOM   4247  N  N      . THR A  1 546  ? 53.646  121.041 -2.848  1.00 104.99 ?  606  THR A N      1 
ATOM   4248  C  CA     . THR A  1 546  ? 54.568  121.519 -1.837  1.00 105.23 ?  606  THR A CA     1 
ATOM   4249  C  C      . THR A  1 546  ? 54.983  122.964 -2.127  1.00 110.89 ?  606  THR A C      1 
ATOM   4250  O  O      . THR A  1 546  ? 55.117  123.766 -1.191  1.00 111.79 ?  606  THR A O      1 
ATOM   4251  C  CB     . THR A  1 546  ? 55.743  120.581 -1.694  1.00 116.06 ?  606  THR A CB     1 
ATOM   4252  O  OG1    . THR A  1 546  ? 55.254  119.284 -1.345  1.00 115.06 ?  606  THR A OG1    1 
ATOM   4253  C  CG2    . THR A  1 546  ? 56.716  121.057 -0.624  1.00 114.14 ?  606  THR A CG2    1 
ATOM   4254  N  N      . ARG A  1 547  ? 55.126  123.316 -3.413  1.00 106.91 ?  607  ARG A N      1 
ATOM   4255  C  CA     . ARG A  1 547  ? 55.474  124.697 -3.757  1.00 107.91 ?  607  ARG A CA     1 
ATOM   4256  C  C      . ARG A  1 547  ? 54.390  125.663 -3.331  1.00 109.78 ?  607  ARG A C      1 
ATOM   4257  O  O      . ARG A  1 547  ? 54.692  126.791 -2.950  1.00 112.14 ?  607  ARG A O      1 
ATOM   4258  C  CB     . ARG A  1 547  ? 55.699  124.870 -5.251  1.00 111.09 ?  607  ARG A CB     1 
ATOM   4259  C  CG     . ARG A  1 547  ? 56.902  124.143 -5.797  1.00 123.21 ?  607  ARG A CG     1 
ATOM   4260  C  CD     . ARG A  1 547  ? 57.165  124.534 -7.226  1.00 125.90 ?  607  ARG A CD     1 
ATOM   4261  N  NE     . ARG A  1 547  ? 55.977  124.418 -8.056  1.00 123.26 ?  607  ARG A NE     1 
ATOM   4262  C  CZ     . ARG A  1 547  ? 55.996  124.560 -9.367  1.00 134.05 ?  607  ARG A CZ     1 
ATOM   4263  N  NH1    . ARG A  1 547  ? 57.142  124.773 -9.998  1.00 93.51  1  607  ARG A NH1    1 
ATOM   4264  N  NH2    . ARG A  1 547  ? 54.869  124.480 -10.064 1.00 142.66 ?  607  ARG A NH2    1 
ATOM   4265  N  N      . LYS A  1 548  ? 53.136  125.246 -3.423  1.00 102.67 ?  608  LYS A N      1 
ATOM   4266  C  CA     . LYS A  1 548  ? 52.026  126.083 -3.005  1.00 102.58 ?  608  LYS A CA     1 
ATOM   4267  C  C      . LYS A  1 548  ? 52.037  126.247 -1.483  1.00 106.55 ?  608  LYS A C      1 
ATOM   4268  O  O      . LYS A  1 548  ? 51.734  127.349 -0.988  1.00 106.75 ?  608  LYS A O      1 
ATOM   4269  C  CB     . LYS A  1 548  ? 50.701  125.509 -3.517  1.00 103.44 ?  608  LYS A CB     1 
ATOM   4270  C  CG     . LYS A  1 548  ? 50.503  125.729 -5.011  1.00 101.76 ?  608  LYS A CG     1 
ATOM   4271  C  CD     . LYS A  1 548  ? 49.366  124.856 -5.527  1.00 104.63 ?  608  LYS A CD     1 
ATOM   4272  C  CE     . LYS A  1 548  ? 48.729  125.415 -6.775  1.00 118.83 ?  608  LYS A CE     1 
ATOM   4273  N  NZ     . LYS A  1 548  ? 47.444  124.732 -7.086  1.00 130.66 1  608  LYS A NZ     1 
ATOM   4274  N  N      . LEU A  1 549  ? 52.417  125.155 -0.740  1.00 101.26 ?  609  LEU A N      1 
ATOM   4275  C  CA     . LEU A  1 549  ? 52.557  125.179 0.731   1.00 98.51  ?  609  LEU A CA     1 
ATOM   4276  C  C      . LEU A  1 549  ? 53.630  126.159 1.123   1.00 104.14 ?  609  LEU A C      1 
ATOM   4277  O  O      . LEU A  1 549  ? 53.423  126.956 2.044   1.00 105.52 ?  609  LEU A O      1 
ATOM   4278  C  CB     . LEU A  1 549  ? 52.876  123.801 1.317   1.00 94.99  ?  609  LEU A CB     1 
ATOM   4279  C  CG     . LEU A  1 549  ? 51.769  122.792 1.245   1.00 96.39  ?  609  LEU A CG     1 
ATOM   4280  C  CD1    . LEU A  1 549  ? 52.258  121.485 1.734   1.00 94.63  ?  609  LEU A CD1    1 
ATOM   4281  C  CD2    . LEU A  1 549  ? 50.547  123.241 2.049   1.00 97.74  ?  609  LEU A CD2    1 
ATOM   4282  N  N      . ILE A  1 550  ? 54.762  126.120 0.401   1.00 99.49  ?  610  ILE A N      1 
ATOM   4283  C  CA     . ILE A  1 550  ? 55.890  127.023 0.616   1.00 99.13  ?  610  ILE A CA     1 
ATOM   4284  C  C      . ILE A  1 550  ? 55.468  128.479 0.384   1.00 102.65 ?  610  ILE A C      1 
ATOM   4285  O  O      . ILE A  1 550  ? 55.739  129.319 1.241   1.00 102.83 ?  610  ILE A O      1 
ATOM   4286  C  CB     . ILE A  1 550  ? 57.094  126.594 -0.247  1.00 101.49 ?  610  ILE A CB     1 
ATOM   4287  C  CG1    . ILE A  1 550  ? 57.717  125.307 0.300   1.00 99.21  ?  610  ILE A CG1    1 
ATOM   4288  C  CG2    . ILE A  1 550  ? 58.135  127.681 -0.255  1.00 104.69 ?  610  ILE A CG2    1 
ATOM   4289  C  CD1    . ILE A  1 550  ? 58.575  124.599 -0.649  1.00 99.71  ?  610  ILE A CD1    1 
ATOM   4290  N  N      . LYS A  1 551  ? 54.783  128.757 -0.742  1.00 99.66  ?  611  LYS A N      1 
ATOM   4291  C  CA     . LYS A  1 551  ? 54.299  130.098 -1.049  1.00 102.83 ?  611  LYS A CA     1 
ATOM   4292  C  C      . LYS A  1 551  ? 53.465  130.662 0.111   1.00 111.65 ?  611  LYS A C      1 
ATOM   4293  O  O      . LYS A  1 551  ? 53.757  131.767 0.579   1.00 114.59 ?  611  LYS A O      1 
ATOM   4294  C  CB     . LYS A  1 551  ? 53.509  130.137 -2.366  1.00 105.29 ?  611  LYS A CB     1 
ATOM   4295  C  CG     . LYS A  1 551  ? 52.922  131.530 -2.720  1.00 120.40 ?  611  LYS A CG     1 
ATOM   4296  C  CD     . LYS A  1 551  ? 52.539  131.642 -4.200  1.00 135.06 ?  611  LYS A CD     1 
ATOM   4297  C  CE     . LYS A  1 551  ? 51.655  132.817 -4.552  1.00 147.29 ?  611  LYS A CE     1 
ATOM   4298  N  NZ     . LYS A  1 551  ? 50.238  132.564 -4.191  1.00 151.34 1  611  LYS A NZ     1 
ATOM   4299  N  N      . LYS A  1 552  ? 52.439  129.903 0.564   1.00 107.18 ?  612  LYS A N      1 
ATOM   4300  C  CA     . LYS A  1 552  ? 51.571  130.337 1.647   1.00 107.06 ?  612  LYS A CA     1 
ATOM   4301  C  C      . LYS A  1 552  ? 52.332  130.489 2.953   1.00 110.89 ?  612  LYS A C      1 
ATOM   4302  O  O      . LYS A  1 552  ? 52.114  131.469 3.655   1.00 110.69 ?  612  LYS A O      1 
ATOM   4303  C  CB     . LYS A  1 552  ? 50.357  129.416 1.806   1.00 107.68 ?  612  LYS A CB     1 
ATOM   4304  C  CG     . LYS A  1 552  ? 49.307  129.962 2.804   1.00 123.47 ?  612  LYS A CG     1 
ATOM   4305  C  CD     . LYS A  1 552  ? 48.039  129.101 2.894   1.00 133.03 ?  612  LYS A CD     1 
ATOM   4306  C  CE     . LYS A  1 552  ? 47.022  129.602 3.896   1.00 144.20 ?  612  LYS A CE     1 
ATOM   4307  N  NZ     . LYS A  1 552  ? 45.791  128.765 3.966   1.00 151.16 1  612  LYS A NZ     1 
ATOM   4308  N  N      . ALA A  1 553  ? 53.213  129.534 3.289   1.00 108.07 ?  613  ALA A N      1 
ATOM   4309  C  CA     . ALA A  1 553  ? 53.976  129.597 4.538   1.00 109.07 ?  613  ALA A CA     1 
ATOM   4310  C  C      . ALA A  1 553  ? 54.880  130.785 4.579   1.00 119.60 ?  613  ALA A C      1 
ATOM   4311  O  O      . ALA A  1 553  ? 54.955  131.450 5.602   1.00 122.50 ?  613  ALA A O      1 
ATOM   4312  C  CB     . ALA A  1 553  ? 54.771  128.333 4.749   1.00 107.79 ?  613  ALA A CB     1 
ATOM   4313  N  N      . ASP A  1 554  ? 55.541  131.081 3.476   1.00 118.51 ?  614  ASP A N      1 
ATOM   4314  C  CA     . ASP A  1 554  ? 56.444  132.214 3.383   1.00 121.29 ?  614  ASP A CA     1 
ATOM   4315  C  C      . ASP A  1 554  ? 55.711  133.509 3.586   1.00 126.07 ?  614  ASP A C      1 
ATOM   4316  O  O      . ASP A  1 554  ? 56.174  134.331 4.385   1.00 126.58 ?  614  ASP A O      1 
ATOM   4317  C  CB     . ASP A  1 554  ? 57.191  132.189 2.042   1.00 124.68 ?  614  ASP A CB     1 
ATOM   4318  C  CG     . ASP A  1 554  ? 58.213  131.060 1.879   1.00 139.44 ?  614  ASP A CG     1 
ATOM   4319  O  OD1    . ASP A  1 554  ? 58.404  130.258 2.852   1.00 137.11 ?  614  ASP A OD1    1 
ATOM   4320  O  OD2    . ASP A  1 554  ? 58.815  130.965 0.786   1.00 150.90 -1 614  ASP A OD2    1 
ATOM   4321  N  N      . GLN A  1 555  ? 54.531  133.648 2.939   1.00 123.58 ?  615  GLN A N      1 
ATOM   4322  C  CA     . GLN A  1 555  ? 53.714  134.860 3.045   1.00 126.21 ?  615  GLN A CA     1 
ATOM   4323  C  C      . GLN A  1 555  ? 53.052  135.001 4.421   1.00 128.70 ?  615  GLN A C      1 
ATOM   4324  O  O      . GLN A  1 555  ? 52.660  136.105 4.785   1.00 130.50 ?  615  GLN A O      1 
ATOM   4325  C  CB     . GLN A  1 555  ? 52.705  135.010 1.881   1.00 128.69 ?  615  GLN A CB     1 
ATOM   4326  C  CG     . GLN A  1 555  ? 51.455  134.129 1.900   1.00 152.39 ?  615  GLN A CG     1 
ATOM   4327  C  CD     . GLN A  1 555  ? 50.797  133.921 0.543   1.00 177.90 ?  615  GLN A CD     1 
ATOM   4328  O  OE1    . GLN A  1 555  ? 51.159  134.530 -0.466  1.00 172.99 ?  615  GLN A OE1    1 
ATOM   4329  N  NE2    . GLN A  1 555  ? 49.805  133.040 0.485   1.00 174.07 ?  615  GLN A NE2    1 
ATOM   4330  N  N      . LYS A  1 556  ? 52.952  133.908 5.186   1.00 121.43 ?  616  LYS A N      1 
ATOM   4331  C  CA     . LYS A  1 556  ? 52.365  133.935 6.514   1.00 120.17 ?  616  LYS A CA     1 
ATOM   4332  C  C      . LYS A  1 556  ? 53.408  133.873 7.631   1.00 124.28 ?  616  LYS A C      1 
ATOM   4333  O  O      . LYS A  1 556  ? 53.026  133.945 8.793   1.00 124.21 ?  616  LYS A O      1 
ATOM   4334  C  CB     . LYS A  1 556  ? 51.305  132.847 6.654   1.00 119.03 ?  616  LYS A CB     1 
ATOM   4335  C  CG     . LYS A  1 556  ? 50.076  133.153 5.792   1.00 127.67 ?  616  LYS A CG     1 
ATOM   4336  C  CD     . LYS A  1 556  ? 48.860  132.566 6.386   1.00 143.16 ?  616  LYS A CD     1 
ATOM   4337  C  CE     . LYS A  1 556  ? 47.639  132.704 5.500   1.00 158.14 ?  616  LYS A CE     1 
ATOM   4338  N  NZ     . LYS A  1 556  ? 46.462  133.351 6.182   1.00 164.00 1  616  LYS A NZ     1 
ATOM   4339  N  N      . GLY A  1 557  ? 54.692  133.748 7.277   1.00 121.36 ?  617  GLY A N      1 
ATOM   4340  C  CA     . GLY A  1 557  ? 55.803  133.676 8.226   1.00 122.35 ?  617  GLY A CA     1 
ATOM   4341  C  C      . GLY A  1 557  ? 55.921  132.379 9.018   1.00 126.33 ?  617  GLY A C      1 
ATOM   4342  O  O      . GLY A  1 557  ? 56.656  132.308 10.024  1.00 127.17 ?  617  GLY A O      1 
ATOM   4343  N  N      . VAL A  1 558  ? 55.195  131.337 8.553   1.00 120.52 ?  618  VAL A N      1 
ATOM   4344  C  CA     . VAL A  1 558  ? 55.160  130.011 9.155   1.00 117.49 ?  618  VAL A CA     1 
ATOM   4345  C  C      . VAL A  1 558  ? 56.341  129.152 8.683   1.00 125.18 ?  618  VAL A C      1 
ATOM   4346  O  O      . VAL A  1 558  ? 56.579  129.028 7.477   1.00 125.63 ?  618  VAL A O      1 
ATOM   4347  C  CB     . VAL A  1 558  ? 53.811  129.328 8.890   1.00 117.20 ?  618  VAL A CB     1 
ATOM   4348  C  CG1    . VAL A  1 558  ? 53.813  127.898 9.431   1.00 114.25 ?  618  VAL A CG1    1 
ATOM   4349  C  CG2    . VAL A  1 558  ? 52.674  130.128 9.500   1.00 117.53 ?  618  VAL A CG2    1 
ATOM   4350  N  N      . THR A  1 559  ? 57.074  128.558 9.641   1.00 122.50 ?  619  THR A N      1 
ATOM   4351  C  CA     . THR A  1 559  ? 58.189  127.666 9.354   1.00 121.39 ?  619  THR A CA     1 
ATOM   4352  C  C      . THR A  1 559  ? 57.624  126.258 9.129   1.00 123.62 ?  619  THR A C      1 
ATOM   4353  O  O      . THR A  1 559  ? 56.935  125.714 9.993   1.00 122.29 ?  619  THR A O      1 
ATOM   4354  C  CB     . THR A  1 559  ? 59.191  127.671 10.510  1.00 128.95 ?  619  THR A CB     1 
ATOM   4355  O  OG1    . THR A  1 559  ? 59.610  129.024 10.799  1.00 134.35 ?  619  THR A OG1    1 
ATOM   4356  C  CG2    . THR A  1 559  ? 60.373  126.715 10.260  1.00 125.13 ?  619  THR A CG2    1 
ATOM   4357  N  N      . ILE A  1 560  ? 57.902  125.683 7.971   1.00 119.82 ?  620  ILE A N      1 
ATOM   4358  C  CA     . ILE A  1 560  ? 57.469  124.329 7.646   1.00 117.33 ?  620  ILE A CA     1 
ATOM   4359  C  C      . ILE A  1 560  ? 58.698  123.442 7.746   1.00 123.88 ?  620  ILE A C      1 
ATOM   4360  O  O      . ILE A  1 560  ? 59.708  123.716 7.102   1.00 126.36 ?  620  ILE A O      1 
ATOM   4361  C  CB     . ILE A  1 560  ? 56.817  124.221 6.209   1.00 119.18 ?  620  ILE A CB     1 
ATOM   4362  C  CG1    . ILE A  1 560  ? 55.657  125.221 5.937   1.00 119.21 ?  620  ILE A CG1    1 
ATOM   4363  C  CG2    . ILE A  1 560  ? 56.368  122.824 5.866   1.00 119.02 ?  620  ILE A CG2    1 
ATOM   4364  C  CD1    . ILE A  1 560  ? 54.571  125.387 6.944   1.00 120.75 ?  620  ILE A CD1    1 
ATOM   4365  N  N      . ILE A  1 561  ? 58.610  122.373 8.529   1.00 119.95 ?  621  ILE A N      1 
ATOM   4366  C  CA     . ILE A  1 561  ? 59.648  121.342 8.587   1.00 120.07 ?  621  ILE A CA     1 
ATOM   4367  C  C      . ILE A  1 561  ? 59.040  120.105 7.867   1.00 123.04 ?  621  ILE A C      1 
ATOM   4368  O  O      . ILE A  1 561  ? 58.003  119.571 8.283   1.00 120.53 ?  621  ILE A O      1 
ATOM   4369  C  CB     . ILE A  1 561  ? 60.155  121.061 10.023  1.00 123.16 ?  621  ILE A CB     1 
ATOM   4370  C  CG1    . ILE A  1 561  ? 60.897  122.283 10.576  1.00 124.33 ?  621  ILE A CG1    1 
ATOM   4371  C  CG2    . ILE A  1 561  ? 61.067  119.823 10.045  1.00 124.44 ?  621  ILE A CG2    1 
ATOM   4372  C  CD1    . ILE A  1 561  ? 61.095  122.260 12.026  1.00 126.42 ?  621  ILE A CD1    1 
ATOM   4373  N  N      . GLY A  1 562  ? 59.669  119.710 6.771   1.00 120.11 ?  622  GLY A N      1 
ATOM   4374  C  CA     . GLY A  1 562  ? 59.142  118.657 5.930   1.00 118.80 ?  622  GLY A CA     1 
ATOM   4375  C  C      . GLY A  1 562  ? 58.701  119.218 4.592   1.00 122.28 ?  622  GLY A C      1 
ATOM   4376  O  O      . GLY A  1 562  ? 59.071  120.346 4.279   1.00 124.71 ?  622  GLY A O      1 
ATOM   4377  N  N      . PRO A  1 563  ? 57.931  118.481 3.760   1.00 114.93 ?  623  PRO A N      1 
ATOM   4378  C  CA     . PRO A  1 563  ? 57.406  117.123 3.976   1.00 113.05 ?  623  PRO A CA     1 
ATOM   4379  C  C      . PRO A  1 563  ? 58.475  116.035 3.971   1.00 117.86 ?  623  PRO A C      1 
ATOM   4380  O  O      . PRO A  1 563  ? 59.687  116.303 3.840   1.00 118.06 ?  623  PRO A O      1 
ATOM   4381  C  CB     . PRO A  1 563  ? 56.430  116.926 2.808   1.00 114.06 ?  623  PRO A CB     1 
ATOM   4382  C  CG     . PRO A  1 563  ? 56.304  118.246 2.123   1.00 119.12 ?  623  PRO A CG     1 
ATOM   4383  C  CD     . PRO A  1 563  ? 57.519  119.020 2.456   1.00 115.98 ?  623  PRO A CD     1 
ATOM   4384  N  N      . ALA A  1 564  ? 58.006  114.793 4.093   1.00 114.44 ?  624  ALA A N      1 
ATOM   4385  C  CA     . ALA A  1 564  ? 58.851  113.605 4.053   1.00 114.67 ?  624  ALA A CA     1 
ATOM   4386  C  C      . ALA A  1 564  ? 59.958  113.670 5.089   1.00 118.69 ?  624  ALA A C      1 
ATOM   4387  O  O      . ALA A  1 564  ? 61.130  113.472 4.776   1.00 118.71 ?  624  ALA A O      1 
ATOM   4388  C  CB     . ALA A  1 564  ? 59.421  113.400 2.648   1.00 116.36 ?  624  ALA A CB     1 
ATOM   4389  N  N      . THR A  1 565  ? 59.567  113.927 6.336   1.00 115.77 ?  625  THR A N      1 
ATOM   4390  C  CA     . THR A  1 565  ? 60.497  113.985 7.448   1.00 116.80 ?  625  THR A CA     1 
ATOM   4391  C  C      . THR A  1 565  ? 59.943  113.328 8.714   1.00 124.01 ?  625  THR A C      1 
ATOM   4392  O  O      . THR A  1 565  ? 58.719  113.227 8.901   1.00 124.10 ?  625  THR A O      1 
ATOM   4393  C  CB     . THR A  1 565  ? 60.862  115.429 7.765   1.00 116.30 ?  625  THR A CB     1 
ATOM   4394  O  OG1    . THR A  1 565  ? 61.937  115.406 8.696   1.00 116.58 ?  625  THR A OG1    1 
ATOM   4395  C  CG2    . THR A  1 565  ? 59.702  116.212 8.374   1.00 107.16 ?  625  THR A CG2    1 
ATOM   4396  N  N      . VAL A  1 566  ? 60.863  112.905 9.597   1.00 121.33 ?  626  VAL A N      1 
ATOM   4397  C  CA     . VAL A  1 566  ? 60.514  112.430 10.928  1.00 119.95 ?  626  VAL A CA     1 
ATOM   4398  C  C      . VAL A  1 566  ? 60.340  113.697 11.824  1.00 124.21 ?  626  VAL A C      1 
ATOM   4399  O  O      . VAL A  1 566  ? 59.589  113.668 12.805  1.00 124.17 ?  626  VAL A O      1 
ATOM   4400  C  CB     . VAL A  1 566  ? 61.517  111.398 11.475  1.00 123.18 ?  626  VAL A CB     1 
ATOM   4401  C  CG1    . VAL A  1 566  ? 62.842  112.048 11.809  1.00 123.87 ?  626  VAL A CG1    1 
ATOM   4402  C  CG2    . VAL A  1 566  ? 60.936  110.654 12.677  1.00 122.58 ?  626  VAL A CG2    1 
ATOM   4403  N  N      . GLY A  1 567  ? 61.020  114.787 11.448  1.00 120.06 ?  627  GLY A N      1 
ATOM   4404  C  CA     . GLY A  1 567  ? 60.884  116.073 12.107  1.00 119.88 ?  627  GLY A CA     1 
ATOM   4405  C  C      . GLY A  1 567  ? 62.199  116.597 12.626  1.00 124.14 ?  627  GLY A C      1 
ATOM   4406  O  O      . GLY A  1 567  ? 63.024  117.118 11.872  1.00 124.52 ?  627  GLY A O      1 
ATOM   4407  N  N      . GLY A  1 568  ? 62.346  116.540 13.930  1.00 120.28 ?  628  GLY A N      1 
ATOM   4408  C  CA     . GLY A  1 568  ? 63.509  117.095 14.593  1.00 121.15 ?  628  GLY A CA     1 
ATOM   4409  C  C      . GLY A  1 568  ? 63.353  117.012 16.092  1.00 123.30 ?  628  GLY A C      1 
ATOM   4410  O  O      . GLY A  1 568  ? 62.355  116.492 16.601  1.00 121.75 ?  628  GLY A O      1 
ATOM   4411  N  N      . ILE A  1 569  ? 64.366  117.509 16.800  1.00 120.20 ?  629  ILE A N      1 
ATOM   4412  C  CA     . ILE A  1 569  ? 64.464  117.421 18.246  1.00 119.96 ?  629  ILE A CA     1 
ATOM   4413  C  C      . ILE A  1 569  ? 65.320  118.554 18.836  1.00 127.17 ?  629  ILE A C      1 
ATOM   4414  O  O      . ILE A  1 569  ? 66.385  118.893 18.309  1.00 128.20 ?  629  ILE A O      1 
ATOM   4415  C  CB     . ILE A  1 569  ? 65.015  116.012 18.632  1.00 121.96 ?  629  ILE A CB     1 
ATOM   4416  C  CG1    . ILE A  1 569  ? 64.908  115.775 20.132  1.00 123.28 ?  629  ILE A CG1    1 
ATOM   4417  C  CG2    . ILE A  1 569  ? 66.436  115.747 18.095  1.00 122.18 ?  629  ILE A CG2    1 
ATOM   4418  C  CD1    . ILE A  1 569  ? 65.109  114.348 20.523  1.00 136.14 ?  629  ILE A CD1    1 
ATOM   4419  N  N      . LYS A  1 570  ? 64.845  119.126 19.940  1.00 123.65 ?  630  LYS A N      1 
ATOM   4420  C  CA     . LYS A  1 570  ? 65.551  120.149 20.692  1.00 124.84 ?  630  LYS A CA     1 
ATOM   4421  C  C      . LYS A  1 570  ? 65.699  119.615 22.115  1.00 132.67 ?  630  LYS A C      1 
ATOM   4422  O  O      . LYS A  1 570  ? 64.777  119.761 22.929  1.00 133.17 ?  630  LYS A O      1 
ATOM   4423  C  CB     . LYS A  1 570  ? 64.844  121.507 20.672  1.00 124.95 ?  630  LYS A CB     1 
ATOM   4424  C  CG     . LYS A  1 570  ? 65.721  122.587 21.292  1.00 131.64 ?  630  LYS A CG     1 
ATOM   4425  C  CD     . LYS A  1 570  ? 65.143  123.988 21.207  1.00 137.56 ?  630  LYS A CD     1 
ATOM   4426  C  CE     . LYS A  1 570  ? 66.090  124.979 21.833  1.00 148.43 ?  630  LYS A CE     1 
ATOM   4427  N  NZ     . LYS A  1 570  ? 65.560  126.366 21.773  1.00 160.71 1  630  LYS A NZ     1 
ATOM   4428  N  N      . PRO A  1 571  ? 66.828  118.927 22.410  1.00 130.56 ?  631  PRO A N      1 
ATOM   4429  C  CA     . PRO A  1 571  ? 67.044  118.391 23.767  1.00 131.61 ?  631  PRO A CA     1 
ATOM   4430  C  C      . PRO A  1 571  ? 66.689  119.356 24.897  1.00 137.09 ?  631  PRO A C      1 
ATOM   4431  O  O      . PRO A  1 571  ? 67.046  120.536 24.861  1.00 138.51 ?  631  PRO A O      1 
ATOM   4432  C  CB     . PRO A  1 571  ? 68.529  118.019 23.755  1.00 134.98 ?  631  PRO A CB     1 
ATOM   4433  C  CG     . PRO A  1 571  ? 68.746  117.577 22.353  1.00 137.42 ?  631  PRO A CG     1 
ATOM   4434  C  CD     . PRO A  1 571  ? 67.945  118.558 21.517  1.00 131.80 ?  631  PRO A CD     1 
ATOM   4435  N  N      . GLY A  1 572  ? 65.943  118.838 25.859  1.00 133.45 ?  632  GLY A N      1 
ATOM   4436  C  CA     . GLY A  1 572  ? 65.467  119.594 27.002  1.00 135.79 ?  632  GLY A CA     1 
ATOM   4437  C  C      . GLY A  1 572  ? 64.182  120.368 26.759  1.00 142.93 ?  632  GLY A C      1 
ATOM   4438  O  O      . GLY A  1 572  ? 63.560  120.825 27.722  1.00 144.20 ?  632  GLY A O      1 
ATOM   4439  N  N      . CYS A  1 573  ? 63.753  120.515 25.488  1.00 140.22 ?  633  CYS A N      1 
ATOM   4440  C  CA     . CYS A  1 573  ? 62.623  121.370 25.119  1.00 140.39 ?  633  CYS A CA     1 
ATOM   4441  C  C      . CYS A  1 573  ? 61.465  120.689 24.439  1.00 140.19 ?  633  CYS A C      1 
ATOM   4442  O  O      . CYS A  1 573  ? 60.340  120.776 24.922  1.00 139.81 ?  633  CYS A O      1 
ATOM   4443  C  CB     . CYS A  1 573  ? 63.119  122.516 24.250  1.00 143.06 ?  633  CYS A CB     1 
ATOM   4444  S  SG     . CYS A  1 573  ? 64.495  123.451 24.952  1.00 151.85 ?  633  CYS A SG     1 
ATOM   4445  N  N      . PHE A  1 574  ? 61.704  120.144 23.243  1.00 133.29 ?  634  PHE A N      1 
ATOM   4446  C  CA     . PHE A  1 574  ? 60.641  119.611 22.417  1.00 129.78 ?  634  PHE A CA     1 
ATOM   4447  C  C      . PHE A  1 574  ? 61.178  118.588 21.431  1.00 132.14 ?  634  PHE A C      1 
ATOM   4448  O  O      . PHE A  1 574  ? 62.290  118.739 20.927  1.00 133.78 ?  634  PHE A O      1 
ATOM   4449  C  CB     . PHE A  1 574  ? 59.995  120.782 21.660  1.00 131.09 ?  634  PHE A CB     1 
ATOM   4450  C  CG     . PHE A  1 574  ? 58.767  120.440 20.876  1.00 130.41 ?  634  PHE A CG     1 
ATOM   4451  C  CD1    . PHE A  1 574  ? 57.556  120.245 21.513  1.00 132.45 ?  634  PHE A CD1    1 
ATOM   4452  C  CD2    . PHE A  1 574  ? 58.815  120.326 19.496  1.00 132.49 ?  634  PHE A CD2    1 
ATOM   4453  C  CE1    . PHE A  1 574  ? 56.416  119.923 20.789  1.00 132.23 ?  634  PHE A CE1    1 
ATOM   4454  C  CE2    . PHE A  1 574  ? 57.668  120.024 18.767  1.00 134.09 ?  634  PHE A CE2    1 
ATOM   4455  C  CZ     . PHE A  1 574  ? 56.472  119.826 19.420  1.00 131.45 ?  634  PHE A CZ     1 
ATOM   4456  N  N      . LYS A  1 575  ? 60.364  117.565 21.141  1.00 124.37 ?  635  LYS A N      1 
ATOM   4457  C  CA     . LYS A  1 575  ? 60.686  116.479 20.228  1.00 122.02 ?  635  LYS A CA     1 
ATOM   4458  C  C      . LYS A  1 575  ? 59.532  116.363 19.230  1.00 125.48 ?  635  LYS A C      1 
ATOM   4459  O  O      . LYS A  1 575  ? 58.385  116.265 19.664  1.00 126.09 ?  635  LYS A O      1 
ATOM   4460  C  CB     . LYS A  1 575  ? 60.859  115.195 21.069  1.00 122.62 ?  635  LYS A CB     1 
ATOM   4461  C  CG     . LYS A  1 575  ? 60.824  113.864 20.358  1.00 123.32 ?  635  LYS A CG     1 
ATOM   4462  C  CD     . LYS A  1 575  ? 61.272  112.735 21.284  1.00 128.97 ?  635  LYS A CD     1 
ATOM   4463  C  CE     . LYS A  1 575  ? 60.305  111.559 21.347  1.00 129.49 ?  635  LYS A CE     1 
ATOM   4464  N  NZ     . LYS A  1 575  ? 60.198  110.801 20.068  1.00 126.90 1  635  LYS A NZ     1 
ATOM   4465  N  N      . ILE A  1 576  ? 59.811  116.401 17.906  1.00 119.41 ?  636  ILE A N      1 
ATOM   4466  C  CA     . ILE A  1 576  ? 58.746  116.260 16.899  1.00 116.26 ?  636  ILE A CA     1 
ATOM   4467  C  C      . ILE A  1 576  ? 58.409  114.791 16.701  1.00 116.74 ?  636  ILE A C      1 
ATOM   4468  O  O      . ILE A  1 576  ? 59.209  114.068 16.110  1.00 117.88 ?  636  ILE A O      1 
ATOM   4469  C  CB     . ILE A  1 576  ? 59.085  116.921 15.539  1.00 119.28 ?  636  ILE A CB     1 
ATOM   4470  C  CG1    . ILE A  1 576  ? 59.308  118.427 15.691  1.00 122.18 ?  636  ILE A CG1    1 
ATOM   4471  C  CG2    . ILE A  1 576  ? 57.984  116.652 14.516  1.00 116.32 ?  636  ILE A CG2    1 
ATOM   4472  C  CD1    . ILE A  1 576  ? 60.014  119.096 14.462  1.00 137.27 ?  636  ILE A CD1    1 
ATOM   4473  N  N      . GLY A  1 577  ? 57.223  114.383 17.148  1.00 108.68 ?  637  GLY A N      1 
ATOM   4474  C  CA     . GLY A  1 577  ? 56.708  113.044 16.947  1.00 106.60 ?  637  GLY A CA     1 
ATOM   4475  C  C      . GLY A  1 577  ? 57.660  111.922 17.294  1.00 111.28 ?  637  GLY A C      1 
ATOM   4476  O  O      . GLY A  1 577  ? 58.138  111.825 18.430  1.00 109.08 ?  637  GLY A O      1 
ATOM   4477  N  N      . ASN A  1 578  ? 57.964  111.087 16.289  1.00 110.80 ?  638  ASN A N      1 
ATOM   4478  C  CA     . ASN A  1 578  ? 58.809  109.912 16.440  1.00 112.72 ?  638  ASN A CA     1 
ATOM   4479  C  C      . ASN A  1 578  ? 60.300  110.193 16.520  1.00 118.40 ?  638  ASN A C      1 
ATOM   4480  O  O      . ASN A  1 578  ? 61.065  109.249 16.751  1.00 119.25 ?  638  ASN A O      1 
ATOM   4481  C  CB     . ASN A  1 578  ? 58.554  108.935 15.296  1.00 118.06 ?  638  ASN A CB     1 
ATOM   4482  C  CG     . ASN A  1 578  ? 57.207  108.263 15.350  1.00 141.37 ?  638  ASN A CG     1 
ATOM   4483  O  OD1    . ASN A  1 578  ? 56.786  107.732 16.397  1.00 132.26 ?  638  ASN A OD1    1 
ATOM   4484  N  ND2    . ASN A  1 578  ? 56.520  108.244 14.205  1.00 131.18 ?  638  ASN A ND2    1 
ATOM   4485  N  N      . THR A  1 579  ? 60.738  111.447 16.296  1.00 115.11 ?  639  THR A N      1 
ATOM   4486  C  CA     . THR A  1 579  ? 62.173  111.776 16.263  1.00 115.68 ?  639  THR A CA     1 
ATOM   4487  C  C      . THR A  1 579  ? 62.860  111.369 17.541  1.00 121.66 ?  639  THR A C      1 
ATOM   4488  O  O      . THR A  1 579  ? 62.418  111.756 18.619  1.00 122.02 ?  639  THR A O      1 
ATOM   4489  C  CB     . THR A  1 579  ? 62.440  113.255 15.987  1.00 114.53 ?  639  THR A CB     1 
ATOM   4490  O  OG1    . THR A  1 579  ? 61.649  113.729 14.900  1.00 106.30 ?  639  THR A OG1    1 
ATOM   4491  C  CG2    . THR A  1 579  ? 63.885  113.501 15.667  1.00 116.15 ?  639  THR A CG2    1 
ATOM   4492  N  N      . GLY A  1 580  ? 63.929  110.592 17.415  1.00 119.41 ?  640  GLY A N      1 
ATOM   4493  C  CA     . GLY A  1 580  ? 64.676  110.133 18.576  1.00 121.24 ?  640  GLY A CA     1 
ATOM   4494  C  C      . GLY A  1 580  ? 64.147  108.868 19.214  1.00 126.10 ?  640  GLY A C      1 
ATOM   4495  O  O      . GLY A  1 580  ? 64.781  108.333 20.120  1.00 127.81 ?  640  GLY A O      1 
ATOM   4496  N  N      . GLY A  1 581  ? 62.997  108.392 18.762  1.00 121.37 ?  641  GLY A N      1 
ATOM   4497  C  CA     . GLY A  1 581  ? 62.445  107.129 19.212  1.00 121.43 ?  641  GLY A CA     1 
ATOM   4498  C  C      . GLY A  1 581  ? 62.065  107.068 20.661  1.00 129.22 ?  641  GLY A C      1 
ATOM   4499  O  O      . GLY A  1 581  ? 61.545  108.051 21.224  1.00 128.30 ?  641  GLY A O      1 
ATOM   4500  N  N      . MET A  1 582  ? 62.301  105.887 21.246  1.00 129.72 ?  642  MET A N      1 
ATOM   4501  C  CA     . MET A  1 582  ? 61.909  105.530 22.637  1.00 132.10 ?  642  MET A CA     1 
ATOM   4502  C  C      . MET A  1 582  ? 62.919  106.010 23.679  1.00 136.48 ?  642  MET A C      1 
ATOM   4503  O  O      . MET A  1 582  ? 64.050  106.358 23.312  1.00 136.71 ?  642  MET A O      1 
ATOM   4504  C  CB     . MET A  1 582  ? 61.784  104.014 22.786  1.00 135.82 ?  642  MET A CB     1 
ATOM   4505  C  CG     . MET A  1 582  ? 60.863  103.380 21.781  1.00 141.46 ?  642  MET A CG     1 
ATOM   4506  S  SD     . MET A  1 582  ? 60.732  101.614 22.116  1.00 148.35 ?  642  MET A SD     1 
ATOM   4507  C  CE     . MET A  1 582  ? 62.302  101.041 21.474  1.00 148.37 ?  642  MET A CE     1 
ATOM   4508  N  N      . LEU A  1 583  ? 62.509  105.950 24.949  1.00 132.60 ?  643  LEU A N      1 
ATOM   4509  C  CA     . LEU A  1 583  ? 63.349  106.384 26.048  1.00 134.33 ?  643  LEU A CA     1 
ATOM   4510  C  C      . LEU A  1 583  ? 64.731  105.784 26.063  1.00 143.55 ?  643  LEU A C      1 
ATOM   4511  O  O      . LEU A  1 583  ? 65.681  106.506 26.355  1.00 145.28 ?  643  LEU A O      1 
ATOM   4512  C  CB     . LEU A  1 583  ? 62.674  106.173 27.381  1.00 134.26 ?  643  LEU A CB     1 
ATOM   4513  C  CG     . LEU A  1 583  ? 61.726  107.288 27.809  1.00 137.89 ?  643  LEU A CG     1 
ATOM   4514  C  CD1    . LEU A  1 583  ? 61.056  106.924 29.094  1.00 138.90 ?  643  LEU A CD1    1 
ATOM   4515  C  CD2    . LEU A  1 583  ? 62.446  108.626 27.987  1.00 141.18 ?  643  LEU A CD2    1 
ATOM   4516  N  N      . ASP A  1 584  ? 64.869  104.487 25.763  1.00 141.82 ?  644  ASP A N      1 
ATOM   4517  C  CA     . ASP A  1 584  ? 66.193  103.854 25.741  1.00 144.20 ?  644  ASP A CA     1 
ATOM   4518  C  C      . ASP A  1 584  ? 67.188  104.629 24.858  1.00 144.64 ?  644  ASP A C      1 
ATOM   4519  O  O      . ASP A  1 584  ? 68.313  104.884 25.299  1.00 146.07 ?  644  ASP A O      1 
ATOM   4520  C  CB     . ASP A  1 584  ? 66.138  102.351 25.384  1.00 147.32 ?  644  ASP A CB     1 
ATOM   4521  C  CG     . ASP A  1 584  ? 65.267  101.918 24.218  1.00 161.81 ?  644  ASP A CG     1 
ATOM   4522  O  OD1    . ASP A  1 584  ? 64.791  102.799 23.464  1.00 163.13 ?  644  ASP A OD1    1 
ATOM   4523  O  OD2    . ASP A  1 584  ? 65.022  100.692 24.081  1.00 167.05 -1 644  ASP A OD2    1 
ATOM   4524  N  N      . ASN A  1 585  ? 66.743  105.081 23.674  1.00 136.44 ?  645  ASN A N      1 
ATOM   4525  C  CA     . ASN A  1 585  ? 67.577  105.855 22.764  1.00 135.81 ?  645  ASN A CA     1 
ATOM   4526  C  C      . ASN A  1 585  ? 67.730  107.312 23.219  1.00 138.46 ?  645  ASN A C      1 
ATOM   4527  O  O      . ASN A  1 585  ? 68.818  107.880 23.090  1.00 140.36 ?  645  ASN A O      1 
ATOM   4528  C  CB     . ASN A  1 585  ? 67.055  105.781 21.345  1.00 133.64 ?  645  ASN A CB     1 
ATOM   4529  C  CG     . ASN A  1 585  ? 67.931  106.497 20.366  1.00 146.82 ?  645  ASN A CG     1 
ATOM   4530  O  OD1    . ASN A  1 585  ? 69.014  106.022 20.025  1.00 134.39 ?  645  ASN A OD1    1 
ATOM   4531  N  ND2    . ASN A  1 585  ? 67.517  107.697 19.973  1.00 141.41 ?  645  ASN A ND2    1 
ATOM   4532  N  N      . ILE A  1 586  ? 66.665  107.921 23.751  1.00 131.18 ?  646  ILE A N      1 
ATOM   4533  C  CA     . ILE A  1 586  ? 66.772  109.283 24.271  1.00 130.79 ?  646  ILE A CA     1 
ATOM   4534  C  C      . ILE A  1 586  ? 67.828  109.329 25.386  1.00 137.25 ?  646  ILE A C      1 
ATOM   4535  O  O      . ILE A  1 586  ? 68.664  110.236 25.414  1.00 138.41 ?  646  ILE A O      1 
ATOM   4536  C  CB     . ILE A  1 586  ? 65.403  109.765 24.756  1.00 131.71 ?  646  ILE A CB     1 
ATOM   4537  C  CG1    . ILE A  1 586  ? 64.471  109.857 23.562  1.00 130.22 ?  646  ILE A CG1    1 
ATOM   4538  C  CG2    . ILE A  1 586  ? 65.516  111.113 25.500  1.00 132.37 ?  646  ILE A CG2    1 
ATOM   4539  C  CD1    . ILE A  1 586  ? 63.192  109.646 23.809  1.00 148.65 ?  646  ILE A CD1    1 
ATOM   4540  N  N      . LEU A  1 587  ? 67.813  108.329 26.276  1.00 133.70 ?  647  LEU A N      1 
ATOM   4541  C  CA     . LEU A  1 587  ? 68.777  108.253 27.364  1.00 135.62 ?  647  LEU A CA     1 
ATOM   4542  C  C      . LEU A  1 587  ? 70.180  107.916 26.866  1.00 141.76 ?  647  LEU A C      1 
ATOM   4543  O  O      . LEU A  1 587  ? 71.136  108.589 27.260  1.00 143.94 ?  647  LEU A O      1 
ATOM   4544  C  CB     . LEU A  1 587  ? 68.318  107.233 28.384  1.00 135.47 ?  647  LEU A CB     1 
ATOM   4545  C  CG     . LEU A  1 587  ? 67.005  107.542 29.072  1.00 137.52 ?  647  LEU A CG     1 
ATOM   4546  C  CD1    . LEU A  1 587  ? 66.513  106.336 29.790  1.00 138.29 ?  647  LEU A CD1    1 
ATOM   4547  C  CD2    . LEU A  1 587  ? 67.089  108.728 29.992  1.00 139.47 ?  647  LEU A CD2    1 
ATOM   4548  N  N      . ALA A  1 588  ? 70.307  106.897 25.994  1.00 135.98 ?  648  ALA A N      1 
ATOM   4549  C  CA     . ALA A  1 588  ? 71.598  106.490 25.448  1.00 136.84 ?  648  ALA A CA     1 
ATOM   4550  C  C      . ALA A  1 588  ? 72.325  107.626 24.725  1.00 139.29 ?  648  ALA A C      1 
ATOM   4551  O  O      . ALA A  1 588  ? 73.525  107.783 24.884  1.00 141.71 ?  648  ALA A O      1 
ATOM   4552  C  CB     . ALA A  1 588  ? 71.414  105.316 24.512  1.00 136.44 ?  648  ALA A CB     1 
ATOM   4553  N  N      . SER A  1 589  ? 71.604  108.426 23.959  1.00 132.80 ?  649  SER A N      1 
ATOM   4554  C  CA     . SER A  1 589  ? 72.211  109.514 23.220  1.00 133.35 ?  649  SER A CA     1 
ATOM   4555  C  C      . SER A  1 589  ? 72.117  110.864 23.958  1.00 138.27 ?  649  SER A C      1 
ATOM   4556  O  O      . SER A  1 589  ? 72.370  111.909 23.347  1.00 138.82 ?  649  SER A O      1 
ATOM   4557  C  CB     . SER A  1 589  ? 71.650  109.574 21.800  1.00 134.79 ?  649  SER A CB     1 
ATOM   4558  O  OG     . SER A  1 589  ? 72.072  108.461 21.023  1.00 139.30 ?  649  SER A OG     1 
ATOM   4559  N  N      . LYS A  1 590  ? 71.820  110.803 25.257  1.00 134.53 ?  650  LYS A N      1 
ATOM   4560  C  CA     . LYS A  1 590  ? 71.760  111.996 26.145  1.00 135.37 ?  650  LYS A CA     1 
ATOM   4561  C  C      . LYS A  1 590  ? 70.962  113.129 25.498  1.00 136.31 ?  650  LYS A C      1 
ATOM   4562  O  O      . LYS A  1 590  ? 71.421  114.276 25.552  1.00 137.99 ?  650  LYS A O      1 
ATOM   4563  C  CB     . LYS A  1 590  ? 73.174  112.469 26.486  1.00 141.39 ?  650  LYS A CB     1 
ATOM   4564  C  CG     . LYS A  1 590  ? 74.116  111.385 26.992  1.00 151.94 ?  650  LYS A CG     1 
ATOM   4565  C  CD     . LYS A  1 590  ? 73.677  110.770 28.301  1.00 156.80 ?  650  LYS A CD     1 
ATOM   4566  C  CE     . LYS A  1 590  ? 74.039  109.304 28.425  1.00 155.61 ?  650  LYS A CE     1 
ATOM   4567  N  NZ     . LYS A  1 590  ? 72.981  108.532 29.118  1.00 148.38 1  650  LYS A NZ     1 
ATOM   4568  N  N      . LEU A  1 591  ? 69.803  112.802 24.936  1.00 128.20 ?  651  LEU A N      1 
ATOM   4569  C  CA     . LEU A  1 591  ? 68.903  113.764 24.295  1.00 125.70 ?  651  LEU A CA     1 
ATOM   4570  C  C      . LEU A  1 591  ? 67.943  114.479 25.267  1.00 135.24 ?  651  LEU A C      1 
ATOM   4571  O  O      . LEU A  1 591  ? 67.101  115.285 24.849  1.00 134.14 ?  651  LEU A O      1 
ATOM   4572  C  CB     . LEU A  1 591  ? 68.140  113.080 23.151  1.00 121.45 ?  651  LEU A CB     1 
ATOM   4573  C  CG     . LEU A  1 591  ? 68.986  112.649 21.976  1.00 123.41 ?  651  LEU A CG     1 
ATOM   4574  C  CD1    . LEU A  1 591  ? 68.238  111.680 21.075  1.00 119.77 ?  651  LEU A CD1    1 
ATOM   4575  C  CD2    . LEU A  1 591  ? 69.442  113.848 21.197  1.00 124.72 ?  651  LEU A CD2    1 
ATOM   4576  N  N      . TYR A  1 592  ? 68.094  114.203 26.562  1.00 136.05 ?  652  TYR A N      1 
ATOM   4577  C  CA     . TYR A  1 592  ? 67.290  114.805 27.616  1.00 136.67 ?  652  TYR A CA     1 
ATOM   4578  C  C      . TYR A  1 592  ? 67.880  116.150 28.111  1.00 144.82 ?  652  TYR A C      1 
ATOM   4579  O  O      . TYR A  1 592  ? 67.256  116.828 28.925  1.00 146.55 ?  652  TYR A O      1 
ATOM   4580  C  CB     . TYR A  1 592  ? 67.082  113.798 28.751  1.00 138.23 ?  652  TYR A CB     1 
ATOM   4581  C  CG     . TYR A  1 592  ? 68.367  113.245 29.327  1.00 143.82 ?  652  TYR A CG     1 
ATOM   4582  C  CD1    . TYR A  1 592  ? 69.046  113.918 30.343  1.00 148.76 ?  652  TYR A CD1    1 
ATOM   4583  C  CD2    . TYR A  1 592  ? 68.891  112.032 28.882  1.00 145.19 ?  652  TYR A CD2    1 
ATOM   4584  C  CE1    . TYR A  1 592  ? 70.215  113.406 30.896  1.00 152.59 ?  652  TYR A CE1    1 
ATOM   4585  C  CE2    . TYR A  1 592  ? 70.071  111.516 29.417  1.00 149.28 ?  652  TYR A CE2    1 
ATOM   4586  C  CZ     . TYR A  1 592  ? 70.721  112.204 30.433  1.00 161.43 ?  652  TYR A CZ     1 
ATOM   4587  O  OH     . TYR A  1 592  ? 71.858  111.706 31.010  1.00 169.09 ?  652  TYR A OH     1 
ATOM   4588  N  N      . ARG A  1 593  ? 69.074  116.522 27.632  1.00 141.93 ?  653  ARG A N      1 
ATOM   4589  C  CA     . ARG A  1 593  ? 69.722  117.802 28.048  1.00 144.04 ?  653  ARG A CA     1 
ATOM   4590  C  C      . ARG A  1 593  ? 70.477  118.322 26.823  1.00 151.03 ?  653  ARG A C      1 
ATOM   4591  O  O      . ARG A  1 593  ? 70.950  117.482 26.047  1.00 151.52 ?  653  ARG A O      1 
ATOM   4592  C  CB     . ARG A  1 593  ? 70.620  117.572 29.263  1.00 144.92 ?  653  ARG A CB     1 
ATOM   4593  C  CG     . ARG A  1 593  ? 71.485  116.327 29.150  1.00 156.50 ?  653  ARG A CG     1 
ATOM   4594  C  CD     . ARG A  1 593  ? 72.940  116.648 28.884  1.00 160.54 ?  653  ARG A CD     1 
ATOM   4595  N  NE     . ARG A  1 593  ? 73.585  115.591 28.126  1.00 172.05 ?  653  ARG A NE     1 
ATOM   4596  C  CZ     . ARG A  1 593  ? 74.824  115.663 27.666  1.00 187.74 ?  653  ARG A CZ     1 
ATOM   4597  N  NH1    . ARG A  1 593  ? 75.355  114.639 27.020  1.00 172.14 1  653  ARG A NH1    1 
ATOM   4598  N  NH2    . ARG A  1 593  ? 75.524  116.769 27.841  1.00 178.69 ?  653  ARG A NH2    1 
ATOM   4599  N  N      . PRO A  1 594  ? 70.665  119.648 26.631  1.00 148.48 ?  654  PRO A N      1 
ATOM   4600  C  CA     . PRO A  1 594  ? 71.315  120.158 25.419  1.00 148.22 ?  654  PRO A CA     1 
ATOM   4601  C  C      . PRO A  1 594  ? 72.806  120.255 25.611  1.00 152.97 ?  654  PRO A C      1 
ATOM   4602  O  O      . PRO A  1 594  ? 73.302  120.486 26.704  1.00 154.89 ?  654  PRO A O      1 
ATOM   4603  C  CB     . PRO A  1 594  ? 70.700  121.544 25.171  1.00 150.15 ?  654  PRO A CB     1 
ATOM   4604  C  CG     . PRO A  1 594  ? 70.254  121.979 26.515  1.00 156.22 ?  654  PRO A CG     1 
ATOM   4605  C  CD     . PRO A  1 594  ? 69.841  120.739 27.262  1.00 150.82 ?  654  PRO A CD     1 
ATOM   4606  N  N      . GLY A  1 595  ? 73.492  120.066 24.505  1.00 148.61 ?  655  GLY A N      1 
ATOM   4607  C  CA     . GLY A  1 595  ? 74.912  120.275 24.360  1.00 151.42 ?  655  GLY A CA     1 
ATOM   4608  C  C      . GLY A  1 595  ? 75.104  121.563 23.581  1.00 156.04 ?  655  GLY A C      1 
ATOM   4609  O  O      . GLY A  1 595  ? 74.271  122.477 23.641  1.00 153.75 ?  655  GLY A O      1 
ATOM   4610  N  N      . SER A  1 596  ? 76.187  121.630 22.815  1.00 155.83 ?  656  SER A N      1 
ATOM   4611  C  CA     . SER A  1 596  ? 76.560  122.838 22.059  1.00 157.35 ?  656  SER A CA     1 
ATOM   4612  C  C      . SER A  1 596  ? 76.501  122.694 20.531  1.00 158.30 ?  656  SER A C      1 
ATOM   4613  O  O      . SER A  1 596  ? 76.836  123.649 19.812  1.00 158.05 ?  656  SER A O      1 
ATOM   4614  C  CB     . SER A  1 596  ? 77.979  123.255 22.438  1.00 165.96 ?  656  SER A CB     1 
ATOM   4615  O  OG     . SER A  1 596  ? 78.114  123.478 23.829  1.00 178.86 ?  656  SER A OG     1 
ATOM   4616  N  N      . VAL A  1 597  ? 76.115  121.504 20.041  1.00 151.54 ?  657  VAL A N      1 
ATOM   4617  C  CA     . VAL A  1 597  ? 76.153  121.158 18.622  1.00 148.57 ?  657  VAL A CA     1 
ATOM   4618  C  C      . VAL A  1 597  ? 74.782  121.133 17.983  1.00 147.22 ?  657  VAL A C      1 
ATOM   4619  O  O      . VAL A  1 597  ? 73.921  120.386 18.424  1.00 145.21 ?  657  VAL A O      1 
ATOM   4620  C  CB     . VAL A  1 597  ? 76.862  119.797 18.443  1.00 151.99 ?  657  VAL A CB     1 
ATOM   4621  C  CG1    . VAL A  1 597  ? 77.076  119.485 16.965  1.00 150.47 ?  657  VAL A CG1    1 
ATOM   4622  C  CG2    . VAL A  1 597  ? 78.178  119.749 19.224  1.00 155.33 ?  657  VAL A CG2    1 
ATOM   4623  N  N      . ALA A  1 598  ? 74.594  121.904 16.916  1.00 141.85 ?  658  ALA A N      1 
ATOM   4624  C  CA     . ALA A  1 598  ? 73.331  121.903 16.192  1.00 138.36 ?  658  ALA A CA     1 
ATOM   4625  C  C      . ALA A  1 598  ? 73.517  121.202 14.864  1.00 141.46 ?  658  ALA A C      1 
ATOM   4626  O  O      . ALA A  1 598  ? 74.600  121.279 14.290  1.00 142.55 ?  658  ALA A O      1 
ATOM   4627  C  CB     . ALA A  1 598  ? 72.836  123.316 15.978  1.00 139.30 ?  658  ALA A CB     1 
ATOM   4628  N  N      . TYR A  1 599  ? 72.492  120.496 14.373  1.00 135.75 ?  659  TYR A N      1 
ATOM   4629  C  CA     . TYR A  1 599  ? 72.626  119.815 13.088  1.00 134.29 ?  659  TYR A CA     1 
ATOM   4630  C  C      . TYR A  1 599  ? 71.386  119.936 12.225  1.00 136.08 ?  659  TYR A C      1 
ATOM   4631  O  O      . TYR A  1 599  ? 70.280  120.179 12.716  1.00 133.05 ?  659  TYR A O      1 
ATOM   4632  C  CB     . TYR A  1 599  ? 73.040  118.330 13.246  1.00 134.59 ?  659  TYR A CB     1 
ATOM   4633  C  CG     . TYR A  1 599  ? 71.936  117.421 13.737  1.00 133.88 ?  659  TYR A CG     1 
ATOM   4634  C  CD1    . TYR A  1 599  ? 70.937  116.972 12.875  1.00 133.33 ?  659  TYR A CD1    1 
ATOM   4635  C  CD2    . TYR A  1 599  ? 71.914  116.969 15.050  1.00 135.40 ?  659  TYR A CD2    1 
ATOM   4636  C  CE1    . TYR A  1 599  ? 69.915  116.142 13.323  1.00 131.99 ?  659  TYR A CE1    1 
ATOM   4637  C  CE2    . TYR A  1 599  ? 70.900  116.130 15.508  1.00 134.76 ?  659  TYR A CE2    1 
ATOM   4638  C  CZ     . TYR A  1 599  ? 69.904  115.718 14.639  1.00 142.15 ?  659  TYR A CZ     1 
ATOM   4639  O  OH     . TYR A  1 599  ? 68.900  114.892 15.077  1.00 147.54 ?  659  TYR A OH     1 
ATOM   4640  N  N      . VAL A  1 600  ? 71.581  119.713 10.931  1.00 133.47 ?  660  VAL A N      1 
ATOM   4641  C  CA     . VAL A  1 600  ? 70.509  119.680 9.959   1.00 131.56 ?  660  VAL A CA     1 
ATOM   4642  C  C      . VAL A  1 600  ? 70.859  118.608 8.926   1.00 135.40 ?  660  VAL A C      1 
ATOM   4643  O  O      . VAL A  1 600  ? 72.009  118.554 8.466   1.00 136.59 ?  660  VAL A O      1 
ATOM   4644  C  CB     . VAL A  1 600  ? 70.179  121.068 9.345   1.00 135.70 ?  660  VAL A CB     1 
ATOM   4645  C  CG1    . VAL A  1 600  ? 71.366  121.659 8.588   1.00 137.03 ?  660  VAL A CG1    1 
ATOM   4646  C  CG2    . VAL A  1 600  ? 68.946  120.994 8.455   1.00 133.79 ?  660  VAL A CG2    1 
ATOM   4647  N  N      . SER A  1 601  ? 69.872  117.750 8.590   1.00 129.67 ?  661  SER A N      1 
ATOM   4648  C  CA     . SER A  1 601  ? 70.022  116.664 7.638   1.00 129.68 ?  661  SER A CA     1 
ATOM   4649  C  C      . SER A  1 601  ? 68.774  116.531 6.823   1.00 134.55 ?  661  SER A C      1 
ATOM   4650  O  O      . SER A  1 601  ? 67.729  116.962 7.279   1.00 133.87 ?  661  SER A O      1 
ATOM   4651  C  CB     . SER A  1 601  ? 70.259  115.362 8.398   1.00 133.31 ?  661  SER A CB     1 
ATOM   4652  O  OG     . SER A  1 601  ? 69.999  114.193 7.643   1.00 146.18 ?  661  SER A OG     1 
ATOM   4653  N  N      . ARG A  1 602  ? 68.849  115.909 5.635   1.00 132.37 ?  662  ARG A N      1 
ATOM   4654  C  CA     . ARG A  1 602  ? 67.630  115.594 4.894   1.00 130.85 ?  662  ARG A CA     1 
ATOM   4655  C  C      . ARG A  1 602  ? 66.984  114.332 5.553   1.00 132.43 ?  662  ARG A C      1 
ATOM   4656  O  O      . ARG A  1 602  ? 65.766  114.249 5.739   1.00 130.96 ?  662  ARG A O      1 
ATOM   4657  C  CB     . ARG A  1 602  ? 67.961  115.248 3.433   1.00 132.61 ?  662  ARG A CB     1 
ATOM   4658  C  CG     . ARG A  1 602  ? 67.943  116.402 2.448   1.00 144.48 ?  662  ARG A CG     1 
ATOM   4659  C  CD     . ARG A  1 602  ? 67.709  115.799 1.069   1.00 162.52 ?  662  ARG A CD     1 
ATOM   4660  N  NE     . ARG A  1 602  ? 67.538  116.772 -0.015  1.00 169.61 ?  662  ARG A NE     1 
ATOM   4661  C  CZ     . ARG A  1 602  ? 66.410  117.427 -0.272  1.00 181.65 ?  662  ARG A CZ     1 
ATOM   4662  N  NH1    . ARG A  1 602  ? 65.350  117.275 0.514   1.00 171.91 1  662  ARG A NH1    1 
ATOM   4663  N  NH2    . ARG A  1 602  ? 66.344  118.267 -1.293  1.00 162.95 ?  662  ARG A NH2    1 
ATOM   4664  N  N      . SER A  1 603  ? 67.828  113.365 5.896   1.00 127.51 ?  663  SER A N      1 
ATOM   4665  C  CA     . SER A  1 603  ? 67.458  112.047 6.355   1.00 125.64 ?  663  SER A CA     1 
ATOM   4666  C  C      . SER A  1 603  ? 66.971  111.948 7.806   1.00 130.24 ?  663  SER A C      1 
ATOM   4667  O  O      . SER A  1 603  ? 67.625  112.452 8.720   1.00 131.75 ?  663  SER A O      1 
ATOM   4668  C  CB     . SER A  1 603  ? 68.638  111.109 6.130   1.00 127.93 ?  663  SER A CB     1 
ATOM   4669  O  OG     . SER A  1 603  ? 68.467  109.836 6.733   1.00 129.22 ?  663  SER A OG     1 
ATOM   4670  N  N      . GLY A  1 604  ? 65.866  111.228 8.005   1.00 124.82 ?  664  GLY A N      1 
ATOM   4671  C  CA     . GLY A  1 604  ? 65.333  110.944 9.335   1.00 123.33 ?  664  GLY A CA     1 
ATOM   4672  C  C      . GLY A  1 604  ? 66.195  109.942 10.090  1.00 127.10 ?  664  GLY A C      1 
ATOM   4673  O  O      . GLY A  1 604  ? 66.649  110.215 11.207  1.00 126.99 ?  664  GLY A O      1 
ATOM   4674  N  N      . GLY A  1 605  ? 66.427  108.784 9.473   1.00 124.11 ?  665  GLY A N      1 
ATOM   4675  C  CA     . GLY A  1 605  ? 67.266  107.738 10.038  1.00 125.70 ?  665  GLY A CA     1 
ATOM   4676  C  C      . GLY A  1 605  ? 68.636  108.266 10.393  1.00 132.87 ?  665  GLY A C      1 
ATOM   4677  O  O      . GLY A  1 605  ? 69.119  108.052 11.512  1.00 134.29 ?  665  GLY A O      1 
ATOM   4678  N  N      . MET A  1 606  ? 69.246  109.017 9.466   1.00 130.64 ?  666  MET A N      1 
ATOM   4679  C  CA     . MET A  1 606  ? 70.579  109.572 9.699   1.00 133.24 ?  666  MET A CA     1 
ATOM   4680  C  C      . MET A  1 606  ? 70.615  110.638 10.780  1.00 137.02 ?  666  MET A C      1 
ATOM   4681  O  O      . MET A  1 606  ? 71.637  110.786 11.442  1.00 137.66 ?  666  MET A O      1 
ATOM   4682  C  CB     . MET A  1 606  ? 71.218  110.066 8.411   1.00 136.90 ?  666  MET A CB     1 
ATOM   4683  C  CG     . MET A  1 606  ? 71.545  108.941 7.442   1.00 142.79 ?  666  MET A CG     1 
ATOM   4684  S  SD     . MET A  1 606  ? 72.456  107.515 8.125   1.00 150.62 ?  666  MET A SD     1 
ATOM   4685  C  CE     . MET A  1 606  ? 73.982  108.253 8.535   1.00 149.58 ?  666  MET A CE     1 
ATOM   4686  N  N      . SER A  1 607  ? 69.502  111.351 11.000  1.00 132.95 ?  667  SER A N      1 
ATOM   4687  C  CA     . SER A  1 607  ? 69.445  112.326 12.086  1.00 133.34 ?  667  SER A CA     1 
ATOM   4688  C  C      . SER A  1 607  ? 69.601  111.609 13.414  1.00 137.38 ?  667  SER A C      1 
ATOM   4689  O  O      . SER A  1 607  ? 70.314  112.106 14.294  1.00 139.37 ?  667  SER A O      1 
ATOM   4690  C  CB     . SER A  1 607  ? 68.136  113.099 12.062  1.00 136.24 ?  667  SER A CB     1 
ATOM   4691  O  OG     . SER A  1 607  ? 68.135  113.994 10.962  1.00 151.36 ?  667  SER A OG     1 
ATOM   4692  N  N      . ASN A  1 608  ? 68.992  110.416 13.550  1.00 130.93 ?  668  ASN A N      1 
ATOM   4693  C  CA     . ASN A  1 608  ? 69.151  109.661 14.791  1.00 130.15 ?  668  ASN A CA     1 
ATOM   4694  C  C      . ASN A  1 608  ? 70.545  109.041 14.911  1.00 131.60 ?  668  ASN A C      1 
ATOM   4695  O  O      . ASN A  1 608  ? 71.042  108.880 16.037  1.00 132.00 ?  668  ASN A O      1 
ATOM   4696  C  CB     . ASN A  1 608  ? 68.049  108.652 14.984  1.00 130.55 ?  668  ASN A CB     1 
ATOM   4697  C  CG     . ASN A  1 608  ? 67.905  108.227 16.415  1.00 166.81 ?  668  ASN A CG     1 
ATOM   4698  O  OD1    . ASN A  1 608  ? 68.030  109.031 17.347  1.00 166.52 ?  668  ASN A OD1    1 
ATOM   4699  N  ND2    . ASN A  1 608  ? 67.570  106.967 16.615  1.00 160.57 ?  668  ASN A ND2    1 
ATOM   4700  N  N      . GLU A  1 609  ? 71.192  108.735 13.764  1.00 125.47 ?  669  GLU A N      1 
ATOM   4701  C  CA     . GLU A  1 609  ? 72.578  108.319 13.792  1.00 127.22 ?  669  GLU A CA     1 
ATOM   4702  C  C      . GLU A  1 609  ? 73.439  109.529 14.238  1.00 133.21 ?  669  GLU A C      1 
ATOM   4703  O  O      . GLU A  1 609  ? 74.389  109.362 15.011  1.00 135.20 ?  669  GLU A O      1 
ATOM   4704  C  CB     . GLU A  1 609  ? 73.023  107.812 12.430  1.00 128.64 ?  669  GLU A CB     1 
ATOM   4705  C  CG     . GLU A  1 609  ? 74.358  107.084 12.465  1.00 140.97 ?  669  GLU A CG     1 
ATOM   4706  C  CD     . GLU A  1 609  ? 74.369  105.762 13.209  1.00 175.79 ?  669  GLU A CD     1 
ATOM   4707  O  OE1    . GLU A  1 609  ? 73.351  105.036 13.150  1.00 172.77 ?  669  GLU A OE1    1 
ATOM   4708  O  OE2    . GLU A  1 609  ? 75.398  105.450 13.854  1.00 185.26 -1 669  GLU A OE2    1 
ATOM   4709  N  N      . LEU A  1 610  ? 73.090  110.747 13.791  1.00 128.32 ?  670  LEU A N      1 
ATOM   4710  C  CA     . LEU A  1 610  ? 73.839  111.927 14.211  1.00 129.40 ?  670  LEU A CA     1 
ATOM   4711  C  C      . LEU A  1 610  ? 73.679  112.184 15.701  1.00 133.46 ?  670  LEU A C      1 
ATOM   4712  O  O      . LEU A  1 610  ? 74.637  112.594 16.347  1.00 133.64 ?  670  LEU A O      1 
ATOM   4713  C  CB     . LEU A  1 610  ? 73.445  113.155 13.404  1.00 128.15 ?  670  LEU A CB     1 
ATOM   4714  C  CG     . LEU A  1 610  ? 73.887  113.206 11.950  1.00 132.15 ?  670  LEU A CG     1 
ATOM   4715  C  CD1    . LEU A  1 610  ? 73.275  114.411 11.276  1.00 131.66 ?  670  LEU A CD1    1 
ATOM   4716  C  CD2    . LEU A  1 610  ? 75.389  113.232 11.814  1.00 134.47 ?  670  LEU A CD2    1 
ATOM   4717  N  N      . ASN A  1 611  ? 72.485  111.925 16.253  1.00 129.91 ?  671  ASN A N      1 
ATOM   4718  C  CA     . ASN A  1 611  ? 72.269  112.053 17.695  1.00 131.34 ?  671  ASN A CA     1 
ATOM   4719  C  C      . ASN A  1 611  ? 73.278  111.174 18.445  1.00 136.86 ?  671  ASN A C      1 
ATOM   4720  O  O      . ASN A  1 611  ? 73.904  111.619 19.414  1.00 137.73 ?  671  ASN A O      1 
ATOM   4721  C  CB     . ASN A  1 611  ? 70.853  111.624 18.064  1.00 133.66 ?  671  ASN A CB     1 
ATOM   4722  C  CG     . ASN A  1 611  ? 69.776  112.547 17.557  1.00 157.41 ?  671  ASN A CG     1 
ATOM   4723  O  OD1    . ASN A  1 611  ? 69.970  113.760 17.386  1.00 151.57 ?  671  ASN A OD1    1 
ATOM   4724  N  ND2    . ASN A  1 611  ? 68.593  111.990 17.358  1.00 145.98 ?  671  ASN A ND2    1 
ATOM   4725  N  N      . ASN A  1 612  ? 73.457  109.943 17.953  1.00 133.13 ?  672  ASN A N      1 
ATOM   4726  C  CA     . ASN A  1 612  ? 74.370  108.971 18.523  1.00 135.07 ?  672  ASN A CA     1 
ATOM   4727  C  C      . ASN A  1 612  ? 75.800  109.451 18.406  1.00 140.23 ?  672  ASN A C      1 
ATOM   4728  O  O      . ASN A  1 612  ? 76.496  109.541 19.422  1.00 142.82 ?  672  ASN A O      1 
ATOM   4729  C  CB     . ASN A  1 612  ? 74.174  107.607 17.845  1.00 136.22 ?  672  ASN A CB     1 
ATOM   4730  C  CG     . ASN A  1 612  ? 75.265  106.595 18.115  1.00 161.96 ?  672  ASN A CG     1 
ATOM   4731  O  OD1    . ASN A  1 612  ? 75.491  106.189 19.258  1.00 157.20 ?  672  ASN A OD1    1 
ATOM   4732  N  ND2    . ASN A  1 612  ? 75.926  106.125 17.056  1.00 155.89 ?  672  ASN A ND2    1 
ATOM   4733  N  N      . ILE A  1 613  ? 76.222  109.801 17.182  1.00 135.03 ?  673  ILE A N      1 
ATOM   4734  C  CA     . ILE A  1 613  ? 77.586  110.250 16.911  1.00 136.96 ?  673  ILE A CA     1 
ATOM   4735  C  C      . ILE A  1 613  ? 77.940  111.483 17.739  1.00 140.62 ?  673  ILE A C      1 
ATOM   4736  O  O      . ILE A  1 613  ? 78.967  111.496 18.418  1.00 143.17 ?  673  ILE A O      1 
ATOM   4737  C  CB     . ILE A  1 613  ? 77.784  110.480 15.391  1.00 139.09 ?  673  ILE A CB     1 
ATOM   4738  C  CG1    . ILE A  1 613  ? 77.641  109.149 14.607  1.00 138.30 ?  673  ILE A CG1    1 
ATOM   4739  C  CG2    . ILE A  1 613  ? 79.126  111.185 15.086  1.00 142.60 ?  673  ILE A CG2    1 
ATOM   4740  C  CD1    . ILE A  1 613  ? 77.414  109.319 13.101  1.00 140.69 ?  673  ILE A CD1    1 
ATOM   4741  N  N      . ILE A  1 614  ? 77.082  112.499 17.695  1.00 134.08 ?  674  ILE A N      1 
ATOM   4742  C  CA     . ILE A  1 614  ? 77.310  113.749 18.403  1.00 135.04 ?  674  ILE A CA     1 
ATOM   4743  C  C      . ILE A  1 614  ? 77.377  113.548 19.919  1.00 139.37 ?  674  ILE A C      1 
ATOM   4744  O  O      . ILE A  1 614  ? 78.242  114.136 20.570  1.00 139.57 ?  674  ILE A O      1 
ATOM   4745  C  CB     . ILE A  1 614  ? 76.262  114.791 17.958  1.00 136.06 ?  674  ILE A CB     1 
ATOM   4746  C  CG1    . ILE A  1 614  ? 76.487  115.159 16.485  1.00 136.46 ?  674  ILE A CG1    1 
ATOM   4747  C  CG2    . ILE A  1 614  ? 76.299  116.056 18.833  1.00 138.12 ?  674  ILE A CG2    1 
ATOM   4748  C  CD1    . ILE A  1 614  ? 75.416  115.995 15.866  1.00 144.29 ?  674  ILE A CD1    1 
ATOM   4749  N  N      . SER A  1 615  ? 76.499  112.688 20.475  1.00 136.04 ?  675  SER A N      1 
ATOM   4750  C  CA     . SER A  1 615  ? 76.507  112.399 21.913  1.00 137.23 ?  675  SER A CA     1 
ATOM   4751  C  C      . SER A  1 615  ? 77.834  111.739 22.369  1.00 145.29 ?  675  SER A C      1 
ATOM   4752  O  O      . SER A  1 615  ? 78.272  111.953 23.503  1.00 146.06 ?  675  SER A O      1 
ATOM   4753  C  CB     . SER A  1 615  ? 75.301  111.551 22.309  1.00 135.31 ?  675  SER A CB     1 
ATOM   4754  O  OG     . SER A  1 615  ? 75.493  110.163 22.094  1.00 137.79 ?  675  SER A OG     1 
ATOM   4755  N  N      . ARG A  1 616  ? 78.485  110.989 21.471  1.00 143.62 ?  676  ARG A N      1 
ATOM   4756  C  CA     . ARG A  1 616  ? 79.727  110.304 21.791  1.00 147.70 ?  676  ARG A CA     1 
ATOM   4757  C  C      . ARG A  1 616  ? 80.962  111.128 21.578  1.00 158.07 ?  676  ARG A C      1 
ATOM   4758  O  O      . ARG A  1 616  ? 82.012  110.792 22.125  1.00 162.25 ?  676  ARG A O      1 
ATOM   4759  C  CB     . ARG A  1 616  ? 79.874  109.056 20.940  1.00 146.26 ?  676  ARG A CB     1 
ATOM   4760  C  CG     . ARG A  1 616  ? 78.849  108.020 21.208  1.00 152.23 ?  676  ARG A CG     1 
ATOM   4761  C  CD     . ARG A  1 616  ? 79.168  106.853 20.328  1.00 166.98 ?  676  ARG A CD     1 
ATOM   4762  N  NE     . ARG A  1 616  ? 78.042  105.940 20.299  1.00 185.89 ?  676  ARG A NE     1 
ATOM   4763  C  CZ     . ARG A  1 616  ? 77.999  104.788 20.953  1.00 204.92 ?  676  ARG A CZ     1 
ATOM   4764  N  NH1    . ARG A  1 616  ? 76.920  104.021 20.884  1.00 189.87 1  676  ARG A NH1    1 
ATOM   4765  N  NH2    . ARG A  1 616  ? 79.048  104.378 21.661  1.00 193.56 ?  676  ARG A NH2    1 
ATOM   4766  N  N      . THR A  1 617  ? 80.876  112.160 20.754  1.00 155.49 ?  677  THR A N      1 
ATOM   4767  C  CA     . THR A  1 617  ? 82.046  112.938 20.371  1.00 159.50 ?  677  THR A CA     1 
ATOM   4768  C  C      . THR A  1 617  ? 82.118  114.316 20.974  1.00 167.49 ?  677  THR A C      1 
ATOM   4769  O  O      . THR A  1 617  ? 83.178  114.953 20.895  1.00 170.22 ?  677  THR A O      1 
ATOM   4770  C  CB     . THR A  1 617  ? 82.104  113.040 18.841  1.00 169.50 ?  677  THR A CB     1 
ATOM   4771  O  OG1    . THR A  1 617  ? 80.854  113.550 18.365  1.00 170.30 ?  677  THR A OG1    1 
ATOM   4772  C  CG2    . THR A  1 617  ? 82.404  111.703 18.181  1.00 167.80 ?  677  THR A CG2    1 
ATOM   4773  N  N      . THR A  1 618  ? 80.987  114.808 21.518  1.00 163.58 ?  678  THR A N      1 
ATOM   4774  C  CA     . THR A  1 618  ? 80.856  116.168 22.032  1.00 164.67 ?  678  THR A CA     1 
ATOM   4775  C  C      . THR A  1 618  ? 80.023  116.200 23.320  1.00 169.90 ?  678  THR A C      1 
ATOM   4776  O  O      . THR A  1 618  ? 79.712  115.143 23.887  1.00 170.95 ?  678  THR A O      1 
ATOM   4777  C  CB     . THR A  1 618  ? 80.194  117.043 20.938  1.00 167.48 ?  678  THR A CB     1 
ATOM   4778  O  OG1    . THR A  1 618  ? 78.789  116.802 20.936  1.00 160.79 ?  678  THR A OG1    1 
ATOM   4779  C  CG2    . THR A  1 618  ? 80.760  116.791 19.536  1.00 166.64 ?  678  THR A CG2    1 
ATOM   4780  N  N      . ASP A  1 619  ? 79.625  117.419 23.752  1.00 165.33 ?  679  ASP A N      1 
ATOM   4781  C  CA     . ASP A  1 619  ? 78.746  117.606 24.906  1.00 164.17 ?  679  ASP A CA     1 
ATOM   4782  C  C      . ASP A  1 619  ? 77.264  117.336 24.546  1.00 162.98 ?  679  ASP A C      1 
ATOM   4783  O  O      . ASP A  1 619  ? 76.407  117.314 25.432  1.00 160.41 ?  679  ASP A O      1 
ATOM   4784  C  CB     . ASP A  1 619  ? 78.956  118.981 25.549  1.00 168.12 ?  679  ASP A CB     1 
ATOM   4785  C  CG     . ASP A  1 619  ? 78.621  120.170 24.680  1.00 173.51 ?  679  ASP A CG     1 
ATOM   4786  O  OD1    . ASP A  1 619  ? 78.480  119.993 23.449  1.00 171.18 ?  679  ASP A OD1    1 
ATOM   4787  O  OD2    . ASP A  1 619  ? 78.504  121.275 25.226  1.00 180.45 -1 679  ASP A OD2    1 
ATOM   4788  N  N      . GLY A  1 620  ? 76.992  117.127 23.255  1.00 157.59 ?  680  GLY A N      1 
ATOM   4789  C  CA     . GLY A  1 620  ? 75.684  116.721 22.771  1.00 153.30 ?  680  GLY A CA     1 
ATOM   4790  C  C      . GLY A  1 620  ? 74.983  117.679 21.847  1.00 153.58 ?  680  GLY A C      1 
ATOM   4791  O  O      . GLY A  1 620  ? 75.462  118.785 21.566  1.00 152.94 ?  680  GLY A O      1 
ATOM   4792  N  N      . VAL A  1 621  ? 73.823  117.217 21.373  1.00 147.59 ?  681  VAL A N      1 
ATOM   4793  C  CA     . VAL A  1 621  ? 72.958  117.972 20.476  1.00 145.18 ?  681  VAL A CA     1 
ATOM   4794  C  C      . VAL A  1 621  ? 72.324  119.160 21.220  1.00 151.69 ?  681  VAL A C      1 
ATOM   4795  O  O      . VAL A  1 621  ? 71.795  118.970 22.314  1.00 153.78 ?  681  VAL A O      1 
ATOM   4796  C  CB     . VAL A  1 621  ? 71.869  117.045 19.867  1.00 144.14 ?  681  VAL A CB     1 
ATOM   4797  C  CG1    . VAL A  1 621  ? 70.861  117.831 19.040  1.00 141.31 ?  681  VAL A CG1    1 
ATOM   4798  C  CG2    . VAL A  1 621  ? 72.497  115.923 19.046  1.00 143.56 ?  681  VAL A CG2    1 
ATOM   4799  N  N      . TYR A  1 622  ? 72.352  120.361 20.621  1.00 146.25 ?  682  TYR A N      1 
ATOM   4800  C  CA     . TYR A  1 622  ? 71.630  121.524 21.114  1.00 145.29 ?  682  TYR A CA     1 
ATOM   4801  C  C      . TYR A  1 622  ? 70.222  121.489 20.478  1.00 145.52 ?  682  TYR A C      1 
ATOM   4802  O  O      . TYR A  1 622  ? 69.215  121.659 21.183  1.00 143.76 ?  682  TYR A O      1 
ATOM   4803  C  CB     . TYR A  1 622  ? 72.346  122.823 20.725  1.00 148.27 ?  682  TYR A CB     1 
ATOM   4804  C  CG     . TYR A  1 622  ? 71.574  124.050 21.163  1.00 150.14 ?  682  TYR A CG     1 
