data_6I0D
# 
_entry.id   6I0D 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.383 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   6I0D         pdb_00006i0d 10.2210/pdb6i0d/pdb 
WWPDB D_1200012108 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2020-09-02 
2 'Structure model' 1 1 2024-01-24 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Data collection'        
2 2 'Structure model' 'Database references'    
3 2 'Structure model' 'Refinement description' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' chem_comp_atom                
2 2 'Structure model' chem_comp_bond                
3 2 'Structure model' database_2                    
4 2 'Structure model' pdbx_initial_refinement_model 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_database_2.pdbx_DOI'                
2 2 'Structure model' '_database_2.pdbx_database_accession' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6I0D 
_pdbx_database_status.recvd_initial_deposition_date   2018-10-25 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Gutierrez-Fernandez, J.' 1 ?                   
'Minhas, G.S.'            2 ?                   
'Sazanov, L.A.'           3 0000-0002-0977-7989 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nat Commun' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2041-1723 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            11 
_citation.language                  ? 
_citation.page_first                4135 
_citation.page_last                 4135 
_citation.title                     'Key role of quinone in the mechanism of respiratory complex I.' 
_citation.year                      2020 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/s41467-020-17957-0 
_citation.pdbx_database_id_PubMed   32811817 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Gutierrez-Fernandez, J.' 1 ?                   
primary 'Kaszuba, K.'             2 ?                   
primary 'Minhas, G.S.'            3 ?                   
primary 'Baradaran, R.'           4 ?                   
primary 'Tambalo, M.'             5 ?                   
primary 'Gallagher, D.T.'         6 ?                   
primary 'Sazanov, L.A.'           7 0000-0002-0977-7989 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat 'NADH-quinone oxidoreductase subunit 1'                     48693.715 2  1.6.5.11 ? ? ? 
2  polymer     nat 'NADH-quinone oxidoreductase subunit 2'                     20309.162 2  1.6.5.11 ? ? ? 
3  polymer     nat 'NADH-quinone oxidoreductase subunit 3'                     86656.203 2  1.6.5.11 ? ? ? 
4  polymer     nat 'NADH-quinone oxidoreductase subunit 4'                     46428.027 2  1.6.5.11 ? ? ? 
5  polymer     nat 'NADH-quinone oxidoreductase subunit 5'                     23893.254 2  1.6.5.11 ? ? ? 
6  polymer     nat 'NADH-quinone oxidoreductase subunit 6'                     20262.564 2  1.6.5.11 ? ? ? 
7  polymer     nat 'NADH-quinone oxidoreductase subunit 9'                     20106.309 2  1.6.5.11 ? ? ? 
8  polymer     nat 'NADH-quinone oxidoreductase subunit 15'                    14812.074 2  1.6.5.11 ? ? ? 
9  polymer     nat 'NADH-quinone oxidoreductase subunit 16'                    14201.612 2  ?        ? ? ? 
10 polymer     nat 'NADH-quinone oxidoreductase subunit 7'                     13154.656 2  1.6.5.11 ? ? ? 
11 polymer     nat 'NADH-quinone oxidoreductase subunit 10'                    18563.330 2  1.6.5.11 ? ? ? 
12 polymer     nat 'NADH-quinone oxidoreductase subunit 11'                    10002.788 2  1.6.5.11 ? ? ? 
13 polymer     nat 'NADH-quinone oxidoreductase subunit 12'                    65189.930 2  1.6.5.11 ? ? ? 
14 polymer     nat 'NADH-quinone oxidoreductase subunit 13'                    49247.117 2  1.6.5.11 ? ? ? 
15 polymer     nat 'NADH-quinone oxidoreductase subunit 14'                    44463.895 2  1.6.5.11 ? ? ? 
16 polymer     nat 'NADH-quinone oxidoreductase subunit 8'                     41034.523 2  1.6.5.11 ? ? ? 
17 non-polymer syn 'IRON/SULFUR CLUSTER'                                       351.640   14 ?        ? ? ? 
18 non-polymer syn 'FLAVIN MONONUCLEOTIDE'                                     456.344   2  ?        ? ? ? 
19 non-polymer syn 'FE2/S2 (INORGANIC) CLUSTER'                                175.820   4  ?        ? ? ? 
20 non-polymer syn 2-decyl-5,6-dimethoxy-3-methylcyclohexa-2,5-diene-1,4-dione 322.439   2  ?        ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1  'NADH dehydrogenase I chain 1,NDH-1 subunit 1'   
2  'NADH dehydrogenase I chain 2,NDH-1 subunit 2'   
3  'NADH dehydrogenase I chain 3,NDH-1 subunit 3'   
4  'NADH dehydrogenase I chain 4,NDH-1 subunit 4'   
5  'NADH dehydrogenase I chain 5,NDH-1 subunit 5'   
6  'NADH dehydrogenase I subunit 6,NDH-1 subunit 6' 
7  'NADH dehydrogenase I subunit 9,NDH-1 subunit 9' 
8  'NADH dehydrogenase I chain 15,NDH-1 subunit 15' 
10 'NADH dehydrogenase I chain 7,NDH-1 subunit 7'   
11 'NADH dehydrogenase I chain 10,NDH-1 subunit 10' 
12 'NADH dehydrogenase I chain 11,NDH-1 subunit 11' 
13 'NADH dehydrogenase I chain 12,NDH-1 subunit 12' 
14 'NADH dehydrogenase I chain 13,NDH-1 subunit 13' 
15 'NADH dehydrogenase I chain 14,NDH-1 subunit 14' 
16 'NADH dehydrogenase I subunit 8,NDH-1 subunit 8' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1  'polypeptide(L)' no no 
;MTGPILSGLDPRFERTLYAHVGKEGSWTLDYYLRHGGYETAKRVLKEKTPDEVIEEVKRSGLRGRGGAGFPTGLKWSFMP
KDDGKQHYLICNADESEPGSFKDRYILEDVPHLLIEGMILAGYAIRATVGYIYVRGEYRRAADRLEQAIKEARARGYLGK
NLFGTDFSFDLHVHRGAGAYICGEETALMNSLEGLRANPRLKPPFPAQSGLWGKPTTINNVETLASVVPIMERGADWFAQ
MGTEQSKGMKLYQISGPVKRPGVYELPMGTTFRELIYEWAGGPLEPIQAIIPGGSSTPPLPFTEEVLDTPMSYEHLQAKG
SMLGTGGVILIPERVSMVDAMWNLTRFYAHESCGKCTPCREGVAGFMVNLFAKIGTGQGEEKDVENLEALLPLIEGRSFC
PLADAAVWPVKGSLRHFKDQYLALAREKRPVPRPSLWR
;
;MTGPILSGLDPRFERTLYAHVGKEGSWTLDYYLRHGGYETAKRVLKEKTPDEVIEEVKRSGLRGRGGAGFPTGLKWSFMP
KDDGKQHYLICNADESEPGSFKDRYILEDVPHLLIEGMILAGYAIRATVGYIYVRGEYRRAADRLEQAIKEARARGYLGK
NLFGTDFSFDLHVHRGAGAYICGEETALMNSLEGLRANPRLKPPFPAQSGLWGKPTTINNVETLASVVPIMERGADWFAQ
MGTEQSKGMKLYQISGPVKRPGVYELPMGTTFRELIYEWAGGPLEPIQAIIPGGSSTPPLPFTEEVLDTPMSYEHLQAKG
SMLGTGGVILIPERVSMVDAMWNLTRFYAHESCGKCTPCREGVAGFMVNLFAKIGTGQGEEKDVENLEALLPLIEGRSFC
PLADAAVWPVKGSLRHFKDQYLALAREKRPVPRPSLWR
;
1,B ? 
2  'polypeptide(L)' no no 
;MGFFDDKQDFLEETFAKYPPEGRRAAIMPLLRRVQQEEGWIRPERIEEIARLVGTTPTEVMGVASFYSYYQFVPTGKYHL
QVCATLSCKLAGAEELWDYLTETLGIGPGEVTPDGLFSVQKVECLGSCHTAPVIQVNDEPYVECVTRARLEALLAGLRAG
KRLEEIELPGKCGHHVHEVEV
;
;MGFFDDKQDFLEETFAKYPPEGRRAAIMPLLRRVQQEEGWIRPERIEEIARLVGTTPTEVMGVASFYSYYQFVPTGKYHL
QVCATLSCKLAGAEELWDYLTETLGIGPGEVTPDGLFSVQKVECLGSCHTAPVIQVNDEPYVECVTRARLEALLAGLRAG
KRLEEIELPGKCGHHVHEVEV
;
2,C ? 
3  'polypeptide(L)' no no 
;MVRVKVNDRIVEVPPGTSVMDAVFHAGYDVPLFCSEKHLSPIGACRMCLVRIGLPKKGPDGKPLLNEKGEPEIQWQPKLA
ASCVTAVADGMVVDTLSDVVREAQAGMVEFTLLNHPLDCPTCDKGGACELQDRTVEYGLYEKYYQKGPLELPVYTRFEFT
RRHVDKHHPLSPFVILDRERCIHCKRCVRYFEEVPGDEVLDFIERGVHTFIGTMDFGLPSGFSGNITDICPVGALLDLTA
RFRARNWEMEETPTTCALCPVGCGITADTRSGELLRIRAREVPEVNEIWICDAGRFGHEWADQNRLKTPLVRKEGRLVEA
TWEEAFLALKEGLKEARGEEVGLYLAHDATLEEGLLASELAKALKTPHLDFQGRTAAPASLFPPASLEDLLQADFALVLG
DPTEEAPILHLRLSEFVRDLKPPHRYNHGTPFADLQIKERMPRRTDKMALFAPYRAPLMKWAAIHEVHRPGEEREILLAL
LGDKEGSEMVAKAKEAWEKAKNPVLILGAGVLQDTVAAERARLLAERKGAKVLAMTPAANARGLEAMGVLPGAKGASWDE
PGALYAYYGFVPPEEALKGKRFVVMHLSHLHPLAERYAHVVLPAPTFYEKRGHLVNLEGRVLPLSPAPIENGEAEGALQV
LALLAEALGVRPPFRLHLEAQKALKARKVPEAMGRLSFRLKELRPKERKGAFYLRPTMWKAHQAVGKAQEAARAELWAHP
ETARAEALPEGAQVAVETPFGRVEARVVHREDVPKGHLYLSALGPAAGLRVEGRVLVPAGGEA
;
;MVRVKVNDRIVEVPPGTSVMDAVFHAGYDVPLFCSEKHLSPIGACRMCLVRIGLPKKGPDGKPLLNEKGEPEIQWQPKLA
ASCVTAVADGMVVDTLSDVVREAQAGMVEFTLLNHPLDCPTCDKGGACELQDRTVEYGLYEKYYQKGPLELPVYTRFEFT
RRHVDKHHPLSPFVILDRERCIHCKRCVRYFEEVPGDEVLDFIERGVHTFIGTMDFGLPSGFSGNITDICPVGALLDLTA
RFRARNWEMEETPTTCALCPVGCGITADTRSGELLRIRAREVPEVNEIWICDAGRFGHEWADQNRLKTPLVRKEGRLVEA
TWEEAFLALKEGLKEARGEEVGLYLAHDATLEEGLLASELAKALKTPHLDFQGRTAAPASLFPPASLEDLLQADFALVLG
DPTEEAPILHLRLSEFVRDLKPPHRYNHGTPFADLQIKERMPRRTDKMALFAPYRAPLMKWAAIHEVHRPGEEREILLAL
LGDKEGSEMVAKAKEAWEKAKNPVLILGAGVLQDTVAAERARLLAERKGAKVLAMTPAANARGLEAMGVLPGAKGASWDE
PGALYAYYGFVPPEEALKGKRFVVMHLSHLHPLAERYAHVVLPAPTFYEKRGHLVNLEGRVLPLSPAPIENGEAEGALQV
LALLAEALGVRPPFRLHLEAQKALKARKVPEAMGRLSFRLKELRPKERKGAFYLRPTMWKAHQAVGKAQEAARAELWAHP
ETARAEALPEGAQVAVETPFGRVEARVVHREDVPKGHLYLSALGPAAGLRVEGRVLVPAGGEA
;
3,D ? 
4  'polypeptide(L)' no no 
;MREEFLEEIPLDAPPEEAKELRTEVMTLNVGPQHPSTHGVLRLMVTLSGEEVLEVVPHIGYLHTGFEKTMEHRTYLQNIT
YTPRMDYLHSFAHDLAYALAVEKLLGAVVPPRAETIRVILNELSRLASHLVFLGTGLLDLGALTPFFYAFRERETILDLF
EWVTGQRFHHNYIRIGGVKEDLPEEFVPELKKLLEVLPHRIDEYEALFAESPIFYERARGVGVIPPEVAIDLGLTGGSLR
ASGVNYDVRKAYPYSGYETYTFDVPLGERGDVFDRMLVRIREMRESVKIIKQALERLEPGPVRDPNPQITPPPRHLLETS
MEAVIYHFKHYTEGFHPPKGEVYVPTESARGELGYYIVSDGGSMPYRVKVRAPSFVNLQSLPYACKGEQVPDMVAIIASL
DPVMGDVDR
;
;MREEFLEEIPLDAPPEEAKELRTEVMTLNVGPQHPSTHGVLRLMVTLSGEEVLEVVPHIGYLHTGFEKTMEHRTYLQNIT
YTPRMDYLHSFAHDLAYALAVEKLLGAVVPPRAETIRVILNELSRLASHLVFLGTGLLDLGALTPFFYAFRERETILDLF
EWVTGQRFHHNYIRIGGVKEDLPEEFVPELKKLLEVLPHRIDEYEALFAESPIFYERARGVGVIPPEVAIDLGLTGGSLR
ASGVNYDVRKAYPYSGYETYTFDVPLGERGDVFDRMLVRIREMRESVKIIKQALERLEPGPVRDPNPQITPPPRHLLETS
MEAVIYHFKHYTEGFHPPKGEVYVPTESARGELGYYIVSDGGSMPYRVKVRAPSFVNLQSLPYACKGEQVPDMVAIIASL
DPVMGDVDR
;
4,E ? 
5  'polypeptide(L)' no no 
;MRLERVLEEARAKGYPIEDNGLGNLWVVLPRERFKEEMAHYKAMGFNFLADIVGLDYLTYPDPRPERFAVVYELVSLPGW
KDGDGSRFFVRVYVPEEDPRLPTVTDLWGSANFLEREVYDLFGIVFEGHPDLRKILTPEDLEGHPLRKDYPLGETPTLFR
EGRYIIPAEFRAALTGKDPGLTFYKGGSRKGYRSLWADLKKAREVKG
;
;MRLERVLEEARAKGYPIEDNGLGNLWVVLPRERFKEEMAHYKAMGFNFLADIVGLDYLTYPDPRPERFAVVYELVSLPGW
KDGDGSRFFVRVYVPEEDPRLPTVTDLWGSANFLEREVYDLFGIVFEGHPDLRKILTPEDLEGHPLRKDYPLGETPTLFR
EGRYIIPAEFRAALTGKDPGLTFYKGGSRKGYRSLWADLKKAREVKG
;
5,F ? 
6  'polypeptide(L)' no no 
;MALKDLFERDVQELEREGILFTTLEKLVAWGRSNSLWPATFGLACCAIEMMASTDARNDLARFGSEVFRASPRQADVMIV
AGRLSKKMAPVMRRVWEQMPDPKWVISMGACASSGGMFNNYAIVQNVDSVVPVDVYVPGCPPRPEALIYAVMQLQKKVRG
QAYNERGERLPPVAAWKRTRG
;
;MALKDLFERDVQELEREGILFTTLEKLVAWGRSNSLWPATFGLACCAIEMMASTDARNDLARFGSEVFRASPRQADVMIV
AGRLSKKMAPVMRRVWEQMPDPKWVISMGACASSGGMFNNYAIVQNVDSVVPVDVYVPGCPPRPEALIYAVMQLQKKVRG
QAYNERGERLPPVAAWKRTRG
;
6,G ? 
7  'polypeptide(L)' no no 
;MTLKALAQSLGITLKYLFSKPVTVPYPDAPVALKPRFHGRHVLTRHPNGLEKCIGCSLCAAACPAYAIYVEPAENDPENP
VSAGERYAKVYEINMLRCIFCGLCEEACPTGAIVLGYDFEMADYEYSDLVYGKEDMLVDVVGTKPQRREAKRTGKPVKVG
YVVPYVRPELEGFKAPTEGGKR
;
;MTLKALAQSLGITLKYLFSKPVTVPYPDAPVALKPRFHGRHVLTRHPNGLEKCIGCSLCAAACPAYAIYVEPAENDPENP
VSAGERYAKVYEINMLRCIFCGLCEEACPTGAIVLGYDFEMADYEYSDLVYGKEDMLVDVVGTKPQRREAKRTGKPVKVG
YVVPYVRPELEGFKAPTEGGKR
;
9,O ? 
8  'polypeptide(L)' no no 
;MSASSERELYEAWVELLSWMREYAQAKGVRFEKEADFPDFIYRMERPYDLPTTIMTASLSDGLGEPFLLADVSPRHAKLK
RIGLRLPRAHIHLHAHYEPGKGLVTGKIPLTKERFFALADRAREALAFA
;
;MSASSERELYEAWVELLSWMREYAQAKGVRFEKEADFPDFIYRMERPYDLPTTIMTASLSDGLGEPFLLADVSPRHAKLK
RIGLRLPRAHIHLHAHYEPGKGLVTGKIPLTKERFFALADRAREALAFA
;
7,I ? 
9  'polypeptide(L)' no no 
;MVRVGMRAAPRVSLEALKAALGGLKLSEAKVYLITDWQDKRDQARYALLLHTGKKDLLVPDAFGPAFPGGEEALSELVGL
LLAQGARRFYEAVVSPGEMTALLDLPPEELLKRVMAIANPTDPGIYLKRAA
;
;MVRVGMRAAPRVSLEALKAALGGLKLSEAKVYLITDWQDKRDQARYALLLHTGKKDLLVPDAFGPAFPGGEEALSELVGL
LLAQGARRFYEAVVSPGEMTALLDLPPEELLKRVMAIANPTDPGIYLKRAA
;
W,X ? 
10 'polypeptide(L)' no no 
;MAPIQEYVGTLIYVGVALFIGVAALLVGALLGPKKPGRAKLMPYESGNDPAGEVKRFPVHFYVVAMLFILFDVEVAFLWP
YAVSAGGLGLYGFLGVLAFTLLLFVGFLYEWWKGVMRWH
;
;MAPIQEYVGTLIYVGVALFIGVAALLVGALLGPKKPGRAKLMPYESGNDPAGEVKRFPVHFYVVAMLFILFDVEVAFLWP
YAVSAGGLGLYGFLGVLAFTLLLFVGFLYEWWKGVMRWH
;
A,P ? 
11 'polypeptide(L)' no no 
;MSLLEGLALFLLLLSGVLVVTLRNAIHAALALILNFLVLAGVYVALDARFLGFIQVIVYAGAIVVLFLFVIMLLFAAQGE
IGFDPLVRSRPLAALLALGVAGILAAGLWGLDLAFTQDLKGGLPQALGPLLYGDWLFVLLAVGFLLMAATVVAVALVEPG
KASRAKEAEKREEVAR
;
;MSLLEGLALFLLLLSGVLVVTLRNAIHAALALILNFLVLAGVYVALDARFLGFIQVIVYAGAIVVLFLFVIMLLFAAQGE
IGFDPLVRSRPLAALLALGVAGILAAGLWGLDLAFTQDLKGGLPQALGPLLYGDWLFVLLAVGFLLMAATVVAVALVEPG
KASRAKEAEKREEVAR
;
J,R ? 
12 'polypeptide(L)' no no 
;MSYLLTSALLFALGVYGVLTRRTAILVFLSIELMLNAANLSLVGFARAYGLDGQVAALMVIAVAAAEVAVGLGLIVAIFR
HRESTAVDDLSELRG
;
;MSYLLTSALLFALGVYGVLTRRTAILVFLSIELMLNAANLSLVGFARAYGLDGQVAALMVIAVAAAEVAVGLGLIVAIFR
HRESTAVDDLSELRG
;
K,S ? 
13 'polypeptide(L)' no no 
;MALLGTILLPLLGFALLGLFGKRMREPLPGVLASGLVLASFLLGAGLLLSGGARFQAEWLPGIPFSLLLDNLSGFMLLIV
TGVGFLIHVYAIGYMGGDPGYSRFFAYFNLFIAMMLTLVLADSYPVMFIGWEGVGLASFLLIGFWYKNPQYADSARKAFI
VNRIGDLGFMLGMAILWALYGTLSISELKEAMEGPLKNPDLLALAGLLLFLGAVGKSAQIPLMVWLPDAMAGPTPVSALI
HAATMVTAGVYLIARSSFLYSVLPDVSYAIAVVGLLTAAYGALSAFGQTDIKKIVAYSTISQLGYMFLAAGVGAYWVALF
HVFTHAFFKALLFLASGSVIHALGGEQDVRKMGGLWKHLPQTRWHALIGALALGGLPLLSGFWSKDAILAATLTYPFGGV
GFYVGALLVAVLTAMYAMRWFVLVFLGEERGHHHPHEAPPVMLWPNHLLALGSVLAGYLALPHPLPNVLEPFLKPALAEV
EAHHLSLGAEWGLIALSAAVALLGLWAGFVFFQRKVFPAWYLAFEAASREAFYVDRAYNALIVNPLKALAEALFYGDRGL
LSGYFGLGGAARSLGQGLARLQTGYLRVYALLFVLGALLLLGVMRW
;
;MALLGTILLPLLGFALLGLFGKRMREPLPGVLASGLVLASFLLGAGLLLSGGARFQAEWLPGIPFSLLLDNLSGFMLLIV
TGVGFLIHVYAIGYMGGDPGYSRFFAYFNLFIAMMLTLVLADSYPVMFIGWEGVGLASFLLIGFWYKNPQYADSARKAFI
VNRIGDLGFMLGMAILWALYGTLSISELKEAMEGPLKNPDLLALAGLLLFLGAVGKSAQIPLMVWLPDAMAGPTPVSALI
HAATMVTAGVYLIARSSFLYSVLPDVSYAIAVVGLLTAAYGALSAFGQTDIKKIVAYSTISQLGYMFLAAGVGAYWVALF
HVFTHAFFKALLFLASGSVIHALGGEQDVRKMGGLWKHLPQTRWHALIGALALGGLPLLSGFWSKDAILAATLTYPFGGV
GFYVGALLVAVLTAMYAMRWFVLVFLGEERGHHHPHEAPPVMLWPNHLLALGSVLAGYLALPHPLPNVLEPFLKPALAEV
EAHHLSLGAEWGLIALSAAVALLGLWAGFVFFQRKVFPAWYLAFEAASREAFYVDRAYNALIVNPLKALAEALFYGDRGL
LSGYFGLGGAARSLGQGLARLQTGYLRVYALLFVLGALLLLGVMRW
;
L,T ? 
14 'polypeptide(L)' no no 
;MVVLAVLLPVVFGALLLLGLPRALGVLGAGLSFLLNLYLFLTHPGGVAHAFQAPLLPGAGVYWAFGLDGLSALFFLTIAL
TVFLGALVARVEGRFLGLALLMEGLLLGLFAARDLLVFYVFFEAALIPALLMLYLYGGEGRTRALYTFVLFTLVGSLPML
AAVLGARLLSGSPTFLLEDLLAHPLQEEAAFWVFLGFALAFAIKTPLFPLHAWLPPFHQENHPSGLADALGTLYKVGVFA
FFRFAIPLAPEGFAQAQGLLLFLAALSALYGAWVAFAAKDFKTLLAYAGLSHMGVAALGVFSGTPEGAMGGLYLLAASGV
YTGGLFLLAGRLYERTGTLEIGRYRGLAQSAPGLAALALILFLAMVGLPGLSGFPGEFLTLLGAYKASPWLAALAFLSVI
ASAAYALTAFQKTFWEEGGSGVKDLAGAEWGFALLSVLALLLMGVFPGYFARGLHPLAEAFAKLLGGGA
;
;MVVLAVLLPVVFGALLLLGLPRALGVLGAGLSFLLNLYLFLTHPGGVAHAFQAPLLPGAGVYWAFGLDGLSALFFLTIAL
TVFLGALVARVEGRFLGLALLMEGLLLGLFAARDLLVFYVFFEAALIPALLMLYLYGGEGRTRALYTFVLFTLVGSLPML
AAVLGARLLSGSPTFLLEDLLAHPLQEEAAFWVFLGFALAFAIKTPLFPLHAWLPPFHQENHPSGLADALGTLYKVGVFA
FFRFAIPLAPEGFAQAQGLLLFLAALSALYGAWVAFAAKDFKTLLAYAGLSHMGVAALGVFSGTPEGAMGGLYLLAASGV
YTGGLFLLAGRLYERTGTLEIGRYRGLAQSAPGLAALALILFLAMVGLPGLSGFPGEFLTLLGAYKASPWLAALAFLSVI
ASAAYALTAFQKTFWEEGGSGVKDLAGAEWGFALLSVLALLLMGVFPGYFARGLHPLAEAFAKLLGGGA
;
M,U ? 
15 'polypeptide(L)' no no 
;MTLAILAVFSVALTLLGFVLPPQGVKRATLLGLALALASLLLTWGKPFAFGPYAVDGVSQVFTLLALLGALWTVGLVRSG
RFEFYLLVLYAALGMHLLASTRHLLLMLVALEALSLPLYALATWRRGQGLEAALKYFLLGALAAAFFLYGAALFYGATGS
LVLGAPGEGPLYALALGLLLVGLGFKAALAPFHFWTPDVYQGSPTPVVLFMATSVKAAAFAALLRVAAPPEALALLVALS
VVVGNLAALAQKEAKRLLAYSSIAHAGYMALALYTGNAQALGFYLLTYVLATGLAFAVLSQISPDRVPLEALRGLYRKDP
LLGLAFLVAMLSLLGLPPLAGFWGKYLAFAEAARAGAWGVLVLALVTSAVSAYYYLGLGLAVFARPEETPFRPGPPWARA
AVVAAGVLLLALGLLPGLVLPALAAGG
;
;MTLAILAVFSVALTLLGFVLPPQGVKRATLLGLALALASLLLTWGKPFAFGPYAVDGVSQVFTLLALLGALWTVGLVRSG
RFEFYLLVLYAALGMHLLASTRHLLLMLVALEALSLPLYALATWRRGQGLEAALKYFLLGALAAAFFLYGAALFYGATGS
LVLGAPGEGPLYALALGLLLVGLGFKAALAPFHFWTPDVYQGSPTPVVLFMATSVKAAAFAALLRVAAPPEALALLVALS
VVVGNLAALAQKEAKRLLAYSSIAHAGYMALALYTGNAQALGFYLLTYVLATGLAFAVLSQISPDRVPLEALRGLYRKDP
LLGLAFLVAMLSLLGLPPLAGFWGKYLAFAEAARAGAWGVLVLALVTSAVSAYYYLGLGLAVFARPEETPFRPGPPWARA
AVVAAGVLLLALGLLPGLVLPALAAGG
;
N,V ? 
16 'polypeptide(L)' no no 
;MTWSYPVDPYWMVALKALLVVVGLLTAFAFMTLIERRLLARFQVRMGPNRVGPFGLLQPLADAIKSIFKEDIVVAQADRF
LFVLAPLISVVFALLAFGLIPFGPPGSFFGYQPWVINLDLGILYLFAVSELAVYGIFLSGWASGSKYSLLGSLRSSASLI
SYELGLGLALLAPVLLVGSLNLNDIVNWQKEHGWLFLYAFPAFLVYLIASMAEAARTPFDLPEAEQELVGGYHTEYSSIK
WALFQMAEYIHFITASALIPTLFLGGWTMPVLEVPYLWMFLKIAFFLFFFIWIRATWFRLRYDQLLRFGWGFLFPLALLW
FLVTALVVALDLPRTYLLYLSALSFLVLLGAVLYTPKPARKGGGA
;
;MTWSYPVDPYWMVALKALLVVVGLLTAFAFMTLIERRLLARFQVRMGPNRVGPFGLLQPLADAIKSIFKEDIVVAQADRF
LFVLAPLISVVFALLAFGLIPFGPPGSFFGYQPWVINLDLGILYLFAVSELAVYGIFLSGWASGSKYSLLGSLRSSASLI
SYELGLGLALLAPVLLVGSLNLNDIVNWQKEHGWLFLYAFPAFLVYLIASMAEAARTPFDLPEAEQELVGGYHTEYSSIK
WALFQMAEYIHFITASALIPTLFLGGWTMPVLEVPYLWMFLKIAFFLFFFIWIRATWFRLRYDQLLRFGWGFLFPLALLW
FLVTALVVALDLPRTYLLYLSALSFLVLLGAVLYTPKPARKGGGA
;
H,Q ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
17 'IRON/SULFUR CLUSTER'                                       SF4 
18 'FLAVIN MONONUCLEOTIDE'                                     FMN 
19 'FE2/S2 (INORGANIC) CLUSTER'                                FES 
20 2-decyl-5,6-dimethoxy-3-methylcyclohexa-2,5-diene-1,4-dione DCQ 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1  1   MET n 
1  2   THR n 
1  3   GLY n 
1  4   PRO n 
1  5   ILE n 
1  6   LEU n 
1  7   SER n 
1  8   GLY n 
1  9   LEU n 
1  10  ASP n 
1  11  PRO n 
1  12  ARG n 
1  13  PHE n 
1  14  GLU n 
1  15  ARG n 
1  16  THR n 
1  17  LEU n 
1  18  TYR n 
1  19  ALA n 
1  20  HIS n 
1  21  VAL n 
1  22  GLY n 
1  23  LYS n 
1  24  GLU n 
1  25  GLY n 
1  26  SER n 
1  27  TRP n 
1  28  THR n 
1  29  LEU n 
1  30  ASP n 
1  31  TYR n 
1  32  TYR n 
1  33  LEU n 
1  34  ARG n 
1  35  HIS n 
1  36  GLY n 
1  37  GLY n 
1  38  TYR n 
1  39  GLU n 
1  40  THR n 
1  41  ALA n 
1  42  LYS n 
1  43  ARG n 
1  44  VAL n 
1  45  LEU n 
1  46  LYS n 
1  47  GLU n 
1  48  LYS n 
1  49  THR n 
1  50  PRO n 
1  51  ASP n 
1  52  GLU n 
1  53  VAL n 
1  54  ILE n 
1  55  GLU n 
1  56  GLU n 
1  57  VAL n 
1  58  LYS n 
1  59  ARG n 
1  60  SER n 
1  61  GLY n 
1  62  LEU n 
1  63  ARG n 
1  64  GLY n 
1  65  ARG n 
1  66  GLY n 
1  67  GLY n 
1  68  ALA n 
1  69  GLY n 
1  70  PHE n 
1  71  PRO n 
1  72  THR n 
1  73  GLY n 
1  74  LEU n 
1  75  LYS n 
1  76  TRP n 
1  77  SER n 
1  78  PHE n 
1  79  MET n 
1  80  PRO n 
1  81  LYS n 
1  82  ASP n 
1  83  ASP n 
1  84  GLY n 
1  85  LYS n 
1  86  GLN n 
1  87  HIS n 
1  88  TYR n 
1  89  LEU n 
1  90  ILE n 
1  91  CYS n 
1  92  ASN n 
1  93  ALA n 
1  94  ASP n 
1  95  GLU n 
1  96  SER n 
1  97  GLU n 
1  98  PRO n 
1  99  GLY n 
1  100 SER n 
1  101 PHE n 
1  102 LYS n 
1  103 ASP n 
1  104 ARG n 
1  105 TYR n 
1  106 ILE n 
1  107 LEU n 
1  108 GLU n 
1  109 ASP n 
1  110 VAL n 
1  111 PRO n 
1  112 HIS n 
1  113 LEU n 
1  114 LEU n 
1  115 ILE n 
1  116 GLU n 
1  117 GLY n 
1  118 MET n 
1  119 ILE n 
1  120 LEU n 
1  121 ALA n 
1  122 GLY n 
1  123 TYR n 
1  124 ALA n 
1  125 ILE n 
1  126 ARG n 
1  127 ALA n 
1  128 THR n 
1  129 VAL n 
1  130 GLY n 
1  131 TYR n 
1  132 ILE n 
1  133 TYR n 
1  134 VAL n 
1  135 ARG n 
1  136 GLY n 
1  137 GLU n 
1  138 TYR n 
1  139 ARG n 
1  140 ARG n 
1  141 ALA n 
1  142 ALA n 
1  143 ASP n 
1  144 ARG n 
1  145 LEU n 
1  146 GLU n 
1  147 GLN n 
1  148 ALA n 
1  149 ILE n 
1  150 LYS n 
1  151 GLU n 
1  152 ALA n 
1  153 ARG n 
1  154 ALA n 
1  155 ARG n 
1  156 GLY n 
1  157 TYR n 
1  158 LEU n 
1  159 GLY n 
1  160 LYS n 
1  161 ASN n 
1  162 LEU n 
1  163 PHE n 
1  164 GLY n 
1  165 THR n 
1  166 ASP n 
1  167 PHE n 
1  168 SER n 
1  169 PHE n 
1  170 ASP n 
1  171 LEU n 
1  172 HIS n 
1  173 VAL n 
1  174 HIS n 
1  175 ARG n 
1  176 GLY n 
1  177 ALA n 
1  178 GLY n 
1  179 ALA n 
1  180 TYR n 
1  181 ILE n 
1  182 CYS n 
1  183 GLY n 
1  184 GLU n 
1  185 GLU n 
1  186 THR n 
1  187 ALA n 
1  188 LEU n 
1  189 MET n 
1  190 ASN n 
1  191 SER n 
1  192 LEU n 
1  193 GLU n 
1  194 GLY n 
1  195 LEU n 
1  196 ARG n 
1  197 ALA n 
1  198 ASN n 
1  199 PRO n 
1  200 ARG n 
1  201 LEU n 
1  202 LYS n 
1  203 PRO n 
1  204 PRO n 
1  205 PHE n 
1  206 PRO n 
1  207 ALA n 
1  208 GLN n 
1  209 SER n 
1  210 GLY n 
1  211 LEU n 
1  212 TRP n 
1  213 GLY n 
1  214 LYS n 
1  215 PRO n 
1  216 THR n 
1  217 THR n 
1  218 ILE n 
1  219 ASN n 
1  220 ASN n 
1  221 VAL n 
1  222 GLU n 
1  223 THR n 
1  224 LEU n 
1  225 ALA n 
1  226 SER n 
1  227 VAL n 
1  228 VAL n 
1  229 PRO n 
1  230 ILE n 
1  231 MET n 
1  232 GLU n 
1  233 ARG n 
1  234 GLY n 
1  235 ALA n 
1  236 ASP n 
1  237 TRP n 
1  238 PHE n 
1  239 ALA n 
1  240 GLN n 
1  241 MET n 
1  242 GLY n 
1  243 THR n 
1  244 GLU n 
1  245 GLN n 
1  246 SER n 
1  247 LYS n 
1  248 GLY n 
1  249 MET n 
1  250 LYS n 
1  251 LEU n 
1  252 TYR n 
1  253 GLN n 
1  254 ILE n 
1  255 SER n 
1  256 GLY n 
1  257 PRO n 
1  258 VAL n 
1  259 LYS n 
1  260 ARG n 
1  261 PRO n 
1  262 GLY n 
1  263 VAL n 
1  264 TYR n 
1  265 GLU n 
1  266 LEU n 
1  267 PRO n 
1  268 MET n 
1  269 GLY n 
1  270 THR n 
1  271 THR n 
1  272 PHE n 
1  273 ARG n 
1  274 GLU n 
1  275 LEU n 
1  276 ILE n 
1  277 TYR n 
1  278 GLU n 
1  279 TRP n 
1  280 ALA n 
1  281 GLY n 
1  282 GLY n 
1  283 PRO n 
1  284 LEU n 
1  285 GLU n 
1  286 PRO n 
1  287 ILE n 
1  288 GLN n 
1  289 ALA n 
1  290 ILE n 
1  291 ILE n 
1  292 PRO n 
1  293 GLY n 
1  294 GLY n 
1  295 SER n 
1  296 SER n 
1  297 THR n 
1  298 PRO n 
1  299 PRO n 
1  300 LEU n 
1  301 PRO n 
1  302 PHE n 
1  303 THR n 
1  304 GLU n 
1  305 GLU n 
1  306 VAL n 
1  307 LEU n 
1  308 ASP n 
1  309 THR n 
1  310 PRO n 
1  311 MET n 
1  312 SER n 
1  313 TYR n 
1  314 GLU n 
1  315 HIS n 
1  316 LEU n 
1  317 GLN n 
1  318 ALA n 
1  319 LYS n 
1  320 GLY n 
1  321 SER n 
1  322 MET n 
1  323 LEU n 
1  324 GLY n 
1  325 THR n 
1  326 GLY n 
1  327 GLY n 
1  328 VAL n 
1  329 ILE n 
1  330 LEU n 
1  331 ILE n 
1  332 PRO n 
1  333 GLU n 
1  334 ARG n 
1  335 VAL n 
1  336 SER n 
1  337 MET n 
1  338 VAL n 
1  339 ASP n 
1  340 ALA n 
1  341 MET n 
1  342 TRP n 
1  343 ASN n 
1  344 LEU n 
1  345 THR n 
1  346 ARG n 
1  347 PHE n 
1  348 TYR n 
1  349 ALA n 
1  350 HIS n 
1  351 GLU n 
1  352 SER n 
1  353 CYS n 
1  354 GLY n 
1  355 LYS n 
1  356 CYS n 
1  357 THR n 
1  358 PRO n 
1  359 CYS n 
1  360 ARG n 
1  361 GLU n 
1  362 GLY n 
1  363 VAL n 
1  364 ALA n 
1  365 GLY n 
1  366 PHE n 
1  367 MET n 
1  368 VAL n 
1  369 ASN n 
1  370 LEU n 
1  371 PHE n 
1  372 ALA n 
1  373 LYS n 
1  374 ILE n 
1  375 GLY n 
1  376 THR n 
1  377 GLY n 
1  378 GLN n 
1  379 GLY n 
1  380 GLU n 
1  381 GLU n 
1  382 LYS n 
1  383 ASP n 
1  384 VAL n 
1  385 GLU n 
1  386 ASN n 
1  387 LEU n 
1  388 GLU n 
1  389 ALA n 
1  390 LEU n 
1  391 LEU n 
1  392 PRO n 
1  393 LEU n 
1  394 ILE n 
1  395 GLU n 
1  396 GLY n 
1  397 ARG n 
1  398 SER n 
1  399 PHE n 
1  400 CYS n 
1  401 PRO n 
1  402 LEU n 
1  403 ALA n 
1  404 ASP n 
1  405 ALA n 
1  406 ALA n 
1  407 VAL n 
1  408 TRP n 
1  409 PRO n 
1  410 VAL n 
1  411 LYS n 
1  412 GLY n 
1  413 SER n 
1  414 LEU n 
1  415 ARG n 
1  416 HIS n 
1  417 PHE n 
1  418 LYS n 
1  419 ASP n 
1  420 GLN n 
1  421 TYR n 
1  422 LEU n 
1  423 ALA n 
1  424 LEU n 
1  425 ALA n 
1  426 ARG n 
1  427 GLU n 
1  428 LYS n 
1  429 ARG n 
1  430 PRO n 
1  431 VAL n 
1  432 PRO n 
1  433 ARG n 
1  434 PRO n 
1  435 SER n 
1  436 LEU n 
1  437 TRP n 
1  438 ARG n 
2  1   MET n 
2  2   GLY n 
2  3   PHE n 
2  4   PHE n 
2  5   ASP n 
2  6   ASP n 
2  7   LYS n 
2  8   GLN n 
2  9   ASP n 
2  10  PHE n 
2  11  LEU n 
2  12  GLU n 
2  13  GLU n 
2  14  THR n 
2  15  PHE n 
2  16  ALA n 
2  17  LYS n 
2  18  TYR n 
2  19  PRO n 
2  20  PRO n 
2  21  GLU n 
2  22  GLY n 
2  23  ARG n 
2  24  ARG n 
2  25  ALA n 
2  26  ALA n 
2  27  ILE n 
2  28  MET n 
2  29  PRO n 
2  30  LEU n 
2  31  LEU n 
2  32  ARG n 
2  33  ARG n 
2  34  VAL n 
2  35  GLN n 
2  36  GLN n 
2  37  GLU n 
2  38  GLU n 
2  39  GLY n 
2  40  TRP n 
2  41  ILE n 
2  42  ARG n 
2  43  PRO n 
2  44  GLU n 
2  45  ARG n 
2  46  ILE n 
2  47  GLU n 
2  48  GLU n 
2  49  ILE n 
2  50  ALA n 
2  51  ARG n 
2  52  LEU n 
2  53  VAL n 
2  54  GLY n 
2  55  THR n 
2  56  THR n 
2  57  PRO n 
2  58  THR n 
2  59  GLU n 
2  60  VAL n 
2  61  MET n 
2  62  GLY n 
2  63  VAL n 
2  64  ALA n 
2  65  SER n 
2  66  PHE n 
2  67  TYR n 
2  68  SER n 
2  69  TYR n 
2  70  TYR n 
2  71  GLN n 
2  72  PHE n 
2  73  VAL n 
2  74  PRO n 
2  75  THR n 
2  76  GLY n 
2  77  LYS n 
2  78  TYR n 
2  79  HIS n 
2  80  LEU n 
2  81  GLN n 
2  82  VAL n 
2  83  CYS n 
2  84  ALA n 
2  85  THR n 
2  86  LEU n 
2  87  SER n 
2  88  CYS n 
2  89  LYS n 
2  90  LEU n 
2  91  ALA n 
2  92  GLY n 
2  93  ALA n 
2  94  GLU n 
2  95  GLU n 
2  96  LEU n 
2  97  TRP n 
2  98  ASP n 
2  99  TYR n 
2  100 LEU n 
2  101 THR n 
2  102 GLU n 
2  103 THR n 
2  104 LEU n 
2  105 GLY n 
2  106 ILE n 
2  107 GLY n 
2  108 PRO n 
2  109 GLY n 
2  110 GLU n 
2  111 VAL n 
2  112 THR n 
2  113 PRO n 
2  114 ASP n 
2  115 GLY n 
2  116 LEU n 
2  117 PHE n 
2  118 SER n 
2  119 VAL n 
2  120 GLN n 
2  121 LYS n 
2  122 VAL n 
2  123 GLU n 
2  124 CYS n 
2  125 LEU n 
2  126 GLY n 
2  127 SER n 
2  128 CYS n 
2  129 HIS n 
2  130 THR n 
2  131 ALA n 
2  132 PRO n 
2  133 VAL n 
2  134 ILE n 
2  135 GLN n 
2  136 VAL n 
2  137 ASN n 
2  138 ASP n 
2  139 GLU n 
2  140 PRO n 
2  141 TYR n 
2  142 VAL n 
2  143 GLU n 
2  144 CYS n 
2  145 VAL n 
2  146 THR n 
2  147 ARG n 
2  148 ALA n 
2  149 ARG n 
2  150 LEU n 
2  151 GLU n 
2  152 ALA n 
2  153 LEU n 
2  154 LEU n 
2  155 ALA n 
2  156 GLY n 
2  157 LEU n 
2  158 ARG n 
2  159 ALA n 
2  160 GLY n 
2  161 LYS n 
2  162 ARG n 
2  163 LEU n 
2  164 GLU n 
2  165 GLU n 
2  166 ILE n 
2  167 GLU n 
2  168 LEU n 
2  169 PRO n 
2  170 GLY n 
2  171 LYS n 
2  172 CYS n 
2  173 GLY n 
2  174 HIS n 
2  175 HIS n 
2  176 VAL n 
2  177 HIS n 
2  178 GLU n 
2  179 VAL n 
2  180 GLU n 
2  181 VAL n 
3  1   MET n 
3  2   VAL n 
3  3   ARG n 
3  4   VAL n 
3  5   LYS n 
3  6   VAL n 
3  7   ASN n 
3  8   ASP n 
3  9   ARG n 
3  10  ILE n 
3  11  VAL n 
3  12  GLU n 
3  13  VAL n 
3  14  PRO n 
3  15  PRO n 
3  16  GLY n 
3  17  THR n 
3  18  SER n 
3  19  VAL n 
3  20  MET n 
3  21  ASP n 
3  22  ALA n 
3  23  VAL n 
3  24  PHE n 
3  25  HIS n 
3  26  ALA n 
3  27  GLY n 
3  28  TYR n 
3  29  ASP n 
3  30  VAL n 
3  31  PRO n 
3  32  LEU n 
3  33  PHE n 
3  34  CYS n 
3  35  SER n 
3  36  GLU n 
3  37  LYS n 
3  38  HIS n 
3  39  LEU n 
3  40  SER n 
3  41  PRO n 
3  42  ILE n 
3  43  GLY n 
3  44  ALA n 
3  45  CYS n 
3  46  ARG n 
3  47  MET n 
3  48  CYS n 
3  49  LEU n 
3  50  VAL n 
3  51  ARG n 
3  52  ILE n 
3  53  GLY n 
3  54  LEU n 
3  55  PRO n 
3  56  LYS n 
3  57  LYS n 
3  58  GLY n 
3  59  PRO n 
3  60  ASP n 
3  61  GLY n 
3  62  LYS n 
3  63  PRO n 
3  64  LEU n 
3  65  LEU n 
3  66  ASN n 
3  67  GLU n 
3  68  LYS n 
3  69  GLY n 
3  70  GLU n 
3  71  PRO n 
3  72  GLU n 
3  73  ILE n 
3  74  GLN n 
3  75  TRP n 
3  76  GLN n 
3  77  PRO n 
3  78  LYS n 
3  79  LEU n 
3  80  ALA n 
3  81  ALA n 
3  82  SER n 
3  83  CYS n 
3  84  VAL n 
3  85  THR n 
3  86  ALA n 
3  87  VAL n 
3  88  ALA n 
3  89  ASP n 
3  90  GLY n 
3  91  MET n 
3  92  VAL n 
3  93  VAL n 
3  94  ASP n 
3  95  THR n 
3  96  LEU n 
3  97  SER n 
3  98  ASP n 
3  99  VAL n 
3  100 VAL n 
3  101 ARG n 
3  102 GLU n 
3  103 ALA n 
3  104 GLN n 
3  105 ALA n 
3  106 GLY n 
3  107 MET n 
3  108 VAL n 
3  109 GLU n 
3  110 PHE n 
3  111 THR n 
3  112 LEU n 
3  113 LEU n 
3  114 ASN n 
3  115 HIS n 
3  116 PRO n 
3  117 LEU n 
3  118 ASP n 
3  119 CYS n 
3  120 PRO n 
3  121 THR n 
3  122 CYS n 
3  123 ASP n 
3  124 LYS n 
3  125 GLY n 
3  126 GLY n 
3  127 ALA n 
3  128 CYS n 
3  129 GLU n 
3  130 LEU n 
3  131 GLN n 
3  132 ASP n 
3  133 ARG n 
3  134 THR n 
3  135 VAL n 
3  136 GLU n 
3  137 TYR n 
3  138 GLY n 
3  139 LEU n 
3  140 TYR n 
3  141 GLU n 
3  142 LYS n 
3  143 TYR n 
3  144 TYR n 
3  145 GLN n 
3  146 LYS n 
3  147 GLY n 
3  148 PRO n 
3  149 LEU n 
3  150 GLU n 
3  151 LEU n 
3  152 PRO n 
3  153 VAL n 
3  154 TYR n 
3  155 THR n 
3  156 ARG n 
3  157 PHE n 
3  158 GLU n 
3  159 PHE n 
3  160 THR n 
3  161 ARG n 
3  162 ARG n 
3  163 HIS n 
3  164 VAL n 
3  165 ASP n 
3  166 LYS n 
3  167 HIS n 
3  168 HIS n 
3  169 PRO n 
3  170 LEU n 
3  171 SER n 
3  172 PRO n 
3  173 PHE n 
3  174 VAL n 
3  175 ILE n 
3  176 LEU n 
3  177 ASP n 
3  178 ARG n 
3  179 GLU n 
3  180 ARG n 
3  181 CYS n 
3  182 ILE n 
3  183 HIS n 
3  184 CYS n 
3  185 LYS n 
3  186 ARG n 
3  187 CYS n 
3  188 VAL n 
3  189 ARG n 
3  190 TYR n 
3  191 PHE n 
3  192 GLU n 
3  193 GLU n 
3  194 VAL n 
3  195 PRO n 
3  196 GLY n 
3  197 ASP n 
3  198 GLU n 
3  199 VAL n 
3  200 LEU n 
3  201 ASP n 
3  202 PHE n 
3  203 ILE n 
3  204 GLU n 
3  205 ARG n 
3  206 GLY n 
3  207 VAL n 
3  208 HIS n 
3  209 THR n 
3  210 PHE n 
3  211 ILE n 
3  212 GLY n 
3  213 THR n 
3  214 MET n 
3  215 ASP n 
3  216 PHE n 
3  217 GLY n 
3  218 LEU n 
3  219 PRO n 
3  220 SER n 
3  221 GLY n 
3  222 PHE n 
3  223 SER n 
3  224 GLY n 
3  225 ASN n 
3  226 ILE n 
3  227 THR n 
3  228 ASP n 
3  229 ILE n 
3  230 CYS n 
3  231 PRO n 
3  232 VAL n 
3  233 GLY n 
3  234 ALA n 
3  235 LEU n 
3  236 LEU n 
3  237 ASP n 
3  238 LEU n 
3  239 THR n 
3  240 ALA n 
3  241 ARG n 
3  242 PHE n 
3  243 ARG n 
3  244 ALA n 
3  245 ARG n 
3  246 ASN n 
3  247 TRP n 
3  248 GLU n 
3  249 MET n 
3  250 GLU n 
3  251 GLU n 
3  252 THR n 
3  253 PRO n 
3  254 THR n 
3  255 THR n 
3  256 CYS n 
3  257 ALA n 
3  258 LEU n 
3  259 CYS n 
3  260 PRO n 
3  261 VAL n 
3  262 GLY n 
3  263 CYS n 
3  264 GLY n 
3  265 ILE n 
3  266 THR n 
3  267 ALA n 
3  268 ASP n 
3  269 THR n 
3  270 ARG n 
3  271 SER n 
3  272 GLY n 
3  273 GLU n 
3  274 LEU n 
3  275 LEU n 
3  276 ARG n 
3  277 ILE n 
3  278 ARG n 
3  279 ALA n 
3  280 ARG n 
3  281 GLU n 
3  282 VAL n 
3  283 PRO n 
3  284 GLU n 
3  285 VAL n 
3  286 ASN n 
3  287 GLU n 
3  288 ILE n 
3  289 TRP n 
3  290 ILE n 
3  291 CYS n 
3  292 ASP n 
3  293 ALA n 
3  294 GLY n 
3  295 ARG n 
3  296 PHE n 
3  297 GLY n 
3  298 HIS n 
3  299 GLU n 
3  300 TRP n 
3  301 ALA n 
3  302 ASP n 
3  303 GLN n 
3  304 ASN n 
3  305 ARG n 
3  306 LEU n 
3  307 LYS n 
3  308 THR n 
3  309 PRO n 
3  310 LEU n 
3  311 VAL n 
3  312 ARG n 
3  313 LYS n 
3  314 GLU n 
3  315 GLY n 
3  316 ARG n 
3  317 LEU n 
3  318 VAL n 
3  319 GLU n 
3  320 ALA n 
3  321 THR n 
3  322 TRP n 
3  323 GLU n 
3  324 GLU n 
3  325 ALA n 
3  326 PHE n 
3  327 LEU n 
3  328 ALA n 
3  329 LEU n 
3  330 LYS n 
3  331 GLU n 
3  332 GLY n 
3  333 LEU n 
3  334 LYS n 
3  335 GLU n 
3  336 ALA n 
3  337 ARG n 
3  338 GLY n 
3  339 GLU n 
3  340 GLU n 
3  341 VAL n 
3  342 GLY n 
3  343 LEU n 
3  344 TYR n 
3  345 LEU n 
3  346 ALA n 
3  347 HIS n 
3  348 ASP n 
3  349 ALA n 
3  350 THR n 
3  351 LEU n 
3  352 GLU n 
3  353 GLU n 
3  354 GLY n 
3  355 LEU n 
3  356 LEU n 
3  357 ALA n 
3  358 SER n 
3  359 GLU n 
3  360 LEU n 
3  361 ALA n 
3  362 LYS n 
3  363 ALA n 
3  364 LEU n 
3  365 LYS n 
3  366 THR n 
3  367 PRO n 
3  368 HIS n 
3  369 LEU n 
3  370 ASP n 
3  371 PHE n 
3  372 GLN n 
3  373 GLY n 
3  374 ARG n 
3  375 THR n 
3  376 ALA n 
3  377 ALA n 
3  378 PRO n 
3  379 ALA n 
3  380 SER n 
3  381 LEU n 
3  382 PHE n 
3  383 PRO n 
3  384 PRO n 
3  385 ALA n 
3  386 SER n 
3  387 LEU n 
3  388 GLU n 
3  389 ASP n 
3  390 LEU n 
3  391 LEU n 
3  392 GLN n 
3  393 ALA n 
3  394 ASP n 
3  395 PHE n 
3  396 ALA n 
3  397 LEU n 
3  398 VAL n 
3  399 LEU n 
3  400 GLY n 
3  401 ASP n 
3  402 PRO n 
3  403 THR n 
3  404 GLU n 
3  405 GLU n 
3  406 ALA n 
3  407 PRO n 
3  408 ILE n 
3  409 LEU n 
3  410 HIS n 
3  411 LEU n 
3  412 ARG n 
3  413 LEU n 
3  414 SER n 
3  415 GLU n 
3  416 PHE n 
3  417 VAL n 
3  418 ARG n 
3  419 ASP n 
3  420 LEU n 
3  421 LYS n 
3  422 PRO n 
3  423 PRO n 
3  424 HIS n 
3  425 ARG n 
3  426 TYR n 
3  427 ASN n 
3  428 HIS n 
3  429 GLY n 
3  430 THR n 
3  431 PRO n 
3  432 PHE n 
3  433 ALA n 
3  434 ASP n 
3  435 LEU n 
3  436 GLN n 
3  437 ILE n 
3  438 LYS n 
3  439 GLU n 
3  440 ARG n 
3  441 MET n 
3  442 PRO n 
3  443 ARG n 
3  444 ARG n 
3  445 THR n 
3  446 ASP n 
3  447 LYS n 
3  448 MET n 
3  449 ALA n 
3  450 LEU n 
3  451 PHE n 
3  452 ALA n 
3  453 PRO n 
3  454 TYR n 
3  455 ARG n 
3  456 ALA n 
3  457 PRO n 
3  458 LEU n 
3  459 MET n 
3  460 LYS n 
3  461 TRP n 
3  462 ALA n 
3  463 ALA n 
3  464 ILE n 
3  465 HIS n 
3  466 GLU n 
3  467 VAL n 
3  468 HIS n 
3  469 ARG n 
3  470 PRO n 
3  471 GLY n 
3  472 GLU n 
3  473 GLU n 
3  474 ARG n 
3  475 GLU n 
3  476 ILE n 
3  477 LEU n 
3  478 LEU n 
3  479 ALA n 
3  480 LEU n 
3  481 LEU n 
3  482 GLY n 
3  483 ASP n 
3  484 LYS n 
3  485 GLU n 
3  486 GLY n 
3  487 SER n 
3  488 GLU n 
3  489 MET n 
3  490 VAL n 
3  491 ALA n 
3  492 LYS n 
3  493 ALA n 
3  494 LYS n 
3  495 GLU n 
3  496 ALA n 
3  497 TRP n 
3  498 GLU n 
3  499 LYS n 
3  500 ALA n 
3  501 LYS n 
3  502 ASN n 
3  503 PRO n 
3  504 VAL n 
3  505 LEU n 
3  506 ILE n 
3  507 LEU n 
3  508 GLY n 
3  509 ALA n 
3  510 GLY n 
3  511 VAL n 
3  512 LEU n 
3  513 GLN n 
3  514 ASP n 
3  515 THR n 
3  516 VAL n 
3  517 ALA n 
3  518 ALA n 
3  519 GLU n 
3  520 ARG n 
3  521 ALA n 
3  522 ARG n 
3  523 LEU n 
3  524 LEU n 
3  525 ALA n 
3  526 GLU n 
3  527 ARG n 
3  528 LYS n 
3  529 GLY n 
3  530 ALA n 
3  531 LYS n 
3  532 VAL n 
3  533 LEU n 
3  534 ALA n 
3  535 MET n 
3  536 THR n 
3  537 PRO n 
3  538 ALA n 
3  539 ALA n 
3  540 ASN n 
3  541 ALA n 
3  542 ARG n 
3  543 GLY n 
3  544 LEU n 
3  545 GLU n 
3  546 ALA n 
3  547 MET n 
3  548 GLY n 
3  549 VAL n 
3  550 LEU n 
3  551 PRO n 
3  552 GLY n 
3  553 ALA n 
3  554 LYS n 
3  555 GLY n 
3  556 ALA n 
3  557 SER n 
3  558 TRP n 
3  559 ASP n 
3  560 GLU n 
3  561 PRO n 
3  562 GLY n 
3  563 ALA n 
3  564 LEU n 
3  565 TYR n 
3  566 ALA n 
3  567 TYR n 
3  568 TYR n 
3  569 GLY n 
3  570 PHE n 
3  571 VAL n 
3  572 PRO n 
3  573 PRO n 
3  574 GLU n 
3  575 GLU n 
3  576 ALA n 
3  577 LEU n 
3  578 LYS n 
3  579 GLY n 
3  580 LYS n 
3  581 ARG n 
3  582 PHE n 
3  583 VAL n 
3  584 VAL n 
3  585 MET n 
3  586 HIS n 
3  587 LEU n 
3  588 SER n 
3  589 HIS n 
3  590 LEU n 
3  591 HIS n 
3  592 PRO n 
3  593 LEU n 
3  594 ALA n 
3  595 GLU n 
3  596 ARG n 
3  597 TYR n 
3  598 ALA n 
3  599 HIS n 
3  600 VAL n 
3  601 VAL n 
3  602 LEU n 
3  603 PRO n 
3  604 ALA n 
3  605 PRO n 
3  606 THR n 
3  607 PHE n 
3  608 TYR n 
3  609 GLU n 
3  610 LYS n 
3  611 ARG n 
3  612 GLY n 
3  613 HIS n 
3  614 LEU n 
3  615 VAL n 
3  616 ASN n 
3  617 LEU n 
3  618 GLU n 
3  619 GLY n 
3  620 ARG n 
3  621 VAL n 
3  622 LEU n 
3  623 PRO n 
3  624 LEU n 
3  625 SER n 
3  626 PRO n 
3  627 ALA n 
3  628 PRO n 
3  629 ILE n 
3  630 GLU n 
3  631 ASN n 
3  632 GLY n 
3  633 GLU n 
3  634 ALA n 
3  635 GLU n 
3  636 GLY n 
3  637 ALA n 
3  638 LEU n 
3  639 GLN n 
3  640 VAL n 
3  641 LEU n 
3  642 ALA n 
3  643 LEU n 
3  644 LEU n 
3  645 ALA n 
3  646 GLU n 
3  647 ALA n 
3  648 LEU n 
3  649 GLY n 
3  650 VAL n 
3  651 ARG n 
3  652 PRO n 
3  653 PRO n 
3  654 PHE n 
3  655 ARG n 
3  656 LEU n 
3  657 HIS n 
3  658 LEU n 
3  659 GLU n 
3  660 ALA n 
3  661 GLN n 
3  662 LYS n 
3  663 ALA n 
3  664 LEU n 
3  665 LYS n 
3  666 ALA n 
3  667 ARG n 
3  668 LYS n 
3  669 VAL n 
3  670 PRO n 
3  671 GLU n 
3  672 ALA n 
3  673 MET n 
3  674 GLY n 
3  675 ARG n 
3  676 LEU n 
3  677 SER n 
3  678 PHE n 
3  679 ARG n 
3  680 LEU n 
3  681 LYS n 
3  682 GLU n 
3  683 LEU n 
3  684 ARG n 
3  685 PRO n 
3  686 LYS n 
3  687 GLU n 
3  688 ARG n 
3  689 LYS n 
3  690 GLY n 
3  691 ALA n 
3  692 PHE n 
3  693 TYR n 
3  694 LEU n 
3  695 ARG n 
3  696 PRO n 
3  697 THR n 
3  698 MET n 
3  699 TRP n 
3  700 LYS n 
3  701 ALA n 
3  702 HIS n 
3  703 GLN n 
3  704 ALA n 
3  705 VAL n 
3  706 GLY n 
3  707 LYS n 
3  708 ALA n 
3  709 GLN n 
3  710 GLU n 
3  711 ALA n 
3  712 ALA n 
3  713 ARG n 
3  714 ALA n 
3  715 GLU n 
3  716 LEU n 
3  717 TRP n 
3  718 ALA n 
3  719 HIS n 
3  720 PRO n 
3  721 GLU n 
3  722 THR n 
3  723 ALA n 
3  724 ARG n 
3  725 ALA n 
3  726 GLU n 
3  727 ALA n 
3  728 LEU n 
3  729 PRO n 
3  730 GLU n 
3  731 GLY n 
3  732 ALA n 
3  733 GLN n 
3  734 VAL n 
3  735 ALA n 
3  736 VAL n 
3  737 GLU n 
3  738 THR n 
3  739 PRO n 
3  740 PHE n 
3  741 GLY n 
3  742 ARG n 
3  743 VAL n 
3  744 GLU n 
3  745 ALA n 
3  746 ARG n 
3  747 VAL n 
3  748 VAL n 
3  749 HIS n 
3  750 ARG n 
3  751 GLU n 
3  752 ASP n 
3  753 VAL n 
3  754 PRO n 
3  755 LYS n 
3  756 GLY n 
3  757 HIS n 
3  758 LEU n 
3  759 TYR n 
3  760 LEU n 
3  761 SER n 
3  762 ALA n 
3  763 LEU n 
3  764 GLY n 
3  765 PRO n 
3  766 ALA n 
3  767 ALA n 
3  768 GLY n 
3  769 LEU n 
3  770 ARG n 
3  771 VAL n 
3  772 GLU n 
3  773 GLY n 
3  774 ARG n 
3  775 VAL n 
3  776 LEU n 
3  777 VAL n 
3  778 PRO n 
3  779 ALA n 
3  780 GLY n 
3  781 GLY n 
3  782 GLU n 
3  783 ALA n 
4  1   MET n 
4  2   ARG n 
4  3   GLU n 
4  4   GLU n 
4  5   PHE n 
4  6   LEU n 
4  7   GLU n 
4  8   GLU n 
4  9   ILE n 
4  10  PRO n 
4  11  LEU n 
4  12  ASP n 
4  13  ALA n 
4  14  PRO n 
4  15  PRO n 
4  16  GLU n 
4  17  GLU n 
4  18  ALA n 
4  19  LYS n 
4  20  GLU n 
4  21  LEU n 
4  22  ARG n 
4  23  THR n 
4  24  GLU n 
4  25  VAL n 
4  26  MET n 
4  27  THR n 
4  28  LEU n 
4  29  ASN n 
4  30  VAL n 
4  31  GLY n 
4  32  PRO n 
4  33  GLN n 
4  34  HIS n 
4  35  PRO n 
4  36  SER n 
4  37  THR n 
4  38  HIS n 
4  39  GLY n 
4  40  VAL n 
4  41  LEU n 
4  42  ARG n 
4  43  LEU n 
4  44  MET n 
4  45  VAL n 
4  46  THR n 
4  47  LEU n 
4  48  SER n 
4  49  GLY n 
4  50  GLU n 
4  51  GLU n 
4  52  VAL n 
4  53  LEU n 
4  54  GLU n 
4  55  VAL n 
4  56  VAL n 
4  57  PRO n 
4  58  HIS n 
4  59  ILE n 
4  60  GLY n 
4  61  TYR n 
4  62  LEU n 
4  63  HIS n 
4  64  THR n 
4  65  GLY n 
4  66  PHE n 
4  67  GLU n 
4  68  LYS n 
4  69  THR n 
4  70  MET n 
4  71  GLU n 
4  72  HIS n 
4  73  ARG n 
4  74  THR n 
4  75  TYR n 
4  76  LEU n 
4  77  GLN n 
4  78  ASN n 
4  79  ILE n 
4  80  THR n 
4  81  TYR n 
4  82  THR n 
4  83  PRO n 
4  84  ARG n 
4  85  MET n 
4  86  ASP n 
4  87  TYR n 
4  88  LEU n 
4  89  HIS n 
4  90  SER n 
4  91  PHE n 
4  92  ALA n 
4  93  HIS n 
4  94  ASP n 
4  95  LEU n 
4  96  ALA n 
4  97  TYR n 
4  98  ALA n 
4  99  LEU n 
4  100 ALA n 
4  101 VAL n 
4  102 GLU n 
4  103 LYS n 
4  104 LEU n 
4  105 LEU n 
4  106 GLY n 
4  107 ALA n 
4  108 VAL n 
4  109 VAL n 
4  110 PRO n 
4  111 PRO n 
4  112 ARG n 
4  113 ALA n 
4  114 GLU n 
4  115 THR n 
4  116 ILE n 
4  117 ARG n 
4  118 VAL n 
4  119 ILE n 
4  120 LEU n 
4  121 ASN n 
4  122 GLU n 
4  123 LEU n 
4  124 SER n 
4  125 ARG n 
4  126 LEU n 
4  127 ALA n 
4  128 SER n 
4  129 HIS n 
4  130 LEU n 
4  131 VAL n 
4  132 PHE n 
4  133 LEU n 
4  134 GLY n 
4  135 THR n 
4  136 GLY n 
4  137 LEU n 
4  138 LEU n 
4  139 ASP n 
4  140 LEU n 
4  141 GLY n 
4  142 ALA n 
4  143 LEU n 
4  144 THR n 
4  145 PRO n 
4  146 PHE n 
4  147 PHE n 
4  148 TYR n 
4  149 ALA n 
4  150 PHE n 
4  151 ARG n 
4  152 GLU n 
4  153 ARG n 
4  154 GLU n 
4  155 THR n 
4  156 ILE n 
4  157 LEU n 
4  158 ASP n 
4  159 LEU n 
4  160 PHE n 
4  161 GLU n 
4  162 TRP n 
4  163 VAL n 
4  164 THR n 
4  165 GLY n 
4  166 GLN n 
4  167 ARG n 
4  168 PHE n 
4  169 HIS n 
4  170 HIS n 
4  171 ASN n 
4  172 TYR n 
4  173 ILE n 
4  174 ARG n 
4  175 ILE n 
4  176 GLY n 
4  177 GLY n 
4  178 VAL n 
4  179 LYS n 
4  180 GLU n 
4  181 ASP n 
4  182 LEU n 
4  183 PRO n 
4  184 GLU n 
4  185 GLU n 
4  186 PHE n 
4  187 VAL n 
4  188 PRO n 
4  189 GLU n 
4  190 LEU n 
4  191 LYS n 
4  192 LYS n 
4  193 LEU n 
4  194 LEU n 
4  195 GLU n 
4  196 VAL n 
4  197 LEU n 
4  198 PRO n 
4  199 HIS n 
4  200 ARG n 
4  201 ILE n 
4  202 ASP n 
4  203 GLU n 
4  204 TYR n 
4  205 GLU n 
4  206 ALA n 
4  207 LEU n 
4  208 PHE n 
4  209 ALA n 
4  210 GLU n 
4  211 SER n 
4  212 PRO n 
4  213 ILE n 
4  214 PHE n 
4  215 TYR n 
4  216 GLU n 
4  217 ARG n 
4  218 ALA n 
4  219 ARG n 
4  220 GLY n 
4  221 VAL n 
4  222 GLY n 
4  223 VAL n 
4  224 ILE n 
4  225 PRO n 
4  226 PRO n 
4  227 GLU n 
4  228 VAL n 
4  229 ALA n 
4  230 ILE n 
4  231 ASP n 
4  232 LEU n 
4  233 GLY n 
4  234 LEU n 
4  235 THR n 
4  236 GLY n 
4  237 GLY n 
4  238 SER n 
4  239 LEU n 
4  240 ARG n 
4  241 ALA n 
4  242 SER n 
4  243 GLY n 
4  244 VAL n 
4  245 ASN n 
4  246 TYR n 
4  247 ASP n 
4  248 VAL n 
4  249 ARG n 
4  250 LYS n 
4  251 ALA n 
4  252 TYR n 
4  253 PRO n 
4  254 TYR n 
4  255 SER n 
4  256 GLY n 
4  257 TYR n 
4  258 GLU n 
4  259 THR n 
4  260 TYR n 
4  261 THR n 
4  262 PHE n 
4  263 ASP n 
4  264 VAL n 
4  265 PRO n 
4  266 LEU n 
4  267 GLY n 
4  268 GLU n 
4  269 ARG n 
4  270 GLY n 
4  271 ASP n 
4  272 VAL n 
4  273 PHE n 
4  274 ASP n 
4  275 ARG n 
4  276 MET n 
4  277 LEU n 
4  278 VAL n 
4  279 ARG n 
4  280 ILE n 
4  281 ARG n 
4  282 GLU n 
4  283 MET n 
4  284 ARG n 
4  285 GLU n 
4  286 SER n 
4  287 VAL n 
4  288 LYS n 
4  289 ILE n 
4  290 ILE n 
4  291 LYS n 
4  292 GLN n 
4  293 ALA n 
4  294 LEU n 
4  295 GLU n 
4  296 ARG n 
4  297 LEU n 
4  298 GLU n 
4  299 PRO n 
4  300 GLY n 
4  301 PRO n 
4  302 VAL n 
4  303 ARG n 
4  304 ASP n 
4  305 PRO n 
4  306 ASN n 
4  307 PRO n 
4  308 GLN n 
4  309 ILE n 
4  310 THR n 
4  311 PRO n 
4  312 PRO n 
4  313 PRO n 
4  314 ARG n 
4  315 HIS n 
4  316 LEU n 
4  317 LEU n 
4  318 GLU n 
4  319 THR n 
4  320 SER n 
4  321 MET n 
4  322 GLU n 
4  323 ALA n 
4  324 VAL n 
4  325 ILE n 
4  326 TYR n 
4  327 HIS n 
4  328 PHE n 
4  329 LYS n 
4  330 HIS n 
4  331 TYR n 
4  332 THR n 
4  333 GLU n 
4  334 GLY n 
4  335 PHE n 
4  336 HIS n 
4  337 PRO n 
4  338 PRO n 
4  339 LYS n 
4  340 GLY n 
4  341 GLU n 
4  342 VAL n 
4  343 TYR n 
4  344 VAL n 
4  345 PRO n 
4  346 THR n 
4  347 GLU n 
4  348 SER n 
4  349 ALA n 
4  350 ARG n 
4  351 GLY n 
4  352 GLU n 
4  353 LEU n 
4  354 GLY n 
4  355 TYR n 
4  356 TYR n 
4  357 ILE n 
4  358 VAL n 
4  359 SER n 
4  360 ASP n 
4  361 GLY n 
4  362 GLY n 
4  363 SER n 
4  364 MET n 
4  365 PRO n 
4  366 TYR n 
4  367 ARG n 
4  368 VAL n 
4  369 LYS n 
4  370 VAL n 
4  371 ARG n 
4  372 ALA n 
4  373 PRO n 
4  374 SER n 
4  375 PHE n 
4  376 VAL n 
4  377 ASN n 
4  378 LEU n 
4  379 GLN n 
4  380 SER n 
4  381 LEU n 
4  382 PRO n 
4  383 TYR n 
4  384 ALA n 
4  385 CYS n 
4  386 LYS n 
4  387 GLY n 
4  388 GLU n 
4  389 GLN n 
4  390 VAL n 
4  391 PRO n 
4  392 ASP n 
4  393 MET n 
4  394 VAL n 
4  395 ALA n 
4  396 ILE n 
4  397 ILE n 
4  398 ALA n 
4  399 SER n 
4  400 LEU n 
4  401 ASP n 
4  402 PRO n 
4  403 VAL n 
4  404 MET n 
4  405 GLY n 
4  406 ASP n 
4  407 VAL n 
4  408 ASP n 
4  409 ARG n 
5  1   MET n 
5  2   ARG n 
5  3   LEU n 
5  4   GLU n 
5  5   ARG n 
5  6   VAL n 
5  7   LEU n 
5  8   GLU n 
5  9   GLU n 
5  10  ALA n 
5  11  ARG n 
5  12  ALA n 
5  13  LYS n 
5  14  GLY n 
5  15  TYR n 
5  16  PRO n 
5  17  ILE n 
5  18  GLU n 
5  19  ASP n 
5  20  ASN n 
5  21  GLY n 
5  22  LEU n 
5  23  GLY n 
5  24  ASN n 
5  25  LEU n 
5  26  TRP n 
5  27  VAL n 
5  28  VAL n 
5  29  LEU n 
5  30  PRO n 
5  31  ARG n 
5  32  GLU n 
5  33  ARG n 
5  34  PHE n 
5  35  LYS n 
5  36  GLU n 
5  37  GLU n 
5  38  MET n 
5  39  ALA n 
5  40  HIS n 
5  41  TYR n 
5  42  LYS n 
5  43  ALA n 
5  44  MET n 
5  45  GLY n 
5  46  PHE n 
5  47  ASN n 
5  48  PHE n 
5  49  LEU n 
5  50  ALA n 
5  51  ASP n 
5  52  ILE n 
5  53  VAL n 
5  54  GLY n 
5  55  LEU n 
5  56  ASP n 
5  57  TYR n 
5  58  LEU n 
5  59  THR n 
5  60  TYR n 
5  61  PRO n 
5  62  ASP n 
5  63  PRO n 
5  64  ARG n 
5  65  PRO n 
5  66  GLU n 
5  67  ARG n 
5  68  PHE n 
5  69  ALA n 
5  70  VAL n 
5  71  VAL n 
5  72  TYR n 
5  73  GLU n 
5  74  LEU n 
5  75  VAL n 
5  76  SER n 
5  77  LEU n 
5  78  PRO n 
5  79  GLY n 
5  80  TRP n 
5  81  LYS n 
5  82  ASP n 
5  83  GLY n 
5  84  ASP n 
5  85  GLY n 
5  86  SER n 
5  87  ARG n 
5  88  PHE n 
5  89  PHE n 
5  90  VAL n 
5  91  ARG n 
5  92  VAL n 
5  93  TYR n 
5  94  VAL n 
5  95  PRO n 
5  96  GLU n 
5  97  GLU n 
5  98  ASP n 
5  99  PRO n 
5  100 ARG n 
5  101 LEU n 
5  102 PRO n 
5  103 THR n 
5  104 VAL n 
5  105 THR n 
5  106 ASP n 
5  107 LEU n 
5  108 TRP n 
5  109 GLY n 
5  110 SER n 
5  111 ALA n 
5  112 ASN n 
5  113 PHE n 
5  114 LEU n 
5  115 GLU n 
5  116 ARG n 
5  117 GLU n 
5  118 VAL n 
5  119 TYR n 
5  120 ASP n 
5  121 LEU n 
5  122 PHE n 
5  123 GLY n 
5  124 ILE n 
5  125 VAL n 
5  126 PHE n 
5  127 GLU n 
5  128 GLY n 
5  129 HIS n 
5  130 PRO n 
5  131 ASP n 
5  132 LEU n 
5  133 ARG n 
5  134 LYS n 
5  135 ILE n 
5  136 LEU n 
5  137 THR n 
5  138 PRO n 
5  139 GLU n 
5  140 ASP n 
5  141 LEU n 
5  142 GLU n 
5  143 GLY n 
5  144 HIS n 
5  145 PRO n 
5  146 LEU n 
5  147 ARG n 
5  148 LYS n 
5  149 ASP n 
5  150 TYR n 
5  151 PRO n 
5  152 LEU n 
5  153 GLY n 
5  154 GLU n 
5  155 THR n 
5  156 PRO n 
5  157 THR n 
5  158 LEU n 
5  159 PHE n 
5  160 ARG n 
5  161 GLU n 
5  162 GLY n 
5  163 ARG n 
5  164 TYR n 
5  165 ILE n 
5  166 ILE n 
5  167 PRO n 
5  168 ALA n 
5  169 GLU n 
5  170 PHE n 
5  171 ARG n 
5  172 ALA n 
5  173 ALA n 
5  174 LEU n 
5  175 THR n 
5  176 GLY n 
5  177 LYS n 
5  178 ASP n 
5  179 PRO n 
5  180 GLY n 
5  181 LEU n 
5  182 THR n 
5  183 PHE n 
5  184 TYR n 
5  185 LYS n 
5  186 GLY n 
5  187 GLY n 
5  188 SER n 
5  189 ARG n 
5  190 LYS n 
5  191 GLY n 
5  192 TYR n 
5  193 ARG n 
5  194 SER n 
5  195 LEU n 
5  196 TRP n 
5  197 ALA n 
5  198 ASP n 
5  199 LEU n 
5  200 LYS n 
5  201 LYS n 
5  202 ALA n 
5  203 ARG n 
5  204 GLU n 
5  205 VAL n 
5  206 LYS n 
5  207 GLY n 
6  1   MET n 
6  2   ALA n 
6  3   LEU n 
6  4   LYS n 
6  5   ASP n 
6  6   LEU n 
6  7   PHE n 
6  8   GLU n 
6  9   ARG n 
6  10  ASP n 
6  11  VAL n 
6  12  GLN n 
6  13  GLU n 
6  14  LEU n 
6  15  GLU n 
6  16  ARG n 
6  17  GLU n 
6  18  GLY n 
6  19  ILE n 
6  20  LEU n 
6  21  PHE n 
6  22  THR n 
6  23  THR n 
6  24  LEU n 
6  25  GLU n 
6  26  LYS n 
6  27  LEU n 
6  28  VAL n 
6  29  ALA n 
6  30  TRP n 
6  31  GLY n 
6  32  ARG n 
6  33  SER n 
6  34  ASN n 
6  35  SER n 
6  36  LEU n 
6  37  TRP n 
6  38  PRO n 
6  39  ALA n 
6  40  THR n 
6  41  PHE n 
6  42  GLY n 
6  43  LEU n 
6  44  ALA n 
6  45  CYS n 
6  46  CYS n 
6  47  ALA n 
6  48  ILE n 
6  49  GLU n 
6  50  MET n 
6  51  MET n 
6  52  ALA n 
6  53  SER n 
6  54  THR n 
6  55  ASP n 
6  56  ALA n 
6  57  ARG n 
6  58  ASN n 
6  59  ASP n 
6  60  LEU n 
6  61  ALA n 
6  62  ARG n 
6  63  PHE n 
6  64  GLY n 
6  65  SER n 
6  66  GLU n 
6  67  VAL n 
6  68  PHE n 
6  69  ARG n 
6  70  ALA n 
6  71  SER n 
6  72  PRO n 
6  73  ARG n 
6  74  GLN n 
6  75  ALA n 
6  76  ASP n 
6  77  VAL n 
6  78  MET n 
6  79  ILE n 
6  80  VAL n 
6  81  ALA n 
6  82  GLY n 
6  83  ARG n 
6  84  LEU n 
6  85  SER n 
6  86  LYS n 
6  87  LYS n 
6  88  MET n 
6  89  ALA n 
6  90  PRO n 
6  91  VAL n 
6  92  MET n 
6  93  ARG n 
6  94  ARG n 
6  95  VAL n 
6  96  TRP n 
6  97  GLU n 
6  98  GLN n 
6  99  MET n 
6  100 PRO n 
6  101 ASP n 
6  102 PRO n 
6  103 LYS n 
6  104 TRP n 
6  105 VAL n 
6  106 ILE n 
6  107 SER n 
6  108 MET n 
6  109 GLY n 
6  110 ALA n 
6  111 CYS n 
6  112 ALA n 
6  113 SER n 
6  114 SER n 
6  115 GLY n 
6  116 GLY n 
6  117 MET n 
6  118 PHE n 
6  119 ASN n 
6  120 ASN n 
6  121 TYR n 
6  122 ALA n 
6  123 ILE n 
6  124 VAL n 
6  125 GLN n 
6  126 ASN n 
6  127 VAL n 
6  128 ASP n 
6  129 SER n 
6  130 VAL n 
6  131 VAL n 
6  132 PRO n 
6  133 VAL n 
6  134 ASP n 
6  135 VAL n 
6  136 TYR n 
6  137 VAL n 
6  138 PRO n 
6  139 GLY n 
6  140 CYS n 
6  141 PRO n 
6  142 PRO n 
6  143 ARG n 
6  144 PRO n 
6  145 GLU n 
6  146 ALA n 
6  147 LEU n 
6  148 ILE n 
6  149 TYR n 
6  150 ALA n 
6  151 VAL n 
6  152 MET n 
6  153 GLN n 
6  154 LEU n 
6  155 GLN n 
6  156 LYS n 
6  157 LYS n 
6  158 VAL n 
6  159 ARG n 
6  160 GLY n 
6  161 GLN n 
6  162 ALA n 
6  163 TYR n 
6  164 ASN n 
6  165 GLU n 
6  166 ARG n 
6  167 GLY n 
6  168 GLU n 
6  169 ARG n 
6  170 LEU n 
6  171 PRO n 
6  172 PRO n 
6  173 VAL n 
6  174 ALA n 
6  175 ALA n 
6  176 TRP n 
6  177 LYS n 
6  178 ARG n 
6  179 THR n 
6  180 ARG n 
6  181 GLY n 
7  1   MET n 
7  2   THR n 
7  3   LEU n 
7  4   LYS n 
7  5   ALA n 
7  6   LEU n 
7  7   ALA n 
7  8   GLN n 
7  9   SER n 
7  10  LEU n 
7  11  GLY n 
7  12  ILE n 
7  13  THR n 
7  14  LEU n 
7  15  LYS n 
7  16  TYR n 
7  17  LEU n 
7  18  PHE n 
7  19  SER n 
7  20  LYS n 
7  21  PRO n 
7  22  VAL n 
7  23  THR n 
7  24  VAL n 
7  25  PRO n 
7  26  TYR n 
7  27  PRO n 
7  28  ASP n 
7  29  ALA n 
7  30  PRO n 
7  31  VAL n 
7  32  ALA n 
7  33  LEU n 
7  34  LYS n 
7  35  PRO n 
7  36  ARG n 
7  37  PHE n 
7  38  HIS n 
7  39  GLY n 
7  40  ARG n 
7  41  HIS n 
7  42  VAL n 
7  43  LEU n 
7  44  THR n 
7  45  ARG n 
7  46  HIS n 
7  47  PRO n 
7  48  ASN n 
7  49  GLY n 
7  50  LEU n 
7  51  GLU n 
7  52  LYS n 
7  53  CYS n 
7  54  ILE n 
7  55  GLY n 
7  56  CYS n 
7  57  SER n 
7  58  LEU n 
7  59  CYS n 
7  60  ALA n 
7  61  ALA n 
7  62  ALA n 
7  63  CYS n 
7  64  PRO n 
7  65  ALA n 
7  66  TYR n 
7  67  ALA n 
7  68  ILE n 
7  69  TYR n 
7  70  VAL n 
7  71  GLU n 
7  72  PRO n 
7  73  ALA n 
7  74  GLU n 
7  75  ASN n 
7  76  ASP n 
7  77  PRO n 
7  78  GLU n 
7  79  ASN n 
7  80  PRO n 
7  81  VAL n 
7  82  SER n 
7  83  ALA n 
7  84  GLY n 
7  85  GLU n 
7  86  ARG n 
7  87  TYR n 
7  88  ALA n 
7  89  LYS n 
7  90  VAL n 
7  91  TYR n 
7  92  GLU n 
7  93  ILE n 
7  94  ASN n 
7  95  MET n 
7  96  LEU n 
7  97  ARG n 
7  98  CYS n 
7  99  ILE n 
7  100 PHE n 
7  101 CYS n 
7  102 GLY n 
7  103 LEU n 
7  104 CYS n 
7  105 GLU n 
7  106 GLU n 
7  107 ALA n 
7  108 CYS n 
7  109 PRO n 
7  110 THR n 
7  111 GLY n 
7  112 ALA n 
7  113 ILE n 
7  114 VAL n 
7  115 LEU n 
7  116 GLY n 
7  117 TYR n 
7  118 ASP n 
7  119 PHE n 
7  120 GLU n 
7  121 MET n 
7  122 ALA n 
7  123 ASP n 
7  124 TYR n 
7  125 GLU n 
7  126 TYR n 
7  127 SER n 
7  128 ASP n 
7  129 LEU n 
7  130 VAL n 
7  131 TYR n 
7  132 GLY n 
7  133 LYS n 
7  134 GLU n 
7  135 ASP n 
7  136 MET n 
7  137 LEU n 
7  138 VAL n 
7  139 ASP n 
7  140 VAL n 
7  141 VAL n 
7  142 GLY n 
7  143 THR n 
7  144 LYS n 
7  145 PRO n 
7  146 GLN n 
7  147 ARG n 
7  148 ARG n 
7  149 GLU n 
7  150 ALA n 
7  151 LYS n 
7  152 ARG n 
7  153 THR n 
7  154 GLY n 
7  155 LYS n 
7  156 PRO n 
7  157 VAL n 
7  158 LYS n 
7  159 VAL n 
7  160 GLY n 
7  161 TYR n 
7  162 VAL n 
7  163 VAL n 
7  164 PRO n 
7  165 TYR n 
7  166 VAL n 
7  167 ARG n 
7  168 PRO n 
7  169 GLU n 
7  170 LEU n 
7  171 GLU n 
7  172 GLY n 
7  173 PHE n 
7  174 LYS n 
7  175 ALA n 
7  176 PRO n 
7  177 THR n 
7  178 GLU n 
7  179 GLY n 
7  180 GLY n 
7  181 LYS n 
7  182 ARG n 
8  1   MET n 
8  2   SER n 
8  3   ALA n 
8  4   SER n 
8  5   SER n 
8  6   GLU n 
8  7   ARG n 
8  8   GLU n 
8  9   LEU n 
8  10  TYR n 
8  11  GLU n 
8  12  ALA n 
8  13  TRP n 
8  14  VAL n 
8  15  GLU n 
8  16  LEU n 
8  17  LEU n 
8  18  SER n 
8  19  TRP n 
8  20  MET n 
8  21  ARG n 
8  22  GLU n 
8  23  TYR n 
8  24  ALA n 
8  25  GLN n 
8  26  ALA n 
8  27  LYS n 
8  28  GLY n 
8  29  VAL n 
8  30  ARG n 
8  31  PHE n 
8  32  GLU n 
8  33  LYS n 
8  34  GLU n 
8  35  ALA n 
8  36  ASP n 
8  37  PHE n 
8  38  PRO n 
8  39  ASP n 
8  40  PHE n 
8  41  ILE n 
8  42  TYR n 
8  43  ARG n 
8  44  MET n 
8  45  GLU n 
8  46  ARG n 
8  47  PRO n 
8  48  TYR n 
8  49  ASP n 
8  50  LEU n 
8  51  PRO n 
8  52  THR n 
8  53  THR n 
8  54  ILE n 
8  55  MET n 
8  56  THR n 
8  57  ALA n 
8  58  SER n 
8  59  LEU n 
8  60  SER n 
8  61  ASP n 
8  62  GLY n 
8  63  LEU n 
8  64  GLY n 
8  65  GLU n 
8  66  PRO n 
8  67  PHE n 
8  68  LEU n 
8  69  LEU n 
8  70  ALA n 
8  71  ASP n 
8  72  VAL n 
8  73  SER n 
8  74  PRO n 
8  75  ARG n 
8  76  HIS n 
8  77  ALA n 
8  78  LYS n 
8  79  LEU n 
8  80  LYS n 
8  81  ARG n 
8  82  ILE n 
8  83  GLY n 
8  84  LEU n 
8  85  ARG n 
8  86  LEU n 
8  87  PRO n 
8  88  ARG n 
8  89  ALA n 
8  90  HIS n 
8  91  ILE n 
8  92  HIS n 
8  93  LEU n 
8  94  HIS n 
8  95  ALA n 
8  96  HIS n 
8  97  TYR n 
8  98  GLU n 
8  99  PRO n 
8  100 GLY n 
8  101 LYS n 
8  102 GLY n 
8  103 LEU n 
8  104 VAL n 
8  105 THR n 
8  106 GLY n 
8  107 LYS n 
8  108 ILE n 
8  109 PRO n 
8  110 LEU n 
8  111 THR n 
8  112 LYS n 
8  113 GLU n 
8  114 ARG n 
8  115 PHE n 
8  116 PHE n 
8  117 ALA n 
8  118 LEU n 
8  119 ALA n 
8  120 ASP n 
8  121 ARG n 
8  122 ALA n 
8  123 ARG n 
8  124 GLU n 
8  125 ALA n 
8  126 LEU n 
8  127 ALA n 
8  128 PHE n 
8  129 ALA n 
9  1   MET n 
9  2   VAL n 
9  3   ARG n 
9  4   VAL n 
9  5   GLY n 
9  6   MET n 
9  7   ARG n 
9  8   ALA n 
9  9   ALA n 
9  10  PRO n 
9  11  ARG n 
9  12  VAL n 
9  13  SER n 
9  14  LEU n 
9  15  GLU n 
9  16  ALA n 
9  17  LEU n 
9  18  LYS n 
9  19  ALA n 
9  20  ALA n 
9  21  LEU n 
9  22  GLY n 
9  23  GLY n 
9  24  LEU n 
9  25  LYS n 
9  26  LEU n 
9  27  SER n 
9  28  GLU n 
9  29  ALA n 
9  30  LYS n 
9  31  VAL n 
9  32  TYR n 
9  33  LEU n 
9  34  ILE n 
9  35  THR n 
9  36  ASP n 
9  37  TRP n 
9  38  GLN n 
9  39  ASP n 
9  40  LYS n 
9  41  ARG n 
9  42  ASP n 
9  43  GLN n 
9  44  ALA n 
9  45  ARG n 
9  46  TYR n 
9  47  ALA n 
9  48  LEU n 
9  49  LEU n 
9  50  LEU n 
9  51  HIS n 
9  52  THR n 
9  53  GLY n 
9  54  LYS n 
9  55  LYS n 
9  56  ASP n 
9  57  LEU n 
9  58  LEU n 
9  59  VAL n 
9  60  PRO n 
9  61  ASP n 
9  62  ALA n 
9  63  PHE n 
9  64  GLY n 
9  65  PRO n 
9  66  ALA n 
9  67  PHE n 
9  68  PRO n 
9  69  GLY n 
9  70  GLY n 
9  71  GLU n 
9  72  GLU n 
9  73  ALA n 
9  74  LEU n 
9  75  SER n 
9  76  GLU n 
9  77  LEU n 
9  78  VAL n 
9  79  GLY n 
9  80  LEU n 
9  81  LEU n 
9  82  LEU n 
9  83  ALA n 
9  84  GLN n 
9  85  GLY n 
9  86  ALA n 
9  87  ARG n 
9  88  ARG n 
9  89  PHE n 
9  90  TYR n 
9  91  GLU n 
9  92  ALA n 
9  93  VAL n 
9  94  VAL n 
9  95  SER n 
9  96  PRO n 
9  97  GLY n 
9  98  GLU n 
9  99  MET n 
9  100 THR n 
9  101 ALA n 
9  102 LEU n 
9  103 LEU n 
9  104 ASP n 
9  105 LEU n 
9  106 PRO n 
9  107 PRO n 
9  108 GLU n 
9  109 GLU n 
9  110 LEU n 
9  111 LEU n 
9  112 LYS n 
9  113 ARG n 
9  114 VAL n 
9  115 MET n 
9  116 ALA n 
9  117 ILE n 
9  118 ALA n 
9  119 ASN n 
9  120 PRO n 
9  121 THR n 
9  122 ASP n 
9  123 PRO n 
9  124 GLY n 
9  125 ILE n 
9  126 TYR n 
9  127 LEU n 
9  128 LYS n 
9  129 ARG n 
9  130 ALA n 
9  131 ALA n 
10 1   MET n 
10 2   ALA n 
10 3   PRO n 
10 4   ILE n 
10 5   GLN n 
10 6   GLU n 
10 7   TYR n 
10 8   VAL n 
10 9   GLY n 
10 10  THR n 
10 11  LEU n 
10 12  ILE n 
10 13  TYR n 
10 14  VAL n 
10 15  GLY n 
10 16  VAL n 
10 17  ALA n 
10 18  LEU n 
10 19  PHE n 
10 20  ILE n 
10 21  GLY n 
10 22  VAL n 
10 23  ALA n 
10 24  ALA n 
10 25  LEU n 
10 26  LEU n 
10 27  VAL n 
10 28  GLY n 
10 29  ALA n 
10 30  LEU n 
10 31  LEU n 
10 32  GLY n 
10 33  PRO n 
10 34  LYS n 
10 35  LYS n 
10 36  PRO n 
10 37  GLY n 
10 38  ARG n 
10 39  ALA n 
10 40  LYS n 
10 41  LEU n 
10 42  MET n 
10 43  PRO n 
10 44  TYR n 
10 45  GLU n 
10 46  SER n 
10 47  GLY n 
10 48  ASN n 
10 49  ASP n 
10 50  PRO n 
10 51  ALA n 
10 52  GLY n 
10 53  GLU n 
10 54  VAL n 
10 55  LYS n 
10 56  ARG n 
10 57  PHE n 
10 58  PRO n 
10 59  VAL n 
10 60  HIS n 
10 61  PHE n 
10 62  TYR n 
10 63  VAL n 
10 64  VAL n 
10 65  ALA n 
10 66  MET n 
10 67  LEU n 
10 68  PHE n 
10 69  ILE n 
10 70  LEU n 
10 71  PHE n 
10 72  ASP n 
10 73  VAL n 
10 74  GLU n 
10 75  VAL n 
10 76  ALA n 
10 77  PHE n 
10 78  LEU n 
10 79  TRP n 
10 80  PRO n 
10 81  TYR n 
10 82  ALA n 
10 83  VAL n 
10 84  SER n 
10 85  ALA n 
10 86  GLY n 
10 87  GLY n 
10 88  LEU n 
10 89  GLY n 
10 90  LEU n 
10 91  TYR n 
10 92  GLY n 
10 93  PHE n 
10 94  LEU n 
10 95  GLY n 
10 96  VAL n 
10 97  LEU n 
10 98  ALA n 
10 99  PHE n 
10 100 THR n 
10 101 LEU n 
10 102 LEU n 
10 103 LEU n 
10 104 PHE n 
10 105 VAL n 
10 106 GLY n 
10 107 PHE n 
10 108 LEU n 
10 109 TYR n 
10 110 GLU n 
10 111 TRP n 
10 112 TRP n 
10 113 LYS n 
10 114 GLY n 
10 115 VAL n 
10 116 MET n 
10 117 ARG n 
10 118 TRP n 
10 119 HIS n 
11 1   MET n 
11 2   SER n 
11 3   LEU n 
11 4   LEU n 
11 5   GLU n 
11 6   GLY n 
11 7   LEU n 
11 8   ALA n 
11 9   LEU n 
11 10  PHE n 
11 11  LEU n 
11 12  LEU n 
11 13  LEU n 
11 14  LEU n 
11 15  SER n 
11 16  GLY n 
11 17  VAL n 
11 18  LEU n 
11 19  VAL n 
11 20  VAL n 
11 21  THR n 
11 22  LEU n 
11 23  ARG n 
11 24  ASN n 
11 25  ALA n 
11 26  ILE n 
11 27  HIS n 
11 28  ALA n 
11 29  ALA n 
11 30  LEU n 
11 31  ALA n 
11 32  LEU n 
11 33  ILE n 
11 34  LEU n 
11 35  ASN n 
11 36  PHE n 
11 37  LEU n 
11 38  VAL n 
11 39  LEU n 
11 40  ALA n 
11 41  GLY n 
11 42  VAL n 
11 43  TYR n 
11 44  VAL n 
11 45  ALA n 
11 46  LEU n 
11 47  ASP n 
11 48  ALA n 
11 49  ARG n 
11 50  PHE n 
11 51  LEU n 
11 52  GLY n 
11 53  PHE n 
11 54  ILE n 
11 55  GLN n 
11 56  VAL n 
11 57  ILE n 
11 58  VAL n 
11 59  TYR n 
11 60  ALA n 
11 61  GLY n 
11 62  ALA n 
11 63  ILE n 
11 64  VAL n 
11 65  VAL n 
11 66  LEU n 
11 67  PHE n 
11 68  LEU n 
11 69  PHE n 
11 70  VAL n 
11 71  ILE n 
11 72  MET n 
11 73  LEU n 
11 74  LEU n 
11 75  PHE n 
11 76  ALA n 
11 77  ALA n 
11 78  GLN n 
11 79  GLY n 
11 80  GLU n 
11 81  ILE n 
11 82  GLY n 
11 83  PHE n 
11 84  ASP n 
11 85  PRO n 
11 86  LEU n 
11 87  VAL n 
11 88  ARG n 
11 89  SER n 
11 90  ARG n 
11 91  PRO n 
11 92  LEU n 
11 93  ALA n 
11 94  ALA n 
11 95  LEU n 
11 96  LEU n 
11 97  ALA n 
11 98  LEU n 
11 99  GLY n 
11 100 VAL n 
11 101 ALA n 
11 102 GLY n 
11 103 ILE n 
11 104 LEU n 
11 105 ALA n 
11 106 ALA n 
11 107 GLY n 
11 108 LEU n 
11 109 TRP n 
11 110 GLY n 
11 111 LEU n 
11 112 ASP n 
11 113 LEU n 
11 114 ALA n 
11 115 PHE n 
11 116 THR n 
11 117 GLN n 
11 118 ASP n 
11 119 LEU n 
11 120 LYS n 
11 121 GLY n 
11 122 GLY n 
11 123 LEU n 
11 124 PRO n 
11 125 GLN n 
11 126 ALA n 
11 127 LEU n 
11 128 GLY n 
11 129 PRO n 
11 130 LEU n 
11 131 LEU n 
11 132 TYR n 
11 133 GLY n 
11 134 ASP n 
11 135 TRP n 
11 136 LEU n 
11 137 PHE n 
11 138 VAL n 
11 139 LEU n 
11 140 LEU n 
11 141 ALA n 
11 142 VAL n 
11 143 GLY n 
11 144 PHE n 
11 145 LEU n 
11 146 LEU n 
11 147 MET n 
11 148 ALA n 
11 149 ALA n 
11 150 THR n 
11 151 VAL n 
11 152 VAL n 
11 153 ALA n 
11 154 VAL n 
11 155 ALA n 
11 156 LEU n 
11 157 VAL n 
11 158 GLU n 
11 159 PRO n 
11 160 GLY n 
11 161 LYS n 
11 162 ALA n 
11 163 SER n 
11 164 ARG n 
11 165 ALA n 
11 166 LYS n 
11 167 GLU n 
11 168 ALA n 
11 169 GLU n 
11 170 LYS n 
11 171 ARG n 
11 172 GLU n 
11 173 GLU n 
11 174 VAL n 
11 175 ALA n 
11 176 ARG n 
12 1   MET n 
12 2   SER n 
12 3   TYR n 
12 4   LEU n 
12 5   LEU n 
12 6   THR n 
12 7   SER n 
12 8   ALA n 
12 9   LEU n 
12 10  LEU n 
12 11  PHE n 
12 12  ALA n 
12 13  LEU n 
12 14  GLY n 
12 15  VAL n 
12 16  TYR n 
12 17  GLY n 
12 18  VAL n 
12 19  LEU n 
12 20  THR n 
12 21  ARG n 
12 22  ARG n 
12 23  THR n 
12 24  ALA n 
12 25  ILE n 
12 26  LEU n 
12 27  VAL n 
12 28  PHE n 
12 29  LEU n 
12 30  SER n 
12 31  ILE n 
12 32  GLU n 
12 33  LEU n 
12 34  MET n 
12 35  LEU n 
12 36  ASN n 
12 37  ALA n 
12 38  ALA n 
12 39  ASN n 
12 40  LEU n 
12 41  SER n 
12 42  LEU n 
12 43  VAL n 
12 44  GLY n 
12 45  PHE n 
12 46  ALA n 
12 47  ARG n 
12 48  ALA n 
12 49  TYR n 
12 50  GLY n 
12 51  LEU n 
12 52  ASP n 
12 53  GLY n 
12 54  GLN n 
12 55  VAL n 
12 56  ALA n 
12 57  ALA n 
12 58  LEU n 
12 59  MET n 
12 60  VAL n 
12 61  ILE n 
12 62  ALA n 
12 63  VAL n 
12 64  ALA n 
12 65  ALA n 
12 66  ALA n 
12 67  GLU n 
12 68  VAL n 
12 69  ALA n 
12 70  VAL n 
12 71  GLY n 
12 72  LEU n 
12 73  GLY n 
12 74  LEU n 
12 75  ILE n 
12 76  VAL n 
12 77  ALA n 
12 78  ILE n 
12 79  PHE n 
12 80  ARG n 
12 81  HIS n 
12 82  ARG n 
12 83  GLU n 
12 84  SER n 
12 85  THR n 
12 86  ALA n 
12 87  VAL n 
12 88  ASP n 
12 89  ASP n 
12 90  LEU n 
12 91  SER n 
12 92  GLU n 
12 93  LEU n 
12 94  ARG n 
12 95  GLY n 
13 1   MET n 
13 2   ALA n 
13 3   LEU n 
13 4   LEU n 
13 5   GLY n 
13 6   THR n 
13 7   ILE n 
13 8   LEU n 
13 9   LEU n 
13 10  PRO n 
13 11  LEU n 
13 12  LEU n 
13 13  GLY n 
13 14  PHE n 
13 15  ALA n 
13 16  LEU n 
13 17  LEU n 
13 18  GLY n 
13 19  LEU n 
13 20  PHE n 
13 21  GLY n 
13 22  LYS n 
13 23  ARG n 
13 24  MET n 
13 25  ARG n 
13 26  GLU n 
13 27  PRO n 
13 28  LEU n 
13 29  PRO n 
13 30  GLY n 
13 31  VAL n 
13 32  LEU n 
13 33  ALA n 
13 34  SER n 
13 35  GLY n 
13 36  LEU n 
13 37  VAL n 
13 38  LEU n 
13 39  ALA n 
13 40  SER n 
13 41  PHE n 
13 42  LEU n 
13 43  LEU n 
13 44  GLY n 
13 45  ALA n 
13 46  GLY n 
13 47  LEU n 
13 48  LEU n 
13 49  LEU n 
13 50  SER n 
13 51  GLY n 
13 52  GLY n 
13 53  ALA n 
13 54  ARG n 
13 55  PHE n 
13 56  GLN n 
13 57  ALA n 
13 58  GLU n 
13 59  TRP n 
13 60  LEU n 
13 61  PRO n 
13 62  GLY n 
13 63  ILE n 
13 64  PRO n 
13 65  PHE n 
13 66  SER n 
13 67  LEU n 
13 68  LEU n 
13 69  LEU n 
13 70  ASP n 
13 71  ASN n 
13 72  LEU n 
13 73  SER n 
13 74  GLY n 
13 75  PHE n 
13 76  MET n 
13 77  LEU n 
13 78  LEU n 
13 79  ILE n 
13 80  VAL n 
13 81  THR n 
13 82  GLY n 
13 83  VAL n 
13 84  GLY n 
13 85  PHE n 
13 86  LEU n 
13 87  ILE n 
13 88  HIS n 
13 89  VAL n 
13 90  TYR n 
13 91  ALA n 
13 92  ILE n 
13 93  GLY n 
13 94  TYR n 
13 95  MET n 
13 96  GLY n 
13 97  GLY n 
13 98  ASP n 
13 99  PRO n 
13 100 GLY n 
13 101 TYR n 
13 102 SER n 
13 103 ARG n 
13 104 PHE n 
13 105 PHE n 
13 106 ALA n 
13 107 TYR n 
13 108 PHE n 
13 109 ASN n 
13 110 LEU n 
13 111 PHE n 
13 112 ILE n 
13 113 ALA n 
13 114 MET n 
13 115 MET n 
13 116 LEU n 
13 117 THR n 
13 118 LEU n 
13 119 VAL n 
13 120 LEU n 
13 121 ALA n 
13 122 ASP n 
13 123 SER n 
13 124 TYR n 
13 125 PRO n 
13 126 VAL n 
13 127 MET n 
13 128 PHE n 
13 129 ILE n 
13 130 GLY n 
13 131 TRP n 
13 132 GLU n 
13 133 GLY n 
13 134 VAL n 
13 135 GLY n 
13 136 LEU n 
13 137 ALA n 
13 138 SER n 
13 139 PHE n 
13 140 LEU n 
13 141 LEU n 
13 142 ILE n 
13 143 GLY n 
13 144 PHE n 
13 145 TRP n 
13 146 TYR n 
13 147 LYS n 
13 148 ASN n 
13 149 PRO n 
13 150 GLN n 
13 151 TYR n 
13 152 ALA n 
13 153 ASP n 
13 154 SER n 
13 155 ALA n 
13 156 ARG n 
13 157 LYS n 
13 158 ALA n 
13 159 PHE n 
13 160 ILE n 
13 161 VAL n 
13 162 ASN n 
13 163 ARG n 
13 164 ILE n 
13 165 GLY n 
13 166 ASP n 
13 167 LEU n 
13 168 GLY n 
13 169 PHE n 
13 170 MET n 
13 171 LEU n 
13 172 GLY n 
13 173 MET n 
13 174 ALA n 
13 175 ILE n 
13 176 LEU n 
13 177 TRP n 
13 178 ALA n 
13 179 LEU n 
13 180 TYR n 
13 181 GLY n 
13 182 THR n 
13 183 LEU n 
13 184 SER n 
13 185 ILE n 
13 186 SER n 
13 187 GLU n 
13 188 LEU n 
13 189 LYS n 
13 190 GLU n 
13 191 ALA n 
13 192 MET n 
13 193 GLU n 
13 194 GLY n 
13 195 PRO n 
13 196 LEU n 
13 197 LYS n 
13 198 ASN n 
13 199 PRO n 
13 200 ASP n 
13 201 LEU n 
13 202 LEU n 
13 203 ALA n 
13 204 LEU n 
13 205 ALA n 
13 206 GLY n 
13 207 LEU n 
13 208 LEU n 
13 209 LEU n 
13 210 PHE n 
13 211 LEU n 
13 212 GLY n 
13 213 ALA n 
13 214 VAL n 
13 215 GLY n 
13 216 LYS n 
13 217 SER n 
13 218 ALA n 
13 219 GLN n 
13 220 ILE n 
13 221 PRO n 
13 222 LEU n 
13 223 MET n 
13 224 VAL n 
13 225 TRP n 
13 226 LEU n 
13 227 PRO n 
13 228 ASP n 
13 229 ALA n 
13 230 MET n 
13 231 ALA n 
13 232 GLY n 
13 233 PRO n 
13 234 THR n 
13 235 PRO n 
13 236 VAL n 
13 237 SER n 
13 238 ALA n 
13 239 LEU n 
13 240 ILE n 
13 241 HIS n 
13 242 ALA n 
13 243 ALA n 
13 244 THR n 
13 245 MET n 
13 246 VAL n 
13 247 THR n 
13 248 ALA n 
13 249 GLY n 
13 250 VAL n 
13 251 TYR n 
13 252 LEU n 
13 253 ILE n 
13 254 ALA n 
13 255 ARG n 
13 256 SER n 
13 257 SER n 
13 258 PHE n 
13 259 LEU n 
13 260 TYR n 
13 261 SER n 
13 262 VAL n 
13 263 LEU n 
13 264 PRO n 
13 265 ASP n 
13 266 VAL n 
13 267 SER n 
13 268 TYR n 
13 269 ALA n 
13 270 ILE n 
13 271 ALA n 
13 272 VAL n 
13 273 VAL n 
13 274 GLY n 
13 275 LEU n 
13 276 LEU n 
13 277 THR n 
13 278 ALA n 
13 279 ALA n 
13 280 TYR n 
13 281 GLY n 
13 282 ALA n 
13 283 LEU n 
13 284 SER n 
13 285 ALA n 
13 286 PHE n 
13 287 GLY n 
13 288 GLN n 
13 289 THR n 
13 290 ASP n 
13 291 ILE n 
13 292 LYS n 
13 293 LYS n 
13 294 ILE n 
13 295 VAL n 
13 296 ALA n 
13 297 TYR n 
13 298 SER n 
13 299 THR n 
13 300 ILE n 
13 301 SER n 
13 302 GLN n 
13 303 LEU n 
13 304 GLY n 
13 305 TYR n 
13 306 MET n 
13 307 PHE n 
13 308 LEU n 
13 309 ALA n 
13 310 ALA n 
13 311 GLY n 
13 312 VAL n 
13 313 GLY n 
13 314 ALA n 
13 315 TYR n 
13 316 TRP n 
13 317 VAL n 
13 318 ALA n 
13 319 LEU n 
13 320 PHE n 
13 321 HIS n 
13 322 VAL n 
13 323 PHE n 
13 324 THR n 
13 325 HIS n 
13 326 ALA n 
13 327 PHE n 
13 328 PHE n 
13 329 LYS n 
13 330 ALA n 
13 331 LEU n 
13 332 LEU n 
13 333 PHE n 
13 334 LEU n 
13 335 ALA n 
13 336 SER n 
13 337 GLY n 
13 338 SER n 
13 339 VAL n 
13 340 ILE n 
13 341 HIS n 
13 342 ALA n 
13 343 LEU n 
13 344 GLY n 
13 345 GLY n 
13 346 GLU n 
13 347 GLN n 
13 348 ASP n 
13 349 VAL n 
13 350 ARG n 
13 351 LYS n 
13 352 MET n 
13 353 GLY n 
13 354 GLY n 
13 355 LEU n 
13 356 TRP n 
13 357 LYS n 
13 358 HIS n 
13 359 LEU n 
13 360 PRO n 
13 361 GLN n 
13 362 THR n 
13 363 ARG n 
13 364 TRP n 
13 365 HIS n 
13 366 ALA n 
13 367 LEU n 
13 368 ILE n 
13 369 GLY n 
13 370 ALA n 
13 371 LEU n 
13 372 ALA n 
13 373 LEU n 
13 374 GLY n 
13 375 GLY n 
13 376 LEU n 
13 377 PRO n 
13 378 LEU n 
13 379 LEU n 
13 380 SER n 
13 381 GLY n 
13 382 PHE n 
13 383 TRP n 
13 384 SER n 
13 385 LYS n 
13 386 ASP n 
13 387 ALA n 
13 388 ILE n 
13 389 LEU n 
13 390 ALA n 
13 391 ALA n 
13 392 THR n 
13 393 LEU n 
13 394 THR n 
13 395 TYR n 
13 396 PRO n 
13 397 PHE n 
13 398 GLY n 
13 399 GLY n 
13 400 VAL n 
13 401 GLY n 
13 402 PHE n 
13 403 TYR n 
13 404 VAL n 
13 405 GLY n 
13 406 ALA n 
13 407 LEU n 
13 408 LEU n 
13 409 VAL n 
13 410 ALA n 
13 411 VAL n 
13 412 LEU n 
13 413 THR n 
13 414 ALA n 
13 415 MET n 
13 416 TYR n 
13 417 ALA n 
13 418 MET n 
13 419 ARG n 
13 420 TRP n 
13 421 PHE n 
13 422 VAL n 
13 423 LEU n 
13 424 VAL n 
13 425 PHE n 
13 426 LEU n 
13 427 GLY n 
13 428 GLU n 
13 429 GLU n 
13 430 ARG n 
13 431 GLY n 
13 432 HIS n 
13 433 HIS n 
13 434 HIS n 
13 435 PRO n 
13 436 HIS n 
13 437 GLU n 
13 438 ALA n 
13 439 PRO n 
13 440 PRO n 
13 441 VAL n 
13 442 MET n 
13 443 LEU n 
13 444 TRP n 
13 445 PRO n 
13 446 ASN n 
13 447 HIS n 
13 448 LEU n 
13 449 LEU n 
13 450 ALA n 
13 451 LEU n 
13 452 GLY n 
13 453 SER n 
13 454 VAL n 
13 455 LEU n 
13 456 ALA n 
13 457 GLY n 
13 458 TYR n 
13 459 LEU n 
13 460 ALA n 
13 461 LEU n 
13 462 PRO n 
13 463 HIS n 
13 464 PRO n 
13 465 LEU n 
13 466 PRO n 
13 467 ASN n 
13 468 VAL n 
13 469 LEU n 
13 470 GLU n 
13 471 PRO n 
13 472 PHE n 
13 473 LEU n 
13 474 LYS n 
13 475 PRO n 
13 476 ALA n 
13 477 LEU n 
13 478 ALA n 
13 479 GLU n 
13 480 VAL n 
13 481 GLU n 
13 482 ALA n 
13 483 HIS n 
13 484 HIS n 
13 485 LEU n 
13 486 SER n 
13 487 LEU n 
13 488 GLY n 
13 489 ALA n 
13 490 GLU n 
13 491 TRP n 
13 492 GLY n 
13 493 LEU n 
13 494 ILE n 
13 495 ALA n 
13 496 LEU n 
13 497 SER n 
13 498 ALA n 
13 499 ALA n 
13 500 VAL n 
13 501 ALA n 
13 502 LEU n 
13 503 LEU n 
13 504 GLY n 
13 505 LEU n 
13 506 TRP n 
13 507 ALA n 
13 508 GLY n 
13 509 PHE n 
13 510 VAL n 
13 511 PHE n 
13 512 PHE n 
13 513 GLN n 
13 514 ARG n 
13 515 LYS n 
13 516 VAL n 
13 517 PHE n 
13 518 PRO n 
13 519 ALA n 
13 520 TRP n 
13 521 TYR n 
13 522 LEU n 
13 523 ALA n 
13 524 PHE n 
13 525 GLU n 
13 526 ALA n 
13 527 ALA n 
13 528 SER n 
13 529 ARG n 
13 530 GLU n 
13 531 ALA n 
13 532 PHE n 
13 533 TYR n 
13 534 VAL n 
13 535 ASP n 
13 536 ARG n 
13 537 ALA n 
13 538 TYR n 
13 539 ASN n 
13 540 ALA n 
13 541 LEU n 
13 542 ILE n 
13 543 VAL n 
13 544 ASN n 
13 545 PRO n 
13 546 LEU n 
13 547 LYS n 
13 548 ALA n 
13 549 LEU n 
13 550 ALA n 
13 551 GLU n 
13 552 ALA n 
13 553 LEU n 
13 554 PHE n 
13 555 TYR n 
13 556 GLY n 
13 557 ASP n 
13 558 ARG n 
13 559 GLY n 
13 560 LEU n 
13 561 LEU n 
13 562 SER n 
13 563 GLY n 
13 564 TYR n 
13 565 PHE n 
13 566 GLY n 
13 567 LEU n 
13 568 GLY n 
13 569 GLY n 
13 570 ALA n 
13 571 ALA n 
13 572 ARG n 
13 573 SER n 
13 574 LEU n 
13 575 GLY n 
13 576 GLN n 
13 577 GLY n 
13 578 LEU n 
13 579 ALA n 
13 580 ARG n 
13 581 LEU n 
13 582 GLN n 
13 583 THR n 
13 584 GLY n 
13 585 TYR n 
13 586 LEU n 
13 587 ARG n 
13 588 VAL n 
13 589 TYR n 
13 590 ALA n 
13 591 LEU n 
13 592 LEU n 
13 593 PHE n 
13 594 VAL n 
13 595 LEU n 
13 596 GLY n 
13 597 ALA n 
13 598 LEU n 
13 599 LEU n 
13 600 LEU n 
13 601 LEU n 
13 602 GLY n 
13 603 VAL n 
13 604 MET n 
13 605 ARG n 
13 606 TRP n 
14 1   MET n 
14 2   VAL n 
14 3   VAL n 
14 4   LEU n 
14 5   ALA n 
14 6   VAL n 
14 7   LEU n 
14 8   LEU n 
14 9   PRO n 
14 10  VAL n 
14 11  VAL n 
14 12  PHE n 
14 13  GLY n 
14 14  ALA n 
14 15  LEU n 
14 16  LEU n 
14 17  LEU n 
14 18  LEU n 
14 19  GLY n 
14 20  LEU n 
14 21  PRO n 
14 22  ARG n 
14 23  ALA n 
14 24  LEU n 
14 25  GLY n 
14 26  VAL n 
14 27  LEU n 
14 28  GLY n 
14 29  ALA n 
14 30  GLY n 
14 31  LEU n 
14 32  SER n 
14 33  PHE n 
14 34  LEU n 
14 35  LEU n 
14 36  ASN n 
14 37  LEU n 
14 38  TYR n 
14 39  LEU n 
14 40  PHE n 
14 41  LEU n 
14 42  THR n 
14 43  HIS n 
14 44  PRO n 
14 45  GLY n 
14 46  GLY n 
14 47  VAL n 
14 48  ALA n 
14 49  HIS n 
14 50  ALA n 
14 51  PHE n 
14 52  GLN n 
14 53  ALA n 
14 54  PRO n 
14 55  LEU n 
14 56  LEU n 
14 57  PRO n 
14 58  GLY n 
14 59  ALA n 
14 60  GLY n 
14 61  VAL n 
14 62  TYR n 
14 63  TRP n 
14 64  ALA n 
14 65  PHE n 
14 66  GLY n 
14 67  LEU n 
14 68  ASP n 
14 69  GLY n 
14 70  LEU n 
14 71  SER n 
14 72  ALA n 
14 73  LEU n 
14 74  PHE n 
14 75  PHE n 
14 76  LEU n 
14 77  THR n 
14 78  ILE n 
14 79  ALA n 
14 80  LEU n 
14 81  THR n 
14 82  VAL n 
14 83  PHE n 
14 84  LEU n 
14 85  GLY n 
14 86  ALA n 
14 87  LEU n 
14 88  VAL n 
14 89  ALA n 
14 90  ARG n 
14 91  VAL n 
14 92  GLU n 
14 93  GLY n 
14 94  ARG n 
14 95  PHE n 
14 96  LEU n 
14 97  GLY n 
14 98  LEU n 
14 99  ALA n 
14 100 LEU n 
14 101 LEU n 
14 102 MET n 
14 103 GLU n 
14 104 GLY n 
14 105 LEU n 
14 106 LEU n 
14 107 LEU n 
14 108 GLY n 
14 109 LEU n 
14 110 PHE n 
14 111 ALA n 
14 112 ALA n 
14 113 ARG n 
14 114 ASP n 
14 115 LEU n 
14 116 LEU n 
14 117 VAL n 
14 118 PHE n 
14 119 TYR n 
14 120 VAL n 
14 121 PHE n 
14 122 PHE n 
14 123 GLU n 
14 124 ALA n 
14 125 ALA n 
14 126 LEU n 
14 127 ILE n 
14 128 PRO n 
14 129 ALA n 
14 130 LEU n 
14 131 LEU n 
14 132 MET n 
14 133 LEU n 
14 134 TYR n 
14 135 LEU n 
14 136 TYR n 
14 137 GLY n 
14 138 GLY n 
14 139 GLU n 
14 140 GLY n 
14 141 ARG n 
14 142 THR n 
14 143 ARG n 
14 144 ALA n 
14 145 LEU n 
14 146 TYR n 
14 147 THR n 
14 148 PHE n 
14 149 VAL n 
14 150 LEU n 
14 151 PHE n 
14 152 THR n 
14 153 LEU n 
14 154 VAL n 
14 155 GLY n 
14 156 SER n 
14 157 LEU n 
14 158 PRO n 
14 159 MET n 
14 160 LEU n 
14 161 ALA n 
14 162 ALA n 
14 163 VAL n 
14 164 LEU n 
14 165 GLY n 
14 166 ALA n 
14 167 ARG n 
14 168 LEU n 
14 169 LEU n 
14 170 SER n 
14 171 GLY n 
14 172 SER n 
14 173 PRO n 
14 174 THR n 
14 175 PHE n 
14 176 LEU n 
14 177 LEU n 
14 178 GLU n 
14 179 ASP n 
14 180 LEU n 
14 181 LEU n 
14 182 ALA n 
14 183 HIS n 
14 184 PRO n 
14 185 LEU n 
14 186 GLN n 
14 187 GLU n 
14 188 GLU n 
14 189 ALA n 
14 190 ALA n 
14 191 PHE n 
14 192 TRP n 
14 193 VAL n 
14 194 PHE n 
14 195 LEU n 
14 196 GLY n 
14 197 PHE n 
14 198 ALA n 
14 199 LEU n 
14 200 ALA n 
14 201 PHE n 
14 202 ALA n 
14 203 ILE n 
14 204 LYS n 
14 205 THR n 
14 206 PRO n 
14 207 LEU n 
14 208 PHE n 
14 209 PRO n 
14 210 LEU n 
14 211 HIS n 
14 212 ALA n 
14 213 TRP n 
14 214 LEU n 
14 215 PRO n 
14 216 PRO n 
14 217 PHE n 
14 218 HIS n 
14 219 GLN n 
14 220 GLU n 
14 221 ASN n 
14 222 HIS n 
14 223 PRO n 
14 224 SER n 
14 225 GLY n 
14 226 LEU n 
14 227 ALA n 
14 228 ASP n 
14 229 ALA n 
14 230 LEU n 
14 231 GLY n 
14 232 THR n 
14 233 LEU n 
14 234 TYR n 
14 235 LYS n 
14 236 VAL n 
14 237 GLY n 
14 238 VAL n 
14 239 PHE n 
14 240 ALA n 
14 241 PHE n 
14 242 PHE n 
14 243 ARG n 
14 244 PHE n 
14 245 ALA n 
14 246 ILE n 
14 247 PRO n 
14 248 LEU n 
14 249 ALA n 
14 250 PRO n 
14 251 GLU n 
14 252 GLY n 
14 253 PHE n 
14 254 ALA n 
14 255 GLN n 
14 256 ALA n 
14 257 GLN n 
14 258 GLY n 
14 259 LEU n 
14 260 LEU n 
14 261 LEU n 
14 262 PHE n 
14 263 LEU n 
14 264 ALA n 
14 265 ALA n 
14 266 LEU n 
14 267 SER n 
14 268 ALA n 
14 269 LEU n 
14 270 TYR n 
14 271 GLY n 
14 272 ALA n 
14 273 TRP n 
14 274 VAL n 
14 275 ALA n 
14 276 PHE n 
14 277 ALA n 
14 278 ALA n 
14 279 LYS n 
14 280 ASP n 
14 281 PHE n 
14 282 LYS n 
14 283 THR n 
14 284 LEU n 
14 285 LEU n 
14 286 ALA n 
14 287 TYR n 
14 288 ALA n 
14 289 GLY n 
14 290 LEU n 
14 291 SER n 
14 292 HIS n 
14 293 MET n 
14 294 GLY n 
14 295 VAL n 
14 296 ALA n 
14 297 ALA n 
14 298 LEU n 
14 299 GLY n 
14 300 VAL n 
14 301 PHE n 
14 302 SER n 
14 303 GLY n 
14 304 THR n 
14 305 PRO n 
14 306 GLU n 
14 307 GLY n 
14 308 ALA n 
14 309 MET n 
14 310 GLY n 
14 311 GLY n 
14 312 LEU n 
14 313 TYR n 
14 314 LEU n 
14 315 LEU n 
14 316 ALA n 
14 317 ALA n 
14 318 SER n 
14 319 GLY n 
14 320 VAL n 
14 321 TYR n 
14 322 THR n 
14 323 GLY n 
14 324 GLY n 
14 325 LEU n 
14 326 PHE n 
14 327 LEU n 
14 328 LEU n 
14 329 ALA n 
14 330 GLY n 
14 331 ARG n 
14 332 LEU n 
14 333 TYR n 
14 334 GLU n 
14 335 ARG n 
14 336 THR n 
14 337 GLY n 
14 338 THR n 
14 339 LEU n 
14 340 GLU n 
14 341 ILE n 
14 342 GLY n 
14 343 ARG n 
14 344 TYR n 
14 345 ARG n 
14 346 GLY n 
14 347 LEU n 
14 348 ALA n 
14 349 GLN n 
14 350 SER n 
14 351 ALA n 
14 352 PRO n 
14 353 GLY n 
14 354 LEU n 
14 355 ALA n 
14 356 ALA n 
14 357 LEU n 
14 358 ALA n 
14 359 LEU n 
14 360 ILE n 
14 361 LEU n 
14 362 PHE n 
14 363 LEU n 
14 364 ALA n 
14 365 MET n 
14 366 VAL n 
14 367 GLY n 
14 368 LEU n 
14 369 PRO n 
14 370 GLY n 
14 371 LEU n 
14 372 SER n 
14 373 GLY n 
14 374 PHE n 
14 375 PRO n 
14 376 GLY n 
14 377 GLU n 
14 378 PHE n 
14 379 LEU n 
14 380 THR n 
14 381 LEU n 
14 382 LEU n 
14 383 GLY n 
14 384 ALA n 
14 385 TYR n 
14 386 LYS n 
14 387 ALA n 
14 388 SER n 
14 389 PRO n 
14 390 TRP n 
14 391 LEU n 
14 392 ALA n 
14 393 ALA n 
14 394 LEU n 
14 395 ALA n 
14 396 PHE n 
14 397 LEU n 
14 398 SER n 
14 399 VAL n 
14 400 ILE n 
14 401 ALA n 
14 402 SER n 
14 403 ALA n 
14 404 ALA n 
14 405 TYR n 
14 406 ALA n 
14 407 LEU n 
14 408 THR n 
14 409 ALA n 
14 410 PHE n 
14 411 GLN n 
14 412 LYS n 
14 413 THR n 
14 414 PHE n 
14 415 TRP n 
14 416 GLU n 
14 417 GLU n 
14 418 GLY n 
14 419 GLY n 
14 420 SER n 
14 421 GLY n 
14 422 VAL n 
14 423 LYS n 
14 424 ASP n 
14 425 LEU n 
14 426 ALA n 
14 427 GLY n 
14 428 ALA n 
14 429 GLU n 
14 430 TRP n 
14 431 GLY n 
14 432 PHE n 
14 433 ALA n 
14 434 LEU n 
14 435 LEU n 
14 436 SER n 
14 437 VAL n 
14 438 LEU n 
14 439 ALA n 
14 440 LEU n 
14 441 LEU n 
14 442 LEU n 
14 443 MET n 
14 444 GLY n 
14 445 VAL n 
14 446 PHE n 
14 447 PRO n 
14 448 GLY n 
14 449 TYR n 
14 450 PHE n 
14 451 ALA n 
14 452 ARG n 
14 453 GLY n 
14 454 LEU n 
14 455 HIS n 
14 456 PRO n 
14 457 LEU n 
14 458 ALA n 
14 459 GLU n 
14 460 ALA n 
14 461 PHE n 
14 462 ALA n 
14 463 LYS n 
14 464 LEU n 
14 465 LEU n 
14 466 GLY n 
14 467 GLY n 
14 468 GLY n 
14 469 ALA n 
15 1   MET n 
15 2   THR n 
15 3   LEU n 
15 4   ALA n 
15 5   ILE n 
15 6   LEU n 
15 7   ALA n 
15 8   VAL n 
15 9   PHE n 
15 10  SER n 
15 11  VAL n 
15 12  ALA n 
15 13  LEU n 
15 14  THR n 
15 15  LEU n 
15 16  LEU n 
15 17  GLY n 
15 18  PHE n 
15 19  VAL n 
15 20  LEU n 
15 21  PRO n 
15 22  PRO n 
15 23  GLN n 
15 24  GLY n 
15 25  VAL n 
15 26  LYS n 
15 27  ARG n 
15 28  ALA n 
15 29  THR n 
15 30  LEU n 
15 31  LEU n 
15 32  GLY n 
15 33  LEU n 
15 34  ALA n 
15 35  LEU n 
15 36  ALA n 
15 37  LEU n 
15 38  ALA n 
15 39  SER n 
15 40  LEU n 
15 41  LEU n 
15 42  LEU n 
15 43  THR n 
15 44  TRP n 
15 45  GLY n 
15 46  LYS n 
15 47  PRO n 
15 48  PHE n 
15 49  ALA n 
15 50  PHE n 
15 51  GLY n 
15 52  PRO n 
15 53  TYR n 
15 54  ALA n 
15 55  VAL n 
15 56  ASP n 
15 57  GLY n 
15 58  VAL n 
15 59  SER n 
15 60  GLN n 
15 61  VAL n 
15 62  PHE n 
15 63  THR n 
15 64  LEU n 
15 65  LEU n 
15 66  ALA n 
15 67  LEU n 
15 68  LEU n 
15 69  GLY n 
15 70  ALA n 
15 71  LEU n 
15 72  TRP n 
15 73  THR n 
15 74  VAL n 
15 75  GLY n 
15 76  LEU n 
15 77  VAL n 
15 78  ARG n 
15 79  SER n 
15 80  GLY n 
15 81  ARG n 
15 82  PHE n 
15 83  GLU n 
15 84  PHE n 
15 85  TYR n 
15 86  LEU n 
15 87  LEU n 
15 88  VAL n 
15 89  LEU n 
15 90  TYR n 
15 91  ALA n 
15 92  ALA n 
15 93  LEU n 
15 94  GLY n 
15 95  MET n 
15 96  HIS n 
15 97  LEU n 
15 98  LEU n 
15 99  ALA n 
15 100 SER n 
15 101 THR n 
15 102 ARG n 
15 103 HIS n 
15 104 LEU n 
15 105 LEU n 
15 106 LEU n 
15 107 MET n 
15 108 LEU n 
15 109 VAL n 
15 110 ALA n 
15 111 LEU n 
15 112 GLU n 
15 113 ALA n 
15 114 LEU n 
15 115 SER n 
15 116 LEU n 
15 117 PRO n 
15 118 LEU n 
15 119 TYR n 
15 120 ALA n 
15 121 LEU n 
15 122 ALA n 
15 123 THR n 
15 124 TRP n 
15 125 ARG n 
15 126 ARG n 
15 127 GLY n 
15 128 GLN n 
15 129 GLY n 
15 130 LEU n 
15 131 GLU n 
15 132 ALA n 
15 133 ALA n 
15 134 LEU n 
15 135 LYS n 
15 136 TYR n 
15 137 PHE n 
15 138 LEU n 
15 139 LEU n 
15 140 GLY n 
15 141 ALA n 
15 142 LEU n 
15 143 ALA n 
15 144 ALA n 
15 145 ALA n 
15 146 PHE n 
15 147 PHE n 
15 148 LEU n 
15 149 TYR n 
15 150 GLY n 
15 151 ALA n 
15 152 ALA n 
15 153 LEU n 
15 154 PHE n 
15 155 TYR n 
15 156 GLY n 
15 157 ALA n 
15 158 THR n 
15 159 GLY n 
15 160 SER n 
15 161 LEU n 
15 162 VAL n 
15 163 LEU n 
15 164 GLY n 
15 165 ALA n 
15 166 PRO n 
15 167 GLY n 
15 168 GLU n 
15 169 GLY n 
15 170 PRO n 
15 171 LEU n 
15 172 TYR n 
15 173 ALA n 
15 174 LEU n 
15 175 ALA n 
15 176 LEU n 
15 177 GLY n 
15 178 LEU n 
15 179 LEU n 
15 180 LEU n 
15 181 VAL n 
15 182 GLY n 
15 183 LEU n 
15 184 GLY n 
15 185 PHE n 
15 186 LYS n 
15 187 ALA n 
15 188 ALA n 
15 189 LEU n 
15 190 ALA n 
15 191 PRO n 
15 192 PHE n 
15 193 HIS n 
15 194 PHE n 
15 195 TRP n 
15 196 THR n 
15 197 PRO n 
15 198 ASP n 
15 199 VAL n 
15 200 TYR n 
15 201 GLN n 
15 202 GLY n 
15 203 SER n 
15 204 PRO n 
15 205 THR n 
15 206 PRO n 
15 207 VAL n 
15 208 VAL n 
15 209 LEU n 
15 210 PHE n 
15 211 MET n 
15 212 ALA n 
15 213 THR n 
15 214 SER n 
15 215 VAL n 
15 216 LYS n 
15 217 ALA n 
15 218 ALA n 
15 219 ALA n 
15 220 PHE n 
15 221 ALA n 
15 222 ALA n 
15 223 LEU n 
15 224 LEU n 
15 225 ARG n 
15 226 VAL n 
15 227 ALA n 
15 228 ALA n 
15 229 PRO n 
15 230 PRO n 
15 231 GLU n 
15 232 ALA n 
15 233 LEU n 
15 234 ALA n 
15 235 LEU n 
15 236 LEU n 
15 237 VAL n 
15 238 ALA n 
15 239 LEU n 
15 240 SER n 
15 241 VAL n 
15 242 VAL n 
15 243 VAL n 
15 244 GLY n 
15 245 ASN n 
15 246 LEU n 
15 247 ALA n 
15 248 ALA n 
15 249 LEU n 
15 250 ALA n 
15 251 GLN n 
15 252 LYS n 
15 253 GLU n 
15 254 ALA n 
15 255 LYS n 
15 256 ARG n 
15 257 LEU n 
15 258 LEU n 
15 259 ALA n 
15 260 TYR n 
15 261 SER n 
15 262 SER n 
15 263 ILE n 
15 264 ALA n 
15 265 HIS n 
15 266 ALA n 
15 267 GLY n 
15 268 TYR n 
15 269 MET n 
15 270 ALA n 
15 271 LEU n 
15 272 ALA n 
15 273 LEU n 
15 274 TYR n 
15 275 THR n 
15 276 GLY n 
15 277 ASN n 
15 278 ALA n 
15 279 GLN n 
15 280 ALA n 
15 281 LEU n 
15 282 GLY n 
15 283 PHE n 
15 284 TYR n 
15 285 LEU n 
15 286 LEU n 
15 287 THR n 
15 288 TYR n 
15 289 VAL n 
15 290 LEU n 
15 291 ALA n 
15 292 THR n 
15 293 GLY n 
15 294 LEU n 
15 295 ALA n 
15 296 PHE n 
15 297 ALA n 
15 298 VAL n 
15 299 LEU n 
15 300 SER n 
15 301 GLN n 
15 302 ILE n 
15 303 SER n 
15 304 PRO n 
15 305 ASP n 
15 306 ARG n 
15 307 VAL n 
15 308 PRO n 
15 309 LEU n 
15 310 GLU n 
15 311 ALA n 
15 312 LEU n 
15 313 ARG n 
15 314 GLY n 
15 315 LEU n 
15 316 TYR n 
15 317 ARG n 
15 318 LYS n 
15 319 ASP n 
15 320 PRO n 
15 321 LEU n 
15 322 LEU n 
15 323 GLY n 
15 324 LEU n 
15 325 ALA n 
15 326 PHE n 
15 327 LEU n 
15 328 VAL n 
15 329 ALA n 
15 330 MET n 
15 331 LEU n 
15 332 SER n 
15 333 LEU n 
15 334 LEU n 
15 335 GLY n 
15 336 LEU n 
15 337 PRO n 
15 338 PRO n 
15 339 LEU n 
15 340 ALA n 
15 341 GLY n 
15 342 PHE n 
15 343 TRP n 
15 344 GLY n 
15 345 LYS n 
15 346 TYR n 
15 347 LEU n 
15 348 ALA n 
15 349 PHE n 
15 350 ALA n 
15 351 GLU n 
15 352 ALA n 
15 353 ALA n 
15 354 ARG n 
15 355 ALA n 
15 356 GLY n 
15 357 ALA n 
15 358 TRP n 
15 359 GLY n 
15 360 VAL n 
15 361 LEU n 
15 362 VAL n 
15 363 LEU n 
15 364 ALA n 
15 365 LEU n 
15 366 VAL n 
15 367 THR n 
15 368 SER n 
15 369 ALA n 
15 370 VAL n 
15 371 SER n 
15 372 ALA n 
15 373 TYR n 
15 374 TYR n 
15 375 TYR n 
15 376 LEU n 
15 377 GLY n 
15 378 LEU n 
15 379 GLY n 
15 380 LEU n 
15 381 ALA n 
15 382 VAL n 
15 383 PHE n 
15 384 ALA n 
15 385 ARG n 
15 386 PRO n 
15 387 GLU n 
15 388 GLU n 
15 389 THR n 
15 390 PRO n 
15 391 PHE n 
15 392 ARG n 
15 393 PRO n 
15 394 GLY n 
15 395 PRO n 
15 396 PRO n 
15 397 TRP n 
15 398 ALA n 
15 399 ARG n 
15 400 ALA n 
15 401 ALA n 
15 402 VAL n 
15 403 VAL n 
15 404 ALA n 
15 405 ALA n 
15 406 GLY n 
15 407 VAL n 
15 408 LEU n 
15 409 LEU n 
15 410 LEU n 
15 411 ALA n 
15 412 LEU n 
15 413 GLY n 
15 414 LEU n 
15 415 LEU n 
15 416 PRO n 
15 417 GLY n 
15 418 LEU n 
15 419 VAL n 
15 420 LEU n 
15 421 PRO n 
15 422 ALA n 
15 423 LEU n 
15 424 ALA n 
15 425 ALA n 
15 426 GLY n 
15 427 GLY n 
16 1   MET n 
16 2   THR n 
16 3   TRP n 
16 4   SER n 
16 5   TYR n 
16 6   PRO n 
16 7   VAL n 
16 8   ASP n 
16 9   PRO n 
16 10  TYR n 
16 11  TRP n 
16 12  MET n 
16 13  VAL n 
16 14  ALA n 
16 15  LEU n 
16 16  LYS n 
16 17  ALA n 
16 18  LEU n 
16 19  LEU n 
16 20  VAL n 
16 21  VAL n 
16 22  VAL n 
16 23  GLY n 
16 24  LEU n 
16 25  LEU n 
16 26  THR n 
16 27  ALA n 
16 28  PHE n 
16 29  ALA n 
16 30  PHE n 
16 31  MET n 
16 32  THR n 
16 33  LEU n 
16 34  ILE n 
16 35  GLU n 
16 36  ARG n 
16 37  ARG n 
16 38  LEU n 
16 39  LEU n 
16 40  ALA n 
16 41  ARG n 
16 42  PHE n 
16 43  GLN n 
16 44  VAL n 
16 45  ARG n 
16 46  MET n 
16 47  GLY n 
16 48  PRO n 
16 49  ASN n 
16 50  ARG n 
16 51  VAL n 
16 52  GLY n 
16 53  PRO n 
16 54  PHE n 
16 55  GLY n 
16 56  LEU n 
16 57  LEU n 
16 58  GLN n 
16 59  PRO n 
16 60  LEU n 
16 61  ALA n 
16 62  ASP n 
16 63  ALA n 
16 64  ILE n 
16 65  LYS n 
16 66  SER n 
16 67  ILE n 
16 68  PHE n 
16 69  LYS n 
16 70  GLU n 
16 71  ASP n 
16 72  ILE n 
16 73  VAL n 
16 74  VAL n 
16 75  ALA n 
16 76  GLN n 
16 77  ALA n 
16 78  ASP n 
16 79  ARG n 
16 80  PHE n 
16 81  LEU n 
16 82  PHE n 
16 83  VAL n 
16 84  LEU n 
16 85  ALA n 
16 86  PRO n 
16 87  LEU n 
16 88  ILE n 
16 89  SER n 
16 90  VAL n 
16 91  VAL n 
16 92  PHE n 
16 93  ALA n 
16 94  LEU n 
16 95  LEU n 
16 96  ALA n 
16 97  PHE n 
16 98  GLY n 
16 99  LEU n 
16 100 ILE n 
16 101 PRO n 
16 102 PHE n 
16 103 GLY n 
16 104 PRO n 
16 105 PRO n 
16 106 GLY n 
16 107 SER n 
16 108 PHE n 
16 109 PHE n 
16 110 GLY n 
16 111 TYR n 
16 112 GLN n 
16 113 PRO n 
16 114 TRP n 
16 115 VAL n 
16 116 ILE n 
16 117 ASN n 
16 118 LEU n 
16 119 ASP n 
16 120 LEU n 
16 121 GLY n 
16 122 ILE n 
16 123 LEU n 
16 124 TYR n 
16 125 LEU n 
16 126 PHE n 
16 127 ALA n 
16 128 VAL n 
16 129 SER n 
16 130 GLU n 
16 131 LEU n 
16 132 ALA n 
16 133 VAL n 
16 134 TYR n 
16 135 GLY n 
16 136 ILE n 
16 137 PHE n 
16 138 LEU n 
16 139 SER n 
16 140 GLY n 
16 141 TRP n 
16 142 ALA n 
16 143 SER n 
16 144 GLY n 
16 145 SER n 
16 146 LYS n 
16 147 TYR n 
16 148 SER n 
16 149 LEU n 
16 150 LEU n 
16 151 GLY n 
16 152 SER n 
16 153 LEU n 
16 154 ARG n 
16 155 SER n 
16 156 SER n 
16 157 ALA n 
16 158 SER n 
16 159 LEU n 
16 160 ILE n 
16 161 SER n 
16 162 TYR n 
16 163 GLU n 
16 164 LEU n 
16 165 GLY n 
16 166 LEU n 
16 167 GLY n 
16 168 LEU n 
16 169 ALA n 
16 170 LEU n 
16 171 LEU n 
16 172 ALA n 
16 173 PRO n 
16 174 VAL n 
16 175 LEU n 
16 176 LEU n 
16 177 VAL n 
16 178 GLY n 
16 179 SER n 
16 180 LEU n 
16 181 ASN n 
16 182 LEU n 
16 183 ASN n 
16 184 ASP n 
16 185 ILE n 
16 186 VAL n 
16 187 ASN n 
16 188 TRP n 
16 189 GLN n 
16 190 LYS n 
16 191 GLU n 
16 192 HIS n 
16 193 GLY n 
16 194 TRP n 
16 195 LEU n 
16 196 PHE n 
16 197 LEU n 
16 198 TYR n 
16 199 ALA n 
16 200 PHE n 
16 201 PRO n 
16 202 ALA n 
16 203 PHE n 
16 204 LEU n 
16 205 VAL n 
16 206 TYR n 
16 207 LEU n 
16 208 ILE n 
16 209 ALA n 
16 210 SER n 
16 211 MET n 
16 212 ALA n 
16 213 GLU n 
16 214 ALA n 
16 215 ALA n 
16 216 ARG n 
16 217 THR n 
16 218 PRO n 
16 219 PHE n 
16 220 ASP n 
16 221 LEU n 
16 222 PRO n 
16 223 GLU n 
16 224 ALA n 
16 225 GLU n 
16 226 GLN n 
16 227 GLU n 
16 228 LEU n 
16 229 VAL n 
16 230 GLY n 
16 231 GLY n 
16 232 TYR n 
16 233 HIS n 
16 234 THR n 
16 235 GLU n 
16 236 TYR n 
16 237 SER n 
16 238 SER n 
16 239 ILE n 
16 240 LYS n 
16 241 TRP n 
16 242 ALA n 
16 243 LEU n 
16 244 PHE n 
16 245 GLN n 
16 246 MET n 
16 247 ALA n 
16 248 GLU n 
16 249 TYR n 
16 250 ILE n 
16 251 HIS n 
16 252 PHE n 
16 253 ILE n 
16 254 THR n 
16 255 ALA n 
16 256 SER n 
16 257 ALA n 
16 258 LEU n 
16 259 ILE n 
16 260 PRO n 
16 261 THR n 
16 262 LEU n 
16 263 PHE n 
16 264 LEU n 
16 265 GLY n 
16 266 GLY n 
16 267 TRP n 
16 268 THR n 
16 269 MET n 
16 270 PRO n 
16 271 VAL n 
16 272 LEU n 
16 273 GLU n 
16 274 VAL n 
16 275 PRO n 
16 276 TYR n 
16 277 LEU n 
16 278 TRP n 
16 279 MET n 
16 280 PHE n 
16 281 LEU n 
16 282 LYS n 
16 283 ILE n 
16 284 ALA n 
16 285 PHE n 
16 286 PHE n 
16 287 LEU n 
16 288 PHE n 
16 289 PHE n 
16 290 PHE n 
16 291 ILE n 
16 292 TRP n 
16 293 ILE n 
16 294 ARG n 
16 295 ALA n 
16 296 THR n 
16 297 TRP n 
16 298 PHE n 
16 299 ARG n 
16 300 LEU n 
16 301 ARG n 
16 302 TYR n 
16 303 ASP n 
16 304 GLN n 
16 305 LEU n 
16 306 LEU n 
16 307 ARG n 
16 308 PHE n 
16 309 GLY n 
16 310 TRP n 
16 311 GLY n 
16 312 PHE n 
16 313 LEU n 
16 314 PHE n 
16 315 PRO n 
16 316 LEU n 
16 317 ALA n 
16 318 LEU n 
16 319 LEU n 
16 320 TRP n 
16 321 PHE n 
16 322 LEU n 
16 323 VAL n 
16 324 THR n 
16 325 ALA n 
16 326 LEU n 
16 327 VAL n 
16 328 VAL n 
16 329 ALA n 
16 330 LEU n 
16 331 ASP n 
16 332 LEU n 
16 333 PRO n 
16 334 ARG n 
16 335 THR n 
16 336 TYR n 
16 337 LEU n 
16 338 LEU n 
16 339 TYR n 
16 340 LEU n 
16 341 SER n 
16 342 ALA n 
16 343 LEU n 
16 344 SER n 
16 345 PHE n 
16 346 LEU n 
16 347 VAL n 
16 348 LEU n 
16 349 LEU n 
16 350 GLY n 
16 351 ALA n 
16 352 VAL n 
16 353 LEU n 
16 354 TYR n 
16 355 THR n 
16 356 PRO n 
16 357 LYS n 
16 358 PRO n 
16 359 ALA n 
16 360 ARG n 
16 361 LYS n 
16 362 GLY n 
16 363 GLY n 
16 364 GLY n 
16 365 ALA n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1  1 sample 1 438 ? 'Thermus thermophilus HB8' 300852 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2  1 sample 1 181 ? 'Thermus thermophilus HB8' 300852 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3  1 sample 1 783 ? 'Thermus thermophilus HB8' 300852 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4  1 sample 1 409 ? 'Thermus thermophilus HB8' 300852 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5  1 sample 1 207 ? 'Thermus thermophilus HB8' 300852 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6  1 sample 1 181 ? 'Thermus thermophilus HB8' 300852 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
7  1 sample 1 182 ? 'Thermus thermophilus HB8' 300852 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
8  1 sample 1 129 ? 'Thermus thermophilus HB8' 300852 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
9  1 sample 1 131 ? 'Thermus thermophilus HB8' 300852 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
10 1 sample 1 119 ? 'Thermus thermophilus HB8' 300852 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
11 1 sample 1 176 ? 'Thermus thermophilus HB8' 300852 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
12 1 sample 1 95  ? 'Thermus thermophilus HB8' 300852 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
13 1 sample 1 606 ? 'Thermus thermophilus HB8' 300852 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
14 1 sample 1 469 ? 'Thermus thermophilus HB8' 300852 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
15 1 sample 1 427 ? 'Thermus thermophilus HB8' 300852 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
16 1 sample 1 365 ? 'Thermus thermophilus HB8' 300852 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                     ?                          'C3 H7 N O2'      
89.093  
ARG 'L-peptide linking' y ARGININE                                                    ?                          'C6 H15 N4 O2 1'  
175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                  ?                          'C4 H8 N2 O3'     
132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                             ?                          'C4 H7 N O4'      
133.103 
CYS 'L-peptide linking' y CYSTEINE                                                    ?                          'C3 H7 N O2 S'    
121.158 
DCQ non-polymer         . 2-decyl-5,6-dimethoxy-3-methylcyclohexa-2,5-diene-1,4-dione decylubiquinone            'C19 H30 O4'      
322.439 
FES non-polymer         . 'FE2/S2 (INORGANIC) CLUSTER'                                ?                          'Fe2 S2'          
175.820 
FMN non-polymer         . 'FLAVIN MONONUCLEOTIDE'                                     'RIBOFLAVIN MONOPHOSPHATE' 'C17 H21 N4 O9 P' 
456.344 
GLN 'L-peptide linking' y GLUTAMINE                                                   ?                          'C5 H10 N2 O3'    
146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                             ?                          'C5 H9 N O4'      
147.129 
GLY 'peptide linking'   y GLYCINE                                                     ?                          'C2 H5 N O2'      
75.067  
HIS 'L-peptide linking' y HISTIDINE                                                   ?                          'C6 H10 N3 O2 1'  
156.162 
ILE 'L-peptide linking' y ISOLEUCINE                                                  ?                          'C6 H13 N O2'     
131.173 
LEU 'L-peptide linking' y LEUCINE                                                     ?                          'C6 H13 N O2'     
131.173 
LYS 'L-peptide linking' y LYSINE                                                      ?                          'C6 H15 N2 O2 1'  
147.195 
MET 'L-peptide linking' y METHIONINE                                                  ?                          'C5 H11 N O2 S'   
149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                               ?                          'C9 H11 N O2'     
165.189 
PRO 'L-peptide linking' y PROLINE                                                     ?                          'C5 H9 N O2'      
115.130 
SER 'L-peptide linking' y SERINE                                                      ?                          'C3 H7 N O3'      
105.093 
SF4 non-polymer         . 'IRON/SULFUR CLUSTER'                                       ?                          'Fe4 S4'          
351.640 
THR 'L-peptide linking' y THREONINE                                                   ?                          'C4 H9 N O3'      
119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                  ?                          'C11 H12 N2 O2'   
204.225 
TYR 'L-peptide linking' y TYROSINE                                                    ?                          'C9 H11 N O3'     
181.189 
VAL 'L-peptide linking' y VALINE                                                      ?                          'C5 H11 N O2'     
117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A  1  1   MET 1   1   ?   ?   ?   1 . n 
A  1  2   THR 2   2   2   THR THR 1 . n 
A  1  3   GLY 3   3   3   GLY GLY 1 . n 
A  1  4   PRO 4   4   4   PRO PRO 1 . n 
A  1  5   ILE 5   5   5   ILE ILE 1 . n 
A  1  6   LEU 6   6   6   LEU LEU 1 . n 
A  1  7   SER 7   7   7   SER SER 1 . n 
A  1  8   GLY 8   8   8   GLY GLY 1 . n 
A  1  9   LEU 9   9   9   LEU LEU 1 . n 
A  1  10  ASP 10  10  10  ASP ASP 1 . n 
A  1  11  PRO 11  11  11  PRO PRO 1 . n 
A  1  12  ARG 12  12  12  ARG ARG 1 . n 
A  1  13  PHE 13  13  13  PHE PHE 1 . n 
A  1  14  GLU 14  14  14  GLU GLU 1 . n 
A  1  15  ARG 15  15  15  ARG ARG 1 . n 
A  1  16  THR 16  16  16  THR THR 1 . n 
A  1  17  LEU 17  17  17  LEU LEU 1 . n 
A  1  18  TYR 18  18  18  TYR TYR 1 . n 
A  1  19  ALA 19  19  19  ALA ALA 1 . n 
A  1  20  HIS 20  20  20  HIS HIS 1 . n 
A  1  21  VAL 21  21  21  VAL VAL 1 . n 
A  1  22  GLY 22  22  22  GLY GLY 1 . n 
A  1  23  LYS 23  23  23  LYS LYS 1 . n 
A  1  24  GLU 24  24  24  GLU GLU 1 . n 
A  1  25  GLY 25  25  25  GLY GLY 1 . n 
A  1  26  SER 26  26  26  SER SER 1 . n 
A  1  27  TRP 27  27  27  TRP TRP 1 . n 
A  1  28  THR 28  28  28  THR THR 1 . n 
A  1  29  LEU 29  29  29  LEU LEU 1 . n 
A  1  30  ASP 30  30  30  ASP ASP 1 . n 
A  1  31  TYR 31  31  31  TYR TYR 1 . n 
A  1  32  TYR 32  32  32  TYR TYR 1 . n 
A  1  33  LEU 33  33  33  LEU LEU 1 . n 
A  1  34  ARG 34  34  34  ARG ARG 1 . n 
A  1  35  HIS 35  35  35  HIS HIS 1 . n 
A  1  36  GLY 36  36  36  GLY GLY 1 . n 
A  1  37  GLY 37  37  37  GLY GLY 1 . n 
A  1  38  TYR 38  38  38  TYR TYR 1 . n 
A  1  39  GLU 39  39  39  GLU GLU 1 . n 
A  1  40  THR 40  40  40  THR THR 1 . n 
A  1  41  ALA 41  41  41  ALA ALA 1 . n 
A  1  42  LYS 42  42  42  LYS LYS 1 . n 
A  1  43  ARG 43  43  43  ARG ARG 1 . n 
A  1  44  VAL 44  44  44  VAL VAL 1 . n 
A  1  45  LEU 45  45  45  LEU LEU 1 . n 
A  1  46  LYS 46  46  46  LYS LYS 1 . n 
A  1  47  GLU 47  47  47  GLU GLU 1 . n 
A  1  48  LYS 48  48  48  LYS LYS 1 . n 
A  1  49  THR 49  49  49  THR THR 1 . n 
A  1  50  PRO 50  50  50  PRO PRO 1 . n 
A  1  51  ASP 51  51  51  ASP ASP 1 . n 
A  1  52  GLU 52  52  52  GLU GLU 1 . n 
A  1  53  VAL 53  53  53  VAL VAL 1 . n 
A  1  54  ILE 54  54  54  ILE ILE 1 . n 
A  1  55  GLU 55  55  55  GLU GLU 1 . n 
A  1  56  GLU 56  56  56  GLU GLU 1 . n 
A  1  57  VAL 57  57  57  VAL VAL 1 . n 
A  1  58  LYS 58  58  58  LYS LYS 1 . n 
A  1  59  ARG 59  59  59  ARG ARG 1 . n 
A  1  60  SER 60  60  60  SER SER 1 . n 
A  1  61  GLY 61  61  61  GLY GLY 1 . n 
A  1  62  LEU 62  62  62  LEU LEU 1 . n 
A  1  63  ARG 63  63  63  ARG ARG 1 . n 
A  1  64  GLY 64  64  64  GLY GLY 1 . n 
A  1  65  ARG 65  65  65  ARG ARG 1 . n 
A  1  66  GLY 66  66  66  GLY GLY 1 . n 
A  1  67  GLY 67  67  67  GLY GLY 1 . n 
A  1  68  ALA 68  68  68  ALA ALA 1 . n 
A  1  69  GLY 69  69  69  GLY GLY 1 . n 
A  1  70  PHE 70  70  70  PHE PHE 1 . n 
A  1  71  PRO 71  71  71  PRO PRO 1 . n 
A  1  72  THR 72  72  72  THR THR 1 . n 
A  1  73  GLY 73  73  73  GLY GLY 1 . n 
A  1  74  LEU 74  74  74  LEU LEU 1 . n 
A  1  75  LYS 75  75  75  LYS LYS 1 . n 
A  1  76  TRP 76  76  76  TRP TRP 1 . n 
A  1  77  SER 77  77  77  SER SER 1 . n 
A  1  78  PHE 78  78  78  PHE PHE 1 . n 
A  1  79  MET 79  79  79  MET MET 1 . n 
A  1  80  PRO 80  80  80  PRO PRO 1 . n 
A  1  81  LYS 81  81  81  LYS LYS 1 . n 
A  1  82  ASP 82  82  82  ASP ASP 1 . n 
A  1  83  ASP 83  83  83  ASP ASP 1 . n 
A  1  84  GLY 84  84  84  GLY GLY 1 . n 
A  1  85  LYS 85  85  85  LYS LYS 1 . n 
A  1  86  GLN 86  86  86  GLN GLN 1 . n 
A  1  87  HIS 87  87  87  HIS HIS 1 . n 
A  1  88  TYR 88  88  88  TYR TYR 1 . n 
A  1  89  LEU 89  89  89  LEU LEU 1 . n 
A  1  90  ILE 90  90  90  ILE ILE 1 . n 
A  1  91  CYS 91  91  91  CYS CYS 1 . n 
A  1  92  ASN 92  92  92  ASN ASN 1 . n 
A  1  93  ALA 93  93  93  ALA ALA 1 . n 
A  1  94  ASP 94  94  94  ASP ASP 1 . n 
A  1  95  GLU 95  95  95  GLU GLU 1 . n 
A  1  96  SER 96  96  96  SER SER 1 . n 
A  1  97  GLU 97  97  97  GLU GLU 1 . n 
A  1  98  PRO 98  98  98  PRO PRO 1 . n 
A  1  99  GLY 99  99  99  GLY GLY 1 . n 
A  1  100 SER 100 100 100 SER SER 1 . n 
A  1  101 PHE 101 101 101 PHE PHE 1 . n 
A  1  102 LYS 102 102 102 LYS LYS 1 . n 
A  1  103 ASP 103 103 103 ASP ASP 1 . n 
A  1  104 ARG 104 104 104 ARG ARG 1 . n 
A  1  105 TYR 105 105 105 TYR TYR 1 . n 
A  1  106 ILE 106 106 106 ILE ILE 1 . n 
A  1  107 LEU 107 107 107 LEU LEU 1 . n 
A  1  108 GLU 108 108 108 GLU GLU 1 . n 
A  1  109 ASP 109 109 109 ASP ASP 1 . n 
A  1  110 VAL 110 110 110 VAL VAL 1 . n 
A  1  111 PRO 111 111 111 PRO PRO 1 . n 
A  1  112 HIS 112 112 112 HIS HIS 1 . n 
A  1  113 LEU 113 113 113 LEU LEU 1 . n 
A  1  114 LEU 114 114 114 LEU LEU 1 . n 
A  1  115 ILE 115 115 115 ILE ILE 1 . n 
A  1  116 GLU 116 116 116 GLU GLU 1 . n 
A  1  117 GLY 117 117 117 GLY GLY 1 . n 
A  1  118 MET 118 118 118 MET MET 1 . n 
A  1  119 ILE 119 119 119 ILE ILE 1 . n 
A  1  120 LEU 120 120 120 LEU LEU 1 . n 
A  1  121 ALA 121 121 121 ALA ALA 1 . n 
A  1  122 GLY 122 122 122 GLY GLY 1 . n 
A  1  123 TYR 123 123 123 TYR TYR 1 . n 
A  1  124 ALA 124 124 124 ALA ALA 1 . n 
A  1  125 ILE 125 125 125 ILE ILE 1 . n 
A  1  126 ARG 126 126 126 ARG ARG 1 . n 
A  1  127 ALA 127 127 127 ALA ALA 1 . n 
A  1  128 THR 128 128 128 THR THR 1 . n 
A  1  129 VAL 129 129 129 VAL VAL 1 . n 
A  1  130 GLY 130 130 130 GLY GLY 1 . n 
A  1  131 TYR 131 131 131 TYR TYR 1 . n 
A  1  132 ILE 132 132 132 ILE ILE 1 . n 
A  1  133 TYR 133 133 133 TYR TYR 1 . n 
A  1  134 VAL 134 134 134 VAL VAL 1 . n 
A  1  135 ARG 135 135 135 ARG ARG 1 . n 
A  1  136 GLY 136 136 136 GLY GLY 1 . n 
A  1  137 GLU 137 137 137 GLU GLU 1 . n 
A  1  138 TYR 138 138 138 TYR TYR 1 . n 
A  1  139 ARG 139 139 139 ARG ARG 1 . n 
A  1  140 ARG 140 140 140 ARG ARG 1 . n 
A  1  141 ALA 141 141 141 ALA ALA 1 . n 
A  1  142 ALA 142 142 142 ALA ALA 1 . n 
A  1  143 ASP 143 143 143 ASP ASP 1 . n 
A  1  144 ARG 144 144 144 ARG ARG 1 . n 
A  1  145 LEU 145 145 145 LEU LEU 1 . n 
A  1  146 GLU 146 146 146 GLU GLU 1 . n 
A  1  147 GLN 147 147 147 GLN GLN 1 . n 
A  1  148 ALA 148 148 148 ALA ALA 1 . n 
A  1  149 ILE 149 149 149 ILE ILE 1 . n 
A  1  150 LYS 150 150 150 LYS LYS 1 . n 
A  1  151 GLU 151 151 151 GLU GLU 1 . n 
A  1  152 ALA 152 152 152 ALA ALA 1 . n 
A  1  153 ARG 153 153 153 ARG ARG 1 . n 
A  1  154 ALA 154 154 154 ALA ALA 1 . n 
A  1  155 ARG 155 155 155 ARG ARG 1 . n 
A  1  156 GLY 156 156 156 GLY GLY 1 . n 
A  1  157 TYR 157 157 157 TYR TYR 1 . n 
A  1  158 LEU 158 158 158 LEU LEU 1 . n 
A  1  159 GLY 159 159 159 GLY GLY 1 . n 
A  1  160 LYS 160 160 160 LYS LYS 1 . n 
A  1  161 ASN 161 161 161 ASN ASN 1 . n 
A  1  162 LEU 162 162 162 LEU LEU 1 . n 
A  1  163 PHE 163 163 163 PHE PHE 1 . n 
A  1  164 GLY 164 164 164 GLY GLY 1 . n 
A  1  165 THR 165 165 165 THR THR 1 . n 
A  1  166 ASP 166 166 166 ASP ASP 1 . n 
A  1  167 PHE 167 167 167 PHE PHE 1 . n 
A  1  168 SER 168 168 168 SER SER 1 . n 
A  1  169 PHE 169 169 169 PHE PHE 1 . n 
A  1  170 ASP 170 170 170 ASP ASP 1 . n 
A  1  171 LEU 171 171 171 LEU LEU 1 . n 
A  1  172 HIS 172 172 172 HIS HIS 1 . n 
A  1  173 VAL 173 173 173 VAL VAL 1 . n 
A  1  174 HIS 174 174 174 HIS HIS 1 . n 
A  1  175 ARG 175 175 175 ARG ARG 1 . n 
A  1  176 GLY 176 176 176 GLY GLY 1 . n 
A  1  177 ALA 177 177 177 ALA ALA 1 . n 
A  1  178 GLY 178 178 178 GLY GLY 1 . n 
A  1  179 ALA 179 179 179 ALA ALA 1 . n 
A  1  180 TYR 180 180 180 TYR TYR 1 . n 
A  1  181 ILE 181 181 181 ILE ILE 1 . n 
A  1  182 CYS 182 182 182 CYS CYS 1 . n 
A  1  183 GLY 183 183 183 GLY GLY 1 . n 
A  1  184 GLU 184 184 184 GLU GLU 1 . n 
A  1  185 GLU 185 185 185 GLU GLU 1 . n 
A  1  186 THR 186 186 186 THR THR 1 . n 
A  1  187 ALA 187 187 187 ALA ALA 1 . n 
A  1  188 LEU 188 188 188 LEU LEU 1 . n 
A  1  189 MET 189 189 189 MET MET 1 . n 
A  1  190 ASN 190 190 190 ASN ASN 1 . n 
A  1  191 SER 191 191 191 SER SER 1 . n 
A  1  192 LEU 192 192 192 LEU LEU 1 . n 
A  1  193 GLU 193 193 193 GLU GLU 1 . n 
A  1  194 GLY 194 194 194 GLY GLY 1 . n 
A  1  195 LEU 195 195 195 LEU LEU 1 . n 
A  1  196 ARG 196 196 196 ARG ARG 1 . n 
A  1  197 ALA 197 197 197 ALA ALA 1 . n 
A  1  198 ASN 198 198 198 ASN ASN 1 . n 
A  1  199 PRO 199 199 199 PRO PRO 1 . n 
A  1  200 ARG 200 200 200 ARG ARG 1 . n 
A  1  201 LEU 201 201 201 LEU LEU 1 . n 
A  1  202 LYS 202 202 202 LYS LYS 1 . n 
A  1  203 PRO 203 203 203 PRO PRO 1 . n 
A  1  204 PRO 204 204 204 PRO PRO 1 . n 
A  1  205 PHE 205 205 205 PHE PHE 1 . n 
A  1  206 PRO 206 206 206 PRO PRO 1 . n 
A  1  207 ALA 207 207 207 ALA ALA 1 . n 
A  1  208 GLN 208 208 208 GLN GLN 1 . n 
A  1  209 SER 209 209 209 SER SER 1 . n 
A  1  210 GLY 210 210 210 GLY GLY 1 . n 
A  1  211 LEU 211 211 211 LEU LEU 1 . n 
A  1  212 TRP 212 212 212 TRP TRP 1 . n 
A  1  213 GLY 213 213 213 GLY GLY 1 . n 
A  1  214 LYS 214 214 214 LYS LYS 1 . n 
A  1  215 PRO 215 215 215 PRO PRO 1 . n 
A  1  216 THR 216 216 216 THR THR 1 . n 
A  1  217 THR 217 217 217 THR THR 1 . n 
A  1  218 ILE 218 218 218 ILE ILE 1 . n 
A  1  219 ASN 219 219 219 ASN ASN 1 . n 
A  1  220 ASN 220 220 220 ASN ASN 1 . n 
A  1  221 VAL 221 221 221 VAL VAL 1 . n 
A  1  222 GLU 222 222 222 GLU GLU 1 . n 
A  1  223 THR 223 223 223 THR THR 1 . n 
A  1  224 LEU 224 224 224 LEU LEU 1 . n 
A  1  225 ALA 225 225 225 ALA ALA 1 . n 
A  1  226 SER 226 226 226 SER SER 1 . n 
A  1  227 VAL 227 227 227 VAL VAL 1 . n 
A  1  228 VAL 228 228 228 VAL VAL 1 . n 
A  1  229 PRO 229 229 229 PRO PRO 1 . n 
A  1  230 ILE 230 230 230 ILE ILE 1 . n 
A  1  231 MET 231 231 231 MET MET 1 . n 
A  1  232 GLU 232 232 232 GLU GLU 1 . n 
A  1  233 ARG 233 233 233 ARG ARG 1 . n 
A  1  234 GLY 234 234 234 GLY GLY 1 . n 
A  1  235 ALA 235 235 235 ALA ALA 1 . n 
A  1  236 ASP 236 236 236 ASP ASP 1 . n 
A  1  237 TRP 237 237 237 TRP TRP 1 . n 
A  1  238 PHE 238 238 238 PHE PHE 1 . n 
A  1  239 ALA 239 239 239 ALA ALA 1 . n 
A  1  240 GLN 240 240 240 GLN GLN 1 . n 
A  1  241 MET 241 241 241 MET MET 1 . n 
A  1  242 GLY 242 242 242 GLY GLY 1 . n 
A  1  243 THR 243 243 243 THR THR 1 . n 
A  1  244 GLU 244 244 244 GLU GLU 1 . n 
A  1  245 GLN 245 245 245 GLN GLN 1 . n 
A  1  246 SER 246 246 246 SER SER 1 . n 
A  1  247 LYS 247 247 247 LYS LYS 1 . n 
A  1  248 GLY 248 248 248 GLY GLY 1 . n 
A  1  249 MET 249 249 249 MET MET 1 . n 
A  1  250 LYS 250 250 250 LYS LYS 1 . n 
A  1  251 LEU 251 251 251 LEU LEU 1 . n 
A  1  252 TYR 252 252 252 TYR TYR 1 . n 
A  1  253 GLN 253 253 253 GLN GLN 1 . n 
A  1  254 ILE 254 254 254 ILE ILE 1 . n 
A  1  255 SER 255 255 255 SER SER 1 . n 
A  1  256 GLY 256 256 256 GLY GLY 1 . n 
A  1  257 PRO 257 257 257 PRO PRO 1 . n 
A  1  258 VAL 258 258 258 VAL VAL 1 . n 
A  1  259 LYS 259 259 259 LYS LYS 1 . n 
A  1  260 ARG 260 260 260 ARG ARG 1 . n 
A  1  261 PRO 261 261 261 PRO PRO 1 . n 
A  1  262 GLY 262 262 262 GLY GLY 1 . n 
A  1  263 VAL 263 263 263 VAL VAL 1 . n 
A  1  264 TYR 264 264 264 TYR TYR 1 . n 
A  1  265 GLU 265 265 265 GLU GLU 1 . n 
A  1  266 LEU 266 266 266 LEU LEU 1 . n 
A  1  267 PRO 267 267 267 PRO PRO 1 . n 
A  1  268 MET 268 268 268 MET MET 1 . n 
A  1  269 GLY 269 269 269 GLY GLY 1 . n 
A  1  270 THR 270 270 270 THR THR 1 . n 
A  1  271 THR 271 271 271 THR THR 1 . n 
A  1  272 PHE 272 272 272 PHE PHE 1 . n 
A  1  273 ARG 273 273 273 ARG ARG 1 . n 
A  1  274 GLU 274 274 274 GLU GLU 1 . n 
A  1  275 LEU 275 275 275 LEU LEU 1 . n 
A  1  276 ILE 276 276 276 ILE ILE 1 . n 
A  1  277 TYR 277 277 277 TYR TYR 1 . n 
A  1  278 GLU 278 278 278 GLU GLU 1 . n 
A  1  279 TRP 279 279 279 TRP TRP 1 . n 
A  1  280 ALA 280 280 280 ALA ALA 1 . n 
A  1  281 GLY 281 281 281 GLY GLY 1 . n 
A  1  282 GLY 282 282 282 GLY GLY 1 . n 
A  1  283 PRO 283 283 283 PRO PRO 1 . n 
A  1  284 LEU 284 284 284 LEU LEU 1 . n 
A  1  285 GLU 285 285 285 GLU GLU 1 . n 
A  1  286 PRO 286 286 286 PRO PRO 1 . n 
A  1  287 ILE 287 287 287 ILE ILE 1 . n 
A  1  288 GLN 288 288 288 GLN GLN 1 . n 
A  1  289 ALA 289 289 289 ALA ALA 1 . n 
A  1  290 ILE 290 290 290 ILE ILE 1 . n 
A  1  291 ILE 291 291 291 ILE ILE 1 . n 
A  1  292 PRO 292 292 292 PRO PRO 1 . n 
A  1  293 GLY 293 293 293 GLY GLY 1 . n 
A  1  294 GLY 294 294 294 GLY GLY 1 . n 
A  1  295 SER 295 295 295 SER SER 1 . n 
A  1  296 SER 296 296 296 SER SER 1 . n 
A  1  297 THR 297 297 297 THR THR 1 . n 
A  1  298 PRO 298 298 298 PRO PRO 1 . n 
A  1  299 PRO 299 299 299 PRO PRO 1 . n 
A  1  300 LEU 300 300 300 LEU LEU 1 . n 
A  1  301 PRO 301 301 301 PRO PRO 1 . n 
A  1  302 PHE 302 302 302 PHE PHE 1 . n 
A  1  303 THR 303 303 303 THR THR 1 . n 
A  1  304 GLU 304 304 304 GLU GLU 1 . n 
A  1  305 GLU 305 305 305 GLU GLU 1 . n 
A  1  306 VAL 306 306 306 VAL VAL 1 . n 
A  1  307 LEU 307 307 307 LEU LEU 1 . n 
A  1  308 ASP 308 308 308 ASP ASP 1 . n 
A  1  309 THR 309 309 309 THR THR 1 . n 
A  1  310 PRO 310 310 310 PRO PRO 1 . n 
A  1  311 MET 311 311 311 MET MET 1 . n 
A  1  312 SER 312 312 312 SER SER 1 . n 
A  1  313 TYR 313 313 313 TYR TYR 1 . n 
A  1  314 GLU 314 314 314 GLU GLU 1 . n 
A  1  315 HIS 315 315 315 HIS HIS 1 . n 
A  1  316 LEU 316 316 316 LEU LEU 1 . n 
A  1  317 GLN 317 317 317 GLN GLN 1 . n 
A  1  318 ALA 318 318 318 ALA ALA 1 . n 
A  1  319 LYS 319 319 319 LYS LYS 1 . n 
A  1  320 GLY 320 320 320 GLY GLY 1 . n 
A  1  321 SER 321 321 321 SER SER 1 . n 
A  1  322 MET 322 322 322 MET MET 1 . n 
A  1  323 LEU 323 323 323 LEU LEU 1 . n 
A  1  324 GLY 324 324 324 GLY GLY 1 . n 
A  1  325 THR 325 325 325 THR THR 1 . n 
A  1  326 GLY 326 326 326 GLY GLY 1 . n 
A  1  327 GLY 327 327 327 GLY GLY 1 . n 
A  1  328 VAL 328 328 328 VAL VAL 1 . n 
A  1  329 ILE 329 329 329 ILE ILE 1 . n 
A  1  330 LEU 330 330 330 LEU LEU 1 . n 
A  1  331 ILE 331 331 331 ILE ILE 1 . n 
A  1  332 PRO 332 332 332 PRO PRO 1 . n 
A  1  333 GLU 333 333 333 GLU GLU 1 . n 
A  1  334 ARG 334 334 334 ARG ARG 1 . n 
A  1  335 VAL 335 335 335 VAL VAL 1 . n 
A  1  336 SER 336 336 336 SER SER 1 . n 
A  1  337 MET 337 337 337 MET MET 1 . n 
A  1  338 VAL 338 338 338 VAL VAL 1 . n 
A  1  339 ASP 339 339 339 ASP ASP 1 . n 
A  1  340 ALA 340 340 340 ALA ALA 1 . n 
A  1  341 MET 341 341 341 MET MET 1 . n 
A  1  342 TRP 342 342 342 TRP TRP 1 . n 
A  1  343 ASN 343 343 343 ASN ASN 1 . n 
A  1  344 LEU 344 344 344 LEU LEU 1 . n 
A  1  345 THR 345 345 345 THR THR 1 . n 
A  1  346 ARG 346 346 346 ARG ARG 1 . n 
A  1  347 PHE 347 347 347 PHE PHE 1 . n 
A  1  348 TYR 348 348 348 TYR TYR 1 . n 
A  1  349 ALA 349 349 349 ALA ALA 1 . n 
A  1  350 HIS 350 350 350 HIS HIS 1 . n 
A  1  351 GLU 351 351 351 GLU GLU 1 . n 
A  1  352 SER 352 352 352 SER SER 1 . n 
A  1  353 CYS 353 353 353 CYS CYS 1 . n 
A  1  354 GLY 354 354 354 GLY GLY 1 . n 
A  1  355 LYS 355 355 355 LYS LYS 1 . n 
A  1  356 CYS 356 356 356 CYS CYS 1 . n 
A  1  357 THR 357 357 357 THR THR 1 . n 
A  1  358 PRO 358 358 358 PRO PRO 1 . n 
A  1  359 CYS 359 359 359 CYS CYS 1 . n 
A  1  360 ARG 360 360 360 ARG ARG 1 . n 
A  1  361 GLU 361 361 361 GLU GLU 1 . n 
A  1  362 GLY 362 362 362 GLY GLY 1 . n 
A  1  363 VAL 363 363 363 VAL VAL 1 . n 
A  1  364 ALA 364 364 364 ALA ALA 1 . n 
A  1  365 GLY 365 365 365 GLY GLY 1 . n 
A  1  366 PHE 366 366 366 PHE PHE 1 . n 
A  1  367 MET 367 367 367 MET MET 1 . n 
A  1  368 VAL 368 368 368 VAL VAL 1 . n 
A  1  369 ASN 369 369 369 ASN ASN 1 . n 
A  1  370 LEU 370 370 370 LEU LEU 1 . n 
A  1  371 PHE 371 371 371 PHE PHE 1 . n 
A  1  372 ALA 372 372 372 ALA ALA 1 . n 
A  1  373 LYS 373 373 373 LYS LYS 1 . n 
A  1  374 ILE 374 374 374 ILE ILE 1 . n 
A  1  375 GLY 375 375 375 GLY GLY 1 . n 
A  1  376 THR 376 376 376 THR THR 1 . n 
A  1  377 GLY 377 377 377 GLY GLY 1 . n 
A  1  378 GLN 378 378 378 GLN GLN 1 . n 
A  1  379 GLY 379 379 379 GLY GLY 1 . n 
A  1  380 GLU 380 380 380 GLU GLU 1 . n 
A  1  381 GLU 381 381 381 GLU GLU 1 . n 
A  1  382 LYS 382 382 382 LYS LYS 1 . n 
A  1  383 ASP 383 383 383 ASP ASP 1 . n 
A  1  384 VAL 384 384 384 VAL VAL 1 . n 
A  1  385 GLU 385 385 385 GLU GLU 1 . n 
A  1  386 ASN 386 386 386 ASN ASN 1 . n 
A  1  387 LEU 387 387 387 LEU LEU 1 . n 
A  1  388 GLU 388 388 388 GLU GLU 1 . n 
A  1  389 ALA 389 389 389 ALA ALA 1 . n 
A  1  390 LEU 390 390 390 LEU LEU 1 . n 
A  1  391 LEU 391 391 391 LEU LEU 1 . n 
A  1  392 PRO 392 392 392 PRO PRO 1 . n 
A  1  393 LEU 393 393 393 LEU LEU 1 . n 
A  1  394 ILE 394 394 394 ILE ILE 1 . n 
A  1  395 GLU 395 395 395 GLU GLU 1 . n 
A  1  396 GLY 396 396 396 GLY GLY 1 . n 
A  1  397 ARG 397 397 397 ARG ARG 1 . n 
A  1  398 SER 398 398 398 SER SER 1 . n 
A  1  399 PHE 399 399 399 PHE PHE 1 . n 
A  1  400 CYS 400 400 400 CYS CYS 1 . n 
A  1  401 PRO 401 401 401 PRO PRO 1 . n 
A  1  402 LEU 402 402 402 LEU LEU 1 . n 
A  1  403 ALA 403 403 403 ALA ALA 1 . n 
A  1  404 ASP 404 404 404 ASP ASP 1 . n 
A  1  405 ALA 405 405 405 ALA ALA 1 . n 
A  1  406 ALA 406 406 406 ALA ALA 1 . n 
A  1  407 VAL 407 407 407 VAL VAL 1 . n 
A  1  408 TRP 408 408 408 TRP TRP 1 . n 
A  1  409 PRO 409 409 409 PRO PRO 1 . n 
A  1  410 VAL 410 410 410 VAL VAL 1 . n 
A  1  411 LYS 411 411 411 LYS LYS 1 . n 
A  1  412 GLY 412 412 412 GLY GLY 1 . n 
A  1  413 SER 413 413 413 SER SER 1 . n 
A  1  414 LEU 414 414 414 LEU LEU 1 . n 
A  1  415 ARG 415 415 415 ARG ARG 1 . n 
A  1  416 HIS 416 416 416 HIS HIS 1 . n 
A  1  417 PHE 417 417 417 PHE PHE 1 . n 
A  1  418 LYS 418 418 418 LYS LYS 1 . n 
A  1  419 ASP 419 419 419 ASP ASP 1 . n 
A  1  420 GLN 420 420 420 GLN GLN 1 . n 
A  1  421 TYR 421 421 421 TYR TYR 1 . n 
A  1  422 LEU 422 422 422 LEU LEU 1 . n 
A  1  423 ALA 423 423 423 ALA ALA 1 . n 
A  1  424 LEU 424 424 424 LEU LEU 1 . n 
A  1  425 ALA 425 425 425 ALA ALA 1 . n 
A  1  426 ARG 426 426 426 ARG ARG 1 . n 
A  1  427 GLU 427 427 427 GLU GLU 1 . n 
A  1  428 LYS 428 428 428 LYS LYS 1 . n 
A  1  429 ARG 429 429 429 ARG ARG 1 . n 
A  1  430 PRO 430 430 430 PRO PRO 1 . n 
A  1  431 VAL 431 431 431 VAL VAL 1 . n 
A  1  432 PRO 432 432 432 PRO PRO 1 . n 
A  1  433 ARG 433 433 433 ARG ARG 1 . n 
A  1  434 PRO 434 434 434 PRO PRO 1 . n 
A  1  435 SER 435 435 435 SER SER 1 . n 
A  1  436 LEU 436 436 436 LEU LEU 1 . n 
A  1  437 TRP 437 437 437 TRP TRP 1 . n 
A  1  438 ARG 438 438 438 ARG ARG 1 . n 
B  2  1   MET 1   1   ?   ?   ?   2 . n 
B  2  2   GLY 2   2   ?   ?   ?   2 . n 
B  2  3   PHE 3   3   3   PHE PHE 2 . n 
B  2  4   PHE 4   4   4   PHE PHE 2 . n 
B  2  5   ASP 5   5   5   ASP ASP 2 . n 
B  2  6   ASP 6   6   6   ASP ASP 2 . n 
B  2  7   LYS 7   7   7   LYS LYS 2 . n 
B  2  8   GLN 8   8   8   GLN GLN 2 . n 
B  2  9   ASP 9   9   9   ASP ASP 2 . n 
B  2  10  PHE 10  10  10  PHE PHE 2 . n 
B  2  11  LEU 11  11  11  LEU LEU 2 . n 
B  2  12  GLU 12  12  12  GLU GLU 2 . n 
B  2  13  GLU 13  13  13  GLU GLU 2 . n 
B  2  14  THR 14  14  14  THR THR 2 . n 
B  2  15  PHE 15  15  15  PHE PHE 2 . n 
B  2  16  ALA 16  16  16  ALA ALA 2 . n 
B  2  17  LYS 17  17  17  LYS LYS 2 . n 
B  2  18  TYR 18  18  18  TYR TYR 2 . n 
B  2  19  PRO 19  19  19  PRO PRO 2 . n 
B  2  20  PRO 20  20  20  PRO PRO 2 . n 
B  2  21  GLU 21  21  21  GLU GLU 2 . n 
B  2  22  GLY 22  22  22  GLY GLY 2 . n 
B  2  23  ARG 23  23  23  ARG ARG 2 . n 
B  2  24  ARG 24  24  24  ARG ARG 2 . n 
B  2  25  ALA 25  25  25  ALA ALA 2 . n 
B  2  26  ALA 26  26  26  ALA ALA 2 . n 
B  2  27  ILE 27  27  27  ILE ILE 2 . n 
B  2  28  MET 28  28  28  MET MET 2 . n 
B  2  29  PRO 29  29  29  PRO PRO 2 . n 
B  2  30  LEU 30  30  30  LEU LEU 2 . n 
B  2  31  LEU 31  31  31  LEU LEU 2 . n 
B  2  32  ARG 32  32  32  ARG ARG 2 . n 
B  2  33  ARG 33  33  33  ARG ARG 2 . n 
B  2  34  VAL 34  34  34  VAL VAL 2 . n 
B  2  35  GLN 35  35  35  GLN GLN 2 . n 
B  2  36  GLN 36  36  36  GLN GLN 2 . n 
B  2  37  GLU 37  37  37  GLU GLU 2 . n 
B  2  38  GLU 38  38  38  GLU GLU 2 . n 
B  2  39  GLY 39  39  39  GLY GLY 2 . n 
B  2  40  TRP 40  40  40  TRP TRP 2 . n 
B  2  41  ILE 41  41  41  ILE ILE 2 . n 
B  2  42  ARG 42  42  42  ARG ARG 2 . n 
B  2  43  PRO 43  43  43  PRO PRO 2 . n 
B  2  44  GLU 44  44  44  GLU GLU 2 . n 
B  2  45  ARG 45  45  45  ARG ARG 2 . n 
B  2  46  ILE 46  46  46  ILE ILE 2 . n 
B  2  47  GLU 47  47  47  GLU GLU 2 . n 
B  2  48  GLU 48  48  48  GLU GLU 2 . n 
B  2  49  ILE 49  49  49  ILE ILE 2 . n 
B  2  50  ALA 50  50  50  ALA ALA 2 . n 
B  2  51  ARG 51  51  51  ARG ARG 2 . n 
B  2  52  LEU 52  52  52  LEU LEU 2 . n 
B  2  53  VAL 53  53  53  VAL VAL 2 . n 
B  2  54  GLY 54  54  54  GLY GLY 2 . n 
B  2  55  THR 55  55  55  THR THR 2 . n 
B  2  56  THR 56  56  56  THR THR 2 . n 
B  2  57  PRO 57  57  57  PRO PRO 2 . n 
B  2  58  THR 58  58  58  THR THR 2 . n 
B  2  59  GLU 59  59  59  GLU GLU 2 . n 
B  2  60  VAL 60  60  60  VAL VAL 2 . n 
B  2  61  MET 61  61  61  MET MET 2 . n 
B  2  62  GLY 62  62  62  GLY GLY 2 . n 
B  2  63  VAL 63  63  63  VAL VAL 2 . n 
B  2  64  ALA 64  64  64  ALA ALA 2 . n 
B  2  65  SER 65  65  65  SER SER 2 . n 
B  2  66  PHE 66  66  66  PHE PHE 2 . n 
B  2  67  TYR 67  67  67  TYR TYR 2 . n 
B  2  68  SER 68  68  68  SER SER 2 . n 
B  2  69  TYR 69  69  69  TYR TYR 2 . n 
B  2  70  TYR 70  70  70  TYR TYR 2 . n 
B  2  71  GLN 71  71  71  GLN GLN 2 . n 
B  2  72  PHE 72  72  72  PHE PHE 2 . n 
B  2  73  VAL 73  73  73  VAL VAL 2 . n 
B  2  74  PRO 74  74  74  PRO PRO 2 . n 
B  2  75  THR 75  75  75  THR THR 2 . n 
B  2  76  GLY 76  76  76  GLY GLY 2 . n 
B  2  77  LYS 77  77  77  LYS LYS 2 . n 
B  2  78  TYR 78  78  78  TYR TYR 2 . n 
B  2  79  HIS 79  79  79  HIS HIS 2 . n 
B  2  80  LEU 80  80  80  LEU LEU 2 . n 
B  2  81  GLN 81  81  81  GLN GLN 2 . n 
B  2  82  VAL 82  82  82  VAL VAL 2 . n 
B  2  83  CYS 83  83  83  CYS CYS 2 . n 
B  2  84  ALA 84  84  84  ALA ALA 2 . n 
B  2  85  THR 85  85  85  THR THR 2 . n 
B  2  86  LEU 86  86  86  LEU LEU 2 . n 
B  2  87  SER 87  87  87  SER SER 2 . n 
B  2  88  CYS 88  88  88  CYS CYS 2 . n 
B  2  89  LYS 89  89  89  LYS LYS 2 . n 
B  2  90  LEU 90  90  90  LEU LEU 2 . n 
B  2  91  ALA 91  91  91  ALA ALA 2 . n 
B  2  92  GLY 92  92  92  GLY GLY 2 . n 
B  2  93  ALA 93  93  93  ALA ALA 2 . n 
B  2  94  GLU 94  94  94  GLU GLU 2 . n 
B  2  95  GLU 95  95  95  GLU GLU 2 . n 
B  2  96  LEU 96  96  96  LEU LEU 2 . n 
B  2  97  TRP 97  97  97  TRP TRP 2 . n 
B  2  98  ASP 98  98  98  ASP ASP 2 . n 
B  2  99  TYR 99  99  99  TYR TYR 2 . n 
B  2  100 LEU 100 100 100 LEU LEU 2 . n 
B  2  101 THR 101 101 101 THR THR 2 . n 
B  2  102 GLU 102 102 102 GLU GLU 2 . n 
B  2  103 THR 103 103 103 THR THR 2 . n 
B  2  104 LEU 104 104 104 LEU LEU 2 . n 
B  2  105 GLY 105 105 105 GLY GLY 2 . n 
B  2  106 ILE 106 106 106 ILE ILE 2 . n 
B  2  107 GLY 107 107 107 GLY GLY 2 . n 
B  2  108 PRO 108 108 108 PRO PRO 2 . n 
B  2  109 GLY 109 109 109 GLY GLY 2 . n 
B  2  110 GLU 110 110 110 GLU GLU 2 . n 
B  2  111 VAL 111 111 111 VAL VAL 2 . n 
B  2  112 THR 112 112 112 THR THR 2 . n 
B  2  113 PRO 113 113 113 PRO PRO 2 . n 
B  2  114 ASP 114 114 114 ASP ASP 2 . n 
B  2  115 GLY 115 115 115 GLY GLY 2 . n 
B  2  116 LEU 116 116 116 LEU LEU 2 . n 
B  2  117 PHE 117 117 117 PHE PHE 2 . n 
B  2  118 SER 118 118 118 SER SER 2 . n 
B  2  119 VAL 119 119 119 VAL VAL 2 . n 
B  2  120 GLN 120 120 120 GLN GLN 2 . n 
B  2  121 LYS 121 121 121 LYS LYS 2 . n 
B  2  122 VAL 122 122 122 VAL VAL 2 . n 
B  2  123 GLU 123 123 123 GLU GLU 2 . n 
B  2  124 CYS 124 124 124 CYS CYS 2 . n 
B  2  125 LEU 125 125 125 LEU LEU 2 . n 
B  2  126 GLY 126 126 126 GLY GLY 2 . n 
B  2  127 SER 127 127 127 SER SER 2 . n 
B  2  128 CYS 128 128 128 CYS CYS 2 . n 
B  2  129 HIS 129 129 129 HIS HIS 2 . n 
B  2  130 THR 130 130 130 THR THR 2 . n 
B  2  131 ALA 131 131 131 ALA ALA 2 . n 
B  2  132 PRO 132 132 132 PRO PRO 2 . n 
B  2  133 VAL 133 133 133 VAL VAL 2 . n 
B  2  134 ILE 134 134 134 ILE ILE 2 . n 
B  2  135 GLN 135 135 135 GLN GLN 2 . n 
B  2  136 VAL 136 136 136 VAL VAL 2 . n 
B  2  137 ASN 137 137 137 ASN ASN 2 . n 
B  2  138 ASP 138 138 138 ASP ASP 2 . n 
B  2  139 GLU 139 139 139 GLU GLU 2 . n 
B  2  140 PRO 140 140 140 PRO PRO 2 . n 
B  2  141 TYR 141 141 141 TYR TYR 2 . n 
B  2  142 VAL 142 142 142 VAL VAL 2 . n 
B  2  143 GLU 143 143 143 GLU GLU 2 . n 
B  2  144 CYS 144 144 144 CYS CYS 2 . n 
B  2  145 VAL 145 145 145 VAL VAL 2 . n 
B  2  146 THR 146 146 146 THR THR 2 . n 
B  2  147 ARG 147 147 147 ARG ARG 2 . n 
B  2  148 ALA 148 148 148 ALA ALA 2 . n 
B  2  149 ARG 149 149 149 ARG ARG 2 . n 
B  2  150 LEU 150 150 150 LEU LEU 2 . n 
B  2  151 GLU 151 151 151 GLU GLU 2 . n 
B  2  152 ALA 152 152 152 ALA ALA 2 . n 
B  2  153 LEU 153 153 153 LEU LEU 2 . n 
B  2  154 LEU 154 154 154 LEU LEU 2 . n 
B  2  155 ALA 155 155 155 ALA ALA 2 . n 
B  2  156 GLY 156 156 156 GLY GLY 2 . n 
B  2  157 LEU 157 157 157 LEU LEU 2 . n 
B  2  158 ARG 158 158 158 ARG ARG 2 . n 
B  2  159 ALA 159 159 159 ALA ALA 2 . n 
B  2  160 GLY 160 160 160 GLY GLY 2 . n 
B  2  161 LYS 161 161 161 LYS LYS 2 . n 
B  2  162 ARG 162 162 162 ARG ARG 2 . n 
B  2  163 LEU 163 163 163 LEU LEU 2 . n 
B  2  164 GLU 164 164 164 GLU GLU 2 . n 
B  2  165 GLU 165 165 165 GLU GLU 2 . n 
B  2  166 ILE 166 166 166 ILE ILE 2 . n 
B  2  167 GLU 167 167 167 GLU GLU 2 . n 
B  2  168 LEU 168 168 168 LEU LEU 2 . n 
B  2  169 PRO 169 169 169 PRO PRO 2 . n 
B  2  170 GLY 170 170 170 GLY GLY 2 . n 
B  2  171 LYS 171 171 171 LYS LYS 2 . n 
B  2  172 CYS 172 172 172 CYS CYS 2 . n 
B  2  173 GLY 173 173 173 GLY GLY 2 . n 
B  2  174 HIS 174 174 174 HIS HIS 2 . n 
B  2  175 HIS 175 175 175 HIS HIS 2 . n 
B  2  176 VAL 176 176 176 VAL VAL 2 . n 
B  2  177 HIS 177 177 177 HIS HIS 2 . n 
B  2  178 GLU 178 178 178 GLU GLU 2 . n 
B  2  179 VAL 179 179 179 VAL VAL 2 . n 
B  2  180 GLU 180 180 180 GLU GLU 2 . n 
B  2  181 VAL 181 181 ?   ?   ?   2 . n 
C  3  1   MET 1   1   1   MET MET 3 . n 
C  3  2   VAL 2   2   2   VAL VAL 3 . n 
C  3  3   ARG 3   3   3   ARG ARG 3 . n 
C  3  4   VAL 4   4   4   VAL VAL 3 . n 
C  3  5   LYS 5   5   5   LYS LYS 3 . n 
C  3  6   VAL 6   6   6   VAL VAL 3 . n 
C  3  7   ASN 7   7   7   ASN ASN 3 . n 
C  3  8   ASP 8   8   8   ASP ASP 3 . n 
C  3  9   ARG 9   9   9   ARG ARG 3 . n 
C  3  10  ILE 10  10  10  ILE ILE 3 . n 
C  3  11  VAL 11  11  11  VAL VAL 3 . n 
C  3  12  GLU 12  12  12  GLU GLU 3 . n 
C  3  13  VAL 13  13  13  VAL VAL 3 . n 
C  3  14  PRO 14  14  14  PRO PRO 3 . n 
C  3  15  PRO 15  15  15  PRO PRO 3 . n 
C  3  16  GLY 16  16  16  GLY GLY 3 . n 
C  3  17  THR 17  17  17  THR THR 3 . n 
C  3  18  SER 18  18  18  SER SER 3 . n 
C  3  19  VAL 19  19  19  VAL VAL 3 . n 
C  3  20  MET 20  20  20  MET MET 3 . n 
C  3  21  ASP 21  21  21  ASP ASP 3 . n 
C  3  22  ALA 22  22  22  ALA ALA 3 . n 
C  3  23  VAL 23  23  23  VAL VAL 3 . n 
C  3  24  PHE 24  24  24  PHE PHE 3 . n 
C  3  25  HIS 25  25  25  HIS HIS 3 . n 
C  3  26  ALA 26  26  26  ALA ALA 3 . n 
C  3  27  GLY 27  27  27  GLY GLY 3 . n 
C  3  28  TYR 28  28  28  TYR TYR 3 . n 
C  3  29  ASP 29  29  29  ASP ASP 3 . n 
C  3  30  VAL 30  30  30  VAL VAL 3 . n 
C  3  31  PRO 31  31  31  PRO PRO 3 . n 
C  3  32  LEU 32  32  32  LEU LEU 3 . n 
C  3  33  PHE 33  33  33  PHE PHE 3 . n 
C  3  34  CYS 34  34  34  CYS CYS 3 . n 
C  3  35  SER 35  35  35  SER SER 3 . n 
C  3  36  GLU 36  36  36  GLU GLU 3 . n 
C  3  37  LYS 37  37  37  LYS LYS 3 . n 
C  3  38  HIS 38  38  38  HIS HIS 3 . n 
C  3  39  LEU 39  39  39  LEU LEU 3 . n 
C  3  40  SER 40  40  40  SER SER 3 . n 
C  3  41  PRO 41  41  41  PRO PRO 3 . n 
C  3  42  ILE 42  42  42  ILE ILE 3 . n 
C  3  43  GLY 43  43  43  GLY GLY 3 . n 
C  3  44  ALA 44  44  44  ALA ALA 3 . n 
C  3  45  CYS 45  45  45  CYS CYS 3 . n 
C  3  46  ARG 46  46  46  ARG ARG 3 . n 
C  3  47  MET 47  47  47  MET MET 3 . n 
C  3  48  CYS 48  48  48  CYS CYS 3 . n 
C  3  49  LEU 49  49  49  LEU LEU 3 . n 
C  3  50  VAL 50  50  50  VAL VAL 3 . n 
C  3  51  ARG 51  51  51  ARG ARG 3 . n 
C  3  52  ILE 52  52  52  ILE ILE 3 . n 
C  3  53  GLY 53  53  53  GLY GLY 3 . n 
C  3  54  LEU 54  54  54  LEU LEU 3 . n 
C  3  55  PRO 55  55  55  PRO PRO 3 . n 
C  3  56  LYS 56  56  ?   ?   ?   3 . n 
C  3  57  LYS 57  57  ?   ?   ?   3 . n 
C  3  58  GLY 58  58  ?   ?   ?   3 . n 
C  3  59  PRO 59  59  ?   ?   ?   3 . n 
C  3  60  ASP 60  60  ?   ?   ?   3 . n 
C  3  61  GLY 61  61  ?   ?   ?   3 . n 
C  3  62  LYS 62  62  ?   ?   ?   3 . n 
C  3  63  PRO 63  63  ?   ?   ?   3 . n 
C  3  64  LEU 64  64  ?   ?   ?   3 . n 
C  3  65  LEU 65  65  ?   ?   ?   3 . n 
C  3  66  ASN 66  66  ?   ?   ?   3 . n 
C  3  67  GLU 67  67  ?   ?   ?   3 . n 
C  3  68  LYS 68  68  ?   ?   ?   3 . n 
C  3  69  GLY 69  69  ?   ?   ?   3 . n 
C  3  70  GLU 70  70  ?   ?   ?   3 . n 
C  3  71  PRO 71  71  ?   ?   ?   3 . n 
C  3  72  GLU 72  72  ?   ?   ?   3 . n 
C  3  73  ILE 73  73  73  ILE ILE 3 . n 
C  3  74  GLN 74  74  74  GLN GLN 3 . n 
C  3  75  TRP 75  75  75  TRP TRP 3 . n 
C  3  76  GLN 76  76  76  GLN GLN 3 . n 
C  3  77  PRO 77  77  77  PRO PRO 3 . n 
C  3  78  LYS 78  78  78  LYS LYS 3 . n 
C  3  79  LEU 79  79  79  LEU LEU 3 . n 
C  3  80  ALA 80  80  80  ALA ALA 3 . n 
C  3  81  ALA 81  81  81  ALA ALA 3 . n 
C  3  82  SER 82  82  82  SER SER 3 . n 
C  3  83  CYS 83  83  83  CYS CYS 3 . n 
C  3  84  VAL 84  84  84  VAL VAL 3 . n 
C  3  85  THR 85  85  85  THR THR 3 . n 
C  3  86  ALA 86  86  86  ALA ALA 3 . n 
C  3  87  VAL 87  87  87  VAL VAL 3 . n 
C  3  88  ALA 88  88  88  ALA ALA 3 . n 
C  3  89  ASP 89  89  89  ASP ASP 3 . n 
C  3  90  GLY 90  90  90  GLY GLY 3 . n 
C  3  91  MET 91  91  91  MET MET 3 . n 
C  3  92  VAL 92  92  92  VAL VAL 3 . n 
C  3  93  VAL 93  93  93  VAL VAL 3 . n 
C  3  94  ASP 94  94  94  ASP ASP 3 . n 
C  3  95  THR 95  95  95  THR THR 3 . n 
C  3  96  LEU 96  96  96  LEU LEU 3 . n 
C  3  97  SER 97  97  97  SER SER 3 . n 
C  3  98  ASP 98  98  98  ASP ASP 3 . n 
C  3  99  VAL 99  99  99  VAL VAL 3 . n 
C  3  100 VAL 100 100 100 VAL VAL 3 . n 
C  3  101 ARG 101 101 101 ARG ARG 3 . n 
C  3  102 GLU 102 102 102 GLU GLU 3 . n 
C  3  103 ALA 103 103 103 ALA ALA 3 . n 
C  3  104 GLN 104 104 104 GLN GLN 3 . n 
C  3  105 ALA 105 105 105 ALA ALA 3 . n 
C  3  106 GLY 106 106 106 GLY GLY 3 . n 
C  3  107 MET 107 107 107 MET MET 3 . n 
C  3  108 VAL 108 108 108 VAL VAL 3 . n 
C  3  109 GLU 109 109 109 GLU GLU 3 . n 
C  3  110 PHE 110 110 110 PHE PHE 3 . n 
C  3  111 THR 111 111 111 THR THR 3 . n 
C  3  112 LEU 112 112 112 LEU LEU 3 . n 
C  3  113 LEU 113 113 113 LEU LEU 3 . n 
C  3  114 ASN 114 114 114 ASN ASN 3 . n 
C  3  115 HIS 115 115 115 HIS HIS 3 . n 
C  3  116 PRO 116 116 116 PRO PRO 3 . n 
C  3  117 LEU 117 117 117 LEU LEU 3 . n 
C  3  118 ASP 118 118 118 ASP ASP 3 . n 
C  3  119 CYS 119 119 119 CYS CYS 3 . n 
C  3  120 PRO 120 120 120 PRO PRO 3 . n 
C  3  121 THR 121 121 121 THR THR 3 . n 
C  3  122 CYS 122 122 122 CYS CYS 3 . n 
C  3  123 ASP 123 123 123 ASP ASP 3 . n 
C  3  124 LYS 124 124 124 LYS LYS 3 . n 
C  3  125 GLY 125 125 125 GLY GLY 3 . n 
C  3  126 GLY 126 126 126 GLY GLY 3 . n 
C  3  127 ALA 127 127 127 ALA ALA 3 . n 
C  3  128 CYS 128 128 128 CYS CYS 3 . n 
C  3  129 GLU 129 129 129 GLU GLU 3 . n 
C  3  130 LEU 130 130 130 LEU LEU 3 . n 
C  3  131 GLN 131 131 131 GLN GLN 3 . n 
C  3  132 ASP 132 132 132 ASP ASP 3 . n 
C  3  133 ARG 133 133 133 ARG ARG 3 . n 
C  3  134 THR 134 134 134 THR THR 3 . n 
C  3  135 VAL 135 135 135 VAL VAL 3 . n 
C  3  136 GLU 136 136 136 GLU GLU 3 . n 
C  3  137 TYR 137 137 137 TYR TYR 3 . n 
C  3  138 GLY 138 138 138 GLY GLY 3 . n 
C  3  139 LEU 139 139 139 LEU LEU 3 . n 
C  3  140 TYR 140 140 140 TYR TYR 3 . n 
C  3  141 GLU 141 141 141 GLU GLU 3 . n 
C  3  142 LYS 142 142 142 LYS LYS 3 . n 
C  3  143 TYR 143 143 143 TYR TYR 3 . n 
C  3  144 TYR 144 144 ?   ?   ?   3 . n 
C  3  145 GLN 145 145 ?   ?   ?   3 . n 
C  3  146 LYS 146 146 ?   ?   ?   3 . n 
C  3  147 GLY 147 147 ?   ?   ?   3 . n 
C  3  148 PRO 148 148 148 PRO PRO 3 . n 
C  3  149 LEU 149 149 149 LEU LEU 3 . n 
C  3  150 GLU 150 150 150 GLU GLU 3 . n 
C  3  151 LEU 151 151 151 LEU LEU 3 . n 
C  3  152 PRO 152 152 152 PRO PRO 3 . n 
C  3  153 VAL 153 153 153 VAL VAL 3 . n 
C  3  154 TYR 154 154 154 TYR TYR 3 . n 
C  3  155 THR 155 155 155 THR THR 3 . n 
C  3  156 ARG 156 156 156 ARG ARG 3 . n 
C  3  157 PHE 157 157 157 PHE PHE 3 . n 
C  3  158 GLU 158 158 158 GLU GLU 3 . n 
C  3  159 PHE 159 159 159 PHE PHE 3 . n 
C  3  160 THR 160 160 160 THR THR 3 . n 
C  3  161 ARG 161 161 161 ARG ARG 3 . n 
C  3  162 ARG 162 162 162 ARG ARG 3 . n 
C  3  163 HIS 163 163 163 HIS HIS 3 . n 
C  3  164 VAL 164 164 164 VAL VAL 3 . n 
C  3  165 ASP 165 165 165 ASP ASP 3 . n 
C  3  166 LYS 166 166 166 LYS LYS 3 . n 
C  3  167 HIS 167 167 167 HIS HIS 3 . n 
C  3  168 HIS 168 168 168 HIS HIS 3 . n 
C  3  169 PRO 169 169 169 PRO PRO 3 . n 
C  3  170 LEU 170 170 170 LEU LEU 3 . n 
C  3  171 SER 171 171 171 SER SER 3 . n 
C  3  172 PRO 172 172 172 PRO PRO 3 . n 
C  3  173 PHE 173 173 173 PHE PHE 3 . n 
C  3  174 VAL 174 174 174 VAL VAL 3 . n 
C  3  175 ILE 175 175 175 ILE ILE 3 . n 
C  3  176 LEU 176 176 176 LEU LEU 3 . n 
C  3  177 ASP 177 177 177 ASP ASP 3 . n 
C  3  178 ARG 178 178 178 ARG ARG 3 . n 
C  3  179 GLU 179 179 179 GLU GLU 3 . n 
C  3  180 ARG 180 180 180 ARG ARG 3 . n 
C  3  181 CYS 181 181 181 CYS CYS 3 . n 
C  3  182 ILE 182 182 182 ILE ILE 3 . n 
C  3  183 HIS 183 183 183 HIS HIS 3 . n 
C  3  184 CYS 184 184 184 CYS CYS 3 . n 
C  3  185 LYS 185 185 185 LYS LYS 3 . n 
C  3  186 ARG 186 186 186 ARG ARG 3 . n 
C  3  187 CYS 187 187 187 CYS CYS 3 . n 
C  3  188 VAL 188 188 188 VAL VAL 3 . n 
C  3  189 ARG 189 189 189 ARG ARG 3 . n 
C  3  190 TYR 190 190 190 TYR TYR 3 . n 
C  3  191 PHE 191 191 191 PHE PHE 3 . n 
C  3  192 GLU 192 192 192 GLU GLU 3 . n 
C  3  193 GLU 193 193 193 GLU GLU 3 . n 
C  3  194 VAL 194 194 194 VAL VAL 3 . n 
C  3  195 PRO 195 195 195 PRO PRO 3 . n 
C  3  196 GLY 196 196 196 GLY GLY 3 . n 
C  3  197 ASP 197 197 197 ASP ASP 3 . n 
C  3  198 GLU 198 198 198 GLU GLU 3 . n 
C  3  199 VAL 199 199 199 VAL VAL 3 . n 
C  3  200 LEU 200 200 200 LEU LEU 3 . n 
C  3  201 ASP 201 201 201 ASP ASP 3 . n 
C  3  202 PHE 202 202 202 PHE PHE 3 . n 
C  3  203 ILE 203 203 203 ILE ILE 3 . n 
C  3  204 GLU 204 204 204 GLU GLU 3 . n 
C  3  205 ARG 205 205 205 ARG ARG 3 . n 
C  3  206 GLY 206 206 206 GLY GLY 3 . n 
C  3  207 VAL 207 207 207 VAL VAL 3 . n 
C  3  208 HIS 208 208 208 HIS HIS 3 . n 
C  3  209 THR 209 209 209 THR THR 3 . n 
C  3  210 PHE 210 210 210 PHE PHE 3 . n 
C  3  211 ILE 211 211 211 ILE ILE 3 . n 
C  3  212 GLY 212 212 212 GLY GLY 3 . n 
C  3  213 THR 213 213 213 THR THR 3 . n 
C  3  214 MET 214 214 214 MET MET 3 . n 
C  3  215 ASP 215 215 215 ASP ASP 3 . n 
C  3  216 PHE 216 216 216 PHE PHE 3 . n 
C  3  217 GLY 217 217 217 GLY GLY 3 . n 
C  3  218 LEU 218 218 218 LEU LEU 3 . n 
C  3  219 PRO 219 219 219 PRO PRO 3 . n 
C  3  220 SER 220 220 220 SER SER 3 . n 
C  3  221 GLY 221 221 221 GLY GLY 3 . n 
C  3  222 PHE 222 222 222 PHE PHE 3 . n 
C  3  223 SER 223 223 223 SER SER 3 . n 
C  3  224 GLY 224 224 224 GLY GLY 3 . n 
C  3  225 ASN 225 225 225 ASN ASN 3 . n 
C  3  226 ILE 226 226 226 ILE ILE 3 . n 
C  3  227 THR 227 227 227 THR THR 3 . n 
C  3  228 ASP 228 228 228 ASP ASP 3 . n 
C  3  229 ILE 229 229 229 ILE ILE 3 . n 
C  3  230 CYS 230 230 230 CYS CYS 3 . n 
C  3  231 PRO 231 231 231 PRO PRO 3 . n 
C  3  232 VAL 232 232 232 VAL VAL 3 . n 
C  3  233 GLY 233 233 233 GLY GLY 3 . n 
C  3  234 ALA 234 234 234 ALA ALA 3 . n 
C  3  235 LEU 235 235 235 LEU LEU 3 . n 
C  3  236 LEU 236 236 236 LEU LEU 3 . n 
C  3  237 ASP 237 237 237 ASP ASP 3 . n 
C  3  238 LEU 238 238 238 LEU LEU 3 . n 
C  3  239 THR 239 239 239 THR THR 3 . n 
C  3  240 ALA 240 240 240 ALA ALA 3 . n 
C  3  241 ARG 241 241 241 ARG ARG 3 . n 
C  3  242 PHE 242 242 242 PHE PHE 3 . n 
C  3  243 ARG 243 243 243 ARG ARG 3 . n 
C  3  244 ALA 244 244 244 ALA ALA 3 . n 
C  3  245 ARG 245 245 245 ARG ARG 3 . n 
C  3  246 ASN 246 246 246 ASN ASN 3 . n 
C  3  247 TRP 247 247 247 TRP TRP 3 . n 
C  3  248 GLU 248 248 248 GLU GLU 3 . n 
C  3  249 MET 249 249 249 MET MET 3 . n 
C  3  250 GLU 250 250 250 GLU GLU 3 . n 
C  3  251 GLU 251 251 251 GLU GLU 3 . n 
C  3  252 THR 252 252 252 THR THR 3 . n 
C  3  253 PRO 253 253 253 PRO PRO 3 . n 
C  3  254 THR 254 254 254 THR THR 3 . n 
C  3  255 THR 255 255 255 THR THR 3 . n 
C  3  256 CYS 256 256 256 CYS CYS 3 . n 
C  3  257 ALA 257 257 257 ALA ALA 3 . n 
C  3  258 LEU 258 258 258 LEU LEU 3 . n 
C  3  259 CYS 259 259 259 CYS CYS 3 . n 
C  3  260 PRO 260 260 260 PRO PRO 3 . n 
C  3  261 VAL 261 261 261 VAL VAL 3 . n 
C  3  262 GLY 262 262 262 GLY GLY 3 . n 
C  3  263 CYS 263 263 263 CYS CYS 3 . n 
C  3  264 GLY 264 264 264 GLY GLY 3 . n 
C  3  265 ILE 265 265 265 ILE ILE 3 . n 
C  3  266 THR 266 266 266 THR THR 3 . n 
C  3  267 ALA 267 267 267 ALA ALA 3 . n 
C  3  268 ASP 268 268 268 ASP ASP 3 . n 
C  3  269 THR 269 269 269 THR THR 3 . n 
C  3  270 ARG 270 270 270 ARG ARG 3 . n 
C  3  271 SER 271 271 271 SER SER 3 . n 
C  3  272 GLY 272 272 272 GLY GLY 3 . n 
C  3  273 GLU 273 273 273 GLU GLU 3 . n 
C  3  274 LEU 274 274 274 LEU LEU 3 . n 
C  3  275 LEU 275 275 275 LEU LEU 3 . n 
C  3  276 ARG 276 276 276 ARG ARG 3 . n 
C  3  277 ILE 277 277 277 ILE ILE 3 . n 
C  3  278 ARG 278 278 278 ARG ARG 3 . n 
C  3  279 ALA 279 279 279 ALA ALA 3 . n 
C  3  280 ARG 280 280 280 ARG ARG 3 . n 
C  3  281 GLU 281 281 281 GLU GLU 3 . n 
C  3  282 VAL 282 282 282 VAL VAL 3 . n 
C  3  283 PRO 283 283 283 PRO PRO 3 . n 
C  3  284 GLU 284 284 284 GLU GLU 3 . n 
C  3  285 VAL 285 285 285 VAL VAL 3 . n 
C  3  286 ASN 286 286 286 ASN ASN 3 . n 
C  3  287 GLU 287 287 287 GLU GLU 3 . n 
C  3  288 ILE 288 288 288 ILE ILE 3 . n 
C  3  289 TRP 289 289 289 TRP TRP 3 . n 
C  3  290 ILE 290 290 290 ILE ILE 3 . n 
C  3  291 CYS 291 291 291 CYS CYS 3 . n 
C  3  292 ASP 292 292 292 ASP ASP 3 . n 
C  3  293 ALA 293 293 293 ALA ALA 3 . n 
C  3  294 GLY 294 294 294 GLY GLY 3 . n 
C  3  295 ARG 295 295 295 ARG ARG 3 . n 
C  3  296 PHE 296 296 296 PHE PHE 3 . n 
C  3  297 GLY 297 297 297 GLY GLY 3 . n 
C  3  298 HIS 298 298 298 HIS HIS 3 . n 
C  3  299 GLU 299 299 299 GLU GLU 3 . n 
C  3  300 TRP 300 300 300 TRP TRP 3 . n 
C  3  301 ALA 301 301 301 ALA ALA 3 . n 
C  3  302 ASP 302 302 302 ASP ASP 3 . n 
C  3  303 GLN 303 303 303 GLN GLN 3 . n 
C  3  304 ASN 304 304 304 ASN ASN 3 . n 
C  3  305 ARG 305 305 305 ARG ARG 3 . n 
C  3  306 LEU 306 306 306 LEU LEU 3 . n 
C  3  307 LYS 307 307 307 LYS LYS 3 . n 
C  3  308 THR 308 308 308 THR THR 3 . n 
C  3  309 PRO 309 309 309 PRO PRO 3 . n 
C  3  310 LEU 310 310 310 LEU LEU 3 . n 
C  3  311 VAL 311 311 311 VAL VAL 3 . n 
C  3  312 ARG 312 312 312 ARG ARG 3 . n 
C  3  313 LYS 313 313 313 LYS LYS 3 . n 
C  3  314 GLU 314 314 314 GLU GLU 3 . n 
C  3  315 GLY 315 315 315 GLY GLY 3 . n 
C  3  316 ARG 316 316 316 ARG ARG 3 . n 
C  3  317 LEU 317 317 317 LEU LEU 3 . n 
C  3  318 VAL 318 318 318 VAL VAL 3 . n 
C  3  319 GLU 319 319 319 GLU GLU 3 . n 
C  3  320 ALA 320 320 320 ALA ALA 3 . n 
C  3  321 THR 321 321 321 THR THR 3 . n 
C  3  322 TRP 322 322 322 TRP TRP 3 . n 
C  3  323 GLU 323 323 323 GLU GLU 3 . n 
C  3  324 GLU 324 324 324 GLU GLU 3 . n 
C  3  325 ALA 325 325 325 ALA ALA 3 . n 
C  3  326 PHE 326 326 326 PHE PHE 3 . n 
C  3  327 LEU 327 327 327 LEU LEU 3 . n 
C  3  328 ALA 328 328 328 ALA ALA 3 . n 
C  3  329 LEU 329 329 329 LEU LEU 3 . n 
C  3  330 LYS 330 330 330 LYS LYS 3 . n 
C  3  331 GLU 331 331 331 GLU GLU 3 . n 
C  3  332 GLY 332 332 332 GLY GLY 3 . n 
C  3  333 LEU 333 333 333 LEU LEU 3 . n 
C  3  334 LYS 334 334 334 LYS LYS 3 . n 
C  3  335 GLU 335 335 335 GLU GLU 3 . n 
C  3  336 ALA 336 336 336 ALA ALA 3 . n 
C  3  337 ARG 337 337 337 ARG ARG 3 . n 
C  3  338 GLY 338 338 338 GLY GLY 3 . n 
C  3  339 GLU 339 339 339 GLU GLU 3 . n 
C  3  340 GLU 340 340 340 GLU GLU 3 . n 
C  3  341 VAL 341 341 341 VAL VAL 3 . n 
C  3  342 GLY 342 342 342 GLY GLY 3 . n 
C  3  343 LEU 343 343 343 LEU LEU 3 . n 
C  3  344 TYR 344 344 344 TYR TYR 3 . n 
C  3  345 LEU 345 345 345 LEU LEU 3 . n 
C  3  346 ALA 346 346 346 ALA ALA 3 . n 
C  3  347 HIS 347 347 347 HIS HIS 3 . n 
C  3  348 ASP 348 348 348 ASP ASP 3 . n 
C  3  349 ALA 349 349 349 ALA ALA 3 . n 
C  3  350 THR 350 350 350 THR THR 3 . n 
C  3  351 LEU 351 351 351 LEU LEU 3 . n 
C  3  352 GLU 352 352 352 GLU GLU 3 . n 
C  3  353 GLU 353 353 353 GLU GLU 3 . n 
C  3  354 GLY 354 354 354 GLY GLY 3 . n 
C  3  355 LEU 355 355 355 LEU LEU 3 . n 
C  3  356 LEU 356 356 356 LEU LEU 3 . n 
C  3  357 ALA 357 357 357 ALA ALA 3 . n 
C  3  358 SER 358 358 358 SER SER 3 . n 
C  3  359 GLU 359 359 359 GLU GLU 3 . n 
C  3  360 LEU 360 360 360 LEU LEU 3 . n 
C  3  361 ALA 361 361 361 ALA ALA 3 . n 
C  3  362 LYS 362 362 362 LYS LYS 3 . n 
C  3  363 ALA 363 363 363 ALA ALA 3 . n 
C  3  364 LEU 364 364 364 LEU LEU 3 . n 
C  3  365 LYS 365 365 365 LYS LYS 3 . n 
C  3  366 THR 366 366 366 THR THR 3 . n 
C  3  367 PRO 367 367 367 PRO PRO 3 . n 
C  3  368 HIS 368 368 368 HIS HIS 3 . n 
C  3  369 LEU 369 369 369 LEU LEU 3 . n 
C  3  370 ASP 370 370 370 ASP ASP 3 . n 
C  3  371 PHE 371 371 371 PHE PHE 3 . n 
C  3  372 GLN 372 372 372 GLN GLN 3 . n 
C  3  373 GLY 373 373 373 GLY GLY 3 . n 
C  3  374 ARG 374 374 374 ARG ARG 3 . n 
C  3  375 THR 375 375 375 THR THR 3 . n 
C  3  376 ALA 376 376 376 ALA ALA 3 . n 
C  3  377 ALA 377 377 377 ALA ALA 3 . n 
C  3  378 PRO 378 378 378 PRO PRO 3 . n 
C  3  379 ALA 379 379 379 ALA ALA 3 . n 
C  3  380 SER 380 380 380 SER SER 3 . n 
C  3  381 LEU 381 381 381 LEU LEU 3 . n 
C  3  382 PHE 382 382 382 PHE PHE 3 . n 
C  3  383 PRO 383 383 383 PRO PRO 3 . n 
C  3  384 PRO 384 384 384 PRO PRO 3 . n 
C  3  385 ALA 385 385 385 ALA ALA 3 . n 
C  3  386 SER 386 386 386 SER SER 3 . n 
C  3  387 LEU 387 387 387 LEU LEU 3 . n 
C  3  388 GLU 388 388 388 GLU GLU 3 . n 
C  3  389 ASP 389 389 389 ASP ASP 3 . n 
C  3  390 LEU 390 390 390 LEU LEU 3 . n 
C  3  391 LEU 391 391 391 LEU LEU 3 . n 
C  3  392 GLN 392 392 392 GLN GLN 3 . n 
C  3  393 ALA 393 393 393 ALA ALA 3 . n 
C  3  394 ASP 394 394 394 ASP ASP 3 . n 
C  3  395 PHE 395 395 395 PHE PHE 3 . n 
C  3  396 ALA 396 396 396 ALA ALA 3 . n 
C  3  397 LEU 397 397 397 LEU LEU 3 . n 
C  3  398 VAL 398 398 398 VAL VAL 3 . n 
C  3  399 LEU 399 399 399 LEU LEU 3 . n 
C  3  400 GLY 400 400 400 GLY GLY 3 . n 
C  3  401 ASP 401 401 401 ASP ASP 3 . n 
C  3  402 PRO 402 402 402 PRO PRO 3 . n 
C  3  403 THR 403 403 403 THR THR 3 . n 
C  3  404 GLU 404 404 404 GLU GLU 3 . n 
C  3  405 GLU 405 405 405 GLU GLU 3 . n 
C  3  406 ALA 406 406 406 ALA ALA 3 . n 
C  3  407 PRO 407 407 407 PRO PRO 3 . n 
C  3  408 ILE 408 408 408 ILE ILE 3 . n 
C  3  409 LEU 409 409 409 LEU LEU 3 . n 
C  3  410 HIS 410 410 410 HIS HIS 3 . n 
C  3  411 LEU 411 411 411 LEU LEU 3 . n 
C  3  412 ARG 412 412 412 ARG ARG 3 . n 
C  3  413 LEU 413 413 413 LEU LEU 3 . n 
C  3  414 SER 414 414 414 SER SER 3 . n 
C  3  415 GLU 415 415 415 GLU GLU 3 . n 
C  3  416 PHE 416 416 416 PHE PHE 3 . n 
C  3  417 VAL 417 417 417 VAL VAL 3 . n 
C  3  418 ARG 418 418 418 ARG ARG 3 . n 
C  3  419 ASP 419 419 419 ASP ASP 3 . n 
C  3  420 LEU 420 420 420 LEU LEU 3 . n 
C  3  421 LYS 421 421 421 LYS LYS 3 . n 
C  3  422 PRO 422 422 422 PRO PRO 3 . n 
C  3  423 PRO 423 423 423 PRO PRO 3 . n 
C  3  424 HIS 424 424 424 HIS HIS 3 . n 
C  3  425 ARG 425 425 425 ARG ARG 3 . n 
C  3  426 TYR 426 426 426 TYR TYR 3 . n 
C  3  427 ASN 427 427 427 ASN ASN 3 . n 
C  3  428 HIS 428 428 428 HIS HIS 3 . n 
C  3  429 GLY 429 429 429 GLY GLY 3 . n 
C  3  430 THR 430 430 430 THR THR 3 . n 
C  3  431 PRO 431 431 431 PRO PRO 3 . n 
C  3  432 PHE 432 432 432 PHE PHE 3 . n 
C  3  433 ALA 433 433 433 ALA ALA 3 . n 
C  3  434 ASP 434 434 434 ASP ASP 3 . n 
C  3  435 LEU 435 435 435 LEU LEU 3 . n 
C  3  436 GLN 436 436 436 GLN GLN 3 . n 
C  3  437 ILE 437 437 437 ILE ILE 3 . n 
C  3  438 LYS 438 438 438 LYS LYS 3 . n 
C  3  439 GLU 439 439 439 GLU GLU 3 . n 
C  3  440 ARG 440 440 440 ARG ARG 3 . n 
C  3  441 MET 441 441 441 MET MET 3 . n 
C  3  442 PRO 442 442 442 PRO PRO 3 . n 
C  3  443 ARG 443 443 443 ARG ARG 3 . n 
C  3  444 ARG 444 444 444 ARG ARG 3 . n 
C  3  445 THR 445 445 445 THR THR 3 . n 
C  3  446 ASP 446 446 446 ASP ASP 3 . n 
C  3  447 LYS 447 447 447 LYS LYS 3 . n 
C  3  448 MET 448 448 448 MET MET 3 . n 
C  3  449 ALA 449 449 449 ALA ALA 3 . n 
C  3  450 LEU 450 450 450 LEU LEU 3 . n 
C  3  451 PHE 451 451 451 PHE PHE 3 . n 
C  3  452 ALA 452 452 452 ALA ALA 3 . n 
C  3  453 PRO 453 453 453 PRO PRO 3 . n 
C  3  454 TYR 454 454 454 TYR TYR 3 . n 
C  3  455 ARG 455 455 455 ARG ARG 3 . n 
C  3  456 ALA 456 456 456 ALA ALA 3 . n 
C  3  457 PRO 457 457 457 PRO PRO 3 . n 
C  3  458 LEU 458 458 458 LEU LEU 3 . n 
C  3  459 MET 459 459 459 MET MET 3 . n 
C  3  460 LYS 460 460 460 LYS LYS 3 . n 
C  3  461 TRP 461 461 461 TRP TRP 3 . n 
C  3  462 ALA 462 462 462 ALA ALA 3 . n 
C  3  463 ALA 463 463 463 ALA ALA 3 . n 
C  3  464 ILE 464 464 464 ILE ILE 3 . n 
C  3  465 HIS 465 465 465 HIS HIS 3 . n 
C  3  466 GLU 466 466 466 GLU GLU 3 . n 
C  3  467 VAL 467 467 467 VAL VAL 3 . n 
C  3  468 HIS 468 468 468 HIS HIS 3 . n 
C  3  469 ARG 469 469 469 ARG ARG 3 . n 
C  3  470 PRO 470 470 470 PRO PRO 3 . n 
C  3  471 GLY 471 471 471 GLY GLY 3 . n 
C  3  472 GLU 472 472 472 GLU GLU 3 . n 
C  3  473 GLU 473 473 473 GLU GLU 3 . n 
C  3  474 ARG 474 474 474 ARG ARG 3 . n 
C  3  475 GLU 475 475 475 GLU GLU 3 . n 
C  3  476 ILE 476 476 476 ILE ILE 3 . n 
C  3  477 LEU 477 477 477 LEU LEU 3 . n 
C  3  478 LEU 478 478 478 LEU LEU 3 . n 
C  3  479 ALA 479 479 479 ALA ALA 3 . n 
C  3  480 LEU 480 480 480 LEU LEU 3 . n 
C  3  481 LEU 481 481 481 LEU LEU 3 . n 
C  3  482 GLY 482 482 482 GLY GLY 3 . n 
C  3  483 ASP 483 483 483 ASP ASP 3 . n 
C  3  484 LYS 484 484 484 LYS LYS 3 . n 
C  3  485 GLU 485 485 485 GLU GLU 3 . n 
C  3  486 GLY 486 486 486 GLY GLY 3 . n 
C  3  487 SER 487 487 487 SER SER 3 . n 
C  3  488 GLU 488 488 488 GLU GLU 3 . n 
C  3  489 MET 489 489 489 MET MET 3 . n 
C  3  490 VAL 490 490 490 VAL VAL 3 . n 
C  3  491 ALA 491 491 491 ALA ALA 3 . n 
C  3  492 LYS 492 492 492 LYS LYS 3 . n 
C  3  493 ALA 493 493 493 ALA ALA 3 . n 
C  3  494 LYS 494 494 494 LYS LYS 3 . n 
C  3  495 GLU 495 495 495 GLU GLU 3 . n 
C  3  496 ALA 496 496 496 ALA ALA 3 . n 
C  3  497 TRP 497 497 497 TRP TRP 3 . n 
C  3  498 GLU 498 498 498 GLU GLU 3 . n 
C  3  499 LYS 499 499 499 LYS LYS 3 . n 
C  3  500 ALA 500 500 500 ALA ALA 3 . n 
C  3  501 LYS 501 501 501 LYS LYS 3 . n 
C  3  502 ASN 502 502 502 ASN ASN 3 . n 
C  3  503 PRO 503 503 503 PRO PRO 3 . n 
C  3  504 VAL 504 504 504 VAL VAL 3 . n 
C  3  505 LEU 505 505 505 LEU LEU 3 . n 
C  3  506 ILE 506 506 506 ILE ILE 3 . n 
C  3  507 LEU 507 507 507 LEU LEU 3 . n 
C  3  508 GLY 508 508 508 GLY GLY 3 . n 
C  3  509 ALA 509 509 509 ALA ALA 3 . n 
C  3  510 GLY 510 510 510 GLY GLY 3 . n 
C  3  511 VAL 511 511 511 VAL VAL 3 . n 
C  3  512 LEU 512 512 512 LEU LEU 3 . n 
C  3  513 GLN 513 513 513 GLN GLN 3 . n 
C  3  514 ASP 514 514 514 ASP ASP 3 . n 
C  3  515 THR 515 515 515 THR THR 3 . n 
C  3  516 VAL 516 516 516 VAL VAL 3 . n 
C  3  517 ALA 517 517 517 ALA ALA 3 . n 
C  3  518 ALA 518 518 518 ALA ALA 3 . n 
C  3  519 GLU 519 519 519 GLU GLU 3 . n 
C  3  520 ARG 520 520 520 ARG ARG 3 . n 
C  3  521 ALA 521 521 521 ALA ALA 3 . n 
C  3  522 ARG 522 522 522 ARG ARG 3 . n 
C  3  523 LEU 523 523 523 LEU LEU 3 . n 
C  3  524 LEU 524 524 524 LEU LEU 3 . n 
C  3  525 ALA 525 525 525 ALA ALA 3 . n 
C  3  526 GLU 526 526 526 GLU GLU 3 . n 
C  3  527 ARG 527 527 527 ARG ARG 3 . n 
C  3  528 LYS 528 528 528 LYS LYS 3 . n 
C  3  529 GLY 529 529 529 GLY GLY 3 . n 
C  3  530 ALA 530 530 530 ALA ALA 3 . n 
C  3  531 LYS 531 531 531 LYS LYS 3 . n 
C  3  532 VAL 532 532 532 VAL VAL 3 . n 
C  3  533 LEU 533 533 533 LEU LEU 3 . n 
C  3  534 ALA 534 534 534 ALA ALA 3 . n 
C  3  535 MET 535 535 535 MET MET 3 . n 
C  3  536 THR 536 536 536 THR THR 3 . n 
C  3  537 PRO 537 537 537 PRO PRO 3 . n 
C  3  538 ALA 538 538 538 ALA ALA 3 . n 
C  3  539 ALA 539 539 539 ALA ALA 3 . n 
C  3  540 ASN 540 540 540 ASN ASN 3 . n 
C  3  541 ALA 541 541 541 ALA ALA 3 . n 
C  3  542 ARG 542 542 542 ARG ARG 3 . n 
C  3  543 GLY 543 543 543 GLY GLY 3 . n 
C  3  544 LEU 544 544 544 LEU LEU 3 . n 
C  3  545 GLU 545 545 545 GLU GLU 3 . n 
C  3  546 ALA 546 546 546 ALA ALA 3 . n 
C  3  547 MET 547 547 547 MET MET 3 . n 
C  3  548 GLY 548 548 548 GLY GLY 3 . n 
C  3  549 VAL 549 549 549 VAL VAL 3 . n 
C  3  550 LEU 550 550 550 LEU LEU 3 . n 
C  3  551 PRO 551 551 551 PRO PRO 3 . n 
C  3  552 GLY 552 552 552 GLY GLY 3 . n 
C  3  553 ALA 553 553 553 ALA ALA 3 . n 
C  3  554 LYS 554 554 554 LYS LYS 3 . n 
C  3  555 GLY 555 555 555 GLY GLY 3 . n 
C  3  556 ALA 556 556 556 ALA ALA 3 . n 
C  3  557 SER 557 557 557 SER SER 3 . n 
C  3  558 TRP 558 558 558 TRP TRP 3 . n 
C  3  559 ASP 559 559 559 ASP ASP 3 . n 
C  3  560 GLU 560 560 560 GLU GLU 3 . n 
C  3  561 PRO 561 561 561 PRO PRO 3 . n 
C  3  562 GLY 562 562 562 GLY GLY 3 . n 
C  3  563 ALA 563 563 563 ALA ALA 3 . n 
C  3  564 LEU 564 564 564 LEU LEU 3 . n 
C  3  565 TYR 565 565 565 TYR TYR 3 . n 
C  3  566 ALA 566 566 566 ALA ALA 3 . n 
C  3  567 TYR 567 567 567 TYR TYR 3 . n 
C  3  568 TYR 568 568 568 TYR TYR 3 . n 
C  3  569 GLY 569 569 569 GLY GLY 3 . n 
C  3  570 PHE 570 570 570 PHE PHE 3 . n 
C  3  571 VAL 571 571 571 VAL VAL 3 . n 
C  3  572 PRO 572 572 572 PRO PRO 3 . n 
C  3  573 PRO 573 573 573 PRO PRO 3 . n 
C  3  574 GLU 574 574 574 GLU GLU 3 . n 
C  3  575 GLU 575 575 575 GLU GLU 3 . n 
C  3  576 ALA 576 576 576 ALA ALA 3 . n 
C  3  577 LEU 577 577 577 LEU LEU 3 . n 
C  3  578 LYS 578 578 578 LYS LYS 3 . n 
C  3  579 GLY 579 579 579 GLY GLY 3 . n 
C  3  580 LYS 580 580 580 LYS LYS 3 . n 
C  3  581 ARG 581 581 581 ARG ARG 3 . n 
C  3  582 PHE 582 582 582 PHE PHE 3 . n 
C  3  583 VAL 583 583 583 VAL VAL 3 . n 
C  3  584 VAL 584 584 584 VAL VAL 3 . n 
C  3  585 MET 585 585 585 MET MET 3 . n 
C  3  586 HIS 586 586 586 HIS HIS 3 . n 
C  3  587 LEU 587 587 587 LEU LEU 3 . n 
C  3  588 SER 588 588 588 SER SER 3 . n 
C  3  589 HIS 589 589 589 HIS HIS 3 . n 
C  3  590 LEU 590 590 590 LEU LEU 3 . n 
C  3  591 HIS 591 591 591 HIS HIS 3 . n 
C  3  592 PRO 592 592 592 PRO PRO 3 . n 
C  3  593 LEU 593 593 593 LEU LEU 3 . n 
C  3  594 ALA 594 594 594 ALA ALA 3 . n 
C  3  595 GLU 595 595 595 GLU GLU 3 . n 
C  3  596 ARG 596 596 596 ARG ARG 3 . n 
C  3  597 TYR 597 597 597 TYR TYR 3 . n 
C  3  598 ALA 598 598 598 ALA ALA 3 . n 
C  3  599 HIS 599 599 599 HIS HIS 3 . n 
C  3  600 VAL 600 600 600 VAL VAL 3 . n 
C  3  601 VAL 601 601 601 VAL VAL 3 . n 
C  3  602 LEU 602 602 602 LEU LEU 3 . n 
C  3  603 PRO 603 603 603 PRO PRO 3 . n 
C  3  604 ALA 604 604 604 ALA ALA 3 . n 
C  3  605 PRO 605 605 605 PRO PRO 3 . n 
C  3  606 THR 606 606 606 THR THR 3 . n 
C  3  607 PHE 607 607 607 PHE PHE 3 . n 
C  3  608 TYR 608 608 608 TYR TYR 3 . n 
C  3  609 GLU 609 609 609 GLU GLU 3 . n 
C  3  610 LYS 610 610 610 LYS LYS 3 . n 
C  3  611 ARG 611 611 611 ARG ARG 3 . n 
C  3  612 GLY 612 612 612 GLY GLY 3 . n 
C  3  613 HIS 613 613 613 HIS HIS 3 . n 
C  3  614 LEU 614 614 614 LEU LEU 3 . n 
C  3  615 VAL 615 615 615 VAL VAL 3 . n 
C  3  616 ASN 616 616 616 ASN ASN 3 . n 
C  3  617 LEU 617 617 617 LEU LEU 3 . n 
C  3  618 GLU 618 618 618 GLU GLU 3 . n 
C  3  619 GLY 619 619 619 GLY GLY 3 . n 
C  3  620 ARG 620 620 620 ARG ARG 3 . n 
C  3  621 VAL 621 621 621 VAL VAL 3 . n 
C  3  622 LEU 622 622 622 LEU LEU 3 . n 
C  3  623 PRO 623 623 623 PRO PRO 3 . n 
C  3  624 LEU 624 624 624 LEU LEU 3 . n 
C  3  625 SER 625 625 625 SER SER 3 . n 
C  3  626 PRO 626 626 626 PRO PRO 3 . n 
C  3  627 ALA 627 627 627 ALA ALA 3 . n 
C  3  628 PRO 628 628 628 PRO PRO 3 . n 
C  3  629 ILE 629 629 629 ILE ILE 3 . n 
C  3  630 GLU 630 630 630 GLU GLU 3 . n 
C  3  631 ASN 631 631 631 ASN ASN 3 . n 
C  3  632 GLY 632 632 632 GLY GLY 3 . n 
C  3  633 GLU 633 633 633 GLU GLU 3 . n 
C  3  634 ALA 634 634 634 ALA ALA 3 . n 
C  3  635 GLU 635 635 635 GLU GLU 3 . n 
C  3  636 GLY 636 636 636 GLY GLY 3 . n 
C  3  637 ALA 637 637 637 ALA ALA 3 . n 
C  3  638 LEU 638 638 638 LEU LEU 3 . n 
C  3  639 GLN 639 639 639 GLN GLN 3 . n 
C  3  640 VAL 640 640 640 VAL VAL 3 . n 
C  3  641 LEU 641 641 641 LEU LEU 3 . n 
C  3  642 ALA 642 642 642 ALA ALA 3 . n 
C  3  643 LEU 643 643 643 LEU LEU 3 . n 
C  3  644 LEU 644 644 644 LEU LEU 3 . n 
C  3  645 ALA 645 645 645 ALA ALA 3 . n 
C  3  646 GLU 646 646 646 GLU GLU 3 . n 
C  3  647 ALA 647 647 647 ALA ALA 3 . n 
C  3  648 LEU 648 648 648 LEU LEU 3 . n 
C  3  649 GLY 649 649 649 GLY GLY 3 . n 
C  3  650 VAL 650 650 650 VAL VAL 3 . n 
C  3  651 ARG 651 651 651 ARG ARG 3 . n 
C  3  652 PRO 652 652 652 PRO PRO 3 . n 
C  3  653 PRO 653 653 653 PRO PRO 3 . n 
C  3  654 PHE 654 654 654 PHE PHE 3 . n 
C  3  655 ARG 655 655 655 ARG ARG 3 . n 
C  3  656 LEU 656 656 656 LEU LEU 3 . n 
C  3  657 HIS 657 657 657 HIS HIS 3 . n 
C  3  658 LEU 658 658 658 LEU LEU 3 . n 
C  3  659 GLU 659 659 659 GLU GLU 3 . n 
C  3  660 ALA 660 660 660 ALA ALA 3 . n 
C  3  661 GLN 661 661 661 GLN GLN 3 . n 
C  3  662 LYS 662 662 662 LYS LYS 3 . n 
C  3  663 ALA 663 663 663 ALA ALA 3 . n 
C  3  664 LEU 664 664 664 LEU LEU 3 . n 
C  3  665 LYS 665 665 665 LYS LYS 3 . n 
C  3  666 ALA 666 666 666 ALA ALA 3 . n 
C  3  667 ARG 667 667 667 ARG ARG 3 . n 
C  3  668 LYS 668 668 668 LYS LYS 3 . n 
C  3  669 VAL 669 669 669 VAL VAL 3 . n 
C  3  670 PRO 670 670 670 PRO PRO 3 . n 
C  3  671 GLU 671 671 671 GLU GLU 3 . n 
C  3  672 ALA 672 672 672 ALA ALA 3 . n 
C  3  673 MET 673 673 673 MET MET 3 . n 
C  3  674 GLY 674 674 674 GLY GLY 3 . n 
C  3  675 ARG 675 675 675 ARG ARG 3 . n 
C  3  676 LEU 676 676 676 LEU LEU 3 . n 
C  3  677 SER 677 677 677 SER SER 3 . n 
C  3  678 PHE 678 678 678 PHE PHE 3 . n 
C  3  679 ARG 679 679 679 ARG ARG 3 . n 
C  3  680 LEU 680 680 680 LEU LEU 3 . n 
C  3  681 LYS 681 681 681 LYS LYS 3 . n 
C  3  682 GLU 682 682 682 GLU GLU 3 . n 
C  3  683 LEU 683 683 683 LEU LEU 3 . n 
C  3  684 ARG 684 684 684 ARG ARG 3 . n 
C  3  685 PRO 685 685 685 PRO PRO 3 . n 
C  3  686 LYS 686 686 686 LYS LYS 3 . n 
C  3  687 GLU 687 687 687 GLU GLU 3 . n 
C  3  688 ARG 688 688 688 ARG ARG 3 . n 
C  3  689 LYS 689 689 689 LYS LYS 3 . n 
C  3  690 GLY 690 690 690 GLY GLY 3 . n 
C  3  691 ALA 691 691 691 ALA ALA 3 . n 
C  3  692 PHE 692 692 692 PHE PHE 3 . n 
C  3  693 TYR 693 693 693 TYR TYR 3 . n 
C  3  694 LEU 694 694 694 LEU LEU 3 . n 
C  3  695 ARG 695 695 695 ARG ARG 3 . n 
C  3  696 PRO 696 696 696 PRO PRO 3 . n 
C  3  697 THR 697 697 697 THR THR 3 . n 
C  3  698 MET 698 698 698 MET MET 3 . n 
C  3  699 TRP 699 699 699 TRP TRP 3 . n 
C  3  700 LYS 700 700 700 LYS LYS 3 . n 
C  3  701 ALA 701 701 701 ALA ALA 3 . n 
C  3  702 HIS 702 702 702 HIS HIS 3 . n 
C  3  703 GLN 703 703 703 GLN GLN 3 . n 
C  3  704 ALA 704 704 704 ALA ALA 3 . n 
C  3  705 VAL 705 705 705 VAL VAL 3 . n 
C  3  706 GLY 706 706 706 GLY GLY 3 . n 
C  3  707 LYS 707 707 707 LYS LYS 3 . n 
C  3  708 ALA 708 708 708 ALA ALA 3 . n 
C  3  709 GLN 709 709 709 GLN GLN 3 . n 
C  3  710 GLU 710 710 710 GLU GLU 3 . n 
C  3  711 ALA 711 711 711 ALA ALA 3 . n 
C  3  712 ALA 712 712 712 ALA ALA 3 . n 
C  3  713 ARG 713 713 713 ARG ARG 3 . n 
C  3  714 ALA 714 714 714 ALA ALA 3 . n 
C  3  715 GLU 715 715 715 GLU GLU 3 . n 
C  3  716 LEU 716 716 716 LEU LEU 3 . n 
C  3  717 TRP 717 717 717 TRP TRP 3 . n 
C  3  718 ALA 718 718 718 ALA ALA 3 . n 
C  3  719 HIS 719 719 719 HIS HIS 3 . n 
C  3  720 PRO 720 720 720 PRO PRO 3 . n 
C  3  721 GLU 721 721 721 GLU GLU 3 . n 
C  3  722 THR 722 722 722 THR THR 3 . n 
C  3  723 ALA 723 723 723 ALA ALA 3 . n 
C  3  724 ARG 724 724 724 ARG ARG 3 . n 
C  3  725 ALA 725 725 725 ALA ALA 3 . n 
C  3  726 GLU 726 726 726 GLU GLU 3 . n 
C  3  727 ALA 727 727 727 ALA ALA 3 . n 
C  3  728 LEU 728 728 728 LEU LEU 3 . n 
C  3  729 PRO 729 729 729 PRO PRO 3 . n 
C  3  730 GLU 730 730 730 GLU GLU 3 . n 
C  3  731 GLY 731 731 731 GLY GLY 3 . n 
C  3  732 ALA 732 732 732 ALA ALA 3 . n 
C  3  733 GLN 733 733 733 GLN GLN 3 . n 
C  3  734 VAL 734 734 734 VAL VAL 3 . n 
C  3  735 ALA 735 735 735 ALA ALA 3 . n 
C  3  736 VAL 736 736 736 VAL VAL 3 . n 
C  3  737 GLU 737 737 737 GLU GLU 3 . n 
C  3  738 THR 738 738 738 THR THR 3 . n 
C  3  739 PRO 739 739 739 PRO PRO 3 . n 
C  3  740 PHE 740 740 740 PHE PHE 3 . n 
C  3  741 GLY 741 741 741 GLY GLY 3 . n 
C  3  742 ARG 742 742 742 ARG ARG 3 . n 
C  3  743 VAL 743 743 743 VAL VAL 3 . n 
C  3  744 GLU 744 744 744 GLU GLU 3 . n 
C  3  745 ALA 745 745 745 ALA ALA 3 . n 
C  3  746 ARG 746 746 746 ARG ARG 3 . n 
C  3  747 VAL 747 747 747 VAL VAL 3 . n 
C  3  748 VAL 748 748 748 VAL VAL 3 . n 
C  3  749 HIS 749 749 749 HIS HIS 3 . n 
C  3  750 ARG 750 750 750 ARG ARG 3 . n 
C  3  751 GLU 751 751 751 GLU GLU 3 . n 
C  3  752 ASP 752 752 752 ASP ASP 3 . n 
C  3  753 VAL 753 753 753 VAL VAL 3 . n 
C  3  754 PRO 754 754 754 PRO PRO 3 . n 
C  3  755 LYS 755 755 755 LYS LYS 3 . n 
C  3  756 GLY 756 756 756 GLY GLY 3 . n 
C  3  757 HIS 757 757 757 HIS HIS 3 . n 
C  3  758 LEU 758 758 758 LEU LEU 3 . n 
C  3  759 TYR 759 759 759 TYR TYR 3 . n 
C  3  760 LEU 760 760 760 LEU LEU 3 . n 
C  3  761 SER 761 761 761 SER SER 3 . n 
C  3  762 ALA 762 762 762 ALA ALA 3 . n 
C  3  763 LEU 763 763 763 LEU LEU 3 . n 
C  3  764 GLY 764 764 764 GLY GLY 3 . n 
C  3  765 PRO 765 765 765 PRO PRO 3 . n 
C  3  766 ALA 766 766 766 ALA ALA 3 . n 
C  3  767 ALA 767 767 767 ALA ALA 3 . n 
C  3  768 GLY 768 768 768 GLY GLY 3 . n 
C  3  769 LEU 769 769 769 LEU LEU 3 . n 
C  3  770 ARG 770 770 770 ARG ARG 3 . n 
C  3  771 VAL 771 771 771 VAL VAL 3 . n 
C  3  772 GLU 772 772 772 GLU GLU 3 . n 
C  3  773 GLY 773 773 773 GLY GLY 3 . n 
C  3  774 ARG 774 774 774 ARG ARG 3 . n 
C  3  775 VAL 775 775 775 VAL VAL 3 . n 
C  3  776 LEU 776 776 776 LEU LEU 3 . n 
C  3  777 VAL 777 777 777 VAL VAL 3 . n 
C  3  778 PRO 778 778 ?   ?   ?   3 . n 
C  3  779 ALA 779 779 ?   ?   ?   3 . n 
C  3  780 GLY 780 780 ?   ?   ?   3 . n 
C  3  781 GLY 781 781 ?   ?   ?   3 . n 
C  3  782 GLU 782 782 ?   ?   ?   3 . n 
C  3  783 ALA 783 783 ?   ?   ?   3 . n 
D  4  1   MET 1   1   ?   ?   ?   4 . n 
D  4  2   ARG 2   2   ?   ?   ?   4 . n 
D  4  3   GLU 3   3   ?   ?   ?   4 . n 
D  4  4   GLU 4   4   ?   ?   ?   4 . n 
D  4  5   PHE 5   5   ?   ?   ?   4 . n 
D  4  6   LEU 6   6   ?   ?   ?   4 . n 
D  4  7   GLU 7   7   ?   ?   ?   4 . n 
D  4  8   GLU 8   8   ?   ?   ?   4 . n 
D  4  9   ILE 9   9   ?   ?   ?   4 . n 
D  4  10  PRO 10  10  ?   ?   ?   4 . n 
D  4  11  LEU 11  11  ?   ?   ?   4 . n 
D  4  12  ASP 12  12  ?   ?   ?   4 . n 
D  4  13  ALA 13  13  ?   ?   ?   4 . n 
D  4  14  PRO 14  14  ?   ?   ?   4 . n 
D  4  15  PRO 15  15  ?   ?   ?   4 . n 
D  4  16  GLU 16  16  ?   ?   ?   4 . n 
D  4  17  GLU 17  17  ?   ?   ?   4 . n 
D  4  18  ALA 18  18  ?   ?   ?   4 . n 
D  4  19  LYS 19  19  ?   ?   ?   4 . n 
D  4  20  GLU 20  20  ?   ?   ?   4 . n 
D  4  21  LEU 21  21  ?   ?   ?   4 . n 
D  4  22  ARG 22  22  ?   ?   ?   4 . n 
D  4  23  THR 23  23  ?   ?   ?   4 . n 
D  4  24  GLU 24  24  ?   ?   ?   4 . n 
D  4  25  VAL 25  25  ?   ?   ?   4 . n 
D  4  26  MET 26  26  26  MET MET 4 . n 
D  4  27  THR 27  27  27  THR THR 4 . n 
D  4  28  LEU 28  28  28  LEU LEU 4 . n 
D  4  29  ASN 29  29  29  ASN ASN 4 . n 
D  4  30  VAL 30  30  30  VAL VAL 4 . n 
D  4  31  GLY 31  31  31  GLY GLY 4 . n 
D  4  32  PRO 32  32  32  PRO PRO 4 . n 
D  4  33  GLN 33  33  33  GLN GLN 4 . n 
D  4  34  HIS 34  34  34  HIS HIS 4 . n 
D  4  35  PRO 35  35  35  PRO PRO 4 . n 
D  4  36  SER 36  36  36  SER SER 4 . n 
D  4  37  THR 37  37  37  THR THR 4 . n 
D  4  38  HIS 38  38  38  HIS HIS 4 . n 
D  4  39  GLY 39  39  39  GLY GLY 4 . n 
D  4  40  VAL 40  40  40  VAL VAL 4 . n 
D  4  41  LEU 41  41  41  LEU LEU 4 . n 
D  4  42  ARG 42  42  42  ARG ARG 4 . n 
D  4  43  LEU 43  43  43  LEU LEU 4 . n 
D  4  44  MET 44  44  44  MET MET 4 . n 
D  4  45  VAL 45  45  45  VAL VAL 4 . n 
D  4  46  THR 46  46  46  THR THR 4 . n 
D  4  47  LEU 47  47  47  LEU LEU 4 . n 
D  4  48  SER 48  48  48  SER SER 4 . n 
D  4  49  GLY 49  49  49  GLY GLY 4 . n 
D  4  50  GLU 50  50  50  GLU GLU 4 . n 
D  4  51  GLU 51  51  51  GLU GLU 4 . n 
D  4  52  VAL 52  52  52  VAL VAL 4 . n 
D  4  53  LEU 53  53  53  LEU LEU 4 . n 
D  4  54  GLU 54  54  54  GLU GLU 4 . n 
D  4  55  VAL 55  55  55  VAL VAL 4 . n 
D  4  56  VAL 56  56  56  VAL VAL 4 . n 
D  4  57  PRO 57  57  57  PRO PRO 4 . n 
D  4  58  HIS 58  58  58  HIS HIS 4 . n 
D  4  59  ILE 59  59  59  ILE ILE 4 . n 
D  4  60  GLY 60  60  60  GLY GLY 4 . n 
D  4  61  TYR 61  61  61  TYR TYR 4 . n 
D  4  62  LEU 62  62  62  LEU LEU 4 . n 
D  4  63  HIS 63  63  63  HIS HIS 4 . n 
D  4  64  THR 64  64  64  THR THR 4 . n 
D  4  65  GLY 65  65  65  GLY GLY 4 . n 
D  4  66  PHE 66  66  66  PHE PHE 4 . n 
D  4  67  GLU 67  67  67  GLU GLU 4 . n 
D  4  68  LYS 68  68  68  LYS LYS 4 . n 
D  4  69  THR 69  69  69  THR THR 4 . n 
D  4  70  MET 70  70  70  MET MET 4 . n 
D  4  71  GLU 71  71  71  GLU GLU 4 . n 
D  4  72  HIS 72  72  72  HIS HIS 4 . n 
D  4  73  ARG 73  73  73  ARG ARG 4 . n 
D  4  74  THR 74  74  74  THR THR 4 . n 
D  4  75  TYR 75  75  75  TYR TYR 4 . n 
D  4  76  LEU 76  76  76  LEU LEU 4 . n 
D  4  77  GLN 77  77  77  GLN GLN 4 . n 
D  4  78  ASN 78  78  78  ASN ASN 4 . n 
D  4  79  ILE 79  79  79  ILE ILE 4 . n 
D  4  80  THR 80  80  80  THR THR 4 . n 
D  4  81  TYR 81  81  81  TYR TYR 4 . n 
D  4  82  THR 82  82  82  THR THR 4 . n 
D  4  83  PRO 83  83  83  PRO PRO 4 . n 
D  4  84  ARG 84  84  84  ARG ARG 4 . n 
D  4  85  MET 85  85  85  MET MET 4 . n 
D  4  86  ASP 86  86  86  ASP ASP 4 . n 
D  4  87  TYR 87  87  87  TYR TYR 4 . n 
D  4  88  LEU 88  88  88  LEU LEU 4 . n 
D  4  89  HIS 89  89  89  HIS HIS 4 . n 
D  4  90  SER 90  90  90  SER SER 4 . n 
D  4  91  PHE 91  91  91  PHE PHE 4 . n 
D  4  92  ALA 92  92  92  ALA ALA 4 . n 
D  4  93  HIS 93  93  93  HIS HIS 4 . n 
D  4  94  ASP 94  94  94  ASP ASP 4 . n 
D  4  95  LEU 95  95  95  LEU LEU 4 . n 
D  4  96  ALA 96  96  96  ALA ALA 4 . n 
D  4  97  TYR 97  97  97  TYR TYR 4 . n 
D  4  98  ALA 98  98  98  ALA ALA 4 . n 
D  4  99  LEU 99  99  99  LEU LEU 4 . n 
D  4  100 ALA 100 100 100 ALA ALA 4 . n 
D  4  101 VAL 101 101 101 VAL VAL 4 . n 
D  4  102 GLU 102 102 102 GLU GLU 4 . n 
D  4  103 LYS 103 103 103 LYS LYS 4 . n 
D  4  104 LEU 104 104 104 LEU LEU 4 . n 
D  4  105 LEU 105 105 105 LEU LEU 4 . n 
D  4  106 GLY 106 106 106 GLY GLY 4 . n 
D  4  107 ALA 107 107 107 ALA ALA 4 . n 
D  4  108 VAL 108 108 108 VAL VAL 4 . n 
D  4  109 VAL 109 109 109 VAL VAL 4 . n 
D  4  110 PRO 110 110 110 PRO PRO 4 . n 
D  4  111 PRO 111 111 111 PRO PRO 4 . n 
D  4  112 ARG 112 112 112 ARG ARG 4 . n 
D  4  113 ALA 113 113 113 ALA ALA 4 . n 
D  4  114 GLU 114 114 114 GLU GLU 4 . n 
D  4  115 THR 115 115 115 THR THR 4 . n 
D  4  116 ILE 116 116 116 ILE ILE 4 . n 
D  4  117 ARG 117 117 117 ARG ARG 4 . n 
D  4  118 VAL 118 118 118 VAL VAL 4 . n 
D  4  119 ILE 119 119 119 ILE ILE 4 . n 
D  4  120 LEU 120 120 120 LEU LEU 4 . n 
D  4  121 ASN 121 121 121 ASN ASN 4 . n 
D  4  122 GLU 122 122 122 GLU GLU 4 . n 
D  4  123 LEU 123 123 123 LEU LEU 4 . n 
D  4  124 SER 124 124 124 SER SER 4 . n 
D  4  125 ARG 125 125 125 ARG ARG 4 . n 
D  4  126 LEU 126 126 126 LEU LEU 4 . n 
D  4  127 ALA 127 127 127 ALA ALA 4 . n 
D  4  128 SER 128 128 128 SER SER 4 . n 
D  4  129 HIS 129 129 129 HIS HIS 4 . n 
D  4  130 LEU 130 130 130 LEU LEU 4 . n 
D  4  131 VAL 131 131 131 VAL VAL 4 . n 
D  4  132 PHE 132 132 132 PHE PHE 4 . n 
D  4  133 LEU 133 133 133 LEU LEU 4 . n 
D  4  134 GLY 134 134 134 GLY GLY 4 . n 
D  4  135 THR 135 135 135 THR THR 4 . n 
D  4  136 GLY 136 136 136 GLY GLY 4 . n 
D  4  137 LEU 137 137 137 LEU LEU 4 . n 
D  4  138 LEU 138 138 138 LEU LEU 4 . n 
D  4  139 ASP 139 139 139 ASP ASP 4 . n 
D  4  140 LEU 140 140 140 LEU LEU 4 . n 
D  4  141 GLY 141 141 141 GLY GLY 4 . n 
D  4  142 ALA 142 142 142 ALA ALA 4 . n 
D  4  143 LEU 143 143 143 LEU LEU 4 . n 
D  4  144 THR 144 144 144 THR THR 4 . n 
D  4  145 PRO 145 145 145 PRO PRO 4 . n 
D  4  146 PHE 146 146 146 PHE PHE 4 . n 
D  4  147 PHE 147 147 147 PHE PHE 4 . n 
D  4  148 TYR 148 148 148 TYR TYR 4 . n 
D  4  149 ALA 149 149 149 ALA ALA 4 . n 
D  4  150 PHE 150 150 150 PHE PHE 4 . n 
D  4  151 ARG 151 151 151 ARG ARG 4 . n 
D  4  152 GLU 152 152 152 GLU GLU 4 . n 
D  4  153 ARG 153 153 153 ARG ARG 4 . n 
D  4  154 GLU 154 154 154 GLU GLU 4 . n 
D  4  155 THR 155 155 155 THR THR 4 . n 
D  4  156 ILE 156 156 156 ILE ILE 4 . n 
D  4  157 LEU 157 157 157 LEU LEU 4 . n 
D  4  158 ASP 158 158 158 ASP ASP 4 . n 
D  4  159 LEU 159 159 159 LEU LEU 4 . n 
D  4  160 PHE 160 160 160 PHE PHE 4 . n 
D  4  161 GLU 161 161 161 GLU GLU 4 . n 
D  4  162 TRP 162 162 162 TRP TRP 4 . n 
D  4  163 VAL 163 163 163 VAL VAL 4 . n 
D  4  164 THR 164 164 164 THR THR 4 . n 
D  4  165 GLY 165 165 165 GLY GLY 4 . n 
D  4  166 GLN 166 166 166 GLN GLN 4 . n 
D  4  167 ARG 167 167 167 ARG ARG 4 . n 
D  4  168 PHE 168 168 168 PHE PHE 4 . n 
D  4  169 HIS 169 169 169 HIS HIS 4 . n 
D  4  170 HIS 170 170 170 HIS HIS 4 . n 
D  4  171 ASN 171 171 171 ASN ASN 4 . n 
D  4  172 TYR 172 172 172 TYR TYR 4 . n 
D  4  173 ILE 173 173 173 ILE ILE 4 . n 
D  4  174 ARG 174 174 174 ARG ARG 4 . n 
D  4  175 ILE 175 175 175 ILE ILE 4 . n 
D  4  176 GLY 176 176 176 GLY GLY 4 . n 
D  4  177 GLY 177 177 177 GLY GLY 4 . n 
D  4  178 VAL 178 178 178 VAL VAL 4 . n 
D  4  179 LYS 179 179 179 LYS LYS 4 . n 
D  4  180 GLU 180 180 180 GLU GLU 4 . n 
D  4  181 ASP 181 181 181 ASP ASP 4 . n 
D  4  182 LEU 182 182 182 LEU LEU 4 . n 
D  4  183 PRO 183 183 183 PRO PRO 4 . n 
D  4  184 GLU 184 184 184 GLU GLU 4 . n 
D  4  185 GLU 185 185 185 GLU GLU 4 . n 
D  4  186 PHE 186 186 186 PHE PHE 4 . n 
D  4  187 VAL 187 187 187 VAL VAL 4 . n 
D  4  188 PRO 188 188 188 PRO PRO 4 . n 
D  4  189 GLU 189 189 189 GLU GLU 4 . n 
D  4  190 LEU 190 190 190 LEU LEU 4 . n 
D  4  191 LYS 191 191 191 LYS LYS 4 . n 
D  4  192 LYS 192 192 192 LYS LYS 4 . n 
D  4  193 LEU 193 193 193 LEU LEU 4 . n 
D  4  194 LEU 194 194 194 LEU LEU 4 . n 
D  4  195 GLU 195 195 195 GLU GLU 4 . n 
D  4  196 VAL 196 196 196 VAL VAL 4 . n 
D  4  197 LEU 197 197 197 LEU LEU 4 . n 
D  4  198 PRO 198 198 198 PRO PRO 4 . n 
D  4  199 HIS 199 199 199 HIS HIS 4 . n 
D  4  200 ARG 200 200 200 ARG ARG 4 . n 
D  4  201 ILE 201 201 201 ILE ILE 4 . n 
D  4  202 ASP 202 202 202 ASP ASP 4 . n 
D  4  203 GLU 203 203 203 GLU GLU 4 . n 
D  4  204 TYR 204 204 204 TYR TYR 4 . n 
D  4  205 GLU 205 205 205 GLU GLU 4 . n 
D  4  206 ALA 206 206 206 ALA ALA 4 . n 
D  4  207 LEU 207 207 207 LEU LEU 4 . n 
D  4  208 PHE 208 208 208 PHE PHE 4 . n 
D  4  209 ALA 209 209 209 ALA ALA 4 . n 
D  4  210 GLU 210 210 210 GLU GLU 4 . n 
D  4  211 SER 211 211 211 SER SER 4 . n 
D  4  212 PRO 212 212 212 PRO PRO 4 . n 
D  4  213 ILE 213 213 213 ILE ILE 4 . n 
D  4  214 PHE 214 214 214 PHE PHE 4 . n 
D  4  215 TYR 215 215 215 TYR TYR 4 . n 
D  4  216 GLU 216 216 216 GLU GLU 4 . n 
D  4  217 ARG 217 217 217 ARG ARG 4 . n 
D  4  218 ALA 218 218 218 ALA ALA 4 . n 
D  4  219 ARG 219 219 219 ARG ARG 4 . n 
D  4  220 GLY 220 220 220 GLY GLY 4 . n 
D  4  221 VAL 221 221 221 VAL VAL 4 . n 
D  4  222 GLY 222 222 222 GLY GLY 4 . n 
D  4  223 VAL 223 223 223 VAL VAL 4 . n 
D  4  224 ILE 224 224 224 ILE ILE 4 . n 
D  4  225 PRO 225 225 225 PRO PRO 4 . n 
D  4  226 PRO 226 226 226 PRO PRO 4 . n 
D  4  227 GLU 227 227 227 GLU GLU 4 . n 
D  4  228 VAL 228 228 228 VAL VAL 4 . n 
D  4  229 ALA 229 229 229 ALA ALA 4 . n 
D  4  230 ILE 230 230 230 ILE ILE 4 . n 
D  4  231 ASP 231 231 231 ASP ASP 4 . n 
D  4  232 LEU 232 232 232 LEU LEU 4 . n 
D  4  233 GLY 233 233 233 GLY GLY 4 . n 
D  4  234 LEU 234 234 234 LEU LEU 4 . n 
D  4  235 THR 235 235 235 THR THR 4 . n 
D  4  236 GLY 236 236 236 GLY GLY 4 . n 
D  4  237 GLY 237 237 237 GLY GLY 4 . n 
D  4  238 SER 238 238 238 SER SER 4 . n 
D  4  239 LEU 239 239 239 LEU LEU 4 . n 
D  4  240 ARG 240 240 240 ARG ARG 4 . n 
D  4  241 ALA 241 241 241 ALA ALA 4 . n 
D  4  242 SER 242 242 242 SER SER 4 . n 
D  4  243 GLY 243 243 243 GLY GLY 4 . n 
D  4  244 VAL 244 244 244 VAL VAL 4 . n 
D  4  245 ASN 245 245 245 ASN ASN 4 . n 
D  4  246 TYR 246 246 246 TYR TYR 4 . n 
D  4  247 ASP 247 247 247 ASP ASP 4 . n 
D  4  248 VAL 248 248 248 VAL VAL 4 . n 
D  4  249 ARG 249 249 249 ARG ARG 4 . n 
D  4  250 LYS 250 250 250 LYS LYS 4 . n 
D  4  251 ALA 251 251 251 ALA ALA 4 . n 
D  4  252 TYR 252 252 252 TYR TYR 4 . n 
D  4  253 PRO 253 253 253 PRO PRO 4 . n 
D  4  254 TYR 254 254 254 TYR TYR 4 . n 
D  4  255 SER 255 255 255 SER SER 4 . n 
D  4  256 GLY 256 256 256 GLY GLY 4 . n 
D  4  257 TYR 257 257 257 TYR TYR 4 . n 
D  4  258 GLU 258 258 258 GLU GLU 4 . n 
D  4  259 THR 259 259 259 THR THR 4 . n 
D  4  260 TYR 260 260 260 TYR TYR 4 . n 
D  4  261 THR 261 261 261 THR THR 4 . n 
D  4  262 PHE 262 262 262 PHE PHE 4 . n 
D  4  263 ASP 263 263 263 ASP ASP 4 . n 
D  4  264 VAL 264 264 264 VAL VAL 4 . n 
D  4  265 PRO 265 265 265 PRO PRO 4 . n 
D  4  266 LEU 266 266 266 LEU LEU 4 . n 
D  4  267 GLY 267 267 267 GLY GLY 4 . n 
D  4  268 GLU 268 268 268 GLU GLU 4 . n 
D  4  269 ARG 269 269 269 ARG ARG 4 . n 
D  4  270 GLY 270 270 270 GLY GLY 4 . n 
D  4  271 ASP 271 271 271 ASP ASP 4 . n 
D  4  272 VAL 272 272 272 VAL VAL 4 . n 
D  4  273 PHE 273 273 273 PHE PHE 4 . n 
D  4  274 ASP 274 274 274 ASP ASP 4 . n 
D  4  275 ARG 275 275 275 ARG ARG 4 . n 
D  4  276 MET 276 276 276 MET MET 4 . n 
D  4  277 LEU 277 277 277 LEU LEU 4 . n 
D  4  278 VAL 278 278 278 VAL VAL 4 . n 
D  4  279 ARG 279 279 279 ARG ARG 4 . n 
D  4  280 ILE 280 280 280 ILE ILE 4 . n 
D  4  281 ARG 281 281 281 ARG ARG 4 . n 
D  4  282 GLU 282 282 282 GLU GLU 4 . n 
D  4  283 MET 283 283 283 MET MET 4 . n 
D  4  284 ARG 284 284 284 ARG ARG 4 . n 
D  4  285 GLU 285 285 285 GLU GLU 4 . n 
D  4  286 SER 286 286 286 SER SER 4 . n 
D  4  287 VAL 287 287 287 VAL VAL 4 . n 
D  4  288 LYS 288 288 288 LYS LYS 4 . n 
D  4  289 ILE 289 289 289 ILE ILE 4 . n 
D  4  290 ILE 290 290 290 ILE ILE 4 . n 
D  4  291 LYS 291 291 291 LYS LYS 4 . n 
D  4  292 GLN 292 292 292 GLN GLN 4 . n 
D  4  293 ALA 293 293 293 ALA ALA 4 . n 
D  4  294 LEU 294 294 294 LEU LEU 4 . n 
D  4  295 GLU 295 295 295 GLU GLU 4 . n 
D  4  296 ARG 296 296 296 ARG ARG 4 . n 
D  4  297 LEU 297 297 297 LEU LEU 4 . n 
D  4  298 GLU 298 298 298 GLU GLU 4 . n 
D  4  299 PRO 299 299 299 PRO PRO 4 . n 
D  4  300 GLY 300 300 300 GLY GLY 4 . n 
D  4  301 PRO 301 301 301 PRO PRO 4 . n 
D  4  302 VAL 302 302 302 VAL VAL 4 . n 
D  4  303 ARG 303 303 303 ARG ARG 4 . n 
D  4  304 ASP 304 304 304 ASP ASP 4 . n 
D  4  305 PRO 305 305 305 PRO PRO 4 . n 
D  4  306 ASN 306 306 306 ASN ASN 4 . n 
D  4  307 PRO 307 307 307 PRO PRO 4 . n 
D  4  308 GLN 308 308 308 GLN GLN 4 . n 
D  4  309 ILE 309 309 309 ILE ILE 4 . n 
D  4  310 THR 310 310 310 THR THR 4 . n 
D  4  311 PRO 311 311 311 PRO PRO 4 . n 
D  4  312 PRO 312 312 312 PRO PRO 4 . n 
D  4  313 PRO 313 313 313 PRO PRO 4 . n 
D  4  314 ARG 314 314 314 ARG ARG 4 . n 
D  4  315 HIS 315 315 315 HIS HIS 4 . n 
D  4  316 LEU 316 316 316 LEU LEU 4 . n 
D  4  317 LEU 317 317 317 LEU LEU 4 . n 
D  4  318 GLU 318 318 318 GLU GLU 4 . n 
D  4  319 THR 319 319 319 THR THR 4 . n 
D  4  320 SER 320 320 320 SER SER 4 . n 
D  4  321 MET 321 321 321 MET MET 4 . n 
D  4  322 GLU 322 322 322 GLU GLU 4 . n 
D  4  323 ALA 323 323 323 ALA ALA 4 . n 
D  4  324 VAL 324 324 324 VAL VAL 4 . n 
D  4  325 ILE 325 325 325 ILE ILE 4 . n 
D  4  326 TYR 326 326 326 TYR TYR 4 . n 
D  4  327 HIS 327 327 327 HIS HIS 4 . n 
D  4  328 PHE 328 328 328 PHE PHE 4 . n 
D  4  329 LYS 329 329 329 LYS LYS 4 . n 
D  4  330 HIS 330 330 330 HIS HIS 4 . n 
D  4  331 TYR 331 331 331 TYR TYR 4 . n 
D  4  332 THR 332 332 332 THR THR 4 . n 
D  4  333 GLU 333 333 333 GLU GLU 4 . n 
D  4  334 GLY 334 334 334 GLY GLY 4 . n 
D  4  335 PHE 335 335 335 PHE PHE 4 . n 
D  4  336 HIS 336 336 336 HIS HIS 4 . n 
D  4  337 PRO 337 337 337 PRO PRO 4 . n 
D  4  338 PRO 338 338 338 PRO PRO 4 . n 
D  4  339 LYS 339 339 339 LYS LYS 4 . n 
D  4  340 GLY 340 340 340 GLY GLY 4 . n 
D  4  341 GLU 341 341 341 GLU GLU 4 . n 
D  4  342 VAL 342 342 342 VAL VAL 4 . n 
D  4  343 TYR 343 343 343 TYR TYR 4 . n 
D  4  344 VAL 344 344 344 VAL VAL 4 . n 
D  4  345 PRO 345 345 345 PRO PRO 4 . n 
D  4  346 THR 346 346 346 THR THR 4 . n 
D  4  347 GLU 347 347 347 GLU GLU 4 . n 
D  4  348 SER 348 348 348 SER SER 4 . n 
D  4  349 ALA 349 349 349 ALA ALA 4 . n 
D  4  350 ARG 350 350 350 ARG ARG 4 . n 
D  4  351 GLY 351 351 351 GLY GLY 4 . n 
D  4  352 GLU 352 352 352 GLU GLU 4 . n 
D  4  353 LEU 353 353 353 LEU LEU 4 . n 
D  4  354 GLY 354 354 354 GLY GLY 4 . n 
D  4  355 TYR 355 355 355 TYR TYR 4 . n 
D  4  356 TYR 356 356 356 TYR TYR 4 . n 
D  4  357 ILE 357 357 357 ILE ILE 4 . n 
D  4  358 VAL 358 358 358 VAL VAL 4 . n 
D  4  359 SER 359 359 359 SER SER 4 . n 
D  4  360 ASP 360 360 360 ASP ASP 4 . n 
D  4  361 GLY 361 361 361 GLY GLY 4 . n 
D  4  362 GLY 362 362 362 GLY GLY 4 . n 
D  4  363 SER 363 363 363 SER SER 4 . n 
D  4  364 MET 364 364 364 MET MET 4 . n 
D  4  365 PRO 365 365 365 PRO PRO 4 . n 
D  4  366 TYR 366 366 366 TYR TYR 4 . n 
D  4  367 ARG 367 367 367 ARG ARG 4 . n 
D  4  368 VAL 368 368 368 VAL VAL 4 . n 
D  4  369 LYS 369 369 369 LYS LYS 4 . n 
D  4  370 VAL 370 370 370 VAL VAL 4 . n 
D  4  371 ARG 371 371 371 ARG ARG 4 . n 
D  4  372 ALA 372 372 372 ALA ALA 4 . n 
D  4  373 PRO 373 373 373 PRO PRO 4 . n 
D  4  374 SER 374 374 374 SER SER 4 . n 
D  4  375 PHE 375 375 375 PHE PHE 4 . n 
D  4  376 VAL 376 376 376 VAL VAL 4 . n 
D  4  377 ASN 377 377 377 ASN ASN 4 . n 
D  4  378 LEU 378 378 378 LEU LEU 4 . n 
D  4  379 GLN 379 379 379 GLN GLN 4 . n 
D  4  380 SER 380 380 380 SER SER 4 . n 
D  4  381 LEU 381 381 381 LEU LEU 4 . n 
D  4  382 PRO 382 382 382 PRO PRO 4 . n 
D  4  383 TYR 383 383 383 TYR TYR 4 . n 
D  4  384 ALA 384 384 384 ALA ALA 4 . n 
D  4  385 CYS 385 385 385 CYS CYS 4 . n 
D  4  386 LYS 386 386 386 LYS LYS 4 . n 
D  4  387 GLY 387 387 387 GLY GLY 4 . n 
D  4  388 GLU 388 388 388 GLU GLU 4 . n 
D  4  389 GLN 389 389 389 GLN GLN 4 . n 
D  4  390 VAL 390 390 390 VAL VAL 4 . n 
D  4  391 PRO 391 391 391 PRO PRO 4 . n 
D  4  392 ASP 392 392 392 ASP ASP 4 . n 
D  4  393 MET 393 393 393 MET MET 4 . n 
D  4  394 VAL 394 394 394 VAL VAL 4 . n 
D  4  395 ALA 395 395 395 ALA ALA 4 . n 
D  4  396 ILE 396 396 396 ILE ILE 4 . n 
D  4  397 ILE 397 397 397 ILE ILE 4 . n 
D  4  398 ALA 398 398 398 ALA ALA 4 . n 
D  4  399 SER 399 399 399 SER SER 4 . n 
D  4  400 LEU 400 400 400 LEU LEU 4 . n 
D  4  401 ASP 401 401 401 ASP ASP 4 . n 
D  4  402 PRO 402 402 402 PRO PRO 4 . n 
D  4  403 VAL 403 403 403 VAL VAL 4 . n 
D  4  404 MET 404 404 404 MET MET 4 . n 
D  4  405 GLY 405 405 405 GLY GLY 4 . n 
D  4  406 ASP 406 406 406 ASP ASP 4 . n 
D  4  407 VAL 407 407 407 VAL VAL 4 . n 
D  4  408 ASP 408 408 408 ASP ASP 4 . n 
D  4  409 ARG 409 409 409 ARG ARG 4 . n 
E  5  1   MET 1   1   1   MET MET 5 . n 
E  5  2   ARG 2   2   2   ARG ARG 5 . n 
E  5  3   LEU 3   3   3   LEU LEU 5 . n 
E  5  4   GLU 4   4   4   GLU GLU 5 . n 
E  5  5   ARG 5   5   5   ARG ARG 5 . n 
E  5  6   VAL 6   6   6   VAL VAL 5 . n 
E  5  7   LEU 7   7   7   LEU LEU 5 . n 
E  5  8   GLU 8   8   8   GLU GLU 5 . n 
E  5  9   GLU 9   9   9   GLU GLU 5 . n 
E  5  10  ALA 10  10  10  ALA ALA 5 . n 
E  5  11  ARG 11  11  11  ARG ARG 5 . n 
E  5  12  ALA 12  12  12  ALA ALA 5 . n 
E  5  13  LYS 13  13  13  LYS LYS 5 . n 
E  5  14  GLY 14  14  14  GLY GLY 5 . n 
E  5  15  TYR 15  15  15  TYR TYR 5 . n 
E  5  16  PRO 16  16  16  PRO PRO 5 . n 
E  5  17  ILE 17  17  17  ILE ILE 5 . n 
E  5  18  GLU 18  18  18  GLU GLU 5 . n 
E  5  19  ASP 19  19  19  ASP ASP 5 . n 
E  5  20  ASN 20  20  20  ASN ASN 5 . n 
E  5  21  GLY 21  21  21  GLY GLY 5 . n 
E  5  22  LEU 22  22  22  LEU LEU 5 . n 
E  5  23  GLY 23  23  23  GLY GLY 5 . n 
E  5  24  ASN 24  24  24  ASN ASN 5 . n 
E  5  25  LEU 25  25  25  LEU LEU 5 . n 
E  5  26  TRP 26  26  26  TRP TRP 5 . n 
E  5  27  VAL 27  27  27  VAL VAL 5 . n 
E  5  28  VAL 28  28  28  VAL VAL 5 . n 
E  5  29  LEU 29  29  29  LEU LEU 5 . n 
E  5  30  PRO 30  30  30  PRO PRO 5 . n 
E  5  31  ARG 31  31  31  ARG ARG 5 . n 
E  5  32  GLU 32  32  32  GLU GLU 5 . n 
E  5  33  ARG 33  33  33  ARG ARG 5 . n 
E  5  34  PHE 34  34  34  PHE PHE 5 . n 
E  5  35  LYS 35  35  35  LYS LYS 5 . n 
E  5  36  GLU 36  36  36  GLU GLU 5 . n 
E  5  37  GLU 37  37  37  GLU GLU 5 . n 
E  5  38  MET 38  38  38  MET MET 5 . n 
E  5  39  ALA 39  39  39  ALA ALA 5 . n 
E  5  40  HIS 40  40  40  HIS HIS 5 . n 
E  5  41  TYR 41  41  41  TYR TYR 5 . n 
E  5  42  LYS 42  42  42  LYS LYS 5 . n 
E  5  43  ALA 43  43  43  ALA ALA 5 . n 
E  5  44  MET 44  44  44  MET MET 5 . n 
E  5  45  GLY 45  45  45  GLY GLY 5 . n 
E  5  46  PHE 46  46  46  PHE PHE 5 . n 
E  5  47  ASN 47  47  47  ASN ASN 5 . n 
E  5  48  PHE 48  48  48  PHE PHE 5 . n 
E  5  49  LEU 49  49  49  LEU LEU 5 . n 
E  5  50  ALA 50  50  50  ALA ALA 5 . n 
E  5  51  ASP 51  51  51  ASP ASP 5 . n 