ATOM   4805  C  CD1    . TYR A  1 622  ? 70.520  124.550 20.395  1.00 149.70 ?  682  TYR A CD1    1 
ATOM   4806  C  CD2    . TYR A  1 622  ? 71.850  124.675 22.377  1.00 153.54 ?  682  TYR A CD2    1 
ATOM   4807  C  CE1    . TYR A  1 622  ? 69.759  125.636 20.824  1.00 150.74 ?  682  TYR A CE1    1 
ATOM   4808  C  CE2    . TYR A  1 622  ? 71.110  125.779 22.806  1.00 154.99 ?  682  TYR A CE2    1 
ATOM   4809  C  CZ     . TYR A  1 622  ? 70.065  126.256 22.025  1.00 160.96 ?  682  TYR A CZ     1 
ATOM   4810  O  OH     . TYR A  1 622  ? 69.328  127.340 22.436  1.00 164.45 ?  682  TYR A OH     1 
ATOM   4811  N  N      . GLU A  1 623  ? 70.176  121.316 19.128  1.00 140.30 ?  683  GLU A N      1 
ATOM   4812  C  CA     . GLU A  1 623  ? 68.972  121.216 18.296  1.00 136.69 ?  683  GLU A CA     1 
ATOM   4813  C  C      . GLU A  1 623  ? 69.321  120.498 16.996  1.00 136.47 ?  683  GLU A C      1 
ATOM   4814  O  O      . GLU A  1 623  ? 70.380  120.736 16.422  1.00 134.93 ?  683  GLU A O      1 
ATOM   4815  C  CB     . GLU A  1 623  ? 68.361  122.606 17.986  1.00 138.47 ?  683  GLU A CB     1 
ATOM   4816  C  CG     . GLU A  1 623  ? 66.998  122.547 17.293  1.00 148.94 ?  683  GLU A CG     1 
ATOM   4817  C  CD     . GLU A  1 623  ? 66.277  123.858 17.025  1.00 165.82 ?  683  GLU A CD     1 
ATOM   4818  O  OE1    . GLU A  1 623  ? 66.943  124.915 17.015  1.00 145.18 ?  683  GLU A OE1    1 
ATOM   4819  O  OE2    . GLU A  1 623  ? 65.043  123.830 16.808  1.00 164.50 -1 683  GLU A OE2    1 
ATOM   4820  N  N      . GLY A  1 624  ? 68.421  119.628 16.555  1.00 131.11 ?  684  GLY A N      1 
ATOM   4821  C  CA     . GLY A  1 624  ? 68.552  118.902 15.302  1.00 129.50 ?  684  GLY A CA     1 
ATOM   4822  C  C      . GLY A  1 624  ? 67.272  118.991 14.508  1.00 129.48 ?  684  GLY A C      1 
ATOM   4823  O  O      . GLY A  1 624  ? 66.191  118.989 15.092  1.00 126.77 ?  684  GLY A O      1 
ATOM   4824  N  N      . VAL A  1 625  ? 67.391  119.118 13.178  1.00 125.40 ?  685  VAL A N      1 
ATOM   4825  C  CA     . VAL A  1 625  ? 66.254  119.173 12.271  1.00 122.52 ?  685  VAL A CA     1 
ATOM   4826  C  C      . VAL A  1 625  ? 66.504  118.258 11.082  1.00 123.62 ?  685  VAL A C      1 
ATOM   4827  O  O      . VAL A  1 625  ? 67.587  118.285 10.491  1.00 124.24 ?  685  VAL A O      1 
ATOM   4828  C  CB     . VAL A  1 625  ? 65.948  120.619 11.778  1.00 127.29 ?  685  VAL A CB     1 
ATOM   4829  C  CG1    . VAL A  1 625  ? 64.832  120.614 10.731  1.00 125.68 ?  685  VAL A CG1    1 
ATOM   4830  C  CG2    . VAL A  1 625  ? 65.594  121.553 12.934  1.00 127.73 ?  685  VAL A CG2    1 
ATOM   4831  N  N      . ALA A  1 626  ? 65.482  117.492 10.696  1.00 117.63 ?  686  ALA A N      1 
ATOM   4832  C  CA     . ALA A  1 626  ? 65.518  116.698 9.467   1.00 116.64 ?  686  ALA A CA     1 
ATOM   4833  C  C      . ALA A  1 626  ? 64.606  117.430 8.488   1.00 119.53 ?  686  ALA A C      1 
ATOM   4834  O  O      . ALA A  1 626  ? 63.413  117.518 8.719   1.00 117.46 ?  686  ALA A O      1 
ATOM   4835  C  CB     . ALA A  1 626  ? 65.053  115.270 9.701   1.00 115.98 ?  686  ALA A CB     1 
ATOM   4836  N  N      . ILE A  1 627  ? 65.173  118.054 7.455   1.00 117.75 ?  687  ILE A N      1 
ATOM   4837  C  CA     . ILE A  1 627  ? 64.389  118.864 6.513   1.00 116.54 ?  687  ILE A CA     1 
ATOM   4838  C  C      . ILE A  1 627  ? 63.532  118.035 5.568   1.00 118.76 ?  687  ILE A C      1 
ATOM   4839  O  O      . ILE A  1 627  ? 62.645  118.585 4.910   1.00 117.46 ?  687  ILE A O      1 
ATOM   4840  C  CB     . ILE A  1 627  ? 65.270  119.880 5.740   1.00 120.23 ?  687  ILE A CB     1 
ATOM   4841  C  CG1    . ILE A  1 627  ? 66.333  119.193 4.848   1.00 119.82 ?  687  ILE A CG1    1 
ATOM   4842  C  CG2    . ILE A  1 627  ? 65.890  120.882 6.706   1.00 122.01 ?  687  ILE A CG2    1 
ATOM   4843  C  CD1    . ILE A  1 627  ? 66.904  120.083 3.806   1.00 119.88 ?  687  ILE A CD1    1 
ATOM   4844  N  N      . GLY A  1 628  ? 63.802  116.745 5.488   1.00 115.16 ?  688  GLY A N      1 
ATOM   4845  C  CA     . GLY A  1 628  ? 63.035  115.891 4.603   1.00 114.41 ?  688  GLY A CA     1 
ATOM   4846  C  C      . GLY A  1 628  ? 63.731  115.623 3.291   1.00 119.04 ?  688  GLY A C      1 
ATOM   4847  O  O      . GLY A  1 628  ? 64.694  116.299 2.943   1.00 117.44 ?  688  GLY A O      1 
ATOM   4848  N  N      . GLY A  1 629  ? 63.230  114.639 2.566   1.00 118.48 ?  689  GLY A N      1 
ATOM   4849  C  CA     . GLY A  1 629  ? 63.854  114.192 1.324   1.00 120.63 ?  689  GLY A CA     1 
ATOM   4850  C  C      . GLY A  1 629  ? 63.324  114.726 0.015   1.00 126.97 ?  689  GLY A C      1 
ATOM   4851  O  O      . GLY A  1 629  ? 63.841  114.373 -1.052  1.00 127.71 ?  689  GLY A O      1 
ATOM   4852  N  N      . ASP A  1 630  ? 62.326  115.601 0.082   1.00 123.63 ?  690  ASP A N      1 
ATOM   4853  C  CA     . ASP A  1 630  ? 61.647  116.070 -1.124  1.00 123.20 ?  690  ASP A CA     1 
ATOM   4854  C  C      . ASP A  1 630  ? 62.416  117.131 -1.881  1.00 122.70 ?  690  ASP A C      1 
ATOM   4855  O  O      . ASP A  1 630  ? 63.300  117.770 -1.321  1.00 123.32 ?  690  ASP A O      1 
ATOM   4856  C  CB     . ASP A  1 630  ? 60.203  116.517 -0.813  1.00 124.94 ?  690  ASP A CB     1 
ATOM   4857  C  CG     . ASP A  1 630  ? 59.212  115.371 -0.530  1.00 138.60 ?  690  ASP A CG     1 
ATOM   4858  O  OD1    . ASP A  1 630  ? 59.619  114.167 -0.644  1.00 138.62 ?  690  ASP A OD1    1 
ATOM   4859  O  OD2    . ASP A  1 630  ? 58.020  115.670 -0.238  1.00 144.48 -1 690  ASP A OD2    1 
ATOM   4860  N  N      . ARG A  1 631  ? 62.078  117.315 -3.165  1.00 115.68 ?  691  ARG A N      1 
ATOM   4861  C  CA     . ARG A  1 631  ? 62.805  118.262 -4.003  1.00 115.84 ?  691  ARG A CA     1 
ATOM   4862  C  C      . ARG A  1 631  ? 62.761  119.658 -3.464  1.00 118.60 ?  691  ARG A C      1 
ATOM   4863  O  O      . ARG A  1 631  ? 63.764  120.361 -3.526  1.00 118.60 ?  691  ARG A O      1 
ATOM   4864  C  CB     . ARG A  1 631  ? 62.317  118.228 -5.442  1.00 116.18 ?  691  ARG A CB     1 
ATOM   4865  C  CG     . ARG A  1 631  ? 63.192  119.028 -6.435  1.00 126.90 ?  691  ARG A CG     1 
ATOM   4866  C  CD     . ARG A  1 631  ? 62.890  118.611 -7.868  1.00 148.54 ?  691  ARG A CD     1 
ATOM   4867  N  NE     . ARG A  1 631  ? 62.879  119.712 -8.841  1.00 166.59 ?  691  ARG A NE     1 
ATOM   4868  C  CZ     . ARG A  1 631  ? 62.341  119.632 -10.062 1.00 189.45 ?  691  ARG A CZ     1 
ATOM   4869  N  NH1    . ARG A  1 631  ? 61.727  118.519 -10.458 1.00 178.59 1  691  ARG A NH1    1 
ATOM   4870  N  NH2    . ARG A  1 631  ? 62.387  120.672 -10.884 1.00 179.43 ?  691  ARG A NH2    1 
ATOM   4871  N  N      . TYR A  1 632  ? 61.608  120.057 -2.934  1.00 115.34 ?  692  TYR A N      1 
ATOM   4872  C  CA     . TYR A  1 632  ? 61.431  121.380 -2.357  1.00 116.29 ?  692  TYR A CA     1 
ATOM   4873  C  C      . TYR A  1 632  ? 61.125  121.262 -0.879  1.00 120.94 ?  692  TYR A C      1 
ATOM   4874  O  O      . TYR A  1 632  ? 59.953  121.225 -0.513  1.00 120.47 ?  692  TYR A O      1 
ATOM   4875  C  CB     . TYR A  1 632  ? 60.326  122.164 -3.079  1.00 117.54 ?  692  TYR A CB     1 
ATOM   4876  C  CG     . TYR A  1 632  ? 60.464  122.153 -4.579  1.00 120.14 ?  692  TYR A CG     1 
ATOM   4877  C  CD1    . TYR A  1 632  ? 61.642  122.573 -5.194  1.00 123.38 ?  692  TYR A CD1    1 
ATOM   4878  C  CD2    . TYR A  1 632  ? 59.435  121.695 -5.385  1.00 120.93 ?  692  TYR A CD2    1 
ATOM   4879  C  CE1    . TYR A  1 632  ? 61.792  122.523 -6.575  1.00 124.93 ?  692  TYR A CE1    1 
ATOM   4880  C  CE2    . TYR A  1 632  ? 59.562  121.667 -6.770  1.00 123.53 ?  692  TYR A CE2    1 
ATOM   4881  C  CZ     . TYR A  1 632  ? 60.743  122.080 -7.359  1.00 133.47 ?  692  TYR A CZ     1 
ATOM   4882  O  OH     . TYR A  1 632  ? 60.863  122.032 -8.723  1.00 138.69 ?  692  TYR A OH     1 
ATOM   4883  N  N      . PRO A  1 633  ? 62.129  121.196 0.009   1.00 117.80 ?  693  PRO A N      1 
ATOM   4884  C  CA     . PRO A  1 633  ? 61.817  121.115 1.443   1.00 117.59 ?  693  PRO A CA     1 
ATOM   4885  C  C      . PRO A  1 633  ? 61.169  122.418 1.921   1.00 125.29 ?  693  PRO A C      1 
ATOM   4886  O  O      . PRO A  1 633  ? 61.536  123.478 1.420   1.00 127.75 ?  693  PRO A O      1 
ATOM   4887  C  CB     . PRO A  1 633  ? 63.190  120.923 2.078   1.00 119.83 ?  693  PRO A CB     1 
ATOM   4888  C  CG     . PRO A  1 633  ? 64.076  120.438 0.951   1.00 124.18 ?  693  PRO A CG     1 
ATOM   4889  C  CD     . PRO A  1 633  ? 63.583  121.207 -0.214  1.00 120.11 ?  693  PRO A CD     1 
ATOM   4890  N  N      . GLY A  1 634  ? 60.204  122.338 2.843   1.00 120.99 ?  694  GLY A N      1 
ATOM   4891  C  CA     . GLY A  1 634  ? 59.491  123.507 3.367   1.00 121.56 ?  694  GLY A CA     1 
ATOM   4892  C  C      . GLY A  1 634  ? 60.438  124.528 3.968   1.00 128.43 ?  694  GLY A C      1 
ATOM   4893  O  O      . GLY A  1 634  ? 60.242  125.742 3.845   1.00 130.23 ?  694  GLY A O      1 
ATOM   4894  N  N      . SER A  1 635  ? 61.494  124.032 4.610   1.00 124.58 ?  695  SER A N      1 
ATOM   4895  C  CA     . SER A  1 635  ? 62.575  124.857 5.130   1.00 125.24 ?  695  SER A CA     1 
ATOM   4896  C  C      . SER A  1 635  ? 63.846  124.181 4.712   1.00 128.25 ?  695  SER A C      1 
ATOM   4897  O  O      . SER A  1 635  ? 63.931  122.945 4.753   1.00 127.85 ?  695  SER A O      1 
ATOM   4898  C  CB     . SER A  1 635  ? 62.504  125.014 6.638   1.00 128.91 ?  695  SER A CB     1 
ATOM   4899  O  OG     . SER A  1 635  ? 62.434  123.756 7.291   1.00 137.93 ?  695  SER A OG     1 
ATOM   4900  N  N      . THR A  1 636  ? 64.817  124.981 4.274   1.00 124.62 ?  696  THR A N      1 
ATOM   4901  C  CA     . THR A  1 636  ? 66.061  124.498 3.691   1.00 124.64 ?  696  THR A CA     1 
ATOM   4902  C  C      . THR A  1 636  ? 67.207  124.397 4.668   1.00 130.68 ?  696  THR A C      1 
ATOM   4903  O  O      . THR A  1 636  ? 67.103  124.871 5.807   1.00 131.02 ?  696  THR A O      1 
ATOM   4904  C  CB     . THR A  1 636  ? 66.461  125.451 2.584   1.00 131.22 ?  696  THR A CB     1 
ATOM   4905  O  OG1    . THR A  1 636  ? 66.797  126.708 3.173   1.00 129.76 ?  696  THR A OG1    1 
ATOM   4906  C  CG2    . THR A  1 636  ? 65.383  125.628 1.536   1.00 131.41 ?  696  THR A CG2    1 
ATOM   4907  N  N      . PHE A  1 637  ? 68.336  123.828 4.197   1.00 128.62 ?  697  PHE A N      1 
ATOM   4908  C  CA     . PHE A  1 637  ? 69.564  123.772 4.984   1.00 130.34 ?  697  PHE A CA     1 
ATOM   4909  C  C      . PHE A  1 637  ? 69.945  125.187 5.437   1.00 137.89 ?  697  PHE A C      1 
ATOM   4910  O  O      . PHE A  1 637  ? 70.172  125.414 6.630   1.00 138.51 ?  697  PHE A O      1 
ATOM   4911  C  CB     . PHE A  1 637  ? 70.722  123.153 4.181   1.00 132.65 ?  697  PHE A CB     1 
ATOM   4912  C  CG     . PHE A  1 637  ? 70.699  121.650 4.039   1.00 132.68 ?  697  PHE A CG     1 
ATOM   4913  C  CD1    . PHE A  1 637  ? 70.496  120.831 5.140   1.00 135.60 ?  697  PHE A CD1    1 
ATOM   4914  C  CD2    . PHE A  1 637  ? 70.936  121.050 2.815   1.00 134.51 ?  697  PHE A CD2    1 
ATOM   4915  C  CE1    . PHE A  1 637  ? 70.462  119.437 5.002   1.00 135.72 ?  697  PHE A CE1    1 
ATOM   4916  C  CE2    . PHE A  1 637  ? 70.929  119.659 2.683   1.00 136.64 ?  697  PHE A CE2    1 
ATOM   4917  C  CZ     . PHE A  1 637  ? 70.675  118.861 3.775   1.00 134.26 ?  697  PHE A CZ     1 
ATOM   4918  N  N      . MET A  1 638  ? 69.953  126.145 4.506   1.00 135.88 ?  698  MET A N      1 
ATOM   4919  C  CA     . MET A  1 638  ? 70.326  127.499 4.861   1.00 138.67 ?  698  MET A CA     1 
ATOM   4920  C  C      . MET A  1 638  ? 69.402  128.135 5.873   1.00 142.59 ?  698  MET A C      1 
ATOM   4921  O  O      . MET A  1 638  ? 69.868  128.846 6.761   1.00 144.07 ?  698  MET A O      1 
ATOM   4922  C  CB     . MET A  1 638  ? 70.433  128.354 3.619   1.00 142.95 ?  698  MET A CB     1 
ATOM   4923  C  CG     . MET A  1 638  ? 71.110  129.662 3.879   1.00 151.04 ?  698  MET A CG     1 
ATOM   4924  S  SD     . MET A  1 638  ? 72.807  129.449 4.480   1.00 159.34 ?  698  MET A SD     1 
ATOM   4925  C  CE     . MET A  1 638  ? 73.353  131.190 4.523   1.00 159.64 ?  698  MET A CE     1 
ATOM   4926  N  N      . ASP A  1 639  ? 68.099  127.873 5.762   1.00 138.04 ?  699  ASP A N      1 
ATOM   4927  C  CA     . ASP A  1 639  ? 67.129  128.400 6.720   1.00 137.76 ?  699  ASP A CA     1 
ATOM   4928  C  C      . ASP A  1 639  ? 67.534  128.052 8.149   1.00 139.09 ?  699  ASP A C      1 
ATOM   4929  O  O      . ASP A  1 639  ? 67.552  128.929 9.014   1.00 139.68 ?  699  ASP A O      1 
ATOM   4930  C  CB     . ASP A  1 639  ? 65.723  127.842 6.422   1.00 138.01 ?  699  ASP A CB     1 
ATOM   4931  C  CG     . ASP A  1 639  ? 65.055  128.428 5.181   1.00 158.82 ?  699  ASP A CG     1 
ATOM   4932  O  OD1    . ASP A  1 639  ? 65.387  129.588 4.805   1.00 165.21 ?  699  ASP A OD1    1 
ATOM   4933  O  OD2    . ASP A  1 639  ? 64.178  127.749 4.602   1.00 162.58 -1 699  ASP A OD2    1 
ATOM   4934  N  N      . HIS A  1 640  ? 67.896  126.782 8.380   1.00 132.26 ?  700  HIS A N      1 
ATOM   4935  C  CA     . HIS A  1 640  ? 68.253  126.303 9.704   1.00 130.85 ?  700  HIS A CA     1 
ATOM   4936  C  C      . HIS A  1 640  ? 69.645  126.675 10.119  1.00 136.42 ?  700  HIS A C      1 
ATOM   4937  O  O      . HIS A  1 640  ? 69.839  127.016 11.280  1.00 136.39 ?  700  HIS A O      1 
ATOM   4938  C  CB     . HIS A  1 640  ? 68.006  124.807 9.820   1.00 128.67 ?  700  HIS A CB     1 
ATOM   4939  C  CG     . HIS A  1 640  ? 66.563  124.488 9.732   1.00 129.19 ?  700  HIS A CG     1 
ATOM   4940  N  ND1    . HIS A  1 640  ? 65.710  124.757 10.775  1.00 130.52 ?  700  HIS A ND1    1 
ATOM   4941  C  CD2    . HIS A  1 640  ? 65.853  123.994 8.701   1.00 129.21 ?  700  HIS A CD2    1 
ATOM   4942  C  CE1    . HIS A  1 640  ? 64.515  124.382 10.367  1.00 128.14 ?  700  HIS A CE1    1 
ATOM   4943  N  NE2    . HIS A  1 640  ? 64.552  123.918 9.122   1.00 127.66 ?  700  HIS A NE2    1 
ATOM   4944  N  N      . VAL A  1 641  ? 70.606  126.651 9.188   1.00 135.18 ?  701  VAL A N      1 
ATOM   4945  C  CA     . VAL A  1 641  ? 71.980  127.071 9.486   1.00 138.43 ?  701  VAL A CA     1 
ATOM   4946  C  C      . VAL A  1 641  ? 71.985  128.531 9.993   1.00 143.25 ?  701  VAL A C      1 
ATOM   4947  O  O      . VAL A  1 641  ? 72.674  128.843 10.972  1.00 144.74 ?  701  VAL A O      1 
ATOM   4948  C  CB     . VAL A  1 641  ? 72.916  126.854 8.279   1.00 143.64 ?  701  VAL A CB     1 
ATOM   4949  C  CG1    . VAL A  1 641  ? 74.259  127.543 8.489   1.00 146.68 ?  701  VAL A CG1    1 
ATOM   4950  C  CG2    . VAL A  1 641  ? 73.129  125.367 8.036   1.00 141.98 ?  701  VAL A CG2    1 
ATOM   4951  N  N      . LEU A  1 642  ? 71.177  129.400 9.368   1.00 137.66 ?  702  LEU A N      1 
ATOM   4952  C  CA     . LEU A  1 642  ? 71.068  130.778 9.824   1.00 138.41 ?  702  LEU A CA     1 
ATOM   4953  C  C      . LEU A  1 642  ? 70.472  130.870 11.226  1.00 140.70 ?  702  LEU A C      1 
ATOM   4954  O  O      . LEU A  1 642  ? 70.981  131.627 12.040  1.00 143.17 ?  702  LEU A O      1 
ATOM   4955  C  CB     . LEU A  1 642  ? 70.279  131.617 8.829   1.00 137.94 ?  702  LEU A CB     1 
ATOM   4956  C  CG     . LEU A  1 642  ? 71.037  131.930 7.547   1.00 142.67 ?  702  LEU A CG     1 
ATOM   4957  C  CD1    . LEU A  1 642  ? 70.138  132.488 6.517   1.00 142.29 ?  702  LEU A CD1    1 
ATOM   4958  C  CD2    . LEU A  1 642  ? 72.107  132.925 7.803   1.00 147.36 ?  702  LEU A CD2    1 
ATOM   4959  N  N      . ARG A  1 643  ? 69.438  130.073 11.534  1.00 133.24 ?  703  ARG A N      1 
ATOM   4960  C  CA     . ARG A  1 643  ? 68.871  130.077 12.881  1.00 132.44 ?  703  ARG A CA     1 
ATOM   4961  C  C      . ARG A  1 643  ? 69.961  129.708 13.882  1.00 138.80 ?  703  ARG A C      1 
ATOM   4962  O  O      . ARG A  1 643  ? 70.094  130.371 14.903  1.00 140.91 ?  703  ARG A O      1 
ATOM   4963  C  CB     . ARG A  1 643  ? 67.732  129.060 13.018  1.00 127.36 ?  703  ARG A CB     1 
ATOM   4964  C  CG     . ARG A  1 643  ? 66.507  129.295 12.168  1.00 128.03 ?  703  ARG A CG     1 
ATOM   4965  C  CD     . ARG A  1 643  ? 65.311  128.493 12.658  1.00 128.44 ?  703  ARG A CD     1 
ATOM   4966  N  NE     . ARG A  1 643  ? 65.582  127.058 12.760  1.00 133.94 ?  703  ARG A NE     1 
ATOM   4967  C  CZ     . ARG A  1 643  ? 65.762  126.410 13.907  1.00 151.13 ?  703  ARG A CZ     1 
ATOM   4968  N  NH1    . ARG A  1 643  ? 65.703  127.062 15.063  1.00 141.38 1  703  ARG A NH1    1 
ATOM   4969  N  NH2    . ARG A  1 643  ? 66.015  125.108 13.906  1.00 139.32 ?  703  ARG A NH2    1 
ATOM   4970  N  N      . TYR A  1 644  ? 70.744  128.658 13.582  1.00 135.49 ?  704  TYR A N      1 
ATOM   4971  C  CA     . TYR A  1 644  ? 71.830  128.178 14.434  1.00 137.46 ?  704  TYR A CA     1 
ATOM   4972  C  C      . TYR A  1 644  ? 72.924  129.222 14.603  1.00 144.24 ?  704  TYR A C      1 
ATOM   4973  O  O      . TYR A  1 644  ? 73.438  129.393 15.709  1.00 146.15 ?  704  TYR A O      1 
ATOM   4974  C  CB     . TYR A  1 644  ? 72.408  126.873 13.890  1.00 138.51 ?  704  TYR A CB     1 
ATOM   4975  C  CG     . TYR A  1 644  ? 71.426  125.721 13.750  1.00 139.37 ?  704  TYR A CG     1 
ATOM   4976  C  CD1    . TYR A  1 644  ? 70.336  125.593 14.611  1.00 140.60 ?  704  TYR A CD1    1 
ATOM   4977  C  CD2    . TYR A  1 644  ? 71.640  124.707 12.819  1.00 138.87 ?  704  TYR A CD2    1 
ATOM   4978  C  CE1    . TYR A  1 644  ? 69.465  124.501 14.525  1.00 138.58 ?  704  TYR A CE1    1 
ATOM   4979  C  CE2    . TYR A  1 644  ? 70.777  123.612 12.727  1.00 137.04 ?  704  TYR A CE2    1 
ATOM   4980  C  CZ     . TYR A  1 644  ? 69.688  123.515 13.579  1.00 142.35 ?  704  TYR A CZ     1 
ATOM   4981  O  OH     . TYR A  1 644  ? 68.835  122.440 13.491  1.00 138.97 ?  704  TYR A OH     1 
ATOM   4982  N  N      . GLN A  1 645  ? 73.265  129.939 13.527  1.00 141.36 ?  705  GLN A N      1 
ATOM   4983  C  CA     . GLN A  1 645  ? 74.246  131.025 13.593  1.00 145.17 ?  705  GLN A CA     1 
ATOM   4984  C  C      . GLN A  1 645  ? 73.783  132.098 14.594  1.00 152.09 ?  705  GLN A C      1 
ATOM   4985  O  O      . GLN A  1 645  ? 74.584  132.635 15.356  1.00 155.36 ?  705  GLN A O      1 
ATOM   4986  C  CB     . GLN A  1 645  ? 74.453  131.641 12.188  1.00 146.68 ?  705  GLN A CB     1 
ATOM   4987  C  CG     . GLN A  1 645  ? 75.292  132.930 12.141  1.00 152.05 ?  705  GLN A CG     1 
ATOM   4988  C  CD     . GLN A  1 645  ? 76.737  132.752 12.573  1.00 160.54 ?  705  GLN A CD     1 
ATOM   4989  O  OE1    . GLN A  1 645  ? 77.409  131.759 12.260  1.00 151.08 ?  705  GLN A OE1    1 
ATOM   4990  N  NE2    . GLN A  1 645  ? 77.260  133.742 13.268  1.00 151.48 ?  705  GLN A NE2    1 
ATOM   4991  N  N      . ASP A  1 646  ? 72.483  132.348 14.625  1.00 147.13 ?  706  ASP A N      1 
ATOM   4992  C  CA     . ASP A  1 646  ? 71.879  133.377 15.458  1.00 148.79 ?  706  ASP A CA     1 
ATOM   4993  C  C      . ASP A  1 646  ? 71.433  132.907 16.840  1.00 152.00 ?  706  ASP A C      1 
ATOM   4994  O  O      . ASP A  1 646  ? 70.860  133.697 17.602  1.00 151.81 ?  706  ASP A O      1 
ATOM   4995  C  CB     . ASP A  1 646  ? 70.714  134.008 14.702  1.00 149.78 ?  706  ASP A CB     1 
ATOM   4996  C  CG     . ASP A  1 646  ? 71.109  134.686 13.406  1.00 162.20 ?  706  ASP A CG     1 
ATOM   4997  O  OD1    . ASP A  1 646  ? 72.291  135.109 13.284  1.00 164.13 ?  706  ASP A OD1    1 
ATOM   4998  O  OD2    . ASP A  1 646  ? 70.240  134.806 12.513  1.00 168.81 -1 706  ASP A OD2    1 
ATOM   4999  N  N      . THR A  1 647  ? 71.676  131.617 17.151  1.00 147.78 ?  707  THR A N      1 
ATOM   5000  C  CA     . THR A  1 647  ? 71.340  131.006 18.434  1.00 147.25 ?  707  THR A CA     1 
ATOM   5001  C  C      . THR A  1 647  ? 72.616  130.967 19.271  1.00 154.32 ?  707  THR A C      1 
ATOM   5002  O  O      . THR A  1 647  ? 73.503  130.170 18.961  1.00 154.17 ?  707  THR A O      1 
ATOM   5003  C  CB     . THR A  1 647  ? 70.708  129.624 18.236  1.00 150.27 ?  707  THR A CB     1 
ATOM   5004  O  OG1    . THR A  1 647  ? 69.486  129.775 17.505  1.00 145.18 ?  707  THR A OG1    1 
ATOM   5005  C  CG2    . THR A  1 647  ? 70.433  128.929 19.552  1.00 150.94 ?  707  THR A CG2    1 
ATOM   5006  N  N      . PRO A  1 648  ? 72.726  131.811 20.324  1.00 153.14 ?  708  PRO A N      1 
ATOM   5007  C  CA     . PRO A  1 648  ? 73.968  131.857 21.110  1.00 156.58 ?  708  PRO A CA     1 
ATOM   5008  C  C      . PRO A  1 648  ? 74.424  130.532 21.703  1.00 161.28 ?  708  PRO A C      1 
ATOM   5009  O  O      . PRO A  1 648  ? 75.649  130.300 21.725  1.00 164.32 ?  708  PRO A O      1 
ATOM   5010  C  CB     . PRO A  1 648  ? 73.667  132.892 22.197  1.00 160.93 ?  708  PRO A CB     1 
ATOM   5011  C  CG     . PRO A  1 648  ? 72.566  133.699 21.661  1.00 163.87 ?  708  PRO A CG     1 
ATOM   5012  C  CD     . PRO A  1 648  ? 71.752  132.807 20.807  1.00 154.97 ?  708  PRO A CD     1 
ATOM   5013  N  N      . GLY A  1 649  ? 73.461  129.687 22.134  1.00 152.85 ?  709  GLY A N      1 
ATOM   5014  C  CA     . GLY A  1 649  ? 73.728  128.377 22.721  1.00 150.82 ?  709  GLY A CA     1 
ATOM   5015  C  C      . GLY A  1 649  ? 74.449  127.409 21.795  1.00 153.22 ?  709  GLY A C      1 
ATOM   5016  O  O      . GLY A  1 649  ? 75.118  126.478 22.269  1.00 152.58 ?  709  GLY A O      1 
ATOM   5017  N  N      . VAL A  1 650  ? 74.303  127.614 20.458  1.00 148.94 ?  710  VAL A N      1 
ATOM   5018  C  CA     . VAL A  1 650  ? 74.941  126.800 19.418  1.00 147.73 ?  710  VAL A CA     1 
ATOM   5019  C  C      . VAL A  1 650  ? 76.344  127.297 19.217  1.00 155.01 ?  710  VAL A C      1 
ATOM   5020  O  O      . VAL A  1 650  ? 76.534  128.480 18.937  1.00 156.97 ?  710  VAL A O      1 
ATOM   5021  C  CB     . VAL A  1 650  ? 74.151  126.840 18.087  1.00 149.23 ?  710  VAL A CB     1 
ATOM   5022  C  CG1    . VAL A  1 650  ? 74.915  126.130 16.974  1.00 148.91 ?  710  VAL A CG1    1 
ATOM   5023  C  CG2    . VAL A  1 650  ? 72.764  126.235 18.249  1.00 145.53 ?  710  VAL A CG2    1 
ATOM   5024  N  N      . LYS A  1 651  ? 77.326  126.398 19.318  1.00 152.84 ?  711  LYS A N      1 
ATOM   5025  C  CA     . LYS A  1 651  ? 78.733  126.778 19.145  1.00 156.43 ?  711  LYS A CA     1 
ATOM   5026  C  C      . LYS A  1 651  ? 79.362  126.200 17.882  1.00 161.30 ?  711  LYS A C      1 
ATOM   5027  O  O      . LYS A  1 651  ? 80.360  126.742 17.399  1.00 163.24 ?  711  LYS A O      1 
ATOM   5028  C  CB     . LYS A  1 651  ? 79.553  126.440 20.391  1.00 160.11 ?  711  LYS A CB     1 
ATOM   5029  C  CG     . LYS A  1 651  ? 78.947  126.946 21.703  1.00 153.75 ?  711  LYS A CG     1 
ATOM   5030  C  CD     . LYS A  1 651  ? 78.962  128.460 21.818  1.00 160.23 ?  711  LYS A CD     1 
ATOM   5031  C  CE     . LYS A  1 651  ? 78.637  128.935 23.210  1.00 182.14 ?  711  LYS A CE     1 
ATOM   5032  N  NZ     . LYS A  1 651  ? 77.195  128.799 23.527  1.00 198.50 1  711  LYS A NZ     1 
ATOM   5033  N  N      . MET A  1 652  ? 78.770  125.116 17.343  1.00 155.07 ?  712  MET A N      1 
ATOM   5034  C  CA     . MET A  1 652  ? 79.207  124.486 16.099  1.00 153.88 ?  712  MET A CA     1 
ATOM   5035  C  C      . MET A  1 652  ? 78.021  123.859 15.392  1.00 150.23 ?  712  MET A C      1 
ATOM   5036  O  O      . MET A  1 652  ? 77.048  123.484 16.047  1.00 147.67 ?  712  MET A O      1 
ATOM   5037  C  CB     . MET A  1 652  ? 80.365  123.494 16.311  1.00 158.52 ?  712  MET A CB     1 
ATOM   5038  C  CG     . MET A  1 652  ? 80.001  122.274 17.127  1.00 161.30 ?  712  MET A CG     1 
ATOM   5039  S  SD     . MET A  1 652  ? 81.399  121.145 17.345  1.00 168.38 ?  712  MET A SD     1 
ATOM   5040  C  CE     . MET A  1 652  ? 81.330  120.216 15.799  1.00 162.47 ?  712  MET A CE     1 
ATOM   5041  N  N      . ILE A  1 653  ? 78.090  123.783 14.062  1.00 143.44 ?  713  ILE A N      1 
ATOM   5042  C  CA     . ILE A  1 653  ? 77.004  123.287 13.229  1.00 139.14 ?  713  ILE A CA     1 
ATOM   5043  C  C      . ILE A  1 653  ? 77.449  122.091 12.388  1.00 143.57 ?  713  ILE A C      1 
ATOM   5044  O  O      . ILE A  1 653  ? 78.529  122.127 11.800  1.00 146.40 ?  713  ILE A O      1 
ATOM   5045  C  CB     . ILE A  1 653  ? 76.416  124.445 12.352  1.00 140.92 ?  713  ILE A CB     1 
ATOM   5046  C  CG1    . ILE A  1 653  ? 75.874  125.585 13.222  1.00 141.69 ?  713  ILE A CG1    1 
ATOM   5047  C  CG2    . ILE A  1 653  ? 75.327  123.944 11.378  1.00 138.04 ?  713  ILE A CG2    1 
ATOM   5048  C  CD1    . ILE A  1 653  ? 75.793  126.887 12.536  1.00 149.75 ?  713  ILE A CD1    1 
ATOM   5049  N  N      . VAL A  1 654  ? 76.603  121.041 12.321  1.00 136.14 ?  714  VAL A N      1 
ATOM   5050  C  CA     . VAL A  1 654  ? 76.834  119.853 11.501  1.00 134.19 ?  714  VAL A CA     1 
ATOM   5051  C  C      . VAL A  1 654  ? 75.739  119.789 10.423  1.00 135.68 ?  714  VAL A C      1 
ATOM   5052  O  O      . VAL A  1 654  ? 74.555  119.904 10.744  1.00 133.55 ?  714  VAL A O      1 
ATOM   5053  C  CB     . VAL A  1 654  ? 76.912  118.555 12.344  1.00 136.86 ?  714  VAL A CB     1 
ATOM   5054  C  CG1    . VAL A  1 654  ? 77.111  117.328 11.449  1.00 136.14 ?  714  VAL A CG1    1 
ATOM   5055  C  CG2    . VAL A  1 654  ? 78.016  118.637 13.389  1.00 139.14 ?  714  VAL A CG2    1 
ATOM   5056  N  N      . VAL A  1 655  ? 76.139  119.623 9.147   1.00 131.70 ?  715  VAL A N      1 
ATOM   5057  C  CA     . VAL A  1 655  ? 75.214  119.532 8.019   1.00 128.65 ?  715  VAL A CA     1 
ATOM   5058  C  C      . VAL A  1 655  ? 75.456  118.227 7.287   1.00 131.45 ?  715  VAL A C      1 
ATOM   5059  O  O      . VAL A  1 655  ? 76.563  117.973 6.830   1.00 132.06 ?  715  VAL A O      1 
ATOM   5060  C  CB     . VAL A  1 655  ? 75.323  120.738 7.052   1.00 132.83 ?  715  VAL A CB     1 
ATOM   5061  C  CG1    . VAL A  1 655  ? 74.339  120.589 5.894   1.00 130.65 ?  715  VAL A CG1    1 
ATOM   5062  C  CG2    . VAL A  1 655  ? 75.118  122.074 7.777   1.00 133.29 ?  715  VAL A CG2    1 
ATOM   5063  N  N      . LEU A  1 656  ? 74.451  117.383 7.215   1.00 127.32 ?  716  LEU A N      1 
ATOM   5064  C  CA     . LEU A  1 656  ? 74.559  116.163 6.438   1.00 127.90 ?  716  LEU A CA     1 
ATOM   5065  C  C      . LEU A  1 656  ? 73.801  116.444 5.146   1.00 133.15 ?  716  LEU A C      1 
ATOM   5066  O  O      . LEU A  1 656  ? 72.569  116.380 5.107   1.00 131.60 ?  716  LEU A O      1 
ATOM   5067  C  CB     . LEU A  1 656  ? 74.022  114.917 7.178   1.00 126.64 ?  716  LEU A CB     1 
ATOM   5068  C  CG     . LEU A  1 656  ? 74.285  113.566 6.494   1.00 131.34 ?  716  LEU A CG     1 
ATOM   5069  C  CD1    . LEU A  1 656  ? 75.788  113.219 6.463   1.00 133.78 ?  716  LEU A CD1    1 
ATOM   5070  C  CD2    . LEU A  1 656  ? 73.483  112.471 7.152   1.00 132.73 ?  716  LEU A CD2    1 
ATOM   5071  N  N      . GLY A  1 657  ? 74.560  116.812 4.121   1.00 132.18 ?  717  GLY A N      1 
ATOM   5072  C  CA     . GLY A  1 657  ? 74.041  117.143 2.804   1.00 131.85 ?  717  GLY A CA     1 
ATOM   5073  C  C      . GLY A  1 657  ? 73.779  115.936 1.930   1.00 135.85 ?  717  GLY A C      1 
ATOM   5074  O  O      . GLY A  1 657  ? 73.916  114.786 2.363   1.00 134.00 ?  717  GLY A O      1 
ATOM   5075  N  N      . GLU A  1 658  ? 73.424  116.198 0.674   1.00 134.89 ?  718  GLU A N      1 
ATOM   5076  C  CA     . GLU A  1 658  ? 73.044  115.134 -0.233  1.00 135.57 ?  718  GLU A CA     1 
ATOM   5077  C  C      . GLU A  1 658  ? 73.113  115.543 -1.688  1.00 141.36 ?  718  GLU A C      1 
ATOM   5078  O  O      . GLU A  1 658  ? 72.816  116.685 -2.019  1.00 141.51 ?  718  GLU A O      1 
ATOM   5079  C  CB     . GLU A  1 658  ? 71.585  114.761 0.091   1.00 134.75 ?  718  GLU A CB     1 
ATOM   5080  C  CG     . GLU A  1 658  ? 71.140  113.409 -0.406  1.00 145.31 ?  718  GLU A CG     1 
ATOM   5081  C  CD     . GLU A  1 658  ? 70.011  112.859 0.424   1.00 173.50 ?  718  GLU A CD     1 
ATOM   5082  O  OE1    . GLU A  1 658  ? 69.146  112.191 -0.182  1.00 176.42 ?  718  GLU A OE1    1 
ATOM   5083  O  OE2    . GLU A  1 658  ? 69.986  113.082 1.661   1.00 171.42 -1 718  GLU A OE2    1 
ATOM   5084  N  N      . ILE A  1 659  ? 73.404  114.577 -2.562  1.00 138.69 ?  719  ILE A N      1 
ATOM   5085  C  CA     . ILE A  1 659  ? 73.323  114.737 -4.005  1.00 139.44 ?  719  ILE A CA     1 
ATOM   5086  C  C      . ILE A  1 659  ? 71.917  115.266 -4.353  1.00 145.08 ?  719  ILE A C      1 
ATOM   5087  O  O      . ILE A  1 659  ? 70.915  114.875 -3.731  1.00 142.38 ?  719  ILE A O      1 
ATOM   5088  C  CB     . ILE A  1 659  ? 73.570  113.372 -4.710  1.00 142.94 ?  719  ILE A CB     1 
ATOM   5089  C  CG1    . ILE A  1 659  ? 73.551  113.520 -6.248  1.00 143.73 ?  719  ILE A CG1    1 
ATOM   5090  C  CG2    . ILE A  1 659  ? 72.569  112.273 -4.228  1.00 142.09 ?  719  ILE A CG2    1 
ATOM   5091  C  CD1    . ILE A  1 659  ? 74.042  112.353 -7.002  1.00 147.13 ?  719  ILE A CD1    1 
ATOM   5092  N  N      . GLY A  1 660  ? 71.867  116.142 -5.347  1.00 145.93 ?  720  GLY A N      1 
ATOM   5093  C  CA     . GLY A  1 660  ? 70.619  116.715 -5.831  1.00 146.20 ?  720  GLY A CA     1 
ATOM   5094  C  C      . GLY A  1 660  ? 70.460  118.154 -5.404  1.00 154.36 ?  720  GLY A C      1 
ATOM   5095  O  O      . GLY A  1 660  ? 70.609  118.479 -4.222  1.00 154.25 ?  720  GLY A O      1 
ATOM   5096  N  N      . GLY A  1 661  ? 70.196  119.028 -6.364  1.00 153.81 ?  721  GLY A N      1 
ATOM   5097  C  CA     . GLY A  1 661  ? 70.043  120.446 -6.060  1.00 154.47 ?  721  GLY A CA     1 
ATOM   5098  C  C      . GLY A  1 661  ? 71.344  121.132 -5.695  1.00 159.94 ?  721  GLY A C      1 
ATOM   5099  O  O      . GLY A  1 661  ? 72.416  120.509 -5.662  1.00 159.94 ?  721  GLY A O      1 
ATOM   5100  N  N      . THR A  1 662  ? 71.233  122.439 -5.409  1.00 156.98 ?  722  THR A N      1 
ATOM   5101  C  CA     . THR A  1 662  ? 72.369  123.314 -5.141  1.00 158.29 ?  722  THR A CA     1 
ATOM   5102  C  C      . THR A  1 662  ? 72.240  124.054 -3.823  1.00 158.19 ?  722  THR A C      1 
ATOM   5103  O  O      . THR A  1 662  ? 72.853  125.110 -3.646  1.00 157.73 ?  722  THR A O      1 
ATOM   5104  C  CB     . THR A  1 662  ? 72.502  124.319 -6.301  1.00 174.39 ?  722  THR A CB     1 
ATOM   5105  O  OG1    . THR A  1 662  ? 71.272  125.051 -6.432  1.00 173.62 ?  722  THR A OG1    1 
ATOM   5106  C  CG2    . THR A  1 662  ? 72.902  123.646 -7.632  1.00 175.70 ?  722  THR A CG2    1 
ATOM   5107  N  N      . GLU A  1 663  ? 71.471  123.499 -2.892  1.00 152.61 ?  723  GLU A N      1 
ATOM   5108  C  CA     . GLU A  1 663  ? 71.222  124.141 -1.613  1.00 152.17 ?  723  GLU A CA     1 
ATOM   5109  C  C      . GLU A  1 663  ? 72.491  124.430 -0.811  1.00 156.16 ?  723  GLU A C      1 
ATOM   5110  O  O      . GLU A  1 663  ? 72.647  125.530 -0.277  1.00 157.67 ?  723  GLU A O      1 
ATOM   5111  C  CB     . GLU A  1 663  ? 70.220  123.323 -0.785  1.00 151.57 ?  723  GLU A CB     1 
ATOM   5112  C  CG     . GLU A  1 663  ? 69.921  123.925 0.583   1.00 168.75 ?  723  GLU A CG     1 
ATOM   5113  C  CD     . GLU A  1 663  ? 69.247  125.286 0.586   1.00 194.29 ?  723  GLU A CD     1 
ATOM   5114  O  OE1    . GLU A  1 663  ? 68.476  125.575 -0.365  1.00 172.01 ?  723  GLU A OE1    1 
ATOM   5115  O  OE2    . GLU A  1 663  ? 69.444  126.034 1.577   1.00 193.38 -1 723  GLU A OE2    1 
ATOM   5116  N  N      . GLU A  1 664  ? 73.388  123.451 -0.722  1.00 151.12 ?  724  GLU A N      1 
ATOM   5117  C  CA     . GLU A  1 664  ? 74.609  123.546 0.086   1.00 151.93 ?  724  GLU A CA     1 
ATOM   5118  C  C      . GLU A  1 664  ? 75.520  124.677 -0.298  1.00 154.97 ?  724  GLU A C      1 
ATOM   5119  O  O      . GLU A  1 664  ? 76.317  125.114 0.534   1.00 155.19 ?  724  GLU A O      1 
ATOM   5120  C  CB     . GLU A  1 664  ? 75.385  122.221 0.088   1.00 153.80 ?  724  GLU A CB     1 
ATOM   5121  C  CG     . GLU A  1 664  ? 74.633  121.053 0.714   1.00 162.06 ?  724  GLU A CG     1 
ATOM   5122  C  CD     . GLU A  1 664  ? 73.632  120.313 -0.165  1.00 176.57 ?  724  GLU A CD     1 
ATOM   5123  O  OE1    . GLU A  1 664  ? 73.270  120.814 -1.254  1.00 159.39 ?  724  GLU A OE1    1 
ATOM   5124  O  OE2    . GLU A  1 664  ? 73.183  119.227 0.263   1.00 172.90 -1 724  GLU A OE2    1 
ATOM   5125  N  N      . TYR A  1 665  ? 75.413  125.152 -1.551  1.00 150.36 ?  725  TYR A N      1 
ATOM   5126  C  CA     . TYR A  1 665  ? 76.223  126.266 -2.023  1.00 151.54 ?  725  TYR A CA     1 
ATOM   5127  C  C      . TYR A  1 665  ? 75.860  127.558 -1.317  1.00 153.32 ?  725  TYR A C      1 
ATOM   5128  O  O      . TYR A  1 665  ? 76.702  128.457 -1.243  1.00 155.86 ?  725  TYR A O      1 
ATOM   5129  C  CB     . TYR A  1 665  ? 76.127  126.422 -3.531  1.00 152.92 ?  725  TYR A CB     1 
ATOM   5130  C  CG     . TYR A  1 665  ? 76.758  125.285 -4.298  1.00 154.29 ?  725  TYR A CG     1 
ATOM   5131  C  CD1    . TYR A  1 665  ? 78.130  125.247 -4.524  1.00 158.59 ?  725  TYR A CD1    1 
ATOM   5132  C  CD2    . TYR A  1 665  ? 75.979  124.273 -4.844  1.00 153.03 ?  725  TYR A CD2    1 
ATOM   5133  C  CE1    . TYR A  1 665  ? 78.710  124.232 -5.283  1.00 160.56 ?  725  TYR A CE1    1 
ATOM   5134  C  CE2    . TYR A  1 665  ? 76.547  123.252 -5.601  1.00 154.69 ?  725  TYR A CE2    1 
ATOM   5135  C  CZ     . TYR A  1 665  ? 77.917  123.227 -5.811  1.00 167.03 ?  725  TYR A CZ     1 
ATOM   5136  O  OH     . TYR A  1 665  ? 78.497  122.222 -6.553  1.00 171.32 ?  725  TYR A OH     1 
ATOM   5137  N  N      . LYS A  1 666  ? 74.637  127.648 -0.762  1.00 144.76 ?  726  LYS A N      1 
ATOM   5138  C  CA     . LYS A  1 666  ? 74.226  128.827 0.011   1.00 143.76 ?  726  LYS A CA     1 
ATOM   5139  C  C      . LYS A  1 666  ? 75.069  128.975 1.291   1.00 146.96 ?  726  LYS A C      1 
ATOM   5140  O  O      . LYS A  1 666  ? 75.268  130.099 1.785   1.00 145.52 ?  726  LYS A O      1 
ATOM   5141  C  CB     . LYS A  1 666  ? 72.745  128.753 0.360   1.00 142.57 ?  726  LYS A CB     1 
ATOM   5142  C  CG     . LYS A  1 666  ? 71.843  128.835 -0.854  1.00 140.43 ?  726  LYS A CG     1 
ATOM   5143  C  CD     . LYS A  1 666  ? 70.369  128.764 -0.468  1.00 135.89 ?  726  LYS A CD     1 
ATOM   5144  C  CE     . LYS A  1 666  ? 69.491  128.600 -1.689  1.00 133.76 ?  726  LYS A CE     1 
ATOM   5145  N  NZ     . LYS A  1 666  ? 68.115  128.127 -1.361  1.00 131.75 1  726  LYS A NZ     1 
ATOM   5146  N  N      . ILE A  1 667  ? 75.559  127.831 1.819   1.00 144.10 ?  727  ILE A N      1 
ATOM   5147  C  CA     . ILE A  1 667  ? 76.436  127.823 2.980   1.00 145.63 ?  727  ILE A CA     1 
ATOM   5148  C  C      . ILE A  1 667  ? 77.761  128.472 2.591   1.00 155.74 ?  727  ILE A C      1 
ATOM   5149  O  O      . ILE A  1 667  ? 78.268  129.306 3.336   1.00 157.41 ?  727  ILE A O      1 
ATOM   5150  C  CB     . ILE A  1 667  ? 76.635  126.395 3.540   1.00 146.40 ?  727  ILE A CB     1 
ATOM   5151  C  CG1    . ILE A  1 667  ? 75.318  125.808 4.008   1.00 142.68 ?  727  ILE A CG1    1 
ATOM   5152  C  CG2    . ILE A  1 667  ? 77.704  126.369 4.662   1.00 149.77 ?  727  ILE A CG2    1 
ATOM   5153  C  CD1    . ILE A  1 667  ? 75.423  124.322 4.345   1.00 147.21 ?  727  ILE A CD1    1 
ATOM   5154  N  N      . CYS A  1 668  ? 78.313  128.099 1.426   1.00 155.34 ?  728  CYS A N      1 
ATOM   5155  C  CA     . CYS A  1 668  ? 79.573  128.641 0.922   1.00 159.59 ?  728  CYS A CA     1 
ATOM   5156  C  C      . CYS A  1 668  ? 79.445  130.135 0.798   1.00 165.67 ?  728  CYS A C      1 
ATOM   5157  O  O      . CYS A  1 668  ? 80.336  130.866 1.238   1.00 168.22 ?  728  CYS A O      1 
ATOM   5158  C  CB     . CYS A  1 668  ? 79.948  128.007 -0.414  1.00 160.92 ?  728  CYS A CB     1 
ATOM   5159  S  SG     . CYS A  1 668  ? 80.006  126.189 -0.401  1.00 163.59 ?  728  CYS A SG     1 
ATOM   5160  N  N      . ARG A  1 669  ? 78.314  130.587 0.220   1.00 161.09 ?  729  ARG A N      1 
ATOM   5161  C  CA     . ARG A  1 669  ? 77.984  131.994 0.010   1.00 162.39 ?  729  ARG A CA     1 
ATOM   5162  C  C      . ARG A  1 669  ? 77.911  132.744 1.342   1.00 164.49 ?  729  ARG A C      1 
ATOM   5163  O  O      . ARG A  1 669  ? 78.562  133.778 1.478   1.00 167.37 ?  729  ARG A O      1 
ATOM   5164  C  CB     . ARG A  1 669  ? 76.691  132.113 -0.799  1.00 162.46 ?  729  ARG A CB     1 
ATOM   5165  C  CG     . ARG A  1 669  ? 76.253  133.536 -1.085  1.00 178.06 ?  729  ARG A CG     1 
ATOM   5166  C  CD     . ARG A  1 669  ? 74.889  133.541 -1.733  1.00 188.14 ?  729  ARG A CD     1 
ATOM   5167  N  NE     . ARG A  1 669  ? 74.270  134.866 -1.767  1.00 196.27 ?  729  ARG A NE     1 
ATOM   5168  C  CZ     . ARG A  1 669  ? 72.962  135.085 -1.915  1.00 204.51 ?  729  ARG A CZ     1 
ATOM   5169  N  NH1    . ARG A  1 669  ? 72.490  136.325 -1.941  1.00 188.53 1  729  ARG A NH1    1 
ATOM   5170  N  NH2    . ARG A  1 669  ? 72.115  134.065 -2.019  1.00 186.50 ?  729  ARG A NH2    1 
ATOM   5171  N  N      . GLY A  1 670  ? 77.184  132.185 2.313   1.00 155.35 ?  730  GLY A N      1 
ATOM   5172  C  CA     . GLY A  1 670  ? 77.059  132.766 3.648   1.00 154.13 ?  730  GLY A CA     1 
ATOM   5173  C  C      . GLY A  1 670  ? 78.372  132.930 4.396   1.00 154.91 ?  730  GLY A C      1 
ATOM   5174  O  O      . GLY A  1 670  ? 78.543  133.906 5.125   1.00 155.84 ?  730  GLY A O      1 
ATOM   5175  N  N      . ILE A  1 671  ? 79.300  131.972 4.235   1.00 148.83 ?  731  ILE A N      1 
ATOM   5176  C  CA     . ILE A  1 671  ? 80.623  132.041 4.846   1.00 151.11 ?  731  ILE A CA     1 
ATOM   5177  C  C      . ILE A  1 671  ? 81.408  133.168 4.182   1.00 159.42 ?  731  ILE A C      1 
ATOM   5178  O  O      . ILE A  1 671  ? 81.969  134.013 4.888   1.00 161.92 ?  731  ILE A O      1 
ATOM   5179  C  CB     . ILE A  1 671  ? 81.362  130.686 4.751   1.00 153.20 ?  731  ILE A CB     1 
ATOM   5180  C  CG1    . ILE A  1 671  ? 80.714  129.667 5.672   1.00 150.73 ?  731  ILE A CG1    1 
ATOM   5181  C  CG2    . ILE A  1 671  ? 82.849  130.827 5.087   1.00 157.91 ?  731  ILE A CG2    1 
ATOM   5182  C  CD1    . ILE A  1 671  ? 81.152  128.267 5.429   1.00 155.37 ?  731  ILE A CD1    1 
ATOM   5183  N  N      . LYS A  1 672  ? 81.433  133.180 2.826   1.00 156.20 ?  732  LYS A N      1 
ATOM   5184  C  CA     . LYS A  1 672  ? 82.124  134.184 2.006   1.00 159.13 ?  732  LYS A CA     1 
ATOM   5185  C  C      . LYS A  1 672  ? 81.639  135.596 2.337   1.00 165.88 ?  732  LYS A C      1 
ATOM   5186  O  O      . LYS A  1 672  ? 82.446  136.514 2.420   1.00 168.65 ?  732  LYS A O      1 
ATOM   5187  C  CB     . LYS A  1 672  ? 81.925  133.888 0.514   1.00 159.89 ?  732  LYS A CB     1 
ATOM   5188  C  CG     . LYS A  1 672  ? 82.897  134.642 -0.380  1.00 175.77 ?  732  LYS A CG     1 
ATOM   5189  C  CD     . LYS A  1 672  ? 82.523  134.519 -1.845  1.00 182.88 ?  732  LYS A CD     1 
ATOM   5190  C  CE     . LYS A  1 672  ? 83.452  135.284 -2.748  1.00 186.88 ?  732  LYS A CE     1 
ATOM   5191  N  NZ     . LYS A  1 672  ? 83.061  135.121 -4.173  1.00 188.84 1  732  LYS A NZ     1 
ATOM   5192  N  N      . GLU A  1 673  ? 80.324  135.753 2.560   1.00 161.54 ?  733  GLU A N      1 
ATOM   5193  C  CA     . GLU A  1 673  ? 79.673  137.019 2.920   1.00 162.84 ?  733  GLU A CA     1 
ATOM   5194  C  C      . GLU A  1 673  ? 79.918  137.435 4.368   1.00 168.18 ?  733  GLU A C      1 
ATOM   5195  O  O      . GLU A  1 673  ? 79.618  138.573 4.728   1.00 169.71 ?  733  GLU A O      1 
ATOM   5196  C  CB     . GLU A  1 673  ? 78.166  136.936 2.660   1.00 161.23 ?  733  GLU A CB     1 
ATOM   5197  C  CG     . GLU A  1 673  ? 77.819  136.931 1.183   1.00 172.27 ?  733  GLU A CG     1 
ATOM   5198  C  CD     . GLU A  1 673  ? 76.366  136.697 0.839   1.00 195.11 ?  733  GLU A CD     1 
ATOM   5199  O  OE1    . GLU A  1 673  ? 75.577  136.303 1.730   1.00 191.36 ?  733  GLU A OE1    1 
ATOM   5200  O  OE2    . GLU A  1 673  ? 76.022  136.898 -0.347  1.00 191.87 -1 733  GLU A OE2    1 
ATOM   5201  N  N      . GLY A  1 674  ? 80.438  136.518 5.181   1.00 164.38 ?  734  GLY A N      1 
ATOM   5202  C  CA     . GLY A  1 674  ? 80.733  136.762 6.587   1.00 166.31 ?  734  GLY A CA     1 
ATOM   5203  C  C      . GLY A  1 674  ? 79.527  136.662 7.491   1.00 168.60 ?  734  GLY A C      1 
ATOM   5204  O  O      . GLY A  1 674  ? 79.602  137.032 8.663   1.00 170.76 ?  734  GLY A O      1 
ATOM   5205  N  N      . ARG A  1 675  ? 78.413  136.158 6.965   1.00 161.28 ?  735  ARG A N      1 
ATOM   5206  C  CA     . ARG A  1 675  ? 77.196  135.970 7.743   1.00 158.57 ?  735  ARG A CA     1 
ATOM   5207  C  C      . ARG A  1 675  ? 77.352  134.759 8.657   1.00 161.14 ?  735  ARG A C      1 
ATOM   5208  O  O      . ARG A  1 675  ? 76.924  134.810 9.809   1.00 160.64 ?  735  ARG A O      1 
ATOM   5209  C  CB     . ARG A  1 675  ? 76.001  135.800 6.803   1.00 154.60 ?  735  ARG A CB     1 
ATOM   5210  C  CG     . ARG A  1 675  ? 74.685  135.551 7.493   1.00 157.42 ?  735  ARG A CG     1 
ATOM   5211  C  CD     . ARG A  1 675  ? 74.150  136.753 8.233   1.00 163.14 ?  735  ARG A CD     1 
ATOM   5212  N  NE     . ARG A  1 675  ? 72.758  136.525 8.617   1.00 163.67 ?  735  ARG A NE     1 
ATOM   5213  C  CZ     . ARG A  1 675  ? 72.382  135.965 9.760   1.00 169.07 ?  735  ARG A CZ     1 
ATOM   5214  N  NH1    . ARG A  1 675  ? 73.292  135.574 10.648  1.00 155.61 1  735  ARG A NH1    1 
ATOM   5215  N  NH2    . ARG A  1 675  ? 71.096  135.790 10.025  1.00 146.58 ?  735  ARG A NH2    1 
ATOM   5216  N  N      . LEU A  1 676  ? 77.974  133.685 8.140   1.00 157.35 ?  736  LEU A N      1 
ATOM   5217  C  CA     . LEU A  1 676  ? 78.224  132.450 8.872   1.00 156.41 ?  736  LEU A CA     1 
ATOM   5218  C  C      . LEU A  1 676  ? 79.643  132.478 9.383   1.00 166.41 ?  736  LEU A C      1 
ATOM   5219  O  O      . LEU A  1 676  ? 80.595  132.545 8.591   1.00 168.53 ?  736  LEU A O      1 
ATOM   5220  C  CB     . LEU A  1 676  ? 77.978  131.224 7.987   1.00 153.29 ?  736  LEU A CB     1 
ATOM   5221  C  CG     . LEU A  1 676  ? 76.607  131.134 7.310   1.00 154.64 ?  736  LEU A CG     1 
ATOM   5222  C  CD1    . LEU A  1 676  ? 76.520  129.910 6.436   1.00 151.62 ?  736  LEU A CD1    1 
ATOM   5223  C  CD2    . LEU A  1 676  ? 75.493  131.127 8.329   1.00 156.62 ?  736  LEU A CD2    1 
ATOM   5224  N  N      . THR A  1 677  ? 79.778  132.506 10.717  1.00 165.08 ?  737  THR A N      1 
ATOM   5225  C  CA     . THR A  1 677  ? 81.065  132.608 11.411  1.00 168.54 ?  737  THR A CA     1 
ATOM   5226  C  C      . THR A  1 677  ? 81.376  131.396 12.278  1.00 171.84 ?  737  THR A C      1 
ATOM   5227  O  O      . THR A  1 677  ? 82.546  131.092 12.513  1.00 173.25 ?  737  THR A O      1 
ATOM   5228  C  CB     . THR A  1 677  ? 81.131  133.910 12.213  1.00 177.27 ?  737  THR A CB     1 
ATOM   5229  O  OG1    . THR A  1 677  ? 80.212  133.842 13.299  1.00 173.64 ?  737  THR A OG1    1 
ATOM   5230  C  CG2    . THR A  1 677  ? 80.826  135.137 11.360  1.00 177.28 ?  737  THR A CG2    1 
ATOM   5231  N  N      . LYS A  1 678  ? 80.333  130.717 12.767  1.00 165.97 ?  738  LYS A N      1 
ATOM   5232  C  CA     . LYS A  1 678  ? 80.485  129.521 13.593  1.00 164.95 ?  738  LYS A CA     1 
ATOM   5233  C  C      . LYS A  1 678  ? 81.081  128.381 12.771  1.00 171.74 ?  738  LYS A C      1 
ATOM   5234  O  O      . LYS A  1 678  ? 80.819  128.316 11.565  1.00 171.77 ?  738  LYS A O      1 
ATOM   5235  C  CB     . LYS A  1 678  ? 79.131  129.089 14.184  1.00 161.63 ?  738  LYS A CB     1 
ATOM   5236  C  CG     . LYS A  1 678  ? 78.652  130.040 15.250  1.00 152.14 ?  738  LYS A CG     1 
ATOM   5237  C  CD     . LYS A  1 678  ? 77.317  129.690 15.859  1.00 142.43 ?  738  LYS A CD     1 
ATOM   5238  C  CE     . LYS A  1 678  ? 76.920  130.853 16.738  1.00 144.03 ?  738  LYS A CE     1 
ATOM   5239  N  NZ     . LYS A  1 678  ? 75.624  130.670 17.396  1.00 134.75 1  738  LYS A NZ     1 
ATOM   5240  N  N      . PRO A  1 679  ? 81.880  127.476 13.385  1.00 169.55 ?  739  PRO A N      1 
ATOM   5241  C  CA     . PRO A  1 679  ? 82.415  126.339 12.618  1.00 168.48 ?  739  PRO A CA     1 
ATOM   5242  C  C      . PRO A  1 679  ? 81.298  125.438 12.080  1.00 166.91 ?  739  PRO A C      1 
ATOM   5243  O  O      . PRO A  1 679  ? 80.341  125.123 12.797  1.00 163.49 ?  739  PRO A O      1 
ATOM   5244  C  CB     . PRO A  1 679  ? 83.287  125.597 13.639  1.00 172.45 ?  739  PRO A CB     1 
ATOM   5245  C  CG     . PRO A  1 679  ? 82.763  126.017 14.980  1.00 177.18 ?  739  PRO A CG     1 
ATOM   5246  C  CD     . PRO A  1 679  ? 82.318  127.427 14.796  1.00 173.31 ?  739  PRO A CD     1 
ATOM   5247  N  N      . ILE A  1 680  ? 81.403  125.068 10.798  1.00 162.06 ?  740  ILE A N      1 
ATOM   5248  C  CA     . ILE A  1 680  ? 80.442  124.193 10.137  1.00 157.43 ?  740  ILE A CA     1 
ATOM   5249  C  C      . ILE A  1 680  ? 81.152  122.940 9.648   1.00 162.30 ?  740  ILE A C      1 
ATOM   5250  O  O      . ILE A  1 680  ? 82.163  123.036 8.945   1.00 164.96 ?  740  ILE A O      1 
ATOM   5251  C  CB     . ILE A  1 680  ? 79.684  124.902 8.980   1.00 158.31 ?  740  ILE A CB     1 
ATOM   5252  C  CG1    . ILE A  1 680  ? 78.884  126.119 9.487   1.00 157.79 ?  740  ILE A CG1    1 
ATOM   5253  C  CG2    . ILE A  1 680  ? 78.785  123.911 8.211   1.00 156.21 ?  740  ILE A CG2    1 
ATOM   5254  C  CD1    . ILE A  1 680  ? 78.443  127.098 8.368   1.00 160.09 ?  740  ILE A CD1    1 
ATOM   5255  N  N      . VAL A  1 681  ? 80.620  121.773 10.016  1.00 156.42 ?  741  VAL A N      1 
ATOM   5256  C  CA     . VAL A  1 681  ? 81.095  120.475 9.554   1.00 156.38 ?  741  VAL A CA     1 
ATOM   5257  C  C      . VAL A  1 681  ? 80.045  119.993 8.555   1.00 158.32 ?  741  VAL A C      1 
ATOM   5258  O  O      . VAL A  1 681  ? 78.857  120.032 8.867   1.00 154.80 ?  741  VAL A O      1 
ATOM   5259  C  CB     . VAL A  1 681  ? 81.298  119.463 10.709  1.00 160.60 ?  741  VAL A CB     1 
ATOM   5260  C  CG1    . VAL A  1 681  ? 81.678  118.088 10.174  1.00 160.31 ?  741  VAL A CG1    1 
ATOM   5261  C  CG2    . VAL A  1 681  ? 82.345  119.954 11.697  1.00 164.05 ?  741  VAL A CG2    1 
ATOM   5262  N  N      . CYS A  1 682  ? 80.466  119.578 7.346   1.00 157.10 ?  742  CYS A N      1 
ATOM   5263  C  CA     . CYS A  1 682  ? 79.518  119.103 6.343   1.00 155.39 ?  742  CYS A CA     1 
ATOM   5264  C  C      . CYS A  1 682  ? 80.045  117.940 5.524   1.00 156.76 ?  742  CYS A C      1 
ATOM   5265  O  O      . CYS A  1 682  ? 81.202  117.945 5.101   1.00 157.74 ?  742  CYS A O      1 
ATOM   5266  C  CB     . CYS A  1 682  ? 79.024  120.238 5.444   1.00 156.37 ?  742  CYS A CB     1 
ATOM   5267  S  SG     . CYS A  1 682  ? 77.781  119.733 4.217   1.00 157.91 ?  742  CYS A SG     1 
ATOM   5268  N  N      . TRP A  1 683  ? 79.163  116.962 5.278   1.00 149.42 ?  743  TRP A N      1 
ATOM   5269  C  CA     . TRP A  1 683  ? 79.401  115.836 4.400   1.00 148.68 ?  743  TRP A CA     1 
ATOM   5270  C  C      . TRP A  1 683  ? 78.162  115.628 3.568   1.00 148.57 ?  743  TRP A C      1 
ATOM   5271  O  O      . TRP A  1 683  ? 77.068  115.541 4.121   1.00 144.55 ?  743  TRP A O      1 
ATOM   5272  C  CB     . TRP A  1 683  ? 79.772  114.550 5.152   1.00 148.31 ?  743  TRP A CB     1 
ATOM   5273  C  CG     . TRP A  1 683  ? 79.893  113.369 4.230   1.00 149.70 ?  743  TRP A CG     1 
ATOM   5274  C  CD1    . TRP A  1 683  ? 78.989  112.356 4.073   1.00 150.77 ?  743  TRP A CD1    1 
ATOM   5275  C  CD2    . TRP A  1 683  ? 80.925  113.143 3.255   1.00 151.88 ?  743  TRP A CD2    1 
ATOM   5276  N  NE1    . TRP A  1 683  ? 79.406  111.496 3.081   1.00 151.36 ?  743  TRP A NE1    1 
ATOM   5277  C  CE2    . TRP A  1 683  ? 80.589  111.961 2.555   1.00 155.48 ?  743  TRP A CE2    1 
ATOM   5278  C  CE3    . TRP A  1 683  ? 82.106  113.825 2.906   1.00 155.72 ?  743  TRP A CE3    1 
ATOM   5279  C  CZ2    . TRP A  1 683  ? 81.397  111.442 1.526   1.00 156.88 ?  743  TRP A CZ2    1 
ATOM   5280  C  CZ3    . TRP A  1 683  ? 82.903  113.309 1.892   1.00 159.23 ?  743  TRP A CZ3    1 
ATOM   5281  C  CH2    . TRP A  1 683  ? 82.546  112.136 1.210   1.00 159.28 ?  743  TRP A CH2    1 
ATOM   5282  N  N      . CYS A  1 684  ? 78.328  115.560 2.236   1.00 147.06 ?  744  CYS A N      1 
ATOM   5283  C  CA     . CYS A  1 684  ? 77.234  115.322 1.296   1.00 145.12 ?  744  CYS A CA     1 
ATOM   5284  C  C      . CYS A  1 684  ? 77.276  113.901 0.833   1.00 150.56 ?  744  CYS A C      1 
ATOM   5285  O  O      . CYS A  1 684  ? 78.273  113.450 0.256   1.00 151.48 ?  744  CYS A O      1 
ATOM   5286  C  CB     . CYS A  1 684  ? 77.267  116.286 0.117   1.00 145.78 ?  744  CYS A CB     1 
ATOM   5287  S  SG     . CYS A  1 684  ? 77.015  118.012 0.577   1.00 149.72 ?  744  CYS A SG     1 
ATOM   5288  N  N      . ILE A  1 685  ? 76.186  113.195 1.077   1.00 147.13 ?  745  ILE A N      1 
ATOM   5289  C  CA     . ILE A  1 685  ? 76.066  111.798 0.693   1.00 147.72 ?  745  ILE A CA     1 
ATOM   5290  C  C      . ILE A  1 685  ? 75.692  111.692 -0.794  1.00 153.98 ?  745  ILE A C      1 
ATOM   5291  O  O      . ILE A  1 685  ? 75.084  112.614 -1.348  1.00 152.98 ?  745  ILE A O      1 
ATOM   5292  C  CB     . ILE A  1 685  ? 75.092  111.048 1.646   1.00 148.50 ?  745  ILE A CB     1 
ATOM   5293  C  CG1    . ILE A  1 685  ? 73.625  111.395 1.365   1.00 146.01 ?  745  ILE A CG1    1 
ATOM   5294  C  CG2    . ILE A  1 685  ? 75.462  111.309 3.110   1.00 149.27 ?  745  ILE A CG2    1 
ATOM   5295  C  CD1    . ILE A  1 685  ? 72.596  110.712 2.262   1.00 152.44 ?  745  ILE A CD1    1 
ATOM   5296  N  N      . GLY A  1 686  ? 76.093  110.589 -1.426  1.00 152.91 ?  746  GLY A N      1 
ATOM   5297  C  CA     . GLY A  1 686  ? 75.811  110.323 -2.835  1.00 153.28 ?  746  GLY A CA     1 
ATOM   5298  C  C      . GLY A  1 686  ? 77.004  110.325 -3.768  1.00 159.96 ?  746  GLY A C      1 
ATOM   5299  O  O      . GLY A  1 686  ? 76.842  110.453 -4.986  1.00 160.21 ?  746  GLY A O      1 
ATOM   5300  N  N      . THR A  1 687  ? 78.204  110.167 -3.217  1.00 158.09 ?  747  THR A N      1 
ATOM   5301  C  CA     . THR A  1 687  ? 79.437  110.121 -4.006  1.00 160.45 ?  747  THR A CA     1 
ATOM   5302  C  C      . THR A  1 687  ? 79.470  108.925 -4.998  1.00 165.71 ?  747  THR A C      1 
ATOM   5303  O  O      . THR A  1 687  ? 80.129  109.008 -6.037  1.00 167.08 ?  747  THR A O      1 
ATOM   5304  C  CB     . THR A  1 687  ? 80.641  110.144 -3.072  1.00 165.31 ?  747  THR A CB     1 
ATOM   5305  O  OG1    . THR A  1 687  ? 80.586  108.998 -2.226  1.00 160.55 ?  747  THR A OG1    1 
ATOM   5306  C  CG2    . THR A  1 687  ? 80.710  111.428 -2.230  1.00 161.86 ?  747  THR A CG2    1 
ATOM   5307  N  N      . CYS A  1 688  ? 78.733  107.843 -4.703  1.00 161.16 ?  748  CYS A N      1 
ATOM   5308  C  CA     . CYS A  1 688  ? 78.658  106.667 -5.578  1.00 161.72 ?  748  CYS A CA     1 
ATOM   5309  C  C      . CYS A  1 688  ? 78.089  106.961 -6.962  1.00 163.90 ?  748  CYS A C      1 
ATOM   5310  O  O      . CYS A  1 688  ? 78.471  106.289 -7.932  1.00 164.63 ?  748  CYS A O      1 
ATOM   5311  C  CB     . CYS A  1 688  ? 77.896  105.523 -4.909  1.00 160.93 ?  748  CYS A CB     1 
ATOM   5312  S  SG     . CYS A  1 688  ? 76.144  105.867 -4.545  1.00 160.81 ?  748  CYS A SG     1 
ATOM   5313  N  N      . ALA A  1 689  ? 77.155  107.948 -7.048  1.00 157.33 ?  749  ALA A N      1 
ATOM   5314  C  CA     . ALA A  1 689  ? 76.451  108.288 -8.286  1.00 156.01 ?  749  ALA A CA     1 
ATOM   5315  C  C      . ALA A  1 689  ? 77.379  108.683 -9.381  1.00 162.56 ?  749  ALA A C      1 
ATOM   5316  O  O      . ALA A  1 689  ? 77.081  108.442 -10.547 1.00 162.89 ?  749  ALA A O      1 
ATOM   5317  C  CB     . ALA A  1 689  ? 75.453  109.387 -8.045  1.00 153.97 ?  749  ALA A CB     1 
ATOM   5318  N  N      . THR A  1 690  ? 78.507  109.293 -9.008  1.00 161.49 ?  750  THR A N      1 
ATOM   5319  C  CA     . THR A  1 690  ? 79.549  109.727 -9.927  1.00 164.49 ?  750  THR A CA     1 
ATOM   5320  C  C      . THR A  1 690  ? 80.140  108.521 -10.701 1.00 171.33 ?  750  THR A C      1 
ATOM   5321  O  O      . THR A  1 690  ? 80.536  108.654 -11.868 1.00 172.60 ?  750  THR A O      1 
ATOM   5322  C  CB     . THR A  1 690  ? 80.604  110.522 -9.126  1.00 175.09 ?  750  THR A CB     1 
ATOM   5323  O  OG1    . THR A  1 690  ? 79.983  111.663 -8.517  1.00 171.92 ?  750  THR A OG1    1 
ATOM   5324  C  CG2    . THR A  1 690  ? 81.764  110.986 -9.980  1.00 178.42 ?  750  THR A CG2    1 
ATOM   5325  N  N      . MET A  1 691  ? 80.164  107.352 -10.043 1.00 168.03 ?  751  MET A N      1 
ATOM   5326  C  CA     . MET A  1 691  ? 80.746  106.130 -10.580 1.00 170.38 ?  751  MET A CA     1 
ATOM   5327  C  C      . MET A  1 691  ? 79.790  105.245 -11.356 1.00 171.38 ?  751  MET A C      1 
ATOM   5328  O  O      . MET A  1 691  ? 80.233  104.296 -11.995 1.00 172.99 ?  751  MET A O      1 
ATOM   5329  C  CB     . MET A  1 691  ? 81.394  105.334 -9.454  1.00 174.25 ?  751  MET A CB     1 
ATOM   5330  C  CG     . MET A  1 691  ? 82.536  106.051 -8.791  1.00 179.90 ?  751  MET A CG     1 
ATOM   5331  S  SD     . MET A  1 691  ? 83.004  105.215 -7.279  1.00 185.70 ?  751  MET A SD     1 
ATOM   5332  C  CE     . MET A  1 691  ? 82.040  106.175 -6.059  1.00 178.77 ?  751  MET A CE     1 
ATOM   5333  N  N      . PHE A  1 692  ? 78.496  105.510 -11.279 1.00 164.61 ?  752  PHE A N      1 
ATOM   5334  C  CA     . PHE A  1 692  ? 77.530  104.703 -12.014 1.00 164.38 ?  752  PHE A CA     1 
ATOM   5335  C  C      . PHE A  1 692  ? 77.460  105.106 -13.485 1.00 169.49 ?  752  PHE A C      1 
ATOM   5336  O  O      . PHE A  1 692  ? 77.631  106.288 -13.810 1.00 168.77 ?  752  PHE A O      1 
ATOM   5337  C  CB     . PHE A  1 692  ? 76.149  104.784 -11.378 1.00 163.12 ?  752  PHE A CB     1 
ATOM   5338  C  CG     . PHE A  1 692  ? 76.047  104.318 -9.937  1.00 163.76 ?  752  PHE A CG     1 
ATOM   5339  C  CD1    . PHE A  1 692  ? 76.873  103.309 -9.448  1.00 168.58 ?  752  PHE A CD1    1 
ATOM   5340  C  CD2    . PHE A  1 692  ? 75.075  104.838 -9.091  1.00 163.63 ?  752  PHE A CD2    1 
ATOM   5341  C  CE1    . PHE A  1 692  ? 76.741  102.848 -8.126  1.00 168.34 ?  752  PHE A CE1    1 
ATOM   5342  C  CE2    . PHE A  1 692  ? 74.936  104.368 -7.773  1.00 165.19 ?  752  PHE A CE2    1 
ATOM   5343  C  CZ     . PHE A  1 692  ? 75.774  103.382 -7.300  1.00 164.87 ?  752  PHE A CZ     1 
ATOM   5344  N  N      . SER A  1 693  ? 77.194  104.114 -14.368 1.00 167.32 ?  753  SER A N      1 
ATOM   5345  C  CA     . SER A  1 693  ? 77.120  104.269 -15.830 1.00 168.27 ?  753  SER A CA     1 
ATOM   5346  C  C      . SER A  1 693  ? 75.803  104.876 -16.325 1.00 168.68 ?  753  SER A C      1 
ATOM   5347  O  O      . SER A  1 693  ? 75.788  105.444 -17.418 1.00 168.70 ?  753  SER A O      1 
ATOM   5348  C  CB     . SER A  1 693  ? 77.424  102.956 -16.540 1.00 174.39 ?  753  SER A CB     1 
ATOM   5349  O  OG     . SER A  1 693  ? 76.475  101.961 -16.207 1.00 183.29 ?  753  SER A OG     1 
ATOM   5350  N  N      . SER A  1 694  ? 74.710  104.771 -15.538 1.00 162.21 ?  754  SER A N      1 
ATOM   5351  C  CA     . SER A  1 694  ? 73.416  105.389 -15.868 1.00 159.80 ?  754  SER A CA     1 
ATOM   5352  C  C      . SER A  1 694  ? 72.949  106.236 -14.689 1.00 159.53 ?  754  SER A C      1 
ATOM   5353  O  O      . SER A  1 694  ? 73.489  106.118 -13.579 1.00 158.27 ?  754  SER A O      1 
ATOM   5354  C  CB     . SER A  1 694  ? 72.362  104.344 -16.227 1.00 163.90 ?  754  SER A CB     1 
ATOM   5355  O  OG     . SER A  1 694  ? 72.169  103.541 -15.080 1.00 172.74 ?  754  SER A OG     1 
ATOM   5356  N  N      . GLU A  1 695  ? 71.970  107.114 -14.937 1.00 154.00 ?  755  GLU A N      1 
ATOM   5357  C  CA     . GLU A  1 695  ? 71.399  107.957 -13.890 1.00 151.07 ?  755  GLU A CA     1 
ATOM   5358  C  C      . GLU A  1 695  ? 70.667  107.085 -12.867 1.00 152.18 ?  755  GLU A C      1 
ATOM   5359  O  O      . GLU A  1 695  ? 69.931  106.174 -13.241 1.00 152.66 ?  755  GLU A O      1 
ATOM   5360  C  CB     . GLU A  1 695  ? 70.437  109.010 -14.488 1.00 151.50 ?  755  GLU A CB     1 
ATOM   5361  C  CG     . GLU A  1 695  ? 69.816  109.966 -13.468 1.00 159.80 ?  755  GLU A CG     1 
ATOM   5362  C  CD     . GLU A  1 695  ? 68.754  110.906 -14.018 1.00 180.50 ?  755  GLU A CD     1 