E  5  52  ILE 52  52  52  ILE ILE 5 . n 
E  5  53  VAL 53  53  53  VAL VAL 5 . n 
E  5  54  GLY 54  54  54  GLY GLY 5 . n 
E  5  55  LEU 55  55  55  LEU LEU 5 . n 
E  5  56  ASP 56  56  56  ASP ASP 5 . n 
E  5  57  TYR 57  57  57  TYR TYR 5 . n 
E  5  58  LEU 58  58  58  LEU LEU 5 . n 
E  5  59  THR 59  59  59  THR THR 5 . n 
E  5  60  TYR 60  60  60  TYR TYR 5 . n 
E  5  61  PRO 61  61  61  PRO PRO 5 . n 
E  5  62  ASP 62  62  62  ASP ASP 5 . n 
E  5  63  PRO 63  63  63  PRO PRO 5 . n 
E  5  64  ARG 64  64  64  ARG ARG 5 . n 
E  5  65  PRO 65  65  65  PRO PRO 5 . n 
E  5  66  GLU 66  66  66  GLU GLU 5 . n 
E  5  67  ARG 67  67  67  ARG ARG 5 . n 
E  5  68  PHE 68  68  68  PHE PHE 5 . n 
E  5  69  ALA 69  69  69  ALA ALA 5 . n 
E  5  70  VAL 70  70  70  VAL VAL 5 . n 
E  5  71  VAL 71  71  71  VAL VAL 5 . n 
E  5  72  TYR 72  72  72  TYR TYR 5 . n 
E  5  73  GLU 73  73  73  GLU GLU 5 . n 
E  5  74  LEU 74  74  74  LEU LEU 5 . n 
E  5  75  VAL 75  75  75  VAL VAL 5 . n 
E  5  76  SER 76  76  76  SER SER 5 . n 
E  5  77  LEU 77  77  77  LEU LEU 5 . n 
E  5  78  PRO 78  78  78  PRO PRO 5 . n 
E  5  79  GLY 79  79  79  GLY GLY 5 . n 
E  5  80  TRP 80  80  80  TRP TRP 5 . n 
E  5  81  LYS 81  81  81  LYS LYS 5 . n 
E  5  82  ASP 82  82  82  ASP ASP 5 . n 
E  5  83  GLY 83  83  83  GLY GLY 5 . n 
E  5  84  ASP 84  84  84  ASP ASP 5 . n 
E  5  85  GLY 85  85  85  GLY GLY 5 . n 
E  5  86  SER 86  86  86  SER SER 5 . n 
E  5  87  ARG 87  87  87  ARG ARG 5 . n 
E  5  88  PHE 88  88  88  PHE PHE 5 . n 
E  5  89  PHE 89  89  89  PHE PHE 5 . n 
E  5  90  VAL 90  90  90  VAL VAL 5 . n 
E  5  91  ARG 91  91  91  ARG ARG 5 . n 
E  5  92  VAL 92  92  92  VAL VAL 5 . n 
E  5  93  TYR 93  93  93  TYR TYR 5 . n 
E  5  94  VAL 94  94  94  VAL VAL 5 . n 
E  5  95  PRO 95  95  95  PRO PRO 5 . n 
E  5  96  GLU 96  96  96  GLU GLU 5 . n 
E  5  97  GLU 97  97  97  GLU GLU 5 . n 
E  5  98  ASP 98  98  98  ASP ASP 5 . n 
E  5  99  PRO 99  99  99  PRO PRO 5 . n 
E  5  100 ARG 100 100 100 ARG ARG 5 . n 
E  5  101 LEU 101 101 101 LEU LEU 5 . n 
E  5  102 PRO 102 102 102 PRO PRO 5 . n 
E  5  103 THR 103 103 103 THR THR 5 . n 
E  5  104 VAL 104 104 104 VAL VAL 5 . n 
E  5  105 THR 105 105 105 THR THR 5 . n 
E  5  106 ASP 106 106 106 ASP ASP 5 . n 
E  5  107 LEU 107 107 107 LEU LEU 5 . n 
E  5  108 TRP 108 108 108 TRP TRP 5 . n 
E  5  109 GLY 109 109 109 GLY GLY 5 . n 
E  5  110 SER 110 110 110 SER SER 5 . n 
E  5  111 ALA 111 111 111 ALA ALA 5 . n 
E  5  112 ASN 112 112 112 ASN ASN 5 . n 
E  5  113 PHE 113 113 113 PHE PHE 5 . n 
E  5  114 LEU 114 114 114 LEU LEU 5 . n 
E  5  115 GLU 115 115 115 GLU GLU 5 . n 
E  5  116 ARG 116 116 116 ARG ARG 5 . n 
E  5  117 GLU 117 117 117 GLU GLU 5 . n 
E  5  118 VAL 118 118 118 VAL VAL 5 . n 
E  5  119 TYR 119 119 119 TYR TYR 5 . n 
E  5  120 ASP 120 120 120 ASP ASP 5 . n 
E  5  121 LEU 121 121 121 LEU LEU 5 . n 
E  5  122 PHE 122 122 122 PHE PHE 5 . n 
E  5  123 GLY 123 123 123 GLY GLY 5 . n 
E  5  124 ILE 124 124 124 ILE ILE 5 . n 
E  5  125 VAL 125 125 125 VAL VAL 5 . n 
E  5  126 PHE 126 126 126 PHE PHE 5 . n 
E  5  127 GLU 127 127 127 GLU GLU 5 . n 
E  5  128 GLY 128 128 128 GLY GLY 5 . n 
E  5  129 HIS 129 129 129 HIS HIS 5 . n 
E  5  130 PRO 130 130 130 PRO PRO 5 . n 
E  5  131 ASP 131 131 131 ASP ASP 5 . n 
E  5  132 LEU 132 132 132 LEU LEU 5 . n 
E  5  133 ARG 133 133 133 ARG ARG 5 . n 
E  5  134 LYS 134 134 134 LYS LYS 5 . n 
E  5  135 ILE 135 135 135 ILE ILE 5 . n 
E  5  136 LEU 136 136 136 LEU LEU 5 . n 
E  5  137 THR 137 137 137 THR THR 5 . n 
E  5  138 PRO 138 138 138 PRO PRO 5 . n 
E  5  139 GLU 139 139 139 GLU GLU 5 . n 
E  5  140 ASP 140 140 140 ASP ASP 5 . n 
E  5  141 LEU 141 141 141 LEU LEU 5 . n 
E  5  142 GLU 142 142 142 GLU GLU 5 . n 
E  5  143 GLY 143 143 143 GLY GLY 5 . n 
E  5  144 HIS 144 144 144 HIS HIS 5 . n 
E  5  145 PRO 145 145 145 PRO PRO 5 . n 
E  5  146 LEU 146 146 146 LEU LEU 5 . n 
E  5  147 ARG 147 147 147 ARG ARG 5 . n 
E  5  148 LYS 148 148 148 LYS LYS 5 . n 
E  5  149 ASP 149 149 149 ASP ASP 5 . n 
E  5  150 TYR 150 150 150 TYR TYR 5 . n 
E  5  151 PRO 151 151 151 PRO PRO 5 . n 
E  5  152 LEU 152 152 152 LEU LEU 5 . n 
E  5  153 GLY 153 153 153 GLY GLY 5 . n 
E  5  154 GLU 154 154 154 GLU GLU 5 . n 
E  5  155 THR 155 155 155 THR THR 5 . n 
E  5  156 PRO 156 156 156 PRO PRO 5 . n 
E  5  157 THR 157 157 157 THR THR 5 . n 
E  5  158 LEU 158 158 158 LEU LEU 5 . n 
E  5  159 PHE 159 159 159 PHE PHE 5 . n 
E  5  160 ARG 160 160 160 ARG ARG 5 . n 
E  5  161 GLU 161 161 161 GLU GLU 5 . n 
E  5  162 GLY 162 162 162 GLY GLY 5 . n 
E  5  163 ARG 163 163 163 ARG ARG 5 . n 
E  5  164 TYR 164 164 164 TYR TYR 5 . n 
E  5  165 ILE 165 165 165 ILE ILE 5 . n 
E  5  166 ILE 166 166 166 ILE ILE 5 . n 
E  5  167 PRO 167 167 167 PRO PRO 5 . n 
E  5  168 ALA 168 168 168 ALA ALA 5 . n 
E  5  169 GLU 169 169 169 GLU GLU 5 . n 
E  5  170 PHE 170 170 170 PHE PHE 5 . n 
E  5  171 ARG 171 171 171 ARG ARG 5 . n 
E  5  172 ALA 172 172 172 ALA ALA 5 . n 
E  5  173 ALA 173 173 173 ALA ALA 5 . n 
E  5  174 LEU 174 174 174 LEU LEU 5 . n 
E  5  175 THR 175 175 175 THR THR 5 . n 
E  5  176 GLY 176 176 176 GLY GLY 5 . n 
E  5  177 LYS 177 177 177 LYS LYS 5 . n 
E  5  178 ASP 178 178 178 ASP ASP 5 . n 
E  5  179 PRO 179 179 179 PRO PRO 5 . n 
E  5  180 GLY 180 180 180 GLY GLY 5 . n 
E  5  181 LEU 181 181 181 LEU LEU 5 . n 
E  5  182 THR 182 182 182 THR THR 5 . n 
E  5  183 PHE 183 183 183 PHE PHE 5 . n 
E  5  184 TYR 184 184 184 TYR TYR 5 . n 
E  5  185 LYS 185 185 185 LYS LYS 5 . n 
E  5  186 GLY 186 186 186 GLY GLY 5 . n 
E  5  187 GLY 187 187 187 GLY GLY 5 . n 
E  5  188 SER 188 188 188 SER SER 5 . n 
E  5  189 ARG 189 189 189 ARG ARG 5 . n 
E  5  190 LYS 190 190 190 LYS LYS 5 . n 
E  5  191 GLY 191 191 191 GLY GLY 5 . n 
E  5  192 TYR 192 192 192 TYR TYR 5 . n 
E  5  193 ARG 193 193 193 ARG ARG 5 . n 
E  5  194 SER 194 194 194 SER SER 5 . n 
E  5  195 LEU 195 195 195 LEU LEU 5 . n 
E  5  196 TRP 196 196 196 TRP TRP 5 . n 
E  5  197 ALA 197 197 ?   ?   ?   5 . n 
E  5  198 ASP 198 198 ?   ?   ?   5 . n 
E  5  199 LEU 199 199 ?   ?   ?   5 . n 
E  5  200 LYS 200 200 ?   ?   ?   5 . n 
E  5  201 LYS 201 201 ?   ?   ?   5 . n 
E  5  202 ALA 202 202 ?   ?   ?   5 . n 
E  5  203 ARG 203 203 ?   ?   ?   5 . n 
E  5  204 GLU 204 204 ?   ?   ?   5 . n 
E  5  205 VAL 205 205 ?   ?   ?   5 . n 
E  5  206 LYS 206 206 ?   ?   ?   5 . n 
E  5  207 GLY 207 207 ?   ?   ?   5 . n 
F  6  1   MET 1   1   ?   ?   ?   6 . n 
F  6  2   ALA 2   2   ?   ?   ?   6 . n 
F  6  3   LEU 3   3   ?   ?   ?   6 . n 
F  6  4   LYS 4   4   ?   ?   ?   6 . n 
F  6  5   ASP 5   5   ?   ?   ?   6 . n 
F  6  6   LEU 6   6   ?   ?   ?   6 . n 
F  6  7   PHE 7   7   ?   ?   ?   6 . n 
F  6  8   GLU 8   8   ?   ?   ?   6 . n 
F  6  9   ARG 9   9   ?   ?   ?   6 . n 
F  6  10  ASP 10  10  ?   ?   ?   6 . n 
F  6  11  VAL 11  11  ?   ?   ?   6 . n 
F  6  12  GLN 12  12  ?   ?   ?   6 . n 
F  6  13  GLU 13  13  ?   ?   ?   6 . n 
F  6  14  LEU 14  14  ?   ?   ?   6 . n 
F  6  15  GLU 15  15  ?   ?   ?   6 . n 
F  6  16  ARG 16  16  16  ARG ARG 6 . n 
F  6  17  GLU 17  17  17  GLU GLU 6 . n 
F  6  18  GLY 18  18  18  GLY GLY 6 . n 
F  6  19  ILE 19  19  19  ILE ILE 6 . n 
F  6  20  LEU 20  20  20  LEU LEU 6 . n 
F  6  21  PHE 21  21  21  PHE PHE 6 . n 
F  6  22  THR 22  22  22  THR THR 6 . n 
F  6  23  THR 23  23  23  THR THR 6 . n 
F  6  24  LEU 24  24  24  LEU LEU 6 . n 
F  6  25  GLU 25  25  25  GLU GLU 6 . n 
F  6  26  LYS 26  26  26  LYS LYS 6 . n 
F  6  27  LEU 27  27  27  LEU LEU 6 . n 
F  6  28  VAL 28  28  28  VAL VAL 6 . n 
F  6  29  ALA 29  29  29  ALA ALA 6 . n 
F  6  30  TRP 30  30  30  TRP TRP 6 . n 
F  6  31  GLY 31  31  31  GLY GLY 6 . n 
F  6  32  ARG 32  32  32  ARG ARG 6 . n 
F  6  33  SER 33  33  33  SER SER 6 . n 
F  6  34  ASN 34  34  34  ASN ASN 6 . n 
F  6  35  SER 35  35  35  SER SER 6 . n 
F  6  36  LEU 36  36  36  LEU LEU 6 . n 
F  6  37  TRP 37  37  37  TRP TRP 6 . n 
F  6  38  PRO 38  38  38  PRO PRO 6 . n 
F  6  39  ALA 39  39  39  ALA ALA 6 . n 
F  6  40  THR 40  40  40  THR THR 6 . n 
F  6  41  PHE 41  41  41  PHE PHE 6 . n 
F  6  42  GLY 42  42  42  GLY GLY 6 . n 
F  6  43  LEU 43  43  43  LEU LEU 6 . n 
F  6  44  ALA 44  44  44  ALA ALA 6 . n 
F  6  45  CYS 45  45  45  CYS CYS 6 . n 
F  6  46  CYS 46  46  46  CYS CYS 6 . n 
F  6  47  ALA 47  47  47  ALA ALA 6 . n 
F  6  48  ILE 48  48  48  ILE ILE 6 . n 
F  6  49  GLU 49  49  49  GLU GLU 6 . n 
F  6  50  MET 50  50  50  MET MET 6 . n 
F  6  51  MET 51  51  51  MET MET 6 . n 
F  6  52  ALA 52  52  52  ALA ALA 6 . n 
F  6  53  SER 53  53  53  SER SER 6 . n 
F  6  54  THR 54  54  54  THR THR 6 . n 
F  6  55  ASP 55  55  55  ASP ASP 6 . n 
F  6  56  ALA 56  56  56  ALA ALA 6 . n 
F  6  57  ARG 57  57  57  ARG ARG 6 . n 
F  6  58  ASN 58  58  58  ASN ASN 6 . n 
F  6  59  ASP 59  59  59  ASP ASP 6 . n 
F  6  60  LEU 60  60  60  LEU LEU 6 . n 
F  6  61  ALA 61  61  61  ALA ALA 6 . n 
F  6  62  ARG 62  62  62  ARG ARG 6 . n 
F  6  63  PHE 63  63  63  PHE PHE 6 . n 
F  6  64  GLY 64  64  64  GLY GLY 6 . n 
F  6  65  SER 65  65  65  SER SER 6 . n 
F  6  66  GLU 66  66  66  GLU GLU 6 . n 
F  6  67  VAL 67  67  67  VAL VAL 6 . n 
F  6  68  PHE 68  68  68  PHE PHE 6 . n 
F  6  69  ARG 69  69  69  ARG ARG 6 . n 
F  6  70  ALA 70  70  70  ALA ALA 6 . n 
F  6  71  SER 71  71  71  SER SER 6 . n 
F  6  72  PRO 72  72  72  PRO PRO 6 . n 
F  6  73  ARG 73  73  73  ARG ARG 6 . n 
F  6  74  GLN 74  74  74  GLN GLN 6 . n 
F  6  75  ALA 75  75  75  ALA ALA 6 . n 
F  6  76  ASP 76  76  76  ASP ASP 6 . n 
F  6  77  VAL 77  77  77  VAL VAL 6 . n 
F  6  78  MET 78  78  78  MET MET 6 . n 
F  6  79  ILE 79  79  79  ILE ILE 6 . n 
F  6  80  VAL 80  80  80  VAL VAL 6 . n 
F  6  81  ALA 81  81  81  ALA ALA 6 . n 
F  6  82  GLY 82  82  82  GLY GLY 6 . n 
F  6  83  ARG 83  83  83  ARG ARG 6 . n 
F  6  84  LEU 84  84  84  LEU LEU 6 . n 
F  6  85  SER 85  85  85  SER SER 6 . n 
F  6  86  LYS 86  86  86  LYS LYS 6 . n 
F  6  87  LYS 87  87  87  LYS LYS 6 . n 
F  6  88  MET 88  88  88  MET MET 6 . n 
F  6  89  ALA 89  89  89  ALA ALA 6 . n 
F  6  90  PRO 90  90  90  PRO PRO 6 . n 
F  6  91  VAL 91  91  91  VAL VAL 6 . n 
F  6  92  MET 92  92  92  MET MET 6 . n 
F  6  93  ARG 93  93  93  ARG ARG 6 . n 
F  6  94  ARG 94  94  94  ARG ARG 6 . n 
F  6  95  VAL 95  95  95  VAL VAL 6 . n 
F  6  96  TRP 96  96  96  TRP TRP 6 . n 
F  6  97  GLU 97  97  97  GLU GLU 6 . n 
F  6  98  GLN 98  98  98  GLN GLN 6 . n 
F  6  99  MET 99  99  99  MET MET 6 . n 
F  6  100 PRO 100 100 100 PRO PRO 6 . n 
F  6  101 ASP 101 101 101 ASP ASP 6 . n 
F  6  102 PRO 102 102 102 PRO PRO 6 . n 
F  6  103 LYS 103 103 103 LYS LYS 6 . n 
F  6  104 TRP 104 104 104 TRP TRP 6 . n 
F  6  105 VAL 105 105 105 VAL VAL 6 . n 
F  6  106 ILE 106 106 106 ILE ILE 6 . n 
F  6  107 SER 107 107 107 SER SER 6 . n 
F  6  108 MET 108 108 108 MET MET 6 . n 
F  6  109 GLY 109 109 109 GLY GLY 6 . n 
F  6  110 ALA 110 110 110 ALA ALA 6 . n 
F  6  111 CYS 111 111 111 CYS CYS 6 . n 
F  6  112 ALA 112 112 112 ALA ALA 6 . n 
F  6  113 SER 113 113 113 SER SER 6 . n 
F  6  114 SER 114 114 114 SER SER 6 . n 
F  6  115 GLY 115 115 115 GLY GLY 6 . n 
F  6  116 GLY 116 116 116 GLY GLY 6 . n 
F  6  117 MET 117 117 117 MET MET 6 . n 
F  6  118 PHE 118 118 118 PHE PHE 6 . n 
F  6  119 ASN 119 119 119 ASN ASN 6 . n 
F  6  120 ASN 120 120 120 ASN ASN 6 . n 
F  6  121 TYR 121 121 121 TYR TYR 6 . n 
F  6  122 ALA 122 122 122 ALA ALA 6 . n 
F  6  123 ILE 123 123 123 ILE ILE 6 . n 
F  6  124 VAL 124 124 124 VAL VAL 6 . n 
F  6  125 GLN 125 125 125 GLN GLN 6 . n 
F  6  126 ASN 126 126 126 ASN ASN 6 . n 
F  6  127 VAL 127 127 127 VAL VAL 6 . n 
F  6  128 ASP 128 128 128 ASP ASP 6 . n 
F  6  129 SER 129 129 129 SER SER 6 . n 
F  6  130 VAL 130 130 130 VAL VAL 6 . n 
F  6  131 VAL 131 131 131 VAL VAL 6 . n 
F  6  132 PRO 132 132 132 PRO PRO 6 . n 
F  6  133 VAL 133 133 133 VAL VAL 6 . n 
F  6  134 ASP 134 134 134 ASP ASP 6 . n 
F  6  135 VAL 135 135 135 VAL VAL 6 . n 
F  6  136 TYR 136 136 136 TYR TYR 6 . n 
F  6  137 VAL 137 137 137 VAL VAL 6 . n 
F  6  138 PRO 138 138 138 PRO PRO 6 . n 
F  6  139 GLY 139 139 139 GLY GLY 6 . n 
F  6  140 CYS 140 140 140 CYS CYS 6 . n 
F  6  141 PRO 141 141 141 PRO PRO 6 . n 
F  6  142 PRO 142 142 142 PRO PRO 6 . n 
F  6  143 ARG 143 143 143 ARG ARG 6 . n 
F  6  144 PRO 144 144 144 PRO PRO 6 . n 
F  6  145 GLU 145 145 145 GLU GLU 6 . n 
F  6  146 ALA 146 146 146 ALA ALA 6 . n 
F  6  147 LEU 147 147 147 LEU LEU 6 . n 
F  6  148 ILE 148 148 148 ILE ILE 6 . n 
F  6  149 TYR 149 149 149 TYR TYR 6 . n 
F  6  150 ALA 150 150 150 ALA ALA 6 . n 
F  6  151 VAL 151 151 151 VAL VAL 6 . n 
F  6  152 MET 152 152 152 MET MET 6 . n 
F  6  153 GLN 153 153 153 GLN GLN 6 . n 
F  6  154 LEU 154 154 154 LEU LEU 6 . n 
F  6  155 GLN 155 155 155 GLN GLN 6 . n 
F  6  156 LYS 156 156 156 LYS LYS 6 . n 
F  6  157 LYS 157 157 157 LYS LYS 6 . n 
F  6  158 VAL 158 158 158 VAL VAL 6 . n 
F  6  159 ARG 159 159 159 ARG ARG 6 . n 
F  6  160 GLY 160 160 160 GLY GLY 6 . n 
F  6  161 GLN 161 161 161 GLN GLN 6 . n 
F  6  162 ALA 162 162 162 ALA ALA 6 . n 
F  6  163 TYR 163 163 163 TYR TYR 6 . n 
F  6  164 ASN 164 164 164 ASN ASN 6 . n 
F  6  165 GLU 165 165 165 GLU GLU 6 . n 
F  6  166 ARG 166 166 166 ARG ARG 6 . n 
F  6  167 GLY 167 167 167 GLY GLY 6 . n 
F  6  168 GLU 168 168 168 GLU GLU 6 . n 
F  6  169 ARG 169 169 169 ARG ARG 6 . n 
F  6  170 LEU 170 170 170 LEU LEU 6 . n 
F  6  171 PRO 171 171 171 PRO PRO 6 . n 
F  6  172 PRO 172 172 172 PRO PRO 6 . n 
F  6  173 VAL 173 173 173 VAL VAL 6 . n 
F  6  174 ALA 174 174 174 ALA ALA 6 . n 
F  6  175 ALA 175 175 175 ALA ALA 6 . n 
F  6  176 TRP 176 176 176 TRP TRP 6 . n 
F  6  177 LYS 177 177 177 LYS LYS 6 . n 
F  6  178 ARG 178 178 178 ARG ARG 6 . n 
F  6  179 THR 179 179 179 THR THR 6 . n 
F  6  180 ARG 180 180 180 ARG ARG 6 . n 
F  6  181 GLY 181 181 181 GLY GLY 6 . n 
G  7  1   MET 1   1   ?   ?   ?   9 . n 
G  7  2   THR 2   2   2   THR THR 9 . n 
G  7  3   LEU 3   3   3   LEU LEU 9 . n 
G  7  4   LYS 4   4   4   LYS LYS 9 . n 
G  7  5   ALA 5   5   5   ALA ALA 9 . n 
G  7  6   LEU 6   6   6   LEU LEU 9 . n 
G  7  7   ALA 7   7   7   ALA ALA 9 . n 
G  7  8   GLN 8   8   8   GLN GLN 9 . n 
G  7  9   SER 9   9   9   SER SER 9 . n 
G  7  10  LEU 10  10  10  LEU LEU 9 . n 
G  7  11  GLY 11  11  11  GLY GLY 9 . n 
G  7  12  ILE 12  12  12  ILE ILE 9 . n 
G  7  13  THR 13  13  13  THR THR 9 . n 
G  7  14  LEU 14  14  14  LEU LEU 9 . n 
G  7  15  LYS 15  15  15  LYS LYS 9 . n 
G  7  16  TYR 16  16  16  TYR TYR 9 . n 
G  7  17  LEU 17  17  17  LEU LEU 9 . n 
G  7  18  PHE 18  18  18  PHE PHE 9 . n 
G  7  19  SER 19  19  19  SER SER 9 . n 
G  7  20  LYS 20  20  20  LYS LYS 9 . n 
G  7  21  PRO 21  21  21  PRO PRO 9 . n 
G  7  22  VAL 22  22  22  VAL VAL 9 . n 
G  7  23  THR 23  23  23  THR THR 9 . n 
G  7  24  VAL 24  24  24  VAL VAL 9 . n 
G  7  25  PRO 25  25  25  PRO PRO 9 . n 
G  7  26  TYR 26  26  26  TYR TYR 9 . n 
G  7  27  PRO 27  27  27  PRO PRO 9 . n 
G  7  28  ASP 28  28  28  ASP ASP 9 . n 
G  7  29  ALA 29  29  29  ALA ALA 9 . n 
G  7  30  PRO 30  30  30  PRO PRO 9 . n 
G  7  31  VAL 31  31  31  VAL VAL 9 . n 
G  7  32  ALA 32  32  32  ALA ALA 9 . n 
G  7  33  LEU 33  33  33  LEU LEU 9 . n 
G  7  34  LYS 34  34  34  LYS LYS 9 . n 
G  7  35  PRO 35  35  35  PRO PRO 9 . n 
G  7  36  ARG 36  36  36  ARG ARG 9 . n 
G  7  37  PHE 37  37  37  PHE PHE 9 . n 
G  7  38  HIS 38  38  38  HIS HIS 9 . n 
G  7  39  GLY 39  39  39  GLY GLY 9 . n 
G  7  40  ARG 40  40  40  ARG ARG 9 . n 
G  7  41  HIS 41  41  41  HIS HIS 9 . n 
G  7  42  VAL 42  42  42  VAL VAL 9 . n 
G  7  43  LEU 43  43  43  LEU LEU 9 . n 
G  7  44  THR 44  44  44  THR THR 9 . n 
G  7  45  ARG 45  45  45  ARG ARG 9 . n 
G  7  46  HIS 46  46  46  HIS HIS 9 . n 
G  7  47  PRO 47  47  47  PRO PRO 9 . n 
G  7  48  ASN 48  48  48  ASN ASN 9 . n 
G  7  49  GLY 49  49  49  GLY GLY 9 . n 
G  7  50  LEU 50  50  50  LEU LEU 9 . n 
G  7  51  GLU 51  51  51  GLU GLU 9 . n 
G  7  52  LYS 52  52  52  LYS LYS 9 . n 
G  7  53  CYS 53  53  53  CYS CYS 9 . n 
G  7  54  ILE 54  54  54  ILE ILE 9 . n 
G  7  55  GLY 55  55  55  GLY GLY 9 . n 
G  7  56  CYS 56  56  56  CYS CYS 9 . n 
G  7  57  SER 57  57  57  SER SER 9 . n 
G  7  58  LEU 58  58  58  LEU LEU 9 . n 
G  7  59  CYS 59  59  59  CYS CYS 9 . n 
G  7  60  ALA 60  60  60  ALA ALA 9 . n 
G  7  61  ALA 61  61  61  ALA ALA 9 . n 
G  7  62  ALA 62  62  62  ALA ALA 9 . n 
G  7  63  CYS 63  63  63  CYS CYS 9 . n 
G  7  64  PRO 64  64  64  PRO PRO 9 . n 
G  7  65  ALA 65  65  65  ALA ALA 9 . n 
G  7  66  TYR 66  66  66  TYR TYR 9 . n 
G  7  67  ALA 67  67  67  ALA ALA 9 . n 
G  7  68  ILE 68  68  68  ILE ILE 9 . n 
G  7  69  TYR 69  69  69  TYR TYR 9 . n 
G  7  70  VAL 70  70  70  VAL VAL 9 . n 
G  7  71  GLU 71  71  71  GLU GLU 9 . n 
G  7  72  PRO 72  72  72  PRO PRO 9 . n 
G  7  73  ALA 73  73  73  ALA ALA 9 . n 
G  7  74  GLU 74  74  74  GLU GLU 9 . n 
G  7  75  ASN 75  75  75  ASN ASN 9 . n 
G  7  76  ASP 76  76  76  ASP ASP 9 . n 
G  7  77  PRO 77  77  77  PRO PRO 9 . n 
G  7  78  GLU 78  78  78  GLU GLU 9 . n 
G  7  79  ASN 79  79  79  ASN ASN 9 . n 
G  7  80  PRO 80  80  80  PRO PRO 9 . n 
G  7  81  VAL 81  81  81  VAL VAL 9 . n 
G  7  82  SER 82  82  82  SER SER 9 . n 
G  7  83  ALA 83  83  83  ALA ALA 9 . n 
G  7  84  GLY 84  84  84  GLY GLY 9 . n 
G  7  85  GLU 85  85  85  GLU GLU 9 . n 
G  7  86  ARG 86  86  86  ARG ARG 9 . n 
G  7  87  TYR 87  87  87  TYR TYR 9 . n 
G  7  88  ALA 88  88  88  ALA ALA 9 . n 
G  7  89  LYS 89  89  89  LYS LYS 9 . n 
G  7  90  VAL 90  90  90  VAL VAL 9 . n 
G  7  91  TYR 91  91  91  TYR TYR 9 . n 
G  7  92  GLU 92  92  92  GLU GLU 9 . n 
G  7  93  ILE 93  93  93  ILE ILE 9 . n 
G  7  94  ASN 94  94  94  ASN ASN 9 . n 
G  7  95  MET 95  95  95  MET MET 9 . n 
G  7  96  LEU 96  96  96  LEU LEU 9 . n 
G  7  97  ARG 97  97  97  ARG ARG 9 . n 
G  7  98  CYS 98  98  98  CYS CYS 9 . n 
G  7  99  ILE 99  99  99  ILE ILE 9 . n 
G  7  100 PHE 100 100 100 PHE PHE 9 . n 
G  7  101 CYS 101 101 101 CYS CYS 9 . n 
G  7  102 GLY 102 102 102 GLY GLY 9 . n 
G  7  103 LEU 103 103 103 LEU LEU 9 . n 
G  7  104 CYS 104 104 104 CYS CYS 9 . n 
G  7  105 GLU 105 105 105 GLU GLU 9 . n 
G  7  106 GLU 106 106 106 GLU GLU 9 . n 
G  7  107 ALA 107 107 107 ALA ALA 9 . n 
G  7  108 CYS 108 108 108 CYS CYS 9 . n 
G  7  109 PRO 109 109 109 PRO PRO 9 . n 
G  7  110 THR 110 110 110 THR THR 9 . n 
G  7  111 GLY 111 111 111 GLY GLY 9 . n 
G  7  112 ALA 112 112 112 ALA ALA 9 . n 
G  7  113 ILE 113 113 113 ILE ILE 9 . n 
G  7  114 VAL 114 114 114 VAL VAL 9 . n 
G  7  115 LEU 115 115 115 LEU LEU 9 . n 
G  7  116 GLY 116 116 116 GLY GLY 9 . n 
G  7  117 TYR 117 117 117 TYR TYR 9 . n 
G  7  118 ASP 118 118 118 ASP ASP 9 . n 
G  7  119 PHE 119 119 119 PHE PHE 9 . n 
G  7  120 GLU 120 120 120 GLU GLU 9 . n 
G  7  121 MET 121 121 121 MET MET 9 . n 
G  7  122 ALA 122 122 122 ALA ALA 9 . n 
G  7  123 ASP 123 123 123 ASP ASP 9 . n 
G  7  124 TYR 124 124 124 TYR TYR 9 . n 
G  7  125 GLU 125 125 125 GLU GLU 9 . n 
G  7  126 TYR 126 126 126 TYR TYR 9 . n 
G  7  127 SER 127 127 127 SER SER 9 . n 
G  7  128 ASP 128 128 128 ASP ASP 9 . n 
G  7  129 LEU 129 129 129 LEU LEU 9 . n 
G  7  130 VAL 130 130 130 VAL VAL 9 . n 
G  7  131 TYR 131 131 131 TYR TYR 9 . n 
G  7  132 GLY 132 132 132 GLY GLY 9 . n 
G  7  133 LYS 133 133 133 LYS LYS 9 . n 
G  7  134 GLU 134 134 134 GLU GLU 9 . n 
G  7  135 ASP 135 135 135 ASP ASP 9 . n 
G  7  136 MET 136 136 136 MET MET 9 . n 
G  7  137 LEU 137 137 137 LEU LEU 9 . n 
G  7  138 VAL 138 138 138 VAL VAL 9 . n 
G  7  139 ASP 139 139 139 ASP ASP 9 . n 
G  7  140 VAL 140 140 140 VAL VAL 9 . n 
G  7  141 VAL 141 141 141 VAL VAL 9 . n 
G  7  142 GLY 142 142 142 GLY GLY 9 . n 
G  7  143 THR 143 143 143 THR THR 9 . n 
G  7  144 LYS 144 144 144 LYS LYS 9 . n 
G  7  145 PRO 145 145 145 PRO PRO 9 . n 
G  7  146 GLN 146 146 146 GLN GLN 9 . n 
G  7  147 ARG 147 147 147 ARG ARG 9 . n 
G  7  148 ARG 148 148 148 ARG ARG 9 . n 
G  7  149 GLU 149 149 149 GLU GLU 9 . n 
G  7  150 ALA 150 150 150 ALA ALA 9 . n 
G  7  151 LYS 151 151 151 LYS LYS 9 . n 
G  7  152 ARG 152 152 152 ARG ARG 9 . n 
G  7  153 THR 153 153 153 THR THR 9 . n 
G  7  154 GLY 154 154 154 GLY GLY 9 . n 
G  7  155 LYS 155 155 155 LYS LYS 9 . n 
G  7  156 PRO 156 156 156 PRO PRO 9 . n 
G  7  157 VAL 157 157 157 VAL VAL 9 . n 
G  7  158 LYS 158 158 158 LYS LYS 9 . n 
G  7  159 VAL 159 159 159 VAL VAL 9 . n 
G  7  160 GLY 160 160 160 GLY GLY 9 . n 
G  7  161 TYR 161 161 161 TYR TYR 9 . n 
G  7  162 VAL 162 162 162 VAL VAL 9 . n 
G  7  163 VAL 163 163 163 VAL VAL 9 . n 
G  7  164 PRO 164 164 164 PRO PRO 9 . n 
G  7  165 TYR 165 165 165 TYR TYR 9 . n 
G  7  166 VAL 166 166 166 VAL VAL 9 . n 
G  7  167 ARG 167 167 167 ARG ARG 9 . n 
G  7  168 PRO 168 168 168 PRO PRO 9 . n 
G  7  169 GLU 169 169 169 GLU GLU 9 . n 
G  7  170 LEU 170 170 170 LEU LEU 9 . n 
G  7  171 GLU 171 171 171 GLU GLU 9 . n 
G  7  172 GLY 172 172 172 GLY GLY 9 . n 
G  7  173 PHE 173 173 173 PHE PHE 9 . n 
G  7  174 LYS 174 174 174 LYS LYS 9 . n 
G  7  175 ALA 175 175 175 ALA ALA 9 . n 
G  7  176 PRO 176 176 176 PRO PRO 9 . n 
G  7  177 THR 177 177 177 THR THR 9 . n 
G  7  178 GLU 178 178 178 GLU GLU 9 . n 
G  7  179 GLY 179 179 179 GLY GLY 9 . n 
G  7  180 GLY 180 180 180 GLY GLY 9 . n 
G  7  181 LYS 181 181 181 LYS LYS 9 . n 
G  7  182 ARG 182 182 ?   ?   ?   9 . n 
H  8  1   MET 1   1   ?   ?   ?   7 . n 
H  8  2   SER 2   2   ?   ?   ?   7 . n 
H  8  3   ALA 3   3   3   ALA ALA 7 . n 
H  8  4   SER 4   4   4   SER SER 7 . n 
H  8  5   SER 5   5   5   SER SER 7 . n 
H  8  6   GLU 6   6   6   GLU GLU 7 . n 
H  8  7   ARG 7   7   7   ARG ARG 7 . n 
H  8  8   GLU 8   8   8   GLU GLU 7 . n 
H  8  9   LEU 9   9   9   LEU LEU 7 . n 
H  8  10  TYR 10  10  10  TYR TYR 7 . n 
H  8  11  GLU 11  11  11  GLU GLU 7 . n 
H  8  12  ALA 12  12  12  ALA ALA 7 . n 
H  8  13  TRP 13  13  13  TRP TRP 7 . n 
H  8  14  VAL 14  14  14  VAL VAL 7 . n 
H  8  15  GLU 15  15  15  GLU GLU 7 . n 
H  8  16  LEU 16  16  16  LEU LEU 7 . n 
H  8  17  LEU 17  17  17  LEU LEU 7 . n 
H  8  18  SER 18  18  18  SER SER 7 . n 
H  8  19  TRP 19  19  19  TRP TRP 7 . n 
H  8  20  MET 20  20  20  MET MET 7 . n 
H  8  21  ARG 21  21  21  ARG ARG 7 . n 
H  8  22  GLU 22  22  22  GLU GLU 7 . n 
H  8  23  TYR 23  23  23  TYR TYR 7 . n 
H  8  24  ALA 24  24  24  ALA ALA 7 . n 
H  8  25  GLN 25  25  25  GLN GLN 7 . n 
H  8  26  ALA 26  26  26  ALA ALA 7 . n 
H  8  27  LYS 27  27  27  LYS LYS 7 . n 
H  8  28  GLY 28  28  28  GLY GLY 7 . n 
H  8  29  VAL 29  29  29  VAL VAL 7 . n 
H  8  30  ARG 30  30  30  ARG ARG 7 . n 
H  8  31  PHE 31  31  31  PHE PHE 7 . n 
H  8  32  GLU 32  32  32  GLU GLU 7 . n 
H  8  33  LYS 33  33  33  LYS LYS 7 . n 
H  8  34  GLU 34  34  34  GLU GLU 7 . n 
H  8  35  ALA 35  35  35  ALA ALA 7 . n 
H  8  36  ASP 36  36  36  ASP ASP 7 . n 
H  8  37  PHE 37  37  37  PHE PHE 7 . n 
H  8  38  PRO 38  38  38  PRO PRO 7 . n 
H  8  39  ASP 39  39  39  ASP ASP 7 . n 
H  8  40  PHE 40  40  40  PHE PHE 7 . n 
H  8  41  ILE 41  41  41  ILE ILE 7 . n 
H  8  42  TYR 42  42  42  TYR TYR 7 . n 
H  8  43  ARG 43  43  43  ARG ARG 7 . n 
H  8  44  MET 44  44  44  MET MET 7 . n 
H  8  45  GLU 45  45  45  GLU GLU 7 . n 
H  8  46  ARG 46  46  46  ARG ARG 7 . n 
H  8  47  PRO 47  47  47  PRO PRO 7 . n 
H  8  48  TYR 48  48  48  TYR TYR 7 . n 
H  8  49  ASP 49  49  49  ASP ASP 7 . n 
H  8  50  LEU 50  50  50  LEU LEU 7 . n 
H  8  51  PRO 51  51  51  PRO PRO 7 . n 
H  8  52  THR 52  52  52  THR THR 7 . n 
H  8  53  THR 53  53  53  THR THR 7 . n 
H  8  54  ILE 54  54  54  ILE ILE 7 . n 
H  8  55  MET 55  55  55  MET MET 7 . n 
H  8  56  THR 56  56  56  THR THR 7 . n 
H  8  57  ALA 57  57  57  ALA ALA 7 . n 
H  8  58  SER 58  58  58  SER SER 7 . n 
H  8  59  LEU 59  59  59  LEU LEU 7 . n 
H  8  60  SER 60  60  60  SER SER 7 . n 
H  8  61  ASP 61  61  61  ASP ASP 7 . n 
H  8  62  GLY 62  62  62  GLY GLY 7 . n 
H  8  63  LEU 63  63  63  LEU LEU 7 . n 
H  8  64  GLY 64  64  64  GLY GLY 7 . n 
H  8  65  GLU 65  65  65  GLU GLU 7 . n 
H  8  66  PRO 66  66  66  PRO PRO 7 . n 
H  8  67  PHE 67  67  67  PHE PHE 7 . n 
H  8  68  LEU 68  68  68  LEU LEU 7 . n 
H  8  69  LEU 69  69  69  LEU LEU 7 . n 
H  8  70  ALA 70  70  70  ALA ALA 7 . n 
H  8  71  ASP 71  71  71  ASP ASP 7 . n 
H  8  72  VAL 72  72  72  VAL VAL 7 . n 
H  8  73  SER 73  73  73  SER SER 7 . n 
H  8  74  PRO 74  74  74  PRO PRO 7 . n 
H  8  75  ARG 75  75  75  ARG ARG 7 . n 
H  8  76  HIS 76  76  76  HIS HIS 7 . n 
H  8  77  ALA 77  77  77  ALA ALA 7 . n 
H  8  78  LYS 78  78  78  LYS LYS 7 . n 
H  8  79  LEU 79  79  79  LEU LEU 7 . n 
H  8  80  LYS 80  80  80  LYS LYS 7 . n 
H  8  81  ARG 81  81  81  ARG ARG 7 . n 
H  8  82  ILE 82  82  82  ILE ILE 7 . n 
H  8  83  GLY 83  83  83  GLY GLY 7 . n 
H  8  84  LEU 84  84  84  LEU LEU 7 . n 
H  8  85  ARG 85  85  85  ARG ARG 7 . n 
H  8  86  LEU 86  86  86  LEU LEU 7 . n 
H  8  87  PRO 87  87  87  PRO PRO 7 . n 
H  8  88  ARG 88  88  88  ARG ARG 7 . n 
H  8  89  ALA 89  89  89  ALA ALA 7 . n 
H  8  90  HIS 90  90  90  HIS HIS 7 . n 
H  8  91  ILE 91  91  91  ILE ILE 7 . n 
H  8  92  HIS 92  92  92  HIS HIS 7 . n 
H  8  93  LEU 93  93  93  LEU LEU 7 . n 
H  8  94  HIS 94  94  94  HIS HIS 7 . n 
H  8  95  ALA 95  95  95  ALA ALA 7 . n 
H  8  96  HIS 96  96  96  HIS HIS 7 . n 
H  8  97  TYR 97  97  97  TYR TYR 7 . n 
H  8  98  GLU 98  98  98  GLU GLU 7 . n 
H  8  99  PRO 99  99  99  PRO PRO 7 . n 
H  8  100 GLY 100 100 100 GLY GLY 7 . n 
H  8  101 LYS 101 101 101 LYS LYS 7 . n 
H  8  102 GLY 102 102 102 GLY GLY 7 . n 
H  8  103 LEU 103 103 103 LEU LEU 7 . n 
H  8  104 VAL 104 104 104 VAL VAL 7 . n 
H  8  105 THR 105 105 105 THR THR 7 . n 
H  8  106 GLY 106 106 106 GLY GLY 7 . n 
H  8  107 LYS 107 107 107 LYS LYS 7 . n 
H  8  108 ILE 108 108 108 ILE ILE 7 . n 
H  8  109 PRO 109 109 109 PRO PRO 7 . n 
H  8  110 LEU 110 110 110 LEU LEU 7 . n 
H  8  111 THR 111 111 111 THR THR 7 . n 
H  8  112 LYS 112 112 112 LYS LYS 7 . n 
H  8  113 GLU 113 113 113 GLU GLU 7 . n 
H  8  114 ARG 114 114 114 ARG ARG 7 . n 
H  8  115 PHE 115 115 115 PHE PHE 7 . n 
H  8  116 PHE 116 116 116 PHE PHE 7 . n 
H  8  117 ALA 117 117 117 ALA ALA 7 . n 
H  8  118 LEU 118 118 118 LEU LEU 7 . n 
H  8  119 ALA 119 119 119 ALA ALA 7 . n 
H  8  120 ASP 120 120 120 ASP ASP 7 . n 
H  8  121 ARG 121 121 121 ARG ARG 7 . n 
H  8  122 ALA 122 122 122 ALA ALA 7 . n 
H  8  123 ARG 123 123 123 ARG ARG 7 . n 
H  8  124 GLU 124 124 124 GLU GLU 7 . n 
H  8  125 ALA 125 125 125 ALA ALA 7 . n 
H  8  126 LEU 126 126 126 LEU LEU 7 . n 
H  8  127 ALA 127 127 127 ALA ALA 7 . n 
H  8  128 PHE 128 128 128 PHE PHE 7 . n 
H  8  129 ALA 129 129 129 ALA ALA 7 . n 
I  9  1   MET 1   1   1   MET MET W . n 
I  9  2   VAL 2   2   2   VAL VAL W . n 
I  9  3   ARG 3   3   3   ARG ARG W . n 
I  9  4   VAL 4   4   4   VAL VAL W . n 
I  9  5   GLY 5   5   5   GLY GLY W . n 
I  9  6   MET 6   6   6   MET MET W . n 
I  9  7   ARG 7   7   7   ARG ARG W . n 
I  9  8   ALA 8   8   8   ALA ALA W . n 
I  9  9   ALA 9   9   9   ALA ALA W . n 
I  9  10  PRO 10  10  10  PRO PRO W . n 
I  9  11  ARG 11  11  11  ARG ARG W . n 
I  9  12  VAL 12  12  12  VAL VAL W . n 
I  9  13  SER 13  13  13  SER SER W . n 
I  9  14  LEU 14  14  14  LEU LEU W . n 
I  9  15  GLU 15  15  15  GLU GLU W . n 
I  9  16  ALA 16  16  16  ALA ALA W . n 
I  9  17  LEU 17  17  17  LEU LEU W . n 
I  9  18  LYS 18  18  18  LYS LYS W . n 
I  9  19  ALA 19  19  19  ALA ALA W . n 
I  9  20  ALA 20  20  20  ALA ALA W . n 
I  9  21  LEU 21  21  21  LEU LEU W . n 
I  9  22  GLY 22  22  22  GLY GLY W . n 
I  9  23  GLY 23  23  23  GLY GLY W . n 
I  9  24  LEU 24  24  24  LEU LEU W . n 
I  9  25  LYS 25  25  25  LYS LYS W . n 
I  9  26  LEU 26  26  26  LEU LEU W . n 
I  9  27  SER 27  27  27  SER SER W . n 
I  9  28  GLU 28  28  28  GLU GLU W . n 
I  9  29  ALA 29  29  29  ALA ALA W . n 
I  9  30  LYS 30  30  30  LYS LYS W . n 
I  9  31  VAL 31  31  31  VAL VAL W . n 
I  9  32  TYR 32  32  32  TYR TYR W . n 
I  9  33  LEU 33  33  33  LEU LEU W . n 
I  9  34  ILE 34  34  34  ILE ILE W . n 
I  9  35  THR 35  35  35  THR THR W . n 
I  9  36  ASP 36  36  36  ASP ASP W . n 
I  9  37  TRP 37  37  37  TRP TRP W . n 
I  9  38  GLN 38  38  38  GLN GLN W . n 
I  9  39  ASP 39  39  39  ASP ASP W . n 
I  9  40  LYS 40  40  40  LYS LYS W . n 
I  9  41  ARG 41  41  41  ARG ARG W . n 
I  9  42  ASP 42  42  42  ASP ASP W . n 
I  9  43  GLN 43  43  43  GLN GLN W . n 
I  9  44  ALA 44  44  44  ALA ALA W . n 
I  9  45  ARG 45  45  45  ARG ARG W . n 
I  9  46  TYR 46  46  46  TYR TYR W . n 
I  9  47  ALA 47  47  47  ALA ALA W . n 
I  9  48  LEU 48  48  48  LEU LEU W . n 
I  9  49  LEU 49  49  49  LEU LEU W . n 
I  9  50  LEU 50  50  50  LEU LEU W . n 
I  9  51  HIS 51  51  51  HIS HIS W . n 
I  9  52  THR 52  52  52  THR THR W . n 
I  9  53  GLY 53  53  53  GLY GLY W . n 
I  9  54  LYS 54  54  54  LYS LYS W . n 
I  9  55  LYS 55  55  55  LYS LYS W . n 
I  9  56  ASP 56  56  56  ASP ASP W . n 
I  9  57  LEU 57  57  57  LEU LEU W . n 
I  9  58  LEU 58  58  58  LEU LEU W . n 
I  9  59  VAL 59  59  59  VAL VAL W . n 
I  9  60  PRO 60  60  60  PRO PRO W . n 
I  9  61  ASP 61  61  61  ASP ASP W . n 
I  9  62  ALA 62  62  62  ALA ALA W . n 
I  9  63  PHE 63  63  63  PHE PHE W . n 
I  9  64  GLY 64  64  64  GLY GLY W . n 
I  9  65  PRO 65  65  65  PRO PRO W . n 
I  9  66  ALA 66  66  66  ALA ALA W . n 
I  9  67  PHE 67  67  67  PHE PHE W . n 
I  9  68  PRO 68  68  68  PRO PRO W . n 
I  9  69  GLY 69  69  69  GLY GLY W . n 
I  9  70  GLY 70  70  70  GLY GLY W . n 
I  9  71  GLU 71  71  71  GLU GLU W . n 
I  9  72  GLU 72  72  72  GLU GLU W . n 
I  9  73  ALA 73  73  73  ALA ALA W . n 
I  9  74  LEU 74  74  74  LEU LEU W . n 
I  9  75  SER 75  75  75  SER SER W . n 
I  9  76  GLU 76  76  76  GLU GLU W . n 
I  9  77  LEU 77  77  77  LEU LEU W . n 
I  9  78  VAL 78  78  78  VAL VAL W . n 
I  9  79  GLY 79  79  79  GLY GLY W . n 
I  9  80  LEU 80  80  80  LEU LEU W . n 
I  9  81  LEU 81  81  81  LEU LEU W . n 
I  9  82  LEU 82  82  82  LEU LEU W . n 
I  9  83  ALA 83  83  83  ALA ALA W . n 
I  9  84  GLN 84  84  84  GLN GLN W . n 
I  9  85  GLY 85  85  85  GLY GLY W . n 
I  9  86  ALA 86  86  86  ALA ALA W . n 
I  9  87  ARG 87  87  87  ARG ARG W . n 
I  9  88  ARG 88  88  88  ARG ARG W . n 
I  9  89  PHE 89  89  89  PHE PHE W . n 
I  9  90  TYR 90  90  90  TYR TYR W . n 
I  9  91  GLU 91  91  91  GLU GLU W . n 
I  9  92  ALA 92  92  92  ALA ALA W . n 
I  9  93  VAL 93  93  93  VAL VAL W . n 
I  9  94  VAL 94  94  94  VAL VAL W . n 
I  9  95  SER 95  95  95  SER SER W . n 
I  9  96  PRO 96  96  96  PRO PRO W . n 
I  9  97  GLY 97  97  97  GLY GLY W . n 
I  9  98  GLU 98  98  98  GLU GLU W . n 
I  9  99  MET 99  99  99  MET MET W . n 
I  9  100 THR 100 100 100 THR THR W . n 
I  9  101 ALA 101 101 101 ALA ALA W . n 
I  9  102 LEU 102 102 102 LEU LEU W . n 
I  9  103 LEU 103 103 103 LEU LEU W . n 
I  9  104 ASP 104 104 104 ASP ASP W . n 
I  9  105 LEU 105 105 105 LEU LEU W . n 
I  9  106 PRO 106 106 106 PRO PRO W . n 
I  9  107 PRO 107 107 107 PRO PRO W . n 
I  9  108 GLU 108 108 108 GLU GLU W . n 
I  9  109 GLU 109 109 109 GLU GLU W . n 
I  9  110 LEU 110 110 110 LEU LEU W . n 
I  9  111 LEU 111 111 111 LEU LEU W . n 
I  9  112 LYS 112 112 112 LYS LYS W . n 
I  9  113 ARG 113 113 113 ARG ARG W . n 
I  9  114 VAL 114 114 114 VAL VAL W . n 
I  9  115 MET 115 115 115 MET MET W . n 
I  9  116 ALA 116 116 116 ALA ALA W . n 
I  9  117 ILE 117 117 117 ILE ILE W . n 
I  9  118 ALA 118 118 118 ALA ALA W . n 
I  9  119 ASN 119 119 119 ASN ASN W . n 
I  9  120 PRO 120 120 120 PRO PRO W . n 
I  9  121 THR 121 121 121 THR THR W . n 
I  9  122 ASP 122 122 122 ASP ASP W . n 
I  9  123 PRO 123 123 123 PRO PRO W . n 
I  9  124 GLY 124 124 124 GLY GLY W . n 
I  9  125 ILE 125 125 125 ILE ILE W . n 
I  9  126 TYR 126 126 126 TYR TYR W . n 
I  9  127 LEU 127 127 127 LEU LEU W . n 
I  9  128 LYS 128 128 ?   ?   ?   W . n 
I  9  129 ARG 129 129 ?   ?   ?   W . n 
I  9  130 ALA 130 130 ?   ?   ?   W . n 
I  9  131 ALA 131 131 ?   ?   ?   W . n 
J  10 1   MET 1   1   1   MET MET A . n 
J  10 2   ALA 2   2   2   ALA ALA A . n 
J  10 3   PRO 3   3   3   PRO PRO A . n 
J  10 4   ILE 4   4   4   ILE ILE A . n 
J  10 5   GLN 5   5   5   GLN GLN A . n 
J  10 6   GLU 6   6   6   GLU GLU A . n 
J  10 7   TYR 7   7   7   TYR TYR A . n 
J  10 8   VAL 8   8   8   VAL VAL A . n 
J  10 9   GLY 9   9   9   GLY GLY A . n 
J  10 10  THR 10  10  10  THR THR A . n 
J  10 11  LEU 11  11  11  LEU LEU A . n 
J  10 12  ILE 12  12  12  ILE ILE A . n 
J  10 13  TYR 13  13  13  TYR TYR A . n 
J  10 14  VAL 14  14  14  VAL VAL A . n 
J  10 15  GLY 15  15  15  GLY GLY A . n 
J  10 16  VAL 16  16  16  VAL VAL A . n 
J  10 17  ALA 17  17  17  ALA ALA A . n 
J  10 18  LEU 18  18  18  LEU LEU A . n 
J  10 19  PHE 19  19  19  PHE PHE A . n 
J  10 20  ILE 20  20  20  ILE ILE A . n 
J  10 21  GLY 21  21  21  GLY GLY A . n 
J  10 22  VAL 22  22  22  VAL VAL A . n 
J  10 23  ALA 23  23  23  ALA ALA A . n 
J  10 24  ALA 24  24  24  ALA ALA A . n 
J  10 25  LEU 25  25  25  LEU LEU A . n 
J  10 26  LEU 26  26  26  LEU LEU A . n 
J  10 27  VAL 27  27  27  VAL VAL A . n 
J  10 28  GLY 28  28  28  GLY GLY A . n 
J  10 29  ALA 29  29  29  ALA ALA A . n 
J  10 30  LEU 30  30  30  LEU LEU A . n 
J  10 31  LEU 31  31  31  LEU LEU A . n 
J  10 32  GLY 32  32  32  GLY GLY A . n 
J  10 33  PRO 33  33  33  PRO PRO A . n 
J  10 34  LYS 34  34  34  LYS LYS A . n 
J  10 35  LYS 35  35  35  LYS LYS A . n 
J  10 36  PRO 36  36  36  PRO PRO A . n 
J  10 37  GLY 37  37  37  GLY GLY A . n 
J  10 38  ARG 38  38  38  ARG ARG A . n 
J  10 39  ALA 39  39  39  ALA ALA A . n 
J  10 40  LYS 40  40  40  LYS LYS A . n 
J  10 41  LEU 41  41  41  LEU LEU A . n 
J  10 42  MET 42  42  42  MET MET A . n 
J  10 43  PRO 43  43  43  PRO PRO A . n 
J  10 44  TYR 44  44  44  TYR TYR A . n 
J  10 45  GLU 45  45  45  GLU GLU A . n 
J  10 46  SER 46  46  46  SER SER A . n 
J  10 47  GLY 47  47  47  GLY GLY A . n 
J  10 48  ASN 48  48  48  ASN ASN A . n 
J  10 49  ASP 49  49  49  ASP ASP A . n 
J  10 50  PRO 50  50  50  PRO PRO A . n 
J  10 51  ALA 51  51  51  ALA ALA A . n 
J  10 52  GLY 52  52  52  GLY GLY A . n 
J  10 53  GLU 53  53  53  GLU GLU A . n 
J  10 54  VAL 54  54  54  VAL VAL A . n 
J  10 55  LYS 55  55  55  LYS LYS A . n 
J  10 56  ARG 56  56  56  ARG ARG A . n 
J  10 57  PHE 57  57  57  PHE PHE A . n 
J  10 58  PRO 58  58  58  PRO PRO A . n 
J  10 59  VAL 59  59  59  VAL VAL A . n 
J  10 60  HIS 60  60  60  HIS HIS A . n 
J  10 61  PHE 61  61  61  PHE PHE A . n 
J  10 62  TYR 62  62  62  TYR TYR A . n 
J  10 63  VAL 63  63  63  VAL VAL A . n 
J  10 64  VAL 64  64  64  VAL VAL A . n 
J  10 65  ALA 65  65  65  ALA ALA A . n 
J  10 66  MET 66  66  66  MET MET A . n 
J  10 67  LEU 67  67  67  LEU LEU A . n 
J  10 68  PHE 68  68  68  PHE PHE A . n 
J  10 69  ILE 69  69  69  ILE ILE A . n 
J  10 70  LEU 70  70  70  LEU LEU A . n 
J  10 71  PHE 71  71  71  PHE PHE A . n 
J  10 72  ASP 72  72  72  ASP ASP A . n 
J  10 73  VAL 73  73  73  VAL VAL A . n 
J  10 74  GLU 74  74  74  GLU GLU A . n 
J  10 75  VAL 75  75  75  VAL VAL A . n 
J  10 76  ALA 76  76  76  ALA ALA A . n 
J  10 77  PHE 77  77  77  PHE PHE A . n 
J  10 78  LEU 78  78  78  LEU LEU A . n 
J  10 79  TRP 79  79  79  TRP TRP A . n 
J  10 80  PRO 80  80  80  PRO PRO A . n 
J  10 81  TYR 81  81  81  TYR TYR A . n 
J  10 82  ALA 82  82  82  ALA ALA A . n 
J  10 83  VAL 83  83  83  VAL VAL A . n 
J  10 84  SER 84  84  84  SER SER A . n 
J  10 85  ALA 85  85  85  ALA ALA A . n 
J  10 86  GLY 86  86  86  GLY GLY A . n 
J  10 87  GLY 87  87  87  GLY GLY A . n 
J  10 88  LEU 88  88  88  LEU LEU A . n 
J  10 89  GLY 89  89  89  GLY GLY A . n 
J  10 90  LEU 90  90  90  LEU LEU A . n 
J  10 91  TYR 91  91  91  TYR TYR A . n 
J  10 92  GLY 92  92  92  GLY GLY A . n 
J  10 93  PHE 93  93  93  PHE PHE A . n 
J  10 94  LEU 94  94  94  LEU LEU A . n 
J  10 95  GLY 95  95  95  GLY GLY A . n 
J  10 96  VAL 96  96  96  VAL VAL A . n 
J  10 97  LEU 97  97  97  LEU LEU A . n 
J  10 98  ALA 98  98  98  ALA ALA A . n 
J  10 99  PHE 99  99  99  PHE PHE A . n 
J  10 100 THR 100 100 100 THR THR A . n 
J  10 101 LEU 101 101 101 LEU LEU A . n 
J  10 102 LEU 102 102 102 LEU LEU A . n 
J  10 103 LEU 103 103 103 LEU LEU A . n 
J  10 104 PHE 104 104 104 PHE PHE A . n 
J  10 105 VAL 105 105 105 VAL VAL A . n 
J  10 106 GLY 106 106 106 GLY GLY A . n 
J  10 107 PHE 107 107 107 PHE PHE A . n 
J  10 108 LEU 108 108 108 LEU LEU A . n 
J  10 109 TYR 109 109 109 TYR TYR A . n 
J  10 110 GLU 110 110 110 GLU GLU A . n 
J  10 111 TRP 111 111 111 TRP TRP A . n 
J  10 112 TRP 112 112 112 TRP TRP A . n 
J  10 113 LYS 113 113 113 LYS LYS A . n 
J  10 114 GLY 114 114 114 GLY GLY A . n 
J  10 115 VAL 115 115 115 VAL VAL A . n 
J  10 116 MET 116 116 116 MET MET A . n 
J  10 117 ARG 117 117 117 ARG ARG A . n 
J  10 118 TRP 118 118 ?   ?   ?   A . n 
J  10 119 HIS 119 119 ?   ?   ?   A . n 
K  11 1   MET 1   1   1   MET MET J . n 
K  11 2   SER 2   2   2   SER SER J . n 
K  11 3   LEU 3   3   3   LEU LEU J . n 
K  11 4   LEU 4   4   4   LEU LEU J . n 
K  11 5   GLU 5   5   5   GLU GLU J . n 
K  11 6   GLY 6   6   6   GLY GLY J . n 
K  11 7   LEU 7   7   7   LEU LEU J . n 
K  11 8   ALA 8   8   8   ALA ALA J . n 
K  11 9   LEU 9   9   9   LEU LEU J . n 
K  11 10  PHE 10  10  10  PHE PHE J . n 
K  11 11  LEU 11  11  11  LEU LEU J . n 
K  11 12  LEU 12  12  12  LEU LEU J . n 
K  11 13  LEU 13  13  13  LEU LEU J . n 
K  11 14  LEU 14  14  14  LEU LEU J . n 
K  11 15  SER 15  15  15  SER SER J . n 
K  11 16  GLY 16  16  16  GLY GLY J . n 
K  11 17  VAL 17  17  17  VAL VAL J . n 
K  11 18  LEU 18  18  18  LEU LEU J . n 
K  11 19  VAL 19  19  19  VAL VAL J . n 
K  11 20  VAL 20  20  20  VAL VAL J . n 
K  11 21  THR 21  21  21  THR THR J . n 
K  11 22  LEU 22  22  22  LEU LEU J . n 
K  11 23  ARG 23  23  23  ARG ARG J . n 
K  11 24  ASN 24  24  24  ASN ASN J . n 
K  11 25  ALA 25  25  25  ALA ALA J . n 
K  11 26  ILE 26  26  26  ILE ILE J . n 
K  11 27  HIS 27  27  27  HIS HIS J . n 
K  11 28  ALA 28  28  28  ALA ALA J . n 
K  11 29  ALA 29  29  29  ALA ALA J . n 
K  11 30  LEU 30  30  30  LEU LEU J . n 
K  11 31  ALA 31  31  31  ALA ALA J . n 
K  11 32  LEU 32  32  32  LEU LEU J . n 
K  11 33  ILE 33  33  33  ILE ILE J . n 
K  11 34  LEU 34  34  34  LEU LEU J . n 
K  11 35  ASN 35  35  35  ASN ASN J . n 
K  11 36  PHE 36  36  36  PHE PHE J . n 
K  11 37  LEU 37  37  37  LEU LEU J . n 
K  11 38  VAL 38  38  38  VAL VAL J . n 
K  11 39  LEU 39  39  39  LEU LEU J . n 
K  11 40  ALA 40  40  40  ALA ALA J . n 
K  11 41  GLY 41  41  41  GLY GLY J . n 
K  11 42  VAL 42  42  42  VAL VAL J . n 
K  11 43  TYR 43  43  43  TYR TYR J . n 
K  11 44  VAL 44  44  44  VAL VAL J . n 
K  11 45  ALA 45  45  45  ALA ALA J . n 
K  11 46  LEU 46  46  46  LEU LEU J . n 
K  11 47  ASP 47  47  47  ASP ASP J . n 
K  11 48  ALA 48  48  48  ALA ALA J . n 
K  11 49  ARG 49  49  49  ARG ARG J . n 
K  11 50  PHE 50  50  50  PHE PHE J . n 
K  11 51  LEU 51  51  51  LEU LEU J . n 
K  11 52  GLY 52  52  52  GLY GLY J . n 
K  11 53  PHE 53  53  53  PHE PHE J . n 
K  11 54  ILE 54  54  54  ILE ILE J . n 
K  11 55  GLN 55  55  55  GLN GLN J . n 
K  11 56  VAL 56  56  56  VAL VAL J . n 
K  11 57  ILE 57  57  57  ILE ILE J . n 
K  11 58  VAL 58  58  58  VAL VAL J . n 
K  11 59  TYR 59  59  59  TYR TYR J . n 
K  11 60  ALA 60  60  60  ALA ALA J . n 
K  11 61  GLY 61  61  61  GLY GLY J . n 
K  11 62  ALA 62  62  62  ALA ALA J . n 
K  11 63  ILE 63  63  63  ILE ILE J . n 
K  11 64  VAL 64  64  64  VAL VAL J . n 
K  11 65  VAL 65  65  65  VAL VAL J . n 
K  11 66  LEU 66  66  66  LEU LEU J . n 
K  11 67  PHE 67  67  67  PHE PHE J . n 
K  11 68  LEU 68  68  68  LEU LEU J . n 
K  11 69  PHE 69  69  69  PHE PHE J . n 
K  11 70  VAL 70  70  70  VAL VAL J . n 
K  11 71  ILE 71  71  71  ILE ILE J . n 
K  11 72  MET 72  72  72  MET MET J . n 
K  11 73  LEU 73  73  73  LEU LEU J . n 
K  11 74  LEU 74  74  74  LEU LEU J . n 
K  11 75  PHE 75  75  75  PHE PHE J . n 
K  11 76  ALA 76  76  76  ALA ALA J . n 
K  11 77  ALA 77  77  77  ALA ALA J . n 
K  11 78  GLN 78  78  78  GLN GLN J . n 
K  11 79  GLY 79  79  79  GLY GLY J . n 
K  11 80  GLU 80  80  80  GLU GLU J . n 
K  11 81  ILE 81  81  81  ILE ILE J . n 
K  11 82  GLY 82  82  82  GLY GLY J . n 
K  11 83  PHE 83  83  83  PHE PHE J . n 
K  11 84  ASP 84  84  84  ASP ASP J . n 
K  11 85  PRO 85  85  85  PRO PRO J . n 
K  11 86  LEU 86  86  86  LEU LEU J . n 
K  11 87  VAL 87  87  87  VAL VAL J . n 
K  11 88  ARG 88  88  88  ARG ARG J . n 
K  11 89  SER 89  89  89  SER SER J . n 
K  11 90  ARG 90  90  90  ARG ARG J . n 
K  11 91  PRO 91  91  91  PRO PRO J . n 
K  11 92  LEU 92  92  92  LEU LEU J . n 
K  11 93  ALA 93  93  93  ALA ALA J . n 
K  11 94  ALA 94  94  94  ALA ALA J . n 
K  11 95  LEU 95  95  95  LEU LEU J . n 
K  11 96  LEU 96  96  96  LEU LEU J . n 
K  11 97  ALA 97  97  97  ALA ALA J . n 
K  11 98  LEU 98  98  98  LEU LEU J . n 
K  11 99  GLY 99  99  99  GLY GLY J . n 
K  11 100 VAL 100 100 100 VAL VAL J . n 
K  11 101 ALA 101 101 101 ALA ALA J . n 
K  11 102 GLY 102 102 102 GLY GLY J . n 
K  11 103 ILE 103 103 103 ILE ILE J . n 
K  11 104 LEU 104 104 104 LEU LEU J . n 
K  11 105 ALA 105 105 105 ALA ALA J . n 
K  11 106 ALA 106 106 106 ALA ALA J . n 
K  11 107 GLY 107 107 107 GLY GLY J . n 
K  11 108 LEU 108 108 108 LEU LEU J . n 
K  11 109 TRP 109 109 109 TRP TRP J . n 
K  11 110 GLY 110 110 110 GLY GLY J . n 
K  11 111 LEU 111 111 111 LEU LEU J . n 
K  11 112 ASP 112 112 112 ASP ASP J . n 
K  11 113 LEU 113 113 113 LEU LEU J . n 
K  11 114 ALA 114 114 114 ALA ALA J . n 
K  11 115 PHE 115 115 115 PHE PHE J . n 
K  11 116 THR 116 116 116 THR THR J . n 
K  11 117 GLN 117 117 117 GLN GLN J . n 
K  11 118 ASP 118 118 118 ASP ASP J . n 
K  11 119 LEU 119 119 119 LEU LEU J . n 
K  11 120 LYS 120 120 120 LYS LYS J . n 
K  11 121 GLY 121 121 121 GLY GLY J . n 
K  11 122 GLY 122 122 122 GLY GLY J . n 
K  11 123 LEU 123 123 123 LEU LEU J . n 
K  11 124 PRO 124 124 124 PRO PRO J . n 
K  11 125 GLN 125 125 125 GLN GLN J . n 
K  11 126 ALA 126 126 126 ALA ALA J . n 
K  11 127 LEU 127 127 127 LEU LEU J . n 
K  11 128 GLY 128 128 128 GLY GLY J . n 
K  11 129 PRO 129 129 129 PRO PRO J . n 
K  11 130 LEU 130 130 130 LEU LEU J . n 
K  11 131 LEU 131 131 131 LEU LEU J . n 
K  11 132 TYR 132 132 132 TYR TYR J . n 
K  11 133 GLY 133 133 133 GLY GLY J . n 
K  11 134 ASP 134 134 134 ASP ASP J . n 
K  11 135 TRP 135 135 135 TRP TRP J . n 
K  11 136 LEU 136 136 136 LEU LEU J . n 
K  11 137 PHE 137 137 137 PHE PHE J . n 
K  11 138 VAL 138 138 138 VAL VAL J . n 
K  11 139 LEU 139 139 139 LEU LEU J . n 
K  11 140 LEU 140 140 140 LEU LEU J . n 
K  11 141 ALA 141 141 141 ALA ALA J . n 
K  11 142 VAL 142 142 142 VAL VAL J . n 
K  11 143 GLY 143 143 143 GLY GLY J . n 
K  11 144 PHE 144 144 144 PHE PHE J . n 
K  11 145 LEU 145 145 145 LEU LEU J . n 
K  11 146 LEU 146 146 146 LEU LEU J . n 
K  11 147 MET 147 147 147 MET MET J . n 
K  11 148 ALA 148 148 148 ALA ALA J . n 
K  11 149 ALA 149 149 149 ALA ALA J . n 
K  11 150 THR 150 150 150 THR THR J . n 
K  11 151 VAL 151 151 151 VAL VAL J . n 
K  11 152 VAL 152 152 152 VAL VAL J . n 
K  11 153 ALA 153 153 153 ALA ALA J . n 
K  11 154 VAL 154 154 154 VAL VAL J . n 
K  11 155 ALA 155 155 155 ALA ALA J . n 
K  11 156 LEU 156 156 156 LEU LEU J . n 
K  11 157 VAL 157 157 157 VAL VAL J . n 
K  11 158 GLU 158 158 158 GLU GLU J . n 
K  11 159 PRO 159 159 159 PRO PRO J . n 
K  11 160 GLY 160 160 160 GLY GLY J . n 
K  11 161 LYS 161 161 ?   ?   ?   J . n 
K  11 162 ALA 162 162 ?   ?   ?   J . n 
K  11 163 SER 163 163 ?   ?   ?   J . n 
K  11 164 ARG 164 164 ?   ?   ?   J . n 
K  11 165 ALA 165 165 ?   ?   ?   J . n 
K  11 166 LYS 166 166 ?   ?   ?   J . n 
K  11 167 GLU 167 167 ?   ?   ?   J . n 
K  11 168 ALA 168 168 ?   ?   ?   J . n 
K  11 169 GLU 169 169 ?   ?   ?   J . n 
K  11 170 LYS 170 170 ?   ?   ?   J . n 
K  11 171 ARG 171 171 ?   ?   ?   J . n 
K  11 172 GLU 172 172 ?   ?   ?   J . n 
K  11 173 GLU 173 173 ?   ?   ?   J . n 
K  11 174 VAL 174 174 ?   ?   ?   J . n 
K  11 175 ALA 175 175 ?   ?   ?   J . n 
K  11 176 ARG 176 176 ?   ?   ?   J . n 
L  12 1   MET 1   1   1   MET MET K . n 
L  12 2   SER 2   2   2   SER SER K . n 
L  12 3   TYR 3   3   3   TYR TYR K . n 
L  12 4   LEU 4   4   4   LEU LEU K . n 
L  12 5   LEU 5   5   5   LEU LEU K . n 
L  12 6   THR 6   6   6   THR THR K . n 
L  12 7   SER 7   7   7   SER SER K . n 
L  12 8   ALA 8   8   8   ALA ALA K . n 
L  12 9   LEU 9   9   9   LEU LEU K . n 
L  12 10  LEU 10  10  10  LEU LEU K . n 
L  12 11  PHE 11  11  11  PHE PHE K . n 
L  12 12  ALA 12  12  12  ALA ALA K . n 
L  12 13  LEU 13  13  13  LEU LEU K . n 
L  12 14  GLY 14  14  14  GLY GLY K . n 
L  12 15  VAL 15  15  15  VAL VAL K . n 
L  12 16  TYR 16  16  16  TYR TYR K . n 
L  12 17  GLY 17  17  17  GLY GLY K . n 
L  12 18  VAL 18  18  18  VAL VAL K . n 
L  12 19  LEU 19  19  19  LEU LEU K . n 
L  12 20  THR 20  20  20  THR THR K . n 
L  12 21  ARG 21  21  21  ARG ARG K . n 
L  12 22  ARG 22  22  22  ARG ARG K . n 
L  12 23  THR 23  23  23  THR THR K . n 
L  12 24  ALA 24  24  24  ALA ALA K . n 
L  12 25  ILE 25  25  25  ILE ILE K . n 
L  12 26  LEU 26  26  26  LEU LEU K . n 
L  12 27  VAL 27  27  27  VAL VAL K . n 
L  12 28  PHE 28  28  28  PHE PHE K . n 
L  12 29  LEU 29  29  29  LEU LEU K . n 
L  12 30  SER 30  30  30  SER SER K . n 
L  12 31  ILE 31  31  31  ILE ILE K . n 
L  12 32  GLU 32  32  32  GLU GLU K . n 
L  12 33  LEU 33  33  33  LEU LEU K . n 
L  12 34  MET 34  34  34  MET MET K . n 
L  12 35  LEU 35  35  35  LEU LEU K . n 
L  12 36  ASN 36  36  36  ASN ASN K . n 
L  12 37  ALA 37  37  37  ALA ALA K . n 
L  12 38  ALA 38  38  38  ALA ALA K . n 
L  12 39  ASN 39  39  39  ASN ASN K . n 
L  12 40  LEU 40  40  40  LEU LEU K . n 
L  12 41  SER 41  41  41  SER SER K . n 
L  12 42  LEU 42  42  42  LEU LEU K . n 
L  12 43  VAL 43  43  43  VAL VAL K . n 
L  12 44  GLY 44  44  44  GLY GLY K . n 
L  12 45  PHE 45  45  45  PHE PHE K . n 
L  12 46  ALA 46  46  46  ALA ALA K . n 
L  12 47  ARG 47  47  47  ARG ARG K . n 
L  12 48  ALA 48  48  48  ALA ALA K . n 
L  12 49  TYR 49  49  49  TYR TYR K . n 
L  12 50  GLY 50  50  50  GLY GLY K . n 
L  12 51  LEU 51  51  51  LEU LEU K . n 
L  12 52  ASP 52  52  52  ASP ASP K . n 
L  12 53  GLY 53  53  53  GLY GLY K . n 
L  12 54  GLN 54  54  54  GLN GLN K . n 
L  12 55  VAL 55  55  55  VAL VAL K . n 
L  12 56  ALA 56  56  56  ALA ALA K . n 
L  12 57  ALA 57  57  57  ALA ALA K . n 
L  12 58  LEU 58  58  58  LEU LEU K . n 
L  12 59  MET 59  59  59  MET MET K . n 
L  12 60  VAL 60  60  60  VAL VAL K . n 
L  12 61  ILE 61  61  61  ILE ILE K . n 
L  12 62  ALA 62  62  62  ALA ALA K . n 
L  12 63  VAL 63  63  63  VAL VAL K . n 
L  12 64  ALA 64  64  64  ALA ALA K . n 
L  12 65  ALA 65  65  65  ALA ALA K . n 
L  12 66  ALA 66  66  66  ALA ALA K . n 
L  12 67  GLU 67  67  67  GLU GLU K . n 
L  12 68  VAL 68  68  68  VAL VAL K . n 
L  12 69  ALA 69  69  69  ALA ALA K . n 
L  12 70  VAL 70  70  70  VAL VAL K . n 
L  12 71  GLY 71  71  71  GLY GLY K . n 
L  12 72  LEU 72  72  72  LEU LEU K . n 
L  12 73  GLY 73  73  73  GLY GLY K . n 
L  12 74  LEU 74  74  74  LEU LEU K . n 
L  12 75  ILE 75  75  75  ILE ILE K . n 
L  12 76  VAL 76  76  76  VAL VAL K . n 
L  12 77  ALA 77  77  77  ALA ALA K . n 
L  12 78  ILE 78  78  78  ILE ILE K . n 
L  12 79  PHE 79  79  79  PHE PHE K . n 
L  12 80  ARG 80  80  80  ARG ARG K . n 
L  12 81  HIS 81  81  81  HIS HIS K . n 
L  12 82  ARG 82  82  82  ARG ARG K . n 
L  12 83  GLU 83  83  83  GLU GLU K . n 
L  12 84  SER 84  84  84  SER SER K . n 
L  12 85  THR 85  85  85  THR THR K . n 
L  12 86  ALA 86  86  86  ALA ALA K . n 
L  12 87  VAL 87  87  87  VAL VAL K . n 
L  12 88  ASP 88  88  88  ASP ASP K . n 
L  12 89  ASP 89  89  89  ASP ASP K . n 
L  12 90  LEU 90  90  90  LEU LEU K . n 
L  12 91  SER 91  91  91  SER SER K . n 
L  12 92  GLU 92  92  92  GLU GLU K . n 
L  12 93  LEU 93  93  93  LEU LEU K . n 
L  12 94  ARG 94  94  94  ARG ARG K . n 
L  12 95  GLY 95  95  95  GLY GLY K . n 
M  13 1   MET 1   1   1   MET MET L . n 
M  13 2   ALA 2   2   2   ALA ALA L . n 
M  13 3   LEU 3   3   3   LEU LEU L . n 
M  13 4   LEU 4   4   4   LEU LEU L . n 
M  13 5   GLY 5   5   5   GLY GLY L . n 
M  13 6   THR 6   6   6   THR THR L . n 
M  13 7   ILE 7   7   7   ILE ILE L . n 
M  13 8   LEU 8   8   8   LEU LEU L . n 
M  13 9   LEU 9   9   9   LEU LEU L . n 
M  13 10  PRO 10  10  10  PRO PRO L . n 
M  13 11  LEU 11  11  11  LEU LEU L . n 
M  13 12  LEU 12  12  12  LEU LEU L . n 
M  13 13  GLY 13  13  13  GLY GLY L . n 
M  13 14  PHE 14  14  14  PHE PHE L . n 
M  13 15  ALA 15  15  15  ALA ALA L . n 
M  13 16  LEU 16  16  16  LEU LEU L . n 
M  13 17  LEU 17  17  17  LEU LEU L . n 
M  13 18  GLY 18  18  18  GLY GLY L . n 
M  13 19  LEU 19  19  19  LEU LEU L . n 
M  13 20  PHE 20  20  20  PHE PHE L . n 
M  13 21  GLY 21  21  21  GLY GLY L . n 
M  13 22  LYS 22  22  22  LYS LYS L . n 
M  13 23  ARG 23  23  23  ARG ARG L . n 
M  13 24  MET 24  24  24  MET MET L . n 
M  13 25  ARG 25  25  25  ARG ARG L . n 
M  13 26  GLU 26  26  26  GLU GLU L . n 
M  13 27  PRO 27  27  27  PRO PRO L . n 
M  13 28  LEU 28  28  28  LEU LEU L . n 
M  13 29  PRO 29  29  29  PRO PRO L . n 
M  13 30  GLY 30  30  30  GLY GLY L . n 
M  13 31  VAL 31  31  31  VAL VAL L . n 
M  13 32  LEU 32  32  32  LEU LEU L . n 
M  13 33  ALA 33  33  33  ALA ALA L . n 
M  13 34  SER 34  34  34  SER SER L . n 
M  13 35  GLY 35  35  35  GLY GLY L . n 
M  13 36  LEU 36  36  36  LEU LEU L . n 
M  13 37  VAL 37  37  37  VAL VAL L . n 
M  13 38  LEU 38  38  38  LEU LEU L . n 
M  13 39  ALA 39  39  39  ALA ALA L . n 
M  13 40  SER 40  40  40  SER SER L . n 
M  13 41  PHE 41  41  41  PHE PHE L . n 
M  13 42  LEU 42  42  42  LEU LEU L . n 
M  13 43  LEU 43  43  43  LEU LEU L . n 
M  13 44  GLY 44  44  44  GLY GLY L . n 
M  13 45  ALA 45  45  45  ALA ALA L . n 
M  13 46  GLY 46  46  46  GLY GLY L . n 
M  13 47  LEU 47  47  47  LEU LEU L . n 
M  13 48  LEU 48  48  48  LEU LEU L . n 
M  13 49  LEU 49  49  49  LEU LEU L . n 
M  13 50  SER 50  50  50  SER SER L . n 
M  13 51  GLY 51  51  51  GLY GLY L . n 
M  13 52  GLY 52  52  52  GLY GLY L . n 
M  13 53  ALA 53  53  53  ALA ALA L . n 
M  13 54  ARG 54  54  54  ARG ARG L . n 
M  13 55  PHE 55  55  55  PHE PHE L . n 
M  13 56  GLN 56  56  56  GLN GLN L . n 
M  13 57  ALA 57  57  57  ALA ALA L . n 
M  13 58  GLU 58  58  58  GLU GLU L . n 
M  13 59  TRP 59  59  59  TRP TRP L . n 
M  13 60  LEU 60  60  60  LEU LEU L . n 
M  13 61  PRO 61  61  61  PRO PRO L . n 
M  13 62  GLY 62  62  62  GLY GLY L . n 
M  13 63  ILE 63  63  63  ILE ILE L . n 
M  13 64  PRO 64  64  64  PRO PRO L . n 
M  13 65  PHE 65  65  65  PHE PHE L . n 
M  13 66  SER 66  66  66  SER SER L . n 
M  13 67  LEU 67  67  67  LEU LEU L . n 
M  13 68  LEU 68  68  68  LEU LEU L . n 
M  13 69  LEU 69  69  69  LEU LEU L . n 
M  13 70  ASP 70  70  70  ASP ASP L . n 
M  13 71  ASN 71  71  71  ASN ASN L . n 
M  13 72  LEU 72  72  72  LEU LEU L . n 
M  13 73  SER 73  73  73  SER SER L . n 
M  13 74  GLY 74  74  74  GLY GLY L . n 
M  13 75  PHE 75  75  75  PHE PHE L . n 
M  13 76  MET 76  76  76  MET MET L . n 
M  13 77  LEU 77  77  77  LEU LEU L . n 
M  13 78  LEU 78  78  78  LEU LEU L . n 
M  13 79  ILE 79  79  79  ILE ILE L . n 
M  13 80  VAL 80  80  80  VAL VAL L . n 
M  13 81  THR 81  81  81  THR THR L . n 
M  13 82  GLY 82  82  82  GLY GLY L . n 
M  13 83  VAL 83  83  83  VAL VAL L . n 
M  13 84  GLY 84  84  84  GLY GLY L . n 
M  13 85  PHE 85  85  85  PHE PHE L . n 
M  13 86  LEU 86  86  86  LEU LEU L . n 
M  13 87  ILE 87  87  87  ILE ILE L . n 
M  13 88  HIS 88  88  88  HIS HIS L . n 
M  13 89  VAL 89  89  89  VAL VAL L . n 
M  13 90  TYR 90  90  90  TYR TYR L . n 
M  13 91  ALA 91  91  91  ALA ALA L . n 
M  13 92  ILE 92  92  92  ILE ILE L . n 
M  13 93  GLY 93  93  93  GLY GLY L . n 
M  13 94  TYR 94  94  94  TYR TYR L . n 
M  13 95  MET 95  95  95  MET MET L . n 
M  13 96  GLY 96  96  96  GLY GLY L . n 
M  13 97  GLY 97  97  97  GLY GLY L . n 
M  13 98  ASP 98  98  98  ASP ASP L . n 
M  13 99  PRO 99  99  99  PRO PRO L . n 
M  13 100 GLY 100 100 100 GLY GLY L . n 
M  13 101 TYR 101 101 101 TYR TYR L . n 
M  13 102 SER 102 102 102 SER SER L . n 
M  13 103 ARG 103 103 103 ARG ARG L . n 
M  13 104 PHE 104 104 104 PHE PHE L . n 
M  13 105 PHE 105 105 105 PHE PHE L . n 
M  13 106 ALA 106 106 106 ALA ALA L . n 
M  13 107 TYR 107 107 107 TYR TYR L . n 
M  13 108 PHE 108 108 108 PHE PHE L . n 
M  13 109 ASN 109 109 109 ASN ASN L . n 
M  13 110 LEU 110 110 110 LEU LEU L . n 
M  13 111 PHE 111 111 111 PHE PHE L . n 
M  13 112 ILE 112 112 112 ILE ILE L . n 
M  13 113 ALA 113 113 113 ALA ALA L . n 
M  13 114 MET 114 114 114 MET MET L . n 
M  13 115 MET 115 115 115 MET MET L . n 
M  13 116 LEU 116 116 116 LEU LEU L . n 
M  13 117 THR 117 117 117 THR THR L . n 
M  13 118 LEU 118 118 118 LEU LEU L . n 
M  13 119 VAL 119 119 119 VAL VAL L . n 
M  13 120 LEU 120 120 120 LEU LEU L . n 
M  13 121 ALA 121 121 121 ALA ALA L . n 
M  13 122 ASP 122 122 122 ASP ASP L . n 
M  13 123 SER 123 123 123 SER SER L . n 
M  13 124 TYR 124 124 124 TYR TYR L . n 
M  13 125 PRO 125 125 125 PRO PRO L . n 
M  13 126 VAL 126 126 126 VAL VAL L . n 
M  13 127 MET 127 127 127 MET MET L . n 
M  13 128 PHE 128 128 128 PHE PHE L . n 
M  13 129 ILE 129 129 129 ILE ILE L . n 
M  13 130 GLY 130 130 130 GLY GLY L . n 
M  13 131 TRP 131 131 131 TRP TRP L . n 
M  13 132 GLU 132 132 132 GLU GLU L . n 
M  13 133 GLY 133 133 133 GLY GLY L . n 
M  13 134 VAL 134 134 134 VAL VAL L . n 
M  13 135 GLY 135 135 135 GLY GLY L . n 
M  13 136 LEU 136 136 136 LEU LEU L . n 
M  13 137 ALA 137 137 137 ALA ALA L . n 
M  13 138 SER 138 138 138 SER SER L . n 
M  13 139 PHE 139 139 139 PHE PHE L . n 
M  13 140 LEU 140 140 140 LEU LEU L . n 
M  13 141 LEU 141 141 141 LEU LEU L . n 
M  13 142 ILE 142 142 142 ILE ILE L . n 
M  13 143 GLY 143 143 143 GLY GLY L . n 
M  13 144 PHE 144 144 144 PHE PHE L . n 
M  13 145 TRP 145 145 145 TRP TRP L . n 
M  13 146 TYR 146 146 146 TYR TYR L . n 
M  13 147 LYS 147 147 147 LYS LYS L . n 
M  13 148 ASN 148 148 148 ASN ASN L . n 
M  13 149 PRO 149 149 149 PRO PRO L . n 
M  13 150 GLN 150 150 150 GLN GLN L . n 
M  13 151 TYR 151 151 151 TYR TYR L . n 
M  13 152 ALA 152 152 152 ALA ALA L . n 
M  13 153 ASP 153 153 153 ASP ASP L . n 
M  13 154 SER 154 154 154 SER SER L . n 
M  13 155 ALA 155 155 155 ALA ALA L . n 
M  13 156 ARG 156 156 156 ARG ARG L . n 
M  13 157 LYS 157 157 157 LYS LYS L . n 
M  13 158 ALA 158 158 158 ALA ALA L . n 
M  13 159 PHE 159 159 159 PHE PHE L . n 
M  13 160 ILE 160 160 160 ILE ILE L . n 
M  13 161 VAL 161 161 161 VAL VAL L . n 
M  13 162 ASN 162 162 162 ASN ASN L . n 
M  13 163 ARG 163 163 163 ARG ARG L . n 
M  13 164 ILE 164 164 164 ILE ILE L . n 
M  13 165 GLY 165 165 165 GLY GLY L . n 
M  13 166 ASP 166 166 166 ASP ASP L . n 
M  13 167 LEU 167 167 167 LEU LEU L . n 
M  13 168 GLY 168 168 168 GLY GLY L . n 
M  13 169 PHE 169 169 169 PHE PHE L . n 
M  13 170 MET 170 170 170 MET MET L . n 
M  13 171 LEU 171 171 171 LEU LEU L . n 
M  13 172 GLY 172 172 172 GLY GLY L . n 
M  13 173 MET 173 173 173 MET MET L . n 
M  13 174 ALA 174 174 174 ALA ALA L . n 
M  13 175 ILE 175 175 175 ILE ILE L . n 
M  13 176 LEU 176 176 176 LEU LEU L . n 
M  13 177 TRP 177 177 177 TRP TRP L . n 
M  13 178 ALA 178 178 178 ALA ALA L . n 
M  13 179 LEU 179 179 179 LEU LEU L . n 
M  13 180 TYR 180 180 180 TYR TYR L . n 
M  13 181 GLY 181 181 181 GLY GLY L . n 
M  13 182 THR 182 182 182 THR THR L . n 
M  13 183 LEU 183 183 183 LEU LEU L . n 
M  13 184 SER 184 184 184 SER SER L . n 
M  13 185 ILE 185 185 185 ILE ILE L . n 
M  13 186 SER 186 186 186 SER SER L . n 
M  13 187 GLU 187 187 187 GLU GLU L . n 
M  13 188 LEU 188 188 188 LEU LEU L . n 
M  13 189 LYS 189 189 189 LYS LYS L . n 
M  13 190 GLU 190 190 190 GLU GLU L . n 
M  13 191 ALA 191 191 191 ALA ALA L . n 
M  13 192 MET 192 192 192 MET MET L . n 
M  13 193 GLU 193 193 193 GLU GLU L . n 
M  13 194 GLY 194 194 194 GLY GLY L . n 
M  13 195 PRO 195 195 195 PRO PRO L . n 
M  13 196 LEU 196 196 196 LEU LEU L . n 
M  13 197 LYS 197 197 197 LYS LYS L . n 
M  13 198 ASN 198 198 198 ASN ASN L . n 
M  13 199 PRO 199 199 199 PRO PRO L . n 
M  13 200 ASP 200 200 200 ASP ASP L . n 
M  13 201 LEU 201 201 201 LEU LEU L . n 
M  13 202 LEU 202 202 202 LEU LEU L . n 
M  13 203 ALA 203 203 203 ALA ALA L . n 
M  13 204 LEU 204 204 204 LEU LEU L . n 
M  13 205 ALA 205 205 205 ALA ALA L . n 
M  13 206 GLY 206 206 206 GLY GLY L . n 
M  13 207 LEU 207 207 207 LEU LEU L . n 
M  13 208 LEU 208 208 208 LEU LEU L . n 
M  13 209 LEU 209 209 209 LEU LEU L . n 
M  13 210 PHE 210 210 210 PHE PHE L . n 
M  13 211 LEU 211 211 211 LEU LEU L . n 
M  13 212 GLY 212 212 212 GLY GLY L . n 
M  13 213 ALA 213 213 213 ALA ALA L . n 
M  13 214 VAL 214 214 214 VAL VAL L . n 
M  13 215 GLY 215 215 215 GLY GLY L . n 
M  13 216 LYS 216 216 216 LYS LYS L . n 
M  13 217 SER 217 217 217 SER SER L . n 
M  13 218 ALA 218 218 218 ALA ALA L . n 
M  13 219 GLN 219 219 219 GLN GLN L . n 
M  13 220 ILE 220 220 220 ILE ILE L . n 
M  13 221 PRO 221 221 221 PRO PRO L . n 
M  13 222 LEU 222 222 222 LEU LEU L . n 
M  13 223 MET 223 223 223 MET MET L . n 
M  13 224 VAL 224 224 224 VAL VAL L . n 
M  13 225 TRP 225 225 225 TRP TRP L . n 
M  13 226 LEU 226 226 226 LEU LEU L . n 
M  13 227 PRO 227 227 227 PRO PRO L . n 
M  13 228 ASP 228 228 228 ASP ASP L . n 
M  13 229 ALA 229 229 229 ALA ALA L . n 
M  13 230 MET 230 230 230 MET MET L . n 
M  13 231 ALA 231 231 231 ALA ALA L . n 
M  13 232 GLY 232 232 232 GLY GLY L . n 
M  13 233 PRO 233 233 233 PRO PRO L . n 
M  13 234 THR 234 234 234 THR THR L . n 
M  13 235 PRO 235 235 235 PRO PRO L . n 
M  13 236 VAL 236 236 236 VAL VAL L . n 
M  13 237 SER 237 237 237 SER SER L . n 
M  13 238 ALA 238 238 238 ALA ALA L . n 
M  13 239 LEU 239 239 239 LEU LEU L . n 
M  13 240 ILE 240 240 240 ILE ILE L . n 
M  13 241 HIS 241 241 241 HIS HIS L . n 
M  13 242 ALA 242 242 242 ALA ALA L . n 
M  13 243 ALA 243 243 243 ALA ALA L . n 
M  13 244 THR 244 244 244 THR THR L . n 
M  13 245 MET 245 245 245 MET MET L . n 
M  13 246 VAL 246 246 246 VAL VAL L . n 
M  13 247 THR 247 247 247 THR THR L . n 
M  13 248 ALA 248 248 248 ALA ALA L . n 
M  13 249 GLY 249 249 249 GLY GLY L . n 
M  13 250 VAL 250 250 250 VAL VAL L . n 
M  13 251 TYR 251 251 251 TYR TYR L . n 
M  13 252 LEU 252 252 252 LEU LEU L . n 
M  13 253 ILE 253 253 253 ILE ILE L . n 
M  13 254 ALA 254 254 254 ALA ALA L . n 
M  13 255 ARG 255 255 255 ARG ARG L . n 
M  13 256 SER 256 256 256 SER SER L . n 
M  13 257 SER 257 257 257 SER SER L . n 
M  13 258 PHE 258 258 258 PHE PHE L . n 
M  13 259 LEU 259 259 259 LEU LEU L . n 
M  13 260 TYR 260 260 260 TYR TYR L . n 
M  13 261 SER 261 261 261 SER SER L . n 
M  13 262 VAL 262 262 262 VAL VAL L . n 
M  13 263 LEU 263 263 263 LEU LEU L . n 
M  13 264 PRO 264 264 264 PRO PRO L . n 
M  13 265 ASP 265 265 265 ASP ASP L . n 
M  13 266 VAL 266 266 266 VAL VAL L . n 
M  13 267 SER 267 267 267 SER SER L . n 
M  13 268 TYR 268 268 268 TYR TYR L . n 
M  13 269 ALA 269 269 269 ALA ALA L . n 
M  13 270 ILE 270 270 270 ILE ILE L . n 
M  13 271 ALA 271 271 271 ALA ALA L . n 
M  13 272 VAL 272 272 272 VAL VAL L . n 
M  13 273 VAL 273 273 273 VAL VAL L . n 
M  13 274 GLY 274 274 274 GLY GLY L . n 
M  13 275 LEU 275 275 275 LEU LEU L . n 
M  13 276 LEU 276 276 276 LEU LEU L . n 
M  13 277 THR 277 277 277 THR THR L . n 
M  13 278 ALA 278 278 278 ALA ALA L . n 
M  13 279 ALA 279 279 279 ALA ALA L . n 
M  13 280 TYR 280 280 280 TYR TYR L . n 
M  13 281 GLY 281 281 281 GLY GLY L . n 
M  13 282 ALA 282 282 282 ALA ALA L . n 
M  13 283 LEU 283 283 283 LEU LEU L . n 
M  13 284 SER 284 284 284 SER SER L . n 
M  13 285 ALA 285 285 285 ALA ALA L . n 
M  13 286 PHE 286 286 286 PHE PHE L . n 
M  13 287 GLY 287 287 287 GLY GLY L . n 
M  13 288 GLN 288 288 288 GLN GLN L . n 
M  13 289 THR 289 289 289 THR THR L . n 
M  13 290 ASP 290 290 290 ASP ASP L . n 
M  13 291 ILE 291 291 291 ILE ILE L . n 
M  13 292 LYS 292 292 292 LYS LYS L . n 
M  13 293 LYS 293 293 293 LYS LYS L . n 
M  13 294 ILE 294 294 294 ILE ILE L . n 
M  13 295 VAL 295 295 295 VAL VAL L . n 
M  13 296 ALA 296 296 296 ALA ALA L . n 
M  13 297 TYR 297 297 297 TYR TYR L . n 
M  13 298 SER 298 298 298 SER SER L . n 
M  13 299 THR 299 299 299 THR THR L . n 
M  13 300 ILE 300 300 300 ILE ILE L . n 
M  13 301 SER 301 301 301 SER SER L . n 
M  13 302 GLN 302 302 302 GLN GLN L . n 
M  13 303 LEU 303 303 303 LEU LEU L . n 
M  13 304 GLY 304 304 304 GLY GLY L . n 
M  13 305 TYR 305 305 305 TYR TYR L . n 
M  13 306 MET 306 306 306 MET MET L . n 
M  13 307 PHE 307 307 307 PHE PHE L . n 
M  13 308 LEU 308 308 308 LEU LEU L . n 
M  13 309 ALA 309 309 309 ALA ALA L . n 
M  13 310 ALA 310 310 310 ALA ALA L . n 
M  13 311 GLY 311 311 311 GLY GLY L . n 
M  13 312 VAL 312 312 312 VAL VAL L . n 
M  13 313 GLY 313 313 313 GLY GLY L . n 
M  13 314 ALA 314 314 314 ALA ALA L . n 
M  13 315 TYR 315 315 315 TYR TYR L . n 
M  13 316 TRP 316 316 316 TRP TRP L . n 
M  13 317 VAL 317 317 317 VAL VAL L . n 
M  13 318 ALA 318 318 318 ALA ALA L . n 
M  13 319 LEU 319 319 319 LEU LEU L . n 
M  13 320 PHE 320 320 320 PHE PHE L . n 
M  13 321 HIS 321 321 321 HIS HIS L . n 
M  13 322 VAL 322 322 322 VAL VAL L . n 
M  13 323 PHE 323 323 323 PHE PHE L . n 
M  13 324 THR 324 324 324 THR THR L . n 
M  13 325 HIS 325 325 325 HIS HIS L . n 
M  13 326 ALA 326 326 326 ALA ALA L . n 
M  13 327 PHE 327 327 327 PHE PHE L . n 
M  13 328 PHE 328 328 328 PHE PHE L . n 
M  13 329 LYS 329 329 329 LYS LYS L . n 
M  13 330 ALA 330 330 330 ALA ALA L . n 
M  13 331 LEU 331 331 331 LEU LEU L . n 
M  13 332 LEU 332 332 332 LEU LEU L . n 
M  13 333 PHE 333 333 333 PHE PHE L . n 
M  13 334 LEU 334 334 334 LEU LEU L . n 
M  13 335 ALA 335 335 335 ALA ALA L . n 
M  13 336 SER 336 336 336 SER SER L . n 
M  13 337 GLY 337 337 337 GLY GLY L . n 
M  13 338 SER 338 338 338 SER SER L . n 
M  13 339 VAL 339 339 339 VAL VAL L . n 
M  13 340 ILE 340 340 340 ILE ILE L . n 
M  13 341 HIS 341 341 341 HIS HIS L . n 
M  13 342 ALA 342 342 342 ALA ALA L . n 
M  13 343 LEU 343 343 343 LEU LEU L . n 
M  13 344 GLY 344 344 344 GLY GLY L . n 
M  13 345 GLY 345 345 345 GLY GLY L . n 
M  13 346 GLU 346 346 346 GLU GLU L . n 
M  13 347 GLN 347 347 347 GLN GLN L . n 
M  13 348 ASP 348 348 348 ASP ASP L . n 
M  13 349 VAL 349 349 349 VAL VAL L . n 
M  13 350 ARG 350 350 350 ARG ARG L . n 
M  13 351 LYS 351 351 351 LYS LYS L . n 
M  13 352 MET 352 352 352 MET MET L . n 
M  13 353 GLY 353 353 353 GLY GLY L . n 
M  13 354 GLY 354 354 354 GLY GLY L . n 
M  13 355 LEU 355 355 355 LEU LEU L . n 
M  13 356 TRP 356 356 356 TRP TRP L . n 
M  13 357 LYS 357 357 357 LYS LYS L . n 
M  13 358 HIS 358 358 358 HIS HIS L . n 
M  13 359 LEU 359 359 359 LEU LEU L . n 
M  13 360 PRO 360 360 360 PRO PRO L . n 
M  13 361 GLN 361 361 361 GLN GLN L . n 
M  13 362 THR 362 362 362 THR THR L . n 
M  13 363 ARG 363 363 363 ARG ARG L . n 
M  13 364 TRP 364 364 364 TRP TRP L . n 
M  13 365 HIS 365 365 365 HIS HIS L . n 
M  13 366 ALA 366 366 366 ALA ALA L . n 
M  13 367 LEU 367 367 367 LEU LEU L . n 
M  13 368 ILE 368 368 368 ILE ILE L . n 
M  13 369 GLY 369 369 369 GLY GLY L . n 
M  13 370 ALA 370 370 370 ALA ALA L . n 
M  13 371 LEU 371 371 371 LEU LEU L . n 
M  13 372 ALA 372 372 372 ALA ALA L . n 
M  13 373 LEU 373 373 373 LEU LEU L . n 
M  13 374 GLY 374 374 374 GLY GLY L . n 
M  13 375 GLY 375 375 375 GLY GLY L . n 
M  13 376 LEU 376 376 376 LEU LEU L . n 
M  13 377 PRO 377 377 377 PRO PRO L . n 
M  13 378 LEU 378 378 378 LEU LEU L . n 
M  13 379 LEU 379 379 379 LEU LEU L . n 
M  13 380 SER 380 380 380 SER SER L . n 
M  13 381 GLY 381 381 381 GLY GLY L . n 
M  13 382 PHE 382 382 382 PHE PHE L . n 
M  13 383 TRP 383 383 383 TRP TRP L . n 
M  13 384 SER 384 384 384 SER SER L . n 
M  13 385 LYS 385 385 385 LYS LYS L . n 
M  13 386 ASP 386 386 386 ASP ASP L . n 
M  13 387 ALA 387 387 387 ALA ALA L . n 
M  13 388 ILE 388 388 388 ILE ILE L . n 
M  13 389 LEU 389 389 389 LEU LEU L . n 
M  13 390 ALA 390 390 390 ALA ALA L . n 
M  13 391 ALA 391 391 391 ALA ALA L . n 
M  13 392 THR 392 392 392 THR THR L . n 
M  13 393 LEU 393 393 393 LEU LEU L . n 
M  13 394 THR 394 394 394 THR THR L . n 
M  13 395 TYR 395 395 395 TYR TYR L . n 
M  13 396 PRO 396 396 396 PRO PRO L . n 
M  13 397 PHE 397 397 397 PHE PHE L . n 
M  13 398 GLY 398 398 398 GLY GLY L . n 
M  13 399 GLY 399 399 399 GLY GLY L . n 
M  13 400 VAL 400 400 400 VAL VAL L . n 
M  13 401 GLY 401 401 401 GLY GLY L . n 
M  13 402 PHE 402 402 402 PHE PHE L . n 
M  13 403 TYR 403 403 403 TYR TYR L . n 
M  13 404 VAL 404 404 404 VAL VAL L . n 
M  13 405 GLY 405 405 405 GLY GLY L . n 
M  13 406 ALA 406 406 406 ALA ALA L . n 
M  13 407 LEU 407 407 407 LEU LEU L . n 
M  13 408 LEU 408 408 408 LEU LEU L . n 
M  13 409 VAL 409 409 409 VAL VAL L . n 
M  13 410 ALA 410 410 410 ALA ALA L . n 
M  13 411 VAL 411 411 411 VAL VAL L . n 
M  13 412 LEU 412 412 412 LEU LEU L . n 
M  13 413 THR 413 413 413 THR THR L . n 
M  13 414 ALA 414 414 414 ALA ALA L . n 
M  13 415 MET 415 415 415 MET MET L . n 
M  13 416 TYR 416 416 416 TYR TYR L . n 
M  13 417 ALA 417 417 417 ALA ALA L . n 
M  13 418 MET 418 418 418 MET MET L . n 
M  13 419 ARG 419 419 419 ARG ARG L . n 
M  13 420 TRP 420 420 420 TRP TRP L . n 
M  13 421 PHE 421 421 421 PHE PHE L . n 
M  13 422 VAL 422 422 422 VAL VAL L . n 
M  13 423 LEU 423 423 423 LEU LEU L . n 
M  13 424 VAL 424 424 424 VAL VAL L . n 
M  13 425 PHE 425 425 425 PHE PHE L . n 
M  13 426 LEU 426 426 426 LEU LEU L . n 
M  13 427 GLY 427 427 427 GLY GLY L . n 
M  13 428 GLU 428 428 428 GLU GLU L . n 
M  13 429 GLU 429 429 429 GLU GLU L . n 
M  13 430 ARG 430 430 430 ARG ARG L . n 
M  13 431 GLY 431 431 431 GLY GLY L . n 
M  13 432 HIS 432 432 432 HIS HIS L . n 
M  13 433 HIS 433 433 433 HIS HIS L . n 
M  13 434 HIS 434 434 434 HIS HIS L . n 
M  13 435 PRO 435 435 435 PRO PRO L . n 
M  13 436 HIS 436 436 436 HIS HIS L . n 
M  13 437 GLU 437 437 437 GLU GLU L . n 
M  13 438 ALA 438 438 438 ALA ALA L . n 
M  13 439 PRO 439 439 439 PRO PRO L . n 
M  13 440 PRO 440 440 440 PRO PRO L . n 
M  13 441 VAL 441 441 441 VAL VAL L . n 
M  13 442 MET 442 442 442 MET MET L . n 
M  13 443 LEU 443 443 443 LEU LEU L . n 
M  13 444 TRP 444 444 444 TRP TRP L . n 
M  13 445 PRO 445 445 445 PRO PRO L . n 
M  13 446 ASN 446 446 446 ASN ASN L . n 
M  13 447 HIS 447 447 447 HIS HIS L . n 
M  13 448 LEU 448 448 448 LEU LEU L . n 
M  13 449 LEU 449 449 449 LEU LEU L . n 
M  13 450 ALA 450 450 450 ALA ALA L . n 
M  13 451 LEU 451 451 451 LEU LEU L . n 
M  13 452 GLY 452 452 452 GLY GLY L . n 
M  13 453 SER 453 453 453 SER SER L . n 
M  13 454 VAL 454 454 454 VAL VAL L . n 
M  13 455 LEU 455 455 455 LEU LEU L . n 
M  13 456 ALA 456 456 456 ALA ALA L . n 
M  13 457 GLY 457 457 457 GLY GLY L . n 
M  13 458 TYR 458 458 458 TYR TYR L . n 
M  13 459 LEU 459 459 459 LEU LEU L . n 
M  13 460 ALA 460 460 460 ALA ALA L . n 
M  13 461 LEU 461 461 461 LEU LEU L . n 
M  13 462 PRO 462 462 462 PRO PRO L . n 
M  13 463 HIS 463 463 463 HIS HIS L . n 
M  13 464 PRO 464 464 464 PRO PRO L . n 
M  13 465 LEU 465 465 465 LEU LEU L . n 
M  13 466 PRO 466 466 466 PRO PRO L . n 
M  13 467 ASN 467 467 467 ASN ASN L . n 
M  13 468 VAL 468 468 468 VAL VAL L . n 
M  13 469 LEU 469 469 469 LEU LEU L . n 
M  13 470 GLU 470 470 470 GLU GLU L . n 
M  13 471 PRO 471 471 471 PRO PRO L . n 
M  13 472 PHE 472 472 472 PHE PHE L . n 
M  13 473 LEU 473 473 473 LEU LEU L . n 
M  13 474 LYS 474 474 474 LYS LYS L . n 
M  13 475 PRO 475 475 475 PRO PRO L . n 
M  13 476 ALA 476 476 476 ALA ALA L . n 
M  13 477 LEU 477 477 477 LEU LEU L . n 
M  13 478 ALA 478 478 478 ALA ALA L . n 
M  13 479 GLU 479 479 479 GLU GLU L . n 
M  13 480 VAL 480 480 480 VAL VAL L . n 
M  13 481 GLU 481 481 481 GLU GLU L . n 
M  13 482 ALA 482 482 482 ALA ALA L . n 
M  13 483 HIS 483 483 483 HIS HIS L . n 
M  13 484 HIS 484 484 484 HIS HIS L . n 
M  13 485 LEU 485 485 485 LEU LEU L . n 
M  13 486 SER 486 486 486 SER SER L . n 
M  13 487 LEU 487 487 487 LEU LEU L . n 
M  13 488 GLY 488 488 488 GLY GLY L . n 
M  13 489 ALA 489 489 489 ALA ALA L . n 
M  13 490 GLU 490 490 490 GLU GLU L . n 
M  13 491 TRP 491 491 491 TRP TRP L . n 
M  13 492 GLY 492 492 492 GLY GLY L . n 
M  13 493 LEU 493 493 493 LEU LEU L . n 
M  13 494 ILE 494 494 494 ILE ILE L . n 
M  13 495 ALA 495 495 495 ALA ALA L . n 
M  13 496 LEU 496 496 496 LEU LEU L . n 
M  13 497 SER 497 497 497 SER SER L . n 
M  13 498 ALA 498 498 498 ALA ALA L . n 
M  13 499 ALA 499 499 499 ALA ALA L . n 
M  13 500 VAL 500 500 500 VAL VAL L . n 
M  13 501 ALA 501 501 501 ALA ALA L . n 
M  13 502 LEU 502 502 502 LEU LEU L . n 
M  13 503 LEU 503 503 503 LEU LEU L . n 
M  13 504 GLY 504 504 504 GLY GLY L . n 
M  13 505 LEU 505 505 505 LEU LEU L . n 
M  13 506 TRP 506 506 506 TRP TRP L . n 
M  13 507 ALA 507 507 507 ALA ALA L . n 
M  13 508 GLY 508 508 508 GLY GLY L . n 
M  13 509 PHE 509 509 509 PHE PHE L . n 
M  13 510 VAL 510 510 510 VAL VAL L . n 
M  13 511 PHE 511 511 511 PHE PHE L . n 
M  13 512 PHE 512 512 512 PHE PHE L . n 
M  13 513 GLN 513 513 513 GLN GLN L . n 
M  13 514 ARG 514 514 514 ARG ARG L . n 
M  13 515 LYS 515 515 515 LYS LYS L . n 
M  13 516 VAL 516 516 516 VAL VAL L . n 
M  13 517 PHE 517 517 517 PHE PHE L . n 
M  13 518 PRO 518 518 518 PRO PRO L . n 
M  13 519 ALA 519 519 519 ALA ALA L . n 
M  13 520 TRP 520 520 520 TRP TRP L . n 
M  13 521 TYR 521 521 521 TYR TYR L . n 
M  13 522 LEU 522 522 522 LEU LEU L . n 
M  13 523 ALA 523 523 523 ALA ALA L . n 
M  13 524 PHE 524 524 524 PHE PHE L . n 
M  13 525 GLU 525 525 525 GLU GLU L . n 
M  13 526 ALA 526 526 526 ALA ALA L . n 
M  13 527 ALA 527 527 527 ALA ALA L . n 
M  13 528 SER 528 528 528 SER SER L . n 
M  13 529 ARG 529 529 529 ARG ARG L . n 
M  13 530 GLU 530 530 530 GLU GLU L . n 
M  13 531 ALA 531 531 531 ALA ALA L . n 
M  13 532 PHE 532 532 532 PHE PHE L . n 
M  13 533 TYR 533 533 533 TYR TYR L . n 
M  13 534 VAL 534 534 534 VAL VAL L . n 
M  13 535 ASP 535 535 535 ASP ASP L . n 
M  13 536 ARG 536 536 536 ARG ARG L . n 
M  13 537 ALA 537 537 537 ALA ALA L . n 
M  13 538 TYR 538 538 538 TYR TYR L . n 
M  13 539 ASN 539 539 539 ASN ASN L . n 
M  13 540 ALA 540 540 540 ALA ALA L . n 
M  13 541 LEU 541 541 541 LEU LEU L . n 
M  13 542 ILE 542 542 542 ILE ILE L . n 
M  13 543 VAL 543 543 543 VAL VAL L . n 
M  13 544 ASN 544 544 544 ASN ASN L . n 
M  13 545 PRO 545 545 545 PRO PRO L . n 
M  13 546 LEU 546 546 546 LEU LEU L . n 
M  13 547 LYS 547 547 547 LYS LYS L . n 
M  13 548 ALA 548 548 548 ALA ALA L . n 
M  13 549 LEU 549 549 549 LEU LEU L . n 
M  13 550 ALA 550 550 550 ALA ALA L . n 
M  13 551 GLU 551 551 551 GLU GLU L . n 
M  13 552 ALA 552 552 552 ALA ALA L . n 
M  13 553 LEU 553 553 553 LEU LEU L . n 
M  13 554 PHE 554 554 554 PHE PHE L . n 
M  13 555 TYR 555 555 555 TYR TYR L . n 
M  13 556 GLY 556 556 556 GLY GLY L . n 
M  13 557 ASP 557 557 557 ASP ASP L . n 
M  13 558 ARG 558 558 558 ARG ARG L . n 
M  13 559 GLY 559 559 559 GLY GLY L . n 
M  13 560 LEU 560 560 560 LEU LEU L . n 
M  13 561 LEU 561 561 561 LEU LEU L . n 
M  13 562 SER 562 562 562 SER SER L . n 
M  13 563 GLY 563 563 563 GLY GLY L . n 
M  13 564 TYR 564 564 564 TYR TYR L . n 
M  13 565 PHE 565 565 565 PHE PHE L . n 
M  13 566 GLY 566 566 566 GLY GLY L . n 
M  13 567 LEU 567 567 567 LEU LEU L . n 
M  13 568 GLY 568 568 568 GLY GLY L . n 
M  13 569 GLY 569 569 569 GLY GLY L . n 
M  13 570 ALA 570 570 570 ALA ALA L . n 
M  13 571 ALA 571 571 571 ALA ALA L . n 
M  13 572 ARG 572 572 572 ARG ARG L . n 
M  13 573 SER 573 573 573 SER SER L . n 
M  13 574 LEU 574 574 574 LEU LEU L . n 
M  13 575 GLY 575 575 575 GLY GLY L . n 
M  13 576 GLN 576 576 576 GLN GLN L . n 
M  13 577 GLY 577 577 577 GLY GLY L . n 
M  13 578 LEU 578 578 578 LEU LEU L . n 
M  13 579 ALA 579 579 579 ALA ALA L . n 
M  13 580 ARG 580 580 580 ARG ARG L . n 
M  13 581 LEU 581 581 581 LEU LEU L . n 
M  13 582 GLN 582 582 582 GLN GLN L . n 
M  13 583 THR 583 583 583 THR THR L . n 
M  13 584 GLY 584 584 584 GLY GLY L . n 
M  13 585 TYR 585 585 585 TYR TYR L . n 
M  13 586 LEU 586 586 586 LEU LEU L . n 
M  13 587 ARG 587 587 587 ARG ARG L . n 
M  13 588 VAL 588 588 588 VAL VAL L . n 
M  13 589 TYR 589 589 589 TYR TYR L . n 
M  13 590 ALA 590 590 590 ALA ALA L . n 
M  13 591 LEU 591 591 591 LEU LEU L . n 
M  13 592 LEU 592 592 592 LEU LEU L . n 
M  13 593 PHE 593 593 593 PHE PHE L . n 
M  13 594 VAL 594 594 594 VAL VAL L . n 
M  13 595 LEU 595 595 595 LEU LEU L . n 
M  13 596 GLY 596 596 596 GLY GLY L . n 
M  13 597 ALA 597 597 597 ALA ALA L . n 
M  13 598 LEU 598 598 598 LEU LEU L . n 
M  13 599 LEU 599 599 599 LEU LEU L . n 
M  13 600 LEU 600 600 600 LEU LEU L . n 
M  13 601 LEU 601 601 601 LEU LEU L . n 
M  13 602 GLY 602 602 602 GLY GLY L . n 
M  13 603 VAL 603 603 603 VAL VAL L . n 
M  13 604 MET 604 604 604 MET MET L . n 
M  13 605 ARG 605 605 605 ARG ARG L . n 
M  13 606 TRP 606 606 ?   ?   ?   L . n 
N  14 1   MET 1   1   1   MET MET M . n 
N  14 2   VAL 2   2   2   VAL VAL M . n 
N  14 3   VAL 3   3   3   VAL VAL M . n 
N  14 4   LEU 4   4   4   LEU LEU M . n 
N  14 5   ALA 5   5   5   ALA ALA M . n 
N  14 6   VAL 6   6   6   VAL VAL M . n 
N  14 7   LEU 7   7   7   LEU LEU M . n 
N  14 8   LEU 8   8   8   LEU LEU M . n 
N  14 9   PRO 9   9   9   PRO PRO M . n 
N  14 10  VAL 10  10  10  VAL VAL M . n 
N  14 11  VAL 11  11  11  VAL VAL M . n 
N  14 12  PHE 12  12  12  PHE PHE M . n 
N  14 13  GLY 13  13  13  GLY GLY M . n 
N  14 14  ALA 14  14  14  ALA ALA M . n 
N  14 15  LEU 15  15  15  LEU LEU M . n 
N  14 16  LEU 16  16  16  LEU LEU M . n 
N  14 17  LEU 17  17  17  LEU LEU M . n 
N  14 18  LEU 18  18  18  LEU LEU M . n 
N  14 19  GLY 19  19  19  GLY GLY M . n 
N  14 20  LEU 20  20  20  LEU LEU M . n 
N  14 21  PRO 21  21  21  PRO PRO M . n 
N  14 22  ARG 22  22  22  ARG ARG M . n 
N  14 23  ALA 23  23  23  ALA ALA M . n 
N  14 24  LEU 24  24  24  LEU LEU M . n 
N  14 25  GLY 25  25  25  GLY GLY M . n 
N  14 26  VAL 26  26  26  VAL VAL M . n 
N  14 27  LEU 27  27  27  LEU LEU M . n 
N  14 28  GLY 28  28  28  GLY GLY M . n 
N  14 29  ALA 29  29  29  ALA ALA M . n 
N  14 30  GLY 30  30  30  GLY GLY M . n 
N  14 31  LEU 31  31  31  LEU LEU M . n 
N  14 32  SER 32  32  32  SER SER M . n 
N  14 33  PHE 33  33  33  PHE PHE M . n 
N  14 34  LEU 34  34  34  LEU LEU M . n 
N  14 35  LEU 35  35  35  LEU LEU M . n 
N  14 36  ASN 36  36  36  ASN ASN M . n 
N  14 37  LEU 37  37  37  LEU LEU M . n 
N  14 38  TYR 38  38  38  TYR TYR M . n 
N  14 39  LEU 39  39  39  LEU LEU M . n 
N  14 40  PHE 40  40  40  PHE PHE M . n 
N  14 41  LEU 41  41  41  LEU LEU M . n 
N  14 42  THR 42  42  42  THR THR M . n 
N  14 43  HIS 43  43  43  HIS HIS M . n 
N  14 44  PRO 44  44  44  PRO PRO M . n 
N  14 45  GLY 45  45  45  GLY GLY M . n 
N  14 46  GLY 46  46  46  GLY GLY M . n 
N  14 47  VAL 47  47  47  VAL VAL M . n 
N  14 48  ALA 48  48  48  ALA ALA M . n 
N  14 49  HIS 49  49  49  HIS HIS M . n 
N  14 50  ALA 50  50  50  ALA ALA M . n 
N  14 51  PHE 51  51  51  PHE PHE M . n 
N  14 52  GLN 52  52  52  GLN GLN M . n 
N  14 53  ALA 53  53  53  ALA ALA M . n 
N  14 54  PRO 54  54  54  PRO PRO M . n 
N  14 55  LEU 55  55  55  LEU LEU M . n 
N  14 56  LEU 56  56  56  LEU LEU M . n 
N  14 57  PRO 57  57  57  PRO PRO M . n 
N  14 58  GLY 58  58  58  GLY GLY M . n 
N  14 59  ALA 59  59  59  ALA ALA M . n 
N  14 60  GLY 60  60  60  GLY GLY M . n 
N  14 61  VAL 61  61  61  VAL VAL M . n 
N  14 62  TYR 62  62  62  TYR TYR M . n 
N  14 63  TRP 63  63  63  TRP TRP M . n 
N  14 64  ALA 64  64  64  ALA ALA M . n 
N  14 65  PHE 65  65  65  PHE PHE M . n 
N  14 66  GLY 66  66  66  GLY GLY M . n 
N  14 67  LEU 67  67  67  LEU LEU M . n 
N  14 68  ASP 68  68  68  ASP ASP M . n 
N  14 69  GLY 69  69  69  GLY GLY M . n 
N  14 70  LEU 70  70  70  LEU LEU M . n 
N  14 71  SER 71  71  71  SER SER M . n 
N  14 72  ALA 72  72  72  ALA ALA M . n 
N  14 73  LEU 73  73  73  LEU LEU M . n 
N  14 74  PHE 74  74  74  PHE PHE M . n 
N  14 75  PHE 75  75  75  PHE PHE M . n 
N  14 76  LEU 76  76  76  LEU LEU M . n 
N  14 77  THR 77  77  77  THR THR M . n 
N  14 78  ILE 78  78  78  ILE ILE M . n 
N  14 79  ALA 79  79  79  ALA ALA M . n 
N  14 80  LEU 80  80  80  LEU LEU M . n 
N  14 81  THR 81  81  81  THR THR M . n 
N  14 82  VAL 82  82  82  VAL VAL M . n 
N  14 83  PHE 83  83  83  PHE PHE M . n 
N  14 84  LEU 84  84  84  LEU LEU M . n 
N  14 85  GLY 85  85  85  GLY GLY M . n 
N  14 86  ALA 86  86  86  ALA ALA M . n 
N  14 87  LEU 87  87  87  LEU LEU M . n 
N  14 88  VAL 88  88  88  VAL VAL M . n 
N  14 89  ALA 89  89  89  ALA ALA M . n 
N  14 90  ARG 90  90  90  ARG ARG M . n 
N  14 91  VAL 91  91  91  VAL VAL M . n 
N  14 92  GLU 92  92  92  GLU GLU M . n 
N  14 93  GLY 93  93  93  GLY GLY M . n 
N  14 94  ARG 94  94  94  ARG ARG M . n 
N  14 95  PHE 95  95  95  PHE PHE M . n 
N  14 96  LEU 96  96  96  LEU LEU M . n 
N  14 97  GLY 97  97  97  GLY GLY M . n 
N  14 98  LEU 98  98  98  LEU LEU M . n 
N  14 99  ALA 99  99  99  ALA ALA M . n 
N  14 100 LEU 100 100 100 LEU LEU M . n 
N  14 101 LEU 101 101 101 LEU LEU M . n 
N  14 102 MET 102 102 102 MET MET M . n 
N  14 103 GLU 103 103 103 GLU GLU M . n 
N  14 104 GLY 104 104 104 GLY GLY M . n 
N  14 105 LEU 105 105 105 LEU LEU M . n 
N  14 106 LEU 106 106 106 LEU LEU M . n 
N  14 107 LEU 107 107 107 LEU LEU M . n 
N  14 108 GLY 108 108 108 GLY GLY M . n 
N  14 109 LEU 109 109 109 LEU LEU M . n 
N  14 110 PHE 110 110 110 PHE PHE M . n 
N  14 111 ALA 111 111 111 ALA ALA M . n 
N  14 112 ALA 112 112 112 ALA ALA M . n 
N  14 113 ARG 113 113 113 ARG ARG M . n 
N  14 114 ASP 114 114 114 ASP ASP M . n 
N  14 115 LEU 115 115 115 LEU LEU M . n 
N  14 116 LEU 116 116 116 LEU LEU M . n 
N  14 117 VAL 117 117 117 VAL VAL M . n 
N  14 118 PHE 118 118 118 PHE PHE M . n 
N  14 119 TYR 119 119 119 TYR TYR M . n 
N  14 120 VAL 120 120 120 VAL VAL M . n 
N  14 121 PHE 121 121 121 PHE PHE M . n 
N  14 122 PHE 122 122 122 PHE PHE M . n 
N  14 123 GLU 123 123 123 GLU GLU M . n 
N  14 124 ALA 124 124 124 ALA ALA M . n 
N  14 125 ALA 125 125 125 ALA ALA M . n 
N  14 126 LEU 126 126 126 LEU LEU M . n 
N  14 127 ILE 127 127 127 ILE ILE M . n 
N  14 128 PRO 128 128 128 PRO PRO M . n 
N  14 129 ALA 129 129 129 ALA ALA M . n 
N  14 130 LEU 130 130 130 LEU LEU M . n 
N  14 131 LEU 131 131 131 LEU LEU M . n 
N  14 132 MET 132 132 132 MET MET M . n 
N  14 133 LEU 133 133 133 LEU LEU M . n 
N  14 134 TYR 134 134 134 TYR TYR M . n 
N  14 135 LEU 135 135 135 LEU LEU M . n 
N  14 136 TYR 136 136 136 TYR TYR M . n 
N  14 137 GLY 137 137 137 GLY GLY M . n 
N  14 138 GLY 138 138 138 GLY GLY M . n 
N  14 139 GLU 139 139 139 GLU GLU M . n 
N  14 140 GLY 140 140 140 GLY GLY M . n 
N  14 141 ARG 141 141 141 ARG ARG M . n 
N  14 142 THR 142 142 142 THR THR M . n 
N  14 143 ARG 143 143 143 ARG ARG M . n 
N  14 144 ALA 144 144 144 ALA ALA M . n 
N  14 145 LEU 145 145 145 LEU LEU M . n 
N  14 146 TYR 146 146 146 TYR TYR M . n 
N  14 147 THR 147 147 147 THR THR M . n 
N  14 148 PHE 148 148 148 PHE PHE M . n 
N  14 149 VAL 149 149 149 VAL VAL M . n 
N  14 150 LEU 150 150 150 LEU LEU M . n 
N  14 151 PHE 151 151 151 PHE PHE M . n 
N  14 152 THR 152 152 152 THR THR M . n 
N  14 153 LEU 153 153 153 LEU LEU M . n 
N  14 154 VAL 154 154 154 VAL VAL M . n 
N  14 155 GLY 155 155 155 GLY GLY M . n 
N  14 156 SER 156 156 156 SER SER M . n 
N  14 157 LEU 157 157 157 LEU LEU M . n 
N  14 158 PRO 158 158 158 PRO PRO M . n 
N  14 159 MET 159 159 159 MET MET M . n 
N  14 160 LEU 160 160 160 LEU LEU M . n 
N  14 161 ALA 161 161 161 ALA ALA M . n 
N  14 162 ALA 162 162 162 ALA ALA M . n 
N  14 163 VAL 163 163 163 VAL VAL M . n 
N  14 164 LEU 164 164 164 LEU LEU M . n 
N  14 165 GLY 165 165 165 GLY GLY M . n 
N  14 166 ALA 166 166 166 ALA ALA M . n 
N  14 167 ARG 167 167 167 ARG ARG M . n 
N  14 168 LEU 168 168 168 LEU LEU M . n 
N  14 169 LEU 169 169 169 LEU LEU M . n 
N  14 170 SER 170 170 170 SER SER M . n 
N  14 171 GLY 171 171 171 GLY GLY M . n 
N  14 172 SER 172 172 172 SER SER M . n 
N  14 173 PRO 173 173 173 PRO PRO M . n 
N  14 174 THR 174 174 174 THR THR M . n 
N  14 175 PHE 175 175 175 PHE PHE M . n 
N  14 176 LEU 176 176 176 LEU LEU M . n 
N  14 177 LEU 177 177 177 LEU LEU M . n 
N  14 178 GLU 178 178 178 GLU GLU M . n 
N  14 179 ASP 179 179 179 ASP ASP M . n 
N  14 180 LEU 180 180 180 LEU LEU M . n 
N  14 181 LEU 181 181 181 LEU LEU M . n 
N  14 182 ALA 182 182 182 ALA ALA M . n 
N  14 183 HIS 183 183 183 HIS HIS M . n 
N  14 184 PRO 184 184 184 PRO PRO M . n 
N  14 185 LEU 185 185 185 LEU LEU M . n 
N  14 186 GLN 186 186 186 GLN GLN M . n 
N  14 187 GLU 187 187 187 GLU GLU M . n 
N  14 188 GLU 188 188 188 GLU GLU M . n 
N  14 189 ALA 189 189 189 ALA ALA M . n 
N  14 190 ALA 190 190 190 ALA ALA M . n 
N  14 191 PHE 191 191 191 PHE PHE M . n 
N  14 192 TRP 192 192 192 TRP TRP M . n 
N  14 193 VAL 193 193 193 VAL VAL M . n 
N  14 194 PHE 194 194 194 PHE PHE M . n 
N  14 195 LEU 195 195 195 LEU LEU M . n 
N  14 196 GLY 196 196 196 GLY GLY M . n 
N  14 197 PHE 197 197 197 PHE PHE M . n 
N  14 198 ALA 198 198 198 ALA ALA M . n 
N  14 199 LEU 199 199 199 LEU LEU M . n 
N  14 200 ALA 200 200 200 ALA ALA M . n 
N  14 201 PHE 201 201 201 PHE PHE M . n 
N  14 202 ALA 202 202 202 ALA ALA M . n 
N  14 203 ILE 203 203 203 ILE ILE M . n 
N  14 204 LYS 204 204 204 LYS LYS M . n 
N  14 205 THR 205 205 205 THR THR M . n 
N  14 206 PRO 206 206 206 PRO PRO M . n 
N  14 207 LEU 207 207 207 LEU LEU M . n 
N  14 208 PHE 208 208 208 PHE PHE M . n 
N  14 209 PRO 209 209 209 PRO PRO M . n 
N  14 210 LEU 210 210 210 LEU LEU M . n 
N  14 211 HIS 211 211 211 HIS HIS M . n 
N  14 212 ALA 212 212 212 ALA ALA M . n 
N  14 213 TRP 213 213 213 TRP TRP M . n 
N  14 214 LEU 214 214 214 LEU LEU M . n 
N  14 215 PRO 215 215 215 PRO PRO M . n 
N  14 216 PRO 216 216 216 PRO PRO M . n 
N  14 217 PHE 217 217 217 PHE PHE M . n 
N  14 218 HIS 218 218 218 HIS HIS M . n 
N  14 219 GLN 219 219 219 GLN GLN M . n 
N  14 220 GLU 220 220 220 GLU GLU M . n 
N  14 221 ASN 221 221 221 ASN ASN M . n 
N  14 222 HIS 222 222 222 HIS HIS M . n 
N  14 223 PRO 223 223 223 PRO PRO M . n 
N  14 224 SER 224 224 224 SER SER M . n 
N  14 225 GLY 225 225 225 GLY GLY M . n 
N  14 226 LEU 226 226 226 LEU LEU M . n 
N  14 227 ALA 227 227 227 ALA ALA M . n 
N  14 228 ASP 228 228 228 ASP ASP M . n 
N  14 229 ALA 229 229 229 ALA ALA M . n 
N  14 230 LEU 230 230 230 LEU LEU M . n 
N  14 231 GLY 231 231 231 GLY GLY M . n 
N  14 232 THR 232 232 232 THR THR M . n 
N  14 233 LEU 233 233 233 LEU LEU M . n 
N  14 234 TYR 234 234 234 TYR TYR M . n 
N  14 235 LYS 235 235 235 LYS LYS M . n 
N  14 236 VAL 236 236 236 VAL VAL M . n 
N  14 237 GLY 237 237 237 GLY GLY M . n 
N  14 238 VAL 238 238 238 VAL VAL M . n 
N  14 239 PHE 239 239 239 PHE PHE M . n 
N  14 240 ALA 240 240 240 ALA ALA M . n 
N  14 241 PHE 241 241 241 PHE PHE M . n 
N  14 242 PHE 242 242 242 PHE PHE M . n 
N  14 243 ARG 243 243 243 ARG ARG M . n 
N  14 244 PHE 244 244 244 PHE PHE M . n 
N  14 245 ALA 245 245 245 ALA ALA M . n 
N  14 246 ILE 246 246 246 ILE ILE M . n 
N  14 247 PRO 247 247 247 PRO PRO M . n 
N  14 248 LEU 248 248 248 LEU LEU M . n 
N  14 249 ALA 249 249 249 ALA ALA M . n 
N  14 250 PRO 250 250 250 PRO PRO M . n 
N  14 251 GLU 251 251 251 GLU GLU M . n 
N  14 252 GLY 252 252 252 GLY GLY M . n 
N  14 253 PHE 253 253 253 PHE PHE M . n 