ATOM   5363  O  OE1    . GLU A  1 695  ? 69.113  112.026 -14.454 1.00 178.52 ?  755  GLU A OE1    1 
ATOM   5364  O  OE2    . GLU A  1 695  ? 67.554  110.545 -13.964 1.00 171.74 -1 755  GLU A OE2    1 
ATOM   5365  N  N      . VAL A  1 696  ? 70.845  107.410 -11.577 1.00 144.71 ?  756  VAL A N      1 
ATOM   5366  C  CA     . VAL A  1 696  ? 70.175  106.723 -10.480 1.00 141.01 ?  756  VAL A CA     1 
ATOM   5367  C  C      . VAL A  1 696  ? 69.402  107.695 -9.585  1.00 141.30 ?  756  VAL A C      1 
ATOM   5368  O  O      . VAL A  1 696  ? 69.948  108.688 -9.074  1.00 141.00 ?  756  VAL A O      1 
ATOM   5369  C  CB     . VAL A  1 696  ? 71.119  105.806 -9.672  1.00 144.31 ?  756  VAL A CB     1 
ATOM   5370  C  CG1    . VAL A  1 696  ? 70.401  105.173 -8.472  1.00 142.40 ?  756  VAL A CG1    1 
ATOM   5371  C  CG2    . VAL A  1 696  ? 71.713  104.733 -10.576 1.00 146.24 ?  756  VAL A CG2    1 
ATOM   5372  N  N      . GLN A  1 697  ? 68.116  107.381 -9.407  1.00 133.80 ?  757  GLN A N      1 
ATOM   5373  C  CA     . GLN A  1 697  ? 67.243  108.083 -8.496  1.00 129.63 ?  757  GLN A CA     1 
ATOM   5374  C  C      . GLN A  1 697  ? 67.343  107.298 -7.190  1.00 131.67 ?  757  GLN A C      1 
ATOM   5375  O  O      . GLN A  1 697  ? 67.031  106.104 -7.126  1.00 128.59 ?  757  GLN A O      1 
ATOM   5376  C  CB     . GLN A  1 697  ? 65.800  108.113 -9.028  1.00 129.33 ?  757  GLN A CB     1 
ATOM   5377  C  CG     . GLN A  1 697  ? 64.758  108.632 -8.053  1.00 127.98 ?  757  GLN A CG     1 
ATOM   5378  C  CD     . GLN A  1 697  ? 64.888  110.112 -7.840  1.00 140.09 ?  757  GLN A CD     1 
ATOM   5379  O  OE1    . GLN A  1 697  ? 64.781  110.902 -8.803  1.00 127.85 ?  757  GLN A OE1    1 
ATOM   5380  N  NE2    . GLN A  1 697  ? 65.080  110.509 -6.566  1.00 136.57 ?  757  GLN A NE2    1 
ATOM   5381  N  N      . PHE A  1 698  ? 67.822  107.970 -6.164  1.00 130.47 ?  758  PHE A N      1 
ATOM   5382  C  CA     . PHE A  1 698  ? 67.906  107.382 -4.839  1.00 130.62 ?  758  PHE A CA     1 
ATOM   5383  C  C      . PHE A  1 698  ? 66.544  107.517 -4.088  1.00 135.87 ?  758  PHE A C      1 
ATOM   5384  O  O      . PHE A  1 698  ? 65.569  108.077 -4.631  1.00 135.19 ?  758  PHE A O      1 
ATOM   5385  C  CB     . PHE A  1 698  ? 69.079  107.995 -4.069  1.00 132.38 ?  758  PHE A CB     1 
ATOM   5386  C  CG     . PHE A  1 698  ? 70.392  107.758 -4.762  1.00 135.38 ?  758  PHE A CG     1 
ATOM   5387  C  CD1    . PHE A  1 698  ? 70.972  106.495 -4.769  1.00 139.16 ?  758  PHE A CD1    1 
ATOM   5388  C  CD2    . PHE A  1 698  ? 71.042  108.792 -5.422  1.00 138.25 ?  758  PHE A CD2    1 
ATOM   5389  C  CE1    . PHE A  1 698  ? 72.189  106.271 -5.400  1.00 142.53 ?  758  PHE A CE1    1 
ATOM   5390  C  CE2    . PHE A  1 698  ? 72.263  108.571 -6.054  1.00 143.58 ?  758  PHE A CE2    1 
ATOM   5391  C  CZ     . PHE A  1 698  ? 72.829  107.309 -6.039  1.00 143.14 ?  758  PHE A CZ     1 
ATOM   5392  N  N      . GLY A  1 699  ? 66.501  106.973 -2.865  1.00 132.76 ?  759  GLY A N      1 
ATOM   5393  C  CA     . GLY A  1 699  ? 65.319  106.913 -2.014  1.00 131.41 ?  759  GLY A CA     1 
ATOM   5394  C  C      . GLY A  1 699  ? 64.589  108.223 -1.850  1.00 136.10 ?  759  GLY A C      1 
ATOM   5395  O  O      . GLY A  1 699  ? 63.371  108.274 -2.055  1.00 135.23 ?  759  GLY A O      1 
ATOM   5396  N  N      . HIS A  1 700  ? 65.339  109.291 -1.495  1.00 133.55 ?  760  HIS A N      1 
ATOM   5397  C  CA     . HIS A  1 700  ? 64.786  110.631 -1.365  1.00 132.52 ?  760  HIS A CA     1 
ATOM   5398  C  C      . HIS A  1 700  ? 64.382  111.141 -2.745  1.00 136.70 ?  760  HIS A C      1 
ATOM   5399  O  O      . HIS A  1 700  ? 65.156  111.030 -3.706  1.00 137.24 ?  760  HIS A O      1 
ATOM   5400  C  CB     . HIS A  1 700  ? 65.780  111.584 -0.690  1.00 133.97 ?  760  HIS A CB     1 
ATOM   5401  C  CG     . HIS A  1 700  ? 66.019  111.282 0.756   1.00 137.41 ?  760  HIS A CG     1 
ATOM   5402  N  ND1    . HIS A  1 700  ? 67.229  111.532 1.343   1.00 140.72 ?  760  HIS A ND1    1 
ATOM   5403  C  CD2    . HIS A  1 700  ? 65.193  110.748 1.687   1.00 138.67 ?  760  HIS A CD2    1 
ATOM   5404  C  CE1    . HIS A  1 700  ? 67.117  111.155 2.604   1.00 140.07 ?  760  HIS A CE1    1 
ATOM   5405  N  NE2    . HIS A  1 700  ? 65.906  110.677 2.858   1.00 138.94 ?  760  HIS A NE2    1 
ATOM   5406  N  N      . ALA A  1 701  ? 63.150  111.669 -2.851  1.00 132.11 ?  761  ALA A N      1 
ATOM   5407  C  CA     . ALA A  1 701  ? 62.612  112.193 -4.101  1.00 132.49 ?  761  ALA A CA     1 
ATOM   5408  C  C      . ALA A  1 701  ? 63.553  113.218 -4.735  1.00 139.53 ?  761  ALA A C      1 
ATOM   5409  O  O      . ALA A  1 701  ? 63.731  113.198 -5.952  1.00 139.18 ?  761  ALA A O      1 
ATOM   5410  C  CB     . ALA A  1 701  ? 61.253  112.809 -3.847  1.00 131.94 ?  761  ALA A CB     1 
ATOM   5411  N  N      . GLY A  1 702  ? 64.153  114.081 -3.897  1.00 139.39 ?  762  GLY A N      1 
ATOM   5412  C  CA     . GLY A  1 702  ? 65.076  115.130 -4.321  1.00 141.73 ?  762  GLY A CA     1 
ATOM   5413  C  C      . GLY A  1 702  ? 66.495  114.702 -4.655  1.00 150.19 ?  762  GLY A C      1 
ATOM   5414  O  O      . GLY A  1 702  ? 67.257  115.500 -5.209  1.00 150.57 ?  762  GLY A O      1 
ATOM   5415  N  N      . ALA A  1 703  ? 66.860  113.435 -4.344  1.00 149.54 ?  763  ALA A N      1 
ATOM   5416  C  CA     . ALA A  1 703  ? 68.215  112.895 -4.506  1.00 151.42 ?  763  ALA A CA     1 
ATOM   5417  C  C      . ALA A  1 703  ? 68.483  112.362 -5.888  1.00 156.74 ?  763  ALA A C      1 
ATOM   5418  O  O      . ALA A  1 703  ? 68.520  111.151 -6.119  1.00 156.61 ?  763  ALA A O      1 
ATOM   5419  C  CB     . ALA A  1 703  ? 68.507  111.844 -3.437  1.00 151.94 ?  763  ALA A CB     1 
ATOM   5420  N  N      . CYS A  1 704  ? 68.634  113.295 -6.820  1.00 155.19 ?  764  CYS A N      1 
ATOM   5421  C  CA     . CYS A  1 704  ? 68.982  113.021 -8.206  1.00 157.77 ?  764  CYS A CA     1 
ATOM   5422  C  C      . CYS A  1 704  ? 69.581  114.279 -8.798  1.00 160.97 ?  764  CYS A C      1 
ATOM   5423  O  O      . CYS A  1 704  ? 68.944  115.341 -8.761  1.00 158.70 ?  764  CYS A O      1 
ATOM   5424  C  CB     . CYS A  1 704  ? 67.794  112.526 -9.018  1.00 158.68 ?  764  CYS A CB     1 
ATOM   5425  S  SG     . CYS A  1 704  ? 68.245  111.970 -10.679 1.00 165.45 ?  764  CYS A SG     1 
ATOM   5426  N  N      . ALA A  1 705  ? 70.837  114.165 -9.290  1.00 159.04 ?  765  ALA A N      1 
ATOM   5427  C  CA     . ALA A  1 705  ? 71.620  115.279 -9.827  1.00 159.74 ?  765  ALA A CA     1 
ATOM   5428  C  C      . ALA A  1 705  ? 71.292  115.522 -11.294 1.00 164.21 ?  765  ALA A C      1 
ATOM   5429  O  O      . ALA A  1 705  ? 71.576  114.683 -12.151 1.00 165.34 ?  765  ALA A O      1 
ATOM   5430  C  CB     . ALA A  1 705  ? 73.109  115.030 -9.635  1.00 162.14 ?  765  ALA A CB     1 
ATOM   5431  N  N      . ASN A  1 706  ? 70.661  116.667 -11.569 1.00 159.52 ?  766  ASN A N      1 
ATOM   5432  C  CA     . ASN A  1 706  ? 70.264  117.065 -12.912 1.00 159.68 ?  766  ASN A CA     1 
ATOM   5433  C  C      . ASN A  1 706  ? 71.349  117.918 -13.578 1.00 165.32 ?  766  ASN A C      1 
ATOM   5434  O  O      . ASN A  1 706  ? 71.260  118.194 -14.768 1.00 167.37 ?  766  ASN A O      1 
ATOM   5435  C  CB     . ASN A  1 706  ? 68.894  117.752 -12.890 1.00 157.71 ?  766  ASN A CB     1 
ATOM   5436  C  CG     . ASN A  1 706  ? 67.798  116.892 -12.275 1.00 183.51 ?  766  ASN A CG     1 
ATOM   5437  O  OD1    . ASN A  1 706  ? 67.645  115.698 -12.567 1.00 172.13 ?  766  ASN A OD1    1 
ATOM   5438  N  ND2    . ASN A  1 706  ? 67.039  117.463 -11.355 1.00 179.32 ?  766  ASN A ND2    1 
ATOM   5439  N  N      . GLN A  1 707  ? 72.410  118.270 -12.838 1.00 160.79 ?  767  GLN A N      1 
ATOM   5440  C  CA     . GLN A  1 707  ? 73.546  119.032 -13.357 1.00 162.02 ?  767  GLN A CA     1 
ATOM   5441  C  C      . GLN A  1 707  ? 74.798  118.603 -12.626 1.00 165.22 ?  767  GLN A C      1 
ATOM   5442  O  O      . GLN A  1 707  ? 74.711  118.039 -11.530 1.00 163.87 ?  767  GLN A O      1 
ATOM   5443  C  CB     . GLN A  1 707  ? 73.329  120.545 -13.200 1.00 163.30 ?  767  GLN A CB     1 
ATOM   5444  C  CG     . GLN A  1 707  ? 72.281  121.126 -14.132 1.00 178.39 ?  767  GLN A CG     1 
ATOM   5445  C  CD     . GLN A  1 707  ? 72.194  122.619 -14.036 1.00 201.60 ?  767  GLN A CD     1 
ATOM   5446  O  OE1    . GLN A  1 707  ? 72.899  123.262 -13.250 1.00 193.53 ?  767  GLN A OE1    1 
ATOM   5447  N  NE2    . GLN A  1 707  ? 71.326  123.207 -14.847 1.00 202.03 ?  767  GLN A NE2    1 
ATOM   5448  N  N      . ALA A  1 708  ? 75.963  118.918 -13.209 1.00 162.54 ?  768  ALA A N      1 
ATOM   5449  C  CA     . ALA A  1 708  ? 77.261  118.556 -12.655 1.00 163.23 ?  768  ALA A CA     1 
ATOM   5450  C  C      . ALA A  1 708  ? 77.467  119.118 -11.260 1.00 164.80 ?  768  ALA A C      1 
ATOM   5451  O  O      . ALA A  1 708  ? 78.073  118.458 -10.413 1.00 164.91 ?  768  ALA A O      1 
ATOM   5452  C  CB     . ALA A  1 708  ? 78.371  119.015 -13.580 1.00 166.94 ?  768  ALA A CB     1 
ATOM   5453  N  N      . SER A  1 709  ? 76.948  120.330 -11.027 1.00 158.91 ?  769  SER A N      1 
ATOM   5454  C  CA     . SER A  1 709  ? 77.038  121.037 -9.752  1.00 157.41 ?  769  SER A CA     1 
ATOM   5455  C  C      . SER A  1 709  ? 76.224  120.372 -8.627  1.00 155.94 ?  769  SER A C      1 
ATOM   5456  O  O      . SER A  1 709  ? 76.510  120.585 -7.456  1.00 153.72 ?  769  SER A O      1 
ATOM   5457  C  CB     . SER A  1 709  ? 76.596  122.486 -9.933  1.00 161.94 ?  769  SER A CB     1 
ATOM   5458  O  OG     . SER A  1 709  ? 75.236  122.566 -10.326 1.00 172.10 ?  769  SER A OG     1 
ATOM   5459  N  N      . GLU A  1 710  ? 75.225  119.573 -8.980  1.00 150.63 ?  770  GLU A N      1 
ATOM   5460  C  CA     . GLU A  1 710  ? 74.369  118.942 -7.995  1.00 147.90 ?  770  GLU A CA     1 
ATOM   5461  C  C      . GLU A  1 710  ? 74.925  117.652 -7.423  1.00 151.69 ?  770  GLU A C      1 
ATOM   5462  O  O      . GLU A  1 710  ? 74.319  117.098 -6.507  1.00 148.88 ?  770  GLU A O      1 
ATOM   5463  C  CB     . GLU A  1 710  ? 72.988  118.689 -8.585  1.00 147.75 ?  770  GLU A CB     1 
ATOM   5464  C  CG     . GLU A  1 710  ? 72.292  119.921 -9.126  1.00 157.55 ?  770  GLU A CG     1 
ATOM   5465  C  CD     . GLU A  1 710  ? 70.876  119.667 -9.613  1.00 177.85 ?  770  GLU A CD     1 
ATOM   5466  O  OE1    . GLU A  1 710  ? 70.392  120.492 -10.416 1.00 174.93 ?  770  GLU A OE1    1 
ATOM   5467  O  OE2    . GLU A  1 710  ? 70.239  118.674 -9.188  1.00 171.34 -1 770  GLU A OE2    1 
ATOM   5468  N  N      . THR A  1 711  ? 76.061  117.165 -7.937  1.00 151.05 ?  771  THR A N      1 
ATOM   5469  C  CA     . THR A  1 711  ? 76.649  115.917 -7.433  1.00 151.16 ?  771  THR A CA     1 
ATOM   5470  C  C      . THR A  1 711  ? 77.239  116.096 -6.050  1.00 154.56 ?  771  THR A C      1 
ATOM   5471  O  O      . THR A  1 711  ? 77.664  117.199 -5.686  1.00 155.03 ?  771  THR A O      1 
ATOM   5472  C  CB     . THR A  1 711  ? 77.700  115.357 -8.381  1.00 160.70 ?  771  THR A CB     1 
ATOM   5473  O  OG1    . THR A  1 711  ? 78.860  116.190 -8.365  1.00 164.14 ?  771  THR A OG1    1 
ATOM   5474  C  CG2    . THR A  1 711  ? 77.176  115.194 -9.790  1.00 158.88 ?  771  THR A CG2    1 
ATOM   5475  N  N      . ALA A  1 712  ? 77.272  115.008 -5.283  1.00 150.06 ?  772  ALA A N      1 
ATOM   5476  C  CA     . ALA A  1 712  ? 77.853  115.069 -3.954  1.00 150.28 ?  772  ALA A CA     1 
ATOM   5477  C  C      . ALA A  1 712  ? 79.343  115.414 -4.026  1.00 154.78 ?  772  ALA A C      1 
ATOM   5478  O  O      . ALA A  1 712  ? 79.831  116.201 -3.211  1.00 156.60 ?  772  ALA A O      1 
ATOM   5479  C  CB     . ALA A  1 712  ? 77.644  113.750 -3.226  1.00 150.53 ?  772  ALA A CB     1 
ATOM   5480  N  N      . VAL A  1 713  ? 80.058  114.852 -4.996  1.00 148.88 ?  773  VAL A N      1 
ATOM   5481  C  CA     . VAL A  1 713  ? 81.481  115.115 -5.138  1.00 149.91 ?  773  VAL A CA     1 
ATOM   5482  C  C      . VAL A  1 713  ? 81.745  116.612 -5.311  1.00 153.36 ?  773  VAL A C      1 
ATOM   5483  O  O      . VAL A  1 713  ? 82.601  117.170 -4.619  1.00 153.94 ?  773  VAL A O      1 
ATOM   5484  C  CB     . VAL A  1 713  ? 82.069  114.277 -6.284  1.00 154.73 ?  773  VAL A CB     1 
ATOM   5485  C  CG1    . VAL A  1 713  ? 83.547  114.591 -6.482  1.00 157.67 ?  773  VAL A CG1    1 
ATOM   5486  C  CG2    . VAL A  1 713  ? 81.873  112.792 -6.014  1.00 154.08 ?  773  VAL A CG2    1 
ATOM   5487  N  N      . ALA A  1 714  ? 80.983  117.255 -6.212  1.00 149.11 ?  774  ALA A N      1 
ATOM   5488  C  CA     . ALA A  1 714  ? 81.106  118.678 -6.526  1.00 149.80 ?  774  ALA A CA     1 
ATOM   5489  C  C      . ALA A  1 714  ? 80.841  119.544 -5.315  1.00 153.53 ?  774  ALA A C      1 
ATOM   5490  O  O      . ALA A  1 714  ? 81.611  120.476 -5.048  1.00 154.86 ?  774  ALA A O      1 
ATOM   5491  C  CB     . ALA A  1 714  ? 80.155  119.054 -7.656  1.00 149.25 ?  774  ALA A CB     1 
ATOM   5492  N  N      . LYS A  1 715  ? 79.770  119.220 -4.569  1.00 147.98 ?  775  LYS A N      1 
ATOM   5493  C  CA     . LYS A  1 715  ? 79.373  119.994 -3.394  1.00 146.64 ?  775  LYS A CA     1 
ATOM   5494  C  C      . LYS A  1 715  ? 80.378  119.857 -2.277  1.00 153.95 ?  775  LYS A C      1 
ATOM   5495  O  O      . LYS A  1 715  ? 80.770  120.866 -1.689  1.00 156.39 ?  775  LYS A O      1 
ATOM   5496  C  CB     . LYS A  1 715  ? 77.942  119.673 -2.959  1.00 144.23 ?  775  LYS A CB     1 
ATOM   5497  C  CG     . LYS A  1 715  ? 76.962  120.079 -4.053  1.00 145.61 ?  775  LYS A CG     1 
ATOM   5498  C  CD     . LYS A  1 715  ? 75.513  120.226 -3.638  1.00 144.97 ?  775  LYS A CD     1 
ATOM   5499  C  CE     . LYS A  1 715  ? 74.819  118.909 -3.506  1.00 135.71 ?  775  LYS A CE     1 
ATOM   5500  N  NZ     . LYS A  1 715  ? 73.346  119.105 -3.416  1.00 124.28 1  775  LYS A NZ     1 
ATOM   5501  N  N      . ASN A  1 716  ? 80.855  118.637 -2.032  1.00 149.68 ?  776  ASN A N      1 
ATOM   5502  C  CA     . ASN A  1 716  ? 81.872  118.405 -1.017  1.00 150.63 ?  776  ASN A CA     1 
ATOM   5503  C  C      . ASN A  1 716  ? 83.132  119.209 -1.308  1.00 157.55 ?  776  ASN A C      1 
ATOM   5504  O  O      . ASN A  1 716  ? 83.704  119.794 -0.386  1.00 158.03 ?  776  ASN A O      1 
ATOM   5505  C  CB     . ASN A  1 716  ? 82.185  116.922 -0.911  1.00 147.86 ?  776  ASN A CB     1 
ATOM   5506  C  CG     . ASN A  1 716  ? 81.144  116.152 -0.142  1.00 147.22 ?  776  ASN A CG     1 
ATOM   5507  O  OD1    . ASN A  1 716  ? 80.493  116.692 0.759   1.00 140.26 ?  776  ASN A OD1    1 
ATOM   5508  N  ND2    . ASN A  1 716  ? 81.001  114.864 -0.454  1.00 129.01 ?  776  ASN A ND2    1 
ATOM   5509  N  N      . GLN A  1 717  ? 83.536  119.270 -2.588  1.00 155.87 ?  777  GLN A N      1 
ATOM   5510  C  CA     . GLN A  1 717  ? 84.710  120.030 -2.999  1.00 159.08 ?  777  GLN A CA     1 
ATOM   5511  C  C      . GLN A  1 717  ? 84.522  121.515 -2.738  1.00 162.52 ?  777  GLN A C      1 
ATOM   5512  O  O      . GLN A  1 717  ? 85.379  122.131 -2.105  1.00 164.30 ?  777  GLN A O      1 
ATOM   5513  C  CB     . GLN A  1 717  ? 85.057  119.757 -4.475  1.00 161.84 ?  777  GLN A CB     1 
ATOM   5514  C  CG     . GLN A  1 717  ? 86.371  120.387 -4.947  1.00 185.89 ?  777  GLN A CG     1 
ATOM   5515  C  CD     . GLN A  1 717  ? 87.588  120.027 -4.108  1.00 213.90 ?  777  GLN A CD     1 
ATOM   5516  O  OE1    . GLN A  1 717  ? 87.768  118.885 -3.657  1.00 209.14 ?  777  GLN A OE1    1 
ATOM   5517  N  NE2    . GLN A  1 717  ? 88.461  121.002 -3.886  1.00 212.59 ?  777  GLN A NE2    1 
ATOM   5518  N  N      . ALA A  1 718  ? 83.389  122.072 -3.185  1.00 157.07 ?  778  ALA A N      1 
ATOM   5519  C  CA     . ALA A  1 718  ? 83.074  123.482 -3.016  1.00 157.78 ?  778  ALA A CA     1 
ATOM   5520  C  C      . ALA A  1 718  ? 83.041  123.903 -1.551  1.00 163.00 ?  778  ALA A C      1 
ATOM   5521  O  O      . ALA A  1 718  ? 83.604  124.952 -1.201  1.00 164.64 ?  778  ALA A O      1 
ATOM   5522  C  CB     . ALA A  1 718  ? 81.753  123.791 -3.679  1.00 156.24 ?  778  ALA A CB     1 
ATOM   5523  N  N      . LEU A  1 719  ? 82.408  123.071 -0.698  1.00 158.19 ?  779  LEU A N      1 
ATOM   5524  C  CA     . LEU A  1 719  ? 82.308  123.324 0.739   1.00 158.44 ?  779  LEU A CA     1 
ATOM   5525  C  C      . LEU A  1 719  ? 83.689  123.345 1.386   1.00 165.98 ?  779  LEU A C      1 
ATOM   5526  O  O      . LEU A  1 719  ? 83.985  124.272 2.143   1.00 168.65 ?  779  LEU A O      1 
ATOM   5527  C  CB     . LEU A  1 719  ? 81.409  122.286 1.425   1.00 155.84 ?  779  LEU A CB     1 
ATOM   5528  C  CG     . LEU A  1 719  ? 79.914  122.353 1.102   1.00 157.25 ?  779  LEU A CG     1 
ATOM   5529  C  CD1    . LEU A  1 719  ? 79.287  120.985 1.225   1.00 154.82 ?  779  LEU A CD1    1 
ATOM   5530  C  CD2    . LEU A  1 719  ? 79.196  123.377 1.982   1.00 159.02 ?  779  LEU A CD2    1 
ATOM   5531  N  N      . LYS A  1 720  ? 84.548  122.356 1.050   1.00 161.46 ?  780  LYS A N      1 
ATOM   5532  C  CA     . LYS A  1 720  ? 85.919  122.256 1.561   1.00 163.06 ?  780  LYS A CA     1 
ATOM   5533  C  C      . LYS A  1 720  ? 86.723  123.499 1.193   1.00 166.92 ?  780  LYS A C      1 
ATOM   5534  O  O      . LYS A  1 720  ? 87.437  124.025 2.041   1.00 167.74 ?  780  LYS A O      1 
ATOM   5535  C  CB     . LYS A  1 720  ? 86.582  120.987 1.025   1.00 165.95 ?  780  LYS A CB     1 
ATOM   5536  C  CG     . LYS A  1 720  ? 87.849  120.563 1.756   1.00 175.20 ?  780  LYS A CG     1 
ATOM   5537  C  CD     . LYS A  1 720  ? 88.600  119.432 1.007   1.00 181.36 ?  780  LYS A CD     1 
ATOM   5538  C  CE     . LYS A  1 720  ? 89.178  119.841 -0.339  1.00 188.23 ?  780  LYS A CE     1 
ATOM   5539  N  NZ     . LYS A  1 720  ? 89.936  118.744 -0.994  1.00 193.26 1  780  LYS A NZ     1 
ATOM   5540  N  N      . GLU A  1 721  ? 86.560  123.990 -0.051  1.00 163.52 ?  781  GLU A N      1 
ATOM   5541  C  CA     . GLU A  1 721  ? 87.220  125.196 -0.574  1.00 166.43 ?  781  GLU A CA     1 
ATOM   5542  C  C      . GLU A  1 721  ? 86.739  126.457 0.141   1.00 169.43 ?  781  GLU A C      1 
ATOM   5543  O  O      . GLU A  1 721  ? 87.523  127.399 0.321   1.00 170.38 ?  781  GLU A O      1 
ATOM   5544  C  CB     . GLU A  1 721  ? 86.967  125.345 -2.082  1.00 167.62 ?  781  GLU A CB     1 
ATOM   5545  C  CG     . GLU A  1 721  ? 87.737  124.374 -2.961  1.00 181.99 ?  781  GLU A CG     1 
ATOM   5546  C  CD     . GLU A  1 721  ? 87.203  124.227 -4.379  1.00 204.16 ?  781  GLU A CD     1 
ATOM   5547  O  OE1    . GLU A  1 721  ? 87.970  123.735 -5.240  1.00 199.24 ?  781  GLU A OE1    1 
ATOM   5548  O  OE2    . GLU A  1 721  ? 85.993  124.480 -4.601  1.00 195.20 -1 781  GLU A OE2    1 
ATOM   5549  N  N      . ALA A  1 722  ? 85.445  126.477 0.531   1.00 163.71 ?  782  ALA A N      1 
ATOM   5550  C  CA     . ALA A  1 722  ? 84.817  127.595 1.238   1.00 163.65 ?  782  ALA A CA     1 
ATOM   5551  C  C      . ALA A  1 722  ? 85.226  127.697 2.714   1.00 169.12 ?  782  ALA A C      1 
ATOM   5552  O  O      . ALA A  1 722  ? 84.940  128.712 3.344   1.00 169.16 ?  782  ALA A O      1 
ATOM   5553  C  CB     . ALA A  1 722  ? 83.302  127.514 1.116   1.00 160.77 ?  782  ALA A CB     1 
ATOM   5554  N  N      . GLY A  1 723  ? 85.878  126.660 3.244   1.00 166.96 ?  783  GLY A N      1 
ATOM   5555  C  CA     . GLY A  1 723  ? 86.348  126.636 4.625   1.00 168.70 ?  783  GLY A CA     1 
ATOM   5556  C  C      . GLY A  1 723  ? 85.564  125.739 5.558   1.00 170.71 ?  783  GLY A C      1 
ATOM   5557  O  O      . GLY A  1 723  ? 85.864  125.684 6.753   1.00 171.80 ?  783  GLY A O      1 
ATOM   5558  N  N      . VAL A  1 724  ? 84.551  125.042 5.027   1.00 164.04 ?  784  VAL A N      1 
ATOM   5559  C  CA     . VAL A  1 724  ? 83.732  124.095 5.784   1.00 161.34 ?  784  VAL A CA     1 
ATOM   5560  C  C      . VAL A  1 724  ? 84.641  122.899 6.140   1.00 166.41 ?  784  VAL A C      1 
ATOM   5561  O  O      . VAL A  1 724  ? 85.545  122.551 5.367   1.00 167.21 ?  784  VAL A O      1 
ATOM   5562  C  CB     . VAL A  1 724  ? 82.480  123.656 4.960   1.00 161.52 ?  784  VAL A CB     1 
ATOM   5563  C  CG1    . VAL A  1 724  ? 81.700  122.546 5.654   1.00 158.82 ?  784  VAL A CG1    1 
ATOM   5564  C  CG2    . VAL A  1 724  ? 81.566  124.839 4.646   1.00 160.06 ?  784  VAL A CG2    1 
ATOM   5565  N  N      . PHE A  1 725  ? 84.417  122.297 7.316   1.00 162.49 ?  785  PHE A N      1 
ATOM   5566  C  CA     . PHE A  1 725  ? 85.169  121.120 7.744   1.00 163.70 ?  785  PHE A CA     1 
ATOM   5567  C  C      . PHE A  1 725  ? 84.522  119.922 7.088   1.00 167.83 ?  785  PHE A C      1 
ATOM   5568  O  O      . PHE A  1 725  ? 83.433  119.515 7.488   1.00 165.12 ?  785  PHE A O      1 
ATOM   5569  C  CB     . PHE A  1 725  ? 85.183  120.999 9.274   1.00 165.47 ?  785  PHE A CB     1 
ATOM   5570  C  CG     . PHE A  1 725  ? 85.817  122.203 9.924   1.00 168.91 ?  785  PHE A CG     1 
ATOM   5571  C  CD1    . PHE A  1 725  ? 85.055  123.324 10.242  1.00 169.90 ?  785  PHE A CD1    1 
ATOM   5572  C  CD2    . PHE A  1 725  ? 87.183  122.245 10.160  1.00 173.90 ?  785  PHE A CD2    1 
ATOM   5573  C  CE1    . PHE A  1 725  ? 85.649  124.456 10.796  1.00 173.41 ?  785  PHE A CE1    1 
ATOM   5574  C  CE2    . PHE A  1 725  ? 87.772  123.369 10.733  1.00 179.15 ?  785  PHE A CE2    1 
ATOM   5575  C  CZ     . PHE A  1 725  ? 87.004  124.463 11.052  1.00 176.04 ?  785  PHE A CZ     1 
ATOM   5576  N  N      . VAL A  1 726  ? 85.158  119.402 6.025   1.00 167.05 ?  786  VAL A N      1 
ATOM   5577  C  CA     . VAL A  1 726  ? 84.632  118.284 5.244   1.00 165.21 ?  786  VAL A CA     1 
ATOM   5578  C  C      . VAL A  1 726  ? 85.500  117.029 5.467   1.00 169.85 ?  786  VAL A C      1 
ATOM   5579  O  O      . VAL A  1 726  ? 86.708  117.076 5.214   1.00 171.84 ?  786  VAL A O      1 
ATOM   5580  C  CB     . VAL A  1 726  ? 84.457  118.642 3.731   1.00 168.68 ?  786  VAL A CB     1 
ATOM   5581  C  CG1    . VAL A  1 726  ? 83.821  117.489 2.950   1.00 166.52 ?  786  VAL A CG1    1 
ATOM   5582  C  CG2    . VAL A  1 726  ? 83.644  119.925 3.547   1.00 166.89 ?  786  VAL A CG2    1 
ATOM   5583  N  N      . PRO A  1 727  ? 84.907  115.902 5.941   1.00 164.49 ?  787  PRO A N      1 
ATOM   5584  C  CA     . PRO A  1 727  ? 85.709  114.677 6.114   1.00 166.34 ?  787  PRO A CA     1 
ATOM   5585  C  C      . PRO A  1 727  ? 86.043  114.027 4.758   1.00 171.11 ?  787  PRO A C      1 
ATOM   5586  O  O      . PRO A  1 727  ? 85.433  114.382 3.745   1.00 169.69 ?  787  PRO A O      1 
ATOM   5587  C  CB     . PRO A  1 727  ? 84.789  113.783 6.954   1.00 165.62 ?  787  PRO A CB     1 
ATOM   5588  C  CG     . PRO A  1 727  ? 83.413  114.199 6.566   1.00 165.93 ?  787  PRO A CG     1 
ATOM   5589  C  CD     . PRO A  1 727  ? 83.484  115.673 6.285   1.00 161.91 ?  787  PRO A CD     1 
ATOM   5590  N  N      . ARG A  1 728  ? 86.985  113.054 4.742   1.00 169.07 ?  788  ARG A N      1 
ATOM   5591  C  CA     . ARG A  1 728  ? 87.365  112.299 3.534   1.00 169.13 ?  788  ARG A CA     1 
ATOM   5592  C  C      . ARG A  1 728  ? 86.162  111.513 2.995   1.00 167.91 ?  788  ARG A C      1 
ATOM   5593  O  O      . ARG A  1 728  ? 85.935  111.480 1.781   1.00 165.44 ?  788  ARG A O      1 
ATOM   5594  C  CB     . ARG A  1 728  ? 88.528  111.338 3.849   1.00 174.80 ?  788  ARG A CB     1 
ATOM   5595  C  CG     . ARG A  1 728  ? 89.074  110.571 2.633   1.00 192.88 ?  788  ARG A CG     1 
ATOM   5596  C  CD     . ARG A  1 728  ? 89.566  109.150 2.949   1.00 206.74 ?  788  ARG A CD     1 
ATOM   5597  N  NE     . ARG A  1 728  ? 88.450  108.199 3.100   1.00 209.31 ?  788  ARG A NE     1 
ATOM   5598  C  CZ     . ARG A  1 728  ? 88.071  107.311 2.178   1.00 213.73 ?  788  ARG A CZ     1 
ATOM   5599  N  NH1    . ARG A  1 728  ? 88.726  107.218 1.026   1.00 203.73 1  788  ARG A NH1    1 
ATOM   5600  N  NH2    . ARG A  1 728  ? 87.044  106.501 2.408   1.00 198.44 ?  788  ARG A NH2    1 
ATOM   5601  N  N      . SER A  1 729  ? 85.381  110.920 3.923   1.00 163.14 ?  789  SER A N      1 
ATOM   5602  C  CA     . SER A  1 729  ? 84.176  110.139 3.664   1.00 159.85 ?  789  SER A CA     1 
ATOM   5603  C  C      . SER A  1 729  ? 83.299  110.191 4.882   1.00 162.60 ?  789  SER A C      1 
ATOM   5604  O  O      . SER A  1 729  ? 83.688  110.779 5.899   1.00 162.86 ?  789  SER A O      1 
ATOM   5605  C  CB     . SER A  1 729  ? 84.529  108.692 3.339   1.00 163.62 ?  789  SER A CB     1 
ATOM   5606  O  OG     . SER A  1 729  ? 84.820  107.942 4.506   1.00 170.58 ?  789  SER A OG     1 
ATOM   5607  N  N      . PHE A  1 730  ? 82.136  109.534 4.816   1.00 157.96 ?  790  PHE A N      1 
ATOM   5608  C  CA     . PHE A  1 730  ? 81.244  109.528 5.963   1.00 156.27 ?  790  PHE A CA     1 
ATOM   5609  C  C      . PHE A  1 730  ? 81.912  108.883 7.198   1.00 164.33 ?  790  PHE A C      1 
ATOM   5610  O  O      . PHE A  1 730  ? 81.644  109.279 8.337   1.00 162.92 ?  790  PHE A O      1 
ATOM   5611  C  CB     . PHE A  1 730  ? 79.930  108.836 5.626   1.00 154.81 ?  790  PHE A CB     1 
ATOM   5612  C  CG     . PHE A  1 730  ? 78.993  108.789 6.803   1.00 154.31 ?  790  PHE A CG     1 
ATOM   5613  C  CD1    . PHE A  1 730  ? 78.184  109.873 7.111   1.00 155.31 ?  790  PHE A CD1    1 
ATOM   5614  C  CD2    . PHE A  1 730  ? 78.945  107.675 7.630   1.00 157.29 ?  790  PHE A CD2    1 
ATOM   5615  C  CE1    . PHE A  1 730  ? 77.331  109.833 8.219   1.00 154.70 ?  790  PHE A CE1    1 
ATOM   5616  C  CE2    . PHE A  1 730  ? 78.099  107.640 8.738   1.00 158.54 ?  790  PHE A CE2    1 
ATOM   5617  C  CZ     . PHE A  1 730  ? 77.303  108.721 9.031   1.00 154.32 ?  790  PHE A CZ     1 
ATOM   5618  N  N      . ASP A  1 731  ? 82.787  107.900 6.963   1.00 164.69 ?  791  ASP A N      1 
ATOM   5619  C  CA     . ASP A  1 731  ? 83.499  107.174 8.011   1.00 167.25 ?  791  ASP A CA     1 
ATOM   5620  C  C      . ASP A  1 731  ? 84.291  108.081 8.945   1.00 172.50 ?  791  ASP A C      1 
ATOM   5621  O  O      . ASP A  1 731  ? 84.393  107.790 10.135  1.00 172.06 ?  791  ASP A O      1 
ATOM   5622  C  CB     . ASP A  1 731  ? 84.417  106.116 7.379   1.00 172.66 ?  791  ASP A CB     1 
ATOM   5623  C  CG     . ASP A  1 731  ? 83.670  105.043 6.604   1.00 187.47 ?  791  ASP A CG     1 
ATOM   5624  O  OD1    . ASP A  1 731  ? 82.899  105.405 5.671   1.00 186.18 ?  791  ASP A OD1    1 
ATOM   5625  O  OD2    . ASP A  1 731  ? 83.852  103.842 6.922   1.00 197.49 -1 791  ASP A OD2    1 
ATOM   5626  N  N      . GLU A  1 732  ? 84.822  109.192 8.408   1.00 171.06 ?  792  GLU A N      1 
ATOM   5627  C  CA     . GLU A  1 732  ? 85.628  110.167 9.145   1.00 173.51 ?  792  GLU A CA     1 
ATOM   5628  C  C      . GLU A  1 732  ? 84.797  111.319 9.710   1.00 173.63 ?  792  GLU A C      1 
ATOM   5629  O  O      . GLU A  1 732  ? 85.371  112.231 10.309  1.00 175.27 ?  792  GLU A O      1 
ATOM   5630  C  CB     . GLU A  1 732  ? 86.782  110.721 8.267   1.00 178.07 ?  792  GLU A CB     1 
ATOM   5631  C  CG     . GLU A  1 732  ? 87.868  109.719 7.906   1.00 195.03 ?  792  GLU A CG     1 
ATOM   5632  C  CD     . GLU A  1 732  ? 87.484  108.706 6.847   1.00 220.26 ?  792  GLU A CD     1 
ATOM   5633  O  OE1    . GLU A  1 732  ? 87.802  107.511 7.037   1.00 217.03 ?  792  GLU A OE1    1 
ATOM   5634  O  OE2    . GLU A  1 732  ? 86.850  109.102 5.841   1.00 222.85 -1 792  GLU A OE2    1 
ATOM   5635  N  N      . LEU A  1 733  ? 83.460  111.297 9.527   1.00 164.56 ?  793  LEU A N      1 
ATOM   5636  C  CA     . LEU A  1 733  ? 82.601  112.370 10.032  1.00 160.75 ?  793  LEU A CA     1 
ATOM   5637  C  C      . LEU A  1 733  ? 82.689  112.520 11.555  1.00 163.99 ?  793  LEU A C      1 
ATOM   5638  O  O      . LEU A  1 733  ? 82.836  113.640 12.053  1.00 165.19 ?  793  LEU A O      1 
ATOM   5639  C  CB     . LEU A  1 733  ? 81.145  112.209 9.578   1.00 156.19 ?  793  LEU A CB     1 
ATOM   5640  C  CG     . LEU A  1 733  ? 80.179  113.325 9.978   1.00 157.14 ?  793  LEU A CG     1 
ATOM   5641  C  CD1    . LEU A  1 733  ? 80.546  114.639 9.319   1.00 157.58 ?  793  LEU A CD1    1 
ATOM   5642  C  CD2    . LEU A  1 733  ? 78.758  112.946 9.679   1.00 154.91 ?  793  LEU A CD2    1 
ATOM   5643  N  N      . GLY A  1 734  ? 82.611  111.408 12.273  1.00 157.45 ?  794  GLY A N      1 
ATOM   5644  C  CA     . GLY A  1 734  ? 82.707  111.445 13.723  1.00 156.91 ?  794  GLY A CA     1 
ATOM   5645  C  C      . GLY A  1 734  ? 84.016  112.043 14.191  1.00 161.42 ?  794  GLY A C      1 
ATOM   5646  O  O      . GLY A  1 734  ? 84.028  112.874 15.099  1.00 160.84 ?  794  GLY A O      1 
ATOM   5647  N  N      . GLU A  1 735  ? 85.121  111.635 13.554  1.00 159.54 ?  795  GLU A N      1 
ATOM   5648  C  CA     . GLU A  1 735  ? 86.469  112.100 13.841  1.00 163.22 ?  795  GLU A CA     1 
ATOM   5649  C  C      . GLU A  1 735  ? 86.571  113.630 13.714  1.00 165.65 ?  795  GLU A C      1 
ATOM   5650  O  O      . GLU A  1 735  ? 87.109  114.294 14.612  1.00 166.84 ?  795  GLU A O      1 
ATOM   5651  C  CB     . GLU A  1 735  ? 87.441  111.408 12.872  1.00 167.05 ?  795  GLU A CB     1 
ATOM   5652  C  CG     . GLU A  1 735  ? 88.909  111.538 13.234  1.00 184.87 ?  795  GLU A CG     1 
ATOM   5653  C  CD     . GLU A  1 735  ? 89.865  110.952 12.210  1.00 204.06 ?  795  GLU A CD     1 
ATOM   5654  O  OE1    . GLU A  1 735  ? 90.849  111.640 11.850  1.00 196.23 ?  795  GLU A OE1    1 
ATOM   5655  O  OE2    . GLU A  1 735  ? 89.639  109.800 11.771  1.00 205.20 -1 795  GLU A OE2    1 
ATOM   5656  N  N      . ILE A  1 736  ? 86.049  114.175 12.595  1.00 159.46 ?  796  ILE A N      1 
ATOM   5657  C  CA     . ILE A  1 736  ? 86.100  115.616 12.331  1.00 159.13 ?  796  ILE A CA     1 
ATOM   5658  C  C      . ILE A  1 736  ? 85.228  116.403 13.315  1.00 163.20 ?  796  ILE A C      1 
ATOM   5659  O  O      . ILE A  1 736  ? 85.657  117.466 13.780  1.00 165.98 ?  796  ILE A O      1 
ATOM   5660  C  CB     . ILE A  1 736  ? 85.824  115.978 10.857  1.00 159.73 ?  796  ILE A CB     1 
ATOM   5661  C  CG1    . ILE A  1 736  ? 86.322  117.379 10.532  1.00 161.56 ?  796  ILE A CG1    1 
ATOM   5662  C  CG2    . ILE A  1 736  ? 84.377  115.846 10.494  1.00 155.75 ?  796  ILE A CG2    1 
ATOM   5663  C  CD1    . ILE A  1 736  ? 86.733  117.546 9.078   1.00 172.05 ?  796  ILE A CD1    1 
ATOM   5664  N  N      . ILE A  1 737  ? 84.030  115.880 13.654  1.00 155.29 ?  797  ILE A N      1 
ATOM   5665  C  CA     . ILE A  1 737  ? 83.164  116.520 14.639  1.00 152.76 ?  797  ILE A CA     1 
ATOM   5666  C  C      . ILE A  1 737  ? 83.910  116.620 15.978  1.00 157.85 ?  797  ILE A C      1 
ATOM   5667  O  O      . ILE A  1 737  ? 83.931  117.688 16.592  1.00 159.19 ?  797  ILE A O      1 
ATOM   5668  C  CB     . ILE A  1 737  ? 81.839  115.751 14.769  1.00 152.28 ?  797  ILE A CB     1 
ATOM   5669  C  CG1    . ILE A  1 737  ? 80.981  115.950 13.512  1.00 149.33 ?  797  ILE A CG1    1 
ATOM   5670  C  CG2    . ILE A  1 737  ? 81.069  116.163 16.036  1.00 153.03 ?  797  ILE A CG2    1 
ATOM   5671  C  CD1    . ILE A  1 737  ? 79.840  114.991 13.413  1.00 151.24 ?  797  ILE A CD1    1 
ATOM   5672  N  N      . GLN A  1 738  ? 84.550  115.528 16.408  1.00 153.68 ?  798  GLN A N      1 
ATOM   5673  C  CA     . GLN A  1 738  ? 85.278  115.505 17.668  1.00 155.44 ?  798  GLN A CA     1 
ATOM   5674  C  C      . GLN A  1 738  ? 86.446  116.479 17.635  1.00 162.60 ?  798  GLN A C      1 
ATOM   5675  O  O      . GLN A  1 738  ? 86.643  117.201 18.605  1.00 163.87 ?  798  GLN A O      1 
ATOM   5676  C  CB     . GLN A  1 738  ? 85.735  114.091 17.994  1.00 157.58 ?  798  GLN A CB     1 
ATOM   5677  C  CG     . GLN A  1 738  ? 86.294  113.974 19.400  1.00 172.48 ?  798  GLN A CG     1 
ATOM   5678  C  CD     . GLN A  1 738  ? 86.531  112.547 19.827  1.00 191.18 ?  798  GLN A CD     1 
ATOM   5679  O  OE1    . GLN A  1 738  ? 86.113  111.593 19.169  1.00 183.15 ?  798  GLN A OE1    1 
ATOM   5680  N  NE2    . GLN A  1 738  ? 87.186  112.360 20.965  1.00 188.22 ?  798  GLN A NE2    1 
ATOM   5681  N  N      . SER A  1 739  ? 87.170  116.555 16.513  1.00 160.28 ?  799  SER A N      1 
ATOM   5682  C  CA     . SER A  1 739  ? 88.302  117.462 16.390  1.00 164.09 ?  799  SER A CA     1 
ATOM   5683  C  C      . SER A  1 739  ? 87.869  118.924 16.523  1.00 167.73 ?  799  SER A C      1 
ATOM   5684  O  O      . SER A  1 739  ? 88.475  119.671 17.303  1.00 172.49 ?  799  SER A O      1 
ATOM   5685  C  CB     . SER A  1 739  ? 89.042  117.219 15.081  1.00 169.93 ?  799  SER A CB     1 
ATOM   5686  O  OG     . SER A  1 739  ? 90.176  118.060 14.934  1.00 185.23 ?  799  SER A OG     1 
ATOM   5687  N  N      . VAL A  1 740  ? 86.808  119.322 15.802  1.00 157.90 ?  800  VAL A N      1 
ATOM   5688  C  CA     . VAL A  1 740  ? 86.281  120.682 15.885  1.00 155.72 ?  800  VAL A CA     1 
ATOM   5689  C  C      . VAL A  1 740  ? 85.870  120.966 17.326  1.00 161.50 ?  800  VAL A C      1 
ATOM   5690  O  O      . VAL A  1 740  ? 86.292  121.974 17.898  1.00 163.45 ?  800  VAL A O      1 
ATOM   5691  C  CB     . VAL A  1 740  ? 85.135  120.915 14.868  1.00 153.64 ?  800  VAL A CB     1 
ATOM   5692  C  CG1    . VAL A  1 740  ? 84.398  122.215 15.148  1.00 152.27 ?  800  VAL A CG1    1 
ATOM   5693  C  CG2    . VAL A  1 740  ? 85.663  120.915 13.439  1.00 153.40 ?  800  VAL A CG2    1 
ATOM   5694  N  N      . TYR A  1 741  ? 85.100  120.046 17.922  1.00 158.19 ?  801  TYR A N      1 
ATOM   5695  C  CA     . TYR A  1 741  ? 84.626  120.183 19.294  1.00 159.80 ?  801  TYR A CA     1 
ATOM   5696  C  C      . TYR A  1 741  ? 85.771  120.399 20.292  1.00 169.67 ?  801  TYR A C      1 
ATOM   5697  O  O      . TYR A  1 741  ? 85.723  121.354 21.068  1.00 170.71 ?  801  TYR A O      1 
ATOM   5698  C  CB     . TYR A  1 741  ? 83.772  118.981 19.706  1.00 158.76 ?  801  TYR A CB     1 
ATOM   5699  C  CG     . TYR A  1 741  ? 83.406  118.985 21.176  1.00 162.91 ?  801  TYR A CG     1 
ATOM   5700  C  CD1    . TYR A  1 741  ? 82.392  119.808 21.661  1.00 164.35 ?  801  TYR A CD1    1 
ATOM   5701  C  CD2    . TYR A  1 741  ? 84.088  118.178 22.089  1.00 166.26 ?  801  TYR A CD2    1 
ATOM   5702  C  CE1    . TYR A  1 741  ? 82.041  119.802 23.014  1.00 167.62 ?  801  TYR A CE1    1 
ATOM   5703  C  CE2    . TYR A  1 741  ? 83.759  118.177 23.447  1.00 168.22 ?  801  TYR A CE2    1 
ATOM   5704  C  CZ     . TYR A  1 741  ? 82.741  118.997 23.907  1.00 175.40 ?  801  TYR A CZ     1 
ATOM   5705  O  OH     . TYR A  1 741  ? 82.430  118.977 25.244  1.00 176.91 ?  801  TYR A OH     1 
ATOM   5706  N  N      . GLU A  1 742  ? 86.790  119.526 20.264  1.00 169.33 ?  802  GLU A N      1 
ATOM   5707  C  CA     . GLU A  1 742  ? 87.927  119.593 21.176  1.00 174.34 ?  802  GLU A CA     1 
ATOM   5708  C  C      . GLU A  1 742  ? 88.668  120.921 21.091  1.00 178.64 ?  802  GLU A C      1 
ATOM   5709  O  O      . GLU A  1 742  ? 89.079  121.463 22.127  1.00 177.79 ?  802  GLU A O      1 
ATOM   5710  C  CB     . GLU A  1 742  ? 88.858  118.406 20.946  1.00 176.76 ?  802  GLU A CB     1 
ATOM   5711  C  CG     . GLU A  1 742  ? 88.293  117.091 21.461  1.00 182.64 ?  802  GLU A CG     1 
ATOM   5712  C  CD     . GLU A  1 742  ? 89.068  115.832 21.106  1.00 197.61 ?  802  GLU A CD     1 
ATOM   5713  O  OE1    . GLU A  1 742  ? 88.749  114.769 21.687  1.00 193.71 ?  802  GLU A OE1    1 
ATOM   5714  O  OE2    . GLU A  1 742  ? 89.912  115.879 20.178  1.00 193.24 -1 802  GLU A OE2    1 
ATOM   5715  N  N      . ASP A  1 743  ? 88.788  121.467 19.863  1.00 177.69 ?  803  ASP A N      1 
ATOM   5716  C  CA     . ASP A  1 743  ? 89.408  122.769 19.626  1.00 177.53 ?  803  ASP A CA     1 
ATOM   5717  C  C      . ASP A  1 743  ? 88.575  123.889 20.255  1.00 180.59 ?  803  ASP A C      1 
ATOM   5718  O  O      . ASP A  1 743  ? 89.140  124.832 20.804  1.00 180.09 ?  803  ASP A O      1 
ATOM   5719  C  CB     . ASP A  1 743  ? 89.609  123.011 18.124  1.00 179.40 ?  803  ASP A CB     1 
ATOM   5720  C  CG     . ASP A  1 743  ? 90.577  122.047 17.461  1.00 188.55 ?  803  ASP A CG     1 
ATOM   5721  O  OD1    . ASP A  1 743  ? 91.538  121.598 18.142  1.00 189.99 ?  803  ASP A OD1    1 
ATOM   5722  O  OD2    . ASP A  1 743  ? 90.330  121.673 16.285  1.00 193.12 -1 803  ASP A OD2    1 
ATOM   5723  N  N      . LEU A  1 744  ? 87.234  123.767 20.199  1.00 179.85 ?  804  LEU A N      1 
ATOM   5724  C  CA     . LEU A  1 744  ? 86.307  124.733 20.789  1.00 179.26 ?  804  LEU A CA     1 
ATOM   5725  C  C      . LEU A  1 744  ? 86.331  124.700 22.318  1.00 180.92 ?  804  LEU A C      1 
ATOM   5726  O  O      . LEU A  1 744  ? 86.140  125.747 22.942  1.00 180.75 ?  804  LEU A O      1 
ATOM   5727  C  CB     . LEU A  1 744  ? 84.891  124.503 20.279  1.00 174.93 ?  804  LEU A CB     1 
ATOM   5728  C  CG     . LEU A  1 744  ? 84.445  125.347 19.097  1.00 178.92 ?  804  LEU A CG     1 
ATOM   5729  C  CD1    . LEU A  1 744  ? 85.031  124.885 17.791  1.00 179.01 ?  804  LEU A CD1    1 
ATOM   5730  C  CD2    . LEU A  1 744  ? 82.935  125.356 18.990  1.00 178.47 ?  804  LEU A CD2    1 
ATOM   5731  N  N      . VAL A  1 745  ? 86.566  123.513 22.926  1.00 177.62 ?  805  VAL A N      1 
ATOM   5732  C  CA     . VAL A  1 745  ? 86.683  123.417 24.384  1.00 175.82 ?  805  VAL A CA     1 
ATOM   5733  C  C      . VAL A  1 745  ? 87.976  124.093 24.782  1.00 180.29 ?  805  VAL A C      1 
ATOM   5734  O  O      . VAL A  1 745  ? 87.980  124.917 25.700  1.00 180.46 ?  805  VAL A O      1 
ATOM   5735  C  CB     . VAL A  1 745  ? 86.689  121.995 24.966  1.00 177.41 ?  805  VAL A CB     1 
ATOM   5736  C  CG1    . VAL A  1 745  ? 86.217  122.026 26.417  1.00 176.61 ?  805  VAL A CG1    1 
ATOM   5737  C  CG2    . VAL A  1 745  ? 85.855  121.029 24.166  1.00 177.99 ?  805  VAL A CG2    1 
ATOM   5738  N  N      . ALA A  1 746  ? 89.073  123.735 24.079  1.00 178.65 ?  806  ALA A N      1 
ATOM   5739  C  CA     . ALA A  1 746  ? 90.419  124.264 24.285  1.00 180.07 ?  806  ALA A CA     1 
ATOM   5740  C  C      . ALA A  1 746  ? 90.467  125.794 24.231  1.00 183.36 ?  806  ALA A C      1 
ATOM   5741  O  O      . ALA A  1 746  ? 91.187  126.410 25.016  1.00 183.42 ?  806  ALA A O      1 
ATOM   5742  C  CB     . ALA A  1 746  ? 91.359  123.679 23.245  1.00 181.20 ?  806  ALA A CB     1 
ATOM   5743  N  N      . ASN A  1 747  ? 89.680  126.397 23.319  1.00 180.88 ?  807  ASN A N      1 
ATOM   5744  C  CA     . ASN A  1 747  ? 89.614  127.844 23.118  1.00 181.21 ?  807  ASN A CA     1 
ATOM   5745  C  C      . ASN A  1 747  ? 88.574  128.539 24.002  1.00 182.26 ?  807  ASN A C      1 
ATOM   5746  O  O      . ASN A  1 747  ? 88.359  129.749 23.866  1.00 181.65 ?  807  ASN A O      1 
ATOM   5747  C  CB     . ASN A  1 747  ? 89.408  128.157 21.638  1.00 183.49 ?  807  ASN A CB     1 
ATOM   5748  C  CG     . ASN A  1 747  ? 90.580  127.727 20.776  1.00 208.31 ?  807  ASN A CG     1 
ATOM   5749  O  OD1    . ASN A  1 747  ? 91.766  127.931 21.102  1.00 205.13 ?  807  ASN A OD1    1 
ATOM   5750  N  ND2    . ASN A  1 747  ? 90.269  127.119 19.649  1.00 204.19 ?  807  ASN A ND2    1 
ATOM   5751  N  N      . GLY A  1 748  ? 87.954  127.769 24.900  1.00 184.06 ?  808  GLY A N      1 
ATOM   5752  C  CA     . GLY A  1 748  ? 86.961  128.250 25.853  1.00 185.43 ?  808  GLY A CA     1 
ATOM   5753  C  C      . GLY A  1 748  ? 85.672  128.735 25.225  1.00 189.18 ?  808  GLY A C      1 
ATOM   5754  O  O      . GLY A  1 748  ? 84.931  129.491 25.860  1.00 191.34 ?  808  GLY A O      1 
ATOM   5755  N  N      . VAL A  1 749  ? 85.394  128.306 23.970  1.00 184.03 ?  809  VAL A N      1 
ATOM   5756  C  CA     . VAL A  1 749  ? 84.183  128.662 23.215  1.00 180.66 ?  809  VAL A CA     1 
ATOM   5757  C  C      . VAL A  1 749  ? 83.051  127.924 23.876  1.00 180.58 ?  809  VAL A C      1 
ATOM   5758  O  O      . VAL A  1 749  ? 81.970  128.488 24.063  1.00 179.52 ?  809  VAL A O      1 
ATOM   5759  C  CB     . VAL A  1 749  ? 84.302  128.305 21.713  1.00 181.74 ?  809  VAL A CB     1 
ATOM   5760  C  CG1    . VAL A  1 749  ? 83.147  128.883 20.920  1.00 180.26 ?  809  VAL A CG1    1 
ATOM   5761  C  CG2    . VAL A  1 749  ? 85.653  128.739 21.128  1.00 184.15 ?  809  VAL A CG2    1 
ATOM   5762  N  N      . ILE A  1 750  ? 83.325  126.661 24.254  1.00 175.84 ?  810  ILE A N      1 
ATOM   5763  C  CA     . ILE A  1 750  ? 82.382  125.798 24.941  1.00 173.40 ?  810  ILE A CA     1 
ATOM   5764  C  C      . ILE A  1 750  ? 82.913  125.479 26.344  1.00 179.84 ?  810  ILE A C      1 
ATOM   5765  O  O      . ILE A  1 750  ? 84.123  125.277 26.541  1.00 181.14 ?  810  ILE A O      1 
ATOM   5766  C  CB     . ILE A  1 750  ? 81.954  124.529 24.116  1.00 172.44 ?  810  ILE A CB     1 
ATOM   5767  C  CG1    . ILE A  1 750  ? 83.107  123.613 23.803  1.00 172.39 ?  810  ILE A CG1    1 
ATOM   5768  C  CG2    . ILE A  1 750  ? 81.175  124.838 22.848  1.00 172.23 ?  810  ILE A CG2    1 
ATOM   5769  C  CD1    . ILE A  1 750  ? 83.142  122.515 24.691  1.00 177.48 ?  810  ILE A CD1    1 
ATOM   5770  N  N      . VAL A  1 751  ? 81.990  125.440 27.309  1.00 176.15 ?  811  VAL A N      1 
ATOM   5771  C  CA     . VAL A  1 751  ? 82.243  125.082 28.700  1.00 177.06 ?  811  VAL A CA     1 
ATOM   5772  C  C      . VAL A  1 751  ? 81.266  123.942 28.996  1.00 178.31 ?  811  VAL A C      1 
ATOM   5773  O  O      . VAL A  1 751  ? 80.068  124.198 29.171  1.00 177.08 ?  811  VAL A O      1 
ATOM   5774  C  CB     . VAL A  1 751  ? 82.136  126.279 29.683  1.00 184.32 ?  811  VAL A CB     1 
ATOM   5775  C  CG1    . VAL A  1 751  ? 80.901  127.145 29.415  1.00 183.76 ?  811  VAL A CG1    1 
ATOM   5776  C  CG2    . VAL A  1 751  ? 82.182  125.810 31.133  1.00 185.40 ?  811  VAL A CG2    1 
ATOM   5777  N  N      . PRO A  1 752  ? 81.713  122.667 28.926  1.00 173.08 ?  812  PRO A N      1 
ATOM   5778  C  CA     . PRO A  1 752  ? 80.766  121.562 29.126  1.00 169.19 ?  812  PRO A CA     1 
ATOM   5779  C  C      . PRO A  1 752  ? 80.144  121.600 30.511  1.00 174.15 ?  812  PRO A C      1 
ATOM   5780  O  O      . PRO A  1 752  ? 80.849  121.824 31.508  1.00 176.71 ?  812  PRO A O      1 
ATOM   5781  C  CB     . PRO A  1 752  ? 81.601  120.301 28.866  1.00 169.86 ?  812  PRO A CB     1 
ATOM   5782  C  CG     . PRO A  1 752  ? 82.822  120.765 28.191  1.00 176.51 ?  812  PRO A CG     1 
ATOM   5783  C  CD     . PRO A  1 752  ? 83.076  122.157 28.687  1.00 175.77 ?  812  PRO A CD     1 
ATOM   5784  N  N      . ALA A  1 753  ? 78.803  121.474 30.543  1.00 168.11 ?  813  ALA A N      1 
ATOM   5785  C  CA     . ALA A  1 753  ? 77.995  121.495 31.758  1.00 168.03 ?  813  ALA A CA     1 
ATOM   5786  C  C      . ALA A  1 753  ? 78.117  120.176 32.519  1.00 169.17 ?  813  ALA A C      1 
ATOM   5787  O  O      . ALA A  1 753  ? 78.184  119.121 31.884  1.00 164.87 ?  813  ALA A O      1 
ATOM   5788  C  CB     . ALA A  1 753  ? 76.546  121.748 31.395  1.00 166.76 ?  813  ALA A CB     1 
ATOM   5789  N  N      . GLN A  1 754  ? 78.168  120.227 33.872  1.00 168.20 ?  814  GLN A N      1 
ATOM   5790  C  CA     . GLN A  1 754  ? 78.263  119.006 34.671  1.00 167.22 ?  814  GLN A CA     1 
ATOM   5791  C  C      . GLN A  1 754  ? 76.964  118.245 34.536  1.00 169.04 ?  814  GLN A C      1 
ATOM   5792  O  O      . GLN A  1 754  ? 75.887  118.849 34.561  1.00 168.74 ?  814  GLN A O      1 
ATOM   5793  C  CB     . GLN A  1 754  ? 78.623  119.265 36.138  1.00 172.16 ?  814  GLN A CB     1 
ATOM   5794  C  CG     . GLN A  1 754  ? 79.226  118.023 36.802  1.00 183.65 ?  814  GLN A CG     1 
ATOM   5795  C  CD     . GLN A  1 754  ? 79.360  118.152 38.287  1.00 199.78 ?  814  GLN A CD     1 
ATOM   5796  O  OE1    . GLN A  1 754  ? 80.164  118.944 38.797  1.00 196.75 ?  814  GLN A OE1    1 
ATOM   5797  N  NE2    . GLN A  1 754  ? 78.600  117.338 39.011  1.00 195.62 ?  814  GLN A NE2    1 
ATOM   5798  N  N      . GLU A  1 755  ? 77.074  116.931 34.308  1.00 163.44 ?  815  GLU A N      1 
ATOM   5799  C  CA     . GLU A  1 755  ? 75.937  116.067 34.056  1.00 159.15 ?  815  GLU A CA     1 
ATOM   5800  C  C      . GLU A  1 755  ? 75.092  115.801 35.281  1.00 161.47 ?  815  GLU A C      1 
ATOM   5801  O  O      . GLU A  1 755  ? 75.596  115.421 36.343  1.00 162.83 ?  815  GLU A O      1 
ATOM   5802  C  CB     . GLU A  1 755  ? 76.379  114.773 33.379  1.00 158.65 ?  815  GLU A CB     1 
ATOM   5803  C  CG     . GLU A  1 755  ? 76.318  114.873 31.865  1.00 170.67 ?  815  GLU A CG     1 
ATOM   5804  C  CD     . GLU A  1 755  ? 75.048  114.355 31.221  1.00 204.94 ?  815  GLU A CD     1 
ATOM   5805  O  OE1    . GLU A  1 755  ? 73.956  114.450 31.835  1.00 205.46 ?  815  GLU A OE1    1 
ATOM   5806  O  OE2    . GLU A  1 755  ? 75.154  113.859 30.076  1.00 206.03 -1 815  GLU A OE2    1 
ATOM   5807  N  N      . VAL A  1 756  ? 73.786  116.040 35.109  1.00 155.01 ?  816  VAL A N      1 
ATOM   5808  C  CA     . VAL A  1 756  ? 72.735  115.822 36.096  1.00 153.30 ?  816  VAL A CA     1 
ATOM   5809  C  C      . VAL A  1 756  ? 71.874  114.599 35.646  1.00 151.33 ?  816  VAL A C      1 
ATOM   5810  O  O      . VAL A  1 756  ? 71.535  114.496 34.449  1.00 148.16 ?  816  VAL A O      1 
ATOM   5811  C  CB     . VAL A  1 756  ? 71.914  117.122 36.373  1.00 158.52 ?  816  VAL A CB     1 
ATOM   5812  C  CG1    . VAL A  1 756  ? 71.167  117.607 35.134  1.00 156.95 ?  816  VAL A CG1    1 
ATOM   5813  C  CG2    . VAL A  1 756  ? 70.963  116.965 37.551  1.00 158.28 ?  816  VAL A CG2    1 
ATOM   5814  N  N      . PRO A  1 757  ? 71.591  113.638 36.579  1.00 146.03 ?  817  PRO A N      1 
ATOM   5815  C  CA     . PRO A  1 757  ? 70.762  112.477 36.213  1.00 141.59 ?  817  PRO A CA     1 
ATOM   5816  C  C      . PRO A  1 757  ? 69.321  112.918 35.970  1.00 140.88 ?  817  PRO A C      1 
ATOM   5817  O  O      . PRO A  1 757  ? 68.838  113.854 36.631  1.00 141.36 ?  817  PRO A O      1 
ATOM   5818  C  CB     . PRO A  1 757  ? 70.862  111.542 37.430  1.00 143.43 ?  817  PRO A CB     1 
ATOM   5819  C  CG     . PRO A  1 757  ? 71.856  112.144 38.328  1.00 151.97 ?  817  PRO A CG     1 
ATOM   5820  C  CD     . PRO A  1 757  ? 71.936  113.593 38.012  1.00 149.90 ?  817  PRO A CD     1 
ATOM   5821  N  N      . PRO A  1 758  ? 68.640  112.278 34.992  1.00 132.27 ?  818  PRO A N      1 
ATOM   5822  C  CA     . PRO A  1 758  ? 67.285  112.722 34.648  1.00 130.98 ?  818  PRO A CA     1 
ATOM   5823  C  C      . PRO A  1 758  ? 66.167  111.996 35.404  1.00 134.12 ?  818  PRO A C      1 
ATOM   5824  O  O      . PRO A  1 758  ? 66.449  110.942 35.988  1.00 133.16 ?  818  PRO A O      1 
ATOM   5825  C  CB     . PRO A  1 758  ? 67.224  112.438 33.153  1.00 130.99 ?  818  PRO A CB     1 
ATOM   5826  C  CG     . PRO A  1 758  ? 68.114  111.254 32.975  1.00 133.73 ?  818  PRO A CG     1 
ATOM   5827  C  CD     . PRO A  1 758  ? 69.098  111.199 34.089  1.00 130.77 ?  818  PRO A CD     1 
ATOM   5828  N  N      . PRO A  1 759  ? 64.891  112.496 35.368  1.00 129.93 ?  819  PRO A N      1 
ATOM   5829  C  CA     . PRO A  1 759  ? 63.795  111.761 36.029  1.00 127.98 ?  819  PRO A CA     1 
ATOM   5830  C  C      . PRO A  1 759  ? 63.624  110.343 35.485  1.00 129.98 ?  819  PRO A C      1 
ATOM   5831  O  O      . PRO A  1 759  ? 63.906  110.048 34.315  1.00 128.61 ?  819  PRO A O      1 
ATOM   5832  C  CB     . PRO A  1 759  ? 62.556  112.623 35.758  1.00 130.29 ?  819  PRO A CB     1 
ATOM   5833  C  CG     . PRO A  1 759  ? 63.078  113.963 35.413  1.00 137.37 ?  819  PRO A CG     1 
ATOM   5834  C  CD     . PRO A  1 759  ? 64.392  113.736 34.736  1.00 132.59 ?  819  PRO A CD     1 
ATOM   5835  N  N      . THR A  1 760  ? 63.194  109.458 36.363  1.00 126.71 ?  820  THR A N      1 
ATOM   5836  C  CA     . THR A  1 760  ? 63.024  108.052 36.048  1.00 124.79 ?  820  THR A CA     1 
ATOM   5837  C  C      . THR A  1 760  ? 61.546  107.715 35.706  1.00 128.67 ?  820  THR A C      1 
ATOM   5838  O  O      . THR A  1 760  ? 60.607  108.087 36.438  1.00 128.67 ?  820  THR A O      1 
ATOM   5839  C  CB     . THR A  1 760  ? 63.646  107.205 37.164  1.00 131.57 ?  820  THR A CB     1 
ATOM   5840  O  OG1    . THR A  1 760  ? 63.208  105.860 37.033  1.00 133.87 ?  820  THR A OG1    1 
ATOM   5841  C  CG2    . THR A  1 760  ? 63.334  107.730 38.574  1.00 129.85 ?  820  THR A CG2    1 
ATOM   5842  N  N      . VAL A  1 761  ? 61.372  107.024 34.560  1.00 123.84 ?  821  VAL A N      1 
ATOM   5843  C  CA     . VAL A  1 761  ? 60.078  106.603 34.019  1.00 122.38 ?  821  VAL A CA     1 
ATOM   5844  C  C      . VAL A  1 761  ? 59.915  105.061 34.171  1.00 124.92 ?  821  VAL A C      1 
ATOM   5845  O  O      . VAL A  1 761  ? 60.849  104.325 33.819  1.00 123.29 ?  821  VAL A O      1 
ATOM   5846  C  CB     . VAL A  1 761  ? 59.949  107.058 32.540  1.00 126.38 ?  821  VAL A CB     1 
ATOM   5847  C  CG1    . VAL A  1 761  ? 58.586  106.694 31.935  1.00 125.69 ?  821  VAL A CG1    1 
ATOM   5848  C  CG2    . VAL A  1 761  ? 60.221  108.545 32.397  1.00 127.53 ?  821  VAL A CG2    1 
ATOM   5849  N  N      . PRO A  1 762  ? 58.738  104.553 34.654  1.00 121.23 ?  822  PRO A N      1 
ATOM   5850  C  CA     . PRO A  1 762  ? 58.563  103.097 34.793  1.00 119.92 ?  822  PRO A CA     1 
ATOM   5851  C  C      . PRO A  1 762  ? 58.518  102.384 33.449  1.00 125.77 ?  822  PRO A C      1 
ATOM   5852  O  O      . PRO A  1 762  ? 58.130  102.983 32.440  1.00 127.70 ?  822  PRO A O      1 
ATOM   5853  C  CB     . PRO A  1 762  ? 57.215  102.955 35.524  1.00 120.37 ?  822  PRO A CB     1 
ATOM   5854  C  CG     . PRO A  1 762  ? 56.929  104.272 36.068  1.00 125.90 ?  822  PRO A CG     1 
ATOM   5855  C  CD     . PRO A  1 762  ? 57.526  105.254 35.110  1.00 122.81 ?  822  PRO A CD     1 
ATOM   5856  N  N      . MET A  1 763  ? 58.918  101.103 33.436  1.00 120.78 ?  823  MET A N      1 
ATOM   5857  C  CA     . MET A  1 763  ? 58.928  100.284 32.228  1.00 120.19 ?  823  MET A CA     1 
ATOM   5858  C  C      . MET A  1 763  ? 57.498  99.951  31.925  1.00 121.83 ?  823  MET A C      1 
ATOM   5859  O  O      . MET A  1 763  ? 56.762  99.665  32.856  1.00 120.67 ?  823  MET A O      1 
ATOM   5860  C  CB     . MET A  1 763  ? 59.712  98.997  32.488  1.00 122.68 ?  823  MET A CB     1 
ATOM   5861  C  CG     . MET A  1 763  ? 59.971  98.200  31.253  1.00 128.29 ?  823  MET A CG     1 
ATOM   5862  S  SD     . MET A  1 763  ? 60.744  96.614  31.657  1.00 134.20 ?  823  MET A SD     1 
ATOM   5863  C  CE     . MET A  1 763  ? 62.460  97.065  31.604  1.00 132.44 ?  823  MET A CE     1 
ATOM   5864  N  N      . ASP A  1 764  ? 57.062  100.033 30.667  1.00 118.78 ?  824  ASP A N      1 
ATOM   5865  C  CA     . ASP A  1 764  ? 55.676  99.647  30.373  1.00 118.91 ?  824  ASP A CA     1 
ATOM   5866  C  C      . ASP A  1 764  ? 55.566  98.106  30.586  1.00 118.94 ?  824  ASP A C      1 
ATOM   5867  O  O      . ASP A  1 764  ? 56.548  97.368  30.396  1.00 117.59 ?  824  ASP A O      1 
ATOM   5868  C  CB     . ASP A  1 764  ? 55.226  100.063 28.949  1.00 124.14 ?  824  ASP A CB     1 
ATOM   5869  C  CG     . ASP A  1 764  ? 55.753  101.401 28.414  1.00 142.43 ?  824  ASP A CG     1 
ATOM   5870  O  OD1    . ASP A  1 764  ? 56.817  101.401 27.732  1.00 144.96 ?  824  ASP A OD1    1 
ATOM   5871  O  OD2    . ASP A  1 764  ? 55.050  102.424 28.578  1.00 148.58 -1 824  ASP A OD2    1 
ATOM   5872  N  N      . TYR A  1 765  ? 54.399  97.642  31.047  1.00 113.53 ?  825  TYR A N      1 
ATOM   5873  C  CA     . TYR A  1 765  ? 54.154  96.235  31.374  1.00 112.42 ?  825  TYR A CA     1 
ATOM   5874  C  C      . TYR A  1 765  ? 54.532  95.319  30.234  1.00 118.17 ?  825  TYR A C      1 
ATOM   5875  O  O      . TYR A  1 765  ? 55.119  94.264  30.439  1.00 117.15 ?  825  TYR A O      1 
ATOM   5876  C  CB     . TYR A  1 765  ? 52.673  96.056  31.767  1.00 112.57 ?  825  TYR A CB     1 
ATOM   5877  C  CG     . TYR A  1 765  ? 52.167  94.630  31.885  1.00 113.23 ?  825  TYR A CG     1 
ATOM   5878  C  CD1    . TYR A  1 765  ? 52.367  93.893  33.043  1.00 113.77 ?  825  TYR A CD1    1 
ATOM   5879  C  CD2    . TYR A  1 765  ? 51.383  94.068  30.891  1.00 115.49 ?  825  TYR A CD2    1 
ATOM   5880  C  CE1    . TYR A  1 765  ? 51.851  92.604  33.180  1.00 115.00 ?  825  TYR A CE1    1 
ATOM   5881  C  CE2    . TYR A  1 765  ? 50.892  92.769  31.000  1.00 116.92 ?  825  TYR A CE2    1 
ATOM   5882  C  CZ     . TYR A  1 765  ? 51.123  92.038  32.149  1.00 122.00 ?  825  TYR A CZ     1 
ATOM   5883  O  OH     . TYR A  1 765  ? 50.625  90.754  32.247  1.00 120.90 ?  825  TYR A OH     1 
ATOM   5884  N  N      . SER A  1 766  ? 54.199  95.754  29.037  1.00 118.46 ?  826  SER A N      1 
ATOM   5885  C  CA     . SER A  1 766  ? 54.370  95.071  27.769  1.00 122.19 ?  826  SER A CA     1 
ATOM   5886  C  C      . SER A  1 766  ? 55.774  94.551  27.552  1.00 128.00 ?  826  SER A C      1 
ATOM   5887  O  O      . SER A  1 766  ? 55.948  93.355  27.346  1.00 128.84 ?  826  SER A O      1 
ATOM   5888  C  CB     . SER A  1 766  ? 53.920  95.992  26.641  1.00 130.07 ?  826  SER A CB     1 
ATOM   5889  O  OG     . SER A  1 766  ? 54.760  97.140  26.588  1.00 142.40 ?  826  SER A OG     1 
ATOM   5890  N  N      . TRP A  1 767  ? 56.767  95.432  27.666  1.00 126.35 ?  827  TRP A N      1 
ATOM   5891  C  CA     . TRP A  1 767  ? 58.188  95.129  27.522  1.00 128.61 ?  827  TRP A CA     1 
ATOM   5892  C  C      . TRP A  1 767  ? 58.635  94.222  28.671  1.00 127.45 ?  827  TRP A C      1 
ATOM   5893  O  O      . TRP A  1 767  ? 59.275  93.203  28.417  1.00 129.35 ?  827  TRP A O      1 
ATOM   5894  C  CB     . TRP A  1 767  ? 58.967  96.447  27.523  1.00 128.90 ?  827  TRP A CB     1 
ATOM   5895  C  CG     . TRP A  1 767  ? 60.425  96.409  27.165  1.00 133.03 ?  827  TRP A CG     1 
ATOM   5896  C  CD1    . TRP A  1 767  ? 61.461  96.242  28.031  1.00 135.55 ?  827  TRP A CD1    1 
ATOM   5897  C  CD2    . TRP A  1 767  ? 61.007  96.886  25.941  1.00 136.16 ?  827  TRP A CD2    1 
ATOM   5898  N  NE1    . TRP A  1 767  ? 62.658  96.470  27.397  1.00 137.04 ?  827  TRP A NE1    1 
ATOM   5899  C  CE2    . TRP A  1 767  ? 62.411  96.901  26.122  1.00 141.01 ?  827  TRP A CE2    1 
ATOM   5900  C  CE3    . TRP A  1 767  ? 60.477  97.311  24.701  1.00 140.06 ?  827  TRP A CE3    1 
ATOM   5901  C  CZ2    . TRP A  1 767  ? 63.298  97.314  25.107  1.00 143.29 ?  827  TRP A CZ2    1 
ATOM   5902  C  CZ3    . TRP A  1 767  ? 61.355  97.714  23.692  1.00 144.09 ?  827  TRP A CZ3    1 
ATOM   5903  C  CH2    . TRP A  1 767  ? 62.748  97.710  23.896  1.00 145.23 ?  827  TRP A CH2    1 
ATOM   5904  N  N      . ALA A  1 768  ? 58.242  94.556  29.920  1.00 117.46 ?  828  ALA A N      1 
ATOM   5905  C  CA     . ALA A  1 768  ? 58.588  93.796  31.126  1.00 113.81 ?  828  ALA A CA     1 
ATOM   5906  C  C      . ALA A  1 768  ? 58.248  92.323  31.012  1.00 113.81 ?  828  ALA A C      1 
ATOM   5907  O  O      . ALA A  1 768  ? 59.082  91.493  31.339  1.00 112.65 ?  828  ALA A O      1 
ATOM   5908  C  CB     . ALA A  1 768  ? 57.930  94.414  32.357  1.00 112.06 ?  828  ALA A CB     1 
ATOM   5909  N  N      . ARG A  1 769  ? 57.069  92.012  30.482  1.00 110.57 ?  829  ARG A N      1 
ATOM   5910  C  CA     . ARG A  1 769  ? 56.688  90.589  30.317  1.00 112.09 ?  829  ARG A CA     1 
ATOM   5911  C  C      . ARG A  1 769  ? 57.575  89.989  29.230  1.00 121.36 ?  829  ARG A C      1 
ATOM   5912  O  O      . ARG A  1 769  ? 58.109  88.891  29.431  1.00 121.78 ?  829  ARG A O      1 
ATOM   5913  C  CB     . ARG A  1 769  ? 55.228  90.477  29.876  1.00 109.76 ?  829  ARG A CB     1 
ATOM   5914  C  CG     . ARG A  1 769  ? 54.231  91.067  30.860  1.00 106.67 ?  829  ARG A CG     1 
ATOM   5915  C  CD     . ARG A  1 769  ? 53.113  90.098  31.185  1.00 115.04 ?  829  ARG A CD     1 
ATOM   5916  N  NE     . ARG A  1 769  ? 53.589  88.728  31.150  1.00 132.67 ?  829  ARG A NE     1 
ATOM   5917  C  CZ     . ARG A  1 769  ? 52.817  87.664  31.310  1.00 156.32 ?  829  ARG A CZ     1 
ATOM   5918  N  NH1    . ARG A  1 769  ? 53.330  86.535  31.762  1.00 152.36 1  829  ARG A NH1    1 
ATOM   5919  N  NH2    . ARG A  1 769  ? 51.533  87.731  31.018  1.00 137.36 ?  829  ARG A NH2    1 
ATOM   5920  N  N      . GLU A  1 770  ? 57.725  90.721  28.129  1.00 121.35 ?  830  GLU A N      1 