N  14 254 ALA 254 254 254 ALA ALA M . n 
N  14 255 GLN 255 255 255 GLN GLN M . n 
N  14 256 ALA 256 256 256 ALA ALA M . n 
N  14 257 GLN 257 257 257 GLN GLN M . n 
N  14 258 GLY 258 258 258 GLY GLY M . n 
N  14 259 LEU 259 259 259 LEU LEU M . n 
N  14 260 LEU 260 260 260 LEU LEU M . n 
N  14 261 LEU 261 261 261 LEU LEU M . n 
N  14 262 PHE 262 262 262 PHE PHE M . n 
N  14 263 LEU 263 263 263 LEU LEU M . n 
N  14 264 ALA 264 264 264 ALA ALA M . n 
N  14 265 ALA 265 265 265 ALA ALA M . n 
N  14 266 LEU 266 266 266 LEU LEU M . n 
N  14 267 SER 267 267 267 SER SER M . n 
N  14 268 ALA 268 268 268 ALA ALA M . n 
N  14 269 LEU 269 269 269 LEU LEU M . n 
N  14 270 TYR 270 270 270 TYR TYR M . n 
N  14 271 GLY 271 271 271 GLY GLY M . n 
N  14 272 ALA 272 272 272 ALA ALA M . n 
N  14 273 TRP 273 273 273 TRP TRP M . n 
N  14 274 VAL 274 274 274 VAL VAL M . n 
N  14 275 ALA 275 275 275 ALA ALA M . n 
N  14 276 PHE 276 276 276 PHE PHE M . n 
N  14 277 ALA 277 277 277 ALA ALA M . n 
N  14 278 ALA 278 278 278 ALA ALA M . n 
N  14 279 LYS 279 279 279 LYS LYS M . n 
N  14 280 ASP 280 280 280 ASP ASP M . n 
N  14 281 PHE 281 281 281 PHE PHE M . n 
N  14 282 LYS 282 282 282 LYS LYS M . n 
N  14 283 THR 283 283 283 THR THR M . n 
N  14 284 LEU 284 284 284 LEU LEU M . n 
N  14 285 LEU 285 285 285 LEU LEU M . n 
N  14 286 ALA 286 286 286 ALA ALA M . n 
N  14 287 TYR 287 287 287 TYR TYR M . n 
N  14 288 ALA 288 288 288 ALA ALA M . n 
N  14 289 GLY 289 289 289 GLY GLY M . n 
N  14 290 LEU 290 290 290 LEU LEU M . n 
N  14 291 SER 291 291 291 SER SER M . n 
N  14 292 HIS 292 292 292 HIS HIS M . n 
N  14 293 MET 293 293 293 MET MET M . n 
N  14 294 GLY 294 294 294 GLY GLY M . n 
N  14 295 VAL 295 295 295 VAL VAL M . n 
N  14 296 ALA 296 296 296 ALA ALA M . n 
N  14 297 ALA 297 297 297 ALA ALA M . n 
N  14 298 LEU 298 298 298 LEU LEU M . n 
N  14 299 GLY 299 299 299 GLY GLY M . n 
N  14 300 VAL 300 300 300 VAL VAL M . n 
N  14 301 PHE 301 301 301 PHE PHE M . n 
N  14 302 SER 302 302 302 SER SER M . n 
N  14 303 GLY 303 303 303 GLY GLY M . n 
N  14 304 THR 304 304 304 THR THR M . n 
N  14 305 PRO 305 305 305 PRO PRO M . n 
N  14 306 GLU 306 306 306 GLU GLU M . n 
N  14 307 GLY 307 307 307 GLY GLY M . n 
N  14 308 ALA 308 308 308 ALA ALA M . n 
N  14 309 MET 309 309 309 MET MET M . n 
N  14 310 GLY 310 310 310 GLY GLY M . n 
N  14 311 GLY 311 311 311 GLY GLY M . n 
N  14 312 LEU 312 312 312 LEU LEU M . n 
N  14 313 TYR 313 313 313 TYR TYR M . n 
N  14 314 LEU 314 314 314 LEU LEU M . n 
N  14 315 LEU 315 315 315 LEU LEU M . n 
N  14 316 ALA 316 316 316 ALA ALA M . n 
N  14 317 ALA 317 317 317 ALA ALA M . n 
N  14 318 SER 318 318 318 SER SER M . n 
N  14 319 GLY 319 319 319 GLY GLY M . n 
N  14 320 VAL 320 320 320 VAL VAL M . n 
N  14 321 TYR 321 321 321 TYR TYR M . n 
N  14 322 THR 322 322 322 THR THR M . n 
N  14 323 GLY 323 323 323 GLY GLY M . n 
N  14 324 GLY 324 324 324 GLY GLY M . n 
N  14 325 LEU 325 325 325 LEU LEU M . n 
N  14 326 PHE 326 326 326 PHE PHE M . n 
N  14 327 LEU 327 327 327 LEU LEU M . n 
N  14 328 LEU 328 328 328 LEU LEU M . n 
N  14 329 ALA 329 329 329 ALA ALA M . n 
N  14 330 GLY 330 330 330 GLY GLY M . n 
N  14 331 ARG 331 331 331 ARG ARG M . n 
N  14 332 LEU 332 332 332 LEU LEU M . n 
N  14 333 TYR 333 333 333 TYR TYR M . n 
N  14 334 GLU 334 334 334 GLU GLU M . n 
N  14 335 ARG 335 335 335 ARG ARG M . n 
N  14 336 THR 336 336 336 THR THR M . n 
N  14 337 GLY 337 337 337 GLY GLY M . n 
N  14 338 THR 338 338 338 THR THR M . n 
N  14 339 LEU 339 339 339 LEU LEU M . n 
N  14 340 GLU 340 340 340 GLU GLU M . n 
N  14 341 ILE 341 341 341 ILE ILE M . n 
N  14 342 GLY 342 342 342 GLY GLY M . n 
N  14 343 ARG 343 343 343 ARG ARG M . n 
N  14 344 TYR 344 344 344 TYR TYR M . n 
N  14 345 ARG 345 345 345 ARG ARG M . n 
N  14 346 GLY 346 346 346 GLY GLY M . n 
N  14 347 LEU 347 347 347 LEU LEU M . n 
N  14 348 ALA 348 348 348 ALA ALA M . n 
N  14 349 GLN 349 349 349 GLN GLN M . n 
N  14 350 SER 350 350 350 SER SER M . n 
N  14 351 ALA 351 351 351 ALA ALA M . n 
N  14 352 PRO 352 352 352 PRO PRO M . n 
N  14 353 GLY 353 353 353 GLY GLY M . n 
N  14 354 LEU 354 354 354 LEU LEU M . n 
N  14 355 ALA 355 355 355 ALA ALA M . n 
N  14 356 ALA 356 356 356 ALA ALA M . n 
N  14 357 LEU 357 357 357 LEU LEU M . n 
N  14 358 ALA 358 358 358 ALA ALA M . n 
N  14 359 LEU 359 359 359 LEU LEU M . n 
N  14 360 ILE 360 360 360 ILE ILE M . n 
N  14 361 LEU 361 361 361 LEU LEU M . n 
N  14 362 PHE 362 362 362 PHE PHE M . n 
N  14 363 LEU 363 363 363 LEU LEU M . n 
N  14 364 ALA 364 364 364 ALA ALA M . n 
N  14 365 MET 365 365 365 MET MET M . n 
N  14 366 VAL 366 366 366 VAL VAL M . n 
N  14 367 GLY 367 367 367 GLY GLY M . n 
N  14 368 LEU 368 368 368 LEU LEU M . n 
N  14 369 PRO 369 369 369 PRO PRO M . n 
N  14 370 GLY 370 370 370 GLY GLY M . n 
N  14 371 LEU 371 371 371 LEU LEU M . n 
N  14 372 SER 372 372 372 SER SER M . n 
N  14 373 GLY 373 373 373 GLY GLY M . n 
N  14 374 PHE 374 374 374 PHE PHE M . n 
N  14 375 PRO 375 375 375 PRO PRO M . n 
N  14 376 GLY 376 376 376 GLY GLY M . n 
N  14 377 GLU 377 377 377 GLU GLU M . n 
N  14 378 PHE 378 378 378 PHE PHE M . n 
N  14 379 LEU 379 379 379 LEU LEU M . n 
N  14 380 THR 380 380 380 THR THR M . n 
N  14 381 LEU 381 381 381 LEU LEU M . n 
N  14 382 LEU 382 382 382 LEU LEU M . n 
N  14 383 GLY 383 383 383 GLY GLY M . n 
N  14 384 ALA 384 384 384 ALA ALA M . n 
N  14 385 TYR 385 385 385 TYR TYR M . n 
N  14 386 LYS 386 386 386 LYS LYS M . n 
N  14 387 ALA 387 387 387 ALA ALA M . n 
N  14 388 SER 388 388 388 SER SER M . n 
N  14 389 PRO 389 389 389 PRO PRO M . n 
N  14 390 TRP 390 390 390 TRP TRP M . n 
N  14 391 LEU 391 391 391 LEU LEU M . n 
N  14 392 ALA 392 392 392 ALA ALA M . n 
N  14 393 ALA 393 393 393 ALA ALA M . n 
N  14 394 LEU 394 394 394 LEU LEU M . n 
N  14 395 ALA 395 395 395 ALA ALA M . n 
N  14 396 PHE 396 396 396 PHE PHE M . n 
N  14 397 LEU 397 397 397 LEU LEU M . n 
N  14 398 SER 398 398 398 SER SER M . n 
N  14 399 VAL 399 399 399 VAL VAL M . n 
N  14 400 ILE 400 400 400 ILE ILE M . n 
N  14 401 ALA 401 401 401 ALA ALA M . n 
N  14 402 SER 402 402 402 SER SER M . n 
N  14 403 ALA 403 403 403 ALA ALA M . n 
N  14 404 ALA 404 404 404 ALA ALA M . n 
N  14 405 TYR 405 405 405 TYR TYR M . n 
N  14 406 ALA 406 406 406 ALA ALA M . n 
N  14 407 LEU 407 407 407 LEU LEU M . n 
N  14 408 THR 408 408 408 THR THR M . n 
N  14 409 ALA 409 409 409 ALA ALA M . n 
N  14 410 PHE 410 410 410 PHE PHE M . n 
N  14 411 GLN 411 411 411 GLN GLN M . n 
N  14 412 LYS 412 412 412 LYS LYS M . n 
N  14 413 THR 413 413 413 THR THR M . n 
N  14 414 PHE 414 414 414 PHE PHE M . n 
N  14 415 TRP 415 415 415 TRP TRP M . n 
N  14 416 GLU 416 416 416 GLU GLU M . n 
N  14 417 GLU 417 417 417 GLU GLU M . n 
N  14 418 GLY 418 418 418 GLY GLY M . n 
N  14 419 GLY 419 419 419 GLY GLY M . n 
N  14 420 SER 420 420 420 SER SER M . n 
N  14 421 GLY 421 421 421 GLY GLY M . n 
N  14 422 VAL 422 422 422 VAL VAL M . n 
N  14 423 LYS 423 423 423 LYS LYS M . n 
N  14 424 ASP 424 424 424 ASP ASP M . n 
N  14 425 LEU 425 425 425 LEU LEU M . n 
N  14 426 ALA 426 426 426 ALA ALA M . n 
N  14 427 GLY 427 427 427 GLY GLY M . n 
N  14 428 ALA 428 428 428 ALA ALA M . n 
N  14 429 GLU 429 429 429 GLU GLU M . n 
N  14 430 TRP 430 430 430 TRP TRP M . n 
N  14 431 GLY 431 431 431 GLY GLY M . n 
N  14 432 PHE 432 432 432 PHE PHE M . n 
N  14 433 ALA 433 433 433 ALA ALA M . n 
N  14 434 LEU 434 434 434 LEU LEU M . n 
N  14 435 LEU 435 435 435 LEU LEU M . n 
N  14 436 SER 436 436 436 SER SER M . n 
N  14 437 VAL 437 437 437 VAL VAL M . n 
N  14 438 LEU 438 438 438 LEU LEU M . n 
N  14 439 ALA 439 439 439 ALA ALA M . n 
N  14 440 LEU 440 440 440 LEU LEU M . n 
N  14 441 LEU 441 441 441 LEU LEU M . n 
N  14 442 LEU 442 442 442 LEU LEU M . n 
N  14 443 MET 443 443 443 MET MET M . n 
N  14 444 GLY 444 444 444 GLY GLY M . n 
N  14 445 VAL 445 445 445 VAL VAL M . n 
N  14 446 PHE 446 446 446 PHE PHE M . n 
N  14 447 PRO 447 447 447 PRO PRO M . n 
N  14 448 GLY 448 448 448 GLY GLY M . n 
N  14 449 TYR 449 449 449 TYR TYR M . n 
N  14 450 PHE 450 450 450 PHE PHE M . n 
N  14 451 ALA 451 451 451 ALA ALA M . n 
N  14 452 ARG 452 452 452 ARG ARG M . n 
N  14 453 GLY 453 453 453 GLY GLY M . n 
N  14 454 LEU 454 454 454 LEU LEU M . n 
N  14 455 HIS 455 455 455 HIS HIS M . n 
N  14 456 PRO 456 456 456 PRO PRO M . n 
N  14 457 LEU 457 457 457 LEU LEU M . n 
N  14 458 ALA 458 458 458 ALA ALA M . n 
N  14 459 GLU 459 459 459 GLU GLU M . n 
N  14 460 ALA 460 460 460 ALA ALA M . n 
N  14 461 PHE 461 461 461 PHE PHE M . n 
N  14 462 ALA 462 462 462 ALA ALA M . n 
N  14 463 LYS 463 463 463 LYS LYS M . n 
N  14 464 LEU 464 464 464 LEU LEU M . n 
N  14 465 LEU 465 465 465 LEU LEU M . n 
N  14 466 GLY 466 466 466 GLY GLY M . n 
N  14 467 GLY 467 467 467 GLY GLY M . n 
N  14 468 GLY 468 468 ?   ?   ?   M . n 
N  14 469 ALA 469 469 ?   ?   ?   M . n 
O  15 1   MET 1   1   1   MET MET N . n 
O  15 2   THR 2   2   2   THR THR N . n 
O  15 3   LEU 3   3   3   LEU LEU N . n 
O  15 4   ALA 4   4   4   ALA ALA N . n 
O  15 5   ILE 5   5   5   ILE ILE N . n 
O  15 6   LEU 6   6   6   LEU LEU N . n 
O  15 7   ALA 7   7   7   ALA ALA N . n 
O  15 8   VAL 8   8   8   VAL VAL N . n 
O  15 9   PHE 9   9   9   PHE PHE N . n 
O  15 10  SER 10  10  10  SER SER N . n 
O  15 11  VAL 11  11  11  VAL VAL N . n 
O  15 12  ALA 12  12  12  ALA ALA N . n 
O  15 13  LEU 13  13  13  LEU LEU N . n 
O  15 14  THR 14  14  14  THR THR N . n 
O  15 15  LEU 15  15  15  LEU LEU N . n 
O  15 16  LEU 16  16  16  LEU LEU N . n 
O  15 17  GLY 17  17  17  GLY GLY N . n 
O  15 18  PHE 18  18  18  PHE PHE N . n 
O  15 19  VAL 19  19  19  VAL VAL N . n 
O  15 20  LEU 20  20  20  LEU LEU N . n 
O  15 21  PRO 21  21  21  PRO PRO N . n 
O  15 22  PRO 22  22  22  PRO PRO N . n 
O  15 23  GLN 23  23  23  GLN GLN N . n 
O  15 24  GLY 24  24  24  GLY GLY N . n 
O  15 25  VAL 25  25  25  VAL VAL N . n 
O  15 26  LYS 26  26  26  LYS LYS N . n 
O  15 27  ARG 27  27  27  ARG ARG N . n 
O  15 28  ALA 28  28  28  ALA ALA N . n 
O  15 29  THR 29  29  29  THR THR N . n 
O  15 30  LEU 30  30  30  LEU LEU N . n 
O  15 31  LEU 31  31  31  LEU LEU N . n 
O  15 32  GLY 32  32  32  GLY GLY N . n 
O  15 33  LEU 33  33  33  LEU LEU N . n 
O  15 34  ALA 34  34  34  ALA ALA N . n 
O  15 35  LEU 35  35  35  LEU LEU N . n 
O  15 36  ALA 36  36  36  ALA ALA N . n 
O  15 37  LEU 37  37  37  LEU LEU N . n 
O  15 38  ALA 38  38  38  ALA ALA N . n 
O  15 39  SER 39  39  39  SER SER N . n 
O  15 40  LEU 40  40  40  LEU LEU N . n 
O  15 41  LEU 41  41  41  LEU LEU N . n 
O  15 42  LEU 42  42  42  LEU LEU N . n 
O  15 43  THR 43  43  43  THR THR N . n 
O  15 44  TRP 44  44  44  TRP TRP N . n 
O  15 45  GLY 45  45  45  GLY GLY N . n 
O  15 46  LYS 46  46  46  LYS LYS N . n 
O  15 47  PRO 47  47  47  PRO PRO N . n 
O  15 48  PHE 48  48  48  PHE PHE N . n 
O  15 49  ALA 49  49  49  ALA ALA N . n 
O  15 50  PHE 50  50  50  PHE PHE N . n 
O  15 51  GLY 51  51  51  GLY GLY N . n 
O  15 52  PRO 52  52  52  PRO PRO N . n 
O  15 53  TYR 53  53  53  TYR TYR N . n 
O  15 54  ALA 54  54  54  ALA ALA N . n 
O  15 55  VAL 55  55  55  VAL VAL N . n 
O  15 56  ASP 56  56  56  ASP ASP N . n 
O  15 57  GLY 57  57  57  GLY GLY N . n 
O  15 58  VAL 58  58  58  VAL VAL N . n 
O  15 59  SER 59  59  59  SER SER N . n 
O  15 60  GLN 60  60  60  GLN GLN N . n 
O  15 61  VAL 61  61  61  VAL VAL N . n 
O  15 62  PHE 62  62  62  PHE PHE N . n 
O  15 63  THR 63  63  63  THR THR N . n 
O  15 64  LEU 64  64  64  LEU LEU N . n 
O  15 65  LEU 65  65  65  LEU LEU N . n 
O  15 66  ALA 66  66  66  ALA ALA N . n 
O  15 67  LEU 67  67  67  LEU LEU N . n 
O  15 68  LEU 68  68  68  LEU LEU N . n 
O  15 69  GLY 69  69  69  GLY GLY N . n 
O  15 70  ALA 70  70  70  ALA ALA N . n 
O  15 71  LEU 71  71  71  LEU LEU N . n 
O  15 72  TRP 72  72  72  TRP TRP N . n 
O  15 73  THR 73  73  73  THR THR N . n 
O  15 74  VAL 74  74  74  VAL VAL N . n 
O  15 75  GLY 75  75  75  GLY GLY N . n 
O  15 76  LEU 76  76  76  LEU LEU N . n 
O  15 77  VAL 77  77  77  VAL VAL N . n 
O  15 78  ARG 78  78  78  ARG ARG N . n 
O  15 79  SER 79  79  79  SER SER N . n 
O  15 80  GLY 80  80  80  GLY GLY N . n 
O  15 81  ARG 81  81  81  ARG ARG N . n 
O  15 82  PHE 82  82  82  PHE PHE N . n 
O  15 83  GLU 83  83  83  GLU GLU N . n 
O  15 84  PHE 84  84  84  PHE PHE N . n 
O  15 85  TYR 85  85  85  TYR TYR N . n 
O  15 86  LEU 86  86  86  LEU LEU N . n 
O  15 87  LEU 87  87  87  LEU LEU N . n 
O  15 88  VAL 88  88  88  VAL VAL N . n 
O  15 89  LEU 89  89  89  LEU LEU N . n 
O  15 90  TYR 90  90  90  TYR TYR N . n 
O  15 91  ALA 91  91  91  ALA ALA N . n 
O  15 92  ALA 92  92  92  ALA ALA N . n 
O  15 93  LEU 93  93  93  LEU LEU N . n 
O  15 94  GLY 94  94  94  GLY GLY N . n 
O  15 95  MET 95  95  95  MET MET N . n 
O  15 96  HIS 96  96  96  HIS HIS N . n 
O  15 97  LEU 97  97  97  LEU LEU N . n 
O  15 98  LEU 98  98  98  LEU LEU N . n 
O  15 99  ALA 99  99  99  ALA ALA N . n 
O  15 100 SER 100 100 100 SER SER N . n 
O  15 101 THR 101 101 101 THR THR N . n 
O  15 102 ARG 102 102 102 ARG ARG N . n 
O  15 103 HIS 103 103 103 HIS HIS N . n 
O  15 104 LEU 104 104 104 LEU LEU N . n 
O  15 105 LEU 105 105 105 LEU LEU N . n 
O  15 106 LEU 106 106 106 LEU LEU N . n 
O  15 107 MET 107 107 107 MET MET N . n 
O  15 108 LEU 108 108 108 LEU LEU N . n 
O  15 109 VAL 109 109 109 VAL VAL N . n 
O  15 110 ALA 110 110 110 ALA ALA N . n 
O  15 111 LEU 111 111 111 LEU LEU N . n 
O  15 112 GLU 112 112 112 GLU GLU N . n 
O  15 113 ALA 113 113 113 ALA ALA N . n 
O  15 114 LEU 114 114 114 LEU LEU N . n 
O  15 115 SER 115 115 115 SER SER N . n 
O  15 116 LEU 116 116 116 LEU LEU N . n 
O  15 117 PRO 117 117 117 PRO PRO N . n 
O  15 118 LEU 118 118 118 LEU LEU N . n 
O  15 119 TYR 119 119 119 TYR TYR N . n 
O  15 120 ALA 120 120 120 ALA ALA N . n 
O  15 121 LEU 121 121 121 LEU LEU N . n 
O  15 122 ALA 122 122 122 ALA ALA N . n 
O  15 123 THR 123 123 123 THR THR N . n 
O  15 124 TRP 124 124 124 TRP TRP N . n 
O  15 125 ARG 125 125 125 ARG ARG N . n 
O  15 126 ARG 126 126 126 ARG ARG N . n 
O  15 127 GLY 127 127 127 GLY GLY N . n 
O  15 128 GLN 128 128 128 GLN GLN N . n 
O  15 129 GLY 129 129 129 GLY GLY N . n 
O  15 130 LEU 130 130 130 LEU LEU N . n 
O  15 131 GLU 131 131 131 GLU GLU N . n 
O  15 132 ALA 132 132 132 ALA ALA N . n 
O  15 133 ALA 133 133 133 ALA ALA N . n 
O  15 134 LEU 134 134 134 LEU LEU N . n 
O  15 135 LYS 135 135 135 LYS LYS N . n 
O  15 136 TYR 136 136 136 TYR TYR N . n 
O  15 137 PHE 137 137 137 PHE PHE N . n 
O  15 138 LEU 138 138 138 LEU LEU N . n 
O  15 139 LEU 139 139 139 LEU LEU N . n 
O  15 140 GLY 140 140 140 GLY GLY N . n 
O  15 141 ALA 141 141 141 ALA ALA N . n 
O  15 142 LEU 142 142 142 LEU LEU N . n 
O  15 143 ALA 143 143 143 ALA ALA N . n 
O  15 144 ALA 144 144 144 ALA ALA N . n 
O  15 145 ALA 145 145 145 ALA ALA N . n 
O  15 146 PHE 146 146 146 PHE PHE N . n 
O  15 147 PHE 147 147 147 PHE PHE N . n 
O  15 148 LEU 148 148 148 LEU LEU N . n 
O  15 149 TYR 149 149 149 TYR TYR N . n 
O  15 150 GLY 150 150 150 GLY GLY N . n 
O  15 151 ALA 151 151 151 ALA ALA N . n 
O  15 152 ALA 152 152 152 ALA ALA N . n 
O  15 153 LEU 153 153 153 LEU LEU N . n 
O  15 154 PHE 154 154 154 PHE PHE N . n 
O  15 155 TYR 155 155 155 TYR TYR N . n 
O  15 156 GLY 156 156 156 GLY GLY N . n 
O  15 157 ALA 157 157 157 ALA ALA N . n 
O  15 158 THR 158 158 158 THR THR N . n 
O  15 159 GLY 159 159 159 GLY GLY N . n 
O  15 160 SER 160 160 160 SER SER N . n 
O  15 161 LEU 161 161 161 LEU LEU N . n 
O  15 162 VAL 162 162 162 VAL VAL N . n 
O  15 163 LEU 163 163 163 LEU LEU N . n 
O  15 164 GLY 164 164 164 GLY GLY N . n 
O  15 165 ALA 165 165 165 ALA ALA N . n 
O  15 166 PRO 166 166 166 PRO PRO N . n 
O  15 167 GLY 167 167 167 GLY GLY N . n 
O  15 168 GLU 168 168 168 GLU GLU N . n 
O  15 169 GLY 169 169 169 GLY GLY N . n 
O  15 170 PRO 170 170 170 PRO PRO N . n 
O  15 171 LEU 171 171 171 LEU LEU N . n 
O  15 172 TYR 172 172 172 TYR TYR N . n 
O  15 173 ALA 173 173 173 ALA ALA N . n 
O  15 174 LEU 174 174 174 LEU LEU N . n 
O  15 175 ALA 175 175 175 ALA ALA N . n 
O  15 176 LEU 176 176 176 LEU LEU N . n 
O  15 177 GLY 177 177 177 GLY GLY N . n 
O  15 178 LEU 178 178 178 LEU LEU N . n 
O  15 179 LEU 179 179 179 LEU LEU N . n 
O  15 180 LEU 180 180 180 LEU LEU N . n 
O  15 181 VAL 181 181 181 VAL VAL N . n 
O  15 182 GLY 182 182 182 GLY GLY N . n 
O  15 183 LEU 183 183 183 LEU LEU N . n 
O  15 184 GLY 184 184 184 GLY GLY N . n 
O  15 185 PHE 185 185 185 PHE PHE N . n 
O  15 186 LYS 186 186 186 LYS LYS N . n 
O  15 187 ALA 187 187 187 ALA ALA N . n 
O  15 188 ALA 188 188 188 ALA ALA N . n 
O  15 189 LEU 189 189 189 LEU LEU N . n 
O  15 190 ALA 190 190 190 ALA ALA N . n 
O  15 191 PRO 191 191 191 PRO PRO N . n 
O  15 192 PHE 192 192 192 PHE PHE N . n 
O  15 193 HIS 193 193 193 HIS HIS N . n 
O  15 194 PHE 194 194 194 PHE PHE N . n 
O  15 195 TRP 195 195 195 TRP TRP N . n 
O  15 196 THR 196 196 196 THR THR N . n 
O  15 197 PRO 197 197 197 PRO PRO N . n 
O  15 198 ASP 198 198 198 ASP ASP N . n 
O  15 199 VAL 199 199 199 VAL VAL N . n 
O  15 200 TYR 200 200 200 TYR TYR N . n 
O  15 201 GLN 201 201 201 GLN GLN N . n 
O  15 202 GLY 202 202 202 GLY GLY N . n 
O  15 203 SER 203 203 203 SER SER N . n 
O  15 204 PRO 204 204 204 PRO PRO N . n 
O  15 205 THR 205 205 205 THR THR N . n 
O  15 206 PRO 206 206 206 PRO PRO N . n 
O  15 207 VAL 207 207 207 VAL VAL N . n 
O  15 208 VAL 208 208 208 VAL VAL N . n 
O  15 209 LEU 209 209 209 LEU LEU N . n 
O  15 210 PHE 210 210 210 PHE PHE N . n 
O  15 211 MET 211 211 211 MET MET N . n 
O  15 212 ALA 212 212 212 ALA ALA N . n 
O  15 213 THR 213 213 213 THR THR N . n 
O  15 214 SER 214 214 214 SER SER N . n 
O  15 215 VAL 215 215 215 VAL VAL N . n 
O  15 216 LYS 216 216 216 LYS LYS N . n 
O  15 217 ALA 217 217 217 ALA ALA N . n 
O  15 218 ALA 218 218 218 ALA ALA N . n 
O  15 219 ALA 219 219 219 ALA ALA N . n 
O  15 220 PHE 220 220 220 PHE PHE N . n 
O  15 221 ALA 221 221 221 ALA ALA N . n 
O  15 222 ALA 222 222 222 ALA ALA N . n 
O  15 223 LEU 223 223 223 LEU LEU N . n 
O  15 224 LEU 224 224 224 LEU LEU N . n 
O  15 225 ARG 225 225 225 ARG ARG N . n 
O  15 226 VAL 226 226 226 VAL VAL N . n 
O  15 227 ALA 227 227 227 ALA ALA N . n 
O  15 228 ALA 228 228 228 ALA ALA N . n 
O  15 229 PRO 229 229 229 PRO PRO N . n 
O  15 230 PRO 230 230 230 PRO PRO N . n 
O  15 231 GLU 231 231 231 GLU GLU N . n 
O  15 232 ALA 232 232 232 ALA ALA N . n 
O  15 233 LEU 233 233 233 LEU LEU N . n 
O  15 234 ALA 234 234 234 ALA ALA N . n 
O  15 235 LEU 235 235 235 LEU LEU N . n 
O  15 236 LEU 236 236 236 LEU LEU N . n 
O  15 237 VAL 237 237 237 VAL VAL N . n 
O  15 238 ALA 238 238 238 ALA ALA N . n 
O  15 239 LEU 239 239 239 LEU LEU N . n 
O  15 240 SER 240 240 240 SER SER N . n 
O  15 241 VAL 241 241 241 VAL VAL N . n 
O  15 242 VAL 242 242 242 VAL VAL N . n 
O  15 243 VAL 243 243 243 VAL VAL N . n 
O  15 244 GLY 244 244 244 GLY GLY N . n 
O  15 245 ASN 245 245 245 ASN ASN N . n 
O  15 246 LEU 246 246 246 LEU LEU N . n 
O  15 247 ALA 247 247 247 ALA ALA N . n 
O  15 248 ALA 248 248 248 ALA ALA N . n 
O  15 249 LEU 249 249 249 LEU LEU N . n 
O  15 250 ALA 250 250 250 ALA ALA N . n 
O  15 251 GLN 251 251 251 GLN GLN N . n 
O  15 252 LYS 252 252 252 LYS LYS N . n 
O  15 253 GLU 253 253 253 GLU GLU N . n 
O  15 254 ALA 254 254 254 ALA ALA N . n 
O  15 255 LYS 255 255 255 LYS LYS N . n 
O  15 256 ARG 256 256 256 ARG ARG N . n 
O  15 257 LEU 257 257 257 LEU LEU N . n 
O  15 258 LEU 258 258 258 LEU LEU N . n 
O  15 259 ALA 259 259 259 ALA ALA N . n 
O  15 260 TYR 260 260 260 TYR TYR N . n 
O  15 261 SER 261 261 261 SER SER N . n 
O  15 262 SER 262 262 262 SER SER N . n 
O  15 263 ILE 263 263 263 ILE ILE N . n 
O  15 264 ALA 264 264 264 ALA ALA N . n 
O  15 265 HIS 265 265 265 HIS HIS N . n 
O  15 266 ALA 266 266 266 ALA ALA N . n 
O  15 267 GLY 267 267 267 GLY GLY N . n 
O  15 268 TYR 268 268 268 TYR TYR N . n 
O  15 269 MET 269 269 269 MET MET N . n 
O  15 270 ALA 270 270 270 ALA ALA N . n 
O  15 271 LEU 271 271 271 LEU LEU N . n 
O  15 272 ALA 272 272 272 ALA ALA N . n 
O  15 273 LEU 273 273 273 LEU LEU N . n 
O  15 274 TYR 274 274 274 TYR TYR N . n 
O  15 275 THR 275 275 275 THR THR N . n 
O  15 276 GLY 276 276 276 GLY GLY N . n 
O  15 277 ASN 277 277 277 ASN ASN N . n 
O  15 278 ALA 278 278 278 ALA ALA N . n 
O  15 279 GLN 279 279 279 GLN GLN N . n 
O  15 280 ALA 280 280 280 ALA ALA N . n 
O  15 281 LEU 281 281 281 LEU LEU N . n 
O  15 282 GLY 282 282 282 GLY GLY N . n 
O  15 283 PHE 283 283 283 PHE PHE N . n 
O  15 284 TYR 284 284 284 TYR TYR N . n 
O  15 285 LEU 285 285 285 LEU LEU N . n 
O  15 286 LEU 286 286 286 LEU LEU N . n 
O  15 287 THR 287 287 287 THR THR N . n 
O  15 288 TYR 288 288 288 TYR TYR N . n 
O  15 289 VAL 289 289 289 VAL VAL N . n 
O  15 290 LEU 290 290 290 LEU LEU N . n 
O  15 291 ALA 291 291 291 ALA ALA N . n 
O  15 292 THR 292 292 292 THR THR N . n 
O  15 293 GLY 293 293 293 GLY GLY N . n 
O  15 294 LEU 294 294 294 LEU LEU N . n 
O  15 295 ALA 295 295 295 ALA ALA N . n 
O  15 296 PHE 296 296 296 PHE PHE N . n 
O  15 297 ALA 297 297 297 ALA ALA N . n 
O  15 298 VAL 298 298 298 VAL VAL N . n 
O  15 299 LEU 299 299 299 LEU LEU N . n 
O  15 300 SER 300 300 300 SER SER N . n 
O  15 301 GLN 301 301 301 GLN GLN N . n 
O  15 302 ILE 302 302 302 ILE ILE N . n 
O  15 303 SER 303 303 303 SER SER N . n 
O  15 304 PRO 304 304 304 PRO PRO N . n 
O  15 305 ASP 305 305 305 ASP ASP N . n 
O  15 306 ARG 306 306 306 ARG ARG N . n 
O  15 307 VAL 307 307 307 VAL VAL N . n 
O  15 308 PRO 308 308 308 PRO PRO N . n 
O  15 309 LEU 309 309 309 LEU LEU N . n 
O  15 310 GLU 310 310 310 GLU GLU N . n 
O  15 311 ALA 311 311 311 ALA ALA N . n 
O  15 312 LEU 312 312 312 LEU LEU N . n 
O  15 313 ARG 313 313 313 ARG ARG N . n 
O  15 314 GLY 314 314 314 GLY GLY N . n 
O  15 315 LEU 315 315 315 LEU LEU N . n 
O  15 316 TYR 316 316 316 TYR TYR N . n 
O  15 317 ARG 317 317 317 ARG ARG N . n 
O  15 318 LYS 318 318 318 LYS LYS N . n 
O  15 319 ASP 319 319 319 ASP ASP N . n 
O  15 320 PRO 320 320 320 PRO PRO N . n 
O  15 321 LEU 321 321 321 LEU LEU N . n 
O  15 322 LEU 322 322 322 LEU LEU N . n 
O  15 323 GLY 323 323 323 GLY GLY N . n 
O  15 324 LEU 324 324 324 LEU LEU N . n 
O  15 325 ALA 325 325 325 ALA ALA N . n 
O  15 326 PHE 326 326 326 PHE PHE N . n 
O  15 327 LEU 327 327 327 LEU LEU N . n 
O  15 328 VAL 328 328 328 VAL VAL N . n 
O  15 329 ALA 329 329 329 ALA ALA N . n 
O  15 330 MET 330 330 330 MET MET N . n 
O  15 331 LEU 331 331 331 LEU LEU N . n 
O  15 332 SER 332 332 332 SER SER N . n 
O  15 333 LEU 333 333 333 LEU LEU N . n 
O  15 334 LEU 334 334 334 LEU LEU N . n 
O  15 335 GLY 335 335 335 GLY GLY N . n 
O  15 336 LEU 336 336 336 LEU LEU N . n 
O  15 337 PRO 337 337 337 PRO PRO N . n 
O  15 338 PRO 338 338 338 PRO PRO N . n 
O  15 339 LEU 339 339 339 LEU LEU N . n 
O  15 340 ALA 340 340 340 ALA ALA N . n 
O  15 341 GLY 341 341 341 GLY GLY N . n 
O  15 342 PHE 342 342 342 PHE PHE N . n 
O  15 343 TRP 343 343 343 TRP TRP N . n 
O  15 344 GLY 344 344 344 GLY GLY N . n 
O  15 345 LYS 345 345 345 LYS LYS N . n 
O  15 346 TYR 346 346 346 TYR TYR N . n 
O  15 347 LEU 347 347 347 LEU LEU N . n 
O  15 348 ALA 348 348 348 ALA ALA N . n 
O  15 349 PHE 349 349 349 PHE PHE N . n 
O  15 350 ALA 350 350 350 ALA ALA N . n 
O  15 351 GLU 351 351 351 GLU GLU N . n 
O  15 352 ALA 352 352 352 ALA ALA N . n 
O  15 353 ALA 353 353 353 ALA ALA N . n 
O  15 354 ARG 354 354 354 ARG ARG N . n 
O  15 355 ALA 355 355 355 ALA ALA N . n 
O  15 356 GLY 356 356 356 GLY GLY N . n 
O  15 357 ALA 357 357 357 ALA ALA N . n 
O  15 358 TRP 358 358 358 TRP TRP N . n 
O  15 359 GLY 359 359 359 GLY GLY N . n 
O  15 360 VAL 360 360 360 VAL VAL N . n 
O  15 361 LEU 361 361 361 LEU LEU N . n 
O  15 362 VAL 362 362 362 VAL VAL N . n 
O  15 363 LEU 363 363 363 LEU LEU N . n 
O  15 364 ALA 364 364 364 ALA ALA N . n 
O  15 365 LEU 365 365 365 LEU LEU N . n 
O  15 366 VAL 366 366 366 VAL VAL N . n 
O  15 367 THR 367 367 367 THR THR N . n 
O  15 368 SER 368 368 368 SER SER N . n 
O  15 369 ALA 369 369 369 ALA ALA N . n 
O  15 370 VAL 370 370 370 VAL VAL N . n 
O  15 371 SER 371 371 371 SER SER N . n 
O  15 372 ALA 372 372 372 ALA ALA N . n 
O  15 373 TYR 373 373 373 TYR TYR N . n 
O  15 374 TYR 374 374 374 TYR TYR N . n 
O  15 375 TYR 375 375 375 TYR TYR N . n 
O  15 376 LEU 376 376 376 LEU LEU N . n 
O  15 377 GLY 377 377 377 GLY GLY N . n 
O  15 378 LEU 378 378 378 LEU LEU N . n 
O  15 379 GLY 379 379 379 GLY GLY N . n 
O  15 380 LEU 380 380 380 LEU LEU N . n 
O  15 381 ALA 381 381 381 ALA ALA N . n 
O  15 382 VAL 382 382 382 VAL VAL N . n 
O  15 383 PHE 383 383 383 PHE PHE N . n 
O  15 384 ALA 384 384 384 ALA ALA N . n 
O  15 385 ARG 385 385 385 ARG ARG N . n 
O  15 386 PRO 386 386 386 PRO PRO N . n 
O  15 387 GLU 387 387 387 GLU GLU N . n 
O  15 388 GLU 388 388 388 GLU GLU N . n 
O  15 389 THR 389 389 389 THR THR N . n 
O  15 390 PRO 390 390 390 PRO PRO N . n 
O  15 391 PHE 391 391 391 PHE PHE N . n 
O  15 392 ARG 392 392 392 ARG ARG N . n 
O  15 393 PRO 393 393 393 PRO PRO N . n 
O  15 394 GLY 394 394 394 GLY GLY N . n 
O  15 395 PRO 395 395 395 PRO PRO N . n 
O  15 396 PRO 396 396 396 PRO PRO N . n 
O  15 397 TRP 397 397 397 TRP TRP N . n 
O  15 398 ALA 398 398 398 ALA ALA N . n 
O  15 399 ARG 399 399 399 ARG ARG N . n 
O  15 400 ALA 400 400 400 ALA ALA N . n 
O  15 401 ALA 401 401 401 ALA ALA N . n 
O  15 402 VAL 402 402 402 VAL VAL N . n 
O  15 403 VAL 403 403 403 VAL VAL N . n 
O  15 404 ALA 404 404 404 ALA ALA N . n 
O  15 405 ALA 405 405 405 ALA ALA N . n 
O  15 406 GLY 406 406 406 GLY GLY N . n 
O  15 407 VAL 407 407 407 VAL VAL N . n 
O  15 408 LEU 408 408 408 LEU LEU N . n 
O  15 409 LEU 409 409 409 LEU LEU N . n 
O  15 410 LEU 410 410 410 LEU LEU N . n 
O  15 411 ALA 411 411 411 ALA ALA N . n 
O  15 412 LEU 412 412 412 LEU LEU N . n 
O  15 413 GLY 413 413 413 GLY GLY N . n 
O  15 414 LEU 414 414 414 LEU LEU N . n 
O  15 415 LEU 415 415 415 LEU LEU N . n 
O  15 416 PRO 416 416 416 PRO PRO N . n 
O  15 417 GLY 417 417 417 GLY GLY N . n 
O  15 418 LEU 418 418 418 LEU LEU N . n 
O  15 419 VAL 419 419 419 VAL VAL N . n 
O  15 420 LEU 420 420 420 LEU LEU N . n 
O  15 421 PRO 421 421 421 PRO PRO N . n 
O  15 422 ALA 422 422 422 ALA ALA N . n 
O  15 423 LEU 423 423 423 LEU LEU N . n 
O  15 424 ALA 424 424 424 ALA ALA N . n 
O  15 425 ALA 425 425 425 ALA ALA N . n 
O  15 426 GLY 426 426 426 GLY GLY N . n 
O  15 427 GLY 427 427 427 GLY GLY N . n 
P  16 1   MET 1   1   ?   ?   ?   H . n 
P  16 2   THR 2   2   2   THR THR H . n 
P  16 3   TRP 3   3   3   TRP TRP H . n 
P  16 4   SER 4   4   4   SER SER H . n 
P  16 5   TYR 5   5   5   TYR TYR H . n 
P  16 6   PRO 6   6   6   PRO PRO H . n 
P  16 7   VAL 7   7   7   VAL VAL H . n 
P  16 8   ASP 8   8   8   ASP ASP H . n 
P  16 9   PRO 9   9   9   PRO PRO H . n 
P  16 10  TYR 10  10  10  TYR TYR H . n 
P  16 11  TRP 11  11  11  TRP TRP H . n 
P  16 12  MET 12  12  12  MET MET H . n 
P  16 13  VAL 13  13  13  VAL VAL H . n 
P  16 14  ALA 14  14  14  ALA ALA H . n 
P  16 15  LEU 15  15  15  LEU LEU H . n 
P  16 16  LYS 16  16  16  LYS LYS H . n 
P  16 17  ALA 17  17  17  ALA ALA H . n 
P  16 18  LEU 18  18  18  LEU LEU H . n 
P  16 19  LEU 19  19  19  LEU LEU H . n 
P  16 20  VAL 20  20  20  VAL VAL H . n 
P  16 21  VAL 21  21  21  VAL VAL H . n 
P  16 22  VAL 22  22  22  VAL VAL H . n 
P  16 23  GLY 23  23  23  GLY GLY H . n 
P  16 24  LEU 24  24  24  LEU LEU H . n 
P  16 25  LEU 25  25  25  LEU LEU H . n 
P  16 26  THR 26  26  26  THR THR H . n 
P  16 27  ALA 27  27  27  ALA ALA H . n 
P  16 28  PHE 28  28  28  PHE PHE H . n 
P  16 29  ALA 29  29  29  ALA ALA H . n 
P  16 30  PHE 30  30  30  PHE PHE H . n 
P  16 31  MET 31  31  31  MET MET H . n 
P  16 32  THR 32  32  32  THR THR H . n 
P  16 33  LEU 33  33  33  LEU LEU H . n 
P  16 34  ILE 34  34  34  ILE ILE H . n 
P  16 35  GLU 35  35  35  GLU GLU H . n 
P  16 36  ARG 36  36  36  ARG ARG H . n 
P  16 37  ARG 37  37  37  ARG ARG H . n 
P  16 38  LEU 38  38  38  LEU LEU H . n 
P  16 39  LEU 39  39  39  LEU LEU H . n 
P  16 40  ALA 40  40  40  ALA ALA H . n 
P  16 41  ARG 41  41  41  ARG ARG H . n 
P  16 42  PHE 42  42  42  PHE PHE H . n 
P  16 43  GLN 43  43  43  GLN GLN H . n 
P  16 44  VAL 44  44  44  VAL VAL H . n 
P  16 45  ARG 45  45  45  ARG ARG H . n 
P  16 46  MET 46  46  46  MET MET H . n 
P  16 47  GLY 47  47  47  GLY GLY H . n 
P  16 48  PRO 48  48  48  PRO PRO H . n 
P  16 49  ASN 49  49  49  ASN ASN H . n 
P  16 50  ARG 50  50  50  ARG ARG H . n 
P  16 51  VAL 51  51  51  VAL VAL H . n 
P  16 52  GLY 52  52  52  GLY GLY H . n 
P  16 53  PRO 53  53  53  PRO PRO H . n 
P  16 54  PHE 54  54  54  PHE PHE H . n 
P  16 55  GLY 55  55  55  GLY GLY H . n 
P  16 56  LEU 56  56  56  LEU LEU H . n 
P  16 57  LEU 57  57  57  LEU LEU H . n 
P  16 58  GLN 58  58  58  GLN GLN H . n 
P  16 59  PRO 59  59  59  PRO PRO H . n 
P  16 60  LEU 60  60  60  LEU LEU H . n 
P  16 61  ALA 61  61  61  ALA ALA H . n 
P  16 62  ASP 62  62  62  ASP ASP H . n 
P  16 63  ALA 63  63  63  ALA ALA H . n 
P  16 64  ILE 64  64  64  ILE ILE H . n 
P  16 65  LYS 65  65  65  LYS LYS H . n 
P  16 66  SER 66  66  66  SER SER H . n 
P  16 67  ILE 67  67  67  ILE ILE H . n 
P  16 68  PHE 68  68  68  PHE PHE H . n 
P  16 69  LYS 69  69  69  LYS LYS H . n 
P  16 70  GLU 70  70  70  GLU GLU H . n 
P  16 71  ASP 71  71  71  ASP ASP H . n 
P  16 72  ILE 72  72  72  ILE ILE H . n 
P  16 73  VAL 73  73  73  VAL VAL H . n 
P  16 74  VAL 74  74  74  VAL VAL H . n 
P  16 75  ALA 75  75  75  ALA ALA H . n 
P  16 76  GLN 76  76  76  GLN GLN H . n 
P  16 77  ALA 77  77  77  ALA ALA H . n 
P  16 78  ASP 78  78  78  ASP ASP H . n 
P  16 79  ARG 79  79  79  ARG ARG H . n 
P  16 80  PHE 80  80  80  PHE PHE H . n 
P  16 81  LEU 81  81  81  LEU LEU H . n 
P  16 82  PHE 82  82  82  PHE PHE H . n 
P  16 83  VAL 83  83  83  VAL VAL H . n 
P  16 84  LEU 84  84  84  LEU LEU H . n 
P  16 85  ALA 85  85  85  ALA ALA H . n 
P  16 86  PRO 86  86  86  PRO PRO H . n 
P  16 87  LEU 87  87  87  LEU LEU H . n 
P  16 88  ILE 88  88  88  ILE ILE H . n 
P  16 89  SER 89  89  89  SER SER H . n 
P  16 90  VAL 90  90  90  VAL VAL H . n 
P  16 91  VAL 91  91  91  VAL VAL H . n 
P  16 92  PHE 92  92  92  PHE PHE H . n 
P  16 93  ALA 93  93  93  ALA ALA H . n 
P  16 94  LEU 94  94  94  LEU LEU H . n 
P  16 95  LEU 95  95  95  LEU LEU H . n 
P  16 96  ALA 96  96  96  ALA ALA H . n 
P  16 97  PHE 97  97  97  PHE PHE H . n 
P  16 98  GLY 98  98  98  GLY GLY H . n 
P  16 99  LEU 99  99  99  LEU LEU H . n 
P  16 100 ILE 100 100 100 ILE ILE H . n 
P  16 101 PRO 101 101 101 PRO PRO H . n 
P  16 102 PHE 102 102 102 PHE PHE H . n 
P  16 103 GLY 103 103 103 GLY GLY H . n 
P  16 104 PRO 104 104 104 PRO PRO H . n 
P  16 105 PRO 105 105 105 PRO PRO H . n 
P  16 106 GLY 106 106 106 GLY GLY H . n 
P  16 107 SER 107 107 107 SER SER H . n 
P  16 108 PHE 108 108 108 PHE PHE H . n 
P  16 109 PHE 109 109 109 PHE PHE H . n 
P  16 110 GLY 110 110 110 GLY GLY H . n 
P  16 111 TYR 111 111 111 TYR TYR H . n 
P  16 112 GLN 112 112 112 GLN GLN H . n 
P  16 113 PRO 113 113 113 PRO PRO H . n 
P  16 114 TRP 114 114 114 TRP TRP H . n 
P  16 115 VAL 115 115 115 VAL VAL H . n 
P  16 116 ILE 116 116 116 ILE ILE H . n 
P  16 117 ASN 117 117 117 ASN ASN H . n 
P  16 118 LEU 118 118 118 LEU LEU H . n 
P  16 119 ASP 119 119 119 ASP ASP H . n 
P  16 120 LEU 120 120 120 LEU LEU H . n 
P  16 121 GLY 121 121 121 GLY GLY H . n 
P  16 122 ILE 122 122 122 ILE ILE H . n 
P  16 123 LEU 123 123 123 LEU LEU H . n 
P  16 124 TYR 124 124 124 TYR TYR H . n 
P  16 125 LEU 125 125 125 LEU LEU H . n 
P  16 126 PHE 126 126 126 PHE PHE H . n 
P  16 127 ALA 127 127 127 ALA ALA H . n 
P  16 128 VAL 128 128 128 VAL VAL H . n 
P  16 129 SER 129 129 129 SER SER H . n 
P  16 130 GLU 130 130 130 GLU GLU H . n 
P  16 131 LEU 131 131 131 LEU LEU H . n 
P  16 132 ALA 132 132 132 ALA ALA H . n 
P  16 133 VAL 133 133 133 VAL VAL H . n 
P  16 134 TYR 134 134 134 TYR TYR H . n 
P  16 135 GLY 135 135 135 GLY GLY H . n 
P  16 136 ILE 136 136 136 ILE ILE H . n 
P  16 137 PHE 137 137 137 PHE PHE H . n 
P  16 138 LEU 138 138 138 LEU LEU H . n 
P  16 139 SER 139 139 139 SER SER H . n 
P  16 140 GLY 140 140 140 GLY GLY H . n 
P  16 141 TRP 141 141 141 TRP TRP H . n 
P  16 142 ALA 142 142 142 ALA ALA H . n 
P  16 143 SER 143 143 143 SER SER H . n 
P  16 144 GLY 144 144 144 GLY GLY H . n 
P  16 145 SER 145 145 145 SER SER H . n 
P  16 146 LYS 146 146 146 LYS LYS H . n 
P  16 147 TYR 147 147 147 TYR TYR H . n 
P  16 148 SER 148 148 148 SER SER H . n 
P  16 149 LEU 149 149 149 LEU LEU H . n 
P  16 150 LEU 150 150 150 LEU LEU H . n 
P  16 151 GLY 151 151 151 GLY GLY H . n 
P  16 152 SER 152 152 152 SER SER H . n 
P  16 153 LEU 153 153 153 LEU LEU H . n 
P  16 154 ARG 154 154 154 ARG ARG H . n 
P  16 155 SER 155 155 155 SER SER H . n 
P  16 156 SER 156 156 156 SER SER H . n 
P  16 157 ALA 157 157 157 ALA ALA H . n 
P  16 158 SER 158 158 158 SER SER H . n 
P  16 159 LEU 159 159 159 LEU LEU H . n 
P  16 160 ILE 160 160 160 ILE ILE H . n 
P  16 161 SER 161 161 161 SER SER H . n 
P  16 162 TYR 162 162 162 TYR TYR H . n 
P  16 163 GLU 163 163 163 GLU GLU H . n 
P  16 164 LEU 164 164 164 LEU LEU H . n 
P  16 165 GLY 165 165 165 GLY GLY H . n 
P  16 166 LEU 166 166 166 LEU LEU H . n 
P  16 167 GLY 167 167 167 GLY GLY H . n 
P  16 168 LEU 168 168 168 LEU LEU H . n 
P  16 169 ALA 169 169 169 ALA ALA H . n 
P  16 170 LEU 170 170 170 LEU LEU H . n 
P  16 171 LEU 171 171 171 LEU LEU H . n 
P  16 172 ALA 172 172 172 ALA ALA H . n 
P  16 173 PRO 173 173 173 PRO PRO H . n 
P  16 174 VAL 174 174 174 VAL VAL H . n 
P  16 175 LEU 175 175 175 LEU LEU H . n 
P  16 176 LEU 176 176 176 LEU LEU H . n 
P  16 177 VAL 177 177 177 VAL VAL H . n 
P  16 178 GLY 178 178 178 GLY GLY H . n 
P  16 179 SER 179 179 179 SER SER H . n 
P  16 180 LEU 180 180 180 LEU LEU H . n 
P  16 181 ASN 181 181 181 ASN ASN H . n 
P  16 182 LEU 182 182 182 LEU LEU H . n 
P  16 183 ASN 183 183 183 ASN ASN H . n 
P  16 184 ASP 184 184 184 ASP ASP H . n 
P  16 185 ILE 185 185 185 ILE ILE H . n 
P  16 186 VAL 186 186 186 VAL VAL H . n 
P  16 187 ASN 187 187 187 ASN ASN H . n 
P  16 188 TRP 188 188 188 TRP TRP H . n 
P  16 189 GLN 189 189 189 GLN GLN H . n 
P  16 190 LYS 190 190 190 LYS LYS H . n 
P  16 191 GLU 191 191 191 GLU GLU H . n 
P  16 192 HIS 192 192 192 HIS HIS H . n 
P  16 193 GLY 193 193 193 GLY GLY H . n 
P  16 194 TRP 194 194 194 TRP TRP H . n 
P  16 195 LEU 195 195 195 LEU LEU H . n 
P  16 196 PHE 196 196 196 PHE PHE H . n 
P  16 197 LEU 197 197 197 LEU LEU H . n 
P  16 198 TYR 198 198 198 TYR TYR H . n 
P  16 199 ALA 199 199 199 ALA ALA H . n 
P  16 200 PHE 200 200 200 PHE PHE H . n 
P  16 201 PRO 201 201 201 PRO PRO H . n 
P  16 202 ALA 202 202 202 ALA ALA H . n 
P  16 203 PHE 203 203 203 PHE PHE H . n 
P  16 204 LEU 204 204 204 LEU LEU H . n 
P  16 205 VAL 205 205 205 VAL VAL H . n 
P  16 206 TYR 206 206 206 TYR TYR H . n 
P  16 207 LEU 207 207 207 LEU LEU H . n 
P  16 208 ILE 208 208 208 ILE ILE H . n 
P  16 209 ALA 209 209 209 ALA ALA H . n 
P  16 210 SER 210 210 210 SER SER H . n 
P  16 211 MET 211 211 211 MET MET H . n 
P  16 212 ALA 212 212 212 ALA ALA H . n 
P  16 213 GLU 213 213 213 GLU GLU H . n 
P  16 214 ALA 214 214 214 ALA ALA H . n 
P  16 215 ALA 215 215 215 ALA ALA H . n 
P  16 216 ARG 216 216 216 ARG ARG H . n 
P  16 217 THR 217 217 217 THR THR H . n 
P  16 218 PRO 218 218 218 PRO PRO H . n 
P  16 219 PHE 219 219 219 PHE PHE H . n 
P  16 220 ASP 220 220 220 ASP ASP H . n 
P  16 221 LEU 221 221 221 LEU LEU H . n 
P  16 222 PRO 222 222 222 PRO PRO H . n 
P  16 223 GLU 223 223 223 GLU GLU H . n 
P  16 224 ALA 224 224 224 ALA ALA H . n 
P  16 225 GLU 225 225 225 GLU GLU H . n 
P  16 226 GLN 226 226 226 GLN GLN H . n 
P  16 227 GLU 227 227 227 GLU GLU H . n 
P  16 228 LEU 228 228 228 LEU LEU H . n 
P  16 229 VAL 229 229 229 VAL VAL H . n 
P  16 230 GLY 230 230 230 GLY GLY H . n 
P  16 231 GLY 231 231 231 GLY GLY H . n 
P  16 232 TYR 232 232 232 TYR TYR H . n 
P  16 233 HIS 233 233 233 HIS HIS H . n 
P  16 234 THR 234 234 234 THR THR H . n 
P  16 235 GLU 235 235 235 GLU GLU H . n 
P  16 236 TYR 236 236 236 TYR TYR H . n 
P  16 237 SER 237 237 237 SER SER H . n 
P  16 238 SER 238 238 238 SER SER H . n 
P  16 239 ILE 239 239 239 ILE ILE H . n 
P  16 240 LYS 240 240 240 LYS LYS H . n 
P  16 241 TRP 241 241 241 TRP TRP H . n 
P  16 242 ALA 242 242 242 ALA ALA H . n 
P  16 243 LEU 243 243 243 LEU LEU H . n 
P  16 244 PHE 244 244 244 PHE PHE H . n 
P  16 245 GLN 245 245 245 GLN GLN H . n 
P  16 246 MET 246 246 246 MET MET H . n 
P  16 247 ALA 247 247 247 ALA ALA H . n 
P  16 248 GLU 248 248 248 GLU GLU H . n 
P  16 249 TYR 249 249 249 TYR TYR H . n 
P  16 250 ILE 250 250 250 ILE ILE H . n 
P  16 251 HIS 251 251 251 HIS HIS H . n 
P  16 252 PHE 252 252 252 PHE PHE H . n 
P  16 253 ILE 253 253 253 ILE ILE H . n 
P  16 254 THR 254 254 254 THR THR H . n 
P  16 255 ALA 255 255 255 ALA ALA H . n 
P  16 256 SER 256 256 256 SER SER H . n 
P  16 257 ALA 257 257 257 ALA ALA H . n 
P  16 258 LEU 258 258 258 LEU LEU H . n 
P  16 259 ILE 259 259 259 ILE ILE H . n 
P  16 260 PRO 260 260 260 PRO PRO H . n 
P  16 261 THR 261 261 261 THR THR H . n 
P  16 262 LEU 262 262 262 LEU LEU H . n 
P  16 263 PHE 263 263 263 PHE PHE H . n 
P  16 264 LEU 264 264 264 LEU LEU H . n 
P  16 265 GLY 265 265 265 GLY GLY H . n 
P  16 266 GLY 266 266 266 GLY GLY H . n 
P  16 267 TRP 267 267 267 TRP TRP H . n 
P  16 268 THR 268 268 268 THR THR H . n 
P  16 269 MET 269 269 269 MET MET H . n 
P  16 270 PRO 270 270 270 PRO PRO H . n 
P  16 271 VAL 271 271 271 VAL VAL H . n 
P  16 272 LEU 272 272 272 LEU LEU H . n 
P  16 273 GLU 273 273 273 GLU GLU H . n 
P  16 274 VAL 274 274 274 VAL VAL H . n 
P  16 275 PRO 275 275 275 PRO PRO H . n 
P  16 276 TYR 276 276 276 TYR TYR H . n 
P  16 277 LEU 277 277 277 LEU LEU H . n 
P  16 278 TRP 278 278 278 TRP TRP H . n 
P  16 279 MET 279 279 279 MET MET H . n 
P  16 280 PHE 280 280 280 PHE PHE H . n 
P  16 281 LEU 281 281 281 LEU LEU H . n 
P  16 282 LYS 282 282 282 LYS LYS H . n 
P  16 283 ILE 283 283 283 ILE ILE H . n 
P  16 284 ALA 284 284 284 ALA ALA H . n 
P  16 285 PHE 285 285 285 PHE PHE H . n 
P  16 286 PHE 286 286 286 PHE PHE H . n 
P  16 287 LEU 287 287 287 LEU LEU H . n 
P  16 288 PHE 288 288 288 PHE PHE H . n 
P  16 289 PHE 289 289 289 PHE PHE H . n 
P  16 290 PHE 290 290 290 PHE PHE H . n 
P  16 291 ILE 291 291 291 ILE ILE H . n 
P  16 292 TRP 292 292 292 TRP TRP H . n 
P  16 293 ILE 293 293 293 ILE ILE H . n 
P  16 294 ARG 294 294 294 ARG ARG H . n 
P  16 295 ALA 295 295 295 ALA ALA H . n 
P  16 296 THR 296 296 296 THR THR H . n 
P  16 297 TRP 297 297 297 TRP TRP H . n 
P  16 298 PHE 298 298 298 PHE PHE H . n 
P  16 299 ARG 299 299 299 ARG ARG H . n 
P  16 300 LEU 300 300 300 LEU LEU H . n 
P  16 301 ARG 301 301 301 ARG ARG H . n 
P  16 302 TYR 302 302 302 TYR TYR H . n 
P  16 303 ASP 303 303 303 ASP ASP H . n 
P  16 304 GLN 304 304 304 GLN GLN H . n 
P  16 305 LEU 305 305 305 LEU LEU H . n 
P  16 306 LEU 306 306 306 LEU LEU H . n 
P  16 307 ARG 307 307 307 ARG ARG H . n 
P  16 308 PHE 308 308 308 PHE PHE H . n 
P  16 309 GLY 309 309 309 GLY GLY H . n 
P  16 310 TRP 310 310 310 TRP TRP H . n 
P  16 311 GLY 311 311 311 GLY GLY H . n 
P  16 312 PHE 312 312 312 PHE PHE H . n 
P  16 313 LEU 313 313 313 LEU LEU H . n 
P  16 314 PHE 314 314 314 PHE PHE H . n 
P  16 315 PRO 315 315 315 PRO PRO H . n 
P  16 316 LEU 316 316 316 LEU LEU H . n 
P  16 317 ALA 317 317 317 ALA ALA H . n 
P  16 318 LEU 318 318 318 LEU LEU H . n 
P  16 319 LEU 319 319 319 LEU LEU H . n 
P  16 320 TRP 320 320 320 TRP TRP H . n 
P  16 321 PHE 321 321 321 PHE PHE H . n 
P  16 322 LEU 322 322 322 LEU LEU H . n 
P  16 323 VAL 323 323 323 VAL VAL H . n 
P  16 324 THR 324 324 324 THR THR H . n 
P  16 325 ALA 325 325 325 ALA ALA H . n 
P  16 326 LEU 326 326 326 LEU LEU H . n 
P  16 327 VAL 327 327 327 VAL VAL H . n 
P  16 328 VAL 328 328 328 VAL VAL H . n 
P  16 329 ALA 329 329 329 ALA ALA H . n 
P  16 330 LEU 330 330 330 LEU LEU H . n 
P  16 331 ASP 331 331 331 ASP ASP H . n 
P  16 332 LEU 332 332 332 LEU LEU H . n 
P  16 333 PRO 333 333 333 PRO PRO H . n 
P  16 334 ARG 334 334 334 ARG ARG H . n 
P  16 335 THR 335 335 335 THR THR H . n 
P  16 336 TYR 336 336 336 TYR TYR H . n 
P  16 337 LEU 337 337 337 LEU LEU H . n 
P  16 338 LEU 338 338 338 LEU LEU H . n 
P  16 339 TYR 339 339 339 TYR TYR H . n 
P  16 340 LEU 340 340 340 LEU LEU H . n 
P  16 341 SER 341 341 341 SER SER H . n 
P  16 342 ALA 342 342 342 ALA ALA H . n 
P  16 343 LEU 343 343 343 LEU LEU H . n 
P  16 344 SER 344 344 344 SER SER H . n 
P  16 345 PHE 345 345 345 PHE PHE H . n 
P  16 346 LEU 346 346 346 LEU LEU H . n 
P  16 347 VAL 347 347 347 VAL VAL H . n 
P  16 348 LEU 348 348 348 LEU LEU H . n 
P  16 349 LEU 349 349 349 LEU LEU H . n 
P  16 350 GLY 350 350 350 GLY GLY H . n 
P  16 351 ALA 351 351 351 ALA ALA H . n 
P  16 352 VAL 352 352 352 VAL VAL H . n 
P  16 353 LEU 353 353 353 LEU LEU H . n 
P  16 354 TYR 354 354 354 TYR TYR H . n 
P  16 355 THR 355 355 ?   ?   ?   H . n 
P  16 356 PRO 356 356 ?   ?   ?   H . n 
P  16 357 LYS 357 357 ?   ?   ?   H . n 
P  16 358 PRO 358 358 ?   ?   ?   H . n 
P  16 359 ALA 359 359 ?   ?   ?   H . n 
P  16 360 ARG 360 360 ?   ?   ?   H . n 
P  16 361 LYS 361 361 ?   ?   ?   H . n 
P  16 362 GLY 362 362 ?   ?   ?   H . n 
P  16 363 GLY 363 363 ?   ?   ?   H . n 
P  16 364 GLY 364 364 ?   ?   ?   H . n 
P  16 365 ALA 365 365 ?   ?   ?   H . n 
Q  1  1   MET 1   1   ?   ?   ?   B . n 
Q  1  2   THR 2   2   2   THR THR B . n 
Q  1  3   GLY 3   3   3   GLY GLY B . n 
Q  1  4   PRO 4   4   4   PRO PRO B . n 
Q  1  5   ILE 5   5   5   ILE ILE B . n 
Q  1  6   LEU 6   6   6   LEU LEU B . n 
Q  1  7   SER 7   7   7   SER SER B . n 
Q  1  8   GLY 8   8   8   GLY GLY B . n 
Q  1  9   LEU 9   9   9   LEU LEU B . n 
Q  1  10  ASP 10  10  10  ASP ASP B . n 
Q  1  11  PRO 11  11  11  PRO PRO B . n 
Q  1  12  ARG 12  12  12  ARG ARG B . n 
Q  1  13  PHE 13  13  13  PHE PHE B . n 
Q  1  14  GLU 14  14  14  GLU GLU B . n 
Q  1  15  ARG 15  15  15  ARG ARG B . n 
Q  1  16  THR 16  16  16  THR THR B . n 
Q  1  17  LEU 17  17  17  LEU LEU B . n 
Q  1  18  TYR 18  18  18  TYR TYR B . n 
Q  1  19  ALA 19  19  19  ALA ALA B . n 
Q  1  20  HIS 20  20  20  HIS HIS B . n 
Q  1  21  VAL 21  21  21  VAL VAL B . n 
Q  1  22  GLY 22  22  22  GLY GLY B . n 
Q  1  23  LYS 23  23  23  LYS LYS B . n 
Q  1  24  GLU 24  24  24  GLU GLU B . n 
Q  1  25  GLY 25  25  25  GLY GLY B . n 
Q  1  26  SER 26  26  26  SER SER B . n 
Q  1  27  TRP 27  27  27  TRP TRP B . n 
Q  1  28  THR 28  28  28  THR THR B . n 
Q  1  29  LEU 29  29  29  LEU LEU B . n 
Q  1  30  ASP 30  30  30  ASP ASP B . n 
Q  1  31  TYR 31  31  31  TYR TYR B . n 
Q  1  32  TYR 32  32  32  TYR TYR B . n 
Q  1  33  LEU 33  33  33  LEU LEU B . n 
Q  1  34  ARG 34  34  34  ARG ARG B . n 
Q  1  35  HIS 35  35  35  HIS HIS B . n 
Q  1  36  GLY 36  36  36  GLY GLY B . n 
Q  1  37  GLY 37  37  37  GLY GLY B . n 
Q  1  38  TYR 38  38  38  TYR TYR B . n 
Q  1  39  GLU 39  39  39  GLU GLU B . n 
Q  1  40  THR 40  40  40  THR THR B . n 
Q  1  41  ALA 41  41  41  ALA ALA B . n 
Q  1  42  LYS 42  42  42  LYS LYS B . n 
Q  1  43  ARG 43  43  43  ARG ARG B . n 
Q  1  44  VAL 44  44  44  VAL VAL B . n 
Q  1  45  LEU 45  45  45  LEU LEU B . n 
Q  1  46  LYS 46  46  46  LYS LYS B . n 
Q  1  47  GLU 47  47  47  GLU GLU B . n 
Q  1  48  LYS 48  48  48  LYS LYS B . n 
Q  1  49  THR 49  49  49  THR THR B . n 
Q  1  50  PRO 50  50  50  PRO PRO B . n 
Q  1  51  ASP 51  51  51  ASP ASP B . n 
Q  1  52  GLU 52  52  52  GLU GLU B . n 
Q  1  53  VAL 53  53  53  VAL VAL B . n 
Q  1  54  ILE 54  54  54  ILE ILE B . n 
Q  1  55  GLU 55  55  55  GLU GLU B . n 
Q  1  56  GLU 56  56  56  GLU GLU B . n 
Q  1  57  VAL 57  57  57  VAL VAL B . n 
Q  1  58  LYS 58  58  58  LYS LYS B . n 
Q  1  59  ARG 59  59  59  ARG ARG B . n 
Q  1  60  SER 60  60  60  SER SER B . n 
Q  1  61  GLY 61  61  61  GLY GLY B . n 
Q  1  62  LEU 62  62  62  LEU LEU B . n 
Q  1  63  ARG 63  63  63  ARG ARG B . n 
Q  1  64  GLY 64  64  64  GLY GLY B . n 
Q  1  65  ARG 65  65  65  ARG ARG B . n 
Q  1  66  GLY 66  66  66  GLY GLY B . n 
Q  1  67  GLY 67  67  67  GLY GLY B . n 
Q  1  68  ALA 68  68  68  ALA ALA B . n 
Q  1  69  GLY 69  69  69  GLY GLY B . n 
Q  1  70  PHE 70  70  70  PHE PHE B . n 
Q  1  71  PRO 71  71  71  PRO PRO B . n 
Q  1  72  THR 72  72  72  THR THR B . n 
Q  1  73  GLY 73  73  73  GLY GLY B . n 
Q  1  74  LEU 74  74  74  LEU LEU B . n 
Q  1  75  LYS 75  75  75  LYS LYS B . n 
Q  1  76  TRP 76  76  76  TRP TRP B . n 
Q  1  77  SER 77  77  77  SER SER B . n 
Q  1  78  PHE 78  78  78  PHE PHE B . n 
Q  1  79  MET 79  79  79  MET MET B . n 
Q  1  80  PRO 80  80  80  PRO PRO B . n 
Q  1  81  LYS 81  81  81  LYS LYS B . n 
Q  1  82  ASP 82  82  82  ASP ASP B . n 
Q  1  83  ASP 83  83  83  ASP ASP B . n 
Q  1  84  GLY 84  84  84  GLY GLY B . n 
Q  1  85  LYS 85  85  85  LYS LYS B . n 
Q  1  86  GLN 86  86  86  GLN GLN B . n 
Q  1  87  HIS 87  87  87  HIS HIS B . n 
Q  1  88  TYR 88  88  88  TYR TYR B . n 
Q  1  89  LEU 89  89  89  LEU LEU B . n 
Q  1  90  ILE 90  90  90  ILE ILE B . n 
Q  1  91  CYS 91  91  91  CYS CYS B . n 
Q  1  92  ASN 92  92  92  ASN ASN B . n 
Q  1  93  ALA 93  93  93  ALA ALA B . n 
Q  1  94  ASP 94  94  94  ASP ASP B . n 
Q  1  95  GLU 95  95  95  GLU GLU B . n 
Q  1  96  SER 96  96  96  SER SER B . n 
Q  1  97  GLU 97  97  97  GLU GLU B . n 
Q  1  98  PRO 98  98  98  PRO PRO B . n 
Q  1  99  GLY 99  99  99  GLY GLY B . n 
Q  1  100 SER 100 100 100 SER SER B . n 
Q  1  101 PHE 101 101 101 PHE PHE B . n 
Q  1  102 LYS 102 102 102 LYS LYS B . n 
Q  1  103 ASP 103 103 103 ASP ASP B . n 
Q  1  104 ARG 104 104 104 ARG ARG B . n 
Q  1  105 TYR 105 105 105 TYR TYR B . n 
Q  1  106 ILE 106 106 106 ILE ILE B . n 
Q  1  107 LEU 107 107 107 LEU LEU B . n 
Q  1  108 GLU 108 108 108 GLU GLU B . n 
Q  1  109 ASP 109 109 109 ASP ASP B . n 
Q  1  110 VAL 110 110 110 VAL VAL B . n 
Q  1  111 PRO 111 111 111 PRO PRO B . n 
Q  1  112 HIS 112 112 112 HIS HIS B . n 
Q  1  113 LEU 113 113 113 LEU LEU B . n 
Q  1  114 LEU 114 114 114 LEU LEU B . n 
Q  1  115 ILE 115 115 115 ILE ILE B . n 
Q  1  116 GLU 116 116 116 GLU GLU B . n 
Q  1  117 GLY 117 117 117 GLY GLY B . n 
Q  1  118 MET 118 118 118 MET MET B . n 
Q  1  119 ILE 119 119 119 ILE ILE B . n 
Q  1  120 LEU 120 120 120 LEU LEU B . n 
Q  1  121 ALA 121 121 121 ALA ALA B . n 
Q  1  122 GLY 122 122 122 GLY GLY B . n 
Q  1  123 TYR 123 123 123 TYR TYR B . n 
Q  1  124 ALA 124 124 124 ALA ALA B . n 
Q  1  125 ILE 125 125 125 ILE ILE B . n 
Q  1  126 ARG 126 126 126 ARG ARG B . n 
Q  1  127 ALA 127 127 127 ALA ALA B . n 
Q  1  128 THR 128 128 128 THR THR B . n 
Q  1  129 VAL 129 129 129 VAL VAL B . n 
Q  1  130 GLY 130 130 130 GLY GLY B . n 
Q  1  131 TYR 131 131 131 TYR TYR B . n 
Q  1  132 ILE 132 132 132 ILE ILE B . n 
Q  1  133 TYR 133 133 133 TYR TYR B . n 
Q  1  134 VAL 134 134 134 VAL VAL B . n 
Q  1  135 ARG 135 135 135 ARG ARG B . n 
Q  1  136 GLY 136 136 136 GLY GLY B . n 
Q  1  137 GLU 137 137 137 GLU GLU B . n 
Q  1  138 TYR 138 138 138 TYR TYR B . n 
Q  1  139 ARG 139 139 139 ARG ARG B . n 
Q  1  140 ARG 140 140 140 ARG ARG B . n 
Q  1  141 ALA 141 141 141 ALA ALA B . n 
Q  1  142 ALA 142 142 142 ALA ALA B . n 
Q  1  143 ASP 143 143 143 ASP ASP B . n 
Q  1  144 ARG 144 144 144 ARG ARG B . n 
Q  1  145 LEU 145 145 145 LEU LEU B . n 
Q  1  146 GLU 146 146 146 GLU GLU B . n 
Q  1  147 GLN 147 147 147 GLN GLN B . n 
Q  1  148 ALA 148 148 148 ALA ALA B . n 
Q  1  149 ILE 149 149 149 ILE ILE B . n 
Q  1  150 LYS 150 150 150 LYS LYS B . n 
Q  1  151 GLU 151 151 151 GLU GLU B . n 
Q  1  152 ALA 152 152 152 ALA ALA B . n 
Q  1  153 ARG 153 153 153 ARG ARG B . n 
Q  1  154 ALA 154 154 154 ALA ALA B . n 
Q  1  155 ARG 155 155 155 ARG ARG B . n 
Q  1  156 GLY 156 156 156 GLY GLY B . n 
Q  1  157 TYR 157 157 157 TYR TYR B . n 
Q  1  158 LEU 158 158 158 LEU LEU B . n 
Q  1  159 GLY 159 159 159 GLY GLY B . n 
Q  1  160 LYS 160 160 160 LYS LYS B . n 
Q  1  161 ASN 161 161 161 ASN ASN B . n 
Q  1  162 LEU 162 162 162 LEU LEU B . n 
Q  1  163 PHE 163 163 163 PHE PHE B . n 
Q  1  164 GLY 164 164 164 GLY GLY B . n 
Q  1  165 THR 165 165 165 THR THR B . n 
Q  1  166 ASP 166 166 166 ASP ASP B . n 
Q  1  167 PHE 167 167 167 PHE PHE B . n 
Q  1  168 SER 168 168 168 SER SER B . n 
Q  1  169 PHE 169 169 169 PHE PHE B . n 
Q  1  170 ASP 170 170 170 ASP ASP B . n 
Q  1  171 LEU 171 171 171 LEU LEU B . n 
Q  1  172 HIS 172 172 172 HIS HIS B . n 
Q  1  173 VAL 173 173 173 VAL VAL B . n 
Q  1  174 HIS 174 174 174 HIS HIS B . n 
Q  1  175 ARG 175 175 175 ARG ARG B . n 
Q  1  176 GLY 176 176 176 GLY GLY B . n 
Q  1  177 ALA 177 177 177 ALA ALA B . n 
Q  1  178 GLY 178 178 178 GLY GLY B . n 
Q  1  179 ALA 179 179 179 ALA ALA B . n 
Q  1  180 TYR 180 180 180 TYR TYR B . n 
Q  1  181 ILE 181 181 181 ILE ILE B . n 
Q  1  182 CYS 182 182 182 CYS CYS B . n 
Q  1  183 GLY 183 183 183 GLY GLY B . n 
Q  1  184 GLU 184 184 184 GLU GLU B . n 
Q  1  185 GLU 185 185 185 GLU GLU B . n 
Q  1  186 THR 186 186 186 THR THR B . n 
Q  1  187 ALA 187 187 187 ALA ALA B . n 
Q  1  188 LEU 188 188 188 LEU LEU B . n 
Q  1  189 MET 189 189 189 MET MET B . n 
Q  1  190 ASN 190 190 190 ASN ASN B . n 
Q  1  191 SER 191 191 191 SER SER B . n 
Q  1  192 LEU 192 192 192 LEU LEU B . n 
Q  1  193 GLU 193 193 193 GLU GLU B . n 
Q  1  194 GLY 194 194 194 GLY GLY B . n 
Q  1  195 LEU 195 195 195 LEU LEU B . n 
Q  1  196 ARG 196 196 196 ARG ARG B . n 
Q  1  197 ALA 197 197 197 ALA ALA B . n 
Q  1  198 ASN 198 198 198 ASN ASN B . n 
Q  1  199 PRO 199 199 199 PRO PRO B . n 
Q  1  200 ARG 200 200 200 ARG ARG B . n 
Q  1  201 LEU 201 201 201 LEU LEU B . n 
Q  1  202 LYS 202 202 202 LYS LYS B . n 
Q  1  203 PRO 203 203 203 PRO PRO B . n 
Q  1  204 PRO 204 204 204 PRO PRO B . n 
Q  1  205 PHE 205 205 205 PHE PHE B . n 
Q  1  206 PRO 206 206 206 PRO PRO B . n 
Q  1  207 ALA 207 207 207 ALA ALA B . n 
Q  1  208 GLN 208 208 208 GLN GLN B . n 
Q  1  209 SER 209 209 209 SER SER B . n 
Q  1  210 GLY 210 210 210 GLY GLY B . n 
Q  1  211 LEU 211 211 211 LEU LEU B . n 
Q  1  212 TRP 212 212 212 TRP TRP B . n 
Q  1  213 GLY 213 213 213 GLY GLY B . n 
Q  1  214 LYS 214 214 214 LYS LYS B . n 
Q  1  215 PRO 215 215 215 PRO PRO B . n 
Q  1  216 THR 216 216 216 THR THR B . n 
Q  1  217 THR 217 217 217 THR THR B . n 
Q  1  218 ILE 218 218 218 ILE ILE B . n 
Q  1  219 ASN 219 219 219 ASN ASN B . n 
Q  1  220 ASN 220 220 220 ASN ASN B . n 
Q  1  221 VAL 221 221 221 VAL VAL B . n 
Q  1  222 GLU 222 222 222 GLU GLU B . n 
Q  1  223 THR 223 223 223 THR THR B . n 
Q  1  224 LEU 224 224 224 LEU LEU B . n 
Q  1  225 ALA 225 225 225 ALA ALA B . n 
Q  1  226 SER 226 226 226 SER SER B . n 
Q  1  227 VAL 227 227 227 VAL VAL B . n 
Q  1  228 VAL 228 228 228 VAL VAL B . n 
Q  1  229 PRO 229 229 229 PRO PRO B . n 
Q  1  230 ILE 230 230 230 ILE ILE B . n 
Q  1  231 MET 231 231 231 MET MET B . n 
Q  1  232 GLU 232 232 232 GLU GLU B . n 
Q  1  233 ARG 233 233 233 ARG ARG B . n 
Q  1  234 GLY 234 234 234 GLY GLY B . n 
Q  1  235 ALA 235 235 235 ALA ALA B . n 
Q  1  236 ASP 236 236 236 ASP ASP B . n 
Q  1  237 TRP 237 237 237 TRP TRP B . n 
Q  1  238 PHE 238 238 238 PHE PHE B . n 
Q  1  239 ALA 239 239 239 ALA ALA B . n 
Q  1  240 GLN 240 240 240 GLN GLN B . n 
Q  1  241 MET 241 241 241 MET MET B . n 
Q  1  242 GLY 242 242 242 GLY GLY B . n 
Q  1  243 THR 243 243 243 THR THR B . n 
Q  1  244 GLU 244 244 244 GLU GLU B . n 
Q  1  245 GLN 245 245 245 GLN GLN B . n 
Q  1  246 SER 246 246 246 SER SER B . n 
Q  1  247 LYS 247 247 247 LYS LYS B . n 
Q  1  248 GLY 248 248 248 GLY GLY B . n 
Q  1  249 MET 249 249 249 MET MET B . n 
Q  1  250 LYS 250 250 250 LYS LYS B . n 
Q  1  251 LEU 251 251 251 LEU LEU B . n 
Q  1  252 TYR 252 252 252 TYR TYR B . n 
Q  1  253 GLN 253 253 253 GLN GLN B . n 
Q  1  254 ILE 254 254 254 ILE ILE B . n 
Q  1  255 SER 255 255 255 SER SER B . n 
Q  1  256 GLY 256 256 256 GLY GLY B . n 
Q  1  257 PRO 257 257 257 PRO PRO B . n 
Q  1  258 VAL 258 258 258 VAL VAL B . n 
Q  1  259 LYS 259 259 259 LYS LYS B . n 
Q  1  260 ARG 260 260 260 ARG ARG B . n 
Q  1  261 PRO 261 261 261 PRO PRO B . n 
Q  1  262 GLY 262 262 262 GLY GLY B . n 
Q  1  263 VAL 263 263 263 VAL VAL B . n 
Q  1  264 TYR 264 264 264 TYR TYR B . n 
Q  1  265 GLU 265 265 265 GLU GLU B . n 
Q  1  266 LEU 266 266 266 LEU LEU B . n 
Q  1  267 PRO 267 267 267 PRO PRO B . n 
Q  1  268 MET 268 268 268 MET MET B . n 
Q  1  269 GLY 269 269 269 GLY GLY B . n 
Q  1  270 THR 270 270 270 THR THR B . n 
Q  1  271 THR 271 271 271 THR THR B . n 
Q  1  272 PHE 272 272 272 PHE PHE B . n 
Q  1  273 ARG 273 273 273 ARG ARG B . n 
Q  1  274 GLU 274 274 274 GLU GLU B . n 
Q  1  275 LEU 275 275 275 LEU LEU B . n 
Q  1  276 ILE 276 276 276 ILE ILE B . n 
Q  1  277 TYR 277 277 277 TYR TYR B . n 
Q  1  278 GLU 278 278 278 GLU GLU B . n 
Q  1  279 TRP 279 279 279 TRP TRP B . n 
Q  1  280 ALA 280 280 280 ALA ALA B . n 
Q  1  281 GLY 281 281 281 GLY GLY B . n 
Q  1  282 GLY 282 282 282 GLY GLY B . n 
Q  1  283 PRO 283 283 283 PRO PRO B . n 
Q  1  284 LEU 284 284 284 LEU LEU B . n 
Q  1  285 GLU 285 285 285 GLU GLU B . n 
Q  1  286 PRO 286 286 286 PRO PRO B . n 
Q  1  287 ILE 287 287 287 ILE ILE B . n 
Q  1  288 GLN 288 288 288 GLN GLN B . n 
Q  1  289 ALA 289 289 289 ALA ALA B . n 
Q  1  290 ILE 290 290 290 ILE ILE B . n 
Q  1  291 ILE 291 291 291 ILE ILE B . n 
Q  1  292 PRO 292 292 292 PRO PRO B . n 
Q  1  293 GLY 293 293 293 GLY GLY B . n 
Q  1  294 GLY 294 294 294 GLY GLY B . n 
Q  1  295 SER 295 295 295 SER SER B . n 
Q  1  296 SER 296 296 296 SER SER B . n 
Q  1  297 THR 297 297 297 THR THR B . n 
Q  1  298 PRO 298 298 298 PRO PRO B . n 
Q  1  299 PRO 299 299 299 PRO PRO B . n 
Q  1  300 LEU 300 300 300 LEU LEU B . n 
Q  1  301 PRO 301 301 301 PRO PRO B . n 
Q  1  302 PHE 302 302 302 PHE PHE B . n 
Q  1  303 THR 303 303 303 THR THR B . n 
Q  1  304 GLU 304 304 304 GLU GLU B . n 
Q  1  305 GLU 305 305 305 GLU GLU B . n 
Q  1  306 VAL 306 306 306 VAL VAL B . n 
Q  1  307 LEU 307 307 307 LEU LEU B . n 
Q  1  308 ASP 308 308 308 ASP ASP B . n 
Q  1  309 THR 309 309 309 THR THR B . n 
Q  1  310 PRO 310 310 310 PRO PRO B . n 
Q  1  311 MET 311 311 311 MET MET B . n 
Q  1  312 SER 312 312 312 SER SER B . n 
Q  1  313 TYR 313 313 313 TYR TYR B . n 
Q  1  314 GLU 314 314 314 GLU GLU B . n 
Q  1  315 HIS 315 315 315 HIS HIS B . n 
Q  1  316 LEU 316 316 316 LEU LEU B . n 
Q  1  317 GLN 317 317 317 GLN GLN B . n 
Q  1  318 ALA 318 318 318 ALA ALA B . n 
Q  1  319 LYS 319 319 319 LYS LYS B . n 
Q  1  320 GLY 320 320 320 GLY GLY B . n 
Q  1  321 SER 321 321 321 SER SER B . n 
Q  1  322 MET 322 322 322 MET MET B . n 
Q  1  323 LEU 323 323 323 LEU LEU B . n 
Q  1  324 GLY 324 324 324 GLY GLY B . n 
Q  1  325 THR 325 325 325 THR THR B . n 
Q  1  326 GLY 326 326 326 GLY GLY B . n 
Q  1  327 GLY 327 327 327 GLY GLY B . n 
Q  1  328 VAL 328 328 328 VAL VAL B . n 
Q  1  329 ILE 329 329 329 ILE ILE B . n 
Q  1  330 LEU 330 330 330 LEU LEU B . n 
Q  1  331 ILE 331 331 331 ILE ILE B . n 
Q  1  332 PRO 332 332 332 PRO PRO B . n 
Q  1  333 GLU 333 333 333 GLU GLU B . n 
Q  1  334 ARG 334 334 334 ARG ARG B . n 
Q  1  335 VAL 335 335 335 VAL VAL B . n 
Q  1  336 SER 336 336 336 SER SER B . n 
Q  1  337 MET 337 337 337 MET MET B . n 
Q  1  338 VAL 338 338 338 VAL VAL B . n 
Q  1  339 ASP 339 339 339 ASP ASP B . n 
Q  1  340 ALA 340 340 340 ALA ALA B . n 
Q  1  341 MET 341 341 341 MET MET B . n 
Q  1  342 TRP 342 342 342 TRP TRP B . n 
Q  1  343 ASN 343 343 343 ASN ASN B . n 
Q  1  344 LEU 344 344 344 LEU LEU B . n 
Q  1  345 THR 345 345 345 THR THR B . n 
Q  1  346 ARG 346 346 346 ARG ARG B . n 
Q  1  347 PHE 347 347 347 PHE PHE B . n 
Q  1  348 TYR 348 348 348 TYR TYR B . n 
Q  1  349 ALA 349 349 349 ALA ALA B . n 
Q  1  350 HIS 350 350 350 HIS HIS B . n 
Q  1  351 GLU 351 351 351 GLU GLU B . n 
Q  1  352 SER 352 352 352 SER SER B . n 
Q  1  353 CYS 353 353 353 CYS CYS B . n 
Q  1  354 GLY 354 354 354 GLY GLY B . n 
Q  1  355 LYS 355 355 355 LYS LYS B . n 
Q  1  356 CYS 356 356 356 CYS CYS B . n 
Q  1  357 THR 357 357 357 THR THR B . n 
Q  1  358 PRO 358 358 358 PRO PRO B . n 
Q  1  359 CYS 359 359 359 CYS CYS B . n 
Q  1  360 ARG 360 360 360 ARG ARG B . n 
Q  1  361 GLU 361 361 361 GLU GLU B . n 
Q  1  362 GLY 362 362 362 GLY GLY B . n 
Q  1  363 VAL 363 363 363 VAL VAL B . n 
Q  1  364 ALA 364 364 364 ALA ALA B . n 
Q  1  365 GLY 365 365 365 GLY GLY B . n 
Q  1  366 PHE 366 366 366 PHE PHE B . n 
Q  1  367 MET 367 367 367 MET MET B . n 
Q  1  368 VAL 368 368 368 VAL VAL B . n 
Q  1  369 ASN 369 369 369 ASN ASN B . n 
Q  1  370 LEU 370 370 370 LEU LEU B . n 
Q  1  371 PHE 371 371 371 PHE PHE B . n 
Q  1  372 ALA 372 372 372 ALA ALA B . n 
Q  1  373 LYS 373 373 373 LYS LYS B . n 
Q  1  374 ILE 374 374 374 ILE ILE B . n 
Q  1  375 GLY 375 375 375 GLY GLY B . n 
Q  1  376 THR 376 376 376 THR THR B . n 
Q  1  377 GLY 377 377 377 GLY GLY B . n 
Q  1  378 GLN 378 378 378 GLN GLN B . n 
Q  1  379 GLY 379 379 379 GLY GLY B . n 
Q  1  380 GLU 380 380 380 GLU GLU B . n 
Q  1  381 GLU 381 381 381 GLU GLU B . n 
Q  1  382 LYS 382 382 382 LYS LYS B . n 
Q  1  383 ASP 383 383 383 ASP ASP B . n 
Q  1  384 VAL 384 384 384 VAL VAL B . n 
Q  1  385 GLU 385 385 385 GLU GLU B . n 
Q  1  386 ASN 386 386 386 ASN ASN B . n 
Q  1  387 LEU 387 387 387 LEU LEU B . n 
Q  1  388 GLU 388 388 388 GLU GLU B . n 
Q  1  389 ALA 389 389 389 ALA ALA B . n 
Q  1  390 LEU 390 390 390 LEU LEU B . n 
Q  1  391 LEU 391 391 391 LEU LEU B . n 
Q  1  392 PRO 392 392 392 PRO PRO B . n 
Q  1  393 LEU 393 393 393 LEU LEU B . n 
Q  1  394 ILE 394 394 394 ILE ILE B . n 
Q  1  395 GLU 395 395 395 GLU GLU B . n 
Q  1  396 GLY 396 396 396 GLY GLY B . n 
Q  1  397 ARG 397 397 397 ARG ARG B . n 
Q  1  398 SER 398 398 398 SER SER B . n 
Q  1  399 PHE 399 399 399 PHE PHE B . n 
Q  1  400 CYS 400 400 400 CYS CYS B . n 
Q  1  401 PRO 401 401 401 PRO PRO B . n 
Q  1  402 LEU 402 402 402 LEU LEU B . n 
Q  1  403 ALA 403 403 403 ALA ALA B . n 
Q  1  404 ASP 404 404 404 ASP ASP B . n 
Q  1  405 ALA 405 405 405 ALA ALA B . n 
Q  1  406 ALA 406 406 406 ALA ALA B . n 
Q  1  407 VAL 407 407 407 VAL VAL B . n 
Q  1  408 TRP 408 408 408 TRP TRP B . n 
Q  1  409 PRO 409 409 409 PRO PRO B . n 
Q  1  410 VAL 410 410 410 VAL VAL B . n 
Q  1  411 LYS 411 411 411 LYS LYS B . n 
Q  1  412 GLY 412 412 412 GLY GLY B . n 
Q  1  413 SER 413 413 413 SER SER B . n 
Q  1  414 LEU 414 414 414 LEU LEU B . n 
Q  1  415 ARG 415 415 415 ARG ARG B . n 
Q  1  416 HIS 416 416 416 HIS HIS B . n 
Q  1  417 PHE 417 417 417 PHE PHE B . n 
Q  1  418 LYS 418 418 418 LYS LYS B . n 
Q  1  419 ASP 419 419 419 ASP ASP B . n 
Q  1  420 GLN 420 420 420 GLN GLN B . n 
Q  1  421 TYR 421 421 421 TYR TYR B . n 
Q  1  422 LEU 422 422 422 LEU LEU B . n 
Q  1  423 ALA 423 423 423 ALA ALA B . n 
Q  1  424 LEU 424 424 424 LEU LEU B . n 
Q  1  425 ALA 425 425 425 ALA ALA B . n 
Q  1  426 ARG 426 426 426 ARG ARG B . n 
Q  1  427 GLU 427 427 427 GLU GLU B . n 
Q  1  428 LYS 428 428 428 LYS LYS B . n 
Q  1  429 ARG 429 429 429 ARG ARG B . n 
Q  1  430 PRO 430 430 430 PRO PRO B . n 
Q  1  431 VAL 431 431 431 VAL VAL B . n 
Q  1  432 PRO 432 432 432 PRO PRO B . n 
Q  1  433 ARG 433 433 433 ARG ARG B . n 
Q  1  434 PRO 434 434 434 PRO PRO B . n 
Q  1  435 SER 435 435 435 SER SER B . n 
Q  1  436 LEU 436 436 436 LEU LEU B . n 
Q  1  437 TRP 437 437 437 TRP TRP B . n 
Q  1  438 ARG 438 438 438 ARG ARG B . n 
R  2  1   MET 1   1   ?   ?   ?   C . n 
R  2  2   GLY 2   2   ?   ?   ?   C . n 
R  2  3   PHE 3   3   3   PHE PHE C . n 
R  2  4   PHE 4   4   4   PHE PHE C . n 
R  2  5   ASP 5   5   5   ASP ASP C . n 
R  2  6   ASP 6   6   6   ASP ASP C . n 
R  2  7   LYS 7   7   7   LYS LYS C . n 
R  2  8   GLN 8   8   8   GLN GLN C . n 
R  2  9   ASP 9   9   9   ASP ASP C . n 
R  2  10  PHE 10  10  10  PHE PHE C . n 
R  2  11  LEU 11  11  11  LEU LEU C . n 
R  2  12  GLU 12  12  12  GLU GLU C . n 
R  2  13  GLU 13  13  13  GLU GLU C . n 
R  2  14  THR 14  14  14  THR THR C . n 
R  2  15  PHE 15  15  15  PHE PHE C . n 
R  2  16  ALA 16  16  16  ALA ALA C . n 
R  2  17  LYS 17  17  17  LYS LYS C . n 
R  2  18  TYR 18  18  18  TYR TYR C . n 
R  2  19  PRO 19  19  19  PRO PRO C . n 
R  2  20  PRO 20  20  20  PRO PRO C . n 
R  2  21  GLU 21  21  21  GLU GLU C . n 
R  2  22  GLY 22  22  22  GLY GLY C . n 
R  2  23  ARG 23  23  23  ARG ARG C . n 
R  2  24  ARG 24  24  24  ARG ARG C . n 
R  2  25  ALA 25  25  25  ALA ALA C . n 
R  2  26  ALA 26  26  26  ALA ALA C . n 
R  2  27  ILE 27  27  27  ILE ILE C . n 
R  2  28  MET 28  28  28  MET MET C . n 
R  2  29  PRO 29  29  29  PRO PRO C . n 
R  2  30  LEU 30  30  30  LEU LEU C . n 
R  2  31  LEU 31  31  31  LEU LEU C . n 
R  2  32  ARG 32  32  32  ARG ARG C . n 
R  2  33  ARG 33  33  33  ARG ARG C . n 
R  2  34  VAL 34  34  34  VAL VAL C . n 
R  2  35  GLN 35  35  35  GLN GLN C . n 
R  2  36  GLN 36  36  36  GLN GLN C . n 
R  2  37  GLU 37  37  37  GLU GLU C . n 
R  2  38  GLU 38  38  38  GLU GLU C . n 
R  2  39  GLY 39  39  39  GLY GLY C . n 
R  2  40  TRP 40  40  40  TRP TRP C . n 
R  2  41  ILE 41  41  41  ILE ILE C . n 
R  2  42  ARG 42  42  42  ARG ARG C . n 
R  2  43  PRO 43  43  43  PRO PRO C . n 
R  2  44  GLU 44  44  44  GLU GLU C . n 
R  2  45  ARG 45  45  45  ARG ARG C . n 
R  2  46  ILE 46  46  46  ILE ILE C . n 
R  2  47  GLU 47  47  47  GLU GLU C . n 
R  2  48  GLU 48  48  48  GLU GLU C . n 
R  2  49  ILE 49  49  49  ILE ILE C . n 
R  2  50  ALA 50  50  50  ALA ALA C . n 
R  2  51  ARG 51  51  51  ARG ARG C . n 
R  2  52  LEU 52  52  52  LEU LEU C . n 
R  2  53  VAL 53  53  53  VAL VAL C . n 
R  2  54  GLY 54  54  54  GLY GLY C . n 
R  2  55  THR 55  55  55  THR THR C . n 
R  2  56  THR 56  56  56  THR THR C . n 
R  2  57  PRO 57  57  57  PRO PRO C . n 
R  2  58  THR 58  58  58  THR THR C . n 
R  2  59  GLU 59  59  59  GLU GLU C . n 
R  2  60  VAL 60  60  60  VAL VAL C . n 
R  2  61  MET 61  61  61  MET MET C . n 
R  2  62  GLY 62  62  62  GLY GLY C . n 
R  2  63  VAL 63  63  63  VAL VAL C . n 
R  2  64  ALA 64  64  64  ALA ALA C . n 
R  2  65  SER 65  65  65  SER SER C . n 
R  2  66  PHE 66  66  66  PHE PHE C . n 
R  2  67  TYR 67  67  67  TYR TYR C . n 
R  2  68  SER 68  68  68  SER SER C . n 
R  2  69  TYR 69  69  69  TYR TYR C . n 
R  2  70  TYR 70  70  70  TYR TYR C . n 
R  2  71  GLN 71  71  71  GLN GLN C . n 
R  2  72  PHE 72  72  72  PHE PHE C . n 
R  2  73  VAL 73  73  73  VAL VAL C . n 
R  2  74  PRO 74  74  74  PRO PRO C . n 
R  2  75  THR 75  75  75  THR THR C . n 
R  2  76  GLY 76  76  76  GLY GLY C . n 
R  2  77  LYS 77  77  77  LYS LYS C . n 
R  2  78  TYR 78  78  78  TYR TYR C . n 
R  2  79  HIS 79  79  79  HIS HIS C . n 
R  2  80  LEU 80  80  80  LEU LEU C . n 
R  2  81  GLN 81  81  81  GLN GLN C . n 
R  2  82  VAL 82  82  82  VAL VAL C . n 
R  2  83  CYS 83  83  83  CYS CYS C . n 
R  2  84  ALA 84  84  84  ALA ALA C . n 
R  2  85  THR 85  85  85  THR THR C . n 
R  2  86  LEU 86  86  86  LEU LEU C . n 
R  2  87  SER 87  87  87  SER SER C . n 
R  2  88  CYS 88  88  88  CYS CYS C . n 
R  2  89  LYS 89  89  89  LYS LYS C . n 
R  2  90  LEU 90  90  90  LEU LEU C . n 
R  2  91  ALA 91  91  91  ALA ALA C . n 
R  2  92  GLY 92  92  92  GLY GLY C . n 
R  2  93  ALA 93  93  93  ALA ALA C . n 
R  2  94  GLU 94  94  94  GLU GLU C . n 
R  2  95  GLU 95  95  95  GLU GLU C . n 
R  2  96  LEU 96  96  96  LEU LEU C . n 
R  2  97  TRP 97  97  97  TRP TRP C . n 
R  2  98  ASP 98  98  98  ASP ASP C . n 
R  2  99  TYR 99  99  99  TYR TYR C . n 
R  2  100 LEU 100 100 100 LEU LEU C . n 
R  2  101 THR 101 101 101 THR THR C . n 
R  2  102 GLU 102 102 102 GLU GLU C . n 
R  2  103 THR 103 103 103 THR THR C . n 
R  2  104 LEU 104 104 104 LEU LEU C . n 
R  2  105 GLY 105 105 105 GLY GLY C . n 
R  2  106 ILE 106 106 106 ILE ILE C . n 
R  2  107 GLY 107 107 107 GLY GLY C . n 
R  2  108 PRO 108 108 108 PRO PRO C . n 
R  2  109 GLY 109 109 109 GLY GLY C . n 
R  2  110 GLU 110 110 110 GLU GLU C . n 
R  2  111 VAL 111 111 111 VAL VAL C . n 
R  2  112 THR 112 112 112 THR THR C . n 
R  2  113 PRO 113 113 113 PRO PRO C . n 
R  2  114 ASP 114 114 114 ASP ASP C . n 
R  2  115 GLY 115 115 115 GLY GLY C . n 
R  2  116 LEU 116 116 116 LEU LEU C . n 
R  2  117 PHE 117 117 117 PHE PHE C . n 
R  2  118 SER 118 118 118 SER SER C . n 
R  2  119 VAL 119 119 119 VAL VAL C . n 
R  2  120 GLN 120 120 120 GLN GLN C . n 
R  2  121 LYS 121 121 121 LYS LYS C . n 
R  2  122 VAL 122 122 122 VAL VAL C . n 
R  2  123 GLU 123 123 123 GLU GLU C . n 
R  2  124 CYS 124 124 124 CYS CYS C . n 
R  2  125 LEU 125 125 125 LEU LEU C . n 
R  2  126 GLY 126 126 126 GLY GLY C . n 
R  2  127 SER 127 127 127 SER SER C . n 
R  2  128 CYS 128 128 128 CYS CYS C . n 
R  2  129 HIS 129 129 129 HIS HIS C . n 
R  2  130 THR 130 130 130 THR THR C . n 
R  2  131 ALA 131 131 131 ALA ALA C . n 
R  2  132 PRO 132 132 132 PRO PRO C . n 
R  2  133 VAL 133 133 133 VAL VAL C . n 
R  2  134 ILE 134 134 134 ILE ILE C . n 
R  2  135 GLN 135 135 135 GLN GLN C . n 
R  2  136 VAL 136 136 136 VAL VAL C . n 
R  2  137 ASN 137 137 137 ASN ASN C . n 
R  2  138 ASP 138 138 138 ASP ASP C . n 
R  2  139 GLU 139 139 139 GLU GLU C . n 
R  2  140 PRO 140 140 140 PRO PRO C . n 
R  2  141 TYR 141 141 141 TYR TYR C . n 
R  2  142 VAL 142 142 142 VAL VAL C . n 
R  2  143 GLU 143 143 143 GLU GLU C . n 
R  2  144 CYS 144 144 144 CYS CYS C . n 
R  2  145 VAL 145 145 145 VAL VAL C . n 
R  2  146 THR 146 146 146 THR THR C . n 
R  2  147 ARG 147 147 147 ARG ARG C . n 
R  2  148 ALA 148 148 148 ALA ALA C . n 
R  2  149 ARG 149 149 149 ARG ARG C . n 
R  2  150 LEU 150 150 150 LEU LEU C . n 
R  2  151 GLU 151 151 151 GLU GLU C . n 
R  2  152 ALA 152 152 152 ALA ALA C . n 
R  2  153 LEU 153 153 153 LEU LEU C . n 
R  2  154 LEU 154 154 154 LEU LEU C . n 
R  2  155 ALA 155 155 155 ALA ALA C . n 
R  2  156 GLY 156 156 156 GLY GLY C . n 
R  2  157 LEU 157 157 157 LEU LEU C . n 
R  2  158 ARG 158 158 158 ARG ARG C . n 
R  2  159 ALA 159 159 159 ALA ALA C . n 
R  2  160 GLY 160 160 160 GLY GLY C . n 
R  2  161 LYS 161 161 161 LYS LYS C . n 
R  2  162 ARG 162 162 162 ARG ARG C . n 
R  2  163 LEU 163 163 163 LEU LEU C . n 
R  2  164 GLU 164 164 164 GLU GLU C . n 
R  2  165 GLU 165 165 165 GLU GLU C . n 
R  2  166 ILE 166 166 166 ILE ILE C . n 
R  2  167 GLU 167 167 167 GLU GLU C . n 
R  2  168 LEU 168 168 168 LEU LEU C . n 
R  2  169 PRO 169 169 169 PRO PRO C . n 
R  2  170 GLY 170 170 170 GLY GLY C . n 
R  2  171 LYS 171 171 171 LYS LYS C . n 
R  2  172 CYS 172 172 172 CYS CYS C . n 
R  2  173 GLY 173 173 173 GLY GLY C . n 
R  2  174 HIS 174 174 174 HIS HIS C . n 
R  2  175 HIS 175 175 175 HIS HIS C . n 
R  2  176 VAL 176 176 176 VAL VAL C . n 
R  2  177 HIS 177 177 177 HIS HIS C . n 
R  2  178 GLU 178 178 178 GLU GLU C . n 
R  2  179 VAL 179 179 179 VAL VAL C . n 
R  2  180 GLU 180 180 180 GLU GLU C . n 
R  2  181 VAL 181 181 ?   ?   ?   C . n 
S  3  1   MET 1   1   1   MET MET D . n 
S  3  2   VAL 2   2   2   VAL VAL D . n 
S  3  3   ARG 3   3   3   ARG ARG D . n 
S  3  4   VAL 4   4   4   VAL VAL D . n 
S  3  5   LYS 5   5   5   LYS LYS D . n 
S  3  6   VAL 6   6   6   VAL VAL D . n 
S  3  7   ASN 7   7   7   ASN ASN D . n 
S  3  8   ASP 8   8   8   ASP ASP D . n 
S  3  9   ARG 9   9   9   ARG ARG D . n 
S  3  10  ILE 10  10  10  ILE ILE D . n 
S  3  11  VAL 11  11  11  VAL VAL D . n 
S  3  12  GLU 12  12  12  GLU GLU D . n 
S  3  13  VAL 13  13  13  VAL VAL D . n 
S  3  14  PRO 14  14  14  PRO PRO D . n 
S  3  15  PRO 15  15  15  PRO PRO D . n 
S  3  16  GLY 16  16  16  GLY GLY D . n 
S  3  17  THR 17  17  17  THR THR D . n 
S  3  18  SER 18  18  18  SER SER D . n 
S  3  19  VAL 19  19  19  VAL VAL D . n 
S  3  20  MET 20  20  20  MET MET D . n 
S  3  21  ASP 21  21  21  ASP ASP D . n 
S  3  22  ALA 22  22  22  ALA ALA D . n 
S  3  23  VAL 23  23  23  VAL VAL D . n 
S  3  24  PHE 24  24  24  PHE PHE D . n 
S  3  25  HIS 25  25  25  HIS HIS D . n 
S  3  26  ALA 26  26  26  ALA ALA D . n 
S  3  27  GLY 27  27  27  GLY GLY D . n 
S  3  28  TYR 28  28  28  TYR TYR D . n 
S  3  29  ASP 29  29  29  ASP ASP D . n 
S  3  30  VAL 30  30  30  VAL VAL D . n 
S  3  31  PRO 31  31  31  PRO PRO D . n 
S  3  32  LEU 32  32  32  LEU LEU D . n 
S  3  33  PHE 33  33  33  PHE PHE D . n 
S  3  34  CYS 34  34  34  CYS CYS D . n 
S  3  35  SER 35  35  35  SER SER D . n 
S  3  36  GLU 36  36  36  GLU GLU D . n 
S  3  37  LYS 37  37  37  LYS LYS D . n 
S  3  38  HIS 38  38  38  HIS HIS D . n 
S  3  39  LEU 39  39  39  LEU LEU D . n 
S  3  40  SER 40  40  40  SER SER D . n 
S  3  41  PRO 41  41  41  PRO PRO D . n 
S  3  42  ILE 42  42  42  ILE ILE D . n 
S  3  43  GLY 43  43  43  GLY GLY D . n 
S  3  44  ALA 44  44  44  ALA ALA D . n 
S  3  45  CYS 45  45  45  CYS CYS D . n 
S  3  46  ARG 46  46  46  ARG ARG D . n 
S  3  47  MET 47  47  47  MET MET D . n 
S  3  48  CYS 48  48  48  CYS CYS D . n 
S  3  49  LEU 49  49  49  LEU LEU D . n 
S  3  50  VAL 50  50  50  VAL VAL D . n 
S  3  51  ARG 51  51  51  ARG ARG D . n 
S  3  52  ILE 52  52  52  ILE ILE D . n 
S  3  53  GLY 53  53  53  GLY GLY D . n 
S  3  54  LEU 54  54  54  LEU LEU D . n 
S  3  55  PRO 55  55  55  PRO PRO D . n 
S  3  56  LYS 56  56  ?   ?   ?   D . n 
S  3  57  LYS 57  57  ?   ?   ?   D . n 
S  3  58  GLY 58  58  ?   ?   ?   D . n 
S  3  59  PRO 59  59  ?   ?   ?   D . n 
S  3  60  ASP 60  60  ?   ?   ?   D . n 
S  3  61  GLY 61  61  ?   ?   ?   D . n 
S  3  62  LYS 62  62  ?   ?   ?   D . n 
S  3  63  PRO 63  63  ?   ?   ?   D . n 
S  3  64  LEU 64  64  ?   ?   ?   D . n 
S  3  65  LEU 65  65  ?   ?   ?   D . n 
S  3  66  ASN 66  66  ?   ?   ?   D . n 
S  3  67  GLU 67  67  ?   ?   ?   D . n 
S  3  68  LYS 68  68  ?   ?   ?   D . n 
S  3  69  GLY 69  69  ?   ?   ?   D . n 
S  3  70  GLU 70  70  ?   ?   ?   D . n 
S  3  71  PRO 71  71  ?   ?   ?   D . n 
S  3  72  GLU 72  72  ?   ?   ?   D . n 
S  3  73  ILE 73  73  73  ILE ILE D . n 
S  3  74  GLN 74  74  74  GLN GLN D . n 
S  3  75  TRP 75  75  75  TRP TRP D . n 
S  3  76  GLN 76  76  76  GLN GLN D . n 
S  3  77  PRO 77  77  77  PRO PRO D . n 
S  3  78  LYS 78  78  78  LYS LYS D . n 
S  3  79  LEU 79  79  79  LEU LEU D . n 
S  3  80  ALA 80  80  80  ALA ALA D . n 
S  3  81  ALA 81  81  81  ALA ALA D . n 
S  3  82  SER 82  82  82  SER SER D . n 
S  3  83  CYS 83  83  83  CYS CYS D . n 
S  3  84  VAL 84  84  84  VAL VAL D . n 
S  3  85  THR 85  85  85  THR THR D . n 
S  3  86  ALA 86  86  86  ALA ALA D . n 
S  3  87  VAL 87  87  87  VAL VAL D . n 
S  3  88  ALA 88  88  88  ALA ALA D . n 
S  3  89  ASP 89  89  89  ASP ASP D . n 
S  3  90  GLY 90  90  90  GLY GLY D . n 
S  3  91  MET 91  91  91  MET MET D . n 
S  3  92  VAL 92  92  92  VAL VAL D . n 
S  3  93  VAL 93  93  93  VAL VAL D . n 
S  3  94  ASP 94  94  94  ASP ASP D . n 
S  3  95  THR 95  95  95  THR THR D . n 
S  3  96  LEU 96  96  96  LEU LEU D . n 
S  3  97  SER 97  97  97  SER SER D . n 
S  3  98  ASP 98  98  98  ASP ASP D . n 
S  3  99  VAL 99  99  99  VAL VAL D . n 
S  3  100 VAL 100 100 100 VAL VAL D . n 
S  3  101 ARG 101 101 101 ARG ARG D . n 
S  3  102 GLU 102 102 102 GLU GLU D . n 
S  3  103 ALA 103 103 103 ALA ALA D . n 
S  3  104 GLN 104 104 104 GLN GLN D . n 
S  3  105 ALA 105 105 105 ALA ALA D . n 
S  3  106 GLY 106 106 106 GLY GLY D . n 
S  3  107 MET 107 107 107 MET MET D . n 
S  3  108 VAL 108 108 108 VAL VAL D . n 
S  3  109 GLU 109 109 109 GLU GLU D . n 
S  3  110 PHE 110 110 110 PHE PHE D . n 
S  3  111 THR 111 111 111 THR THR D . n 
S  3  112 LEU 112 112 112 LEU LEU D . n 
S  3  113 LEU 113 113 113 LEU LEU D . n 
S  3  114 ASN 114 114 114 ASN ASN D . n 
S  3  115 HIS 115 115 115 HIS HIS D . n 
S  3  116 PRO 116 116 116 PRO PRO D . n 
S  3  117 LEU 117 117 117 LEU LEU D . n 
S  3  118 ASP 118 118 118 ASP ASP D . n 
S  3  119 CYS 119 119 119 CYS CYS D . n 
S  3  120 PRO 120 120 120 PRO PRO D . n 
S  3  121 THR 121 121 121 THR THR D . n 
S  3  122 CYS 122 122 122 CYS CYS D . n 
S  3  123 ASP 123 123 123 ASP ASP D . n 
S  3  124 LYS 124 124 124 LYS LYS D . n 
S  3  125 GLY 125 125 125 GLY GLY D . n 
S  3  126 GLY 126 126 126 GLY GLY D . n 
S  3  127 ALA 127 127 127 ALA ALA D . n 
S  3  128 CYS 128 128 128 CYS CYS D . n 
S  3  129 GLU 129 129 129 GLU GLU D . n 
S  3  130 LEU 130 130 130 LEU LEU D . n 
S  3  131 GLN 131 131 131 GLN GLN D . n 
S  3  132 ASP 132 132 132 ASP ASP D . n 
S  3  133 ARG 133 133 133 ARG ARG D . n 
S  3  134 THR 134 134 134 THR THR D . n 
S  3  135 VAL 135 135 135 VAL VAL D . n 
S  3  136 GLU 136 136 136 GLU GLU D . n 
S  3  137 TYR 137 137 137 TYR TYR D . n 
S  3  138 GLY 138 138 138 GLY GLY D . n 
S  3  139 LEU 139 139 139 LEU LEU D . n 
S  3  140 TYR 140 140 140 TYR TYR D . n 
S  3  141 GLU 141 141 141 GLU GLU D . n 
S  3  142 LYS 142 142 142 LYS LYS D . n 
S  3  143 TYR 143 143 143 TYR TYR D . n 
S  3  144 TYR 144 144 ?   ?   ?   D . n 
S  3  145 GLN 145 145 ?   ?   ?   D . n 
S  3  146 LYS 146 146 ?   ?   ?   D . n 
S  3  147 GLY 147 147 ?   ?   ?   D . n 
S  3  148 PRO 148 148 148 PRO PRO D . n 
S  3  149 LEU 149 149 149 LEU LEU D . n 
S  3  150 GLU 150 150 150 GLU GLU D . n 
S  3  151 LEU 151 151 151 LEU LEU D . n 
S  3  152 PRO 152 152 152 PRO PRO D . n 
S  3  153 VAL 153 153 153 VAL VAL D . n 
S  3  154 TYR 154 154 154 TYR TYR D . n 
S  3  155 THR 155 155 155 THR THR D . n 
S  3  156 ARG 156 156 156 ARG ARG D . n 
S  3  157 PHE 157 157 157 PHE PHE D . n 
S  3  158 GLU 158 158 158 GLU GLU D . n 
S  3  159 PHE 159 159 159 PHE PHE D . n 
S  3  160 THR 160 160 160 THR THR D . n 
S  3  161 ARG 161 161 161 ARG ARG D . n 
S  3  162 ARG 162 162 162 ARG ARG D . n 
S  3  163 HIS 163 163 163 HIS HIS D . n 
S  3  164 VAL 164 164 164 VAL VAL D . n 
S  3  165 ASP 165 165 165 ASP ASP D . n 
S  3  166 LYS 166 166 166 LYS LYS D . n 
S  3  167 HIS 167 167 167 HIS HIS D . n 
S  3  168 HIS 168 168 168 HIS HIS D . n 
S  3  169 PRO 169 169 169 PRO PRO D . n 
S  3  170 LEU 170 170 170 LEU LEU D . n 
S  3  171 SER 171 171 171 SER SER D . n 
S  3  172 PRO 172 172 172 PRO PRO D . n 
S  3  173 PHE 173 173 173 PHE PHE D . n 
S  3  174 VAL 174 174 174 VAL VAL D . n 
S  3  175 ILE 175 175 175 ILE ILE D . n 
S  3  176 LEU 176 176 176 LEU LEU D . n 
S  3  177 ASP 177 177 177 ASP ASP D . n 
S  3  178 ARG 178 178 178 ARG ARG D . n 
S  3  179 GLU 179 179 179 GLU GLU D . n 
S  3  180 ARG 180 180 180 ARG ARG D . n 
S  3  181 CYS 181 181 181 CYS CYS D . n 
S  3  182 ILE 182 182 182 ILE ILE D . n 
S  3  183 HIS 183 183 183 HIS HIS D . n 
S  3  184 CYS 184 184 184 CYS CYS D . n 
S  3  185 LYS 185 185 185 LYS LYS D . n 
S  3  186 ARG 186 186 186 ARG ARG D . n 
S  3  187 CYS 187 187 187 CYS CYS D . n 
S  3  188 VAL 188 188 188 VAL VAL D . n 
S  3  189 ARG 189 189 189 ARG ARG D . n 
S  3  190 TYR 190 190 190 TYR TYR D . n 
S  3  191 PHE 191 191 191 PHE PHE D . n 
S  3  192 GLU 192 192 192 GLU GLU D . n 
S  3  193 GLU 193 193 193 GLU GLU D . n 
S  3  194 VAL 194 194 194 VAL VAL D . n 
S  3  195 PRO 195 195 195 PRO PRO D . n 
S  3  196 GLY 196 196 196 GLY GLY D . n 
S  3  197 ASP 197 197 197 ASP ASP D . n 
S  3  198 GLU 198 198 198 GLU GLU D . n 
S  3  199 VAL 199 199 199 VAL VAL D . n 
S  3  200 LEU 200 200 200 LEU LEU D . n 
S  3  201 ASP 201 201 201 ASP ASP D . n 
S  3  202 PHE 202 202 202 PHE PHE D . n 
S  3  203 ILE 203 203 203 ILE ILE D . n 
S  3  204 GLU 204 204 204 GLU GLU D . n 
S  3  205 ARG 205 205 205 ARG ARG D . n 
S  3  206 GLY 206 206 206 GLY GLY D . n 
S  3  207 VAL 207 207 207 VAL VAL D . n 
S  3  208 HIS 208 208 208 HIS HIS D . n 
S  3  209 THR 209 209 209 THR THR D . n 
S  3  210 PHE 210 210 210 PHE PHE D . n 
S  3  211 ILE 211 211 211 ILE ILE D . n 
S  3  212 GLY 212 212 212 GLY GLY D . n 
S  3  213 THR 213 213 213 THR THR D . n 
S  3  214 MET 214 214 214 MET MET D . n 
S  3  215 ASP 215 215 215 ASP ASP D . n 
S  3  216 PHE 216 216 216 PHE PHE D . n 
S  3  217 GLY 217 217 217 GLY GLY D . n 
S  3  218 LEU 218 218 218 LEU LEU D . n 
S  3  219 PRO 219 219 219 PRO PRO D . n 
S  3  220 SER 220 220 220 SER SER D . n 
S  3  221 GLY 221 221 221 GLY GLY D . n 
S  3  222 PHE 222 222 222 PHE PHE D . n 
S  3  223 SER 223 223 223 SER SER D . n 
S  3  224 GLY 224 224 224 GLY GLY D . n 
S  3  225 ASN 225 225 225 ASN ASN D . n 
S  3  226 ILE 226 226 226 ILE ILE D . n 
S  3  227 THR 227 227 227 THR THR D . n 
S  3  228 ASP 228 228 228 ASP ASP D . n 
S  3  229 ILE 229 229 229 ILE ILE D . n 
S  3  230 CYS 230 230 230 CYS CYS D . n 
S  3  231 PRO 231 231 231 PRO PRO D . n 
S  3  232 VAL 232 232 232 VAL VAL D . n 
S  3  233 GLY 233 233 233 GLY GLY D . n 
S  3  234 ALA 234 234 234 ALA ALA D . n 
S  3  235 LEU 235 235 235 LEU LEU D . n 
S  3  236 LEU 236 236 236 LEU LEU D . n 
S  3  237 ASP 237 237 237 ASP ASP D . n 
S  3  238 LEU 238 238 238 LEU LEU D . n 
S  3  239 THR 239 239 239 THR THR D . n 
S  3  240 ALA 240 240 240 ALA ALA D . n 
S  3  241 ARG 241 241 241 ARG ARG D . n 
S  3  242 PHE 242 242 242 PHE PHE D . n 
S  3  243 ARG 243 243 243 ARG ARG D . n 
S  3  244 ALA 244 244 244 ALA ALA D . n 
S  3  245 ARG 245 245 245 ARG ARG D . n 
S  3  246 ASN 246 246 246 ASN ASN D . n 
S  3  247 TRP 247 247 247 TRP TRP D . n 
S  3  248 GLU 248 248 248 GLU GLU D . n 
S  3  249 MET 249 249 249 MET MET D . n 
S  3  250 GLU 250 250 250 GLU GLU D . n 
S  3  251 GLU 251 251 251 GLU GLU D . n 
S  3  252 THR 252 252 252 THR THR D . n 
S  3  253 PRO 253 253 253 PRO PRO D . n 
S  3  254 THR 254 254 254 THR THR D . n 
S  3  255 THR 255 255 255 THR THR D . n 
S  3  256 CYS 256 256 256 CYS CYS D . n 
S  3  257 ALA 257 257 257 ALA ALA D . n 
S  3  258 LEU 258 258 258 LEU LEU D . n 
S  3  259 CYS 259 259 259 CYS CYS D . n 
S  3  260 PRO 260 260 260 PRO PRO D . n 
S  3  261 VAL 261 261 261 VAL VAL D . n 
S  3  262 GLY 262 262 262 GLY GLY D . n 
S  3  263 CYS 263 263 263 CYS CYS D . n 
S  3  264 GLY 264 264 264 GLY GLY D . n 
S  3  265 ILE 265 265 265 ILE ILE D . n 
S  3  266 THR 266 266 266 THR THR D . n 
S  3  267 ALA 267 267 267 ALA ALA D . n 
S  3  268 ASP 268 268 268 ASP ASP D . n 
S  3  269 THR 269 269 269 THR THR D . n 
S  3  270 ARG 270 270 270 ARG ARG D . n 
S  3  271 SER 271 271 271 SER SER D . n 
S  3  272 GLY 272 272 272 GLY GLY D . n 
S  3  273 GLU 273 273 273 GLU GLU D . n 
S  3  274 LEU 274 274 274 LEU LEU D . n 
S  3  275 LEU 275 275 275 LEU LEU D . n 
S  3  276 ARG 276 276 276 ARG ARG D . n 
S  3  277 ILE 277 277 277 ILE ILE D . n 
S  3  278 ARG 278 278 278 ARG ARG D . n 
S  3  279 ALA 279 279 279 ALA ALA D . n 
S  3  280 ARG 280 280 280 ARG ARG D . n 
S  3  281 GLU 281 281 281 GLU GLU D . n 
S  3  282 VAL 282 282 282 VAL VAL D . n 
S  3  283 PRO 283 283 283 PRO PRO D . n 
S  3  284 GLU 284 284 284 GLU GLU D . n 
S  3  285 VAL 285 285 285 VAL VAL D . n 
S  3  286 ASN 286 286 286 ASN ASN D . n 
S  3  287 GLU 287 287 287 GLU GLU D . n 
S  3  288 ILE 288 288 288 ILE ILE D . n 
S  3  289 TRP 289 289 289 TRP TRP D . n 
S  3  290 ILE 290 290 290 ILE ILE D . n 
S  3  291 CYS 291 291 291 CYS CYS D . n 
S  3  292 ASP 292 292 292 ASP ASP D . n 
S  3  293 ALA 293 293 293 ALA ALA D . n 
S  3  294 GLY 294 294 294 GLY GLY D . n 
S  3  295 ARG 295 295 295 ARG ARG D . n 
S  3  296 PHE 296 296 296 PHE PHE D . n 
S  3  297 GLY 297 297 297 GLY GLY D . n 
S  3  298 HIS 298 298 298 HIS HIS D . n 
S  3  299 GLU 299 299 299 GLU GLU D . n 
S  3  300 TRP 300 300 300 TRP TRP D . n 
S  3  301 ALA 301 301 301 ALA ALA D . n 
S  3  302 ASP 302 302 302 ASP ASP D . n 
S  3  303 GLN 303 303 303 GLN GLN D . n 
S  3  304 ASN 304 304 304 ASN ASN D . n 
S  3  305 ARG 305 305 305 ARG ARG D . n 
S  3  306 LEU 306 306 306 LEU LEU D . n 
S  3  307 LYS 307 307 307 LYS LYS D . n 
S  3  308 THR 308 308 308 THR THR D . n 
S  3  309 PRO 309 309 309 PRO PRO D . n 
S  3  310 LEU 310 310 310 LEU LEU D . n 
S  3  311 VAL 311 311 311 VAL VAL D . n 
S  3  312 ARG 312 312 312 ARG ARG D . n 
S  3  313 LYS 313 313 313 LYS LYS D . n 
S  3  314 GLU 314 314 314 GLU GLU D . n 
S  3  315 GLY 315 315 315 GLY GLY D . n 
S  3  316 ARG 316 316 316 ARG ARG D . n 
S  3  317 LEU 317 317 317 LEU LEU D . n 
S  3  318 VAL 318 318 318 VAL VAL D . n 
S  3  319 GLU 319 319 319 GLU GLU D . n 
S  3  320 ALA 320 320 320 ALA ALA D . n 
S  3  321 THR 321 321 321 THR THR D . n 
S  3  322 TRP 322 322 322 TRP TRP D . n 
S  3  323 GLU 323 323 323 GLU GLU D . n 
S  3  324 GLU 324 324 324 GLU GLU D . n 
S  3  325 ALA 325 325 325 ALA ALA D . n 
S  3  326 PHE 326 326 326 PHE PHE D . n 
S  3  327 LEU 327 327 327 LEU LEU D . n 
S  3  328 ALA 328 328 328 ALA ALA D . n 
S  3  329 LEU 329 329 329 LEU LEU D . n 
S  3  330 LYS 330 330 330 LYS LYS D . n 
S  3  331 GLU 331 331 331 GLU GLU D . n 
S  3  332 GLY 332 332 332 GLY GLY D . n 
S  3  333 LEU 333 333 333 LEU LEU D . n 
S  3  334 LYS 334 334 334 LYS LYS D . n 
S  3  335 GLU 335 335 335 GLU GLU D . n 
S  3  336 ALA 336 336 336 ALA ALA D . n 
S  3  337 ARG 337 337 337 ARG ARG D . n 
S  3  338 GLY 338 338 338 GLY GLY D . n 
S  3  339 GLU 339 339 339 GLU GLU D . n 
S  3  340 GLU 340 340 340 GLU GLU D . n 
S  3  341 VAL 341 341 341 VAL VAL D . n 
S  3  342 GLY 342 342 342 GLY GLY D . n 
S  3  343 LEU 343 343 343 LEU LEU D . n 
S  3  344 TYR 344 344 344 TYR TYR D . n 
S  3  345 LEU 345 345 345 LEU LEU D . n 
S  3  346 ALA 346 346 346 ALA ALA D . n 
S  3  347 HIS 347 347 347 HIS HIS D . n 
S  3  348 ASP 348 348 348 ASP ASP D . n 
S  3  349 ALA 349 349 349 ALA ALA D . n 
S  3  350 THR 350 350 350 THR THR D . n 
S  3  351 LEU 351 351 351 LEU LEU D . n 
S  3  352 GLU 352 352 352 GLU GLU D . n 
S  3  353 GLU 353 353 353 GLU GLU D . n 
S  3  354 GLY 354 354 354 GLY GLY D . n 
S  3  355 LEU 355 355 355 LEU LEU D . n 
S  3  356 LEU 356 356 356 LEU LEU D . n 
S  3  357 ALA 357 357 357 ALA ALA D . n 
S  3  358 SER 358 358 358 SER SER D . n 
S  3  359 GLU 359 359 359 GLU GLU D . n 
S  3  360 LEU 360 360 360 LEU LEU D . n 
S  3  361 ALA 361 361 361 ALA ALA D . n 
S  3  362 LYS 362 362 362 LYS LYS D . n 
S  3  363 ALA 363 363 363 ALA ALA D . n 
S  3  364 LEU 364 364 364 LEU LEU D . n 
S  3  365 LYS 365 365 365 LYS LYS D . n 
S  3  366 THR 366 366 366 THR THR D . n 
S  3  367 PRO 367 367 367 PRO PRO D . n 
S  3  368 HIS 368 368 368 HIS HIS D . n 
S  3  369 LEU 369 369 369 LEU LEU D . n 
S  3  370 ASP 370 370 370 ASP ASP D . n 
S  3  371 PHE 371 371 371 PHE PHE D . n 
S  3  372 GLN 372 372 372 GLN GLN D . n 
S  3  373 GLY 373 373 373 GLY GLY D . n 
S  3  374 ARG 374 374 374 ARG ARG D . n 
S  3  375 THR 375 375 375 THR THR D . n 
S  3  376 ALA 376 376 376 ALA ALA D . n 
S  3  377 ALA 377 377 377 ALA ALA D . n 
S  3  378 PRO 378 378 378 PRO PRO D . n 
S  3  379 ALA 379 379 379 ALA ALA D . n 
S  3  380 SER 380 380 380 SER SER D . n 
S  3  381 LEU 381 381 381 LEU LEU D . n 
S  3  382 PHE 382 382 382 PHE PHE D . n 
S  3  383 PRO 383 383 383 PRO PRO D . n 
S  3  384 PRO 384 384 384 PRO PRO D . n 
S  3  385 ALA 385 385 385 ALA ALA D . n 
S  3  386 SER 386 386 386 SER SER D . n 
S  3  387 LEU 387 387 387 LEU LEU D . n 
S  3  388 GLU 388 388 388 GLU GLU D . n 
S  3  389 ASP 389 389 389 ASP ASP D . n 
S  3  390 LEU 390 390 390 LEU LEU D . n 
S  3  391 LEU 391 391 391 LEU LEU D . n 
S  3  392 GLN 392 392 392 GLN GLN D . n 
S  3  393 ALA 393 393 393 ALA ALA D . n 
S  3  394 ASP 394 394 394 ASP ASP D . n 
S  3  395 PHE 395 395 395 PHE PHE D . n 
S  3  396 ALA 396 396 396 ALA ALA D . n 
S  3  397 LEU 397 397 397 LEU LEU D . n 
S  3  398 VAL 398 398 398 VAL VAL D . n 
S  3  399 LEU 399 399 399 LEU LEU D . n 
S  3  400 GLY 400 400 400 GLY GLY D . n 
S  3  401 ASP 401 401 401 ASP ASP D . n 