ATOM   5921  C  CA     . GLU A  1 770  ? 58.515  90.272  26.974  1.00 125.29 ?  830  GLU A CA     1 
ATOM   5922  C  C      . GLU A  1 770  ? 59.923  89.870  27.395  1.00 129.34 ?  830  GLU A C      1 
ATOM   5923  O  O      . GLU A  1 770  ? 60.359  88.778  27.043  1.00 131.72 ?  830  GLU A O      1 
ATOM   5924  C  CB     . GLU A  1 770  ? 58.536  91.332  25.859  1.00 128.32 ?  830  GLU A CB     1 
ATOM   5925  C  CG     . GLU A  1 770  ? 58.922  90.783  24.486  1.00 153.40 ?  830  GLU A CG     1 
ATOM   5926  C  CD     . GLU A  1 770  ? 58.965  91.753  23.316  1.00 192.29 ?  830  GLU A CD     1 
ATOM   5927  O  OE1    . GLU A  1 770  ? 59.528  91.390  22.254  1.00 191.83 ?  830  GLU A OE1    1 
ATOM   5928  O  OE2    . GLU A  1 770  ? 58.388  92.858  23.439  1.00 192.27 -1 830  GLU A OE2    1 
ATOM   5929  N  N      . LEU A  1 771  ? 60.601  90.693  28.211  1.00 124.84 ?  831  LEU A N      1 
ATOM   5930  C  CA     . LEU A  1 771  ? 61.932  90.340  28.732  1.00 126.89 ?  831  LEU A CA     1 
ATOM   5931  C  C      . LEU A  1 771  ? 61.844  89.375  29.946  1.00 132.57 ?  831  LEU A C      1 
ATOM   5932  O  O      . LEU A  1 771  ? 62.866  89.104  30.604  1.00 133.47 ?  831  LEU A O      1 
ATOM   5933  C  CB     . LEU A  1 771  ? 62.764  91.566  29.153  1.00 125.68 ?  831  LEU A CB     1 
ATOM   5934  C  CG     . LEU A  1 771  ? 62.655  92.858  28.413  1.00 130.62 ?  831  LEU A CG     1 
ATOM   5935  C  CD1    . LEU A  1 771  ? 63.432  93.906  29.087  1.00 128.25 ?  831  LEU A CD1    1 
ATOM   5936  C  CD2    . LEU A  1 771  ? 63.295  92.707  27.077  1.00 135.94 ?  831  LEU A CD2    1 
ATOM   5937  N  N      . GLY A  1 772  ? 60.623  88.903  30.240  1.00 128.44 ?  832  GLY A N      1 
ATOM   5938  C  CA     . GLY A  1 772  ? 60.297  87.973  31.324  1.00 127.48 ?  832  GLY A CA     1 
ATOM   5939  C  C      . GLY A  1 772  ? 60.727  88.385  32.719  1.00 127.57 ?  832  GLY A C      1 
ATOM   5940  O  O      . GLY A  1 772  ? 61.060  87.529  33.544  1.00 128.88 ?  832  GLY A O      1 
ATOM   5941  N  N      . LEU A  1 773  ? 60.722  89.687  32.991  1.00 118.93 ?  833  LEU A N      1 
ATOM   5942  C  CA     . LEU A  1 773  ? 61.116  90.221  34.284  1.00 115.86 ?  833  LEU A CA     1 
ATOM   5943  C  C      . LEU A  1 773  ? 59.971  90.148  35.278  1.00 113.13 ?  833  LEU A C      1 
ATOM   5944  O  O      . LEU A  1 773  ? 60.202  90.070  36.487  1.00 113.50 ?  833  LEU A O      1 
ATOM   5945  C  CB     . LEU A  1 773  ? 61.584  91.656  34.114  1.00 115.59 ?  833  LEU A CB     1 
ATOM   5946  C  CG     . LEU A  1 773  ? 62.475  91.913  32.900  1.00 122.21 ?  833  LEU A CG     1 
ATOM   5947  C  CD1    . LEU A  1 773  ? 62.232  93.270  32.367  1.00 121.44 ?  833  LEU A CD1    1 
ATOM   5948  C  CD2    . LEU A  1 773  ? 63.940  91.744  33.232  1.00 128.37 ?  833  LEU A CD2    1 
ATOM   5949  N  N      . ILE A  1 774  ? 58.738  90.183  34.779  1.00 104.45 ?  834  ILE A N      1 
ATOM   5950  C  CA     . ILE A  1 774  ? 57.557  90.083  35.627  1.00 101.01 ?  834  ILE A CA     1 
ATOM   5951  C  C      . ILE A  1 774  ? 56.710  88.895  35.217  1.00 105.95 ?  834  ILE A C      1 
ATOM   5952  O  O      . ILE A  1 774  ? 56.917  88.323  34.141  1.00 108.83 ?  834  ILE A O      1 
ATOM   5953  C  CB     . ILE A  1 774  ? 56.727  91.405  35.757  1.00 101.23 ?  834  ILE A CB     1 
ATOM   5954  C  CG1    . ILE A  1 774  ? 56.156  91.869  34.419  1.00 101.75 ?  834  ILE A CG1    1 
ATOM   5955  C  CG2    . ILE A  1 774  ? 57.502  92.528  36.441  1.00 99.58  ?  834  ILE A CG2    1 
ATOM   5956  C  CD1    . ILE A  1 774  ? 54.859  91.477  34.232  1.00 105.91 ?  834  ILE A CD1    1 
ATOM   5957  N  N      . ARG A  1 775  ? 55.749  88.536  36.082  1.00 100.83 ?  835  ARG A N      1 
ATOM   5958  C  CA     . ARG A  1 775  ? 54.784  87.457  35.883  1.00 101.44 ?  835  ARG A CA     1 
ATOM   5959  C  C      . ARG A  1 775  ? 53.469  87.902  36.425  1.00 105.24 ?  835  ARG A C      1 
ATOM   5960  O  O      . ARG A  1 775  ? 53.400  88.423  37.540  1.00 102.98 ?  835  ARG A O      1 
ATOM   5961  C  CB     . ARG A  1 775  ? 55.231  86.125  36.516  1.00 103.62 ?  835  ARG A CB     1 
ATOM   5962  C  CG     . ARG A  1 775  ? 55.421  86.089  38.044  1.00 111.38 ?  835  ARG A CG     1 
ATOM   5963  C  CD     . ARG A  1 775  ? 55.897  84.719  38.515  1.00 124.18 ?  835  ARG A CD     1 
ATOM   5964  N  NE     . ARG A  1 775  ? 55.782  84.583  39.970  1.00 132.70 ?  835  ARG A NE     1 
ATOM   5965  C  CZ     . ARG A  1 775  ? 56.104  83.495  40.670  1.00 131.77 ?  835  ARG A CZ     1 
ATOM   5966  N  NH1    . ARG A  1 775  ? 56.584  82.419  40.056  1.00 94.60  1  835  ARG A NH1    1 
ATOM   5967  N  NH2    . ARG A  1 775  ? 55.950  83.479  41.991  1.00 116.08 ?  835  ARG A NH2    1 
ATOM   5968  N  N      . LYS A  1 776  ? 52.439  87.794  35.598  1.00 104.93 ?  836  LYS A N      1 
ATOM   5969  C  CA     . LYS A  1 776  ? 51.068  88.178  35.964  1.00 104.08 ?  836  LYS A CA     1 
ATOM   5970  C  C      . LYS A  1 776  ? 50.111  87.042  35.572  1.00 109.86 ?  836  LYS A C      1 
ATOM   5971  O  O      . LYS A  1 776  ? 50.124  86.552  34.412  1.00 114.22 ?  836  LYS A O      1 
ATOM   5972  C  CB     . LYS A  1 776  ? 50.636  89.523  35.337  1.00 106.39 ?  836  LYS A CB     1 
ATOM   5973  C  CG     . LYS A  1 776  ? 49.447  90.198  36.045  1.00 117.85 ?  836  LYS A CG     1 
ATOM   5974  C  CD     . LYS A  1 776  ? 48.671  91.230  35.202  1.00 119.83 ?  836  LYS A CD     1 
ATOM   5975  C  CE     . LYS A  1 776  ? 47.214  90.833  35.046  1.00 125.79 ?  836  LYS A CE     1 
ATOM   5976  N  NZ     . LYS A  1 776  ? 47.037  89.754  34.013  1.00 137.01 1  836  LYS A NZ     1 
ATOM   5977  N  N      . PRO A  1 777  ? 49.315  86.571  36.547  1.00 101.26 ?  837  PRO A N      1 
ATOM   5978  C  CA     . PRO A  1 777  ? 48.432  85.449  36.269  1.00 102.60 ?  837  PRO A CA     1 
ATOM   5979  C  C      . PRO A  1 777  ? 47.211  85.800  35.414  1.00 106.82 ?  837  PRO A C      1 
ATOM   5980  O  O      . PRO A  1 777  ? 46.625  86.865  35.574  1.00 107.56 ?  837  PRO A O      1 
ATOM   5981  C  CB     . PRO A  1 777  ? 48.069  84.935  37.667  1.00 102.47 ?  837  PRO A CB     1 
ATOM   5982  C  CG     . PRO A  1 777  ? 48.928  85.695  38.610  1.00 104.24 ?  837  PRO A CG     1 
ATOM   5983  C  CD     . PRO A  1 777  ? 49.198  86.977  37.949  1.00 99.36  ?  837  PRO A CD     1 
ATOM   5984  N  N      . ALA A  1 778  ? 46.827  84.892  34.509  1.00 105.68 ?  838  ALA A N      1 
ATOM   5985  C  CA     . ALA A  1 778  ? 45.647  85.073  33.676  1.00 102.75 ?  838  ALA A CA     1 
ATOM   5986  C  C      . ALA A  1 778  ? 44.425  84.827  34.549  1.00 104.70 ?  838  ALA A C      1 
ATOM   5987  O  O      . ALA A  1 778  ? 44.411  83.894  35.349  1.00 105.73 ?  838  ALA A O      1 
ATOM   5988  C  CB     . ALA A  1 778  ? 45.660  84.089  32.519  1.00 103.59 ?  838  ALA A CB     1 
ATOM   5989  N  N      . SER A  1 779  ? 43.427  85.690  34.434  1.00 98.70  ?  839  SER A N      1 
ATOM   5990  C  CA     . SER A  1 779  ? 42.189  85.599  35.190  1.00 97.52  ?  839  SER A CA     1 
ATOM   5991  C  C      . SER A  1 779  ? 41.220  84.637  34.508  1.00 102.27 ?  839  SER A C      1 
ATOM   5992  O  O      . SER A  1 779  ? 40.317  84.126  35.166  1.00 102.21 ?  839  SER A O      1 
ATOM   5993  C  CB     . SER A  1 779  ? 41.528  86.971  35.273  1.00 101.10 ?  839  SER A CB     1 
ATOM   5994  O  OG     . SER A  1 779  ? 42.436  88.018  35.583  1.00 113.38 ?  839  SER A OG     1 
ATOM   5995  N  N      . PHE A  1 780  ? 41.378  84.431  33.183  1.00 99.00  ?  840  PHE A N      1 
ATOM   5996  C  CA     . PHE A  1 780  ? 40.503  83.603  32.348  1.00 98.26  ?  840  PHE A CA     1 
ATOM   5997  C  C      . PHE A  1 780  ? 41.148  82.355  31.801  1.00 105.67 ?  840  PHE A C      1 
ATOM   5998  O  O      . PHE A  1 780  ? 42.380  82.236  31.762  1.00 106.03 ?  840  PHE A O      1 
ATOM   5999  C  CB     . PHE A  1 780  ? 39.938  84.424  31.187  1.00 98.28  ?  840  PHE A CB     1 
ATOM   6000  C  CG     . PHE A  1 780  ? 38.963  85.473  31.642  1.00 97.59  ?  840  PHE A CG     1 
ATOM   6001  C  CD1    . PHE A  1 780  ? 37.625  85.165  31.837  1.00 99.53  ?  840  PHE A CD1    1 
ATOM   6002  C  CD2    . PHE A  1 780  ? 39.385  86.755  31.923  1.00 98.66  ?  840  PHE A CD2    1 
ATOM   6003  C  CE1    . PHE A  1 780  ? 36.728  86.135  32.290  1.00 99.08  ?  840  PHE A CE1    1 
ATOM   6004  C  CE2    . PHE A  1 780  ? 38.487  87.719  32.379  1.00 100.21 ?  840  PHE A CE2    1 
ATOM   6005  C  CZ     . PHE A  1 780  ? 37.168  87.402  32.566  1.00 97.22  ?  840  PHE A CZ     1 
ATOM   6006  N  N      . MET A  1 781  ? 40.280  81.423  31.331  1.00 102.22 ?  841  MET A N      1 
ATOM   6007  C  CA     . MET A  1 781  ? 40.723  80.160  30.757  1.00 102.13 ?  841  MET A CA     1 
ATOM   6008  C  C      . MET A  1 781  ? 39.737  79.638  29.738  1.00 103.03 ?  841  MET A C      1 
ATOM   6009  O  O      . MET A  1 781  ? 38.566  79.492  30.048  1.00 101.75 ?  841  MET A O      1 
ATOM   6010  C  CB     . MET A  1 781  ? 40.909  79.142  31.855  1.00 105.20 ?  841  MET A CB     1 
ATOM   6011  C  CG     . MET A  1 781  ? 41.933  78.140  31.528  1.00 110.53 ?  841  MET A CG     1 
ATOM   6012  S  SD     . MET A  1 781  ? 42.036  76.814  32.731  1.00 115.92 ?  841  MET A SD     1 
ATOM   6013  C  CE     . MET A  1 781  ? 42.104  77.800  34.373  1.00 111.68 ?  841  MET A CE     1 
ATOM   6014  N  N      . THR A  1 782  ? 40.200  79.400  28.513  1.00 99.05  ?  842  THR A N      1 
ATOM   6015  C  CA     . THR A  1 782  ? 39.372  78.919  27.407  1.00 98.41  ?  842  THR A CA     1 
ATOM   6016  C  C      . THR A  1 782  ? 39.999  77.670  26.821  1.00 101.32 ?  842  THR A C      1 
ATOM   6017  O  O      . THR A  1 782  ? 41.178  77.434  27.023  1.00 100.31 ?  842  THR A O      1 
ATOM   6018  C  CB     . THR A  1 782  ? 39.087  80.041  26.354  1.00 108.98 ?  842  THR A CB     1 
ATOM   6019  O  OG1    . THR A  1 782  ? 37.880  79.750  25.637  1.00 111.22 ?  842  THR A OG1    1 
ATOM   6020  C  CG2    . THR A  1 782  ? 40.238  80.265  25.378  1.00 104.85 ?  842  THR A CG2    1 
ATOM   6021  N  N      . SER A  1 783  ? 39.211  76.868  26.101  1.00 97.25  ?  843  SER A N      1 
ATOM   6022  C  CA     . SER A  1 783  ? 39.688  75.645  25.485  1.00 96.21  ?  843  SER A CA     1 
ATOM   6023  C  C      . SER A  1 783  ? 38.983  75.293  24.171  1.00 97.27  ?  843  SER A C      1 
ATOM   6024  O  O      . SER A  1 783  ? 39.314  74.267  23.586  1.00 98.34  ?  843  SER A O      1 
ATOM   6025  C  CB     . SER A  1 783  ? 39.565  74.502  26.483  1.00 98.48  ?  843  SER A CB     1 
ATOM   6026  O  OG     . SER A  1 783  ? 38.243  74.408  26.981  1.00 99.66  ?  843  SER A OG     1 
ATOM   6027  N  N      . ILE A  1 784  ? 38.045  76.119  23.686  1.00 91.33  ?  844  ILE A N      1 
ATOM   6028  C  CA     . ILE A  1 784  ? 37.264  75.791  22.488  1.00 90.82  ?  844  ILE A CA     1 
ATOM   6029  C  C      . ILE A  1 784  ? 37.679  76.505  21.199  1.00 97.55  ?  844  ILE A C      1 
ATOM   6030  O  O      . ILE A  1 784  ? 37.479  75.935  20.122  1.00 97.29  ?  844  ILE A O      1 
ATOM   6031  C  CB     . ILE A  1 784  ? 35.747  75.961  22.711  1.00 91.82  ?  844  ILE A CB     1 
ATOM   6032  C  CG1    . ILE A  1 784  ? 35.276  77.419  22.479  1.00 89.63  ?  844  ILE A CG1    1 
ATOM   6033  C  CG2    . ILE A  1 784  ? 35.349  75.407  24.079  1.00 93.56  ?  844  ILE A CG2    1 
ATOM   6034  C  CD1    . ILE A  1 784  ? 33.807  77.622  22.631  1.00 89.43  ?  844  ILE A CD1    1 
ATOM   6035  N  N      . CYS A  1 785  ? 38.184  77.746  21.287  1.00 96.01  ?  845  CYS A N      1 
ATOM   6036  C  CA     . CYS A  1 785  ? 38.532  78.454  20.066  1.00 97.10  ?  845  CYS A CA     1 
ATOM   6037  C  C      . CYS A  1 785  ? 39.752  79.347  20.281  1.00 101.61 ?  845  CYS A C      1 
ATOM   6038  O  O      . CYS A  1 785  ? 39.875  79.932  21.358  1.00 99.82  ?  845  CYS A O      1 
ATOM   6039  C  CB     . CYS A  1 785  ? 37.320  79.243  19.578  1.00 96.65  ?  845  CYS A CB     1 
ATOM   6040  S  SG     . CYS A  1 785  ? 37.639  80.343  18.172  1.00 100.85 ?  845  CYS A SG     1 
ATOM   6041  N  N      . ASP A  1 786  ? 40.656  79.418  19.264  1.00 99.86  ?  846  ASP A N      1 
ATOM   6042  C  CA     . ASP A  1 786  ? 41.837  80.279  19.270  1.00 100.77 ?  846  ASP A CA     1 
ATOM   6043  C  C      . ASP A  1 786  ? 41.904  81.169  18.013  1.00 107.77 ?  846  ASP A C      1 
ATOM   6044  O  O      . ASP A  1 786  ? 42.283  80.726  16.911  1.00 108.78 ?  846  ASP A O      1 
ATOM   6045  C  CB     . ASP A  1 786  ? 43.136  79.500  19.490  1.00 103.77 ?  846  ASP A CB     1 
ATOM   6046  C  CG     . ASP A  1 786  ? 44.414  80.342  19.655  1.00 110.54 ?  846  ASP A CG     1 
ATOM   6047  O  OD1    . ASP A  1 786  ? 44.340  81.584  19.529  1.00 107.21 ?  846  ASP A OD1    1 
ATOM   6048  O  OD2    . ASP A  1 786  ? 45.483  79.752  19.924  1.00 119.94 -1 846  ASP A OD2    1 
ATOM   6049  N  N      . GLU A  1 787  ? 41.585  82.458  18.221  1.00 103.91 ?  847  GLU A N      1 
ATOM   6050  C  CA     . GLU A  1 787  ? 41.568  83.472  17.177  1.00 102.99 ?  847  GLU A CA     1 
ATOM   6051  C  C      . GLU A  1 787  ? 42.911  84.231  17.017  1.00 105.86 ?  847  GLU A C      1 
ATOM   6052  O  O      . GLU A  1 787  ? 43.079  85.004  16.070  1.00 106.99 ?  847  GLU A O      1 
ATOM   6053  C  CB     . GLU A  1 787  ? 40.384  84.433  17.407  1.00 103.03 ?  847  GLU A CB     1 
ATOM   6054  C  CG     . GLU A  1 787  ? 40.651  85.618  18.340  1.00 112.60 ?  847  GLU A CG     1 
ATOM   6055  C  CD     . GLU A  1 787  ? 40.469  85.389  19.832  1.00 124.13 ?  847  GLU A CD     1 
ATOM   6056  O  OE1    . GLU A  1 787  ? 41.061  84.422  20.358  1.00 112.12 ?  847  GLU A OE1    1 
ATOM   6057  O  OE2    . GLU A  1 787  ? 39.709  86.156  20.471  1.00 109.92 -1 847  GLU A OE2    1 
ATOM   6058  N  N      . ARG A  1 788  ? 43.853  84.021  17.936  1.00 99.76  ?  848  ARG A N      1 
ATOM   6059  C  CA     . ARG A  1 788  ? 45.127  84.754  17.936  1.00 98.71  ?  848  ARG A CA     1 
ATOM   6060  C  C      . ARG A  1 788  ? 46.036  84.488  16.742  1.00 105.40 ?  848  ARG A C      1 
ATOM   6061  O  O      . ARG A  1 788  ? 46.812  85.380  16.367  1.00 104.82 ?  848  ARG A O      1 
ATOM   6062  C  CB     . ARG A  1 788  ? 45.906  84.501  19.241  1.00 90.87  ?  848  ARG A CB     1 
ATOM   6063  C  CG     . ARG A  1 788  ? 45.046  84.555  20.475  1.00 80.21  ?  848  ARG A CG     1 
ATOM   6064  C  CD     . ARG A  1 788  ? 45.783  84.077  21.671  1.00 78.52  ?  848  ARG A CD     1 
ATOM   6065  N  NE     . ARG A  1 788  ? 45.987  82.637  21.644  1.00 85.68  ?  848  ARG A NE     1 
ATOM   6066  C  CZ     . ARG A  1 788  ? 46.709  81.977  22.547  1.00 113.19 ?  848  ARG A CZ     1 
ATOM   6067  N  NH1    . ARG A  1 788  ? 47.289  82.628  23.552  1.00 114.72 1  848  ARG A NH1    1 
ATOM   6068  N  NH2    . ARG A  1 788  ? 46.833  80.662  22.470  1.00 94.17  ?  848  ARG A NH2    1 
ATOM   6069  N  N      . GLY A  1 789  ? 45.924  83.274  16.180  1.00 103.85 ?  849  GLY A N      1 
ATOM   6070  C  CA     . GLY A  1 789  ? 46.802  82.756  15.143  1.00 105.25 ?  849  GLY A CA     1 
ATOM   6071  C  C      . GLY A  1 789  ? 46.684  83.317  13.754  1.00 107.72 ?  849  GLY A C      1 
ATOM   6072  O  O      . GLY A  1 789  ? 45.864  84.197  13.488  1.00 105.43 ?  849  GLY A O      1 
ATOM   6073  N  N      . GLN A  1 790  ? 47.501  82.749  12.851  1.00 105.84 ?  850  GLN A N      1 
ATOM   6074  C  CA     . GLN A  1 790  ? 47.456  83.072  11.435  1.00 106.98 ?  850  GLN A CA     1 
ATOM   6075  C  C      . GLN A  1 790  ? 46.190  82.521  10.800  1.00 109.50 ?  850  GLN A C      1 
ATOM   6076  O  O      . GLN A  1 790  ? 45.843  82.925  9.694   1.00 110.43 ?  850  GLN A O      1 
ATOM   6077  C  CB     . GLN A  1 790  ? 48.699  82.569  10.694  1.00 110.94 ?  850  GLN A CB     1 
ATOM   6078  C  CG     . GLN A  1 790  ? 49.772  83.655  10.595  1.00 150.72 ?  850  GLN A CG     1 
ATOM   6079  C  CD     . GLN A  1 790  ? 49.352  84.823  9.720   1.00 181.73 ?  850  GLN A CD     1 
ATOM   6080  O  OE1    . GLN A  1 790  ? 49.194  84.677  8.504   1.00 184.56 ?  850  GLN A OE1    1 
ATOM   6081  N  NE2    . GLN A  1 790  ? 49.107  85.992  10.327  1.00 166.36 ?  850  GLN A NE2    1 
ATOM   6082  N  N      . GLU A  1 791  ? 45.517  81.583  11.482  1.00 103.56 ?  851  GLU A N      1 
ATOM   6083  C  CA     . GLU A  1 791  ? 44.251  80.995  11.059  1.00 101.38 ?  851  GLU A CA     1 
ATOM   6084  C  C      . GLU A  1 791  ? 43.363  80.759  12.255  1.00 103.15 ?  851  GLU A C      1 
ATOM   6085  O  O      . GLU A  1 791  ? 43.853  80.569  13.396  1.00 104.80 ?  851  GLU A O      1 
ATOM   6086  C  CB     . GLU A  1 791  ? 44.492  79.683  10.344  1.00 103.74 ?  851  GLU A CB     1 
ATOM   6087  C  CG     . GLU A  1 791  ? 43.434  79.394  9.312   1.00 113.19 ?  851  GLU A CG     1 
ATOM   6088  C  CD     . GLU A  1 791  ? 43.646  78.094  8.570   1.00 134.91 ?  851  GLU A CD     1 
ATOM   6089  O  OE1    . GLU A  1 791  ? 44.686  77.933  7.891   1.00 128.46 ?  851  GLU A OE1    1 
ATOM   6090  O  OE2    . GLU A  1 791  ? 42.715  77.264  8.604   1.00 129.08 -1 851  GLU A OE2    1 
ATOM   6091  N  N      . LEU A  1 792  ? 42.046  80.805  12.021  1.00 95.81  ?  852  LEU A N      1 
ATOM   6092  C  CA     . LEU A  1 792  ? 41.096  80.539  13.097  1.00 93.73  ?  852  LEU A CA     1 
ATOM   6093  C  C      . LEU A  1 792  ? 41.145  79.043  13.434  1.00 98.92  ?  852  LEU A C      1 
ATOM   6094  O  O      . LEU A  1 792  ? 41.219  78.206  12.529  1.00 100.72 ?  852  LEU A O      1 
ATOM   6095  C  CB     . LEU A  1 792  ? 39.682  80.950  12.682  1.00 92.19  ?  852  LEU A CB     1 
ATOM   6096  C  CG     . LEU A  1 792  ? 38.586  80.853  13.761  1.00 94.80  ?  852  LEU A CG     1 
ATOM   6097  C  CD1    . LEU A  1 792  ? 39.000  81.498  15.092  1.00 93.19  ?  852  LEU A CD1    1 
ATOM   6098  C  CD2    . LEU A  1 792  ? 37.282  81.461  13.272  1.00 96.88  ?  852  LEU A CD2    1 
ATOM   6099  N  N      . ILE A  1 793  ? 41.177  78.715  14.726  1.00 92.90  ?  853  ILE A N      1 
ATOM   6100  C  CA     . ILE A  1 793  ? 41.231  77.322  15.161  1.00 91.96  ?  853  ILE A CA     1 
ATOM   6101  C  C      . ILE A  1 793  ? 40.014  77.041  16.010  1.00 94.81  ?  853  ILE A C      1 
ATOM   6102  O  O      . ILE A  1 793  ? 39.722  77.766  16.974  1.00 93.41  ?  853  ILE A O      1 
ATOM   6103  C  CB     . ILE A  1 793  ? 42.511  77.013  15.974  1.00 94.76  ?  853  ILE A CB     1 
ATOM   6104  C  CG1    . ILE A  1 793  ? 43.807  77.418  15.244  1.00 96.51  ?  853  ILE A CG1    1 
ATOM   6105  C  CG2    . ILE A  1 793  ? 42.544  75.572  16.437  1.00 92.55  ?  853  ILE A CG2    1 
ATOM   6106  C  CD1    . ILE A  1 793  ? 44.042  76.902  13.962  1.00 113.58 ?  853  ILE A CD1    1 
ATOM   6107  N  N      . TYR A  1 794  ? 39.313  75.973  15.657  1.00 90.94  ?  854  TYR A N      1 
ATOM   6108  C  CA     . TYR A  1 794  ? 38.183  75.498  16.419  1.00 89.41  ?  854  TYR A CA     1 
ATOM   6109  C  C      . TYR A  1 794  ? 38.648  74.202  17.071  1.00 94.13  ?  854  TYR A C      1 
ATOM   6110  O  O      . TYR A  1 794  ? 38.872  73.215  16.368  1.00 93.65  ?  854  TYR A O      1 
ATOM   6111  C  CB     . TYR A  1 794  ? 36.974  75.204  15.512  1.00 89.38  ?  854  TYR A CB     1 
ATOM   6112  C  CG     . TYR A  1 794  ? 36.195  76.380  14.972  1.00 89.49  ?  854  TYR A CG     1 
ATOM   6113  C  CD1    . TYR A  1 794  ? 36.364  77.656  15.491  1.00 92.38  ?  854  TYR A CD1    1 
ATOM   6114  C  CD2    . TYR A  1 794  ? 35.240  76.205  13.982  1.00 89.18  ?  854  TYR A CD2    1 
ATOM   6115  C  CE1    . TYR A  1 794  ? 35.636  78.742  14.992  1.00 94.86  ?  854  TYR A CE1    1 
ATOM   6116  C  CE2    . TYR A  1 794  ? 34.489  77.270  13.497  1.00 88.98  ?  854  TYR A CE2    1 
ATOM   6117  C  CZ     . TYR A  1 794  ? 34.705  78.545  13.980  1.00 93.86  ?  854  TYR A CZ     1 
ATOM   6118  O  OH     . TYR A  1 794  ? 33.942  79.575  13.472  1.00 85.30  ?  854  TYR A OH     1 
ATOM   6119  N  N      . ALA A  1 795  ? 38.828  74.215  18.403  1.00 91.90  ?  855  ALA A N      1 
ATOM   6120  C  CA     . ALA A  1 795  ? 39.214  73.048  19.189  1.00 93.50  ?  855  ALA A CA     1 
ATOM   6121  C  C      . ALA A  1 795  ? 40.380  72.245  18.571  1.00 103.60 ?  855  ALA A C      1 
ATOM   6122  O  O      . ALA A  1 795  ? 40.280  71.036  18.331  1.00 106.50 ?  855  ALA A O      1 
ATOM   6123  C  CB     . ALA A  1 795  ? 38.001  72.161  19.374  1.00 93.76  ?  855  ALA A CB     1 
ATOM   6124  N  N      . GLY A  1 796  ? 41.455  72.928  18.231  1.00 100.96 ?  856  GLY A N      1 
ATOM   6125  C  CA     . GLY A  1 796  ? 42.581  72.241  17.609  1.00 102.14 ?  856  GLY A CA     1 
ATOM   6126  C  C      . GLY A  1 796  ? 42.515  72.033  16.101  1.00 104.61 ?  856  GLY A C      1 
ATOM   6127  O  O      . GLY A  1 796  ? 43.533  71.680  15.502  1.00 106.98 ?  856  GLY A O      1 
ATOM   6128  N  N      . MET A  1 797  ? 41.348  72.256  15.470  1.00 97.02  ?  857  MET A N      1 
ATOM   6129  C  CA     . MET A  1 797  ? 41.191  72.102  14.023  1.00 95.84  ?  857  MET A CA     1 
ATOM   6130  C  C      . MET A  1 797  ? 41.136  73.482  13.308  1.00 97.00  ?  857  MET A C      1 
ATOM   6131  O  O      . MET A  1 797  ? 40.272  74.304  13.633  1.00 97.18  ?  857  MET A O      1 
ATOM   6132  C  CB     . MET A  1 797  ? 39.945  71.284  13.743  1.00 97.80  ?  857  MET A CB     1 
ATOM   6133  C  CG     . MET A  1 797  ? 39.916  70.669  12.398  1.00 103.21 ?  857  MET A CG     1 
ATOM   6134  S  SD     . MET A  1 797  ? 38.393  69.677  12.232  1.00 108.36 ?  857  MET A SD     1 
ATOM   6135  C  CE     . MET A  1 797  ? 38.517  69.157  10.551  1.00 106.51 ?  857  MET A CE     1 
ATOM   6136  N  N      . PRO A  1 798  ? 42.058  73.762  12.360  1.00 89.35  ?  858  PRO A N      1 
ATOM   6137  C  CA     . PRO A  1 798  ? 42.047  75.059  11.655  1.00 87.94  ?  858  PRO A CA     1 
ATOM   6138  C  C      . PRO A  1 798  ? 40.831  75.180  10.784  1.00 93.63  ?  858  PRO A C      1 
ATOM   6139  O  O      . PRO A  1 798  ? 40.367  74.175  10.242  1.00 94.43  ?  858  PRO A O      1 
ATOM   6140  C  CB     . PRO A  1 798  ? 43.296  75.009  10.785  1.00 90.72  ?  858  PRO A CB     1 
ATOM   6141  C  CG     . PRO A  1 798  ? 44.105  73.947  11.356  1.00 96.51  ?  858  PRO A CG     1 
ATOM   6142  C  CD     . PRO A  1 798  ? 43.155  72.926  11.880  1.00 91.65  ?  858  PRO A CD     1 
ATOM   6143  N  N      . ILE A  1 799  ? 40.298  76.400  10.651  1.00 89.72  ?  859  ILE A N      1 
ATOM   6144  C  CA     . ILE A  1 799  ? 39.073  76.667  9.897   1.00 88.37  ?  859  ILE A CA     1 
ATOM   6145  C  C      . ILE A  1 799  ? 39.114  76.084  8.473   1.00 95.43  ?  859  ILE A C      1 
ATOM   6146  O  O      . ILE A  1 799  ? 38.106  75.529  8.047   1.00 94.95  ?  859  ILE A O      1 
ATOM   6147  C  CB     . ILE A  1 799  ? 38.673  78.160  9.931   1.00 89.48  ?  859  ILE A CB     1 
ATOM   6148  C  CG1    . ILE A  1 799  ? 37.216  78.351  9.558   1.00 89.30  ?  859  ILE A CG1    1 
ATOM   6149  C  CG2    . ILE A  1 799  ? 39.567  79.053  9.081   1.00 90.03  ?  859  ILE A CG2    1 
ATOM   6150  C  CD1    . ILE A  1 799  ? 36.237  77.723  10.509  1.00 97.94  ?  859  ILE A CD1    1 
ATOM   6151  N  N      . THR A  1 800  ? 40.271  76.145  7.776   1.00 94.19  ?  860  THR A N      1 
ATOM   6152  C  CA     . THR A  1 800  ? 40.368  75.614  6.428   1.00 95.78  ?  860  THR A CA     1 
ATOM   6153  C  C      . THR A  1 800  ? 40.152  74.134  6.430   1.00 103.54 ?  860  THR A C      1 
ATOM   6154  O  O      . THR A  1 800  ? 39.468  73.640  5.524   1.00 106.12 ?  860  THR A O      1 
ATOM   6155  C  CB     . THR A  1 800  ? 41.678  75.987  5.763   1.00 107.57 ?  860  THR A CB     1 
ATOM   6156  O  OG1    . THR A  1 800  ? 42.759  75.515  6.565   1.00 103.75 ?  860  THR A OG1    1 
ATOM   6157  C  CG2    . THR A  1 800  ? 41.789  77.486  5.482   1.00 111.44 ?  860  THR A CG2    1 
ATOM   6158  N  N      . GLU A  1 801  ? 40.709  73.424  7.444   1.00 98.96  ?  861  GLU A N      1 
ATOM   6159  C  CA     . GLU A  1 801  ? 40.603  71.971  7.607   1.00 98.38  ?  861  GLU A CA     1 
ATOM   6160  C  C      . GLU A  1 801  ? 39.148  71.598  7.903   1.00 96.63  ?  861  GLU A C      1 
ATOM   6161  O  O      . GLU A  1 801  ? 38.665  70.612  7.359   1.00 95.48  ?  861  GLU A O      1 
ATOM   6162  C  CB     . GLU A  1 801  ? 41.550  71.515  8.708   1.00 100.62 ?  861  GLU A CB     1 
ATOM   6163  C  CG     . GLU A  1 801  ? 41.909  70.048  8.753   1.00 118.40 ?  861  GLU A CG     1 
ATOM   6164  C  CD     . GLU A  1 801  ? 42.855  69.726  9.910   1.00 162.20 ?  861  GLU A CD     1 
ATOM   6165  O  OE1    . GLU A  1 801  ? 42.448  68.964  10.822  1.00 153.57 ?  861  GLU A OE1    1 
ATOM   6166  O  OE2    . GLU A  1 801  ? 43.998  70.250  9.914   1.00 168.29 -1 861  GLU A OE2    1 
ATOM   6167  N  N      . VAL A  1 802  ? 38.430  72.415  8.709   1.00 90.98  ?  862  VAL A N      1 
ATOM   6168  C  CA     . VAL A  1 802  ? 37.002  72.226  9.011   1.00 89.66  ?  862  VAL A CA     1 
ATOM   6169  C  C      . VAL A  1 802  ? 36.228  72.158  7.691   1.00 93.94  ?  862  VAL A C      1 
ATOM   6170  O  O      . VAL A  1 802  ? 35.465  71.219  7.484   1.00 93.41  ?  862  VAL A O      1 
ATOM   6171  C  CB     . VAL A  1 802  ? 36.458  73.355  9.932   1.00 91.33  ?  862  VAL A CB     1 
ATOM   6172  C  CG1    . VAL A  1 802  ? 34.941  73.313  10.062  1.00 89.83  ?  862  VAL A CG1    1 
ATOM   6173  C  CG2    . VAL A  1 802  ? 37.115  73.307  11.300  1.00 90.76  ?  862  VAL A CG2    1 
ATOM   6174  N  N      . PHE A  1 803  ? 36.481  73.126  6.788   1.00 91.39  ?  863  PHE A N      1 
ATOM   6175  C  CA     . PHE A  1 803  ? 35.842  73.177  5.483   1.00 92.36  ?  863  PHE A CA     1 
ATOM   6176  C  C      . PHE A  1 803  ? 36.325  72.065  4.533   1.00 99.82  ?  863  PHE A C      1 
ATOM   6177  O  O      . PHE A  1 803  ? 35.489  71.401  3.915   1.00 101.33 ?  863  PHE A O      1 
ATOM   6178  C  CB     . PHE A  1 803  ? 35.979  74.572  4.858   1.00 93.35  ?  863  PHE A CB     1 
ATOM   6179  C  CG     . PHE A  1 803  ? 35.022  75.535  5.492   1.00 92.32  ?  863  PHE A CG     1 
ATOM   6180  C  CD1    . PHE A  1 803  ? 33.674  75.527  5.155   1.00 94.26  ?  863  PHE A CD1    1 
ATOM   6181  C  CD2    . PHE A  1 803  ? 35.444  76.398  6.476   1.00 94.79  ?  863  PHE A CD2    1 
ATOM   6182  C  CE1    . PHE A  1 803  ? 32.758  76.371  5.801   1.00 94.27  ?  863  PHE A CE1    1 
ATOM   6183  C  CE2    . PHE A  1 803  ? 34.529  77.250  7.127   1.00 96.92  ?  863  PHE A CE2    1 
ATOM   6184  C  CZ     . PHE A  1 803  ? 33.186  77.229  6.785   1.00 93.81  ?  863  PHE A CZ     1 
ATOM   6185  N  N      . LYS A  1 804  ? 37.647  71.832  4.454   1.00 95.94  ?  864  LYS A N      1 
ATOM   6186  C  CA     . LYS A  1 804  ? 38.227  70.790  3.622   1.00 97.86  ?  864  LYS A CA     1 
ATOM   6187  C  C      . LYS A  1 804  ? 37.614  69.430  3.959   1.00 103.58 ?  864  LYS A C      1 
ATOM   6188  O  O      . LYS A  1 804  ? 37.265  68.685  3.044   1.00 104.76 ?  864  LYS A O      1 
ATOM   6189  C  CB     . LYS A  1 804  ? 39.762  70.771  3.776   1.00 101.94 ?  864  LYS A CB     1 
ATOM   6190  C  CG     . LYS A  1 804  ? 40.509  69.778  2.868   1.00 126.02 ?  864  LYS A CG     1 
ATOM   6191  C  CD     . LYS A  1 804  ? 40.995  68.512  3.600   1.00 135.91 ?  864  LYS A CD     1 
ATOM   6192  C  CE     . LYS A  1 804  ? 41.469  67.436  2.634   1.00 148.93 ?  864  LYS A CE     1 
ATOM   6193  N  NZ     . LYS A  1 804  ? 41.638  66.101  3.275   1.00 158.70 1  864  LYS A NZ     1 
ATOM   6194  N  N      . GLU A  1 805  ? 37.449  69.140  5.264   1.00 101.03 ?  865  GLU A N      1 
ATOM   6195  C  CA     . GLU A  1 805  ? 36.909  67.882  5.768   1.00 102.88 ?  865  GLU A CA     1 
ATOM   6196  C  C      . GLU A  1 805  ? 35.377  67.790  5.696   1.00 112.39 ?  865  GLU A C      1 
ATOM   6197  O  O      . GLU A  1 805  ? 34.801  66.755  6.091   1.00 113.52 ?  865  GLU A O      1 
ATOM   6198  C  CB     . GLU A  1 805  ? 37.419  67.608  7.178   1.00 103.55 ?  865  GLU A CB     1 
ATOM   6199  C  CG     . GLU A  1 805  ? 38.897  67.308  7.237   1.00 116.90 ?  865  GLU A CG     1 
ATOM   6200  C  CD     . GLU A  1 805  ? 39.303  66.011  6.587   1.00 155.15 ?  865  GLU A CD     1 
ATOM   6201  O  OE1    . GLU A  1 805  ? 38.694  64.965  6.911   1.00 162.45 ?  865  GLU A OE1    1 
ATOM   6202  O  OE2    . GLU A  1 805  ? 40.238  66.042  5.756   1.00 161.81 -1 865  GLU A OE2    1 
ATOM   6203  N  N      . GLU A  1 806  ? 34.722  68.864  5.174   1.00 110.49 ?  866  GLU A N      1 
ATOM   6204  C  CA     . GLU A  1 806  ? 33.265  68.966  5.014   1.00 110.72 ?  866  GLU A CA     1 
ATOM   6205  C  C      . GLU A  1 806  ? 32.554  68.608  6.329   1.00 115.09 ?  866  GLU A C      1 
ATOM   6206  O  O      . GLU A  1 806  ? 31.711  67.696  6.389   1.00 115.99 ?  866  GLU A O      1 
ATOM   6207  C  CB     . GLU A  1 806  ? 32.804  68.080  3.846   1.00 113.87 ?  866  GLU A CB     1 
ATOM   6208  C  CG     . GLU A  1 806  ? 33.467  68.448  2.533   1.00 130.72 ?  866  GLU A CG     1 
ATOM   6209  C  CD     . GLU A  1 806  ? 33.101  67.567  1.365   1.00 168.41 ?  866  GLU A CD     1 
ATOM   6210  O  OE1    . GLU A  1 806  ? 33.906  66.670  1.020   1.00 175.94 ?  866  GLU A OE1    1 
ATOM   6211  O  OE2    . GLU A  1 806  ? 32.021  67.802  0.774   1.00 164.94 -1 866  GLU A OE2    1 
ATOM   6212  N  N      . MET A  1 807  ? 32.977  69.288  7.403   1.00 110.55 ?  867  MET A N      1 
ATOM   6213  C  CA     . MET A  1 807  ? 32.491  69.075  8.767   1.00 109.63 ?  867  MET A CA     1 
ATOM   6214  C  C      . MET A  1 807  ? 31.029  69.441  8.928   1.00 109.40 ?  867  MET A C      1 
ATOM   6215  O  O      . MET A  1 807  ? 30.262  68.702  9.581   1.00 109.74 ?  867  MET A O      1 
ATOM   6216  C  CB     . MET A  1 807  ? 33.315  69.892  9.766   1.00 111.59 ?  867  MET A CB     1 
ATOM   6217  C  CG     . MET A  1 807  ? 34.760  69.483  9.853   1.00 116.02 ?  867  MET A CG     1 
ATOM   6218  S  SD     . MET A  1 807  ? 35.023  67.980  10.784  1.00 120.95 ?  867  MET A SD     1 
ATOM   6219  C  CE     . MET A  1 807  ? 34.872  68.607  12.508  1.00 116.16 ?  867  MET A CE     1 
ATOM   6220  N  N      . GLY A  1 808  ? 30.666  70.581  8.340   1.00 100.85 ?  868  GLY A N      1 
ATOM   6221  C  CA     . GLY A  1 808  ? 29.305  71.085  8.416   1.00 98.66  ?  868  GLY A CA     1 
ATOM   6222  C  C      . GLY A  1 808  ? 28.987  71.670  9.770   1.00 97.85  ?  868  GLY A C      1 
ATOM   6223  O  O      . GLY A  1 808  ? 29.856  71.693  10.652  1.00 97.27  ?  868  GLY A O      1 
ATOM   6224  N  N      . ILE A  1 809  ? 27.739  72.150  9.938   1.00 91.21  ?  869  ILE A N      1 
ATOM   6225  C  CA     . ILE A  1 809  ? 27.302  72.752  11.193  1.00 89.75  ?  869  ILE A CA     1 
ATOM   6226  C  C      . ILE A  1 809  ? 27.444  71.780  12.365  1.00 94.37  ?  869  ILE A C      1 
ATOM   6227  O  O      . ILE A  1 809  ? 27.986  72.153  13.403  1.00 94.41  ?  869  ILE A O      1 
ATOM   6228  C  CB     . ILE A  1 809  ? 25.892  73.332  11.039  1.00 92.26  ?  869  ILE A CB     1 
ATOM   6229  C  CG1    . ILE A  1 809  ? 25.953  74.504  10.039  1.00 94.96  ?  869  ILE A CG1    1 
ATOM   6230  C  CG2    . ILE A  1 809  ? 25.321  73.768  12.410  1.00 89.11  ?  869  ILE A CG2    1 
ATOM   6231  C  CD1    . ILE A  1 809  ? 24.646  74.953  9.470   1.00 117.40 ?  869  ILE A CD1    1 
ATOM   6232  N  N      . GLY A  1 810  ? 27.037  70.532  12.150  1.00 91.32  ?  870  GLY A N      1 
ATOM   6233  C  CA     . GLY A  1 810  ? 27.112  69.473  13.143  1.00 91.44  ?  870  GLY A CA     1 
ATOM   6234  C  C      . GLY A  1 810  ? 28.527  69.262  13.615  1.00 96.78  ?  870  GLY A C      1 
ATOM   6235  O  O      . GLY A  1 810  ? 28.756  69.210  14.825  1.00 96.40  ?  870  GLY A O      1 
ATOM   6236  N  N      . GLY A  1 811  ? 29.467  69.208  12.658  1.00 93.88  ?  871  GLY A N      1 
ATOM   6237  C  CA     . GLY A  1 811  ? 30.893  69.038  12.922  1.00 93.46  ?  871  GLY A CA     1 
ATOM   6238  C  C      . GLY A  1 811  ? 31.463  70.186  13.727  1.00 95.04  ?  871  GLY A C      1 
ATOM   6239  O  O      . GLY A  1 811  ? 32.228  69.954  14.670  1.00 97.19  ?  871  GLY A O      1 
ATOM   6240  N  N      . VAL A  1 812  ? 31.077  71.430  13.376  1.00 85.99  ?  872  VAL A N      1 
ATOM   6241  C  CA     . VAL A  1 812  ? 31.537  72.616  14.090  1.00 83.70  ?  872  VAL A CA     1 
ATOM   6242  C  C      . VAL A  1 812  ? 31.002  72.578  15.514  1.00 91.77  ?  872  VAL A C      1 
ATOM   6243  O  O      . VAL A  1 812  ? 31.729  72.888  16.458  1.00 92.51  ?  872  VAL A O      1 
ATOM   6244  C  CB     . VAL A  1 812  ? 31.168  73.910  13.333  1.00 84.51  ?  872  VAL A CB     1 
ATOM   6245  C  CG1    . VAL A  1 812  ? 31.304  75.161  14.212  1.00 81.66  ?  872  VAL A CG1    1 
ATOM   6246  C  CG2    . VAL A  1 812  ? 32.018  74.036  12.086  1.00 85.00  ?  872  VAL A CG2    1 
ATOM   6247  N  N      . LEU A  1 813  ? 29.763  72.127  15.685  1.00 89.83  ?  873  LEU A N      1 
ATOM   6248  C  CA     . LEU A  1 813  ? 29.201  72.034  17.020  1.00 89.18  ?  873  LEU A CA     1 
ATOM   6249  C  C      . LEU A  1 813  ? 29.981  70.983  17.840  1.00 90.06  ?  873  LEU A C      1 
ATOM   6250  O  O      . LEU A  1 813  ? 30.292  71.234  19.005  1.00 89.34  ?  873  LEU A O      1 
ATOM   6251  C  CB     . LEU A  1 813  ? 27.719  71.716  16.940  1.00 89.71  ?  873  LEU A CB     1 
ATOM   6252  C  CG     . LEU A  1 813  ? 26.964  71.746  18.234  1.00 94.87  ?  873  LEU A CG     1 
ATOM   6253  C  CD1    . LEU A  1 813  ? 25.579  72.216  17.985  1.00 94.90  ?  873  LEU A CD1    1 
ATOM   6254  C  CD2    . LEU A  1 813  ? 26.984  70.332  18.951  1.00 99.93  ?  873  LEU A CD2    1 
ATOM   6255  N  N      . GLY A  1 814  ? 30.336  69.857  17.226  1.00 84.55  ?  874  GLY A N      1 
ATOM   6256  C  CA     . GLY A  1 814  ? 31.148  68.853  17.906  1.00 84.56  ?  874  GLY A CA     1 
ATOM   6257  C  C      . GLY A  1 814  ? 32.444  69.453  18.429  1.00 88.31  ?  874  GLY A C      1 
ATOM   6258  O  O      . GLY A  1 814  ? 32.850  69.208  19.571  1.00 87.10  ?  874  GLY A O      1 
ATOM   6259  N  N      . LEU A  1 815  ? 33.062  70.310  17.623  1.00 86.53  ?  875  LEU A N      1 
ATOM   6260  C  CA     . LEU A  1 815  ? 34.300  70.977  18.023  1.00 87.03  ?  875  LEU A CA     1 
ATOM   6261  C  C      . LEU A  1 815  ? 34.094  71.997  19.139  1.00 90.63  ?  875  LEU A C      1 
ATOM   6262  O  O      . LEU A  1 815  ? 34.779  71.962  20.151  1.00 90.75  ?  875  LEU A O      1 
ATOM   6263  C  CB     . LEU A  1 815  ? 34.970  71.667  16.826  1.00 87.42  ?  875  LEU A CB     1 
ATOM   6264  C  CG     . LEU A  1 815  ? 35.457  70.763  15.710  1.00 94.27  ?  875  LEU A CG     1 
ATOM   6265  C  CD1    . LEU A  1 815  ? 35.873  71.558  14.513  1.00 94.88  ?  875  LEU A CD1    1 
ATOM   6266  C  CD2    . LEU A  1 815  ? 36.615  69.940  16.162  1.00 98.45  ?  875  LEU A CD2    1 
ATOM   6267  N  N      . LEU A  1 816  ? 33.178  72.916  18.948  1.00 86.08  ?  876  LEU A N      1 
ATOM   6268  C  CA     . LEU A  1 816  ? 33.003  73.983  19.911  1.00 85.02  ?  876  LEU A CA     1 
ATOM   6269  C  C      . LEU A  1 816  ? 32.316  73.561  21.208  1.00 91.81  ?  876  LEU A C      1 
ATOM   6270  O  O      . LEU A  1 816  ? 32.646  74.089  22.283  1.00 91.98  ?  876  LEU A O      1 
ATOM   6271  C  CB     . LEU A  1 816  ? 32.291  75.163  19.259  1.00 83.99  ?  876  LEU A CB     1 
ATOM   6272  C  CG     . LEU A  1 816  ? 33.072  75.818  18.106  1.00 88.75  ?  876  LEU A CG     1 
ATOM   6273  C  CD1    . LEU A  1 816  ? 32.254  76.851  17.445  1.00 89.59  ?  876  LEU A CD1    1 
ATOM   6274  C  CD2    . LEU A  1 816  ? 34.339  76.494  18.585  1.00 87.02  ?  876  LEU A CD2    1 
ATOM   6275  N  N      . TRP A  1 817  ? 31.416  72.580  21.144  1.00 89.27  ?  877  TRP A N      1 
ATOM   6276  C  CA     . TRP A  1 817  ? 30.735  72.173  22.366  1.00 88.41  ?  877  TRP A CA     1 
ATOM   6277  C  C      . TRP A  1 817  ? 31.448  71.090  23.124  1.00 90.73  ?  877  TRP A C      1 
ATOM   6278  O  O      . TRP A  1 817  ? 31.586  71.194  24.358  1.00 90.58  ?  877  TRP A O      1 
ATOM   6279  C  CB     . TRP A  1 817  ? 29.288  71.778  22.070  1.00 86.82  ?  877  TRP A CB     1 
ATOM   6280  C  CG     . TRP A  1 817  ? 28.407  72.936  21.666  1.00 86.39  ?  877  TRP A CG     1 
ATOM   6281  C  CD1    . TRP A  1 817  ? 28.794  74.168  21.206  1.00 88.52  ?  877  TRP A CD1    1 
ATOM   6282  C  CD2    . TRP A  1 817  ? 26.991  72.931  21.648  1.00 85.81  ?  877  TRP A CD2    1 
ATOM   6283  N  NE1    . TRP A  1 817  ? 27.696  74.928  20.909  1.00 86.99  ?  877  TRP A NE1    1 
ATOM   6284  C  CE2    . TRP A  1 817  ? 26.571  74.192  21.161  1.00 88.76  ?  877  TRP A CE2    1 
ATOM   6285  C  CE3    . TRP A  1 817  ? 26.021  71.975  21.992  1.00 87.33  ?  877  TRP A CE3    1 
ATOM   6286  C  CZ2    . TRP A  1 817  ? 25.220  74.517  21.000  1.00 87.67  ?  877  TRP A CZ2    1 
ATOM   6287  C  CZ3    . TRP A  1 817  ? 24.681  72.306  21.847  1.00 87.98  ?  877  TRP A CZ3    1 
ATOM   6288  C  CH2    . TRP A  1 817  ? 24.292  73.558  21.346  1.00 87.75  ?  877  TRP A CH2    1 
ATOM   6289  N  N      . PHE A  1 818  ? 31.951  70.090  22.378  1.00 85.48  ?  878  PHE A N      1 
ATOM   6290  C  CA     . PHE A  1 818  ? 32.573  68.917  22.962  1.00 86.43  ?  878  PHE A CA     1 
ATOM   6291  C  C      . PHE A  1 818  ? 34.061  68.781  22.773  1.00 90.36  ?  878  PHE A C      1 
ATOM   6292  O  O      . PHE A  1 818  ? 34.680  67.933  23.440  1.00 91.94  ?  878  PHE A O      1 
ATOM   6293  C  CB     . PHE A  1 818  ? 31.879  67.660  22.427  1.00 89.75  ?  878  PHE A CB     1 
ATOM   6294  C  CG     . PHE A  1 818  ? 30.365  67.735  22.496  1.00 91.60  ?  878  PHE A CG     1 
ATOM   6295  C  CD1    . PHE A  1 818  ? 29.716  68.046  23.691  1.00 94.82  ?  878  PHE A CD1    1 
ATOM   6296  C  CD2    . PHE A  1 818  ? 29.590  67.517  21.364  1.00 94.20  ?  878  PHE A CD2    1 
ATOM   6297  C  CE1    . PHE A  1 818  ? 28.318  68.145  23.745  1.00 95.76  ?  878  PHE A CE1    1 
ATOM   6298  C  CE2    . PHE A  1 818  ? 28.195  67.639  21.413  1.00 96.97  ?  878  PHE A CE2    1 
ATOM   6299  C  CZ     . PHE A  1 818  ? 27.565  67.951  22.602  1.00 94.85  ?  878  PHE A CZ     1 
ATOM   6300  N  N      . GLN A  1 819  ? 34.641  69.606  21.890  1.00 85.49  ?  879  GLN A N      1 
ATOM   6301  C  CA     . GLN A  1 819  ? 36.067  69.550  21.533  1.00 86.15  ?  879  GLN A CA     1 
ATOM   6302  C  C      . GLN A  1 819  ? 36.415  68.155  21.006  1.00 90.24  ?  879  GLN A C      1 
ATOM   6303  O  O      . GLN A  1 819  ? 37.415  67.571  21.393  1.00 91.02  ?  879  GLN A O      1 
ATOM   6304  C  CB     . GLN A  1 819  ? 37.014  70.036  22.662  1.00 87.33  ?  879  GLN A CB     1 
ATOM   6305  C  CG     . GLN A  1 819  ? 36.953  71.517  22.931  1.00 91.54  ?  879  GLN A CG     1 
ATOM   6306  C  CD     . GLN A  1 819  ? 36.027  71.768  24.076  1.00 117.33 ?  879  GLN A CD     1 
ATOM   6307  O  OE1    . GLN A  1 819  ? 36.384  71.488  25.216  1.00 118.83 ?  879  GLN A OE1    1 
ATOM   6308  N  NE2    . GLN A  1 819  ? 34.803  72.196  23.842  1.00 109.86 ?  879  GLN A NE2    1 
ATOM   6309  N  N      . LYS A  1 820  ? 35.527  67.601  20.183  1.00 86.80  ?  880  LYS A N      1 
ATOM   6310  C  CA     . LYS A  1 820  ? 35.690  66.295  19.570  1.00 88.47  ?  880  LYS A CA     1 
ATOM   6311  C  C      . LYS A  1 820  ? 35.434  66.379  18.050  1.00 95.36  ?  880  LYS A C      1 
ATOM   6312  O  O      . LYS A  1 820  ? 34.583  67.176  17.584  1.00 92.50  ?  880  LYS A O      1 
ATOM   6313  C  CB     . LYS A  1 820  ? 34.691  65.261  20.142  1.00 90.37  ?  880  LYS A CB     1 
ATOM   6314  C  CG     . LYS A  1 820  ? 34.679  65.056  21.642  1.00 90.66  ?  880  LYS A CG     1 
ATOM   6315  C  CD     . LYS A  1 820  ? 35.934  64.416  22.148  1.00 94.95  ?  880  LYS A CD     1 
ATOM   6316  C  CE     . LYS A  1 820  ? 35.778  64.128  23.603  1.00 105.28 ?  880  LYS A CE     1 
ATOM   6317  N  NZ     . LYS A  1 820  ? 37.021  63.560  24.185  1.00 115.00 1  880  LYS A NZ     1 
ATOM   6318  N  N      . ARG A  1 821  ? 36.142  65.486  17.270  1.00 94.43  ?  881  ARG A N      1 
ATOM   6319  C  CA     . ARG A  1 821  ? 35.897  65.316  15.840  1.00 93.24  ?  881  ARG A CA     1 
ATOM   6320  C  C      . ARG A  1 821  ? 34.972  64.115  15.827  1.00 97.67  ?  881  ARG A C      1 
ATOM   6321  O  O      . ARG A  1 821  ? 35.400  62.982  16.081  1.00 97.19  ?  881  ARG A O      1 
ATOM   6322  C  CB     . ARG A  1 821  ? 37.182  65.092  15.044  1.00 89.66  ?  881  ARG A CB     1 
ATOM   6323  C  CG     . ARG A  1 821  ? 37.110  65.682  13.634  1.00 101.93 ?  881  ARG A CG     1 
ATOM   6324  C  CD     . ARG A  1 821  ? 38.141  65.056  12.691  1.00 117.19 ?  881  ARG A CD     1 
ATOM   6325  N  NE     . ARG A  1 821  ? 37.915  65.276  11.250  1.00 129.19 ?  881  ARG A NE     1 
ATOM   6326  C  CZ     . ARG A  1 821  ? 36.963  64.694  10.511  1.00 156.67 ?  881  ARG A CZ     1 
ATOM   6327  N  NH1    . ARG A  1 821  ? 36.875  64.948  9.211   1.00 148.04 1  881  ARG A NH1    1 
ATOM   6328  N  NH2    . ARG A  1 821  ? 36.072  63.879  11.076  1.00 149.11 ?  881  ARG A NH2    1 
ATOM   6329  N  N      . LEU A  1 822  ? 33.666  64.411  15.736  1.00 94.06  ?  882  LEU A N      1 
ATOM   6330  C  CA     . LEU A  1 822  ? 32.616  63.405  15.799  1.00 93.06  ?  882  LEU A CA     1 
ATOM   6331  C  C      . LEU A  1 822  ? 32.485  62.603  14.511  1.00 96.05  ?  882  LEU A C      1 
ATOM   6332  O  O      . LEU A  1 822  ? 32.757  63.135  13.412  1.00 93.81  ?  882  LEU A O      1 
ATOM   6333  C  CB     . LEU A  1 822  ? 31.257  64.046  16.161  1.00 90.75  ?  882  LEU A CB     1 
ATOM   6334  C  CG     . LEU A  1 822  ? 31.187  64.712  17.478  1.00 94.10  ?  882  LEU A CG     1 
ATOM   6335  C  CD1    . LEU A  1 822  ? 29.842  65.291  17.668  1.00 95.19  ?  882  LEU A CD1    1 
ATOM   6336  C  CD2    . LEU A  1 822  ? 31.539  63.761  18.629  1.00 95.45  ?  882  LEU A CD2    1 
ATOM   6337  N  N      . PRO A  1 823  ? 31.962  61.353  14.627  1.00 93.23  ?  883  PRO A N      1 
ATOM   6338  C  CA     . PRO A  1 823  ? 31.695  60.586  13.415  1.00 96.41  ?  883  PRO A CA     1 
ATOM   6339  C  C      . PRO A  1 823  ? 30.704  61.325  12.520  1.00 103.74 ?  883  PRO A C      1 
ATOM   6340  O  O      . PRO A  1 823  ? 29.881  62.070  13.047  1.00 103.63 ?  883  PRO A O      1 
ATOM   6341  C  CB     . PRO A  1 823  ? 31.081  59.310  13.963  1.00 99.39  ?  883  PRO A CB     1 
ATOM   6342  C  CG     . PRO A  1 823  ? 31.579  59.213  15.373  1.00 102.43 ?  883  PRO A CG     1 
ATOM   6343  C  CD     . PRO A  1 823  ? 31.573  60.592  15.839  1.00 94.41  ?  883  PRO A CD     1 
ATOM   6344  N  N      . LYS A  1 824  ? 30.756  61.130  11.184  1.00 102.51 ?  884  LYS A N      1 
ATOM   6345  C  CA     . LYS A  1 824  ? 29.864  61.882  10.311  1.00 102.04 ?  884  LYS A CA     1 
ATOM   6346  C  C      . LYS A  1 824  ? 28.404  61.619  10.611  1.00 109.06 ?  884  LYS A C      1 
ATOM   6347  O  O      . LYS A  1 824  ? 27.643  62.594  10.605  1.00 110.31 ?  884  LYS A O      1 
ATOM   6348  C  CB     . LYS A  1 824  ? 30.198  61.736  8.828   1.00 105.59 ?  884  LYS A CB     1 
ATOM   6349  C  CG     . LYS A  1 824  ? 31.528  62.480  8.422   1.00 141.37 ?  884  LYS A CG     1 
ATOM   6350  C  CD     . LYS A  1 824  ? 31.497  64.089  8.314   1.00 150.61 ?  884  LYS A CD     1 
ATOM   6351  C  CE     . LYS A  1 824  ? 32.332  64.860  9.336   1.00 137.37 ?  884  LYS A CE     1 
ATOM   6352  N  NZ     . LYS A  1 824  ? 33.786  64.654  9.149   1.00 133.60 1  884  LYS A NZ     1 
ATOM   6353  N  N      . TYR A  1 825  ? 28.020  60.371  11.005  1.00 106.45 ?  885  TYR A N      1 
ATOM   6354  C  CA     . TYR A  1 825  ? 26.617  60.107  11.366  1.00 106.55 ?  885  TYR A CA     1 
ATOM   6355  C  C      . TYR A  1 825  ? 26.160  60.916  12.585  1.00 110.24 ?  885  TYR A C      1 
ATOM   6356  O  O      . TYR A  1 825  ? 24.994  61.332  12.645  1.00 109.56 ?  885  TYR A O      1 
ATOM   6357  C  CB     . TYR A  1 825  ? 26.322  58.627  11.566  1.00 109.31 ?  885  TYR A CB     1 
ATOM   6358  C  CG     . TYR A  1 825  ? 26.950  58.027  12.806  1.00 112.33 ?  885  TYR A CG     1 
ATOM   6359  C  CD1    . TYR A  1 825  ? 28.240  57.513  12.774  1.00 115.46 ?  885  TYR A CD1    1 
ATOM   6360  C  CD2    . TYR A  1 825  ? 26.244  57.951  14.013  1.00 112.55 ?  885  TYR A CD2    1 
ATOM   6361  C  CE1    . TYR A  1 825  ? 28.806  56.915  13.895  1.00 116.90 ?  885  TYR A CE1    1 
ATOM   6362  C  CE2    . TYR A  1 825  ? 26.822  57.400  15.154  1.00 113.46 ?  885  TYR A CE2    1 
ATOM   6363  C  CZ     . TYR A  1 825  ? 28.097  56.877  15.082  1.00 122.74 ?  885  TYR A CZ     1 
ATOM   6364  O  OH     . TYR A  1 825  ? 28.680  56.347  16.193  1.00 125.77 ?  885  TYR A OH     1 
ATOM   6365  N  N      . SER A  1 826  ? 27.081  61.142  13.548  1.00 105.43 ?  886  SER A N      1 
ATOM   6366  C  CA     . SER A  1 826  ? 26.785  61.916  14.741  1.00 103.54 ?  886  SER A CA     1 
ATOM   6367  C  C      . SER A  1 826  ? 26.565  63.366  14.375  1.00 107.36 ?  886  SER A C      1 
ATOM   6368  O  O      . SER A  1 826  ? 25.606  63.967  14.868  1.00 107.83 ?  886  SER A O      1 
ATOM   6369  C  CB     . SER A  1 826  ? 27.912  61.785  15.750  1.00 105.96 ?  886  SER A CB     1 
ATOM   6370  O  OG     . SER A  1 826  ? 28.026  60.429  16.143  1.00 112.63 ?  886  SER A OG     1 
ATOM   6371  N  N      . CYS A  1 827  ? 27.405  63.917  13.471  1.00 102.83 ?  887  CYS A N      1 
ATOM   6372  C  CA     . CYS A  1 827  ? 27.283  65.300  13.009  1.00 101.02 ?  887  CYS A CA     1 
ATOM   6373  C  C      . CYS A  1 827  ? 25.936  65.483  12.356  1.00 99.67  ?  887  CYS A C      1 
ATOM   6374  O  O      . CYS A  1 827  ? 25.237  66.451  12.656  1.00 96.54  ?  887  CYS A O      1 
ATOM   6375  C  CB     . CYS A  1 827  ? 28.398  65.650  12.028  1.00 102.52 ?  887  CYS A CB     1 
ATOM   6376  S  SG     . CYS A  1 827  ? 30.054  65.540  12.713  1.00 106.93 ?  887  CYS A SG     1 
ATOM   6377  N  N      . GLN A  1 828  ? 25.596  64.564  11.436  1.00 94.43  ?  888  GLN A N      1 
ATOM   6378  C  CA     . GLN A  1 828  ? 24.372  64.618  10.672  1.00 93.83  ?  888  GLN A CA     1 
ATOM   6379  C  C      . GLN A  1 828  ? 23.166  64.521  11.603  1.00 97.11  ?  888  GLN A C      1 
ATOM   6380  O  O      . GLN A  1 828  ? 22.171  65.235  11.400  1.00 97.49  ?  888  GLN A O      1 
ATOM   6381  C  CB     . GLN A  1 828  ? 24.380  63.505  9.641   1.00 96.80  ?  888  GLN A CB     1 
ATOM   6382  C  CG     . GLN A  1 828  ? 23.585  63.777  8.407   1.00 124.19 ?  888  GLN A CG     1 
ATOM   6383  C  CD     . GLN A  1 828  ? 24.042  62.801  7.358   1.00 167.85 ?  888  GLN A CD     1 
ATOM   6384  O  OE1    . GLN A  1 828  ? 23.586  61.653  7.313   1.00 170.11 ?  888  GLN A OE1    1 
ATOM   6385  N  NE2    . GLN A  1 828  ? 25.040  63.180  6.559   1.00 166.75 ?  888  GLN A NE2    1 
ATOM   6386  N  N      . PHE A  1 829  ? 23.266  63.674  12.653  1.00 90.76  ?  889  PHE A N      1 
ATOM   6387  C  CA     . PHE A  1 829  ? 22.203  63.545  13.628  1.00 88.81  ?  889  PHE A CA     1 
ATOM   6388  C  C      . PHE A  1 829  ? 22.005  64.862  14.379  1.00 89.89  ?  889  PHE A C      1 
ATOM   6389  O  O      . PHE A  1 829  ? 20.879  65.319  14.503  1.00 90.07  ?  889  PHE A O      1 
ATOM   6390  C  CB     . PHE A  1 829  ? 22.477  62.388  14.559  1.00 91.29  ?  889  PHE A CB     1 
ATOM   6391  C  CG     . PHE A  1 829  ? 21.618  62.386  15.789  1.00 93.26  ?  889  PHE A CG     1 
ATOM   6392  C  CD1    . PHE A  1 829  ? 20.277  61.992  15.725  1.00 95.89  ?  889  PHE A CD1    1 
ATOM   6393  C  CD2    . PHE A  1 829  ? 22.149  62.760  17.024  1.00 96.96  ?  889  PHE A CD2    1 
ATOM   6394  C  CE1    . PHE A  1 829  ? 19.477  61.988  16.876  1.00 97.61  ?  889  PHE A CE1    1 
ATOM   6395  C  CE2    . PHE A  1 829  ? 21.353  62.742  18.181  1.00 100.31 ?  889  PHE A CE2    1 
ATOM   6396  C  CZ     . PHE A  1 829  ? 20.023  62.344  18.102  1.00 98.60  ?  889  PHE A CZ     1 
ATOM   6397  N  N      . ILE A  1 830  ? 23.079  65.505  14.819  1.00 84.72  ?  890  ILE A N      1 
ATOM   6398  C  CA     . ILE A  1 830  ? 22.988  66.810  15.490  1.00 83.45  ?  890  ILE A CA     1 
ATOM   6399  C  C      . ILE A  1 830  ? 22.238  67.815  14.600  1.00 89.94  ?  890  ILE A C      1 
ATOM   6400  O  O      . ILE A  1 830  ? 21.309  68.467  15.071  1.00 88.62  ?  890  ILE A O      1 
ATOM   6401  C  CB     . ILE A  1 830  ? 24.394  67.349  15.893  1.00 85.40  ?  890  ILE A CB     1 
ATOM   6402  C  CG1    . ILE A  1 830  ? 24.989  66.508  17.040  1.00 85.65  ?  890  ILE A CG1    1 
ATOM   6403  C  CG2    . ILE A  1 830  ? 24.370  68.871  16.247  1.00 82.53  ?  890  ILE A CG2    1 
ATOM   6404  C  CD1    . ILE A  1 830  ? 26.460  66.651  17.152  1.00 89.11  ?  890  ILE A CD1    1 
ATOM   6405  N  N      . GLU A  1 831  ? 22.619  67.909  13.309  1.00 89.19  ?  891  GLU A N      1 
ATOM   6406  C  CA     . GLU A  1 831  ? 21.983  68.807  12.337  1.00 88.55  ?  891  GLU A CA     1 
ATOM   6407  C  C      . GLU A  1 831  ? 20.483  68.494  12.221  1.00 92.32  ?  891  GLU A C      1 
ATOM   6408  O  O      . GLU A  1 831  ? 19.649  69.398  12.152  1.00 89.73  ?  891  GLU A O      1 
ATOM   6409  C  CB     . GLU A  1 831  ? 22.675  68.704  10.967  1.00 90.78  ?  891  GLU A CB     1 
ATOM   6410  C  CG     . GLU A  1 831  ? 24.132  69.143  10.973  1.00 104.28 ?  891  GLU A CG     1 
ATOM   6411  C  CD     . GLU A  1 831  ? 24.800  69.454  9.641   1.00 141.99 ?  891  GLU A CD     1 
ATOM   6412  O  OE1    . GLU A  1 831  ? 24.084  69.813  8.676   1.00 147.42 ?  891  GLU A OE1    1 
ATOM   6413  O  OE2    . GLU A  1 831  ? 26.054  69.438  9.595   1.00 140.54 -1 891  GLU A OE2    1 
ATOM   6414  N  N      . MET A  1 832  ? 20.151  67.205  12.260  1.00 92.40  ?  892  MET A N      1 
ATOM   6415  C  CA     . MET A  1 832  ? 18.801  66.686  12.197  1.00 94.06  ?  892  MET A CA     1 
ATOM   6416  C  C      . MET A  1 832  ? 17.969  67.171  13.385  1.00 94.63  ?  892  MET A C      1 
ATOM   6417  O  O      . MET A  1 832  ? 16.818  67.545  13.210  1.00 92.78  ?  892  MET A O      1 
ATOM   6418  C  CB     . MET A  1 832  ? 18.890  65.180  12.194  1.00 98.94  ?  892  MET A CB     1 
ATOM   6419  C  CG     . MET A  1 832  ? 17.864  64.568  11.389  1.00 107.15 ?  892  MET A CG     1 
ATOM   6420  S  SD     . MET A  1 832  ? 18.402  62.977  10.776  1.00 117.74 ?  892  MET A SD     1 
ATOM   6421  C  CE     . MET A  1 832  ? 19.783  63.468  9.550   1.00 115.33 ?  892  MET A CE     1 
ATOM   6422  N  N      . CYS A  1 833  ? 18.563  67.174  14.588  1.00 90.99  ?  893  CYS A N      1 
ATOM   6423  C  CA     . CYS A  1 833  ? 17.928  67.642  15.819  1.00 90.30  ?  893  CYS A CA     1 
ATOM   6424  C  C      . CYS A  1 833  ? 17.657  69.125  15.738  1.00 94.27  ?  893  CYS A C      1 
ATOM   6425  O  O      . CYS A  1 833  ? 16.563  69.568  16.104  1.00 94.88  ?  893  CYS A O      1 
ATOM   6426  C  CB     . CYS A  1 833  ? 18.789  67.321  17.027  1.00 90.05  ?  893  CYS A CB     1 
ATOM   6427  S  SG     . CYS A  1 833  ? 18.921  65.560  17.367  1.00 95.00  ?  893  CYS A SG     1 
ATOM   6428  N  N      . LEU A  1 834  ? 18.650  69.900  15.262  1.00 88.33  ?  894  LEU A N      1 
ATOM   6429  C  CA     . LEU A  1 834  ? 18.463  71.327  15.088  1.00 86.40  ?  894  LEU A CA     1 
ATOM   6430  C  C      . LEU A  1 834  ? 17.314  71.616  14.088  1.00 94.60  ?  894  LEU A C      1 
ATOM   6431  O  O      . LEU A  1 834  ? 16.551  72.571  14.278  1.00 94.83  ?  894  LEU A O      1 
ATOM   6432  C  CB     . LEU A  1 834  ? 19.767  71.980  14.659  1.00 84.89  ?  894  LEU A CB     1 
ATOM   6433  C  CG     . LEU A  1 834  ? 20.875  71.874  15.659  1.00 88.57  ?  894  LEU A CG     1 
ATOM   6434  C  CD1    . LEU A  1 834  ? 22.144  72.407  15.088  1.00 89.58  ?  894  LEU A CD1    1 
ATOM   6435  C  CD2    . LEU A  1 834  ? 20.566  72.660  16.905  1.00 89.91  ?  894  LEU A CD2    1 
ATOM   6436  N  N      . MET A  1 835  ? 17.138  70.739  13.094  1.00 92.03  ?  895  MET A N      1 
ATOM   6437  C  CA     . MET A  1 835  ? 16.107  70.927  12.108  1.00 92.29  ?  895  MET A CA     1 
ATOM   6438  C  C      . MET A  1 835  ? 14.723  70.639  12.654  1.00 95.99  ?  895  MET A C      1 
ATOM   6439  O  O      . MET A  1 835  ? 13.808  71.404  12.358  1.00 96.68  ?  895  MET A O      1 
ATOM   6440  C  CB     . MET A  1 835  ? 16.401  70.066  10.892  1.00 96.02  ?  895  MET A CB     1 
ATOM   6441  C  CG     . MET A  1 835  ? 17.484  70.626  10.006  1.00 99.13  ?  895  MET A CG     1 
ATOM   6442  S  SD     . MET A  1 835  ? 17.834  69.348  8.809   1.00 104.51 ?  895  MET A SD     1 
ATOM   6443  C  CE     . MET A  1 835  ? 16.545  69.588  7.618   1.00 101.84 ?  895  MET A CE     1 
ATOM   6444  N  N      . VAL A  1 836  ? 14.551  69.546  13.434  1.00 91.31  ?  896  VAL A N      1 
ATOM   6445  C  CA     . VAL A  1 836  ? 13.227  69.186  13.990  1.00 91.00  ?  896  VAL A CA     1 
ATOM   6446  C  C      . VAL A  1 836  ? 12.799  70.145  15.132  1.00 98.82  ?  896  VAL A C      1 
ATOM   6447  O  O      . VAL A  1 836  ? 11.584  70.289  15.409  1.00 99.80  ?  896  VAL A O      1 
ATOM   6448  C  CB     . VAL A  1 836  ? 13.064  67.708  14.399  1.00 93.32  ?  896  VAL A CB     1 
ATOM   6449  C  CG1    . VAL A  1 836  ? 13.294  66.787  13.235  1.00 93.46  ?  896  VAL A CG1    1 
ATOM   6450  C  CG2    . VAL A  1 836  ? 13.997  67.350  15.529  1.00 92.80  ?  896  VAL A CG2    1 
ATOM   6451  N  N      . THR A  1 837  ? 13.794  70.804  15.782  1.00 94.63  ?  897  THR A N      1 
ATOM   6452  C  CA     . THR A  1 837  ? 13.520  71.746  16.862  1.00 93.27  ?  897  THR A CA     1 
ATOM   6453  C  C      . THR A  1 837  ? 13.429  73.184  16.389  1.00 97.39  ?  897  THR A C      1 
ATOM   6454  O  O      . THR A  1 837  ? 13.104  74.050  17.208  1.00 96.62  ?  897  THR A O      1 
ATOM   6455  C  CB     . THR A  1 837  ? 14.536  71.597  18.023  1.00 91.84  ?  897  THR A CB     1 
ATOM   6456  O  OG1    . THR A  1 837  ? 15.841  71.998  17.602  1.00 81.57  ?  897  THR A OG1    1 
ATOM   6457  C  CG2    . THR A  1 837  ? 14.547  70.174  18.624  1.00 85.43  ?  897  THR A CG2    1 
ATOM   6458  N  N      . ALA A  1 838  ? 13.703  73.442  15.084  1.00 94.65  ?  898  ALA A N      1 
ATOM   6459  C  CA     . ALA A  1 838  ? 13.739  74.790  14.502  1.00 94.55  ?  898  ALA A CA     1 
ATOM   6460  C  C      . ALA A  1 838  ? 12.542  75.631  14.884  1.00 97.81  ?  898  ALA A C      1 
ATOM   6461  O  O      . ALA A  1 838  ? 12.737  76.716  15.437  1.00 98.12  ?  898  ALA A O      1 
ATOM   6462  C  CB     . ALA A  1 838  ? 13.933  74.743  13.004  1.00 96.19  ?  898  ALA A CB     1 
ATOM   6463  N  N      . ASP A  1 839  ? 11.317  75.123  14.668  1.00 92.79  ?  899  ASP A N      1 
ATOM   6464  C  CA     . ASP A  1 839  ? 10.128  75.813  15.140  1.00 92.50  ?  899  ASP A CA     1 
ATOM   6465  C  C      . ASP A  1 839  ? 8.989   74.869  15.387  1.00 94.12  ?  899  ASP A C      1 
ATOM   6466  O  O      . ASP A  1 839  ? 9.040   73.706  15.019  1.00 94.45  ?  899  ASP A O      1 
ATOM   6467  C  CB     . ASP A  1 839  ? 9.699   77.013  14.259  1.00 95.67  ?  899  ASP A CB     1 
ATOM   6468  C  CG     . ASP A  1 839  ? 8.867   78.084  15.000  1.00 108.36 ?  899  ASP A CG     1 
ATOM   6469  O  OD1    . ASP A  1 839  ? 9.274   78.511  16.131  1.00 104.73 ?  899  ASP A OD1    1 
ATOM   6470  O  OD2    . ASP A  1 839  ? 7.761   78.389  14.530  1.00 120.69 -1 899  ASP A OD2    1 
ATOM   6471  N  N      . HIS A  1 840  ? 7.996   75.368  16.096  1.00 90.58  ?  900  HIS A N      1 
ATOM   6472  C  CA     . HIS A  1 840  ? 6.760   74.703  16.424  1.00 91.63  ?  900  HIS A CA     1 
ATOM   6473  C  C      . HIS A  1 840  ? 5.602   75.691  16.543  1.00 96.87  ?  900  HIS A C      1 
ATOM   6474  O  O      . HIS A  1 840  ? 4.775   75.591  17.443  1.00 98.19  ?  900  HIS A O      1 
ATOM   6475  C  CB     . HIS A  1 840  ? 6.909   73.853  17.670  1.00 92.78  ?  900  HIS A CB     1 
ATOM   6476  C  CG     . HIS A  1 840  ? 6.000   72.692  17.624  1.00 98.40  ?  900  HIS A CG     1 
ATOM   6477  N  ND1    . HIS A  1 840  ? 4.881   72.630  18.427  1.00 101.42 ?  900  HIS A ND1    1 
ATOM   6478  C  CD2    . HIS A  1 840  ? 6.041   71.608  16.818  1.00 101.91 ?  900  HIS A CD2    1 