S  3  402 PRO 402 402 402 PRO PRO D . n 
S  3  403 THR 403 403 403 THR THR D . n 
S  3  404 GLU 404 404 404 GLU GLU D . n 
S  3  405 GLU 405 405 405 GLU GLU D . n 
S  3  406 ALA 406 406 406 ALA ALA D . n 
S  3  407 PRO 407 407 407 PRO PRO D . n 
S  3  408 ILE 408 408 408 ILE ILE D . n 
S  3  409 LEU 409 409 409 LEU LEU D . n 
S  3  410 HIS 410 410 410 HIS HIS D . n 
S  3  411 LEU 411 411 411 LEU LEU D . n 
S  3  412 ARG 412 412 412 ARG ARG D . n 
S  3  413 LEU 413 413 413 LEU LEU D . n 
S  3  414 SER 414 414 414 SER SER D . n 
S  3  415 GLU 415 415 415 GLU GLU D . n 
S  3  416 PHE 416 416 416 PHE PHE D . n 
S  3  417 VAL 417 417 417 VAL VAL D . n 
S  3  418 ARG 418 418 418 ARG ARG D . n 
S  3  419 ASP 419 419 419 ASP ASP D . n 
S  3  420 LEU 420 420 420 LEU LEU D . n 
S  3  421 LYS 421 421 421 LYS LYS D . n 
S  3  422 PRO 422 422 422 PRO PRO D . n 
S  3  423 PRO 423 423 423 PRO PRO D . n 
S  3  424 HIS 424 424 424 HIS HIS D . n 
S  3  425 ARG 425 425 425 ARG ARG D . n 
S  3  426 TYR 426 426 426 TYR TYR D . n 
S  3  427 ASN 427 427 427 ASN ASN D . n 
S  3  428 HIS 428 428 428 HIS HIS D . n 
S  3  429 GLY 429 429 429 GLY GLY D . n 
S  3  430 THR 430 430 430 THR THR D . n 
S  3  431 PRO 431 431 431 PRO PRO D . n 
S  3  432 PHE 432 432 432 PHE PHE D . n 
S  3  433 ALA 433 433 433 ALA ALA D . n 
S  3  434 ASP 434 434 434 ASP ASP D . n 
S  3  435 LEU 435 435 435 LEU LEU D . n 
S  3  436 GLN 436 436 436 GLN GLN D . n 
S  3  437 ILE 437 437 437 ILE ILE D . n 
S  3  438 LYS 438 438 438 LYS LYS D . n 
S  3  439 GLU 439 439 439 GLU GLU D . n 
S  3  440 ARG 440 440 440 ARG ARG D . n 
S  3  441 MET 441 441 441 MET MET D . n 
S  3  442 PRO 442 442 442 PRO PRO D . n 
S  3  443 ARG 443 443 443 ARG ARG D . n 
S  3  444 ARG 444 444 444 ARG ARG D . n 
S  3  445 THR 445 445 445 THR THR D . n 
S  3  446 ASP 446 446 446 ASP ASP D . n 
S  3  447 LYS 447 447 447 LYS LYS D . n 
S  3  448 MET 448 448 448 MET MET D . n 
S  3  449 ALA 449 449 449 ALA ALA D . n 
S  3  450 LEU 450 450 450 LEU LEU D . n 
S  3  451 PHE 451 451 451 PHE PHE D . n 
S  3  452 ALA 452 452 452 ALA ALA D . n 
S  3  453 PRO 453 453 453 PRO PRO D . n 
S  3  454 TYR 454 454 454 TYR TYR D . n 
S  3  455 ARG 455 455 455 ARG ARG D . n 
S  3  456 ALA 456 456 456 ALA ALA D . n 
S  3  457 PRO 457 457 457 PRO PRO D . n 
S  3  458 LEU 458 458 458 LEU LEU D . n 
S  3  459 MET 459 459 459 MET MET D . n 
S  3  460 LYS 460 460 460 LYS LYS D . n 
S  3  461 TRP 461 461 461 TRP TRP D . n 
S  3  462 ALA 462 462 462 ALA ALA D . n 
S  3  463 ALA 463 463 463 ALA ALA D . n 
S  3  464 ILE 464 464 464 ILE ILE D . n 
S  3  465 HIS 465 465 465 HIS HIS D . n 
S  3  466 GLU 466 466 466 GLU GLU D . n 
S  3  467 VAL 467 467 467 VAL VAL D . n 
S  3  468 HIS 468 468 468 HIS HIS D . n 
S  3  469 ARG 469 469 469 ARG ARG D . n 
S  3  470 PRO 470 470 470 PRO PRO D . n 
S  3  471 GLY 471 471 471 GLY GLY D . n 
S  3  472 GLU 472 472 472 GLU GLU D . n 
S  3  473 GLU 473 473 473 GLU GLU D . n 
S  3  474 ARG 474 474 474 ARG ARG D . n 
S  3  475 GLU 475 475 475 GLU GLU D . n 
S  3  476 ILE 476 476 476 ILE ILE D . n 
S  3  477 LEU 477 477 477 LEU LEU D . n 
S  3  478 LEU 478 478 478 LEU LEU D . n 
S  3  479 ALA 479 479 479 ALA ALA D . n 
S  3  480 LEU 480 480 480 LEU LEU D . n 
S  3  481 LEU 481 481 481 LEU LEU D . n 
S  3  482 GLY 482 482 482 GLY GLY D . n 
S  3  483 ASP 483 483 483 ASP ASP D . n 
S  3  484 LYS 484 484 484 LYS LYS D . n 
S  3  485 GLU 485 485 485 GLU GLU D . n 
S  3  486 GLY 486 486 486 GLY GLY D . n 
S  3  487 SER 487 487 487 SER SER D . n 
S  3  488 GLU 488 488 488 GLU GLU D . n 
S  3  489 MET 489 489 489 MET MET D . n 
S  3  490 VAL 490 490 490 VAL VAL D . n 
S  3  491 ALA 491 491 491 ALA ALA D . n 
S  3  492 LYS 492 492 492 LYS LYS D . n 
S  3  493 ALA 493 493 493 ALA ALA D . n 
S  3  494 LYS 494 494 494 LYS LYS D . n 
S  3  495 GLU 495 495 495 GLU GLU D . n 
S  3  496 ALA 496 496 496 ALA ALA D . n 
S  3  497 TRP 497 497 497 TRP TRP D . n 
S  3  498 GLU 498 498 498 GLU GLU D . n 
S  3  499 LYS 499 499 499 LYS LYS D . n 
S  3  500 ALA 500 500 500 ALA ALA D . n 
S  3  501 LYS 501 501 501 LYS LYS D . n 
S  3  502 ASN 502 502 502 ASN ASN D . n 
S  3  503 PRO 503 503 503 PRO PRO D . n 
S  3  504 VAL 504 504 504 VAL VAL D . n 
S  3  505 LEU 505 505 505 LEU LEU D . n 
S  3  506 ILE 506 506 506 ILE ILE D . n 
S  3  507 LEU 507 507 507 LEU LEU D . n 
S  3  508 GLY 508 508 508 GLY GLY D . n 
S  3  509 ALA 509 509 509 ALA ALA D . n 
S  3  510 GLY 510 510 510 GLY GLY D . n 
S  3  511 VAL 511 511 511 VAL VAL D . n 
S  3  512 LEU 512 512 512 LEU LEU D . n 
S  3  513 GLN 513 513 513 GLN GLN D . n 
S  3  514 ASP 514 514 514 ASP ASP D . n 
S  3  515 THR 515 515 515 THR THR D . n 
S  3  516 VAL 516 516 516 VAL VAL D . n 
S  3  517 ALA 517 517 517 ALA ALA D . n 
S  3  518 ALA 518 518 518 ALA ALA D . n 
S  3  519 GLU 519 519 519 GLU GLU D . n 
S  3  520 ARG 520 520 520 ARG ARG D . n 
S  3  521 ALA 521 521 521 ALA ALA D . n 
S  3  522 ARG 522 522 522 ARG ARG D . n 
S  3  523 LEU 523 523 523 LEU LEU D . n 
S  3  524 LEU 524 524 524 LEU LEU D . n 
S  3  525 ALA 525 525 525 ALA ALA D . n 
S  3  526 GLU 526 526 526 GLU GLU D . n 
S  3  527 ARG 527 527 527 ARG ARG D . n 
S  3  528 LYS 528 528 528 LYS LYS D . n 
S  3  529 GLY 529 529 529 GLY GLY D . n 
S  3  530 ALA 530 530 530 ALA ALA D . n 
S  3  531 LYS 531 531 531 LYS LYS D . n 
S  3  532 VAL 532 532 532 VAL VAL D . n 
S  3  533 LEU 533 533 533 LEU LEU D . n 
S  3  534 ALA 534 534 534 ALA ALA D . n 
S  3  535 MET 535 535 535 MET MET D . n 
S  3  536 THR 536 536 536 THR THR D . n 
S  3  537 PRO 537 537 537 PRO PRO D . n 
S  3  538 ALA 538 538 538 ALA ALA D . n 
S  3  539 ALA 539 539 539 ALA ALA D . n 
S  3  540 ASN 540 540 540 ASN ASN D . n 
S  3  541 ALA 541 541 541 ALA ALA D . n 
S  3  542 ARG 542 542 542 ARG ARG D . n 
S  3  543 GLY 543 543 543 GLY GLY D . n 
S  3  544 LEU 544 544 544 LEU LEU D . n 
S  3  545 GLU 545 545 545 GLU GLU D . n 
S  3  546 ALA 546 546 546 ALA ALA D . n 
S  3  547 MET 547 547 547 MET MET D . n 
S  3  548 GLY 548 548 548 GLY GLY D . n 
S  3  549 VAL 549 549 549 VAL VAL D . n 
S  3  550 LEU 550 550 550 LEU LEU D . n 
S  3  551 PRO 551 551 551 PRO PRO D . n 
S  3  552 GLY 552 552 552 GLY GLY D . n 
S  3  553 ALA 553 553 553 ALA ALA D . n 
S  3  554 LYS 554 554 554 LYS LYS D . n 
S  3  555 GLY 555 555 555 GLY GLY D . n 
S  3  556 ALA 556 556 556 ALA ALA D . n 
S  3  557 SER 557 557 557 SER SER D . n 
S  3  558 TRP 558 558 558 TRP TRP D . n 
S  3  559 ASP 559 559 559 ASP ASP D . n 
S  3  560 GLU 560 560 560 GLU GLU D . n 
S  3  561 PRO 561 561 561 PRO PRO D . n 
S  3  562 GLY 562 562 562 GLY GLY D . n 
S  3  563 ALA 563 563 563 ALA ALA D . n 
S  3  564 LEU 564 564 564 LEU LEU D . n 
S  3  565 TYR 565 565 565 TYR TYR D . n 
S  3  566 ALA 566 566 566 ALA ALA D . n 
S  3  567 TYR 567 567 567 TYR TYR D . n 
S  3  568 TYR 568 568 568 TYR TYR D . n 
S  3  569 GLY 569 569 569 GLY GLY D . n 
S  3  570 PHE 570 570 570 PHE PHE D . n 
S  3  571 VAL 571 571 571 VAL VAL D . n 
S  3  572 PRO 572 572 572 PRO PRO D . n 
S  3  573 PRO 573 573 573 PRO PRO D . n 
S  3  574 GLU 574 574 574 GLU GLU D . n 
S  3  575 GLU 575 575 575 GLU GLU D . n 
S  3  576 ALA 576 576 576 ALA ALA D . n 
S  3  577 LEU 577 577 577 LEU LEU D . n 
S  3  578 LYS 578 578 578 LYS LYS D . n 
S  3  579 GLY 579 579 579 GLY GLY D . n 
S  3  580 LYS 580 580 580 LYS LYS D . n 
S  3  581 ARG 581 581 581 ARG ARG D . n 
S  3  582 PHE 582 582 582 PHE PHE D . n 
S  3  583 VAL 583 583 583 VAL VAL D . n 
S  3  584 VAL 584 584 584 VAL VAL D . n 
S  3  585 MET 585 585 585 MET MET D . n 
S  3  586 HIS 586 586 586 HIS HIS D . n 
S  3  587 LEU 587 587 587 LEU LEU D . n 
S  3  588 SER 588 588 588 SER SER D . n 
S  3  589 HIS 589 589 589 HIS HIS D . n 
S  3  590 LEU 590 590 590 LEU LEU D . n 
S  3  591 HIS 591 591 591 HIS HIS D . n 
S  3  592 PRO 592 592 592 PRO PRO D . n 
S  3  593 LEU 593 593 593 LEU LEU D . n 
S  3  594 ALA 594 594 594 ALA ALA D . n 
S  3  595 GLU 595 595 595 GLU GLU D . n 
S  3  596 ARG 596 596 596 ARG ARG D . n 
S  3  597 TYR 597 597 597 TYR TYR D . n 
S  3  598 ALA 598 598 598 ALA ALA D . n 
S  3  599 HIS 599 599 599 HIS HIS D . n 
S  3  600 VAL 600 600 600 VAL VAL D . n 
S  3  601 VAL 601 601 601 VAL VAL D . n 
S  3  602 LEU 602 602 602 LEU LEU D . n 
S  3  603 PRO 603 603 603 PRO PRO D . n 
S  3  604 ALA 604 604 604 ALA ALA D . n 
S  3  605 PRO 605 605 605 PRO PRO D . n 
S  3  606 THR 606 606 606 THR THR D . n 
S  3  607 PHE 607 607 607 PHE PHE D . n 
S  3  608 TYR 608 608 608 TYR TYR D . n 
S  3  609 GLU 609 609 609 GLU GLU D . n 
S  3  610 LYS 610 610 610 LYS LYS D . n 
S  3  611 ARG 611 611 611 ARG ARG D . n 
S  3  612 GLY 612 612 612 GLY GLY D . n 
S  3  613 HIS 613 613 613 HIS HIS D . n 
S  3  614 LEU 614 614 614 LEU LEU D . n 
S  3  615 VAL 615 615 615 VAL VAL D . n 
S  3  616 ASN 616 616 616 ASN ASN D . n 
S  3  617 LEU 617 617 617 LEU LEU D . n 
S  3  618 GLU 618 618 618 GLU GLU D . n 
S  3  619 GLY 619 619 619 GLY GLY D . n 
S  3  620 ARG 620 620 620 ARG ARG D . n 
S  3  621 VAL 621 621 621 VAL VAL D . n 
S  3  622 LEU 622 622 622 LEU LEU D . n 
S  3  623 PRO 623 623 623 PRO PRO D . n 
S  3  624 LEU 624 624 624 LEU LEU D . n 
S  3  625 SER 625 625 625 SER SER D . n 
S  3  626 PRO 626 626 626 PRO PRO D . n 
S  3  627 ALA 627 627 627 ALA ALA D . n 
S  3  628 PRO 628 628 628 PRO PRO D . n 
S  3  629 ILE 629 629 629 ILE ILE D . n 
S  3  630 GLU 630 630 630 GLU GLU D . n 
S  3  631 ASN 631 631 631 ASN ASN D . n 
S  3  632 GLY 632 632 632 GLY GLY D . n 
S  3  633 GLU 633 633 633 GLU GLU D . n 
S  3  634 ALA 634 634 634 ALA ALA D . n 
S  3  635 GLU 635 635 635 GLU GLU D . n 
S  3  636 GLY 636 636 636 GLY GLY D . n 
S  3  637 ALA 637 637 637 ALA ALA D . n 
S  3  638 LEU 638 638 638 LEU LEU D . n 
S  3  639 GLN 639 639 639 GLN GLN D . n 
S  3  640 VAL 640 640 640 VAL VAL D . n 
S  3  641 LEU 641 641 641 LEU LEU D . n 
S  3  642 ALA 642 642 642 ALA ALA D . n 
S  3  643 LEU 643 643 643 LEU LEU D . n 
S  3  644 LEU 644 644 644 LEU LEU D . n 
S  3  645 ALA 645 645 645 ALA ALA D . n 
S  3  646 GLU 646 646 646 GLU GLU D . n 
S  3  647 ALA 647 647 647 ALA ALA D . n 
S  3  648 LEU 648 648 648 LEU LEU D . n 
S  3  649 GLY 649 649 649 GLY GLY D . n 
S  3  650 VAL 650 650 650 VAL VAL D . n 
S  3  651 ARG 651 651 651 ARG ARG D . n 
S  3  652 PRO 652 652 652 PRO PRO D . n 
S  3  653 PRO 653 653 653 PRO PRO D . n 
S  3  654 PHE 654 654 654 PHE PHE D . n 
S  3  655 ARG 655 655 655 ARG ARG D . n 
S  3  656 LEU 656 656 656 LEU LEU D . n 
S  3  657 HIS 657 657 657 HIS HIS D . n 
S  3  658 LEU 658 658 658 LEU LEU D . n 
S  3  659 GLU 659 659 659 GLU GLU D . n 
S  3  660 ALA 660 660 660 ALA ALA D . n 
S  3  661 GLN 661 661 661 GLN GLN D . n 
S  3  662 LYS 662 662 662 LYS LYS D . n 
S  3  663 ALA 663 663 663 ALA ALA D . n 
S  3  664 LEU 664 664 664 LEU LEU D . n 
S  3  665 LYS 665 665 665 LYS LYS D . n 
S  3  666 ALA 666 666 666 ALA ALA D . n 
S  3  667 ARG 667 667 667 ARG ARG D . n 
S  3  668 LYS 668 668 668 LYS LYS D . n 
S  3  669 VAL 669 669 669 VAL VAL D . n 
S  3  670 PRO 670 670 670 PRO PRO D . n 
S  3  671 GLU 671 671 671 GLU GLU D . n 
S  3  672 ALA 672 672 672 ALA ALA D . n 
S  3  673 MET 673 673 673 MET MET D . n 
S  3  674 GLY 674 674 674 GLY GLY D . n 
S  3  675 ARG 675 675 675 ARG ARG D . n 
S  3  676 LEU 676 676 676 LEU LEU D . n 
S  3  677 SER 677 677 677 SER SER D . n 
S  3  678 PHE 678 678 678 PHE PHE D . n 
S  3  679 ARG 679 679 679 ARG ARG D . n 
S  3  680 LEU 680 680 680 LEU LEU D . n 
S  3  681 LYS 681 681 681 LYS LYS D . n 
S  3  682 GLU 682 682 682 GLU GLU D . n 
S  3  683 LEU 683 683 683 LEU LEU D . n 
S  3  684 ARG 684 684 684 ARG ARG D . n 
S  3  685 PRO 685 685 685 PRO PRO D . n 
S  3  686 LYS 686 686 686 LYS LYS D . n 
S  3  687 GLU 687 687 687 GLU GLU D . n 
S  3  688 ARG 688 688 688 ARG ARG D . n 
S  3  689 LYS 689 689 689 LYS LYS D . n 
S  3  690 GLY 690 690 690 GLY GLY D . n 
S  3  691 ALA 691 691 691 ALA ALA D . n 
S  3  692 PHE 692 692 692 PHE PHE D . n 
S  3  693 TYR 693 693 693 TYR TYR D . n 
S  3  694 LEU 694 694 694 LEU LEU D . n 
S  3  695 ARG 695 695 695 ARG ARG D . n 
S  3  696 PRO 696 696 696 PRO PRO D . n 
S  3  697 THR 697 697 697 THR THR D . n 
S  3  698 MET 698 698 698 MET MET D . n 
S  3  699 TRP 699 699 699 TRP TRP D . n 
S  3  700 LYS 700 700 700 LYS LYS D . n 
S  3  701 ALA 701 701 701 ALA ALA D . n 
S  3  702 HIS 702 702 702 HIS HIS D . n 
S  3  703 GLN 703 703 703 GLN GLN D . n 
S  3  704 ALA 704 704 704 ALA ALA D . n 
S  3  705 VAL 705 705 705 VAL VAL D . n 
S  3  706 GLY 706 706 706 GLY GLY D . n 
S  3  707 LYS 707 707 707 LYS LYS D . n 
S  3  708 ALA 708 708 708 ALA ALA D . n 
S  3  709 GLN 709 709 709 GLN GLN D . n 
S  3  710 GLU 710 710 710 GLU GLU D . n 
S  3  711 ALA 711 711 711 ALA ALA D . n 
S  3  712 ALA 712 712 712 ALA ALA D . n 
S  3  713 ARG 713 713 713 ARG ARG D . n 
S  3  714 ALA 714 714 714 ALA ALA D . n 
S  3  715 GLU 715 715 715 GLU GLU D . n 
S  3  716 LEU 716 716 716 LEU LEU D . n 
S  3  717 TRP 717 717 717 TRP TRP D . n 
S  3  718 ALA 718 718 718 ALA ALA D . n 
S  3  719 HIS 719 719 719 HIS HIS D . n 
S  3  720 PRO 720 720 720 PRO PRO D . n 
S  3  721 GLU 721 721 721 GLU GLU D . n 
S  3  722 THR 722 722 722 THR THR D . n 
S  3  723 ALA 723 723 723 ALA ALA D . n 
S  3  724 ARG 724 724 724 ARG ARG D . n 
S  3  725 ALA 725 725 725 ALA ALA D . n 
S  3  726 GLU 726 726 726 GLU GLU D . n 
S  3  727 ALA 727 727 727 ALA ALA D . n 
S  3  728 LEU 728 728 728 LEU LEU D . n 
S  3  729 PRO 729 729 729 PRO PRO D . n 
S  3  730 GLU 730 730 730 GLU GLU D . n 
S  3  731 GLY 731 731 731 GLY GLY D . n 
S  3  732 ALA 732 732 732 ALA ALA D . n 
S  3  733 GLN 733 733 733 GLN GLN D . n 
S  3  734 VAL 734 734 734 VAL VAL D . n 
S  3  735 ALA 735 735 735 ALA ALA D . n 
S  3  736 VAL 736 736 736 VAL VAL D . n 
S  3  737 GLU 737 737 737 GLU GLU D . n 
S  3  738 THR 738 738 738 THR THR D . n 
S  3  739 PRO 739 739 739 PRO PRO D . n 
S  3  740 PHE 740 740 740 PHE PHE D . n 
S  3  741 GLY 741 741 741 GLY GLY D . n 
S  3  742 ARG 742 742 742 ARG ARG D . n 
S  3  743 VAL 743 743 743 VAL VAL D . n 
S  3  744 GLU 744 744 744 GLU GLU D . n 
S  3  745 ALA 745 745 745 ALA ALA D . n 
S  3  746 ARG 746 746 746 ARG ARG D . n 
S  3  747 VAL 747 747 747 VAL VAL D . n 
S  3  748 VAL 748 748 748 VAL VAL D . n 
S  3  749 HIS 749 749 749 HIS HIS D . n 
S  3  750 ARG 750 750 750 ARG ARG D . n 
S  3  751 GLU 751 751 751 GLU GLU D . n 
S  3  752 ASP 752 752 752 ASP ASP D . n 
S  3  753 VAL 753 753 753 VAL VAL D . n 
S  3  754 PRO 754 754 754 PRO PRO D . n 
S  3  755 LYS 755 755 755 LYS LYS D . n 
S  3  756 GLY 756 756 756 GLY GLY D . n 
S  3  757 HIS 757 757 757 HIS HIS D . n 
S  3  758 LEU 758 758 758 LEU LEU D . n 
S  3  759 TYR 759 759 759 TYR TYR D . n 
S  3  760 LEU 760 760 760 LEU LEU D . n 
S  3  761 SER 761 761 761 SER SER D . n 
S  3  762 ALA 762 762 762 ALA ALA D . n 
S  3  763 LEU 763 763 763 LEU LEU D . n 
S  3  764 GLY 764 764 764 GLY GLY D . n 
S  3  765 PRO 765 765 765 PRO PRO D . n 
S  3  766 ALA 766 766 766 ALA ALA D . n 
S  3  767 ALA 767 767 767 ALA ALA D . n 
S  3  768 GLY 768 768 768 GLY GLY D . n 
S  3  769 LEU 769 769 769 LEU LEU D . n 
S  3  770 ARG 770 770 770 ARG ARG D . n 
S  3  771 VAL 771 771 771 VAL VAL D . n 
S  3  772 GLU 772 772 772 GLU GLU D . n 
S  3  773 GLY 773 773 773 GLY GLY D . n 
S  3  774 ARG 774 774 774 ARG ARG D . n 
S  3  775 VAL 775 775 775 VAL VAL D . n 
S  3  776 LEU 776 776 776 LEU LEU D . n 
S  3  777 VAL 777 777 777 VAL VAL D . n 
S  3  778 PRO 778 778 ?   ?   ?   D . n 
S  3  779 ALA 779 779 ?   ?   ?   D . n 
S  3  780 GLY 780 780 ?   ?   ?   D . n 
S  3  781 GLY 781 781 ?   ?   ?   D . n 
S  3  782 GLU 782 782 ?   ?   ?   D . n 
S  3  783 ALA 783 783 ?   ?   ?   D . n 
T  4  1   MET 1   1   ?   ?   ?   E . n 
T  4  2   ARG 2   2   ?   ?   ?   E . n 
T  4  3   GLU 3   3   ?   ?   ?   E . n 
T  4  4   GLU 4   4   ?   ?   ?   E . n 
T  4  5   PHE 5   5   ?   ?   ?   E . n 
T  4  6   LEU 6   6   ?   ?   ?   E . n 
T  4  7   GLU 7   7   ?   ?   ?   E . n 
T  4  8   GLU 8   8   ?   ?   ?   E . n 
T  4  9   ILE 9   9   ?   ?   ?   E . n 
T  4  10  PRO 10  10  ?   ?   ?   E . n 
T  4  11  LEU 11  11  ?   ?   ?   E . n 
T  4  12  ASP 12  12  ?   ?   ?   E . n 
T  4  13  ALA 13  13  ?   ?   ?   E . n 
T  4  14  PRO 14  14  ?   ?   ?   E . n 
T  4  15  PRO 15  15  ?   ?   ?   E . n 
T  4  16  GLU 16  16  ?   ?   ?   E . n 
T  4  17  GLU 17  17  ?   ?   ?   E . n 
T  4  18  ALA 18  18  ?   ?   ?   E . n 
T  4  19  LYS 19  19  ?   ?   ?   E . n 
T  4  20  GLU 20  20  ?   ?   ?   E . n 
T  4  21  LEU 21  21  ?   ?   ?   E . n 
T  4  22  ARG 22  22  ?   ?   ?   E . n 
T  4  23  THR 23  23  ?   ?   ?   E . n 
T  4  24  GLU 24  24  ?   ?   ?   E . n 
T  4  25  VAL 25  25  ?   ?   ?   E . n 
T  4  26  MET 26  26  26  MET MET E . n 
T  4  27  THR 27  27  27  THR THR E . n 
T  4  28  LEU 28  28  28  LEU LEU E . n 
T  4  29  ASN 29  29  29  ASN ASN E . n 
T  4  30  VAL 30  30  30  VAL VAL E . n 
T  4  31  GLY 31  31  31  GLY GLY E . n 
T  4  32  PRO 32  32  32  PRO PRO E . n 
T  4  33  GLN 33  33  33  GLN GLN E . n 
T  4  34  HIS 34  34  34  HIS HIS E . n 
T  4  35  PRO 35  35  35  PRO PRO E . n 
T  4  36  SER 36  36  36  SER SER E . n 
T  4  37  THR 37  37  37  THR THR E . n 
T  4  38  HIS 38  38  38  HIS HIS E . n 
T  4  39  GLY 39  39  39  GLY GLY E . n 
T  4  40  VAL 40  40  40  VAL VAL E . n 
T  4  41  LEU 41  41  41  LEU LEU E . n 
T  4  42  ARG 42  42  42  ARG ARG E . n 
T  4  43  LEU 43  43  43  LEU LEU E . n 
T  4  44  MET 44  44  44  MET MET E . n 
T  4  45  VAL 45  45  45  VAL VAL E . n 
T  4  46  THR 46  46  46  THR THR E . n 
T  4  47  LEU 47  47  47  LEU LEU E . n 
T  4  48  SER 48  48  48  SER SER E . n 
T  4  49  GLY 49  49  49  GLY GLY E . n 
T  4  50  GLU 50  50  50  GLU GLU E . n 
T  4  51  GLU 51  51  51  GLU GLU E . n 
T  4  52  VAL 52  52  52  VAL VAL E . n 
T  4  53  LEU 53  53  53  LEU LEU E . n 
T  4  54  GLU 54  54  54  GLU GLU E . n 
T  4  55  VAL 55  55  55  VAL VAL E . n 
T  4  56  VAL 56  56  56  VAL VAL E . n 
T  4  57  PRO 57  57  57  PRO PRO E . n 
T  4  58  HIS 58  58  58  HIS HIS E . n 
T  4  59  ILE 59  59  59  ILE ILE E . n 
T  4  60  GLY 60  60  60  GLY GLY E . n 
T  4  61  TYR 61  61  61  TYR TYR E . n 
T  4  62  LEU 62  62  62  LEU LEU E . n 
T  4  63  HIS 63  63  63  HIS HIS E . n 
T  4  64  THR 64  64  64  THR THR E . n 
T  4  65  GLY 65  65  65  GLY GLY E . n 
T  4  66  PHE 66  66  66  PHE PHE E . n 
T  4  67  GLU 67  67  67  GLU GLU E . n 
T  4  68  LYS 68  68  68  LYS LYS E . n 
T  4  69  THR 69  69  69  THR THR E . n 
T  4  70  MET 70  70  70  MET MET E . n 
T  4  71  GLU 71  71  71  GLU GLU E . n 
T  4  72  HIS 72  72  72  HIS HIS E . n 
T  4  73  ARG 73  73  73  ARG ARG E . n 
T  4  74  THR 74  74  74  THR THR E . n 
T  4  75  TYR 75  75  75  TYR TYR E . n 
T  4  76  LEU 76  76  76  LEU LEU E . n 
T  4  77  GLN 77  77  77  GLN GLN E . n 
T  4  78  ASN 78  78  78  ASN ASN E . n 
T  4  79  ILE 79  79  79  ILE ILE E . n 
T  4  80  THR 80  80  80  THR THR E . n 
T  4  81  TYR 81  81  81  TYR TYR E . n 
T  4  82  THR 82  82  82  THR THR E . n 
T  4  83  PRO 83  83  83  PRO PRO E . n 
T  4  84  ARG 84  84  84  ARG ARG E . n 
T  4  85  MET 85  85  85  MET MET E . n 
T  4  86  ASP 86  86  86  ASP ASP E . n 
T  4  87  TYR 87  87  87  TYR TYR E . n 
T  4  88  LEU 88  88  88  LEU LEU E . n 
T  4  89  HIS 89  89  89  HIS HIS E . n 
T  4  90  SER 90  90  90  SER SER E . n 
T  4  91  PHE 91  91  91  PHE PHE E . n 
T  4  92  ALA 92  92  92  ALA ALA E . n 
T  4  93  HIS 93  93  93  HIS HIS E . n 
T  4  94  ASP 94  94  94  ASP ASP E . n 
T  4  95  LEU 95  95  95  LEU LEU E . n 
T  4  96  ALA 96  96  96  ALA ALA E . n 
T  4  97  TYR 97  97  97  TYR TYR E . n 
T  4  98  ALA 98  98  98  ALA ALA E . n 
T  4  99  LEU 99  99  99  LEU LEU E . n 
T  4  100 ALA 100 100 100 ALA ALA E . n 
T  4  101 VAL 101 101 101 VAL VAL E . n 
T  4  102 GLU 102 102 102 GLU GLU E . n 
T  4  103 LYS 103 103 103 LYS LYS E . n 
T  4  104 LEU 104 104 104 LEU LEU E . n 
T  4  105 LEU 105 105 105 LEU LEU E . n 
T  4  106 GLY 106 106 106 GLY GLY E . n 
T  4  107 ALA 107 107 107 ALA ALA E . n 
T  4  108 VAL 108 108 108 VAL VAL E . n 
T  4  109 VAL 109 109 109 VAL VAL E . n 
T  4  110 PRO 110 110 110 PRO PRO E . n 
T  4  111 PRO 111 111 111 PRO PRO E . n 
T  4  112 ARG 112 112 112 ARG ARG E . n 
T  4  113 ALA 113 113 113 ALA ALA E . n 
T  4  114 GLU 114 114 114 GLU GLU E . n 
T  4  115 THR 115 115 115 THR THR E . n 
T  4  116 ILE 116 116 116 ILE ILE E . n 
T  4  117 ARG 117 117 117 ARG ARG E . n 
T  4  118 VAL 118 118 118 VAL VAL E . n 
T  4  119 ILE 119 119 119 ILE ILE E . n 
T  4  120 LEU 120 120 120 LEU LEU E . n 
T  4  121 ASN 121 121 121 ASN ASN E . n 
T  4  122 GLU 122 122 122 GLU GLU E . n 
T  4  123 LEU 123 123 123 LEU LEU E . n 
T  4  124 SER 124 124 124 SER SER E . n 
T  4  125 ARG 125 125 125 ARG ARG E . n 
T  4  126 LEU 126 126 126 LEU LEU E . n 
T  4  127 ALA 127 127 127 ALA ALA E . n 
T  4  128 SER 128 128 128 SER SER E . n 
T  4  129 HIS 129 129 129 HIS HIS E . n 
T  4  130 LEU 130 130 130 LEU LEU E . n 
T  4  131 VAL 131 131 131 VAL VAL E . n 
T  4  132 PHE 132 132 132 PHE PHE E . n 
T  4  133 LEU 133 133 133 LEU LEU E . n 
T  4  134 GLY 134 134 134 GLY GLY E . n 
T  4  135 THR 135 135 135 THR THR E . n 
T  4  136 GLY 136 136 136 GLY GLY E . n 
T  4  137 LEU 137 137 137 LEU LEU E . n 
T  4  138 LEU 138 138 138 LEU LEU E . n 
T  4  139 ASP 139 139 139 ASP ASP E . n 
T  4  140 LEU 140 140 140 LEU LEU E . n 
T  4  141 GLY 141 141 141 GLY GLY E . n 
T  4  142 ALA 142 142 142 ALA ALA E . n 
T  4  143 LEU 143 143 143 LEU LEU E . n 
T  4  144 THR 144 144 144 THR THR E . n 
T  4  145 PRO 145 145 145 PRO PRO E . n 
T  4  146 PHE 146 146 146 PHE PHE E . n 
T  4  147 PHE 147 147 147 PHE PHE E . n 
T  4  148 TYR 148 148 148 TYR TYR E . n 
T  4  149 ALA 149 149 149 ALA ALA E . n 
T  4  150 PHE 150 150 150 PHE PHE E . n 
T  4  151 ARG 151 151 151 ARG ARG E . n 
T  4  152 GLU 152 152 152 GLU GLU E . n 
T  4  153 ARG 153 153 153 ARG ARG E . n 
T  4  154 GLU 154 154 154 GLU GLU E . n 
T  4  155 THR 155 155 155 THR THR E . n 
T  4  156 ILE 156 156 156 ILE ILE E . n 
T  4  157 LEU 157 157 157 LEU LEU E . n 
T  4  158 ASP 158 158 158 ASP ASP E . n 
T  4  159 LEU 159 159 159 LEU LEU E . n 
T  4  160 PHE 160 160 160 PHE PHE E . n 
T  4  161 GLU 161 161 161 GLU GLU E . n 
T  4  162 TRP 162 162 162 TRP TRP E . n 
T  4  163 VAL 163 163 163 VAL VAL E . n 
T  4  164 THR 164 164 164 THR THR E . n 
T  4  165 GLY 165 165 165 GLY GLY E . n 
T  4  166 GLN 166 166 166 GLN GLN E . n 
T  4  167 ARG 167 167 167 ARG ARG E . n 
T  4  168 PHE 168 168 168 PHE PHE E . n 
T  4  169 HIS 169 169 169 HIS HIS E . n 
T  4  170 HIS 170 170 170 HIS HIS E . n 
T  4  171 ASN 171 171 171 ASN ASN E . n 
T  4  172 TYR 172 172 172 TYR TYR E . n 
T  4  173 ILE 173 173 173 ILE ILE E . n 
T  4  174 ARG 174 174 174 ARG ARG E . n 
T  4  175 ILE 175 175 175 ILE ILE E . n 
T  4  176 GLY 176 176 176 GLY GLY E . n 
T  4  177 GLY 177 177 177 GLY GLY E . n 
T  4  178 VAL 178 178 178 VAL VAL E . n 
T  4  179 LYS 179 179 179 LYS LYS E . n 
T  4  180 GLU 180 180 180 GLU GLU E . n 
T  4  181 ASP 181 181 181 ASP ASP E . n 
T  4  182 LEU 182 182 182 LEU LEU E . n 
T  4  183 PRO 183 183 183 PRO PRO E . n 
T  4  184 GLU 184 184 184 GLU GLU E . n 
T  4  185 GLU 185 185 185 GLU GLU E . n 
T  4  186 PHE 186 186 186 PHE PHE E . n 
T  4  187 VAL 187 187 187 VAL VAL E . n 
T  4  188 PRO 188 188 188 PRO PRO E . n 
T  4  189 GLU 189 189 189 GLU GLU E . n 
T  4  190 LEU 190 190 190 LEU LEU E . n 
T  4  191 LYS 191 191 191 LYS LYS E . n 
T  4  192 LYS 192 192 192 LYS LYS E . n 
T  4  193 LEU 193 193 193 LEU LEU E . n 
T  4  194 LEU 194 194 194 LEU LEU E . n 
T  4  195 GLU 195 195 195 GLU GLU E . n 
T  4  196 VAL 196 196 196 VAL VAL E . n 
T  4  197 LEU 197 197 197 LEU LEU E . n 
T  4  198 PRO 198 198 198 PRO PRO E . n 
T  4  199 HIS 199 199 199 HIS HIS E . n 
T  4  200 ARG 200 200 200 ARG ARG E . n 
T  4  201 ILE 201 201 201 ILE ILE E . n 
T  4  202 ASP 202 202 202 ASP ASP E . n 
T  4  203 GLU 203 203 203 GLU GLU E . n 
T  4  204 TYR 204 204 204 TYR TYR E . n 
T  4  205 GLU 205 205 205 GLU GLU E . n 
T  4  206 ALA 206 206 206 ALA ALA E . n 
T  4  207 LEU 207 207 207 LEU LEU E . n 
T  4  208 PHE 208 208 208 PHE PHE E . n 
T  4  209 ALA 209 209 209 ALA ALA E . n 
T  4  210 GLU 210 210 210 GLU GLU E . n 
T  4  211 SER 211 211 211 SER SER E . n 
T  4  212 PRO 212 212 212 PRO PRO E . n 
T  4  213 ILE 213 213 213 ILE ILE E . n 
T  4  214 PHE 214 214 214 PHE PHE E . n 
T  4  215 TYR 215 215 215 TYR TYR E . n 
T  4  216 GLU 216 216 216 GLU GLU E . n 
T  4  217 ARG 217 217 217 ARG ARG E . n 
T  4  218 ALA 218 218 218 ALA ALA E . n 
T  4  219 ARG 219 219 219 ARG ARG E . n 
T  4  220 GLY 220 220 220 GLY GLY E . n 
T  4  221 VAL 221 221 221 VAL VAL E . n 
T  4  222 GLY 222 222 222 GLY GLY E . n 
T  4  223 VAL 223 223 223 VAL VAL E . n 
T  4  224 ILE 224 224 224 ILE ILE E . n 
T  4  225 PRO 225 225 225 PRO PRO E . n 
T  4  226 PRO 226 226 226 PRO PRO E . n 
T  4  227 GLU 227 227 227 GLU GLU E . n 
T  4  228 VAL 228 228 228 VAL VAL E . n 
T  4  229 ALA 229 229 229 ALA ALA E . n 
T  4  230 ILE 230 230 230 ILE ILE E . n 
T  4  231 ASP 231 231 231 ASP ASP E . n 
T  4  232 LEU 232 232 232 LEU LEU E . n 
T  4  233 GLY 233 233 233 GLY GLY E . n 
T  4  234 LEU 234 234 234 LEU LEU E . n 
T  4  235 THR 235 235 235 THR THR E . n 
T  4  236 GLY 236 236 236 GLY GLY E . n 
T  4  237 GLY 237 237 237 GLY GLY E . n 
T  4  238 SER 238 238 238 SER SER E . n 
T  4  239 LEU 239 239 239 LEU LEU E . n 
T  4  240 ARG 240 240 240 ARG ARG E . n 
T  4  241 ALA 241 241 241 ALA ALA E . n 
T  4  242 SER 242 242 242 SER SER E . n 
T  4  243 GLY 243 243 243 GLY GLY E . n 
T  4  244 VAL 244 244 244 VAL VAL E . n 
T  4  245 ASN 245 245 245 ASN ASN E . n 
T  4  246 TYR 246 246 246 TYR TYR E . n 
T  4  247 ASP 247 247 247 ASP ASP E . n 
T  4  248 VAL 248 248 248 VAL VAL E . n 
T  4  249 ARG 249 249 249 ARG ARG E . n 
T  4  250 LYS 250 250 250 LYS LYS E . n 
T  4  251 ALA 251 251 251 ALA ALA E . n 
T  4  252 TYR 252 252 252 TYR TYR E . n 
T  4  253 PRO 253 253 253 PRO PRO E . n 
T  4  254 TYR 254 254 254 TYR TYR E . n 
T  4  255 SER 255 255 255 SER SER E . n 
T  4  256 GLY 256 256 256 GLY GLY E . n 
T  4  257 TYR 257 257 257 TYR TYR E . n 
T  4  258 GLU 258 258 258 GLU GLU E . n 
T  4  259 THR 259 259 259 THR THR E . n 
T  4  260 TYR 260 260 260 TYR TYR E . n 
T  4  261 THR 261 261 261 THR THR E . n 
T  4  262 PHE 262 262 262 PHE PHE E . n 
T  4  263 ASP 263 263 263 ASP ASP E . n 
T  4  264 VAL 264 264 264 VAL VAL E . n 
T  4  265 PRO 265 265 265 PRO PRO E . n 
T  4  266 LEU 266 266 266 LEU LEU E . n 
T  4  267 GLY 267 267 267 GLY GLY E . n 
T  4  268 GLU 268 268 268 GLU GLU E . n 
T  4  269 ARG 269 269 269 ARG ARG E . n 
T  4  270 GLY 270 270 270 GLY GLY E . n 
T  4  271 ASP 271 271 271 ASP ASP E . n 
T  4  272 VAL 272 272 272 VAL VAL E . n 
T  4  273 PHE 273 273 273 PHE PHE E . n 
T  4  274 ASP 274 274 274 ASP ASP E . n 
T  4  275 ARG 275 275 275 ARG ARG E . n 
T  4  276 MET 276 276 276 MET MET E . n 
T  4  277 LEU 277 277 277 LEU LEU E . n 
T  4  278 VAL 278 278 278 VAL VAL E . n 
T  4  279 ARG 279 279 279 ARG ARG E . n 
T  4  280 ILE 280 280 280 ILE ILE E . n 
T  4  281 ARG 281 281 281 ARG ARG E . n 
T  4  282 GLU 282 282 282 GLU GLU E . n 
T  4  283 MET 283 283 283 MET MET E . n 
T  4  284 ARG 284 284 284 ARG ARG E . n 
T  4  285 GLU 285 285 285 GLU GLU E . n 
T  4  286 SER 286 286 286 SER SER E . n 
T  4  287 VAL 287 287 287 VAL VAL E . n 
T  4  288 LYS 288 288 288 LYS LYS E . n 
T  4  289 ILE 289 289 289 ILE ILE E . n 
T  4  290 ILE 290 290 290 ILE ILE E . n 
T  4  291 LYS 291 291 291 LYS LYS E . n 
T  4  292 GLN 292 292 292 GLN GLN E . n 
T  4  293 ALA 293 293 293 ALA ALA E . n 
T  4  294 LEU 294 294 294 LEU LEU E . n 
T  4  295 GLU 295 295 295 GLU GLU E . n 
T  4  296 ARG 296 296 296 ARG ARG E . n 
T  4  297 LEU 297 297 297 LEU LEU E . n 
T  4  298 GLU 298 298 298 GLU GLU E . n 
T  4  299 PRO 299 299 299 PRO PRO E . n 
T  4  300 GLY 300 300 300 GLY GLY E . n 
T  4  301 PRO 301 301 301 PRO PRO E . n 
T  4  302 VAL 302 302 302 VAL VAL E . n 
T  4  303 ARG 303 303 303 ARG ARG E . n 
T  4  304 ASP 304 304 304 ASP ASP E . n 
T  4  305 PRO 305 305 305 PRO PRO E . n 
T  4  306 ASN 306 306 306 ASN ASN E . n 
T  4  307 PRO 307 307 307 PRO PRO E . n 
T  4  308 GLN 308 308 308 GLN GLN E . n 
T  4  309 ILE 309 309 309 ILE ILE E . n 
T  4  310 THR 310 310 310 THR THR E . n 
T  4  311 PRO 311 311 311 PRO PRO E . n 
T  4  312 PRO 312 312 312 PRO PRO E . n 
T  4  313 PRO 313 313 313 PRO PRO E . n 
T  4  314 ARG 314 314 314 ARG ARG E . n 
T  4  315 HIS 315 315 315 HIS HIS E . n 
T  4  316 LEU 316 316 316 LEU LEU E . n 
T  4  317 LEU 317 317 317 LEU LEU E . n 
T  4  318 GLU 318 318 318 GLU GLU E . n 
T  4  319 THR 319 319 319 THR THR E . n 
T  4  320 SER 320 320 320 SER SER E . n 
T  4  321 MET 321 321 321 MET MET E . n 
T  4  322 GLU 322 322 322 GLU GLU E . n 
T  4  323 ALA 323 323 323 ALA ALA E . n 
T  4  324 VAL 324 324 324 VAL VAL E . n 
T  4  325 ILE 325 325 325 ILE ILE E . n 
T  4  326 TYR 326 326 326 TYR TYR E . n 
T  4  327 HIS 327 327 327 HIS HIS E . n 
T  4  328 PHE 328 328 328 PHE PHE E . n 
T  4  329 LYS 329 329 329 LYS LYS E . n 
T  4  330 HIS 330 330 330 HIS HIS E . n 
T  4  331 TYR 331 331 331 TYR TYR E . n 
T  4  332 THR 332 332 332 THR THR E . n 
T  4  333 GLU 333 333 333 GLU GLU E . n 
T  4  334 GLY 334 334 334 GLY GLY E . n 
T  4  335 PHE 335 335 335 PHE PHE E . n 
T  4  336 HIS 336 336 336 HIS HIS E . n 
T  4  337 PRO 337 337 337 PRO PRO E . n 
T  4  338 PRO 338 338 338 PRO PRO E . n 
T  4  339 LYS 339 339 339 LYS LYS E . n 
T  4  340 GLY 340 340 340 GLY GLY E . n 
T  4  341 GLU 341 341 341 GLU GLU E . n 
T  4  342 VAL 342 342 342 VAL VAL E . n 
T  4  343 TYR 343 343 343 TYR TYR E . n 
T  4  344 VAL 344 344 344 VAL VAL E . n 
T  4  345 PRO 345 345 345 PRO PRO E . n 
T  4  346 THR 346 346 346 THR THR E . n 
T  4  347 GLU 347 347 347 GLU GLU E . n 
T  4  348 SER 348 348 348 SER SER E . n 
T  4  349 ALA 349 349 349 ALA ALA E . n 
T  4  350 ARG 350 350 350 ARG ARG E . n 
T  4  351 GLY 351 351 351 GLY GLY E . n 
T  4  352 GLU 352 352 352 GLU GLU E . n 
T  4  353 LEU 353 353 353 LEU LEU E . n 
T  4  354 GLY 354 354 354 GLY GLY E . n 
T  4  355 TYR 355 355 355 TYR TYR E . n 
T  4  356 TYR 356 356 356 TYR TYR E . n 
T  4  357 ILE 357 357 357 ILE ILE E . n 
T  4  358 VAL 358 358 358 VAL VAL E . n 
T  4  359 SER 359 359 359 SER SER E . n 
T  4  360 ASP 360 360 360 ASP ASP E . n 
T  4  361 GLY 361 361 361 GLY GLY E . n 
T  4  362 GLY 362 362 362 GLY GLY E . n 
T  4  363 SER 363 363 363 SER SER E . n 
T  4  364 MET 364 364 364 MET MET E . n 
T  4  365 PRO 365 365 365 PRO PRO E . n 
T  4  366 TYR 366 366 366 TYR TYR E . n 
T  4  367 ARG 367 367 367 ARG ARG E . n 
T  4  368 VAL 368 368 368 VAL VAL E . n 
T  4  369 LYS 369 369 369 LYS LYS E . n 
T  4  370 VAL 370 370 370 VAL VAL E . n 
T  4  371 ARG 371 371 371 ARG ARG E . n 
T  4  372 ALA 372 372 372 ALA ALA E . n 
T  4  373 PRO 373 373 373 PRO PRO E . n 
T  4  374 SER 374 374 374 SER SER E . n 
T  4  375 PHE 375 375 375 PHE PHE E . n 
T  4  376 VAL 376 376 376 VAL VAL E . n 
T  4  377 ASN 377 377 377 ASN ASN E . n 
T  4  378 LEU 378 378 378 LEU LEU E . n 
T  4  379 GLN 379 379 379 GLN GLN E . n 
T  4  380 SER 380 380 380 SER SER E . n 
T  4  381 LEU 381 381 381 LEU LEU E . n 
T  4  382 PRO 382 382 382 PRO PRO E . n 
T  4  383 TYR 383 383 383 TYR TYR E . n 
T  4  384 ALA 384 384 384 ALA ALA E . n 
T  4  385 CYS 385 385 385 CYS CYS E . n 
T  4  386 LYS 386 386 386 LYS LYS E . n 
T  4  387 GLY 387 387 387 GLY GLY E . n 
T  4  388 GLU 388 388 388 GLU GLU E . n 
T  4  389 GLN 389 389 389 GLN GLN E . n 
T  4  390 VAL 390 390 390 VAL VAL E . n 
T  4  391 PRO 391 391 391 PRO PRO E . n 
T  4  392 ASP 392 392 392 ASP ASP E . n 
T  4  393 MET 393 393 393 MET MET E . n 
T  4  394 VAL 394 394 394 VAL VAL E . n 
T  4  395 ALA 395 395 395 ALA ALA E . n 
T  4  396 ILE 396 396 396 ILE ILE E . n 
T  4  397 ILE 397 397 397 ILE ILE E . n 
T  4  398 ALA 398 398 398 ALA ALA E . n 
T  4  399 SER 399 399 399 SER SER E . n 
T  4  400 LEU 400 400 400 LEU LEU E . n 
T  4  401 ASP 401 401 401 ASP ASP E . n 
T  4  402 PRO 402 402 402 PRO PRO E . n 
T  4  403 VAL 403 403 403 VAL VAL E . n 
T  4  404 MET 404 404 404 MET MET E . n 
T  4  405 GLY 405 405 405 GLY GLY E . n 
T  4  406 ASP 406 406 406 ASP ASP E . n 
T  4  407 VAL 407 407 407 VAL VAL E . n 
T  4  408 ASP 408 408 408 ASP ASP E . n 
T  4  409 ARG 409 409 409 ARG ARG E . n 
U  5  1   MET 1   1   1   MET MET F . n 
U  5  2   ARG 2   2   2   ARG ARG F . n 
U  5  3   LEU 3   3   3   LEU LEU F . n 
U  5  4   GLU 4   4   4   GLU GLU F . n 
U  5  5   ARG 5   5   5   ARG ARG F . n 
U  5  6   VAL 6   6   6   VAL VAL F . n 
U  5  7   LEU 7   7   7   LEU LEU F . n 
U  5  8   GLU 8   8   8   GLU GLU F . n 
U  5  9   GLU 9   9   9   GLU GLU F . n 
U  5  10  ALA 10  10  10  ALA ALA F . n 
U  5  11  ARG 11  11  11  ARG ARG F . n 
U  5  12  ALA 12  12  12  ALA ALA F . n 
U  5  13  LYS 13  13  13  LYS LYS F . n 
U  5  14  GLY 14  14  14  GLY GLY F . n 
U  5  15  TYR 15  15  15  TYR TYR F . n 
U  5  16  PRO 16  16  16  PRO PRO F . n 
U  5  17  ILE 17  17  17  ILE ILE F . n 
U  5  18  GLU 18  18  18  GLU GLU F . n 
U  5  19  ASP 19  19  19  ASP ASP F . n 
U  5  20  ASN 20  20  20  ASN ASN F . n 
U  5  21  GLY 21  21  21  GLY GLY F . n 
U  5  22  LEU 22  22  22  LEU LEU F . n 
U  5  23  GLY 23  23  23  GLY GLY F . n 
U  5  24  ASN 24  24  24  ASN ASN F . n 
U  5  25  LEU 25  25  25  LEU LEU F . n 
U  5  26  TRP 26  26  26  TRP TRP F . n 
U  5  27  VAL 27  27  27  VAL VAL F . n 
U  5  28  VAL 28  28  28  VAL VAL F . n 
U  5  29  LEU 29  29  29  LEU LEU F . n 
U  5  30  PRO 30  30  30  PRO PRO F . n 
U  5  31  ARG 31  31  31  ARG ARG F . n 
U  5  32  GLU 32  32  32  GLU GLU F . n 
U  5  33  ARG 33  33  33  ARG ARG F . n 
U  5  34  PHE 34  34  34  PHE PHE F . n 
U  5  35  LYS 35  35  35  LYS LYS F . n 
U  5  36  GLU 36  36  36  GLU GLU F . n 
U  5  37  GLU 37  37  37  GLU GLU F . n 
U  5  38  MET 38  38  38  MET MET F . n 
U  5  39  ALA 39  39  39  ALA ALA F . n 
U  5  40  HIS 40  40  40  HIS HIS F . n 
U  5  41  TYR 41  41  41  TYR TYR F . n 
U  5  42  LYS 42  42  42  LYS LYS F . n 
U  5  43  ALA 43  43  43  ALA ALA F . n 
U  5  44  MET 44  44  44  MET MET F . n 
U  5  45  GLY 45  45  45  GLY GLY F . n 
U  5  46  PHE 46  46  46  PHE PHE F . n 
U  5  47  ASN 47  47  47  ASN ASN F . n 
U  5  48  PHE 48  48  48  PHE PHE F . n 
U  5  49  LEU 49  49  49  LEU LEU F . n 
U  5  50  ALA 50  50  50  ALA ALA F . n 
U  5  51  ASP 51  51  51  ASP ASP F . n 
U  5  52  ILE 52  52  52  ILE ILE F . n 
U  5  53  VAL 53  53  53  VAL VAL F . n 
U  5  54  GLY 54  54  54  GLY GLY F . n 
U  5  55  LEU 55  55  55  LEU LEU F . n 
U  5  56  ASP 56  56  56  ASP ASP F . n 
U  5  57  TYR 57  57  57  TYR TYR F . n 
U  5  58  LEU 58  58  58  LEU LEU F . n 
U  5  59  THR 59  59  59  THR THR F . n 
U  5  60  TYR 60  60  60  TYR TYR F . n 
U  5  61  PRO 61  61  61  PRO PRO F . n 
U  5  62  ASP 62  62  62  ASP ASP F . n 
U  5  63  PRO 63  63  63  PRO PRO F . n 
U  5  64  ARG 64  64  64  ARG ARG F . n 
U  5  65  PRO 65  65  65  PRO PRO F . n 
U  5  66  GLU 66  66  66  GLU GLU F . n 
U  5  67  ARG 67  67  67  ARG ARG F . n 
U  5  68  PHE 68  68  68  PHE PHE F . n 
U  5  69  ALA 69  69  69  ALA ALA F . n 
U  5  70  VAL 70  70  70  VAL VAL F . n 
U  5  71  VAL 71  71  71  VAL VAL F . n 
U  5  72  TYR 72  72  72  TYR TYR F . n 
U  5  73  GLU 73  73  73  GLU GLU F . n 
U  5  74  LEU 74  74  74  LEU LEU F . n 
U  5  75  VAL 75  75  75  VAL VAL F . n 
U  5  76  SER 76  76  76  SER SER F . n 
U  5  77  LEU 77  77  77  LEU LEU F . n 
U  5  78  PRO 78  78  78  PRO PRO F . n 
U  5  79  GLY 79  79  79  GLY GLY F . n 
U  5  80  TRP 80  80  80  TRP TRP F . n 
U  5  81  LYS 81  81  81  LYS LYS F . n 
U  5  82  ASP 82  82  82  ASP ASP F . n 
U  5  83  GLY 83  83  83  GLY GLY F . n 
U  5  84  ASP 84  84  84  ASP ASP F . n 
U  5  85  GLY 85  85  85  GLY GLY F . n 
U  5  86  SER 86  86  86  SER SER F . n 
U  5  87  ARG 87  87  87  ARG ARG F . n 
U  5  88  PHE 88  88  88  PHE PHE F . n 
U  5  89  PHE 89  89  89  PHE PHE F . n 
U  5  90  VAL 90  90  90  VAL VAL F . n 
U  5  91  ARG 91  91  91  ARG ARG F . n 
U  5  92  VAL 92  92  92  VAL VAL F . n 
U  5  93  TYR 93  93  93  TYR TYR F . n 
U  5  94  VAL 94  94  94  VAL VAL F . n 
U  5  95  PRO 95  95  95  PRO PRO F . n 
U  5  96  GLU 96  96  96  GLU GLU F . n 
U  5  97  GLU 97  97  97  GLU GLU F . n 
U  5  98  ASP 98  98  98  ASP ASP F . n 
U  5  99  PRO 99  99  99  PRO PRO F . n 
U  5  100 ARG 100 100 100 ARG ARG F . n 
U  5  101 LEU 101 101 101 LEU LEU F . n 
U  5  102 PRO 102 102 102 PRO PRO F . n 
U  5  103 THR 103 103 103 THR THR F . n 
U  5  104 VAL 104 104 104 VAL VAL F . n 
U  5  105 THR 105 105 105 THR THR F . n 
U  5  106 ASP 106 106 106 ASP ASP F . n 
U  5  107 LEU 107 107 107 LEU LEU F . n 
U  5  108 TRP 108 108 108 TRP TRP F . n 
U  5  109 GLY 109 109 109 GLY GLY F . n 
U  5  110 SER 110 110 110 SER SER F . n 
U  5  111 ALA 111 111 111 ALA ALA F . n 
U  5  112 ASN 112 112 112 ASN ASN F . n 
U  5  113 PHE 113 113 113 PHE PHE F . n 
U  5  114 LEU 114 114 114 LEU LEU F . n 
U  5  115 GLU 115 115 115 GLU GLU F . n 
U  5  116 ARG 116 116 116 ARG ARG F . n 
U  5  117 GLU 117 117 117 GLU GLU F . n 
U  5  118 VAL 118 118 118 VAL VAL F . n 
U  5  119 TYR 119 119 119 TYR TYR F . n 
U  5  120 ASP 120 120 120 ASP ASP F . n 
U  5  121 LEU 121 121 121 LEU LEU F . n 
U  5  122 PHE 122 122 122 PHE PHE F . n 
U  5  123 GLY 123 123 123 GLY GLY F . n 
U  5  124 ILE 124 124 124 ILE ILE F . n 
U  5  125 VAL 125 125 125 VAL VAL F . n 
U  5  126 PHE 126 126 126 PHE PHE F . n 
U  5  127 GLU 127 127 127 GLU GLU F . n 
U  5  128 GLY 128 128 128 GLY GLY F . n 
U  5  129 HIS 129 129 129 HIS HIS F . n 
U  5  130 PRO 130 130 130 PRO PRO F . n 
U  5  131 ASP 131 131 131 ASP ASP F . n 
U  5  132 LEU 132 132 132 LEU LEU F . n 
U  5  133 ARG 133 133 133 ARG ARG F . n 
U  5  134 LYS 134 134 134 LYS LYS F . n 
U  5  135 ILE 135 135 135 ILE ILE F . n 
U  5  136 LEU 136 136 136 LEU LEU F . n 
U  5  137 THR 137 137 137 THR THR F . n 
U  5  138 PRO 138 138 138 PRO PRO F . n 
U  5  139 GLU 139 139 139 GLU GLU F . n 
U  5  140 ASP 140 140 140 ASP ASP F . n 
U  5  141 LEU 141 141 141 LEU LEU F . n 
U  5  142 GLU 142 142 142 GLU GLU F . n 
U  5  143 GLY 143 143 143 GLY GLY F . n 
U  5  144 HIS 144 144 144 HIS HIS F . n 
U  5  145 PRO 145 145 145 PRO PRO F . n 
U  5  146 LEU 146 146 146 LEU LEU F . n 
U  5  147 ARG 147 147 147 ARG ARG F . n 
U  5  148 LYS 148 148 148 LYS LYS F . n 
U  5  149 ASP 149 149 149 ASP ASP F . n 
U  5  150 TYR 150 150 150 TYR TYR F . n 
U  5  151 PRO 151 151 151 PRO PRO F . n 
U  5  152 LEU 152 152 152 LEU LEU F . n 
U  5  153 GLY 153 153 153 GLY GLY F . n 
U  5  154 GLU 154 154 154 GLU GLU F . n 
U  5  155 THR 155 155 155 THR THR F . n 
U  5  156 PRO 156 156 156 PRO PRO F . n 
U  5  157 THR 157 157 157 THR THR F . n 
U  5  158 LEU 158 158 158 LEU LEU F . n 
U  5  159 PHE 159 159 159 PHE PHE F . n 
U  5  160 ARG 160 160 160 ARG ARG F . n 
U  5  161 GLU 161 161 161 GLU GLU F . n 
U  5  162 GLY 162 162 162 GLY GLY F . n 
U  5  163 ARG 163 163 163 ARG ARG F . n 
U  5  164 TYR 164 164 164 TYR TYR F . n 
U  5  165 ILE 165 165 165 ILE ILE F . n 
U  5  166 ILE 166 166 166 ILE ILE F . n 
U  5  167 PRO 167 167 167 PRO PRO F . n 
U  5  168 ALA 168 168 168 ALA ALA F . n 
U  5  169 GLU 169 169 169 GLU GLU F . n 
U  5  170 PHE 170 170 170 PHE PHE F . n 
U  5  171 ARG 171 171 171 ARG ARG F . n 
U  5  172 ALA 172 172 172 ALA ALA F . n 
U  5  173 ALA 173 173 173 ALA ALA F . n 
U  5  174 LEU 174 174 174 LEU LEU F . n 
U  5  175 THR 175 175 175 THR THR F . n 
U  5  176 GLY 176 176 176 GLY GLY F . n 
U  5  177 LYS 177 177 177 LYS LYS F . n 
U  5  178 ASP 178 178 178 ASP ASP F . n 
U  5  179 PRO 179 179 179 PRO PRO F . n 
U  5  180 GLY 180 180 180 GLY GLY F . n 
U  5  181 LEU 181 181 181 LEU LEU F . n 
U  5  182 THR 182 182 182 THR THR F . n 
U  5  183 PHE 183 183 183 PHE PHE F . n 
U  5  184 TYR 184 184 184 TYR TYR F . n 
U  5  185 LYS 185 185 185 LYS LYS F . n 
U  5  186 GLY 186 186 186 GLY GLY F . n 
U  5  187 GLY 187 187 187 GLY GLY F . n 
U  5  188 SER 188 188 188 SER SER F . n 
U  5  189 ARG 189 189 189 ARG ARG F . n 
U  5  190 LYS 190 190 190 LYS LYS F . n 
U  5  191 GLY 191 191 191 GLY GLY F . n 
U  5  192 TYR 192 192 192 TYR TYR F . n 
U  5  193 ARG 193 193 193 ARG ARG F . n 
U  5  194 SER 194 194 194 SER SER F . n 
U  5  195 LEU 195 195 195 LEU LEU F . n 
U  5  196 TRP 196 196 196 TRP TRP F . n 
U  5  197 ALA 197 197 ?   ?   ?   F . n 
U  5  198 ASP 198 198 ?   ?   ?   F . n 
U  5  199 LEU 199 199 ?   ?   ?   F . n 
U  5  200 LYS 200 200 ?   ?   ?   F . n 
U  5  201 LYS 201 201 ?   ?   ?   F . n 
U  5  202 ALA 202 202 ?   ?   ?   F . n 
U  5  203 ARG 203 203 ?   ?   ?   F . n 
U  5  204 GLU 204 204 ?   ?   ?   F . n 
U  5  205 VAL 205 205 ?   ?   ?   F . n 
U  5  206 LYS 206 206 ?   ?   ?   F . n 
U  5  207 GLY 207 207 ?   ?   ?   F . n 
V  6  1   MET 1   1   ?   ?   ?   G . n 
V  6  2   ALA 2   2   ?   ?   ?   G . n 
V  6  3   LEU 3   3   ?   ?   ?   G . n 
V  6  4   LYS 4   4   ?   ?   ?   G . n 
V  6  5   ASP 5   5   ?   ?   ?   G . n 
V  6  6   LEU 6   6   ?   ?   ?   G . n 
V  6  7   PHE 7   7   ?   ?   ?   G . n 
V  6  8   GLU 8   8   ?   ?   ?   G . n 
V  6  9   ARG 9   9   ?   ?   ?   G . n 
V  6  10  ASP 10  10  ?   ?   ?   G . n 
V  6  11  VAL 11  11  ?   ?   ?   G . n 
V  6  12  GLN 12  12  ?   ?   ?   G . n 
V  6  13  GLU 13  13  ?   ?   ?   G . n 
V  6  14  LEU 14  14  ?   ?   ?   G . n 
V  6  15  GLU 15  15  ?   ?   ?   G . n 
V  6  16  ARG 16  16  16  ARG ARG G . n 
V  6  17  GLU 17  17  17  GLU GLU G . n 
V  6  18  GLY 18  18  18  GLY GLY G . n 
V  6  19  ILE 19  19  19  ILE ILE G . n 
V  6  20  LEU 20  20  20  LEU LEU G . n 
V  6  21  PHE 21  21  21  PHE PHE G . n 
V  6  22  THR 22  22  22  THR THR G . n 
V  6  23  THR 23  23  23  THR THR G . n 
V  6  24  LEU 24  24  24  LEU LEU G . n 
V  6  25  GLU 25  25  25  GLU GLU G . n 
V  6  26  LYS 26  26  26  LYS LYS G . n 
V  6  27  LEU 27  27  27  LEU LEU G . n 
V  6  28  VAL 28  28  28  VAL VAL G . n 
V  6  29  ALA 29  29  29  ALA ALA G . n 
V  6  30  TRP 30  30  30  TRP TRP G . n 
V  6  31  GLY 31  31  31  GLY GLY G . n 
V  6  32  ARG 32  32  32  ARG ARG G . n 
V  6  33  SER 33  33  33  SER SER G . n 
V  6  34  ASN 34  34  34  ASN ASN G . n 
V  6  35  SER 35  35  35  SER SER G . n 
V  6  36  LEU 36  36  36  LEU LEU G . n 
V  6  37  TRP 37  37  37  TRP TRP G . n 
V  6  38  PRO 38  38  38  PRO PRO G . n 
V  6  39  ALA 39  39  39  ALA ALA G . n 
V  6  40  THR 40  40  40  THR THR G . n 
V  6  41  PHE 41  41  41  PHE PHE G . n 
V  6  42  GLY 42  42  42  GLY GLY G . n 
V  6  43  LEU 43  43  43  LEU LEU G . n 
V  6  44  ALA 44  44  44  ALA ALA G . n 
V  6  45  CYS 45  45  45  CYS CYS G . n 
V  6  46  CYS 46  46  46  CYS CYS G . n 
V  6  47  ALA 47  47  47  ALA ALA G . n 
V  6  48  ILE 48  48  48  ILE ILE G . n 
V  6  49  GLU 49  49  49  GLU GLU G . n 
V  6  50  MET 50  50  50  MET MET G . n 
V  6  51  MET 51  51  51  MET MET G . n 
V  6  52  ALA 52  52  52  ALA ALA G . n 
V  6  53  SER 53  53  53  SER SER G . n 
V  6  54  THR 54  54  54  THR THR G . n 
V  6  55  ASP 55  55  55  ASP ASP G . n 
V  6  56  ALA 56  56  56  ALA ALA G . n 
V  6  57  ARG 57  57  57  ARG ARG G . n 
V  6  58  ASN 58  58  58  ASN ASN G . n 
V  6  59  ASP 59  59  59  ASP ASP G . n 
V  6  60  LEU 60  60  60  LEU LEU G . n 
V  6  61  ALA 61  61  61  ALA ALA G . n 
V  6  62  ARG 62  62  62  ARG ARG G . n 
V  6  63  PHE 63  63  63  PHE PHE G . n 
V  6  64  GLY 64  64  64  GLY GLY G . n 
V  6  65  SER 65  65  65  SER SER G . n 
V  6  66  GLU 66  66  66  GLU GLU G . n 
V  6  67  VAL 67  67  67  VAL VAL G . n 
V  6  68  PHE 68  68  68  PHE PHE G . n 
V  6  69  ARG 69  69  69  ARG ARG G . n 
V  6  70  ALA 70  70  70  ALA ALA G . n 
V  6  71  SER 71  71  71  SER SER G . n 
V  6  72  PRO 72  72  72  PRO PRO G . n 
V  6  73  ARG 73  73  73  ARG ARG G . n 
V  6  74  GLN 74  74  74  GLN GLN G . n 
V  6  75  ALA 75  75  75  ALA ALA G . n 
V  6  76  ASP 76  76  76  ASP ASP G . n 
V  6  77  VAL 77  77  77  VAL VAL G . n 
V  6  78  MET 78  78  78  MET MET G . n 
V  6  79  ILE 79  79  79  ILE ILE G . n 
V  6  80  VAL 80  80  80  VAL VAL G . n 
V  6  81  ALA 81  81  81  ALA ALA G . n 
V  6  82  GLY 82  82  82  GLY GLY G . n 
V  6  83  ARG 83  83  83  ARG ARG G . n 
V  6  84  LEU 84  84  84  LEU LEU G . n 
V  6  85  SER 85  85  85  SER SER G . n 
V  6  86  LYS 86  86  86  LYS LYS G . n 
V  6  87  LYS 87  87  87  LYS LYS G . n 
V  6  88  MET 88  88  88  MET MET G . n 
V  6  89  ALA 89  89  89  ALA ALA G . n 
V  6  90  PRO 90  90  90  PRO PRO G . n 
V  6  91  VAL 91  91  91  VAL VAL G . n 
V  6  92  MET 92  92  92  MET MET G . n 
V  6  93  ARG 93  93  93  ARG ARG G . n 
V  6  94  ARG 94  94  94  ARG ARG G . n 
V  6  95  VAL 95  95  95  VAL VAL G . n 
V  6  96  TRP 96  96  96  TRP TRP G . n 
V  6  97  GLU 97  97  97  GLU GLU G . n 
V  6  98  GLN 98  98  98  GLN GLN G . n 
V  6  99  MET 99  99  99  MET MET G . n 
V  6  100 PRO 100 100 100 PRO PRO G . n 
V  6  101 ASP 101 101 101 ASP ASP G . n 
V  6  102 PRO 102 102 102 PRO PRO G . n 
V  6  103 LYS 103 103 103 LYS LYS G . n 
V  6  104 TRP 104 104 104 TRP TRP G . n 
V  6  105 VAL 105 105 105 VAL VAL G . n 
V  6  106 ILE 106 106 106 ILE ILE G . n 
V  6  107 SER 107 107 107 SER SER G . n 
V  6  108 MET 108 108 108 MET MET G . n 
V  6  109 GLY 109 109 109 GLY GLY G . n 
V  6  110 ALA 110 110 110 ALA ALA G . n 
V  6  111 CYS 111 111 111 CYS CYS G . n 
V  6  112 ALA 112 112 112 ALA ALA G . n 
V  6  113 SER 113 113 113 SER SER G . n 
V  6  114 SER 114 114 114 SER SER G . n 
V  6  115 GLY 115 115 115 GLY GLY G . n 
V  6  116 GLY 116 116 116 GLY GLY G . n 
V  6  117 MET 117 117 117 MET MET G . n 
V  6  118 PHE 118 118 118 PHE PHE G . n 
V  6  119 ASN 119 119 119 ASN ASN G . n 
V  6  120 ASN 120 120 120 ASN ASN G . n 
V  6  121 TYR 121 121 121 TYR TYR G . n 
V  6  122 ALA 122 122 122 ALA ALA G . n 
V  6  123 ILE 123 123 123 ILE ILE G . n 
V  6  124 VAL 124 124 124 VAL VAL G . n 
V  6  125 GLN 125 125 125 GLN GLN G . n 
V  6  126 ASN 126 126 126 ASN ASN G . n 
V  6  127 VAL 127 127 127 VAL VAL G . n 
V  6  128 ASP 128 128 128 ASP ASP G . n 
V  6  129 SER 129 129 129 SER SER G . n 
V  6  130 VAL 130 130 130 VAL VAL G . n 
V  6  131 VAL 131 131 131 VAL VAL G . n 
V  6  132 PRO 132 132 132 PRO PRO G . n 
V  6  133 VAL 133 133 133 VAL VAL G . n 
V  6  134 ASP 134 134 134 ASP ASP G . n 
V  6  135 VAL 135 135 135 VAL VAL G . n 
V  6  136 TYR 136 136 136 TYR TYR G . n 
V  6  137 VAL 137 137 137 VAL VAL G . n 
V  6  138 PRO 138 138 138 PRO PRO G . n 
V  6  139 GLY 139 139 139 GLY GLY G . n 
V  6  140 CYS 140 140 140 CYS CYS G . n 
V  6  141 PRO 141 141 141 PRO PRO G . n 
V  6  142 PRO 142 142 142 PRO PRO G . n 
V  6  143 ARG 143 143 143 ARG ARG G . n 
V  6  144 PRO 144 144 144 PRO PRO G . n 
V  6  145 GLU 145 145 145 GLU GLU G . n 
V  6  146 ALA 146 146 146 ALA ALA G . n 
V  6  147 LEU 147 147 147 LEU LEU G . n 
V  6  148 ILE 148 148 148 ILE ILE G . n 
V  6  149 TYR 149 149 149 TYR TYR G . n 
V  6  150 ALA 150 150 150 ALA ALA G . n 
V  6  151 VAL 151 151 151 VAL VAL G . n 
V  6  152 MET 152 152 152 MET MET G . n 
V  6  153 GLN 153 153 153 GLN GLN G . n 
V  6  154 LEU 154 154 154 LEU LEU G . n 
V  6  155 GLN 155 155 155 GLN GLN G . n 
V  6  156 LYS 156 156 156 LYS LYS G . n 
V  6  157 LYS 157 157 157 LYS LYS G . n 
V  6  158 VAL 158 158 158 VAL VAL G . n 
V  6  159 ARG 159 159 159 ARG ARG G . n 
V  6  160 GLY 160 160 160 GLY GLY G . n 
V  6  161 GLN 161 161 161 GLN GLN G . n 
V  6  162 ALA 162 162 162 ALA ALA G . n 
V  6  163 TYR 163 163 163 TYR TYR G . n 
V  6  164 ASN 164 164 164 ASN ASN G . n 
V  6  165 GLU 165 165 165 GLU GLU G . n 
V  6  166 ARG 166 166 166 ARG ARG G . n 
V  6  167 GLY 167 167 167 GLY GLY G . n 
V  6  168 GLU 168 168 168 GLU GLU G . n 
V  6  169 ARG 169 169 169 ARG ARG G . n 
V  6  170 LEU 170 170 170 LEU LEU G . n 
V  6  171 PRO 171 171 171 PRO PRO G . n 
V  6  172 PRO 172 172 172 PRO PRO G . n 
V  6  173 VAL 173 173 173 VAL VAL G . n 
V  6  174 ALA 174 174 174 ALA ALA G . n 
V  6  175 ALA 175 175 175 ALA ALA G . n 
V  6  176 TRP 176 176 176 TRP TRP G . n 
V  6  177 LYS 177 177 177 LYS LYS G . n 
V  6  178 ARG 178 178 178 ARG ARG G . n 
V  6  179 THR 179 179 179 THR THR G . n 
V  6  180 ARG 180 180 180 ARG ARG G . n 
V  6  181 GLY 181 181 181 GLY GLY G . n 
W  7  1   MET 1   1   ?   ?   ?   O . n 
W  7  2   THR 2   2   2   THR THR O . n 
W  7  3   LEU 3   3   3   LEU LEU O . n 
W  7  4   LYS 4   4   4   LYS LYS O . n 
W  7  5   ALA 5   5   5   ALA ALA O . n 
W  7  6   LEU 6   6   6   LEU LEU O . n 
W  7  7   ALA 7   7   7   ALA ALA O . n 
W  7  8   GLN 8   8   8   GLN GLN O . n 
W  7  9   SER 9   9   9   SER SER O . n 
W  7  10  LEU 10  10  10  LEU LEU O . n 
W  7  11  GLY 11  11  11  GLY GLY O . n 
W  7  12  ILE 12  12  12  ILE ILE O . n 
W  7  13  THR 13  13  13  THR THR O . n 
W  7  14  LEU 14  14  14  LEU LEU O . n 
W  7  15  LYS 15  15  15  LYS LYS O . n 
W  7  16  TYR 16  16  16  TYR TYR O . n 
W  7  17  LEU 17  17  17  LEU LEU O . n 
W  7  18  PHE 18  18  18  PHE PHE O . n 
W  7  19  SER 19  19  19  SER SER O . n 
W  7  20  LYS 20  20  20  LYS LYS O . n 
W  7  21  PRO 21  21  21  PRO PRO O . n 
W  7  22  VAL 22  22  22  VAL VAL O . n 
W  7  23  THR 23  23  23  THR THR O . n 
W  7  24  VAL 24  24  24  VAL VAL O . n 
W  7  25  PRO 25  25  25  PRO PRO O . n 
W  7  26  TYR 26  26  26  TYR TYR O . n 
W  7  27  PRO 27  27  27  PRO PRO O . n 
W  7  28  ASP 28  28  28  ASP ASP O . n 
W  7  29  ALA 29  29  29  ALA ALA O . n 
W  7  30  PRO 30  30  30  PRO PRO O . n 
W  7  31  VAL 31  31  31  VAL VAL O . n 
W  7  32  ALA 32  32  32  ALA ALA O . n 
W  7  33  LEU 33  33  33  LEU LEU O . n 
W  7  34  LYS 34  34  34  LYS LYS O . n 
W  7  35  PRO 35  35  35  PRO PRO O . n 
W  7  36  ARG 36  36  36  ARG ARG O . n 
W  7  37  PHE 37  37  37  PHE PHE O . n 
W  7  38  HIS 38  38  38  HIS HIS O . n 
W  7  39  GLY 39  39  39  GLY GLY O . n 
W  7  40  ARG 40  40  40  ARG ARG O . n 
W  7  41  HIS 41  41  41  HIS HIS O . n 
W  7  42  VAL 42  42  42  VAL VAL O . n 
W  7  43  LEU 43  43  43  LEU LEU O . n 
W  7  44  THR 44  44  44  THR THR O . n 
W  7  45  ARG 45  45  45  ARG ARG O . n 
W  7  46  HIS 46  46  46  HIS HIS O . n 
W  7  47  PRO 47  47  47  PRO PRO O . n 
W  7  48  ASN 48  48  48  ASN ASN O . n 
W  7  49  GLY 49  49  49  GLY GLY O . n 
W  7  50  LEU 50  50  50  LEU LEU O . n 
W  7  51  GLU 51  51  51  GLU GLU O . n 
W  7  52  LYS 52  52  52  LYS LYS O . n 
W  7  53  CYS 53  53  53  CYS CYS O . n 
W  7  54  ILE 54  54  54  ILE ILE O . n 
W  7  55  GLY 55  55  55  GLY GLY O . n 
W  7  56  CYS 56  56  56  CYS CYS O . n 
W  7  57  SER 57  57  57  SER SER O . n 
W  7  58  LEU 58  58  58  LEU LEU O . n 
W  7  59  CYS 59  59  59  CYS CYS O . n 
W  7  60  ALA 60  60  60  ALA ALA O . n 
W  7  61  ALA 61  61  61  ALA ALA O . n 
W  7  62  ALA 62  62  62  ALA ALA O . n 
W  7  63  CYS 63  63  63  CYS CYS O . n 
W  7  64  PRO 64  64  64  PRO PRO O . n 
W  7  65  ALA 65  65  65  ALA ALA O . n 
W  7  66  TYR 66  66  66  TYR TYR O . n 
W  7  67  ALA 67  67  67  ALA ALA O . n 
W  7  68  ILE 68  68  68  ILE ILE O . n 
W  7  69  TYR 69  69  69  TYR TYR O . n 
W  7  70  VAL 70  70  70  VAL VAL O . n 
W  7  71  GLU 71  71  71  GLU GLU O . n 
W  7  72  PRO 72  72  72  PRO PRO O . n 
W  7  73  ALA 73  73  73  ALA ALA O . n 
W  7  74  GLU 74  74  74  GLU GLU O . n 
W  7  75  ASN 75  75  75  ASN ASN O . n 
W  7  76  ASP 76  76  76  ASP ASP O . n 
W  7  77  PRO 77  77  77  PRO PRO O . n 
W  7  78  GLU 78  78  78  GLU GLU O . n 
W  7  79  ASN 79  79  79  ASN ASN O . n 
W  7  80  PRO 80  80  80  PRO PRO O . n 
W  7  81  VAL 81  81  81  VAL VAL O . n 
W  7  82  SER 82  82  82  SER SER O . n 
W  7  83  ALA 83  83  83  ALA ALA O . n 
W  7  84  GLY 84  84  84  GLY GLY O . n 
W  7  85  GLU 85  85  85  GLU GLU O . n 
W  7  86  ARG 86  86  86  ARG ARG O . n 
W  7  87  TYR 87  87  87  TYR TYR O . n 
W  7  88  ALA 88  88  88  ALA ALA O . n 
W  7  89  LYS 89  89  89  LYS LYS O . n 
W  7  90  VAL 90  90  90  VAL VAL O . n 
W  7  91  TYR 91  91  91  TYR TYR O . n 
W  7  92  GLU 92  92  92  GLU GLU O . n 
W  7  93  ILE 93  93  93  ILE ILE O . n 
W  7  94  ASN 94  94  94  ASN ASN O . n 
W  7  95  MET 95  95  95  MET MET O . n 
W  7  96  LEU 96  96  96  LEU LEU O . n 
W  7  97  ARG 97  97  97  ARG ARG O . n 
W  7  98  CYS 98  98  98  CYS CYS O . n 
W  7  99  ILE 99  99  99  ILE ILE O . n 
W  7  100 PHE 100 100 100 PHE PHE O . n 
W  7  101 CYS 101 101 101 CYS CYS O . n 
W  7  102 GLY 102 102 102 GLY GLY O . n 
W  7  103 LEU 103 103 103 LEU LEU O . n 
W  7  104 CYS 104 104 104 CYS CYS O . n 
W  7  105 GLU 105 105 105 GLU GLU O . n 
W  7  106 GLU 106 106 106 GLU GLU O . n 
W  7  107 ALA 107 107 107 ALA ALA O . n 
W  7  108 CYS 108 108 108 CYS CYS O . n 
W  7  109 PRO 109 109 109 PRO PRO O . n 
W  7  110 THR 110 110 110 THR THR O . n 
W  7  111 GLY 111 111 111 GLY GLY O . n 
W  7  112 ALA 112 112 112 ALA ALA O . n 
W  7  113 ILE 113 113 113 ILE ILE O . n 
W  7  114 VAL 114 114 114 VAL VAL O . n 
W  7  115 LEU 115 115 115 LEU LEU O . n 
W  7  116 GLY 116 116 116 GLY GLY O . n 
W  7  117 TYR 117 117 117 TYR TYR O . n 
W  7  118 ASP 118 118 118 ASP ASP O . n 
W  7  119 PHE 119 119 119 PHE PHE O . n 
W  7  120 GLU 120 120 120 GLU GLU O . n 
W  7  121 MET 121 121 121 MET MET O . n 
W  7  122 ALA 122 122 122 ALA ALA O . n 
W  7  123 ASP 123 123 123 ASP ASP O . n 
W  7  124 TYR 124 124 124 TYR TYR O . n 
W  7  125 GLU 125 125 125 GLU GLU O . n 
W  7  126 TYR 126 126 126 TYR TYR O . n 
W  7  127 SER 127 127 127 SER SER O . n 
W  7  128 ASP 128 128 128 ASP ASP O . n 
W  7  129 LEU 129 129 129 LEU LEU O . n 
W  7  130 VAL 130 130 130 VAL VAL O . n 
W  7  131 TYR 131 131 131 TYR TYR O . n 
W  7  132 GLY 132 132 132 GLY GLY O . n 
W  7  133 LYS 133 133 133 LYS LYS O . n 
W  7  134 GLU 134 134 134 GLU GLU O . n 
W  7  135 ASP 135 135 135 ASP ASP O . n 
W  7  136 MET 136 136 136 MET MET O . n 
W  7  137 LEU 137 137 137 LEU LEU O . n 
W  7  138 VAL 138 138 138 VAL VAL O . n 
W  7  139 ASP 139 139 139 ASP ASP O . n 
W  7  140 VAL 140 140 140 VAL VAL O . n 
W  7  141 VAL 141 141 141 VAL VAL O . n 
W  7  142 GLY 142 142 142 GLY GLY O . n 
W  7  143 THR 143 143 143 THR THR O . n 
W  7  144 LYS 144 144 144 LYS LYS O . n 
W  7  145 PRO 145 145 145 PRO PRO O . n 
W  7  146 GLN 146 146 146 GLN GLN O . n 
W  7  147 ARG 147 147 147 ARG ARG O . n 
W  7  148 ARG 148 148 148 ARG ARG O . n 
W  7  149 GLU 149 149 149 GLU GLU O . n 
W  7  150 ALA 150 150 150 ALA ALA O . n 
W  7  151 LYS 151 151 151 LYS LYS O . n 
W  7  152 ARG 152 152 152 ARG ARG O . n 
W  7  153 THR 153 153 153 THR THR O . n 
W  7  154 GLY 154 154 154 GLY GLY O . n 
W  7  155 LYS 155 155 155 LYS LYS O . n 
W  7  156 PRO 156 156 156 PRO PRO O . n 
W  7  157 VAL 157 157 157 VAL VAL O . n 
W  7  158 LYS 158 158 158 LYS LYS O . n 
W  7  159 VAL 159 159 159 VAL VAL O . n 
W  7  160 GLY 160 160 160 GLY GLY O . n 
W  7  161 TYR 161 161 161 TYR TYR O . n 
W  7  162 VAL 162 162 162 VAL VAL O . n 
W  7  163 VAL 163 163 163 VAL VAL O . n 
W  7  164 PRO 164 164 164 PRO PRO O . n 
W  7  165 TYR 165 165 165 TYR TYR O . n 
W  7  166 VAL 166 166 166 VAL VAL O . n 
W  7  167 ARG 167 167 167 ARG ARG O . n 
W  7  168 PRO 168 168 168 PRO PRO O . n 
W  7  169 GLU 169 169 169 GLU GLU O . n 
W  7  170 LEU 170 170 170 LEU LEU O . n 
W  7  171 GLU 171 171 171 GLU GLU O . n 
W  7  172 GLY 172 172 172 GLY GLY O . n 
W  7  173 PHE 173 173 173 PHE PHE O . n 
W  7  174 LYS 174 174 174 LYS LYS O . n 
W  7  175 ALA 175 175 175 ALA ALA O . n 
W  7  176 PRO 176 176 176 PRO PRO O . n 
W  7  177 THR 177 177 177 THR THR O . n 
W  7  178 GLU 178 178 178 GLU GLU O . n 
W  7  179 GLY 179 179 179 GLY GLY O . n 
W  7  180 GLY 180 180 180 GLY GLY O . n 
W  7  181 LYS 181 181 181 LYS LYS O . n 
W  7  182 ARG 182 182 ?   ?   ?   O . n 
X  8  1   MET 1   1   ?   ?   ?   I . n 
X  8  2   SER 2   2   ?   ?   ?   I . n 
X  8  3   ALA 3   3   3   ALA ALA I . n 
X  8  4   SER 4   4   4   SER SER I . n 
X  8  5   SER 5   5   5   SER SER I . n 
X  8  6   GLU 6   6   6   GLU GLU I . n 
X  8  7   ARG 7   7   7   ARG ARG I . n 
X  8  8   GLU 8   8   8   GLU GLU I . n 
X  8  9   LEU 9   9   9   LEU LEU I . n 
X  8  10  TYR 10  10  10  TYR TYR I . n 
X  8  11  GLU 11  11  11  GLU GLU I . n 
X  8  12  ALA 12  12  12  ALA ALA I . n 
X  8  13  TRP 13  13  13  TRP TRP I . n 
X  8  14  VAL 14  14  14  VAL VAL I . n 
X  8  15  GLU 15  15  15  GLU GLU I . n 
X  8  16  LEU 16  16  16  LEU LEU I . n 
X  8  17  LEU 17  17  17  LEU LEU I . n 
X  8  18  SER 18  18  18  SER SER I . n 
X  8  19  TRP 19  19  19  TRP TRP I . n 
X  8  20  MET 20  20  20  MET MET I . n 
X  8  21  ARG 21  21  21  ARG ARG I . n 
X  8  22  GLU 22  22  22  GLU GLU I . n 
X  8  23  TYR 23  23  23  TYR TYR I . n 
X  8  24  ALA 24  24  24  ALA ALA I . n 
X  8  25  GLN 25  25  25  GLN GLN I . n 
X  8  26  ALA 26  26  26  ALA ALA I . n 
X  8  27  LYS 27  27  27  LYS LYS I . n 
X  8  28  GLY 28  28  28  GLY GLY I . n 
X  8  29  VAL 29  29  29  VAL VAL I . n 
X  8  30  ARG 30  30  30  ARG ARG I . n 
X  8  31  PHE 31  31  31  PHE PHE I . n 
X  8  32  GLU 32  32  32  GLU GLU I . n 
X  8  33  LYS 33  33  33  LYS LYS I . n 
X  8  34  GLU 34  34  34  GLU GLU I . n 
X  8  35  ALA 35  35  35  ALA ALA I . n 
X  8  36  ASP 36  36  36  ASP ASP I . n 
X  8  37  PHE 37  37  37  PHE PHE I . n 
X  8  38  PRO 38  38  38  PRO PRO I . n 
X  8  39  ASP 39  39  39  ASP ASP I . n 
X  8  40  PHE 40  40  40  PHE PHE I . n 
X  8  41  ILE 41  41  41  ILE ILE I . n 
X  8  42  TYR 42  42  42  TYR TYR I . n 
X  8  43  ARG 43  43  43  ARG ARG I . n 
X  8  44  MET 44  44  44  MET MET I . n 
X  8  45  GLU 45  45  45  GLU GLU I . n 
X  8  46  ARG 46  46  46  ARG ARG I . n 
X  8  47  PRO 47  47  47  PRO PRO I . n 
X  8  48  TYR 48  48  48  TYR TYR I . n 
X  8  49  ASP 49  49  49  ASP ASP I . n 
X  8  50  LEU 50  50  50  LEU LEU I . n 
X  8  51  PRO 51  51  51  PRO PRO I . n 
X  8  52  THR 52  52  52  THR THR I . n 
X  8  53  THR 53  53  53  THR THR I . n 
X  8  54  ILE 54  54  54  ILE ILE I . n 
X  8  55  MET 55  55  55  MET MET I . n 
X  8  56  THR 56  56  56  THR THR I . n 
X  8  57  ALA 57  57  57  ALA ALA I . n 
X  8  58  SER 58  58  58  SER SER I . n 
X  8  59  LEU 59  59  59  LEU LEU I . n 
X  8  60  SER 60  60  60  SER SER I . n 
X  8  61  ASP 61  61  61  ASP ASP I . n 
X  8  62  GLY 62  62  62  GLY GLY I . n 
X  8  63  LEU 63  63  63  LEU LEU I . n 
X  8  64  GLY 64  64  64  GLY GLY I . n 
X  8  65  GLU 65  65  65  GLU GLU I . n 
X  8  66  PRO 66  66  66  PRO PRO I . n 
X  8  67  PHE 67  67  67  PHE PHE I . n 
X  8  68  LEU 68  68  68  LEU LEU I . n 
X  8  69  LEU 69  69  69  LEU LEU I . n 
X  8  70  ALA 70  70  70  ALA ALA I . n 
X  8  71  ASP 71  71  71  ASP ASP I . n 
X  8  72  VAL 72  72  72  VAL VAL I . n 
X  8  73  SER 73  73  73  SER SER I . n 
X  8  74  PRO 74  74  74  PRO PRO I . n 
X  8  75  ARG 75  75  75  ARG ARG I . n 
X  8  76  HIS 76  76  76  HIS HIS I . n 
X  8  77  ALA 77  77  77  ALA ALA I . n 
X  8  78  LYS 78  78  78  LYS LYS I . n 
X  8  79  LEU 79  79  79  LEU LEU I . n 
X  8  80  LYS 80  80  80  LYS LYS I . n 
X  8  81  ARG 81  81  81  ARG ARG I . n 
X  8  82  ILE 82  82  82  ILE ILE I . n 
X  8  83  GLY 83  83  83  GLY GLY I . n 
X  8  84  LEU 84  84  84  LEU LEU I . n 
X  8  85  ARG 85  85  85  ARG ARG I . n 
X  8  86  LEU 86  86  86  LEU LEU I . n 
X  8  87  PRO 87  87  87  PRO PRO I . n 
X  8  88  ARG 88  88  88  ARG ARG I . n 
X  8  89  ALA 89  89  89  ALA ALA I . n 
X  8  90  HIS 90  90  90  HIS HIS I . n 
X  8  91  ILE 91  91  91  ILE ILE I . n 
X  8  92  HIS 92  92  92  HIS HIS I . n 
X  8  93  LEU 93  93  93  LEU LEU I . n 
X  8  94  HIS 94  94  94  HIS HIS I . n 
X  8  95  ALA 95  95  95  ALA ALA I . n 
X  8  96  HIS 96  96  96  HIS HIS I . n 
X  8  97  TYR 97  97  97  TYR TYR I . n 
X  8  98  GLU 98  98  98  GLU GLU I . n 
X  8  99  PRO 99  99  99  PRO PRO I . n 
X  8  100 GLY 100 100 100 GLY GLY I . n 
X  8  101 LYS 101 101 101 LYS LYS I . n 
X  8  102 GLY 102 102 102 GLY GLY I . n 
X  8  103 LEU 103 103 103 LEU LEU I . n 
X  8  104 VAL 104 104 104 VAL VAL I . n 
X  8  105 THR 105 105 105 THR THR I . n 
X  8  106 GLY 106 106 106 GLY GLY I . n 
X  8  107 LYS 107 107 107 LYS LYS I . n 
X  8  108 ILE 108 108 108 ILE ILE I . n 
X  8  109 PRO 109 109 109 PRO PRO I . n 
X  8  110 LEU 110 110 110 LEU LEU I . n 
X  8  111 THR 111 111 111 THR THR I . n 
X  8  112 LYS 112 112 112 LYS LYS I . n 
X  8  113 GLU 113 113 113 GLU GLU I . n 
X  8  114 ARG 114 114 114 ARG ARG I . n 
X  8  115 PHE 115 115 115 PHE PHE I . n 
X  8  116 PHE 116 116 116 PHE PHE I . n 
X  8  117 ALA 117 117 117 ALA ALA I . n 
X  8  118 LEU 118 118 118 LEU LEU I . n 
X  8  119 ALA 119 119 119 ALA ALA I . n 
X  8  120 ASP 120 120 120 ASP ASP I . n 
X  8  121 ARG 121 121 121 ARG ARG I . n 
X  8  122 ALA 122 122 122 ALA ALA I . n 
X  8  123 ARG 123 123 123 ARG ARG I . n 
X  8  124 GLU 124 124 124 GLU GLU I . n 
X  8  125 ALA 125 125 125 ALA ALA I . n 
X  8  126 LEU 126 126 126 LEU LEU I . n 
X  8  127 ALA 127 127 127 ALA ALA I . n 
X  8  128 PHE 128 128 128 PHE PHE I . n 
X  8  129 ALA 129 129 129 ALA ALA I . n 
Y  9  1   MET 1   1   1   MET MET X . n 
Y  9  2   VAL 2   2   2   VAL VAL X . n 
Y  9  3   ARG 3   3   3   ARG ARG X . n 
Y  9  4   VAL 4   4   4   VAL VAL X . n 
Y  9  5   GLY 5   5   5   GLY GLY X . n 
Y  9  6   MET 6   6   6   MET MET X . n 
Y  9  7   ARG 7   7   7   ARG ARG X . n 
Y  9  8   ALA 8   8   8   ALA ALA X . n 
Y  9  9   ALA 9   9   9   ALA ALA X . n 
Y  9  10  PRO 10  10  10  PRO PRO X . n 
Y  9  11  ARG 11  11  11  ARG ARG X . n 
Y  9  12  VAL 12  12  12  VAL VAL X . n 
Y  9  13  SER 13  13  13  SER SER X . n 
Y  9  14  LEU 14  14  14  LEU LEU X . n 
Y  9  15  GLU 15  15  15  GLU GLU X . n 
Y  9  16  ALA 16  16  16  ALA ALA X . n 
Y  9  17  LEU 17  17  17  LEU LEU X . n 
Y  9  18  LYS 18  18  18  LYS LYS X . n 
Y  9  19  ALA 19  19  19  ALA ALA X . n 
Y  9  20  ALA 20  20  20  ALA ALA X . n 
Y  9  21  LEU 21  21  21  LEU LEU X . n 
Y  9  22  GLY 22  22  22  GLY GLY X . n 
Y  9  23  GLY 23  23  23  GLY GLY X . n 
Y  9  24  LEU 24  24  24  LEU LEU X . n 
Y  9  25  LYS 25  25  25  LYS LYS X . n 
Y  9  26  LEU 26  26  26  LEU LEU X . n 
Y  9  27  SER 27  27  27  SER SER X . n 
Y  9  28  GLU 28  28  28  GLU GLU X . n 
Y  9  29  ALA 29  29  29  ALA ALA X . n 
Y  9  30  LYS 30  30  30  LYS LYS X . n 
Y  9  31  VAL 31  31  31  VAL VAL X . n 
Y  9  32  TYR 32  32  32  TYR TYR X . n 
Y  9  33  LEU 33  33  33  LEU LEU X . n 
Y  9  34  ILE 34  34  34  ILE ILE X . n 
Y  9  35  THR 35  35  35  THR THR X . n 
Y  9  36  ASP 36  36  36  ASP ASP X . n 
Y  9  37  TRP 37  37  37  TRP TRP X . n 
Y  9  38  GLN 38  38  38  GLN GLN X . n 
Y  9  39  ASP 39  39  39  ASP ASP X . n 
Y  9  40  LYS 40  40  40  LYS LYS X . n 
Y  9  41  ARG 41  41  41  ARG ARG X . n 
Y  9  42  ASP 42  42  42  ASP ASP X . n 
Y  9  43  GLN 43  43  43  GLN GLN X . n 
Y  9  44  ALA 44  44  44  ALA ALA X . n 
Y  9  45  ARG 45  45  45  ARG ARG X . n 
Y  9  46  TYR 46  46  46  TYR TYR X . n 
Y  9  47  ALA 47  47  47  ALA ALA X . n 
Y  9  48  LEU 48  48  48  LEU LEU X . n 
Y  9  49  LEU 49  49  49  LEU LEU X . n 
Y  9  50  LEU 50  50  50  LEU LEU X . n 
Y  9  51  HIS 51  51  51  HIS HIS X . n 
Y  9  52  THR 52  52  52  THR THR X . n 
Y  9  53  GLY 53  53  53  GLY GLY X . n 
Y  9  54  LYS 54  54  54  LYS LYS X . n 
Y  9  55  LYS 55  55  55  LYS LYS X . n 
Y  9  56  ASP 56  56  56  ASP ASP X . n 
Y  9  57  LEU 57  57  57  LEU LEU X . n 
Y  9  58  LEU 58  58  58  LEU LEU X . n 
Y  9  59  VAL 59  59  59  VAL VAL X . n 
Y  9  60  PRO 60  60  60  PRO PRO X . n 
Y  9  61  ASP 61  61  61  ASP ASP X . n 
Y  9  62  ALA 62  62  62  ALA ALA X . n 
Y  9  63  PHE 63  63  63  PHE PHE X . n 
Y  9  64  GLY 64  64  64  GLY GLY X . n 
Y  9  65  PRO 65  65  65  PRO PRO X . n 
Y  9  66  ALA 66  66  66  ALA ALA X . n 
Y  9  67  PHE 67  67  67  PHE PHE X . n 
Y  9  68  PRO 68  68  68  PRO PRO X . n 
Y  9  69  GLY 69  69  69  GLY GLY X . n 
Y  9  70  GLY 70  70  70  GLY GLY X . n 
Y  9  71  GLU 71  71  71  GLU GLU X . n 
Y  9  72  GLU 72  72  72  GLU GLU X . n 
Y  9  73  ALA 73  73  73  ALA ALA X . n 
Y  9  74  LEU 74  74  74  LEU LEU X . n 
Y  9  75  SER 75  75  75  SER SER X . n 
Y  9  76  GLU 76  76  76  GLU GLU X . n 
Y  9  77  LEU 77  77  77  LEU LEU X . n 
Y  9  78  VAL 78  78  78  VAL VAL X . n 
Y  9  79  GLY 79  79  79  GLY GLY X . n 
Y  9  80  LEU 80  80  80  LEU LEU X . n 
Y  9  81  LEU 81  81  81  LEU LEU X . n 
Y  9  82  LEU 82  82  82  LEU LEU X . n 
Y  9  83  ALA 83  83  83  ALA ALA X . n 
Y  9  84  GLN 84  84  84  GLN GLN X . n 
Y  9  85  GLY 85  85  85  GLY GLY X . n 
Y  9  86  ALA 86  86  86  ALA ALA X . n 
Y  9  87  ARG 87  87  87  ARG ARG X . n 
Y  9  88  ARG 88  88  88  ARG ARG X . n 
Y  9  89  PHE 89  89  89  PHE PHE X . n 
Y  9  90  TYR 90  90  90  TYR TYR X . n 
Y  9  91  GLU 91  91  91  GLU GLU X . n 
Y  9  92  ALA 92  92  92  ALA ALA X . n 
Y  9  93  VAL 93  93  93  VAL VAL X . n 
Y  9  94  VAL 94  94  94  VAL VAL X . n 
Y  9  95  SER 95  95  95  SER SER X . n 
Y  9  96  PRO 96  96  96  PRO PRO X . n 
Y  9  97  GLY 97  97  97  GLY GLY X . n 
Y  9  98  GLU 98  98  98  GLU GLU X . n 
Y  9  99  MET 99  99  99  MET MET X . n 
Y  9  100 THR 100 100 100 THR THR X . n 
Y  9  101 ALA 101 101 101 ALA ALA X . n 
Y  9  102 LEU 102 102 102 LEU LEU X . n 
Y  9  103 LEU 103 103 103 LEU LEU X . n 
Y  9  104 ASP 104 104 104 ASP ASP X . n 
Y  9  105 LEU 105 105 105 LEU LEU X . n 
Y  9  106 PRO 106 106 106 PRO PRO X . n 
Y  9  107 PRO 107 107 107 PRO PRO X . n 
Y  9  108 GLU 108 108 108 GLU GLU X . n 
Y  9  109 GLU 109 109 109 GLU GLU X . n 
Y  9  110 LEU 110 110 110 LEU LEU X . n 
Y  9  111 LEU 111 111 111 LEU LEU X . n 
Y  9  112 LYS 112 112 112 LYS LYS X . n 
Y  9  113 ARG 113 113 113 ARG ARG X . n 
Y  9  114 VAL 114 114 114 VAL VAL X . n 
Y  9  115 MET 115 115 115 MET MET X . n 
Y  9  116 ALA 116 116 116 ALA ALA X . n 
Y  9  117 ILE 117 117 117 ILE ILE X . n 
Y  9  118 ALA 118 118 118 ALA ALA X . n 
Y  9  119 ASN 119 119 119 ASN ASN X . n 
Y  9  120 PRO 120 120 120 PRO PRO X . n 
Y  9  121 THR 121 121 121 THR THR X . n 
Y  9  122 ASP 122 122 122 ASP ASP X . n 
Y  9  123 PRO 123 123 123 PRO PRO X . n 
Y  9  124 GLY 124 124 124 GLY GLY X . n 
Y  9  125 ILE 125 125 125 ILE ILE X . n 
Y  9  126 TYR 126 126 126 TYR TYR X . n 
Y  9  127 LEU 127 127 127 LEU LEU X . n 
Y  9  128 LYS 128 128 ?   ?   ?   X . n 
Y  9  129 ARG 129 129 ?   ?   ?   X . n 
Y  9  130 ALA 130 130 ?   ?   ?   X . n 
Y  9  131 ALA 131 131 ?   ?   ?   X . n 
Z  10 1   MET 1   1   1   MET MET P . n 
Z  10 2   ALA 2   2   2   ALA ALA P . n 
Z  10 3   PRO 3   3   3   PRO PRO P . n 
Z  10 4   ILE 4   4   4   ILE ILE P . n 
Z  10 5   GLN 5   5   5   GLN GLN P . n 
Z  10 6   GLU 6   6   6   GLU GLU P . n 
Z  10 7   TYR 7   7   7   TYR TYR P . n 
Z  10 8   VAL 8   8   8   VAL VAL P . n 
Z  10 9   GLY 9   9   9   GLY GLY P . n 
Z  10 10  THR 10  10  10  THR THR P . n 
Z  10 11  LEU 11  11  11  LEU LEU P . n 
Z  10 12  ILE 12  12  12  ILE ILE P . n 
Z  10 13  TYR 13  13  13  TYR TYR P . n 
Z  10 14  VAL 14  14  14  VAL VAL P . n 
Z  10 15  GLY 15  15  15  GLY GLY P . n 
Z  10 16  VAL 16  16  16  VAL VAL P . n 
Z  10 17  ALA 17  17  17  ALA ALA P . n 
Z  10 18  LEU 18  18  18  LEU LEU P . n 
Z  10 19  PHE 19  19  19  PHE PHE P . n 
Z  10 20  ILE 20  20  20  ILE ILE P . n 
Z  10 21  GLY 21  21  21  GLY GLY P . n 
Z  10 22  VAL 22  22  22  VAL VAL P . n 
Z  10 23  ALA 23  23  23  ALA ALA P . n 
Z  10 24  ALA 24  24  24  ALA ALA P . n 
Z  10 25  LEU 25  25  25  LEU LEU P . n 
Z  10 26  LEU 26  26  26  LEU LEU P . n 
Z  10 27  VAL 27  27  27  VAL VAL P . n 
Z  10 28  GLY 28  28  28  GLY GLY P . n 
Z  10 29  ALA 29  29  29  ALA ALA P . n 
Z  10 30  LEU 30  30  30  LEU LEU P . n 
Z  10 31  LEU 31  31  31  LEU LEU P . n 
Z  10 32  GLY 32  32  32  GLY GLY P . n 
Z  10 33  PRO 33  33  33  PRO PRO P . n 
Z  10 34  LYS 34  34  34  LYS LYS P . n 
Z  10 35  LYS 35  35  35  LYS LYS P . n 
Z  10 36  PRO 36  36  36  PRO PRO P . n 
Z  10 37  GLY 37  37  37  GLY GLY P . n 
Z  10 38  ARG 38  38  38  ARG ARG P . n 
Z  10 39  ALA 39  39  39  ALA ALA P . n 
Z  10 40  LYS 40  40  40  LYS LYS P . n 
Z  10 41  LEU 41  41  41  LEU LEU P . n 
Z  10 42  MET 42  42  42  MET MET P . n 
Z  10 43  PRO 43  43  43  PRO PRO P . n 
Z  10 44  TYR 44  44  44  TYR TYR P . n 
Z  10 45  GLU 45  45  45  GLU GLU P . n 
Z  10 46  SER 46  46  46  SER SER P . n 
Z  10 47  GLY 47  47  47  GLY GLY P . n 
Z  10 48  ASN 48  48  48  ASN ASN P . n 
Z  10 49  ASP 49  49  49  ASP ASP P . n 
Z  10 50  PRO 50  50  50  PRO PRO P . n 
Z  10 51  ALA 51  51  51  ALA ALA P . n 
Z  10 52  GLY 52  52  52  GLY GLY P . n 
Z  10 53  GLU 53  53  53  GLU GLU P . n 
Z  10 54  VAL 54  54  54  VAL VAL P . n 
Z  10 55  LYS 55  55  55  LYS LYS P . n 
Z  10 56  ARG 56  56  56  ARG ARG P . n 
Z  10 57  PHE 57  57  57  PHE PHE P . n 
Z  10 58  PRO 58  58  58  PRO PRO P . n 
Z  10 59  VAL 59  59  59  VAL VAL P . n 
Z  10 60  HIS 60  60  60  HIS HIS P . n 
Z  10 61  PHE 61  61  61  PHE PHE P . n 
Z  10 62  TYR 62  62  62  TYR TYR P . n 
Z  10 63  VAL 63  63  63  VAL VAL P . n 
Z  10 64  VAL 64  64  64  VAL VAL P . n 
Z  10 65  ALA 65  65  65  ALA ALA P . n 
Z  10 66  MET 66  66  66  MET MET P . n 
Z  10 67  LEU 67  67  67  LEU LEU P . n 
Z  10 68  PHE 68  68  68  PHE PHE P . n 
Z  10 69  ILE 69  69  69  ILE ILE P . n 
Z  10 70  LEU 70  70  70  LEU LEU P . n 
Z  10 71  PHE 71  71  71  PHE PHE P . n 
Z  10 72  ASP 72  72  72  ASP ASP P . n 
Z  10 73  VAL 73  73  73  VAL VAL P . n 
Z  10 74  GLU 74  74  74  GLU GLU P . n 
Z  10 75  VAL 75  75  75  VAL VAL P . n 
Z  10 76  ALA 76  76  76  ALA ALA P . n 
Z  10 77  PHE 77  77  77  PHE PHE P . n 
Z  10 78  LEU 78  78  78  LEU LEU P . n 
Z  10 79  TRP 79  79  79  TRP TRP P . n 
Z  10 80  PRO 80  80  80  PRO PRO P . n 
Z  10 81  TYR 81  81  81  TYR TYR P . n 
Z  10 82  ALA 82  82  82  ALA ALA P . n 
Z  10 83  VAL 83  83  83  VAL VAL P . n 
Z  10 84  SER 84  84  84  SER SER P . n 
Z  10 85  ALA 85  85  85  ALA ALA P . n 
Z  10 86  GLY 86  86  86  GLY GLY P . n 
Z  10 87  GLY 87  87  87  GLY GLY P . n 
Z  10 88  LEU 88  88  88  LEU LEU P . n 
Z  10 89  GLY 89  89  89  GLY GLY P . n 
Z  10 90  LEU 90  90  90  LEU LEU P . n 
Z  10 91  TYR 91  91  91  TYR TYR P . n 
Z  10 92  GLY 92  92  92  GLY GLY P . n 
Z  10 93  PHE 93  93  93  PHE PHE P . n 
Z  10 94  LEU 94  94  94  LEU LEU P . n 
Z  10 95  GLY 95  95  95  GLY GLY P . n 
Z  10 96  VAL 96  96  96  VAL VAL P . n 
Z  10 97  LEU 97  97  97  LEU LEU P . n 
Z  10 98  ALA 98  98  98  ALA ALA P . n 
Z  10 99  PHE 99  99  99  PHE PHE P . n 
Z  10 100 THR 100 100 100 THR THR P . n 
Z  10 101 LEU 101 101 101 LEU LEU P . n 
Z  10 102 LEU 102 102 102 LEU LEU P . n 
Z  10 103 LEU 103 103 103 LEU LEU P . n 
Z  10 104 PHE 104 104 104 PHE PHE P . n 
Z  10 105 VAL 105 105 105 VAL VAL P . n 
Z  10 106 GLY 106 106 106 GLY GLY P . n 
Z  10 107 PHE 107 107 107 PHE PHE P . n 
Z  10 108 LEU 108 108 108 LEU LEU P . n 
Z  10 109 TYR 109 109 109 TYR TYR P . n 
Z  10 110 GLU 110 110 110 GLU GLU P . n 
Z  10 111 TRP 111 111 111 TRP TRP P . n 
Z  10 112 TRP 112 112 112 TRP TRP P . n 
Z  10 113 LYS 113 113 113 LYS LYS P . n 
Z  10 114 GLY 114 114 114 GLY GLY P . n 
Z  10 115 VAL 115 115 115 VAL VAL P . n 
Z  10 116 MET 116 116 116 MET MET P . n 
Z  10 117 ARG 117 117 117 ARG ARG P . n 
Z  10 118 TRP 118 118 ?   ?   ?   P . n 
Z  10 119 HIS 119 119 ?   ?   ?   P . n 
AA 11 1   MET 1   1   1   MET MET R . n 
AA 11 2   SER 2   2   2   SER SER R . n 
AA 11 3   LEU 3   3   3   LEU LEU R . n 
AA 11 4   LEU 4   4   4   LEU LEU R . n 
AA 11 5   GLU 5   5   5   GLU GLU R . n 
AA 11 6   GLY 6   6   6   GLY GLY R . n 
AA 11 7   LEU 7   7   7   LEU LEU R . n 
AA 11 8   ALA 8   8   8   ALA ALA R . n 
AA 11 9   LEU 9   9   9   LEU LEU R . n 
AA 11 10  PHE 10  10  10  PHE PHE R . n 
AA 11 11  LEU 11  11  11  LEU LEU R . n 
AA 11 12  LEU 12  12  12  LEU LEU R . n 
AA 11 13  LEU 13  13  13  LEU LEU R . n 
AA 11 14  LEU 14  14  14  LEU LEU R . n 
AA 11 15  SER 15  15  15  SER SER R . n 
AA 11 16  GLY 16  16  16  GLY GLY R . n 
AA 11 17  VAL 17  17  17  VAL VAL R . n 
AA 11 18  LEU 18  18  18  LEU LEU R . n 
AA 11 19  VAL 19  19  19  VAL VAL R . n 
AA 11 20  VAL 20  20  20  VAL VAL R . n 
AA 11 21  THR 21  21  21  THR THR R . n 
AA 11 22  LEU 22  22  22  LEU LEU R . n 
AA 11 23  ARG 23  23  23  ARG ARG R . n 
AA 11 24  ASN 24  24  24  ASN ASN R . n 
AA 11 25  ALA 25  25  25  ALA ALA R . n 
AA 11 26  ILE 26  26  26  ILE ILE R . n 
AA 11 27  HIS 27  27  27  HIS HIS R . n 
AA 11 28  ALA 28  28  28  ALA ALA R . n 
AA 11 29  ALA 29  29  29  ALA ALA R . n 
AA 11 30  LEU 30  30  30  LEU LEU R . n 
AA 11 31  ALA 31  31  31  ALA ALA R . n 
AA 11 32  LEU 32  32  32  LEU LEU R . n 
AA 11 33  ILE 33  33  33  ILE ILE R . n 
AA 11 34  LEU 34  34  34  LEU LEU R . n 
AA 11 35  ASN 35  35  35  ASN ASN R . n 
AA 11 36  PHE 36  36  36  PHE PHE R . n 
AA 11 37  LEU 37  37  37  LEU LEU R . n 
AA 11 38  VAL 38  38  38  VAL VAL R . n 
AA 11 39  LEU 39  39  39  LEU LEU R . n 
AA 11 40  ALA 40  40  40  ALA ALA R . n 
AA 11 41  GLY 41  41  41  GLY GLY R . n 
AA 11 42  VAL 42  42  42  VAL VAL R . n 
AA 11 43  TYR 43  43  43  TYR TYR R . n 
AA 11 44  VAL 44  44  44  VAL VAL R . n 
AA 11 45  ALA 45  45  45  ALA ALA R . n 
AA 11 46  LEU 46  46  46  LEU LEU R . n 
AA 11 47  ASP 47  47  47  ASP ASP R . n 
AA 11 48  ALA 48  48  48  ALA ALA R . n 
AA 11 49  ARG 49  49  49  ARG ARG R . n 
AA 11 50  PHE 50  50  50  PHE PHE R . n 
AA 11 51  LEU 51  51  51  LEU LEU R . n 
AA 11 52  GLY 52  52  52  GLY GLY R . n 
AA 11 53  PHE 53  53  53  PHE PHE R . n 
AA 11 54  ILE 54  54  54  ILE ILE R . n 
AA 11 55  GLN 55  55  55  GLN GLN R . n 
AA 11 56  VAL 56  56  56  VAL VAL R . n 
AA 11 57  ILE 57  57  57  ILE ILE R . n 
AA 11 58  VAL 58  58  58  VAL VAL R . n 
AA 11 59  TYR 59  59  59  TYR TYR R . n 
AA 11 60  ALA 60  60  60  ALA ALA R . n 
AA 11 61  GLY 61  61  61  GLY GLY R . n 
AA 11 62  ALA 62  62  62  ALA ALA R . n 
AA 11 63  ILE 63  63  63  ILE ILE R . n 
AA 11 64  VAL 64  64  64  VAL VAL R . n 
AA 11 65  VAL 65  65  65  VAL VAL R . n 
AA 11 66  LEU 66  66  66  LEU LEU R . n 
AA 11 67  PHE 67  67  67  PHE PHE R . n 
AA 11 68  LEU 68  68  68  LEU LEU R . n 
AA 11 69  PHE 69  69  69  PHE PHE R . n 
AA 11 70  VAL 70  70  70  VAL VAL R . n 
AA 11 71  ILE 71  71  71  ILE ILE R . n 
AA 11 72  MET 72  72  72  MET MET R . n 
AA 11 73  LEU 73  73  73  LEU LEU R . n 
AA 11 74  LEU 74  74  74  LEU LEU R . n 
AA 11 75  PHE 75  75  75  PHE PHE R . n 
AA 11 76  ALA 76  76  76  ALA ALA R . n 
AA 11 77  ALA 77  77  77  ALA ALA R . n 
AA 11 78  GLN 78  78  78  GLN GLN R . n 
AA 11 79  GLY 79  79  79  GLY GLY R . n 
AA 11 80  GLU 80  80  80  GLU GLU R . n 
AA 11 81  ILE 81  81  81  ILE ILE R . n 
AA 11 82  GLY 82  82  82  GLY GLY R . n 
AA 11 83  PHE 83  83  83  PHE PHE R . n 
AA 11 84  ASP 84  84  84  ASP ASP R . n 
AA 11 85  PRO 85  85  85  PRO PRO R . n 
AA 11 86  LEU 86  86  86  LEU LEU R . n 
AA 11 87  VAL 87  87  87  VAL VAL R . n 
AA 11 88  ARG 88  88  88  ARG ARG R . n 
AA 11 89  SER 89  89  89  SER SER R . n 
AA 11 90  ARG 90  90  90  ARG ARG R . n 
AA 11 91  PRO 91  91  91  PRO PRO R . n 
AA 11 92  LEU 92  92  92  LEU LEU R . n 
AA 11 93  ALA 93  93  93  ALA ALA R . n 
AA 11 94  ALA 94  94  94  ALA ALA R . n 
AA 11 95  LEU 95  95  95  LEU LEU R . n 
AA 11 96  LEU 96  96  96  LEU LEU R . n 
AA 11 97  ALA 97  97  97  ALA ALA R . n 
AA 11 98  LEU 98  98  98  LEU LEU R . n 
AA 11 99  GLY 99  99  99  GLY GLY R . n 
AA 11 100 VAL 100 100 100 VAL VAL R . n 
AA 11 101 ALA 101 101 101 ALA ALA R . n 
AA 11 102 GLY 102 102 102 GLY GLY R . n 
AA 11 103 ILE 103 103 103 ILE ILE R . n 
AA 11 104 LEU 104 104 104 LEU LEU R . n 
AA 11 105 ALA 105 105 105 ALA ALA R . n 
AA 11 106 ALA 106 106 106 ALA ALA R . n 
AA 11 107 GLY 107 107 107 GLY GLY R . n 
AA 11 108 LEU 108 108 108 LEU LEU R . n 
AA 11 109 TRP 109 109 109 TRP TRP R . n 
AA 11 110 GLY 110 110 110 GLY GLY R . n 
AA 11 111 LEU 111 111 111 LEU LEU R . n 
AA 11 112 ASP 112 112 112 ASP ASP R . n 
AA 11 113 LEU 113 113 113 LEU LEU R . n 
AA 11 114 ALA 114 114 114 ALA ALA R . n 
AA 11 115 PHE 115 115 115 PHE PHE R . n 
AA 11 116 THR 116 116 116 THR THR R . n 
AA 11 117 GLN 117 117 117 GLN GLN R . n 
AA 11 118 ASP 118 118 118 ASP ASP R . n 
AA 11 119 LEU 119 119 119 LEU LEU R . n 
AA 11 120 LYS 120 120 120 LYS LYS R . n 
AA 11 121 GLY 121 121 121 GLY GLY R . n 
AA 11 122 GLY 122 122 122 GLY GLY R . n 
AA 11 123 LEU 123 123 123 LEU LEU R . n 
AA 11 124 PRO 124 124 124 PRO PRO R . n 
AA 11 125 GLN 125 125 125 GLN GLN R . n 
AA 11 126 ALA 126 126 126 ALA ALA R . n 
AA 11 127 LEU 127 127 127 LEU LEU R . n 
AA 11 128 GLY 128 128 128 GLY GLY R . n 
AA 11 129 PRO 129 129 129 PRO PRO R . n 
AA 11 130 LEU 130 130 130 LEU LEU R . n 
AA 11 131 LEU 131 131 131 LEU LEU R . n 
AA 11 132 TYR 132 132 132 TYR TYR R . n 
AA 11 133 GLY 133 133 133 GLY GLY R . n 
AA 11 134 ASP 134 134 134 ASP ASP R . n 
AA 11 135 TRP 135 135 135 TRP TRP R . n 
AA 11 136 LEU 136 136 136 LEU LEU R . n 
AA 11 137 PHE 137 137 137 PHE PHE R . n 
AA 11 138 VAL 138 138 138 VAL VAL R . n 
AA 11 139 LEU 139 139 139 LEU LEU R . n 
AA 11 140 LEU 140 140 140 LEU LEU R . n 
AA 11 141 ALA 141 141 141 ALA ALA R . n 
AA 11 142 VAL 142 142 142 VAL VAL R . n 
AA 11 143 GLY 143 143 143 GLY GLY R . n 
AA 11 144 PHE 144 144 144 PHE PHE R . n 
AA 11 145 LEU 145 145 145 LEU LEU R . n 
AA 11 146 LEU 146 146 146 LEU LEU R . n 
AA 11 147 MET 147 147 147 MET MET R . n 
AA 11 148 ALA 148 148 148 ALA ALA R . n 
AA 11 149 ALA 149 149 149 ALA ALA R . n 
AA 11 150 THR 150 150 150 THR THR R . n 
AA 11 151 VAL 151 151 151 VAL VAL R . n 
AA 11 152 VAL 152 152 152 VAL VAL R . n 
AA 11 153 ALA 153 153 153 ALA ALA R . n 
AA 11 154 VAL 154 154 154 VAL VAL R . n 
AA 11 155 ALA 155 155 155 ALA ALA R . n 
AA 11 156 LEU 156 156 156 LEU LEU R . n 
AA 11 157 VAL 157 157 157 VAL VAL R . n 
AA 11 158 GLU 158 158 158 GLU GLU R . n 
AA 11 159 PRO 159 159 159 PRO PRO R . n 
AA 11 160 GLY 160 160 160 GLY GLY R . n 
AA 11 161 LYS 161 161 ?   ?   ?   R . n 
AA 11 162 ALA 162 162 ?   ?   ?   R . n 
AA 11 163 SER 163 163 ?   ?   ?   R . n 
AA 11 164 ARG 164 164 ?   ?   ?   R . n 
AA 11 165 ALA 165 165 ?   ?   ?   R . n 
AA 11 166 LYS 166 166 ?   ?   ?   R . n 
AA 11 167 GLU 167 167 ?   ?   ?   R . n 
AA 11 168 ALA 168 168 ?   ?   ?   R . n 
AA 11 169 GLU 169 169 ?   ?   ?   R . n 
AA 11 170 LYS 170 170 ?   ?   ?   R . n 
AA 11 171 ARG 171 171 ?   ?   ?   R . n 
AA 11 172 GLU 172 172 ?   ?   ?   R . n 
AA 11 173 GLU 173 173 ?   ?   ?   R . n 
AA 11 174 VAL 174 174 ?   ?   ?   R . n 
AA 11 175 ALA 175 175 ?   ?   ?   R . n 
AA 11 176 ARG 176 176 ?   ?   ?   R . n 
BA 12 1   MET 1   1   1   MET MET S . n 
BA 12 2   SER 2   2   2   SER SER S . n 
BA 12 3   TYR 3   3   3   TYR TYR S . n 
BA 12 4   LEU 4   4   4   LEU LEU S . n 
BA 12 5   LEU 5   5   5   LEU LEU S . n 
BA 12 6   THR 6   6   6   THR THR S . n 
BA 12 7   SER 7   7   7   SER SER S . n 
BA 12 8   ALA 8   8   8   ALA ALA S . n 
BA 12 9   LEU 9   9   9   LEU LEU S . n 
BA 12 10  LEU 10  10  10  LEU LEU S . n 
BA 12 11  PHE 11  11  11  PHE PHE S . n 
BA 12 12  ALA 12  12  12  ALA ALA S . n 
BA 12 13  LEU 13  13  13  LEU LEU S . n 
BA 12 14  GLY 14  14  14  GLY GLY S . n 
BA 12 15  VAL 15  15  15  VAL VAL S . n 
BA 12 16  TYR 16  16  16  TYR TYR S . n 
BA 12 17  GLY 17  17  17  GLY GLY S . n 
BA 12 18  VAL 18  18  18  VAL VAL S . n 
BA 12 19  LEU 19  19  19  LEU LEU S . n 
BA 12 20  THR 20  20  20  THR THR S . n 
BA 12 21  ARG 21  21  21  ARG ARG S . n 
BA 12 22  ARG 22  22  22  ARG ARG S . n 
BA 12 23  THR 23  23  23  THR THR S . n 
BA 12 24  ALA 24  24  24  ALA ALA S . n 
BA 12 25  ILE 25  25  25  ILE ILE S . n 
BA 12 26  LEU 26  26  26  LEU LEU S . n 
BA 12 27  VAL 27  27  27  VAL VAL S . n 
BA 12 28  PHE 28  28  28  PHE PHE S . n 
BA 12 29  LEU 29  29  29  LEU LEU S . n 
BA 12 30  SER 30  30  30  SER SER S . n 
BA 12 31  ILE 31  31  31  ILE ILE S . n 
BA 12 32  GLU 32  32  32  GLU GLU S . n 
BA 12 33  LEU 33  33  33  LEU LEU S . n 
BA 12 34  MET 34  34  34  MET MET S . n 
BA 12 35  LEU 35  35  35  LEU LEU S . n 
BA 12 36  ASN 36  36  36  ASN ASN S . n 
BA 12 37  ALA 37  37  37  ALA ALA S . n 
BA 12 38  ALA 38  38  38  ALA ALA S . n 
BA 12 39  ASN 39  39  39  ASN ASN S . n 
BA 12 40  LEU 40  40  40  LEU LEU S . n 
BA 12 41  SER 41  41  41  SER SER S . n 
BA 12 42  LEU 42  42  42  LEU LEU S . n 
BA 12 43  VAL 43  43  43  VAL VAL S . n 
BA 12 44  GLY 44  44  44  GLY GLY S . n 
BA 12 45  PHE 45  45  45  PHE PHE S . n 
BA 12 46  ALA 46  46  46  ALA ALA S . n 
BA 12 47  ARG 47  47  47  ARG ARG S . n 
BA 12 48  ALA 48  48  48  ALA ALA S . n 
BA 12 49  TYR 49  49  49  TYR TYR S . n 
BA 12 50  GLY 50  50  50  GLY GLY S . n 
BA 12 51  LEU 51  51  51  LEU LEU S . n 
BA 12 52  ASP 52  52  52  ASP ASP S . n 
BA 12 53  GLY 53  53  53  GLY GLY S . n 
BA 12 54  GLN 54  54  54  GLN GLN S . n 
BA 12 55  VAL 55  55  55  VAL VAL S . n 
BA 12 56  ALA 56  56  56  ALA ALA S . n 
BA 12 57  ALA 57  57  57  ALA ALA S . n 
BA 12 58  LEU 58  58  58  LEU LEU S . n 
BA 12 59  MET 59  59  59  MET MET S . n 
BA 12 60  VAL 60  60  60  VAL VAL S . n 
BA 12 61  ILE 61  61  61  ILE ILE S . n 
BA 12 62  ALA 62  62  62  ALA ALA S . n 
BA 12 63  VAL 63  63  63  VAL VAL S . n 
BA 12 64  ALA 64  64  64  ALA ALA S . n 
BA 12 65  ALA 65  65  65  ALA ALA S . n 
BA 12 66  ALA 66  66  66  ALA ALA S . n 
BA 12 67  GLU 67  67  67  GLU GLU S . n 
BA 12 68  VAL 68  68  68  VAL VAL S . n 
BA 12 69  ALA 69  69  69  ALA ALA S . n 
BA 12 70  VAL 70  70  70  VAL VAL S . n 
BA 12 71  GLY 71  71  71  GLY GLY S . n 
BA 12 72  LEU 72  72  72  LEU LEU S . n 
BA 12 73  GLY 73  73  73  GLY GLY S . n 
BA 12 74  LEU 74  74  74  LEU LEU S . n 
BA 12 75  ILE 75  75  75  ILE ILE S . n 
BA 12 76  VAL 76  76  76  VAL VAL S . n 
BA 12 77  ALA 77  77  77  ALA ALA S . n 
BA 12 78  ILE 78  78  78  ILE ILE S . n 
BA 12 79  PHE 79  79  79  PHE PHE S . n 
BA 12 80  ARG 80  80  80  ARG ARG S . n 
BA 12 81  HIS 81  81  81  HIS HIS S . n 
BA 12 82  ARG 82  82  82  ARG ARG S . n 
BA 12 83  GLU 83  83  83  GLU GLU S . n 
BA 12 84  SER 84  84  84  SER SER S . n 
BA 12 85  THR 85  85  85  THR THR S . n 
BA 12 86  ALA 86  86  86  ALA ALA S . n 
BA 12 87  VAL 87  87  87  VAL VAL S . n 
BA 12 88  ASP 88  88  88  ASP ASP S . n 
BA 12 89  ASP 89  89  89  ASP ASP S . n 
BA 12 90  LEU 90  90  90  LEU LEU S . n 
BA 12 91  SER 91  91  91  SER SER S . n 
BA 12 92  GLU 92  92  92  GLU GLU S . n 
BA 12 93  LEU 93  93  93  LEU LEU S . n 
BA 12 94  ARG 94  94  94  ARG ARG S . n 
BA 12 95  GLY 95  95  95  GLY GLY S . n 
CA 13 1   MET 1   1   1   MET MET T . n 
CA 13 2   ALA 2   2   2   ALA ALA T . n 
CA 13 3   LEU 3   3   3   LEU LEU T . n 
CA 13 4   LEU 4   4   4   LEU LEU T . n 
CA 13 5   GLY 5   5   5   GLY GLY T . n 
CA 13 6   THR 6   6   6   THR THR T . n 
CA 13 7   ILE 7   7   7   ILE ILE T . n 
CA 13 8   LEU 8   8   8   LEU LEU T . n 
CA 13 9   LEU 9   9   9   LEU LEU T . n 
CA 13 10  PRO 10  10  10  PRO PRO T . n 
CA 13 11  LEU 11  11  11  LEU LEU T . n 
CA 13 12  LEU 12  12  12  LEU LEU T . n 
CA 13 13  GLY 13  13  13  GLY GLY T . n 
CA 13 14  PHE 14  14  14  PHE PHE T . n 
CA 13 15  ALA 15  15  15  ALA ALA T . n 
CA 13 16  LEU 16  16  16  LEU LEU T . n 
CA 13 17  LEU 17  17  17  LEU LEU T . n 
CA 13 18  GLY 18  18  18  GLY GLY T . n 
CA 13 19  LEU 19  19  19  LEU LEU T . n 
CA 13 20  PHE 20  20  20  PHE PHE T . n 
CA 13 21  GLY 21  21  21  GLY GLY T . n 
CA 13 22  LYS 22  22  22  LYS LYS T . n 
CA 13 23  ARG 23  23  23  ARG ARG T . n 
CA 13 24  MET 24  24  24  MET MET T . n 
CA 13 25  ARG 25  25  25  ARG ARG T . n 
CA 13 26  GLU 26  26  26  GLU GLU T . n 
CA 13 27  PRO 27  27  27  PRO PRO T . n 
CA 13 28  LEU 28  28  28  LEU LEU T . n 
CA 13 29  PRO 29  29  29  PRO PRO T . n 
CA 13 30  GLY 30  30  30  GLY GLY T . n 
CA 13 31  VAL 31  31  31  VAL VAL T . n 
CA 13 32  LEU 32  32  32  LEU LEU T . n 
CA 13 33  ALA 33  33  33  ALA ALA T . n 
CA 13 34  SER 34  34  34  SER SER T . n 
CA 13 35  GLY 35  35  35  GLY GLY T . n 
CA 13 36  LEU 36  36  36  LEU LEU T . n 
CA 13 37  VAL 37  37  37  VAL VAL T . n 
CA 13 38  LEU 38  38  38  LEU LEU T . n 
CA 13 39  ALA 39  39  39  ALA ALA T . n 
CA 13 40  SER 40  40  40  SER SER T . n 
CA 13 41  PHE 41  41  41  PHE PHE T . n 
CA 13 42  LEU 42  42  42  LEU LEU T . n 
CA 13 43  LEU 43  43  43  LEU LEU T . n 
CA 13 44  GLY 44  44  44  GLY GLY T . n 
CA 13 45  ALA 45  45  45  ALA ALA T . n 
CA 13 46  GLY 46  46  46  GLY GLY T . n 
CA 13 47  LEU 47  47  47  LEU LEU T . n 
CA 13 48  LEU 48  48  48  LEU LEU T . n 
CA 13 49  LEU 49  49  49  LEU LEU T . n 
CA 13 50  SER 50  50  50  SER SER T . n 
CA 13 51  GLY 51  51  51  GLY GLY T . n 
CA 13 52  GLY 52  52  52  GLY GLY T . n 
CA 13 53  ALA 53  53  53  ALA ALA T . n 
CA 13 54  ARG 54  54  54  ARG ARG T . n 
CA 13 55  PHE 55  55  55  PHE PHE T . n 
CA 13 56  GLN 56  56  56  GLN GLN T . n 
CA 13 57  ALA 57  57  57  ALA ALA T . n 
CA 13 58  GLU 58  58  58  GLU GLU T . n 
CA 13 59  TRP 59  59  59  TRP TRP T . n 
CA 13 60  LEU 60  60  60  LEU LEU T . n 
CA 13 61  PRO 61  61  61  PRO PRO T . n 
CA 13 62  GLY 62  62  62  GLY GLY T . n 
CA 13 63  ILE 63  63  63  ILE ILE T . n 
CA 13 64  PRO 64  64  64  PRO PRO T . n 
CA 13 65  PHE 65  65  65  PHE PHE T . n 
CA 13 66  SER 66  66  66  SER SER T . n 
CA 13 67  LEU 67  67  67  LEU LEU T . n 
CA 13 68  LEU 68  68  68  LEU LEU T . n 
CA 13 69  LEU 69  69  69  LEU LEU T . n 
CA 13 70  ASP 70  70  70  ASP ASP T . n 
CA 13 71  ASN 71  71  71  ASN ASN T . n 
CA 13 72  LEU 72  72  72  LEU LEU T . n 
CA 13 73  SER 73  73  73  SER SER T . n 
CA 13 74  GLY 74  74  74  GLY GLY T . n 
CA 13 75  PHE 75  75  75  PHE PHE T . n 
CA 13 76  MET 76  76  76  MET MET T . n 
CA 13 77  LEU 77  77  77  LEU LEU T . n 
CA 13 78  LEU 78  78  78  LEU LEU T . n 
CA 13 79  ILE 79  79  79  ILE ILE T . n 
CA 13 80  VAL 80  80  80  VAL VAL T . n 
CA 13 81  THR 81  81  81  THR THR T . n 
CA 13 82  GLY 82  82  82  GLY GLY T . n 
CA 13 83  VAL 83  83  83  VAL VAL T . n 
CA 13 84  GLY 84  84  84  GLY GLY T . n 
CA 13 85  PHE 85  85  85  PHE PHE T . n 
CA 13 86  LEU 86  86  86  LEU LEU T . n 
CA 13 87  ILE 87  87  87  ILE ILE T . n 
CA 13 88  HIS 88  88  88  HIS HIS T . n 
CA 13 89  VAL 89  89  89  VAL VAL T . n 
CA 13 90  TYR 90  90  90  TYR TYR T . n 
CA 13 91  ALA 91  91  91  ALA ALA T . n 
CA 13 92  ILE 92  92  92  ILE ILE T . n 
CA 13 93  GLY 93  93  93  GLY GLY T . n 
CA 13 94  TYR 94  94  94  TYR TYR T . n 
CA 13 95  MET 95  95  95  MET MET T . n 
CA 13 96  GLY 96  96  96  GLY GLY T . n 
CA 13 97  GLY 97  97  97  GLY GLY T . n 
CA 13 98  ASP 98  98  98  ASP ASP T . n 
CA 13 99  PRO 99  99  99  PRO PRO T . n 
CA 13 100 GLY 100 100 100 GLY GLY T . n 
CA 13 101 TYR 101 101 101 TYR TYR T . n 
CA 13 102 SER 102 102 102 SER SER T . n 
CA 13 103 ARG 103 103 103 ARG ARG T . n 
CA 13 104 PHE 104 104 104 PHE PHE T . n 
CA 13 105 PHE 105 105 105 PHE PHE T . n 
CA 13 106 ALA 106 106 106 ALA ALA T . n 
CA 13 107 TYR 107 107 107 TYR TYR T . n 
CA 13 108 PHE 108 108 108 PHE PHE T . n 
CA 13 109 ASN 109 109 109 ASN ASN T . n 
CA 13 110 LEU 110 110 110 LEU LEU T . n 
CA 13 111 PHE 111 111 111 PHE PHE T . n 
CA 13 112 ILE 112 112 112 ILE ILE T . n 
CA 13 113 ALA 113 113 113 ALA ALA T . n 
CA 13 114 MET 114 114 114 MET MET T . n 
CA 13 115 MET 115 115 115 MET MET T . n 
CA 13 116 LEU 116 116 116 LEU LEU T . n 
CA 13 117 THR 117 117 117 THR THR T . n 
CA 13 118 LEU 118 118 118 LEU LEU T . n 
CA 13 119 VAL 119 119 119 VAL VAL T . n 
CA 13 120 LEU 120 120 120 LEU LEU T . n 
CA 13 121 ALA 121 121 121 ALA ALA T . n 
CA 13 122 ASP 122 122 122 ASP ASP T . n 
CA 13 123 SER 123 123 123 SER SER T . n 
CA 13 124 TYR 124 124 124 TYR TYR T . n 
CA 13 125 PRO 125 125 125 PRO PRO T . n 
CA 13 126 VAL 126 126 126 VAL VAL T . n 
CA 13 127 MET 127 127 127 MET MET T . n 
CA 13 128 PHE 128 128 128 PHE PHE T . n 
CA 13 129 ILE 129 129 129 ILE ILE T . n 
CA 13 130 GLY 130 130 130 GLY GLY T . n 
CA 13 131 TRP 131 131 131 TRP TRP T . n 
CA 13 132 GLU 132 132 132 GLU GLU T . n 
CA 13 133 GLY 133 133 133 GLY GLY T . n 
CA 13 134 VAL 134 134 134 VAL VAL T . n 
CA 13 135 GLY 135 135 135 GLY GLY T . n 
CA 13 136 LEU 136 136 136 LEU LEU T . n 
CA 13 137 ALA 137 137 137 ALA ALA T . n 
CA 13 138 SER 138 138 138 SER SER T . n 
CA 13 139 PHE 139 139 139 PHE PHE T . n 
CA 13 140 LEU 140 140 140 LEU LEU T . n 
CA 13 141 LEU 141 141 141 LEU LEU T . n 
CA 13 142 ILE 142 142 142 ILE ILE T . n 
CA 13 143 GLY 143 143 143 GLY GLY T . n 
CA 13 144 PHE 144 144 144 PHE PHE T . n 
CA 13 145 TRP 145 145 145 TRP TRP T . n 
CA 13 146 TYR 146 146 146 TYR TYR T . n 
CA 13 147 LYS 147 147 147 LYS LYS T . n 
CA 13 148 ASN 148 148 148 ASN ASN T . n 
CA 13 149 PRO 149 149 149 PRO PRO T . n 
CA 13 150 GLN 150 150 150 GLN GLN T . n 
CA 13 151 TYR 151 151 151 TYR TYR T . n 
CA 13 152 ALA 152 152 152 ALA ALA T . n 
CA 13 153 ASP 153 153 153 ASP ASP T . n 
CA 13 154 SER 154 154 154 SER SER T . n 
CA 13 155 ALA 155 155 155 ALA ALA T . n 
CA 13 156 ARG 156 156 156 ARG ARG T . n 
CA 13 157 LYS 157 157 157 LYS LYS T . n 
CA 13 158 ALA 158 158 158 ALA ALA T . n 
CA 13 159 PHE 159 159 159 PHE PHE T . n 
CA 13 160 ILE 160 160 160 ILE ILE T . n 
CA 13 161 VAL 161 161 161 VAL VAL T . n 
CA 13 162 ASN 162 162 162 ASN ASN T . n 
CA 13 163 ARG 163 163 163 ARG ARG T . n 
CA 13 164 ILE 164 164 164 ILE ILE T . n 
CA 13 165 GLY 165 165 165 GLY GLY T . n 
CA 13 166 ASP 166 166 166 ASP ASP T . n 
CA 13 167 LEU 167 167 167 LEU LEU T . n 
CA 13 168 GLY 168 168 168 GLY GLY T . n 
CA 13 169 PHE 169 169 169 PHE PHE T . n 
CA 13 170 MET 170 170 170 MET MET T . n 
CA 13 171 LEU 171 171 171 LEU LEU T . n 
CA 13 172 GLY 172 172 172 GLY GLY T . n 
CA 13 173 MET 173 173 173 MET MET T . n 
CA 13 174 ALA 174 174 174 ALA ALA T . n 
CA 13 175 ILE 175 175 175 ILE ILE T . n 
CA 13 176 LEU 176 176 176 LEU LEU T . n 
CA 13 177 TRP 177 177 177 TRP TRP T . n 
CA 13 178 ALA 178 178 178 ALA ALA T . n 
CA 13 179 LEU 179 179 179 LEU LEU T . n 
CA 13 180 TYR 180 180 180 TYR TYR T . n 
CA 13 181 GLY 181 181 181 GLY GLY T . n 
CA 13 182 THR 182 182 182 THR THR T . n 
CA 13 183 LEU 183 183 183 LEU LEU T . n 
CA 13 184 SER 184 184 184 SER SER T . n 
CA 13 185 ILE 185 185 185 ILE ILE T . n 
CA 13 186 SER 186 186 186 SER SER T . n 
CA 13 187 GLU 187 187 187 GLU GLU T . n 
CA 13 188 LEU 188 188 188 LEU LEU T . n 
CA 13 189 LYS 189 189 189 LYS LYS T . n 
CA 13 190 GLU 190 190 190 GLU GLU T . n 
CA 13 191 ALA 191 191 191 ALA ALA T . n 
CA 13 192 MET 192 192 192 MET MET T . n 
CA 13 193 GLU 193 193 193 GLU GLU T . n 
CA 13 194 GLY 194 194 194 GLY GLY T . n 
CA 13 195 PRO 195 195 195 PRO PRO T . n 
CA 13 196 LEU 196 196 196 LEU LEU T . n 
CA 13 197 LYS 197 197 197 LYS LYS T . n 
CA 13 198 ASN 198 198 198 ASN ASN T . n 
CA 13 199 PRO 199 199 199 PRO PRO T . n 
CA 13 200 ASP 200 200 200 ASP ASP T . n 
CA 13 201 LEU 201 201 201 LEU LEU T . n 
CA 13 202 LEU 202 202 202 LEU LEU T . n 
CA 13 203 ALA 203 203 203 ALA ALA T . n 
CA 13 204 LEU 204 204 204 LEU LEU T . n 
CA 13 205 ALA 205 205 205 ALA ALA T . n 
CA 13 206 GLY 206 206 206 GLY GLY T . n 
CA 13 207 LEU 207 207 207 LEU LEU T . n 
CA 13 208 LEU 208 208 208 LEU LEU T . n 
CA 13 209 LEU 209 209 209 LEU LEU T . n 
CA 13 210 PHE 210 210 210 PHE PHE T . n 
CA 13 211 LEU 211 211 211 LEU LEU T . n 
CA 13 212 GLY 212 212 212 GLY GLY T . n 
CA 13 213 ALA 213 213 213 ALA ALA T . n 
CA 13 214 VAL 214 214 214 VAL VAL T . n 
CA 13 215 GLY 215 215 215 GLY GLY T . n 
CA 13 216 LYS 216 216 216 LYS LYS T . n 
CA 13 217 SER 217 217 217 SER SER T . n 
CA 13 218 ALA 218 218 218 ALA ALA T . n 
CA 13 219 GLN 219 219 219 GLN GLN T . n 
CA 13 220 ILE 220 220 220 ILE ILE T . n 
CA 13 221 PRO 221 221 221 PRO PRO T . n 
CA 13 222 LEU 222 222 222 LEU LEU T . n 
CA 13 223 MET 223 223 223 MET MET T . n 
CA 13 224 VAL 224 224 224 VAL VAL T . n 
CA 13 225 TRP 225 225 225 TRP TRP T . n 
CA 13 226 LEU 226 226 226 LEU LEU T . n 
CA 13 227 PRO 227 227 227 PRO PRO T . n 
CA 13 228 ASP 228 228 228 ASP ASP T . n 
CA 13 229 ALA 229 229 229 ALA ALA T . n 
CA 13 230 MET 230 230 230 MET MET T . n 
CA 13 231 ALA 231 231 231 ALA ALA T . n 
CA 13 232 GLY 232 232 232 GLY GLY T . n 
CA 13 233 PRO 233 233 233 PRO PRO T . n 
CA 13 234 THR 234 234 234 THR THR T . n 
CA 13 235 PRO 235 235 235 PRO PRO T . n 
CA 13 236 VAL 236 236 236 VAL VAL T . n 
CA 13 237 SER 237 237 237 SER SER T . n 
CA 13 238 ALA 238 238 238 ALA ALA T . n 
CA 13 239 LEU 239 239 239 LEU LEU T . n 
CA 13 240 ILE 240 240 240 ILE ILE T . n 
CA 13 241 HIS 241 241 241 HIS HIS T . n 
CA 13 242 ALA 242 242 242 ALA ALA T . n 
CA 13 243 ALA 243 243 243 ALA ALA T . n 
CA 13 244 THR 244 244 244 THR THR T . n 
CA 13 245 MET 245 245 245 MET MET T . n 
CA 13 246 VAL 246 246 246 VAL VAL T . n 
CA 13 247 THR 247 247 247 THR THR T . n 
CA 13 248 ALA 248 248 248 ALA ALA T . n 
CA 13 249 GLY 249 249 249 GLY GLY T . n 
CA 13 250 VAL 250 250 250 VAL VAL T . n 
CA 13 251 TYR 251 251 251 TYR TYR T . n 
CA 13 252 LEU 252 252 252 LEU LEU T . n 
CA 13 253 ILE 253 253 253 ILE ILE T . n 
CA 13 254 ALA 254 254 254 ALA ALA T . n 
CA 13 255 ARG 255 255 255 ARG ARG T . n 
CA 13 256 SER 256 256 256 SER SER T . n 
CA 13 257 SER 257 257 257 SER SER T . n 
CA 13 258 PHE 258 258 258 PHE PHE T . n 
CA 13 259 LEU 259 259 259 LEU LEU T . n 
CA 13 260 TYR 260 260 260 TYR TYR T . n 
CA 13 261 SER 261 261 261 SER SER T . n 
CA 13 262 VAL 262 262 262 VAL VAL T . n 
CA 13 263 LEU 263 263 263 LEU LEU T . n 
CA 13 264 PRO 264 264 264 PRO PRO T . n 
CA 13 265 ASP 265 265 265 ASP ASP T . n 
CA 13 266 VAL 266 266 266 VAL VAL T . n 
CA 13 267 SER 267 267 267 SER SER T . n 
CA 13 268 TYR 268 268 268 TYR TYR T . n 
CA 13 269 ALA 269 269 269 ALA ALA T . n 
CA 13 270 ILE 270 270 270 ILE ILE T . n 
CA 13 271 ALA 271 271 271 ALA ALA T . n 
CA 13 272 VAL 272 272 272 VAL VAL T . n 
CA 13 273 VAL 273 273 273 VAL VAL T . n 
CA 13 274 GLY 274 274 274 GLY GLY T . n 
CA 13 275 LEU 275 275 275 LEU LEU T . n 
CA 13 276 LEU 276 276 276 LEU LEU T . n 
CA 13 277 THR 277 277 277 THR THR T . n 
CA 13 278 ALA 278 278 278 ALA ALA T . n 
CA 13 279 ALA 279 279 279 ALA ALA T . n 
CA 13 280 TYR 280 280 280 TYR TYR T . n 
CA 13 281 GLY 281 281 281 GLY GLY T . n 
CA 13 282 ALA 282 282 282 ALA ALA T . n 
CA 13 283 LEU 283 283 283 LEU LEU T . n 
CA 13 284 SER 284 284 284 SER SER T . n 
CA 13 285 ALA 285 285 285 ALA ALA T . n 
CA 13 286 PHE 286 286 286 PHE PHE T . n 
CA 13 287 GLY 287 287 287 GLY GLY T . n 
CA 13 288 GLN 288 288 288 GLN GLN T . n 
CA 13 289 THR 289 289 289 THR THR T . n 
CA 13 290 ASP 290 290 290 ASP ASP T . n 
CA 13 291 ILE 291 291 291 ILE ILE T . n 
CA 13 292 LYS 292 292 292 LYS LYS T . n 
CA 13 293 LYS 293 293 293 LYS LYS T . n 
CA 13 294 ILE 294 294 294 ILE ILE T . n 
CA 13 295 VAL 295 295 295 VAL VAL T . n 
CA 13 296 ALA 296 296 296 ALA ALA T . n 
CA 13 297 TYR 297 297 297 TYR TYR T . n 
CA 13 298 SER 298 298 298 SER SER T . n 
CA 13 299 THR 299 299 299 THR THR T . n 
CA 13 300 ILE 300 300 300 ILE ILE T . n 
CA 13 301 SER 301 301 301 SER SER T . n 
CA 13 302 GLN 302 302 302 GLN GLN T . n 
CA 13 303 LEU 303 303 303 LEU LEU T . n 
CA 13 304 GLY 304 304 304 GLY GLY T . n 
CA 13 305 TYR 305 305 305 TYR TYR T . n 
CA 13 306 MET 306 306 306 MET MET T . n 
CA 13 307 PHE 307 307 307 PHE PHE T . n 
CA 13 308 LEU 308 308 308 LEU LEU T . n 
CA 13 309 ALA 309 309 309 ALA ALA T . n 
CA 13 310 ALA 310 310 310 ALA ALA T . n 
CA 13 311 GLY 311 311 311 GLY GLY T . n 
CA 13 312 VAL 312 312 312 VAL VAL T . n 
CA 13 313 GLY 313 313 313 GLY GLY T . n 
CA 13 314 ALA 314 314 314 ALA ALA T . n 
CA 13 315 TYR 315 315 315 TYR TYR T . n 
CA 13 316 TRP 316 316 316 TRP TRP T . n 
CA 13 317 VAL 317 317 317 VAL VAL T . n 
CA 13 318 ALA 318 318 318 ALA ALA T . n 
CA 13 319 LEU 319 319 319 LEU LEU T . n 
CA 13 320 PHE 320 320 320 PHE PHE T . n 
CA 13 321 HIS 321 321 321 HIS HIS T . n 
CA 13 322 VAL 322 322 322 VAL VAL T . n 
CA 13 323 PHE 323 323 323 PHE PHE T . n 
CA 13 324 THR 324 324 324 THR THR T . n 
CA 13 325 HIS 325 325 325 HIS HIS T . n 
CA 13 326 ALA 326 326 326 ALA ALA T . n 
CA 13 327 PHE 327 327 327 PHE PHE T . n 
CA 13 328 PHE 328 328 328 PHE PHE T . n 
CA 13 329 LYS 329 329 329 LYS LYS T . n 
CA 13 330 ALA 330 330 330 ALA ALA T . n 
CA 13 331 LEU 331 331 331 LEU LEU T . n 
CA 13 332 LEU 332 332 332 LEU LEU T . n 
CA 13 333 PHE 333 333 333 PHE PHE T . n 
CA 13 334 LEU 334 334 334 LEU LEU T . n 
CA 13 335 ALA 335 335 335 ALA ALA T . n 
CA 13 336 SER 336 336 336 SER SER T . n 
CA 13 337 GLY 337 337 337 GLY GLY T . n 
CA 13 338 SER 338 338 338 SER SER T . n 
CA 13 339 VAL 339 339 339 VAL VAL T . n 
CA 13 340 ILE 340 340 340 ILE ILE T . n 
CA 13 341 HIS 341 341 341 HIS HIS T . n 
CA 13 342 ALA 342 342 342 ALA ALA T . n 
CA 13 343 LEU 343 343 343 LEU LEU T . n 
CA 13 344 GLY 344 344 344 GLY GLY T . n 
CA 13 345 GLY 345 345 345 GLY GLY T . n 
CA 13 346 GLU 346 346 346 GLU GLU T . n 
CA 13 347 GLN 347 347 347 GLN GLN T . n 
CA 13 348 ASP 348 348 348 ASP ASP T . n 
CA 13 349 VAL 349 349 349 VAL VAL T . n 
CA 13 350 ARG 350 350 350 ARG ARG T . n 
CA 13 351 LYS 351 351 351 LYS LYS T . n 
CA 13 352 MET 352 352 352 MET MET T . n 
CA 13 353 GLY 353 353 353 GLY GLY T . n 
CA 13 354 GLY 354 354 354 GLY GLY T . n 
CA 13 355 LEU 355 355 355 LEU LEU T . n 
CA 13 356 TRP 356 356 356 TRP TRP T . n 
CA 13 357 LYS 357 357 357 LYS LYS T . n 
CA 13 358 HIS 358 358 358 HIS HIS T . n 
CA 13 359 LEU 359 359 359 LEU LEU T . n 
CA 13 360 PRO 360 360 360 PRO PRO T . n 
CA 13 361 GLN 361 361 361 GLN GLN T . n 
CA 13 362 THR 362 362 362 THR THR T . n 
CA 13 363 ARG 363 363 363 ARG ARG T . n 
CA 13 364 TRP 364 364 364 TRP TRP T . n 
CA 13 365 HIS 365 365 365 HIS HIS T . n 
CA 13 366 ALA 366 366 366 ALA ALA T . n 
CA 13 367 LEU 367 367 367 LEU LEU T . n 
CA 13 368 ILE 368 368 368 ILE ILE T . n 
CA 13 369 GLY 369 369 369 GLY GLY T . n 
CA 13 370 ALA 370 370 370 ALA ALA T . n 
CA 13 371 LEU 371 371 371 LEU LEU T . n 
CA 13 372 ALA 372 372 372 ALA ALA T . n 
CA 13 373 LEU 373 373 373 LEU LEU T . n 
CA 13 374 GLY 374 374 374 GLY GLY T . n 
CA 13 375 GLY 375 375 375 GLY GLY T . n 
CA 13 376 LEU 376 376 376 LEU LEU T . n 
CA 13 377 PRO 377 377 377 PRO PRO T . n 
CA 13 378 LEU 378 378 378 LEU LEU T . n 
CA 13 379 LEU 379 379 379 LEU LEU T . n 
CA 13 380 SER 380 380 380 SER SER T . n 
CA 13 381 GLY 381 381 381 GLY GLY T . n 
CA 13 382 PHE 382 382 382 PHE PHE T . n 
CA 13 383 TRP 383 383 383 TRP TRP T . n 
CA 13 384 SER 384 384 384 SER SER T . n 
CA 13 385 LYS 385 385 385 LYS LYS T . n 
CA 13 386 ASP 386 386 386 ASP ASP T . n 
CA 13 387 ALA 387 387 387 ALA ALA T . n 
CA 13 388 ILE 388 388 388 ILE ILE T . n 
CA 13 389 LEU 389 389 389 LEU LEU T . n 
CA 13 390 ALA 390 390 390 ALA ALA T . n 
CA 13 391 ALA 391 391 391 ALA ALA T . n 
CA 13 392 THR 392 392 392 THR THR T . n 
CA 13 393 LEU 393 393 393 LEU LEU T . n 
CA 13 394 THR 394 394 394 THR THR T . n 
CA 13 395 TYR 395 395 395 TYR TYR T . n 
CA 13 396 PRO 396 396 396 PRO PRO T . n 
CA 13 397 PHE 397 397 397 PHE PHE T . n 
CA 13 398 GLY 398 398 398 GLY GLY T . n 
CA 13 399 GLY 399 399 399 GLY GLY T . n 
CA 13 400 VAL 400 400 400 VAL VAL T . n 
CA 13 401 GLY 401 401 401 GLY GLY T . n 
CA 13 402 PHE 402 402 402 PHE PHE T . n 
CA 13 403 TYR 403 403 403 TYR TYR T . n 
CA 13 404 VAL 404 404 404 VAL VAL T . n 
CA 13 405 GLY 405 405 405 GLY GLY T . n 
CA 13 406 ALA 406 406 406 ALA ALA T . n 
CA 13 407 LEU 407 407 407 LEU LEU T . n 
CA 13 408 LEU 408 408 408 LEU LEU T . n 
CA 13 409 VAL 409 409 409 VAL VAL T . n 
CA 13 410 ALA 410 410 410 ALA ALA T . n 
CA 13 411 VAL 411 411 411 VAL VAL T . n 
CA 13 412 LEU 412 412 412 LEU LEU T . n 
CA 13 413 THR 413 413 413 THR THR T . n 
CA 13 414 ALA 414 414 414 ALA ALA T . n 
CA 13 415 MET 415 415 415 MET MET T . n 
CA 13 416 TYR 416 416 416 TYR TYR T . n 
CA 13 417 ALA 417 417 417 ALA ALA T . n 
CA 13 418 MET 418 418 418 MET MET T . n 
CA 13 419 ARG 419 419 419 ARG ARG T . n 
CA 13 420 TRP 420 420 420 TRP TRP T . n 
CA 13 421 PHE 421 421 421 PHE PHE T . n 
CA 13 422 VAL 422 422 422 VAL VAL T . n 
CA 13 423 LEU 423 423 423 LEU LEU T . n 
CA 13 424 VAL 424 424 424 VAL VAL T . n 
CA 13 425 PHE 425 425 425 PHE PHE T . n 
CA 13 426 LEU 426 426 426 LEU LEU T . n 
CA 13 427 GLY 427 427 427 GLY GLY T . n 
CA 13 428 GLU 428 428 428 GLU GLU T . n 
CA 13 429 GLU 429 429 429 GLU GLU T . n 
CA 13 430 ARG 430 430 430 ARG ARG T . n 
CA 13 431 GLY 431 431 431 GLY GLY T . n 
CA 13 432 HIS 432 432 432 HIS HIS T . n 
CA 13 433 HIS 433 433 433 HIS HIS T . n 
CA 13 434 HIS 434 434 434 HIS HIS T . n 
CA 13 435 PRO 435 435 435 PRO PRO T . n 
CA 13 436 HIS 436 436 436 HIS HIS T . n 
CA 13 437 GLU 437 437 437 GLU GLU T . n 
CA 13 438 ALA 438 438 438 ALA ALA T . n 
CA 13 439 PRO 439 439 439 PRO PRO T . n 
CA 13 440 PRO 440 440 440 PRO PRO T . n 
CA 13 441 VAL 441 441 441 VAL VAL T . n 
CA 13 442 MET 442 442 442 MET MET T . n 
CA 13 443 LEU 443 443 443 LEU LEU T . n 
CA 13 444 TRP 444 444 444 TRP TRP T . n 
CA 13 445 PRO 445 445 445 PRO PRO T . n 
CA 13 446 ASN 446 446 446 ASN ASN T . n 
CA 13 447 HIS 447 447 447 HIS HIS T . n 
CA 13 448 LEU 448 448 448 LEU LEU T . n 
CA 13 449 LEU 449 449 449 LEU LEU T . n 
CA 13 450 ALA 450 450 450 ALA ALA T . n 
CA 13 451 LEU 451 451 451 LEU LEU T . n 
CA 13 452 GLY 452 452 452 GLY GLY T . n 
CA 13 453 SER 453 453 453 SER SER T . n 
CA 13 454 VAL 454 454 454 VAL VAL T . n 
CA 13 455 LEU 455 455 455 LEU LEU T . n 
CA 13 456 ALA 456 456 456 ALA ALA T . n 
CA 13 457 GLY 457 457 457 GLY GLY T . n 
CA 13 458 TYR 458 458 458 TYR TYR T . n 
CA 13 459 LEU 459 459 459 LEU LEU T . n 
CA 13 460 ALA 460 460 460 ALA ALA T . n 
CA 13 461 LEU 461 461 461 LEU LEU T . n 
CA 13 462 PRO 462 462 462 PRO PRO T . n 
CA 13 463 HIS 463 463 463 HIS HIS T . n 
CA 13 464 PRO 464 464 464 PRO PRO T . n 
CA 13 465 LEU 465 465 465 LEU LEU T . n 
CA 13 466 PRO 466 466 466 PRO PRO T . n 
CA 13 467 ASN 467 467 467 ASN ASN T . n 
CA 13 468 VAL 468 468 468 VAL VAL T . n 
CA 13 469 LEU 469 469 469 LEU LEU T . n 
CA 13 470 GLU 470 470 470 GLU GLU T . n 
CA 13 471 PRO 471 471 471 PRO PRO T . n 
CA 13 472 PHE 472 472 472 PHE PHE T . n 
CA 13 473 LEU 473 473 473 LEU LEU T . n 
CA 13 474 LYS 474 474 474 LYS LYS T . n 
CA 13 475 PRO 475 475 475 PRO PRO T . n 
CA 13 476 ALA 476 476 476 ALA ALA T . n 
CA 13 477 LEU 477 477 477 LEU LEU T . n 
CA 13 478 ALA 478 478 478 ALA ALA T . n 
CA 13 479 GLU 479 479 479 GLU GLU T . n 
CA 13 480 VAL 480 480 480 VAL VAL T . n 
CA 13 481 GLU 481 481 481 GLU GLU T . n 
CA 13 482 ALA 482 482 482 ALA ALA T . n 
CA 13 483 HIS 483 483 483 HIS HIS T . n 
CA 13 484 HIS 484 484 484 HIS HIS T . n 
CA 13 485 LEU 485 485 485 LEU LEU T . n 
CA 13 486 SER 486 486 486 SER SER T . n 
CA 13 487 LEU 487 487 487 LEU LEU T . n 
CA 13 488 GLY 488 488 488 GLY GLY T . n 
CA 13 489 ALA 489 489 489 ALA ALA T . n 
CA 13 490 GLU 490 490 490 GLU GLU T . n 
CA 13 491 TRP 491 491 491 TRP TRP T . n 
CA 13 492 GLY 492 492 492 GLY GLY T . n 
CA 13 493 LEU 493 493 493 LEU LEU T . n 
CA 13 494 ILE 494 494 494 ILE ILE T . n 
CA 13 495 ALA 495 495 495 ALA ALA T . n 
CA 13 496 LEU 496 496 496 LEU LEU T . n 
CA 13 497 SER 497 497 497 SER SER T . n 
CA 13 498 ALA 498 498 498 ALA ALA T . n 
CA 13 499 ALA 499 499 499 ALA ALA T . n 
CA 13 500 VAL 500 500 500 VAL VAL T . n 
CA 13 501 ALA 501 501 501 ALA ALA T . n 
CA 13 502 LEU 502 502 502 LEU LEU T . n 
CA 13 503 LEU 503 503 503 LEU LEU T . n 
CA 13 504 GLY 504 504 504 GLY GLY T . n 
CA 13 505 LEU 505 505 505 LEU LEU T . n 
CA 13 506 TRP 506 506 506 TRP TRP T . n 
CA 13 507 ALA 507 507 507 ALA ALA T . n 
CA 13 508 GLY 508 508 508 GLY GLY T . n 
CA 13 509 PHE 509 509 509 PHE PHE T . n 
CA 13 510 VAL 510 510 510 VAL VAL T . n 
CA 13 511 PHE 511 511 511 PHE PHE T . n 
CA 13 512 PHE 512 512 512 PHE PHE T . n 
CA 13 513 GLN 513 513 513 GLN GLN T . n 
CA 13 514 ARG 514 514 514 ARG ARG T . n 
CA 13 515 LYS 515 515 515 LYS LYS T . n 
CA 13 516 VAL 516 516 516 VAL VAL T . n 
CA 13 517 PHE 517 517 517 PHE PHE T . n 
CA 13 518 PRO 518 518 518 PRO PRO T . n 
CA 13 519 ALA 519 519 519 ALA ALA T . n 
CA 13 520 TRP 520 520 520 TRP TRP T . n 
CA 13 521 TYR 521 521 521 TYR TYR T . n 
CA 13 522 LEU 522 522 522 LEU LEU T . n 
CA 13 523 ALA 523 523 523 ALA ALA T . n 
CA 13 524 PHE 524 524 524 PHE PHE T . n 
CA 13 525 GLU 525 525 525 GLU GLU T . n 
CA 13 526 ALA 526 526 526 ALA ALA T . n 
CA 13 527 ALA 527 527 527 ALA ALA T . n 
CA 13 528 SER 528 528 528 SER SER T . n 
CA 13 529 ARG 529 529 529 ARG ARG T . n 
CA 13 530 GLU 530 530 530 GLU GLU T . n 
CA 13 531 ALA 531 531 531 ALA ALA T . n 
CA 13 532 PHE 532 532 532 PHE PHE T . n 
CA 13 533 TYR 533 533 533 TYR TYR T . n 
CA 13 534 VAL 534 534 534 VAL VAL T . n 
CA 13 535 ASP 535 535 535 ASP ASP T . n 
CA 13 536 ARG 536 536 536 ARG ARG T . n 
CA 13 537 ALA 537 537 537 ALA ALA T . n 
CA 13 538 TYR 538 538 538 TYR TYR T . n 
CA 13 539 ASN 539 539 539 ASN ASN T . n 
CA 13 540 ALA 540 540 540 ALA ALA T . n 
CA 13 541 LEU 541 541 541 LEU LEU T . n 
CA 13 542 ILE 542 542 542 ILE ILE T . n 
CA 13 543 VAL 543 543 543 VAL VAL T . n 
CA 13 544 ASN 544 544 544 ASN ASN T . n 
CA 13 545 PRO 545 545 545 PRO PRO T . n 
CA 13 546 LEU 546 546 546 LEU LEU T . n 
CA 13 547 LYS 547 547 547 LYS LYS T . n 
CA 13 548 ALA 548 548 548 ALA ALA T . n 
CA 13 549 LEU 549 549 549 LEU LEU T . n 
CA 13 550 ALA 550 550 550 ALA ALA T . n 
CA 13 551 GLU 551 551 551 GLU GLU T . n 
CA 13 552 ALA 552 552 552 ALA ALA T . n 
CA 13 553 LEU 553 553 553 LEU LEU T . n 
CA 13 554 PHE 554 554 554 PHE PHE T . n 
CA 13 555 TYR 555 555 555 TYR TYR T . n 
CA 13 556 GLY 556 556 556 GLY GLY T . n 
CA 13 557 ASP 557 557 557 ASP ASP T . n 
CA 13 558 ARG 558 558 558 ARG ARG T . n 
CA 13 559 GLY 559 559 559 GLY GLY T . n 
CA 13 560 LEU 560 560 560 LEU LEU T . n 
CA 13 561 LEU 561 561 561 LEU LEU T . n 
CA 13 562 SER 562 562 562 SER SER T . n 
CA 13 563 GLY 563 563 563 GLY GLY T . n 
CA 13 564 TYR 564 564 564 TYR TYR T . n 
CA 13 565 PHE 565 565 565 PHE PHE T . n 
CA 13 566 GLY 566 566 566 GLY GLY T . n 
CA 13 567 LEU 567 567 567 LEU LEU T . n 
CA 13 568 GLY 568 568 568 GLY GLY T . n 
CA 13 569 GLY 569 569 569 GLY GLY T . n 
CA 13 570 ALA 570 570 570 ALA ALA T . n 
CA 13 571 ALA 571 571 571 ALA ALA T . n 
CA 13 572 ARG 572 572 572 ARG ARG T . n 
CA 13 573 SER 573 573 573 SER SER T . n 
CA 13 574 LEU 574 574 574 LEU LEU T . n 
CA 13 575 GLY 575 575 575 GLY GLY T . n 
CA 13 576 GLN 576 576 576 GLN GLN T . n 
CA 13 577 GLY 577 577 577 GLY GLY T . n 
CA 13 578 LEU 578 578 578 LEU LEU T . n 
CA 13 579 ALA 579 579 579 ALA ALA T . n 
CA 13 580 ARG 580 580 580 ARG ARG T . n 
CA 13 581 LEU 581 581 581 LEU LEU T . n 
CA 13 582 GLN 582 582 582 GLN GLN T . n 
CA 13 583 THR 583 583 583 THR THR T . n 
CA 13 584 GLY 584 584 584 GLY GLY T . n 
CA 13 585 TYR 585 585 585 TYR TYR T . n 
CA 13 586 LEU 586 586 586 LEU LEU T . n 
CA 13 587 ARG 587 587 587 ARG ARG T . n 
CA 13 588 VAL 588 588 588 VAL VAL T . n 
CA 13 589 TYR 589 589 589 TYR TYR T . n 
CA 13 590 ALA 590 590 590 ALA ALA T . n 
CA 13 591 LEU 591 591 591 LEU LEU T . n 
CA 13 592 LEU 592 592 592 LEU LEU T . n 
CA 13 593 PHE 593 593 593 PHE PHE T . n 
CA 13 594 VAL 594 594 594 VAL VAL T . n 
CA 13 595 LEU 595 595 595 LEU LEU T . n 
CA 13 596 GLY 596 596 596 GLY GLY T . n 
CA 13 597 ALA 597 597 597 ALA ALA T . n 
CA 13 598 LEU 598 598 598 LEU LEU T . n 
CA 13 599 LEU 599 599 599 LEU LEU T . n 
CA 13 600 LEU 600 600 600 LEU LEU T . n 
CA 13 601 LEU 601 601 601 LEU LEU T . n 
CA 13 602 GLY 602 602 602 GLY GLY T . n 
CA 13 603 VAL 603 603 603 VAL VAL T . n 
CA 13 604 MET 604 604 604 MET MET T . n 
CA 13 605 ARG 605 605 605 ARG ARG T . n 
CA 13 606 TRP 606 606 ?   ?   ?   T . n 
DA 14 1   MET 1   1   1   MET MET U . n 
DA 14 2   VAL 2   2   2   VAL VAL U . n 
DA 14 3   VAL 3   3   3   VAL VAL U . n 
DA 14 4   LEU 4   4   4   LEU LEU U . n 
DA 14 5   ALA 5   5   5   ALA ALA U . n 
DA 14 6   VAL 6   6   6   VAL VAL U . n 
DA 14 7   LEU 7   7   7   LEU LEU U . n 
DA 14 8   LEU 8   8   8   LEU LEU U . n 
DA 14 9   PRO 9   9   9   PRO PRO U . n 
DA 14 10  VAL 10  10  10  VAL VAL U . n 
DA 14 11  VAL 11  11  11  VAL VAL U . n 
DA 14 12  PHE 12  12  12  PHE PHE U . n 
DA 14 13  GLY 13  13  13  GLY GLY U . n 
DA 14 14  ALA 14  14  14  ALA ALA U . n 
DA 14 15  LEU 15  15  15  LEU LEU U . n 
DA 14 16  LEU 16  16  16  LEU LEU U . n 
DA 14 17  LEU 17  17  17  LEU LEU U . n 
DA 14 18  LEU 18  18  18  LEU LEU U . n 
DA 14 19  GLY 19  19  19  GLY GLY U . n 
DA 14 20  LEU 20  20  20  LEU LEU U . n 
DA 14 21  PRO 21  21  21  PRO PRO U . n 
DA 14 22  ARG 22  22  22  ARG ARG U . n 
DA 14 23  ALA 23  23  23  ALA ALA U . n 
DA 14 24  LEU 24  24  24  LEU LEU U . n 
DA 14 25  GLY 25  25  25  GLY GLY U . n 
DA 14 26  VAL 26  26  26  VAL VAL U . n 
DA 14 27  LEU 27  27  27  LEU LEU U . n 
DA 14 28  GLY 28  28  28  GLY GLY U . n 
DA 14 29  ALA 29  29  29  ALA ALA U . n 
DA 14 30  GLY 30  30  30  GLY GLY U . n 
DA 14 31  LEU 31  31  31  LEU LEU U . n 
DA 14 32  SER 32  32  32  SER SER U . n 
DA 14 33  PHE 33  33  33  PHE PHE U . n 
DA 14 34  LEU 34  34  34  LEU LEU U . n 
DA 14 35  LEU 35  35  35  LEU LEU U . n 
DA 14 36  ASN 36  36  36  ASN ASN U . n 
DA 14 37  LEU 37  37  37  LEU LEU U . n 
DA 14 38  TYR 38  38  38  TYR TYR U . n 
DA 14 39  LEU 39  39  39  LEU LEU U . n 
DA 14 40  PHE 40  40  40  PHE PHE U . n 
DA 14 41  LEU 41  41  41  LEU LEU U . n 
DA 14 42  THR 42  42  42  THR THR U . n 
DA 14 43  HIS 43  43  43  HIS HIS U . n 
DA 14 44  PRO 44  44  44  PRO PRO U . n 
DA 14 45  GLY 45  45  45  GLY GLY U . n 
DA 14 46  GLY 46  46  46  GLY GLY U . n 
DA 14 47  VAL 47  47  47  VAL VAL U . n 
DA 14 48  ALA 48  48  48  ALA ALA U . n 
DA 14 49  HIS 49  49  49  HIS HIS U . n 
DA 14 50  ALA 50  50  50  ALA ALA U . n 
DA 14 51  PHE 51  51  51  PHE PHE U . n 
DA 14 52  GLN 52  52  52  GLN GLN U . n 
DA 14 53  ALA 53  53  53  ALA ALA U . n 
DA 14 54  PRO 54  54  54  PRO PRO U . n 
DA 14 55  LEU 55  55  55  LEU LEU U . n 
DA 14 56  LEU 56  56  56  LEU LEU U . n 
DA 14 57  PRO 57  57  57  PRO PRO U . n 
DA 14 58  GLY 58  58  58  GLY GLY U . n 
DA 14 59  ALA 59  59  59  ALA ALA U . n 
DA 14 60  GLY 60  60  60  GLY GLY U . n 
DA 14 61  VAL 61  61  61  VAL VAL U . n 
DA 14 62  TYR 62  62  62  TYR TYR U . n 
DA 14 63  TRP 63  63  63  TRP TRP U . n 
DA 14 64  ALA 64  64  64  ALA ALA U . n 
DA 14 65  PHE 65  65  65  PHE PHE U . n 
DA 14 66  GLY 66  66  66  GLY GLY U . n 
DA 14 67  LEU 67  67  67  LEU LEU U . n 
DA 14 68  ASP 68  68  68  ASP ASP U . n 
DA 14 69  GLY 69  69  69  GLY GLY U . n 
DA 14 70  LEU 70  70  70  LEU LEU U . n 
DA 14 71  SER 71  71  71  SER SER U . n 
DA 14 72  ALA 72  72  72  ALA ALA U . n 
DA 14 73  LEU 73  73  73  LEU LEU U . n 
DA 14 74  PHE 74  74  74  PHE PHE U . n 
DA 14 75  PHE 75  75  75  PHE PHE U . n 
DA 14 76  LEU 76  76  76  LEU LEU U . n 
DA 14 77  THR 77  77  77  THR THR U . n 
DA 14 78  ILE 78  78  78  ILE ILE U . n 
DA 14 79  ALA 79  79  79  ALA ALA U . n 
DA 14 80  LEU 80  80  80  LEU LEU U . n 
DA 14 81  THR 81  81  81  THR THR U . n 
DA 14 82  VAL 82  82  82  VAL VAL U . n 
DA 14 83  PHE 83  83  83  PHE PHE U . n 
DA 14 84  LEU 84  84  84  LEU LEU U . n 
DA 14 85  GLY 85  85  85  GLY GLY U . n 
DA 14 86  ALA 86  86  86  ALA ALA U . n 
DA 14 87  LEU 87  87  87  LEU LEU U . n 
DA 14 88  VAL 88  88  88  VAL VAL U . n 
DA 14 89  ALA 89  89  89  ALA ALA U . n 
DA 14 90  ARG 90  90  90  ARG ARG U . n 
DA 14 91  VAL 91  91  91  VAL VAL U . n 
DA 14 92  GLU 92  92  92  GLU GLU U . n 
DA 14 93  GLY 93  93  93  GLY GLY U . n 
DA 14 94  ARG 94  94  94  ARG ARG U . n 
DA 14 95  PHE 95  95  95  PHE PHE U . n 
DA 14 96  LEU 96  96  96  LEU LEU U . n 
DA 14 97  GLY 97  97  97  GLY GLY U . n 
DA 14 98  LEU 98  98  98  LEU LEU U . n 
DA 14 99  ALA 99  99  99  ALA ALA U . n 
DA 14 100 LEU 100 100 100 LEU LEU U . n 
DA 14 101 LEU 101 101 101 LEU LEU U . n 
DA 14 102 MET 102 102 102 MET MET U . n 
DA 14 103 GLU 103 103 103 GLU GLU U . n 
DA 14 104 GLY 104 104 104 GLY GLY U . n 
DA 14 105 LEU 105 105 105 LEU LEU U . n 
DA 14 106 LEU 106 106 106 LEU LEU U . n 
DA 14 107 LEU 107 107 107 LEU LEU U . n 
DA 14 108 GLY 108 108 108 GLY GLY U . n 
DA 14 109 LEU 109 109 109 LEU LEU U . n 
DA 14 110 PHE 110 110 110 PHE PHE U . n 
DA 14 111 ALA 111 111 111 ALA ALA U . n 
DA 14 112 ALA 112 112 112 ALA ALA U . n 
DA 14 113 ARG 113 113 113 ARG ARG U . n 
DA 14 114 ASP 114 114 114 ASP ASP U . n 
DA 14 115 LEU 115 115 115 LEU LEU U . n 
DA 14 116 LEU 116 116 116 LEU LEU U . n 
DA 14 117 VAL 117 117 117 VAL VAL U . n 
DA 14 118 PHE 118 118 118 PHE PHE U . n 
DA 14 119 TYR 119 119 119 TYR TYR U . n 
DA 14 120 VAL 120 120 120 VAL VAL U . n 
DA 14 121 PHE 121 121 121 PHE PHE U . n 
DA 14 122 PHE 122 122 122 PHE PHE U . n 
DA 14 123 GLU 123 123 123 GLU GLU U . n 
DA 14 124 ALA 124 124 124 ALA ALA U . n 
DA 14 125 ALA 125 125 125 ALA ALA U . n 
DA 14 126 LEU 126 126 126 LEU LEU U . n 
DA 14 127 ILE 127 127 127 ILE ILE U . n 
DA 14 128 PRO 128 128 128 PRO PRO U . n 
DA 14 129 ALA 129 129 129 ALA ALA U . n 
DA 14 130 LEU 130 130 130 LEU LEU U . n 
DA 14 131 LEU 131 131 131 LEU LEU U . n 
DA 14 132 MET 132 132 132 MET MET U . n 
DA 14 133 LEU 133 133 133 LEU LEU U . n 
DA 14 134 TYR 134 134 134 TYR TYR U . n 
DA 14 135 LEU 135 135 135 LEU LEU U . n 
DA 14 136 TYR 136 136 136 TYR TYR U . n 
DA 14 137 GLY 137 137 137 GLY GLY U . n 
DA 14 138 GLY 138 138 138 GLY GLY U . n 
DA 14 139 GLU 139 139 139 GLU GLU U . n 
DA 14 140 GLY 140 140 140 GLY GLY U . n 
DA 14 141 ARG 141 141 141 ARG ARG U . n 
DA 14 142 THR 142 142 142 THR THR U . n 
DA 14 143 ARG 143 143 143 ARG ARG U . n 
DA 14 144 ALA 144 144 144 ALA ALA U . n 
DA 14 145 LEU 145 145 145 LEU LEU U . n 
DA 14 146 TYR 146 146 146 TYR TYR U . n 
DA 14 147 THR 147 147 147 THR THR U . n 
DA 14 148 PHE 148 148 148 PHE PHE U . n 
DA 14 149 VAL 149 149 149 VAL VAL U . n 
DA 14 150 LEU 150 150 150 LEU LEU U . n 
DA 14 151 PHE 151 151 151 PHE PHE U . n 
DA 14 152 THR 152 152 152 THR THR U . n 
DA 14 153 LEU 153 153 153 LEU LEU U . n 
DA 14 154 VAL 154 154 154 VAL VAL U . n 
DA 14 155 GLY 155 155 155 GLY GLY U . n 
DA 14 156 SER 156 156 156 SER SER U . n 
DA 14 157 LEU 157 157 157 LEU LEU U . n 
DA 14 158 PRO 158 158 158 PRO PRO U . n 
DA 14 159 MET 159 159 159 MET MET U . n 
DA 14 160 LEU 160 160 160 LEU LEU U . n 
DA 14 161 ALA 161 161 161 ALA ALA U . n 
DA 14 162 ALA 162 162 162 ALA ALA U . n 
DA 14 163 VAL 163 163 163 VAL VAL U . n 
DA 14 164 LEU 164 164 164 LEU LEU U . n 
DA 14 165 GLY 165 165 165 GLY GLY U . n 
DA 14 166 ALA 166 166 166 ALA ALA U . n 
DA 14 167 ARG 167 167 167 ARG ARG U . n 
DA 14 168 LEU 168 168 168 LEU LEU U . n 
DA 14 169 LEU 169 169 169 LEU LEU U . n 
DA 14 170 SER 170 170 170 SER SER U . n 
DA 14 171 GLY 171 171 171 GLY GLY U . n 
DA 14 172 SER 172 172 172 SER SER U . n 
DA 14 173 PRO 173 173 173 PRO PRO U . n 
DA 14 174 THR 174 174 174 THR THR U . n 
DA 14 175 PHE 175 175 175 PHE PHE U . n 
DA 14 176 LEU 176 176 176 LEU LEU U . n 
DA 14 177 LEU 177 177 177 LEU LEU U . n 
DA 14 178 GLU 178 178 178 GLU GLU U . n 
DA 14 179 ASP 179 179 179 ASP ASP U . n 
DA 14 180 LEU 180 180 180 LEU LEU U . n 
DA 14 181 LEU 181 181 181 LEU LEU U . n 
DA 14 182 ALA 182 182 182 ALA ALA U . n 
DA 14 183 HIS 183 183 183 HIS HIS U . n 
DA 14 184 PRO 184 184 184 PRO PRO U . n 
DA 14 185 LEU 185 185 185 LEU LEU U . n 
DA 14 186 GLN 186 186 186 GLN GLN U . n 
DA 14 187 GLU 187 187 187 GLU GLU U . n 
DA 14 188 GLU 188 188 188 GLU GLU U . n 
DA 14 189 ALA 189 189 189 ALA ALA U . n 
DA 14 190 ALA 190 190 190 ALA ALA U . n 
DA 14 191 PHE 191 191 191 PHE PHE U . n 
DA 14 192 TRP 192 192 192 TRP TRP U . n 
DA 14 193 VAL 193 193 193 VAL VAL U . n 
DA 14 194 PHE 194 194 194 PHE PHE U . n 
DA 14 195 LEU 195 195 195 LEU LEU U . n 
DA 14 196 GLY 196 196 196 GLY GLY U . n 
DA 14 197 PHE 197 197 197 PHE PHE U . n 
DA 14 198 ALA 198 198 198 ALA ALA U . n 
DA 14 199 LEU 199 199 199 LEU LEU U . n 
DA 14 200 ALA 200 200 200 ALA ALA U . n 
DA 14 201 PHE 201 201 201 PHE PHE U . n 
DA 14 202 ALA 202 202 202 ALA ALA U . n 
DA 14 203 ILE 203 203 203 ILE ILE U . n 
DA 14 204 LYS 204 204 204 LYS LYS U . n 
DA 14 205 THR 205 205 205 THR THR U . n 
DA 14 206 PRO 206 206 206 PRO PRO U . n 
DA 14 207 LEU 207 207 207 LEU LEU U . n 
DA 14 208 PHE 208 208 208 PHE PHE U . n 
DA 14 209 PRO 209 209 209 PRO PRO U . n 
DA 14 210 LEU 210 210 210 LEU LEU U . n 
DA 14 211 HIS 211 211 211 HIS HIS U . n 
DA 14 212 ALA 212 212 212 ALA ALA U . n 
DA 14 213 TRP 213 213 213 TRP TRP U . n 
DA 14 214 LEU 214 214 214 LEU LEU U . n 
DA 14 215 PRO 215 215 215 PRO PRO U . n 
DA 14 216 PRO 216 216 216 PRO PRO U . n 
DA 14 217 PHE 217 217 217 PHE PHE U . n 
DA 14 218 HIS 218 218 218 HIS HIS U . n 
DA 14 219 GLN 219 219 219 GLN GLN U . n 
DA 14 220 GLU 220 220 220 GLU GLU U . n 
DA 14 221 ASN 221 221 221 ASN ASN U . n 
DA 14 222 HIS 222 222 222 HIS HIS U . n 
DA 14 223 PRO 223 223 223 PRO PRO U . n 
DA 14 224 SER 224 224 224 SER SER U . n 
DA 14 225 GLY 225 225 225 GLY GLY U . n 
DA 14 226 LEU 226 226 226 LEU LEU U . n 
DA 14 227 ALA 227 227 227 ALA ALA U . n 
DA 14 228 ASP 228 228 228 ASP ASP U . n 
DA 14 229 ALA 229 229 229 ALA ALA U . n 
DA 14 230 LEU 230 230 230 LEU LEU U . n 
DA 14 231 GLY 231 231 231 GLY GLY U . n 
DA 14 232 THR 232 232 232 THR THR U . n 
DA 14 233 LEU 233 233 233 LEU LEU U . n 
DA 14 234 TYR 234 234 234 TYR TYR U . n 
DA 14 235 LYS 235 235 235 LYS LYS U . n 
DA 14 236 VAL 236 236 236 VAL VAL U . n 
DA 14 237 GLY 237 237 237 GLY GLY U . n 
DA 14 238 VAL 238 238 238 VAL VAL U . n 
DA 14 239 PHE 239 239 239 PHE PHE U . n 
DA 14 240 ALA 240 240 240 ALA ALA U . n 
DA 14 241 PHE 241 241 241 PHE PHE U . n 
DA 14 242 PHE 242 242 242 PHE PHE U . n 
DA 14 243 ARG 243 243 243 ARG ARG U . n 
DA 14 244 PHE 244 244 244 PHE PHE U . n 
DA 14 245 ALA 245 245 245 ALA ALA U . n 
DA 14 246 ILE 246 246 246 ILE ILE U . n 
DA 14 247 PRO 247 247 247 PRO PRO U . n 
DA 14 248 LEU 248 248 248 LEU LEU U . n 
DA 14 249 ALA 249 249 249 ALA ALA U . n 
DA 14 250 PRO 250 250 250 PRO PRO U . n 
DA 14 251 GLU 251 251 251 GLU GLU U . n 
DA 14 252 GLY 252 252 252 GLY GLY U . n 
DA 14 253 PHE 253 253 253 PHE PHE U . n 
DA 14 254 ALA 254 254 254 ALA ALA U . n 
DA 14 255 GLN 255 255 255 GLN GLN U . n 
DA 14 256 ALA 256 256 256 ALA ALA U . n 
DA 14 257 GLN 257 257 257 GLN GLN U . n 
DA 14 258 GLY 258 258 258 GLY GLY U . n 
DA 14 259 LEU 259 259 259 LEU LEU U . n 
DA 14 260 LEU 260 260 260 LEU LEU U . n 
DA 14 261 LEU 261 261 261 LEU LEU U . n 
DA 14 262 PHE 262 262 262 PHE PHE U . n 
DA 14 263 LEU 263 263 263 LEU LEU U . n 
DA 14 264 ALA 264 264 264 ALA ALA U . n 
DA 14 265 ALA 265 265 265 ALA ALA U . n 
DA 14 266 LEU 266 266 266 LEU LEU U . n 
DA 14 267 SER 267 267 267 SER SER U . n 
DA 14 268 ALA 268 268 268 ALA ALA U . n 
DA 14 269 LEU 269 269 269 LEU LEU U . n 
DA 14 270 TYR 270 270 270 TYR TYR U . n 
DA 14 271 GLY 271 271 271 GLY GLY U . n 
DA 14 272 ALA 272 272 272 ALA ALA U . n 
DA 14 273 TRP 273 273 273 TRP TRP U . n 
DA 14 274 VAL 274 274 274 VAL VAL U . n 
DA 14 275 ALA 275 275 275 ALA ALA U . n 
DA 14 276 PHE 276 276 276 PHE PHE U . n 
DA 14 277 ALA 277 277 277 ALA ALA U . n 
DA 14 278 ALA 278 278 278 ALA ALA U . n 
DA 14 279 LYS 279 279 279 LYS LYS U . n 
DA 14 280 ASP 280 280 280 ASP ASP U . n 
DA 14 281 PHE 281 281 281 PHE PHE U . n 
DA 14 282 LYS 282 282 282 LYS LYS U . n 
DA 14 283 THR 283 283 283 THR THR U . n 
DA 14 284 LEU 284 284 284 LEU LEU U . n 
DA 14 285 LEU 285 285 285 LEU LEU U . n 
DA 14 286 ALA 286 286 286 ALA ALA U . n 
DA 14 287 TYR 287 287 287 TYR TYR U . n 
DA 14 288 ALA 288 288 288 ALA ALA U . n 
DA 14 289 GLY 289 289 289 GLY GLY U . n 
DA 14 290 LEU 290 290 290 LEU LEU U . n 
DA 14 291 SER 291 291 291 SER SER U . n 
DA 14 292 HIS 292 292 292 HIS HIS U . n 
DA 14 293 MET 293 293 293 MET MET U . n 
DA 14 294 GLY 294 294 294 GLY GLY U . n 
DA 14 295 VAL 295 295 295 VAL VAL U . n 
DA 14 296 ALA 296 296 296 ALA ALA U . n 
DA 14 297 ALA 297 297 297 ALA ALA U . n 
DA 14 298 LEU 298 298 298 LEU LEU U . n 
DA 14 299 GLY 299 299 299 GLY GLY U . n 
DA 14 300 VAL 300 300 300 VAL VAL U . n 
DA 14 301 PHE 301 301 301 PHE PHE U . n 
DA 14 302 SER 302 302 302 SER SER U . n 
DA 14 303 GLY 303 303 303 GLY GLY U . n 
DA 14 304 THR 304 304 304 THR THR U . n 
DA 14 305 PRO 305 305 305 PRO PRO U . n 
DA 14 306 GLU 306 306 306 GLU GLU U . n 
DA 14 307 GLY 307 307 307 GLY GLY U . n 
DA 14 308 ALA 308 308 308 ALA ALA U . n 
DA 14 309 MET 309 309 309 MET MET U . n 
DA 14 310 GLY 310 310 310 GLY GLY U . n 
DA 14 311 GLY 311 311 311 GLY GLY U . n 
DA 14 312 LEU 312 312 312 LEU LEU U . n 
DA 14 313 TYR 313 313 313 TYR TYR U . n 
DA 14 314 LEU 314 314 314 LEU LEU U . n 
DA 14 315 LEU 315 315 315 LEU LEU U . n 
DA 14 316 ALA 316 316 316 ALA ALA U . n 
DA 14 317 ALA 317 317 317 ALA ALA U . n 
DA 14 318 SER 318 318 318 SER SER U . n 
DA 14 319 GLY 319 319 319 GLY GLY U . n 
DA 14 320 VAL 320 320 320 VAL VAL U . n 
DA 14 321 TYR 321 321 321 TYR TYR U . n 
DA 14 322 THR 322 322 322 THR THR U . n 
DA 14 323 GLY 323 323 323 GLY GLY U . n 
DA 14 324 GLY 324 324 324 GLY GLY U . n 
DA 14 325 LEU 325 325 325 LEU LEU U . n 
DA 14 326 PHE 326 326 326 PHE PHE U . n 
DA 14 327 LEU 327 327 327 LEU LEU U . n 
DA 14 328 LEU 328 328 328 LEU LEU U . n 
DA 14 329 ALA 329 329 329 ALA ALA U . n 
DA 14 330 GLY 330 330 330 GLY GLY U . n 
DA 14 331 ARG 331 331 331 ARG ARG U . n 
DA 14 332 LEU 332 332 332 LEU LEU U . n 
DA 14 333 TYR 333 333 333 TYR TYR U . n 
DA 14 334 GLU 334 334 334 GLU GLU U . n 
DA 14 335 ARG 335 335 335 ARG ARG U . n 
DA 14 336 THR 336 336 336 THR THR U . n 
DA 14 337 GLY 337 337 337 GLY GLY U . n 
DA 14 338 THR 338 338 338 THR THR U . n 
DA 14 339 LEU 339 339 339 LEU LEU U . n 
DA 14 340 GLU 340 340 340 GLU GLU U . n 
DA 14 341 ILE 341 341 341 ILE ILE U . n 
DA 14 342 GLY 342 342 342 GLY GLY U . n 
DA 14 343 ARG 343 343 343 ARG ARG U . n 
DA 14 344 TYR 344 344 344 TYR TYR U . n 
DA 14 345 ARG 345 345 345 ARG ARG U . n 
DA 14 346 GLY 346 346 346 GLY GLY U . n 
DA 14 347 LEU 347 347 347 LEU LEU U . n 
DA 14 348 ALA 348 348 348 ALA ALA U . n 
DA 14 349 GLN 349 349 349 GLN GLN U . n 
DA 14 350 SER 350 350 350 SER SER U . n 
DA 14 351 ALA 351 351 351 ALA ALA U . n 
DA 14 352 PRO 352 352 352 PRO PRO U . n 
DA 14 353 GLY 353 353 353 GLY GLY U . n 
DA 14 354 LEU 354 354 354 LEU LEU U . n 
DA 14 355 ALA 355 355 355 ALA ALA U . n 
DA 14 356 ALA 356 356 356 ALA ALA U . n 
DA 14 357 LEU 357 357 357 LEU LEU U . n 
DA 14 358 ALA 358 358 358 ALA ALA U . n 
DA 14 359 LEU 359 359 359 LEU LEU U . n 
DA 14 360 ILE 360 360 360 ILE ILE U . n 
DA 14 361 LEU 361 361 361 LEU LEU U . n 
DA 14 362 PHE 362 362 362 PHE PHE U . n 
DA 14 363 LEU 363 363 363 LEU LEU U . n 
DA 14 364 ALA 364 364 364 ALA ALA U . n 
DA 14 365 MET 365 365 365 MET MET U . n 
DA 14 366 VAL 366 366 366 VAL VAL U . n 
DA 14 367 GLY 367 367 367 GLY GLY U . n 
DA 14 368 LEU 368 368 368 LEU LEU U . n 
DA 14 369 PRO 369 369 369 PRO PRO U . n 
DA 14 370 GLY 370 370 370 GLY GLY U . n 
DA 14 371 LEU 371 371 371 LEU LEU U . n 
DA 14 372 SER 372 372 372 SER SER U . n 
DA 14 373 GLY 373 373 373 GLY GLY U . n 
DA 14 374 PHE 374 374 374 PHE PHE U . n 
DA 14 375 PRO 375 375 375 PRO PRO U . n 
DA 14 376 GLY 376 376 376 GLY GLY U . n 
DA 14 377 GLU 377 377 377 GLU GLU U . n 
DA 14 378 PHE 378 378 378 PHE PHE U . n 
DA 14 379 LEU 379 379 379 LEU LEU U . n 
DA 14 380 THR 380 380 380 THR THR U . n 
DA 14 381 LEU 381 381 381 LEU LEU U . n 
DA 14 382 LEU 382 382 382 LEU LEU U . n 
DA 14 383 GLY 383 383 383 GLY GLY U . n 
DA 14 384 ALA 384 384 384 ALA ALA U . n 
DA 14 385 TYR 385 385 385 TYR TYR U . n 
DA 14 386 LYS 386 386 386 LYS LYS U . n 
DA 14 387 ALA 387 387 387 ALA ALA U . n 
DA 14 388 SER 388 388 388 SER SER U . n 
DA 14 389 PRO 389 389 389 PRO PRO U . n 
DA 14 390 TRP 390 390 390 TRP TRP U . n 
DA 14 391 LEU 391 391 391 LEU LEU U . n 
DA 14 392 ALA 392 392 392 ALA ALA U . n 
DA 14 393 ALA 393 393 393 ALA ALA U . n 
DA 14 394 LEU 394 394 394 LEU LEU U . n 
DA 14 395 ALA 395 395 395 ALA ALA U . n 
DA 14 396 PHE 396 396 396 PHE PHE U . n 
DA 14 397 LEU 397 397 397 LEU LEU U . n 
DA 14 398 SER 398 398 398 SER SER U . n 
DA 14 399 VAL 399 399 399 VAL VAL U . n 
DA 14 400 ILE 400 400 400 ILE ILE U . n 
DA 14 401 ALA 401 401 401 ALA ALA U . n 
DA 14 402 SER 402 402 402 SER SER U . n 
DA 14 403 ALA 403 403 403 ALA ALA U . n 
DA 14 404 ALA 404 404 404 ALA ALA U . n 
DA 14 405 TYR 405 405 405 TYR TYR U . n 
DA 14 406 ALA 406 406 406 ALA ALA U . n 
DA 14 407 LEU 407 407 407 LEU LEU U . n 
DA 14 408 THR 408 408 408 THR THR U . n 
DA 14 409 ALA 409 409 409 ALA ALA U . n 
DA 14 410 PHE 410 410 410 PHE PHE U . n 
DA 14 411 GLN 411 411 411 GLN GLN U . n 
DA 14 412 LYS 412 412 412 LYS LYS U . n 
DA 14 413 THR 413 413 413 THR THR U . n 
DA 14 414 PHE 414 414 414 PHE PHE U . n 
DA 14 415 TRP 415 415 415 TRP TRP U . n 
DA 14 416 GLU 416 416 416 GLU GLU U . n 
DA 14 417 GLU 417 417 417 GLU GLU U . n 
DA 14 418 GLY 418 418 418 GLY GLY U . n 
DA 14 419 GLY 419 419 419 GLY GLY U . n 
DA 14 420 SER 420 420 420 SER SER U . n 
DA 14 421 GLY 421 421 421 GLY GLY U . n 
DA 14 422 VAL 422 422 422 VAL VAL U . n 
DA 14 423 LYS 423 423 423 LYS LYS U . n 
DA 14 424 ASP 424 424 424 ASP ASP U . n 
DA 14 425 LEU 425 425 425 LEU LEU U . n 
DA 14 426 ALA 426 426 426 ALA ALA U . n 
DA 14 427 GLY 427 427 427 GLY GLY U . n 
DA 14 428 ALA 428 428 428 ALA ALA U . n 
DA 14 429 GLU 429 429 429 GLU GLU U . n 
DA 14 430 TRP 430 430 430 TRP TRP U . n 
DA 14 431 GLY 431 431 431 GLY GLY U . n 
DA 14 432 PHE 432 432 432 PHE PHE U . n 
DA 14 433 ALA 433 433 433 ALA ALA U . n 
DA 14 434 LEU 434 434 434 LEU LEU U . n 
DA 14 435 LEU 435 435 435 LEU LEU U . n 
DA 14 436 SER 436 436 436 SER SER U . n 
DA 14 437 VAL 437 437 437 VAL VAL U . n 
DA 14 438 LEU 438 438 438 LEU LEU U . n 
DA 14 439 ALA 439 439 439 ALA ALA U . n 
DA 14 440 LEU 440 440 440 LEU LEU U . n 
DA 14 441 LEU 441 441 441 LEU LEU U . n 
DA 14 442 LEU 442 442 442 LEU LEU U . n 
DA 14 443 MET 443 443 443 MET MET U . n 
DA 14 444 GLY 444 444 444 GLY GLY U . n 
DA 14 445 VAL 445 445 445 VAL VAL U . n 
DA 14 446 PHE 446 446 446 PHE PHE U . n 
DA 14 447 PRO 447 447 447 PRO PRO U . n 
DA 14 448 GLY 448 448 448 GLY GLY U . n 
DA 14 449 TYR 449 449 449 TYR TYR U . n 
DA 14 450 PHE 450 450 450 PHE PHE U . n 
DA 14 451 ALA 451 451 451 ALA ALA U . n 
DA 14 452 ARG 452 452 452 ARG ARG U . n 
DA 14 453 GLY 453 453 453 GLY GLY U . n 
DA 14 454 LEU 454 454 454 LEU LEU U . n 
DA 14 455 HIS 455 455 455 HIS HIS U . n 
DA 14 456 PRO 456 456 456 PRO PRO U . n 
DA 14 457 LEU 457 457 457 LEU LEU U . n 
DA 14 458 ALA 458 458 458 ALA ALA U . n 
DA 14 459 GLU 459 459 459 GLU GLU U . n 
DA 14 460 ALA 460 460 460 ALA ALA U . n 
DA 14 461 PHE 461 461 461 PHE PHE U . n 
DA 14 462 ALA 462 462 462 ALA ALA U . n 
DA 14 463 LYS 463 463 463 LYS LYS U . n 
DA 14 464 LEU 464 464 464 LEU LEU U . n 
DA 14 465 LEU 465 465 465 LEU LEU U . n 
DA 14 466 GLY 466 466 466 GLY GLY U . n 
DA 14 467 GLY 467 467 467 GLY GLY U . n 
DA 14 468 GLY 468 468 ?   ?   ?   U . n 
DA 14 469 ALA 469 469 ?   ?   ?   U . n 
EA 15 1   MET 1   1   1   MET MET V . n 
EA 15 2   THR 2   2   2   THR THR V . n 
EA 15 3   LEU 3   3   3   LEU LEU V . n 
EA 15 4   ALA 4   4   4   ALA ALA V . n 
EA 15 5   ILE 5   5   5   ILE ILE V . n 
EA 15 6   LEU 6   6   6   LEU LEU V . n 
EA 15 7   ALA 7   7   7   ALA ALA V . n 
EA 15 8   VAL 8   8   8   VAL VAL V . n 
EA 15 9   PHE 9   9   9   PHE PHE V . n 
EA 15 10  SER 10  10  10  SER SER V . n 
EA 15 11  VAL 11  11  11  VAL VAL V . n 
EA 15 12  ALA 12  12  12  ALA ALA V . n 
EA 15 13  LEU 13  13  13  LEU LEU V . n 
EA 15 14  THR 14  14  14  THR THR V . n 
EA 15 15  LEU 15  15  15  LEU LEU V . n 
EA 15 16  LEU 16  16  16  LEU LEU V . n 
EA 15 17  GLY 17  17  17  GLY GLY V . n 
EA 15 18  PHE 18  18  18  PHE PHE V . n 
EA 15 19  VAL 19  19  19  VAL VAL V . n 
EA 15 20  LEU 20  20  20  LEU LEU V . n 
EA 15 21  PRO 21  21  21  PRO PRO V . n 
EA 15 22  PRO 22  22  22  PRO PRO V . n 
EA 15 23  GLN 23  23  23  GLN GLN V . n 
EA 15 24  GLY 24  24  24  GLY GLY V . n 
EA 15 25  VAL 25  25  25  VAL VAL V . n 
EA 15 26  LYS 26  26  26  LYS LYS V . n 
EA 15 27  ARG 27  27  27  ARG ARG V . n 
EA 15 28  ALA 28  28  28  ALA ALA V . n 
EA 15 29  THR 29  29  29  THR THR V . n 
EA 15 30  LEU 30  30  30  LEU LEU V . n 
EA 15 31  LEU 31  31  31  LEU LEU V . n 
EA 15 32  GLY 32  32  32  GLY GLY V . n 
EA 15 33  LEU 33  33  33  LEU LEU V . n 
EA 15 34  ALA 34  34  34  ALA ALA V . n 
EA 15 35  LEU 35  35  35  LEU LEU V . n 
EA 15 36  ALA 36  36  36  ALA ALA V . n 
EA 15 37  LEU 37  37  37  LEU LEU V . n 
EA 15 38  ALA 38  38  38  ALA ALA V . n 
EA 15 39  SER 39  39  39  SER SER V . n 
EA 15 40  LEU 40  40  40  LEU LEU V . n 
EA 15 41  LEU 41  41  41  LEU LEU V . n 
EA 15 42  LEU 42  42  42  LEU LEU V . n 
EA 15 43  THR 43  43  43  THR THR V . n 
EA 15 44  TRP 44  44  44  TRP TRP V . n 
EA 15 45  GLY 45  45  45  GLY GLY V . n 
EA 15 46  LYS 46  46  46  LYS LYS V . n 
EA 15 47  PRO 47  47  47  PRO PRO V . n 
EA 15 48  PHE 48  48  48  PHE PHE V . n 
EA 15 49  ALA 49  49  49  ALA ALA V . n 
EA 15 50  PHE 50  50  50  PHE PHE V . n 
EA 15 51  GLY 51  51  51  GLY GLY V . n 
EA 15 52  PRO 52  52  52  PRO PRO V . n 
EA 15 53  TYR 53  53  53  TYR TYR V . n 
EA 15 54  ALA 54  54  54  ALA ALA V . n 
EA 15 55  VAL 55  55  55  VAL VAL V . n 
EA 15 56  ASP 56  56  56  ASP ASP V . n 
EA 15 57  GLY 57  57  57  GLY GLY V . n 
EA 15 58  VAL 58  58  58  VAL VAL V . n 
EA 15 59  SER 59  59  59  SER SER V . n 
EA 15 60  GLN 60  60  60  GLN GLN V . n 
EA 15 61  VAL 61  61  61  VAL VAL V . n 
EA 15 62  PHE 62  62  62  PHE PHE V . n 
EA 15 63  THR 63  63  63  THR THR V . n 
EA 15 64  LEU 64  64  64  LEU LEU V . n 
EA 15 65  LEU 65  65  65  LEU LEU V . n 
EA 15 66  ALA 66  66  66  ALA ALA V . n 
EA 15 67  LEU 67  67  67  LEU LEU V . n 
EA 15 68  LEU 68  68  68  LEU LEU V . n 
EA 15 69  GLY 69  69  69  GLY GLY V . n 
EA 15 70  ALA 70  70  70  ALA ALA V . n 
EA 15 71  LEU 71  71  71  LEU LEU V . n 
EA 15 72  TRP 72  72  72  TRP TRP V . n 
EA 15 73  THR 73  73  73  THR THR V . n 
EA 15 74  VAL 74  74  74  VAL VAL V . n 
EA 15 75  GLY 75  75  75  GLY GLY V . n 
EA 15 76  LEU 76  76  76  LEU LEU V . n 
EA 15 77  VAL 77  77  77  VAL VAL V . n 
EA 15 78  ARG 78  78  78  ARG ARG V . n 
EA 15 79  SER 79  79  79  SER SER V . n 
EA 15 80  GLY 80  80  80  GLY GLY V . n 
EA 15 81  ARG 81  81  81  ARG ARG V . n 
EA 15 82  PHE 82  82  82  PHE PHE V . n 
EA 15 83  GLU 83  83  83  GLU GLU V . n 
EA 15 84  PHE 84  84  84  PHE PHE V . n 
EA 15 85  TYR 85  85  85  TYR TYR V . n 
EA 15 86  LEU 86  86  86  LEU LEU V . n 
EA 15 87  LEU 87  87  87  LEU LEU V . n 
EA 15 88  VAL 88  88  88  VAL VAL V . n 
EA 15 89  LEU 89  89  89  LEU LEU V . n 
EA 15 90  TYR 90  90  90  TYR TYR V . n 
EA 15 91  ALA 91  91  91  ALA ALA V . n 
EA 15 92  ALA 92  92  92  ALA ALA V . n 
EA 15 93  LEU 93  93  93  LEU LEU V . n 
EA 15 94  GLY 94  94  94  GLY GLY V . n 
EA 15 95  MET 95  95  95  MET MET V . n 
EA 15 96  HIS 96  96  96  HIS HIS V . n 
EA 15 97  LEU 97  97  97  LEU LEU V . n 
EA 15 98  LEU 98  98  98  LEU LEU V . n 
EA 15 99  ALA 99  99  99  ALA ALA V . n 
EA 15 100 SER 100 100 100 SER SER V . n 
EA 15 101 THR 101 101 101 THR THR V . n 
EA 15 102 ARG 102 102 102 ARG ARG V . n 
EA 15 103 HIS 103 103 103 HIS HIS V . n 
EA 15 104 LEU 104 104 104 LEU LEU V . n 
EA 15 105 LEU 105 105 105 LEU LEU V . n 
EA 15 106 LEU 106 106 106 LEU LEU V . n 
EA 15 107 MET 107 107 107 MET MET V . n 
EA 15 108 LEU 108 108 108 LEU LEU V . n 
EA 15 109 VAL 109 109 109 VAL VAL V . n 
EA 15 110 ALA 110 110 110 ALA ALA V . n 
EA 15 111 LEU 111 111 111 LEU LEU V . n 
EA 15 112 GLU 112 112 112 GLU GLU V . n 
EA 15 113 ALA 113 113 113 ALA ALA V . n 
EA 15 114 LEU 114 114 114 LEU LEU V . n 
EA 15 115 SER 115 115 115 SER SER V . n 
EA 15 116 LEU 116 116 116 LEU LEU V . n 
EA 15 117 PRO 117 117 117 PRO PRO V . n 
EA 15 118 LEU 118 118 118 LEU LEU V . n 
EA 15 119 TYR 119 119 119 TYR TYR V . n 
EA 15 120 ALA 120 120 120 ALA ALA V . n 
EA 15 121 LEU 121 121 121 LEU LEU V . n 
EA 15 122 ALA 122 122 122 ALA ALA V . n 
EA 15 123 THR 123 123 123 THR THR V . n 
EA 15 124 TRP 124 124 124 TRP TRP V . n 
EA 15 125 ARG 125 125 125 ARG ARG V . n 
EA 15 126 ARG 126 126 126 ARG ARG V . n 
EA 15 127 GLY 127 127 127 GLY GLY V . n 
EA 15 128 GLN 128 128 128 GLN GLN V . n 
EA 15 129 GLY 129 129 129 GLY GLY V . n 
EA 15 130 LEU 130 130 130 LEU LEU V . n 
EA 15 131 GLU 131 131 131 GLU GLU V . n 
EA 15 132 ALA 132 132 132 ALA ALA V . n 
EA 15 133 ALA 133 133 133 ALA ALA V . n 
EA 15 134 LEU 134 134 134 LEU LEU V . n 
EA 15 135 LYS 135 135 135 LYS LYS V . n 
EA 15 136 TYR 136 136 136 TYR TYR V . n 
EA 15 137 PHE 137 137 137 PHE PHE V . n 
EA 15 138 LEU 138 138 138 LEU LEU V . n 
EA 15 139 LEU 139 139 139 LEU LEU V . n 
EA 15 140 GLY 140 140 140 GLY GLY V . n 
EA 15 141 ALA 141 141 141 ALA ALA V . n 
EA 15 142 LEU 142 142 142 LEU LEU V . n 
EA 15 143 ALA 143 143 143 ALA ALA V . n 
EA 15 144 ALA 144 144 144 ALA ALA V . n 
EA 15 145 ALA 145 145 145 ALA ALA V . n 
EA 15 146 PHE 146 146 146 PHE PHE V . n 
EA 15 147 PHE 147 147 147 PHE PHE V . n 
EA 15 148 LEU 148 148 148 LEU LEU V . n 
EA 15 149 TYR 149 149 149 TYR TYR V . n 
EA 15 150 GLY 150 150 150 GLY GLY V . n 
EA 15 151 ALA 151 151 151 ALA ALA V . n 
EA 15 152 ALA 152 152 152 ALA ALA V . n 
EA 15 153 LEU 153 153 153 LEU LEU V . n 
EA 15 154 PHE 154 154 154 PHE PHE V . n 
EA 15 155 TYR 155 155 155 TYR TYR V . n 
EA 15 156 GLY 156 156 156 GLY GLY V . n 
EA 15 157 ALA 157 157 157 ALA ALA V . n 
EA 15 158 THR 158 158 158 THR THR V . n 
EA 15 159 GLY 159 159 159 GLY GLY V . n 
EA 15 160 SER 160 160 160 SER SER V . n 
EA 15 161 LEU 161 161 161 LEU LEU V . n 
EA 15 162 VAL 162 162 162 VAL VAL V . n 
EA 15 163 LEU 163 163 163 LEU LEU V . n 
EA 15 164 GLY 164 164 164 GLY GLY V . n 
EA 15 165 ALA 165 165 165 ALA ALA V . n 
EA 15 166 PRO 166 166 166 PRO PRO V . n 
EA 15 167 GLY 167 167 167 GLY GLY V . n 
EA 15 168 GLU 168 168 168 GLU GLU V . n 
EA 15 169 GLY 169 169 169 GLY GLY V . n 
EA 15 170 PRO 170 170 170 PRO PRO V . n 
EA 15 171 LEU 171 171 171 LEU LEU V . n 
EA 15 172 TYR 172 172 172 TYR TYR V . n 
EA 15 173 ALA 173 173 173 ALA ALA V . n 
EA 15 174 LEU 174 174 174 LEU LEU V . n 
EA 15 175 ALA 175 175 175 ALA ALA V . n 
EA 15 176 LEU 176 176 176 LEU LEU V . n 
EA 15 177 GLY 177 177 177 GLY GLY V . n 
EA 15 178 LEU 178 178 178 LEU LEU V . n 
EA 15 179 LEU 179 179 179 LEU LEU V . n 
EA 15 180 LEU 180 180 180 LEU LEU V . n 
EA 15 181 VAL 181 181 181 VAL VAL V . n 
EA 15 182 GLY 182 182 182 GLY GLY V . n 
EA 15 183 LEU 183 183 183 LEU LEU V . n 
EA 15 184 GLY 184 184 184 GLY GLY V . n 
EA 15 185 PHE 185 185 185 PHE PHE V . n 
EA 15 186 LYS 186 186 186 LYS LYS V . n 
EA 15 187 ALA 187 187 187 ALA ALA V . n 
EA 15 188 ALA 188 188 188 ALA ALA V . n 
EA 15 189 LEU 189 189 189 LEU LEU V . n 
EA 15 190 ALA 190 190 190 ALA ALA V . n 
EA 15 191 PRO 191 191 191 PRO PRO V . n 
EA 15 192 PHE 192 192 192 PHE PHE V . n 
EA 15 193 HIS 193 193 193 HIS HIS V . n 
EA 15 194 PHE 194 194 194 PHE PHE V . n 
EA 15 195 TRP 195 195 195 TRP TRP V . n 
EA 15 196 THR 196 196 196 THR THR V . n 
EA 15 197 PRO 197 197 197 PRO PRO V . n 
EA 15 198 ASP 198 198 198 ASP ASP V . n 
EA 15 199 VAL 199 199 199 VAL VAL V . n 
EA 15 200 TYR 200 200 200 TYR TYR V . n 
EA 15 201 GLN 201 201 201 GLN GLN V . n 
EA 15 202 GLY 202 202 202 GLY GLY V . n 
EA 15 203 SER 203 203 203 SER SER V . n 
EA 15 204 PRO 204 204 204 PRO PRO V . n 
EA 15 205 THR 205 205 205 THR THR V . n 
EA 15 206 PRO 206 206 206 PRO PRO V . n 
EA 15 207 VAL 207 207 207 VAL VAL V . n 
EA 15 208 VAL 208 208 208 VAL VAL V . n 
EA 15 209 LEU 209 209 209 LEU LEU V . n 
EA 15 210 PHE 210 210 210 PHE PHE V . n 
EA 15 211 MET 211 211 211 MET MET V . n 
EA 15 212 ALA 212 212 212 ALA ALA V . n 
EA 15 213 THR 213 213 213 THR THR V . n 
EA 15 214 SER 214 214 214 SER SER V . n 
EA 15 215 VAL 215 215 215 VAL VAL V . n 
EA 15 216 LYS 216 216 216 LYS LYS V . n 
EA 15 217 ALA 217 217 217 ALA ALA V . n 
EA 15 218 ALA 218 218 218 ALA ALA V . n 
EA 15 219 ALA 219 219 219 ALA ALA V . n 
EA 15 220 PHE 220 220 220 PHE PHE V . n 
EA 15 221 ALA 221 221 221 ALA ALA V . n 
EA 15 222 ALA 222 222 222 ALA ALA V . n 
EA 15 223 LEU 223 223 223 LEU LEU V . n 
EA 15 224 LEU 224 224 224 LEU LEU V . n 
EA 15 225 ARG 225 225 225 ARG ARG V . n 
EA 15 226 VAL 226 226 226 VAL VAL V . n 
EA 15 227 ALA 227 227 227 ALA ALA V . n 
EA 15 228 ALA 228 228 228 ALA ALA V . n 
EA 15 229 PRO 229 229 229 PRO PRO V . n 
EA 15 230 PRO 230 230 230 PRO PRO V . n 
EA 15 231 GLU 231 231 231 GLU GLU V . n 
EA 15 232 ALA 232 232 232 ALA ALA V . n 
EA 15 233 LEU 233 233 233 LEU LEU V . n 
EA 15 234 ALA 234 234 234 ALA ALA V . n 
EA 15 235 LEU 235 235 235 LEU LEU V . n 
EA 15 236 LEU 236 236 236 LEU LEU V . n 
EA 15 237 VAL 237 237 237 VAL VAL V . n 
EA 15 238 ALA 238 238 238 ALA ALA V . n 
EA 15 239 LEU 239 239 239 LEU LEU V . n 
EA 15 240 SER 240 240 240 SER SER V . n 
EA 15 241 VAL 241 241 241 VAL VAL V . n 
EA 15 242 VAL 242 242 242 VAL VAL V . n 
EA 15 243 VAL 243 243 243 VAL VAL V . n 
EA 15 244 GLY 244 244 244 GLY GLY V . n 
EA 15 245 ASN 245 245 245 ASN ASN V . n 
EA 15 246 LEU 246 246 246 LEU LEU V . n 
EA 15 247 ALA 247 247 247 ALA ALA V . n 
EA 15 248 ALA 248 248 248 ALA ALA V . n 
EA 15 249 LEU 249 249 249 LEU LEU V . n 
EA 15 250 ALA 250 250 250 ALA ALA V . n 
EA 15 251 GLN 251 251 251 GLN GLN V . n 
EA 15 252 LYS 252 252 252 LYS LYS V . n 
EA 15 253 GLU 253 253 253 GLU GLU V . n 
EA 15 254 ALA 254 254 254 ALA ALA V . n 
EA 15 255 LYS 255 255 255 LYS LYS V . n 
EA 15 256 ARG 256 256 256 ARG ARG V . n 
EA 15 257 LEU 257 257 257 LEU LEU V . n 
EA 15 258 LEU 258 258 258 LEU LEU V . n 
EA 15 259 ALA 259 259 259 ALA ALA V . n 
EA 15 260 TYR 260 260 260 TYR TYR V . n 
EA 15 261 SER 261 261 261 SER SER V . n 
EA 15 262 SER 262 262 262 SER SER V . n 
EA 15 263 ILE 263 263 263 ILE ILE V . n 
EA 15 264 ALA 264 264 264 ALA ALA V . n 
EA 15 265 HIS 265 265 265 HIS HIS V . n 
EA 15 266 ALA 266 266 266 ALA ALA V . n 
EA 15 267 GLY 267 267 267 GLY GLY V . n 
EA 15 268 TYR 268 268 268 TYR TYR V . n 
EA 15 269 MET 269 269 269 MET MET V . n 
EA 15 270 ALA 270 270 270 ALA ALA V . n 
EA 15 271 LEU 271 271 271 LEU LEU V . n 
EA 15 272 ALA 272 272 272 ALA ALA V . n 
EA 15 273 LEU 273 273 273 LEU LEU V . n 
EA 15 274 TYR 274 274 274 TYR TYR V . n 
EA 15 275 THR 275 275 275 THR THR V . n 
EA 15 276 GLY 276 276 276 GLY GLY V . n 
EA 15 277 ASN 277 277 277 ASN ASN V . n 
EA 15 278 ALA 278 278 278 ALA ALA V . n 
EA 15 279 GLN 279 279 279 GLN GLN V . n 
EA 15 280 ALA 280 280 280 ALA ALA V . n 
EA 15 281 LEU 281 281 281 LEU LEU V . n 
EA 15 282 GLY 282 282 282 GLY GLY V . n 
EA 15 283 PHE 283 283 283 PHE PHE V . n 
EA 15 284 TYR 284 284 284 TYR TYR V . n 
EA 15 285 LEU 285 285 285 LEU LEU V . n 
EA 15 286 LEU 286 286 286 LEU LEU V . n 
EA 15 287 THR 287 287 287 THR THR V . n 
EA 15 288 TYR 288 288 288 TYR TYR V . n 
EA 15 289 VAL 289 289 289 VAL VAL V . n 
EA 15 290 LEU 290 290 290 LEU LEU V . n 
EA 15 291 ALA 291 291 291 ALA ALA V . n 
EA 15 292 THR 292 292 292 THR THR V . n 
EA 15 293 GLY 293 293 293 GLY GLY V . n 
EA 15 294 LEU 294 294 294 LEU LEU V . n 
EA 15 295 ALA 295 295 295 ALA ALA V . n 
EA 15 296 PHE 296 296 296 PHE PHE V . n 
EA 15 297 ALA 297 297 297 ALA ALA V . n 
EA 15 298 VAL 298 298 298 VAL VAL V . n 
EA 15 299 LEU 299 299 299 LEU LEU V . n 
EA 15 300 SER 300 300 300 SER SER V . n 
EA 15 301 GLN 301 301 301 GLN GLN V . n 
EA 15 302 ILE 302 302 302 ILE ILE V . n 
EA 15 303 SER 303 303 303 SER SER V . n 
EA 15 304 PRO 304 304 304 PRO PRO V . n 
EA 15 305 ASP 305 305 305 ASP ASP V . n 
EA 15 306 ARG 306 306 306 ARG ARG V . n 
EA 15 307 VAL 307 307 307 VAL VAL V . n 
EA 15 308 PRO 308 308 308 PRO PRO V . n 
EA 15 309 LEU 309 309 309 LEU LEU V . n 
EA 15 310 GLU 310 310 310 GLU GLU V . n 
EA 15 311 ALA 311 311 311 ALA ALA V . n 
EA 15 312 LEU 312 312 312 LEU LEU V . n 
EA 15 313 ARG 313 313 313 ARG ARG V . n 
EA 15 314 GLY 314 314 314 GLY GLY V . n 
EA 15 315 LEU 315 315 315 LEU LEU V . n 
EA 15 316 TYR 316 316 316 TYR TYR V . n 
EA 15 317 ARG 317 317 317 ARG ARG V . n 
EA 15 318 LYS 318 318 318 LYS LYS V . n 
EA 15 319 ASP 319 319 319 ASP ASP V . n 
EA 15 320 PRO 320 320 320 PRO PRO V . n 
EA 15 321 LEU 321 321 321 LEU LEU V . n 
EA 15 322 LEU 322 322 322 LEU LEU V . n 
EA 15 323 GLY 323 323 323 GLY GLY V . n 
EA 15 324 LEU 324 324 324 LEU LEU V . n 
EA 15 325 ALA 325 325 325 ALA ALA V . n 
EA 15 326 PHE 326 326 326 PHE PHE V . n 
EA 15 327 LEU 327 327 327 LEU LEU V . n 
EA 15 328 VAL 328 328 328 VAL VAL V . n 
EA 15 329 ALA 329 329 329 ALA ALA V . n 
EA 15 330 MET 330 330 330 MET MET V . n 
EA 15 331 LEU 331 331 331 LEU LEU V . n 
EA 15 332 SER 332 332 332 SER SER V . n 
EA 15 333 LEU 333 333 333 LEU LEU V . n 
EA 15 334 LEU 334 334 334 LEU LEU V . n 
EA 15 335 GLY 335 335 335 GLY GLY V . n 
EA 15 336 LEU 336 336 336 LEU LEU V . n 
EA 15 337 PRO 337 337 337 PRO PRO V . n 
EA 15 338 PRO 338 338 338 PRO PRO V . n 
EA 15 339 LEU 339 339 339 LEU LEU V . n 
EA 15 340 ALA 340 340 340 ALA ALA V . n 
EA 15 341 GLY 341 341 341 GLY GLY V . n 
EA 15 342 PHE 342 342 342 PHE PHE V . n 
EA 15 343 TRP 343 343 343 TRP TRP V . n 
EA 15 344 GLY 344 344 344 GLY GLY V . n 
EA 15 345 LYS 345 345 345 LYS LYS V . n 
EA 15 346 TYR 346 346 346 TYR TYR V . n 
EA 15 347 LEU 347 347 347 LEU LEU V . n 
EA 15 348 ALA 348 348 348 ALA ALA V . n 
EA 15 349 PHE 349 349 349 PHE PHE V . n 
EA 15 350 ALA 350 350 350 ALA ALA V . n 
EA 15 351 GLU 351 351 351 GLU GLU V . n 
EA 15 352 ALA 352 352 352 ALA ALA V . n 
EA 15 353 ALA 353 353 353 ALA ALA V . n 
EA 15 354 ARG 354 354 354 ARG ARG V . n 
EA 15 355 ALA 355 355 355 ALA ALA V . n 
EA 15 356 GLY 356 356 356 GLY GLY V . n 
EA 15 357 ALA 357 357 357 ALA ALA V . n 
EA 15 358 TRP 358 358 358 TRP TRP V . n 
EA 15 359 GLY 359 359 359 GLY GLY V . n 
EA 15 360 VAL 360 360 360 VAL VAL V . n 
EA 15 361 LEU 361 361 361 LEU LEU V . n 
EA 15 362 VAL 362 362 362 VAL VAL V . n 
EA 15 363 LEU 363 363 363 LEU LEU V . n 
EA 15 364 ALA 364 364 364 ALA ALA V . n 
EA 15 365 LEU 365 365 365 LEU LEU V . n 
EA 15 366 VAL 366 366 366 VAL VAL V . n 
EA 15 367 THR 367 367 367 THR THR V . n 
EA 15 368 SER 368 368 368 SER SER V . n 
EA 15 369 ALA 369 369 369 ALA ALA V . n 
EA 15 370 VAL 370 370 370 VAL VAL V . n 
EA 15 371 SER 371 371 371 SER SER V . n 
EA 15 372 ALA 372 372 372 ALA ALA V . n 
EA 15 373 TYR 373 373 373 TYR TYR V . n 
EA 15 374 TYR 374 374 374 TYR TYR V . n 
EA 15 375 TYR 375 375 375 TYR TYR V . n 
EA 15 376 LEU 376 376 376 LEU LEU V . n 
EA 15 377 GLY 377 377 377 GLY GLY V . n 
EA 15 378 LEU 378 378 378 LEU LEU V . n 
EA 15 379 GLY 379 379 379 GLY GLY V . n 
EA 15 380 LEU 380 380 380 LEU LEU V . n 
EA 15 381 ALA 381 381 381 ALA ALA V . n 
EA 15 382 VAL 382 382 382 VAL VAL V . n 
EA 15 383 PHE 383 383 383 PHE PHE V . n 
EA 15 384 ALA 384 384 384 ALA ALA V . n 
EA 15 385 ARG 385 385 385 ARG ARG V . n 
EA 15 386 PRO 386 386 386 PRO PRO V . n 
EA 15 387 GLU 387 387 387 GLU GLU V . n 
EA 15 388 GLU 388 388 388 GLU GLU V . n 
EA 15 389 THR 389 389 389 THR THR V . n 
EA 15 390 PRO 390 390 390 PRO PRO V . n 
EA 15 391 PHE 391 391 391 PHE PHE V . n 
EA 15 392 ARG 392 392 392 ARG ARG V . n 
EA 15 393 PRO 393 393 393 PRO PRO V . n 
EA 15 394 GLY 394 394 394 GLY GLY V . n 
EA 15 395 PRO 395 395 395 PRO PRO V . n 
EA 15 396 PRO 396 396 396 PRO PRO V . n 
EA 15 397 TRP 397 397 397 TRP TRP V . n 
EA 15 398 ALA 398 398 398 ALA ALA V . n 
EA 15 399 ARG 399 399 399 ARG ARG V . n 
EA 15 400 ALA 400 400 400 ALA ALA V . n 
EA 15 401 ALA 401 401 401 ALA ALA V . n 
EA 15 402 VAL 402 402 402 VAL VAL V . n 
EA 15 403 VAL 403 403 403 VAL VAL V . n 
EA 15 404 ALA 404 404 404 ALA ALA V . n 
EA 15 405 ALA 405 405 405 ALA ALA V . n 
EA 15 406 GLY 406 406 406 GLY GLY V . n 
EA 15 407 VAL 407 407 407 VAL VAL V . n 
EA 15 408 LEU 408 408 408 LEU LEU V . n 
EA 15 409 LEU 409 409 409 LEU LEU V . n 
EA 15 410 LEU 410 410 410 LEU LEU V . n 
EA 15 411 ALA 411 411 411 ALA ALA V . n 
EA 15 412 LEU 412 412 412 LEU LEU V . n 
EA 15 413 GLY 413 413 413 GLY GLY V . n 
EA 15 414 LEU 414 414 414 LEU LEU V . n 
EA 15 415 LEU 415 415 415 LEU LEU V . n 
EA 15 416 PRO 416 416 416 PRO PRO V . n 
EA 15 417 GLY 417 417 417 GLY GLY V . n 
EA 15 418 LEU 418 418 418 LEU LEU V . n 
EA 15 419 VAL 419 419 419 VAL VAL V . n 
EA 15 420 LEU 420 420 420 LEU LEU V . n 
EA 15 421 PRO 421 421 421 PRO PRO V . n 
EA 15 422 ALA 422 422 422 ALA ALA V . n 
EA 15 423 LEU 423 423 423 LEU LEU V . n 
EA 15 424 ALA 424 424 424 ALA ALA V . n 
EA 15 425 ALA 425 425 425 ALA ALA V . n 
EA 15 426 GLY 426 426 426 GLY GLY V . n 
EA 15 427 GLY 427 427 427 GLY GLY V . n 
FA 16 1   MET 1   1   ?   ?   ?   Q . n 
FA 16 2   THR 2   2   2   THR THR Q . n 
FA 16 3   TRP 3   3   3   TRP TRP Q . n 
FA 16 4   SER 4   4   4   SER SER Q . n 
FA 16 5   TYR 5   5   5   TYR TYR Q . n 
FA 16 6   PRO 6   6   6   PRO PRO Q . n 
FA 16 7   VAL 7   7   7   VAL VAL Q . n 
FA 16 8   ASP 8   8   8   ASP ASP Q . n 
FA 16 9   PRO 9   9   9   PRO PRO Q . n 
FA 16 10  TYR 10  10  10  TYR TYR Q . n 
FA 16 11  TRP 11  11  11  TRP TRP Q . n 
FA 16 12  MET 12  12  12  MET MET Q . n 
FA 16 13  VAL 13  13  13  VAL VAL Q . n 
FA 16 14  ALA 14  14  14  ALA ALA Q . n 
FA 16 15  LEU 15  15  15  LEU LEU Q . n 
FA 16 16  LYS 16  16  16  LYS LYS Q . n 
FA 16 17  ALA 17  17  17  ALA ALA Q . n 
FA 16 18  LEU 18  18  18  LEU LEU Q . n 
FA 16 19  LEU 19  19  19  LEU LEU Q . n 
FA 16 20  VAL 20  20  20  VAL VAL Q . n 
FA 16 21  VAL 21  21  21  VAL VAL Q . n 
FA 16 22  VAL 22  22  22  VAL VAL Q . n 
FA 16 23  GLY 23  23  23  GLY GLY Q . n 
FA 16 24  LEU 24  24  24  LEU LEU Q . n 
FA 16 25  LEU 25  25  25  LEU LEU Q . n 
FA 16 26  THR 26  26  26  THR THR Q . n 
FA 16 27  ALA 27  27  27  ALA ALA Q . n 
FA 16 28  PHE 28  28  28  PHE PHE Q . n 
FA 16 29  ALA 29  29  29  ALA ALA Q . n 
FA 16 30  PHE 30  30  30  PHE PHE Q . n 
FA 16 31  MET 31  31  31  MET MET Q . n 
FA 16 32  THR 32  32  32  THR THR Q . n 
FA 16 33  LEU 33  33  33  LEU LEU Q . n 
FA 16 34  ILE 34  34  34  ILE ILE Q . n 
FA 16 35  GLU 35  35  35  GLU GLU Q . n 
FA 16 36  ARG 36  36  36  ARG ARG Q . n 
FA 16 37  ARG 37  37  37  ARG ARG Q . n 
FA 16 38  LEU 38  38  38  LEU LEU Q . n 
FA 16 39  LEU 39  39  39  LEU LEU Q . n 
FA 16 40  ALA 40  40  40  ALA ALA Q . n 
FA 16 41  ARG 41  41  41  ARG ARG Q . n 
FA 16 42  PHE 42  42  42  PHE PHE Q . n 
FA 16 43  GLN 43  43  43  GLN GLN Q . n 
FA 16 44  VAL 44  44  44  VAL VAL Q . n 
FA 16 45  ARG 45  45  45  ARG ARG Q . n 
FA 16 46  MET 46  46  46  MET MET Q . n 
FA 16 47  GLY 47  47  47  GLY GLY Q . n 
FA 16 48  PRO 48  48  48  PRO PRO Q . n 
FA 16 49  ASN 49  49  49  ASN ASN Q . n 
FA 16 50  ARG 50  50  50  ARG ARG Q . n 
FA 16 51  VAL 51  51  51  VAL VAL Q . n 
FA 16 52  GLY 52  52  52  GLY GLY Q . n 
FA 16 53  PRO 53  53  53  PRO PRO Q . n 
FA 16 54  PHE 54  54  54  PHE PHE Q . n 
FA 16 55  GLY 55  55  55  GLY GLY Q . n 
FA 16 56  LEU 56  56  56  LEU LEU Q . n 
FA 16 57  LEU 57  57  57  LEU LEU Q . n 
FA 16 58  GLN 58  58  58  GLN GLN Q . n 
FA 16 59  PRO 59  59  59  PRO PRO Q . n 
FA 16 60  LEU 60  60  60  LEU LEU Q . n 
FA 16 61  ALA 61  61  61  ALA ALA Q . n 
FA 16 62  ASP 62  62  62  ASP ASP Q . n 
FA 16 63  ALA 63  63  63  ALA ALA Q . n 
FA 16 64  ILE 64  64  64  ILE ILE Q . n 
FA 16 65  LYS 65  65  65  LYS LYS Q . n 
FA 16 66  SER 66  66  66  SER SER Q . n 
FA 16 67  ILE 67  67  67  ILE ILE Q . n 
FA 16 68  PHE 68  68  68  PHE PHE Q . n 
FA 16 69  LYS 69  69  69  LYS LYS Q . n 
FA 16 70  GLU 70  70  70  GLU GLU Q . n 
FA 16 71  ASP 71  71  71  ASP ASP Q . n 
FA 16 72  ILE 72  72  72  ILE ILE Q . n 
FA 16 73  VAL 73  73  73  VAL VAL Q . n 
FA 16 74  VAL 74  74  74  VAL VAL Q . n 
FA 16 75  ALA 75  75  75  ALA ALA Q . n 
FA 16 76  GLN 76  76  76  GLN GLN Q . n 
FA 16 77  ALA 77  77  77  ALA ALA Q . n 
FA 16 78  ASP 78  78  78  ASP ASP Q . n 
FA 16 79  ARG 79  79  79  ARG ARG Q . n 
FA 16 80  PHE 80  80  80  PHE PHE Q . n 
FA 16 81  LEU 81  81  81  LEU LEU Q . n 
FA 16 82  PHE 82  82  82  PHE PHE Q . n 
FA 16 83  VAL 83  83  83  VAL VAL Q . n 
FA 16 84  LEU 84  84  84  LEU LEU Q . n 
FA 16 85  ALA 85  85  85  ALA ALA Q . n 
FA 16 86  PRO 86  86  86  PRO PRO Q . n 
FA 16 87  LEU 87  87  87  LEU LEU Q . n 
FA 16 88  ILE 88  88  88  ILE ILE Q . n 
FA 16 89  SER 89  89  89  SER SER Q . n 
FA 16 90  VAL 90  90  90  VAL VAL Q . n 
FA 16 91  VAL 91  91  91  VAL VAL Q . n 
FA 16 92  PHE 92  92  92  PHE PHE Q . n 
FA 16 93  ALA 93  93  93  ALA ALA Q . n 
FA 16 94  LEU 94  94  94  LEU LEU Q . n 
FA 16 95  LEU 95  95  95  LEU LEU Q . n 
FA 16 96  ALA 96  96  96  ALA ALA Q . n 
FA 16 97  PHE 97  97  97  PHE PHE Q . n 
FA 16 98  GLY 98  98  98  GLY GLY Q . n 
FA 16 99  LEU 99  99  99  LEU LEU Q . n 
FA 16 100 ILE 100 100 100 ILE ILE Q . n 
FA 16 101 PRO 101 101 101 PRO PRO Q . n 
FA 16 102 PHE 102 102 102 PHE PHE Q . n 
FA 16 103 GLY 103 103 103 GLY GLY Q . n 
FA 16 104 PRO 104 104 104 PRO PRO Q . n 
FA 16 105 PRO 105 105 105 PRO PRO Q . n 
FA 16 106 GLY 106 106 106 GLY GLY Q . n 
FA 16 107 SER 107 107 107 SER SER Q . n 
FA 16 108 PHE 108 108 108 PHE PHE Q . n 
FA 16 109 PHE 109 109 109 PHE PHE Q . n 
FA 16 110 GLY 110 110 110 GLY GLY Q . n 
FA 16 111 TYR 111 111 111 TYR TYR Q . n 
FA 16 112 GLN 112 112 112 GLN GLN Q . n 
FA 16 113 PRO 113 113 113 PRO PRO Q . n 
FA 16 114 TRP 114 114 114 TRP TRP Q . n 
FA 16 115 VAL 115 115 115 VAL VAL Q . n 
FA 16 116 ILE 116 116 116 ILE ILE Q . n 
FA 16 117 ASN 117 117 117 ASN ASN Q . n 
FA 16 118 LEU 118 118 118 LEU LEU Q . n 
FA 16 119 ASP 119 119 119 ASP ASP Q . n 
FA 16 120 LEU 120 120 120 LEU LEU Q . n 
FA 16 121 GLY 121 121 121 GLY GLY Q . n 
FA 16 122 ILE 122 122 122 ILE ILE Q . n 
FA 16 123 LEU 123 123 123 LEU LEU Q . n 
FA 16 124 TYR 124 124 124 TYR TYR Q . n 
FA 16 125 LEU 125 125 125 LEU LEU Q . n 
FA 16 126 PHE 126 126 126 PHE PHE Q . n 
FA 16 127 ALA 127 127 127 ALA ALA Q . n 
FA 16 128 VAL 128 128 128 VAL VAL Q . n 
FA 16 129 SER 129 129 129 SER SER Q . n 
FA 16 130 GLU 130 130 130 GLU GLU Q . n 
FA 16 131 LEU 131 131 131 LEU LEU Q . n 
FA 16 132 ALA 132 132 132 ALA ALA Q . n 
FA 16 133 VAL 133 133 133 VAL VAL Q . n 
FA 16 134 TYR 134 134 134 TYR TYR Q . n 
FA 16 135 GLY 135 135 135 GLY GLY Q . n 
FA 16 136 ILE 136 136 136 ILE ILE Q . n 
FA 16 137 PHE 137 137 137 PHE PHE Q . n 
FA 16 138 LEU 138 138 138 LEU LEU Q . n 
FA 16 139 SER 139 139 139 SER SER Q . n 
FA 16 140 GLY 140 140 140 GLY GLY Q . n 
FA 16 141 TRP 141 141 141 TRP TRP Q . n 
FA 16 142 ALA 142 142 142 ALA ALA Q . n 
FA 16 143 SER 143 143 143 SER SER Q . n 
FA 16 144 GLY 144 144 144 GLY GLY Q . n 
FA 16 145 SER 145 145 145 SER SER Q . n 
FA 16 146 LYS 146 146 146 LYS LYS Q . n 
FA 16 147 TYR 147 147 147 TYR TYR Q . n 
FA 16 148 SER 148 148 148 SER SER Q . n 
FA 16 149 LEU 149 149 149 LEU LEU Q . n 
FA 16 150 LEU 150 150 150 LEU LEU Q . n 
FA 16 151 GLY 151 151 151 GLY GLY Q . n 
FA 16 152 SER 152 152 152 SER SER Q . n 
FA 16 153 LEU 153 153 153 LEU LEU Q . n 
FA 16 154 ARG 154 154 154 ARG ARG Q . n 
FA 16 155 SER 155 155 155 SER SER Q . n 
FA 16 156 SER 156 156 156 SER SER Q . n 
FA 16 157 ALA 157 157 157 ALA ALA Q . n 
FA 16 158 SER 158 158 158 SER SER Q . n 
FA 16 159 LEU 159 159 159 LEU LEU Q . n 
FA 16 160 ILE 160 160 160 ILE ILE Q . n 
FA 16 161 SER 161 161 161 SER SER Q . n 
FA 16 162 TYR 162 162 162 TYR TYR Q . n 
FA 16 163 GLU 163 163 163 GLU GLU Q . n 
FA 16 164 LEU 164 164 164 LEU LEU Q . n 
FA 16 165 GLY 165 165 165 GLY GLY Q . n 
FA 16 166 LEU 166 166 166 LEU LEU Q . n 
FA 16 167 GLY 167 167 167 GLY GLY Q . n 
FA 16 168 LEU 168 168 168 LEU LEU Q . n 
FA 16 169 ALA 169 169 169 ALA ALA Q . n 
FA 16 170 LEU 170 170 170 LEU LEU Q . n 
FA 16 171 LEU 171 171 171 LEU LEU Q . n 
FA 16 172 ALA 172 172 172 ALA ALA Q . n 
FA 16 173 PRO 173 173 173 PRO PRO Q . n 
FA 16 174 VAL 174 174 174 VAL VAL Q . n 
FA 16 175 LEU 175 175 175 LEU LEU Q . n 
FA 16 176 LEU 176 176 176 LEU LEU Q . n 
FA 16 177 VAL 177 177 177 VAL VAL Q . n 
FA 16 178 GLY 178 178 178 GLY GLY Q . n 
FA 16 179 SER 179 179 179 SER SER Q . n 
FA 16 180 LEU 180 180 180 LEU LEU Q . n 
FA 16 181 ASN 181 181 181 ASN ASN Q . n 
FA 16 182 LEU 182 182 182 LEU LEU Q . n 
FA 16 183 ASN 183 183 183 ASN ASN Q . n 
FA 16 184 ASP 184 184 184 ASP ASP Q . n 
FA 16 185 ILE 185 185 185 ILE ILE Q . n 
FA 16 186 VAL 186 186 186 VAL VAL Q . n 
FA 16 187 ASN 187 187 187 ASN ASN Q . n 
FA 16 188 TRP 188 188 188 TRP TRP Q . n 
FA 16 189 GLN 189 189 189 GLN GLN Q . n 
FA 16 190 LYS 190 190 190 LYS LYS Q . n 
FA 16 191 GLU 191 191 191 GLU GLU Q . n 
FA 16 192 HIS 192 192 192 HIS HIS Q . n 
FA 16 193 GLY 193 193 193 GLY GLY Q . n 
FA 16 194 TRP 194 194 194 TRP TRP Q . n 
FA 16 195 LEU 195 195 195 LEU LEU Q . n 
FA 16 196 PHE 196 196 196 PHE PHE Q . n 
FA 16 197 LEU 197 197 197 LEU LEU Q . n 
FA 16 198 TYR 198 198 198 TYR TYR Q . n 
FA 16 199 ALA 199 199 199 ALA ALA Q . n 
FA 16 200 PHE 200 200 200 PHE PHE Q . n 
FA 16 201 PRO 201 201 201 PRO PRO Q . n 
FA 16 202 ALA 202 202 202 ALA ALA Q . n 
FA 16 203 PHE 203 203 203 PHE PHE Q . n 
FA 16 204 LEU 204 204 204 LEU LEU Q . n 
FA 16 205 VAL 205 205 205 VAL VAL Q . n 
FA 16 206 TYR 206 206 206 TYR TYR Q . n 
FA 16 207 LEU 207 207 207 LEU LEU Q . n 
FA 16 208 ILE 208 208 208 ILE ILE Q . n 
FA 16 209 ALA 209 209 209 ALA ALA Q . n 
FA 16 210 SER 210 210 210 SER SER Q . n 
FA 16 211 MET 211 211 211 MET MET Q . n 
FA 16 212 ALA 212 212 212 ALA ALA Q . n 
FA 16 213 GLU 213 213 213 GLU GLU Q . n 
FA 16 214 ALA 214 214 214 ALA ALA Q . n 
FA 16 215 ALA 215 215 215 ALA ALA Q . n 
FA 16 216 ARG 216 216 216 ARG ARG Q . n 
FA 16 217 THR 217 217 217 THR THR Q . n 
FA 16 218 PRO 218 218 218 PRO PRO Q . n 
FA 16 219 PHE 219 219 219 PHE PHE Q . n 
FA 16 220 ASP 220 220 220 ASP ASP Q . n 
FA 16 221 LEU 221 221 221 LEU LEU Q . n 
FA 16 222 PRO 222 222 222 PRO PRO Q . n 
FA 16 223 GLU 223 223 223 GLU GLU Q . n 
FA 16 224 ALA 224 224 224 ALA ALA Q . n 
FA 16 225 GLU 225 225 225 GLU GLU Q . n 
FA 16 226 GLN 226 226 226 GLN GLN Q . n 
FA 16 227 GLU 227 227 227 GLU GLU Q . n 
FA 16 228 LEU 228 228 228 LEU LEU Q . n 
FA 16 229 VAL 229 229 229 VAL VAL Q . n 
FA 16 230 GLY 230 230 230 GLY GLY Q . n 
FA 16 231 GLY 231 231 231 GLY GLY Q . n 
FA 16 232 TYR 232 232 232 TYR TYR Q . n 
FA 16 233 HIS 233 233 233 HIS HIS Q . n 
FA 16 234 THR 234 234 234 THR THR Q . n 
FA 16 235 GLU 235 235 235 GLU GLU Q . n 
FA 16 236 TYR 236 236 236 TYR TYR Q . n 
FA 16 237 SER 237 237 237 SER SER Q . n 
FA 16 238 SER 238 238 238 SER SER Q . n 
FA 16 239 ILE 239 239 239 ILE ILE Q . n 
FA 16 240 LYS 240 240 240 LYS LYS Q . n 
FA 16 241 TRP 241 241 241 TRP TRP Q . n 
FA 16 242 ALA 242 242 242 ALA ALA Q . n 
FA 16 243 LEU 243 243 243 LEU LEU Q . n 
FA 16 244 PHE 244 244 244 PHE PHE Q . n 
FA 16 245 GLN 245 245 245 GLN GLN Q . n 
FA 16 246 MET 246 246 246 MET MET Q . n 
FA 16 247 ALA 247 247 247 ALA ALA Q . n 
FA 16 248 GLU 248 248 248 GLU GLU Q . n 
FA 16 249 TYR 249 249 249 TYR TYR Q . n 
FA 16 250 ILE 250 250 250 ILE ILE Q . n 
FA 16 251 HIS 251 251 251 HIS HIS Q . n 
FA 16 252 PHE 252 252 252 PHE PHE Q . n 
FA 16 253 ILE 253 253 253 ILE ILE Q . n 
FA 16 254 THR 254 254 254 THR THR Q . n 
FA 16 255 ALA 255 255 255 ALA ALA Q . n 
FA 16 256 SER 256 256 256 SER SER Q . n 
FA 16 257 ALA 257 257 257 ALA ALA Q . n 
FA 16 258 LEU 258 258 258 LEU LEU Q . n 
FA 16 259 ILE 259 259 259 ILE ILE Q . n 
FA 16 260 PRO 260 260 260 PRO PRO Q . n 
FA 16 261 THR 261 261 261 THR THR Q . n 
FA 16 262 LEU 262 262 262 LEU LEU Q . n 
FA 16 263 PHE 263 263 263 PHE PHE Q . n 
FA 16 264 LEU 264 264 264 LEU LEU Q . n 
FA 16 265 GLY 265 265 265 GLY GLY Q . n 
FA 16 266 GLY 266 266 266 GLY GLY Q . n 
FA 16 267 TRP 267 267 267 TRP TRP Q . n 
FA 16 268 THR 268 268 268 THR THR Q . n 
FA 16 269 MET 269 269 269 MET MET Q . n 
FA 16 270 PRO 270 270 270 PRO PRO Q . n 
FA 16 271 VAL 271 271 271 VAL VAL Q . n 
FA 16 272 LEU 272 272 272 LEU LEU Q . n 
FA 16 273 GLU 273 273 273 GLU GLU Q . n 
FA 16 274 VAL 274 274 274 VAL VAL Q . n 
FA 16 275 PRO 275 275 275 PRO PRO Q . n 
FA 16 276 TYR 276 276 276 TYR TYR Q . n 
FA 16 277 LEU 277 277 277 LEU LEU Q . n 
FA 16 278 TRP 278 278 278 TRP TRP Q . n 
FA 16 279 MET 279 279 279 MET MET Q . n 
FA 16 280 PHE 280 280 280 PHE PHE Q . n 
FA 16 281 LEU 281 281 281 LEU LEU Q . n 
FA 16 282 LYS 282 282 282 LYS LYS Q . n 
FA 16 283 ILE 283 283 283 ILE ILE Q . n 
FA 16 284 ALA 284 284 284 ALA ALA Q . n 
FA 16 285 PHE 285 285 285 PHE PHE Q . n 
FA 16 286 PHE 286 286 286 PHE PHE Q . n 
FA 16 287 LEU 287 287 287 LEU LEU Q . n 
FA 16 288 PHE 288 288 288 PHE PHE Q . n 
FA 16 289 PHE 289 289 289 PHE PHE Q . n 
FA 16 290 PHE 290 290 290 PHE PHE Q . n 
FA 16 291 ILE 291 291 291 ILE ILE Q . n 
FA 16 292 TRP 292 292 292 TRP TRP Q . n 
FA 16 293 ILE 293 293 293 ILE ILE Q . n 
FA 16 294 ARG 294 294 294 ARG ARG Q . n 
FA 16 295 ALA 295 295 295 ALA ALA Q . n 
FA 16 296 THR 296 296 296 THR THR Q . n 
FA 16 297 TRP 297 297 297 TRP TRP Q . n 
FA 16 298 PHE 298 298 298 PHE PHE Q . n 
FA 16 299 ARG 299 299 299 ARG ARG Q . n 
FA 16 300 LEU 300 300 300 LEU LEU Q . n 
FA 16 301 ARG 301 301 301 ARG ARG Q . n 
FA 16 302 TYR 302 302 302 TYR TYR Q . n 
FA 16 303 ASP 303 303 303 ASP ASP Q . n 
FA 16 304 GLN 304 304 304 GLN GLN Q . n 
FA 16 305 LEU 305 305 305 LEU LEU Q . n 
FA 16 306 LEU 306 306 306 LEU LEU Q . n 
FA 16 307 ARG 307 307 307 ARG ARG Q . n 
FA 16 308 PHE 308 308 308 PHE PHE Q . n 
FA 16 309 GLY 309 309 309 GLY GLY Q . n 
FA 16 310 TRP 310 310 310 TRP TRP Q . n 
FA 16 311 GLY 311 311 311 GLY GLY Q . n 
FA 16 312 PHE 312 312 312 PHE PHE Q . n 
FA 16 313 LEU 313 313 313 LEU LEU Q . n 
FA 16 314 PHE 314 314 314 PHE PHE Q . n 
FA 16 315 PRO 315 315 315 PRO PRO Q . n 
FA 16 316 LEU 316 316 316 LEU LEU Q . n 
FA 16 317 ALA 317 317 317 ALA ALA Q . n 
FA 16 318 LEU 318 318 318 LEU LEU Q . n 
FA 16 319 LEU 319 319 319 LEU LEU Q . n 
FA 16 320 TRP 320 320 320 TRP TRP Q . n 
FA 16 321 PHE 321 321 321 PHE PHE Q . n 
FA 16 322 LEU 322 322 322 LEU LEU Q . n 
FA 16 323 VAL 323 323 323 VAL VAL Q . n 
FA 16 324 THR 324 324 324 THR THR Q . n 
FA 16 325 ALA 325 325 325 ALA ALA Q . n 
FA 16 326 LEU 326 326 326 LEU LEU Q . n 
FA 16 327 VAL 327 327 327 VAL VAL Q . n 
FA 16 328 VAL 328 328 328 VAL VAL Q . n 
FA 16 329 ALA 329 329 329 ALA ALA Q . n 
FA 16 330 LEU 330 330 330 LEU LEU Q . n 
FA 16 331 ASP 331 331 331 ASP ASP Q . n 
FA 16 332 LEU 332 332 332 LEU LEU Q . n 
FA 16 333 PRO 333 333 333 PRO PRO Q . n 
FA 16 334 ARG 334 334 334 ARG ARG Q . n 
FA 16 335 THR 335 335 335 THR THR Q . n 
FA 16 336 TYR 336 336 336 TYR TYR Q . n 
FA 16 337 LEU 337 337 337 LEU LEU Q . n 
FA 16 338 LEU 338 338 338 LEU LEU Q . n 
FA 16 339 TYR 339 339 339 TYR TYR Q . n 
FA 16 340 LEU 340 340 340 LEU LEU Q . n 
FA 16 341 SER 341 341 341 SER SER Q . n 
FA 16 342 ALA 342 342 342 ALA ALA Q . n 
FA 16 343 LEU 343 343 343 LEU LEU Q . n 
FA 16 344 SER 344 344 344 SER SER Q . n 
FA 16 345 PHE 345 345 345 PHE PHE Q . n 
FA 16 346 LEU 346 346 346 LEU LEU Q . n 
FA 16 347 VAL 347 347 347 VAL VAL Q . n 
FA 16 348 LEU 348 348 348 LEU LEU Q . n 
FA 16 349 LEU 349 349 349 LEU LEU Q . n 
FA 16 350 GLY 350 350 350 GLY GLY Q . n 
FA 16 351 ALA 351 351 351 ALA ALA Q . n 
FA 16 352 VAL 352 352 352 VAL VAL Q . n 
FA 16 353 LEU 353 353 353 LEU LEU Q . n 
FA 16 354 TYR 354 354 354 TYR TYR Q . n 
FA 16 355 THR 355 355 ?   ?   ?   Q . n 
FA 16 356 PRO 356 356 ?   ?   ?   Q . n 
FA 16 357 LYS 357 357 ?   ?   ?   Q . n 
FA 16 358 PRO 358 358 ?   ?   ?   Q . n 
FA 16 359 ALA 359 359 ?   ?   ?   Q . n 
FA 16 360 ARG 360 360 ?   ?   ?   Q . n 
FA 16 361 LYS 361 361 ?   ?   ?   Q . n 
FA 16 362 GLY 362 362 ?   ?   ?   Q . n 
FA 16 363 GLY 363 363 ?   ?   ?   Q . n 
FA 16 364 GLY 364 364 ?   ?   ?   Q . n 
FA 16 365 ALA 365 365 ?   ?   ?   Q . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
GA 17 SF4 1 501 501 SF4 SF4 1 . 
HA 18 FMN 1 502 502 FMN FMN 1 . 
IA 19 FES 1 201 201 FES FES 2 . 
JA 17 SF4 1 801 801 SF4 SF4 3 . 
KA 17 SF4 1 802 802 SF4 SF4 3 . 
LA 17 SF4 1 803 803 SF4 SF4 3 . 
MA 19 FES 1 804 804 FES FES 3 . 
NA 20 DCQ 1 501 501 DCQ DCQ 4 . 
OA 17 SF4 1 201 201 SF4 SF4 6 . 
PA 17 SF4 1 201 201 SF4 SF4 9 . 
QA 17 SF4 1 202 202 SF4 SF4 9 . 
RA 17 SF4 1 501 501 SF4 SF4 B . 
SA 18 FMN 1 502 502 FMN FMN B . 
TA 19 FES 1 201 201 FES FES C . 
UA 17 SF4 1 801 801 SF4 SF4 D . 
VA 17 SF4 1 802 802 SF4 SF4 D . 
WA 17 SF4 1 803 803 SF4 SF4 D . 
XA 19 FES 1 804 804 FES FES D . 
YA 20 DCQ 1 501 501 DCQ DCQ E . 
ZA 17 SF4 1 201 201 SF4 SF4 G . 
AB 17 SF4 1 201 201 SF4 SF4 O . 
BB 17 SF4 1 202 202 SF4 SF4 O . 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS    ? ? ? . 2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   100.40 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6I0D 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     94.700 
_cell.length_a_esd                 ? 
_cell.length_b                     328.000 
_cell.length_b_esd                 ? 
_cell.length_c                     260.900 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        4 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6I0D 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6I0D 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.71 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         66.85 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            296 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
'100 mM Bis-Tris pH 6.0, 23% (w/v) polyethylene glycol (PEG) 4000, 100 mM KCl, 100 mM glutaric acid pH 6.0 and 50 mM NDSB-201' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315r' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2011-03-14 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.900 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ESRF BEAMLINE ID29' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.900 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   ID29 
_diffrn_source.pdbx_synchrotron_site       ESRF 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6I0D 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                3.6 
_reflns.d_resolution_low                 49.0 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       173452 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             96.3 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  2.0 
_reflns.pdbx_Rmerge_I_obs                0.262 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            4.0 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  0.243 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  3.6 
_reflns_shell.d_res_low                   3.79 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         0.6 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           25274 
_reflns_shell.percent_possible_all        95.8 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                1.605 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             2.0 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             1.523 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               80.3 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  
;TLS refinement.

Twin refinement.
TWINNING INFORMATION:                                               
FRACTION: 0.490                                                    
OPERATOR: -h,-k,h+l  

Data cut anisotropically to limits (Angstrom) along a*, b* and c*:
3.6, 4.5, 3.6
;
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6I0D 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            3.600 
_refine.ls_d_res_low                             29.867 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     137819 
_refine.ls_number_reflns_R_free                  1492 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    76.55 
_refine.ls_percent_reflns_R_free                 1.08 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2197 
_refine.ls_R_factor_R_free                       0.2247 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2139 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4HEA 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 20.93 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        73896 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         236 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               74132 
_refine_hist.d_res_high                       3.600 
_refine_hist.d_res_low                        29.867 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.005 ? 76236  ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.816 ? 103968 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 6.863 ? 44662  ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.044 ? 11640  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.006 ? 13102  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 3.6191 3.7482  . . 54  4308  24.00 . . . 0.2482 . 0.2612 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.7482 3.8979  . . 65  7765  44.00 . . . 0.2668 . 0.2491 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.8979 4.0749  . . 114 10527 59.00 . . . 0.2706 . 0.2322 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.0749 4.2891  . . 162 13151 74.00 . . . 0.2543 . 0.2253 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.2891 4.5568  . . 165 16027 90.00 . . . 0.1999 . 0.2148 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.5568 4.9071  . . 200 16970 96.00 . . . 0.2335 . 0.2103 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.9071 5.3981  . . 175 16975 96.00 . . . 0.2074 . 0.2169 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.3981 6.1726  . . 186 17092 96.00 . . . 0.2575 . 0.2344 . . . . . . . . . . 
'X-RAY DIFFRACTION' 6.1726 7.7521  . . 153 16993 95.00 . . . 0.2220 . 0.2193 . . . . . . . . . . 
'X-RAY DIFFRACTION' 7.7521 28.9841 . . 180 16319 91.00 . . . 0.2221 . 0.2071 . . . . . . . . . . 
# 
_struct.entry_id                     6I0D 
_struct.title                        'Respiratory complex I from Thermus thermophilus with bound Decyl-Ubiquinone' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6I0D 
_struct_keywords.text            
'Respiratory chain, complex I, NADH:ubiquinone oxidoreductase, electron transfer, proton translocation, MEMBRANE PROTEIN' 
_struct_keywords.pdbx_keywords   'MEMBRANE PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1  ? 
B  N N 2  ? 
C  N N 3  ? 
D  N N 4  ? 
E  N N 5  ? 
F  N N 6  ? 
G  N N 7  ? 
H  N N 8  ? 
I  N N 9  ? 
J  N N 10 ? 
K  N N 11 ? 
L  N N 12 ? 
M  N N 13 ? 
N  N N 14 ? 
O  N N 15 ? 
P  N N 16 ? 
Q  N N 1  ? 
R  N N 2  ? 
S  N N 3  ? 
T  N N 4  ? 
U  N N 5  ? 
V  N N 6  ? 
W  N N 7  ? 
X  N N 8  ? 
Y  N N 9  ? 
Z  N N 10 ? 
AA N N 11 ? 
BA N N 12 ? 
CA N N 13 ? 
DA N N 14 ? 
EA N N 15 ? 
FA N N 16 ? 
GA N N 17 ? 
HA N N 18 ? 
IA N N 19 ? 
JA N N 17 ? 
KA N N 17 ? 
LA N N 17 ? 
MA N N 19 ? 
NA N N 20 ? 
OA N N 17 ? 
PA N N 17 ? 
QA N N 17 ? 
RA N N 17 ? 
SA N N 18 ? 
TA N N 19 ? 
UA N N 17 ? 
VA N N 17 ? 
WA N N 17 ? 
XA N N 19 ? 
YA N N 20 ? 
ZA N N 17 ? 
AB N N 17 ? 