ATOM   6479  C  CE1    . HIS A  1 840  ? 4.296   71.488  18.114  1.00 102.80 ?  900  HIS A CE1    1 
ATOM   6480  N  NE2    . HIS A  1 840  ? 4.970   70.833  17.156  1.00 103.25 ?  900  HIS A NE2    1 
ATOM   6481  N  N      . GLY A  1 841  ? 5.558   76.654  15.634  1.00 92.70  ?  901  GLY A N      1 
ATOM   6482  C  CA     . GLY A  1 841  ? 4.494   77.642  15.612  1.00 91.65  ?  901  GLY A CA     1 
ATOM   6483  C  C      . GLY A  1 841  ? 4.630   78.811  16.557  1.00 92.75  ?  901  GLY A C      1 
ATOM   6484  O  O      . GLY A  1 841  ? 5.517   78.854  17.421  1.00 89.31  ?  901  GLY A O      1 
ATOM   6485  N  N      . PRO A  1 842  ? 3.678   79.740  16.379  1.00 92.52  ?  902  PRO A N      1 
ATOM   6486  C  CA     . PRO A  1 842  ? 3.670   81.000  17.141  1.00 93.05  ?  902  PRO A CA     1 
ATOM   6487  C  C      . PRO A  1 842  ? 2.944   80.980  18.499  1.00 96.72  ?  902  PRO A C      1 
ATOM   6488  O  O      . PRO A  1 842  ? 2.916   82.022  19.192  1.00 95.32  ?  902  PRO A O      1 
ATOM   6489  C  CB     . PRO A  1 842  ? 2.903   81.924  16.190  1.00 95.66  ?  902  PRO A CB     1 
ATOM   6490  C  CG     . PRO A  1 842  ? 1.887   81.035  15.609  1.00 100.64 ?  902  PRO A CG     1 
ATOM   6491  C  CD     . PRO A  1 842  ? 2.641   79.767  15.332  1.00 95.84  ?  902  PRO A CD     1 
ATOM   6492  N  N      . ALA A  1 843  ? 2.306   79.832  18.836  1.00 92.01  ?  903  ALA A N      1 
ATOM   6493  C  CA     . ALA A  1 843  ? 1.499   79.704  20.021  1.00 91.58  ?  903  ALA A CA     1 
ATOM   6494  C  C      . ALA A  1 843  ? 2.274   79.460  21.313  1.00 95.93  ?  903  ALA A C      1 
ATOM   6495  O  O      . ALA A  1 843  ? 1.823   79.886  22.390  1.00 96.60  ?  903  ALA A O      1 
ATOM   6496  C  CB     . ALA A  1 843  ? 0.480   78.625  19.803  1.00 93.34  ?  903  ALA A CB     1 
ATOM   6497  N  N      . VAL A  1 844  ? 3.412   78.760  21.218  1.00 90.61  ?  904  VAL A N      1 
ATOM   6498  C  CA     . VAL A  1 844  ? 4.262   78.433  22.373  1.00 89.56  ?  904  VAL A CA     1 
ATOM   6499  C  C      . VAL A  1 844  ? 4.871   79.653  23.052  1.00 92.94  ?  904  VAL A C      1 
ATOM   6500  O  O      . VAL A  1 844  ? 5.116   80.681  22.401  1.00 92.58  ?  904  VAL A O      1 
ATOM   6501  C  CB     . VAL A  1 844  ? 5.327   77.396  22.005  1.00 93.89  ?  904  VAL A CB     1 
ATOM   6502  C  CG1    . VAL A  1 844  ? 4.639   76.135  21.525  1.00 95.43  ?  904  VAL A CG1    1 
ATOM   6503  C  CG2    . VAL A  1 844  ? 6.318   77.917  20.947  1.00 93.27  ?  904  VAL A CG2    1 
ATOM   6504  N  N      . SER A  1 845  ? 5.129   79.529  24.360  1.00 89.11  ?  905  SER A N      1 
ATOM   6505  C  CA     . SER A  1 845  ? 5.613   80.648  25.195  1.00 87.88  ?  905  SER A CA     1 
ATOM   6506  C  C      . SER A  1 845  ? 6.688   81.564  24.573  1.00 85.17  ?  905  SER A C      1 
ATOM   6507  O  O      . SER A  1 845  ? 6.499   82.777  24.488  1.00 79.93  ?  905  SER A O      1 
ATOM   6508  C  CB     . SER A  1 845  ? 6.091   80.139  26.557  1.00 92.62  ?  905  SER A CB     1 
ATOM   6509  O  OG     . SER A  1 845  ? 5.026   79.637  27.358  1.00 98.53  ?  905  SER A OG     1 
ATOM   6510  N  N      . GLY A  1 846  ? 7.786   80.974  24.156  1.00 83.87  ?  906  GLY A N      1 
ATOM   6511  C  CA     . GLY A  1 846  ? 8.885   81.741  23.596  1.00 84.72  ?  906  GLY A CA     1 
ATOM   6512  C  C      . GLY A  1 846  ? 8.559   82.443  22.296  1.00 90.17  ?  906  GLY A C      1 
ATOM   6513  O  O      . GLY A  1 846  ? 8.939   83.604  22.110  1.00 88.78  ?  906  GLY A O      1 
ATOM   6514  N  N      . ALA A  1 847  ? 7.875   81.730  21.370  1.00 87.51  ?  907  ALA A N      1 
ATOM   6515  C  CA     . ALA A  1 847  ? 7.561   82.331  20.074  1.00 87.43  ?  907  ALA A CA     1 
ATOM   6516  C  C      . ALA A  1 847  ? 6.625   83.488  20.275  1.00 90.40  ?  907  ALA A C      1 
ATOM   6517  O  O      . ALA A  1 847  ? 6.824   84.569  19.710  1.00 90.75  ?  907  ALA A O      1 
ATOM   6518  C  CB     . ALA A  1 847  ? 6.955   81.310  19.140  1.00 89.22  ?  907  ALA A CB     1 
ATOM   6519  N  N      . HIS A  1 848  ? 5.659   83.288  21.165  1.00 85.37  ?  908  HIS A N      1 
ATOM   6520  C  CA     . HIS A  1 848  ? 4.688   84.299  21.517  1.00 84.13  ?  908  HIS A CA     1 
ATOM   6521  C  C      . HIS A  1 848  ? 5.370   85.577  22.035  1.00 80.59  ?  908  HIS A C      1 
ATOM   6522  O  O      . HIS A  1 848  ? 5.125   86.658  21.508  1.00 76.49  ?  908  HIS A O      1 
ATOM   6523  C  CB     . HIS A  1 848  ? 3.720   83.682  22.537  1.00 85.86  ?  908  HIS A CB     1 
ATOM   6524  C  CG     . HIS A  1 848  ? 2.627   84.612  22.951  1.00 89.74  ?  908  HIS A CG     1 
ATOM   6525  N  ND1    . HIS A  1 848  ? 1.483   84.793  22.165  1.00 92.39  ?  908  HIS A ND1    1 
ATOM   6526  C  CD2    . HIS A  1 848  ? 2.556   85.433  24.024  1.00 90.54  ?  908  HIS A CD2    1 
ATOM   6527  C  CE1    . HIS A  1 848  ? 0.755   85.696  22.801  1.00 91.61  ?  908  HIS A CE1    1 
ATOM   6528  N  NE2    . HIS A  1 848  ? 1.351   86.096  23.933  1.00 91.13  ?  908  HIS A NE2    1 
ATOM   6529  N  N      . ASN A  1 849  ? 6.296   85.425  22.991  1.00 77.35  ?  909  ASN A N      1 
ATOM   6530  C  CA     . ASN A  1 849  ? 7.056   86.561  23.551  1.00 76.09  ?  909  ASN A CA     1 
ATOM   6531  C  C      . ASN A  1 849  ? 7.888   87.283  22.499  1.00 80.66  ?  909  ASN A C      1 
ATOM   6532  O  O      . ASN A  1 849  ? 7.864   88.504  22.469  1.00 81.02  ?  909  ASN A O      1 
ATOM   6533  C  CB     . ASN A  1 849  ? 7.909   86.155  24.743  1.00 69.26  ?  909  ASN A CB     1 
ATOM   6534  C  CG     . ASN A  1 849  ? 7.101   86.088  26.016  1.00 93.09  ?  909  ASN A CG     1 
ATOM   6535  O  OD1    . ASN A  1 849  ? 5.869   85.975  26.003  1.00 92.57  ?  909  ASN A OD1    1 
ATOM   6536  N  ND2    . ASN A  1 849  ? 7.766   86.149  27.157  1.00 82.84  ?  909  ASN A ND2    1 
ATOM   6537  N  N      . THR A  1 850  ? 8.573   86.534  21.605  1.00 76.74  ?  910  THR A N      1 
ATOM   6538  C  CA     . THR A  1 850  ? 9.355   87.105  20.509  1.00 75.22  ?  910  THR A CA     1 
ATOM   6539  C  C      . THR A  1 850  ? 8.437   87.933  19.635  1.00 80.05  ?  910  THR A C      1 
ATOM   6540  O  O      . THR A  1 850  ? 8.773   89.084  19.322  1.00 79.83  ?  910  THR A O      1 
ATOM   6541  C  CB     . THR A  1 850  ? 10.077  86.018  19.700  1.00 73.54  ?  910  THR A CB     1 
ATOM   6542  O  OG1    . THR A  1 850  ? 11.116  85.473  20.509  1.00 73.05  ?  910  THR A OG1    1 
ATOM   6543  C  CG2    . THR A  1 850  ? 10.712  86.562  18.421  1.00 71.01  ?  910  THR A CG2    1 
ATOM   6544  N  N      . ILE A  1 851  ? 7.286   87.350  19.241  1.00 76.53  ?  911  ILE A N      1 
ATOM   6545  C  CA     . ILE A  1 851  ? 6.300   88.048  18.420  1.00 76.03  ?  911  ILE A CA     1 
ATOM   6546  C  C      . ILE A  1 851  ? 5.844   89.383  19.103  1.00 83.56  ?  911  ILE A C      1 
ATOM   6547  O  O      . ILE A  1 851  ? 5.881   90.439  18.455  1.00 83.01  ?  911  ILE A O      1 
ATOM   6548  C  CB     . ILE A  1 851  ? 5.131   87.108  18.119  1.00 77.41  ?  911  ILE A CB     1 
ATOM   6549  C  CG1    . ILE A  1 851  ? 5.554   86.096  17.110  1.00 77.60  ?  911  ILE A CG1    1 
ATOM   6550  C  CG2    . ILE A  1 851  ? 3.917   87.872  17.638  1.00 77.26  ?  911  ILE A CG2    1 
ATOM   6551  C  CD1    . ILE A  1 851  ? 4.624   84.929  17.005  1.00 84.11  ?  911  ILE A CD1    1 
ATOM   6552  N  N      . ILE A  1 852  ? 5.418   89.323  20.391  1.00 81.53  ?  912  ILE A N      1 
ATOM   6553  C  CA     . ILE A  1 852  ? 4.953   90.492  21.134  1.00 83.06  ?  912  ILE A CA     1 
ATOM   6554  C  C      . ILE A  1 852  ? 5.992   91.592  21.035  1.00 88.82  ?  912  ILE A C      1 
ATOM   6555  O  O      . ILE A  1 852  ? 5.674   92.774  20.786  1.00 90.41  ?  912  ILE A O      1 
ATOM   6556  C  CB     . ILE A  1 852  ? 4.671   90.159  22.634  1.00 86.69  ?  912  ILE A CB     1 
ATOM   6557  C  CG1    . ILE A  1 852  ? 3.611   89.053  22.825  1.00 87.24  ?  912  ILE A CG1    1 
ATOM   6558  C  CG2    . ILE A  1 852  ? 4.308   91.423  23.451  1.00 88.68  ?  912  ILE A CG2    1 
ATOM   6559  C  CD1    . ILE A  1 852  ? 2.224   89.408  22.579  1.00 82.67  ?  912  ILE A CD1    1 
ATOM   6560  N  N      . CYS A  1 853  ? 7.234   91.177  21.247  1.00 85.33  ?  913  CYS A N      1 
ATOM   6561  C  CA     . CYS A  1 853  ? 8.422   92.000  21.247  1.00 85.66  ?  913  CYS A CA     1 
ATOM   6562  C  C      . CYS A  1 853  ? 8.712   92.720  19.954  1.00 88.07  ?  913  CYS A C      1 
ATOM   6563  O  O      . CYS A  1 853  ? 9.006   93.917  19.991  1.00 84.28  ?  913  CYS A O      1 
ATOM   6564  C  CB     . CYS A  1 853  ? 9.608   91.173  21.668  1.00 86.56  ?  913  CYS A CB     1 
ATOM   6565  S  SG     . CYS A  1 853  ? 10.920  92.185  22.303  1.00 91.18  ?  913  CYS A SG     1 
ATOM   6566  N  N      . ALA A  1 854  ? 8.673   91.950  18.807  1.00 85.94  ?  914  ALA A N      1 
ATOM   6567  C  CA     . ALA A  1 854  ? 8.831   92.424  17.431  1.00 84.21  ?  914  ALA A CA     1 
ATOM   6568  C  C      . ALA A  1 854  ? 7.682   93.419  17.168  1.00 90.05  ?  914  ALA A C      1 
ATOM   6569  O  O      . ALA A  1 854  ? 7.935   94.499  16.634  1.00 91.10  ?  914  ALA A O      1 
ATOM   6570  C  CB     . ALA A  1 854  ? 8.778   91.252  16.475  1.00 84.28  ?  914  ALA A CB     1 
ATOM   6571  N  N      . ARG A  1 855  ? 6.445   93.106  17.645  1.00 86.36  ?  915  ARG A N      1 
ATOM   6572  C  CA     . ARG A  1 855  ? 5.273   93.994  17.521  1.00 86.85  ?  915  ARG A CA     1 
ATOM   6573  C  C      . ARG A  1 855  ? 5.381   95.260  18.374  1.00 92.96  ?  915  ARG A C      1 
ATOM   6574  O  O      . ARG A  1 855  ? 4.775   96.285  18.053  1.00 92.25  ?  915  ARG A O      1 
ATOM   6575  C  CB     . ARG A  1 855  ? 3.993   93.237  17.815  1.00 83.09  ?  915  ARG A CB     1 
ATOM   6576  C  CG     . ARG A  1 855  ? 3.715   92.211  16.728  1.00 82.51  ?  915  ARG A CG     1 
ATOM   6577  C  CD     . ARG A  1 855  ? 2.406   91.488  16.914  1.00 85.87  ?  915  ARG A CD     1 
ATOM   6578  N  NE     . ARG A  1 855  ? 1.288   92.424  16.991  1.00 84.44  ?  915  ARG A NE     1 
ATOM   6579  C  CZ     . ARG A  1 855  ? 0.015   92.056  17.055  1.00 98.98  ?  915  ARG A CZ     1 
ATOM   6580  N  NH1    . ARG A  1 855  ? -0.319  90.768  16.982  1.00 70.82  1  915  ARG A NH1    1 
ATOM   6581  N  NH2    . ARG A  1 855  ? -0.939  92.971  17.153  1.00 101.46 ?  915  ARG A NH2    1 
ATOM   6582  N  N      . ALA A  1 856  ? 6.201   95.202  19.428  1.00 91.44  ?  916  ALA A N      1 
ATOM   6583  C  CA     . ALA A  1 856  ? 6.443   96.357  20.285  1.00 92.35  ?  916  ALA A CA     1 
ATOM   6584  C  C      . ALA A  1 856  ? 7.575   97.264  19.727  1.00 95.42  ?  916  ALA A C      1 
ATOM   6585  O  O      . ALA A  1 856  ? 8.091   98.143  20.456  1.00 94.39  ?  916  ALA A O      1 
ATOM   6586  C  CB     . ALA A  1 856  ? 6.766   95.899  21.702  1.00 92.74  ?  916  ALA A CB     1 
ATOM   6587  N  N      . GLY A  1 857  ? 7.943   97.005  18.460  1.00 90.60  ?  917  GLY A N      1 
ATOM   6588  C  CA     . GLY A  1 857  ? 8.944   97.717  17.668  1.00 89.19  ?  917  GLY A CA     1 
ATOM   6589  C  C      . GLY A  1 857  ? 10.385  97.532  18.062  1.00 89.74  ?  917  GLY A C      1 
ATOM   6590  O  O      . GLY A  1 857  ? 11.190  98.411  17.771  1.00 89.75  ?  917  GLY A O      1 
ATOM   6591  N  N      . LYS A  1 858  ? 10.726  96.407  18.702  1.00 84.84  ?  918  LYS A N      1 
ATOM   6592  C  CA     . LYS A  1 858  ? 12.085  96.117  19.156  1.00 83.91  ?  918  LYS A CA     1 
ATOM   6593  C  C      . LYS A  1 858  ? 12.974  95.489  18.067  1.00 91.07  ?  918  LYS A C      1 
ATOM   6594  O  O      . LYS A  1 858  ? 12.480  95.115  17.003  1.00 91.19  ?  918  LYS A O      1 
ATOM   6595  C  CB     . LYS A  1 858  ? 12.084  95.271  20.441  1.00 83.68  ?  918  LYS A CB     1 
ATOM   6596  C  CG     . LYS A  1 858  ? 11.502  95.985  21.662  1.00 79.91  ?  918  LYS A CG     1 
ATOM   6597  C  CD     . LYS A  1 858  ? 12.197  97.322  22.095  1.00 78.70  ?  918  LYS A CD     1 
ATOM   6598  C  CE     . LYS A  1 858  ? 13.697  97.259  22.383  1.00 86.69  ?  918  LYS A CE     1 
ATOM   6599  N  NZ     . LYS A  1 858  ? 14.046  96.861  23.786  1.00 91.68  1  918  LYS A NZ     1 
ATOM   6600  N  N      . ASP A  1 859  ? 14.297  95.449  18.326  1.00 89.32  ?  919  ASP A N      1 
ATOM   6601  C  CA     . ASP A  1 859  ? 15.322  94.894  17.446  1.00 90.56  ?  919  ASP A CA     1 
ATOM   6602  C  C      . ASP A  1 859  ? 15.317  93.367  17.498  1.00 93.81  ?  919  ASP A C      1 
ATOM   6603  O  O      . ASP A  1 859  ? 14.685  92.767  18.383  1.00 92.95  ?  919  ASP A O      1 
ATOM   6604  C  CB     . ASP A  1 859  ? 16.709  95.397  17.861  1.00 93.84  ?  919  ASP A CB     1 
ATOM   6605  C  CG     . ASP A  1 859  ? 17.061  95.128  19.325  1.00 115.93 ?  919  ASP A CG     1 
ATOM   6606  O  OD1    . ASP A  1 859  ? 16.560  95.873  20.202  1.00 118.15 ?  919  ASP A OD1    1 
ATOM   6607  O  OD2    . ASP A  1 859  ? 17.850  94.174  19.592  1.00 123.58 -1 919  ASP A OD2    1 
ATOM   6608  N  N      . LEU A  1 860  ? 16.075  92.738  16.576  1.00 87.64  ?  920  LEU A N      1 
ATOM   6609  C  CA     . LEU A  1 860  ? 16.133  91.278  16.470  1.00 83.46  ?  920  LEU A CA     1 
ATOM   6610  C  C      . LEU A  1 860  ? 16.640  90.643  17.738  1.00 83.81  ?  920  LEU A C      1 
ATOM   6611  O  O      . LEU A  1 860  ? 16.013  89.702  18.213  1.00 83.57  ?  920  LEU A O      1 
ATOM   6612  C  CB     . LEU A  1 860  ? 17.024  90.879  15.288  1.00 82.01  ?  920  LEU A CB     1 
ATOM   6613  C  CG     . LEU A  1 860  ? 17.074  89.445  14.864  1.00 82.51  ?  920  LEU A CG     1 
ATOM   6614  C  CD1    . LEU A  1 860  ? 17.339  89.365  13.405  1.00 81.72  ?  920  LEU A CD1    1 
ATOM   6615  C  CD2    . LEU A  1 860  ? 18.164  88.683  15.592  1.00 83.17  ?  920  LEU A CD2    1 
ATOM   6616  N  N      . VAL A  1 861  ? 17.775  91.130  18.269  1.00 77.83  ?  921  VAL A N      1 
ATOM   6617  C  CA     . VAL A  1 861  ? 18.376  90.558  19.479  1.00 76.61  ?  921  VAL A CA     1 
ATOM   6618  C  C      . VAL A  1 861  ? 17.441  90.644  20.676  1.00 77.77  ?  921  VAL A C      1 
ATOM   6619  O  O      . VAL A  1 861  ? 17.291  89.635  21.387  1.00 74.87  ?  921  VAL A O      1 
ATOM   6620  C  CB     . VAL A  1 861  ? 19.774  91.158  19.794  1.00 80.01  ?  921  VAL A CB     1 
ATOM   6621  C  CG1    . VAL A  1 861  ? 20.323  90.646  21.133  1.00 78.75  ?  921  VAL A CG1    1 
ATOM   6622  C  CG2    . VAL A  1 861  ? 20.760  90.907  18.653  1.00 79.77  ?  921  VAL A CG2    1 
ATOM   6623  N  N      . SER A  1 862  ? 16.825  91.842  20.903  1.00 73.62  ?  922  SER A N      1 
ATOM   6624  C  CA     . SER A  1 862  ? 15.905  92.017  22.021  1.00 72.76  ?  922  SER A CA     1 
ATOM   6625  C  C      . SER A  1 862  ? 14.738  91.076  21.875  1.00 76.67  ?  922  SER A C      1 
ATOM   6626  O  O      . SER A  1 862  ? 14.407  90.369  22.832  1.00 73.52  ?  922  SER A O      1 
ATOM   6627  C  CB     . SER A  1 862  ? 15.420  93.447  22.141  1.00 76.94  ?  922  SER A CB     1 
ATOM   6628  O  OG     . SER A  1 862  ? 16.497  94.319  22.452  1.00 91.73  ?  922  SER A OG     1 
ATOM   6629  N  N      . SER A  1 863  ? 14.193  90.956  20.652  1.00 76.92  ?  923  SER A N      1 
ATOM   6630  C  CA     . SER A  1 863  ? 13.022  90.108  20.401  1.00 78.35  ?  923  SER A CA     1 
ATOM   6631  C  C      . SER A  1 863  ? 13.317  88.656  20.539  1.00 81.76  ?  923  SER A C      1 
ATOM   6632  O  O      . SER A  1 863  ? 12.572  87.948  21.216  1.00 82.73  ?  923  SER A O      1 
ATOM   6633  C  CB     . SER A  1 863  ? 12.386  90.425  19.062  1.00 84.38  ?  923  SER A CB     1 
ATOM   6634  O  OG     . SER A  1 863  ? 12.060  91.808  19.017  1.00 98.38  ?  923  SER A OG     1 
ATOM   6635  N  N      . LEU A  1 864  ? 14.445  88.231  19.988  1.00 76.87  ?  924  LEU A N      1 
ATOM   6636  C  CA     . LEU A  1 864  ? 14.885  86.869  20.138  1.00 76.41  ?  924  LEU A CA     1 
ATOM   6637  C  C      . LEU A  1 864  ? 15.103  86.518  21.631  1.00 82.54  ?  924  LEU A C      1 
ATOM   6638  O  O      . LEU A  1 864  ? 14.557  85.509  22.082  1.00 84.06  ?  924  LEU A O      1 
ATOM   6639  C  CB     . LEU A  1 864  ? 16.172  86.631  19.334  1.00 75.58  ?  924  LEU A CB     1 
ATOM   6640  C  CG     . LEU A  1 864  ? 16.920  85.316  19.661  1.00 78.79  ?  924  LEU A CG     1 
ATOM   6641  C  CD1    . LEU A  1 864  ? 16.087  84.054  19.296  1.00 77.67  ?  924  LEU A CD1    1 
ATOM   6642  C  CD2    . LEU A  1 864  ? 18.279  85.309  19.028  1.00 81.46  ?  924  LEU A CD2    1 
ATOM   6643  N  N      . THR A  1 865  ? 15.922  87.319  22.381  1.00 77.82  ?  925  THR A N      1 
ATOM   6644  C  CA     . THR A  1 865  ? 16.241  87.015  23.778  1.00 77.24  ?  925  THR A CA     1 
ATOM   6645  C  C      . THR A  1 865  ? 14.992  87.048  24.631  1.00 83.93  ?  925  THR A C      1 
ATOM   6646  O  O      . THR A  1 865  ? 14.867  86.178  25.483  1.00 85.25  ?  925  THR A O      1 
ATOM   6647  C  CB     . THR A  1 865  ? 17.385  87.862  24.336  1.00 83.52  ?  925  THR A CB     1 
ATOM   6648  O  OG1    . THR A  1 865  ? 17.011  89.198  24.239  1.00 96.24  ?  925  THR A OG1    1 
ATOM   6649  C  CG2    . THR A  1 865  ? 18.648  87.731  23.558  1.00 80.30  ?  925  THR A CG2    1 
ATOM   6650  N  N      . SER A  1 866  ? 14.014  87.958  24.333  1.00 81.05  ?  926  SER A N      1 
ATOM   6651  C  CA     . SER A  1 866  ? 12.749  88.027  25.079  1.00 81.34  ?  926  SER A CA     1 
ATOM   6652  C  C      . SER A  1 866  ? 12.048  86.636  25.040  1.00 88.08  ?  926  SER A C      1 
ATOM   6653  O  O      . SER A  1 866  ? 11.572  86.134  26.062  1.00 89.73  ?  926  SER A O      1 
ATOM   6654  C  CB     . SER A  1 866  ? 11.861  89.130  24.514  1.00 83.51  ?  926  SER A CB     1 
ATOM   6655  O  OG     . SER A  1 866  ? 10.672  89.334  25.253  1.00 92.55  ?  926  SER A OG     1 
ATOM   6656  N  N      . GLY A  1 867  ? 12.076  85.993  23.885  1.00 83.71  ?  927  GLY A N      1 
ATOM   6657  C  CA     . GLY A  1 867  ? 11.519  84.657  23.753  1.00 83.48  ?  927  GLY A CA     1 
ATOM   6658  C  C      . GLY A  1 867  ? 12.414  83.584  24.332  1.00 85.21  ?  927  GLY A C      1 
ATOM   6659  O  O      . GLY A  1 867  ? 11.903  82.655  24.955  1.00 86.16  ?  927  GLY A O      1 
ATOM   6660  N  N      . LEU A  1 868  ? 13.755  83.686  24.139  1.00 78.98  ?  928  LEU A N      1 
ATOM   6661  C  CA     . LEU A  1 868  ? 14.688  82.681  24.670  1.00 77.40  ?  928  LEU A CA     1 
ATOM   6662  C  C      . LEU A  1 868  ? 14.587  82.578  26.160  1.00 84.80  ?  928  LEU A C      1 
ATOM   6663  O  O      . LEU A  1 868  ? 14.715  81.478  26.691  1.00 88.24  ?  928  LEU A O      1 
ATOM   6664  C  CB     . LEU A  1 868  ? 16.141  82.927  24.302  1.00 75.81  ?  928  LEU A CB     1 
ATOM   6665  C  CG     . LEU A  1 868  ? 16.512  82.758  22.852  1.00 81.09  ?  928  LEU A CG     1 
ATOM   6666  C  CD1    . LEU A  1 868  ? 17.971  83.112  22.651  1.00 82.05  ?  928  LEU A CD1    1 
ATOM   6667  C  CD2    . LEU A  1 868  ? 16.205  81.324  22.305  1.00 81.92  ?  928  LEU A CD2    1 
ATOM   6668  N  N      . LEU A  1 869  ? 14.305  83.693  26.838  1.00 78.98  ?  929  LEU A N      1 
ATOM   6669  C  CA     . LEU A  1 869  ? 14.225  83.718  28.289  1.00 77.29  ?  929  LEU A CA     1 
ATOM   6670  C  C      . LEU A  1 869  ? 13.068  82.906  28.833  1.00 82.43  ?  929  LEU A C      1 
ATOM   6671  O  O      . LEU A  1 869  ? 13.133  82.558  30.005  1.00 83.73  ?  929  LEU A O      1 
ATOM   6672  C  CB     . LEU A  1 869  ? 14.243  85.141  28.848  1.00 76.26  ?  929  LEU A CB     1 
ATOM   6673  C  CG     . LEU A  1 869  ? 15.564  85.829  28.706  1.00 79.18  ?  929  LEU A CG     1 
ATOM   6674  C  CD1    . LEU A  1 869  ? 15.388  87.292  28.680  1.00 79.52  ?  929  LEU A CD1    1 
ATOM   6675  C  CD2    . LEU A  1 869  ? 16.527  85.381  29.757  1.00 81.90  ?  929  LEU A CD2    1 
ATOM   6676  N  N      . THR A  1 870  ? 12.088  82.497  28.003  1.00 78.70  ?  930  THR A N      1 
ATOM   6677  C  CA     . THR A  1 870  ? 11.015  81.595  28.491  1.00 79.23  ?  930  THR A CA     1 
ATOM   6678  C  C      . THR A  1 870  ? 11.477  80.106  28.575  1.00 82.60  ?  930  THR A C      1 
ATOM   6679  O  O      . THR A  1 870  ? 10.768  79.249  29.174  1.00 82.98  ?  930  THR A O      1 
ATOM   6680  C  CB     . THR A  1 870  ? 9.800   81.656  27.575  1.00 86.09  ?  930  THR A CB     1 
ATOM   6681  O  OG1    . THR A  1 870  ? 10.131  81.066  26.321  1.00 84.69  ?  930  THR A OG1    1 
ATOM   6682  C  CG2    . THR A  1 870  ? 9.310   83.057  27.366  1.00 88.73  ?  930  THR A CG2    1 
ATOM   6683  N  N      . ILE A  1 871  ? 12.634  79.798  27.915  1.00 76.02  ?  931  ILE A N      1 
ATOM   6684  C  CA     . ILE A  1 871  ? 13.156  78.442  27.818  1.00 75.56  ?  931  ILE A CA     1 
ATOM   6685  C  C      . ILE A  1 871  ? 13.715  77.982  29.135  1.00 88.67  ?  931  ILE A C      1 
ATOM   6686  O  O      . ILE A  1 871  ? 14.416  78.742  29.813  1.00 86.92  ?  931  ILE A O      1 
ATOM   6687  C  CB     . ILE A  1 871  ? 14.113  78.277  26.635  1.00 75.10  ?  931  ILE A CB     1 
ATOM   6688  C  CG1    . ILE A  1 871  ? 13.394  78.623  25.359  1.00 73.89  ?  931  ILE A CG1    1 
ATOM   6689  C  CG2    . ILE A  1 871  ? 14.678  76.836  26.580  1.00 73.92  ?  931  ILE A CG2    1 
ATOM   6690  C  CD1    . ILE A  1 871  ? 14.256  78.669  24.194  1.00 69.67  ?  931  ILE A CD1    1 
ATOM   6691  N  N      . GLY A  1 872  ? 13.406  76.745  29.501  1.00 92.79  ?  932  GLY A N      1 
ATOM   6692  C  CA     . GLY A  1 872  ? 14.019  76.247  30.695  1.00 95.20  ?  932  GLY A CA     1 
ATOM   6693  C  C      . GLY A  1 872  ? 13.235  75.231  31.490  1.00 104.17 ?  932  GLY A C      1 
ATOM   6694  O  O      . GLY A  1 872  ? 13.762  74.135  31.752  1.00 104.79 ?  932  GLY A O      1 
ATOM   6695  N  N      . ASP A  1 873  ? 12.047  75.622  31.967  1.00 102.80 ?  933  ASP A N      1 
ATOM   6696  C  CA     . ASP A  1 873  ? 11.380  74.622  32.738  1.00 104.87 ?  933  ASP A CA     1 
ATOM   6697  C  C      . ASP A  1 873  ? 10.209  73.951  32.044  1.00 103.77 ?  933  ASP A C      1 
ATOM   6698  O  O      . ASP A  1 873  ? 10.347  72.862  31.462  1.00 104.24 ?  933  ASP A O      1 
ATOM   6699  C  CB     . ASP A  1 873  ? 11.022  75.191  34.151  1.00 109.52 ?  933  ASP A CB     1 
ATOM   6700  C  CG     . ASP A  1 873  ? 10.319  74.205  35.118  1.00 143.73 ?  933  ASP A CG     1 
ATOM   6701  O  OD1    . ASP A  1 873  ? 10.678  72.993  35.111  1.00 146.75 ?  933  ASP A OD1    1 
ATOM   6702  O  OD2    . ASP A  1 873  ? 9.406   74.653  35.889  1.00 158.71 -1 933  ASP A OD2    1 
ATOM   6703  N  N      . ARG A  1 874  ? 9.076   74.637  32.074  1.00 94.44  ?  934  ARG A N      1 
ATOM   6704  C  CA     . ARG A  1 874  ? 7.832   74.191  31.499  1.00 92.33  ?  934  ARG A CA     1 
ATOM   6705  C  C      . ARG A  1 874  ? 7.899   74.257  29.993  1.00 95.88  ?  934  ARG A C      1 
ATOM   6706  O  O      . ARG A  1 874  ? 7.202   73.495  29.325  1.00 95.42  ?  934  ARG A O      1 
ATOM   6707  C  CB     . ARG A  1 874  ? 6.681   75.026  32.062  1.00 88.94  ?  934  ARG A CB     1 
ATOM   6708  C  CG     . ARG A  1 874  ? 6.763   75.209  33.580  1.00 92.12  ?  934  ARG A CG     1 
ATOM   6709  C  CD     . ARG A  1 874  ? 5.413   75.256  34.227  1.00 105.76 ?  934  ARG A CD     1 
ATOM   6710  N  NE     . ARG A  1 874  ? 5.453   76.003  35.476  1.00 116.56 ?  934  ARG A NE     1 
ATOM   6711  C  CZ     . ARG A  1 874  ? 4.390   76.596  35.998  1.00 137.39 ?  934  ARG A CZ     1 
ATOM   6712  N  NH1    . ARG A  1 874  ? 3.213   76.511  35.391  1.00 117.42 1  934  ARG A NH1    1 
ATOM   6713  N  NH2    . ARG A  1 874  ? 4.493   77.284  37.129  1.00 134.97 ?  934  ARG A NH2    1 
ATOM   6714  N  N      . PHE A  1 875  ? 8.773   75.135  29.456  1.00 93.12  ?  935  PHE A N      1 
ATOM   6715  C  CA     . PHE A  1 875  ? 8.945   75.270  28.021  1.00 92.13  ?  935  PHE A CA     1 
ATOM   6716  C  C      . PHE A  1 875  ? 10.387  75.008  27.619  1.00 101.33 ?  935  PHE A C      1 
ATOM   6717  O  O      . PHE A  1 875  ? 11.292  75.673  28.115  1.00 100.49 ?  935  PHE A O      1 
ATOM   6718  C  CB     . PHE A  1 875  ? 8.437   76.629  27.532  1.00 90.78  ?  935  PHE A CB     1 
ATOM   6719  C  CG     . PHE A  1 875  ? 8.750   76.896  26.095  1.00 89.73  ?  935  PHE A CG     1 
ATOM   6720  C  CD1    . PHE A  1 875  ? 8.175   76.144  25.095  1.00 92.65  ?  935  PHE A CD1    1 
ATOM   6721  C  CD2    . PHE A  1 875  ? 9.620   77.900  25.739  1.00 91.43  ?  935  PHE A CD2    1 
ATOM   6722  C  CE1    . PHE A  1 875  ? 8.472   76.385  23.766  1.00 94.04  ?  935  PHE A CE1    1 
ATOM   6723  C  CE2    . PHE A  1 875  ? 9.910   78.154  24.406  1.00 94.73  ?  935  PHE A CE2    1 
ATOM   6724  C  CZ     . PHE A  1 875  ? 9.353   77.376  23.432  1.00 93.70  ?  935  PHE A CZ     1 
ATOM   6725  N  N      . GLY A  1 876  ? 10.565  74.001  26.777  1.00 102.00 ?  936  GLY A N      1 
ATOM   6726  C  CA     . GLY A  1 876  ? 11.853  73.610  26.230  1.00 103.64 ?  936  GLY A CA     1 
ATOM   6727  C  C      . GLY A  1 876  ? 12.720  72.694  27.076  1.00 110.83 ?  936  GLY A C      1 
ATOM   6728  O  O      . GLY A  1 876  ? 13.750  72.189  26.587  1.00 110.38 ?  936  GLY A O      1 
ATOM   6729  N  N      . GLY A  1 877  ? 12.310  72.464  28.332  1.00 109.21 ?  937  GLY A N      1 
ATOM   6730  C  CA     . GLY A  1 877  ? 13.096  71.695  29.296  1.00 108.41 ?  937  GLY A CA     1 
ATOM   6731  C  C      . GLY A  1 877  ? 13.076  70.187  29.186  1.00 111.12 ?  937  GLY A C      1 
ATOM   6732  O  O      . GLY A  1 877  ? 14.005  69.527  29.667  1.00 111.58 ?  937  GLY A O      1 
ATOM   6733  N  N      . ALA A  1 878  ? 12.019  69.647  28.555  1.00 105.25 ?  938  ALA A N      1 
ATOM   6734  C  CA     . ALA A  1 878  ? 11.715  68.221  28.409  1.00 103.39 ?  938  ALA A CA     1 
ATOM   6735  C  C      . ALA A  1 878  ? 12.800  67.334  27.832  1.00 102.07 ?  938  ALA A C      1 
ATOM   6736  O  O      . ALA A  1 878  ? 12.877  66.188  28.246  1.00 98.69  ?  938  ALA A O      1 
ATOM   6737  C  CB     . ALA A  1 878  ? 10.462  68.060  27.596  1.00 105.20 ?  938  ALA A CB     1 
ATOM   6738  N  N      . LEU A  1 879  ? 13.618  67.840  26.881  1.00 99.19  ?  939  LEU A N      1 
ATOM   6739  C  CA     . LEU A  1 879  ? 14.719  67.073  26.266  1.00 98.20  ?  939  LEU A CA     1 
ATOM   6740  C  C      . LEU A  1 879  ? 15.684  66.673  27.351  1.00 101.54 ?  939  LEU A C      1 
ATOM   6741  O  O      . LEU A  1 879  ? 16.005  65.487  27.485  1.00 101.02 ?  939  LEU A O      1 
ATOM   6742  C  CB     . LEU A  1 879  ? 15.496  67.880  25.202  1.00 97.85  ?  939  LEU A CB     1 
ATOM   6743  C  CG     . LEU A  1 879  ? 14.871  68.076  23.844  1.00 102.94 ?  939  LEU A CG     1 
ATOM   6744  C  CD1    . LEU A  1 879  ? 13.973  69.310  23.857  1.00 105.78 ?  939  LEU A CD1    1 
ATOM   6745  C  CD2    . LEU A  1 879  ? 15.941  68.299  22.837  1.00 101.89 ?  939  LEU A CD2    1 
ATOM   6746  N  N      . ASP A  1 880  ? 16.142  67.668  28.136  1.00 98.91  ?  940  ASP A N      1 
ATOM   6747  C  CA     . ASP A  1 880  ? 17.087  67.459  29.236  1.00 99.55  ?  940  ASP A CA     1 
ATOM   6748  C  C      . ASP A  1 880  ? 16.467  66.561  30.295  1.00 99.40  ?  940  ASP A C      1 
ATOM   6749  O  O      . ASP A  1 880  ? 17.061  65.546  30.661  1.00 99.10  ?  940  ASP A O      1 
ATOM   6750  C  CB     . ASP A  1 880  ? 17.548  68.808  29.824  1.00 103.74 ?  940  ASP A CB     1 
ATOM   6751  C  CG     . ASP A  1 880  ? 18.777  68.762  30.744  1.00 130.71 ?  940  ASP A CG     1 
ATOM   6752  O  OD1    . ASP A  1 880  ? 19.929  68.523  30.224  1.00 132.65 ?  940  ASP A OD1    1 
ATOM   6753  O  OD2    . ASP A  1 880  ? 18.627  69.097  31.950  1.00 142.61 -1 940  ASP A OD2    1 
ATOM   6754  N  N      . ALA A  1 881  ? 15.237  66.883  30.706  1.00 93.31  ?  941  ALA A N      1 
ATOM   6755  C  CA     . ALA A  1 881  ? 14.485  66.149  31.716  1.00 92.41  ?  941  ALA A CA     1 
ATOM   6756  C  C      . ALA A  1 881  ? 14.345  64.688  31.378  1.00 95.31  ?  941  ALA A C      1 
ATOM   6757  O  O      . ALA A  1 881  ? 14.614  63.859  32.249  1.00 94.72  ?  941  ALA A O      1 
ATOM   6758  C  CB     . ALA A  1 881  ? 13.122  66.771  31.878  1.00 93.68  ?  941  ALA A CB     1 
ATOM   6759  N  N      . ALA A  1 882  ? 13.965  64.374  30.101  1.00 91.35  ?  942  ALA A N      1 
ATOM   6760  C  CA     . ALA A  1 882  ? 13.784  63.010  29.587  1.00 89.83  ?  942  ALA A CA     1 
ATOM   6761  C  C      . ALA A  1 882  ? 15.090  62.286  29.576  1.00 91.28  ?  942  ALA A C      1 
ATOM   6762  O  O      . ALA A  1 882  ? 15.152  61.175  30.088  1.00 92.62  ?  942  ALA A O      1 
ATOM   6763  C  CB     . ALA A  1 882  ? 13.192  63.036  28.182  1.00 90.39  ?  942  ALA A CB     1 
ATOM   6764  N  N      . ALA A  1 883  ? 16.143  62.915  29.047  1.00 86.58  ?  943  ALA A N      1 
ATOM   6765  C  CA     . ALA A  1 883  ? 17.467  62.300  28.979  1.00 88.18  ?  943  ALA A CA     1 
ATOM   6766  C  C      . ALA A  1 883  ? 17.950  61.909  30.363  1.00 95.24  ?  943  ALA A C      1 
ATOM   6767  O  O      . ALA A  1 883  ? 18.397  60.772  30.565  1.00 93.25  ?  943  ALA A O      1 
ATOM   6768  C  CB     . ALA A  1 883  ? 18.451  63.267  28.351  1.00 88.59  ?  943  ALA A CB     1 
ATOM   6769  N  N      . LYS A  1 884  ? 17.823  62.857  31.328  1.00 94.25  ?  944  LYS A N      1 
ATOM   6770  C  CA     . LYS A  1 884  ? 18.269  62.669  32.705  1.00 94.80  ?  944  LYS A CA     1 
ATOM   6771  C  C      . LYS A  1 884  ? 17.491  61.571  33.405  1.00 100.75 ?  944  LYS A C      1 
ATOM   6772  O  O      . LYS A  1 884  ? 18.118  60.680  33.984  1.00 102.17 ?  944  LYS A O      1 
ATOM   6773  C  CB     . LYS A  1 884  ? 18.226  63.987  33.460  1.00 96.04  ?  944  LYS A CB     1 
ATOM   6774  C  CG     . LYS A  1 884  ? 19.350  64.941  33.050  1.00 100.29 ?  944  LYS A CG     1 
ATOM   6775  C  CD     . LYS A  1 884  ? 19.190  66.318  33.714  1.00 110.70 ?  944  LYS A CD     1 
ATOM   6776  C  CE     . LYS A  1 884  ? 20.471  67.112  33.709  1.00 126.94 ?  944  LYS A CE     1 
ATOM   6777  N  NZ     . LYS A  1 884  ? 20.276  68.539  34.107  1.00 133.57 1  944  LYS A NZ     1 
ATOM   6778  N  N      . MET A  1 885  ? 16.139  61.611  33.313  1.00 96.27  ?  945  MET A N      1 
ATOM   6779  C  CA     . MET A  1 885  ? 15.231  60.636  33.915  1.00 95.75  ?  945  MET A CA     1 
ATOM   6780  C  C      . MET A  1 885  ? 15.502  59.187  33.412  1.00 98.55  ?  945  MET A C      1 
ATOM   6781  O  O      . MET A  1 885  ? 15.669  58.270  34.220  1.00 98.36  ?  945  MET A O      1 
ATOM   6782  C  CB     . MET A  1 885  ? 13.774  61.078  33.687  1.00 97.58  ?  945  MET A CB     1 
ATOM   6783  C  CG     . MET A  1 885  ? 12.792  60.196  34.336  1.00 102.97 ?  945  MET A CG     1 
ATOM   6784  S  SD     . MET A  1 885  ? 11.097  60.769  34.138  1.00 108.50 ?  945  MET A SD     1 
ATOM   6785  C  CE     . MET A  1 885  ? 10.960  61.945  35.447  1.00 106.29 ?  945  MET A CE     1 
ATOM   6786  N  N      . PHE A  1 886  ? 15.541  58.991  32.093  1.00 94.36  ?  946  PHE A N      1 
ATOM   6787  C  CA     . PHE A  1 886  ? 15.773  57.684  31.500  1.00 94.43  ?  946  PHE A CA     1 
ATOM   6788  C  C      . PHE A  1 886  ? 17.170  57.183  31.803  1.00 102.28 ?  946  PHE A C      1 
ATOM   6789  O  O      . PHE A  1 886  ? 17.327  55.991  32.086  1.00 101.99 ?  946  PHE A O      1 
ATOM   6790  C  CB     . PHE A  1 886  ? 15.520  57.727  29.993  1.00 94.74  ?  946  PHE A CB     1 
ATOM   6791  C  CG     . PHE A  1 886  ? 14.068  57.617  29.595  1.00 96.31  ?  946  PHE A CG     1 
ATOM   6792  C  CD1    . PHE A  1 886  ? 13.433  56.382  29.548  1.00 100.44 ?  946  PHE A CD1    1 
ATOM   6793  C  CD2    . PHE A  1 886  ? 13.332  58.746  29.254  1.00 97.59  ?  946  PHE A CD2    1 
ATOM   6794  C  CE1    . PHE A  1 886  ? 12.086  56.283  29.163  1.00 100.55 ?  946  PHE A CE1    1 
ATOM   6795  C  CE2    . PHE A  1 886  ? 11.980  58.646  28.887  1.00 100.26 ?  946  PHE A CE2    1 
ATOM   6796  C  CZ     . PHE A  1 886  ? 11.376  57.413  28.820  1.00 98.64  ?  946  PHE A CZ     1 
ATOM   6797  N  N      . SER A  1 887  ? 18.194  58.091  31.762  1.00 100.98 ?  947  SER A N      1 
ATOM   6798  C  CA     . SER A  1 887  ? 19.592  57.716  32.041  1.00 101.58 ?  947  SER A CA     1 
ATOM   6799  C  C      . SER A  1 887  ? 19.705  57.218  33.451  1.00 104.93 ?  947  SER A C      1 
ATOM   6800  O  O      . SER A  1 887  ? 20.352  56.194  33.661  1.00 105.49 ?  947  SER A O      1 
ATOM   6801  C  CB     . SER A  1 887  ? 20.543  58.893  31.852  1.00 105.73 ?  947  SER A CB     1 
ATOM   6802  O  OG     . SER A  1 887  ? 20.702  59.224  30.485  1.00 118.60 ?  947  SER A OG     1 
ATOM   6803  N  N      . LYS A  1 888  ? 19.051  57.917  34.414  1.00 99.92  ?  948  LYS A N      1 
ATOM   6804  C  CA     . LYS A  1 888  ? 19.076  57.542  35.826  1.00 101.04 ?  948  LYS A CA     1 
ATOM   6805  C  C      . LYS A  1 888  ? 18.470  56.166  36.015  1.00 109.87 ?  948  LYS A C      1 
ATOM   6806  O  O      . LYS A  1 888  ? 19.086  55.307  36.668  1.00 112.32 ?  948  LYS A O      1 
ATOM   6807  C  CB     . LYS A  1 888  ? 18.332  58.576  36.676  1.00 101.66 ?  948  LYS A CB     1 
ATOM   6808  C  CG     . LYS A  1 888  ? 18.564  58.402  38.171  1.00 110.07 ?  948  LYS A CG     1 
ATOM   6809  C  CD     . LYS A  1 888  ? 17.471  59.073  39.024  1.00 115.71 ?  948  LYS A CD     1 
ATOM   6810  C  CE     . LYS A  1 888  ? 17.974  59.462  40.397  1.00 123.18 ?  948  LYS A CE     1 
ATOM   6811  N  NZ     . LYS A  1 888  ? 16.869  59.763  41.349  1.00 134.84 1  948  LYS A NZ     1 
ATOM   6812  N  N      . ALA A  1 889  ? 17.269  55.968  35.423  1.00 106.61 ?  949  ALA A N      1 
ATOM   6813  C  CA     . ALA A  1 889  ? 16.534  54.706  35.507  1.00 107.54 ?  949  ALA A CA     1 
ATOM   6814  C  C      . ALA A  1 889  ? 17.344  53.555  34.936  1.00 109.51 ?  949  ALA A C      1 
ATOM   6815  O  O      . ALA A  1 889  ? 17.531  52.533  35.597  1.00 111.49 ?  949  ALA A O      1 
ATOM   6816  C  CB     . ALA A  1 889  ? 15.227  54.819  34.761  1.00 107.61 ?  949  ALA A CB     1 
ATOM   6817  N  N      . PHE A  1 890  ? 17.873  53.749  33.740  1.00 101.93 ?  950  PHE A N      1 
ATOM   6818  C  CA     . PHE A  1 890  ? 18.657  52.748  33.053  1.00 101.40 ?  950  PHE A CA     1 
ATOM   6819  C  C      . PHE A  1 890  ? 19.825  52.333  33.890  1.00 106.02 ?  950  PHE A C      1 
ATOM   6820  O  O      . PHE A  1 890  ? 19.953  51.159  34.219  1.00 106.08 ?  950  PHE A O      1 
ATOM   6821  C  CB     . PHE A  1 890  ? 19.122  53.330  31.732  1.00 101.38 ?  950  PHE A CB     1 
ATOM   6822  C  CG     . PHE A  1 890  ? 19.931  52.400  30.885  1.00 103.61 ?  950  PHE A CG     1 
ATOM   6823  C  CD1    . PHE A  1 890  ? 19.317  51.541  29.990  1.00 106.40 ?  950  PHE A CD1    1 
ATOM   6824  C  CD2    . PHE A  1 890  ? 21.313  52.447  30.911  1.00 107.24 ?  950  PHE A CD2    1 
ATOM   6825  C  CE1    . PHE A  1 890  ? 20.080  50.692  29.181  1.00 108.88 ?  950  PHE A CE1    1 
ATOM   6826  C  CE2    . PHE A  1 890  ? 22.075  51.613  30.095  1.00 110.92 ?  950  PHE A CE2    1 
ATOM   6827  C  CZ     . PHE A  1 890  ? 21.457  50.727  29.247  1.00 108.91 ?  950  PHE A CZ     1 
ATOM   6828  N  N      . ASP A  1 891  ? 20.644  53.312  34.264  1.00 104.98 ?  951  ASP A N      1 
ATOM   6829  C  CA     . ASP A  1 891  ? 21.861  53.122  35.047  1.00 108.37 ?  951  ASP A CA     1 
ATOM   6830  C  C      . ASP A  1 891  ? 21.624  52.526  36.437  1.00 111.85 ?  951  ASP A C      1 
ATOM   6831  O  O      . ASP A  1 891  ? 22.507  51.850  36.961  1.00 112.14 ?  951  ASP A O      1 
ATOM   6832  C  CB     . ASP A  1 891  ? 22.666  54.434  35.134  1.00 111.24 ?  951  ASP A CB     1 
ATOM   6833  C  CG     . ASP A  1 891  ? 23.152  55.012  33.801  1.00 129.49 ?  951  ASP A CG     1 
ATOM   6834  O  OD1    . ASP A  1 891  ? 23.315  54.233  32.825  1.00 131.04 ?  951  ASP A OD1    1 
ATOM   6835  O  OD2    . ASP A  1 891  ? 23.396  56.230  33.746  1.00 137.40 -1 951  ASP A OD2    1 
ATOM   6836  N  N      . SER A  1 892  ? 20.433  52.739  37.015  1.00 108.15 ?  952  SER A N      1 
ATOM   6837  C  CA     . SER A  1 892  ? 20.064  52.182  38.321  1.00 110.02 ?  952  SER A CA     1 
ATOM   6838  C  C      . SER A  1 892  ? 19.878  50.666  38.236  1.00 116.04 ?  952  SER A C      1 
ATOM   6839  O  O      . SER A  1 892  ? 19.953  49.979  39.260  1.00 119.59 ?  952  SER A O      1 
ATOM   6840  C  CB     . SER A  1 892  ? 18.780  52.824  38.844  1.00 112.57 ?  952  SER A CB     1 
ATOM   6841  O  OG     . SER A  1 892  ? 17.610  52.314  38.220  1.00 118.25 ?  952  SER A OG     1 
ATOM   6842  N  N      . GLY A  1 893  ? 19.625  50.175  37.020  1.00 109.06 ?  953  GLY A N      1 
ATOM   6843  C  CA     . GLY A  1 893  ? 19.429  48.765  36.728  1.00 108.52 ?  953  GLY A CA     1 
ATOM   6844  C  C      . GLY A  1 893  ? 18.001  48.314  36.848  1.00 108.85 ?  953  GLY A C      1 
ATOM   6845  O  O      . GLY A  1 893  ? 17.723  47.121  36.747  1.00 109.76 ?  953  GLY A O      1 
ATOM   6846  N  N      . ILE A  1 894  ? 17.084  49.239  37.094  1.00 103.95 ?  954  ILE A N      1 
ATOM   6847  C  CA     . ILE A  1 894  ? 15.673  48.857  37.189  1.00 103.92 ?  954  ILE A CA     1 
ATOM   6848  C  C      . ILE A  1 894  ? 15.156  48.571  35.778  1.00 107.05 ?  954  ILE A C      1 
ATOM   6849  O  O      . ILE A  1 894  ? 15.554  49.263  34.813  1.00 105.91 ?  954  ILE A O      1 
ATOM   6850  C  CB     . ILE A  1 894  ? 14.778  49.842  38.000  1.00 105.81 ?  954  ILE A CB     1 
ATOM   6851  C  CG1    . ILE A  1 894  ? 14.541  51.162  37.248  1.00 104.10 ?  954  ILE A CG1    1 
ATOM   6852  C  CG2    . ILE A  1 894  ? 15.320  50.043  39.407  1.00 107.26 ?  954  ILE A CG2    1 
ATOM   6853  C  CD1    . ILE A  1 894  ? 14.014  52.341  38.078  1.00 117.74 ?  954  ILE A CD1    1 
ATOM   6854  N  N      . ILE A  1 895  ? 14.331  47.525  35.653  1.00 102.85 ?  955  ILE A N      1 
ATOM   6855  C  CA     . ILE A  1 895  ? 13.775  47.163  34.356  1.00 102.01 ?  955  ILE A CA     1 
ATOM   6856  C  C      . ILE A  1 895  ? 12.672  48.178  33.977  1.00 107.76 ?  955  ILE A C      1 
ATOM   6857  O  O      . ILE A  1 895  ? 12.112  48.805  34.894  1.00 108.29 ?  955  ILE A O      1 
ATOM   6858  C  CB     . ILE A  1 895  ? 13.335  45.659  34.286  1.00 106.18 ?  955  ILE A CB     1 
ATOM   6859  C  CG1    . ILE A  1 895  ? 12.220  45.262  35.275  1.00 105.38 ?  955  ILE A CG1    1 
ATOM   6860  C  CG2    . ILE A  1 895  ? 14.508  44.733  34.444  1.00 109.69 ?  955  ILE A CG2    1 
ATOM   6861  C  CD1    . ILE A  1 895  ? 10.856  45.210  34.607  1.00 103.81 ?  955  ILE A CD1    1 
ATOM   6862  N  N      . PRO A  1 896  ? 12.343  48.358  32.669  1.00 104.03 ?  956  PRO A N      1 
ATOM   6863  C  CA     . PRO A  1 896  ? 11.310  49.336  32.288  1.00 103.15 ?  956  PRO A CA     1 
ATOM   6864  C  C      . PRO A  1 896  ? 9.997   49.262  33.085  1.00 111.99 ?  956  PRO A C      1 
ATOM   6865  O  O      . PRO A  1 896  ? 9.530   50.316  33.531  1.00 111.51 ?  956  PRO A O      1 
ATOM   6866  C  CB     . PRO A  1 896  ? 11.132  49.066  30.807  1.00 103.54 ?  956  PRO A CB     1 
ATOM   6867  C  CG     . PRO A  1 896  ? 12.489  48.678  30.383  1.00 107.59 ?  956  PRO A CG     1 
ATOM   6868  C  CD     . PRO A  1 896  ? 12.951  47.764  31.467  1.00 105.22 ?  956  PRO A CD     1 
ATOM   6869  N  N      . MET A  1 897  ? 9.447   48.053  33.342  1.00 111.88 ?  957  MET A N      1 
ATOM   6870  C  CA     . MET A  1 897  ? 8.227   47.938  34.142  1.00 113.89 ?  957  MET A CA     1 
ATOM   6871  C  C      . MET A  1 897  ? 8.405   48.460  35.578  1.00 115.60 ?  957  MET A C      1 
ATOM   6872  O  O      . MET A  1 897  ? 7.517   49.164  36.062  1.00 114.62 ?  957  MET A O      1 
ATOM   6873  C  CB     . MET A  1 897  ? 7.690   46.512  34.117  1.00 119.60 ?  957  MET A CB     1 
ATOM   6874  C  CG     . MET A  1 897  ? 6.283   46.345  34.715  1.00 125.82 ?  957  MET A CG     1 
ATOM   6875  S  SD     . MET A  1 897  ? 5.036   47.551  34.152  1.00 129.77 ?  957  MET A SD     1 
ATOM   6876  C  CE     . MET A  1 897  ? 3.491   46.748  34.804  1.00 128.52 ?  957  MET A CE     1 
ATOM   6877  N  N      . GLU A  1 898  ? 9.559   48.148  36.233  1.00 111.95 ?  958  GLU A N      1 
ATOM   6878  C  CA     . GLU A  1 898  ? 9.896   48.616  37.587  1.00 112.39 ?  958  GLU A CA     1 
ATOM   6879  C  C      . GLU A  1 898  ? 9.922   50.145  37.562  1.00 112.91 ?  958  GLU A C      1 
ATOM   6880  O  O      . GLU A  1 898  ? 9.355   50.777  38.454  1.00 112.66 ?  958  GLU A O      1 
ATOM   6881  C  CB     . GLU A  1 898  ? 11.302  48.140  38.047  1.00 115.44 ?  958  GLU A CB     1 
ATOM   6882  C  CG     . GLU A  1 898  ? 11.581  46.653  38.175  1.00 136.18 ?  958  GLU A CG     1 
ATOM   6883  C  CD     . GLU A  1 898  ? 12.965  46.295  38.719  1.00 164.64 ?  958  GLU A CD     1 
ATOM   6884  O  OE1    . GLU A  1 898  ? 13.108  46.264  39.962  1.00 175.20 ?  958  GLU A OE1    1 
ATOM   6885  O  OE2    . GLU A  1 898  ? 13.893  46.017  37.920  1.00 144.22 -1 958  GLU A OE2    1 
ATOM   6886  N  N      . PHE A  1 899  ? 10.565  50.731  36.529  1.00 106.19 ?  959  PHE A N      1 
ATOM   6887  C  CA     . PHE A  1 899  ? 10.665  52.168  36.370  1.00 104.39 ?  959  PHE A CA     1 
ATOM   6888  C  C      . PHE A  1 899  ? 9.289   52.833  36.270  1.00 108.01 ?  959  PHE A C      1 
ATOM   6889  O  O      . PHE A  1 899  ? 9.029   53.821  36.975  1.00 108.00 ?  959  PHE A O      1 
ATOM   6890  C  CB     . PHE A  1 899  ? 11.538  52.509  35.159  1.00 104.87 ?  959  PHE A CB     1 
ATOM   6891  C  CG     . PHE A  1 899  ? 11.500  53.963  34.739  1.00 105.23 ?  959  PHE A CG     1 
ATOM   6892  C  CD1    . PHE A  1 899  ? 11.897  54.973  35.615  1.00 107.69 ?  959  PHE A CD1    1 
ATOM   6893  C  CD2    . PHE A  1 899  ? 11.065  54.326  33.473  1.00 106.66 ?  959  PHE A CD2    1 
ATOM   6894  C  CE1    . PHE A  1 899  ? 11.882  56.309  35.217  1.00 107.28 ?  959  PHE A CE1    1 
ATOM   6895  C  CE2    . PHE A  1 899  ? 11.051  55.671  33.078  1.00 107.88 ?  959  PHE A CE2    1 
ATOM   6896  C  CZ     . PHE A  1 899  ? 11.433  56.651  33.962  1.00 105.58 ?  959  PHE A CZ     1 
ATOM   6897  N  N      . VAL A  1 900  ? 8.418   52.297  35.388  1.00 102.71 ?  960  VAL A N      1 
ATOM   6898  C  CA     . VAL A  1 900  ? 7.062   52.810  35.178  1.00 100.71 ?  960  VAL A CA     1 
ATOM   6899  C  C      . VAL A  1 900  ? 6.309   52.853  36.526  1.00 105.84 ?  960  VAL A C      1 
ATOM   6900  O  O      . VAL A  1 900  ? 5.734   53.884  36.890  1.00 104.42 ?  960  VAL A O      1 
ATOM   6901  C  CB     . VAL A  1 900  ? 6.345   51.968  34.084  1.00 102.70 ?  960  VAL A CB     1 
ATOM   6902  C  CG1    . VAL A  1 900  ? 4.834   52.075  34.163  1.00 103.31 ?  960  VAL A CG1    1 
ATOM   6903  C  CG2    . VAL A  1 900  ? 6.854   52.312  32.692  1.00 100.38 ?  960  VAL A CG2    1 
ATOM   6904  N  N      . ASN A  1 901  ? 6.390   51.753  37.284  1.00 104.13 ?  961  ASN A N      1 
ATOM   6905  C  CA     . ASN A  1 901  ? 5.703   51.636  38.562  1.00 105.11 ?  961  ASN A CA     1 
ATOM   6906  C  C      . ASN A  1 901  ? 6.287   52.515  39.630  1.00 107.89 ?  961  ASN A C      1 
ATOM   6907  O  O      . ASN A  1 901  ? 5.520   53.045  40.438  1.00 107.81 ?  961  ASN A O      1 
ATOM   6908  C  CB     . ASN A  1 901  ? 5.627   50.191  39.004  1.00 108.86 ?  961  ASN A CB     1 
ATOM   6909  C  CG     . ASN A  1 901  ? 4.854   49.320  38.038  1.00 129.97 ?  961  ASN A CG     1 
ATOM   6910  O  OD1    . ASN A  1 901  ? 3.899   49.775  37.376  1.00 124.16 ?  961  ASN A OD1    1 
ATOM   6911  N  ND2    . ASN A  1 901  ? 5.239   48.049  37.948  1.00 120.40 ?  961  ASN A ND2    1 
ATOM   6912  N  N      . LYS A  1 902  ? 7.636   52.678  39.638  1.00 104.43 ?  962  LYS A N      1 
ATOM   6913  C  CA     . LYS A  1 902  ? 8.384   53.523  40.592  1.00 105.34 ?  962  LYS A CA     1 
ATOM   6914  C  C      . LYS A  1 902  ? 7.918   54.955  40.438  1.00 110.11 ?  962  LYS A C      1 
ATOM   6915  O  O      . LYS A  1 902  ? 7.554   55.585  41.429  1.00 111.15 ?  962  LYS A O      1 
ATOM   6916  C  CB     . LYS A  1 902  ? 9.909   53.421  40.359  1.00 107.60 ?  962  LYS A CB     1 
ATOM   6917  C  CG     . LYS A  1 902  ? 10.790  54.293  41.274  1.00 119.46 ?  962  LYS A CG     1 
ATOM   6918  C  CD     . LYS A  1 902  ? 12.285  54.366  40.844  1.00 129.62 ?  962  LYS A CD     1 
ATOM   6919  C  CE     . LYS A  1 902  ? 12.887  55.769  40.666  1.00 133.56 ?  962  LYS A CE     1 
ATOM   6920  N  NZ     . LYS A  1 902  ? 13.712  55.910  39.416  1.00 136.99 1  962  LYS A NZ     1 
ATOM   6921  N  N      . MET A  1 903  ? 7.877   55.440  39.189  1.00 106.66 ?  963  MET A N      1 
ATOM   6922  C  CA     . MET A  1 903  ? 7.404   56.779  38.861  1.00 106.20 ?  963  MET A CA     1 
ATOM   6923  C  C      . MET A  1 903  ? 5.968   57.021  39.347  1.00 108.39 ?  963  MET A C      1 
ATOM   6924  O  O      . MET A  1 903  ? 5.702   58.048  39.964  1.00 107.93 ?  963  MET A O      1 
ATOM   6925  C  CB     . MET A  1 903  ? 7.529   57.011  37.356  1.00 107.64 ?  963  MET A CB     1 
ATOM   6926  C  CG     . MET A  1 903  ? 8.936   57.053  36.913  1.00 111.65 ?  963  MET A CG     1 
ATOM   6927  S  SD     . MET A  1 903  ? 9.629   58.600  37.523  1.00 117.05 ?  963  MET A SD     1 
ATOM   6928  C  CE     . MET A  1 903  ? 10.733  57.957  38.671  1.00 116.13 ?  963  MET A CE     1 
ATOM   6929  N  N      . LYS A  1 904  ? 5.061   56.061  39.115  1.00 103.11 ?  964  LYS A N      1 
ATOM   6930  C  CA     . LYS A  1 904  ? 3.682   56.148  39.574  1.00 101.97 ?  964  LYS A CA     1 
ATOM   6931  C  C      . LYS A  1 904  ? 3.656   56.293  41.101  1.00 107.95 ?  964  LYS A C      1 
ATOM   6932  O  O      . LYS A  1 904  ? 2.985   57.207  41.613  1.00 108.28 ?  964  LYS A O      1 
ATOM   6933  C  CB     . LYS A  1 904  ? 2.878   54.921  39.119  1.00 101.13 ?  964  LYS A CB     1 
ATOM   6934  C  CG     . LYS A  1 904  ? 1.364   55.129  39.165  1.00 80.37  ?  964  LYS A CG     1 
ATOM   6935  C  CD     . LYS A  1 904  ? 0.559   53.867  38.811  1.00 86.05  ?  964  LYS A CD     1 
ATOM   6936  C  CE     . LYS A  1 904  ? -0.726  53.619  39.613  1.00 90.73  ?  964  LYS A CE     1 
ATOM   6937  N  NZ     . LYS A  1 904  ? -1.386  52.299  39.349  1.00 84.03  1  964  LYS A NZ     1 
ATOM   6938  N  N      . LYS A  1 905  ? 4.440   55.466  41.788  1.00 105.07 ?  965  LYS A N      1 
ATOM   6939  C  CA     . LYS A  1 905  ? 4.501   55.517  43.268  1.00 107.41 ?  965  LYS A CA     1 
ATOM   6940  C  C      . LYS A  1 905  ? 4.992   56.895  43.709  1.00 112.51 ?  965  LYS A C      1 
ATOM   6941  O  O      . LYS A  1 905  ? 4.358   57.503  44.575  1.00 115.15 ?  965  LYS A O      1 
ATOM   6942  C  CB     . LYS A  1 905  ? 5.485   54.463  43.775  1.00 110.97 ?  965  LYS A CB     1 
ATOM   6943  C  CG     . LYS A  1 905  ? 5.595   54.355  45.288  1.00 137.45 ?  965  LYS A CG     1 
ATOM   6944  C  CD     . LYS A  1 905  ? 6.742   53.479  45.739  1.00 150.57 ?  965  LYS A CD     1 
ATOM   6945  C  CE     . LYS A  1 905  ? 6.804   53.315  47.242  1.00 162.99 ?  965  LYS A CE     1 
ATOM   6946  N  NZ     . LYS A  1 905  ? 5.671   52.508  47.752  1.00 173.82 1  965  LYS A NZ     1 
ATOM   6947  N  N      . GLU A  1 906  ? 6.088   57.356  43.115  1.00 106.19 ?  966  GLU A N      1 
ATOM   6948  C  CA     . GLU A  1 906  ? 6.712   58.635  43.464  1.00 105.14 ?  966  GLU A CA     1 
ATOM   6949  C  C      . GLU A  1 906  ? 5.839   59.832  43.068  1.00 107.31 ?  966  GLU A C      1 
ATOM   6950  O  O      . GLU A  1 906  ? 6.176   60.958  43.423  1.00 107.88 ?  966  GLU A O      1 
ATOM   6951  C  CB     . GLU A  1 906  ? 8.100   58.740  42.815  1.00 104.83 ?  966  GLU A CB     1 
ATOM   6952  C  CG     . GLU A  1 906  ? 9.135   57.845  43.485  1.00 117.92 ?  966  GLU A CG     1 
ATOM   6953  C  CD     . GLU A  1 906  ? 10.503  57.723  42.828  1.00 152.27 ?  966  GLU A CD     1 
ATOM   6954  O  OE1    . GLU A  1 906  ? 10.776  58.434  41.833  1.00 157.31 ?  966  GLU A OE1    1 
ATOM   6955  O  OE2    . GLU A  1 906  ? 11.293  56.869  43.291  1.00 151.67 -1 966  GLU A OE2    1 
ATOM   6956  N  N      . GLY A  1 907  ? 4.741   59.576  42.351  1.00 101.96 ?  967  GLY A N      1 
ATOM   6957  C  CA     . GLY A  1 907  ? 3.804   60.597  41.895  1.00 101.14 ?  967  GLY A CA     1 
ATOM   6958  C  C      . GLY A  1 907  ? 4.381   61.517  40.835  1.00 103.00 ?  967  GLY A C      1 
ATOM   6959  O  O      . GLY A  1 907  ? 4.058   62.704  40.780  1.00 102.02 ?  967  GLY A O      1 
ATOM   6960  N  N      . LYS A  1 908  ? 5.230   60.965  39.979  1.00 99.92  ?  968  LYS A N      1 
ATOM   6961  C  CA     . LYS A  1 908  ? 5.897   61.697  38.909  1.00 99.10  ?  968  LYS A CA     1 
ATOM   6962  C  C      . LYS A  1 908  ? 5.479   61.130  37.537  1.00 104.42 ?  968  LYS A C      1 
ATOM   6963  O  O      . LYS A  1 908  ? 5.337   59.908  37.381  1.00 105.77 ?  968  LYS A O      1 
ATOM   6964  C  CB     . LYS A  1 908  ? 7.437   61.565  39.064  1.00 101.17 ?  968  LYS A CB     1 
ATOM   6965  C  CG     . LYS A  1 908  ? 8.028   61.904  40.437  1.00 117.90 ?  968  LYS A CG     1 
ATOM   6966  C  CD     . LYS A  1 908  ? 9.502   61.528  40.490  1.00 128.63 ?  968  LYS A CD     1 
ATOM   6967  C  CE     . LYS A  1 908  ? 10.110  61.685  41.849  1.00 142.53 ?  968  LYS A CE     1 
ATOM   6968  N  NZ     . LYS A  1 908  ? 11.486  61.126  41.879  1.00 150.60 1  968  LYS A NZ     1 
ATOM   6969  N  N      . LEU A  1 909  ? 5.324   61.984  36.534  1.00 99.53  ?  969  LEU A N      1 
ATOM   6970  C  CA     . LEU A  1 909  ? 5.040   61.458  35.195  1.00 97.57  ?  969  LEU A CA     1 
ATOM   6971  C  C      . LEU A  1 909  ? 6.366   61.246  34.468  1.00 100.77 ?  969  LEU A C      1 
ATOM   6972  O  O      . LEU A  1 909  ? 7.392   61.816  34.864  1.00 100.47 ?  969  LEU A O      1 
ATOM   6973  C  CB     . LEU A  1 909  ? 4.114   62.385  34.400  1.00 97.49  ?  969  LEU A CB     1 
ATOM   6974  C  CG     . LEU A  1 909  ? 2.745   62.569  35.001  1.00 104.80 ?  969  LEU A CG     1 
ATOM   6975  C  CD1    . LEU A  1 909  ? 2.049   63.747  34.406  1.00 106.97 ?  969  LEU A CD1    1 
ATOM   6976  C  CD2    . LEU A  1 909  ? 1.908   61.350  34.811  1.00 108.79 ?  969  LEU A CD2    1 
ATOM   6977  N  N      . ILE A  1 910  ? 6.364   60.413  33.433  1.00 97.44  ?  970  ILE A N      1 
ATOM   6978  C  CA     . ILE A  1 910  ? 7.570   60.153  32.656  1.00 96.51  ?  970  ILE A CA     1 
ATOM   6979  C  C      . ILE A  1 910  ? 7.763   61.255  31.622  1.00 102.83 ?  970  ILE A C      1 
ATOM   6980  O  O      . ILE A  1 910  ? 6.901   61.493  30.778  1.00 102.65 ?  970  ILE A O      1 
ATOM   6981  C  CB     . ILE A  1 910  ? 7.615   58.726  32.050  1.00 98.60  ?  970  ILE A CB     1 
ATOM   6982  C  CG1    . ILE A  1 910  ? 7.489   57.675  33.148  1.00 98.72  ?  970  ILE A CG1    1 
ATOM   6983  C  CG2    . ILE A  1 910  ? 8.897   58.505  31.251  1.00 98.15  ?  970  ILE A CG2    1 
ATOM   6984  C  CD1    . ILE A  1 910  ? 7.157   56.334  32.629  1.00 102.53 ?  970  ILE A CD1    1 
ATOM   6985  N  N      . MET A  1 911  ? 8.904   61.929  31.720  1.00 101.91 ?  971  MET A N      1 
ATOM   6986  C  CA     . MET A  1 911  ? 9.322   62.995  30.821  1.00 102.96 ?  971  MET A CA     1 
ATOM   6987  C  C      . MET A  1 911  ? 9.672   62.394  29.497  1.00 105.46 ?  971  MET A C      1 
ATOM   6988  O  O      . MET A  1 911  ? 10.420  61.397  29.458  1.00 105.62 ?  971  MET A O      1 
ATOM   6989  C  CB     . MET A  1 911  ? 10.562  63.701  31.385  1.00 106.07 ?  971  MET A CB     1 
ATOM   6990  C  CG     . MET A  1 911  ? 10.292  64.453  32.646  1.00 111.67 ?  971  MET A CG     1 
ATOM   6991  S  SD     . MET A  1 911  ? 8.970   65.633  32.408  1.00 117.91 ?  971  MET A SD     1 
ATOM   6992  C  CE     . MET A  1 911  ? 9.640   66.715  31.204  1.00 113.94 ?  971  MET A CE     1 
ATOM   6993  N  N      . GLY A  1 912  ? 9.131   62.978  28.431  1.00 99.88  ?  972  GLY A N      1 
ATOM   6994  C  CA     . GLY A  1 912  ? 9.386   62.454  27.095  1.00 98.74  ?  972  GLY A CA     1 
ATOM   6995  C  C      . GLY A  1 912  ? 8.388   61.409  26.623  1.00 100.57 ?  972  GLY A C      1 
ATOM   6996  O  O      . GLY A  1 912  ? 8.547   60.843  25.536  1.00 99.26  ?  972  GLY A O      1 
ATOM   6997  N  N      . ILE A  1 913  ? 7.331   61.166  27.438  1.00 95.22  ?  973  ILE A N      1 
ATOM   6998  C  CA     . ILE A  1 913  ? 6.205   60.280  27.156  1.00 93.04  ?  973  ILE A CA     1 
ATOM   6999  C  C      . ILE A  1 913  ? 4.952   61.156  27.102  1.00 95.82  ?  973  ILE A C      1 
ATOM   7000  O  O      . ILE A  1 913  ? 4.792   62.061  27.929  1.00 96.11  ?  973  ILE A O      1 
ATOM   7001  C  CB     . ILE A  1 913  ? 6.098   59.169  28.231  1.00 95.26  ?  973  ILE A CB     1 
ATOM   7002  C  CG1    . ILE A  1 913  ? 7.208   58.119  28.068  1.00 93.53  ?  973  ILE A CG1    1 
ATOM   7003  C  CG2    . ILE A  1 913  ? 4.700   58.519  28.249  1.00 98.32  ?  973  ILE A CG2    1 
ATOM   7004  C  CD1    . ILE A  1 913  ? 7.151   57.247  26.790  1.00 94.42  ?  973  ILE A CD1    1 
ATOM   7005  N  N      . GLY A  1 914  ? 4.097   60.875  26.122  1.00 91.61  ?  974  GLY A N      1 
ATOM   7006  C  CA     . GLY A  1 914  ? 2.814   61.537  25.908  1.00 92.35  ?  974  GLY A CA     1 
ATOM   7007  C  C      . GLY A  1 914  ? 2.752   62.497  24.743  1.00 95.65  ?  974  GLY A C      1 
ATOM   7008  O  O      . GLY A  1 914  ? 3.753   63.119  24.404  1.00 93.98  ?  974  GLY A O      1 
ATOM   7009  N  N      . HIS A  1 915  ? 1.568   62.614  24.137  1.00 96.05  ?  975  HIS A N      1 
ATOM   7010  C  CA     . HIS A  1 915  ? 1.269   63.497  23.016  1.00 100.39 ?  975  HIS A CA     1 
ATOM   7011  C  C      . HIS A  1 915  ? -0.225  63.810  23.012  1.00 111.52 ?  975  HIS A C      1 
ATOM   7012  O  O      . HIS A  1 915  ? -1.031  62.900  23.225  1.00 112.93 ?  975  HIS A O      1 
ATOM   7013  C  CB     . HIS A  1 915  ? 1.647   62.823  21.685  1.00 102.76 ?  975  HIS A CB     1 
ATOM   7014  C  CG     . HIS A  1 915  ? 1.662   63.753  20.504  1.00 108.94 ?  975  HIS A CG     1 
ATOM   7015  N  ND1    . HIS A  1 915  ? 0.566   64.549  20.175  1.00 113.50 ?  975  HIS A ND1    1 
ATOM   7016  C  CD2    . HIS A  1 915  ? 2.642   63.978  19.599  1.00 111.60 ?  975  HIS A CD2    1 
ATOM   7017  C  CE1    . HIS A  1 915  ? 0.920   65.227  19.098  1.00 114.00 ?  975  HIS A CE1    1 
ATOM   7018  N  NE2    . HIS A  1 915  ? 2.155   64.916  18.709  1.00 113.10 ?  975  HIS A NE2    1 
ATOM   7019  N  N      . ARG A  1 916  ? -0.595  65.038  22.662  1.00 112.14 ?  976  ARG A N      1 
ATOM   7020  C  CA     . ARG A  1 916  ? -2.031  65.417  22.679  1.00 115.80 ?  976  ARG A CA     1 
ATOM   7021  C  C      . ARG A  1 916  ? -2.831  64.615  21.646  1.00 119.95 ?  976  ARG A C      1 
ATOM   7022  O  O      . ARG A  1 916  ? -3.944  64.200  21.980  1.00 121.42 ?  976  ARG A O      1 
ATOM   7023  C  CB     . ARG A  1 916  ? -2.191  66.926  22.472  1.00 124.13 ?  976  ARG A CB     1 
ATOM   7024  C  CG     . ARG A  1 916  ? -2.008  67.753  23.739  1.00 150.98 ?  976  ARG A CG     1 
ATOM   7025  C  CD     . ARG A  1 916  ? -3.119  68.762  23.983  1.00 173.87 ?  976  ARG A CD     1 
ATOM   7026  N  NE     . ARG A  1 916  ? -2.844  70.075  23.412  1.00 185.64 ?  976  ARG A NE     1 
ATOM   7027  C  CZ     . ARG A  1 916  ? -3.590  71.159  23.610  1.00 198.37 ?  976  ARG A CZ     1 
ATOM   7028  N  NH1    . ARG A  1 916  ? -4.642  71.104  24.409  1.00 189.97 1  976  ARG A NH1    1 
ATOM   7029  N  NH2    . ARG A  1 916  ? -3.282  72.294  23.009  1.00 174.56 ?  976  ARG A NH2    1 
ATOM   7030  N  N      . VAL A  1 917  ? -2.286  64.396  20.449  1.00 115.39 ?  977  VAL A N      1 
ATOM   7031  C  CA     . VAL A  1 917  ? -3.029  63.697  19.394  1.00 116.92 ?  977  VAL A CA     1 
ATOM   7032  C  C      . VAL A  1 917  ? -2.368  62.477  18.824  1.00 120.86 ?  977  VAL A C      1 
ATOM   7033  O  O      . VAL A  1 917  ? -3.081  61.553  18.415  1.00 124.59 ?  977  VAL A O      1 
ATOM   7034  C  CB     . VAL A  1 917  ? -3.426  64.609  18.237  1.00 123.73 ?  977  VAL A CB     1 
ATOM   7035  C  CG1    . VAL A  1 917  ? -4.394  65.686  18.718  1.00 126.45 ?  977  VAL A CG1    1 
ATOM   7036  C  CG2    . VAL A  1 917  ? -2.197  65.197  17.530  1.00 122.94 ?  977  VAL A CG2    1 
ATOM   7037  N  N      . LYS A  1 918  ? -1.037  62.464  18.720  1.00 113.05 ?  978  LYS A N      1 
ATOM   7038  C  CA     . LYS A  1 918  ? -0.395  61.299  18.134  1.00 111.11 ?  978  LYS A CA     1 
ATOM   7039  C  C      . LYS A  1 918  ? -0.566  60.044  19.014  1.00 115.27 ?  978  LYS A C      1 
ATOM   7040  O  O      . LYS A  1 918  ? -0.337  60.050  20.224  1.00 113.17 ?  978  LYS A O      1 
ATOM   7041  C  CB     . LYS A  1 918  ? 1.054   61.566  17.723  1.00 109.34 ?  978  LYS A CB     1 
ATOM   7042  C  CG     . LYS A  1 918  ? 1.179   62.583  16.585  1.00 96.67  ?  978  LYS A CG     1 
ATOM   7043  C  CD     . LYS A  1 918  ? 0.222   62.360  15.428  1.00 102.42 ?  978  LYS A CD     1 
ATOM   7044  C  CE     . LYS A  1 918  ? 0.602   63.187  14.223  1.00 110.58 ?  978  LYS A CE     1 
ATOM   7045  N  NZ     . LYS A  1 918  ? 0.707   62.359  12.978  1.00 125.03 1  978  LYS A NZ     1 
ATOM   7046  N  N      . SER A  1 919  ? -1.105  59.022  18.377  1.00 113.00 ?  979  SER A N      1 
ATOM   7047  C  CA     . SER A  1 919  ? -1.399  57.726  18.931  1.00 112.37 ?  979  SER A CA     1 
ATOM   7048  C  C      . SER A  1 919  ? -0.221  56.780  18.602  1.00 114.35 ?  979  SER A C      1 
ATOM   7049  O  O      . SER A  1 919  ? 0.715   57.137  17.885  1.00 111.14 ?  979  SER A O      1 
ATOM   7050  C  CB     . SER A  1 919  ? -2.685  57.225  18.258  1.00 119.62 ?  979  SER A CB     1 
ATOM   7051  O  OG     . SER A  1 919  ? -3.110  55.901  18.564  1.00 129.67 ?  979  SER A OG     1 
ATOM   7052  N  N      . ILE A  1 920  ? -0.312  55.555  19.110  1.00 114.04 ?  980  ILE A N      1 
ATOM   7053  C  CA     . ILE A  1 920  ? 0.588   54.443  18.796  1.00 114.50 ?  980  ILE A CA     1 
ATOM   7054  C  C      . ILE A  1 920  ? 0.404   54.013  17.280  1.00 119.61 ?  980  ILE A C      1 
ATOM   7055  O  O      . ILE A  1 920  ? 1.382   53.704  16.599  1.00 117.36 ?  980  ILE A O      1 
ATOM   7056  C  CB     . ILE A  1 920  ? 0.369   53.288  19.818  1.00 117.85 ?  980  ILE A CB     1 
ATOM   7057  C  CG1    . ILE A  1 920  ? 1.371   52.149  19.569  1.00 118.86 ?  980  ILE A CG1    1 
ATOM   7058  C  CG2    . ILE A  1 920  ? -1.103  52.799  19.877  1.00 120.07 ?  980  ILE A CG2    1 
ATOM   7059  C  CD1    . ILE A  1 920  ? 1.353   50.949  20.589  1.00 129.39 ?  980  ILE A CD1    1 
ATOM   7060  N  N      . ASN A  1 921  ? -0.854  54.070  16.772  1.00 119.07 ?  981  ASN A N      1 
ATOM   7061  C  CA     . ASN A  1 921  ? -1.271  53.770  15.402  1.00 121.68 ?  981  ASN A CA     1 
ATOM   7062  C  C      . ASN A  1 921  ? -1.210  55.021  14.485  1.00 127.61 ?  981  ASN A C      1 
ATOM   7063  O  O      . ASN A  1 921  ? -1.513  54.907  13.299  1.00 129.90 ?  981  ASN A O      1 
ATOM   7064  C  CB     . ASN A  1 921  ? -2.733  53.291  15.396  1.00 126.03 ?  981  ASN A CB     1 
ATOM   7065  C  CG     . ASN A  1 921  ? -3.113  52.182  16.335  1.00 155.96 ?  981  ASN A CG     1 
ATOM   7066  O  OD1    . ASN A  1 921  ? -3.166  51.011  15.944  1.00 147.88 ?  981  ASN A OD1    1 
ATOM   7067  N  ND2    . ASN A  1 921  ? -3.597  52.556  17.519  1.00 147.96 ?  981  ASN A ND2    1 
ATOM   7068  N  N      . ASN A  1 922  ? -0.912  56.213  15.043  1.00 122.67 ?  982  ASN A N      1 
ATOM   7069  C  CA     . ASN A  1 922  ? -0.867  57.486  14.322  1.00 122.64 ?  982  ASN A CA     1 
ATOM   7070  C  C      . ASN A  1 922  ? 0.397   58.195  14.796  1.00 124.40 ?  982  ASN A C      1 
ATOM   7071  O  O      . ASN A  1 922  ? 0.347   59.007  15.713  1.00 122.99 ?  982  ASN A O      1 
ATOM   7072  C  CB     . ASN A  1 922  ? -2.137  58.281  14.646  1.00 123.31 ?  982  ASN A CB     1 
ATOM   7073  C  CG     . ASN A  1 922  ? -2.265  59.611  13.977  1.00 150.01 ?  982  ASN A CG     1 
ATOM   7074  O  OD1    . ASN A  1 922  ? -3.022  60.447  14.465  1.00 141.38 ?  982  ASN A OD1    1 
ATOM   7075  N  ND2    . ASN A  1 922  ? -1.588  59.822  12.826  1.00 143.54 ?  982  ASN A ND2    1 
ATOM   7076  N  N      . PRO A  1 923  ? 1.563   57.829  14.256  1.00 121.23 ?  983  PRO A N      1 
ATOM   7077  C  CA     . PRO A  1 923  ? 2.833   58.356  14.808  1.00 119.29 ?  983  PRO A CA     1 
ATOM   7078  C  C      . PRO A  1 923  ? 3.201   59.801  14.544  1.00 122.77 ?  983  PRO A C      1 
ATOM   7079  O  O      . PRO A  1 923  ? 2.746   60.369  13.556  1.00 124.73 ?  983  PRO A O      1 
ATOM   7080  C  CB     . PRO A  1 923  ? 3.887   57.460  14.159  1.00 121.08 ?  983  PRO A CB     1 
ATOM   7081  C  CG     . PRO A  1 923  ? 3.252   57.047  12.875  1.00 127.88 ?  983  PRO A CG     1 
ATOM   7082  C  CD     . PRO A  1 923  ? 1.814   56.817  13.214  1.00 124.16 ?  983  PRO A CD     1 
ATOM   7083  N  N      . ASP A  1 924  ? 4.098   60.355  15.405  1.00 117.09 ?  984  ASP A N      1 
ATOM   7084  C  CA     . ASP A  1 924  ? 4.691   61.689  15.253  1.00 116.56 ?  984  ASP A CA     1 
ATOM   7085  C  C      . ASP A  1 924  ? 5.815   61.518  14.242  1.00 120.71 ?  984  ASP A C      1 
ATOM   7086  O  O      . ASP A  1 924  ? 6.743   60.736  14.469  1.00 120.73 ?  984  ASP A O      1 
ATOM   7087  C  CB     . ASP A  1 924  ? 5.254   62.234  16.592  1.00 115.98 ?  984  ASP A CB     1 
ATOM   7088  C  CG     . ASP A  1 924  ? 5.771   63.690  16.625  1.00 128.37 ?  984  ASP A CG     1 
ATOM   7089  O  OD1    . ASP A  1 924  ? 5.903   64.321  15.529  1.00 130.81 ?  984  ASP A OD1    1 
ATOM   7090  O  OD2    . ASP A  1 924  ? 5.993   64.228  17.763  1.00 131.96 -1 984  ASP A OD2    1 
ATOM   7091  N  N      . MET A  1 925  ? 5.705   62.202  13.104  1.00 116.75 ?  985  MET A N      1 
ATOM   7092  C  CA     . MET A  1 925  ? 6.677   62.109  12.022  1.00 116.18 ?  985  MET A CA     1 
ATOM   7093  C  C      . MET A  1 925  ? 8.070   62.539  12.385  1.00 114.76 ?  985  MET A C      1 
ATOM   7094  O  O      . MET A  1 925  ? 9.015   61.970  11.863  1.00 112.93 ?  985  MET A O      1 
ATOM   7095  C  CB     . MET A  1 925  ? 6.198   62.857  10.796  1.00 121.70 ?  985  MET A CB     1 
ATOM   7096  C  CG     . MET A  1 925  ? 5.056   62.150  10.149  1.00 129.27 ?  985  MET A CG     1 
ATOM   7097  S  SD     . MET A  1 925  ? 5.465   60.378  9.979   1.00 134.63 ?  985  MET A SD     1 
ATOM   7098  C  CE     . MET A  1 925  ? 5.013   60.119  8.248   1.00 135.36 ?  985  MET A CE     1 
ATOM   7099  N  N      . ARG A  1 926  ? 8.215   63.532  13.283  1.00 109.02 ?  986  ARG A N      1 
ATOM   7100  C  CA     . ARG A  1 926  ? 9.531   63.993  13.736  1.00 105.23 ?  986  ARG A CA     1 
ATOM   7101  C  C      . ARG A  1 926  ? 10.224  62.842  14.468  1.00 107.40 ?  986  ARG A C      1 
ATOM   7102  O  O      . ARG A  1 926  ? 11.411  62.565  14.228  1.00 106.31 ?  986  ARG A O      1 
ATOM   7103  C  CB     . ARG A  1 926  ? 9.409   65.227  14.628  1.00 98.39  ?  986  ARG A CB     1 
ATOM   7104  C  CG     . ARG A  1 926  ? 8.978   66.466  13.891  1.00 95.32  ?  986  ARG A CG     1 
ATOM   7105  C  CD     . ARG A  1 926  ? 8.826   67.610  14.850  1.00 95.97  ?  986  ARG A CD     1 
ATOM   7106  N  NE     . ARG A  1 926  ? 7.765   67.375  15.824  1.00 99.29  ?  986  ARG A NE     1 
ATOM   7107  C  CZ     . ARG A  1 926  ? 7.546   68.167  16.863  1.00 123.76 ?  986  ARG A CZ     1 
ATOM   7108  N  NH1    . ARG A  1 926  ? 8.307   69.241  17.062  1.00 118.76 1  986  ARG A NH1    1 
ATOM   7109  N  NH2    . ARG A  1 926  ? 6.571   67.894  17.716  1.00 116.63 ?  986  ARG A NH2    1 
ATOM   7110  N  N      . VAL A  1 927  ? 9.449   62.116  15.285  1.00 103.22 ?  987  VAL A N      1 
ATOM   7111  C  CA     . VAL A  1 927  ? 9.956   60.959  16.000  1.00 101.93 ?  987  VAL A CA     1 
ATOM   7112  C  C      . VAL A  1 927  ? 10.368  59.890  14.998  1.00 105.35 ?  987  VAL A C      1 
ATOM   7113  O  O      . VAL A  1 927  ? 11.474  59.362  15.117  1.00 104.09 ?  987  VAL A O      1 
ATOM   7114  C  CB     . VAL A  1 927  ? 8.956   60.436  17.050  1.00 105.84 ?  987  VAL A CB     1 
ATOM   7115  C  CG1    . VAL A  1 927  ? 9.440   59.126  17.673  1.00 105.89 ?  987  VAL A CG1    1 
ATOM   7116  C  CG2    . VAL A  1 927  ? 8.727   61.473  18.128  1.00 104.15 ?  987  VAL A CG2    1 
ATOM   7117  N  N      . GLN A  1 928  ? 9.511   59.608  13.996  1.00 101.86 ?  988  GLN A N      1 
ATOM   7118  C  CA     . GLN A  1 928  ? 9.825   58.608  12.977  1.00 102.29 ?  988  GLN A CA     1 
ATOM   7119  C  C      . GLN A  1 928  ? 11.119  58.905  12.240  1.00 102.06 ?  988  GLN A C      1 
ATOM   7120  O  O      . GLN A  1 928  ? 12.009  58.076  12.246  1.00 99.14  ?  988  GLN A O      1 
ATOM   7121  C  CB     . GLN A  1 928  ? 8.679   58.413  11.991  1.00 106.43 ?  988  GLN A CB     1 
ATOM   7122  C  CG     . GLN A  1 928  ? 7.500   57.642  12.559  1.00 125.68 ?  988  GLN A CG     1 
ATOM   7123  C  CD     . GLN A  1 928  ? 7.943   56.313  13.104  1.00 144.43 ?  988  GLN A CD     1 
ATOM   7124  O  OE1    . GLN A  1 928  ? 7.876   56.078  14.298  1.00 140.06 ?  988  GLN A OE1    1 
ATOM   7125  N  NE2    . GLN A  1 928  ? 8.507   55.464  12.261  1.00 138.01 ?  988  GLN A NE2    1 
ATOM   7126  N  N      . ILE A  1 929  ? 11.264  60.122  11.712  1.00 99.93  ?  989  ILE A N      1 
ATOM   7127  C  CA     . ILE A  1 929  ? 12.437  60.573  10.968  1.00 100.16 ?  989  ILE A CA     1 
ATOM   7128  C  C      . ILE A  1 929  ? 13.707  60.293  11.763  1.00 106.74 ?  989  ILE A C      1 
ATOM   7129  O  O      . ILE A  1 929  ? 14.608  59.599  11.267  1.00 108.18 ?  989  ILE A O      1 
ATOM   7130  C  CB     . ILE A  1 929  ? 12.291  62.081  10.572  1.00 102.02 ?  989  ILE A CB     1 
ATOM   7131  C  CG1    . ILE A  1 929  ? 11.212  62.266  9.501   1.00 104.32 ?  989  ILE A CG1    1 
ATOM   7132  C  CG2    . ILE A  1 929  ? 13.627  62.675  10.102  1.00 101.51 ?  989  ILE A CG2    1 
ATOM   7133  C  CD1    . ILE A  1 929  ? 10.624  63.671  9.390   1.00 107.26 ?  989  ILE A CD1    1 
ATOM   7134  N  N      . LEU A  1 930  ? 13.734  60.780  13.010  1.00 102.54 ?  990  LEU A N      1 
ATOM   7135  C  CA     . LEU A  1 930  ? 14.887  60.636  13.875  1.00 101.02 ?  990  LEU A CA     1 
ATOM   7136  C  C      . LEU A  1 930  ? 15.124  59.194  14.278  1.00 103.13 ?  990  LEU A C      1 
ATOM   7137  O  O      . LEU A  1 930  ? 16.242  58.703  14.133  1.00 101.03 ?  990  LEU A O      1 
ATOM   7138  C  CB     . LEU A  1 930  ? 14.742  61.517  15.106  1.00 99.74  ?  990  LEU A CB     1 
ATOM   7139  C  CG     . LEU A  1 930  ? 14.908  62.983  14.917  1.00 105.13 ?  990  LEU A CG     1 
ATOM   7140  C  CD1    . LEU A  1 930  ? 14.360  63.711  16.103  1.00 104.90 ?  990  LEU A CD1    1 
ATOM   7141  C  CD2    . LEU A  1 930  ? 16.366  63.348  14.663  1.00 107.53 ?  990  LEU A CD2    1 
ATOM   7142  N  N      . LYS A  1 931  ? 14.070  58.499  14.750  1.00 99.61  ?  991  LYS A N      1 
ATOM   7143  C  CA     . LYS A  1 931  ? 14.157  57.105  15.200  1.00 98.50  ?  991  LYS A CA     1 
ATOM   7144  C  C      . LYS A  1 931  ? 14.790  56.270  14.125  1.00 103.20 ?  991  LYS A C      1 
ATOM   7145  O  O      . LYS A  1 931  ? 15.775  55.592  14.398  1.00 101.97 ?  991  LYS A O      1 
ATOM   7146  C  CB     . LYS A  1 931  ? 12.765  56.571  15.609  1.00 100.03 ?  991  LYS A CB     1 
ATOM   7147  C  CG     . LYS A  1 931  ? 12.778  55.359  16.514  1.00 104.94 ?  991  LYS A CG     1 
ATOM   7148  C  CD     . LYS A  1 931  ? 11.491  54.515  16.367  1.00 119.63 ?  991  LYS A CD     1 
ATOM   7149  C  CE     . LYS A  1 931  ? 10.258  54.969  17.116  1.00 120.57 ?  991  LYS A CE     1 
ATOM   7150  N  NZ     . LYS A  1 931  ? 9.179   53.938  17.038  1.00 119.19 1  991  LYS A NZ     1 
ATOM   7151  N  N      . ASP A  1 932  ? 14.295  56.410  12.884  1.00 103.24 ?  992  ASP A N      1 
ATOM   7152  C  CA     . ASP A  1 932  ? 14.770  55.652  11.727  1.00 105.66 ?  992  ASP A CA     1 
ATOM   7153  C  C      . ASP A  1 932  ? 16.230  55.939  11.414  1.00 107.83 ?  992  ASP A C      1 
ATOM   7154  O  O      . ASP A  1 932  ? 16.987  54.989  11.210  1.00 107.61 ?  992  ASP A O      1 
ATOM   7155  C  CB     . ASP A  1 932  ? 13.842  55.863  10.521  1.00 110.28 ?  992  ASP A CB     1 
ATOM   7156  C  CG     . ASP A  1 932  ? 12.383  55.393  10.764  1.00 129.62 ?  992  ASP A CG     1 
ATOM   7157  O  OD1    . ASP A  1 932  ? 12.176  54.432  11.574  1.00 128.50 ?  992  ASP A OD1    1 
ATOM   7158  O  OD2    . ASP A  1 932  ? 11.452  56.010  10.185  1.00 143.65 -1 992  ASP A OD2    1 
ATOM   7159  N  N      . TYR A  1 933  ? 16.646  57.231  11.444  1.00 102.39 ?  993  TYR A N      1 
ATOM   7160  C  CA     . TYR A  1 933  ? 18.045  57.580  11.206  1.00 100.60 ?  993  TYR A CA     1 
ATOM   7161  C  C      . TYR A  1 933  ? 18.923  56.933  12.263  1.00 104.18 ?  993  TYR A C      1 
ATOM   7162  O  O      . TYR A  1 933  ? 19.899  56.268  11.917  1.00 106.30 ?  993  TYR A O      1 
ATOM   7163  C  CB     . TYR A  1 933  ? 18.270  59.090  11.218  1.00 99.24  ?  993  TYR A CB     1 
ATOM   7164  C  CG     . TYR A  1 933  ? 19.711  59.458  10.926  1.00 100.44 ?  993  TYR A CG     1 
ATOM   7165  C  CD1    . TYR A  1 933  ? 20.647  59.581  11.952  1.00 100.08 ?  993  TYR A CD1    1 
ATOM   7166  C  CD2    . TYR A  1 933  ? 20.150  59.643  9.625   1.00 104.19 ?  993  TYR A CD2    1 
ATOM   7167  C  CE1    . TYR A  1 933  ? 21.975  59.913  11.684  1.00 100.54 ?  993  TYR A CE1    1 
ATOM   7168  C  CE2    . TYR A  1 933  ? 21.468  59.981  9.346   1.00 105.80 ?  993  TYR A CE2    1 
ATOM   7169  C  CZ     . TYR A  1 933  ? 22.383  60.087  10.370  1.00 111.86 ?  993  TYR A CZ     1 
ATOM   7170  O  OH     . TYR A  1 933  ? 23.687  60.350  10.029  1.00 114.31 ?  993  TYR A OH     1 
ATOM   7171  N  N      . VAL A  1 934  ? 18.575  57.137  13.549  1.00 97.89  ?  994  VAL A N      1 
ATOM   7172  C  CA     . VAL A  1 934  ? 19.298  56.617  14.708  1.00 96.80  ?  994  VAL A CA     1 
ATOM   7173  C  C      . VAL A  1 934  ? 19.478  55.092  14.626  1.00 106.93 ?  994  VAL A C      1 
ATOM   7174  O  O      . VAL A  1 934  ? 20.594  54.585  14.765  1.00 107.77 ?  994  VAL A O      1 
ATOM   7175  C  CB     . VAL A  1 934  ? 18.626  57.064  16.023  1.00 97.36  ?  994  VAL A CB     1 
ATOM   7176  C  CG1    . VAL A  1 934  ? 19.142  56.290  17.219  1.00 96.06  ?  994  VAL A CG1    1 
ATOM   7177  C  CG2    . VAL A  1 934  ? 18.825  58.547  16.244  1.00 96.15  ?  994  VAL A CG2    1 
ATOM   7178  N  N      . ARG A  1 935  ? 18.393  54.371  14.366  1.00 106.79 ?  995  ARG A N      1 
ATOM   7179  C  CA     . ARG A  1 935  ? 18.457  52.927  14.299  1.00 109.75 ?  995  ARG A CA     1 
ATOM   7180  C  C      . ARG A  1 935  ? 19.360  52.464  13.173  1.00 116.69 ?  995  ARG A C      1 
ATOM   7181  O  O      . ARG A  1 935  ? 20.168  51.568  13.391  1.00 117.88 ?  995  ARG A O      1 
ATOM   7182  C  CB     . ARG A  1 935  ? 17.054  52.324  14.200  1.00 114.19 ?  995  ARG A CB     1 
ATOM   7183  C  CG     . ARG A  1 935  ? 16.223  52.506  15.471  1.00 125.94 ?  995  ARG A CG     1 
ATOM   7184  C  CD     . ARG A  1 935  ? 15.141  51.435  15.496  1.00 138.23 ?  995  ARG A CD     1 
ATOM   7185  N  NE     . ARG A  1 935  ? 14.834  50.919  16.835  1.00 143.66 ?  995  ARG A NE     1 
ATOM   7186  C  CZ     . ARG A  1 935  ? 15.721  50.446  17.716  1.00 155.93 ?  995  ARG A CZ     1 
ATOM   7187  N  NH1    . ARG A  1 935  ? 17.024  50.483  17.451  1.00 145.69 1  995  ARG A NH1    1 
ATOM   7188  N  NH2    . ARG A  1 935  ? 15.314  49.971  18.883  1.00 135.45 ?  995  ARG A NH2    1 
ATOM   7189  N  N      . GLN A  1 936  ? 19.300  53.143  12.018  1.00 114.39 ?  996  GLN A N      1 
ATOM   7190  C  CA     . GLN A  1 936  ? 20.086  52.805  10.835  1.00 116.71 ?  996  GLN A CA     1 
ATOM   7191  C  C      . GLN A  1 936  ? 21.563  53.179  10.919  1.00 120.09 ?  996  GLN A C      1 
ATOM   7192  O  O      . GLN A  1 936  ? 22.364  52.522  10.247  1.00 122.13 ?  996  GLN A O      1 
ATOM   7193  C  CB     . GLN A  1 936  ? 19.441  53.438  9.595   1.00 119.27 ?  996  GLN A CB     1 
ATOM   7194  C  CG     . GLN A  1 936  ? 19.930  52.970  8.254   1.00 150.29 ?  996  GLN A CG     1 
ATOM   7195  C  CD     . GLN A  1 936  ? 19.644  54.005  7.195   1.00 184.54 ?  996  GLN A CD     1 
ATOM   7196  O  OE1    . GLN A  1 936  ? 18.645  54.736  7.240   1.00 178.84 ?  996  GLN A OE1    1 
ATOM   7197  N  NE2    . GLN A  1 936  ? 20.531  54.091  6.217   1.00 186.01 ?  996  GLN A NE2    1 
ATOM   7198  N  N      . HIS A  1 937  ? 21.945  54.200  11.724  1.00 113.91 ?  997  HIS A N      1 
ATOM   7199  C  CA     . HIS A  1 937  ? 23.345  54.667  11.728  1.00 114.19 ?  997  HIS A CA     1 
ATOM   7200  C  C      . HIS A  1 937  ? 24.142  54.517  13.007  1.00 115.70 ?  997  HIS A C      1 
ATOM   7201  O  O      . HIS A  1 937  ? 25.383  54.485  12.949  1.00 114.85 ?  997  HIS A O      1 
ATOM   7202  C  CB     . HIS A  1 937  ? 23.405  56.122  11.304  1.00 114.61 ?  997  HIS A CB     1 
ATOM   7203  C  CG     . HIS A  1 937  ? 23.343  56.292  9.827   1.00 120.94 ?  997  HIS A CG     1 
ATOM   7204  N  ND1    . HIS A  1 937  ? 22.134  56.411  9.166   1.00 125.50 ?  997  HIS A ND1    1 
ATOM   7205  C  CD2    . HIS A  1 937  ? 24.351  56.473  8.936   1.00 124.16 ?  997  HIS A CD2    1 
ATOM   7206  C  CE1    . HIS A  1 937  ? 22.444  56.600  7.889   1.00 126.99 ?  997  HIS A CE1    1 
ATOM   7207  N  NE2    . HIS A  1 937  ? 23.769  56.635  7.701   1.00 126.39 ?  997  HIS A NE2    1 
ATOM   7208  N  N      . PHE A  1 938  ? 23.460  54.506  14.156  1.00 110.25 ?  998  PHE A N      1 
ATOM   7209  C  CA     . PHE A  1 938  ? 24.139  54.393  15.442  1.00 108.12 ?  998  PHE A CA     1 
ATOM   7210  C  C      . PHE A  1 938  ? 24.605  52.965  15.639  1.00 113.75 ?  998  PHE A C      1 
ATOM   7211  O  O      . PHE A  1 938  ? 23.890  52.022  15.246  1.00 114.30 ?  998  PHE A O      1 
ATOM   7212  C  CB     . PHE A  1 938  ? 23.225  54.806  16.589  1.00 107.17 ?  998  PHE A CB     1 
ATOM   7213  C  CG     . PHE A  1 938  ? 23.034  56.283  16.805  1.00 106.32 ?  998  PHE A CG     1 
ATOM   7214  C  CD1    . PHE A  1 938  ? 23.054  57.182  15.727  1.00 107.55 ?  998  PHE A CD1    1 
ATOM   7215  C  CD2    . PHE A  1 938  ? 22.753  56.776  18.069  1.00 107.35 ?  998  PHE A CD2    1 
ATOM   7216  C  CE1    . PHE A  1 938  ? 22.851  58.541  15.921  1.00 106.58 ?  998  PHE A CE1    1 
ATOM   7217  C  CE2    . PHE A  1 938  ? 22.548  58.141  18.267  1.00 108.29 ?  998  PHE A CE2    1 
ATOM   7218  C  CZ     . PHE A  1 938  ? 22.605  59.015  17.192  1.00 105.73 ?  998  PHE A CZ     1 
ATOM   7219  N  N      . PRO A  1 939  ? 25.815  52.794  16.228  1.00 109.60 ?  999  PRO A N      1 
ATOM   7220  C  CA     . PRO A  1 939  ? 26.340  51.440  16.464  1.00 111.49 ?  999  PRO A CA     1 
ATOM   7221  C  C      . PRO A  1 939  ? 25.541  50.668  17.518  1.00 113.27 ?  999  PRO A C      1 
ATOM   7222  O  O      . PRO A  1 939  ? 25.341  49.467  17.382  1.00 114.52 ?  999  PRO A O      1 
ATOM   7223  C  CB     . PRO A  1 939  ? 27.784  51.698  16.920  1.00 113.61 ?  999  PRO A CB     1 
ATOM   7224  C  CG     . PRO A  1 939  ? 28.040  53.133  16.690  1.00 115.53 ?  999  PRO A CG     1 
ATOM   7225  C  CD     . PRO A  1 939  ? 26.736  53.811  16.765  1.00 109.14 ?  999  PRO A CD     1 
ATOM   7226  N  N      . ALA A  1 940  ? 25.090  51.369  18.560  1.00 106.98 ?  1000 ALA A N      1 
ATOM   7227  C  CA     . ALA A  1 940  ? 24.286  50.829  19.645  1.00 105.77 ?  1000 ALA A CA     1 
ATOM   7228  C  C      . ALA A  1 940  ? 23.325  51.928  20.122  1.00 108.43 ?  1000 ALA A C      1 
ATOM   7229  O  O      . ALA A  1 940  ? 23.664  53.127  20.094  1.00 103.50 ?  1000 ALA A O      1 
ATOM   7230  C  CB     . ALA A  1 940  ? 25.190  50.413  20.785  1.00 106.96 ?  1000 ALA A CB     1 
ATOM   7231  N  N      . THR A  1 941  ? 22.115  51.517  20.539  1.00 107.49 ?  1001 THR A N      1 
ATOM   7232  C  CA     . THR A  1 941  ? 21.103  52.456  21.056  1.00 105.93 ?  1001 THR A CA     1 
ATOM   7233  C  C      . THR A  1 941  ? 20.447  51.889  22.339  1.00 109.28 ?  1001 THR A C      1 
ATOM   7234  O  O      . THR A  1 941  ? 19.207  51.814  22.405  1.00 109.07 ?  1001 THR A O      1 
ATOM   7235  C  CB     . THR A  1 941  ? 20.062  52.792  19.979  1.00 119.89 ?  1001 THR A CB     1 
ATOM   7236  O  OG1    . THR A  1 941  ? 19.420  51.586  19.534  1.00 127.28 ?  1001 THR A OG1    1 
ATOM   7237  C  CG2    . THR A  1 941  ? 20.662  53.551  18.812  1.00 118.18 ?  1001 THR A CG2    1 
ATOM   7238  N  N      . PRO A  1 942  ? 21.250  51.485  23.364  1.00 103.77 ?  1002 PRO A N      1 
ATOM   7239  C  CA     . PRO A  1 942  ? 20.668  50.853  24.565  1.00 102.83 ?  1002 PRO A CA     1 
ATOM   7240  C  C      . PRO A  1 942  ? 19.591  51.633  25.308  1.00 101.65 ?  1002 PRO A C      1 
ATOM   7241  O  O      . PRO A  1 942  ? 18.599  51.018  25.733  1.00 101.34 ?  1002 PRO A O      1 
ATOM   7242  C  CB     . PRO A  1 942  ? 21.886  50.629  25.452  1.00 105.75 ?  1002 PRO A CB     1 
ATOM   7243  C  CG     . PRO A  1 942  ? 22.923  51.585  24.918  1.00 109.84 ?  1002 PRO A CG     1 
ATOM   7244  C  CD     . PRO A  1 942  ? 22.720  51.522  23.471  1.00 105.30 ?  1002 PRO A CD     1 
ATOM   7245  N  N      . LEU A  1 943  ? 19.793  52.970  25.476  1.00 93.39  ?  1003 LEU A N      1 
ATOM   7246  C  CA     . LEU A  1 943  ? 18.842  53.815  26.179  1.00 90.34  ?  1003 LEU A CA     1 
ATOM   7247  C  C      . LEU A  1 943  ? 17.579  54.015  25.353  1.00 97.03  ?  1003 LEU A C      1 
ATOM   7248  O  O      . LEU A  1 943  ? 16.485  53.996  25.921  1.00 95.08  ?  1003 LEU A O      1 
ATOM   7249  C  CB     . LEU A  1 943  ? 19.465  55.150  26.585  1.00 88.27  ?  1003 LEU A CB     1 
ATOM   7250  C  CG     . LEU A  1 943  ? 18.659  55.943  27.612  1.00 90.38  ?  1003 LEU A CG     1 
ATOM   7251  C  CD1    . LEU A  1 943  ? 18.623  55.233  28.959  1.00 91.10  ?  1003 LEU A CD1    1 
ATOM   7252  C  CD2    . LEU A  1 943  ? 19.175  57.343  27.759  1.00 88.24  ?  1003 LEU A CD2    1 
ATOM   7253  N  N      . LEU A  1 944  ? 17.713  54.159  24.004  1.00 96.11  ?  1004 LEU A N      1 
ATOM   7254  C  CA     . LEU A  1 944  ? 16.548  54.258  23.124  1.00 94.94  ?  1004 LEU A CA     1 
ATOM   7255  C  C      . LEU A  1 944  ? 15.755  52.961  23.238  1.00 100.51 ?  1004 LEU A C      1 
ATOM   7256  O  O      . LEU A  1 944  ? 14.531  53.001  23.402  1.00 98.95  ?  1004 LEU A O      1 
ATOM   7257  C  CB     . LEU A  1 944  ? 16.960  54.497  21.668  1.00 94.28  ?  1004 LEU A CB     1 
ATOM   7258  C  CG     . LEU A  1 944  ? 15.827  54.433  20.659  1.00 97.38  ?  1004 LEU A CG     1 
ATOM   7259  C  CD1    . LEU A  1 944  ? 14.763  55.476  20.942  1.00 95.38  ?  1004 LEU A CD1    1 
ATOM   7260  C  CD2    . LEU A  1 944  ? 16.354  54.531  19.250  1.00 99.51  ?  1004 LEU A CD2    1 
ATOM   7261  N  N      . ASP A  1 945  ? 16.462  51.818  23.214  1.00 100.20 ?  1005 ASP A N      1 
ATOM   7262  C  CA     . ASP A  1 945  ? 15.813  50.515  23.355  1.00 103.03 ?  1005 ASP A CA     1 
ATOM   7263  C  C      . ASP A  1 945  ? 14.978  50.434  24.655  1.00 106.96 ?  1005 ASP A C      1 
ATOM   7264  O  O      . ASP A  1 945  ? 13.808  50.013  24.622  1.00 107.79 ?  1005 ASP A O      1 
ATOM   7265  C  CB     . ASP A  1 945  ? 16.859  49.396  23.265  1.00 107.62 ?  1005 ASP A CB     1 
ATOM   7266  C  CG     . ASP A  1 945  ? 17.591  49.287  21.924  1.00 127.20 ?  1005 ASP A CG     1 
ATOM   7267  O  OD1    . ASP A  1 945  ? 17.122  49.891  20.935  1.00 127.59 ?  1005 ASP A OD1    1 
ATOM   7268  O  OD2    . ASP A  1 945  ? 18.672  48.643  21.882  1.00 139.52 -1 1005 ASP A OD2    1 
ATOM   7269  N  N      . TYR A  1 946  ? 15.568  50.889  25.780  1.00 101.20 ?  1006 TYR A N      1 
ATOM   7270  C  CA     . TYR A  1 946  ? 14.918  50.940  27.089  1.00 99.91  ?  1006 TYR A CA     1 
ATOM   7271  C  C      . TYR A  1 946  ? 13.691  51.841  27.017  1.00 105.07 ?  1006 TYR A C      1 
ATOM   7272  O  O      . TYR A  1 946  ? 12.624  51.434  27.470  1.00 107.50 ?  1006 TYR A O      1 
ATOM   7273  C  CB     . TYR A  1 946  ? 15.903  51.492  28.125  1.00 99.51  ?  1006 TYR A CB     1 
ATOM   7274  C  CG     . TYR A  1 946  ? 15.428  51.458  29.563  1.00 99.88  ?  1006 TYR A CG     1 
ATOM   7275  C  CD1    . TYR A  1 946  ? 14.624  52.472  30.079  1.00 101.65 ?  1006 TYR A CD1    1 
ATOM   7276  C  CD2    . TYR A  1 946  ? 15.876  50.477  30.439  1.00 100.70 ?  1006 TYR A CD2    1 
ATOM   7277  C  CE1    . TYR A  1 946  ? 14.220  52.460  31.411  1.00 103.64 ?  1006 TYR A CE1    1 
ATOM   7278  C  CE2    . TYR A  1 946  ? 15.480  50.455  31.771  1.00 101.29 ?  1006 TYR A CE2    1 
ATOM   7279  C  CZ     . TYR A  1 946  ? 14.652  51.443  32.253  1.00 107.92 ?  1006 TYR A CZ     1 
ATOM   7280  O  OH     . TYR A  1 946  ? 14.291  51.405  33.574  1.00 107.65 ?  1006 TYR A OH     1 
ATOM   7281  N  N      . ALA A  1 947  ? 13.836  53.062  26.464  1.00 99.64  ?  1007 ALA A N      1 
ATOM   7282  C  CA     . ALA A  1 947  ? 12.731  54.012  26.345  1.00 98.78  ?  1007 ALA A CA     1 
ATOM   7283  C  C      . ALA A  1 947  ? 11.577  53.449  25.496  1.00 100.50 ?  1007 ALA A C      1 
ATOM   7284  O  O      . ALA A  1 947  ? 10.403  53.666  25.830  1.00 99.68  ?  1007 ALA A O      1 
ATOM   7285  C  CB     . ALA A  1 947  ? 13.231  55.312  25.742  1.00 98.81  ?  1007 ALA A CB     1 
ATOM   7286  N  N      . LEU A  1 948  ? 11.915  52.707  24.423  1.00 94.84  ?  1008 LEU A N      1 
ATOM   7287  C  CA     . LEU A  1 948  ? 10.898  52.110  23.562  1.00 94.52  ?  1008 LEU A CA     1 
ATOM   7288  C  C      . LEU A  1 948  ? 10.115  51.021  24.294  1.00 98.75  ?  1008 LEU A C      1 
ATOM   7289  O  O      . LEU A  1 948  ? 8.920   50.808  24.012  1.00 97.26  ?  1008 LEU A O      1 
ATOM   7290  C  CB     . LEU A  1 948  ? 11.525  51.593  22.275  1.00 94.91  ?  1008 LEU A CB     1 
ATOM   7291  C  CG     . LEU A  1 948  ? 12.048  52.682  21.325  1.00 97.31  ?  1008 LEU A CG     1 
ATOM   7292  C  CD1    . LEU A  1 948  ? 13.011  52.118  20.330  1.00 96.42  ?  1008 LEU A CD1    1 
ATOM   7293  C  CD2    . LEU A  1 948  ? 10.901  53.464  20.662  1.00 102.00 ?  1008 LEU A CD2    1 
ATOM   7294  N  N      . GLU A  1 949  ? 10.786  50.373  25.275  1.00 95.83  ?  1009 GLU A N      1 
ATOM   7295  C  CA     . GLU A  1 949  ? 10.162  49.384  26.148  1.00 95.87  ?  1009 GLU A CA     1 
ATOM   7296  C  C      . GLU A  1 949  ? 9.207   50.069  27.122  1.00 98.41  ?  1009 GLU A C      1 
ATOM   7297  O  O      . GLU A  1 949  ? 8.109   49.569  27.368  1.00 100.48 ?  1009 GLU A O      1 
ATOM   7298  C  CB     . GLU A  1 949  ? 11.217  48.555  26.863  1.00 97.70  ?  1009 GLU A CB     1 
ATOM   7299  C  CG     . GLU A  1 949  ? 11.786  47.502  25.939  1.00 114.04 ?  1009 GLU A CG     1 
ATOM   7300  C  CD     . GLU A  1 949  ? 10.764  46.446  25.513  1.00 158.37 ?  1009 GLU A CD     1 
ATOM   7301  O  OE1    . GLU A  1 949  ? 9.826   46.153  26.296  1.00 151.24 ?  1009 GLU A OE1    1 
ATOM   7302  O  OE2    . GLU A  1 949  ? 10.888  45.930  24.378  1.00 170.22 -1 1009 GLU A OE2    1 
ATOM   7303  N  N      . VAL A  1 950  ? 9.598   51.236  27.639  1.00 91.02  ?  1010 VAL A N      1 
ATOM   7304  C  CA     . VAL A  1 950  ? 8.745   52.016  28.514  1.00 89.98  ?  1010 VAL A CA     1 
ATOM   7305  C  C      . VAL A  1 950  ? 7.488   52.465  27.723  1.00 94.65  ?  1010 VAL A C      1 
ATOM   7306  O  O      . VAL A  1 950  ? 6.364   52.393  28.233  1.00 93.87  ?  1010 VAL A O      1 
ATOM   7307  C  CB     . VAL A  1 950  ? 9.529   53.202  29.106  1.00 92.89  ?  1010 VAL A CB     1 
ATOM   7308  C  CG1    . VAL A  1 950  ? 8.596   54.144  29.869  1.00 92.70  ?  1010 VAL A CG1    1 
ATOM   7309  C  CG2    . VAL A  1 950  ? 10.658  52.713  30.019  1.00 93.13  ?  1010 VAL A CG2    1 
ATOM   7310  N  N      . GLU A  1 951  ? 7.685   52.875  26.463  1.00 92.95  ?  1011 GLU A N      1 
ATOM   7311  C  CA     . GLU A  1 951  ? 6.605   53.288  25.554  1.00 93.35  ?  1011 GLU A CA     1 
ATOM   7312  C  C      . GLU A  1 951  ? 5.654   52.126  25.330  1.00 97.23  ?  1011 GLU A C      1 
ATOM   7313  O  O      . GLU A  1 951  ? 4.451   52.342  25.331  1.00 97.81  ?  1011 GLU A O      1 
ATOM   7314  C  CB     . GLU A  1 951  ? 7.171   53.791  24.217  1.00 94.55  ?  1011 GLU A CB     1 
ATOM   7315  C  CG     . GLU A  1 951  ? 6.126   54.266  23.232  1.00 100.66 ?  1011 GLU A CG     1 
ATOM   7316  C  CD     . GLU A  1 951  ? 6.638   54.639  21.856  1.00 135.63 ?  1011 GLU A CD     1 
ATOM   7317  O  OE1    . GLU A  1 951  ? 7.558   53.966  21.333  1.00 141.06 ?  1011 GLU A OE1    1 
ATOM   7318  O  OE2    . GLU A  1 951  ? 6.063   55.578  21.267  1.00 138.73 -1 1011 GLU A OE2    1 
ATOM   7319  N  N      . LYS A  1 952  ? 6.189   50.898  25.165  1.00 93.73  ?  1012 LYS A N      1 
ATOM   7320  C  CA     . LYS A  1 952  ? 5.361   49.697  25.014  1.00 95.40  ?  1012 LYS A CA     1 
ATOM   7321  C  C      . LYS A  1 952  ? 4.368   49.572  26.193  1.00 97.63  ?  1012 LYS A C      1 
ATOM   7322  O  O      . LYS A  1 952  ? 3.194   49.234  25.961  1.00 100.34 ?  1012 LYS A O      1 
ATOM   7323  C  CB     . LYS A  1 952  ? 6.227   48.420  24.934  1.00 99.15  ?  1012 LYS A CB     1 
ATOM   7324  C  CG     . LYS A  1 952  ? 6.809   48.092  23.575  1.00 107.96 ?  1012 LYS A CG     1 
ATOM   7325  C  CD     . LYS A  1 952  ? 7.709   46.823  23.684  1.00 122.07 ?  1012 LYS A CD     1 
ATOM   7326  C  CE     . LYS A  1 952  ? 7.350   45.650  22.785  1.00 135.38 ?  1012 LYS A CE     1 
ATOM   7327  N  NZ     . LYS A  1 952  ? 8.200   44.449  23.036  1.00 140.66 1  1012 LYS A NZ     1 
ATOM   7328  N  N      . ILE A  1 953  ? 4.840   49.881  27.429  1.00 88.17  ?  1013 ILE A N      1 
ATOM   7329  C  CA     . ILE A  1 953  ? 4.052   49.812  28.654  1.00 87.54  ?  1013 ILE A CA     1 
ATOM   7330  C  C      . ILE A  1 953  ? 3.010   50.952  28.729  1.00 95.62  ?  1013 ILE A C      1 
ATOM   7331  O  O      . ILE A  1 953  ? 1.825   50.719  29.011  1.00 95.94  ?  1013 ILE A O      1 
ATOM   7332  C  CB     . ILE A  1 953  ? 4.991   49.818  29.896  1.00 88.88  ?  1013 ILE A CB     1 
ATOM   7333  C  CG1    . ILE A  1 953  ? 5.951   48.665  29.883  1.00 89.05  ?  1013 ILE A CG1    1 
ATOM   7334  C  CG2    . ILE A  1 953  ? 4.217   49.884  31.225  1.00 89.31  ?  1013 ILE A CG2    1 
ATOM   7335  C  CD1    . ILE A  1 953  ? 7.190   48.940  30.703  1.00 88.16  ?  1013 ILE A CD1    1 
ATOM   7336  N  N      . THR A  1 954  ? 3.471   52.194  28.549  1.00 93.81  ?  1014 THR A N      1 
ATOM   7337  C  CA     . THR A  1 954  ? 2.606   53.360  28.691  1.00 93.68  ?  1014 THR A CA     1 
ATOM   7338  C  C      . THR A  1 954  ? 1.512   53.363  27.635  1.00 99.84  ?  1014 THR A C      1 
ATOM   7339  O  O      . THR A  1 954  ? 0.371   53.667  27.983  1.00 102.41 ?  1014 THR A O      1 
ATOM   7340  C  CB     . THR A  1 954  ? 3.431   54.658  28.751  1.00 95.83  ?  1014 THR A CB     1 
ATOM   7341  O  OG1    . THR A  1 954  ? 4.186   54.768  27.563  1.00 101.02 ?  1014 THR A OG1    1 
ATOM   7342  C  CG2    . THR A  1 954  ? 4.401   54.674  29.914  1.00 90.78  ?  1014 THR A CG2    1 
ATOM   7343  N  N      . THR A  1 955  ? 1.826   52.945  26.388  1.00 95.45  ?  1015 THR A N      1 
ATOM   7344  C  CA     . THR A  1 955  ? 0.826   52.932  25.322  1.00 97.81  ?  1015 THR A CA     1 
ATOM   7345  C  C      . THR A  1 955  ? -0.229  51.851  25.531  1.00 106.34 ?  1015 THR A C      1 
ATOM   7346  O  O      . THR A  1 955  ? -1.254  51.831  24.826  1.00 108.17 ?  1015 THR A O      1 
ATOM   7347  C  CB     . THR A  1 955  ? 1.447   52.828  23.934  1.00 111.83 ?  1015 THR A CB     1 
ATOM   7348  O  OG1    . THR A  1 955  ? 2.268   51.647  23.851  1.00 109.14 ?  1015 THR A OG1    1 
ATOM   7349  C  CG2    . THR A  1 955  ? 2.180   54.096  23.512  1.00 110.15 ?  1015 THR A CG2    1 
ATOM   7350  N  N      . SER A  1 956  ? 0.022   50.938  26.479  1.00 103.64 ?  1016 SER A N      1 
ATOM   7351  C  CA     . SER A  1 956  ? -0.955  49.906  26.799  1.00 105.44 ?  1016 SER A CA     1 
ATOM   7352  C  C      . SER A  1 956  ? -1.875  50.360  27.921  1.00 109.40 ?  1016 SER A C      1 
ATOM   7353  O  O      . SER A  1 956  ? -2.821  49.649  28.250  1.00 112.55 ?  1016 SER A O      1 
ATOM   7354  C  CB     . SER A  1 956  ? -0.316  48.548  27.057  1.00 111.94 ?  1016 SER A CB     1 
ATOM   7355  O  OG     . SER A  1 956  ? 0.987   48.626  27.601  1.00 130.38 ?  1016 SER A OG     1 
ATOM   7356  N  N      . LYS A  1 957  ? -1.660  51.589  28.444  1.00 102.07 ?  1017 LYS A N      1 
ATOM   7357  C  CA     . LYS A  1 957  ? -2.512  52.248  29.438  1.00 100.79 ?  1017 LYS A CA     1 
ATOM   7358  C  C      . LYS A  1 957  ? -3.476  53.167  28.630  1.00 106.57 ?  1017 LYS A C      1 
ATOM   7359  O  O      . LYS A  1 957  ? -4.707  52.986  28.675  1.00 111.91 ?  1017 LYS A O      1 
ATOM   7360  C  CB     . LYS A  1 957  ? -1.680  53.072  30.431  1.00 98.90  ?  1017 LYS A CB     1 
ATOM   7361  C  CG     . LYS A  1 957  ? -0.635  52.292  31.190  1.00 94.35  ?  1017 LYS A CG     1 
ATOM   7362  C  CD     . LYS A  1 957  ? -0.660  52.704  32.650  1.00 102.46 ?  1017 LYS A CD     1 
ATOM   7363  C  CE     . LYS A  1 957  ? 0.571   52.288  33.425  1.00 96.21  ?  1017 LYS A CE     1 
ATOM   7364  N  NZ     . LYS A  1 957  ? 0.812   53.173  34.598  1.00 80.00  1  1017 LYS A NZ     1 
ATOM   7365  N  N      . LYS A  1 958  ? -2.891  54.096  27.845  1.00 97.52  ?  1018 LYS A N      1 
ATOM   7366  C  CA     . LYS A  1 958  ? -3.548  55.083  26.999  1.00 96.87  ?  1018 LYS A CA     1 
ATOM   7367  C  C      . LYS A  1 958  ? -2.727  55.093  25.679  1.00 98.45  ?  1018 LYS A C      1 
ATOM   7368  O  O      . LYS A  1 958  ? -1.495  55.222  25.735  1.00 95.49  ?  1018 LYS A O      1 
ATOM   7369  C  CB     . LYS A  1 958  ? -3.434  56.447  27.713  1.00 99.24  ?  1018 LYS A CB     1 
ATOM   7370  C  CG     . LYS A  1 958  ? -4.522  57.503  27.544  1.00 114.01 ?  1018 LYS A CG     1 
ATOM   7371  C  CD     . LYS A  1 958  ? -4.010  58.823  28.139  1.00 118.07 ?  1018 LYS A CD     1 
ATOM   7372  C  CE     . LYS A  1 958  ? -5.067  59.650  28.857  1.00 126.14 ?  1018 LYS A CE     1 
ATOM   7373  N  NZ     . LYS A  1 958  ? -4.452  60.562  29.865  1.00 130.53 1  1018 LYS A NZ     1 
ATOM   7374  N  N      . PRO A  1 959  ? -3.375  54.950  24.493  1.00 95.60  ?  1019 PRO A N      1 
ATOM   7375  C  CA     . PRO A  1 959  ? -2.619  54.928  23.221  1.00 95.36  ?  1019 PRO A CA     1 
ATOM   7376  C  C      . PRO A  1 959  ? -1.761  56.157  22.880  1.00 101.71 ?  1019 PRO A C      1 
ATOM   7377  O  O      . PRO A  1 959  ? -0.836  56.035  22.077  1.00 101.93 ?  1019 PRO A O      1 
ATOM   7378  C  CB     . PRO A  1 959  ? -3.718  54.736  22.178  1.00 98.30  ?  1019 PRO A CB     1 
ATOM   7379  C  CG     . PRO A  1 959  ? -4.948  55.256  22.829  1.00 102.64 ?  1019 PRO A CG     1 
ATOM   7380  C  CD     . PRO A  1 959  ? -4.817  54.794  24.244  1.00 97.62  ?  1019 PRO A CD     1 
ATOM   7381  N  N      . ASN A  1 960  ? -2.052  57.328  23.461  1.00 99.47  ?  1020 ASN A N      1 
ATOM   7382  C  CA     . ASN A  1 960  ? -1.283  58.550  23.170  1.00 98.45  ?  1020 ASN A CA     1 
ATOM   7383  C  C      . ASN A  1 960  ? -0.066  58.726  24.077  1.00 100.81 ?  1020 ASN A C      1 
ATOM   7384  O  O      . ASN A  1 960  ? 0.626   59.731  23.973  1.00 99.42  ?  1020 ASN A O      1 
ATOM   7385  C  CB     . ASN A  1 960  ? -2.169  59.792  23.191  1.00 100.70 ?  1020 ASN A CB     1 
ATOM   7386  C  CG     . ASN A  1 960  ? -2.866  59.995  24.501  1.00 138.89 ?  1020 ASN A CG     1 
ATOM   7387  O  OD1    . ASN A  1 960  ? -3.867  59.323  24.794  1.00 136.53 ?  1020 ASN A OD1    1 
ATOM   7388  N  ND2    . ASN A  1 960  ? -2.341  60.885  25.330  1.00 135.14 ?  1020 ASN A ND2    1 
ATOM   7389  N  N      . LEU A  1 961  ? 0.233   57.750  24.943  1.00 98.32  ?  1021 LEU A N      1 
ATOM   7390  C  CA     . LEU A  1 961  ? 1.410   57.861  25.816  1.00 96.59  ?  1021 LEU A CA     1 
ATOM   7391  C  C      . LEU A  1 961  ? 2.640   57.333  25.088  1.00 102.07 ?  1021 LEU A C      1 
ATOM   7392  O  O      . LEU A  1 961  ? 3.346   56.444  25.574  1.00 102.74 ?  1021 LEU A O      1 
ATOM   7393  C  CB     . LEU A  1 961  ? 1.194   57.191  27.180  1.00 95.95  ?  1021 LEU A CB     1 
ATOM   7394  C  CG     . LEU A  1 961  ? -0.005  57.693  27.959  1.00 100.45 ?  1021 LEU A CG     1 
ATOM   7395  C  CD1    . LEU A  1 961  ? -0.084  57.033  29.295  1.00 101.54 ?  1021 LEU A CD1    1 
ATOM   7396  C  CD2    . LEU A  1 961  ? 0.023   59.173  28.115  1.00 99.50  ?  1021 LEU A CD2    1 
ATOM   7397  N  N      . ILE A  1 962  ? 2.867   57.894  23.889  1.00 98.01  ?  1022 ILE A N      1 
ATOM   7398  C  CA     . ILE A  1 962  ? 3.966   57.576  22.992  1.00 97.74  ?  1022 ILE A CA     1 
ATOM   7399  C  C      . ILE A  1 962  ? 5.239   58.282  23.414  1.00 102.24 ?  1022 ILE A C      1 
ATOM   7400  O  O      . ILE A  1 962  ? 5.193   59.265  24.163  1.00 102.92 ?  1022 ILE A O      1 
ATOM   7401  C  CB     . ILE A  1 962  ? 3.598   57.961  21.538  1.00 102.38 ?  1022 ILE A CB     1 
ATOM   7402  C  CG1    . ILE A  1 962  ? 3.399   59.483  21.383  1.00 102.40 ?  1022 ILE A CG1    1 
ATOM   7403  C  CG2    . ILE A  1 962  ? 2.372   57.167  21.049  1.00 107.32 ?  1022 ILE A CG2    1 
ATOM   7404  C  CD1    . ILE A  1 962  ? 3.609   60.019  20.017  1.00 109.20 ?  1022 ILE A CD1    1 
ATOM   7405  N  N      . LEU A  1 963  ? 6.379   57.803  22.904  1.00 97.52  ?  1023 LEU A N      1 
ATOM   7406  C  CA     . LEU A  1 963  ? 7.644   58.471  23.139  1.00 94.73  ?  1023 LEU A CA     1 
ATOM   7407  C  C      . LEU A  1 963  ? 7.584   59.676  22.186  1.00 98.43  ?  1023 LEU A C      1 
ATOM   7408  O  O      . LEU A  1 963  ? 7.464   59.481  20.965  1.00 98.06  ?  1023 LEU A O      1 
ATOM   7409  C  CB     . LEU A  1 963  ? 8.811   57.533  22.804  1.00 93.33  ?  1023 LEU A CB     1 
ATOM   7410  C  CG     . LEU A  1 963  ? 10.218  58.047  23.074  1.00 94.42  ?  1023 LEU A CG     1 
ATOM   7411  C  CD1    . LEU A  1 963  ? 10.455  58.246  24.530  1.00 92.07  ?  1023 LEU A CD1    1 
ATOM   7412  C  CD2    . LEU A  1 963  ? 11.235  57.080  22.557  1.00 97.28  ?  1023 LEU A CD2    1 
ATOM   7413  N  N      . ASN A  1 964  ? 7.539   60.902  22.764  1.00 93.70  ?  1024 ASN A N      1 
ATOM   7414  C  CA     . ASN A  1 964  ? 7.454   62.143  22.008  1.00 93.54  ?  1024 ASN A CA     1 
ATOM   7415  C  C      . ASN A  1 964  ? 8.818   62.588  21.505  1.00 97.46  ?  1024 ASN A C      1 
ATOM   7416  O  O      . ASN A  1 964  ? 9.838   61.969  21.832  1.00 94.92  ?  1024 ASN A O      1 
ATOM   7417  C  CB     . ASN A  1 964  ? 6.745   63.248  22.798  1.00 91.25  ?  1024 ASN A CB     1 
ATOM   7418  C  CG     . ASN A  1 964  ? 7.413   63.588  24.100  1.00 109.07 ?  1024 ASN A CG     1 
ATOM   7419  O  OD1    . ASN A  1 964  ? 8.629   63.818  24.166  1.00 102.76 ?  1024 ASN A OD1    1 
ATOM   7420  N  ND2    . ASN A  1 964  ? 6.626   63.672  25.164  1.00 102.66 ?  1024 ASN A ND2    1 
ATOM   7421  N  N      . VAL A  1 965  ? 8.838   63.680  20.714  1.00 95.81  ?  1025 VAL A N      1 
ATOM   7422  C  CA     . VAL A  1 965  ? 10.078  64.150  20.104  1.00 94.44  ?  1025 VAL A CA     1 
ATOM   7423  C  C      . VAL A  1 965  ? 11.126  64.586  21.152  1.00 98.77  ?  1025 VAL A C      1 
ATOM   7424  O  O      . VAL A  1 965  ? 12.310  64.351  20.911  1.00 99.42  ?  1025 VAL A O      1 
ATOM   7425  C  CB     . VAL A  1 965  ? 9.822   65.190  18.998  1.00 96.93  ?  1025 VAL A CB     1 
ATOM   7426  C  CG1    . VAL A  1 965  ? 9.469   66.541  19.559  1.00 96.79  ?  1025 VAL A CG1    1 
ATOM   7427  C  CG2    . VAL A  1 965  ? 10.991  65.276  18.036  1.00 95.86  ?  1025 VAL A CG2    1 
ATOM   7428  N  N      . ASP A  1 966  ? 10.706  65.094  22.322  1.00 95.07  ?  1026 ASP A N      1 
ATOM   7429  C  CA     . ASP A  1 966  ? 11.648  65.494  23.371  1.00 95.33  ?  1026 ASP A CA     1 
ATOM   7430  C  C      . ASP A  1 966  ? 12.276  64.277  24.019  1.00 96.48  ?  1026 ASP A C      1 
ATOM   7431  O  O      . ASP A  1 966  ? 13.474  64.277  24.312  1.00 96.73  ?  1026 ASP A O      1 
ATOM   7432  C  CB     . ASP A  1 966  ? 10.990  66.377  24.416  1.00 99.53  ?  1026 ASP A CB     1 
ATOM   7433  C  CG     . ASP A  1 966  ? 10.331  67.627  23.856  1.00 133.52 ?  1026 ASP A CG     1 
ATOM   7434  O  OD1    . ASP A  1 966  ? 9.211   67.507  23.298  1.00 139.48 -1 1026 ASP A OD1    1 
ATOM   7435  O  OD2    . ASP A  1 966  ? 10.872  68.743  24.076  1.00 146.30 -1 1026 ASP A OD2    1 
ATOM   7436  N  N      . GLY A  1 967  ? 11.490  63.229  24.181  1.00 90.18  ?  1027 GLY A N      1 
ATOM   7437  C  CA     . GLY A  1 967  ? 12.007  61.996  24.740  1.00 89.47  ?  1027 GLY A CA     1 
ATOM   7438  C  C      . GLY A  1 967  ? 12.944  61.301  23.769  1.00 92.55  ?  1027 GLY A C      1 
ATOM   7439  O  O      . GLY A  1 967  ? 14.010  60.810  24.170  1.00 89.48  ?  1027 GLY A O      1 
ATOM   7440  N  N      . LEU A  1 968  ? 12.551  61.288  22.466  1.00 90.74  ?  1028 LEU A N      1 
ATOM   7441  C  CA     . LEU A  1 968  ? 13.321  60.645  21.407  1.00 91.00  ?  1028 LEU A CA     1 
ATOM   7442  C  C      . LEU A  1 968  ? 14.671  61.303  21.205  1.00 95.38  ?  1028 LEU A C      1 
ATOM   7443  O  O      . LEU A  1 968  ? 15.662  60.579  21.093  1.00 94.39  ?  1028 LEU A O      1 
ATOM   7444  C  CB     . LEU A  1 968  ? 12.517  60.571  20.100  1.00 92.05  ?  1028 LEU A CB     1 
ATOM   7445  C  CG     . LEU A  1 968  ? 13.014  59.616  18.976  1.00 97.03  ?  1028 LEU A CG     1 
ATOM   7446  C  CD1    . LEU A  1 968  ? 14.084  60.224  18.142  1.00 96.62  ?  1028 LEU A CD1    1 
ATOM   7447  C  CD2    . LEU A  1 968  ? 13.523  58.368  19.506  1.00 100.62 ?  1028 LEU A CD2    1 
ATOM   7448  N  N      . ILE A  1 969  ? 14.715  62.662  21.183  1.00 92.71  ?  1029 ILE A N      1 
ATOM   7449  C  CA     . ILE A  1 969  ? 15.967  63.408  21.048  1.00 92.86  ?  1029 ILE A CA     1 
ATOM   7450  C  C      . ILE A  1 969  ? 16.807  63.209  22.300  1.00 97.67  ?  1029 ILE A C      1 
ATOM   7451  O  O      . ILE A  1 969  ? 17.989  62.899  22.167  1.00 98.63  ?  1029 ILE A O      1 
ATOM   7452  C  CB     . ILE A  1 969  ? 15.761  64.903  20.718  1.00 96.55  ?  1029 ILE A CB     1 
ATOM   7453  C  CG1    . ILE A  1 969  ? 15.150  65.061  19.318  1.00 97.34  ?  1029 ILE A CG1    1 
ATOM   7454  C  CG2    . ILE A  1 969  ? 17.095  65.660  20.794  1.00 99.03  ?  1029 ILE A CG2    1 
ATOM   7455  C  CD1    . ILE A  1 969  ? 14.540  66.404  19.056  1.00 97.90  ?  1029 ILE A CD1    1 
ATOM   7456  N  N      . GLY A  1 970  ? 16.191  63.356  23.481  1.00 93.27  ?  1030 GLY A N      1 
ATOM   7457  C  CA     . GLY A  1 970  ? 16.863  63.154  24.758  1.00 92.72  ?  1030 GLY A CA     1 
ATOM   7458  C  C      . GLY A  1 970  ? 17.616  61.832  24.859  1.00 96.11  ?  1030 GLY A C      1 
ATOM   7459  O  O      . GLY A  1 970  ? 18.829  61.833  25.087  1.00 95.04  ?  1030 GLY A O      1 
ATOM   7460  N  N      . VAL A  1 971  ? 16.925  60.696  24.655  1.00 92.75  ?  1031 VAL A N      1 
ATOM   7461  C  CA     . VAL A  1 971  ? 17.582  59.391  24.791  1.00 93.26  ?  1031 VAL A CA     1 
ATOM   7462  C  C      . VAL A  1 971  ? 18.551  59.109  23.649  1.00 99.28  ?  1031 VAL A C      1 
ATOM   7463  O  O      . VAL A  1 971  ? 19.609  58.544  23.907  1.00 100.22 ?  1031 VAL A O      1 
ATOM   7464  C  CB     . VAL A  1 971  ? 16.626  58.210  25.041  1.00 97.11  ?  1031 VAL A CB     1 
ATOM   7465  C  CG1    . VAL A  1 971  ? 15.816  58.443  26.308  1.00 95.39  ?  1031 VAL A CG1    1 
ATOM   7466  C  CG2    . VAL A  1 971  ? 15.716  57.948  23.837  1.00 98.05  ?  1031 VAL A CG2    1 
ATOM   7467  N  N      . ALA A  1 972  ? 18.226  59.528  22.410  1.00 96.01  ?  1032 ALA A N      1 
ATOM   7468  C  CA     . ALA A  1 972  ? 19.124  59.308  21.271  1.00 96.32  ?  1032 ALA A CA     1 
ATOM   7469  C  C      . ALA A  1 972  ? 20.416  60.071  21.424  1.00 99.84  ?  1032 ALA A C      1 
ATOM   7470  O  O      . ALA A  1 972  ? 21.468  59.534  21.095  1.00 101.79 ?  1032 ALA A O      1 
ATOM   7471  C  CB     . ALA A  1 972  ? 18.456  59.683  19.966  1.00 97.30  ?  1032 ALA A CB     1 
ATOM   7472  N  N      . PHE A  1 973  ? 20.346  61.295  21.959  1.00 94.17  ?  1033 PHE A N      1 
ATOM   7473  C  CA     . PHE A  1 973  ? 21.520  62.107  22.199  1.00 93.70  ?  1033 PHE A CA     1 
ATOM   7474  C  C      . PHE A  1 973  ? 22.421  61.459  23.244  1.00 93.75  ?  1033 PHE A C      1 
ATOM   7475  O  O      . PHE A  1 973  ? 23.634  61.467  23.077  1.00 92.71  ?  1033 PHE A O      1 
ATOM   7476  C  CB     . PHE A  1 973  ? 21.118  63.505  22.634  1.00 96.69  ?  1033 PHE A CB     1 
ATOM   7477  C  CG     . PHE A  1 973  ? 22.159  64.525  22.263  1.00 101.08 ?  1033 PHE A CG     1 
ATOM   7478  C  CD1    . PHE A  1 973  ? 22.126  65.160  21.023  1.00 107.02 ?  1033 PHE A CD1    1 
ATOM   7479  C  CD2    . PHE A  1 973  ? 23.200  64.831  23.136  1.00 105.29 ?  1033 PHE A CD2    1 
ATOM   7480  C  CE1    . PHE A  1 973  ? 23.107  66.096  20.667  1.00 109.08 ?  1033 PHE A CE1    1 
ATOM   7481  C  CE2    . PHE A  1 973  ? 24.181  65.765  22.783  1.00 109.31 ?  1033 PHE A CE2    1 
ATOM   7482  C  CZ     . PHE A  1 973  ? 24.107  66.424  21.568  1.00 108.43 ?  1033 PHE A CZ     1 
ATOM   7483  N  N      . VAL A  1 974  ? 21.836  60.870  24.302  1.00 89.47  ?  1034 VAL A N      1 
ATOM   7484  C  CA     . VAL A  1 974  ? 22.591  60.149  25.326  1.00 89.66  ?  1034 VAL A CA     1 
ATOM   7485  C  C      . VAL A  1 974  ? 23.282  58.951  24.663  1.00 98.34  ?  1034 VAL A C      1 
ATOM   7486  O  O      . VAL A  1 974  ? 24.492  58.750  24.850  1.00 99.34  ?  1034 VAL A O      1 
ATOM   7487  C  CB     . VAL A  1 974  ? 21.707  59.711  26.508  1.00 92.58  ?  1034 VAL A CB     1 
ATOM   7488  C  CG1    . VAL A  1 974  ? 22.482  58.832  27.479  1.00 93.21  ?  1034 VAL A CG1    1 
ATOM   7489  C  CG2    . VAL A  1 974  ? 21.126  60.923  27.226  1.00 91.48  ?  1034 VAL A CG2    1 
ATOM   7490  N  N      . ASP A  1 975  ? 22.535  58.190  23.830  1.00 95.55  ?  1035 ASP A N      1 
ATOM   7491  C  CA     . ASP A  1 975  ? 23.105  57.058  23.109  1.00 95.53  ?  1035 ASP A CA     1 
ATOM   7492  C  C      . ASP A  1 975  ? 24.225  57.496  22.208  1.00 94.72  ?  1035 ASP A C      1 
ATOM   7493  O  O      . ASP A  1 975  ? 25.224  56.812  22.140  1.00 93.51  ?  1035 ASP A O      1 
ATOM   7494  C  CB     . ASP A  1 975  ? 22.039  56.317  22.334  1.00 99.18  ?  1035 ASP A CB     1 
ATOM   7495  C  CG     . ASP A  1 975  ? 21.223  55.319  23.165  1.00 120.43 ?  1035 ASP A CG     1 
ATOM   7496  O  OD1    . ASP A  1 975  ? 21.784  54.747  24.168  1.00 119.67 ?  1035 ASP A OD1    1 
ATOM   7497  O  OD2    . ASP A  1 975  ? 20.056  55.063  22.792  1.00 132.68 -1 1035 ASP A OD2    1 
ATOM   7498  N  N      . MET A  1 976  ? 24.096  58.666  21.581  1.00 91.47  ?  1036 MET A N      1 
ATOM   7499  C  CA     . MET A  1 976  ? 25.137  59.234  20.736  1.00 92.48  ?  1036 MET A CA     1 
ATOM   7500  C  C      . MET A  1 976  ? 26.382  59.536  21.538  1.00 94.62  ?  1036 MET A C      1 
ATOM   7501  O  O      . MET A  1 976  ? 27.422  59.000  21.202  1.00 96.89  ?  1036 MET A O      1 
ATOM   7502  C  CB     . MET A  1 976  ? 24.651  60.454  19.966  1.00 95.03  ?  1036 MET A CB     1 
ATOM   7503  C  CG     . MET A  1 976  ? 25.647  60.946  18.968  1.00 102.20 ?  1036 MET A CG     1 
ATOM   7504  S  SD     . MET A  1 976  ? 25.641  62.759  18.863  1.00 110.54 ?  1036 MET A SD     1 
ATOM   7505  C  CE     . MET A  1 976  ? 26.449  63.233  20.449  1.00 106.71 ?  1036 MET A CE     1 
ATOM   7506  N  N      . LEU A  1 977  ? 26.281  60.311  22.625  1.00 88.23  ?  1037 LEU A N      1 
ATOM   7507  C  CA     . LEU A  1 977  ? 27.424  60.648  23.475  1.00 88.05  ?  1037 LEU A CA     1 
ATOM   7508  C  C      . LEU A  1 977  ? 28.110  59.385  24.024  1.00 98.15  ?  1037 LEU A C      1 
ATOM   7509  O  O      . LEU A  1 977  ? 29.355  59.252  23.964  1.00 98.78  ?  1037 LEU A O      1 
ATOM   7510  C  CB     . LEU A  1 977  ? 27.012  61.557  24.648  1.00 86.04  ?  1037 LEU A CB     1 
ATOM   7511  C  CG     . LEU A  1 977  ? 26.501  62.947  24.343  1.00 88.06  ?  1037 LEU A CG     1 
ATOM   7512  C  CD1    . LEU A  1 977  ? 26.053  63.615  25.578  1.00 86.37  ?  1037 LEU A CD1    1 
ATOM   7513  C  CD2    . LEU A  1 977  ? 27.562  63.808  23.757  1.00 92.30  ?  1037 LEU A CD2    1 
ATOM   7514  N  N      . ARG A  1 978  ? 27.291  58.433  24.509  1.00 97.37  ?  1038 ARG A N      1 
ATOM   7515  C  CA     . ARG A  1 978  ? 27.834  57.220  25.102  1.00 100.68 ?  1038 ARG A CA     1 
ATOM   7516  C  C      . ARG A  1 978  ? 28.459  56.227  24.093  1.00 110.32 ?  1038 ARG A C      1 
ATOM   7517  O  O      . ARG A  1 978  ? 29.558  55.717  24.329  1.00 112.29 ?  1038 ARG A O      1 
ATOM   7518  C  CB     . ARG A  1 978  ? 26.779  56.534  25.960  1.00 98.54  ?  1038 ARG A CB     1 
ATOM   7519  C  CG     . ARG A  1 978  ? 26.457  57.296  27.212  1.00 104.88 ?  1038 ARG A CG     1 
ATOM   7520  C  CD     . ARG A  1 978  ? 25.406  56.585  28.033  1.00 114.17 ?  1038 ARG A CD     1 
ATOM   7521  N  NE     . ARG A  1 978  ? 25.220  57.247  29.320  1.00 114.87 ?  1038 ARG A NE     1 
ATOM   7522  C  CZ     . ARG A  1 978  ? 24.543  56.735  30.335  1.00 121.74 ?  1038 ARG A CZ     1 
ATOM   7523  N  NH1    . ARG A  1 978  ? 23.952  55.549  30.222  1.00 90.11  1  1038 ARG A NH1    1 
ATOM   7524  N  NH2    . ARG A  1 978  ? 24.468  57.390  31.479  1.00 120.12 ?  1038 ARG A NH2    1 
ATOM   7525  N  N      . ASN A  1 979  ? 27.807  56.027  22.946  1.00 107.56 ?  1039 ASN A N      1 
ATOM   7526  C  CA     . ASN A  1 979  ? 28.200  55.000  21.994  1.00 109.11 ?  1039 ASN A CA     1 
ATOM   7527  C  C      . ASN A  1 979  ? 28.801  55.469  20.656  1.00 112.45 ?  1039 ASN A C      1 
ATOM   7528  O  O      . ASN A  1 979  ? 29.074  54.614  19.820  1.00 115.74 ?  1039 ASN A O      1 
ATOM   7529  C  CB     . ASN A  1 979  ? 26.995  54.085  21.739  1.00 110.98 ?  1039 ASN A CB     1 
ATOM   7530  C  CG     . ASN A  1 979  ? 26.356  53.573  23.021  1.00 116.79 ?  1039 ASN A CG     1 
ATOM   7531  O  OD1    . ASN A  1 979  ? 26.826  52.629  23.647  1.00 99.69  ?  1039 ASN A OD1    1 
ATOM   7532  N  ND2    . ASN A  1 979  ? 25.299  54.230  23.478  1.00 108.19 ?  1039 ASN A ND2    1 
ATOM   7533  N  N      . CYS A  1 980  ? 29.066  56.764  20.449  1.00 105.42 ?  1040 CYS A N      1 
ATOM   7534  C  CA     . CYS A  1 980  ? 29.703  57.179  19.190  1.00 105.20 ?  1040 CYS A CA     1 
ATOM   7535  C  C      . CYS A  1 980  ? 31.186  56.894  19.234  1.00 110.73 ?  1040 CYS A C      1 
ATOM   7536  O  O      . CYS A  1 980  ? 31.851  56.875  18.196  1.00 110.42 ?  1040 CYS A O      1 
ATOM   7537  C  CB     . CYS A  1 980  ? 29.434  58.640  18.851  1.00 103.82 ?  1040 CYS A CB     1 
ATOM   7538  S  SG     . CYS A  1 980  ? 30.401  59.808  19.829  1.00 106.99 ?  1040 CYS A SG     1 
ATOM   7539  N  N      . GLY A  1 981  ? 31.689  56.698  20.446  1.00 109.78 ?  1041 GLY A N      1 
ATOM   7540  C  CA     . GLY A  1 981  ? 33.082  56.352  20.675  1.00 112.74 ?  1041 GLY A CA     1 
ATOM   7541  C  C      . GLY A  1 981  ? 34.045  57.505  20.832  1.00 118.08 ?  1041 GLY A C      1 
ATOM   7542  O  O      . GLY A  1 981  ? 35.247  57.272  20.961  1.00 121.01 ?  1041 GLY A O      1 
ATOM   7543  N  N      . SER A  1 982  ? 33.537  58.746  20.841  1.00 111.87 ?  1042 SER A N      1 
ATOM   7544  C  CA     . SER A  1 982  ? 34.376  59.936  21.043  1.00 110.63 ?  1042 SER A CA     1 
ATOM   7545  C  C      . SER A  1 982  ? 34.449  60.337  22.537  1.00 113.79 ?  1042 SER A C      1 
ATOM   7546  O  O      . SER A  1 982  ? 35.326  61.118  22.919  1.00 114.37 ?  1042 SER A O      1 
ATOM   7547  C  CB     . SER A  1 982  ? 33.885  61.114  20.194  1.00 110.60 ?  1042 SER A CB     1 
ATOM   7548  O  OG     . SER A  1 982  ? 34.054  60.853  18.815  1.00 112.42 ?  1042 SER A OG     1 
ATOM   7549  N  N      . PHE A  1 983  ? 33.539  59.794  23.376  1.00 107.67 ?  1043 PHE A N      1 
ATOM   7550  C  CA     . PHE A  1 983  ? 33.475  60.170  24.779  1.00 105.80 ?  1043 PHE A CA     1 
ATOM   7551  C  C      . PHE A  1 983  ? 33.579  59.021  25.701  1.00 106.41 ?  1043 PHE A C      1 
ATOM   7552  O  O      . PHE A  1 983  ? 32.978  57.974  25.434  1.00 105.26 ?  1043 PHE A O      1 
ATOM   7553  C  CB     . PHE A  1 983  ? 32.138  60.846  25.101  1.00 106.06 ?  1043 PHE A CB     1 
ATOM   7554  C  CG     . PHE A  1 983  ? 31.775  62.021  24.242  1.00 106.29 ?  1043 PHE A CG     1 
ATOM   7555  C  CD1    . PHE A  1 983  ? 31.091  61.843  23.045  1.00 108.90 ?  1043 PHE A CD1    1 
ATOM   7556  C  CD2    . PHE A  1 983  ? 32.063  63.300  24.649  1.00 109.24 ?  1043 PHE A CD2    1 
ATOM   7557  C  CE1    . PHE A  1 983  ? 30.766  62.917  22.245  1.00 109.04 ?  1043 PHE A CE1    1 
ATOM   7558  C  CE2    . PHE A  1 983  ? 31.698  64.383  23.871  1.00 112.24 ?  1043 PHE A CE2    1 
ATOM   7559  C  CZ     . PHE A  1 983  ? 31.068  64.184  22.661  1.00 109.93 ?  1043 PHE A CZ     1 
ATOM   7560  N  N      . THR A  1 984  ? 34.222  59.273  26.870  1.00 101.54 ?  1044 THR A N      1 
ATOM   7561  C  CA     . THR A  1 984  ? 34.304  58.332  27.983  1.00 103.00 ?  1044 THR A CA     1 
ATOM   7562  C  C      . THR A  1 984  ? 32.948  58.443  28.661  1.00 107.40 ?  1044 THR A C      1 
ATOM   7563  O  O      . THR A  1 984  ? 32.258  59.468  28.459  1.00 106.82 ?  1044 THR A O      1 
ATOM   7564  C  CB     . THR A  1 984  ? 35.410  58.718  28.970  1.00 110.03 ?  1044 THR A CB     1 
ATOM   7565  O  OG1    . THR A  1 984  ? 35.001  59.802  29.780  1.00 99.24  ?  1044 THR A OG1    1 
ATOM   7566  C  CG2    . THR A  1 984  ? 36.705  59.116  28.298  1.00 116.27 ?  1044 THR A CG2    1 
ATOM   7567  N  N      . ARG A  1 985  ? 32.551  57.436  29.473  1.00 103.32 ?  1045 ARG A N      1 
ATOM   7568  C  CA     . ARG A  1 985  ? 31.243  57.544  30.128  1.00 100.95 ?  1045 ARG A CA     1 
ATOM   7569  C  C      . ARG A  1 985  ? 31.131  58.825  30.946  1.00 106.22 ?  1045 ARG A C      1 
ATOM   7570  O  O      . ARG A  1 985  ? 30.166  59.566  30.791  1.00 104.48 ?  1045 ARG A O      1 
ATOM   7571  C  CB     . ARG A  1 985  ? 30.928  56.323  30.968  1.00 99.05  ?  1045 ARG A CB     1 
ATOM   7572  C  CG     . ARG A  1 985  ? 29.568  56.402  31.632  1.00 95.65  ?  1045 ARG A CG     1 
ATOM   7573  C  CD     . ARG A  1 985  ? 28.448  56.331  30.633  1.00 94.56  ?  1045 ARG A CD     1 
ATOM   7574  N  NE     . ARG A  1 985  ? 27.964  54.971  30.423  1.00 93.70  ?  1045 ARG A NE     1 
ATOM   7575  C  CZ     . ARG A  1 985  ? 27.110  54.390  31.256  1.00 125.59 ?  1045 ARG A CZ     1 
ATOM   7576  N  NH1    . ARG A  1 985  ? 26.695  55.030  32.346  1.00 127.62 1  1045 ARG A NH1    1 
ATOM   7577  N  NH2    . ARG A  1 985  ? 26.658  53.168  31.007  1.00 114.43 ?  1045 ARG A NH2    1 
ATOM   7578  N  N      . GLU A  1 986  ? 32.168  59.112  31.750  1.00 105.36 ?  1046 GLU A N      1 
ATOM   7579  C  CA     . GLU A  1 986  ? 32.345  60.286  32.609  1.00 104.50 ?  1046 GLU A CA     1 
ATOM   7580  C  C      . GLU A  1 986  ? 32.076  61.582  31.813  1.00 104.78 ?  1046 GLU A C      1 
ATOM   7581  O  O      . GLU A  1 986  ? 31.280  62.411  32.261  1.00 103.10 ?  1046 GLU A O      1 
ATOM   7582  C  CB     . GLU A  1 986  ? 33.773  60.285  33.204  1.00 108.09 ?  1046 GLU A CB     1 
ATOM   7583  C  CG     . GLU A  1 986  ? 34.158  59.024  33.970  1.00 125.75 ?  1046 GLU A CG     1 
ATOM   7584  C  CD     . GLU A  1 986  ? 34.244  57.679  33.249  1.00 162.73 ?  1046 GLU A CD     1 
ATOM   7585  O  OE1    . GLU A  1 986  ? 33.810  56.666  33.846  1.00 173.65 ?  1046 GLU A OE1    1 
ATOM   7586  O  OE2    . GLU A  1 986  ? 34.713  57.634  32.088  1.00 156.92 -1 1046 GLU A OE2    1 
ATOM   7587  N  N      . GLU A  1 987  ? 32.692  61.703  30.608  1.00 99.45  ?  1047 GLU A N      1 
ATOM   7588  C  CA     . GLU A  1 987  ? 32.562  62.831  29.698  1.00 96.86  ?  1047 GLU A CA     1 
ATOM   7589  C  C      . GLU A  1 987  ? 31.131  62.951  29.234  1.00 101.80 ?  1047 GLU A C      1 
ATOM   7590  O  O      . GLU A  1 987  ? 30.581  64.056  29.288  1.00 100.88 ?  1047 GLU A O      1 
ATOM   7591  C  CB     . GLU A  1 987  ? 33.477  62.680  28.474  1.00 97.79  ?  1047 GLU A CB     1 
ATOM   7592  C  CG     . GLU A  1 987  ? 34.963  62.879  28.730  1.00 108.02 ?  1047 GLU A CG     1 
ATOM   7593  C  CD     . GLU A  1 987  ? 35.866  62.667  27.524  1.00 134.25 ?  1047 GLU A CD     1 