BB N N 17 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1  UNP NQO1_THET8   Q56222 ? 1  
;MTGPILSGLDPRFERTLYAHVGKEGSWTLDYYLRHGGYETAKRVLKEKTPDEVIEEVKRSGLRGRGGAGFPTGLKWSFMP
KDDGKQHYLICNADESEPGSFKDRYILEDVPHLLIEGMILAGYAIRATVGYIYVRGEYRRAADRLEQAIKEARARGYLGK
NLFGTDFSFDLHVHRGAGAYICGEETALMNSLEGLRANPRLKPPFPAQSGLWGKPTTINNVETLASVVPIMERGADWFAQ
MGTEQSKGMKLYQISGPVKRPGVYELPMGTTFRELIYEWAGGPLEPIQAIIPGGSSTPPLPFTEEVLDTPMSYEHLQAKG
SMLGTGGVILIPERVSMVDAMWNLTRFYAHESCGKCTPCREGVAGFMVNLFAKIGTGQGEEKDVENLEALLPLIEGRSFC
PLADAAVWPVKGSLRHFKDQYLALAREKRPVPRPSLWR
;
1 
2  UNP NQO2_THET8   Q56221 ? 2  
;MGFFDDKQDFLEETFAKYPPEGRRAAIMPLLRRVQQEEGWIRPERIEEIARLVGTTPTEVMGVASFYSYYQFVPTGKYHL
QVCATLSCKLAGAEELWDYLTETLGIGPGEVTPDGLFSVQKVECLGSCHTAPVIQVNDEPYVECVTRARLEALLAGLRAG
KRLEEIELPGKCGHHVHEVEV
;
1 
3  UNP NQO3_THET8   Q56223 ? 3  
;MVRVKVNDRIVEVPPGTSVMDAVFHAGYDVPLFCSEKHLSPIGACRMCLVRIGLPKKGPDGKPLLNEKGEPEIQWQPKLA
ASCVTAVADGMVVDTLSDVVREAQAGMVEFTLLNHPLDCPTCDKGGACELQDRTVEYGLYEKYYQKGPLELPVYTRFEFT
RRHVDKHHPLSPFVILDRERCIHCKRCVRYFEEVPGDEVLDFIERGVHTFIGTMDFGLPSGFSGNITDICPVGALLDLTA
RFRARNWEMEETPTTCALCPVGCGITADTRSGELLRIRAREVPEVNEIWICDAGRFGHEWADQNRLKTPLVRKEGRLVEA
TWEEAFLALKEGLKEARGEEVGLYLAHDATLEEGLLASELAKALKTPHLDFQGRTAAPASLFPPASLEDLLQADFALVLG
DPTEEAPILHLRLSEFVRDLKPPHRYNHGTPFADLQIKERMPRRTDKMALFAPYRAPLMKWAAIHEVHRPGEEREILLAL
LGDKEGSEMVAKAKEAWEKAKNPVLILGAGVLQDTVAAERARLLAERKGAKVLAMTPAANARGLEAMGVLPGAKGASWDE
PGALYAYYGFVPPEEALKGKRFVVMHLSHLHPLAERYAHVVLPAPTFYEKRGHLVNLEGRVLPLSPAPIENGEAEGALQV
LALLAEALGVRPPFRLHLEAQKALKARKVPEAMGRLSFRLKELRPKERKGAFYLRPTMWKAHQAVGKAQEAARAELWAHP
ETARAEALPEGAQVAVETPFGRVEARVVHREDVPKGHLYLSALGPAAGLRVEGRVLVPAGGEA
;
1 
4  UNP NQO4_THET8   Q56220 ? 4  
;MREEFLEEIPLDAPPEEAKELRTEVMTLNVGPQHPSTHGVLRLMVTLSGEEVLEVVPHIGYLHTGFEKTMEHRTYLQNIT
YTPRMDYLHSFAHDLAYALAVEKLLGAVVPPRAETIRVILNELSRLASHLVFLGTGLLDLGALTPFFYAFRERETILDLF
EWVTGQRFHHNYIRIGGVKEDLPEEFVPELKKLLEVLPHRIDEYEALFAESPIFYERARGVGVIPPEVAIDLGLTGGSLR
ASGVNYDVRKAYPYSGYETYTFDVPLGERGDVFDRMLVRIREMRESVKIIKQALERLEPGPVRDPNPQITPPPRHLLETS
MEAVIYHFKHYTEGFHPPKGEVYVPTESARGELGYYIVSDGGSMPYRVKVRAPSFVNLQSLPYACKGEQVPDMVAIIASL
DPVMGDVDR
;
1 
5  UNP NQO5_THET8   Q56219 ? 5  
;MRLERVLEEARAKGYPIEDNGLGNLWVVLPRERFKEEMAHYKAMGFNFLADIVGLDYLTYPDPRPERFAVVYELVSLPGW
KDGDGSRFFVRVYVPEEDPRLPTVTDLWGSANFLEREVYDLFGIVFEGHPDLRKILTPEDLEGHPLRKDYPLGETPTLFR
EGRYIIPAEFRAALTGKDPGLTFYKGGSRKGYRSLWADLKKAREVKG
;
1 
6  UNP NQO6_THET8   Q56218 ? 6  
;MALKDLFERDVQELEREGILFTTLEKLVAWGRSNSLWPATFGLACCAIEMMASTDARNDLARFGSEVFRASPRQADVMIV
AGRLSKKMAPVMRRVWEQMPDPKWVISMGACASSGGMFNNYAIVQNVDSVVPVDVYVPGCPPRPEALIYAVMQLQKKVRG
QAYNERGERLPPVAAWKRTRG
;
1 
7  UNP NQO9_THET8   Q56224 ? 7  
;MTLKALAQSLGITLKYLFSKPVTVPYPDAPVALKPRFHGRHVLTRHPNGLEKCIGCSLCAAACPAYAIYVEPAENDPENP
VSAGERYAKVYEINMLRCIFCGLCEEACPTGAIVLGYDFEMADYEYSDLVYGKEDMLVDVVGTKPQRREAKRTGKPVKVG
YVVPYVRPELEGFKAPTEGGKR
;
1 
8  UNP NQO15_THET8  Q5SKZ7 ? 8  
;MSASSERELYEAWVELLSWMREYAQAKGVRFEKEADFPDFIYRMERPYDLPTTIMTASLSDGLGEPFLLADVSPRHAKLK
RIGLRLPRAHIHLHAHYEPGKGLVTGKIPLTKERFFALADRAREALAFA
;
1 
9  UNP Q5SI52_THET8 Q5SI52 ? 9  
;MVRVGMRAAPRVSLEALKAALGGLKLSEAKVYLITDWQDKRDQARYALLLHTGKKDLLVPDAFGPAFPGGEEALSELVGL
LLAQGARRFYEAVVSPGEMTALLDLPPEELLKRVMAIANPTDPGIYLKRAA
;
1 
10 UNP NQO7_THET8   Q56217 ? 10 
;MAPIQEYVGTLIYVGVALFIGVAALLVGALLGPKKPGRAKLMPYESGNDPAGEVKRFPVHFYVVAMLFILFDVEVAFLWP
YAVSAGGLGLYGFLGVLAFTLLLFVGFLYEWWKGVMRWH
;
1 
11 UNP NQO10_THET8  Q56225 ? 11 
;MSLLEGLALFLLLLSGVLVVTLRNAIHAALALILNFLVLAGVYVALDARFLGFIQVIVYAGAIVVLFLFVIMLLFAAQGE
IGFDPLVRSRPLAALLALGVAGILAAGLWGLDLAFTQDLKGGLPQALGPLLYGDWLFVLLAVGFLLMAATVVAVALVEPG
KASRAKEAEKREEVAR
;
1 
12 UNP NQO11_THET8  Q56226 ? 12 
;MSYLLTSALLFALGVYGVLTRRTAILVFLSIELMLNAANLSLVGFARAYGLDGQVAALMVIAVAAAEVAVGLGLIVAIFR
HRESTAVDDLSELRG
;
1 
13 UNP NQO12_THET8  Q56227 ? 13 
;MALLGTILLPLLGFALLGLFGKRMREPLPGVLASGLVLASFLLGAGLLLSGGARFQAEWLPGIPFSLLLDNLSGFMLLIV
TGVGFLIHVYAIGYMGGDPGYSRFFAYFNLFIAMMLTLVLADSYPVMFIGWEGVGLASFLLIGFWYKNPQYADSARKAFI
VNRIGDLGFMLGMAILWALYGTLSISELKEAMEGPLKNPDLLALAGLLLFLGAVGKSAQIPLMVWLPDAMAGPTPVSALI
HAATMVTAGVYLIARSSFLYSVLPDVSYAIAVVGLLTAAYGALSAFGQTDIKKIVAYSTISQLGYMFLAAGVGAYWVALF
HVFTHAFFKALLFLASGSVIHALGGEQDVRKMGGLWKHLPQTRWHALIGALALGGLPLLSGFWSKDAILAATLTYPFGGV
GFYVGALLVAVLTAMYAMRWFVLVFLGEERGHHHPHEAPPVMLWPNHLLALGSVLAGYLALPHPLPNVLEPFLKPALAEV
EAHHLSLGAEWGLIALSAAVALLGLWAGFVFFQRKVFPAWYLAFEAASREAFYVDRAYNALIVNPLKALAEALFYGDRGL
LSGYFGLGGAARSLGQGLARLQTGYLRVYALLFVLGALLLLGVMRW
;
1 
14 UNP NQO13_THET8  Q56228 ? 14 
;MVVLAVLLPVVFGALLLLGLPRALGVLGAGLSFLLNLYLFLTHPGGVAHAFQAPLLPGAGVYWAFGLDGLSALFFLTIAL
TVFLGALVARVEGRFLGLALLMEGLLLGLFAARDLLVFYVFFEAALIPALLMLYLYGGEGRTRALYTFVLFTLVGSLPML
AAVLGARLLSGSPTFLLEDLLAHPLQEEAAFWVFLGFALAFAIKTPLFPLHAWLPPFHQENHPSGLADALGTLYKVGVFA
FFRFAIPLAPEGFAQAQGLLLFLAALSALYGAWVAFAAKDFKTLLAYAGLSHMGVAALGVFSGTPEGAMGGLYLLAASGV
YTGGLFLLAGRLYERTGTLEIGRYRGLAQSAPGLAALALILFLAMVGLPGLSGFPGEFLTLLGAYKASPWLAALAFLSVI
ASAAYALTAFQKTFWEEGGSGVKDLAGAEWGFALLSVLALLLMGVFPGYFARGLHPLAEAFAKLLGGGA
;
1 
15 UNP NQO14_THET8  Q56229 ? 15 
;MTLAILAVFSVALTLLGFVLPPQGVKRATLLGLALALASLLLTWGKPFAFGPYAVDGVSQVFTLLALLGALWTVGLVRSG
RFEFYLLVLYAALGMHLLASTRHLLLMLVALEALSLPLYALATWRRGQGLEAALKYFLLGALAAAFFLYGAALFYGATGS
LVLGAPGEGPLYALALGLLLVGLGFKAALAPFHFWTPDVYQGSPTPVVLFMATSVKAAAFAALLRVAAPPEALALLVALS
VVVGNLAALAQKEAKRLLAYSSIAHAGYMALALYTGNAQALGFYLLTYVLATGLAFAVLSQISPDRVPLEALRGLYRKDP
LLGLAFLVAMLSLLGLPPLAGFWGKYLAFAEAARAGAWGVLVLALVTSAVSAYYYLGLGLAVFARPEETPFRPGPPWARA
AVVAAGVLLLALGLLPGLVLPALAAGG
;
1 
16 UNP NQO8_THET8   Q60019 ? 16 
;MTWSYPVDPYWMVALKALLVVVGLLTAFAFMTLIERRLLARFQVRMGPNRVGPFGLLQPLADAIKSIFKEDIVVAQADRF
LFVLAPLISVVFALLAFGLIPFGPPGSFFGYQPWVINLDLGILYLFAVSELAVYGIFLSGWASGSKYSLLGSLRSSASLI
SYELGLGLALLAPVLLVGSLNLNDIVNWQKEHGWLFLYAFPAFLVYLIASMAEAARTPFDLPEAEQELVGGYHTEYSSIK
WALFQMAEYIHFITASALIPTLFLGGWTMPVLEVPYLWMFLKIAFFLFFFIWIRATWFRLRYDQLLRFGWGFLFPLALLW
FLVTALVVALDLPRTYLLYLSALSFLVLLGAVLYTPKPARKGGGA
;
1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1  6I0D 1 1 ? 438 ? Q56222 1 ? 438 ? 1 438 
2  2  6I0D 2 1 ? 181 ? Q56221 1 ? 181 ? 1 181 
3  3  6I0D 3 1 ? 783 ? Q56223 1 ? 783 ? 1 783 
4  4  6I0D 4 1 ? 409 ? Q56220 1 ? 409 ? 1 409 
5  5  6I0D 5 1 ? 207 ? Q56219 1 ? 207 ? 1 207 
6  6  6I0D 6 1 ? 181 ? Q56218 1 ? 181 ? 1 181 
7  7  6I0D 9 1 ? 182 ? Q56224 1 ? 182 ? 1 182 
8  8  6I0D 7 1 ? 129 ? Q5SKZ7 1 ? 129 ? 1 129 
9  9  6I0D W 1 ? 131 ? Q5SI52 1 ? 131 ? 1 131 
10 10 6I0D A 1 ? 119 ? Q56217 1 ? 119 ? 1 119 
11 11 6I0D J 1 ? 176 ? Q56225 1 ? 176 ? 1 176 
12 12 6I0D K 1 ? 95  ? Q56226 1 ? 95  ? 1 95  
13 13 6I0D L 1 ? 606 ? Q56227 1 ? 606 ? 1 606 
14 14 6I0D M 1 ? 469 ? Q56228 1 ? 469 ? 1 469 
15 15 6I0D N 1 ? 427 ? Q56229 1 ? 427 ? 1 427 
16 16 6I0D H 1 ? 365 ? Q60019 1 ? 365 ? 1 365 
17 1  6I0D B 1 ? 438 ? Q56222 1 ? 438 ? 1 438 
18 2  6I0D C 1 ? 181 ? Q56221 1 ? 181 ? 1 181 
19 3  6I0D D 1 ? 783 ? Q56223 1 ? 783 ? 1 783 
20 4  6I0D E 1 ? 409 ? Q56220 1 ? 409 ? 1 409 
21 5  6I0D F 1 ? 207 ? Q56219 1 ? 207 ? 1 207 
22 6  6I0D G 1 ? 181 ? Q56218 1 ? 181 ? 1 181 
23 7  6I0D O 1 ? 182 ? Q56224 1 ? 182 ? 1 182 
24 8  6I0D I 1 ? 129 ? Q5SKZ7 1 ? 129 ? 1 129 
25 9  6I0D X 1 ? 131 ? Q5SI52 1 ? 131 ? 1 131 
26 10 6I0D P 1 ? 119 ? Q56217 1 ? 119 ? 1 119 
27 11 6I0D R 1 ? 176 ? Q56225 1 ? 176 ? 1 176 
28 12 6I0D S 1 ? 95  ? Q56226 1 ? 95  ? 1 95  
29 13 6I0D T 1 ? 606 ? Q56227 1 ? 606 ? 1 606 
30 14 6I0D U 1 ? 469 ? Q56228 1 ? 469 ? 1 469 
31 15 6I0D V 1 ? 427 ? Q56229 1 ? 427 ? 1 427 
32 16 6I0D Q 1 ? 365 ? Q60019 1 ? 365 ? 1 365 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? hexadecameric 16 
2 author_defined_assembly ? hexadecameric 16 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,GA,HA,IA,JA,KA,LA,MA,NA,OA,PA,QA       
2 1 Q,R,S,T,U,V,W,X,Y,Z,AA,BA,CA,DA,EA,FA,RA,SA,TA,UA,VA,WA,XA,YA,ZA,AB,BB 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'gel filtration' 
_pdbx_struct_assembly_auth_evidence.details                ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 LEU A  17  ? VAL A  21  ? LEU 1 17  VAL 1 21  5 ? 5  
HELX_P HELX_P2   AA2 THR A  28  ? HIS A  35  ? THR 1 28  HIS 1 35  1 ? 8  
HELX_P HELX_P3   AA3 TYR A  38  ? LYS A  48  ? TYR 1 38  LYS 1 48  1 ? 11 
HELX_P HELX_P4   AA4 THR A  49  ? GLY A  61  ? THR 1 49  GLY 1 61  1 ? 13 
HELX_P HELX_P5   AA5 PRO A  71  ? PHE A  78  ? PRO 1 71  PHE 1 78  1 ? 8  
HELX_P HELX_P6   AA6 PHE A  101 ? VAL A  110 ? PHE 1 101 VAL 1 110 1 ? 10 
HELX_P HELX_P7   AA7 VAL A  110 ? ARG A  126 ? VAL 1 110 ARG 1 126 1 ? 17 
HELX_P HELX_P8   AA8 TYR A  138 ? ARG A  155 ? TYR 1 138 ARG 1 155 1 ? 18 
HELX_P HELX_P9   AA9 ALA A  179 ? GLY A  183 ? ALA 1 179 GLY 1 183 5 ? 5  
HELX_P HELX_P10  AB1 GLU A  184 ? GLY A  194 ? GLU 1 184 GLY 1 194 1 ? 11 
HELX_P HELX_P11  AB2 GLY A  210 ? LYS A  214 ? GLY 1 210 LYS 1 214 5 ? 5  
HELX_P HELX_P12  AB3 VAL A  221 ? ARG A  233 ? VAL 1 221 ARG 1 233 1 ? 13 
HELX_P HELX_P13  AB4 TRP A  237 ? MET A  241 ? TRP 1 237 MET 1 241 5 ? 5  
HELX_P HELX_P14  AB5 THR A  271 ? TRP A  279 ? THR 1 271 TRP 1 279 1 ? 9  
HELX_P HELX_P15  AB6 THR A  303 ? ASP A  308 ? THR 1 303 ASP 1 308 1 ? 6  
HELX_P HELX_P16  AB7 LEU A  316 ? GLY A  320 ? LEU 1 316 GLY 1 320 5 ? 5  
HELX_P HELX_P17  AB8 SER A  336 ? GLU A  351 ? SER 1 336 GLU 1 351 1 ? 16 
HELX_P HELX_P18  AB9 CYS A  356 ? PHE A  366 ? CYS 1 356 PHE 1 366 1 ? 11 
HELX_P HELX_P19  AC1 PHE A  366 ? THR A  376 ? PHE 1 366 THR 1 376 1 ? 11 
HELX_P HELX_P20  AC2 GLU A  380 ? LEU A  391 ? GLU 1 380 LEU 1 391 1 ? 12 
HELX_P HELX_P21  AC3 LEU A  391 ? GLY A  396 ? LEU 1 391 GLY 1 396 1 ? 6  
HELX_P HELX_P22  AC4 PRO A  401 ? LYS A  428 ? PRO 1 401 LYS 1 428 1 ? 28 
HELX_P HELX_P23  AC5 LYS B  7   ? ALA B  16  ? LYS 2 7   ALA 2 16  1 ? 10 
HELX_P HELX_P24  AC6 GLY B  22  ? ALA B  25  ? GLY 2 22  ALA 2 25  5 ? 4  
HELX_P HELX_P25  AC7 ALA B  26  ? GLY B  39  ? ALA 2 26  GLY 2 39  1 ? 14 
HELX_P HELX_P26  AC8 ARG B  42  ? GLY B  54  ? ARG 2 42  GLY 2 54  1 ? 13 
HELX_P HELX_P27  AC9 THR B  56  ? SER B  65  ? THR 2 56  SER 2 65  1 ? 10 
HELX_P HELX_P28  AD1 THR B  85  ? ALA B  91  ? THR 2 85  ALA 2 91  1 ? 7  
HELX_P HELX_P29  AD2 GLY B  92  ? GLY B  105 ? GLY 2 92  GLY 2 105 1 ? 14 
HELX_P HELX_P30  AD3 THR B  146 ? ALA B  159 ? THR 2 146 ALA 2 159 1 ? 14 
HELX_P HELX_P31  AD4 SER C  18  ? ALA C  26  ? SER 3 18  ALA 3 26  1 ? 9  
HELX_P HELX_P32  AD5 SER C  97  ? LEU C  113 ? SER 3 97  LEU 3 113 1 ? 17 
HELX_P HELX_P33  AD6 ASP C  118 ? CYS C  122 ? ASP 3 118 CYS 3 122 5 ? 5  
HELX_P HELX_P34  AD7 CYS C  128 ? GLY C  138 ? CYS 3 128 GLY 3 138 1 ? 11 
HELX_P HELX_P35  AD8 LYS C  185 ? VAL C  194 ? LYS 3 185 VAL 3 194 1 ? 10 
HELX_P HELX_P36  AD9 ARG C  205 ? THR C  209 ? ARG 3 205 THR 3 209 5 ? 5  
HELX_P HELX_P37  AE1 GLY C  224 ? CYS C  230 ? GLY 3 224 CYS 3 230 1 ? 7  
HELX_P HELX_P38  AE2 THR C  239 ? ARG C  241 ? THR 3 239 ARG 3 241 5 ? 3  
HELX_P HELX_P39  AE3 ARG C  245 ? MET C  249 ? ARG 3 245 MET 3 249 5 ? 5  
HELX_P HELX_P40  AE4 CYS C  291 ? GLY C  297 ? CYS 3 291 GLY 3 297 1 ? 7  
HELX_P HELX_P41  AE5 HIS C  298 ? GLN C  303 ? HIS 3 298 GLN 3 303 1 ? 6  
HELX_P HELX_P42  AE6 THR C  321 ? LYS C  334 ? THR 3 321 LYS 3 334 1 ? 14 
HELX_P HELX_P43  AE7 THR C  350 ? LEU C  364 ? THR 3 350 LEU 3 364 1 ? 15 
HELX_P HELX_P44  AE8 PRO C  378 ? PHE C  382 ? PRO 3 378 PHE 3 382 5 ? 5  
HELX_P HELX_P45  AE9 SER C  386 ? GLN C  392 ? SER 3 386 GLN 3 392 1 ? 7  
HELX_P HELX_P46  AF1 ASP C  401 ? ALA C  406 ? ASP 3 401 ALA 3 406 1 ? 6  
HELX_P HELX_P47  AF2 ALA C  406 ? ARG C  418 ? ALA 3 406 ARG 3 418 1 ? 13 
HELX_P HELX_P48  AF3 ALA C  456 ? TRP C  461 ? ALA 3 456 TRP 3 461 5 ? 6  
HELX_P HELX_P49  AF4 GLU C  472 ? GLY C  482 ? GLU 3 472 GLY 3 482 1 ? 11 
HELX_P HELX_P50  AF5 SER C  487 ? ALA C  500 ? SER 3 487 ALA 3 500 1 ? 14 
HELX_P HELX_P51  AF6 GLY C  508 ? GLN C  513 ? GLY 3 508 GLN 3 513 1 ? 6  
HELX_P HELX_P52  AF7 ASP C  514 ? LYS C  528 ? ASP 3 514 LYS 3 528 1 ? 15 
HELX_P HELX_P53  AF8 ASN C  540 ? MET C  547 ? ASN 3 540 MET 3 547 1 ? 8  
HELX_P HELX_P54  AF9 PRO C  573 ? LYS C  578 ? PRO 3 573 LYS 3 578 1 ? 6  
HELX_P HELX_P55  AG1 LEU C  593 ? ALA C  598 ? LEU 3 593 ALA 3 598 1 ? 6  
HELX_P HELX_P56  AG2 THR C  606 ? LYS C  610 ? THR 3 606 LYS 3 610 5 ? 5  
HELX_P HELX_P57  AG3 GLY C  636 ? ALA C  647 ? GLY 3 636 ALA 3 647 1 ? 12 
HELX_P HELX_P58  AG4 LEU C  656 ? ARG C  667 ? LEU 3 656 ARG 3 667 1 ? 12 
HELX_P HELX_P59  AG5 LYS C  700 ? ALA C  704 ? LYS 3 700 ALA 3 704 5 ? 5  
HELX_P HELX_P60  AG6 VAL C  705 ? GLN C  709 ? VAL 3 705 GLN 3 709 5 ? 5  
HELX_P HELX_P61  AG7 HIS C  719 ? GLU C  726 ? HIS 3 719 GLU 3 726 1 ? 8  
HELX_P HELX_P62  AG8 GLY D  65  ? MET D  70  ? GLY 4 65  MET 4 70  1 ? 6  
HELX_P HELX_P63  AG9 GLU D  71  ? ARG D  73  ? GLU 4 71  ARG 4 73  5 ? 3  
HELX_P HELX_P64  AH1 LEU D  76  ? MET D  85  ? LEU 4 76  MET 4 85  5 ? 10 
HELX_P HELX_P65  AH2 SER D  90  ? GLY D  106 ? SER 4 90  GLY 4 106 1 ? 17 
HELX_P HELX_P66  AH3 PRO D  110 ? LEU D  140 ? PRO 4 110 LEU 4 140 1 ? 31 
HELX_P HELX_P67  AH4 THR D  144 ? GLY D  165 ? THR 4 144 GLY 4 165 1 ? 22 
HELX_P HELX_P68  AH5 GLU D  185 ? ALA D  209 ? GLU 4 185 ALA 4 209 1 ? 25 
HELX_P HELX_P69  AH6 ILE D  213 ? ARG D  219 ? ILE 4 213 ARG 4 219 1 ? 7  
HELX_P HELX_P70  AH7 PRO D  225 ? LEU D  232 ? PRO 4 225 LEU 4 232 1 ? 8  
HELX_P HELX_P71  AH8 LEU D  239 ? GLY D  243 ? LEU 4 239 GLY 4 243 5 ? 5  
HELX_P HELX_P72  AH9 ASP D  247 ? TYR D  252 ? ASP 4 247 TYR 4 252 1 ? 6  
HELX_P HELX_P73  AI1 GLY D  256 ? TYR D  260 ? GLY 4 256 TYR 4 260 5 ? 5  
HELX_P HELX_P74  AI2 ASP D  271 ? ARG D  296 ? ASP 4 271 ARG 4 296 1 ? 26 
HELX_P HELX_P75  AI3 ARG D  314 ? THR D  319 ? ARG 4 314 THR 4 319 5 ? 6  
HELX_P HELX_P76  AI4 SER D  320 ? GLU D  333 ? SER 4 320 GLU 4 333 1 ? 14 
HELX_P HELX_P77  AI5 ALA D  372 ? LEU D  378 ? ALA 4 372 LEU 4 378 1 ? 7  
HELX_P HELX_P78  AI6 SER D  380 ? CYS D  385 ? SER 4 380 CYS 4 385 1 ? 6  
HELX_P HELX_P79  AI7 PRO D  391 ? ASP D  401 ? PRO 4 391 ASP 4 401 1 ? 11 
HELX_P HELX_P80  AI8 VAL D  403 ? ASP D  408 ? VAL 4 403 ASP 4 408 1 ? 6  
HELX_P HELX_P81  AI9 ARG E  2   ? LYS E  13  ? ARG 5 2   LYS 5 13  1 ? 12 
HELX_P HELX_P82  AJ1 PRO E  30  ? MET E  44  ? PRO 5 30  MET 5 44  1 ? 15 
HELX_P HELX_P83  AJ2 SER E  110 ? PHE E  122 ? SER 5 110 PHE 5 122 1 ? 13 
HELX_P HELX_P84  AJ3 ILE E  166 ? ARG E  171 ? ILE 5 166 ARG 5 171 1 ? 6  
HELX_P HELX_P85  AJ4 GLY E  186 ? GLY E  191 ? GLY 5 186 GLY 5 191 5 ? 6  
HELX_P HELX_P86  AJ5 PHE F  21  ? SER F  35  ? PHE 6 21  SER 6 35  1 ? 15 
HELX_P HELX_P87  AJ6 CYS F  45  ? SER F  53  ? CYS 6 45  SER 6 53  1 ? 9  
HELX_P HELX_P88  AJ7 SER F  71  ? ALA F  75  ? SER 6 71  ALA 6 75  5 ? 5  
HELX_P HELX_P89  AJ8 SER F  85  ? LYS F  87  ? SER 6 85  LYS 6 87  5 ? 3  
HELX_P HELX_P90  AJ9 MET F  88  ? GLN F  98  ? MET 6 88  GLN 6 98  1 ? 11 
HELX_P HELX_P91  AK1 GLY F  109 ? SER F  114 ? GLY 6 109 SER 6 114 1 ? 6  
HELX_P HELX_P92  AK2 ASN F  126 ? VAL F  130 ? ASN 6 126 VAL 6 130 5 ? 5  
HELX_P HELX_P93  AK3 ARG F  143 ? ARG F  159 ? ARG 6 143 ARG 6 159 1 ? 17 
HELX_P HELX_P94  AK4 LEU G  3   ? SER G  19  ? LEU 9 3   SER 9 19  1 ? 17 
HELX_P HELX_P95  AK5 SER G  57  ? ALA G  62  ? SER 9 57  ALA 9 62  1 ? 6  
HELX_P HELX_P96  AK6 GLY G  102 ? CYS G  108 ? GLY 9 102 CYS 9 108 1 ? 7  
HELX_P HELX_P97  AK7 GLU G  125 ? ASP G  128 ? GLU 9 125 ASP 9 128 5 ? 4  
HELX_P HELX_P98  AK8 GLY G  132 ? MET G  136 ? GLY 9 132 MET 9 136 5 ? 5  
HELX_P HELX_P99  AK9 THR G  143 ? GLY G  154 ? THR 9 143 GLY 9 154 1 ? 12 
HELX_P HELX_P100 AL1 ARG G  167 ? GLU G  171 ? ARG 9 167 GLU 9 171 5 ? 5  
HELX_P HELX_P101 AL2 SER H  4   ? GLY H  28  ? SER 7 4   GLY 7 28  1 ? 25 
HELX_P HELX_P102 AL3 PHE H  37  ? TYR H  42  ? PHE 7 37  TYR 7 42  1 ? 6  
HELX_P HELX_P103 AL4 THR H  111 ? ALA H  127 ? THR 7 111 ALA 7 127 1 ? 17 
HELX_P HELX_P104 AL5 ALA I  9   ? GLY I  22  ? ALA W 9   GLY W 22  1 ? 14 
HELX_P HELX_P105 AL6 GLY I  69  ? GLN I  84  ? GLY W 69  GLN W 84  1 ? 16 
HELX_P HELX_P106 AL7 GLY I  97  ? LEU I  103 ? GLY W 97  LEU W 103 1 ? 7  
HELX_P HELX_P107 AL8 PRO I  106 ? ALA I  118 ? PRO W 106 ALA W 118 1 ? 13 
HELX_P HELX_P108 AL9 ASP I  122 ? LEU I  127 ? ASP W 122 LEU W 127 5 ? 6  
HELX_P HELX_P109 AM1 PRO J  3   ? LEU J  31  ? PRO A 3   LEU A 31  1 ? 29 
HELX_P HELX_P110 AM2 GLY J  37  ? MET J  42  ? GLY A 37  MET A 42  1 ? 6  
HELX_P HELX_P111 AM3 VAL J  59  ? SER J  84  ? VAL A 59  SER A 84  1 ? 26 
HELX_P HELX_P112 AM4 LEU J  88  ? GLY J  114 ? LEU A 88  GLY A 114 1 ? 27 
HELX_P HELX_P113 AM5 SER K  2   ? LEU K  22  ? SER J 2   LEU J 22  1 ? 21 
HELX_P HELX_P114 AM6 ASN K  24  ? LEU K  46  ? ASN J 24  LEU J 46  1 ? 23 
HELX_P HELX_P115 AM7 ARG K  49  ? TYR K  59  ? ARG J 49  TYR J 59  1 ? 11 
HELX_P HELX_P116 AM8 ALA K  62  ? LEU K  74  ? ALA J 62  LEU J 74  1 ? 13 
HELX_P HELX_P117 AM9 ARG K  88  ? TRP K  109 ? ARG J 88  TRP J 109 1 ? 22 
HELX_P HELX_P118 AN1 LEU K  123 ? TYR K  132 ? LEU J 123 TYR J 132 1 ? 10 
HELX_P HELX_P119 AN2 TRP K  135 ? GLU K  158 ? TRP J 135 GLU J 158 1 ? 24 
HELX_P HELX_P120 AN3 SER L  2   ? ARG L  21  ? SER K 2   ARG K 21  1 ? 20 
HELX_P HELX_P121 AN4 THR L  23  ? GLY L  50  ? THR K 23  GLY K 50  1 ? 28 
HELX_P HELX_P122 AN5 LEU L  51  ? ARG L  80  ? LEU K 51  ARG K 80  1 ? 30 
HELX_P HELX_P123 AN6 ALA L  86  ? LEU L  90  ? ALA K 86  LEU K 90  5 ? 5  
HELX_P HELX_P124 AN7 ALA M  2   ? PHE M  20  ? ALA L 2   PHE L 20  1 ? 19 
HELX_P HELX_P125 AN8 PRO M  27  ? SER M  50  ? PRO L 27  SER L 50  1 ? 24 
HELX_P HELX_P126 AN9 ASP M  70  ? MET M  95  ? ASP L 70  MET L 95  1 ? 26 
HELX_P HELX_P127 AO1 GLY M  100 ? LEU M  120 ? GLY L 100 LEU L 120 1 ? 21 
HELX_P HELX_P128 AO2 SER M  123 ? GLY M  143 ? SER L 123 GLY L 143 1 ? 21 
HELX_P HELX_P129 AO3 ALA M  152 ? LEU M  179 ? ALA L 152 LEU L 179 1 ? 28 
HELX_P HELX_P130 AO4 SER M  184 ? GLU M  193 ? SER L 184 GLU L 193 1 ? 10 
HELX_P HELX_P131 AO5 ASN M  198 ? ALA M  218 ? ASN L 198 ALA L 218 1 ? 21 
HELX_P HELX_P132 AO6 PRO M  221 ? MET M  223 ? PRO L 221 MET L 223 5 ? 3  
HELX_P HELX_P133 AO7 VAL M  224 ? ALA M  229 ? VAL L 224 ALA L 229 1 ? 6  
HELX_P HELX_P134 AO8 MET M  230 ? GLY M  232 ? MET L 230 GLY L 232 5 ? 3  
HELX_P HELX_P135 AO9 PRO M  233 ? ALA M  242 ? PRO L 233 ALA L 242 1 ? 10 
HELX_P HELX_P136 AP1 VAL M  246 ? SER M  256 ? VAL L 246 SER L 256 1 ? 11 
HELX_P HELX_P137 AP2 SER M  256 ? SER M  261 ? SER L 256 SER L 261 1 ? 6  
HELX_P HELX_P138 AP3 LEU M  263 ? GLN M  288 ? LEU L 263 GLN L 288 1 ? 26 
HELX_P HELX_P139 AP4 ASP M  290 ? VAL M  312 ? ASP L 290 VAL L 312 1 ? 23 
HELX_P HELX_P140 AP5 ALA M  314 ? LEU M  343 ? ALA L 314 LEU L 343 1 ? 30 
HELX_P HELX_P141 AP6 GLN M  361 ? GLY M  375 ? GLN L 361 GLY L 375 1 ? 15 
HELX_P HELX_P142 AP7 LEU M  379 ? TYR M  395 ? LEU L 379 TYR L 395 1 ? 17 
HELX_P HELX_P143 AP8 GLY M  399 ? LEU M  426 ? GLY L 399 LEU L 426 1 ? 28 
HELX_P HELX_P144 AP9 PRO M  439 ? GLY M  457 ? PRO L 439 GLY L 457 1 ? 19 
HELX_P HELX_P145 AQ1 TYR M  458 ? ALA M  460 ? TYR L 458 ALA L 460 5 ? 3  
HELX_P HELX_P146 AQ2 VAL M  468 ? LEU M  477 ? VAL L 468 LEU L 477 1 ? 10 
HELX_P HELX_P147 AQ3 GLY M  488 ? ARG M  514 ? GLY L 488 ARG L 514 1 ? 27 
HELX_P HELX_P148 AQ4 PRO M  518 ? GLU M  530 ? PRO L 518 GLU L 530 1 ? 13 
HELX_P HELX_P149 AQ5 VAL M  534 ? ILE M  542 ? VAL L 534 ILE L 542 1 ? 9  
HELX_P HELX_P150 AQ6 ILE M  542 ? LEU M  581 ? ILE L 542 LEU L 581 1 ? 40 
HELX_P HELX_P151 AQ7 TYR M  585 ? MET M  604 ? TYR L 585 MET L 604 1 ? 20 
HELX_P HELX_P152 AQ8 VAL N  2   ? LEU N  18  ? VAL M 2   LEU M 18  1 ? 17 
HELX_P HELX_P153 AQ9 PRO N  21  ? LEU N  41  ? PRO M 21  LEU M 41  1 ? 21 
HELX_P HELX_P154 AR1 ASP N  68  ? ALA N  89  ? ASP M 68  ALA M 89  1 ? 22 
HELX_P HELX_P155 AR2 PHE N  95  ? ALA N  112 ? PHE M 95  ALA M 112 1 ? 18 
HELX_P HELX_P156 AR3 ASP N  114 ? ALA N  125 ? ASP M 114 ALA M 125 1 ? 12 
HELX_P HELX_P157 AR4 ALA N  125 ? LEU N  135 ? ALA M 125 LEU M 135 1 ? 11 
HELX_P HELX_P158 AR5 GLY N  140 ? GLY N  171 ? GLY M 140 GLY M 171 1 ? 32 
HELX_P HELX_P159 AR6 LEU N  176 ? HIS N  183 ? LEU M 176 HIS M 183 1 ? 8  
HELX_P HELX_P160 AR7 ALA N  189 ? ILE N  203 ? ALA M 189 ILE M 203 1 ? 15 
HELX_P HELX_P161 AR8 LEU N  207 ? HIS N  211 ? LEU M 207 HIS M 211 5 ? 5  
HELX_P HELX_P162 AR9 TRP N  213 ? GLU N  220 ? TRP M 213 GLU M 220 1 ? 8  
HELX_P HELX_P163 AS1 GLY N  225 ? LEU N  233 ? GLY M 225 LEU M 233 1 ? 9  
HELX_P HELX_P164 AS2 VAL N  236 ? PHE N  244 ? VAL M 236 PHE M 244 1 ? 9  
HELX_P HELX_P165 AS3 PHE N  244 ? ALA N  249 ? PHE M 244 ALA M 249 1 ? 6  
HELX_P HELX_P166 AS4 ALA N  249 ? ALA N  275 ? ALA M 249 ALA M 275 1 ? 27 
HELX_P HELX_P167 AS5 PHE N  276 ? ALA N  278 ? PHE M 276 ALA M 278 5 ? 3  
HELX_P HELX_P168 AS6 ASP N  280 ? SER N  302 ? ASP M 280 SER M 302 1 ? 23 
HELX_P HELX_P169 AS7 THR N  304 ? GLY N  337 ? THR M 304 GLY M 337 1 ? 34 
HELX_P HELX_P170 AS8 GLY N  346 ? ALA N  351 ? GLY M 346 ALA M 351 1 ? 6  
HELX_P HELX_P171 AS9 GLY N  353 ? GLY N  367 ? GLY M 353 GLY M 367 1 ? 15 
HELX_P HELX_P172 AT1 SER N  372 ? SER N  388 ? SER M 372 SER M 388 1 ? 17 
HELX_P HELX_P173 AT2 SER N  388 ? PHE N  396 ? SER M 388 PHE M 396 1 ? 9  
HELX_P HELX_P174 AT3 SER N  398 ? PHE N  414 ? SER M 398 PHE M 414 1 ? 17 
HELX_P HELX_P175 AT4 ALA N  426 ? PHE N  446 ? ALA M 426 PHE M 446 1 ? 21 
HELX_P HELX_P176 AT5 GLY N  453 ? LEU N  464 ? GLY M 453 LEU M 464 1 ? 12 
HELX_P HELX_P177 AT6 THR O  2   ? LEU O  20  ? THR N 2   LEU N 20  1 ? 19 
HELX_P HELX_P178 AT7 PRO O  21  ? THR O  43  ? PRO N 21  THR N 43  1 ? 23 
HELX_P HELX_P179 AT8 ASP O  56  ? VAL O  77  ? ASP N 56  VAL N 77  1 ? 22 
HELX_P HELX_P180 AT9 PHE O  82  ? SER O  100 ? PHE N 82  SER N 100 1 ? 19 
HELX_P HELX_P181 AU1 HIS O  103 ? ALA O  122 ? HIS N 103 ALA N 122 1 ? 20 
HELX_P HELX_P182 AU2 ARG O  126 ? THR O  158 ? ARG N 126 THR N 158 1 ? 33 
HELX_P HELX_P183 AU3 GLY O  169 ? ALA O  187 ? GLY N 169 ALA N 187 1 ? 19 
HELX_P HELX_P184 AU4 PHE O  194 ? SER O  203 ? PHE N 194 SER N 203 1 ? 10 
HELX_P HELX_P185 AU5 PRO O  204 ? LEU O  224 ? PRO N 204 LEU N 224 1 ? 21 
HELX_P HELX_P186 AU6 PRO O  229 ? ALA O  250 ? PRO N 229 ALA N 250 1 ? 22 
HELX_P HELX_P187 AU7 GLU O  253 ? ALA O  270 ? GLU N 253 ALA N 270 1 ? 18 
HELX_P HELX_P188 AU8 LEU O  271 ? THR O  275 ? LEU N 271 THR N 275 5 ? 5  
HELX_P HELX_P189 AU9 GLN O  279 ? SER O  303 ? GLN N 279 SER N 303 1 ? 25 
HELX_P HELX_P190 AV1 PRO O  308 ? ARG O  313 ? PRO N 308 ARG N 313 5 ? 6  
HELX_P HELX_P191 AV2 GLY O  314 ? ASP O  319 ? GLY N 314 ASP N 319 1 ? 6  
HELX_P HELX_P192 AV3 ASP O  319 ? GLY O  335 ? ASP N 319 GLY N 335 1 ? 17 
HELX_P HELX_P193 AV4 LEU O  339 ? ALA O  355 ? LEU N 339 ALA N 355 1 ? 17 
HELX_P HELX_P194 AV5 TRP O  358 ? SER O  371 ? TRP N 358 SER N 371 1 ? 14 
HELX_P HELX_P195 AV6 SER O  371 ? LEU O  380 ? SER N 371 LEU N 380 1 ? 10 
HELX_P HELX_P196 AV7 ALA O  381 ? ALA O  384 ? ALA N 381 ALA N 384 5 ? 4  
HELX_P HELX_P197 AV8 PRO O  395 ? LEU O  415 ? PRO N 395 LEU N 415 1 ? 21 
HELX_P HELX_P198 AV9 VAL O  419 ? ALA O  424 ? VAL N 419 ALA N 424 5 ? 6  
HELX_P HELX_P199 AW1 PRO P  9   ? GLN P  43  ? PRO H 9   GLN H 43  1 ? 35 
HELX_P HELX_P200 AW2 LEU P  57  ? ILE P  67  ? LEU H 57  ILE H 67  1 ? 11 
HELX_P HELX_P201 AW3 ASP P  78  ? LEU P  95  ? ASP H 78  LEU H 95  1 ? 18 
HELX_P HELX_P202 AW4 LEU P  120 ? SER P  143 ? LEU H 120 SER H 143 1 ? 24 
HELX_P HELX_P203 AW5 SER P  145 ? GLY P  178 ? SER H 145 GLY H 178 1 ? 34 
HELX_P HELX_P204 AW6 ASN P  181 ? HIS P  192 ? ASN H 181 HIS H 192 1 ? 12 
HELX_P HELX_P205 AW7 TRP P  194 ? TYR P  198 ? TRP H 194 TYR H 198 5 ? 5  
HELX_P HELX_P206 AW8 ALA P  199 ? GLU P  213 ? ALA H 199 GLU H 213 1 ? 15 
HELX_P HELX_P207 AW9 ILE P  239 ? PHE P  263 ? ILE H 239 PHE H 263 1 ? 25 
HELX_P HELX_P208 AX1 TYR P  276 ? TRP P  297 ? TYR H 276 TRP H 297 1 ? 22 
HELX_P HELX_P209 AX2 TYR P  302 ? PHE P  312 ? TYR H 302 PHE H 312 1 ? 11 
HELX_P HELX_P210 AX3 PHE P  312 ? ASP P  331 ? PHE H 312 ASP H 331 1 ? 20 
HELX_P HELX_P211 AX4 ARG P  334 ? ALA P  351 ? ARG H 334 ALA H 351 1 ? 18 
HELX_P HELX_P212 AX5 LEU Q  17  ? VAL Q  21  ? LEU B 17  VAL B 21  5 ? 5  
HELX_P HELX_P213 AX6 THR Q  28  ? HIS Q  35  ? THR B 28  HIS B 35  1 ? 8  
HELX_P HELX_P214 AX7 TYR Q  38  ? LYS Q  48  ? TYR B 38  LYS B 48  1 ? 11 
HELX_P HELX_P215 AX8 THR Q  49  ? GLY Q  61  ? THR B 49  GLY B 61  1 ? 13 
HELX_P HELX_P216 AX9 PRO Q  71  ? PHE Q  78  ? PRO B 71  PHE B 78  1 ? 8  
HELX_P HELX_P217 AY1 PHE Q  101 ? VAL Q  110 ? PHE B 101 VAL B 110 1 ? 10 
HELX_P HELX_P218 AY2 VAL Q  110 ? ARG Q  126 ? VAL B 110 ARG B 126 1 ? 17 
HELX_P HELX_P219 AY3 TYR Q  138 ? ARG Q  155 ? TYR B 138 ARG B 155 1 ? 18 
HELX_P HELX_P220 AY4 ASN Q  161 ? THR Q  165 ? ASN B 161 THR B 165 5 ? 5  
HELX_P HELX_P221 AY5 ALA Q  179 ? GLY Q  183 ? ALA B 179 GLY B 183 5 ? 5  
HELX_P HELX_P222 AY6 GLU Q  184 ? GLY Q  194 ? GLU B 184 GLY B 194 1 ? 11 
HELX_P HELX_P223 AY7 GLY Q  210 ? LYS Q  214 ? GLY B 210 LYS B 214 5 ? 5  
HELX_P HELX_P224 AY8 VAL Q  221 ? ARG Q  233 ? VAL B 221 ARG B 233 1 ? 13 
HELX_P HELX_P225 AY9 TRP Q  237 ? MET Q  241 ? TRP B 237 MET B 241 5 ? 5  
HELX_P HELX_P226 AZ1 THR Q  271 ? GLU Q  278 ? THR B 271 GLU B 278 1 ? 8  
HELX_P HELX_P227 AZ2 THR Q  303 ? ASP Q  308 ? THR B 303 ASP B 308 1 ? 6  
HELX_P HELX_P228 AZ3 LEU Q  316 ? GLY Q  320 ? LEU B 316 GLY B 320 5 ? 5  
HELX_P HELX_P229 AZ4 SER Q  336 ? GLU Q  351 ? SER B 336 GLU B 351 1 ? 16 
HELX_P HELX_P230 AZ5 CYS Q  356 ? PHE Q  366 ? CYS B 356 PHE B 366 1 ? 11 
HELX_P HELX_P231 AZ6 PHE Q  366 ? THR Q  376 ? PHE B 366 THR B 376 1 ? 11 
HELX_P HELX_P232 AZ7 GLU Q  380 ? LEU Q  391 ? GLU B 380 LEU B 391 1 ? 12 
HELX_P HELX_P233 AZ8 LEU Q  391 ? GLY Q  396 ? LEU B 391 GLY B 396 1 ? 6  
HELX_P HELX_P234 AZ9 PRO Q  401 ? LYS Q  428 ? PRO B 401 LYS B 428 1 ? 28 
HELX_P HELX_P235 BA1 LYS R  7   ? ALA R  16  ? LYS C 7   ALA C 16  1 ? 10 
HELX_P HELX_P236 BA2 GLY R  22  ? ALA R  25  ? GLY C 22  ALA C 25  5 ? 4  
HELX_P HELX_P237 BA3 ALA R  26  ? GLY R  39  ? ALA C 26  GLY C 39  1 ? 14 
HELX_P HELX_P238 BA4 ARG R  42  ? GLY R  54  ? ARG C 42  GLY C 54  1 ? 13 
HELX_P HELX_P239 BA5 THR R  56  ? SER R  65  ? THR C 56  SER C 65  1 ? 10 
HELX_P HELX_P240 BA6 THR R  85  ? LEU R  90  ? THR C 85  LEU C 90  1 ? 6  
HELX_P HELX_P241 BA7 GLY R  92  ? GLY R  105 ? GLY C 92  GLY C 105 1 ? 14 
HELX_P HELX_P242 BA8 THR R  146 ? ALA R  159 ? THR C 146 ALA C 159 1 ? 14 
HELX_P HELX_P243 BA9 SER S  18  ? ALA S  26  ? SER D 18  ALA D 26  1 ? 9  
HELX_P HELX_P244 BB1 SER S  97  ? LEU S  113 ? SER D 97  LEU D 113 1 ? 17 
HELX_P HELX_P245 BB2 ASP S  118 ? CYS S  122 ? ASP D 118 CYS D 122 5 ? 5  
HELX_P HELX_P246 BB3 CYS S  128 ? GLY S  138 ? CYS D 128 GLY D 138 1 ? 11 
HELX_P HELX_P247 BB4 LYS S  185 ? VAL S  194 ? LYS D 185 VAL D 194 1 ? 10 
HELX_P HELX_P248 BB5 ARG S  205 ? THR S  209 ? ARG D 205 THR D 209 5 ? 5  
HELX_P HELX_P249 BB6 PHE S  222 ? GLY S  224 ? PHE D 222 GLY D 224 5 ? 3  
HELX_P HELX_P250 BB7 ASN S  225 ? CYS S  230 ? ASN D 225 CYS D 230 1 ? 6  
HELX_P HELX_P251 BB8 THR S  239 ? ARG S  241 ? THR D 239 ARG D 241 5 ? 3  
HELX_P HELX_P252 BB9 ARG S  245 ? MET S  249 ? ARG D 245 MET D 249 5 ? 5  
HELX_P HELX_P253 BC1 CYS S  291 ? GLY S  297 ? CYS D 291 GLY D 297 1 ? 7  
HELX_P HELX_P254 BC2 HIS S  298 ? GLN S  303 ? HIS D 298 GLN D 303 1 ? 6  
HELX_P HELX_P255 BC3 THR S  321 ? LEU S  333 ? THR D 321 LEU D 333 1 ? 13 
HELX_P HELX_P256 BC4 THR S  350 ? LEU S  364 ? THR D 350 LEU D 364 1 ? 15 
HELX_P HELX_P257 BC5 PRO S  378 ? PHE S  382 ? PRO D 378 PHE D 382 5 ? 5  
HELX_P HELX_P258 BC6 SER S  386 ? ALA S  393 ? SER D 386 ALA D 393 1 ? 8  
HELX_P HELX_P259 BC7 ASP S  401 ? ALA S  406 ? ASP D 401 ALA D 406 1 ? 6  
HELX_P HELX_P260 BC8 ILE S  408 ? ARG S  418 ? ILE D 408 ARG D 418 1 ? 11 
HELX_P HELX_P261 BC9 ALA S  456 ? TRP S  461 ? ALA D 456 TRP D 461 5 ? 6  
HELX_P HELX_P262 BD1 GLU S  472 ? GLY S  482 ? GLU D 472 GLY D 482 1 ? 11 
HELX_P HELX_P263 BD2 SER S  487 ? ALA S  500 ? SER D 487 ALA D 500 1 ? 14 
HELX_P HELX_P264 BD3 GLY S  508 ? GLN S  513 ? GLY D 508 GLN D 513 1 ? 6  
HELX_P HELX_P265 BD4 ASP S  514 ? LYS S  528 ? ASP D 514 LYS D 528 1 ? 15 
HELX_P HELX_P266 BD5 ASN S  540 ? MET S  547 ? ASN D 540 MET D 547 1 ? 8  
HELX_P HELX_P267 BD6 PRO S  573 ? LYS S  578 ? PRO D 573 LYS D 578 1 ? 6  
HELX_P HELX_P268 BD7 HIS S  591 ? ALA S  598 ? HIS D 591 ALA D 598 1 ? 8  
HELX_P HELX_P269 BD8 THR S  606 ? LYS S  610 ? THR D 606 LYS D 610 5 ? 5  
HELX_P HELX_P270 BD9 GLY S  636 ? ALA S  647 ? GLY D 636 ALA D 647 1 ? 12 
HELX_P HELX_P271 BE1 LEU S  656 ? ARG S  667 ? LEU D 656 ARG D 667 1 ? 12 
HELX_P HELX_P272 BE2 LYS S  700 ? ALA S  704 ? LYS D 700 ALA D 704 5 ? 5  
HELX_P HELX_P273 BE3 VAL S  705 ? GLN S  709 ? VAL D 705 GLN D 709 5 ? 5  
HELX_P HELX_P274 BE4 HIS S  719 ? GLU S  726 ? HIS D 719 GLU D 726 1 ? 8  
HELX_P HELX_P275 BE5 GLY T  65  ? MET T  70  ? GLY E 65  MET E 70  1 ? 6  
HELX_P HELX_P276 BE6 GLU T  71  ? ARG T  73  ? GLU E 71  ARG E 73  5 ? 3  
HELX_P HELX_P277 BE7 THR T  74  ? ILE T  79  ? THR E 74  ILE E 79  1 ? 6  
HELX_P HELX_P278 BE8 THR T  80  ? MET T  85  ? THR E 80  MET E 85  5 ? 6  
HELX_P HELX_P279 BE9 SER T  90  ? GLY T  106 ? SER E 90  GLY E 106 1 ? 17 
HELX_P HELX_P280 BF1 PRO T  110 ? LEU T  140 ? PRO E 110 LEU E 140 1 ? 31 
HELX_P HELX_P281 BF2 THR T  144 ? GLY T  165 ? THR E 144 GLY E 165 1 ? 22 
HELX_P HELX_P282 BF3 GLU T  185 ? ALA T  209 ? GLU E 185 ALA E 209 1 ? 25 
HELX_P HELX_P283 BF4 PHE T  214 ? ARG T  219 ? PHE E 214 ARG E 219 1 ? 6  
HELX_P HELX_P284 BF5 PRO T  225 ? LEU T  232 ? PRO E 225 LEU E 232 1 ? 8  
HELX_P HELX_P285 BF6 LEU T  239 ? GLY T  243 ? LEU E 239 GLY E 243 5 ? 5  
HELX_P HELX_P286 BF7 ASP T  247 ? TYR T  252 ? ASP E 247 TYR E 252 1 ? 6  
HELX_P HELX_P287 BF8 GLY T  256 ? TYR T  260 ? GLY E 256 TYR E 260 5 ? 5  
HELX_P HELX_P288 BF9 ASP T  271 ? ARG T  296 ? ASP E 271 ARG E 296 1 ? 26 
HELX_P HELX_P289 BG1 ARG T  314 ? THR T  319 ? ARG E 314 THR E 319 5 ? 6  
HELX_P HELX_P290 BG2 SER T  320 ? GLU T  333 ? SER E 320 GLU E 333 1 ? 14 
HELX_P HELX_P291 BG3 ALA T  372 ? LEU T  378 ? ALA E 372 LEU E 378 1 ? 7  
HELX_P HELX_P292 BG4 SER T  380 ? CYS T  385 ? SER E 380 CYS E 385 1 ? 6  
HELX_P HELX_P293 BG5 PRO T  391 ? ASP T  401 ? PRO E 391 ASP E 401 1 ? 11 
HELX_P HELX_P294 BG6 VAL T  403 ? ASP T  408 ? VAL E 403 ASP E 408 1 ? 6  
HELX_P HELX_P295 BG7 ARG U  2   ? LYS U  13  ? ARG F 2   LYS F 13  1 ? 12 
HELX_P HELX_P296 BG8 ARG U  33  ? MET U  44  ? ARG F 33  MET F 44  1 ? 12 
HELX_P HELX_P297 BG9 SER U  110 ? PHE U  122 ? SER F 110 PHE F 122 1 ? 13 
HELX_P HELX_P298 BH1 ILE U  166 ? ARG U  171 ? ILE F 166 ARG F 171 1 ? 6  
HELX_P HELX_P299 BH2 GLY U  186 ? GLY U  191 ? GLY F 186 GLY F 191 5 ? 6  
HELX_P HELX_P300 BH3 PHE V  21  ? SER V  35  ? PHE G 21  SER G 35  1 ? 15 
HELX_P HELX_P301 BH4 CYS V  45  ? SER V  53  ? CYS G 45  SER G 53  1 ? 9  
HELX_P HELX_P302 BH5 SER V  85  ? LYS V  87  ? SER G 85  LYS G 87  5 ? 3  
HELX_P HELX_P303 BH6 MET V  88  ? GLN V  98  ? MET G 88  GLN G 98  1 ? 11 
HELX_P HELX_P304 BH7 GLY V  109 ? SER V  114 ? GLY G 109 SER G 114 1 ? 6  
HELX_P HELX_P305 BH8 ASN V  126 ? VAL V  130 ? ASN G 126 VAL G 130 5 ? 5  
HELX_P HELX_P306 BH9 ARG V  143 ? ARG V  159 ? ARG G 143 ARG G 159 1 ? 17 
HELX_P HELX_P307 BI1 LEU W  3   ? SER W  19  ? LEU O 3   SER O 19  1 ? 17 
HELX_P HELX_P308 BI2 SER W  57  ? ALA W  62  ? SER O 57  ALA O 62  1 ? 6  
HELX_P HELX_P309 BI3 GLY W  102 ? CYS W  108 ? GLY O 102 CYS O 108 1 ? 7  
HELX_P HELX_P310 BI4 GLU W  125 ? ASP W  128 ? GLU O 125 ASP O 128 5 ? 4  
HELX_P HELX_P311 BI5 GLY W  132 ? MET W  136 ? GLY O 132 MET O 136 5 ? 5  
HELX_P HELX_P312 BI6 THR W  143 ? GLY W  154 ? THR O 143 GLY O 154 1 ? 12 
HELX_P HELX_P313 BI7 ARG W  167 ? GLU W  171 ? ARG O 167 GLU O 171 5 ? 5  
HELX_P HELX_P314 BI8 SER X  4   ? GLY X  28  ? SER I 4   GLY I 28  1 ? 25 
HELX_P HELX_P315 BI9 PHE X  37  ? TYR X  42  ? PHE I 37  TYR I 42  1 ? 6  
HELX_P HELX_P316 BJ1 THR X  111 ? ALA X  127 ? THR I 111 ALA I 127 1 ? 17 
HELX_P HELX_P317 BJ2 ALA Y  9   ? GLY Y  22  ? ALA X 9   GLY X 22  1 ? 14 
HELX_P HELX_P318 BJ3 GLY Y  69  ? GLN Y  84  ? GLY X 69  GLN X 84  1 ? 16 
HELX_P HELX_P319 BJ4 SER Y  95  ? LEU Y  103 ? SER X 95  LEU X 103 1 ? 9  
HELX_P HELX_P320 BJ5 PRO Y  106 ? ALA Y  118 ? PRO X 106 ALA X 118 1 ? 13 
HELX_P HELX_P321 BJ6 ASP Y  122 ? LEU Y  127 ? ASP X 122 LEU X 127 5 ? 6  
HELX_P HELX_P322 BJ7 ILE Z  4   ? LEU Z  31  ? ILE P 4   LEU P 31  1 ? 28 
HELX_P HELX_P323 BJ8 ARG Z  38  ? MET Z  42  ? ARG P 38  MET P 42  5 ? 5  
HELX_P HELX_P324 BJ9 VAL Z  59  ? SER Z  84  ? VAL P 59  SER P 84  1 ? 26 
HELX_P HELX_P325 BK1 LEU Z  88  ? GLY Z  114 ? LEU P 88  GLY P 114 1 ? 27 
HELX_P HELX_P326 BK2 SER AA 2   ? LEU AA 22  ? SER R 2   LEU R 22  1 ? 21 
HELX_P HELX_P327 BK3 ASN AA 24  ? LEU AA 46  ? ASN R 24  LEU R 46  1 ? 23 
HELX_P HELX_P328 BK4 ARG AA 49  ? VAL AA 58  ? ARG R 49  VAL R 58  1 ? 10 
HELX_P HELX_P329 BK5 ALA AA 62  ? LEU AA 74  ? ALA R 62  LEU R 74  1 ? 13 
HELX_P HELX_P330 BK6 ARG AA 88  ? TRP AA 109 ? ARG R 88  TRP R 109 1 ? 22 
HELX_P HELX_P331 BK7 LEU AA 123 ? TYR AA 132 ? LEU R 123 TYR R 132 1 ? 10 
HELX_P HELX_P332 BK8 TRP AA 135 ? GLU AA 158 ? TRP R 135 GLU R 158 1 ? 24 
HELX_P HELX_P333 BK9 SER BA 2   ? ARG BA 21  ? SER S 2   ARG S 21  1 ? 20 
HELX_P HELX_P334 BL1 THR BA 23  ? GLY BA 50  ? THR S 23  GLY S 50  1 ? 28 
HELX_P HELX_P335 BL2 LEU BA 51  ? PHE BA 79  ? LEU S 51  PHE S 79  1 ? 29 
HELX_P HELX_P336 BL3 ALA BA 86  ? LEU BA 90  ? ALA S 86  LEU S 90  5 ? 5  
HELX_P HELX_P337 BL4 ALA CA 2   ? PHE CA 20  ? ALA T 2   PHE T 20  1 ? 19 
HELX_P HELX_P338 BL5 PRO CA 27  ? SER CA 50  ? PRO T 27  SER T 50  1 ? 24 
HELX_P HELX_P339 BL6 ASP CA 70  ? MET CA 95  ? ASP T 70  MET T 95  1 ? 26 
HELX_P HELX_P340 BL7 GLY CA 100 ? LEU CA 120 ? GLY T 100 LEU T 120 1 ? 21 
HELX_P HELX_P341 BL8 SER CA 123 ? GLY CA 143 ? SER T 123 GLY T 143 1 ? 21 
HELX_P HELX_P342 BL9 ALA CA 152 ? LEU CA 179 ? ALA T 152 LEU T 179 1 ? 28 
HELX_P HELX_P343 BM1 SER CA 184 ? GLU CA 193 ? SER T 184 GLU T 193 1 ? 10 
HELX_P HELX_P344 BM2 ASN CA 198 ? ALA CA 218 ? ASN T 198 ALA T 218 1 ? 21 
HELX_P HELX_P345 BM3 PRO CA 221 ? GLY CA 232 ? PRO T 221 GLY T 232 5 ? 12 
HELX_P HELX_P346 BM4 PRO CA 233 ? ALA CA 242 ? PRO T 233 ALA T 242 1 ? 10 
HELX_P HELX_P347 BM5 VAL CA 246 ? SER CA 256 ? VAL T 246 SER T 256 1 ? 11 
HELX_P HELX_P348 BM6 SER CA 256 ? SER CA 261 ? SER T 256 SER T 261 1 ? 6  
HELX_P HELX_P349 BM7 LEU CA 263 ? PHE CA 286 ? LEU T 263 PHE T 286 1 ? 24 
HELX_P HELX_P350 BM8 ASP CA 290 ? GLY CA 313 ? ASP T 290 GLY T 313 1 ? 24 
HELX_P HELX_P351 BM9 ALA CA 314 ? LEU CA 343 ? ALA T 314 LEU T 343 1 ? 30 
HELX_P HELX_P352 BN1 GLN CA 361 ? GLY CA 375 ? GLN T 361 GLY T 375 1 ? 15 
HELX_P HELX_P353 BN2 LEU CA 379 ? TYR CA 395 ? LEU T 379 TYR T 395 1 ? 17 
HELX_P HELX_P354 BN3 GLY CA 399 ? LEU CA 426 ? GLY T 399 LEU T 426 1 ? 28 
HELX_P HELX_P355 BN4 PRO CA 439 ? GLY CA 457 ? PRO T 439 GLY T 457 1 ? 19 
HELX_P HELX_P356 BN5 TYR CA 458 ? ALA CA 460 ? TYR T 458 ALA T 460 5 ? 3  
HELX_P HELX_P357 BN6 VAL CA 468 ? LEU CA 477 ? VAL T 468 LEU T 477 1 ? 10 
HELX_P HELX_P358 BN7 GLY CA 488 ? ARG CA 514 ? GLY T 488 ARG T 514 1 ? 27 
HELX_P HELX_P359 BN8 PRO CA 518 ? GLU CA 530 ? PRO T 518 GLU T 530 1 ? 13 
HELX_P HELX_P360 BN9 VAL CA 534 ? ILE CA 542 ? VAL T 534 ILE T 542 1 ? 9  
HELX_P HELX_P361 BO1 ILE CA 542 ? LEU CA 581 ? ILE T 542 LEU T 581 1 ? 40 
HELX_P HELX_P362 BO2 TYR CA 585 ? MET CA 604 ? TYR T 585 MET T 604 1 ? 20 
HELX_P HELX_P363 BO3 VAL DA 2   ? LEU DA 18  ? VAL U 2   LEU U 18  1 ? 17 
HELX_P HELX_P364 BO4 PRO DA 21  ? LEU DA 41  ? PRO U 21  LEU U 41  1 ? 21 
HELX_P HELX_P365 BO5 ASP DA 68  ? ALA DA 89  ? ASP U 68  ALA U 89  1 ? 22 
HELX_P HELX_P366 BO6 PHE DA 95  ? ALA DA 112 ? PHE U 95  ALA U 112 1 ? 18 
HELX_P HELX_P367 BO7 ASP DA 114 ? ALA DA 125 ? ASP U 114 ALA U 125 1 ? 12 
HELX_P HELX_P368 BO8 ALA DA 125 ? LEU DA 135 ? ALA U 125 LEU U 135 1 ? 11 
HELX_P HELX_P369 BO9 GLY DA 140 ? SER DA 170 ? GLY U 140 SER U 170 1 ? 31 
HELX_P HELX_P370 BP1 LEU DA 176 ? HIS DA 183 ? LEU U 176 HIS U 183 1 ? 8  
HELX_P HELX_P371 BP2 ALA DA 189 ? ILE DA 203 ? ALA U 189 ILE U 203 1 ? 15 
HELX_P HELX_P372 BP3 LEU DA 207 ? HIS DA 211 ? LEU U 207 HIS U 211 5 ? 5  
HELX_P HELX_P373 BP4 TRP DA 213 ? ASN DA 221 ? TRP U 213 ASN U 221 1 ? 9  
HELX_P HELX_P374 BP5 GLY DA 225 ? LEU DA 233 ? GLY U 225 LEU U 233 1 ? 9  
HELX_P HELX_P375 BP6 VAL DA 236 ? PHE DA 244 ? VAL U 236 PHE U 244 1 ? 9  
HELX_P HELX_P376 BP7 PHE DA 244 ? ALA DA 249 ? PHE U 244 ALA U 249 1 ? 6  
HELX_P HELX_P377 BP8 ALA DA 249 ? ALA DA 275 ? ALA U 249 ALA U 275 1 ? 27 
HELX_P HELX_P378 BP9 PHE DA 276 ? ALA DA 278 ? PHE U 276 ALA U 278 5 ? 3  
HELX_P HELX_P379 BQ1 ASP DA 280 ? SER DA 302 ? ASP U 280 SER U 302 1 ? 23 
HELX_P HELX_P380 BQ2 THR DA 304 ? GLY DA 337 ? THR U 304 GLY U 337 1 ? 34 
HELX_P HELX_P381 BQ3 GLY DA 346 ? ALA DA 351 ? GLY U 346 ALA U 351 1 ? 6  
HELX_P HELX_P382 BQ4 GLY DA 353 ? GLY DA 367 ? GLY U 353 GLY U 367 1 ? 15 
HELX_P HELX_P383 BQ5 SER DA 372 ? SER DA 388 ? SER U 372 SER U 388 1 ? 17 
HELX_P HELX_P384 BQ6 SER DA 388 ? PHE DA 396 ? SER U 388 PHE U 396 1 ? 9  
HELX_P HELX_P385 BQ7 SER DA 398 ? TRP DA 415 ? SER U 398 TRP U 415 1 ? 18 
HELX_P HELX_P386 BQ8 ALA DA 426 ? PHE DA 446 ? ALA U 426 PHE U 446 1 ? 21 
HELX_P HELX_P387 BQ9 GLY DA 453 ? LEU DA 464 ? GLY U 453 LEU U 464 1 ? 12 
HELX_P HELX_P388 BR1 THR EA 2   ? GLY EA 17  ? THR V 2   GLY V 17  1 ? 16 
HELX_P HELX_P389 BR2 PRO EA 21  ? THR EA 43  ? PRO V 21  THR V 43  1 ? 23 
HELX_P HELX_P390 BR3 ASP EA 56  ? VAL EA 77  ? ASP V 56  VAL V 77  1 ? 22 
HELX_P HELX_P391 BR4 PHE EA 82  ? SER EA 100 ? PHE V 82  SER V 100 1 ? 19 
HELX_P HELX_P392 BR5 HIS EA 103 ? ALA EA 122 ? HIS V 103 ALA V 122 1 ? 20 
HELX_P HELX_P393 BR6 ARG EA 126 ? THR EA 158 ? ARG V 126 THR V 158 1 ? 33 
HELX_P HELX_P394 BR7 GLY EA 169 ? ALA EA 188 ? GLY V 169 ALA V 188 1 ? 20 
HELX_P HELX_P395 BR8 PHE EA 194 ? SER EA 203 ? PHE V 194 SER V 203 1 ? 10 
HELX_P HELX_P396 BR9 PRO EA 204 ? VAL EA 226 ? PRO V 204 VAL V 226 1 ? 23 
HELX_P HELX_P397 BS1 PRO EA 229 ? ALA EA 250 ? PRO V 229 ALA V 250 1 ? 22 
HELX_P HELX_P398 BS2 GLU EA 253 ? ALA EA 270 ? GLU V 253 ALA V 270 1 ? 18 
HELX_P HELX_P399 BS3 LEU EA 271 ? THR EA 275 ? LEU V 271 THR V 275 5 ? 5  
HELX_P HELX_P400 BS4 GLN EA 279 ? SER EA 303 ? GLN V 279 SER V 303 1 ? 25 
HELX_P HELX_P401 BS5 PRO EA 308 ? ARG EA 313 ? PRO V 308 ARG V 313 1 ? 6  
HELX_P HELX_P402 BS6 GLY EA 314 ? ASP EA 319 ? GLY V 314 ASP V 319 1 ? 6  
HELX_P HELX_P403 BS7 ASP EA 319 ? GLY EA 335 ? ASP V 319 GLY V 335 1 ? 17 
HELX_P HELX_P404 BS8 LEU EA 339 ? GLY EA 356 ? LEU V 339 GLY V 356 1 ? 18 
HELX_P HELX_P405 BS9 TRP EA 358 ? LEU EA 380 ? TRP V 358 LEU V 380 1 ? 23 
HELX_P HELX_P406 BT1 ALA EA 381 ? ALA EA 384 ? ALA V 381 ALA V 384 5 ? 4  
HELX_P HELX_P407 BT2 PRO EA 395 ? LEU EA 415 ? PRO V 395 LEU V 415 1 ? 21 
HELX_P HELX_P408 BT3 LEU EA 420 ? ALA EA 424 ? LEU V 420 ALA V 424 5 ? 5  
HELX_P HELX_P409 BT4 PRO FA 9   ? GLN FA 43  ? PRO Q 9   GLN Q 43  1 ? 35 
HELX_P HELX_P410 BT5 LEU FA 57  ? ILE FA 67  ? LEU Q 57  ILE Q 67  1 ? 11 
HELX_P HELX_P411 BT6 ASP FA 78  ? LEU FA 95  ? ASP Q 78  LEU Q 95  1 ? 18 
HELX_P HELX_P412 BT7 LEU FA 120 ? SER FA 143 ? LEU Q 120 SER Q 143 1 ? 24 
HELX_P HELX_P413 BT8 SER FA 145 ? GLY FA 178 ? SER Q 145 GLY Q 178 1 ? 34 
HELX_P HELX_P414 BT9 ASN FA 181 ? HIS FA 192 ? ASN Q 181 HIS Q 192 1 ? 12 
HELX_P HELX_P415 BU1 LEU FA 195 ? GLU FA 213 ? LEU Q 195 GLU Q 213 1 ? 19 
HELX_P HELX_P416 BU2 ILE FA 239 ? PHE FA 263 ? ILE Q 239 PHE Q 263 1 ? 25 
HELX_P HELX_P417 BU3 TYR FA 276 ? TRP FA 297 ? TYR Q 276 TRP Q 297 1 ? 22 
HELX_P HELX_P418 BU4 TYR FA 302 ? PHE FA 312 ? TYR Q 302 PHE Q 312 1 ? 11 
HELX_P HELX_P419 BU5 PHE FA 312 ? ASP FA 331 ? PHE Q 312 ASP Q 331 1 ? 20 
HELX_P HELX_P420 BU6 ARG FA 334 ? ALA FA 351 ? ARG Q 334 ALA Q 351 1 ? 18 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ? ? B CYS 144 SG  ? ? ? 1_555 B  CYS 172 SG  ? ? 2 CYS 144 2 CYS 172 1_555 ? ? ? ? ? ? ? 2.083 ? ? 
disulf2  disulf ? ? R CYS 144 SG  ? ? ? 1_555 R  CYS 172 SG  ? ? C CYS 144 C CYS 172 1_555 ? ? ? ? ? ? ? 2.030 ? ? 
metalc1  metalc ? ? A CYS 353 SG  ? ? ? 1_555 GA SF4 .   FE4 ? ? 1 CYS 353 1 SF4 501 1_555 ? ? ? ? ? ? ? 2.328 ? ? 
metalc2  metalc ? ? A CYS 356 SG  ? ? ? 1_555 GA SF4 .   FE1 ? ? 1 CYS 356 1 SF4 501 1_555 ? ? ? ? ? ? ? 2.323 ? ? 
metalc3  metalc ? ? A CYS 359 SG  ? ? ? 1_555 GA SF4 .   FE2 ? ? 1 CYS 359 1 SF4 501 1_555 ? ? ? ? ? ? ? 2.305 ? ? 
metalc4  metalc ? ? A CYS 400 SG  ? ? ? 1_555 GA SF4 .   FE3 ? ? 1 CYS 400 1 SF4 501 1_555 ? ? ? ? ? ? ? 2.325 ? ? 
metalc5  metalc ? ? B CYS 83  SG  ? ? ? 1_555 IA FES .   FE1 ? ? 2 CYS 83  2 FES 201 1_555 ? ? ? ? ? ? ? 2.318 ? ? 
metalc6  metalc ? ? B CYS 88  SG  ? ? ? 1_555 IA FES .   FE1 ? ? 2 CYS 88  2 FES 201 1_555 ? ? ? ? ? ? ? 2.328 ? ? 
metalc7  metalc ? ? B CYS 124 SG  ? ? ? 1_555 IA FES .   FE2 ? ? 2 CYS 124 2 FES 201 1_555 ? ? ? ? ? ? ? 2.332 ? ? 
metalc8  metalc ? ? B CYS 128 SG  ? ? ? 1_555 IA FES .   FE2 ? ? 2 CYS 128 2 FES 201 1_555 ? ? ? ? ? ? ? 2.330 ? ? 
metalc9  metalc ? ? C CYS 34  SG  ? ? ? 1_555 MA FES .   FE1 ? ? 3 CYS 34  3 FES 804 1_555 ? ? ? ? ? ? ? 2.325 ? ? 
metalc10 metalc ? ? C CYS 45  SG  ? ? ? 1_555 MA FES .   FE1 ? ? 3 CYS 45  3 FES 804 1_555 ? ? ? ? ? ? ? 2.320 ? ? 
metalc11 metalc ? ? C CYS 48  SG  ? ? ? 1_555 MA FES .   FE2 ? ? 3 CYS 48  3 FES 804 1_555 ? ? ? ? ? ? ? 2.330 ? ? 
metalc12 metalc ? ? C CYS 83  SG  ? ? ? 1_555 MA FES .   FE2 ? ? 3 CYS 83  3 FES 804 1_555 ? ? ? ? ? ? ? 2.297 ? ? 
metalc13 metalc ? ? C HIS 115 NE2 ? ? ? 1_555 JA SF4 .   FE3 ? ? 3 HIS 115 3 SF4 801 1_555 ? ? ? ? ? ? ? 2.197 ? ? 
metalc14 metalc ? ? C CYS 119 SG  ? ? ? 1_555 JA SF4 .   FE2 ? ? 3 CYS 119 3 SF4 801 1_555 ? ? ? ? ? ? ? 2.322 ? ? 
metalc15 metalc ? ? C CYS 122 SG  ? ? ? 1_555 JA SF4 .   FE4 ? ? 3 CYS 122 3 SF4 801 1_555 ? ? ? ? ? ? ? 2.315 ? ? 
metalc16 metalc ? ? C CYS 128 SG  ? ? ? 1_555 JA SF4 .   FE1 ? ? 3 CYS 128 3 SF4 801 1_555 ? ? ? ? ? ? ? 2.333 ? ? 
metalc17 metalc ? ? C CYS 181 SG  ? ? ? 1_555 KA SF4 .   FE2 ? ? 3 CYS 181 3 SF4 802 1_555 ? ? ? ? ? ? ? 2.314 ? ? 
metalc18 metalc ? ? C CYS 184 SG  ? ? ? 1_555 KA SF4 .   FE1 ? ? 3 CYS 184 3 SF4 802 1_555 ? ? ? ? ? ? ? 2.323 ? ? 
metalc19 metalc ? ? C CYS 187 SG  ? ? ? 1_555 KA SF4 .   FE3 ? ? 3 CYS 187 3 SF4 802 1_555 ? ? ? ? ? ? ? 2.330 ? ? 
metalc20 metalc ? ? C CYS 230 SG  ? ? ? 1_555 KA SF4 .   FE4 ? ? 3 CYS 230 3 SF4 802 1_555 ? ? ? ? ? ? ? 2.338 ? ? 
metalc21 metalc ? ? C CYS 256 SG  ? ? ? 1_555 LA SF4 .   FE1 ? ? 3 CYS 256 3 SF4 803 1_555 ? ? ? ? ? ? ? 2.321 ? ? 
metalc22 metalc ? ? C CYS 263 SG  ? ? ? 1_555 LA SF4 .   FE3 ? ? 3 CYS 263 3 SF4 803 1_555 ? ? ? ? ? ? ? 2.312 ? ? 
metalc23 metalc ? ? C CYS 291 SG  ? ? ? 1_555 LA SF4 .   FE2 ? ? 3 CYS 291 3 SF4 803 1_555 ? ? ? ? ? ? ? 2.317 ? ? 
metalc24 metalc ? ? F CYS 45  SG  ? ? ? 1_555 OA SF4 .   FE3 ? ? 6 CYS 45  6 SF4 201 1_555 ? ? ? ? ? ? ? 2.286 ? ? 
metalc25 metalc ? ? F CYS 46  SG  ? ? ? 1_555 OA SF4 .   FE2 ? ? 6 CYS 46  6 SF4 201 1_555 ? ? ? ? ? ? ? 2.316 ? ? 
metalc26 metalc ? ? F CYS 111 SG  ? ? ? 1_555 OA SF4 .   FE1 ? ? 6 CYS 111 6 SF4 201 1_555 ? ? ? ? ? ? ? 2.312 ? ? 
metalc27 metalc ? ? F CYS 140 SG  ? ? ? 1_555 OA SF4 .   FE4 ? ? 6 CYS 140 6 SF4 201 1_555 ? ? ? ? ? ? ? 2.326 ? ? 
metalc28 metalc ? ? G CYS 53  SG  ? ? ? 1_555 QA SF4 .   FE3 ? ? 9 CYS 53  9 SF4 202 1_555 ? ? ? ? ? ? ? 2.342 ? ? 
metalc29 metalc ? ? G CYS 56  SG  ? ? ? 1_555 QA SF4 .   FE4 ? ? 9 CYS 56  9 SF4 202 1_555 ? ? ? ? ? ? ? 2.326 ? ? 
metalc30 metalc ? ? G CYS 59  SG  ? ? ? 1_555 QA SF4 .   FE2 ? ? 9 CYS 59  9 SF4 202 1_555 ? ? ? ? ? ? ? 2.331 ? ? 
metalc31 metalc ? ? G CYS 63  SG  ? ? ? 1_555 PA SF4 .   FE4 ? ? 9 CYS 63  9 SF4 201 1_555 ? ? ? ? ? ? ? 2.329 ? ? 
metalc32 metalc ? ? G CYS 98  SG  ? ? ? 1_555 PA SF4 .   FE2 ? ? 9 CYS 98  9 SF4 201 1_555 ? ? ? ? ? ? ? 2.332 ? ? 
metalc33 metalc ? ? G CYS 101 SG  ? ? ? 1_555 PA SF4 .   FE1 ? ? 9 CYS 101 9 SF4 201 1_555 ? ? ? ? ? ? ? 2.328 ? ? 
metalc34 metalc ? ? G CYS 104 SG  ? ? ? 1_555 PA SF4 .   FE3 ? ? 9 CYS 104 9 SF4 201 1_555 ? ? ? ? ? ? ? 2.331 ? ? 
metalc35 metalc ? ? G CYS 108 SG  ? ? ? 1_555 QA SF4 .   FE1 ? ? 9 CYS 108 9 SF4 202 1_555 ? ? ? ? ? ? ? 2.322 ? ? 
metalc36 metalc ? ? Q CYS 356 SG  ? ? ? 1_555 RA SF4 .   FE1 ? ? B CYS 356 B SF4 501 1_555 ? ? ? ? ? ? ? 2.318 ? ? 
metalc37 metalc ? ? Q CYS 359 SG  ? ? ? 1_555 RA SF4 .   FE2 ? ? B CYS 359 B SF4 501 1_555 ? ? ? ? ? ? ? 2.306 ? ? 
metalc38 metalc ? ? Q CYS 400 SG  ? ? ? 1_555 RA SF4 .   FE3 ? ? B CYS 400 B SF4 501 1_555 ? ? ? ? ? ? ? 2.324 ? ? 
metalc39 metalc ? ? R CYS 83  SG  ? ? ? 1_555 TA FES .   FE1 ? ? C CYS 83  C FES 201 1_555 ? ? ? ? ? ? ? 2.331 ? ? 
metalc40 metalc ? ? R CYS 88  SG  ? ? ? 1_555 TA FES .   FE1 ? ? C CYS 88  C FES 201 1_555 ? ? ? ? ? ? ? 2.322 ? ? 
metalc41 metalc ? ? R CYS 124 SG  ? ? ? 1_555 TA FES .   FE2 ? ? C CYS 124 C FES 201 1_555 ? ? ? ? ? ? ? 2.333 ? ? 
metalc42 metalc ? ? R CYS 128 SG  ? ? ? 1_555 TA FES .   FE2 ? ? C CYS 128 C FES 201 1_555 ? ? ? ? ? ? ? 2.326 ? ? 
metalc43 metalc ? ? S CYS 34  SG  ? ? ? 1_555 XA FES .   FE1 ? ? D CYS 34  D FES 804 1_555 ? ? ? ? ? ? ? 2.325 ? ? 
metalc44 metalc ? ? S CYS 45  SG  ? ? ? 1_555 XA FES .   FE1 ? ? D CYS 45  D FES 804 1_555 ? ? ? ? ? ? ? 2.322 ? ? 
metalc45 metalc ? ? S CYS 48  SG  ? ? ? 1_555 XA FES .   FE2 ? ? D CYS 48  D FES 804 1_555 ? ? ? ? ? ? ? 2.330 ? ? 
metalc46 metalc ? ? S CYS 83  SG  ? ? ? 1_555 XA FES .   FE2 ? ? D CYS 83  D FES 804 1_555 ? ? ? ? ? ? ? 2.330 ? ? 
metalc47 metalc ? ? S HIS 115 NE2 ? ? ? 1_555 UA SF4 .   FE3 ? ? D HIS 115 D SF4 801 1_555 ? ? ? ? ? ? ? 2.027 ? ? 
metalc48 metalc ? ? S CYS 119 SG  ? ? ? 1_555 UA SF4 .   FE2 ? ? D CYS 119 D SF4 801 1_555 ? ? ? ? ? ? ? 2.322 ? ? 
metalc49 metalc ? ? S CYS 122 SG  ? ? ? 1_555 UA SF4 .   FE4 ? ? D CYS 122 D SF4 801 1_555 ? ? ? ? ? ? ? 2.317 ? ? 
metalc50 metalc ? ? S CYS 128 SG  ? ? ? 1_555 UA SF4 .   FE1 ? ? D CYS 128 D SF4 801 1_555 ? ? ? ? ? ? ? 2.323 ? ? 
metalc51 metalc ? ? S CYS 181 SG  ? ? ? 1_555 VA SF4 .   FE2 ? ? D CYS 181 D SF4 802 1_555 ? ? ? ? ? ? ? 2.323 ? ? 
metalc52 metalc ? ? S CYS 184 SG  ? ? ? 1_555 VA SF4 .   FE1 ? ? D CYS 184 D SF4 802 1_555 ? ? ? ? ? ? ? 2.322 ? ? 
metalc53 metalc ? ? S CYS 187 SG  ? ? ? 1_555 VA SF4 .   FE3 ? ? D CYS 187 D SF4 802 1_555 ? ? ? ? ? ? ? 2.331 ? ? 
metalc54 metalc ? ? S CYS 230 SG  ? ? ? 1_555 VA SF4 .   FE4 ? ? D CYS 230 D SF4 802 1_555 ? ? ? ? ? ? ? 2.335 ? ? 
metalc55 metalc ? ? S CYS 256 SG  ? ? ? 1_555 WA SF4 .   FE1 ? ? D CYS 256 D SF4 803 1_555 ? ? ? ? ? ? ? 2.324 ? ? 
metalc56 metalc ? ? S CYS 263 SG  ? ? ? 1_555 WA SF4 .   FE3 ? ? D CYS 263 D SF4 803 1_555 ? ? ? ? ? ? ? 2.324 ? ? 
metalc57 metalc ? ? S CYS 291 SG  ? ? ? 1_555 WA SF4 .   FE2 ? ? D CYS 291 D SF4 803 1_555 ? ? ? ? ? ? ? 2.321 ? ? 
metalc58 metalc ? ? V CYS 45  SG  ? ? ? 1_555 ZA SF4 .   FE3 ? ? G CYS 45  G SF4 201 1_555 ? ? ? ? ? ? ? 2.294 ? ? 
metalc59 metalc ? ? V CYS 46  SG  ? ? ? 1_555 ZA SF4 .   FE2 ? ? G CYS 46  G SF4 201 1_555 ? ? ? ? ? ? ? 2.322 ? ? 
metalc60 metalc ? ? V CYS 111 SG  ? ? ? 1_555 ZA SF4 .   FE1 ? ? G CYS 111 G SF4 201 1_555 ? ? ? ? ? ? ? 2.320 ? ? 
metalc61 metalc ? ? V CYS 140 SG  ? ? ? 1_555 ZA SF4 .   FE4 ? ? G CYS 140 G SF4 201 1_555 ? ? ? ? ? ? ? 2.316 ? ? 
metalc62 metalc ? ? W CYS 53  SG  ? ? ? 1_555 BB SF4 .   FE3 ? ? O CYS 53  O SF4 202 1_555 ? ? ? ? ? ? ? 2.334 ? ? 
metalc63 metalc ? ? W CYS 56  SG  ? ? ? 1_555 BB SF4 .   FE4 ? ? O CYS 56  O SF4 202 1_555 ? ? ? ? ? ? ? 2.329 ? ? 
metalc64 metalc ? ? W CYS 59  SG  ? ? ? 1_555 BB SF4 .   FE2 ? ? O CYS 59  O SF4 202 1_555 ? ? ? ? ? ? ? 2.331 ? ? 
metalc65 metalc ? ? W CYS 63  SG  ? ? ? 1_555 AB SF4 .   FE4 ? ? O CYS 63  O SF4 201 1_555 ? ? ? ? ? ? ? 2.324 ? ? 
metalc66 metalc ? ? W CYS 98  SG  ? ? ? 1_555 AB SF4 .   FE2 ? ? O CYS 98  O SF4 201 1_555 ? ? ? ? ? ? ? 2.326 ? ? 
metalc67 metalc ? ? W CYS 101 SG  ? ? ? 1_555 AB SF4 .   FE1 ? ? O CYS 101 O SF4 201 1_555 ? ? ? ? ? ? ? 2.315 ? ? 
metalc68 metalc ? ? W CYS 104 SG  ? ? ? 1_555 AB SF4 .   FE3 ? ? O CYS 104 O SF4 201 1_555 ? ? ? ? ? ? ? 2.334 ? ? 
metalc69 metalc ? ? W CYS 108 SG  ? ? ? 1_555 BB SF4 .   FE1 ? ? O CYS 108 O SF4 202 1_555 ? ? ? ? ? ? ? 2.331 ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1   SG  ? A  CYS 353 ? 1 CYS 353 ? 1_555 FE4 ? GA SF4 . ? 1 SF4 501 ? 1_555 S1 ? GA SF4 .   ? 1 SF4 501 ? 1_555 116.1 ? 
2   SG  ? A  CYS 353 ? 1 CYS 353 ? 1_555 FE4 ? GA SF4 . ? 1 SF4 501 ? 1_555 S2 ? GA SF4 .   ? 1 SF4 501 ? 1_555 112.0 ? 
3   S1  ? GA SF4 .   ? 1 SF4 501 ? 1_555 FE4 ? GA SF4 . ? 1 SF4 501 ? 1_555 S2 ? GA SF4 .   ? 1 SF4 501 ? 1_555 106.6 ? 
4   SG  ? A  CYS 353 ? 1 CYS 353 ? 1_555 FE4 ? GA SF4 . ? 1 SF4 501 ? 1_555 S3 ? GA SF4 .   ? 1 SF4 501 ? 1_555 111.9 ? 
5   S1  ? GA SF4 .   ? 1 SF4 501 ? 1_555 FE4 ? GA SF4 . ? 1 SF4 501 ? 1_555 S3 ? GA SF4 .   ? 1 SF4 501 ? 1_555 105.2 ? 
6   S2  ? GA SF4 .   ? 1 SF4 501 ? 1_555 FE4 ? GA SF4 . ? 1 SF4 501 ? 1_555 S3 ? GA SF4 .   ? 1 SF4 501 ? 1_555 104.1 ? 
7   SG  ? A  CYS 356 ? 1 CYS 356 ? 1_555 FE1 ? GA SF4 . ? 1 SF4 501 ? 1_555 S2 ? GA SF4 .   ? 1 SF4 501 ? 1_555 119.1 ? 
8   SG  ? A  CYS 356 ? 1 CYS 356 ? 1_555 FE1 ? GA SF4 . ? 1 SF4 501 ? 1_555 S3 ? GA SF4 .   ? 1 SF4 501 ? 1_555 107.8 ? 
9   S2  ? GA SF4 .   ? 1 SF4 501 ? 1_555 FE1 ? GA SF4 . ? 1 SF4 501 ? 1_555 S3 ? GA SF4 .   ? 1 SF4 501 ? 1_555 104.2 ? 
10  SG  ? A  CYS 356 ? 1 CYS 356 ? 1_555 FE1 ? GA SF4 . ? 1 SF4 501 ? 1_555 S4 ? GA SF4 .   ? 1 SF4 501 ? 1_555 112.9 ? 
11  S2  ? GA SF4 .   ? 1 SF4 501 ? 1_555 FE1 ? GA SF4 . ? 1 SF4 501 ? 1_555 S4 ? GA SF4 .   ? 1 SF4 501 ? 1_555 104.9 ? 
12  S3  ? GA SF4 .   ? 1 SF4 501 ? 1_555 FE1 ? GA SF4 . ? 1 SF4 501 ? 1_555 S4 ? GA SF4 .   ? 1 SF4 501 ? 1_555 107.0 ? 
13  SG  ? A  CYS 359 ? 1 CYS 359 ? 1_555 FE2 ? GA SF4 . ? 1 SF4 501 ? 1_555 S1 ? GA SF4 .   ? 1 SF4 501 ? 1_555 124.6 ? 
14  SG  ? A  CYS 359 ? 1 CYS 359 ? 1_555 FE2 ? GA SF4 . ? 1 SF4 501 ? 1_555 S3 ? GA SF4 .   ? 1 SF4 501 ? 1_555 109.3 ? 
15  S1  ? GA SF4 .   ? 1 SF4 501 ? 1_555 FE2 ? GA SF4 . ? 1 SF4 501 ? 1_555 S3 ? GA SF4 .   ? 1 SF4 501 ? 1_555 105.1 ? 
16  SG  ? A  CYS 359 ? 1 CYS 359 ? 1_555 FE2 ? GA SF4 . ? 1 SF4 501 ? 1_555 S4 ? GA SF4 .   ? 1 SF4 501 ? 1_555 104.1 ? 
17  S1  ? GA SF4 .   ? 1 SF4 501 ? 1_555 FE2 ? GA SF4 . ? 1 SF4 501 ? 1_555 S4 ? GA SF4 .   ? 1 SF4 501 ? 1_555 105.8 ? 
18  S3  ? GA SF4 .   ? 1 SF4 501 ? 1_555 FE2 ? GA SF4 . ? 1 SF4 501 ? 1_555 S4 ? GA SF4 .   ? 1 SF4 501 ? 1_555 106.8 ? 
19  SG  ? A  CYS 400 ? 1 CYS 400 ? 1_555 FE3 ? GA SF4 . ? 1 SF4 501 ? 1_555 S1 ? GA SF4 .   ? 1 SF4 501 ? 1_555 113.3 ? 
20  SG  ? A  CYS 400 ? 1 CYS 400 ? 1_555 FE3 ? GA SF4 . ? 1 SF4 501 ? 1_555 S2 ? GA SF4 .   ? 1 SF4 501 ? 1_555 114.0 ? 
21  S1  ? GA SF4 .   ? 1 SF4 501 ? 1_555 FE3 ? GA SF4 . ? 1 SF4 501 ? 1_555 S2 ? GA SF4 .   ? 1 SF4 501 ? 1_555 106.6 ? 
22  SG  ? A  CYS 400 ? 1 CYS 400 ? 1_555 FE3 ? GA SF4 . ? 1 SF4 501 ? 1_555 S4 ? GA SF4 .   ? 1 SF4 501 ? 1_555 111.9 ? 
23  S1  ? GA SF4 .   ? 1 SF4 501 ? 1_555 FE3 ? GA SF4 . ? 1 SF4 501 ? 1_555 S4 ? GA SF4 .   ? 1 SF4 501 ? 1_555 105.7 ? 
24  S2  ? GA SF4 .   ? 1 SF4 501 ? 1_555 FE3 ? GA SF4 . ? 1 SF4 501 ? 1_555 S4 ? GA SF4 .   ? 1 SF4 501 ? 1_555 104.7 ? 
25  SG  ? B  CYS 83  ? 2 CYS 83  ? 1_555 FE1 ? IA FES . ? 2 FES 201 ? 1_555 S1 ? IA FES .   ? 2 FES 201 ? 1_555 113.5 ? 
26  SG  ? B  CYS 83  ? 2 CYS 83  ? 1_555 FE1 ? IA FES . ? 2 FES 201 ? 1_555 S2 ? IA FES .   ? 2 FES 201 ? 1_555 111.7 ? 
27  S1  ? IA FES .   ? 2 FES 201 ? 1_555 FE1 ? IA FES . ? 2 FES 201 ? 1_555 S2 ? IA FES .   ? 2 FES 201 ? 1_555 90.7  ? 
28  SG  ? B  CYS 83  ? 2 CYS 83  ? 1_555 FE1 ? IA FES . ? 2 FES 201 ? 1_555 SG ? B  CYS 88  ? 2 CYS 88  ? 1_555 111.5 ? 
29  S1  ? IA FES .   ? 2 FES 201 ? 1_555 FE1 ? IA FES . ? 2 FES 201 ? 1_555 SG ? B  CYS 88  ? 2 CYS 88  ? 1_555 112.6 ? 
30  S2  ? IA FES .   ? 2 FES 201 ? 1_555 FE1 ? IA FES . ? 2 FES 201 ? 1_555 SG ? B  CYS 88  ? 2 CYS 88  ? 1_555 115.5 ? 
31  SG  ? B  CYS 124 ? 2 CYS 124 ? 1_555 FE2 ? IA FES . ? 2 FES 201 ? 1_555 S1 ? IA FES .   ? 2 FES 201 ? 1_555 110.9 ? 
32  SG  ? B  CYS 124 ? 2 CYS 124 ? 1_555 FE2 ? IA FES . ? 2 FES 201 ? 1_555 S2 ? IA FES .   ? 2 FES 201 ? 1_555 113.9 ? 
33  S1  ? IA FES .   ? 2 FES 201 ? 1_555 FE2 ? IA FES . ? 2 FES 201 ? 1_555 S2 ? IA FES .   ? 2 FES 201 ? 1_555 90.5  ? 
34  SG  ? B  CYS 124 ? 2 CYS 124 ? 1_555 FE2 ? IA FES . ? 2 FES 201 ? 1_555 SG ? B  CYS 128 ? 2 CYS 128 ? 1_555 114.3 ? 
35  S1  ? IA FES .   ? 2 FES 201 ? 1_555 FE2 ? IA FES . ? 2 FES 201 ? 1_555 SG ? B  CYS 128 ? 2 CYS 128 ? 1_555 113.0 ? 
36  S2  ? IA FES .   ? 2 FES 201 ? 1_555 FE2 ? IA FES . ? 2 FES 201 ? 1_555 SG ? B  CYS 128 ? 2 CYS 128 ? 1_555 112.0 ? 
37  SG  ? C  CYS 34  ? 3 CYS 34  ? 1_555 FE1 ? MA FES . ? 3 FES 804 ? 1_555 S1 ? MA FES .   ? 3 FES 804 ? 1_555 106.0 ? 
38  SG  ? C  CYS 34  ? 3 CYS 34  ? 1_555 FE1 ? MA FES . ? 3 FES 804 ? 1_555 S2 ? MA FES .   ? 3 FES 804 ? 1_555 106.6 ? 
39  S1  ? MA FES .   ? 3 FES 804 ? 1_555 FE1 ? MA FES . ? 3 FES 804 ? 1_555 S2 ? MA FES .   ? 3 FES 804 ? 1_555 88.8  ? 
40  SG  ? C  CYS 34  ? 3 CYS 34  ? 1_555 FE1 ? MA FES . ? 3 FES 804 ? 1_555 SG ? C  CYS 45  ? 3 CYS 45  ? 1_555 128.9 ? 
41  S1  ? MA FES .   ? 3 FES 804 ? 1_555 FE1 ? MA FES . ? 3 FES 804 ? 1_555 SG ? C  CYS 45  ? 3 CYS 45  ? 1_555 107.2 ? 
42  S2  ? MA FES .   ? 3 FES 804 ? 1_555 FE1 ? MA FES . ? 3 FES 804 ? 1_555 SG ? C  CYS 45  ? 3 CYS 45  ? 1_555 111.8 ? 
43  SG  ? C  CYS 48  ? 3 CYS 48  ? 1_555 FE2 ? MA FES . ? 3 FES 804 ? 1_555 S1 ? MA FES .   ? 3 FES 804 ? 1_555 106.8 ? 
44  SG  ? C  CYS 48  ? 3 CYS 48  ? 1_555 FE2 ? MA FES . ? 3 FES 804 ? 1_555 S2 ? MA FES .   ? 3 FES 804 ? 1_555 110.8 ? 
45  S1  ? MA FES .   ? 3 FES 804 ? 1_555 FE2 ? MA FES . ? 3 FES 804 ? 1_555 S2 ? MA FES .   ? 3 FES 804 ? 1_555 88.6  ? 
46  SG  ? C  CYS 48  ? 3 CYS 48  ? 1_555 FE2 ? MA FES . ? 3 FES 804 ? 1_555 SG ? C  CYS 83  ? 3 CYS 83  ? 1_555 125.8 ? 
47  S1  ? MA FES .   ? 3 FES 804 ? 1_555 FE2 ? MA FES . ? 3 FES 804 ? 1_555 SG ? C  CYS 83  ? 3 CYS 83  ? 1_555 103.2 ? 
48  S2  ? MA FES .   ? 3 FES 804 ? 1_555 FE2 ? MA FES . ? 3 FES 804 ? 1_555 SG ? C  CYS 83  ? 3 CYS 83  ? 1_555 114.2 ? 
49  NE2 ? C  HIS 115 ? 3 HIS 115 ? 1_555 FE3 ? JA SF4 . ? 3 SF4 801 ? 1_555 S1 ? JA SF4 .   ? 3 SF4 801 ? 1_555 110.0 ? 
50  NE2 ? C  HIS 115 ? 3 HIS 115 ? 1_555 FE3 ? JA SF4 . ? 3 SF4 801 ? 1_555 S2 ? JA SF4 .   ? 3 SF4 801 ? 1_555 124.3 ? 
51  S1  ? JA SF4 .   ? 3 SF4 801 ? 1_555 FE3 ? JA SF4 . ? 3 SF4 801 ? 1_555 S2 ? JA SF4 .   ? 3 SF4 801 ? 1_555 104.1 ? 
52  NE2 ? C  HIS 115 ? 3 HIS 115 ? 1_555 FE3 ? JA SF4 . ? 3 SF4 801 ? 1_555 S4 ? JA SF4 .   ? 3 SF4 801 ? 1_555 104.4 ? 
53  S1  ? JA SF4 .   ? 3 SF4 801 ? 1_555 FE3 ? JA SF4 . ? 3 SF4 801 ? 1_555 S4 ? JA SF4 .   ? 3 SF4 801 ? 1_555 107.1 ? 
54  S2  ? JA SF4 .   ? 3 SF4 801 ? 1_555 FE3 ? JA SF4 . ? 3 SF4 801 ? 1_555 S4 ? JA SF4 .   ? 3 SF4 801 ? 1_555 105.9 ? 
55  SG  ? C  CYS 119 ? 3 CYS 119 ? 1_555 FE2 ? JA SF4 . ? 3 SF4 801 ? 1_555 S1 ? JA SF4 .   ? 3 SF4 801 ? 1_555 109.4 ? 
56  SG  ? C  CYS 119 ? 3 CYS 119 ? 1_555 FE2 ? JA SF4 . ? 3 SF4 801 ? 1_555 S3 ? JA SF4 .   ? 3 SF4 801 ? 1_555 115.5 ? 
57  S1  ? JA SF4 .   ? 3 SF4 801 ? 1_555 FE2 ? JA SF4 . ? 3 SF4 801 ? 1_555 S3 ? JA SF4 .   ? 3 SF4 801 ? 1_555 106.9 ? 
58  SG  ? C  CYS 119 ? 3 CYS 119 ? 1_555 FE2 ? JA SF4 . ? 3 SF4 801 ? 1_555 S4 ? JA SF4 .   ? 3 SF4 801 ? 1_555 113.4 ? 
59  S1  ? JA SF4 .   ? 3 SF4 801 ? 1_555 FE2 ? JA SF4 . ? 3 SF4 801 ? 1_555 S4 ? JA SF4 .   ? 3 SF4 801 ? 1_555 106.9 ? 
60  S3  ? JA SF4 .   ? 3 SF4 801 ? 1_555 FE2 ? JA SF4 . ? 3 SF4 801 ? 1_555 S4 ? JA SF4 .   ? 3 SF4 801 ? 1_555 104.2 ? 
61  SG  ? C  CYS 122 ? 3 CYS 122 ? 1_555 FE4 ? JA SF4 . ? 3 SF4 801 ? 1_555 S1 ? JA SF4 .   ? 3 SF4 801 ? 1_555 113.4 ? 
62  SG  ? C  CYS 122 ? 3 CYS 122 ? 1_555 FE4 ? JA SF4 . ? 3 SF4 801 ? 1_555 S2 ? JA SF4 .   ? 3 SF4 801 ? 1_555 113.5 ? 
63  S1  ? JA SF4 .   ? 3 SF4 801 ? 1_555 FE4 ? JA SF4 . ? 3 SF4 801 ? 1_555 S2 ? JA SF4 .   ? 3 SF4 801 ? 1_555 104.4 ? 
64  SG  ? C  CYS 122 ? 3 CYS 122 ? 1_555 FE4 ? JA SF4 . ? 3 SF4 801 ? 1_555 S3 ? JA SF4 .   ? 3 SF4 801 ? 1_555 113.2 ? 
65  S1  ? JA SF4 .   ? 3 SF4 801 ? 1_555 FE4 ? JA SF4 . ? 3 SF4 801 ? 1_555 S3 ? JA SF4 .   ? 3 SF4 801 ? 1_555 107.1 ? 
66  S2  ? JA SF4 .   ? 3 SF4 801 ? 1_555 FE4 ? JA SF4 . ? 3 SF4 801 ? 1_555 S3 ? JA SF4 .   ? 3 SF4 801 ? 1_555 104.3 ? 
67  SG  ? C  CYS 128 ? 3 CYS 128 ? 1_555 FE1 ? JA SF4 . ? 3 SF4 801 ? 1_555 S2 ? JA SF4 .   ? 3 SF4 801 ? 1_555 109.6 ? 
68  SG  ? C  CYS 128 ? 3 CYS 128 ? 1_555 FE1 ? JA SF4 . ? 3 SF4 801 ? 1_555 S3 ? JA SF4 .   ? 3 SF4 801 ? 1_555 116.8 ? 
69  S2  ? JA SF4 .   ? 3 SF4 801 ? 1_555 FE1 ? JA SF4 . ? 3 SF4 801 ? 1_555 S3 ? JA SF4 .   ? 3 SF4 801 ? 1_555 104.4 ? 
70  SG  ? C  CYS 128 ? 3 CYS 128 ? 1_555 FE1 ? JA SF4 . ? 3 SF4 801 ? 1_555 S4 ? JA SF4 .   ? 3 SF4 801 ? 1_555 114.2 ? 
71  S2  ? JA SF4 .   ? 3 SF4 801 ? 1_555 FE1 ? JA SF4 . ? 3 SF4 801 ? 1_555 S4 ? JA SF4 .   ? 3 SF4 801 ? 1_555 106.3 ? 
72  S3  ? JA SF4 .   ? 3 SF4 801 ? 1_555 FE1 ? JA SF4 . ? 3 SF4 801 ? 1_555 S4 ? JA SF4 .   ? 3 SF4 801 ? 1_555 104.8 ? 
73  SG  ? C  CYS 181 ? 3 CYS 181 ? 1_555 FE2 ? KA SF4 . ? 3 SF4 802 ? 1_555 S1 ? KA SF4 .   ? 3 SF4 802 ? 1_555 112.7 ? 
74  SG  ? C  CYS 181 ? 3 CYS 181 ? 1_555 FE2 ? KA SF4 . ? 3 SF4 802 ? 1_555 S3 ? KA SF4 .   ? 3 SF4 802 ? 1_555 117.7 ? 
75  S1  ? KA SF4 .   ? 3 SF4 802 ? 1_555 FE2 ? KA SF4 . ? 3 SF4 802 ? 1_555 S3 ? KA SF4 .   ? 3 SF4 802 ? 1_555 105.6 ? 
76  SG  ? C  CYS 181 ? 3 CYS 181 ? 1_555 FE2 ? KA SF4 . ? 3 SF4 802 ? 1_555 S4 ? KA SF4 .   ? 3 SF4 802 ? 1_555 109.1 ? 
77  S1  ? KA SF4 .   ? 3 SF4 802 ? 1_555 FE2 ? KA SF4 . ? 3 SF4 802 ? 1_555 S4 ? KA SF4 .   ? 3 SF4 802 ? 1_555 105.7 ? 
78  S3  ? KA SF4 .   ? 3 SF4 802 ? 1_555 FE2 ? KA SF4 . ? 3 SF4 802 ? 1_555 S4 ? KA SF4 .   ? 3 SF4 802 ? 1_555 105.2 ? 
79  SG  ? C  CYS 184 ? 3 CYS 184 ? 1_555 FE1 ? KA SF4 . ? 3 SF4 802 ? 1_555 S2 ? KA SF4 .   ? 3 SF4 802 ? 1_555 107.7 ? 
80  SG  ? C  CYS 184 ? 3 CYS 184 ? 1_555 FE1 ? KA SF4 . ? 3 SF4 802 ? 1_555 S3 ? KA SF4 .   ? 3 SF4 802 ? 1_555 118.2 ? 
81  S2  ? KA SF4 .   ? 3 SF4 802 ? 1_555 FE1 ? KA SF4 . ? 3 SF4 802 ? 1_555 S3 ? KA SF4 .   ? 3 SF4 802 ? 1_555 105.2 ? 
82  SG  ? C  CYS 184 ? 3 CYS 184 ? 1_555 FE1 ? KA SF4 . ? 3 SF4 802 ? 1_555 S4 ? KA SF4 .   ? 3 SF4 802 ? 1_555 114.0 ? 
83  S2  ? KA SF4 .   ? 3 SF4 802 ? 1_555 FE1 ? KA SF4 . ? 3 SF4 802 ? 1_555 S4 ? KA SF4 .   ? 3 SF4 802 ? 1_555 105.5 ? 
84  S3  ? KA SF4 .   ? 3 SF4 802 ? 1_555 FE1 ? KA SF4 . ? 3 SF4 802 ? 1_555 S4 ? KA SF4 .   ? 3 SF4 802 ? 1_555 105.1 ? 
85  SG  ? C  CYS 187 ? 3 CYS 187 ? 1_555 FE3 ? KA SF4 . ? 3 SF4 802 ? 1_555 S1 ? KA SF4 .   ? 3 SF4 802 ? 1_555 118.9 ? 
86  SG  ? C  CYS 187 ? 3 CYS 187 ? 1_555 FE3 ? KA SF4 . ? 3 SF4 802 ? 1_555 S2 ? KA SF4 .   ? 3 SF4 802 ? 1_555 108.5 ? 
87  S1  ? KA SF4 .   ? 3 SF4 802 ? 1_555 FE3 ? KA SF4 . ? 3 SF4 802 ? 1_555 S2 ? KA SF4 .   ? 3 SF4 802 ? 1_555 105.0 ? 
88  SG  ? C  CYS 187 ? 3 CYS 187 ? 1_555 FE3 ? KA SF4 . ? 3 SF4 802 ? 1_555 S4 ? KA SF4 .   ? 3 SF4 802 ? 1_555 112.6 ? 
89  S1  ? KA SF4 .   ? 3 SF4 802 ? 1_555 FE3 ? KA SF4 . ? 3 SF4 802 ? 1_555 S4 ? KA SF4 .   ? 3 SF4 802 ? 1_555 104.8 ? 
90  S2  ? KA SF4 .   ? 3 SF4 802 ? 1_555 FE3 ? KA SF4 . ? 3 SF4 802 ? 1_555 S4 ? KA SF4 .   ? 3 SF4 802 ? 1_555 106.0 ? 
91  SG  ? C  CYS 230 ? 3 CYS 230 ? 1_555 FE4 ? KA SF4 . ? 3 SF4 802 ? 1_555 S1 ? KA SF4 .   ? 3 SF4 802 ? 1_555 115.8 ? 
92  SG  ? C  CYS 230 ? 3 CYS 230 ? 1_555 FE4 ? KA SF4 . ? 3 SF4 802 ? 1_555 S2 ? KA SF4 .   ? 3 SF4 802 ? 1_555 109.2 ? 
93  S1  ? KA SF4 .   ? 3 SF4 802 ? 1_555 FE4 ? KA SF4 . ? 3 SF4 802 ? 1_555 S2 ? KA SF4 .   ? 3 SF4 802 ? 1_555 105.0 ? 
94  SG  ? C  CYS 230 ? 3 CYS 230 ? 1_555 FE4 ? KA SF4 . ? 3 SF4 802 ? 1_555 S3 ? KA SF4 .   ? 3 SF4 802 ? 1_555 114.9 ? 
95  S1  ? KA SF4 .   ? 3 SF4 802 ? 1_555 FE4 ? KA SF4 . ? 3 SF4 802 ? 1_555 S3 ? KA SF4 .   ? 3 SF4 802 ? 1_555 105.7 ? 
96  S2  ? KA SF4 .   ? 3 SF4 802 ? 1_555 FE4 ? KA SF4 . ? 3 SF4 802 ? 1_555 S3 ? KA SF4 .   ? 3 SF4 802 ? 1_555 105.3 ? 
97  SG  ? C  CYS 256 ? 3 CYS 256 ? 1_555 FE1 ? LA SF4 . ? 3 SF4 803 ? 1_555 S2 ? LA SF4 .   ? 3 SF4 803 ? 1_555 111.6 ? 
98  SG  ? C  CYS 256 ? 3 CYS 256 ? 1_555 FE1 ? LA SF4 . ? 3 SF4 803 ? 1_555 S3 ? LA SF4 .   ? 3 SF4 803 ? 1_555 115.6 ? 
99  S2  ? LA SF4 .   ? 3 SF4 803 ? 1_555 FE1 ? LA SF4 . ? 3 SF4 803 ? 1_555 S3 ? LA SF4 .   ? 3 SF4 803 ? 1_555 105.0 ? 
100 SG  ? C  CYS 256 ? 3 CYS 256 ? 1_555 FE1 ? LA SF4 . ? 3 SF4 803 ? 1_555 S4 ? LA SF4 .   ? 3 SF4 803 ? 1_555 113.7 ? 
101 S2  ? LA SF4 .   ? 3 SF4 803 ? 1_555 FE1 ? LA SF4 . ? 3 SF4 803 ? 1_555 S4 ? LA SF4 .   ? 3 SF4 803 ? 1_555 103.6 ? 
102 S3  ? LA SF4 .   ? 3 SF4 803 ? 1_555 FE1 ? LA SF4 . ? 3 SF4 803 ? 1_555 S4 ? LA SF4 .   ? 3 SF4 803 ? 1_555 106.3 ? 
103 SG  ? C  CYS 263 ? 3 CYS 263 ? 1_555 FE3 ? LA SF4 . ? 3 SF4 803 ? 1_555 S1 ? LA SF4 .   ? 3 SF4 803 ? 1_555 114.4 ? 
104 SG  ? C  CYS 263 ? 3 CYS 263 ? 1_555 FE3 ? LA SF4 . ? 3 SF4 803 ? 1_555 S2 ? LA SF4 .   ? 3 SF4 803 ? 1_555 111.0 ? 
105 S1  ? LA SF4 .   ? 3 SF4 803 ? 1_555 FE3 ? LA SF4 . ? 3 SF4 803 ? 1_555 S2 ? LA SF4 .   ? 3 SF4 803 ? 1_555 106.9 ? 
106 SG  ? C  CYS 263 ? 3 CYS 263 ? 1_555 FE3 ? LA SF4 . ? 3 SF4 803 ? 1_555 S4 ? LA SF4 .   ? 3 SF4 803 ? 1_555 115.3 ? 
107 S1  ? LA SF4 .   ? 3 SF4 803 ? 1_555 FE3 ? LA SF4 . ? 3 SF4 803 ? 1_555 S4 ? LA SF4 .   ? 3 SF4 803 ? 1_555 104.9 ? 
108 S2  ? LA SF4 .   ? 3 SF4 803 ? 1_555 FE3 ? LA SF4 . ? 3 SF4 803 ? 1_555 S4 ? LA SF4 .   ? 3 SF4 803 ? 1_555 103.4 ? 
109 SG  ? C  CYS 291 ? 3 CYS 291 ? 1_555 FE2 ? LA SF4 . ? 3 SF4 803 ? 1_555 S1 ? LA SF4 .   ? 3 SF4 803 ? 1_555 111.2 ? 
110 SG  ? C  CYS 291 ? 3 CYS 291 ? 1_555 FE2 ? LA SF4 . ? 3 SF4 803 ? 1_555 S3 ? LA SF4 .   ? 3 SF4 803 ? 1_555 114.5 ? 
111 S1  ? LA SF4 .   ? 3 SF4 803 ? 1_555 FE2 ? LA SF4 . ? 3 SF4 803 ? 1_555 S3 ? LA SF4 .   ? 3 SF4 803 ? 1_555 105.3 ? 
112 SG  ? C  CYS 291 ? 3 CYS 291 ? 1_555 FE2 ? LA SF4 . ? 3 SF4 803 ? 1_555 S4 ? LA SF4 .   ? 3 SF4 803 ? 1_555 114.3 ? 
113 S1  ? LA SF4 .   ? 3 SF4 803 ? 1_555 FE2 ? LA SF4 . ? 3 SF4 803 ? 1_555 S4 ? LA SF4 .   ? 3 SF4 803 ? 1_555 104.9 ? 
114 S3  ? LA SF4 .   ? 3 SF4 803 ? 1_555 FE2 ? LA SF4 . ? 3 SF4 803 ? 1_555 S4 ? LA SF4 .   ? 3 SF4 803 ? 1_555 105.8 ? 
115 SG  ? F  CYS 45  ? 6 CYS 45  ? 1_555 FE3 ? OA SF4 . ? 6 SF4 201 ? 1_555 S1 ? OA SF4 .   ? 6 SF4 201 ? 1_555 113.5 ? 
116 SG  ? F  CYS 45  ? 6 CYS 45  ? 1_555 FE3 ? OA SF4 . ? 6 SF4 201 ? 1_555 S2 ? OA SF4 .   ? 6 SF4 201 ? 1_555 112.9 ? 
117 S1  ? OA SF4 .   ? 6 SF4 201 ? 1_555 FE3 ? OA SF4 . ? 6 SF4 201 ? 1_555 S2 ? OA SF4 .   ? 6 SF4 201 ? 1_555 103.4 ? 
118 SG  ? F  CYS 45  ? 6 CYS 45  ? 1_555 FE3 ? OA SF4 . ? 6 SF4 201 ? 1_555 S4 ? OA SF4 .   ? 6 SF4 201 ? 1_555 112.7 ? 
119 S1  ? OA SF4 .   ? 6 SF4 201 ? 1_555 FE3 ? OA SF4 . ? 6 SF4 201 ? 1_555 S4 ? OA SF4 .   ? 6 SF4 201 ? 1_555 107.8 ? 
120 S2  ? OA SF4 .   ? 6 SF4 201 ? 1_555 FE3 ? OA SF4 . ? 6 SF4 201 ? 1_555 S4 ? OA SF4 .   ? 6 SF4 201 ? 1_555 105.9 ? 
121 SG  ? F  CYS 46  ? 6 CYS 46  ? 1_555 FE2 ? OA SF4 . ? 6 SF4 201 ? 1_555 S1 ? OA SF4 .   ? 6 SF4 201 ? 1_555 109.0 ? 
122 SG  ? F  CYS 46  ? 6 CYS 46  ? 1_555 FE2 ? OA SF4 . ? 6 SF4 201 ? 1_555 S3 ? OA SF4 .   ? 6 SF4 201 ? 1_555 119.7 ? 
123 S1  ? OA SF4 .   ? 6 SF4 201 ? 1_555 FE2 ? OA SF4 . ? 6 SF4 201 ? 1_555 S3 ? OA SF4 .   ? 6 SF4 201 ? 1_555 104.0 ? 
124 SG  ? F  CYS 46  ? 6 CYS 46  ? 1_555 FE2 ? OA SF4 . ? 6 SF4 201 ? 1_555 S4 ? OA SF4 .   ? 6 SF4 201 ? 1_555 111.0 ? 
125 S1  ? OA SF4 .   ? 6 SF4 201 ? 1_555 FE2 ? OA SF4 . ? 6 SF4 201 ? 1_555 S4 ? OA SF4 .   ? 6 SF4 201 ? 1_555 108.1 ? 
126 S3  ? OA SF4 .   ? 6 SF4 201 ? 1_555 FE2 ? OA SF4 . ? 6 SF4 201 ? 1_555 S4 ? OA SF4 .   ? 6 SF4 201 ? 1_555 104.4 ? 
127 SG  ? F  CYS 111 ? 6 CYS 111 ? 1_555 FE1 ? OA SF4 . ? 6 SF4 201 ? 1_555 S2 ? OA SF4 .   ? 6 SF4 201 ? 1_555 109.6 ? 
128 SG  ? F  CYS 111 ? 6 CYS 111 ? 1_555 FE1 ? OA SF4 . ? 6 SF4 201 ? 1_555 S3 ? OA SF4 .   ? 6 SF4 201 ? 1_555 115.1 ? 
129 S2  ? OA SF4 .   ? 6 SF4 201 ? 1_555 FE1 ? OA SF4 . ? 6 SF4 201 ? 1_555 S3 ? OA SF4 .   ? 6 SF4 201 ? 1_555 107.8 ? 
130 SG  ? F  CYS 111 ? 6 CYS 111 ? 1_555 FE1 ? OA SF4 . ? 6 SF4 201 ? 1_555 S4 ? OA SF4 .   ? 6 SF4 201 ? 1_555 114.1 ? 
131 S2  ? OA SF4 .   ? 6 SF4 201 ? 1_555 FE1 ? OA SF4 . ? 6 SF4 201 ? 1_555 S4 ? OA SF4 .   ? 6 SF4 201 ? 1_555 105.6 ? 
132 S3  ? OA SF4 .   ? 6 SF4 201 ? 1_555 FE1 ? OA SF4 . ? 6 SF4 201 ? 1_555 S4 ? OA SF4 .   ? 6 SF4 201 ? 1_555 104.1 ? 
133 SG  ? F  CYS 140 ? 6 CYS 140 ? 1_555 FE4 ? OA SF4 . ? 6 SF4 201 ? 1_555 S1 ? OA SF4 .   ? 6 SF4 201 ? 1_555 116.1 ? 
134 SG  ? F  CYS 140 ? 6 CYS 140 ? 1_555 FE4 ? OA SF4 . ? 6 SF4 201 ? 1_555 S2 ? OA SF4 .   ? 6 SF4 201 ? 1_555 112.3 ? 
135 S1  ? OA SF4 .   ? 6 SF4 201 ? 1_555 FE4 ? OA SF4 . ? 6 SF4 201 ? 1_555 S2 ? OA SF4 .   ? 6 SF4 201 ? 1_555 103.1 ? 
136 SG  ? F  CYS 140 ? 6 CYS 140 ? 1_555 FE4 ? OA SF4 . ? 6 SF4 201 ? 1_555 S3 ? OA SF4 .   ? 6 SF4 201 ? 1_555 112.4 ? 
137 S1  ? OA SF4 .   ? 6 SF4 201 ? 1_555 FE4 ? OA SF4 . ? 6 SF4 201 ? 1_555 S3 ? OA SF4 .   ? 6 SF4 201 ? 1_555 104.1 ? 
138 S2  ? OA SF4 .   ? 6 SF4 201 ? 1_555 FE4 ? OA SF4 . ? 6 SF4 201 ? 1_555 S3 ? OA SF4 .   ? 6 SF4 201 ? 1_555 108.2 ? 
139 SG  ? G  CYS 53  ? 9 CYS 53  ? 1_555 FE3 ? QA SF4 . ? 9 SF4 202 ? 1_555 S1 ? QA SF4 .   ? 9 SF4 202 ? 1_555 112.4 ? 
140 SG  ? G  CYS 53  ? 9 CYS 53  ? 1_555 FE3 ? QA SF4 . ? 9 SF4 202 ? 1_555 S2 ? QA SF4 .   ? 9 SF4 202 ? 1_555 117.1 ? 
141 S1  ? QA SF4 .   ? 9 SF4 202 ? 1_555 FE3 ? QA SF4 . ? 9 SF4 202 ? 1_555 S2 ? QA SF4 .   ? 9 SF4 202 ? 1_555 103.1 ? 
142 SG  ? G  CYS 53  ? 9 CYS 53  ? 1_555 FE3 ? QA SF4 . ? 9 SF4 202 ? 1_555 S4 ? QA SF4 .   ? 9 SF4 202 ? 1_555 110.5 ? 
143 S1  ? QA SF4 .   ? 9 SF4 202 ? 1_555 FE3 ? QA SF4 . ? 9 SF4 202 ? 1_555 S4 ? QA SF4 .   ? 9 SF4 202 ? 1_555 106.8 ? 
144 S2  ? QA SF4 .   ? 9 SF4 202 ? 1_555 FE3 ? QA SF4 . ? 9 SF4 202 ? 1_555 S4 ? QA SF4 .   ? 9 SF4 202 ? 1_555 106.2 ? 
145 SG  ? G  CYS 56  ? 9 CYS 56  ? 1_555 FE4 ? QA SF4 . ? 9 SF4 202 ? 1_555 S1 ? QA SF4 .   ? 9 SF4 202 ? 1_555 116.7 ? 
146 SG  ? G  CYS 56  ? 9 CYS 56  ? 1_555 FE4 ? QA SF4 . ? 9 SF4 202 ? 1_555 S2 ? QA SF4 .   ? 9 SF4 202 ? 1_555 115.2 ? 
147 S1  ? QA SF4 .   ? 9 SF4 202 ? 1_555 FE4 ? QA SF4 . ? 9 SF4 202 ? 1_555 S2 ? QA SF4 .   ? 9 SF4 202 ? 1_555 103.2 ? 
148 SG  ? G  CYS 56  ? 9 CYS 56  ? 1_555 FE4 ? QA SF4 . ? 9 SF4 202 ? 1_555 S3 ? QA SF4 .   ? 9 SF4 202 ? 1_555 108.9 ? 
149 S1  ? QA SF4 .   ? 9 SF4 202 ? 1_555 FE4 ? QA SF4 . ? 9 SF4 202 ? 1_555 S3 ? QA SF4 .   ? 9 SF4 202 ? 1_555 105.5 ? 
150 S2  ? QA SF4 .   ? 9 SF4 202 ? 1_555 FE4 ? QA SF4 . ? 9 SF4 202 ? 1_555 S3 ? QA SF4 .   ? 9 SF4 202 ? 1_555 106.5 ? 
151 SG  ? G  CYS 59  ? 9 CYS 59  ? 1_555 FE2 ? QA SF4 . ? 9 SF4 202 ? 1_555 S1 ? QA SF4 .   ? 9 SF4 202 ? 1_555 113.0 ? 
152 SG  ? G  CYS 59  ? 9 CYS 59  ? 1_555 FE2 ? QA SF4 . ? 9 SF4 202 ? 1_555 S3 ? QA SF4 .   ? 9 SF4 202 ? 1_555 112.5 ? 
153 S1  ? QA SF4 .   ? 9 SF4 202 ? 1_555 FE2 ? QA SF4 . ? 9 SF4 202 ? 1_555 S3 ? QA SF4 .   ? 9 SF4 202 ? 1_555 105.5 ? 
154 SG  ? G  CYS 59  ? 9 CYS 59  ? 1_555 FE2 ? QA SF4 . ? 9 SF4 202 ? 1_555 S4 ? QA SF4 .   ? 9 SF4 202 ? 1_555 114.3 ? 
155 S1  ? QA SF4 .   ? 9 SF4 202 ? 1_555 FE2 ? QA SF4 . ? 9 SF4 202 ? 1_555 S4 ? QA SF4 .   ? 9 SF4 202 ? 1_555 106.5 ? 
156 S3  ? QA SF4 .   ? 9 SF4 202 ? 1_555 FE2 ? QA SF4 . ? 9 SF4 202 ? 1_555 S4 ? QA SF4 .   ? 9 SF4 202 ? 1_555 104.3 ? 
157 SG  ? G  CYS 63  ? 9 CYS 63  ? 1_555 FE4 ? PA SF4 . ? 9 SF4 201 ? 1_555 S1 ? PA SF4 .   ? 9 SF4 201 ? 1_555 117.0 ? 
158 SG  ? G  CYS 63  ? 9 CYS 63  ? 1_555 FE4 ? PA SF4 . ? 9 SF4 201 ? 1_555 S2 ? PA SF4 .   ? 9 SF4 201 ? 1_555 112.2 ? 
159 S1  ? PA SF4 .   ? 9 SF4 201 ? 1_555 FE4 ? PA SF4 . ? 9 SF4 201 ? 1_555 S2 ? PA SF4 .   ? 9 SF4 201 ? 1_555 104.0 ? 
160 SG  ? G  CYS 63  ? 9 CYS 63  ? 1_555 FE4 ? PA SF4 . ? 9 SF4 201 ? 1_555 S3 ? PA SF4 .   ? 9 SF4 201 ? 1_555 110.4 ? 
161 S1  ? PA SF4 .   ? 9 SF4 201 ? 1_555 FE4 ? PA SF4 . ? 9 SF4 201 ? 1_555 S3 ? PA SF4 .   ? 9 SF4 201 ? 1_555 104.7 ? 
162 S2  ? PA SF4 .   ? 9 SF4 201 ? 1_555 FE4 ? PA SF4 . ? 9 SF4 201 ? 1_555 S3 ? PA SF4 .   ? 9 SF4 201 ? 1_555 107.9 ? 
163 SG  ? G  CYS 98  ? 9 CYS 98  ? 1_555 FE2 ? PA SF4 . ? 9 SF4 201 ? 1_555 S1 ? PA SF4 .   ? 9 SF4 201 ? 1_555 112.6 ? 
164 SG  ? G  CYS 98  ? 9 CYS 98  ? 1_555 FE2 ? PA SF4 . ? 9 SF4 201 ? 1_555 S3 ? PA SF4 .   ? 9 SF4 201 ? 1_555 116.6 ? 
165 S1  ? PA SF4 .   ? 9 SF4 201 ? 1_555 FE2 ? PA SF4 . ? 9 SF4 201 ? 1_555 S3 ? PA SF4 .   ? 9 SF4 201 ? 1_555 105.1 ? 
166 SG  ? G  CYS 98  ? 9 CYS 98  ? 1_555 FE2 ? PA SF4 . ? 9 SF4 201 ? 1_555 S4 ? PA SF4 .   ? 9 SF4 201 ? 1_555 111.1 ? 
167 S1  ? PA SF4 .   ? 9 SF4 201 ? 1_555 FE2 ? PA SF4 . ? 9 SF4 201 ? 1_555 S4 ? PA SF4 .   ? 9 SF4 201 ? 1_555 106.5 ? 
168 S3  ? PA SF4 .   ? 9 SF4 201 ? 1_555 FE2 ? PA SF4 . ? 9 SF4 201 ? 1_555 S4 ? PA SF4 .   ? 9 SF4 201 ? 1_555 104.1 ? 
169 SG  ? G  CYS 101 ? 9 CYS 101 ? 1_555 FE1 ? PA SF4 . ? 9 SF4 201 ? 1_555 S2 ? PA SF4 .   ? 9 SF4 201 ? 1_555 113.1 ? 
170 SG  ? G  CYS 101 ? 9 CYS 101 ? 1_555 FE1 ? PA SF4 . ? 9 SF4 201 ? 1_555 S3 ? PA SF4 .   ? 9 SF4 201 ? 1_555 110.6 ? 
171 S2  ? PA SF4 .   ? 9 SF4 201 ? 1_555 FE1 ? PA SF4 . ? 9 SF4 201 ? 1_555 S3 ? PA SF4 .   ? 9 SF4 201 ? 1_555 108.2 ? 
172 SG  ? G  CYS 101 ? 9 CYS 101 ? 1_555 FE1 ? PA SF4 . ? 9 SF4 201 ? 1_555 S4 ? PA SF4 .   ? 9 SF4 201 ? 1_555 115.4 ? 
173 S2  ? PA SF4 .   ? 9 SF4 201 ? 1_555 FE1 ? PA SF4 . ? 9 SF4 201 ? 1_555 S4 ? PA SF4 .   ? 9 SF4 201 ? 1_555 104.8 ? 
174 S3  ? PA SF4 .   ? 9 SF4 201 ? 1_555 FE1 ? PA SF4 . ? 9 SF4 201 ? 1_555 S4 ? PA SF4 .   ? 9 SF4 201 ? 1_555 104.0 ? 
175 SG  ? G  CYS 104 ? 9 CYS 104 ? 1_555 FE3 ? PA SF4 . ? 9 SF4 201 ? 1_555 S1 ? PA SF4 .   ? 9 SF4 201 ? 1_555 117.4 ? 
176 SG  ? G  CYS 104 ? 9 CYS 104 ? 1_555 FE3 ? PA SF4 . ? 9 SF4 201 ? 1_555 S2 ? PA SF4 .   ? 9 SF4 201 ? 1_555 116.1 ? 
177 S1  ? PA SF4 .   ? 9 SF4 201 ? 1_555 FE3 ? PA SF4 . ? 9 SF4 201 ? 1_555 S2 ? PA SF4 .   ? 9 SF4 201 ? 1_555 104.0 ? 
178 SG  ? G  CYS 104 ? 9 CYS 104 ? 1_555 FE3 ? PA SF4 . ? 9 SF4 201 ? 1_555 S4 ? PA SF4 .   ? 9 SF4 201 ? 1_555 106.9 ? 
179 S1  ? PA SF4 .   ? 9 SF4 201 ? 1_555 FE3 ? PA SF4 . ? 9 SF4 201 ? 1_555 S4 ? PA SF4 .   ? 9 SF4 201 ? 1_555 106.1 ? 
180 S2  ? PA SF4 .   ? 9 SF4 201 ? 1_555 FE3 ? PA SF4 . ? 9 SF4 201 ? 1_555 S4 ? PA SF4 .   ? 9 SF4 201 ? 1_555 105.3 ? 
181 SG  ? G  CYS 108 ? 9 CYS 108 ? 1_555 FE1 ? QA SF4 . ? 9 SF4 202 ? 1_555 S2 ? QA SF4 .   ? 9 SF4 202 ? 1_555 116.3 ? 
182 SG  ? G  CYS 108 ? 9 CYS 108 ? 1_555 FE1 ? QA SF4 . ? 9 SF4 202 ? 1_555 S3 ? QA SF4 .   ? 9 SF4 202 ? 1_555 110.2 ? 
183 S2  ? QA SF4 .   ? 9 SF4 202 ? 1_555 FE1 ? QA SF4 . ? 9 SF4 202 ? 1_555 S3 ? QA SF4 .   ? 9 SF4 202 ? 1_555 106.0 ? 
184 SG  ? G  CYS 108 ? 9 CYS 108 ? 1_555 FE1 ? QA SF4 . ? 9 SF4 202 ? 1_555 S4 ? QA SF4 .   ? 9 SF4 202 ? 1_555 113.2 ? 
185 S2  ? QA SF4 .   ? 9 SF4 202 ? 1_555 FE1 ? QA SF4 . ? 9 SF4 202 ? 1_555 S4 ? QA SF4 .   ? 9 SF4 202 ? 1_555 106.2 ? 
186 S3  ? QA SF4 .   ? 9 SF4 202 ? 1_555 FE1 ? QA SF4 . ? 9 SF4 202 ? 1_555 S4 ? QA SF4 .   ? 9 SF4 202 ? 1_555 103.9 ? 
187 SG  ? Q  CYS 356 ? B CYS 356 ? 1_555 FE1 ? RA SF4 . ? B SF4 501 ? 1_555 S2 ? RA SF4 .   ? B SF4 501 ? 1_555 118.6 ? 
188 SG  ? Q  CYS 356 ? B CYS 356 ? 1_555 FE1 ? RA SF4 . ? B SF4 501 ? 1_555 S3 ? RA SF4 .   ? B SF4 501 ? 1_555 109.7 ? 
189 S2  ? RA SF4 .   ? B SF4 501 ? 1_555 FE1 ? RA SF4 . ? B SF4 501 ? 1_555 S3 ? RA SF4 .   ? B SF4 501 ? 1_555 104.1 ? 
190 SG  ? Q  CYS 356 ? B CYS 356 ? 1_555 FE1 ? RA SF4 . ? B SF4 501 ? 1_555 S4 ? RA SF4 .   ? B SF4 501 ? 1_555 111.1 ? 
191 S2  ? RA SF4 .   ? B SF4 501 ? 1_555 FE1 ? RA SF4 . ? B SF4 501 ? 1_555 S4 ? RA SF4 .   ? B SF4 501 ? 1_555 106.1 ? 
192 S3  ? RA SF4 .   ? B SF4 501 ? 1_555 FE1 ? RA SF4 . ? B SF4 501 ? 1_555 S4 ? RA SF4 .   ? B SF4 501 ? 1_555 106.4 ? 
193 SG  ? Q  CYS 359 ? B CYS 359 ? 1_555 FE2 ? RA SF4 . ? B SF4 501 ? 1_555 S1 ? RA SF4 .   ? B SF4 501 ? 1_555 123.4 ? 
194 SG  ? Q  CYS 359 ? B CYS 359 ? 1_555 FE2 ? RA SF4 . ? B SF4 501 ? 1_555 S3 ? RA SF4 .   ? B SF4 501 ? 1_555 107.9 ? 
195 S1  ? RA SF4 .   ? B SF4 501 ? 1_555 FE2 ? RA SF4 . ? B SF4 501 ? 1_555 S3 ? RA SF4 .   ? B SF4 501 ? 1_555 104.7 ? 
196 SG  ? Q  CYS 359 ? B CYS 359 ? 1_555 FE2 ? RA SF4 . ? B SF4 501 ? 1_555 S4 ? RA SF4 .   ? B SF4 501 ? 1_555 107.6 ? 
197 S1  ? RA SF4 .   ? B SF4 501 ? 1_555 FE2 ? RA SF4 . ? B SF4 501 ? 1_555 S4 ? RA SF4 .   ? B SF4 501 ? 1_555 105.8 ? 
198 S3  ? RA SF4 .   ? B SF4 501 ? 1_555 FE2 ? RA SF4 . ? B SF4 501 ? 1_555 S4 ? RA SF4 .   ? B SF4 501 ? 1_555 106.4 ? 
199 SG  ? Q  CYS 400 ? B CYS 400 ? 1_555 FE3 ? RA SF4 . ? B SF4 501 ? 1_555 S1 ? RA SF4 .   ? B SF4 501 ? 1_555 114.4 ? 
200 SG  ? Q  CYS 400 ? B CYS 400 ? 1_555 FE3 ? RA SF4 . ? B SF4 501 ? 1_555 S2 ? RA SF4 .   ? B SF4 501 ? 1_555 109.9 ? 
201 S1  ? RA SF4 .   ? B SF4 501 ? 1_555 FE3 ? RA SF4 . ? B SF4 501 ? 1_555 S2 ? RA SF4 .   ? B SF4 501 ? 1_555 106.6 ? 
202 SG  ? Q  CYS 400 ? B CYS 400 ? 1_555 FE3 ? RA SF4 . ? B SF4 501 ? 1_555 S4 ? RA SF4 .   ? B SF4 501 ? 1_555 114.1 ? 
203 S1  ? RA SF4 .   ? B SF4 501 ? 1_555 FE3 ? RA SF4 . ? B SF4 501 ? 1_555 S4 ? RA SF4 .   ? B SF4 501 ? 1_555 105.5 ? 
204 S2  ? RA SF4 .   ? B SF4 501 ? 1_555 FE3 ? RA SF4 . ? B SF4 501 ? 1_555 S4 ? RA SF4 .   ? B SF4 501 ? 1_555 105.7 ? 
205 SG  ? R  CYS 83  ? C CYS 83  ? 1_555 FE1 ? TA FES . ? C FES 201 ? 1_555 S1 ? TA FES .   ? C FES 201 ? 1_555 114.1 ? 
206 SG  ? R  CYS 83  ? C CYS 83  ? 1_555 FE1 ? TA FES . ? C FES 201 ? 1_555 S2 ? TA FES .   ? C FES 201 ? 1_555 115.4 ? 
207 S1  ? TA FES .   ? C FES 201 ? 1_555 FE1 ? TA FES . ? C FES 201 ? 1_555 S2 ? TA FES .   ? C FES 201 ? 1_555 89.6  ? 
208 SG  ? R  CYS 83  ? C CYS 83  ? 1_555 FE1 ? TA FES . ? C FES 201 ? 1_555 SG ? R  CYS 88  ? C CYS 88  ? 1_555 109.2 ? 
209 S1  ? TA FES .   ? C FES 201 ? 1_555 FE1 ? TA FES . ? C FES 201 ? 1_555 SG ? R  CYS 88  ? C CYS 88  ? 1_555 110.3 ? 
210 S2  ? TA FES .   ? C FES 201 ? 1_555 FE1 ? TA FES . ? C FES 201 ? 1_555 SG ? R  CYS 88  ? C CYS 88  ? 1_555 117.1 ? 
211 SG  ? R  CYS 124 ? C CYS 124 ? 1_555 FE2 ? TA FES . ? C FES 201 ? 1_555 S1 ? TA FES .   ? C FES 201 ? 1_555 112.6 ? 
212 SG  ? R  CYS 124 ? C CYS 124 ? 1_555 FE2 ? TA FES . ? C FES 201 ? 1_555 S2 ? TA FES .   ? C FES 201 ? 1_555 116.3 ? 
213 S1  ? TA FES .   ? C FES 201 ? 1_555 FE2 ? TA FES . ? C FES 201 ? 1_555 S2 ? TA FES .   ? C FES 201 ? 1_555 89.6  ? 
214 SG  ? R  CYS 124 ? C CYS 124 ? 1_555 FE2 ? TA FES . ? C FES 201 ? 1_555 SG ? R  CYS 128 ? C CYS 128 ? 1_555 111.2 ? 
215 S1  ? TA FES .   ? C FES 201 ? 1_555 FE2 ? TA FES . ? C FES 201 ? 1_555 SG ? R  CYS 128 ? C CYS 128 ? 1_555 110.0 ? 
216 S2  ? TA FES .   ? C FES 201 ? 1_555 FE2 ? TA FES . ? C FES 201 ? 1_555 SG ? R  CYS 128 ? C CYS 128 ? 1_555 115.2 ? 
217 SG  ? S  CYS 34  ? D CYS 34  ? 1_555 FE1 ? XA FES . ? D FES 804 ? 1_555 S1 ? XA FES .   ? D FES 804 ? 1_555 107.8 ? 
218 SG  ? S  CYS 34  ? D CYS 34  ? 1_555 FE1 ? XA FES . ? D FES 804 ? 1_555 S2 ? XA FES .   ? D FES 804 ? 1_555 108.3 ? 
219 S1  ? XA FES .   ? D FES 804 ? 1_555 FE1 ? XA FES . ? D FES 804 ? 1_555 S2 ? XA FES .   ? D FES 804 ? 1_555 89.2  ? 
220 SG  ? S  CYS 34  ? D CYS 34  ? 1_555 FE1 ? XA FES . ? D FES 804 ? 1_555 SG ? S  CYS 45  ? D CYS 45  ? 1_555 126.8 ? 
221 S1  ? XA FES .   ? D FES 804 ? 1_555 FE1 ? XA FES . ? D FES 804 ? 1_555 SG ? S  CYS 45  ? D CYS 45  ? 1_555 106.6 ? 
222 S2  ? XA FES .   ? D FES 804 ? 1_555 FE1 ? XA FES . ? D FES 804 ? 1_555 SG ? S  CYS 45  ? D CYS 45  ? 1_555 111.4 ? 
223 SG  ? S  CYS 48  ? D CYS 48  ? 1_555 FE2 ? XA FES . ? D FES 804 ? 1_555 S1 ? XA FES .   ? D FES 804 ? 1_555 110.4 ? 
224 SG  ? S  CYS 48  ? D CYS 48  ? 1_555 FE2 ? XA FES . ? D FES 804 ? 1_555 S2 ? XA FES .   ? D FES 804 ? 1_555 110.3 ? 
225 S1  ? XA FES .   ? D FES 804 ? 1_555 FE2 ? XA FES . ? D FES 804 ? 1_555 S2 ? XA FES .   ? D FES 804 ? 1_555 89.0  ? 
226 SG  ? S  CYS 48  ? D CYS 48  ? 1_555 FE2 ? XA FES . ? D FES 804 ? 1_555 SG ? S  CYS 83  ? D CYS 83  ? 1_555 123.0 ? 
227 S1  ? XA FES .   ? D FES 804 ? 1_555 FE2 ? XA FES . ? D FES 804 ? 1_555 SG ? S  CYS 83  ? D CYS 83  ? 1_555 104.2 ? 
228 S2  ? XA FES .   ? D FES 804 ? 1_555 FE2 ? XA FES . ? D FES 804 ? 1_555 SG ? S  CYS 83  ? D CYS 83  ? 1_555 114.2 ? 
229 NE2 ? S  HIS 115 ? D HIS 115 ? 1_555 FE3 ? UA SF4 . ? D SF4 801 ? 1_555 S1 ? UA SF4 .   ? D SF4 801 ? 1_555 93.1  ? 
230 NE2 ? S  HIS 115 ? D HIS 115 ? 1_555 FE3 ? UA SF4 . ? D SF4 801 ? 1_555 S2 ? UA SF4 .   ? D SF4 801 ? 1_555 151.5 ? 
231 S1  ? UA SF4 .   ? D SF4 801 ? 1_555 FE3 ? UA SF4 . ? D SF4 801 ? 1_555 S2 ? UA SF4 .   ? D SF4 801 ? 1_555 105.9 ? 
232 NE2 ? S  HIS 115 ? D HIS 115 ? 1_555 FE3 ? UA SF4 . ? D SF4 801 ? 1_555 S4 ? UA SF4 .   ? D SF4 801 ? 1_555 88.5  ? 
233 S1  ? UA SF4 .   ? D SF4 801 ? 1_555 FE3 ? UA SF4 . ? D SF4 801 ? 1_555 S4 ? UA SF4 .   ? D SF4 801 ? 1_555 105.0 ? 
234 S2  ? UA SF4 .   ? D SF4 801 ? 1_555 FE3 ? UA SF4 . ? D SF4 801 ? 1_555 S4 ? UA SF4 .   ? D SF4 801 ? 1_555 106.1 ? 
235 SG  ? S  CYS 119 ? D CYS 119 ? 1_555 FE2 ? UA SF4 . ? D SF4 801 ? 1_555 S1 ? UA SF4 .   ? D SF4 801 ? 1_555 113.8 ? 
236 SG  ? S  CYS 119 ? D CYS 119 ? 1_555 FE2 ? UA SF4 . ? D SF4 801 ? 1_555 S3 ? UA SF4 .   ? D SF4 801 ? 1_555 113.6 ? 
237 S1  ? UA SF4 .   ? D SF4 801 ? 1_555 FE2 ? UA SF4 . ? D SF4 801 ? 1_555 S3 ? UA SF4 .   ? D SF4 801 ? 1_555 106.1 ? 
238 SG  ? S  CYS 119 ? D CYS 119 ? 1_555 FE2 ? UA SF4 . ? D SF4 801 ? 1_555 S4 ? UA SF4 .   ? D SF4 801 ? 1_555 112.6 ? 
239 S1  ? UA SF4 .   ? D SF4 801 ? 1_555 FE2 ? UA SF4 . ? D SF4 801 ? 1_555 S4 ? UA SF4 .   ? D SF4 801 ? 1_555 105.2 ? 
240 S3  ? UA SF4 .   ? D SF4 801 ? 1_555 FE2 ? UA SF4 . ? D SF4 801 ? 1_555 S4 ? UA SF4 .   ? D SF4 801 ? 1_555 104.7 ? 
241 SG  ? S  CYS 122 ? D CYS 122 ? 1_555 FE4 ? UA SF4 . ? D SF4 801 ? 1_555 S1 ? UA SF4 .   ? D SF4 801 ? 1_555 111.8 ? 
242 SG  ? S  CYS 122 ? D CYS 122 ? 1_555 FE4 ? UA SF4 . ? D SF4 801 ? 1_555 S2 ? UA SF4 .   ? D SF4 801 ? 1_555 113.1 ? 
243 S1  ? UA SF4 .   ? D SF4 801 ? 1_555 FE4 ? UA SF4 . ? D SF4 801 ? 1_555 S2 ? UA SF4 .   ? D SF4 801 ? 1_555 106.1 ? 
244 SG  ? S  CYS 122 ? D CYS 122 ? 1_555 FE4 ? UA SF4 . ? D SF4 801 ? 1_555 S3 ? UA SF4 .   ? D SF4 801 ? 1_555 114.5 ? 
245 S1  ? UA SF4 .   ? D SF4 801 ? 1_555 FE4 ? UA SF4 . ? D SF4 801 ? 1_555 S3 ? UA SF4 .   ? D SF4 801 ? 1_555 105.7 ? 
246 S2  ? UA SF4 .   ? D SF4 801 ? 1_555 FE4 ? UA SF4 . ? D SF4 801 ? 1_555 S3 ? UA SF4 .   ? D SF4 801 ? 1_555 104.9 ? 
247 SG  ? S  CYS 128 ? D CYS 128 ? 1_555 FE1 ? UA SF4 . ? D SF4 801 ? 1_555 S2 ? UA SF4 .   ? D SF4 801 ? 1_555 113.1 ? 
248 SG  ? S  CYS 128 ? D CYS 128 ? 1_555 FE1 ? UA SF4 . ? D SF4 801 ? 1_555 S3 ? UA SF4 .   ? D SF4 801 ? 1_555 113.9 ? 
249 S2  ? UA SF4 .   ? D SF4 801 ? 1_555 FE1 ? UA SF4 . ? D SF4 801 ? 1_555 S3 ? UA SF4 .   ? D SF4 801 ? 1_555 105.1 ? 
250 SG  ? S  CYS 128 ? D CYS 128 ? 1_555 FE1 ? UA SF4 . ? D SF4 801 ? 1_555 S4 ? UA SF4 .   ? D SF4 801 ? 1_555 113.2 ? 
251 S2  ? UA SF4 .   ? D SF4 801 ? 1_555 FE1 ? UA SF4 . ? D SF4 801 ? 1_555 S4 ? UA SF4 .   ? D SF4 801 ? 1_555 106.2 ? 
252 S3  ? UA SF4 .   ? D SF4 801 ? 1_555 FE1 ? UA SF4 . ? D SF4 801 ? 1_555 S4 ? UA SF4 .   ? D SF4 801 ? 1_555 104.6 ? 
253 SG  ? S  CYS 181 ? D CYS 181 ? 1_555 FE2 ? VA SF4 . ? D SF4 802 ? 1_555 S1 ? VA SF4 .   ? D SF4 802 ? 1_555 111.9 ? 
254 SG  ? S  CYS 181 ? D CYS 181 ? 1_555 FE2 ? VA SF4 . ? D SF4 802 ? 1_555 S3 ? VA SF4 .   ? D SF4 802 ? 1_555 115.2 ? 
255 S1  ? VA SF4 .   ? D SF4 802 ? 1_555 FE2 ? VA SF4 . ? D SF4 802 ? 1_555 S3 ? VA SF4 .   ? D SF4 802 ? 1_555 106.0 ? 
256 SG  ? S  CYS 181 ? D CYS 181 ? 1_555 FE2 ? VA SF4 . ? D SF4 802 ? 1_555 S4 ? VA SF4 .   ? D SF4 802 ? 1_555 112.6 ? 
257 S1  ? VA SF4 .   ? D SF4 802 ? 1_555 FE2 ? VA SF4 . ? D SF4 802 ? 1_555 S4 ? VA SF4 .   ? D SF4 802 ? 1_555 105.0 ? 
258 S3  ? VA SF4 .   ? D SF4 802 ? 1_555 FE2 ? VA SF4 . ? D SF4 802 ? 1_555 S4 ? VA SF4 .   ? D SF4 802 ? 1_555 105.4 ? 
259 SG  ? S  CYS 184 ? D CYS 184 ? 1_555 FE1 ? VA SF4 . ? D SF4 802 ? 1_555 S2 ? VA SF4 .   ? D SF4 802 ? 1_555 109.6 ? 
260 SG  ? S  CYS 184 ? D CYS 184 ? 1_555 FE1 ? VA SF4 . ? D SF4 802 ? 1_555 S3 ? VA SF4 .   ? D SF4 802 ? 1_555 115.3 ? 
261 S2  ? VA SF4 .   ? D SF4 802 ? 1_555 FE1 ? VA SF4 . ? D SF4 802 ? 1_555 S3 ? VA SF4 .   ? D SF4 802 ? 1_555 105.0 ? 
262 SG  ? S  CYS 184 ? D CYS 184 ? 1_555 FE1 ? VA SF4 . ? D SF4 802 ? 1_555 S4 ? VA SF4 .   ? D SF4 802 ? 1_555 115.1 ? 
263 S2  ? VA SF4 .   ? D SF4 802 ? 1_555 FE1 ? VA SF4 . ? D SF4 802 ? 1_555 S4 ? VA SF4 .   ? D SF4 802 ? 1_555 105.4 ? 
264 S3  ? VA SF4 .   ? D SF4 802 ? 1_555 FE1 ? VA SF4 . ? D SF4 802 ? 1_555 S4 ? VA SF4 .   ? D SF4 802 ? 1_555 105.5 ? 
265 SG  ? S  CYS 187 ? D CYS 187 ? 1_555 FE3 ? VA SF4 . ? D SF4 802 ? 1_555 S1 ? VA SF4 .   ? D SF4 802 ? 1_555 117.1 ? 
266 SG  ? S  CYS 187 ? D CYS 187 ? 1_555 FE3 ? VA SF4 . ? D SF4 802 ? 1_555 S2 ? VA SF4 .   ? D SF4 802 ? 1_555 109.3 ? 
267 S1  ? VA SF4 .   ? D SF4 802 ? 1_555 FE3 ? VA SF4 . ? D SF4 802 ? 1_555 S2 ? VA SF4 .   ? D SF4 802 ? 1_555 105.5 ? 
268 SG  ? S  CYS 187 ? D CYS 187 ? 1_555 FE3 ? VA SF4 . ? D SF4 802 ? 1_555 S4 ? VA SF4 .   ? D SF4 802 ? 1_555 113.8 ? 
269 S1  ? VA SF4 .   ? D SF4 802 ? 1_555 FE3 ? VA SF4 . ? D SF4 802 ? 1_555 S4 ? VA SF4 .   ? D SF4 802 ? 1_555 104.5 ? 
270 S2  ? VA SF4 .   ? D SF4 802 ? 1_555 FE3 ? VA SF4 . ? D SF4 802 ? 1_555 S4 ? VA SF4 .   ? D SF4 802 ? 1_555 105.7 ? 
271 SG  ? S  CYS 230 ? D CYS 230 ? 1_555 FE4 ? VA SF4 . ? D SF4 802 ? 1_555 S1 ? VA SF4 .   ? D SF4 802 ? 1_555 112.9 ? 
272 SG  ? S  CYS 230 ? D CYS 230 ? 1_555 FE4 ? VA SF4 . ? D SF4 802 ? 1_555 S2 ? VA SF4 .   ? D SF4 802 ? 1_555 110.9 ? 
273 S1  ? VA SF4 .   ? D SF4 802 ? 1_555 FE4 ? VA SF4 . ? D SF4 802 ? 1_555 S2 ? VA SF4 .   ? D SF4 802 ? 1_555 105.3 ? 
274 SG  ? S  CYS 230 ? D CYS 230 ? 1_555 FE4 ? VA SF4 . ? D SF4 802 ? 1_555 S3 ? VA SF4 .   ? D SF4 802 ? 1_555 116.0 ? 
275 S1  ? VA SF4 .   ? D SF4 802 ? 1_555 FE4 ? VA SF4 . ? D SF4 802 ? 1_555 S3 ? VA SF4 .   ? D SF4 802 ? 1_555 105.9 ? 
276 S2  ? VA SF4 .   ? D SF4 802 ? 1_555 FE4 ? VA SF4 . ? D SF4 802 ? 1_555 S3 ? VA SF4 .   ? D SF4 802 ? 1_555 104.8 ? 
277 SG  ? S  CYS 256 ? D CYS 256 ? 1_555 FE1 ? WA SF4 . ? D SF4 803 ? 1_555 S2 ? WA SF4 .   ? D SF4 803 ? 1_555 113.5 ? 
278 SG  ? S  CYS 256 ? D CYS 256 ? 1_555 FE1 ? WA SF4 . ? D SF4 803 ? 1_555 S3 ? WA SF4 .   ? D SF4 803 ? 1_555 112.6 ? 
279 S2  ? WA SF4 .   ? D SF4 803 ? 1_555 FE1 ? WA SF4 . ? D SF4 803 ? 1_555 S3 ? WA SF4 .   ? D SF4 803 ? 1_555 106.3 ? 
280 SG  ? S  CYS 256 ? D CYS 256 ? 1_555 FE1 ? WA SF4 . ? D SF4 803 ? 1_555 S4 ? WA SF4 .   ? D SF4 803 ? 1_555 114.3 ? 
281 S2  ? WA SF4 .   ? D SF4 803 ? 1_555 FE1 ? WA SF4 . ? D SF4 803 ? 1_555 S4 ? WA SF4 .   ? D SF4 803 ? 1_555 103.6 ? 
282 S3  ? WA SF4 .   ? D SF4 803 ? 1_555 FE1 ? WA SF4 . ? D SF4 803 ? 1_555 S4 ? WA SF4 .   ? D SF4 803 ? 1_555 105.7 ? 
283 SG  ? S  CYS 263 ? D CYS 263 ? 1_555 FE3 ? WA SF4 . ? D SF4 803 ? 1_555 S1 ? WA SF4 .   ? D SF4 803 ? 1_555 112.0 ? 
284 SG  ? S  CYS 263 ? D CYS 263 ? 1_555 FE3 ? WA SF4 . ? D SF4 803 ? 1_555 S2 ? WA SF4 .   ? D SF4 803 ? 1_555 113.0 ? 
285 S1  ? WA SF4 .   ? D SF4 803 ? 1_555 FE3 ? WA SF4 . ? D SF4 803 ? 1_555 S2 ? WA SF4 .   ? D SF4 803 ? 1_555 108.0 ? 
286 SG  ? S  CYS 263 ? D CYS 263 ? 1_555 FE3 ? WA SF4 . ? D SF4 803 ? 1_555 S4 ? WA SF4 .   ? D SF4 803 ? 1_555 115.4 ? 
287 S1  ? WA SF4 .   ? D SF4 803 ? 1_555 FE3 ? WA SF4 . ? D SF4 803 ? 1_555 S4 ? WA SF4 .   ? D SF4 803 ? 1_555 104.2 ? 
288 S2  ? WA SF4 .   ? D SF4 803 ? 1_555 FE3 ? WA SF4 . ? D SF4 803 ? 1_555 S4 ? WA SF4 .   ? D SF4 803 ? 1_555 103.4 ? 
289 SG  ? S  CYS 291 ? D CYS 291 ? 1_555 FE2 ? WA SF4 . ? D SF4 803 ? 1_555 S1 ? WA SF4 .   ? D SF4 803 ? 1_555 114.2 ? 
290 SG  ? S  CYS 291 ? D CYS 291 ? 1_555 FE2 ? WA SF4 . ? D SF4 803 ? 1_555 S3 ? WA SF4 .   ? D SF4 803 ? 1_555 114.5 ? 
291 S1  ? WA SF4 .   ? D SF4 803 ? 1_555 FE2 ? WA SF4 . ? D SF4 803 ? 1_555 S3 ? WA SF4 .   ? D SF4 803 ? 1_555 104.5 ? 
292 SG  ? S  CYS 291 ? D CYS 291 ? 1_555 FE2 ? WA SF4 . ? D SF4 803 ? 1_555 S4 ? WA SF4 .   ? D SF4 803 ? 1_555 112.2 ? 
293 S1  ? WA SF4 .   ? D SF4 803 ? 1_555 FE2 ? WA SF4 . ? D SF4 803 ? 1_555 S4 ? WA SF4 .   ? D SF4 803 ? 1_555 104.4 ? 
294 S3  ? WA SF4 .   ? D SF4 803 ? 1_555 FE2 ? WA SF4 . ? D SF4 803 ? 1_555 S4 ? WA SF4 .   ? D SF4 803 ? 1_555 106.1 ? 
295 SG  ? V  CYS 45  ? G CYS 45  ? 1_555 FE3 ? ZA SF4 . ? G SF4 201 ? 1_555 S1 ? ZA SF4 .   ? G SF4 201 ? 1_555 111.9 ? 
296 SG  ? V  CYS 45  ? G CYS 45  ? 1_555 FE3 ? ZA SF4 . ? G SF4 201 ? 1_555 S2 ? ZA SF4 .   ? G SF4 201 ? 1_555 113.4 ? 
297 S1  ? ZA SF4 .   ? G SF4 201 ? 1_555 FE3 ? ZA SF4 . ? G SF4 201 ? 1_555 S2 ? ZA SF4 .   ? G SF4 201 ? 1_555 104.3 ? 
298 SG  ? V  CYS 45  ? G CYS 45  ? 1_555 FE3 ? ZA SF4 . ? G SF4 201 ? 1_555 S4 ? ZA SF4 .   ? G SF4 201 ? 1_555 113.8 ? 
299 S1  ? ZA SF4 .   ? G SF4 201 ? 1_555 FE3 ? ZA SF4 . ? G SF4 201 ? 1_555 S4 ? ZA SF4 .   ? G SF4 201 ? 1_555 107.8 ? 
300 S2  ? ZA SF4 .   ? G SF4 201 ? 1_555 FE3 ? ZA SF4 . ? G SF4 201 ? 1_555 S4 ? ZA SF4 .   ? G SF4 201 ? 1_555 105.0 ? 
301 SG  ? V  CYS 46  ? G CYS 46  ? 1_555 FE2 ? ZA SF4 . ? G SF4 201 ? 1_555 S1 ? ZA SF4 .   ? G SF4 201 ? 1_555 110.3 ? 
302 SG  ? V  CYS 46  ? G CYS 46  ? 1_555 FE2 ? ZA SF4 . ? G SF4 201 ? 1_555 S3 ? ZA SF4 .   ? G SF4 201 ? 1_555 117.5 ? 
303 S1  ? ZA SF4 .   ? G SF4 201 ? 1_555 FE2 ? ZA SF4 . ? G SF4 201 ? 1_555 S3 ? ZA SF4 .   ? G SF4 201 ? 1_555 104.2 ? 
304 SG  ? V  CYS 46  ? G CYS 46  ? 1_555 FE2 ? ZA SF4 . ? G SF4 201 ? 1_555 S4 ? ZA SF4 .   ? G SF4 201 ? 1_555 112.0 ? 
305 S1  ? ZA SF4 .   ? G SF4 201 ? 1_555 FE2 ? ZA SF4 . ? G SF4 201 ? 1_555 S4 ? ZA SF4 .   ? G SF4 201 ? 1_555 107.3 ? 
306 S3  ? ZA SF4 .   ? G SF4 201 ? 1_555 FE2 ? ZA SF4 . ? G SF4 201 ? 1_555 S4 ? ZA SF4 .   ? G SF4 201 ? 1_555 104.7 ? 
307 SG  ? V  CYS 111 ? G CYS 111 ? 1_555 FE1 ? ZA SF4 . ? G SF4 201 ? 1_555 S2 ? ZA SF4 .   ? G SF4 201 ? 1_555 111.3 ? 
308 SG  ? V  CYS 111 ? G CYS 111 ? 1_555 FE1 ? ZA SF4 . ? G SF4 201 ? 1_555 S3 ? ZA SF4 .   ? G SF4 201 ? 1_555 112.2 ? 
309 S2  ? ZA SF4 .   ? G SF4 201 ? 1_555 FE1 ? ZA SF4 . ? G SF4 201 ? 1_555 S3 ? ZA SF4 .   ? G SF4 201 ? 1_555 107.8 ? 
310 SG  ? V  CYS 111 ? G CYS 111 ? 1_555 FE1 ? ZA SF4 . ? G SF4 201 ? 1_555 S4 ? ZA SF4 .   ? G SF4 201 ? 1_555 115.8 ? 
311 S2  ? ZA SF4 .   ? G SF4 201 ? 1_555 FE1 ? ZA SF4 . ? G SF4 201 ? 1_555 S4 ? ZA SF4 .   ? G SF4 201 ? 1_555 104.7 ? 
312 S3  ? ZA SF4 .   ? G SF4 201 ? 1_555 FE1 ? ZA SF4 . ? G SF4 201 ? 1_555 S4 ? ZA SF4 .   ? G SF4 201 ? 1_555 104.3 ? 
313 SG  ? V  CYS 140 ? G CYS 140 ? 1_555 FE4 ? ZA SF4 . ? G SF4 201 ? 1_555 S1 ? ZA SF4 .   ? G SF4 201 ? 1_555 114.6 ? 
314 SG  ? V  CYS 140 ? G CYS 140 ? 1_555 FE4 ? ZA SF4 . ? G SF4 201 ? 1_555 S2 ? ZA SF4 .   ? G SF4 201 ? 1_555 110.7 ? 
315 S1  ? ZA SF4 .   ? G SF4 201 ? 1_555 FE4 ? ZA SF4 . ? G SF4 201 ? 1_555 S2 ? ZA SF4 .   ? G SF4 201 ? 1_555 104.1 ? 
316 SG  ? V  CYS 140 ? G CYS 140 ? 1_555 FE4 ? ZA SF4 . ? G SF4 201 ? 1_555 S3 ? ZA SF4 .   ? G SF4 201 ? 1_555 114.7 ? 
317 S1  ? ZA SF4 .   ? G SF4 201 ? 1_555 FE4 ? ZA SF4 . ? G SF4 201 ? 1_555 S3 ? ZA SF4 .   ? G SF4 201 ? 1_555 104.0 ? 
318 S2  ? ZA SF4 .   ? G SF4 201 ? 1_555 FE4 ? ZA SF4 . ? G SF4 201 ? 1_555 S3 ? ZA SF4 .   ? G SF4 201 ? 1_555 107.9 ? 
319 SG  ? W  CYS 53  ? O CYS 53  ? 1_555 FE3 ? BB SF4 . ? O SF4 202 ? 1_555 S1 ? BB SF4 .   ? O SF4 202 ? 1_555 112.1 ? 
320 SG  ? W  CYS 53  ? O CYS 53  ? 1_555 FE3 ? BB SF4 . ? O SF4 202 ? 1_555 S2 ? BB SF4 .   ? O SF4 202 ? 1_555 117.6 ? 
321 S1  ? BB SF4 .   ? O SF4 202 ? 1_555 FE3 ? BB SF4 . ? O SF4 202 ? 1_555 S2 ? BB SF4 .   ? O SF4 202 ? 1_555 103.0 ? 
322 SG  ? W  CYS 53  ? O CYS 53  ? 1_555 FE3 ? BB SF4 . ? O SF4 202 ? 1_555 S4 ? BB SF4 .   ? O SF4 202 ? 1_555 111.1 ? 
323 S1  ? BB SF4 .   ? O SF4 202 ? 1_555 FE3 ? BB SF4 . ? O SF4 202 ? 1_555 S4 ? BB SF4 .   ? O SF4 202 ? 1_555 106.8 ? 
324 S2  ? BB SF4 .   ? O SF4 202 ? 1_555 FE3 ? BB SF4 . ? O SF4 202 ? 1_555 S4 ? BB SF4 .   ? O SF4 202 ? 1_555 105.4 ? 
325 SG  ? W  CYS 56  ? O CYS 56  ? 1_555 FE4 ? BB SF4 . ? O SF4 202 ? 1_555 S1 ? BB SF4 .   ? O SF4 202 ? 1_555 117.9 ? 
326 SG  ? W  CYS 56  ? O CYS 56  ? 1_555 FE4 ? BB SF4 . ? O SF4 202 ? 1_555 S2 ? BB SF4 .   ? O SF4 202 ? 1_555 116.1 ? 
327 S1  ? BB SF4 .   ? O SF4 202 ? 1_555 FE4 ? BB SF4 . ? O SF4 202 ? 1_555 S2 ? BB SF4 .   ? O SF4 202 ? 1_555 103.0 ? 
328 SG  ? W  CYS 56  ? O CYS 56  ? 1_555 FE4 ? BB SF4 . ? O SF4 202 ? 1_555 S3 ? BB SF4 .   ? O SF4 202 ? 1_555 106.6 ? 
329 S1  ? BB SF4 .   ? O SF4 202 ? 1_555 FE4 ? BB SF4 . ? O SF4 202 ? 1_555 S3 ? BB SF4 .   ? O SF4 202 ? 1_555 105.2 ? 
330 S2  ? BB SF4 .   ? O SF4 202 ? 1_555 FE4 ? BB SF4 . ? O SF4 202 ? 1_555 S3 ? BB SF4 .   ? O SF4 202 ? 1_555 107.2 ? 
331 SG  ? W  CYS 59  ? O CYS 59  ? 1_555 FE2 ? BB SF4 . ? O SF4 202 ? 1_555 S1 ? BB SF4 .   ? O SF4 202 ? 1_555 112.5 ? 
332 SG  ? W  CYS 59  ? O CYS 59  ? 1_555 FE2 ? BB SF4 . ? O SF4 202 ? 1_555 S3 ? BB SF4 .   ? O SF4 202 ? 1_555 113.3 ? 
333 S1  ? BB SF4 .   ? O SF4 202 ? 1_555 FE2 ? BB SF4 . ? O SF4 202 ? 1_555 S3 ? BB SF4 .   ? O SF4 202 ? 1_555 105.3 ? 
334 SG  ? W  CYS 59  ? O CYS 59  ? 1_555 FE2 ? BB SF4 . ? O SF4 202 ? 1_555 S4 ? BB SF4 .   ? O SF4 202 ? 1_555 114.7 ? 
335 S1  ? BB SF4 .   ? O SF4 202 ? 1_555 FE2 ? BB SF4 . ? O SF4 202 ? 1_555 S4 ? BB SF4 .   ? O SF4 202 ? 1_555 106.6 ? 
336 S3  ? BB SF4 .   ? O SF4 202 ? 1_555 FE2 ? BB SF4 . ? O SF4 202 ? 1_555 S4 ? BB SF4 .   ? O SF4 202 ? 1_555 103.6 ? 
337 SG  ? W  CYS 63  ? O CYS 63  ? 1_555 FE4 ? AB SF4 . ? O SF4 201 ? 1_555 S1 ? AB SF4 .   ? O SF4 201 ? 1_555 119.7 ? 
338 SG  ? W  CYS 63  ? O CYS 63  ? 1_555 FE4 ? AB SF4 . ? O SF4 201 ? 1_555 S2 ? AB SF4 .   ? O SF4 201 ? 1_555 110.1 ? 
339 S1  ? AB SF4 .   ? O SF4 201 ? 1_555 FE4 ? AB SF4 . ? O SF4 201 ? 1_555 S2 ? AB SF4 .   ? O SF4 201 ? 1_555 104.0 ? 
340 SG  ? W  CYS 63  ? O CYS 63  ? 1_555 FE4 ? AB SF4 . ? O SF4 201 ? 1_555 S3 ? AB SF4 .   ? O SF4 201 ? 1_555 110.6 ? 
341 S1  ? AB SF4 .   ? O SF4 201 ? 1_555 FE4 ? AB SF4 . ? O SF4 201 ? 1_555 S3 ? AB SF4 .   ? O SF4 201 ? 1_555 104.8 ? 
342 S2  ? AB SF4 .   ? O SF4 201 ? 1_555 FE4 ? AB SF4 . ? O SF4 201 ? 1_555 S3 ? AB SF4 .   ? O SF4 201 ? 1_555 106.9 ? 
343 SG  ? W  CYS 98  ? O CYS 98  ? 1_555 FE2 ? AB SF4 . ? O SF4 201 ? 1_555 S1 ? AB SF4 .   ? O SF4 201 ? 1_555 115.2 ? 
344 SG  ? W  CYS 98  ? O CYS 98  ? 1_555 FE2 ? AB SF4 . ? O SF4 201 ? 1_555 S3 ? AB SF4 .   ? O SF4 201 ? 1_555 114.3 ? 
345 S1  ? AB SF4 .   ? O SF4 201 ? 1_555 FE2 ? AB SF4 . ? O SF4 201 ? 1_555 S3 ? AB SF4 .   ? O SF4 201 ? 1_555 104.9 ? 
346 SG  ? W  CYS 98  ? O CYS 98  ? 1_555 FE2 ? AB SF4 . ? O SF4 201 ? 1_555 S4 ? AB SF4 .   ? O SF4 201 ? 1_555 110.2 ? 
347 S1  ? AB SF4 .   ? O SF4 201 ? 1_555 FE2 ? AB SF4 . ? O SF4 201 ? 1_555 S4 ? AB SF4 .   ? O SF4 201 ? 1_555 106.8 ? 
348 S3  ? AB SF4 .   ? O SF4 201 ? 1_555 FE2 ? AB SF4 . ? O SF4 201 ? 1_555 S4 ? AB SF4 .   ? O SF4 201 ? 1_555 104.6 ? 
349 SG  ? W  CYS 101 ? O CYS 101 ? 1_555 FE1 ? AB SF4 . ? O SF4 201 ? 1_555 S2 ? AB SF4 .   ? O SF4 201 ? 1_555 111.1 ? 
350 SG  ? W  CYS 101 ? O CYS 101 ? 1_555 FE1 ? AB SF4 . ? O SF4 201 ? 1_555 S3 ? AB SF4 .   ? O SF4 201 ? 1_555 111.1 ? 
351 S2  ? AB SF4 .   ? O SF4 201 ? 1_555 FE1 ? AB SF4 . ? O SF4 201 ? 1_555 S3 ? AB SF4 .   ? O SF4 201 ? 1_555 107.1 ? 
352 SG  ? W  CYS 101 ? O CYS 101 ? 1_555 FE1 ? AB SF4 . ? O SF4 201 ? 1_555 S4 ? AB SF4 .   ? O SF4 201 ? 1_555 117.2 ? 
353 S2  ? AB SF4 .   ? O SF4 201 ? 1_555 FE1 ? AB SF4 . ? O SF4 201 ? 1_555 S4 ? AB SF4 .   ? O SF4 201 ? 1_555 104.9 ? 
354 S3  ? AB SF4 .   ? O SF4 201 ? 1_555 FE1 ? AB SF4 . ? O SF4 201 ? 1_555 S4 ? AB SF4 .   ? O SF4 201 ? 1_555 104.6 ? 
355 SG  ? W  CYS 104 ? O CYS 104 ? 1_555 FE3 ? AB SF4 . ? O SF4 201 ? 1_555 S1 ? AB SF4 .   ? O SF4 201 ? 1_555 118.9 ? 
356 SG  ? W  CYS 104 ? O CYS 104 ? 1_555 FE3 ? AB SF4 . ? O SF4 201 ? 1_555 S2 ? AB SF4 .   ? O SF4 201 ? 1_555 111.6 ? 
357 S1  ? AB SF4 .   ? O SF4 201 ? 1_555 FE3 ? AB SF4 . ? O SF4 201 ? 1_555 S2 ? AB SF4 .   ? O SF4 201 ? 1_555 103.6 ? 
358 SG  ? W  CYS 104 ? O CYS 104 ? 1_555 FE3 ? AB SF4 . ? O SF4 201 ? 1_555 S4 ? AB SF4 .   ? O SF4 201 ? 1_555 109.5 ? 
359 S1  ? AB SF4 .   ? O SF4 201 ? 1_555 FE3 ? AB SF4 . ? O SF4 201 ? 1_555 S4 ? AB SF4 .   ? O SF4 201 ? 1_555 106.8 ? 
360 S2  ? AB SF4 .   ? O SF4 201 ? 1_555 FE3 ? AB SF4 . ? O SF4 201 ? 1_555 S4 ? AB SF4 .   ? O SF4 201 ? 1_555 105.3 ? 
361 SG  ? W  CYS 108 ? O CYS 108 ? 1_555 FE1 ? BB SF4 . ? O SF4 202 ? 1_555 S2 ? BB SF4 .   ? O SF4 202 ? 1_555 115.2 ? 
362 SG  ? W  CYS 108 ? O CYS 108 ? 1_555 FE1 ? BB SF4 . ? O SF4 202 ? 1_555 S3 ? BB SF4 .   ? O SF4 202 ? 1_555 109.0 ? 
363 S2  ? BB SF4 .   ? O SF4 202 ? 1_555 FE1 ? BB SF4 . ? O SF4 202 ? 1_555 S3 ? BB SF4 .   ? O SF4 202 ? 1_555 106.9 ? 
364 SG  ? W  CYS 108 ? O CYS 108 ? 1_555 FE1 ? BB SF4 . ? O SF4 202 ? 1_555 S4 ? BB SF4 .   ? O SF4 202 ? 1_555 115.7 ? 
365 S2  ? BB SF4 .   ? O SF4 202 ? 1_555 FE1 ? BB SF4 . ? O SF4 202 ? 1_555 S4 ? BB SF4 .   ? O SF4 202 ? 1_555 105.4 ? 
366 S3  ? BB SF4 .   ? O SF4 202 ? 1_555 FE1 ? BB SF4 . ? O SF4 202 ? 1_555 S4 ? BB SF4 .   ? O SF4 202 ? 1_555 103.7 ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  ALA 131 B  . ? ALA 131 2 PRO 132 B  ? PRO 132 2 1 -3.05  
2  HIS 34  D  . ? HIS 34  4 PRO 35  D  ? PRO 35  4 1 4.86   
3  CYS 140 F  . ? CYS 140 6 PRO 141 F  ? PRO 141 6 1 -10.08 
4  TYR 26  G  . ? TYR 26  9 PRO 27  G  ? PRO 27  9 1 -5.09  
5  ILE 220 M  . ? ILE 220 L PRO 221 M  ? PRO 221 L 1 -3.95  
6  LEU 20  N  . ? LEU 20  M PRO 21  N  ? PRO 21  M 1 -4.37  
7  THR 205 N  . ? THR 205 M PRO 206 N  ? PRO 206 M 1 0.55   
8  ALA 190 O  . ? ALA 190 N PRO 191 O  ? PRO 191 N 1 -2.46  
9  PRO 337 O  . ? PRO 337 N PRO 338 O  ? PRO 338 N 1 3.58   
10 LEU 221 P  . ? LEU 221 H PRO 222 P  ? PRO 222 H 1 -5.42  
11 ALA 131 R  . ? ALA 131 C PRO 132 R  ? PRO 132 C 1 -4.67  
12 HIS 34  T  . ? HIS 34  E PRO 35  T  ? PRO 35  E 1 2.52   
13 CYS 140 V  . ? CYS 140 G PRO 141 V  ? PRO 141 G 1 -10.26 
14 TYR 26  W  . ? TYR 26  O PRO 27  W  ? PRO 27  O 1 -1.76  
15 ILE 220 CA . ? ILE 220 T PRO 221 CA ? PRO 221 T 1 -3.32  
16 LEU 20  DA . ? LEU 20  U PRO 21  DA ? PRO 21  U 1 -2.28  
17 THR 205 DA . ? THR 205 U PRO 206 DA ? PRO 206 U 1 -0.33  
18 ALA 190 EA . ? ALA 190 V PRO 191 EA ? PRO 191 V 1 -1.52  
19 PRO 337 EA . ? PRO 337 V PRO 338 EA ? PRO 338 V 1 4.42   
20 LEU 221 FA . ? LEU 221 Q PRO 222 FA ? PRO 222 Q 1 -4.79  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 4 ? 
AA2 ? 5 ? 