ATOM   7594  O  OE1    . GLU A  1 987  ? 35.595  61.737  26.734  1.00 143.42 ?  1047 GLU A OE1    1 
ATOM   7595  O  OE2    . GLU A  1 987  ? 36.865  63.407  27.381  1.00 126.52 -1 1047 GLU A OE2    1 
ATOM   7596  N  N      . ALA A  1 988  ? 30.518  61.820  28.786  1.00 99.38  ?  1048 ALA A N      1 
ATOM   7597  C  CA     . ALA A  1 988  ? 29.127  61.797  28.294  1.00 98.18  ?  1048 ALA A CA     1 
ATOM   7598  C  C      . ALA A  1 988  ? 28.155  62.252  29.375  1.00 103.27 ?  1048 ALA A C      1 
ATOM   7599  O  O      . ALA A  1 988  ? 27.304  63.118  29.135  1.00 101.44 ?  1048 ALA A O      1 
ATOM   7600  C  CB     . ALA A  1 988  ? 28.761  60.410  27.797  1.00 99.12  ?  1048 ALA A CB     1 
ATOM   7601  N  N      . ASP A  1 989  ? 28.345  61.728  30.590  1.00 102.39 ?  1049 ASP A N      1 
ATOM   7602  C  CA     . ASP A  1 989  ? 27.528  62.056  31.746  1.00 103.01 ?  1049 ASP A CA     1 
ATOM   7603  C  C      . ASP A  1 989  ? 27.651  63.538  32.132  1.00 105.44 ?  1049 ASP A C      1 
ATOM   7604  O  O      . ASP A  1 989  ? 26.622  64.181  32.400  1.00 104.50 ?  1049 ASP A O      1 
ATOM   7605  C  CB     . ASP A  1 989  ? 27.852  61.080  32.908  1.00 107.77 ?  1049 ASP A CB     1 
ATOM   7606  C  CG     . ASP A  1 989  ? 27.373  59.629  32.686  1.00 124.49 ?  1049 ASP A CG     1 
ATOM   7607  O  OD1    . ASP A  1 989  ? 26.588  59.395  31.718  1.00 126.46 ?  1049 ASP A OD1    1 
ATOM   7608  O  OD2    . ASP A  1 989  ? 27.787  58.723  33.481  1.00 126.88 -1 1049 ASP A OD2    1 
ATOM   7609  N  N      . GLU A  1 990  ? 28.908  64.088  32.103  1.00 100.98 ?  1050 GLU A N      1 
ATOM   7610  C  CA     . GLU A  1 990  ? 29.182  65.502  32.417  1.00 98.98  ?  1050 GLU A CA     1 
ATOM   7611  C  C      . GLU A  1 990  ? 28.451  66.405  31.467  1.00 97.11  ?  1050 GLU A C      1 
ATOM   7612  O  O      . GLU A  1 990  ? 27.780  67.315  31.932  1.00 96.11  ?  1050 GLU A O      1 
ATOM   7613  C  CB     . GLU A  1 990  ? 30.681  65.843  32.425  1.00 101.55 ?  1050 GLU A CB     1 
ATOM   7614  C  CG     . GLU A  1 990  ? 30.954  67.210  33.048  1.00 118.00 ?  1050 GLU A CG     1 
ATOM   7615  C  CD     . GLU A  1 990  ? 32.386  67.700  33.182  1.00 157.56 ?  1050 GLU A CD     1 
ATOM   7616  O  OE1    . GLU A  1 990  ? 32.656  68.460  34.142  1.00 151.98 ?  1050 GLU A OE1    1 
ATOM   7617  O  OE2    . GLU A  1 990  ? 33.228  67.357  32.318  1.00 165.44 -1 1050 GLU A OE2    1 
ATOM   7618  N  N      . TYR A  1 991  ? 28.529  66.126  30.149  1.00 91.58  ?  1051 TYR A N      1 
ATOM   7619  C  CA     . TYR A  1 991  ? 27.867  66.940  29.125  1.00 89.21  ?  1051 TYR A CA     1 
ATOM   7620  C  C      . TYR A  1 991  ? 26.383  66.974  29.267  1.00 94.64  ?  1051 TYR A C      1 
ATOM   7621  O  O      . TYR A  1 991  ? 25.802  68.041  29.067  1.00 94.52  ?  1051 TYR A O      1 
ATOM   7622  C  CB     . TYR A  1 991  ? 28.264  66.549  27.705  1.00 88.18  ?  1051 TYR A CB     1 
ATOM   7623  C  CG     . TYR A  1 991  ? 29.565  67.182  27.310  1.00 87.96  ?  1051 TYR A CG     1 
ATOM   7624  C  CD1    . TYR A  1 991  ? 29.694  68.567  27.249  1.00 88.99  ?  1051 TYR A CD1    1 
ATOM   7625  C  CD2    . TYR A  1 991  ? 30.686  66.406  27.045  1.00 89.22  ?  1051 TYR A CD2    1 
ATOM   7626  C  CE1    . TYR A  1 991  ? 30.907  69.168  26.927  1.00 89.26  ?  1051 TYR A CE1    1 
ATOM   7627  C  CE2    . TYR A  1 991  ? 31.900  66.991  26.711  1.00 91.44  ?  1051 TYR A CE2    1 
ATOM   7628  C  CZ     . TYR A  1 991  ? 32.009  68.380  26.657  1.00 100.04 ?  1051 TYR A CZ     1 
ATOM   7629  O  OH     . TYR A  1 991  ? 33.199  68.983  26.317  1.00 101.09 ?  1051 TYR A OH     1 
ATOM   7630  N  N      . ILE A  1 992  ? 25.760  65.843  29.654  1.00 92.19  ?  1052 ILE A N      1 
ATOM   7631  C  CA     . ILE A  1 992  ? 24.310  65.831  29.858  1.00 91.52  ?  1052 ILE A CA     1 
ATOM   7632  C  C      . ILE A  1 992  ? 23.942  66.702  31.063  1.00 96.46  ?  1052 ILE A C      1 
ATOM   7633  O  O      . ILE A  1 992  ? 23.027  67.546  30.983  1.00 94.31  ?  1052 ILE A O      1 
ATOM   7634  C  CB     . ILE A  1 992  ? 23.763  64.394  29.964  1.00 93.61  ?  1052 ILE A CB     1 
ATOM   7635  C  CG1    . ILE A  1 992  ? 23.878  63.677  28.619  1.00 92.34  ?  1052 ILE A CG1    1 
ATOM   7636  C  CG2    . ILE A  1 992  ? 22.316  64.373  30.526  1.00 93.39  ?  1052 ILE A CG2    1 
ATOM   7637  C  CD1    . ILE A  1 992  ? 23.005  64.234  27.458  1.00 97.79  ?  1052 ILE A CD1    1 
ATOM   7638  N  N      . ASP A  1 993  ? 24.709  66.516  32.140  1.00 96.04  ?  1053 ASP A N      1 
ATOM   7639  C  CA     . ASP A  1 993  ? 24.536  67.220  33.381  1.00 98.62  ?  1053 ASP A CA     1 
ATOM   7640  C  C      . ASP A  1 993  ? 24.657  68.752  33.237  1.00 103.39 ?  1053 ASP A C      1 
ATOM   7641  O  O      . ASP A  1 993  ? 23.770  69.477  33.739  1.00 104.37 ?  1053 ASP A O      1 
ATOM   7642  C  CB     . ASP A  1 993  ? 25.484  66.683  34.443  1.00 103.51 ?  1053 ASP A CB     1 
ATOM   7643  C  CG     . ASP A  1 993  ? 25.285  67.369  35.770  1.00 125.76 ?  1053 ASP A CG     1 
ATOM   7644  O  OD1    . ASP A  1 993  ? 24.214  67.151  36.397  1.00 128.61 ?  1053 ASP A OD1    1 
ATOM   7645  O  OD2    . ASP A  1 993  ? 26.147  68.205  36.137  1.00 135.85 -1 1053 ASP A OD2    1 
ATOM   7646  N  N      . ILE A  1 994  ? 25.701  69.244  32.516  1.00 97.35  ?  1054 ILE A N      1 
ATOM   7647  C  CA     . ILE A  1 994  ? 25.910  70.686  32.331  1.00 95.63  ?  1054 ILE A CA     1 
ATOM   7648  C  C      . ILE A  1 994  ? 24.901  71.330  31.314  1.00 102.58 ?  1054 ILE A C      1 
ATOM   7649  O  O      . ILE A  1 994  ? 24.894  72.562  31.151  1.00 102.26 ?  1054 ILE A O      1 
ATOM   7650  C  CB     . ILE A  1 994  ? 27.369  71.070  32.047  1.00 97.06  ?  1054 ILE A CB     1 
ATOM   7651  C  CG1    . ILE A  1 994  ? 27.909  70.462  30.772  1.00 96.04  ?  1054 ILE A CG1    1 
ATOM   7652  C  CG2    . ILE A  1 994  ? 28.229  70.730  33.230  1.00 97.78  ?  1054 ILE A CG2    1 
ATOM   7653  C  CD1    . ILE A  1 994  ? 29.304  70.958  30.446  1.00 106.23 ?  1054 ILE A CD1    1 
ATOM   7654  N  N      . GLY A  1 995  ? 24.019  70.505  30.726  1.00 102.10 ?  1055 GLY A N      1 
ATOM   7655  C  CA     . GLY A  1 995  ? 22.905  70.913  29.877  1.00 101.03 ?  1055 GLY A CA     1 
ATOM   7656  C  C      . GLY A  1 995  ? 23.181  71.064  28.400  1.00 102.83 ?  1055 GLY A C      1 
ATOM   7657  O  O      . GLY A  1 995  ? 22.594  71.952  27.766  1.00 103.68 ?  1055 GLY A O      1 
ATOM   7658  N  N      . ALA A  1 996  ? 24.003  70.176  27.817  1.00 95.99  ?  1056 ALA A N      1 
ATOM   7659  C  CA     . ALA A  1 996  ? 24.300  70.251  26.389  1.00 94.84  ?  1056 ALA A CA     1 
ATOM   7660  C  C      . ALA A  1 996  ? 23.006  70.120  25.619  1.00 98.80  ?  1056 ALA A C      1 
ATOM   7661  O  O      . ALA A  1 996  ? 22.823  70.789  24.590  1.00 98.35  ?  1056 ALA A O      1 
ATOM   7662  C  CB     . ALA A  1 996  ? 25.237  69.142  25.989  1.00 96.43  ?  1056 ALA A CB     1 
ATOM   7663  N  N      . LEU A  1 997  ? 22.066  69.317  26.189  1.00 95.08  ?  1057 LEU A N      1 
ATOM   7664  C  CA     . LEU A  1 997  ? 20.758  69.107  25.601  1.00 94.65  ?  1057 LEU A CA     1 
ATOM   7665  C  C      . LEU A  1 997  ? 19.889  70.379  25.568  1.00 100.11 ?  1057 LEU A C      1 
ATOM   7666  O  O      . LEU A  1 997  ? 19.147  70.596  24.607  1.00 100.03 ?  1057 LEU A O      1 
ATOM   7667  C  CB     . LEU A  1 997  ? 20.064  67.951  26.265  1.00 94.67  ?  1057 LEU A CB     1 
ATOM   7668  C  CG     . LEU A  1 997  ? 20.134  66.691  25.414  1.00 100.91 ?  1057 LEU A CG     1 
ATOM   7669  C  CD1    . LEU A  1 997  ? 19.686  65.509  26.183  1.00 102.03 ?  1057 LEU A CD1    1 
ATOM   7670  C  CD2    . LEU A  1 997  ? 19.268  66.803  24.167  1.00 104.75 ?  1057 LEU A CD2    1 
ATOM   7671  N  N      . ASN A  1 998  ? 20.039  71.251  26.579  1.00 96.59  ?  1058 ASN A N      1 
ATOM   7672  C  CA     . ASN A  1 998  ? 19.368  72.540  26.629  1.00 95.45  ?  1058 ASN A CA     1 
ATOM   7673  C  C      . ASN A  1 998  ? 19.947  73.433  25.546  1.00 100.98 ?  1058 ASN A C      1 
ATOM   7674  O  O      . ASN A  1 998  ? 19.185  74.134  24.871  1.00 104.29 ?  1058 ASN A O      1 
ATOM   7675  C  CB     . ASN A  1 998  ? 19.490  73.163  27.992  1.00 90.64  ?  1058 ASN A CB     1 
ATOM   7676  C  CG     . ASN A  1 998  ? 18.596  72.488  28.996  1.00 117.76 ?  1058 ASN A CG     1 
ATOM   7677  O  OD1    . ASN A  1 998  ? 17.511  71.938  28.681  1.00 115.54 ?  1058 ASN A OD1    1 
ATOM   7678  N  ND2    . ASN A  1 998  ? 19.060  72.504  30.232  1.00 109.06 ?  1058 ASN A ND2    1 
ATOM   7679  N  N      . GLY A  1 999  ? 21.255  73.319  25.313  1.00 93.31  ?  1059 GLY A N      1 
ATOM   7680  C  CA     . GLY A  1 999  ? 21.919  74.022  24.228  1.00 91.21  ?  1059 GLY A CA     1 
ATOM   7681  C  C      . GLY A  1 999  ? 21.310  73.665  22.885  1.00 91.45  ?  1059 GLY A C      1 
ATOM   7682  O  O      . GLY A  1 999  ? 21.021  74.571  22.095  1.00 88.95  ?  1059 GLY A O      1 
ATOM   7683  N  N      . ILE A  1 1000 ? 21.065  72.338  22.635  1.00 86.80  ?  1060 ILE A N      1 
ATOM   7684  C  CA     . ILE A  1 1000 ? 20.447  71.850  21.376  1.00 85.54  ?  1060 ILE A CA     1 
ATOM   7685  C  C      . ILE A  1 1000 ? 19.112  72.551  21.144  1.00 89.72  ?  1060 ILE A C      1 
ATOM   7686  O  O      . ILE A  1 1000 ? 18.914  73.145  20.077  1.00 89.43  ?  1060 ILE A O      1 
ATOM   7687  C  CB     . ILE A  1 1000 ? 20.320  70.299  21.292  1.00 87.21  ?  1060 ILE A CB     1 
ATOM   7688  C  CG1    . ILE A  1 1000 ? 21.686  69.600  21.283  1.00 88.03  ?  1060 ILE A CG1    1 
ATOM   7689  C  CG2    . ILE A  1 1000 ? 19.470  69.842  20.128  1.00 84.30  ?  1060 ILE A CG2    1 
ATOM   7690  C  CD1    . ILE A  1 1000 ? 22.613  69.907  20.095  1.00 90.10  ?  1060 ILE A CD1    1 
ATOM   7691  N  N      . PHE A  1 1001 ? 18.222  72.519  22.152  1.00 84.63  ?  1061 PHE A N      1 
ATOM   7692  C  CA     . PHE A  1 1001 ? 16.930  73.143  21.997  1.00 83.78  ?  1061 PHE A CA     1 
ATOM   7693  C  C      . PHE A  1 1001 ? 17.045  74.629  21.738  1.00 82.73  ?  1061 PHE A C      1 
ATOM   7694  O  O      . PHE A  1 1001 ? 16.423  75.139  20.809  1.00 80.45  ?  1061 PHE A O      1 
ATOM   7695  C  CB     . PHE A  1 1001 ? 16.025  72.852  23.193  1.00 86.91  ?  1061 PHE A CB     1 
ATOM   7696  C  CG     . PHE A  1 1001 ? 14.630  73.394  22.960  1.00 89.79  ?  1061 PHE A CG     1 
ATOM   7697  C  CD1    . PHE A  1 1001 ? 13.697  72.667  22.234  1.00 92.58  ?  1061 PHE A CD1    1 
ATOM   7698  C  CD2    . PHE A  1 1001 ? 14.277  74.672  23.400  1.00 93.07  ?  1061 PHE A CD2    1 
ATOM   7699  C  CE1    . PHE A  1 1001 ? 12.435  73.193  21.972  1.00 94.00  ?  1061 PHE A CE1    1 
ATOM   7700  C  CE2    . PHE A  1 1001 ? 13.000  75.188  23.147  1.00 95.63  ?  1061 PHE A CE2    1 
ATOM   7701  C  CZ     . PHE A  1 1001 ? 12.088  74.441  22.441  1.00 93.42  ?  1061 PHE A CZ     1 
ATOM   7702  N  N      . VAL A  1 1002 ? 17.822  75.317  22.562  1.00 80.05  ?  1062 VAL A N      1 
ATOM   7703  C  CA     . VAL A  1 1002 ? 18.025  76.763  22.447  1.00 80.54  ?  1062 VAL A CA     1 
ATOM   7704  C  C      . VAL A  1 1002 ? 18.569  77.150  21.068  1.00 87.68  ?  1062 VAL A C      1 
ATOM   7705  O  O      . VAL A  1 1002 ? 18.012  78.035  20.407  1.00 89.74  ?  1062 VAL A O      1 
ATOM   7706  C  CB     . VAL A  1 1002 ? 18.928  77.297  23.580  1.00 82.83  ?  1062 VAL A CB     1 
ATOM   7707  C  CG1    . VAL A  1 1002 ? 19.341  78.734  23.313  1.00 81.49  ?  1062 VAL A CG1    1 
ATOM   7708  C  CG2    . VAL A  1 1002 ? 18.218  77.194  24.920  1.00 82.44  ?  1062 VAL A CG2    1 
ATOM   7709  N  N      . LEU A  1 1003 ? 19.647  76.484  20.638  1.00 82.03  ?  1063 LEU A N      1 
ATOM   7710  C  CA     . LEU A  1 1003 ? 20.239  76.786  19.350  1.00 80.45  ?  1063 LEU A CA     1 
ATOM   7711  C  C      . LEU A  1 1003 ? 19.287  76.488  18.227  1.00 85.63  ?  1063 LEU A C      1 
ATOM   7712  O  O      . LEU A  1 1003 ? 19.127  77.326  17.353  1.00 86.97  ?  1063 LEU A O      1 
ATOM   7713  C  CB     . LEU A  1 1003 ? 21.559  76.041  19.154  1.00 80.04  ?  1063 LEU A CB     1 
ATOM   7714  C  CG     . LEU A  1 1003 ? 22.332  76.402  17.900  1.00 81.84  ?  1063 LEU A CG     1 
ATOM   7715  C  CD1    . LEU A  1 1003 ? 22.839  77.843  17.934  1.00 79.41  ?  1063 LEU A CD1    1 
ATOM   7716  C  CD2    . LEU A  1 1003 ? 23.426  75.420  17.653  1.00 81.12  ?  1063 LEU A CD2    1 
ATOM   7717  N  N      . GLY A  1 1004 ? 18.635  75.337  18.277  1.00 82.84  ?  1064 GLY A N      1 
ATOM   7718  C  CA     . GLY A  1 1004 ? 17.678  74.938  17.249  1.00 83.90  ?  1064 GLY A CA     1 
ATOM   7719  C  C      . GLY A  1 1004 ? 16.512  75.903  17.105  1.00 86.52  ?  1064 GLY A C      1 
ATOM   7720  O  O      . GLY A  1 1004 ? 16.266  76.412  15.998  1.00 86.95  ?  1064 GLY A O      1 
ATOM   7721  N  N      . ARG A  1 1005 ? 15.834  76.202  18.248  1.00 78.71  ?  1065 ARG A N      1 
ATOM   7722  C  CA     . ARG A  1 1005 ? 14.659  77.048  18.281  1.00 77.03  ?  1065 ARG A CA     1 
ATOM   7723  C  C      . ARG A  1 1005 ? 14.942  78.504  17.990  1.00 81.83  ?  1065 ARG A C      1 
ATOM   7724  O  O      . ARG A  1 1005 ? 14.036  79.224  17.555  1.00 81.48  ?  1065 ARG A O      1 
ATOM   7725  C  CB     . ARG A  1 1005 ? 13.905  76.882  19.594  1.00 74.30  ?  1065 ARG A CB     1 
ATOM   7726  C  CG     . ARG A  1 1005 ? 12.481  77.472  19.583  1.00 73.32  ?  1065 ARG A CG     1 
ATOM   7727  C  CD     . ARG A  1 1005 ? 11.608  76.893  18.487  1.00 72.25  ?  1065 ARG A CD     1 
ATOM   7728  N  NE     . ARG A  1 1005 ? 11.205  75.514  18.807  1.00 73.28  ?  1065 ARG A NE     1 
ATOM   7729  C  CZ     . ARG A  1 1005 ? 10.013  75.236  19.319  1.00 98.40  ?  1065 ARG A CZ     1 
ATOM   7730  N  NH1    . ARG A  1 1005 ? 9.110   76.202  19.481  1.00 105.19 1  1065 ARG A NH1    1 
ATOM   7731  N  NH2    . ARG A  1 1005 ? 9.697   73.989  19.653  1.00 77.73  ?  1065 ARG A NH2    1 
ATOM   7732  N  N      . SER A  1 1006 ? 16.190  78.939  18.181  1.00 79.45  ?  1066 SER A N      1 
ATOM   7733  C  CA     . SER A  1 1006 ? 16.577  80.301  17.875  1.00 80.38  ?  1066 SER A CA     1 
ATOM   7734  C  C      . SER A  1 1006 ? 16.265  80.612  16.424  1.00 89.40  ?  1066 SER A C      1 
ATOM   7735  O  O      . SER A  1 1006 ? 15.872  81.747  16.134  1.00 89.13  ?  1066 SER A O      1 
ATOM   7736  C  CB     . SER A  1 1006 ? 18.063  80.521  18.153  1.00 84.75  ?  1066 SER A CB     1 
ATOM   7737  O  OG     . SER A  1 1006 ? 18.306  80.733  19.535  1.00 95.22  ?  1066 SER A OG     1 
ATOM   7738  N  N      . MET A  1 1007 ? 16.377  79.608  15.519  1.00 90.08  ?  1067 MET A N      1 
ATOM   7739  C  CA     . MET A  1 1007 ? 16.044  79.795  14.104  1.00 92.12  ?  1067 MET A CA     1 
ATOM   7740  C  C      . MET A  1 1007 ? 14.579  80.163  13.892  1.00 96.86  ?  1067 MET A C      1 
ATOM   7741  O  O      . MET A  1 1007 ? 14.289  81.133  13.185  1.00 98.40  ?  1067 MET A O      1 
ATOM   7742  C  CB     . MET A  1 1007 ? 16.405  78.595  13.286  1.00 95.68  ?  1067 MET A CB     1 
ATOM   7743  C  CG     . MET A  1 1007 ? 16.863  78.978  11.903  1.00 101.15 ?  1067 MET A CG     1 
ATOM   7744  S  SD     . MET A  1 1007 ? 17.398  77.534  10.954  1.00 108.70 ?  1067 MET A SD     1 
ATOM   7745  C  CE     . MET A  1 1007 ? 17.771  76.188  12.451  1.00 104.88 ?  1067 MET A CE     1 
ATOM   7746  N  N      . GLY A  1 1008 ? 13.686  79.422  14.546  1.00 90.58  ?  1068 GLY A N      1 
ATOM   7747  C  CA     . GLY A  1 1008 ? 12.263  79.702  14.498  1.00 88.92  ?  1068 GLY A CA     1 
ATOM   7748  C  C      . GLY A  1 1008 ? 11.952  81.060  15.070  1.00 90.93  ?  1068 GLY A C      1 
ATOM   7749  O  O      . GLY A  1 1008 ? 11.237  81.837  14.441  1.00 91.71  ?  1068 GLY A O      1 
ATOM   7750  N  N      . PHE A  1 1009 ? 12.522  81.384  16.237  1.00 86.10  ?  1069 PHE A N      1 
ATOM   7751  C  CA     . PHE A  1 1009 ? 12.260  82.694  16.843  1.00 84.94  ?  1069 PHE A CA     1 
ATOM   7752  C  C      . PHE A  1 1009 ? 12.728  83.855  15.973  1.00 85.66  ?  1069 PHE A C      1 
ATOM   7753  O  O      . PHE A  1 1009 ? 11.971  84.806  15.811  1.00 85.46  ?  1069 PHE A O      1 
ATOM   7754  C  CB     . PHE A  1 1009 ? 12.831  82.801  18.263  1.00 86.30  ?  1069 PHE A CB     1 
ATOM   7755  C  CG     . PHE A  1 1009 ? 12.210  81.913  19.315  1.00 88.43  ?  1069 PHE A CG     1 
ATOM   7756  C  CD1    . PHE A  1 1009 ? 11.156  81.055  18.999  1.00 92.53  ?  1069 PHE A CD1    1 
ATOM   7757  C  CD2    . PHE A  1 1009 ? 12.667  81.947  20.624  1.00 91.45  ?  1069 PHE A CD2    1 
ATOM   7758  C  CE1    . PHE A  1 1009 ? 10.574  80.250  19.976  1.00 94.76  ?  1069 PHE A CE1    1 
ATOM   7759  C  CE2    . PHE A  1 1009 ? 12.096  81.132  21.601  1.00 95.38  ?  1069 PHE A CE2    1 
ATOM   7760  C  CZ     . PHE A  1 1009 ? 11.064  80.276  21.268  1.00 94.53  ?  1069 PHE A CZ     1 
ATOM   7761  N  N      . ILE A  1 1010 ? 13.931  83.774  15.377  1.00 80.22  ?  1070 ILE A N      1 
ATOM   7762  C  CA     . ILE A  1 1010 ? 14.381  84.842  14.493  1.00 80.45  ?  1070 ILE A CA     1 
ATOM   7763  C  C      . ILE A  1 1010 ? 13.424  84.908  13.294  1.00 88.50  ?  1070 ILE A C      1 
ATOM   7764  O  O      . ILE A  1 1010 ? 13.072  86.008  12.849  1.00 90.62  ?  1070 ILE A O      1 
ATOM   7765  C  CB     . ILE A  1 1010 ? 15.836  84.658  14.070  1.00 83.18  ?  1070 ILE A CB     1 
ATOM   7766  C  CG1    . ILE A  1 1010 ? 16.784  84.773  15.254  1.00 82.26  ?  1070 ILE A CG1    1 
ATOM   7767  C  CG2    . ILE A  1 1010 ? 16.211  85.689  12.987  1.00 84.46  ?  1070 ILE A CG2    1 
ATOM   7768  C  CD1    . ILE A  1 1010 ? 18.179  84.219  14.957  1.00 91.99  ?  1070 ILE A CD1    1 
ATOM   7769  N  N      . GLY A  1 1011 ? 12.963  83.739  12.842  1.00 85.00  ?  1071 GLY A N      1 
ATOM   7770  C  CA     . GLY A  1 1011 ? 11.990  83.623  11.761  1.00 85.51  ?  1071 GLY A CA     1 
ATOM   7771  C  C      . GLY A  1 1011 ? 10.718  84.387  12.063  1.00 88.53  ?  1071 GLY A C      1 
ATOM   7772  O  O      . GLY A  1 1011 ? 10.204  85.106  11.189  1.00 89.26  ?  1071 GLY A O      1 
ATOM   7773  N  N      . HIS A  1 1012 ? 10.229  84.265  13.321  1.00 84.14  ?  1072 HIS A N      1 
ATOM   7774  C  CA     . HIS A  1 1012 ? 9.017   84.954  13.763  1.00 85.01  ?  1072 HIS A CA     1 
ATOM   7775  C  C      . HIS A  1 1012 ? 9.236   86.442  13.854  1.00 86.57  ?  1072 HIS A C      1 
ATOM   7776  O  O      . HIS A  1 1012 ? 8.352   87.212  13.505  1.00 85.14  ?  1072 HIS A O      1 
ATOM   7777  C  CB     . HIS A  1 1012 ? 8.505   84.406  15.098  1.00 86.55  ?  1072 HIS A CB     1 
ATOM   7778  C  CG     . HIS A  1 1012 ? 7.831   83.095  14.977  1.00 90.97  ?  1072 HIS A CG     1 
ATOM   7779  N  ND1    . HIS A  1 1012 ? 6.654   82.965  14.281  1.00 94.31  ?  1072 HIS A ND1    1 
ATOM   7780  C  CD2    . HIS A  1 1012 ? 8.217   81.889  15.450  1.00 93.44  ?  1072 HIS A CD2    1 
ATOM   7781  C  CE1    . HIS A  1 1012 ? 6.363   81.672  14.336  1.00 95.42  ?  1072 HIS A CE1    1 
ATOM   7782  N  NE2    . HIS A  1 1012 ? 7.281   80.989  15.032  1.00 94.98  ?  1072 HIS A NE2    1 
ATOM   7783  N  N      . TYR A  1 1013 ? 10.394  86.858  14.330  1.00 84.16  ?  1073 TYR A N      1 
ATOM   7784  C  CA     . TYR A  1 1013 ? 10.703  88.274  14.406  1.00 84.58  ?  1073 TYR A CA     1 
ATOM   7785  C  C      . TYR A  1 1013 ? 10.586  88.870  13.019  1.00 90.64  ?  1073 TYR A C      1 
ATOM   7786  O  O      . TYR A  1 1013 ? 9.857   89.847  12.848  1.00 90.75  ?  1073 TYR A O      1 
ATOM   7787  C  CB     . TYR A  1 1013 ? 12.106  88.506  14.990  1.00 85.40  ?  1073 TYR A CB     1 
ATOM   7788  C  CG     . TYR A  1 1013 ? 12.594  89.924  14.779  1.00 88.88  ?  1073 TYR A CG     1 
ATOM   7789  C  CD1    . TYR A  1 1013 ? 12.199  90.955  15.630  1.00 90.60  ?  1073 TYR A CD1    1 
ATOM   7790  C  CD2    . TYR A  1 1013 ? 13.424  90.241  13.709  1.00 90.26  ?  1073 TYR A CD2    1 
ATOM   7791  C  CE1    . TYR A  1 1013 ? 12.631  92.258  15.426  1.00 91.59  ?  1073 TYR A CE1    1 
ATOM   7792  C  CE2    . TYR A  1 1013 ? 13.852  91.539  13.491  1.00 91.30  ?  1073 TYR A CE2    1 
ATOM   7793  C  CZ     . TYR A  1 1013 ? 13.461  92.541  14.348  1.00 103.15 ?  1073 TYR A CZ     1 
ATOM   7794  O  OH     . TYR A  1 1013 ? 13.954  93.789  14.058  1.00 114.35 ?  1073 TYR A OH     1 
ATOM   7795  N  N      . LEU A  1 1014 ? 11.284  88.264  12.029  1.00 88.46  ?  1074 LEU A N      1 
ATOM   7796  C  CA     . LEU A  1 1014 ? 11.301  88.729  10.639  1.00 88.91  ?  1074 LEU A CA     1 
ATOM   7797  C  C      . LEU A  1 1014 ? 9.900   88.760  10.054  1.00 94.01  ?  1074 LEU A C      1 
ATOM   7798  O  O      . LEU A  1 1014 ? 9.496   89.753  9.448   1.00 92.40  ?  1074 LEU A O      1 
ATOM   7799  C  CB     . LEU A  1 1014 ? 12.253  87.881  9.782   1.00 88.78  ?  1074 LEU A CB     1 
ATOM   7800  C  CG     . LEU A  1 1014 ? 13.741  87.962  10.151  1.00 92.09  ?  1074 LEU A CG     1 
ATOM   7801  C  CD1    . LEU A  1 1014 ? 14.529  86.905  9.430   1.00 93.10  ?  1074 LEU A CD1    1 
ATOM   7802  C  CD2    . LEU A  1 1014 ? 14.319  89.329  9.849   1.00 92.27  ?  1074 LEU A CD2    1 
ATOM   7803  N  N      . ASP A  1 1015 ? 9.135   87.724  10.338  1.00 93.26  ?  1075 ASP A N      1 
ATOM   7804  C  CA     . ASP A  1 1015 ? 7.758   87.613  9.888   1.00 94.62  ?  1075 ASP A CA     1 
ATOM   7805  C  C      . ASP A  1 1015 ? 6.886   88.771  10.405  1.00 94.17  ?  1075 ASP A C      1 
ATOM   7806  O  O      . ASP A  1 1015 ? 6.153   89.364  9.625   1.00 93.55  ?  1075 ASP A O      1 
ATOM   7807  C  CB     . ASP A  1 1015 ? 7.191   86.261  10.376  1.00 97.98  ?  1075 ASP A CB     1 
ATOM   7808  C  CG     . ASP A  1 1015 ? 5.855   85.877  9.801   1.00 111.68 ?  1075 ASP A CG     1 
ATOM   7809  O  OD1    . ASP A  1 1015 ? 5.563   86.299  8.658   1.00 112.67 ?  1075 ASP A OD1    1 
ATOM   7810  O  OD2    . ASP A  1 1015 ? 5.107   85.130  10.491  1.00 116.85 -1 1075 ASP A OD2    1 
ATOM   7811  N  N      . GLN A  1 1016 ? 6.967   89.100  11.706  1.00 87.58  ?  1076 GLN A N      1 
ATOM   7812  C  CA     . GLN A  1 1016 ? 6.096   90.133  12.247  1.00 86.35  ?  1076 GLN A CA     1 
ATOM   7813  C  C      . GLN A  1 1016 ? 6.423   91.450  11.638  1.00 89.98  ?  1076 GLN A C      1 
ATOM   7814  O  O      . GLN A  1 1016 ? 5.515   92.252  11.404  1.00 92.68  ?  1076 GLN A O      1 
ATOM   7815  C  CB     . GLN A  1 1016 ? 6.179   90.189  13.770  1.00 86.32  ?  1076 GLN A CB     1 
ATOM   7816  C  CG     . GLN A  1 1016 ? 5.680   88.945  14.468  1.00 88.88  ?  1076 GLN A CG     1 
ATOM   7817  C  CD     . GLN A  1 1016 ? 4.247   88.628  14.121  1.00 110.46 ?  1076 GLN A CD     1 
ATOM   7818  O  OE1    . GLN A  1 1016 ? 3.328   89.433  14.286  1.00 109.43 ?  1076 GLN A OE1    1 
ATOM   7819  N  NE2    . GLN A  1 1016 ? 4.017   87.414  13.673  1.00 101.40 ?  1076 GLN A NE2    1 
ATOM   7820  N  N      . LYS A  1 1017 ? 7.727   91.672  11.376  1.00 83.03  ?  1077 LYS A N      1 
ATOM   7821  C  CA     . LYS A  1 1017 ? 8.208   92.907  10.803  1.00 82.66  ?  1077 LYS A CA     1 
ATOM   7822  C  C      . LYS A  1 1017 ? 7.707   93.017  9.345   1.00 91.14  ?  1077 LYS A C      1 
ATOM   7823  O  O      . LYS A  1 1017 ? 7.165   94.065  8.939   1.00 93.56  ?  1077 LYS A O      1 
ATOM   7824  C  CB     . LYS A  1 1017 ? 9.748   92.993  10.892  1.00 81.98  ?  1077 LYS A CB     1 
ATOM   7825  C  CG     . LYS A  1 1017 ? 10.297  93.270  12.266  1.00 81.12  ?  1077 LYS A CG     1 
ATOM   7826  C  CD     . LYS A  1 1017 ? 10.639  94.747  12.414  1.00 94.29  ?  1077 LYS A CD     1 
ATOM   7827  C  CE     . LYS A  1 1017 ? 11.226  95.188  13.758  1.00 107.72 ?  1077 LYS A CE     1 
ATOM   7828  N  NZ     . LYS A  1 1017 ? 10.281  95.196  14.918  1.00 103.61 1  1077 LYS A NZ     1 
ATOM   7829  N  N      . ARG A  1 1018 ? 7.841   91.925  8.575   1.00 86.13  ?  1078 ARG A N      1 
ATOM   7830  C  CA     . ARG A  1 1018 ? 7.450   91.923  7.177   1.00 85.61  ?  1078 ARG A CA     1 
ATOM   7831  C  C      . ARG A  1 1018 ? 5.925   92.035  7.074   1.00 88.38  ?  1078 ARG A C      1 
ATOM   7832  O  O      . ARG A  1 1018 ? 5.473   92.805  6.230   1.00 89.78  ?  1078 ARG A O      1 
ATOM   7833  C  CB     . ARG A  1 1018 ? 8.066   90.698  6.485   1.00 86.64  ?  1078 ARG A CB     1 
ATOM   7834  C  CG     . ARG A  1 1018 ? 8.168   90.688  4.938   1.00 107.42 ?  1078 ARG A CG     1 
ATOM   7835  C  CD     . ARG A  1 1018 ? 8.104   89.265  4.344   1.00 128.96 ?  1078 ARG A CD     1 
ATOM   7836  N  NE     . ARG A  1 1018 ? 8.801   88.281  5.193   1.00 157.72 ?  1078 ARG A NE     1 
ATOM   7837  C  CZ     . ARG A  1 1018 ? 8.212   87.368  5.973   1.00 177.61 ?  1078 ARG A CZ     1 
ATOM   7838  N  NH1    . ARG A  1 1018 ? 6.885   87.277  6.019   1.00 159.49 1  1078 ARG A NH1    1 
ATOM   7839  N  NH2    . ARG A  1 1018 ? 8.951   86.548  6.726   1.00 164.24 ?  1078 ARG A NH2    1 
ATOM   7840  N  N      . LEU A  1 1019 ? 5.155   91.410  8.034   1.00 83.54  ?  1079 LEU A N      1 
ATOM   7841  C  CA     . LEU A  1 1019 ? 3.682   91.448  8.124   1.00 84.84  ?  1079 LEU A CA     1 
ATOM   7842  C  C      . LEU A  1 1019 ? 3.177   92.773  8.657   1.00 95.03  ?  1079 LEU A C      1 
ATOM   7843  O  O      . LEU A  1 1019 ? 1.967   92.958  8.780   1.00 97.21  ?  1079 LEU A O      1 
ATOM   7844  C  CB     . LEU A  1 1019 ? 3.089   90.311  8.980   1.00 84.39  ?  1079 LEU A CB     1 
ATOM   7845  C  CG     . LEU A  1 1019 ? 3.135   88.886  8.448   1.00 90.53  ?  1079 LEU A CG     1 
ATOM   7846  C  CD1    . LEU A  1 1019 ? 2.725   87.894  9.493   1.00 89.15  ?  1079 LEU A CD1    1 
ATOM   7847  C  CD2    . LEU A  1 1019 ? 2.206   88.709  7.303   1.00 99.92  ?  1079 LEU A CD2    1 
ATOM   7848  N  N      . LYS A  1 1020 ? 4.095   93.707  8.959   1.00 94.07  ?  1080 LYS A N      1 
ATOM   7849  C  CA     . LYS A  1 1020 ? 3.812   95.070  9.447   1.00 94.67  ?  1080 LYS A CA     1 
ATOM   7850  C  C      . LYS A  1 1020 ? 2.792   95.079  10.620  1.00 98.36  ?  1080 LYS A C      1 
ATOM   7851  O  O      . LYS A  1 1020 ? 1.780   95.799  10.612  1.00 97.02  ?  1080 LYS A O      1 
ATOM   7852  C  CB     . LYS A  1 1020 ? 3.404   95.975  8.268   1.00 98.26  ?  1080 LYS A CB     1 
ATOM   7853  C  CG     . LYS A  1 1020 ? 4.458   95.969  7.158   1.00 115.31 ?  1080 LYS A CG     1 
ATOM   7854  C  CD     . LYS A  1 1020 ? 4.561   97.280  6.408   1.00 133.71 ?  1080 LYS A CD     1 
ATOM   7855  C  CE     . LYS A  1 1020 ? 5.220   97.110  5.055   1.00 150.60 ?  1080 LYS A CE     1 
ATOM   7856  N  NZ     . LYS A  1 1020 ? 6.447   96.253  5.103   1.00 161.05 1  1080 LYS A NZ     1 
ATOM   7857  N  N      . GLN A  1 1021 ? 3.086   94.235  11.620  1.00 94.91  ?  1081 GLN A N      1 
ATOM   7858  C  CA     . GLN A  1 1021 ? 2.224   94.049  12.769  1.00 94.61  ?  1081 GLN A CA     1 
ATOM   7859  C  C      . GLN A  1 1021 ? 2.448   95.106  13.791  1.00 99.41  ?  1081 GLN A C      1 
ATOM   7860  O  O      . GLN A  1 1021 ? 3.611   95.393  14.122  1.00 98.57  ?  1081 GLN A O      1 
ATOM   7861  C  CB     . GLN A  1 1021 ? 2.395   92.648  13.333  1.00 94.99  ?  1081 GLN A CB     1 
ATOM   7862  C  CG     . GLN A  1 1021 ? 1.981   91.591  12.332  1.00 111.48 ?  1081 GLN A CG     1 
ATOM   7863  C  CD     . GLN A  1 1021 ? 0.484   91.558  12.169  1.00 122.27 ?  1081 GLN A CD     1 
ATOM   7864  O  OE1    . GLN A  1 1021 ? -0.231  90.994  13.013  1.00 108.74 ?  1081 GLN A OE1    1 
ATOM   7865  N  NE2    . GLN A  1 1021 ? -0.013  92.133  11.075  1.00 119.94 ?  1081 GLN A NE2    1 
ATOM   7866  N  N      . GLY A  1 1022 ? 1.329   95.701  14.231  1.00 96.64  ?  1082 GLY A N      1 
ATOM   7867  C  CA     . GLY A  1 1022 ? 1.261   96.779  15.212  1.00 96.08  ?  1082 GLY A CA     1 
ATOM   7868  C  C      . GLY A  1 1022 ? 1.399   96.365  16.656  1.00 99.25  ?  1082 GLY A C      1 
ATOM   7869  O  O      . GLY A  1 1022 ? 1.384   95.171  16.978  1.00 100.43 ?  1082 GLY A O      1 
ATOM   7870  N  N      . LEU A  1 1023 ? 1.522   97.355  17.540  1.00 93.60  ?  1083 LEU A N      1 
ATOM   7871  C  CA     . LEU A  1 1023 ? 1.693   97.086  18.969  1.00 92.07  ?  1083 LEU A CA     1 
ATOM   7872  C  C      . LEU A  1 1023 ? 0.603   96.191  19.550  1.00 97.50  ?  1083 LEU A C      1 
ATOM   7873  O  O      . LEU A  1 1023 ? -0.575  96.472  19.332  1.00 98.94  ?  1083 LEU A O      1 
ATOM   7874  C  CB     . LEU A  1 1023 ? 1.811   98.396  19.764  1.00 91.02  ?  1083 LEU A CB     1 
ATOM   7875  C  CG     . LEU A  1 1023 ? 1.907   98.297  21.282  1.00 93.66  ?  1083 LEU A CG     1 
ATOM   7876  C  CD1    . LEU A  1 1023 ? 3.165   97.634  21.718  1.00 92.99  ?  1083 LEU A CD1    1 
ATOM   7877  C  CD2    . LEU A  1 1023 ? 1.938   99.626  21.877  1.00 95.39  ?  1083 LEU A CD2    1 
ATOM   7878  N  N      . TYR A  1 1024 ? 0.990   95.132  20.288  1.00 92.68  ?  1084 TYR A N      1 
ATOM   7879  C  CA     . TYR A  1 1024 ? -0.005  94.284  20.918  1.00 93.20  ?  1084 TYR A CA     1 
ATOM   7880  C  C      . TYR A  1 1024 ? -0.330  94.737  22.351  1.00 98.50  ?  1084 TYR A C      1 
ATOM   7881  O  O      . TYR A  1 1024 ? 0.544   95.167  23.114  1.00 98.65  ?  1084 TYR A O      1 
ATOM   7882  C  CB     . TYR A  1 1024 ? 0.450   92.819  20.921  1.00 94.02  ?  1084 TYR A CB     1 
ATOM   7883  C  CG     . TYR A  1 1024 ? -0.579  91.842  21.472  1.00 94.83  ?  1084 TYR A CG     1 
ATOM   7884  C  CD1    . TYR A  1 1024 ? -1.697  91.496  20.737  1.00 98.08  ?  1084 TYR A CD1    1 
ATOM   7885  C  CD2    . TYR A  1 1024 ? -0.434  91.281  22.733  1.00 94.36  ?  1084 TYR A CD2    1 
ATOM   7886  C  CE1    . TYR A  1 1024 ? -2.654  90.616  21.246  1.00 100.60 ?  1084 TYR A CE1    1 
ATOM   7887  C  CE2    . TYR A  1 1024 ? -1.366  90.379  23.241  1.00 95.62  ?  1084 TYR A CE2    1 
ATOM   7888  C  CZ     . TYR A  1 1024 ? -2.483  90.051  22.499  1.00 106.00 ?  1084 TYR A CZ     1 
ATOM   7889  O  OH     . TYR A  1 1024 ? -3.429  89.172  22.996  1.00 110.14 ?  1084 TYR A OH     1 
ATOM   7890  N  N      . ARG A  1 1025 ? -1.583  94.601  22.724  1.00 96.19  ?  1085 ARG A N      1 
ATOM   7891  C  CA     . ARG A  1 1025 ? -2.053  94.832  24.084  1.00 96.97  ?  1085 ARG A CA     1 
ATOM   7892  C  C      . ARG A  1 1025 ? -3.053  93.713  24.313  1.00 104.53 ?  1085 ARG A C      1 
ATOM   7893  O  O      . ARG A  1 1025 ? -3.962  93.509  23.488  1.00 108.12 ?  1085 ARG A O      1 
ATOM   7894  C  CB     . ARG A  1 1025 ? -2.711  96.206  24.249  1.00 98.43  ?  1085 ARG A CB     1 
ATOM   7895  C  CG     . ARG A  1 1025 ? -3.078  96.565  25.675  1.00 113.60 ?  1085 ARG A CG     1 
ATOM   7896  C  CD     . ARG A  1 1025 ? -3.608  97.995  25.799  1.00 137.78 ?  1085 ARG A CD     1 
ATOM   7897  N  NE     . ARG A  1 1025 ? -3.359  98.549  27.133  1.00 155.53 ?  1085 ARG A NE     1 
ATOM   7898  C  CZ     . ARG A  1 1025 ? -4.130  98.338  28.197  1.00 166.91 ?  1085 ARG A CZ     1 
ATOM   7899  N  NH1    . ARG A  1 1025 ? -5.233  97.593  28.094  1.00 146.50 1  1085 ARG A NH1    1 
ATOM   7900  N  NH2    . ARG A  1 1025 ? -3.806  98.866  29.373  1.00 149.68 ?  1085 ARG A NH2    1 
ATOM   7901  N  N      . HIS A  1 1026 ? -2.858  92.948  25.390  1.00 98.19  ?  1086 HIS A N      1 
ATOM   7902  C  CA     . HIS A  1 1026 ? -3.734  91.832  25.701  1.00 96.77  ?  1086 HIS A CA     1 
ATOM   7903  C  C      . HIS A  1 1026 ? -5.156  92.287  26.078  1.00 102.28 ?  1086 HIS A C      1 
ATOM   7904  O  O      . HIS A  1 1026 ? -5.305  93.263  26.828  1.00 103.38 ?  1086 HIS A O      1 
ATOM   7905  C  CB     . HIS A  1 1026 ? -3.125  90.956  26.789  1.00 95.47  ?  1086 HIS A CB     1 
ATOM   7906  C  CG     . HIS A  1 1026 ? -3.668  89.579  26.749  1.00 98.17  ?  1086 HIS A CG     1 
ATOM   7907  N  ND1    . HIS A  1 1026 ? -3.276  88.692  25.780  1.00 99.33  ?  1086 HIS A ND1    1 
ATOM   7908  C  CD2    . HIS A  1 1026 ? -4.627  89.007  27.513  1.00 99.62  ?  1086 HIS A CD2    1 
ATOM   7909  C  CE1    . HIS A  1 1026 ? -3.964  87.591  26.017  1.00 99.08  ?  1086 HIS A CE1    1 
ATOM   7910  N  NE2    . HIS A  1 1026 ? -4.794  87.741  27.049  1.00 99.49  ?  1086 HIS A NE2    1 
ATOM   7911  N  N      . PRO A  1 1027 ? -6.204  91.624  25.532  1.00 99.21  ?  1087 PRO A N      1 
ATOM   7912  C  CA     . PRO A  1 1027 ? -7.582  92.040  25.835  1.00 101.44 ?  1087 PRO A CA     1 
ATOM   7913  C  C      . PRO A  1 1027 ? -8.007  91.825  27.279  1.00 109.16 ?  1087 PRO A C      1 
ATOM   7914  O  O      . PRO A  1 1027 ? -7.716  90.793  27.880  1.00 110.00 ?  1087 PRO A O      1 
ATOM   7915  C  CB     . PRO A  1 1027 ? -8.431  91.218  24.872  1.00 103.87 ?  1087 PRO A CB     1 
ATOM   7916  C  CG     . PRO A  1 1027 ? -7.620  90.059  24.573  1.00 107.90 ?  1087 PRO A CG     1 
ATOM   7917  C  CD     . PRO A  1 1027 ? -6.194  90.489  24.599  1.00 101.40 ?  1087 PRO A CD     1 
ATOM   7918  N  N      . TRP A  1 1028 ? -8.717  92.801  27.819  1.00 107.34 ?  1088 TRP A N      1 
ATOM   7919  C  CA     . TRP A  1 1028 ? -9.157  92.763  29.194  1.00 108.76 ?  1088 TRP A CA     1 
ATOM   7920  C  C      . TRP A  1 1028 ? -10.077 91.627  29.513  1.00 111.06 ?  1088 TRP A C      1 
ATOM   7921  O  O      . TRP A  1 1028 ? -10.080 91.158  30.652  1.00 109.10 ?  1088 TRP A O      1 
ATOM   7922  C  CB     . TRP A  1 1028 ? -9.804  94.106  29.555  1.00 110.21 ?  1088 TRP A CB     1 
ATOM   7923  C  CG     . TRP A  1 1028 ? -8.827  95.211  29.848  1.00 110.74 ?  1088 TRP A CG     1 
ATOM   7924  C  CD1    . TRP A  1 1028 ? -7.601  95.081  30.425  1.00 112.46 ?  1088 TRP A CD1    1 
ATOM   7925  C  CD2    . TRP A  1 1028 ? -9.037  96.613  29.671  1.00 110.93 ?  1088 TRP A CD2    1 
ATOM   7926  N  NE1    . TRP A  1 1028 ? -7.033  96.310  30.615  1.00 111.89 ?  1088 TRP A NE1    1 
ATOM   7927  C  CE2    . TRP A  1 1028 ? -7.882  97.270  30.139  1.00 114.27 ?  1088 TRP A CE2    1 
ATOM   7928  C  CE3    . TRP A  1 1028 ? -10.052 97.375  29.093  1.00 113.50 ?  1088 TRP A CE3    1 
ATOM   7929  C  CZ2    . TRP A  1 1028 ? -7.745  98.656  30.106  1.00 113.74 ?  1088 TRP A CZ2    1 
ATOM   7930  C  CZ3    . TRP A  1 1028 ? -9.905  98.746  29.044  1.00 115.38 ?  1088 TRP A CZ3    1 
ATOM   7931  C  CH2    . TRP A  1 1028 ? -8.768  99.373  29.556  1.00 114.85 ?  1088 TRP A CH2    1 
ATOM   7932  N  N      . ASP A  1 1029 ? -10.837 91.160  28.516  1.00 110.41 ?  1089 ASP A N      1 
ATOM   7933  C  CA     . ASP A  1 1029 ? -11.784 90.066  28.752  1.00 113.20 ?  1089 ASP A CA     1 
ATOM   7934  C  C      . ASP A  1 1029 ? -11.089 88.705  28.941  1.00 112.16 ?  1089 ASP A C      1 
ATOM   7935  O  O      . ASP A  1 1029 ? -11.750 87.719  29.295  1.00 116.01 ?  1089 ASP A O      1 
ATOM   7936  C  CB     . ASP A  1 1029 ? -12.910 90.013  27.686  1.00 119.24 ?  1089 ASP A CB     1 
ATOM   7937  C  CG     . ASP A  1 1029 ? -12.484 89.522  26.321  1.00 148.27 ?  1089 ASP A CG     1 
ATOM   7938  O  OD1    . ASP A  1 1029 ? -12.438 88.270  26.123  1.00 151.69 -1 1089 ASP A OD1    1 
ATOM   7939  O  OD2    . ASP A  1 1029 ? -12.271 90.378  25.422  1.00 159.89 -1 1089 ASP A OD2    1 
ATOM   7940  N  N      . ASP A  1 1030 ? -9.776  88.650  28.725  1.00 99.78  ?  1090 ASP A N      1 
ATOM   7941  C  CA     . ASP A  1 1030 ? -9.035  87.424  28.934  1.00 96.66  ?  1090 ASP A CA     1 
ATOM   7942  C  C      . ASP A  1 1030 ? -8.236  87.498  30.240  1.00 96.36  ?  1090 ASP A C      1 
ATOM   7943  O  O      . ASP A  1 1030 ? -7.388  86.636  30.515  1.00 97.49  ?  1090 ASP A O      1 
ATOM   7944  C  CB     . ASP A  1 1030 ? -8.107  87.148  27.755  1.00 98.04  ?  1090 ASP A CB     1 
ATOM   7945  C  CG     . ASP A  1 1030 ? -7.599  85.720  27.737  1.00 118.23 ?  1090 ASP A CG     1 
ATOM   7946  O  OD1    . ASP A  1 1030 ? -8.425  84.795  27.957  1.00 124.40 ?  1090 ASP A OD1    1 
ATOM   7947  O  OD2    . ASP A  1 1030 ? -6.367  85.520  27.519  1.00 117.52 -1 1090 ASP A OD2    1 
ATOM   7948  N  N      . ILE A  1 1031 ? -8.502  88.528  31.059  1.00 86.98  ?  1091 ILE A N      1 
ATOM   7949  C  CA     . ILE A  1 1031 ? -7.760  88.743  32.302  1.00 82.05  ?  1091 ILE A CA     1 
ATOM   7950  C  C      . ILE A  1 1031 ? -8.728  88.828  33.458  1.00 86.93  ?  1091 ILE A C      1 
ATOM   7951  O  O      . ILE A  1 1031 ? -9.632  89.686  33.443  1.00 87.98  ?  1091 ILE A O      1 
ATOM   7952  C  CB     . ILE A  1 1031 ? -6.866  90.034  32.211  1.00 81.21  ?  1091 ILE A CB     1 
ATOM   7953  C  CG1    . ILE A  1 1031 ? -6.038  90.071  30.924  1.00 78.65  ?  1091 ILE A CG1    1 
ATOM   7954  C  CG2    . ILE A  1 1031 ? -5.978  90.193  33.467  1.00 79.62  ?  1091 ILE A CG2    1 
ATOM   7955  C  CD1    . ILE A  1 1031 ? -5.435  91.337  30.594  1.00 82.67  ?  1091 ILE A CD1    1 
ATOM   7956  N  N      . SER A  1 1032 ? -8.505  87.996  34.485  1.00 84.03  ?  1092 SER A N      1 
ATOM   7957  C  CA     . SER A  1 1032 ? -9.306  88.015  35.700  1.00 86.87  ?  1092 SER A CA     1 
ATOM   7958  C  C      . SER A  1 1032 ? -8.638  88.938  36.709  1.00 95.58  ?  1092 SER A C      1 
ATOM   7959  O  O      . SER A  1 1032 ? -7.578  88.560  37.216  1.00 96.31  ?  1092 SER A O      1 
ATOM   7960  C  CB     . SER A  1 1032 ? -9.436  86.613  36.286  1.00 91.66  ?  1092 SER A CB     1 
ATOM   7961  O  OG     . SER A  1 1032 ? -10.157 85.716  35.445  1.00 108.24 ?  1092 SER A OG     1 
ATOM   7962  N  N      . TYR A  1 1033 ? -9.221  90.148  36.988  1.00 93.36  ?  1093 TYR A N      1 
ATOM   7963  C  CA     . TYR A  1 1033 ? -8.610  91.076  37.947  1.00 92.45  ?  1093 TYR A CA     1 
ATOM   7964  C  C      . TYR A  1 1033 ? -9.194  90.809  39.309  1.00 100.13 ?  1093 TYR A C      1 
ATOM   7965  O  O      . TYR A  1 1033 ? -10.350 91.128  39.552  1.00 101.10 ?  1093 TYR A O      1 
ATOM   7966  C  CB     . TYR A  1 1033 ? -8.861  92.517  37.558  1.00 92.96  ?  1093 TYR A CB     1 
ATOM   7967  C  CG     . TYR A  1 1033 ? -8.064  93.066  36.396  1.00 91.98  ?  1093 TYR A CG     1 
ATOM   7968  C  CD1    . TYR A  1 1033 ? -8.336  92.667  35.089  1.00 93.14  ?  1093 TYR A CD1    1 
ATOM   7969  C  CD2    . TYR A  1 1033 ? -7.223  94.154  36.568  1.00 91.70  ?  1093 TYR A CD2    1 
ATOM   7970  C  CE1    . TYR A  1 1033 ? -7.700  93.256  34.002  1.00 90.42  ?  1093 TYR A CE1    1 
ATOM   7971  C  CE2    . TYR A  1 1033 ? -6.589  94.762  35.487  1.00 91.77  ?  1093 TYR A CE2    1 
ATOM   7972  C  CZ     . TYR A  1 1033 ? -6.817  94.298  34.205  1.00 96.22  ?  1093 TYR A CZ     1 
ATOM   7973  O  OH     . TYR A  1 1033 ? -6.167  94.860  33.133  1.00 94.16  ?  1093 TYR A OH     1 
ATOM   7974  N  N      . VAL A  1 1034 ? -8.397  90.201  40.193  1.00 99.21  ?  1094 VAL A N      1 
ATOM   7975  C  CA     . VAL A  1 1034 ? -8.784  89.817  41.547  1.00 101.20 ?  1094 VAL A CA     1 
ATOM   7976  C  C      . VAL A  1 1034 ? -8.007  90.612  42.586  1.00 109.51 ?  1094 VAL A C      1 
ATOM   7977  O  O      . VAL A  1 1034 ? -7.254  90.048  43.388  1.00 109.02 ?  1094 VAL A O      1 
ATOM   7978  C  CB     . VAL A  1 1034 ? -8.685  88.296  41.793  1.00 104.95 ?  1094 VAL A CB     1 
ATOM   7979  C  CG1    . VAL A  1 1034 ? -8.982  87.986  43.249  1.00 107.17 ?  1094 VAL A CG1    1 
ATOM   7980  C  CG2    . VAL A  1 1034 ? -9.575  87.472  40.858  1.00 103.61 ?  1094 VAL A CG2    1 
ATOM   7981  N  N      . LEU A  1 1035 ? -8.182  91.937  42.549  1.00 109.31 ?  1095 LEU A N      1 
ATOM   7982  C  CA     . LEU A  1 1035 ? -7.487  92.880  43.423  1.00 108.92 ?  1095 LEU A CA     1 
ATOM   7983  C  C      . LEU A  1 1035 ? -8.144  92.971  44.821  1.00 115.58 ?  1095 LEU A C      1 
ATOM   7984  O  O      . LEU A  1 1035 ? -9.351  92.685  44.956  1.00 115.64 ?  1095 LEU A O      1 
ATOM   7985  C  CB     . LEU A  1 1035 ? -7.434  94.288  42.752  1.00 108.24 ?  1095 LEU A CB     1 
ATOM   7986  C  CG     . LEU A  1 1035 ? -6.205  94.626  41.928  1.00 109.81 ?  1095 LEU A CG     1 
ATOM   7987  C  CD1    . LEU A  1 1035 ? -6.269  93.988  40.551  1.00 109.28 ?  1095 LEU A CD1    1 
ATOM   7988  C  CD2    . LEU A  1 1035 ? -6.049  96.114  41.809  1.00 111.09 ?  1095 LEU A CD2    1 
ATOM   7989  N  N      . PRO A  1 1036 ? -7.349  93.434  45.844  1.00 113.02 ?  1096 PRO A N      1 
ATOM   7990  C  CA     . PRO A  1 1036 ? -7.893  93.665  47.197  1.00 114.09 ?  1096 PRO A CA     1 
ATOM   7991  C  C      . PRO A  1 1036 ? -8.967  94.761  47.239  1.00 121.37 ?  1096 PRO A C      1 
ATOM   7992  O  O      . PRO A  1 1036 ? -9.225  95.434  46.239  1.00 121.70 ?  1096 PRO A O      1 
ATOM   7993  C  CB     . PRO A  1 1036 ? -6.665  94.119  47.993  1.00 114.68 ?  1096 PRO A CB     1 
ATOM   7994  C  CG     . PRO A  1 1036 ? -5.492  93.656  47.202  1.00 117.57 ?  1096 PRO A CG     1 
ATOM   7995  C  CD     . PRO A  1 1036 ? -5.914  93.790  45.800  1.00 113.08 ?  1096 PRO A CD     1 
ATOM   7996  N  N      . GLU A  1 1037 ? -9.553  95.016  48.416  1.00 119.24 ?  1097 GLU A N      1 
ATOM   7997  C  CA     . GLU A  1 1037 ? -10.671 95.953  48.467  1.00 140.33 ?  1097 GLU A CA     1 
ATOM   7998  C  C      . GLU A  1 1037 ? -10.358 97.328  49.058  1.00 154.47 ?  1097 GLU A C      1 
ATOM   7999  O  O      . GLU A  1 1037 ? -10.787 98.340  48.481  1.00 107.61 ?  1097 GLU A O      1 
ATOM   8000  C  CB     . GLU A  1 1037 ? -11.851 95.293  49.178  1.00 143.33 ?  1097 GLU A CB     1 
ATOM   8001  C  CG     . GLU A  1 1037 ? -12.271 93.990  48.497  1.00 154.76 ?  1097 GLU A CG     1 
ATOM   8002  C  CD     . GLU A  1 1037 ? -13.731 93.595  48.594  1.00 188.39 ?  1097 GLU A CD     1 
ATOM   8003  O  OE1    . GLU A  1 1037 ? -14.267 93.054  47.598  1.00 179.98 ?  1097 GLU A OE1    1 
ATOM   8004  O  OE2    . GLU A  1 1037 ? -14.335 93.802  49.673  1.00 192.51 -1 1097 GLU A OE2    1 
ATOM   8005  N  N      . SER B  1 2    ? -14.590 40.683  31.450  1.00 125.38 ?  2    SER B N      1 
ATOM   8006  C  CA     . SER B  1 2    ? -15.514 39.577  31.588  1.00 125.75 ?  2    SER B CA     1 
ATOM   8007  C  C      . SER B  1 2    ? -14.759 38.282  31.821  1.00 125.84 ?  2    SER B C      1 
ATOM   8008  O  O      . SER B  1 2    ? -13.573 38.180  31.494  1.00 122.80 ?  2    SER B O      1 
ATOM   8009  C  CB     . SER B  1 2    ? -16.369 39.451  30.331  1.00 132.43 ?  2    SER B CB     1 
ATOM   8010  O  OG     . SER B  1 2    ? -15.548 39.161  29.213  1.00 143.23 ?  2    SER B OG     1 
ATOM   8011  N  N      . ALA B  1 3    ? -15.465 37.282  32.376  1.00 122.33 ?  3    ALA B N      1 
ATOM   8012  C  CA     . ALA B  1 3    ? -14.922 35.943  32.591  1.00 120.23 ?  3    ALA B CA     1 
ATOM   8013  C  C      . ALA B  1 3    ? -14.957 35.240  31.230  1.00 120.70 ?  3    ALA B C      1 
ATOM   8014  O  O      . ALA B  1 3    ? -15.984 35.240  30.522  1.00 120.76 ?  3    ALA B O      1 
ATOM   8015  C  CB     . ALA B  1 3    ? -15.744 35.176  33.618  1.00 122.03 ?  3    ALA B CB     1 
ATOM   8016  N  N      . LYS B  1 4    ? -13.793 34.727  30.832  1.00 113.88 ?  4    LYS B N      1 
ATOM   8017  C  CA     . LYS B  1 4    ? -13.622 34.073  29.544  1.00 112.92 ?  4    LYS B CA     1 
ATOM   8018  C  C      . LYS B  1 4    ? -13.114 32.662  29.718  1.00 114.83 ?  4    LYS B C      1 
ATOM   8019  O  O      . LYS B  1 4    ? -12.243 32.406  30.555  1.00 112.94 ?  4    LYS B O      1 
ATOM   8020  C  CB     . LYS B  1 4    ? -12.668 34.870  28.647  1.00 114.19 ?  4    LYS B CB     1 
ATOM   8021  C  CG     . LYS B  1 4    ? -13.208 36.215  28.174  1.00 120.98 ?  4    LYS B CG     1 
ATOM   8022  C  CD     . LYS B  1 4    ? -12.299 36.806  27.111  1.00 121.54 ?  4    LYS B CD     1 
ATOM   8023  C  CE     . LYS B  1 4    ? -12.571 38.259  26.811  1.00 119.78 ?  4    LYS B CE     1 
ATOM   8024  N  NZ     . LYS B  1 4    ? -11.795 38.725  25.628  1.00 112.76 1  4    LYS B NZ     1 
ATOM   8025  N  N      . ALA B  1 5    ? -13.647 31.745  28.909  1.00 111.61 ?  5    ALA B N      1 
ATOM   8026  C  CA     . ALA B  1 5    ? -13.235 30.354  28.955  1.00 111.07 ?  5    ALA B CA     1 
ATOM   8027  C  C      . ALA B  1 5    ? -11.908 30.193  28.277  1.00 112.90 ?  5    ALA B C      1 
ATOM   8028  O  O      . ALA B  1 5    ? -11.629 30.874  27.282  1.00 112.25 ?  5    ALA B O      1 
ATOM   8029  C  CB     . ALA B  1 5    ? -14.258 29.483  28.260  1.00 114.52 ?  5    ALA B CB     1 
ATOM   8030  N  N      . ILE B  1 6    ? -11.096 29.270  28.820  1.00 109.55 ?  6    ILE B N      1 
ATOM   8031  C  CA     . ILE B  1 6    ? -9.770  28.883  28.314  1.00 109.75 ?  6    ILE B CA     1 
ATOM   8032  C  C      . ILE B  1 6    ? -9.779  27.409  27.943  1.00 115.36 ?  6    ILE B C      1 
ATOM   8033  O  O      . ILE B  1 6    ? -10.591 26.656  28.504  1.00 115.26 ?  6    ILE B O      1 
ATOM   8034  C  CB     . ILE B  1 6    ? -8.628  29.219  29.324  1.00 111.94 ?  6    ILE B CB     1 
ATOM   8035  C  CG1    . ILE B  1 6    ? -8.818  28.528  30.707  1.00 111.64 ?  6    ILE B CG1    1 
ATOM   8036  C  CG2    . ILE B  1 6    ? -8.450  30.742  29.466  1.00 112.60 ?  6    ILE B CG2    1 
ATOM   8037  C  CD1    . ILE B  1 6    ? -7.553  28.396  31.533  1.00 113.34 ?  6    ILE B CD1    1 
ATOM   8038  N  N      . SER B  1 7    ? -8.885  26.988  27.004  1.00 113.88 ?  7    SER B N      1 
ATOM   8039  C  CA     . SER B  1 7    ? -8.775  25.566  26.591  1.00 115.73 ?  7    SER B CA     1 
ATOM   8040  C  C      . SER B  1 7    ? -8.256  24.626  27.739  1.00 117.99 ?  7    SER B C      1 
ATOM   8041  O  O      . SER B  1 7    ? -7.618  25.081  28.695  1.00 116.33 ?  7    SER B O      1 
ATOM   8042  C  CB     . SER B  1 7    ? -7.940  25.418  25.314  1.00 120.97 ?  7    SER B CB     1 
ATOM   8043  O  OG     . SER B  1 7    ? -6.545  25.607  25.502  1.00 128.55 ?  7    SER B OG     1 
ATOM   8044  N  N      . GLU B  1 8    ? -8.558  23.326  27.650  1.00 115.29 ?  8    GLU B N      1 
ATOM   8045  C  CA     . GLU B  1 8    ? -8.144  22.302  28.626  1.00 115.12 ?  8    GLU B CA     1 
ATOM   8046  C  C      . GLU B  1 8    ? -6.614  22.345  28.764  1.00 120.07 ?  8    GLU B C      1 
ATOM   8047  O  O      . GLU B  1 8    ? -6.092  22.312  29.877  1.00 119.55 ?  8    GLU B O      1 
ATOM   8048  C  CB     . GLU B  1 8    ? -8.638  20.906  28.166  1.00 118.41 ?  8    GLU B CB     1 
ATOM   8049  C  CG     . GLU B  1 8    ? -8.423  19.771  29.148  1.00 126.76 ?  8    GLU B CG     1 
ATOM   8050  C  CD     . GLU B  1 8    ? -9.412  18.629  29.010  1.00 153.28 ?  8    GLU B CD     1 
ATOM   8051  O  OE1    . GLU B  1 8    ? -10.629 18.900  29.108  1.00 166.47 ?  8    GLU B OE1    1 
ATOM   8052  O  OE2    . GLU B  1 8    ? -8.980  17.462  28.852  1.00 138.87 -1 8    GLU B OE2    1 
ATOM   8053  N  N      . GLN B  1 9    ? -5.919  22.503  27.624  1.00 117.72 ?  9    GLN B N      1 
ATOM   8054  C  CA     . GLN B  1 9    ? -4.475  22.606  27.514  1.00 117.99 ?  9    GLN B CA     1 
ATOM   8055  C  C      . GLN B  1 9    ? -3.976  23.844  28.233  1.00 117.43 ?  9    GLN B C      1 
ATOM   8056  O  O      . GLN B  1 9    ? -3.111  23.712  29.089  1.00 118.55 ?  9    GLN B O      1 
ATOM   8057  C  CB     . GLN B  1 9    ? -4.079  22.636  26.040  1.00 121.70 ?  9    GLN B CB     1 
ATOM   8058  C  CG     . GLN B  1 9    ? -2.617  22.343  25.787  1.00 141.15 ?  9    GLN B CG     1 
ATOM   8059  C  CD     . GLN B  1 9    ? -2.299  22.763  24.385  1.00 155.88 ?  9    GLN B CD     1 
ATOM   8060  O  OE1    . GLN B  1 9    ? -2.884  22.264  23.412  1.00 148.49 ?  9    GLN B OE1    1 
ATOM   8061  N  NE2    . GLN B  1 9    ? -1.448  23.765  24.257  1.00 144.77 ?  9    GLN B NE2    1 
ATOM   8062  N  N      . THR B  1 10   ? -4.543  25.027  27.920  1.00 109.65 ?  10   THR B N      1 
ATOM   8063  C  CA     . THR B  1 10   ? -4.211  26.314  28.560  1.00 106.87 ?  10   THR B CA     1 
ATOM   8064  C  C      . THR B  1 10   ? -4.293  26.153  30.094  1.00 105.16 ?  10   THR B C      1 
ATOM   8065  O  O      . THR B  1 10   ? -3.365  26.540  30.806  1.00 103.24 ?  10   THR B O      1 
ATOM   8066  C  CB     . THR B  1 10   ? -5.169  27.453  28.061  1.00 118.23 ?  10   THR B CB     1 
ATOM   8067  O  OG1    . THR B  1 10   ? -5.100  27.622  26.647  1.00 119.81 ?  10   THR B OG1    1 
ATOM   8068  C  CG2    . THR B  1 10   ? -4.902  28.783  28.725  1.00 116.80 ?  10   THR B CG2    1 
ATOM   8069  N  N      . GLY B  1 11   ? -5.390  25.550  30.554  1.00 99.78  ?  11   GLY B N      1 
ATOM   8070  C  CA     . GLY B  1 11   ? -5.660  25.321  31.967  1.00 99.24  ?  11   GLY B CA     1 
ATOM   8071  C  C      . GLY B  1 11   ? -4.672  24.400  32.655  1.00 103.90 ?  11   GLY B C      1 
ATOM   8072  O  O      . GLY B  1 11   ? -4.161  24.701  33.740  1.00 102.53 ?  11   GLY B O      1 
ATOM   8073  N  N      . LYS B  1 12   ? -4.405  23.264  32.017  1.00 102.48 ?  12   LYS B N      1 
ATOM   8074  C  CA     . LYS B  1 12   ? -3.461  22.271  32.505  1.00 103.05 ?  12   LYS B CA     1 
ATOM   8075  C  C      . LYS B  1 12   ? -2.054  22.854  32.530  1.00 107.32 ?  12   LYS B C      1 
ATOM   8076  O  O      . LYS B  1 12   ? -1.367  22.706  33.533  1.00 105.92 ?  12   LYS B O      1 
ATOM   8077  C  CB     . LYS B  1 12   ? -3.547  20.993  31.662  1.00 105.49 ?  12   LYS B CB     1 
ATOM   8078  C  CG     . LYS B  1 12   ? -4.743  20.147  32.049  1.00 111.27 ?  12   LYS B CG     1 
ATOM   8079  C  CD     . LYS B  1 12   ? -4.712  18.770  31.444  1.00 125.13 ?  12   LYS B CD     1 
ATOM   8080  C  CE     . LYS B  1 12   ? -5.925  17.978  31.869  1.00 131.98 ?  12   LYS B CE     1 
ATOM   8081  N  NZ     . LYS B  1 12   ? -6.507  17.216  30.742  1.00 139.47 1  12   LYS B NZ     1 
ATOM   8082  N  N      . GLU B  1 13   ? -1.668  23.584  31.469  1.00 106.71 ?  13   GLU B N      1 
ATOM   8083  C  CA     . GLU B  1 13   ? -0.375  24.253  31.327  1.00 109.53 ?  13   GLU B CA     1 
ATOM   8084  C  C      . GLU B  1 13   ? -0.097  25.082  32.551  1.00 113.48 ?  13   GLU B C      1 
ATOM   8085  O  O      . GLU B  1 13   ? 0.964   24.941  33.158  1.00 116.17 ?  13   GLU B O      1 
ATOM   8086  C  CB     . GLU B  1 13   ? -0.411  25.192  30.125  1.00 111.13 ?  13   GLU B CB     1 
ATOM   8087  C  CG     . GLU B  1 13   ? 0.895   25.315  29.369  1.00 137.01 ?  13   GLU B CG     1 
ATOM   8088  C  CD     . GLU B  1 13   ? 0.612   25.360  27.878  1.00 195.14 ?  13   GLU B CD     1 
ATOM   8089  O  OE1    . GLU B  1 13   ? 0.569   24.275  27.252  1.00 204.34 ?  13   GLU B OE1    1 
ATOM   8090  O  OE2    . GLU B  1 13   ? 0.302   26.462  27.365  1.00 206.79 -1 13   GLU B OE2    1 
ATOM   8091  N  N      . LEU B  1 14   ? -1.076  25.931  32.920  1.00 106.86 ?  14   LEU B N      1 
ATOM   8092  C  CA     . LEU B  1 14   ? -1.024  26.822  34.075  1.00 106.03 ?  14   LEU B CA     1 
ATOM   8093  C  C      . LEU B  1 14   ? -1.043  26.042  35.378  1.00 112.66 ?  14   LEU B C      1 
ATOM   8094  O  O      . LEU B  1 14   ? -0.249  26.339  36.267  1.00 113.51 ?  14   LEU B O      1 
ATOM   8095  C  CB     . LEU B  1 14   ? -2.191  27.804  34.047  1.00 103.52 ?  14   LEU B CB     1 
ATOM   8096  C  CG     . LEU B  1 14   ? -2.207  28.805  32.916  1.00 107.38 ?  14   LEU B CG     1 
ATOM   8097  C  CD1    . LEU B  1 14   ? -3.581  29.417  32.770  1.00 105.98 ?  14   LEU B CD1    1 
ATOM   8098  C  CD2    . LEU B  1 14   ? -1.141  29.865  33.102  1.00 109.50 ?  14   LEU B CD2    1 
ATOM   8099  N  N      . LEU B  1 15   ? -1.942  25.043  35.501  1.00 110.55 ?  15   LEU B N      1 
ATOM   8100  C  CA     . LEU B  1 15   ? -2.012  24.213  36.705  1.00 111.78 ?  15   LEU B CA     1 
ATOM   8101  C  C      . LEU B  1 15   ? -0.674  23.569  36.950  1.00 115.79 ?  15   LEU B C      1 
ATOM   8102  O  O      . LEU B  1 15   ? -0.100  23.801  37.999  1.00 114.95 ?  15   LEU B O      1 
ATOM   8103  C  CB     . LEU B  1 15   ? -3.128  23.164  36.619  1.00 112.20 ?  15   LEU B CB     1 
ATOM   8104  C  CG     . LEU B  1 15   ? -3.427  22.439  37.928  1.00 118.42 ?  15   LEU B CG     1 
ATOM   8105  C  CD1    . LEU B  1 15   ? -4.904  22.186  38.077  1.00 117.46 ?  15   LEU B CD1    1 
ATOM   8106  C  CD2    . LEU B  1 15   ? -2.670  21.122  38.008  1.00 124.37 ?  15   LEU B CD2    1 
ATOM   8107  N  N      . TYR B  1 16   ? -0.149  22.839  35.959  1.00 115.42 ?  16   TYR B N      1 
ATOM   8108  C  CA     . TYR B  1 16   ? 1.149   22.185  36.046  1.00 120.36 ?  16   TYR B CA     1 
ATOM   8109  C  C      . TYR B  1 16   ? 2.254   23.181  36.382  1.00 125.95 ?  16   TYR B C      1 
ATOM   8110  O  O      . TYR B  1 16   ? 3.019   22.944  37.324  1.00 128.61 ?  16   TYR B O      1 
ATOM   8111  C  CB     . TYR B  1 16   ? 1.463   21.406  34.763  1.00 124.16 ?  16   TYR B CB     1 
ATOM   8112  C  CG     . TYR B  1 16   ? 0.551   20.227  34.477  1.00 128.83 ?  16   TYR B CG     1 
ATOM   8113  C  CD1    . TYR B  1 16   ? 0.039   19.442  35.512  1.00 132.35 ?  16   TYR B CD1    1 
ATOM   8114  C  CD2    . TYR B  1 16   ? 0.262   19.846  33.171  1.00 130.34 ?  16   TYR B CD2    1 
ATOM   8115  C  CE1    . TYR B  1 16   ? -0.769  18.329  35.250  1.00 135.63 ?  16   TYR B CE1    1 
ATOM   8116  C  CE2    . TYR B  1 16   ? -0.535  18.729  32.895  1.00 132.45 ?  16   TYR B CE2    1 
ATOM   8117  C  CZ     . TYR B  1 16   ? -1.053  17.973  33.937  1.00 143.89 ?  16   TYR B CZ     1 
ATOM   8118  O  OH     . TYR B  1 16   ? -1.844  16.873  33.656  1.00 148.01 ?  16   TYR B OH     1 
ATOM   8119  N  N      . LYS B  1 17   ? 2.266   24.333  35.684  1.00 120.06 ?  17   LYS B N      1 
ATOM   8120  C  CA     . LYS B  1 17   ? 3.247   25.390  35.886  1.00 120.68 ?  17   LYS B CA     1 
ATOM   8121  C  C      . LYS B  1 17   ? 3.209   26.001  37.288  1.00 128.46 ?  17   LYS B C      1 
ATOM   8122  O  O      . LYS B  1 17   ? 4.275   26.286  37.826  1.00 133.26 ?  17   LYS B O      1 
ATOM   8123  C  CB     . LYS B  1 17   ? 3.027   26.519  34.870  1.00 119.30 ?  17   LYS B CB     1 
ATOM   8124  C  CG     . LYS B  1 17   ? 4.039   26.625  33.745  1.00 126.99 ?  17   LYS B CG     1 
ATOM   8125  C  CD     . LYS B  1 17   ? 3.599   27.690  32.707  1.00 134.47 ?  17   LYS B CD     1 
ATOM   8126  C  CE     . LYS B  1 17   ? 4.344   29.011  32.758  1.00 145.21 ?  17   LYS B CE     1 
ATOM   8127  N  NZ     . LYS B  1 17   ? 3.709   30.058  31.894  1.00 144.91 1  17   LYS B NZ     1 
ATOM   8128  N  N      . PHE B  1 18   ? 2.007   26.220  37.878  1.00 122.29 ?  18   PHE B N      1 
ATOM   8129  C  CA     . PHE B  1 18   ? 1.868   26.988  39.116  1.00 121.73 ?  18   PHE B CA     1 
ATOM   8130  C  C      . PHE B  1 18   ? 1.151   26.382  40.318  1.00 130.74 ?  18   PHE B C      1 
ATOM   8131  O  O      . PHE B  1 18   ? 0.954   27.105  41.306  1.00 130.09 ?  18   PHE B O      1 
ATOM   8132  C  CB     . PHE B  1 18   ? 1.152   28.290  38.785  1.00 119.26 ?  18   PHE B CB     1 
ATOM   8133  C  CG     . PHE B  1 18   ? 1.782   29.114  37.688  1.00 119.10 ?  18   PHE B CG     1 
ATOM   8134  C  CD1    . PHE B  1 18   ? 2.937   29.847  37.923  1.00 123.07 ?  18   PHE B CD1    1 
ATOM   8135  C  CD2    . PHE B  1 18   ? 1.181   29.214  36.441  1.00 118.63 ?  18   PHE B CD2    1 
ATOM   8136  C  CE1    . PHE B  1 18   ? 3.489   30.646  36.921  1.00 123.65 ?  18   PHE B CE1    1 
ATOM   8137  C  CE2    . PHE B  1 18   ? 1.747   29.999  35.434  1.00 120.83 ?  18   PHE B CE2    1 
ATOM   8138  C  CZ     . PHE B  1 18   ? 2.898   30.706  35.682  1.00 120.53 ?  18   PHE B CZ     1 
ATOM   8139  N  N      . ILE B  1 19   ? 0.733   25.112  40.275  1.00 131.89 ?  19   ILE B N      1 
ATOM   8140  C  CA     . ILE B  1 19   ? 0.061   24.589  41.466  1.00 133.79 ?  19   ILE B CA     1 
ATOM   8141  C  C      . ILE B  1 19   ? 1.115   24.232  42.493  1.00 146.39 ?  19   ILE B C      1 
ATOM   8142  O  O      . ILE B  1 19   ? 2.112   23.584  42.167  1.00 147.22 ?  19   ILE B O      1 
ATOM   8143  C  CB     . ILE B  1 19   ? -0.990  23.482  41.210  1.00 135.20 ?  19   ILE B CB     1 
ATOM   8144  C  CG1    . ILE B  1 19   ? -1.905  23.288  42.434  1.00 135.41 ?  19   ILE B CG1    1 
ATOM   8145  C  CG2    . ILE B  1 19   ? -0.340  22.182  40.758  1.00 138.28 ?  19   ILE B CG2    1 
ATOM   8146  C  CD1    . ILE B  1 19   ? -3.079  22.347  42.212  1.00 138.54 ?  19   ILE B CD1    1 
ATOM   8147  N  N      . CYS B  1 20   ? 0.941   24.749  43.703  1.00 149.20 ?  20   CYS B N      1 
ATOM   8148  C  CA     . CYS B  1 20   ? 1.892   24.479  44.762  1.00 155.97 ?  20   CYS B CA     1 
ATOM   8149  C  C      . CYS B  1 20   ? 1.296   23.495  45.744  1.00 163.72 ?  20   CYS B C      1 
ATOM   8150  O  O      . CYS B  1 20   ? 0.358   23.837  46.468  1.00 163.65 ?  20   CYS B O      1 
ATOM   8151  C  CB     . CYS B  1 20   ? 2.322   25.770  45.437  1.00 158.50 ?  20   CYS B CB     1 
ATOM   8152  S  SG     . CYS B  1 20   ? 3.942   25.663  46.231  1.00 168.68 ?  20   CYS B SG     1 
ATOM   8153  N  N      . THR B  1 21   ? 1.791   22.251  45.726  1.00 163.20 ?  21   THR B N      1 
ATOM   8154  C  CA     . THR B  1 21   ? 1.223   21.194  46.558  1.00 165.72 ?  21   THR B CA     1 
ATOM   8155  C  C      . THR B  1 21   ? 2.258   20.165  47.010  1.00 174.96 ?  21   THR B C      1 
ATOM   8156  O  O      . THR B  1 21   ? 3.221   19.893  46.292  1.00 174.29 ?  21   THR B O      1 
ATOM   8157  C  CB     . THR B  1 21   ? 0.004   20.541  45.816  1.00 172.74 ?  21   THR B CB     1 
ATOM   8158  O  OG1    . THR B  1 21   ? -0.645  19.599  46.666  1.00 177.76 ?  21   THR B OG1    1 
ATOM   8159  C  CG2    . THR B  1 21   ? 0.372   19.884  44.478  1.00 168.77 ?  21   THR B CG2    1 
ATOM   8160  N  N      . THR B  1 22   ? 2.025   19.573  48.199  1.00 177.04 ?  22   THR B N      1 
ATOM   8161  C  CA     . THR B  1 22   ? 2.843   18.492  48.782  1.00 183.05 ?  22   THR B CA     1 
ATOM   8162  C  C      . THR B  1 22   ? 2.569   17.211  47.974  1.00 189.73 ?  22   THR B C      1 
ATOM   8163  O  O      . THR B  1 22   ? 3.439   16.337  47.870  1.00 192.10 ?  22   THR B O      1 
ATOM   8164  C  CB     . THR B  1 22   ? 2.473   18.247  50.256  1.00 191.14 ?  22   THR B CB     1 
ATOM   8165  O  OG1    . THR B  1 22   ? 2.708   19.421  51.031  1.00 190.48 ?  22   THR B OG1    1 
ATOM   8166  C  CG2    . THR B  1 22   ? 3.209   17.070  50.854  1.00 193.88 ?  22   THR B CG2    1 
ATOM   8167  N  N      . SER B  1 23   ? 1.331   17.119  47.418  1.00 185.22 ?  23   SER B N      1 
ATOM   8168  C  CA     . SER B  1 23   ? 0.820   16.046  46.562  1.00 184.88 ?  23   SER B CA     1 
ATOM   8169  C  C      . SER B  1 23   ? 1.657   15.966  45.285  1.00 189.01 ?  23   SER B C      1 
ATOM   8170  O  O      . SER B  1 23   ? 1.879   16.986  44.617  1.00 186.06 ?  23   SER B O      1 
ATOM   8171  C  CB     . SER B  1 23   ? -0.636  16.318  46.178  1.00 183.76 ?  23   SER B CB     1 
ATOM   8172  O  OG     . SER B  1 23   ? -1.482  16.447  47.308  1.00 190.73 ?  23   SER B OG     1 
ATOM   8173  N  N      . ALA B  1 24   ? 2.129   14.759  44.957  1.00 188.22 ?  24   ALA B N      1 
ATOM   8174  C  CA     . ALA B  1 24   ? 2.901   14.554  43.744  1.00 187.79 ?  24   ALA B CA     1 
ATOM   8175  C  C      . ALA B  1 24   ? 1.926   14.445  42.570  1.00 187.13 ?  24   ALA B C      1 
ATOM   8176  O  O      . ALA B  1 24   ? 1.170   13.463  42.471  1.00 188.38 ?  24   ALA B O      1 
ATOM   8177  C  CB     . ALA B  1 24   ? 3.744   13.293  43.864  1.00 193.78 ?  24   ALA B CB     1 
ATOM   8178  N  N      . ILE B  1 25   ? 1.885   15.497  41.728  1.00 177.39 ?  25   ILE B N      1 
ATOM   8179  C  CA     . ILE B  1 25   ? 1.030   15.493  40.545  1.00 172.26 ?  25   ILE B CA     1 
ATOM   8180  C  C      . ILE B  1 25   ? 1.788   14.803  39.440  1.00 174.38 ?  25   ILE B C      1 
ATOM   8181  O  O      . ILE B  1 25   ? 2.926   15.167  39.131  1.00 175.25 ?  25   ILE B O      1 
ATOM   8182  C  CB     . ILE B  1 25   ? 0.462   16.867  40.160  1.00 170.93 ?  25   ILE B CB     1 
ATOM   8183  C  CG1    . ILE B  1 25   ? -0.507  17.326  41.262  1.00 170.65 ?  25   ILE B CG1    1 
ATOM   8184  C  CG2    . ILE B  1 25   ? -0.234  16.815  38.778  1.00 168.57 ?  25   ILE B CG2    1 
ATOM   8185  C  CD1    . ILE B  1 25   ? -0.872  18.712  41.215  1.00 180.04 ?  25   ILE B CD1    1 
ATOM   8186  N  N      . GLN B  1 26   ? 1.181   13.737  38.919  1.00 166.14 ?  26   GLN B N      1 
ATOM   8187  C  CA     . GLN B  1 26   ? 1.762   12.908  37.878  1.00 162.27 ?  26   GLN B CA     1 
ATOM   8188  C  C      . GLN B  1 26   ? 1.383   13.436  36.501  1.00 158.16 ?  26   GLN B C      1 
ATOM   8189  O  O      . GLN B  1 26   ? 0.452   14.245  36.362  1.00 155.64 ?  26   GLN B O      1 
ATOM   8190  C  CB     . GLN B  1 26   ? 1.317   11.448  38.040  1.00 164.51 ?  26   GLN B CB     1 
ATOM   8191  C  CG     . GLN B  1 26   ? 1.393   10.897  39.453  1.00 173.58 ?  26   GLN B CG     1 
ATOM   8192  C  CD     . GLN B  1 26   ? 2.805   10.774  39.953  1.00 196.97 ?  26   GLN B CD     1 
ATOM   8193  O  OE1    . GLN B  1 26   ? 3.683   10.218  39.290  1.00 196.05 ?  26   GLN B OE1    1 
ATOM   8194  N  NE2    . GLN B  1 26   ? 3.044   11.265  41.153  1.00 190.76 ?  26   GLN B NE2    1 
ATOM   8195  N  N      . ASN B  1 27   ? 2.132   12.973  35.486  1.00 150.61 ?  27   ASN B N      1 
ATOM   8196  C  CA     . ASN B  1 27   ? 1.971   13.301  34.075  1.00 145.89 ?  27   ASN B CA     1 
ATOM   8197  C  C      . ASN B  1 27   ? 2.015   14.805  33.786  1.00 143.43 ?  27   ASN B C      1 
ATOM   8198  O  O      . ASN B  1 27   ? 1.368   15.273  32.836  1.00 140.08 ?  27   ASN B O      1 
ATOM   8199  C  CB     . ASN B  1 27   ? 0.709   12.651  33.504  1.00 146.94 ?  27   ASN B CB     1 
ATOM   8200  C  CG     . ASN B  1 27   ? 0.758   11.149  33.414  1.00 168.57 ?  27   ASN B CG     1 
ATOM   8201  O  OD1    . ASN B  1 27   ? 1.820   10.518  33.339  1.00 169.23 ?  27   ASN B OD1    1 
ATOM   8202  N  ND2    . ASN B  1 27   ? -0.411  10.549  33.345  1.00 156.87 ?  27   ASN B ND2    1 
ATOM   8203  N  N      . ARG B  1 28   ? 2.811   15.553  34.587  1.00 137.78 ?  28   ARG B N      1 
ATOM   8204  C  CA     . ARG B  1 28   ? 2.985   16.994  34.422  1.00 134.28 ?  28   ARG B CA     1 
ATOM   8205  C  C      . ARG B  1 28   ? 3.562   17.295  33.053  1.00 131.51 ?  28   ARG B C      1 
ATOM   8206  O  O      . ARG B  1 28   ? 4.538   16.674  32.642  1.00 131.36 ?  28   ARG B O      1 
ATOM   8207  C  CB     . ARG B  1 28   ? 3.838   17.590  35.546  1.00 137.19 ?  28   ARG B CB     1 
ATOM   8208  C  CG     . ARG B  1 28   ? 3.086   17.660  36.873  1.00 148.52 ?  28   ARG B CG     1 
ATOM   8209  C  CD     . ARG B  1 28   ? 3.912   18.200  38.029  1.00 156.22 ?  28   ARG B CD     1 
ATOM   8210  N  NE     . ARG B  1 28   ? 4.103   19.651  37.958  1.00 147.56 ?  28   ARG B NE     1 
ATOM   8211  C  CZ     . ARG B  1 28   ? 5.245   20.231  37.605  1.00 154.85 ?  28   ARG B CZ     1 
ATOM   8212  N  NH1    . ARG B  1 28   ? 5.340   21.548  37.575  1.00 143.26 1  28   ARG B NH1    1 
ATOM   8213  N  NH2    . ARG B  1 28   ? 6.304   19.496  37.291  1.00 139.24 ?  28   ARG B NH2    1 
ATOM   8214  N  N      . PHE B  1 29   ? 2.864   18.156  32.307  1.00 123.76 ?  29   PHE B N      1 
ATOM   8215  C  CA     . PHE B  1 29   ? 3.171   18.628  30.954  1.00 121.55 ?  29   PHE B CA     1 
ATOM   8216  C  C      . PHE B  1 29   ? 3.063   17.549  29.856  1.00 125.80 ?  29   PHE B C      1 
ATOM   8217  O  O      . PHE B  1 29   ? 3.374   17.822  28.688  1.00 123.99 ?  29   PHE B O      1 
ATOM   8218  C  CB     . PHE B  1 29   ? 4.523   19.341  30.911  1.00 124.50 ?  29   PHE B CB     1 
ATOM   8219  C  CG     . PHE B  1 29   ? 4.624   20.440  31.930  1.00 127.31 ?  29   PHE B CG     1 
ATOM   8220  C  CD1    . PHE B  1 29   ? 3.957   21.643  31.742  1.00 130.34 ?  29   PHE B CD1    1 
ATOM   8221  C  CD2    . PHE B  1 29   ? 5.371   20.269  33.088  1.00 131.63 ?  29   PHE B CD2    1 
ATOM   8222  C  CE1    . PHE B  1 29   ? 4.039   22.657  32.687  1.00 133.40 ?  29   PHE B CE1    1 
ATOM   8223  C  CE2    . PHE B  1 29   ? 5.458   21.283  34.032  1.00 137.21 ?  29   PHE B CE2    1 
ATOM   8224  C  CZ     . PHE B  1 29   ? 4.795   22.475  33.824  1.00 135.08 ?  29   PHE B CZ     1 
ATOM   8225  N  N      . LYS B  1 30   ? 2.541   16.369  30.211  1.00 124.57 ?  30   LYS B N      1 
ATOM   8226  C  CA     . LYS B  1 30   ? 2.350   15.296  29.265  1.00 125.27 ?  30   LYS B CA     1 
ATOM   8227  C  C      . LYS B  1 30   ? 1.000   15.448  28.548  1.00 133.03 ?  30   LYS B C      1 
ATOM   8228  O  O      . LYS B  1 30   ? -0.009  14.897  28.975  1.00 133.32 ?  30   LYS B O      1 
ATOM   8229  C  CB     . LYS B  1 30   ? 2.518   13.937  29.954  1.00 129.21 ?  30   LYS B CB     1 
ATOM   8230  C  CG     . LYS B  1 30   ? 3.965   13.495  30.106  1.00 138.86 ?  30   LYS B CG     1 
ATOM   8231  C  CD     . LYS B  1 30   ? 4.033   12.226  30.926  1.00 154.62 ?  30   LYS B CD     1 
ATOM   8232  C  CE     . LYS B  1 30   ? 5.076   11.244  30.450  1.00 169.32 ?  30   LYS B CE     1 
ATOM   8233  N  NZ     . LYS B  1 30   ? 4.750   9.843   30.850  1.00 176.16 1  30   LYS B NZ     1 
ATOM   8234  N  N      . TYR B  1 31   ? 0.986   16.277  27.493  1.00 131.97 ?  31   TYR B N      1 
ATOM   8235  C  CA     . TYR B  1 31   ? -0.145  16.547  26.582  1.00 131.05 ?  31   TYR B CA     1 
ATOM   8236  C  C      . TYR B  1 31   ? 0.429   17.015  25.241  1.00 134.75 ?  31   TYR B C      1 
ATOM   8237  O  O      . TYR B  1 31   ? 1.494   17.666  25.207  1.00 134.73 ?  31   TYR B O      1 
ATOM   8238  C  CB     . TYR B  1 31   ? -1.176  17.565  27.130  1.00 131.21 ?  31   TYR B CB     1 
ATOM   8239  C  CG     . TYR B  1 31   ? -0.543  18.807  27.709  1.00 133.93 ?  31   TYR B CG     1 
ATOM   8240  C  CD1    . TYR B  1 31   ? -0.134  19.854  26.889  1.00 135.02 ?  31   TYR B CD1    1 
ATOM   8241  C  CD2    . TYR B  1 31   ? -0.329  18.928  29.076  1.00 136.81 ?  31   TYR B CD2    1 
ATOM   8242  C  CE1    . TYR B  1 31   ? 0.503   20.975  27.413  1.00 137.34 ?  31   TYR B CE1    1 
ATOM   8243  C  CE2    . TYR B  1 31   ? 0.279   20.059  29.616  1.00 138.86 ?  31   TYR B CE2    1 
ATOM   8244  C  CZ     . TYR B  1 31   ? 0.710   21.073  28.781  1.00 147.28 ?  31   TYR B CZ     1 
ATOM   8245  O  OH     . TYR B  1 31   ? 1.343   22.162  29.330  1.00 151.52 ?  31   TYR B OH     1 
ATOM   8246  N  N      . ALA B  1 32   ? -0.260  16.658  24.145  1.00 129.40 ?  32   ALA B N      1 
ATOM   8247  C  CA     . ALA B  1 32   ? 0.144   17.005  22.790  1.00 128.41 ?  32   ALA B CA     1 
ATOM   8248  C  C      . ALA B  1 32   ? -1.076  17.452  22.026  1.00 132.02 ?  32   ALA B C      1 
ATOM   8249  O  O      . ALA B  1 32   ? -2.121  16.812  22.123  1.00 132.96 ?  32   ALA B O      1 
ATOM   8250  C  CB     . ALA B  1 32   ? 0.784   15.804  22.113  1.00 130.40 ?  32   ALA B CB     1 
ATOM   8251  N  N      . ARG B  1 33   ? -0.956  18.573  21.297  1.00 126.37 ?  33   ARG B N      1 
ATOM   8252  C  CA     . ARG B  1 33   ? -2.047  19.160  20.518  1.00 124.05 ?  33   ARG B CA     1 
ATOM   8253  C  C      . ARG B  1 33   ? -1.952  18.754  19.053  1.00 126.48 ?  33   ARG B C      1 
ATOM   8254  O  O      . ARG B  1 33   ? -0.889  18.878  18.421  1.00 125.67 ?  33   ARG B O      1 
ATOM   8255  C  CB     . ARG B  1 33   ? -2.027  20.679  20.684  1.00 122.69 ?  33   ARG B CB     1 
ATOM   8256  C  CG     . ARG B  1 33   ? -3.003  21.499  19.862  1.00 125.24 ?  33   ARG B CG     1 
ATOM   8257  C  CD     . ARG B  1 33   ? -2.604  22.937  20.070  1.00 127.69 ?  33   ARG B CD     1 
ATOM   8258  N  NE     . ARG B  1 33   ? -3.369  23.871  19.259  1.00 148.01 ?  33   ARG B NE     1 
ATOM   8259  C  CZ     . ARG B  1 33   ? -3.295  25.187  19.406  1.00 180.79 ?  33   ARG B CZ     1 
ATOM   8260  N  NH1    . ARG B  1 33   ? -2.492  25.716  20.324  1.00 171.76 1  33   ARG B NH1    1 
ATOM   8261  N  NH2    . ARG B  1 33   ? -4.029  25.988  18.645  1.00 180.97 ?  33   ARG B NH2    1 
ATOM   8262  N  N      . VAL B  1 34   ? -3.079  18.261  18.524  1.00 122.01 ?  34   VAL B N      1 
ATOM   8263  C  CA     . VAL B  1 34   ? -3.154  17.807  17.149  1.00 122.16 ?  34   VAL B CA     1 
ATOM   8264  C  C      . VAL B  1 34   ? -4.213  18.588  16.380  1.00 125.95 ?  34   VAL B C      1 
ATOM   8265  O  O      . VAL B  1 34   ? -5.343  18.734  16.847  1.00 124.78 ?  34   VAL B O      1 
ATOM   8266  C  CB     . VAL B  1 34   ? -3.323  16.266  17.072  1.00 126.56 ?  34   VAL B CB     1 
ATOM   8267  C  CG1    . VAL B  1 34   ? -3.690  15.808  15.666  1.00 128.16 ?  34   VAL B CG1    1 
ATOM   8268  C  CG2    . VAL B  1 34   ? -2.058  15.562  17.539  1.00 127.09 ?  34   VAL B CG2    1 
ATOM   8269  N  N      . THR B  1 35   ? -3.811  19.139  15.222  1.00 123.49 ?  35   THR B N      1 
ATOM   8270  C  CA     . THR B  1 35   ? -4.668  19.885  14.298  1.00 123.59 ?  35   THR B CA     1 
ATOM   8271  C  C      . THR B  1 35   ? -4.569  19.222  12.924  1.00 131.69 ?  35   THR B C      1 
ATOM   8272  O  O      . THR B  1 35   ? -3.690  18.369  12.746  1.00 132.21 ?  35   THR B O      1 
ATOM   8273  C  CB     . THR B  1 35   ? -4.286  21.374  14.229  1.00 126.22 ?  35   THR B CB     1 
ATOM   8274  O  OG1    . THR B  1 35   ? -3.046  21.537  13.531  1.00 122.31 ?  35   THR B OG1    1 
ATOM   8275  C  CG2    . THR B  1 35   ? -4.287  22.051  15.599  1.00 126.22 ?  35   THR B CG2    1 
ATOM   8276  N  N      . PRO B  1 36   ? -5.394  19.602  11.914  1.00 130.47 ?  36   PRO B N      1 
ATOM   8277  C  CA     . PRO B  1 36   ? -5.263  18.963  10.594  1.00 133.98 ?  36   PRO B CA     1 
ATOM   8278  C  C      . PRO B  1 36   ? -3.909  19.212  9.887   1.00 142.40 ?  36   PRO B C      1 
ATOM   8279  O  O      . PRO B  1 36   ? -3.566  18.500  8.924   1.00 144.93 ?  36   PRO B O      1 
ATOM   8280  C  CB     . PRO B  1 36   ? -6.460  19.537  9.820   1.00 135.66 ?  36   PRO B CB     1 
ATOM   8281  C  CG     . PRO B  1 36   ? -7.413  20.005  10.880  1.00 136.45 ?  36   PRO B CG     1 
ATOM   8282  C  CD     . PRO B  1 36   ? -6.510  20.565  11.909  1.00 130.07 ?  36   PRO B CD     1 
ATOM   8283  N  N      . ASP B  1 37   ? -3.122  20.183  10.410  1.00 138.44 ?  37   ASP B N      1 
ATOM   8284  C  CA     . ASP B  1 37   ? -1.822  20.581  9.876   1.00 140.19 ?  37   ASP B CA     1 
ATOM   8285  C  C      . ASP B  1 37   ? -0.640  20.039  10.675  1.00 142.68 ?  37   ASP B C      1 
ATOM   8286  O  O      . ASP B  1 37   ? 0.500   20.373  10.361  1.00 143.19 ?  37   ASP B O      1 
ATOM   8287  C  CB     . ASP B  1 37   ? -1.739  22.110  9.798   1.00 142.54 ?  37   ASP B CB     1 
ATOM   8288  C  CG     . ASP B  1 37   ? -3.031  22.771  9.367   1.00 164.04 ?  37   ASP B CG     1 
ATOM   8289  O  OD1    . ASP B  1 37   ? -3.564  22.393  8.286   1.00 168.14 ?  37   ASP B OD1    1 
ATOM   8290  O  OD2    . ASP B  1 37   ? -3.532  23.647  10.124  1.00 172.02 -1 37   ASP B OD2    1 
ATOM   8291  N  N      . THR B  1 38   ? -0.902  19.198  11.688  1.00 138.48 ?  38   THR B N      1 
ATOM   8292  C  CA     . THR B  1 38   ? 0.120   18.614  12.564  1.00 138.77 ?  38   THR B CA     1 
ATOM   8293  C  C      . THR B  1 38   ? 1.134   17.756  11.779  1.00 146.10 ?  38   THR B C      1 
ATOM   8294  O  O      . THR B  1 38   ? 0.738   16.863  11.031  1.00 148.43 ?  38   THR B O      1 
ATOM   8295  C  CB     . THR B  1 38   ? -0.563  17.855  13.747  1.00 144.40 ?  38   THR B CB     1 
ATOM   8296  O  OG1    . THR B  1 38   ? -1.071  18.807  14.688  1.00 143.00 ?  38   THR B OG1    1 
ATOM   8297  C  CG2    . THR B  1 38   ? 0.367   16.905  14.479  1.00 142.19 ?  38   THR B CG2    1 
ATOM   8298  N  N      . ASP B  1 39   ? 2.435   18.056  11.943  1.00 142.43 ?  39   ASP B N      1 
ATOM   8299  C  CA     . ASP B  1 39   ? 3.538   17.279  11.375  1.00 144.56 ?  39   ASP B CA     1 
ATOM   8300  C  C      . ASP B  1 39   ? 3.868   16.275  12.475  1.00 146.10 ?  39   ASP B C      1 
ATOM   8301  O  O      . ASP B  1 39   ? 4.405   16.644  13.523  1.00 144.65 ?  39   ASP B O      1 
ATOM   8302  C  CB     . ASP B  1 39   ? 4.736   18.193  11.080  1.00 147.97 ?  39   ASP B CB     1 
ATOM   8303  C  CG     . ASP B  1 39   ? 6.055   17.517  10.739  1.00 158.76 ?  39   ASP B CG     1 
ATOM   8304  O  OD1    . ASP B  1 39   ? 6.062   16.275  10.550  1.00 158.09 ?  39   ASP B OD1    1 
ATOM   8305  O  OD2    . ASP B  1 39   ? 7.077   18.236  10.635  1.00 168.69 -1 39   ASP B OD2    1 
ATOM   8306  N  N      . TRP B  1 40   ? 3.488   15.021  12.260  1.00 142.46 ?  40   TRP B N      1 
ATOM   8307  C  CA     . TRP B  1 40   ? 3.624   13.966  13.254  1.00 142.04 ?  40   TRP B CA     1 
ATOM   8308  C  C      . TRP B  1 40   ? 5.059   13.656  13.627  1.00 144.81 ?  40   TRP B C      1 
ATOM   8309  O  O      . TRP B  1 40   ? 5.320   13.344  14.788  1.00 142.32 ?  40   TRP B O      1 
ATOM   8310  C  CB     . TRP B  1 40   ? 2.866   12.741  12.796  1.00 143.53 ?  40   TRP B CB     1 
ATOM   8311  C  CG     . TRP B  1 40   ? 1.391   12.936  12.962  1.00 143.93 ?  40   TRP B CG     1 
ATOM   8312  C  CD1    . TRP B  1 40   ? 0.556   13.650  12.150  1.00 146.83 ?  40   TRP B CD1    1 
ATOM   8313  C  CD2    . TRP B  1 40   ? 0.611   12.544  14.094  1.00 142.74 ?  40   TRP B CD2    1 
ATOM   8314  N  NE1    . TRP B  1 40   ? -0.706  13.717  12.703  1.00 145.10 ?  40   TRP B NE1    1 
ATOM   8315  C  CE2    . TRP B  1 40   ? -0.704  13.028  13.890  1.00 145.96 ?  40   TRP B CE2    1 
ATOM   8316  C  CE3    . TRP B  1 40   ? 0.890   11.808  15.257  1.00 144.10 ?  40   TRP B CE3    1 
ATOM   8317  C  CZ2    . TRP B  1 40   ? -1.740  12.789  14.804  1.00 143.75 ?  40   TRP B CZ2    1 
ATOM   8318  C  CZ3    . TRP B  1 40   ? -0.139  11.559  16.153  1.00 144.31 ?  40   TRP B CZ3    1 
ATOM   8319  C  CH2    . TRP B  1 40   ? -1.432  12.054  15.928  1.00 143.65 ?  40   TRP B CH2    1 
ATOM   8320  N  N      . ALA B  1 41   ? 5.997   13.829  12.672  1.00 143.60 ?  41   ALA B N      1 
ATOM   8321  C  CA     . ALA B  1 41   ? 7.439   13.667  12.887  1.00 145.16 ?  41   ALA B CA     1 
ATOM   8322  C  C      . ALA B  1 41   ? 7.915   14.700  13.922  1.00 145.98 ?  41   ALA B C      1 
ATOM   8323  O  O      . ALA B  1 41   ? 8.617   14.347  14.871  1.00 145.06 ?  41   ALA B O      1 
ATOM   8324  C  CB     . ALA B  1 41   ? 8.187   13.864  11.577  1.00 148.98 ?  41   ALA B CB     1 
ATOM   8325  N  N      . ARG B  1 42   ? 7.479   15.966  13.762  1.00 140.56 ?  42   ARG B N      1 
ATOM   8326  C  CA     . ARG B  1 42   ? 7.813   17.052  14.686  1.00 138.46 ?  42   ARG B CA     1 
ATOM   8327  C  C      . ARG B  1 42   ? 7.123   16.859  16.034  1.00 137.39 ?  42   ARG B C      1 
ATOM   8328  O  O      . ARG B  1 42   ? 7.747   17.097  17.065  1.00 137.11 ?  42   ARG B O      1 
ATOM   8329  C  CB     . ARG B  1 42   ? 7.456   18.424  14.094  1.00 139.03 ?  42   ARG B CB     1 
ATOM   8330  C  CG     . ARG B  1 42   ? 8.449   19.521  14.477  1.00 156.59 ?  42   ARG B CG     1 
ATOM   8331  C  CD     . ARG B  1 42   ? 8.010   20.946  14.132  1.00 175.80 ?  42   ARG B CD     1 
ATOM   8332  N  NE     . ARG B  1 42   ? 7.496   21.095  12.764  1.00 193.44 ?  42   ARG B NE     1 
ATOM   8333  C  CZ     . ARG B  1 42   ? 8.244   21.269  11.676  1.00 215.64 ?  42   ARG B CZ     1 
ATOM   8334  N  NH1    . ARG B  1 42   ? 7.672   21.395  10.485  1.00 206.75 1  42   ARG B NH1    1 
ATOM   8335  N  NH2    . ARG B  1 42   ? 9.571   21.308  11.770  1.00 205.71 ?  42   ARG B NH2    1 
ATOM   8336  N  N      . LEU B  1 43   ? 5.850   16.411  16.033  1.00 129.99 ?  43   LEU B N      1 
ATOM   8337  C  CA     . LEU B  1 43   ? 5.095   16.168  17.260  1.00 126.69 ?  43   LEU B CA     1 
ATOM   8338  C  C      . LEU B  1 43   ? 5.839   15.167  18.153  1.00 132.27 ?  43   LEU B C      1 
ATOM   8339  O  O      . LEU B  1 43   ? 5.992   15.416  19.351  1.00 131.56 ?  43   LEU B O      1 
ATOM   8340  C  CB     . LEU B  1 43   ? 3.683   15.678  16.917  1.00 125.08 ?  43   LEU B CB     1 
ATOM   8341  C  CG     . LEU B  1 43   ? 2.725   15.448  18.092  1.00 127.37 ?  43   LEU B CG     1 
ATOM   8342  C  CD1    . LEU B  1 43   ? 2.084   16.702  18.560  1.00 124.27 ?  43   LEU B CD1    1 
ATOM   8343  C  CD2    . LEU B  1 43   ? 1.630   14.541  17.690  1.00 132.21 ?  43   LEU B CD2    1 
ATOM   8344  N  N      . LEU B  1 44   ? 6.349   14.075  17.550  1.00 130.69 ?  44   LEU B N      1 
ATOM   8345  C  CA     . LEU B  1 44   ? 7.120   13.046  18.249  1.00 132.28 ?  44   LEU B CA     1 
ATOM   8346  C  C      . LEU B  1 44   ? 8.521   13.517  18.655  1.00 139.43 ?  44   LEU B C      1 
ATOM   8347  O  O      . LEU B  1 44   ? 9.105   12.960  19.591  1.00 141.51 ?  44   LEU B O      1 
ATOM   8348  C  CB     . LEU B  1 44   ? 7.211   11.777  17.411  1.00 133.92 ?  44   LEU B CB     1 
ATOM   8349  C  CG     . LEU B  1 44   ? 5.939   10.989  17.360  1.00 136.44 ?  44   LEU B CG     1 
ATOM   8350  C  CD1    . LEU B  1 44   ? 5.877   10.172  16.104  1.00 138.76 ?  44   LEU B CD1    1 
ATOM   8351  C  CD2    . LEU B  1 44   ? 5.777   10.140  18.580  1.00 135.54 ?  44   LEU B CD2    1 
ATOM   8352  N  N      . GLN B  1 45   ? 9.058   14.533  17.951  1.00 135.08 ?  45   GLN B N      1 
ATOM   8353  C  CA     . GLN B  1 45   ? 10.362  15.126  18.237  1.00 136.22 ?  45   GLN B CA     1 
ATOM   8354  C  C      . GLN B  1 45   ? 10.242  15.985  19.503  1.00 139.83 ?  45   GLN B C      1 
ATOM   8355  O  O      . GLN B  1 45   ? 11.218  16.172  20.223  1.00 140.32 ?  45   GLN B O      1 
ATOM   8356  C  CB     . GLN B  1 45   ? 10.835  15.945  17.014  1.00 138.30 ?  45   GLN B CB     1 
ATOM   8357  C  CG     . GLN B  1 45   ? 12.230  16.554  17.074  1.00 156.26 ?  45   GLN B CG     1 
ATOM   8358  C  CD     . GLN B  1 45   ? 13.357  15.589  17.408  1.00 192.28 ?  45   GLN B CD     1 
ATOM   8359  O  OE1    . GLN B  1 45   ? 13.724  14.676  16.648  1.00 196.65 ?  45   GLN B OE1    1 
ATOM   8360  N  NE2    . GLN B  1 45   ? 13.954  15.805  18.558  1.00 183.40 ?  45   GLN B NE2    1 
ATOM   8361  N  N      . ASP B  1 46   ? 9.036   16.489  19.774  1.00 136.44 ?  46   ASP B N      1 
ATOM   8362  C  CA     . ASP B  1 46   ? 8.758   17.346  20.924  1.00 136.15 ?  46   ASP B CA     1 
ATOM   8363  C  C      . ASP B  1 46   ? 8.161   16.546  22.075  1.00 141.11 ?  46   ASP B C      1 
ATOM   8364  O  O      . ASP B  1 46   ? 8.345   16.916  23.237  1.00 140.73 ?  46   ASP B O      1 
ATOM   8365  C  CB     . ASP B  1 46   ? 7.808   18.496  20.523  1.00 135.83 ?  46   ASP B CB     1 
ATOM   8366  C  CG     . ASP B  1 46   ? 8.283   19.387  19.371  1.00 150.79 ?  46   ASP B CG     1 
ATOM   8367  O  OD1    . ASP B  1 46   ? 9.521   19.553  19.204  1.00 152.66 ?  46   ASP B OD1    1 
ATOM   8368  O  OD2    . ASP B  1 46   ? 7.421   19.950  18.663  1.00 161.15 -1 46   ASP B OD2    1 
ATOM   8369  N  N      . HIS B  1 47   ? 7.423   15.465  21.748  1.00 137.99 ?  47   HIS B N      1 
ATOM   8370  C  CA     . HIS B  1 47   ? 6.775   14.613  22.737  1.00 137.71 ?  47   HIS B CA     1 
ATOM   8371  C  C      . HIS B  1 47   ? 7.180   13.185  22.539  1.00 140.57 ?  47   HIS B C      1 
ATOM   8372  O  O      . HIS B  1 47   ? 6.414   12.410  21.973  1.00 140.15 ?  47   HIS B O      1 
ATOM   8373  C  CB     . HIS B  1 47   ? 5.265   14.760  22.670  1.00 137.25 ?  47   HIS B CB     1 
ATOM   8374  C  CG     . HIS B  1 47   ? 4.827   16.172  22.819  1.00 140.01 ?  47   HIS B CG     1 
ATOM   8375  N  ND1    . HIS B  1 47   ? 4.719   17.006  21.717  1.00 141.48 ?  47   HIS B ND1    1 
ATOM   8376  C  CD2    . HIS B  1 47   ? 4.518   16.868  23.941  1.00 141.71 ?  47   HIS B CD2    1 
ATOM   8377  C  CE1    . HIS B  1 47   ? 4.306   18.166  22.195  1.00 140.02 ?  47   HIS B CE1    1 
ATOM   8378  N  NE2    . HIS B  1 47   ? 4.158   18.126  23.532  1.00 140.38 ?  47   HIS B NE2    1 
ATOM   8379  N  N      . PRO B  1 48   ? 8.388   12.801  22.989  1.00 137.67 ?  48   PRO B N      1 
ATOM   8380  C  CA     . PRO B  1 48   ? 8.811   11.409  22.813  1.00 139.80 ?  48   PRO B CA     1 
ATOM   8381  C  C      . PRO B  1 48   ? 8.039   10.425  23.702  1.00 144.67 ?  48   PRO B C      1 
ATOM   8382  O  O      . PRO B  1 48   ? 7.985   9.226   23.394  1.00 146.72 ?  48   PRO B O      1 
ATOM   8383  C  CB     . PRO B  1 48   ? 10.311  11.459  23.106  1.00 143.92 ?  48   PRO B CB     1 
ATOM   8384  C  CG     . PRO B  1 48   ? 10.479  12.599  24.000  1.00 147.19 ?  48   PRO B CG     1 
ATOM   8385  C  CD     . PRO B  1 48   ? 9.425   13.597  23.675  1.00 139.71 ?  48   PRO B CD     1 
ATOM   8386  N  N      . TRP B  1 49   ? 7.390   10.940  24.770  1.00 139.38 ?  49   TRP B N      1 
ATOM   8387  C  CA     . TRP B  1 49   ? 6.586   10.134  25.689  1.00 140.02 ?  49   TRP B CA     1 
ATOM   8388  C  C      . TRP B  1 49   ? 5.406   9.449   24.988  1.00 140.59 ?  49   TRP B C      1 
ATOM   8389  O  O      . TRP B  1 49   ? 4.883   8.457   25.501  1.00 141.88 ?  49   TRP B O      1 
ATOM   8390  C  CB     . TRP B  1 49   ? 6.107   10.956  26.883  1.00 138.59 ?  49   TRP B CB     1 
ATOM   8391  C  CG     . TRP B  1 49   ? 5.341   12.186  26.501  1.00 137.86 ?  49   TRP B CG     1 
ATOM   8392  C  CD1    . TRP B  1 49   ? 5.849   13.438  26.311  1.00 140.19 ?  49   TRP B CD1    1 
ATOM   8393  C  CD2    . TRP B  1 49   ? 3.929   12.285  26.257  1.00 136.35 ?  49   TRP B CD2    1 
ATOM   8394  N  NE1    . TRP B  1 49   ? 4.839   14.318  25.985  1.00 137.43 ?  49   TRP B NE1    1 
ATOM   8395  C  CE2    . TRP B  1 49   ? 3.654   13.634  25.924  1.00 137.99 ?  49   TRP B CE2    1 
ATOM   8396  C  CE3    . TRP B  1 49   ? 2.863   11.361  26.279  1.00 138.24 ?  49   TRP B CE3    1 
ATOM   8397  C  CZ2    . TRP B  1 49   ? 2.372   14.079  25.589  1.00 135.12 ?  49   TRP B CZ2    1 
ATOM   8398  C  CZ3    . TRP B  1 49   ? 1.587   11.809  25.951  1.00 137.94 ?  49   TRP B CZ3    1 
ATOM   8399  C  CH2    . TRP B  1 49   ? 1.350   13.159  25.631  1.00 136.23 ?  49   TRP B CH2    1 
ATOM   8400  N  N      . LEU B  1 50   ? 5.026   9.951   23.791  1.00 131.88 ?  50   LEU B N      1 
ATOM   8401  C  CA     . LEU B  1 50   ? 3.949   9.407   22.962  1.00 129.43 ?  50   LEU B CA     1 
ATOM   8402  C  C      . LEU B  1 50   ? 4.192   7.923   22.584  1.00 134.71 ?  50   LEU B C      1 
ATOM   8403  O  O      . LEU B  1 50   ? 3.254   7.195   22.237  1.00 135.47 ?  50   LEU B O      1 
ATOM   8404  C  CB     . LEU B  1 50   ? 3.785   10.264  21.693  1.00 127.28 ?  50   LEU B CB     1 
ATOM   8405  C  CG     . LEU B  1 50   ? 3.214   11.675  21.830  1.00 127.78 ?  50   LEU B CG     1 
ATOM   8406  C  CD1    . LEU B  1 50   ? 3.388   12.429  20.542  1.00 126.42 ?  50   LEU B CD1    1 
ATOM   8407  C  CD2    . LEU B  1 50   ? 1.744   11.647  22.234  1.00 128.15 ?  50   LEU B CD2    1 
ATOM   8408  N  N      . LEU B  1 51   ? 5.445   7.480   22.683  1.00 131.00 ?  51   LEU B N      1 
ATOM   8409  C  CA     . LEU B  1 51   ? 5.823   6.112   22.366  1.00 133.12 ?  51   LEU B CA     1 
ATOM   8410  C  C      . LEU B  1 51   ? 5.998   5.256   23.626  1.00 143.06 ?  51   LEU B C      1 
ATOM   8411  O  O      . LEU B  1 51   ? 5.864   4.029   23.561  1.00 144.98 ?  51   LEU B O      1 
ATOM   8412  C  CB     . LEU B  1 51   ? 7.124   6.142   21.573  1.00 133.25 ?  51   LEU B CB     1 
ATOM   8413  C  CG     . LEU B  1 51   ? 7.142   7.078   20.408  1.00 133.30 ?  51   LEU B CG     1 
ATOM   8414  C  CD1    . LEU B  1 51   ? 8.539   7.332   19.984  1.00 133.66 ?  51   LEU B CD1    1 
ATOM   8415  C  CD2    . LEU B  1 51   ? 6.307   6.539   19.272  1.00 135.64 ?  51   LEU B CD2    1 
ATOM   8416  N  N      . SER B  1 52   ? 6.300   5.920   24.767  1.00 141.23 ?  52   SER B N      1 
ATOM   8417  C  CA     . SER B  1 52   ? 6.549   5.331   26.087  1.00 143.91 ?  52   SER B CA     1 
ATOM   8418  C  C      . SER B  1 52   ? 5.407   4.490   26.668  1.00 150.53 ?  52   SER B C      1 
ATOM   8419  O  O      . SER B  1 52   ? 5.672   3.529   27.399  1.00 152.42 ?  52   SER B O      1 
ATOM   8420  C  CB     . SER B  1 52   ? 6.931   6.426   27.075  1.00 146.06 ?  52   SER B CB     1 
ATOM   8421  O  OG     . SER B  1 52   ? 7.891   7.313   26.526  1.00 151.09 ?  52   SER B OG     1 
ATOM   8422  N  N      . GLN B  1 53   ? 4.148   4.882   26.388  1.00 146.69 ?  53   GLN B N      1 
ATOM   8423  C  CA     . GLN B  1 53   ? 2.968   4.201   26.917  1.00 147.71 ?  53   GLN B CA     1 
ATOM   8424  C  C      . GLN B  1 53   ? 1.735   4.355   26.029  1.00 151.82 ?  53   GLN B C      1 
ATOM   8425  O  O      . GLN B  1 53   ? 1.815   4.948   24.945  1.00 150.70 ?  53   GLN B O      1 
ATOM   8426  C  CB     . GLN B  1 53   ? 2.682   4.667   28.378  1.00 148.13 ?  53   GLN B CB     1 
ATOM   8427  C  CG     . GLN B  1 53   ? 2.047   6.047   28.572  1.00 133.45 ?  53   GLN B CG     1 
ATOM   8428  C  CD     . GLN B  1 53   ? 3.008   7.174   28.310  1.00 151.60 ?  53   GLN B CD     1 
ATOM   8429  O  OE1    . GLN B  1 53   ? 3.871   7.509   29.123  1.00 144.90 ?  53   GLN B OE1    1 
ATOM   8430  N  NE2    . GLN B  1 53   ? 2.845   7.813   27.178  1.00 149.44 ?  53   GLN B NE2    1 
ATOM   8431  N  N      . ASN B  1 54   ? 0.595   3.799   26.500  1.00 148.98 ?  54   ASN B N      1 
ATOM   8432  C  CA     . ASN B  1 54   ? -0.695  3.933   25.844  1.00 147.05 ?  54   ASN B CA     1 
ATOM   8433  C  C      . ASN B  1 54   ? -1.298  5.277   26.180  1.00 145.50 ?  54   ASN B C      1 
ATOM   8434  O  O      . ASN B  1 54   ? -1.001  5.848   27.234  1.00 143.85 ?  54   ASN B O      1 
ATOM   8435  C  CB     . ASN B  1 54   ? -1.615  2.771   26.142  1.00 150.94 ?  54   ASN B CB     1 
ATOM   8436  C  CG     . ASN B  1 54   ? -1.641  1.788   25.004  1.00 171.59 ?  54   ASN B CG     1 
ATOM   8437  O  OD1    . ASN B  1 54   ? -0.628  1.538   24.330  1.00 160.79 ?  54   ASN B OD1    1 
ATOM   8438  N  ND2    . ASN B  1 54   ? -2.814  1.245   24.736  1.00 167.48 ?  54   ASN B ND2    1 
ATOM   8439  N  N      . LEU B  1 55   ? -2.075  5.815   25.237  1.00 139.59 ?  55   LEU B N      1 
ATOM   8440  C  CA     . LEU B  1 55   ? -2.615  7.166   25.291  1.00 136.05 ?  55   LEU B CA     1 
ATOM   8441  C  C      . LEU B  1 55   ? -4.150  7.266   25.245  1.00 138.62 ?  55   LEU B C      1 
ATOM   8442  O  O      . LEU B  1 55   ? -4.832  6.267   25.020  1.00 140.69 ?  55   LEU B O      1 
ATOM   8443  C  CB     . LEU B  1 55   ? -2.009  7.962   24.119  1.00 134.32 ?  55   LEU B CB     1 
ATOM   8444  C  CG     . LEU B  1 55   ? -0.550  7.681   23.747  1.00 140.35 ?  55   LEU B CG     1 
ATOM   8445  C  CD1    . LEU B  1 55   ? -0.293  8.016   22.307  1.00 140.27 ?  55   LEU B CD1    1 
ATOM   8446  C  CD2    . LEU B  1 55   ? 0.418   8.415   24.662  1.00 142.54 ?  55   LEU B CD2    1 
ATOM   8447  N  N      . VAL B  1 56   ? -4.682  8.484   25.513  1.00 131.15 ?  56   VAL B N      1 
ATOM   8448  C  CA     . VAL B  1 56   ? -6.095  8.863   25.443  1.00 129.51 ?  56   VAL B CA     1 
ATOM   8449  C  C      . VAL B  1 56   ? -6.156  10.136  24.595  1.00 133.75 ?  56   VAL B C      1 
ATOM   8450  O  O      . VAL B  1 56   ? -5.395  11.074  24.843  1.00 132.12 ?  56   VAL B O      1 
ATOM   8451  C  CB     . VAL B  1 56   ? -6.766  9.034   26.823  1.00 132.61 ?  56   VAL B CB     1 
ATOM   8452  C  CG1    . VAL B  1 56   ? -8.207  9.518   26.690  1.00 131.29 ?  56   VAL B CG1    1 
ATOM   8453  C  CG2    . VAL B  1 56   ? -6.725  7.736   27.601  1.00 135.52 ?  56   VAL B CG2    1 
ATOM   8454  N  N      . VAL B  1 57   ? -7.013  10.140  23.556  1.00 132.36 ?  57   VAL B N      1 
ATOM   8455  C  CA     . VAL B  1 57   ? -7.189  11.263  22.613  1.00 130.78 ?  57   VAL B CA     1 
ATOM   8456  C  C      . VAL B  1 57   ? -8.644  11.823  22.683  1.00 135.66 ?  57   VAL B C      1 
ATOM   8457  O  O      . VAL B  1 57   ? -9.591  11.024  22.774  1.00 137.74 ?  57   VAL B O      1 
ATOM   8458  C  CB     . VAL B  1 57   ? -6.717  10.877  21.173  1.00 134.77 ?  57   VAL B CB     1 
ATOM   8459  C  CG1    . VAL B  1 57   ? -7.342  9.565   20.686  1.00 136.76 ?  57   VAL B CG1    1 
ATOM   8460  C  CG2    . VAL B  1 57   ? -6.930  12.010  20.170  1.00 132.79 ?  57   VAL B CG2    1 
ATOM   8461  N  N      . LYS B  1 58   ? -8.806  13.187  22.679  1.00 129.08 ?  58   LYS B N      1 
ATOM   8462  C  CA     . LYS B  1 58   ? -10.107 13.871  22.784  1.00 128.15 ?  58   LYS B CA     1 
ATOM   8463  C  C      . LYS B  1 58   ? -10.071 15.297  22.202  1.00 132.46 ?  58   LYS B C      1 
ATOM   8464  O  O      . LYS B  1 58   ? -8.992  15.881  22.187  1.00 130.59 ?  58   LYS B O      1 
ATOM   8465  C  CB     . LYS B  1 58   ? -10.603 13.885  24.253  1.00 129.99 ?  58   LYS B CB     1 
ATOM   8466  C  CG     . LYS B  1 58   ? -9.639  14.475  25.288  1.00 127.07 ?  58   LYS B CG     1 
ATOM   8467  C  CD     . LYS B  1 58   ? -10.121 14.278  26.724  1.00 131.27 ?  58   LYS B CD     1 
ATOM   8468  C  CE     . LYS B  1 58   ? -9.000  14.483  27.702  1.00 128.56 ?  58   LYS B CE     1 
ATOM   8469  N  NZ     . LYS B  1 58   ? -9.351  14.030  29.068  1.00 136.06 1  58   LYS B NZ     1 
ATOM   8470  N  N      . PRO B  1 59   ? -11.190 15.906  21.723  1.00 131.59 ?  59   PRO B N      1 
ATOM   8471  C  CA     . PRO B  1 59   ? -11.087 17.279  21.203  1.00 130.72 ?  59   PRO B CA     1 
ATOM   8472  C  C      . PRO B  1 59   ? -11.127 18.357  22.288  1.00 135.81 ?  59   PRO B C      1 
ATOM   8473  O  O      . PRO B  1 59   ? -11.941 18.294  23.207  1.00 135.32 ?  59   PRO B O      1 
ATOM   8474  C  CB     . PRO B  1 59   ? -12.252 17.384  20.212  1.00 132.97 ?  59   PRO B CB     1 
ATOM   8475  C  CG     . PRO B  1 59   ? -13.228 16.340  20.640  1.00 138.64 ?  59   PRO B CG     1 
ATOM   8476  C  CD     . PRO B  1 59   ? -12.574 15.402  21.613  1.00 134.82 ?  59   PRO B CD     1 
ATOM   8477  N  N      . ASP B  1 60   ? -10.222 19.348  22.177  1.00 133.85 ?  60   ASP B N      1 
ATOM   8478  C  CA     . ASP B  1 60   ? -10.108 20.481  23.104  1.00 134.26 ?  60   ASP B CA     1 
ATOM   8479  C  C      . ASP B  1 60   ? -10.748 21.700  22.420  1.00 138.00 ?  60   ASP B C      1 
ATOM   8480  O  O      . ASP B  1 60   ? -10.042 22.608  21.952  1.00 138.69 ?  60   ASP B O      1 
ATOM   8481  C  CB     . ASP B  1 60   ? -8.615  20.726  23.467  1.00 136.79 ?  60   ASP B CB     1 
ATOM   8482  C  CG     . ASP B  1 60   ? -8.324  21.791  24.527  1.00 157.34 ?  60   ASP B CG     1 
ATOM   8483  O  OD1    . ASP B  1 60   ? -9.294  22.291  25.159  1.00 160.45 ?  60   ASP B OD1    1 
ATOM   8484  O  OD2    . ASP B  1 60   ? -7.121  22.136  24.717  1.00 165.19 -1 60   ASP B OD2    1 
ATOM   8485  N  N      . GLN B  1 61   ? -12.092 21.700  22.310  1.00 132.37 ?  61   GLN B N      1 
ATOM   8486  C  CA     . GLN B  1 61   ? -12.766 22.785  21.589  1.00 130.04 ?  61   GLN B CA     1 
ATOM   8487  C  C      . GLN B  1 61   ? -13.935 23.408  22.345  1.00 131.16 ?  61   GLN B C      1 
ATOM   8488  O  O      . GLN B  1 61   ? -14.815 24.052  21.742  1.00 131.32 ?  61   GLN B O      1 
ATOM   8489  C  CB     . GLN B  1 61   ? -13.189 22.306  20.195  1.00 131.04 ?  61   GLN B CB     1 
ATOM   8490  C  CG     . GLN B  1 61   ? -12.051 22.364  19.190  1.00 126.61 ?  61   GLN B CG     1 
ATOM   8491  C  CD     . GLN B  1 61   ? -12.447 21.816  17.857  1.00 133.91 ?  61   GLN B CD     1 
ATOM   8492  O  OE1    . GLN B  1 61   ? -11.907 20.805  17.396  1.00 134.94 ?  61   GLN B OE1    1 
ATOM   8493  N  NE2    . GLN B  1 61   ? -13.400 22.474  17.209  1.00 114.90 ?  61   GLN B NE2    1 
ATOM   8494  N  N      . LEU B  1 62   ? -13.888 23.286  23.682  1.00 124.65 ?  62   LEU B N      1 
ATOM   8495  C  CA     . LEU B  1 62   ? -14.916 23.795  24.583  1.00 123.89 ?  62   LEU B CA     1 
ATOM   8496  C  C      . LEU B  1 62   ? -16.214 22.994  24.373  1.00 129.59 ?  62   LEU B C      1 
ATOM   8497  O  O      . LEU B  1 62   ? -17.320 23.543  24.441  1.00 129.03 ?  62   LEU B O      1 
ATOM   8498  C  CB     . LEU B  1 62   ? -15.107 25.344  24.500  1.00 122.82 ?  62   LEU B CB     1 
ATOM   8499  C  CG     . LEU B  1 62   ? -13.849 26.258  24.629  1.00 124.95 ?  62   LEU B CG     1 
ATOM   8500  C  CD1    . LEU B  1 62   ? -14.198 27.680  24.396  1.00 125.13 ?  62   LEU B CD1    1 
ATOM   8501  C  CD2    . LEU B  1 62   ? -13.198 26.178  25.997  1.00 125.30 ?  62   LEU B CD2    1 
ATOM   8502  N  N      . ILE B  1 63   ? -16.027 21.664  24.093  1.00 127.88 ?  63   ILE B N      1 
ATOM   8503  C  CA     . ILE B  1 63   ? -17.072 20.653  23.929  1.00 129.01 ?  63   ILE B CA     1 
ATOM   8504  C  C      . ILE B  1 63   ? -17.220 19.886  25.243  1.00 134.98 ?  63   ILE B C      1 
ATOM   8505  O  O      . ILE B  1 63   ? -16.281 19.239  25.724  1.00 132.82 ?  63   ILE B O      1 
ATOM   8506  C  CB     . ILE B  1 63   ? -16.892 19.696  22.728  1.00 131.63 ?  63   ILE B CB     1 
ATOM   8507  C  CG1    . ILE B  1 63   ? -16.801 20.465  21.411  1.00 130.89 ?  63   ILE B CG1    1 
ATOM   8508  C  CG2    . ILE B  1 63   ? -18.039 18.666  22.677  1.00 134.09 ?  63   ILE B CG2    1 
ATOM   8509  C  CD1    . ILE B  1 63   ? -15.981 19.758  20.365  1.00 137.49 ?  63   ILE B CD1    1 
ATOM   8510  N  N      . LYS B  1 64   ? -18.424 20.006  25.795  1.00 134.71 ?  64   LYS B N      1 
ATOM   8511  C  CA     . LYS B  1 64   ? -18.808 19.347  27.059  1.00 136.64 ?  64   LYS B CA     1 
ATOM   8512  C  C      . LYS B  1 64   ? -19.389 17.977  26.715  1.00 141.13 ?  64   LYS B C      1 
ATOM   8513  O  O      . LYS B  1 64   ? -19.814 17.774  25.572  1.00 140.59 ?  64   LYS B O      1 
ATOM   8514  C  CB     . LYS B  1 64   ? -19.834 20.211  27.794  1.00 140.63 ?  64   LYS B CB     1 
ATOM   8515  C  CG     . LYS B  1 64   ? -19.305 21.544  28.308  1.00 149.50 ?  64   LYS B CG     1 
ATOM   8516  C  CD     . LYS B  1 64   ? -20.354 22.385  29.011  1.00 161.56 ?  64   LYS B CD     1 
ATOM   8517  C  CE     . LYS B  1 64   ? -19.819 23.699  29.542  1.00 163.45 ?  64   LYS B CE     1 
ATOM   8518  N  NZ     . LYS B  1 64   ? -20.879 24.500  30.199  1.00 165.52 1  64   LYS B NZ     1 
ATOM   8519  N  N      . ARG B  1 65   ? -19.390 17.090  27.701  1.00 138.95 ?  65   ARG B N      1 
ATOM   8520  C  CA     . ARG B  1 65   ? -19.884 15.698  27.601  1.00 141.14 ?  65   ARG B CA     1 
ATOM   8521  C  C      . ARG B  1 65   ? -19.210 14.836  26.462  1.00 142.23 ?  65   ARG B C      1 
ATOM   8522  O  O      . ARG B  1 65   ? -19.835 13.877  25.987  1.00 143.76 ?  65   ARG B O      1 
ATOM   8523  C  CB     . ARG B  1 65   ? -21.439 15.631  27.486  1.00 143.87 ?  65   ARG B CB     1 
ATOM   8524  C  CG     . ARG B  1 65   ? -22.246 16.561  28.390  1.00 154.25 ?  65   ARG B CG     1 
ATOM   8525  C  CD     . ARG B  1 65   ? -23.717 16.208  28.349  1.00 174.30 ?  65   ARG B CD     1 
ATOM   8526  N  NE     . ARG B  1 65   ? -24.596 17.376  28.498  1.00 194.34 ?  65   ARG B NE     1 
ATOM   8527  C  CZ     . ARG B  1 65   ? -25.932 17.325  28.529  1.00 213.00 ?  65   ARG B CZ     1 
ATOM   8528  N  NH1    . ARG B  1 65   ? -26.564 16.158  28.435  1.00 200.24 1  65   ARG B NH1    1 
ATOM   8529  N  NH2    . ARG B  1 65   ? -26.643 18.439  28.657  1.00 198.06 ?  65   ARG B NH2    1 
ATOM   8530  N  N      . ARG B  1 66   ? -17.936 15.168  26.062  1.00 133.22 ?  66   ARG B N      1 
ATOM   8531  C  CA     . ARG B  1 66   ? -17.121 14.498  25.025  1.00 130.20 ?  66   ARG B CA     1 
ATOM   8532  C  C      . ARG B  1 66   ? -17.235 12.981  25.056  1.00 134.25 ?  66   ARG B C      1 
ATOM   8533  O  O      . ARG B  1 66   ? -17.443 12.358  24.016  1.00 134.00 ?  66   ARG B O      1 
ATOM   8534  C  CB     . ARG B  1 66   ? -15.647 14.855  25.194  1.00 123.51 ?  66   ARG B CB     1 
ATOM   8535  C  CG     . ARG B  1 66   ? -15.214 16.072  24.446  1.00 122.02 ?  66   ARG B CG     1 
ATOM   8536  C  CD     . ARG B  1 66   ? -13.840 16.448  24.940  1.00 129.85 ?  66   ARG B CD     1 
ATOM   8537  N  NE     . ARG B  1 66   ? -13.854 16.850  26.350  1.00 134.19 ?  66   ARG B NE     1 
ATOM   8538  C  CZ     . ARG B  1 66   ? -12.772 17.142  27.070  1.00 130.00 ?  66   ARG B CZ     1 
ATOM   8539  N  NH1    . ARG B  1 66   ? -11.560 17.080  26.523  1.00 93.80  1  66   ARG B NH1    1 
ATOM   8540  N  NH2    . ARG B  1 66   ? -12.893 17.503  28.342  1.00 111.71 ?  66   ARG B NH2    1 
ATOM   8541  N  N      . GLY B  1 67   ? -17.064 12.424  26.254  1.00 131.03 ?  67   GLY B N      1 
ATOM   8542  C  CA     . GLY B  1 67   ? -17.133 11.006  26.532  1.00 133.29 ?  67   GLY B CA     1 
ATOM   8543  C  C      . GLY B  1 67   ? -18.414 10.424  25.998  1.00 139.97 ?  67   GLY B C      1 
ATOM   8544  O  O      . GLY B  1 67   ? -18.378 9.554   25.118  1.00 141.21 ?  67   GLY B O      1 
ATOM   8545  N  N      . LYS B  1 68   ? -19.550 10.981  26.458  1.00 136.99 ?  68   LYS B N      1 
ATOM   8546  C  CA     . LYS B  1 68   ? -20.899 10.548  26.069  1.00 139.65 ?  68   LYS B CA     1 
ATOM   8547  C  C      . LYS B  1 68   ? -21.192 10.680  24.555  1.00 142.38 ?  68   LYS B C      1 
ATOM   8548  O  O      . LYS B  1 68   ? -22.069 9.983   24.040  1.00 143.64 ?  68   LYS B O      1 
ATOM   8549  C  CB     . LYS B  1 68   ? -21.958 11.278  26.908  1.00 143.56 ?  68   LYS B CB     1 
ATOM   8550  C  CG     . LYS B  1 68   ? -21.834 11.086  28.427  1.00 150.25 ?  68   LYS B CG     1 
ATOM   8551  C  CD     . LYS B  1 68   ? -22.193 9.686   28.882  1.00 155.93 ?  68   LYS B CD     1 
ATOM   8552  C  CE     . LYS B  1 68   ? -23.455 9.594   29.717  1.00 162.21 ?  68   LYS B CE     1 
ATOM   8553  N  NZ     . LYS B  1 68   ? -23.429 10.465  30.926  1.00 166.79 1  68   LYS B NZ     1 
ATOM   8554  N  N      . LEU B  1 69   ? -20.419 11.534  23.850  1.00 136.55 ?  69   LEU B N      1 
ATOM   8555  C  CA     . LEU B  1 69   ? -20.514 11.778  22.409  1.00 135.79 ?  69   LEU B CA     1 
ATOM   8556  C  C      . LEU B  1 69   ? -19.562 10.882  21.624  1.00 140.44 ?  69   LEU B C      1 
ATOM   8557  O  O      . LEU B  1 69   ? -19.446 11.057  20.409  1.00 140.72 ?  69   LEU B O      1 
ATOM   8558  C  CB     . LEU B  1 69   ? -20.160 13.231  22.116  1.00 132.56 ?  69   LEU B CB     1 
ATOM   8559  C  CG     . LEU B  1 69   ? -21.049 14.296  22.720  1.00 137.32 ?  69   LEU B CG     1 
ATOM   8560  C  CD1    . LEU B  1 69   ? -20.407 15.668  22.590  1.00 133.79 ?  69   LEU B CD1    1 
ATOM   8561  C  CD2    . LEU B  1 69   ? -22.395 14.314  22.045  1.00 144.22 ?  69   LEU B CD2    1 
ATOM   8562  N  N      . GLY B  1 70   ? -18.868 9.971   22.328  1.00 136.68 ?  70   GLY B N      1 
ATOM   8563  C  CA     . GLY B  1 70   ? -17.907 9.025   21.766  1.00 136.88 ?  70   GLY B CA     1 
ATOM   8564  C  C      . GLY B  1 70   ? -16.725 9.703   21.127  1.00 137.76 ?  70   GLY B C      1 
ATOM   8565  O  O      . GLY B  1 70   ? -16.185 9.233   20.127  1.00 137.68 ?  70   GLY B O      1 
ATOM   8566  N  N      . LEU B  1 71   ? -16.362 10.839  21.689  1.00 133.07 ?  71   LEU B N      1 
ATOM   8567  C  CA     . LEU B  1 71   ? -15.268 11.657  21.220  1.00 131.06 ?  71   LEU B CA     1 
ATOM   8568  C  C      . LEU B  1 71   ? -14.056 11.516  22.130  1.00 137.16 ?  71   LEU B C      1 
ATOM   8569  O  O      . LEU B  1 71   ? -13.129 12.324  22.069  1.00 134.04 ?  71   LEU B O      1 
ATOM   8570  C  CB     . LEU B  1 71   ? -15.719 13.106  21.115  1.00 129.04 ?  71   LEU B CB     1 
ATOM   8571  C  CG     . LEU B  1 71   ? -16.767 13.409  20.063  1.00 134.71 ?  71   LEU B CG     1 
ATOM   8572  C  CD1    . LEU B  1 71   ? -17.313 14.830  20.251  1.00 133.14 ?  71   LEU B CD1    1 
ATOM   8573  C  CD2    . LEU B  1 71   ? -16.214 13.180  18.647  1.00 136.57 ?  71   LEU B CD2    1 
ATOM   8574  N  N      . VAL B  1 72   ? -14.049 10.460  22.962  1.00 138.62 ?  72   VAL B N      1 
ATOM   8575  C  CA     . VAL B  1 72   ? -12.902 10.110  23.800  1.00 138.46 ?  72   VAL B CA     1 
ATOM   8576  C  C      . VAL B  1 72   ? -12.434 8.727   23.329  1.00 143.86 ?  72   VAL B C      1 
ATOM   8577  O  O      . VAL B  1 72   ? -13.247 7.796   23.254  1.00 145.00 ?  72   VAL B O      1 
ATOM   8578  C  CB     . VAL B  1 72   ? -13.143 10.233  25.335  1.00 142.57 ?  72   VAL B CB     1 
ATOM   8579  C  CG1    . VAL B  1 72   ? -11.937 9.731   26.135  1.00 142.56 ?  72   VAL B CG1    1 
ATOM   8580  C  CG2    . VAL B  1 72   ? -13.469 11.681  25.717  1.00 139.95 ?  72   VAL B CG2    1 
ATOM   8581  N  N      . GLY B  1 73   ? -11.174 8.684   22.883  1.00 140.32 ?  73   GLY B N      1 
ATOM   8582  C  CA     . GLY B  1 73   ? -10.471 7.491   22.424  1.00 143.14 ?  73   GLY B CA     1 
ATOM   8583  C  C      . GLY B  1 73   ? -9.552  7.070   23.546  1.00 148.54 ?  73   GLY B C      1 
ATOM   8584  O  O      . GLY B  1 73   ? -8.576  7.769   23.828  1.00 146.55 ?  73   GLY B O      1 
ATOM   8585  N  N      . VAL B  1 74   ? -9.909  5.977   24.249  1.00 147.75 ?  74   VAL B N      1 
ATOM   8586  C  CA     . VAL B  1 74   ? -9.214  5.530   25.465  1.00 148.22 ?  74   VAL B CA     1 
ATOM   8587  C  C      . VAL B  1 74   ? -8.287  4.341   25.264  1.00 152.05 ?  74   VAL B C      1 
ATOM   8588  O  O      . VAL B  1 74   ? -8.682  3.368   24.624  1.00 154.66 ?  74   VAL B O      1 
ATOM   8589  C  CB     . VAL B  1 74   ? -10.202 5.232   26.639  1.00 154.23 ?  74   VAL B CB     1 
ATOM   8590  C  CG1    . VAL B  1 74   ? -9.521  5.412   27.989  1.00 153.84 ?  74   VAL B CG1    1 
ATOM   8591  C  CG2    . VAL B  1 74   ? -11.475 6.069   26.563  1.00 153.13 ?  74   VAL B CG2    1 
ATOM   8592  N  N      . ASN B  1 75   ? -7.093  4.386   25.906  1.00 145.55 ?  75   ASN B N      1 
ATOM   8593  C  CA     . ASN B  1 75   ? -6.078  3.331   25.928  1.00 146.41 ?  75   ASN B CA     1 
ATOM   8594  C  C      . ASN B  1 75   ? -5.728  2.821   24.518  1.00 150.59 ?  75   ASN B C      1 
ATOM   8595  O  O      . ASN B  1 75   ? -6.175  1.746   24.089  1.00 153.16 ?  75   ASN B O      1 
ATOM   8596  C  CB     . ASN B  1 75   ? -6.495  2.208   26.885  1.00 146.32 ?  75   ASN B CB     1 
ATOM   8597  C  CG     . ASN B  1 75   ? -5.447  1.166   27.083  1.00 165.42 ?  75   ASN B CG     1 
ATOM   8598  O  OD1    . ASN B  1 75   ? -4.379  1.429   27.629  1.00 150.77 ?  75   ASN B OD1    1 
ATOM   8599  N  ND2    . ASN B  1 75   ? -5.725  -0.043  26.617  1.00 168.21 ?  75   ASN B ND2    1 
ATOM   8600  N  N      . LEU B  1 76   ? -4.965  3.645   23.778  1.00 144.25 ?  76   LEU B N      1 
ATOM   8601  C  CA     . LEU B  1 76   ? -4.530  3.346   22.410  1.00 144.16 ?  76   LEU B CA     1 
ATOM   8602  C  C      . LEU B  1 76   ? -3.052  3.655   22.230  1.00 148.51 ?  76   LEU B C      1 
ATOM   8603  O  O      . LEU B  1 76   ? -2.546  4.643   22.778  1.00 145.41 ?  76   LEU B O      1 
ATOM   8604  C  CB     . LEU B  1 76   ? -5.311  4.149   21.328  1.00 141.37 ?  76   LEU B CB     1 
ATOM   8605  C  CG     . LEU B  1 76   ? -6.781  4.482   21.523  1.00 143.71 ?  76   LEU B CG     1 
ATOM   8606  C  CD1    . LEU B  1 76   ? -7.265  5.372   20.433  1.00 141.41 ?  76   LEU B CD1    1 
ATOM   8607  C  CD2    . LEU B  1 76   ? -7.611  3.253   21.486  1.00 150.46 ?  76   LEU B CD2    1 
ATOM   8608  N  N      . THR B  1 77   ? -2.382  2.853   21.378  1.00 147.54 ?  77   THR B N      1 
ATOM   8609  C  CA     . THR B  1 77   ? -0.988  3.042   20.957  1.00 146.42 ?  77   THR B CA     1 
ATOM   8610  C  C      . THR B  1 77   ? -1.001  4.307   20.097  1.00 146.79 ?  77   THR B C      1 
ATOM   8611  O  O      . THR B  1 77   ? -2.062  4.651   19.564  1.00 145.29 ?  77   THR B O      1 
ATOM   8612  C  CB     . THR B  1 77   ? -0.554  1.850   20.099  1.00 151.08 ?  77   THR B CB     1 
ATOM   8613  O  OG1    . THR B  1 77   ? -1.386  1.766   18.941  1.00 148.88 ?  77   THR B OG1    1 
ATOM   8614  C  CG2    . THR B  1 77   ? -0.620  0.541   20.848  1.00 151.45 ?  77   THR B CG2    1 
ATOM   8615  N  N      . LEU B  1 78   ? 0.142   4.994   19.937  1.00 142.10 ?  78   LEU B N      1 
ATOM   8616  C  CA     . LEU B  1 78   ? 0.182   6.229   19.116  1.00 139.00 ?  78   LEU B CA     1 
ATOM   8617  C  C      . LEU B  1 78   ? -0.384  6.004   17.698  1.00 144.71 ?  78   LEU B C      1 
ATOM   8618  O  O      . LEU B  1 78   ? -1.053  6.879   17.153  1.00 142.47 ?  78   LEU B O      1 
ATOM   8619  C  CB     . LEU B  1 78   ? 1.607   6.837   19.074  1.00 137.86 ?  78   LEU B CB     1 
ATOM   8620  C  CG     . LEU B  1 78   ? 1.868   7.920   18.049  1.00 139.51 ?  78   LEU B CG     1 
ATOM   8621  C  CD1    . LEU B  1 78   ? 1.713   9.263   18.644  1.00 136.50 ?  78   LEU B CD1    1 
ATOM   8622  C  CD2    . LEU B  1 78   ? 3.215   7.765   17.433  1.00 142.39 ?  78   LEU B CD2    1 
ATOM   8623  N  N      . ASP B  1 79   ? -0.152  4.806   17.142  1.00 145.26 ?  79   ASP B N      1 
ATOM   8624  C  CA     . ASP B  1 79   ? -0.606  4.412   15.811  1.00 147.63 ?  79   ASP B CA     1 
ATOM   8625  C  C      . ASP B  1 79   ? -2.112  4.124   15.819  1.00 148.01 ?  79   ASP B C      1 
ATOM   8626  O  O      . ASP B  1 79   ? -2.776  4.271   14.797  1.00 147.64 ?  79   ASP B O      1 
ATOM   8627  C  CB     . ASP B  1 79   ? 0.271   3.252   15.264  1.00 155.17 ?  79   ASP B CB     1 
ATOM   8628  C  CG     . ASP B  1 79   ? 1.790   3.476   15.479  1.00 176.46 ?  79   ASP B CG     1 
ATOM   8629  O  OD1    . ASP B  1 79   ? 2.381   4.339   14.773  1.00 177.52 ?  79   ASP B OD1    1 
ATOM   8630  O  OD2    . ASP B  1 79   ? 2.366   2.844   16.398  1.00 185.10 -1 79   ASP B OD2    1 
ATOM   8631  N  N      . GLY B  1 80   ? -2.631  3.803   16.998  1.00 142.84 ?  80   GLY B N      1 
ATOM   8632  C  CA     . GLY B  1 80   ? -4.046  3.563   17.244  1.00 143.07 ?  80   GLY B CA     1 
ATOM   8633  C  C      . GLY B  1 80   ? -4.781  4.872   17.388  1.00 143.37 ?  80   GLY B C      1 
ATOM   8634  O  O      . GLY B  1 80   ? -5.929  5.012   16.950  1.00 141.42 ?  80   GLY B O      1 
ATOM   8635  N  N      . VAL B  1 81   ? -4.094  5.845   17.996  1.00 140.48 ?  81   VAL B N      1 
ATOM   8636  C  CA     . VAL B  1 81   ? -4.548  7.242   18.184  1.00 138.05 ?  81   VAL B CA     1 
ATOM   8637  C  C      . VAL B  1 81   ? -4.645  7.892   16.777  1.00 140.97 ?  81   VAL B C      1 
ATOM   8638  O  O      . VAL B  1 81   ? -5.633  8.568   16.470  1.00 138.40 ?  81   VAL B O      1 
ATOM   8639  C  CB     . VAL B  1 81   ? -3.593  8.037   19.143  1.00 139.70 ?  81   VAL B CB     1 
ATOM   8640  C  CG1    . VAL B  1 81   ? -3.919  9.515   19.132  1.00 136.81 ?  81   VAL B CG1    1 
ATOM   8641  C  CG2    . VAL B  1 81   ? -3.639  7.505   20.579  1.00 139.83 ?  81   VAL B CG2    1 
ATOM   8642  N  N      . LYS B  1 82   ? -3.621  7.632   15.925  1.00 139.01 ?  82   LYS B N      1 
ATOM   8643  C  CA     . LYS B  1 82   ? -3.519  8.107   14.544  1.00 139.01 ?  82   LYS B CA     1 
ATOM   8644  C  C      . LYS B  1 82   ? -4.745  7.641   13.746  1.00 144.62 ?  82   LYS B C      1 
ATOM   8645  O  O      . LYS B  1 82   ? -5.385  8.442   13.043  1.00 142.59 ?  82   LYS B O      1 
ATOM   8646  C  CB     . LYS B  1 82   ? -2.210  7.593   13.896  1.00 143.06 ?  82   LYS B CB     1 
ATOM   8647  C  CG     . LYS B  1 82   ? -0.969  8.430   14.216  1.00 146.23 ?  82   LYS B CG     1 
ATOM   8648  C  CD     . LYS B  1 82   ? 0.269   7.847   13.554  1.00 153.62 ?  82   LYS B CD     1 
ATOM   8649  C  CE     . LYS B  1 82   ? 1.572   8.420   14.056  1.00 162.85 ?  82   LYS B CE     1 
ATOM   8650  N  NZ     . LYS B  1 82   ? 2.710   7.470   13.857  1.00 177.20 1  82   LYS B NZ     1 
ATOM   8651  N  N      . SER B  1 83   ? -5.094  6.348   13.922  1.00 144.12 ?  83   SER B N      1 
ATOM   8652  C  CA     . SER B  1 83   ? -6.234  5.698   13.290  1.00 146.59 ?  83   SER B CA     1 
ATOM   8653  C  C      . SER B  1 83   ? -7.565  6.272   13.777  1.00 149.91 ?  83   SER B C      1 
ATOM   8654  O  O      . SER B  1 83   ? -8.445  6.513   12.956  1.00 152.02 ?  83   SER B O      1 
ATOM   8655  C  CB     . SER B  1 83   ? -6.184  4.197   13.525  1.00 152.29 ?  83   SER B CB     1 
ATOM   8656  O  OG     . SER B  1 83   ? -4.989  3.687   12.962  1.00 161.51 ?  83   SER B OG     1 
ATOM   8657  N  N      . TRP B  1 84   ? -7.706  6.515   15.099  1.00 142.58 ?  84   TRP B N      1 
ATOM   8658  C  CA     . TRP B  1 84   ? -8.924  7.055   15.718  1.00 140.02 ?  84   TRP B CA     1 
ATOM   8659  C  C      . TRP B  1 84   ? -9.295  8.406   15.114  1.00 143.58 ?  84   TRP B C      1 
ATOM   8660  O  O      . TRP B  1 84   ? -10.471 8.649   14.810  1.00 143.27 ?  84   TRP B O      1 
ATOM   8661  C  CB     . TRP B  1 84   ? -8.722  7.155   17.238  1.00 136.29 ?  84   TRP B CB     1 
ATOM   8662  C  CG     . TRP B  1 84   ? -9.927  7.586   18.025  1.00 136.12 ?  84   TRP B CG     1 
ATOM   8663  C  CD1    . TRP B  1 84   ? -10.843 6.778   18.627  1.00 140.85 ?  84   TRP B CD1    1 
ATOM   8664  C  CD2    . TRP B  1 84   ? -10.280 8.936   18.392  1.00 133.40 ?  84   TRP B CD2    1 
ATOM   8665  N  NE1    . TRP B  1 84   ? -11.770 7.534   19.313  1.00 138.79 ?  84   TRP B NE1    1 
ATOM   8666  C  CE2    . TRP B  1 84   ? -11.440 8.862   19.196  1.00 137.55 ?  84   TRP B CE2    1 
ATOM   8667  C  CE3    . TRP B  1 84   ? -9.744  10.214  18.086  1.00 131.99 ?  84   TRP B CE3    1 
ATOM   8668  C  CZ2    . TRP B  1 84   ? -12.067 10.010  19.710  1.00 134.69 ?  84   TRP B CZ2    1 
ATOM   8669  C  CZ3    . TRP B  1 84   ? -10.351 11.343  18.613  1.00 131.04 ?  84   TRP B CZ3    1 
ATOM   8670  C  CH2    . TRP B  1 84   ? -11.504 11.239  19.405  1.00 132.16 ?  84   TRP B CH2    1 
ATOM   8671  N  N      . LEU B  1 85   ? -8.269  9.263   14.929  1.00 140.32 ?  85   LEU B N      1 
ATOM   8672  C  CA     . LEU B  1 85   ? -8.365  10.619  14.386  1.00 138.79 ?  85   LEU B CA     1 
ATOM   8673  C  C      . LEU B  1 85   ? -8.619  10.618  12.889  1.00 147.94 ?  85   LEU B C      1 
ATOM   8674  O  O      . LEU B  1 85   ? -9.308  11.528  12.416  1.00 147.35 ?  85   LEU B O      1 
ATOM   8675  C  CB     . LEU B  1 85   ? -7.074  11.399  14.656  1.00 136.16 ?  85   LEU B CB     1 
ATOM   8676  C  CG     . LEU B  1 85   ? -6.795  11.796  16.077  1.00 136.84 ?  85   LEU B CG     1 
ATOM   8677  C  CD1    . LEU B  1 85   ? -5.308  11.943  16.305  1.00 136.07 ?  85   LEU B CD1    1 
ATOM   8678  C  CD2    . LEU B  1 85   ? -7.499  13.062  16.409  1.00 135.28 ?  85   LEU B CD2    1 
ATOM   8679  N  N      . LYS B  1 86   ? -8.031  9.634   12.129  1.00 147.00 ?  86   LYS B N      1 
ATOM   8680  C  CA     . LYS B  1 86   ? -8.195  9.541   10.665  1.00 148.84 ?  86   LYS B CA     1 
ATOM   8681  C  C      . LYS B  1 86   ? -9.636  9.935   10.199  1.00 152.80 ?  86   LYS B C      1 
ATOM   8682  O  O      . LYS B  1 86   ? -9.746  10.928  9.474   1.00 152.14 ?  86   LYS B O      1 
ATOM   8683  C  CB     . LYS B  1 86   ? -7.748  8.176   10.127  1.00 154.48 ?  86   LYS B CB     1 
ATOM   8684  C  CG     . LYS B  1 86   ? -7.678  8.072   8.604   1.00 166.81 ?  86   LYS B CG     1 
ATOM   8685  C  CD     . LYS B  1 86   ? -7.186  6.679   8.184   1.00 182.13 ?  86   LYS B CD     1 
ATOM   8686  C  CE     . LYS B  1 86   ? -7.556  6.277   6.771   1.00 195.09 ?  86   LYS B CE     1 
ATOM   8687  N  NZ     . LYS B  1 86   ? -7.251  4.841   6.492   1.00 202.93 1  86   LYS B NZ     1 
ATOM   8688  N  N      . PRO B  1 87   ? -10.740 9.314   10.692  1.00 149.39 ?  87   PRO B N      1 
ATOM   8689  C  CA     . PRO B  1 87   ? -12.073 9.767   10.262  1.00 150.36 ?  87   PRO B CA     1 
ATOM   8690  C  C      . PRO B  1 87   ? -12.579 11.072  10.903  1.00 153.86 ?  87   PRO B C      1 
ATOM   8691  O  O      . PRO B  1 87   ? -13.293 11.840  10.243  1.00 155.81 ?  87   PRO B O      1 
ATOM   8692  C  CB     . PRO B  1 87   ? -12.966 8.602   10.670  1.00 154.48 ?  87   PRO B CB     1 
ATOM   8693  C  CG     . PRO B  1 87   ? -12.299 8.035   11.872  1.00 156.83 ?  87   PRO B CG     1 
ATOM   8694  C  CD     . PRO B  1 87   ? -10.845 8.144   11.590  1.00 151.51 ?  87   PRO B CD     1 
ATOM   8695  N  N      . ARG B  1 88   ? -12.229 11.307  12.189  1.00 146.43 ?  88   ARG B N      1 
ATOM   8696  C  CA     . ARG B  1 88   ? -12.699 12.425  13.016  1.00 142.06 ?  88   ARG B CA     1 
ATOM   8697  C  C      . ARG B  1 88   ? -12.055 13.785  12.753  1.00 143.57 ?  88   ARG B C      1 
ATOM   8698  O  O      . ARG B  1 88   ? -12.751 14.803  12.789  1.00 141.82 ?  88   ARG B O      1 
ATOM   8699  C  CB     . ARG B  1 88   ? -12.547 12.074  14.492  1.00 137.45 ?  88   ARG B CB     1 
ATOM   8700  C  CG     . ARG B  1 88   ? -13.475 10.981  14.943  1.00 142.35 ?  88   ARG B CG     1 
ATOM   8701  C  CD     . ARG B  1 88   ? -12.967 10.449  16.245  1.00 140.33 ?  88   ARG B CD     1 
ATOM   8702  N  NE     . ARG B  1 88   ? -13.886 9.494   16.850  1.00 137.31 ?  88   ARG B NE     1 
ATOM   8703  C  CZ     . ARG B  1 88   ? -13.810 8.182   16.683  1.00 144.50 ?  88   ARG B CZ     1 
ATOM   8704  N  NH1    . ARG B  1 88   ? -12.873 7.658   15.899  1.00 127.83 1  88   ARG B NH1    1 
ATOM   8705  N  NH2    . ARG B  1 88   ? -14.674 7.380   17.292  1.00 131.48 ?  88   ARG B NH2    1 
ATOM   8706  N  N      . LEU B  1 89   ? -10.729 13.819  12.573  1.00 139.54 ?  89   LEU B N      1 
ATOM   8707  C  CA     . LEU B  1 89   ? -10.008 15.067  12.355  1.00 136.49 ?  89   LEU B CA     1 
ATOM   8708  C  C      . LEU B  1 89   ? -10.441 15.679  11.036  1.00 140.79 ?  89   LEU B C      1 
ATOM   8709  O  O      . LEU B  1 89   ? -10.430 15.011  10.000  1.00 143.32 ?  89   LEU B O      1 
ATOM   8710  C