AA3 ? 3 ? 
AA4 ? 5 ? 
AA5 ? 3 ? 
AA6 ? 2 ? 
AA7 ? 3 ? 
AA8 ? 7 ? 
AA9 ? 5 ? 
AB1 ? 2 ? 
AB2 ? 6 ? 
AB3 ? 3 ? 
AB4 ? 3 ? 
AB5 ? 2 ? 
AB6 ? 5 ? 
AB7 ? 2 ? 
AB8 ? 4 ? 
AB9 ? 2 ? 
AC1 ? 2 ? 
AC2 ? 3 ? 
AC3 ? 7 ? 
AC4 ? 6 ? 
AC5 ? 2 ? 
AC6 ? 2 ? 
AC7 ? 4 ? 
AC8 ? 5 ? 
AC9 ? 3 ? 
AD1 ? 5 ? 
AD2 ? 3 ? 
AD3 ? 2 ? 
AD4 ? 3 ? 
AD5 ? 7 ? 
AD6 ? 5 ? 
AD7 ? 2 ? 
AD8 ? 7 ? 
AD9 ? 3 ? 
AE1 ? 3 ? 
AE2 ? 2 ? 
AE3 ? 5 ? 
AE4 ? 2 ? 
AE5 ? 4 ? 
AE6 ? 2 ? 
AE7 ? 2 ? 
AE8 ? 3 ? 
AE9 ? 7 ? 
AF1 ? 6 ? 
AF2 ? 2 ? 
AF3 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel      
AA1 2 3 ? parallel      
AA1 3 4 ? parallel      
AA2 1 2 ? anti-parallel 
AA2 2 3 ? parallel      
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
AA3 1 2 ? parallel      
AA3 2 3 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? parallel      
AA4 3 4 ? anti-parallel 
AA4 4 5 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA8 3 4 ? parallel      
AA8 4 5 ? parallel      
AA8 5 6 ? parallel      
AA8 6 7 ? parallel      
AA9 1 2 ? parallel      
AA9 2 3 ? parallel      
AA9 3 4 ? parallel      
AA9 4 5 ? parallel      
AB1 1 2 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB2 2 3 ? parallel      
AB2 3 4 ? anti-parallel 
AB2 4 5 ? parallel      
AB2 5 6 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB6 2 3 ? parallel      
AB6 3 4 ? anti-parallel 
AB6 4 5 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB8 1 2 ? parallel      
AB8 2 3 ? parallel      
AB8 3 4 ? parallel      
AB9 1 2 ? parallel      
AC1 1 2 ? anti-parallel 
AC2 1 2 ? anti-parallel 
AC2 2 3 ? anti-parallel 
AC3 1 2 ? anti-parallel 
AC3 2 3 ? anti-parallel 
AC3 3 4 ? anti-parallel 
AC3 4 5 ? anti-parallel 
AC3 5 6 ? anti-parallel 
AC3 6 7 ? anti-parallel 
AC4 1 2 ? parallel      
AC4 2 3 ? anti-parallel 
AC4 3 4 ? anti-parallel 
AC4 4 5 ? parallel      
AC4 5 6 ? anti-parallel 
AC5 1 2 ? anti-parallel 
AC6 1 2 ? anti-parallel 
AC7 1 2 ? parallel      
AC7 2 3 ? parallel      
AC7 3 4 ? parallel      
AC8 1 2 ? anti-parallel 
AC8 2 3 ? parallel      
AC8 3 4 ? anti-parallel 
AC8 4 5 ? anti-parallel 
AC9 1 2 ? parallel      
AC9 2 3 ? anti-parallel 
AD1 1 2 ? anti-parallel 
AD1 2 3 ? parallel      
AD1 3 4 ? anti-parallel 
AD1 4 5 ? anti-parallel 
AD2 1 2 ? anti-parallel 
AD2 2 3 ? anti-parallel 
AD3 1 2 ? anti-parallel 
AD4 1 2 ? anti-parallel 
AD4 2 3 ? anti-parallel 
AD5 1 2 ? anti-parallel 
AD5 2 3 ? anti-parallel 
AD5 3 4 ? parallel      
AD5 4 5 ? parallel      
AD5 5 6 ? parallel      
AD5 6 7 ? parallel      
AD6 1 2 ? parallel      
AD6 2 3 ? parallel      
AD6 3 4 ? parallel      
AD6 4 5 ? parallel      
AD7 1 2 ? anti-parallel 
AD8 1 2 ? anti-parallel 
AD8 2 3 ? parallel      
AD8 3 4 ? anti-parallel 
AD8 4 5 ? parallel      
AD8 5 6 ? anti-parallel 
AD8 6 7 ? anti-parallel 
AD9 1 2 ? anti-parallel 
AD9 2 3 ? anti-parallel 
AE1 1 2 ? anti-parallel 
AE1 2 3 ? anti-parallel 
AE2 1 2 ? anti-parallel 
AE3 1 2 ? anti-parallel 
AE3 2 3 ? parallel      
AE3 3 4 ? anti-parallel 
AE3 4 5 ? anti-parallel 
AE4 1 2 ? anti-parallel 
AE5 1 2 ? parallel      
AE5 2 3 ? parallel      
AE5 3 4 ? parallel      
AE6 1 2 ? parallel      
AE7 1 2 ? anti-parallel 
AE8 1 2 ? anti-parallel 
AE8 2 3 ? anti-parallel 
AE9 1 2 ? anti-parallel 
AE9 2 3 ? anti-parallel 
AE9 3 4 ? anti-parallel 
AE9 4 5 ? anti-parallel 
AE9 5 6 ? anti-parallel 
AE9 6 7 ? anti-parallel 
AF1 1 2 ? parallel      
AF1 2 3 ? anti-parallel 
AF1 3 4 ? anti-parallel 
AF1 4 5 ? parallel      
AF1 5 6 ? anti-parallel 
AF2 1 2 ? anti-parallel 
AF3 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 LEU A  171 ? ARG A  175 ? LEU 1 171 ARG 1 175 
AA1 2 VAL A  129 ? VAL A  134 ? VAL 1 129 VAL 1 134 
AA1 3 TYR A  88  ? ASN A  92  ? TYR 1 88  ASN 1 92  
AA1 4 THR A  217 ? ASN A  220 ? THR 1 217 ASN 1 220 
AA2 1 GLY A  262 ? PRO A  267 ? GLY 1 262 PRO 1 267 
AA2 2 MET A  249 ? SER A  255 ? MET 1 249 SER 1 255 
AA2 3 GLY A  327 ? PRO A  332 ? GLY 1 327 PRO 1 332 
AA2 4 ILE A  287 ? ILE A  291 ? ILE 1 287 ILE 1 291 
AA2 5 LEU A  300 ? PRO A  301 ? LEU 1 300 PRO 1 301 
AA3 1 PHE B  117 ? VAL B  122 ? PHE 2 117 VAL 2 122 
AA3 2 TYR B  78  ? CYS B  83  ? TYR 2 78  CYS 2 83  
AA3 3 ILE B  134 ? VAL B  136 ? ILE 2 134 VAL 2 136 
AA4 1 ARG C  9   ? VAL C  13  ? ARG 3 9   VAL 3 13  
AA4 2 VAL C  2   ? VAL C  6   ? VAL 3 2   VAL 3 6   
AA4 3 MET C  91  ? ASP C  94  ? MET 3 91  ASP 3 94  
AA4 4 LEU C  49  ? GLY C  53  ? LEU 3 49  GLY 3 53  
AA4 5 ALA C  80  ? ALA C  81  ? ALA 3 80  ALA 3 81  
AA5 1 HIS C  168 ? PRO C  169 ? HIS 3 168 PRO 3 169 
AA5 2 VAL C  174 ? LEU C  176 ? VAL 3 174 LEU 3 176 
AA5 3 LEU C  236 ? ASP C  237 ? LEU 3 236 ASP 3 237 
AA6 1 ASP C  201 ? PHE C  202 ? ASP 3 201 PHE 3 202 
AA6 2 ILE C  211 ? GLY C  212 ? ILE 3 211 GLY 3 212 
AA7 1 GLU C  250 ? THR C  255 ? GLU 3 250 THR 3 255 
AA7 2 GLY C  264 ? ARG C  270 ? GLY 3 264 ARG 3 270 
AA7 3 GLU C  273 ? ALA C  279 ? GLU 3 273 ALA 3 279 
AA8 1 LEU C  317 ? GLU C  319 ? LEU 3 317 GLU 3 319 
AA8 2 LEU C  310 ? ARG C  312 ? LEU 3 310 ARG 3 312 
AA8 3 VAL C  600 ? PRO C  603 ? VAL 3 600 PRO 3 603 
AA8 4 PHE C  582 ? LEU C  587 ? PHE 3 582 LEU 3 587 
AA8 5 TYR C  565 ? TYR C  568 ? TYR 3 565 TYR 3 568 
AA8 6 VAL C  341 ? LEU C  345 ? VAL 3 341 LEU 3 345 
AA8 7 LEU C  369 ? PHE C  371 ? LEU 3 369 PHE 3 371 
AA9 1 ILE C  464 ? HIS C  465 ? ILE 3 464 HIS 3 465 
AA9 2 MET C  448 ? PHE C  451 ? MET 3 448 PHE 3 451 
AA9 3 ALA C  396 ? LEU C  399 ? ALA 3 396 LEU 3 399 
AA9 4 VAL C  504 ? LEU C  507 ? VAL 3 504 LEU 3 507 
AA9 5 VAL C  532 ? ALA C  534 ? VAL 3 532 ALA 3 534 
AB1 1 GLY C  612 ? VAL C  615 ? GLY 3 612 VAL 3 615 
AB1 2 VAL C  621 ? LEU C  624 ? VAL 3 621 LEU 3 624 
AB2 1 GLN C  733 ? THR C  738 ? GLN 3 733 THR 3 738 
AB2 2 GLY C  741 ? HIS C  749 ? GLY 3 741 HIS 3 749 
AB2 3 ALA C  714 ? ALA C  718 ? ALA 3 714 ALA 3 718 
AB2 4 LEU C  758 ? ALA C  762 ? LEU 3 758 ALA 3 762 
AB2 5 PHE C  692 ? PRO C  696 ? PHE 3 692 PRO 3 696 
AB2 6 ARG C  770 ? VAL C  771 ? ARG 3 770 VAL 3 771 
AB3 1 THR D  27  ? VAL D  30  ? THR 4 27  VAL 4 30  
AB3 2 ARG D  42  ? THR D  46  ? ARG 4 42  THR 4 46  
AB3 3 GLU D  54  ? HIS D  58  ? GLU 4 54  HIS 4 58  
AB4 1 GLY D  340 ? VAL D  342 ? GLY 4 340 VAL 4 342 
AB4 2 TYR D  355 ? SER D  359 ? TYR 4 355 SER 4 359 
AB4 3 ARG D  367 ? VAL D  370 ? ARG 4 367 VAL 4 370 
AB5 1 THR D  346 ? SER D  348 ? THR 4 346 SER 4 348 
AB5 2 GLY D  351 ? LEU D  353 ? GLY 4 351 LEU 4 353 
AB6 1 ILE E  17  ? ASN E  20  ? ILE 5 17  ASN 5 20  
AB6 2 ASN E  24  ? VAL E  28  ? ASN 5 24  VAL 5 28  
AB6 3 ARG E  87  ? VAL E  94  ? ARG 5 87  VAL 5 94  
AB6 4 PHE E  68  ? VAL E  75  ? PHE 5 68  VAL 5 75  
AB6 5 PHE E  48  ? ASP E  56  ? PHE 5 48  ASP 5 56  
AB7 1 THR E  157 ? LEU E  158 ? THR 5 157 LEU 5 158 
AB7 2 TYR E  164 ? ILE E  165 ? TYR 5 164 ILE 5 165 
AB8 1 PRO F  38  ? GLY F  42  ? PRO 6 38  GLY 6 42  
AB8 2 VAL F  77  ? ALA F  81  ? VAL 6 77  ALA 6 81  
AB8 3 TRP F  104 ? MET F  108 ? TRP 6 104 MET 6 108 
AB8 4 VAL F  133 ? VAL F  137 ? VAL 6 133 VAL 6 137 
AB9 1 VAL G  31  ? ALA G  32  ? VAL 9 31  ALA 9 32  
AB9 2 TYR G  161 ? VAL G  162 ? TYR 9 161 VAL 9 162 
AC1 1 VAL G  42  ? LEU G  43  ? VAL 9 42  LEU 9 43  
AC1 2 ILE G  113 ? VAL G  114 ? ILE 9 113 VAL 9 114 
AC2 1 ILE G  68  ? ALA G  73  ? ILE 9 68  ALA 9 73  
AC2 2 TYR G  87  ? ASN G  94  ? TYR 9 87  ASN 9 94  
AC2 3 VAL G  130 ? TYR G  131 ? VAL 9 130 TYR 9 131 
AC3 1 ARG H  30  ? ASP H  36  ? ARG 7 30  ASP 7 36  
AC3 2 ILE H  54  ? SER H  60  ? ILE 7 54  SER 7 60  
AC3 3 PRO H  66  ? VAL H  72  ? PRO 7 66  VAL 7 72  
AC3 4 ILE H  82  ? LEU H  86  ? ILE 7 82  LEU 7 86  
AC3 5 ILE H  91  ? GLU H  98  ? ILE 7 91  GLU 7 98  
AC3 6 GLY H  102 ? THR H  105 ? GLY 7 102 THR 7 105 
AC3 7 ILE H  108 ? PRO H  109 ? ILE 7 108 PRO 7 109 
AC4 1 VAL I  2   ? ARG I  3   ? VAL W 2   ARG W 3   
AC4 2 ASP I  56  ? PHE I  63  ? ASP W 56  PHE W 63  
AC4 3 TYR I  46  ? HIS I  51  ? TYR W 46  HIS W 51  
AC4 4 LYS I  30  ? THR I  35  ? LYS W 30  THR W 35  
AC4 5 PHE I  89  ? VAL I  93  ? PHE W 89  VAL W 93  
AC4 6 ASN I  119 ? PRO I  120 ? ASN W 119 PRO W 120 
AC5 1 ALA M  53  ? ALA M  57  ? ALA L 53  ALA L 57  
AC5 2 PHE M  65  ? LEU M  69  ? PHE L 65  LEU L 69  
AC6 1 PHE N  51  ? LEU N  56  ? PHE M 51  LEU M 56  
AC6 2 VAL N  61  ? PHE N  65  ? VAL M 61  PHE M 65  
AC7 1 LEU Q  171 ? ARG Q  175 ? LEU B 171 ARG B 175 
AC7 2 VAL Q  129 ? VAL Q  134 ? VAL B 129 VAL B 134 
AC7 3 TYR Q  88  ? ALA Q  93  ? TYR B 88  ALA B 93  
AC7 4 THR Q  216 ? ASN Q  220 ? THR B 216 ASN B 220 
AC8 1 GLY Q  262 ? PRO Q  267 ? GLY B 262 PRO B 267 
AC8 2 MET Q  249 ? SER Q  255 ? MET B 249 SER B 255 
AC8 3 GLY Q  327 ? PRO Q  332 ? GLY B 327 PRO B 332 
AC8 4 ILE Q  287 ? ILE Q  291 ? ILE B 287 ILE B 291 
AC8 5 LEU Q  300 ? PRO Q  301 ? LEU B 300 PRO B 301 
AC9 1 PHE R  117 ? VAL R  122 ? PHE C 117 VAL C 122 
AC9 2 TYR R  78  ? CYS R  83  ? TYR C 78  CYS C 83  
AC9 3 ILE R  134 ? VAL R  136 ? ILE C 134 VAL C 136 
AD1 1 ARG S  9   ? VAL S  13  ? ARG D 9   VAL D 13  
AD1 2 VAL S  2   ? VAL S  6   ? VAL D 2   VAL D 6   
AD1 3 MET S  91  ? ASP S  94  ? MET D 91  ASP D 94  
AD1 4 LEU S  49  ? GLY S  53  ? LEU D 49  GLY D 53  
AD1 5 ALA S  80  ? ALA S  81  ? ALA D 80  ALA D 81  
AD2 1 HIS S  168 ? SER S  171 ? HIS D 168 SER D 171 
AD2 2 VAL S  174 ? LEU S  176 ? VAL D 174 LEU D 176 
AD2 3 LEU S  235 ? ASP S  237 ? LEU D 235 ASP D 237 
AD3 1 ASP S  201 ? PHE S  202 ? ASP D 201 PHE D 202 
AD3 2 ILE S  211 ? GLY S  212 ? ILE D 211 GLY D 212 
AD4 1 GLU S  250 ? THR S  255 ? GLU D 250 THR D 255 
AD4 2 GLY S  264 ? ARG S  270 ? GLY D 264 ARG D 270 
AD4 3 GLU S  273 ? ALA S  279 ? GLU D 273 ALA D 279 
AD5 1 LEU S  317 ? GLU S  319 ? LEU D 317 GLU D 319 
AD5 2 LEU S  310 ? ARG S  312 ? LEU D 310 ARG D 312 
AD5 3 VAL S  600 ? PRO S  603 ? VAL D 600 PRO D 603 
AD5 4 PHE S  582 ? LEU S  587 ? PHE D 582 LEU D 587 
AD5 5 TYR S  565 ? TYR S  568 ? TYR D 565 TYR D 568 
AD5 6 VAL S  341 ? LEU S  345 ? VAL D 341 LEU D 345 
AD5 7 LEU S  369 ? PHE S  371 ? LEU D 369 PHE D 371 
AD6 1 ILE S  464 ? VAL S  467 ? ILE D 464 VAL D 467 
AD6 2 MET S  448 ? ALA S  452 ? MET D 448 ALA D 452 
AD6 3 ALA S  396 ? LEU S  399 ? ALA D 396 LEU D 399 
AD6 4 VAL S  504 ? LEU S  507 ? VAL D 504 LEU D 507 
AD6 5 VAL S  532 ? ALA S  534 ? VAL D 532 ALA D 534 
AD7 1 GLY S  612 ? VAL S  615 ? GLY D 612 VAL D 615 
AD7 2 VAL S  621 ? LEU S  624 ? VAL D 621 LEU D 624 
AD8 1 ARG S  770 ? VAL S  771 ? ARG D 770 VAL D 771 
AD8 2 PHE S  692 ? PRO S  696 ? PHE D 692 PRO D 696 
AD8 3 LEU S  758 ? ALA S  762 ? LEU D 758 ALA D 762 
AD8 4 ALA S  714 ? ALA S  718 ? ALA D 714 ALA D 718 
AD8 5 GLY S  741 ? HIS S  749 ? GLY D 741 HIS D 749 
AD8 6 GLN S  733 ? THR S  738 ? GLN D 733 THR D 738 
AD8 7 ARG S  774 ? VAL S  775 ? ARG D 774 VAL D 775 
AD9 1 THR T  27  ? VAL T  30  ? THR E 27  VAL E 30  
AD9 2 ARG T  42  ? THR T  46  ? ARG E 42  THR E 46  
AD9 3 GLU T  54  ? HIS T  58  ? GLU E 54  HIS E 58  
AE1 1 LYS T  339 ? VAL T  342 ? LYS E 339 VAL E 342 
AE1 2 TYR T  355 ? ASP T  360 ? TYR E 355 ASP E 360 
AE1 3 ARG T  367 ? VAL T  370 ? ARG E 367 VAL E 370 
AE2 1 THR T  346 ? SER T  348 ? THR E 346 SER E 348 
AE2 2 GLY T  351 ? LEU T  353 ? GLY E 351 LEU E 353 
AE3 1 ILE U  17  ? ASN U  20  ? ILE F 17  ASN F 20  
AE3 2 ASN U  24  ? VAL U  28  ? ASN F 24  VAL F 28  
AE3 3 ARG U  87  ? VAL U  94  ? ARG F 87  VAL F 94  
AE3 4 PHE U  68  ? VAL U  75  ? PHE F 68  VAL F 75  
AE3 5 PHE U  48  ? ASP U  56  ? PHE F 48  ASP F 56  
AE4 1 THR U  157 ? LEU U  158 ? THR F 157 LEU F 158 
AE4 2 TYR U  164 ? ILE U  165 ? TYR F 164 ILE F 165 
AE5 1 PRO V  38  ? GLY V  42  ? PRO G 38  GLY G 42  
AE5 2 VAL V  77  ? ALA V  81  ? VAL G 77  ALA G 81  
AE5 3 TRP V  104 ? MET V  108 ? TRP G 104 MET G 108 
AE5 4 VAL V  135 ? VAL V  137 ? VAL G 135 VAL G 137 
AE6 1 VAL W  31  ? ALA W  32  ? VAL O 31  ALA O 32  
AE6 2 TYR W  161 ? VAL W  162 ? TYR O 161 VAL O 162 
AE7 1 GLY W  39  ? LEU W  43  ? GLY O 39  LEU O 43  
AE7 2 ILE W  113 ? GLY W  116 ? ILE O 113 GLY O 116 
AE8 1 ILE W  68  ? ALA W  73  ? ILE O 68  ALA O 73  
AE8 2 TYR W  87  ? ASN W  94  ? TYR O 87  ASN O 94  
AE8 3 VAL W  130 ? TYR W  131 ? VAL O 130 TYR O 131 
AE9 1 PHE X  31  ? ASP X  36  ? PHE I 31  ASP I 36  
AE9 2 ILE X  54  ? SER X  60  ? ILE I 54  SER I 60  
AE9 3 PRO X  66  ? VAL X  72  ? PRO I 66  VAL I 72  
AE9 4 ILE X  82  ? LEU X  86  ? ILE I 82  LEU I 86  
AE9 5 ILE X  91  ? GLU X  98  ? ILE I 91  GLU I 98  
AE9 6 GLY X  102 ? THR X  105 ? GLY I 102 THR I 105 
AE9 7 ILE X  108 ? PRO X  109 ? ILE I 108 PRO I 109 
AF1 1 VAL Y  2   ? ARG Y  3   ? VAL X 2   ARG X 3   
AF1 2 ASP Y  56  ? PHE Y  63  ? ASP X 56  PHE X 63  
AF1 3 TYR Y  46  ? HIS Y  51  ? TYR X 46  HIS X 51  
AF1 4 LYS Y  30  ? THR Y  35  ? LYS X 30  THR X 35  
AF1 5 ARG Y  88  ? VAL Y  93  ? ARG X 88  VAL X 93  
AF1 6 ASN Y  119 ? PRO Y  120 ? ASN X 119 PRO X 120 
AF2 1 ALA CA 53  ? ALA CA 57  ? ALA T 53  ALA T 57  
AF2 2 PHE CA 65  ? LEU CA 69  ? PHE T 65  LEU T 69  
AF3 1 PHE DA 51  ? LEU DA 56  ? PHE U 51  LEU U 56  
AF3 2 VAL DA 61  ? PHE DA 65  ? VAL U 61  PHE U 65  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O HIS A  174 ? O HIS 1 174 N VAL A  134 ? N VAL 1 134 
AA1 2 3 O TYR A  131 ? O TYR 1 131 N LEU A  89  ? N LEU 1 89  
AA1 3 4 N ASN A  92  ? N ASN 1 92  O ASN A  219 ? O ASN 1 219 
AA2 1 2 O TYR A  264 ? O TYR 1 264 N TYR A  252 ? N TYR 1 252 
AA2 2 3 N GLN A  253 ? N GLN 1 253 O VAL A  328 ? O VAL 1 328 
AA2 3 4 O ILE A  331 ? O ILE 1 331 N ALA A  289 ? N ALA 1 289 
AA2 4 5 N ILE A  290 ? N ILE 1 290 O LEU A  300 ? O LEU 1 300 
AA3 1 2 O VAL B  122 ? O VAL 2 122 N VAL B  82  ? N VAL 2 82  
AA3 2 3 N GLN B  81  ? N GLN 2 81  O GLN B  135 ? O GLN 2 135 
AA4 1 2 O VAL C  13  ? O VAL 3 13  N VAL C  2   ? N VAL 3 2   
AA4 2 3 N LYS C  5   ? N LYS 3 5   O VAL C  93  ? O VAL 3 93  
AA4 3 4 O ASP C  94  ? O ASP 3 94  N ARG C  51  ? N ARG 3 51  
AA4 4 5 N VAL C  50  ? N VAL 3 50  O ALA C  80  ? O ALA 3 80  
AA5 1 2 N HIS C  168 ? N HIS 3 168 O LEU C  176 ? O LEU 3 176 
AA5 2 3 N ILE C  175 ? N ILE 3 175 O LEU C  236 ? O LEU 3 236 
AA6 1 2 N ASP C  201 ? N ASP 3 201 O GLY C  212 ? O GLY 3 212 
AA7 1 2 N GLU C  250 ? N GLU 3 250 O THR C  269 ? O THR 3 269 
AA7 2 3 N ASP C  268 ? N ASP 3 268 O ARG C  276 ? O ARG 3 276 
AA8 1 2 O VAL C  318 ? O VAL 3 318 N VAL C  311 ? N VAL 3 311 
AA8 2 3 N LEU C  310 ? N LEU 3 310 O VAL C  601 ? O VAL 3 601 
AA8 3 4 O VAL C  600 ? O VAL 3 600 N MET C  585 ? N MET 3 585 
AA8 4 5 O HIS C  586 ? O HIS 3 586 N TYR C  568 ? N TYR 3 568 
AA8 5 6 O TYR C  567 ? O TYR 3 567 N GLY C  342 ? N GLY 3 342 
AA8 6 7 N LEU C  343 ? N LEU 3 343 O ASP C  370 ? O ASP 3 370 
AA9 1 2 O ILE C  464 ? O ILE 3 464 N LEU C  450 ? N LEU 3 450 
AA9 2 3 O ALA C  449 ? O ALA 3 449 N VAL C  398 ? N VAL 3 398 
AA9 3 4 N LEU C  397 ? N LEU 3 397 O ILE C  506 ? O ILE 3 506 
AA9 4 5 N LEU C  507 ? N LEU 3 507 O LEU C  533 ? O LEU 3 533 
AB1 1 2 N GLY C  612 ? N GLY 3 612 O LEU C  624 ? O LEU 3 624 
AB2 1 2 N VAL C  734 ? N VAL 3 734 O ALA C  745 ? O ALA 3 745 
AB2 2 3 O VAL C  748 ? O VAL 3 748 N LEU C  716 ? N LEU 3 716 
AB2 3 4 N GLU C  715 ? N GLU 3 715 O SER C  761 ? O SER 3 761 
AB2 4 5 O LEU C  760 ? O LEU 3 760 N TYR C  693 ? N TYR 3 693 
AB2 5 6 N PHE C  692 ? N PHE 3 692 O VAL C  771 ? O VAL 3 771 
AB3 1 2 N VAL D  30  ? N VAL 4 30  O LEU D  43  ? O LEU 4 43  
AB3 2 3 N ARG D  42  ? N ARG 4 42  O HIS D  58  ? O HIS 4 58  
AB4 1 2 N VAL D  342 ? N VAL 4 342 O ILE D  357 ? O ILE 4 357 
AB4 2 3 N TYR D  356 ? N TYR 4 356 O LYS D  369 ? O LYS 4 369 
AB5 1 2 N SER D  348 ? N SER 4 348 O GLY D  351 ? O GLY 4 351 
AB6 1 2 N GLU E  18  ? N GLU 5 18  O TRP E  26  ? O TRP 5 26  
AB6 2 3 N VAL E  27  ? N VAL 5 27  O ARG E  91  ? O ARG 5 91  
AB6 3 4 O VAL E  92  ? O VAL 5 92  N VAL E  70  ? N VAL 5 70  
AB6 4 5 O VAL E  71  ? O VAL 5 71  N VAL E  53  ? N VAL 5 53  
AB7 1 2 N THR E  157 ? N THR 5 157 O ILE E  165 ? O ILE 5 165 
AB8 1 2 N ALA F  39  ? N ALA 6 39  O VAL F  77  ? O VAL 6 77  
AB8 2 3 N MET F  78  ? N MET 6 78  O ILE F  106 ? O ILE 6 106 
AB8 3 4 N SER F  107 ? N SER 6 107 O VAL F  135 ? O VAL 6 135 
AB9 1 2 N VAL G  31  ? N VAL 9 31  O VAL G  162 ? O VAL 9 162 
AC1 1 2 N VAL G  42  ? N VAL 9 42  O VAL G  114 ? O VAL 9 114 
AC2 1 2 N GLU G  71  ? N GLU 9 71  O VAL G  90  ? O VAL 9 90  
AC2 2 3 N ILE G  93  ? N ILE 9 93  O TYR G  131 ? O TYR 9 131 
AC3 1 2 N ALA H  35  ? N ALA 7 35  O THR H  56  ? O THR 7 56  
AC3 2 3 N LEU H  59  ? N LEU 7 59  O PHE H  67  ? O PHE 7 67  
AC3 3 4 N LEU H  69  ? N LEU 7 69  O ARG H  85  ? O ARG 7 85  
AC3 4 5 N LEU H  84  ? N LEU 7 84  O LEU H  93  ? O LEU 7 93  
AC3 5 6 N GLU H  98  ? N GLU 7 98  O GLY H  102 ? O GLY 7 102 
AC3 6 7 N THR H  105 ? N THR 7 105 O ILE H  108 ? O ILE 7 108 
AC4 1 2 N VAL I  2   ? N VAL W 2   O ASP I  56  ? O ASP W 56  
AC4 2 3 O LEU I  57  ? O LEU W 57  N LEU I  50  ? N LEU W 50  
AC4 3 4 O LEU I  49  ? O LEU W 49  N TYR I  32  ? N TYR W 32  
AC4 4 5 N VAL I  31  ? N VAL W 31  O TYR I  90  ? O TYR W 90  
AC4 5 6 N GLU I  91  ? N GLU W 91  O ASN I  119 ? O ASN W 119 
AC5 1 2 N ALA M  53  ? N ALA L 53  O LEU M  69  ? O LEU L 69  
AC6 1 2 N LEU N  56  ? N LEU M 56  O VAL N  61  ? O VAL M 61  
AC7 1 2 O HIS Q  174 ? O HIS B 174 N VAL Q  134 ? N VAL B 134 
AC7 2 3 O TYR Q  131 ? O TYR B 131 N LEU Q  89  ? N LEU B 89  
AC7 3 4 N ASN Q  92  ? N ASN B 92  O ASN Q  219 ? O ASN B 219 
AC8 1 2 O LEU Q  266 ? O LEU B 266 N LYS Q  250 ? N LYS B 250 
AC8 2 3 N SER Q  255 ? N SER B 255 O LEU Q  330 ? O LEU B 330 
AC8 3 4 O ILE Q  331 ? O ILE B 331 N ALA Q  289 ? N ALA B 289 
AC8 4 5 N ILE Q  290 ? N ILE B 290 O LEU Q  300 ? O LEU B 300 
AC9 1 2 O SER R  118 ? O SER C 118 N LEU R  80  ? N LEU C 80  
AC9 2 3 N GLN R  81  ? N GLN C 81  O GLN R  135 ? O GLN C 135 
AD1 1 2 O ARG S  9   ? O ARG D 9   N VAL S  6   ? N VAL D 6   
AD1 2 3 N LYS S  5   ? N LYS D 5   O VAL S  93  ? O VAL D 93  
AD1 3 4 O ASP S  94  ? O ASP D 94  N ARG S  51  ? N ARG D 51  
AD1 4 5 N VAL S  50  ? N VAL D 50  O ALA S  80  ? O ALA D 80  
AD2 1 2 N HIS S  168 ? N HIS D 168 O LEU S  176 ? O LEU D 176 
AD2 2 3 N ILE S  175 ? N ILE D 175 O LEU S  236 ? O LEU D 236 
AD3 1 2 N ASP S  201 ? N ASP D 201 O GLY S  212 ? O GLY D 212 
AD4 1 2 N THR S  254 ? N THR D 254 O ILE S  265 ? O ILE D 265 
AD4 2 3 N THR S  266 ? N THR D 266 O ARG S  278 ? O ARG D 278 
AD5 1 2 O VAL S  318 ? O VAL D 318 N VAL S  311 ? N VAL D 311 
AD5 2 3 N LEU S  310 ? N LEU D 310 O VAL S  601 ? O VAL D 601 
AD5 3 4 O VAL S  600 ? O VAL D 600 N MET S  585 ? N MET D 585 
AD5 4 5 O HIS S  586 ? O HIS D 586 N TYR S  568 ? N TYR D 568 
AD5 5 6 O TYR S  567 ? O TYR D 567 N TYR S  344 ? N TYR D 344 
AD5 6 7 N LEU S  343 ? N LEU D 343 O ASP S  370 ? O ASP D 370 
AD6 1 2 O ILE S  464 ? O ILE D 464 N LEU S  450 ? N LEU D 450 
AD6 2 3 O ALA S  449 ? O ALA D 449 N VAL S  398 ? N VAL D 398 
AD6 3 4 N LEU S  397 ? N LEU D 397 O ILE S  506 ? O ILE D 506 
AD6 4 5 N LEU S  507 ? N LEU D 507 O LEU S  533 ? O LEU D 533 
AD7 1 2 N GLY S  612 ? N GLY D 612 O LEU S  624 ? O LEU D 624 
AD8 1 2 O VAL S  771 ? O VAL D 771 N PHE S  692 ? N PHE D 692 
AD8 2 3 N TYR S  693 ? N TYR D 693 O LEU S  760 ? O LEU D 760 
AD8 3 4 O SER S  761 ? O SER D 761 N GLU S  715 ? N GLU D 715 
AD8 4 5 N LEU S  716 ? N LEU D 716 O VAL S  748 ? O VAL D 748 
AD8 5 6 O ALA S  745 ? O ALA D 745 N VAL S  734 ? N VAL D 734 
AD8 6 7 N GLU S  737 ? N GLU D 737 O ARG S  774 ? O ARG D 774 
AD9 1 2 N LEU T  28  ? N LEU E 28  O VAL T  45  ? O VAL E 45  
AD9 2 3 N MET T  44  ? N MET E 44  O VAL T  56  ? O VAL E 56  
AE1 1 2 N GLY T  340 ? N GLY E 340 O SER T  359 ? O SER E 359 
AE1 2 3 N TYR T  356 ? N TYR E 356 O LYS T  369 ? O LYS E 369 
AE2 1 2 N SER T  348 ? N SER E 348 O GLY T  351 ? O GLY E 351 
AE3 1 2 N GLU U  18  ? N GLU F 18  O TRP U  26  ? O TRP F 26  
AE3 2 3 N VAL U  27  ? N VAL F 27  O ARG U  91  ? O ARG F 91  
AE3 3 4 O VAL U  92  ? O VAL F 92  N VAL U  70  ? N VAL F 70  
AE3 4 5 O VAL U  75  ? O VAL F 75  N PHE U  48  ? N PHE F 48  
AE4 1 2 N THR U  157 ? N THR F 157 O ILE U  165 ? O ILE F 165 
AE5 1 2 N ALA V  39  ? N ALA G 39  O VAL V  77  ? O VAL G 77  
AE5 2 3 N VAL V  80  ? N VAL G 80  O ILE V  106 ? O ILE G 106 
AE5 3 4 N SER V  107 ? N SER G 107 O VAL V  135 ? O VAL G 135 
AE6 1 2 N VAL W  31  ? N VAL O 31  O VAL W  162 ? O VAL O 162 
AE7 1 2 N VAL W  42  ? N VAL O 42  O VAL W  114 ? O VAL O 114 
AE8 1 2 N GLU W  71  ? N GLU O 71  O VAL W  90  ? O VAL O 90  
AE8 2 3 N ILE W  93  ? N ILE O 93  O TYR W  131 ? O TYR O 131 
AE9 1 2 N ALA X  35  ? N ALA I 35  O THR X  56  ? O THR I 56  
AE9 2 3 N LEU X  59  ? N LEU I 59  O PHE X  67  ? O PHE I 67  
AE9 3 4 N LEU X  69  ? N LEU I 69  O ARG X  85  ? O ARG I 85  
AE9 4 5 N ILE X  82  ? N ILE I 82  O ALA X  95  ? O ALA I 95  
AE9 5 6 N GLU X  98  ? N GLU I 98  O GLY X  102 ? O GLY I 102 
AE9 6 7 N THR X  105 ? N THR I 105 O ILE X  108 ? O ILE I 108 
AF1 1 2 N VAL Y  2   ? N VAL X 2   O ASP Y  56  ? O ASP X 56  
AF1 2 3 O LEU Y  57  ? O LEU X 57  N LEU Y  50  ? N LEU X 50  
AF1 3 4 O HIS Y  51  ? O HIS X 51  N LYS Y  30  ? N LYS X 30  
AF1 4 5 N VAL Y  31  ? N VAL X 31  O TYR Y  90  ? O TYR X 90  
AF1 5 6 N GLU Y  91  ? N GLU X 91  O ASN Y  119 ? O ASN X 119 
AF2 1 2 N ALA CA 53  ? N ALA T 53  O LEU CA 69  ? O LEU T 69  
AF3 1 2 N LEU DA 56  ? N LEU U 56  O VAL DA 61  ? O VAL U 61  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software 1 SF4 501 ? 8  'binding site for residue SF4 1 501' 
AC2 Software 1 FMN 502 ? 13 'binding site for residue FMN 1 502' 
AC3 Software 2 FES 201 ? 7  'binding site for residue FES 2 201' 
AC4 Software 3 SF4 801 ? 8  'binding site for residue SF4 3 801' 
AC5 Software 3 SF4 802 ? 7  'binding site for residue SF4 3 802' 
AC6 Software 3 SF4 803 ? 9  'binding site for residue SF4 3 803' 
AC7 Software 3 FES 804 ? 6  'binding site for residue FES 3 804' 
AC8 Software 4 DCQ 501 ? 10 'binding site for residue DCQ 4 501' 
AC9 Software 6 SF4 201 ? 10 'binding site for residue SF4 6 201' 
AD1 Software 9 SF4 201 ? 9  'binding site for residue SF4 9 201' 
AD2 Software 9 SF4 202 ? 8  'binding site for residue SF4 9 202' 
AD3 Software B SF4 501 ? 8  'binding site for residue SF4 B 501' 
AD4 Software B FMN 502 ? 14 'binding site for residue FMN B 502' 
AD5 Software C FES 201 ? 6  'binding site for residue FES C 201' 
AD6 Software D SF4 801 ? 9  'binding site for residue SF4 D 801' 
AD7 Software D SF4 802 ? 7  'binding site for residue SF4 D 802' 
AD8 Software D SF4 803 ? 8  'binding site for residue SF4 D 803' 
AD9 Software D FES 804 ? 6  'binding site for residue FES D 804' 
AE1 Software E DCQ 501 ? 10 'binding site for residue DCQ E 501' 
AE2 Software G SF4 201 ? 8  'binding site for residue SF4 G 201' 
AE3 Software O SF4 201 ? 9  'binding site for residue SF4 O 201' 
AE4 Software O SF4 202 ? 8  'binding site for residue SF4 O 202' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 8  PRO A 199 ? PRO 1 199 . ? 1_555 ? 
2   AC1 8  SER A 352 ? SER 1 352 . ? 1_555 ? 
3   AC1 8  CYS A 353 ? CYS 1 353 . ? 1_555 ? 
4   AC1 8  GLY A 354 ? GLY 1 354 . ? 1_555 ? 
5   AC1 8  LYS A 355 ? LYS 1 355 . ? 1_555 ? 
6   AC1 8  CYS A 356 ? CYS 1 356 . ? 1_555 ? 
7   AC1 8  CYS A 359 ? CYS 1 359 . ? 1_555 ? 
8   AC1 8  CYS A 400 ? CYS 1 400 . ? 1_555 ? 
9   AC2 13 GLY A 64  ? GLY 1 64  . ? 1_555 ? 
10  AC2 13 ARG A 65  ? ARG 1 65  . ? 1_555 ? 
11  AC2 13 GLY A 66  ? GLY 1 66  . ? 1_555 ? 
12  AC2 13 LYS A 75  ? LYS 1 75  . ? 1_555 ? 
13  AC2 13 ASN A 92  ? ASN 1 92  . ? 1_555 ? 
14  AC2 13 ASP A 94  ? ASP 1 94  . ? 1_555 ? 
15  AC2 13 TYR A 180 ? TYR 1 180 . ? 1_555 ? 
16  AC2 13 GLY A 183 ? GLY 1 183 . ? 1_555 ? 
17  AC2 13 ASN A 219 ? ASN 1 219 . ? 1_555 ? 
18  AC2 13 ASN A 220 ? ASN 1 220 . ? 1_555 ? 
19  AC2 13 THR A 223 ? THR 1 223 . ? 1_555 ? 
20  AC2 13 PRO A 401 ? PRO 1 401 . ? 1_555 ? 
21  AC2 13 LEU A 402 ? LEU 1 402 . ? 1_555 ? 
22  AC3 7  CYS B 83  ? CYS 2 83  . ? 1_555 ? 
23  AC3 7  THR B 85  ? THR 2 85  . ? 1_555 ? 
24  AC3 7  CYS B 88  ? CYS 2 88  . ? 1_555 ? 
25  AC3 7  CYS B 124 ? CYS 2 124 . ? 1_555 ? 
26  AC3 7  LEU B 125 ? LEU 2 125 . ? 1_555 ? 
27  AC3 7  SER B 127 ? SER 2 127 . ? 1_555 ? 
28  AC3 7  CYS B 128 ? CYS 2 128 . ? 1_555 ? 
29  AC4 8  HIS C 115 ? HIS 3 115 . ? 1_555 ? 
30  AC4 8  CYS C 119 ? CYS 3 119 . ? 1_555 ? 
31  AC4 8  CYS C 122 ? CYS 3 122 . ? 1_555 ? 
32  AC4 8  CYS C 128 ? CYS 3 128 . ? 1_555 ? 
33  AC4 8  GLN C 131 ? GLN 3 131 . ? 1_555 ? 
34  AC4 8  VAL C 232 ? VAL 3 232 . ? 1_555 ? 
35  AC4 8  GLY C 233 ? GLY 3 233 . ? 1_555 ? 
36  AC4 8  ILE D 325 ? ILE 4 325 . ? 1_555 ? 
37  AC5 7  CYS C 181 ? CYS 3 181 . ? 1_555 ? 
38  AC5 7  ILE C 182 ? ILE 3 182 . ? 1_555 ? 
39  AC5 7  CYS C 184 ? CYS 3 184 . ? 1_555 ? 
40  AC5 7  CYS C 187 ? CYS 3 187 . ? 1_555 ? 
41  AC5 7  CYS C 230 ? CYS 3 230 . ? 1_555 ? 
42  AC5 7  VAL C 232 ? VAL 3 232 . ? 1_555 ? 
43  AC5 7  LEU C 235 ? LEU 3 235 . ? 1_555 ? 
44  AC6 9  CYS C 256 ? CYS 3 256 . ? 1_555 ? 
45  AC6 9  LEU C 258 ? LEU 3 258 . ? 1_555 ? 
46  AC6 9  CYS C 259 ? CYS 3 259 . ? 1_555 ? 
47  AC6 9  VAL C 261 ? VAL 3 261 . ? 1_555 ? 
48  AC6 9  GLY C 262 ? GLY 3 262 . ? 1_555 ? 
49  AC6 9  CYS C 263 ? CYS 3 263 . ? 1_555 ? 
50  AC6 9  CYS C 291 ? CYS 3 291 . ? 1_555 ? 
51  AC6 9  GLY C 294 ? GLY 3 294 . ? 1_555 ? 
52  AC6 9  PRO C 407 ? PRO 3 407 . ? 1_555 ? 
53  AC7 6  CYS C 34  ? CYS 3 34  . ? 1_555 ? 
54  AC7 6  SER C 35  ? SER 3 35  . ? 1_555 ? 
55  AC7 6  CYS C 45  ? CYS 3 45  . ? 1_555 ? 
56  AC7 6  ARG C 46  ? ARG 3 46  . ? 1_555 ? 
57  AC7 6  CYS C 48  ? CYS 3 48  . ? 1_555 ? 
58  AC7 6  CYS C 83  ? CYS 3 83  . ? 1_555 ? 
59  AC8 10 GLN D 33  ? GLN 4 33  . ? 1_555 ? 
60  AC8 10 HIS D 38  ? HIS 4 38  . ? 1_555 ? 
61  AC8 10 GLY D 39  ? GLY 4 39  . ? 1_555 ? 
62  AC8 10 TYR D 87  ? TYR 4 87  . ? 1_555 ? 
63  AC8 10 THR D 135 ? THR 4 135 . ? 1_555 ? 
64  AC8 10 PRO D 402 ? PRO 4 402 . ? 1_555 ? 
65  AC8 10 THR F 40  ? THR 6 40  . ? 1_555 ? 
66  AC8 10 GLY F 42  ? GLY 6 42  . ? 1_555 ? 
67  AC8 10 LEU F 43  ? LEU 6 43  . ? 1_555 ? 
68  AC8 10 MET F 51  ? MET 6 51  . ? 1_555 ? 
69  AC9 10 ARG D 84  ? ARG 4 84  . ? 1_555 ? 
70  AC9 10 HIS D 169 ? HIS 4 169 . ? 1_555 ? 
71  AC9 10 CYS F 45  ? CYS 6 45  . ? 1_555 ? 
72  AC9 10 CYS F 46  ? CYS 6 46  . ? 1_555 ? 
73  AC9 10 GLY F 82  ? GLY 6 82  . ? 1_555 ? 
74  AC9 10 ALA F 110 ? ALA 6 110 . ? 1_555 ? 
75  AC9 10 CYS F 111 ? CYS 6 111 . ? 1_555 ? 
76  AC9 10 GLY F 139 ? GLY 6 139 . ? 1_555 ? 
77  AC9 10 CYS F 140 ? CYS 6 140 . ? 1_555 ? 
78  AC9 10 PRO F 141 ? PRO 6 141 . ? 1_555 ? 
79  AD1 9  HIS G 41  ? HIS 9 41  . ? 1_555 ? 
80  AD1 9  CYS G 63  ? CYS 9 63  . ? 1_555 ? 
81  AD1 9  PRO G 64  ? PRO 9 64  . ? 1_555 ? 
82  AD1 9  ILE G 68  ? ILE 9 68  . ? 1_555 ? 
83  AD1 9  CYS G 98  ? CYS 9 98  . ? 1_555 ? 
84  AD1 9  ILE G 99  ? ILE 9 99  . ? 1_555 ? 
85  AD1 9  PHE G 100 ? PHE 9 100 . ? 1_555 ? 
86  AD1 9  CYS G 101 ? CYS 9 101 . ? 1_555 ? 
87  AD1 9  CYS G 104 ? CYS 9 104 . ? 1_555 ? 
88  AD2 8  CYS G 53  ? CYS 9 53  . ? 1_555 ? 
89  AD2 8  ILE G 54  ? ILE 9 54  . ? 1_555 ? 
90  AD2 8  GLY G 55  ? GLY 9 55  . ? 1_555 ? 
91  AD2 8  CYS G 56  ? CYS 9 56  . ? 1_555 ? 
92  AD2 8  SER G 57  ? SER 9 57  . ? 1_555 ? 
93  AD2 8  CYS G 59  ? CYS 9 59  . ? 1_555 ? 
94  AD2 8  CYS G 108 ? CYS 9 108 . ? 1_555 ? 
95  AD2 8  THR G 110 ? THR 9 110 . ? 1_555 ? 
96  AD3 8  PRO Q 199 ? PRO B 199 . ? 1_555 ? 
97  AD3 8  SER Q 352 ? SER B 352 . ? 1_555 ? 
98  AD3 8  CYS Q 353 ? CYS B 353 . ? 1_555 ? 
99  AD3 8  GLY Q 354 ? GLY B 354 . ? 1_555 ? 
100 AD3 8  LYS Q 355 ? LYS B 355 . ? 1_555 ? 
101 AD3 8  CYS Q 356 ? CYS B 356 . ? 1_555 ? 
102 AD3 8  CYS Q 359 ? CYS B 359 . ? 1_555 ? 
103 AD3 8  CYS Q 400 ? CYS B 400 . ? 1_555 ? 
104 AD4 14 GLY Q 64  ? GLY B 64  . ? 1_555 ? 
105 AD4 14 ARG Q 65  ? ARG B 65  . ? 1_555 ? 
106 AD4 14 GLY Q 66  ? GLY B 66  . ? 1_555 ? 
107 AD4 14 LYS Q 75  ? LYS B 75  . ? 1_555 ? 
108 AD4 14 ASN Q 92  ? ASN B 92  . ? 1_555 ? 
109 AD4 14 ASP Q 94  ? ASP B 94  . ? 1_555 ? 
110 AD4 14 TYR Q 180 ? TYR B 180 . ? 1_555 ? 
111 AD4 14 GLY Q 183 ? GLY B 183 . ? 1_555 ? 
112 AD4 14 GLU Q 184 ? GLU B 184 . ? 1_555 ? 
113 AD4 14 GLU Q 185 ? GLU B 185 . ? 1_555 ? 
114 AD4 14 ILE Q 218 ? ILE B 218 . ? 1_555 ? 
115 AD4 14 ASN Q 219 ? ASN B 219 . ? 1_555 ? 
116 AD4 14 ASN Q 220 ? ASN B 220 . ? 1_555 ? 
117 AD4 14 THR Q 223 ? THR B 223 . ? 1_555 ? 
118 AD5 6  CYS R 83  ? CYS C 83  . ? 1_555 ? 
119 AD5 6  CYS R 88  ? CYS C 88  . ? 1_555 ? 
120 AD5 6  CYS R 124 ? CYS C 124 . ? 1_555 ? 
121 AD5 6  LEU R 125 ? LEU C 125 . ? 1_555 ? 
122 AD5 6  SER R 127 ? SER C 127 . ? 1_555 ? 
123 AD5 6  CYS R 128 ? CYS C 128 . ? 1_555 ? 
124 AD6 9  HIS S 115 ? HIS D 115 . ? 1_555 ? 
125 AD6 9  ASP S 118 ? ASP D 118 . ? 1_555 ? 
126 AD6 9  CYS S 119 ? CYS D 119 . ? 1_555 ? 
127 AD6 9  CYS S 122 ? CYS D 122 . ? 1_555 ? 
128 AD6 9  CYS S 128 ? CYS D 128 . ? 1_555 ? 
129 AD6 9  GLN S 131 ? GLN D 131 . ? 1_555 ? 
130 AD6 9  VAL S 232 ? VAL D 232 . ? 1_555 ? 
131 AD6 9  GLY S 233 ? GLY D 233 . ? 1_555 ? 
132 AD6 9  ILE T 325 ? ILE E 325 . ? 1_555 ? 
133 AD7 7  CYS S 181 ? CYS D 181 . ? 1_555 ? 
134 AD7 7  CYS S 184 ? CYS D 184 . ? 1_555 ? 
135 AD7 7  ARG S 186 ? ARG D 186 . ? 1_555 ? 
136 AD7 7  CYS S 187 ? CYS D 187 . ? 1_555 ? 
137 AD7 7  CYS S 230 ? CYS D 230 . ? 1_555 ? 
138 AD7 7  VAL S 232 ? VAL D 232 . ? 1_555 ? 
139 AD7 7  LEU S 235 ? LEU D 235 . ? 1_555 ? 
140 AD8 8  CYS S 256 ? CYS D 256 . ? 1_555 ? 
141 AD8 8  LEU S 258 ? LEU D 258 . ? 1_555 ? 
142 AD8 8  CYS S 259 ? CYS D 259 . ? 1_555 ? 
143 AD8 8  VAL S 261 ? VAL D 261 . ? 1_555 ? 
144 AD8 8  GLY S 262 ? GLY D 262 . ? 1_555 ? 
145 AD8 8  CYS S 263 ? CYS D 263 . ? 1_555 ? 
146 AD8 8  CYS S 291 ? CYS D 291 . ? 1_555 ? 
147 AD8 8  ILE S 408 ? ILE D 408 . ? 1_555 ? 
148 AD9 6  CYS S 34  ? CYS D 34  . ? 1_555 ? 
149 AD9 6  SER S 35  ? SER D 35  . ? 1_555 ? 
150 AD9 6  CYS S 45  ? CYS D 45  . ? 1_555 ? 
151 AD9 6  ARG S 46  ? ARG D 46  . ? 1_555 ? 
152 AD9 6  CYS S 48  ? CYS D 48  . ? 1_555 ? 
153 AD9 6  CYS S 83  ? CYS D 83  . ? 1_555 ? 
154 AE1 10 GLN T 33  ? GLN E 33  . ? 1_555 ? 
155 AE1 10 HIS T 38  ? HIS E 38  . ? 1_555 ? 
156 AE1 10 GLY T 39  ? GLY E 39  . ? 1_555 ? 
157 AE1 10 TYR T 87  ? TYR E 87  . ? 1_555 ? 
158 AE1 10 PRO T 402 ? PRO E 402 . ? 1_555 ? 
159 AE1 10 VAL T 403 ? VAL E 403 . ? 1_555 ? 
160 AE1 10 THR V 40  ? THR G 40  . ? 1_555 ? 
161 AE1 10 GLY V 42  ? GLY G 42  . ? 1_555 ? 
162 AE1 10 LEU V 43  ? LEU G 43  . ? 1_555 ? 
163 AE1 10 MET V 51  ? MET G 51  . ? 1_555 ? 
164 AE2 8  ARG T 84  ? ARG E 84  . ? 1_555 ? 
165 AE2 8  HIS T 169 ? HIS E 169 . ? 1_555 ? 
166 AE2 8  CYS V 45  ? CYS G 45  . ? 1_555 ? 
167 AE2 8  CYS V 46  ? CYS G 46  . ? 1_555 ? 
168 AE2 8  ALA V 110 ? ALA G 110 . ? 1_555 ? 
169 AE2 8  CYS V 111 ? CYS G 111 . ? 1_555 ? 
170 AE2 8  CYS V 140 ? CYS G 140 . ? 1_555 ? 
171 AE2 8  PRO V 141 ? PRO G 141 . ? 1_555 ? 
172 AE3 9  HIS W 41  ? HIS O 41  . ? 1_555 ? 
173 AE3 9  CYS W 63  ? CYS O 63  . ? 1_555 ? 
174 AE3 9  PRO W 64  ? PRO O 64  . ? 1_555 ? 
175 AE3 9  ILE W 68  ? ILE O 68  . ? 1_555 ? 
176 AE3 9  CYS W 98  ? CYS O 98  . ? 1_555 ? 
177 AE3 9  ILE W 99  ? ILE O 99  . ? 1_555 ? 
178 AE3 9  PHE W 100 ? PHE O 100 . ? 1_555 ? 
179 AE3 9  CYS W 101 ? CYS O 101 . ? 1_555 ? 
180 AE3 9  CYS W 104 ? CYS O 104 . ? 1_555 ? 
181 AE4 8  CYS W 53  ? CYS O 53  . ? 1_555 ? 
182 AE4 8  GLY W 55  ? GLY O 55  . ? 1_555 ? 
183 AE4 8  CYS W 56  ? CYS O 56  . ? 1_555 ? 
184 AE4 8  SER W 57  ? SER O 57  . ? 1_555 ? 
185 AE4 8  CYS W 59  ? CYS O 59  . ? 1_555 ? 
186 AE4 8  CYS W 108 ? CYS O 108 . ? 1_555 ? 
187 AE4 8  THR W 110 ? THR O 110 . ? 1_555 ? 
188 AE4 8  ILE W 113 ? ILE O 113 . ? 1_555 ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1 CB  3 CYS 83  ? ? FE2   3 FES 804 ? ? 1.72 
2  1 CB  D CYS 83  ? ? FE2   D FES 804 ? ? 1.74 
3  1 SG  3 CYS 259 ? ? FE4   3 SF4 803 ? ? 1.81 
4  1 SG  D CYS 259 ? ? FE4   D SF4 803 ? ? 1.84 
5  1 SG  B CYS 353 ? ? FE4   B SF4 501 ? ? 1.86 
6  1 OE2 E GLU 185 ? ? OH    O TYR 165 ? ? 2.03 
7  1 O   Q TRP 292 ? ? OG1   Q THR 296 ? ? 2.03 
8  1 OH  1 TYR 131 ? ? O     2 LYS 17  ? ? 2.04 
9  1 O   M PHE 122 ? ? OH    M TYR 234 ? ? 2.04 
10 1 OD2 D ASP 401 ? ? OH    D TYR 454 ? ? 2.04 
11 1 OH  O TYR 26  ? ? OE2   O GLU 120 ? ? 2.05 
12 1 O   H TRP 292 ? ? OG1   H THR 296 ? ? 2.06 
13 1 O   3 GLU 193 ? ? NH2   3 ARG 443 ? ? 2.07 
14 1 O   U LEU 332 ? ? OG1   U THR 336 ? ? 2.08 
15 1 OE2 E GLU 341 ? ? OH    F TYR 57  ? ? 2.08 
16 1 OD2 D ASP 94  ? ? OG    D SER 97  ? ? 2.10 
17 1 O   M LEU 332 ? ? OG1   M THR 336 ? ? 2.10 
18 1 OH  B TYR 131 ? ? O     C LYS 17  ? ? 2.10 
19 1 OD1 L ASP 557 ? ? NE2   M HIS 211 ? ? 2.10 
20 1 OG1 N THR 14  ? ? OH    N TYR 90  ? ? 2.10 
21 1 OG1 C THR 56  ? ? O     D GLU 198 ? ? 2.12 
22 1 NE2 1 GLN 288 ? ? O     1 VAL 335 ? ? 2.12 
23 1 OH  4 TYR 81  ? ? O     6 MET 117 ? ? 2.12 
24 1 O   D VAL 30  ? ? OH    F TYR 184 ? ? 2.12 
25 1 OE1 1 GLU 184 ? ? OG1   1 THR 186 ? ? 2.13 
26 1 O   6 MET 50  ? ? OG    6 SER 53  ? ? 2.13 
27 1 OH  L TYR 90  ? ? O     L LEU 334 ? ? 2.13 
28 1 O   1 LYS 48  ? ? OH    1 TYR 123 ? ? 2.13 
29 1 NH2 E ARG 409 ? ? OE2   F GLU 117 ? ? 2.13 
30 1 O   B ALA 372 ? ? OG1   B THR 376 ? ? 2.14 
31 1 OG  N SER 262 ? ? OH    N TYR 288 ? ? 2.14 
32 1 OH  T TYR 305 ? ? O     T ALA 406 ? ? 2.14 
33 1 O   U PHE 217 ? ? ND2   U ASN 221 ? ? 2.14 
34 1 ND2 3 ASN 286 ? ? O     3 TRP 289 ? ? 2.14 
35 1 NZ  4 LYS 68  ? ? O     5 PRO 145 ? ? 2.15 
36 1 OE1 4 GLU 341 ? ? NH2   5 ARG 91  ? ? 2.15 
37 1 O   G MET 50  ? ? OG    G SER 53  ? ? 2.15 
38 1 O   3 ALA 81  ? ? OG1   3 THR 85  ? ? 2.15 
39 1 O   6 TYR 149 ? ? NE2   6 GLN 153 ? ? 2.15 
40 1 OH  T TYR 90  ? ? O     T LEU 334 ? ? 2.15 
41 1 ND2 1 ASN 92  ? ? "O3'" 1 FMN 502 ? ? 2.15 
42 1 OE1 P GLN 5   ? ? OH    Q TYR 10  ? ? 2.15 
43 1 OG  4 SER 128 ? ? NH2   4 ARG 350 ? ? 2.15 
44 1 O   R VAL 17  ? ? OG1   R THR 21  ? ? 2.16 
45 1 OG1 3 THR 697 ? ? O     3 ALA 762 ? ? 2.16 
46 1 OG  L SER 298 ? ? NZ    L LYS 329 ? ? 2.16 
47 1 NE2 Q GLN 189 ? ? O     Q LEU 264 ? ? 2.16 
48 1 NZ  5 LYS 13  ? ? OE2   5 GLU 37  ? ? 2.16 
49 1 O   D GLY 297 ? ? NE1   D TRP 300 ? ? 2.16 
50 1 OH  1 TYR 32  ? ? OE1   1 GLU 116 ? ? 2.16 
51 1 NH1 E ARG 200 ? ? OH    O TYR 16  ? ? 2.16 
52 1 OH  D TYR 190 ? ? O     D PHE 222 ? ? 2.16 
53 1 OE2 B GLU 395 ? ? NE1   B TRP 408 ? ? 2.16 
54 1 OD2 3 ASP 559 ? ? NZ    3 LYS 686 ? ? 2.16 
55 1 O   M PHE 208 ? ? ND1   M HIS 211 ? ? 2.16 
56 1 O   Q ALA 215 ? ? NH1   Q ARG 294 ? ? 2.16 
57 1 OD2 3 ASP 94  ? ? OG    3 SER 97  ? ? 2.17 
58 1 O   Q VAL 327 ? ? N     Q ASP 331 ? ? 2.17 
59 1 ND2 1 ASN 190 ? ? O     1 ASN 198 ? ? 2.17 
60 1 OD2 3 ASP 401 ? ? OH    3 TYR 454 ? ? 2.17 
61 1 O   H TYR 198 ? ? OG    H SER 341 ? ? 2.17 
62 1 O   B GLU 305 ? ? OG1   B THR 309 ? ? 2.17 
63 1 NH2 O ARG 45  ? ? OD2   O ASP 139 ? ? 2.17 
64 1 O   G GLY 160 ? ? NH1   G ARG 169 ? ? 2.17 
65 1 OH  4 TYR 254 ? ? OG1   4 THR 346 ? ? 2.17 
66 1 O   C MET 28  ? ? OH    C TYR 70  ? ? 2.17 
67 1 OH  Q TYR 162 ? ? O     Q LEU 305 ? ? 2.17 
68 1 N   4 MET 26  ? ? O     4 LEU 47  ? ? 2.18 
69 1 O   D CYS 48  ? ? OG    D SER 82  ? ? 2.18 
70 1 O   H VAL 327 ? ? N     H ASP 331 ? ? 2.18 
71 1 O   H ALA 29  ? ? OG1   H THR 32  ? ? 2.18 
72 1 ND2 1 ASN 220 ? ? O2    1 FMN 502 ? ? 2.18 
73 1 OH  U TYR 313 ? ? O     U MET 443 ? ? 2.18 
74 1 NE2 E GLN 166 ? ? O     O PHE 100 ? ? 2.18 
75 1 O   H GLY 265 ? ? NZ    H LYS 282 ? ? 2.18 
76 1 OE2 4 GLU 185 ? ? OH    9 TYR 165 ? ? 2.18 
77 1 O   J VAL 17  ? ? OG1   J THR 21  ? ? 2.18 
78 1 O   M PHE 217 ? ? ND2   M ASN 221 ? ? 2.18 
79 1 O   G PRO 102 ? ? NZ    Q LYS 69  ? ? 2.19 
80 1 OG  N SER 59  ? ? OG    N SER 100 ? ? 2.19 
81 1 ND2 B ASN 92  ? ? "O3'" B FMN 502 ? ? 2.19 
82 1 O   T VAL 119 ? ? OH    T TYR 251 ? ? 2.19 
83 1 O   T ILE 340 ? ? N     T GLY 345 ? ? 2.19 
84 1 OH  L TYR 90  ? ? OG    L SER 338 ? ? 2.19 
85 1 OE1 B GLU 184 ? ? OG1   B THR 186 ? ? 2.19 
86 1 OE1 A GLN 5   ? ? OH    H TYR 10  ? ? 2.19 
87 1 OH  E TYR 252 ? ? O     F GLY 85  ? ? 2.19 
88 1 OG  V SER 261 ? ? OH    V TYR 375 ? ? 2.19 
89 1 OH  H TYR 5   ? ? OD1   H ASP 184 ? ? 2.19 
90 1 O   J ALA 60  ? ? OH    H TYR 134 ? ? 2.19 
91 1 OE1 H GLU 35  ? ? OH    H TYR 249 ? ? 2.19 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             C 
_pdbx_validate_rmsd_angle.auth_asym_id_1             D 
_pdbx_validate_rmsd_angle.auth_comp_id_1             ASP 
_pdbx_validate_rmsd_angle.auth_seq_id_1              559 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             N 
_pdbx_validate_rmsd_angle.auth_asym_id_2             D 
_pdbx_validate_rmsd_angle.auth_comp_id_2             GLU 
_pdbx_validate_rmsd_angle.auth_seq_id_2              560 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_3             D 
_pdbx_validate_rmsd_angle.auth_comp_id_3             GLU 
_pdbx_validate_rmsd_angle.auth_seq_id_3              560 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                106.06 
_pdbx_validate_rmsd_angle.angle_target_value         121.70 
_pdbx_validate_rmsd_angle.angle_deviation            -15.64 
_pdbx_validate_rmsd_angle.angle_standard_deviation   2.50 
_pdbx_validate_rmsd_angle.linker_flag                Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1   1 LEU 1 9   ? ? -94.34  31.99   
2   1 LYS 1 81  ? ? 72.23   -11.08  
3   1 ASP 1 82  ? ? -166.31 114.92  
4   1 PHE 1 366 ? ? -95.04  -62.15  
5   1 PRO 1 401 ? ? -62.86  2.65    
6   1 ASN 2 137 ? ? 70.97   -25.51  
7   1 ASP 2 138 ? ? -158.20 -2.56   
8   1 ASN 3 7   ? ? 65.44   -29.53  
9   1 ASP 3 8   ? ? -157.20 -2.65   
10  1 PRO 3 31  ? ? -59.76  172.27  
11  1 PHE 3 33  ? ? -121.39 -57.35  
12  1 HIS 3 38  ? ? 57.42   11.07   
13  1 ALA 3 44  ? ? -120.10 -52.17  
14  1 PRO 3 172 ? ? -55.51  -8.47   
15  1 LEU 3 218 ? ? 52.84   71.84   
16  1 LEU 3 275 ? ? -97.54  -62.65  
17  1 GLU 3 287 ? ? -72.45  -71.37  
18  1 GLU 3 314 ? ? -103.25 64.71   
19  1 GLU 3 335 ? ? -97.79  32.70   
20  1 LYS 3 365 ? ? -69.11  94.13   
21  1 ARG 3 667 ? ? -68.81  4.49    
22  1 HIS 3 702 ? ? -69.09  9.65    
23  1 PRO 3 765 ? ? -82.50  44.78   
24  1 GLU 3 772 ? ? -68.45  -177.72 
25  1 GLN 4 33  ? ? 71.52   -5.13   
26  1 GLU 4 51  ? ? -78.89  -163.25 
27  1 MET 4 85  ? ? -95.79  -62.74  
28  1 PRO 4 299 ? ? -49.17  153.14  
29  1 ASP 4 401 ? ? 46.37   70.15   
30  1 LEU 5 107 ? ? -93.26  -62.98  
31  1 ALA 5 111 ? ? -67.98  0.83    
32  1 ILE 5 135 ? ? -96.60  -62.41  
33  1 GLU 6 17  ? ? 71.59   -8.46   
34  1 ARG 6 178 ? ? -170.70 136.26  
35  1 VAL 9 22  ? ? -55.49  109.69  
36  1 THR 9 23  ? ? 175.95  167.37  
37  1 GLU 9 178 ? ? 67.23   -6.50   
38  1 MET 7 44  ? ? -99.96  -61.06  
39  1 ARG 7 88  ? ? 67.86   -4.65   
40  1 TRP W 37  ? ? 62.35   72.88   
41  1 LYS A 35  ? ? -119.21 74.80   
42  1 GLU A 45  ? ? 60.89   70.75   
43  1 SER A 46  ? ? 65.97   62.75   
44  1 ASN A 48  ? ? 178.33  174.75  
45  1 ALA J 62  ? ? -98.80  -61.43  
46  1 ALA J 76  ? ? 49.25   14.41   
47  1 VAL J 157 ? ? -87.50  -71.03  
48  1 GLU J 158 ? ? 27.60   64.42   
49  1 LEU K 51  ? ? 72.22   -8.28   
50  1 GLU K 83  ? ? -73.48  -167.46 
51  1 PRO L 10  ? ? -83.78  40.00   
52  1 TRP L 59  ? ? -149.14 -159.65 
53  1 LEU L 60  ? ? -39.72  136.22  
54  1 ASP L 70  ? ? -126.98 -167.88 
55  1 TYR L 151 ? ? -97.62  36.44   
56  1 LEU L 183 ? ? 55.40   15.51   
57  1 MET L 245 ? ? 70.93   -10.49  
58  1 GLN L 361 ? ? 71.25   -7.98   
59  1 LEU L 378 ? ? -100.06 72.82   
60  1 PHE L 397 ? ? 72.45   -1.84   
61  1 GLU L 428 ? ? 179.90  174.53  
62  1 PHE L 517 ? ? 53.79   75.40   
63  1 THR M 42  ? ? 71.22   -1.66   
64  1 HIS M 43  ? ? -50.44  109.62  
65  1 ARG M 90  ? ? 76.11   -6.57   
66  1 GLU M 92  ? ? 54.55   15.94   
67  1 GLU M 188 ? ? 57.42   18.19   
68  1 LYS M 235 ? ? -91.40  31.40   
69  1 ALA M 249 ? ? -155.38 71.91   
70  1 THR M 304 ? ? 49.05   77.90   
71  1 TYR M 344 ? ? 63.50   65.09   
72  1 LEU M 397 ? ? -83.05  47.95   
73  1 GLU M 416 ? ? -68.80  -178.12 
74  1 PHE M 446 ? ? -118.15 58.38   
75  1 ARG N 125 ? ? 72.48   -5.60   
76  1 PRO N 191 ? ? -87.24  42.08   
77  1 THR N 213 ? ? -94.37  -66.00  
78  1 ALA N 227 ? ? -89.93  33.13   
79  1 ALA N 278 ? ? 69.98   -9.24   
80  1 PRO N 338 ? ? -99.61  49.24   
81  1 PRO N 393 ? ? -77.56  42.40   
82  1 ALA N 422 ? ? -90.57  48.06   
83  1 ALA N 425 ? ? -59.00  -2.02   
84  1 VAL H 44  ? ? -43.54  -14.05  
85  1 ASN H 49  ? ? -66.54  1.99    
86  1 ARG H 50  ? ? -79.22  -140.42 
87  1 VAL H 51  ? ? -41.40  17.16   
88  1 GLU H 70  ? ? 60.76   68.28   
89  1 PHE H 108 ? ? -95.83  34.60   
90  1 TYR H 111 ? ? -104.13 -71.86  
91  1 ALA H 214 ? ? 69.54   -0.43   
92  1 ALA H 215 ? ? -57.25  -70.51  
93  1 ARG H 216 ? ? 177.16  165.46  
94  1 PHE H 219 ? ? 61.24   -1.66   
95  1 ASP H 220 ? ? -91.31  48.24   
96  1 GLN H 226 ? ? 75.63   -7.36   
97  1 TYR H 232 ? ? 64.99   -4.73   
98  1 THR H 234 ? ? 77.46   -2.61   
99  1 SER H 238 ? ? -97.92  -66.07  
100 1 THR H 268 ? ? 23.68   54.78   
101 1 LEU H 272 ? ? 73.14   -14.37  
102 1 GLU H 273 ? ? 32.00   51.90   
103 1 ARG H 301 ? ? 73.25   -0.09   
104 1 TYR H 302 ? ? 65.89   -7.67   
105 1 ASP H 331 ? ? 53.08   19.77   
106 1 LEU H 332 ? ? -70.62  -71.34  
107 1 PRO B 4   ? ? -67.29  72.15   
108 1 LEU B 9   ? ? -93.85  33.43   
109 1 LYS B 81  ? ? 71.55   -11.10  
110 1 ASP B 82  ? ? -165.98 112.95  
111 1 PHE B 366 ? ? -93.74  -62.31  
112 1 PRO B 401 ? ? -63.26  1.50    
113 1 ASN C 137 ? ? 70.56   -27.89  
114 1 ASP C 138 ? ? -159.22 -2.07   
115 1 ASN D 7   ? ? 65.01   -27.84  
116 1 ASP D 8   ? ? -154.92 -6.70   
117 1 VAL D 30  ? ? -170.82 142.74  
118 1 PRO D 31  ? ? -58.86  172.21  
119 1 HIS D 38  ? ? 57.17   9.38    
120 1 ALA D 44  ? ? -120.25 -53.01  
121 1 PRO D 172 ? ? -54.44  -8.11   
122 1 LEU D 218 ? ? 52.20   73.48   
123 1 GLU D 287 ? ? -74.99  -71.28  
124 1 GLU D 314 ? ? -101.72 64.74   
125 1 LYS D 365 ? ? -69.58  99.06   
126 1 ARG D 667 ? ? -66.50  4.73    
127 1 GLU D 682 ? ? -170.04 135.12  
128 1 HIS D 702 ? ? -66.85  6.87    
129 1 PRO D 765 ? ? -83.54  46.07   
130 1 GLU D 772 ? ? -69.50  -176.98 
131 1 GLN E 33  ? ? 72.86   -4.86   
132 1 GLU E 51  ? ? -79.12  -162.13 
133 1 MET E 85  ? ? -95.55  -62.14  
134 1 SER E 255 ? ? -99.09  36.34   
135 1 ASP E 401 ? ? 45.78   70.70   
136 1 LEU F 107 ? ? -93.99  -61.67  
137 1 ALA F 111 ? ? -66.48  1.75    
138 1 ILE F 135 ? ? -94.27  -62.95  
139 1 GLU G 17  ? ? 73.31   -9.00   
140 1 ARG G 178 ? ? -170.95 137.84  
141 1 THR O 23  ? ? 179.97  164.20  
142 1 SER O 57  ? ? 59.28   16.08   
143 1 GLU O 134 ? ? -69.47  3.80    
144 1 GLU O 178 ? ? 67.10   -3.38   
145 1 MET I 44  ? ? -97.45  -61.03  
146 1 ARG I 88  ? ? 67.48   -4.88   
147 1 HIS I 96  ? ? -121.75 -169.89 
148 1 TRP X 37  ? ? 62.48   72.95   
149 1 LYS P 34  ? ? 60.07   66.68   
150 1 GLU P 45  ? ? 61.71   71.14   
151 1 SER P 46  ? ? 66.28   62.12   
152 1 ASN P 48  ? ? 176.93  173.11  
153 1 ALA R 62  ? ? -94.96  -61.53  
154 1 ALA R 76  ? ? 49.61   13.17   
155 1 GLU R 158 ? ? 28.77   64.76   
156 1 LEU S 51  ? ? 72.46   -7.70   
157 1 GLU S 83  ? ? -74.49  -166.21 
158 1 PRO T 10  ? ? -83.64  38.76   
159 1 TRP T 59  ? ? -149.78 -157.97 
160 1 LEU T 60  ? ? -37.58  135.55  
161 1 ASP T 70  ? ? -125.98 -167.64 
162 1 TYR T 151 ? ? -93.90  46.38   
163 1 MET T 245 ? ? 70.69   -9.76   
164 1 GLN T 361 ? ? 72.35   -8.92   
165 1 PHE T 397 ? ? 73.90   -3.80   
166 1 GLU T 428 ? ? 179.38  175.72  
167 1 PHE T 517 ? ? 51.84   76.28   
168 1 THR U 42  ? ? 71.54   -2.33   
169 1 HIS U 43  ? ? -51.31  108.75  
170 1 ARG U 90  ? ? 75.61   -8.03   
171 1 GLU U 92  ? ? 55.29   16.83   
172 1 GLU U 188 ? ? 52.78   17.76   
173 1 LYS U 235 ? ? -92.72  31.29   
174 1 ALA U 249 ? ? -157.14 72.17   
175 1 THR U 304 ? ? 50.56   78.21   
176 1 THR U 336 ? ? -103.11 -60.55  
177 1 TYR U 344 ? ? 60.02   66.95   
178 1 LEU U 397 ? ? -82.59  48.92   
179 1 ASP U 424 ? ? -82.17  -70.71  
180 1 ARG V 125 ? ? 71.16   -9.35   
181 1 PRO V 191 ? ? -86.94  43.05   
182 1 THR V 213 ? ? -94.18  -64.88  
183 1 ALA V 227 ? ? -90.71  33.58   
184 1 ALA V 278 ? ? 72.70   -7.85   
185 1 PRO V 338 ? ? -101.00 48.01   
186 1 PRO V 393 ? ? -80.10  40.75   
187 1 ALA V 422 ? ? -84.29  48.78   
188 1 ALA V 424 ? ? -78.67  -160.06 
189 1 ALA V 425 ? ? -55.38  -2.60   
190 1 VAL Q 44  ? ? -42.61  -16.12  
191 1 ASN Q 49  ? ? -68.43  1.61    
192 1 ARG Q 50  ? ? -78.88  -147.27 
193 1 VAL Q 51  ? ? -22.67  -47.21  
194 1 LYS Q 69  ? ? -91.10  30.43   
195 1 GLU Q 70  ? ? 60.58   69.52   
196 1 PHE Q 108 ? ? -96.70  34.15   
197 1 TYR Q 111 ? ? -109.31 -71.50  
198 1 VAL Q 115 ? ? -102.07 -60.37  
199 1 ALA Q 215 ? ? -56.58  -70.04  
200 1 ARG Q 216 ? ? 176.92  167.00  
201 1 PHE Q 219 ? ? 61.82   -3.58   
202 1 ASP Q 220 ? ? -91.50  47.33   
203 1 GLN Q 226 ? ? 77.69   -6.69   
204 1 TYR Q 232 ? ? 64.41   -4.85   
205 1 THR Q 234 ? ? 76.65   -0.99   
206 1 SER Q 238 ? ? -98.17  -64.81  
207 1 THR Q 268 ? ? 26.91   48.71   
208 1 LEU Q 272 ? ? 72.11   -11.93  
209 1 GLU Q 273 ? ? 33.45   53.89   
210 1 ARG Q 301 ? ? 72.59   -2.95   
211 1 TYR Q 302 ? ? 64.71   -8.08   
212 1 LEU Q 332 ? ? -69.15  -73.04  
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1  1 LYS 9 20  ? ? PRO 9 21  ? ? -147.30 
2  1 PRO 9 21  ? ? VAL 9 22  ? ? -145.26 
3  1 GLY K 50  ? ? LEU K 51  ? ? 148.83  
4  1 PRO L 435 ? ? HIS L 436 ? ? -140.59 
5  1 GLY H 52  ? ? PRO H 53  ? ? 49.98   
6  1 THR H 217 ? ? PRO H 218 ? ? 115.05  
7  1 GLY H 266 ? ? TRP H 267 ? ? -144.74 
8  1 TRP H 267 ? ? THR H 268 ? ? 149.61  
9  1 LYS O 20  ? ? PRO O 21  ? ? -149.27 
10 1 PRO O 21  ? ? VAL O 22  ? ? -149.04 
11 1 GLY S 50  ? ? LEU S 51  ? ? 147.98  
12 1 PRO T 435 ? ? HIS T 436 ? ? -143.06 
13 1 THR Q 217 ? ? PRO Q 218 ? ? 114.03  
14 1 GLY Q 266 ? ? TRP Q 267 ? ? -147.40 
15 1 LEU Q 332 ? ? PRO Q 333 ? ? 148.66  
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1   ? refined 53.6671  14.7489  403.8312 0.4512  0.1187  0.2795 0.1079  0.1072  0.0760  0.1079  0.0307  0.2138 
-0.0242 -0.1178 0.0405  0.0545  -0.0153 0.1150  0.0960  -0.0473 -0.0130 -0.1309 0.0320  0.0322  
'X-RAY DIFFRACTION' 2   ? refined 70.4908  22.8120  394.6554 0.4973  0.4151  0.4270 0.3011  -0.0401 -0.1061 0.0156  0.0007  0.0137 
-0.0022 0.0146  -0.0025 -0.0432 -0.0655 0.0323  -0.0281 -0.0193 -0.0574 0.0043  -0.0075 -0.0264 
'X-RAY DIFFRACTION' 3   ? refined 65.0396  21.9510  381.0571 0.7610  0.6378  0.4657 0.3570  -0.1651 -0.0704 0.0031  0.0017  0.0086 
0.0039  0.0072  0.0039  0.1004  0.0419  -0.0907 -0.0268 0.0590  0.0365  0.0242  -0.0400 0.0008  
'X-RAY DIFFRACTION' 4   ? refined 50.1157  26.7938  390.8371 0.2698  0.0301  0.2714 -0.0604 -0.0889 0.0889  0.1219  0.1704  0.1998 
-0.0786 -0.0891 -0.0679 0.1146  0.0175  0.0723  -0.0118 0.0563  0.0364  -0.0517 -0.0347 0.4132  
'X-RAY DIFFRACTION' 5   ? refined 55.7417  28.5375  382.6261 0.3199  0.2315  0.0488 0.0677  0.0887  0.0103  0.0137  0.0165  0.1346 
0.0014  -0.0451 -0.0116 -0.0422 -0.0067 0.0255  0.0119  -0.0304 -0.0207 0.0479  -0.1611 -0.2910 
'X-RAY DIFFRACTION' 6   ? refined 46.3153  3.8108   383.2569 0.6218  -0.0212 0.1911 0.0046  -0.0432 0.0204  0.0534  0.0968  0.0174 
-0.0492 -0.0126 0.0406  0.0691  0.0236  -0.0105 -0.1329 -0.0632 0.0163  -0.0696 -0.0110 -0.1040 
'X-RAY DIFFRACTION' 7   ? refined 36.4303  1.4715   366.8250 0.4250  0.0574  0.3642 -0.0061 0.0629  0.0261  0.0333  0.0693  0.0978 
0.0029  0.0072  0.0807  0.0713  0.0090  -0.0542 -0.0746 0.0743  -0.0381 0.0396  0.0250  0.0509  
'X-RAY DIFFRACTION' 8   ? refined 43.1427  46.1280  383.5418 0.5373  0.6086  0.3601 0.1308  0.1472  -0.2080 0.0004  0.0753  0.0192 
0.0061  -0.0034 -0.0366 0.0182  -0.0125 0.0344  0.0221  0.0281  -0.0674 0.0115  -0.0406 0.0244  
'X-RAY DIFFRACTION' 9   ? refined 37.2405  38.4747  380.2362 0.3171  0.2486  0.1697 0.1818  0.0108  0.0526  0.0102  0.0225  0.0095 
-0.0015 0.0095  0.0042  0.0232  -0.0168 -0.0281 0.0115  0.0087  0.0325  -0.0114 -0.0151 0.0321  
'X-RAY DIFFRACTION' 10  ? refined 35.0431  40.9405  371.7239 0.4310  0.2430  0.2714 0.1240  0.1303  -0.1048 0.0645  0.0628  0.0040 
-0.0190 -0.0151 0.0085  -0.0004 0.0106  0.0086  0.0235  0.0537  -0.0497 0.0426  0.0218  0.0569  
'X-RAY DIFFRACTION' 11  ? refined 28.8742  30.8973  377.7387 0.4727  0.1244  0.4655 -0.0058 0.1416  0.0946  -0.0003 0.0021  0.0132 
0.0001  -0.0005 -0.0050 0.0112  -0.0110 -0.0186 0.0152  -0.0404 -0.0263 -0.0043 0.0204  -0.0556 
'X-RAY DIFFRACTION' 12  ? refined 28.8100  15.2220  383.0816 0.5277  0.1058  0.4415 0.0673  0.0522  0.1554  0.0017  0.0148  0.0100 
0.0042  0.0028  0.0117  -0.1014 0.0145  0.0786  -0.0436 0.0055  0.0107  -0.0094 0.0370  -0.0517 
'X-RAY DIFFRACTION' 13  ? refined 18.7686  13.2868  381.1171 0.3606  0.1187  0.3089 0.0606  0.0621  -0.1464 0.0202  0.0083  0.0038 
0.0023  -0.0084 -0.0035 0.0137  -0.0031 -0.0124 0.0007  -0.0007 0.0071  0.0142  0.0374  0.0223  
'X-RAY DIFFRACTION' 14  ? refined 15.5702  26.3922  379.3187 0.1916  0.1592  0.2705 0.0535  0.0497  0.0263  0.0080  0.0001  0.0042 
-0.0007 0.0056  -0.0007 -0.0097 0.0045  0.0025  0.0245  -0.0045 0.0086  0.0066  0.0068  -0.0176 
'X-RAY DIFFRACTION' 15  ? refined 30.4914  17.5716  384.2623 0.6668  0.7934  0.7734 -0.0973 -0.0262 0.2046  0.0038  0.0065  0.0048 
0.0048  -0.0049 -0.0067 0.0049  -0.0094 0.0260  0.0057  0.0219  0.0032  -0.0090 0.0359  -0.0002 
'X-RAY DIFFRACTION' 16  ? refined 29.3272  20.7934  390.5335 0.4670  0.3516  0.3712 -0.1358 0.0063  -0.0124 0.0037  0.0085  0.0029 
0.0003  -0.0003 -0.0055 0.0694  0.0018  -0.0770 -0.0115 -0.0016 -0.0216 -0.0748 0.0330  0.0001  
'X-RAY DIFFRACTION' 17  ? refined 18.0725  17.8637  393.0483 0.3207  0.4462  0.5081 -0.0078 0.1721  0.2261  0.0297  0.0160  0.0469 
0.0072  -0.0366 -0.0129 -0.0281 0.0361  -0.0053 -0.0068 0.0048  0.0076  0.0387  -0.0364 -0.0537 
'X-RAY DIFFRACTION' 18  ? refined 22.5736  28.6876  398.6876 0.2989  0.1155  0.3388 -0.0170 0.1589  -0.0123 0.0146  0.0240  0.0339 
0.0181  0.0209  0.0246  0.0006  0.0029  0.0034  -0.0044 -0.0194 0.0085  -0.0057 -0.0086 -0.0047 
'X-RAY DIFFRACTION' 19  ? refined 30.7256  11.5732  399.6246 0.3514  0.2224  0.1426 -0.0083 0.0195  0.1180  0.0276  0.0150  0.0102 
-0.0011 -0.0074 0.0121  -0.0374 -0.0216 -0.0055 0.0187  0.0401  0.0407  -0.0464 -0.0576 0.0441  
'X-RAY DIFFRACTION' 20  ? refined 55.4252  17.6710  349.5545 0.4106  -0.0910 0.7056 0.2189  0.1423  -0.0936 0.1069  0.0990  0.0379 
0.0206  -0.0036 -0.0023 -0.1532 -0.0713 -0.0356 0.1614  0.0072  0.1175  0.2556  -0.0108 -0.7322 
'X-RAY DIFFRACTION' 21  ? refined 37.3996  21.4138  350.6030 0.4169  -0.0617 0.5270 -0.0225 0.0573  0.0571  0.2075  0.1032  0.0729 
0.0760  -0.0455 0.0491  0.0944  -0.0055 0.0375  -0.0665 -0.0217 0.0919  0.1517  -0.0153 0.1277  
'X-RAY DIFFRACTION' 22  ? refined 41.1457  40.0674  342.6447 0.1043  -0.5465 0.5359 -0.1595 0.0153  -0.0672 0.0091  0.1640  0.0275 
0.0540  0.0124  0.0232  -0.0161 -0.0772 -0.0622 0.0029  0.0776  0.2329  -0.0408 0.0247  0.1975  
'X-RAY DIFFRACTION' 23  ? refined 40.9625  68.9534  316.6094 0.2196  0.1769  0.3472 0.1363  -0.0460 0.1646  0.0346  0.0027  0.0004 
-0.0017 -0.0044 0.0002  -0.0008 -0.0180 -0.0127 -0.0819 -0.0565 -0.0304 -0.0302 0.0259  -0.1849 
'X-RAY DIFFRACTION' 24  ? refined 58.4238  51.7736  346.9192 -0.0136 -0.2386 0.0802 -0.0827 -0.0251 -0.0426 0.1174  0.0059  0.0911 
0.0184  0.0538  0.0168  0.0478  -0.0008 -0.1233 -0.0172 0.0117  0.0283  0.0656  -0.0003 -0.0124 
'X-RAY DIFFRACTION' 25  ? refined 55.6430  66.9035  344.3566 0.1617  0.2007  0.3710 -0.2129 -0.1739 0.0616  0.0492  0.0688  0.2241 
0.0197  0.0867  -0.0241 -0.0030 -0.1529 -0.1311 0.1139  -0.0457 -0.0538 0.1016  -0.1878 -0.0656 
'X-RAY DIFFRACTION' 26  ? refined 50.4717  56.0806  321.8628 0.1070  0.1512  0.4962 -0.1062 0.1288  -0.2212 0.0084  0.0616  
-0.0022 -0.0199 0.0028  -0.0066 -0.0276 0.0716  -0.0123 -0.0972 -0.0296 0.0605  0.0188  -0.0605 -0.4342 
'X-RAY DIFFRACTION' 27  ? refined 48.8080  61.4372  342.7267 0.1219  -0.0410 0.3640 0.0394  0.0280  0.0535  0.0160  0.0309  0.0506 
-0.0086 0.0268  -0.0278 -0.0377 -0.0235 -0.0306 0.0327  0.0559  0.0566  -0.0329 -0.0263 -0.1166 
'X-RAY DIFFRACTION' 28  ? refined 36.2716  68.8736  352.9422 0.2232  0.0808  0.3745 -0.0294 0.0018  -0.1328 0.0380  0.0041  0.0455 
-0.0011 0.0098  -0.0063 -0.0003 0.0350  -0.0786 0.0087  0.0815  -0.0911 0.0558  0.0298  0.2608  
'X-RAY DIFFRACTION' 29  ? refined 42.0594  6.6237   304.3481 0.1367  -0.1638 0.2481 -0.0014 0.1618  0.0155  0.0148  0.0867  0.0220 
0.0272  0.0072  -0.0017 -0.0474 0.0906  -0.0664 0.0023  0.0400  0.0552  0.0301  0.0168  0.0626  
'X-RAY DIFFRACTION' 30  ? refined 26.5557  -3.3794  307.5483 0.7012  0.0237  0.7923 -0.2244 0.0042  0.0015  0.0093  0.0154  0.0695 
-0.0029 0.0081  0.0271  -0.0461 0.0953  -0.0233 0.0034  0.0284  -0.0795 -0.0203 0.0004  0.1336  
'X-RAY DIFFRACTION' 31  ? refined 48.1790  -8.3522  291.6626 0.4558  0.2835  0.2667 0.0827  0.0990  -0.1950 0.0169  0.0025  0.0056 
0.0041  -0.0000 -0.0030 0.0021  -0.0194 0.0035  0.0139  -0.0059 -0.0157 0.0026  0.0061  0.0596  
'X-RAY DIFFRACTION' 32  ? refined 43.3821  0.2445   312.4397 0.3782  -0.1018 0.3577 0.0646  0.1291  -0.2613 -0.0283 0.0505  0.0497 
-0.0209 -0.0159 0.0440  0.0414  0.0681  0.0214  -0.0912 0.1423  -0.0288 0.0307  0.0514  0.9668  
'X-RAY DIFFRACTION' 33  ? refined 72.6776  -7.8107  315.4972 0.6489  0.3607  0.6851 0.2764  0.0023  0.0325  0.0041  0.0102  0.0264 
-0.0043 0.0013  -0.0129 -0.0103 0.0149  -0.0227 -0.0225 -0.0257 -0.0163 0.0525  0.0206  -0.0006 
'X-RAY DIFFRACTION' 34  ? refined 67.5344  3.1627   318.4716 0.4573  0.4315  0.4228 0.2678  -0.1004 -0.0695 0.0103  0.0379  0.0277 
-0.0118 0.0056  -0.0347 0.0180  -0.0439 0.0348  0.1112  0.0929  -0.0178 0.0545  0.0187  0.0406  
'X-RAY DIFFRACTION' 35  ? refined 74.3575  1.7218   305.7900 0.4753  0.3467  0.4547 -0.1556 0.0321  -0.2483 0.0236  0.0398  0.0899 
-0.0237 -0.0095 0.0470  -0.0611 0.0137  -0.0011 0.0074  -0.0132 0.0058  -0.0569 -0.0005 -0.0719 
'X-RAY DIFFRACTION' 36  ? refined 63.0902  10.4414  314.3273 0.6746  0.4932  0.2656 0.2064  0.0303  0.0527  0.0041  0.0154  0.0202 
-0.0073 0.0052  -0.0169 -0.0498 0.1319  -0.0165 -0.0274 -0.0294 0.0252  0.0306  -0.0146 -0.0004 
'X-RAY DIFFRACTION' 37  ? refined 62.0099  -4.1654  307.1851 0.4248  0.3404  0.5985 -0.2993 0.1103  -0.0180 0.0182  0.0111  0.0255 
-0.0118 -0.0086 -0.0022 0.0148  -0.0129 0.0757  -0.0066 -0.0064 -0.0021 -0.0286 0.0349  0.0118  
'X-RAY DIFFRACTION' 38  ? refined 67.5077  9.6444   307.0914 0.5878  0.4375  0.4402 0.2467  -0.2215 -0.1111 0.0082  0.0038  0.0087 
-0.0028 0.0096  -0.0017 0.0100  -0.0185 0.0389  0.0370  -0.0161 -0.0661 0.0193  0.0050  0.0003  
'X-RAY DIFFRACTION' 39  ? refined 58.4959  12.9366  300.3687 0.2536  0.1209  0.3818 0.1211  -0.0099 0.0319  0.0559  0.0589  0.0115 
-0.0578 0.0062  -0.0088 -0.0268 0.0101  0.0009  0.0271  0.0046  -0.0240 -0.0169 -0.0007 0.0186  
'X-RAY DIFFRACTION' 40  ? refined 59.2702  18.6580  298.5109 0.1794  0.0959  0.3462 0.0354  0.0420  -0.0822 0.0960  0.1135  0.0781 
0.0890  -0.0577 -0.0904 0.0179  0.0303  -0.0064 -0.0239 0.0661  0.0062  0.0793  0.0538  0.1837  
'X-RAY DIFFRACTION' 41  ? refined 43.4537  28.7773  316.8221 0.2755  0.2263  0.4915 0.2102  0.0316  -0.0418 0.0606  0.0122  0.1261 
0.0141  0.0258  0.0326  0.0034  -0.0194 -0.0108 -0.0471 0.0181  -0.0005 -0.0191 -0.0583 0.1581  
'X-RAY DIFFRACTION' 42  ? refined 51.8958  24.8624  334.7510 0.3031  0.3502  0.3810 -0.1306 -0.0301 0.0877  0.0063  0.0465  0.0097 
0.0169  -0.0078 -0.0209 -0.0313 0.0153  -0.0141 -0.0173 0.0009  -0.0142 0.0289  -0.0172 -0.0403 
'X-RAY DIFFRACTION' 43  ? refined 51.5846  6.8367   335.3140 0.3320  0.1550  0.2754 0.2377  0.2455  0.1192  0.0068  0.0392  0.0083 
0.0002  -0.0005 -0.0179 0.0005  -0.0024 -0.0365 -0.0215 -0.0043 -0.0050 0.0114  0.0194  0.0951  
'X-RAY DIFFRACTION' 44  ? refined 8.5414   29.2526  285.5688 0.2630  0.1895  0.3008 -0.1379 -0.0649 -0.1007 0.0033  0.0103  0.0069 
0.0056  -0.0047 -0.0086 -0.0039 -0.0032 -0.0177 -0.0102 0.0006  0.0066  0.0028  -0.0204 0.0428  
'X-RAY DIFFRACTION' 45  ? refined 26.5902  12.5125  295.5438 0.1827  0.0864  0.3211 0.1568  0.0187  -0.0807 0.0045  0.0250  0.0489 
0.0014  -0.0152 0.0031  -0.0317 0.0107  0.0173  0.0271  -0.0084 -0.0178 0.0310  -0.0400 -0.1791 
'X-RAY DIFFRACTION' 46  ? refined 21.3284  13.6088  289.6950 0.0373  0.0190  0.2518 -0.0265 0.0454  -0.0236 0.0395  0.0264  0.0388 
-0.0324 -0.0054 0.0120  -0.0136 -0.0062 0.0569  -0.0219 -0.0212 -0.0599 -0.0144 0.0057  -0.0815 
'X-RAY DIFFRACTION' 47  ? refined 26.9555  25.9370  298.5543 -0.0076 -0.0823 0.3157 -0.1862 0.0302  -0.1411 0.0029  0.0353  0.0674 
-0.0134 -0.0106 0.0515  -0.0672 0.0783  -0.0579 -0.0294 -0.0571 0.1127  0.0143  -0.1288 -0.1974 
'X-RAY DIFFRACTION' 48  ? refined 20.9881  -13.1383 285.1670 0.1675  0.0379  0.2694 0.0694  -0.1392 -0.1024 0.0056  0.0048  
-0.0012 0.0021  -0.0004 0.0028  -0.0093 -0.0112 0.0106  0.0016  0.0012  -0.0052 0.0033  0.0060  -0.0835 
'X-RAY DIFFRACTION' 49  ? refined 14.5845  4.8656   306.8640 0.2759  0.2788  0.5199 -0.2072 -0.0714 -0.0710 0.0280  0.0835  0.1232 
-0.0454 0.0529  -0.0827 0.0213  0.0087  -0.0129 0.0149  -0.0220 -0.0046 -0.0278 0.0160  -0.2106 
'X-RAY DIFFRACTION' 50  ? refined 16.2733  19.0172  327.5512 0.1194  0.0349  0.2634 -0.0387 0.1511  -0.0591 0.0446  0.0413  0.0529 
0.0365  -0.0251 -0.0402 -0.0119 0.0044  -0.0356 -0.0100 0.0316  -0.0054 -0.0033 0.0049  0.1206  
'X-RAY DIFFRACTION' 51  ? refined 27.8550  25.5217  328.5786 0.1880  0.0532  0.2925 -0.1053 0.0475  0.0040  0.0744  0.0650  0.0876 
0.0444  -0.0044 0.0086  -0.0296 0.0583  -0.0535 -0.0925 0.0696  -0.0488 -0.0625 0.0542  0.2576  
'X-RAY DIFFRACTION' 52  ? refined 24.0650  24.4108  328.2519 0.2280  -0.0362 0.5011 0.0723  0.2274  -0.0036 0.0099  0.0310  0.1680 
0.0218  0.0411  0.0665  0.0315  0.0591  -0.0729 0.0030  0.0695  -0.0572 0.0526  0.0277  0.5667  
'X-RAY DIFFRACTION' 53  ? refined 19.8771  23.6968  314.0003 0.3252  -0.0659 0.5224 0.0260  0.0102  -0.0772 0.0341  0.0133  0.0088 
-0.0251 -0.0188 0.0131  -0.0790 0.0390  -0.0666 -0.0691 0.0021  0.0211  -0.0310 -0.0621 -0.3198 
'X-RAY DIFFRACTION' 54  ? refined 10.2582  19.3083  314.3947 0.1893  0.0485  0.4048 -0.0185 0.0117  -0.1645 0.0336  0.0013  0.2768 
0.0001  0.0806  0.0053  0.0030  0.0065  -0.0278 0.0871  -0.0603 -0.0150 0.1812  -0.0577 -0.1024 
'X-RAY DIFFRACTION' 55  ? refined 9.7718   9.7440   322.2983 0.1425  0.0472  0.1277 -0.0978 0.0428  -0.0542 0.1046  0.0123  0.0561 
0.0031  -0.0757 -0.0062 -0.0280 0.0396  -0.0026 -0.0213 -0.0059 0.0061  0.0460  -0.0325 -0.0815 
'X-RAY DIFFRACTION' 56  ? refined 9.9341   22.2259  357.3245 0.1213  0.0448  0.3534 -0.0046 0.1326  -0.0886 0.0502  0.0445  0.0456 
0.0313  -0.0339 -0.0131 -0.0306 0.0229  -0.0792 -0.0201 0.0169  -0.0317 0.0531  0.0153  0.1291  
'X-RAY DIFFRACTION' 57  ? refined 18.2822  21.5639  346.9697 0.2437  0.2827  0.6269 -0.0887 0.2430  -0.3972 0.0652  0.0226  0.0305 
0.0405  0.0013  0.0025  0.0284  0.0254  0.0060  0.0244  -0.0088 0.0020  -0.0015 0.0162  -0.0688 
'X-RAY DIFFRACTION' 58  ? refined 22.1852  21.5024  356.8219 0.3530  -0.0079 0.3897 0.0262  -0.0061 0.0389  0.0348  0.0053  0.0085 
-0.0068 -0.0164 0.0032  0.0207  0.0113  -0.0167 -0.0034 0.0041  -0.0001 0.0260  0.0385  0.0624  
'X-RAY DIFFRACTION' 59  ? refined 17.3561  18.3898  367.0832 0.1669  0.2063  0.2142 0.1144  0.1550  0.1652  0.0528  0.0250  0.0716 
-0.0232 -0.0223 -0.0124 0.0093  0.0143  0.0281  -0.0075 0.0195  -0.0070 0.0151  -0.0144 0.2073  
'X-RAY DIFFRACTION' 60  ? refined 15.3413  33.1384  368.0841 0.4465  0.6360  0.4404 0.1613  0.1994  0.2192  0.1308  0.0554  0.0340 
-0.0516 0.0668  -0.0237 -0.0092 0.1018  0.0618  0.0263  -0.1008 -0.0445 0.0610  0.0225  -0.1762 
'X-RAY DIFFRACTION' 61  ? refined 48.0892  52.1015  307.5283 0.9412  0.4488  1.0689 0.1328  0.0008  -0.0630 0.0082  0.0069  0.0040 
0.0003  -0.0030 -0.0021 -0.0080 0.0382  0.0064  -0.0340 -0.0178 -0.0362 -0.0627 -0.0223 0.0005  
'X-RAY DIFFRACTION' 62  ? refined 47.1550  48.0863  296.8393 0.1301  0.0110  0.3345 -0.0024 0.0610  0.0506  0.0151  0.0559  0.0015 
0.0290  -0.0037 -0.0097 0.0137  0.0719  0.0083  -0.1122 0.0025  -0.0816 -0.0659 0.0425  0.1470  
'X-RAY DIFFRACTION' 63  ? refined 31.9456  41.2202  308.0167 0.3937  0.1158  0.4987 -0.1631 -0.0376 -0.0871 0.0225  0.0162  0.0870 
0.0099  -0.0225 -0.0373 0.0032  -0.0186 -0.0002 -0.0015 -0.0110 -0.0054 -0.0060 0.0216  0.0593  
'X-RAY DIFFRACTION' 64  ? refined 45.9148  46.8510  302.6140 0.2338  0.2809  0.2289 0.1671  -0.0044 0.0595  0.0211  0.0097  0.0658 
0.0114  0.0389  0.0213  -0.0443 -0.0549 -0.0389 0.0324  0.0020  -0.0100 -0.0110 -0.0345 -0.0360 
'X-RAY DIFFRACTION' 65  ? refined 41.0638  43.4212  296.0476 0.2592  0.0143  0.4793 -0.0004 0.1390  -0.0109 0.0296  0.0667  0.0342 
0.0449  -0.0023 0.0006  -0.0582 -0.0128 -0.0609 0.1151  -0.0127 -0.0017 0.0694  0.0027  -0.1599 
'X-RAY DIFFRACTION' 66  ? refined 47.3385  43.1898  314.8734 0.1981  0.0903  0.3234 0.1577  0.0297  -0.0230 0.0000  0.0087  0.0038 
0.0005  -0.0001 0.0063  -0.0055 0.0078  0.0173  0.0047  -0.0074 0.0125  -0.0163 -0.0130 -0.0607 
'X-RAY DIFFRACTION' 67  ? refined 52.0523  35.3972  309.1639 0.5006  0.2576  0.4974 0.1508  -0.0155 -0.1619 0.0007  0.0504  0.0138 
0.0068  0.0036  0.0262  -0.0050 -0.0469 0.0072  0.0533  0.0277  0.0018  -0.0174 0.0033  0.0086  
'X-RAY DIFFRACTION' 68  ? refined 37.1240  37.2151  297.3286 0.3193  0.1197  0.4002 -0.2385 0.0359  -0.0127 0.0033  0.0282  0.0016 
0.0103  -0.0013 -0.0052 0.0123  -0.0106 -0.0143 0.0031  -0.0001 -0.0230 0.0094  -0.0029 -0.0096 
'X-RAY DIFFRACTION' 69  ? refined 29.1851  12.1802  261.0185 0.0451  0.1197  0.2786 -0.0065 -0.0630 -0.1159 0.0846  0.2274  0.1704 
0.0330  -0.0876 -0.1129 -0.0187 0.1227  -0.0318 -0.1826 -0.0775 0.1351  0.0359  -0.1534 -0.2506 
'X-RAY DIFFRACTION' 70  ? refined 39.9718  -12.9471 251.3405 0.6063  0.3783  0.3059 -0.1574 0.2320  -0.1399 0.0347  0.1190  0.0114 
-0.0601 -0.0127 0.0313  -0.0592 -0.0750 0.0240  0.0262  0.1078  -0.0534 0.0466  0.0374  0.0375  
'X-RAY DIFFRACTION' 71  ? refined 28.5346  23.6762  243.5030 0.7484  0.4375  0.3188 0.0687  0.1520  0.0499  0.0111  0.0053  0.0119 
0.0024  0.0053  -0.0084 0.0796  0.0730  0.0103  -0.0817 -0.0250 0.0740  -0.0653 -0.0075 0.0004  
'X-RAY DIFFRACTION' 72  ? refined 30.9903  11.2059  249.3045 0.3611  0.1812  0.3975 -0.1510 0.1511  -0.1964 0.0019  0.0667  0.0261 
0.0126  0.0077  0.0246  -0.0030 -0.0192 0.0153  -0.1056 -0.0408 0.1232  -0.0097 -0.0274 -0.1367 
'X-RAY DIFFRACTION' 73  ? refined 46.6910  26.2386  241.2880 0.3455  0.1831  0.2136 0.1404  0.0831  -0.0913 0.0279  0.0487  
-0.0002 -0.0217 -0.0002 0.0051  0.0066  0.0099  0.0421  0.0044  0.0416  -0.0769 0.0015  0.0079  0.0654  
'X-RAY DIFFRACTION' 74  ? refined 33.7598  -1.5835  238.1805 0.3801  0.1100  0.3559 -0.1796 0.1740  -0.1509 0.0787  0.2654  0.0388 
-0.1166 0.0217  -0.0856 0.0493  0.0384  -0.0520 -0.1895 0.0670  0.0647  0.0220  0.0201  0.5734  
'X-RAY DIFFRACTION' 75  ? refined 38.0457  20.6352  237.9904 0.3744  0.4135  0.1980 0.2295  -0.0661 -0.1067 0.0568  0.1911  0.0805 
0.0564  -0.0117 -0.1134 -0.0061 0.0417  -0.0072 0.1114  -0.0337 -0.0364 -0.0407 -0.0624 -0.0231 
'X-RAY DIFFRACTION' 76  ? refined 34.7727  11.0121  237.7398 0.0394  0.2392  0.2491 -0.0789 0.0230  0.0093  0.0159  0.0445  0.0575 
-0.0263 -0.0302 0.0516  -0.0417 -0.0024 -0.0069 -0.0290 0.0500  0.0724  0.0304  -0.0042 0.0060  
'X-RAY DIFFRACTION' 77  ? refined 41.1313  4.1084   244.3127 0.3359  0.0626  0.3544 -0.0609 0.1796  0.0842  0.0243  0.0167  0.0235 
0.0162  0.0162  0.0035  -0.0017 -0.0052 -0.0014 0.0184  0.0418  0.0874  -0.0465 -0.0285 -0.0107 
'X-RAY DIFFRACTION' 78  ? refined 56.6783  15.0898  256.9752 0.7267  0.9200  0.8393 0.0654  -0.0435 0.0331  0.0031  0.0132  0.0054 
-0.0025 0.0039  -0.0070 0.0315  0.0030  -0.0155 0.0001  0.0371  -0.0051 0.0170  -0.0042 -0.0001 
'X-RAY DIFFRACTION' 79  ? refined 63.0303  18.8333  245.7711 0.7764  0.7644  0.7361 -0.1095 -0.0591 -0.3801 0.0068  0.0026  0.0064 
-0.0033 0.0002  0.0035  -0.0357 -0.0068 -0.0462 -0.0387 0.0627  -0.0489 -0.0387 -0.0384 -0.0000 
'X-RAY DIFFRACTION' 80  ? refined 118.2952 2.5936   177.5922 0.4892  0.7789  0.6359 0.0577  0.0805  -0.2756 0.0207  0.0095  0.0086 
0.0092  0.0141  0.0088  -0.0211 -0.0299 -0.0166 -0.1030 0.0780  0.0938  -0.0288 -0.0786 0.0006  
'X-RAY DIFFRACTION' 81  ? refined 119.7949 25.4069  177.9738 0.2586  0.4336  0.1223 -0.2479 0.1119  -0.1008 0.3456  0.3072  0.2662 
-0.1228 -0.1143 0.1092  -0.0681 0.4093  -0.0325 -0.2214 0.0293  -0.1393 -0.1466 0.0059  -0.0568 
'X-RAY DIFFRACTION' 82  ? refined 142.1236 23.2648  180.2069 0.8740  0.9117  0.8739 -0.2313 0.0443  0.0056  0.0012  0.0044  0.0060 
0.0022  0.0059  -0.0040 -0.1195 0.2108  -0.1281 -0.0027 -0.1454 0.0001  -0.0060 -0.1305 -0.0001 
'X-RAY DIFFRACTION' 83  ? refined 124.1961 32.4654  158.6665 0.7212  1.2718  0.6623 -0.1490 0.2871  0.0841  0.0039  0.0074  0.0016 
0.0089  0.0048  0.0054  -0.0157 0.2298  0.0536  -0.0582 -0.0804 0.0080  -0.0065 -0.0519 -0.0006 
'X-RAY DIFFRACTION' 84  ? refined 125.9475 45.2535  188.9171 0.4524  0.1657  0.4445 -0.0984 0.0487  0.0833  0.0057  0.1574  0.2251 
-0.0311 -0.0396 0.1901  0.0068  -0.0123 0.0671  0.0009  -0.0769 0.0147  0.0189  0.0160  -0.2811 
'X-RAY DIFFRACTION' 85  ? refined 73.2696  24.1994  221.8652 0.2072  0.1145  0.1263 -0.1272 -0.0533 0.0255  0.0315  0.0279  0.1917 
0.0119  0.0232  0.0450  -0.0041 -0.0290 0.0371  -0.0281 0.0028  0.0052  0.0488  -0.1335 0.0897  
'X-RAY DIFFRACTION' 86  ? refined 89.0610  -9.0244  203.3482 0.4363  0.7981  0.3081 0.0201  0.1085  -0.2836 0.0385  0.0014  0.0790 
0.0089  -0.0430 -0.0129 0.0271  -0.0290 -0.0154 -0.0242 0.0160  -0.0598 -0.0238 0.1287  -0.2504 
'X-RAY DIFFRACTION' 87  ? refined 90.1144  11.4920  201.4615 0.4642  -0.0830 0.0864 -0.1539 0.1146  -0.2588 0.0538  0.2167  0.0997 
-0.0197 0.0229  0.1421  -0.0120 0.0434  -0.0590 -0.1049 -0.1351 -0.0045 -0.1007 0.0487  -0.6562 
'X-RAY DIFFRACTION' 88  ? refined 101.5034 2.6878   193.4892 0.3499  0.3189  0.2080 0.0502  0.2275  0.0441  0.0004  0.0279  0.1382 
-0.0029 0.0153  -0.0645 0.0650  -0.1205 0.0252  -0.0272 -0.0452 -0.0202 -0.0030 0.1939  -0.0417 
'X-RAY DIFFRACTION' 89  ? refined 54.0927  -10.6597 237.4899 0.3158  0.2841  0.4633 -0.1966 0.2363  -0.2958 0.0734  0.0505  0.0273 
0.0737  0.0574  0.0438  -0.0967 0.0980  -0.0830 0.0113  -0.0365 0.0931  0.1035  -0.0866 -0.8371 
'X-RAY DIFFRACTION' 90  ? refined 44.5583  8.9666   229.7042 0.5442  0.3682  0.3591 -0.1087 -0.1034 -0.3121 0.0704  0.0866  0.0776 
-0.0788 -0.0468 0.0628  0.0029  0.0595  -0.0632 -0.0163 -0.0798 0.0492  -0.0094 -0.1269 -0.0623 
'X-RAY DIFFRACTION' 91  ? refined 66.4295  3.3883   226.1499 0.1584  0.0239  0.0393 -0.1275 0.0845  -0.0022 0.0287  0.0098  0.0237 
0.0259  0.0071  0.0080  -0.0305 0.0231  0.0323  -0.0876 -0.0012 -0.0135 -0.0586 0.0106  -0.2252 
'X-RAY DIFFRACTION' 92  ? refined 77.7151  6.2229   226.6314 0.3030  0.0868  0.1999 -0.0410 0.0043  -0.1146 0.0434  0.0901  0.0392 
-0.0185 0.0156  -0.0604 -0.0047 -0.0281 0.0364  -0.0248 0.0423  -0.0610 -0.0233 0.0179  0.1588  
'X-RAY DIFFRACTION' 93  ? refined 69.4387  -12.9554 221.7862 0.2375  0.1265  0.1630 -0.0665 0.1613  -0.0403 0.0957  0.0334  0.0726 
-0.0556 0.0448  -0.0340 -0.0148 0.0791  0.0063  -0.0336 -0.0365 0.0225  0.0524  -0.0113 -0.0708 
'X-RAY DIFFRACTION' 94  ? refined 7.7995   7.8016   265.5403 0.1654  0.1887  0.2806 -0.1232 0.0773  -0.1607 0.4607  0.3282  0.0185 
0.2173  0.0831  0.0646  -0.0911 0.2002  0.0041  -0.1668 0.0924  0.0998  -0.0260 0.0337  0.0545  
'X-RAY DIFFRACTION' 95  ? refined 17.4639  15.7039  273.7335 0.1755  0.2622  0.3680 -0.0281 0.0345  -0.2797 0.1147  0.1617  0.0642 
0.0267  -0.0530 0.0367  -0.0303 0.0597  -0.0181 -0.1154 0.0064  -0.0512 0.0003  -0.0418 -0.2481 
'X-RAY DIFFRACTION' 96  ? refined 19.2725  8.1369   258.4430 0.1965  0.2809  0.3150 -0.1491 0.1018  -0.2588 0.0228  0.0066  0.0055 
0.0009  -0.0034 0.0069  -0.0254 0.0413  -0.0445 -0.0233 -0.0257 0.0382  0.0152  -0.0584 -0.1698 
'X-RAY DIFFRACTION' 97  ? refined 22.6711  -0.2474  265.1295 0.4274  0.2785  0.4551 -0.1243 0.1266  -0.3368 0.0112  0.1176  0.0365 
-0.0078 -0.0157 0.0476  -0.0358 0.0818  -0.0638 -0.1345 -0.0878 0.1327  0.0661  -0.1071 -0.1872 
'X-RAY DIFFRACTION' 98  ? refined 9.2389   -6.1482  269.3269 0.3064  0.3372  0.3370 -0.2177 0.0333  -0.1121 0.1302  0.0225  0.0346 
0.0529  0.0415  0.0166  -0.0426 0.0604  0.0446  -0.0721 0.0053  0.0313  0.0341  -0.1011 -0.0399 
'X-RAY DIFFRACTION' 99  ? refined 30.2275  -12.6746 261.0055 0.3147  0.2686  0.3113 -0.2332 0.1178  -0.1006 0.0210  0.0143  0.0157 
0.0145  0.0024  -0.0093 0.0143  0.0140  -0.0803 0.0101  0.0099  0.0310  0.0098  -0.0186 0.0340  
'X-RAY DIFFRACTION' 100 ? refined 22.6106  -25.4259 265.5816 0.1963  0.3299  0.4195 -0.1546 0.1431  -0.0218 0.0092  -0.0010 0.0080 
0.0015  -0.0017 0.0005  0.0177  -0.0056 0.0007  -0.0131 0.0389  -0.0007 -0.0132 -0.0070 0.0730  
'X-RAY DIFFRACTION' 101 ? refined 7.2743   104.9255 252.3937 0.8068  0.8087  0.5777 -0.1509 0.1424  0.1382  0.0121  0.0035  0.0211 
-0.0074 -0.0163 0.0086  -0.0123 0.0563  0.0059  -0.0004 -0.0576 -0.1040 -0.0551 -0.1429 -0.0003 
'X-RAY DIFFRACTION' 102 ? refined 23.9902  96.4307  261.1274 0.5328  0.5502  0.5771 -0.3022 -0.0811 0.1986  0.0366  0.0103  0.0104 
-0.0164 -0.0124 0.0094  0.0237  -0.0410 0.0494  -0.0628 0.0029  -0.0327 -0.0144 0.0177  0.0213  
'X-RAY DIFFRACTION' 103 ? refined 10.2971  96.8464  269.3245 0.8712  0.1934  0.7482 0.0998  0.0072  -0.0775 0.0753  0.0439  0.0495 
0.0032  -0.0465 -0.0251 0.0436  0.1987  -0.0456 -0.2261 0.0713  -0.0931 -0.0107 0.0191  -0.0007 
'X-RAY DIFFRACTION' 104 ? refined 6.9799   95.6786  268.4129 0.2874  0.4674  0.0489 -0.0098 0.0226  -0.0374 0.0870  0.0490  0.0856 
-0.0243 -0.0144 -0.0594 0.0771  -0.0798 0.0345  -0.0268 0.1100  -0.0176 -0.0341 0.0687  0.4190  
'X-RAY DIFFRACTION' 105 ? refined -2.7549  116.7463 276.5719 0.4308  0.0713  0.1195 -0.0834 -0.0689 0.1024  0.0541  0.1635  0.1850 
-0.0337 0.0421  0.0253  -0.0242 0.0067  -0.0005 0.0545  -0.1367 -0.0565 0.0882  -0.0138 -0.3808 
'X-RAY DIFFRACTION' 106 ? refined -10.8312 117.3742 294.9253 0.8262  1.0743  0.4055 -0.3373 0.1967  0.0810  0.0049  0.0086  0.0011 
-0.0065 0.0009  0.0004  0.0256  0.0043  0.0256  0.0369  0.0474  0.0274  -0.1068 -0.0402 -0.0005 
'X-RAY DIFFRACTION' 107 ? refined -9.5919  118.4744 285.4799 0.4750  0.1168  0.4123 0.0762  0.0184  0.1584  0.0474  0.0556  0.0497 
-0.0060 -0.0055 0.0560  -0.0630 0.0231  -0.0732 0.0258  -0.0564 -0.0441 0.0667  0.0451  -0.2335 
'X-RAY DIFFRACTION' 108 ? refined -3.6643  73.0566  272.1529 0.6927  0.9385  0.3335 0.4075  -0.0099 0.0982  0.0328  0.0499  0.0140 
-0.0408 0.0226  -0.0265 0.0008  0.0981  -0.0171 -0.1642 -0.1128 0.0128  -0.0614 -0.0665 -0.0360 
'X-RAY DIFFRACTION' 109 ? refined -9.5227  81.1042  275.0567 0.4923  0.3193  0.2435 0.1890  0.0786  -0.1292 -0.0002 0.0626  
-0.0000 -0.0005 -0.0004 0.0023  0.0287  0.0082  0.0346  -0.0176 -0.0302 0.0478  -0.0145 -0.0347 -0.0022 
'X-RAY DIFFRACTION' 110 ? refined -14.3957 75.8657  281.4336 0.2768  0.1296  0.2752 -0.0208 -0.0192 0.1215  0.0348  0.1808  0.0694 
0.0540  -0.0418 -0.0205 -0.0406 0.0116  0.0016  0.0042  0.0269  0.0439  0.0853  -0.0262 -0.1098 
'X-RAY DIFFRACTION' 111 ? refined -7.7616  81.7969  287.4192 0.0883  0.0302  0.1983 -0.0520 0.0975  -0.0703 0.0906  0.0294  0.0003 
0.0274  0.0013  -0.0048 -0.0100 0.0161  -0.0601 0.0064  0.0093  0.0024  0.0231  0.0010  0.1034  
'X-RAY DIFFRACTION' 112 ? refined -17.6808 88.6995  277.5816 0.2819  0.1231  0.2497 0.0454  -0.0991 0.0338  0.0346  0.0247  0.3155 
0.0006  -0.0205 0.0868  0.0678  0.0126  0.0238  -0.0149 0.0492  -0.0143 -0.0381 0.0075  0.0375  
'X-RAY DIFFRACTION' 113 ? refined -17.6716 104.5560 272.6282 0.6634  0.1841  0.4506 -0.1860 0.0864  -0.0524 0.0020  0.0496  0.0024 
0.0114  0.0016  0.0084  -0.0445 -0.0021 -0.0252 0.0247  -0.0263 -0.0117 -0.0299 0.0101  -0.0344 
'X-RAY DIFFRACTION' 114 ? refined -27.7602 106.6279 274.2758 0.2093  0.0989  0.3508 0.0312  0.0618  0.1943  0.0024  0.0116  0.0051 
0.0023  0.0026  0.0032  -0.0011 -0.0037 0.0122  0.0083  0.0162  0.0141  -0.0120 0.0001  0.0730  
'X-RAY DIFFRACTION' 115 ? refined -31.0059 93.4777  276.3165 0.7813  0.6377  0.6088 -0.1778 -0.1469 0.1192  0.0140  0.0048  0.0034 
0.0044  0.0049  -0.0012 0.0114  -0.0697 0.0346  -0.0047 0.0309  -0.0356 -0.0259 0.0071  0.0003  
'X-RAY DIFFRACTION' 116 ? refined -16.4317 100.7098 268.5912 0.5225  0.3229  0.3363 0.1014  0.0808  -0.2212 -0.0001 0.0360  0.0152 
0.0029  -0.0020 -0.0233 0.0318  0.0016  0.0394  0.0108  0.0007  -0.0151 -0.0159 0.0032  0.0784  
'X-RAY DIFFRACTION' 117 ? refined -28.5078 101.6359 262.7239 0.3487  0.4933  0.3944 0.0287  -0.2567 -0.0049 0.0054  0.0043  0.0016 
0.0002  -0.0025 -0.0021 -0.0035 -0.0067 -0.0038 0.0038  -0.0029 -0.0003 -0.0036 -0.0109 -0.0180 
'X-RAY DIFFRACTION' 118 ? refined -18.1655 102.8450 256.4873 0.5959  0.3050  0.4451 0.0050  -0.3038 0.0565  0.0997  0.0541  0.2141 
-0.0537 -0.1354 0.0998  0.0222  0.0275  -0.0741 0.0124  0.0346  0.0220  -0.0249 0.1593  0.1020  
'X-RAY DIFFRACTION' 119 ? refined 9.6128   101.1711 305.7836 0.3417  0.0291  0.2951 -0.0465 -0.1419 -0.0755 0.0804  0.0844  0.1485 
0.0646  0.0405  -0.0304 -0.1395 0.0814  0.0552  -0.0137 -0.0477 0.0879  -0.1701 0.0300  -0.5835 
'X-RAY DIFFRACTION' 120 ? refined -7.9961  98.2258  306.2823 0.4882  -0.0202 0.2067 -0.0307 -0.1328 -0.0154 0.1450  0.1516  0.0229 
-0.0031 0.0040  0.0528  0.0981  -0.0502 -0.0336 -0.0114 -0.0254 0.0473  0.0419  -0.0336 0.2790  
'X-RAY DIFFRACTION' 121 ? refined -5.7540  78.8089  312.9200 -0.0129 -0.1153 0.1482 -0.0059 -0.1011 -0.0997 -0.0149 0.0302  0.0351 
-0.0086 -0.0019 -0.0072 0.0155  -0.0270 -0.0409 -0.0036 0.0764  -0.0236 0.0185  0.0697  0.3376  
'X-RAY DIFFRACTION' 122 ? refined -6.4249  49.5921  338.3711 0.3174  0.1816  0.4612 -0.2385 -0.0038 -0.0859 0.0177  0.1121  0.0372 
-0.0203 -0.0158 -0.0336 -0.0405 0.0467  -0.0395 -0.0159 0.0418  0.0444  0.0279  -0.0179 -0.0953 
'X-RAY DIFFRACTION' 123 ? refined 12.8509  61.7447  305.4340 -0.0346 -0.2344 0.0432 -0.1435 -0.1768 -0.2118 0.0646  0.0285  0.1075 
0.0414  0.0589  0.0441  -0.0571 0.0169  0.1505  0.0075  -0.0607 0.0472  -0.0814 -0.0272 -0.5464 
'X-RAY DIFFRACTION' 124 ? refined -3.1792  47.2227  327.0979 0.0349  0.2290  0.2866 -0.0789 0.0935  -0.1574 0.1565  0.1147  0.0976 
-0.0627 0.0190  -0.0978 0.0788  -0.0648 0.0203  -0.0023 0.0548  0.0143  -0.0040 0.0133  0.6063  
'X-RAY DIFFRACTION' 125 ? refined 2.9206   62.2053  333.3496 0.2926  0.2207  0.1682 0.2276  -0.0519 -0.1909 0.0792  0.0096  0.0750 
-0.0286 -0.0495 -0.0007 0.0902  -0.0520 0.0443  -0.0657 -0.0111 -0.0023 -0.1045 -0.0547 0.6485  
'X-RAY DIFFRACTION' 126 ? refined 1.4096   57.3129  312.5790 0.1350  0.1209  0.2647 0.0396  -0.1964 -0.0635 0.0261  0.0075  0.1475 
0.0059  0.0475  0.0282  -0.0413 -0.0252 0.0322  -0.0616 -0.1019 0.1054  -0.0656 -0.1411 -0.3912 
'X-RAY DIFFRACTION' 127 ? refined -11.2826 50.1432  302.1781 0.4427  0.0661  0.5283 -0.1643 -0.0121 -0.0400 0.0959  0.1024  0.0548 
-0.0362 -0.0100 -0.0684 0.0307  -0.1200 0.0030  -0.0189 0.0148  -0.0438 -0.1404 0.0488  0.2738  
'X-RAY DIFFRACTION' 128 ? refined -2.0039  106.6824 372.6445 0.4804  0.4120  0.3660 0.1410  0.1643  -0.1935 0.0673  0.0339  0.0207 
-0.0483 -0.0377 0.0270  0.0017  0.0382  0.0103  -0.0314 -0.0129 -0.0065 -0.0134 -0.0212 -0.0002 
'X-RAY DIFFRACTION' 129 ? refined -5.4946  113.2922 345.0672 0.4866  0.0639  0.5218 -0.1218 -0.0661 -0.2100 0.0999  -0.0023 0.0301 
0.0085  0.0448  0.0043  -0.0805 -0.0216 0.1015  -0.1103 -0.0146 0.0686  -0.0347 -0.0200 -0.6011 
'X-RAY DIFFRACTION' 130 ? refined -19.9125 121.9423 348.4289 0.3085  0.0374  0.2896 0.0597  -0.0468 -0.0473 0.0385  0.0633  0.2387 
-0.0257 -0.0018 0.0976  0.0691  0.0235  0.0217  0.0222  0.0889  0.0835  0.0701  0.0048  0.1990  
'X-RAY DIFFRACTION' 131 ? refined -0.1257  126.7815 369.3587 0.4829  0.1693  0.2880 -0.1659 -0.1845 0.0332  0.0175  0.0854  0.0515 
0.0102  0.0060  0.0697  0.0032  -0.0370 0.0438  0.0837  -0.0444 0.0158  -0.0419 -0.0213 -0.0078 
'X-RAY DIFFRACTION' 132 ? refined -2.7660  118.7987 344.6398 0.5528  -0.0799 0.5050 -0.0915 -0.0518 -0.0638 0.0643  0.1921  0.1704 
-0.0049 0.0294  -0.1805 0.0676  0.0198  0.2070  -0.1417 -0.0187 -0.0158 -0.0231 -0.0997 0.2140  
'X-RAY DIFFRACTION' 133 ? refined 26.3928  126.2481 340.9998 0.7267  0.3154  0.6190 -0.1229 0.0412  -0.1538 0.0226  0.0492  0.0110 
-0.0317 -0.0158 0.0225  0.0553  -0.0025 -0.0132 0.0231  0.0017  0.0094  -0.0516 0.0065  0.0209  
'X-RAY DIFFRACTION' 134 ? refined 20.7519  115.6055 337.2126 1.0029  0.8606  0.8675 -0.1536 -0.0511 -0.0592 0.0019  0.0096  0.0012 
0.0006  0.0006  -0.0042 -0.0118 -0.0695 -0.0709 -0.0464 -0.0265 -0.0568 -0.0023 0.0600  -0.0010 
'X-RAY DIFFRACTION' 135 ? refined 18.6170  114.6151 346.0621 0.2800  0.2599  0.1717 -0.2355 -0.0285 0.0297  0.0280  0.0309  0.0374 
0.0281  0.0326  0.0330  0.0592  -0.0772 -0.0166 -0.0007 0.0237  -0.0548 0.0137  -0.0358 0.2284  
'X-RAY DIFFRACTION' 136 ? refined 17.6582  107.2268 350.9745 0.2441  0.2748  0.5012 -0.1116 0.0827  0.0722  0.1563  0.0370  0.0037 
-0.0284 -0.0082 -0.0114 -0.0094 0.1108  -0.0952 -0.1328 0.1536  -0.0724 -0.1123 0.0953  0.0674  
'X-RAY DIFFRACTION' 137 ? refined 2.3881   93.2684  345.6717 0.1725  0.1514  0.2942 -0.0101 -0.1645 -0.0650 0.2021  0.0325  0.3725 
0.0154  0.1227  0.1038  0.0217  0.0709  -0.0725 -0.0015 0.0001  -0.0309 -0.0833 0.1820  0.1109  
'X-RAY DIFFRACTION' 138 ? refined 5.6948   103.4305 320.4870 0.4909  0.5876  0.6860 -0.1752 -0.1499 0.1320  0.0057  0.0021  0.0095 
0.0028  0.0103  0.0022  0.0063  0.0700  -0.0101 0.0150  -0.0686 -0.0284 -0.0081 -0.0658 -0.0003 
'X-RAY DIFFRACTION' 139 ? refined -38.6026 89.4674  369.9128 0.2276  0.1240  0.4038 0.0423  -0.0615 -0.2336 0.0119  0.0009  0.0141 
-0.0029 -0.0069 0.0022  -0.0461 0.0182  0.0003  -0.0174 -0.0241 0.0416  0.0032  -0.0552 -0.1462 
'X-RAY DIFFRACTION' 140 ? refined -20.3322 105.8075 360.1423 0.1592  0.1474  0.2202 0.0836  -0.1519 -0.0913 0.0798  0.0554  0.0872 
-0.0356 0.0654  -0.0648 -0.0224 0.0078  0.0350  0.0203  -0.0209 -0.0333 -0.0282 -0.0096 -0.1206 
'X-RAY DIFFRACTION' 141 ? refined -20.3172 102.2753 363.2560 0.2933  0.0221  0.4871 -0.0377 0.0307  -0.0983 0.0317  0.0361  0.0420 
0.0372  0.0185  0.0193  -0.0049 0.0393  -0.0162 -0.0452 0.0128  -0.0278 -0.0666 0.0002  0.0157  
'X-RAY DIFFRACTION' 142 ? refined -18.6773 94.7539  356.4653 0.1733  0.2048  0.1328 0.1464  -0.0744 -0.0243 0.0918  0.1391  0.1301 
-0.0971 0.0280  0.0293  -0.0987 -0.0135 0.0161  0.0292  -0.0358 0.0731  -0.1084 -0.0862 -0.2196 
'X-RAY DIFFRACTION' 143 ? refined -34.2692 85.7266  352.6206 0.0582  0.1084  0.1817 -0.0967 -0.0221 -0.0191 0.0092  0.0131  0.0053 
-0.0050 -0.0039 -0.0037 0.0035  -0.0111 0.0002  0.0014  0.0135  -0.0025 -0.0135 0.0024  0.0001  
'X-RAY DIFFRACTION' 144 ? refined -24.2634 83.0533  363.2413 0.4390  0.2352  0.1632 -0.0931 -0.0231 -0.0589 0.0302  0.0286  0.0346 
0.0158  -0.0023 0.0260  0.0160  0.0426  -0.0427 -0.0033 -0.0285 -0.0261 -0.0623 -0.0389 -0.0136 
'X-RAY DIFFRACTION' 145 ? refined -25.2420 131.6870 370.6712 0.9340  0.2678  0.6412 -0.0509 0.1586  -0.1038 0.0262  0.0014  0.0311 
0.0046  0.0049  0.0060  0.0673  0.0462  0.0091  0.0316  -0.0489 0.0096  -0.0633 -0.1118 0.0020  
'X-RAY DIFFRACTION' 146 ? refined -36.3777 114.4612 355.5652 0.8107  1.0286  0.8741 -0.0277 0.0594  0.0187  0.0048  0.0178  0.0025 
0.0040  -0.0019 0.0051  -0.0074 -0.0177 0.0346  -0.0024 -0.0118 0.0040  0.0244  -0.0060 -0.0002 
'X-RAY DIFFRACTION' 147 ? refined -29.2047 105.3396 333.2663 0.2968  0.3698  0.4447 0.0465  -0.0549 0.1351  0.0060  0.0050  0.0133 
0.0070  -0.0015 -0.0006 -0.0116 0.0602  -0.1071 -0.0218 0.0752  0.0656  0.0003  -0.0397 -0.0000 
'X-RAY DIFFRACTION' 148 ? refined -18.9782 93.3634  326.9100 0.3940  0.1429  0.1290 -0.1726 -0.1055 0.0834  0.0141  0.0503  0.0019 
0.0210  -0.0018 0.0043  -0.0009 0.0114  0.0069  0.0082  0.0272  0.0308  -0.0390 -0.0155 0.0586  
'X-RAY DIFFRACTION' 149 ? refined -22.8243 94.5970  327.1326 0.3262  0.3621  0.4297 -0.2060 -0.1882 -0.1382 0.1610  0.1606  0.1659 
-0.0465 0.1657  -0.0543 0.0367  -0.1684 0.0183  0.0421  -0.0029 -0.0931 -0.1369 0.0667  0.1968  
'X-RAY DIFFRACTION' 150 ? refined -27.8819 98.9285  343.0113 0.3113  0.3674  0.5287 0.1003  -0.2000 -0.0398 0.0058  0.0162  0.0890 
-0.0024 -0.0095 -0.0261 0.0311  -0.1044 -0.0497 -0.0272 0.0284  -0.0028 -0.0892 -0.0518 0.0052  
'X-RAY DIFFRACTION' 151 ? refined -33.9791 97.0033  340.4973 0.4394  0.1288  0.4314 -0.1688 -0.1461 0.0078  0.0576  0.0099  0.0269 
0.0254  -0.0415 -0.0153 0.0743  -0.0240 0.0088  -0.0015 0.0594  -0.0048 0.0610  -0.0139 0.2458  
'X-RAY DIFFRACTION' 152 ? refined -37.3709 109.5061 334.2455 0.9898  1.2838  1.1009 0.0180  -0.0610 0.0188  0.0023  0.0022  0.0017 
-0.0007 0.0002  -0.0016 0.0014  -0.0087 0.0159  0.0129  -0.0074 -0.0040 -0.0398 0.0162  -0.0002 
'X-RAY DIFFRACTION' 153 ? refined -36.3881 97.9231  298.6258 0.8436  1.0680  0.6795 0.1571  -0.3617 -0.0195 0.0106  0.0006  0.0074 
-0.0030 0.0112  -0.0014 -0.0199 0.0903  0.0207  -0.0091 -0.0190 0.0419  0.0110  -0.0590 0.0003  
'X-RAY DIFFRACTION' 154 ? refined -28.3547 97.9620  308.7788 0.4387  0.0564  0.4982 0.0507  -0.0690 -0.1114 0.0163  0.0118  0.1250 
0.0046  0.0216  -0.0189 -0.0954 -0.0607 0.0578  0.0351  0.0291  -0.0291 0.0018  -0.0417 0.0002  
'X-RAY DIFFRACTION' 155 ? refined -24.7055 97.7368  298.5868 0.4580  0.3171  0.5590 0.2058  -0.2751 -0.1717 0.1178  0.0250  0.0789 
-0.0412 -0.0486 0.0072  0.0444  -0.0176 -0.0283 -0.0027 0.0744  0.0200  0.0924  -0.0033 0.0638  
'X-RAY DIFFRACTION' 156 ? refined -29.2222 101.0578 288.6327 0.2693  0.1433  0.2178 0.1632  -0.1320 -0.0601 0.0487  0.0735  0.0362 
-0.0183 -0.0168 -0.0113 0.0112  -0.0054 -0.0172 0.0413  0.0216  -0.0429 0.0470  0.0468  0.0190  
'X-RAY DIFFRACTION' 157 ? refined -31.2129 86.4705  287.7627 0.7392  0.6004  0.4494 -0.1517 -0.2827 -0.0785 0.0933  0.0886  0.1122 
0.0403  -0.0782 -0.0921 0.0019  0.0066  0.0484  0.0179  -0.1224 0.0555  -0.0858 0.0407  -0.0414 
'X-RAY DIFFRACTION' 158 ? refined 0.8233   65.7373  348.5578 0.4507  0.2753  0.6848 0.1406  0.2132  -0.0559 0.0788  0.0956  0.0867 
-0.0289 -0.0129 0.0573  0.0148  0.0120  -0.0615 0.0447  0.0257  0.0422  -0.0042 -0.0244 0.0329  
'X-RAY DIFFRACTION' 159 ? refined -2.1839  62.2056  357.2764 0.7034  0.3409  0.7151 0.2109  0.0243  0.1954  0.0388  0.0028  0.1608 
-0.0105 -0.0788 0.0207  -0.0251 -0.0786 -0.0284 -0.0088 0.0176  0.0034  0.0210  0.0613  0.0136  
'X-RAY DIFFRACTION' 160 ? refined 6.0907   74.1193  365.2510 2.0183  1.9655  1.9664 0.0958  -0.1259 -0.0385 0.0007  0.0679  0.0024 
-0.0031 -0.0005 -0.0082 0.0161  -0.0063 0.0147  0.0022  0.0033  0.0021  0.0023  -0.0026 -0.0001 
'X-RAY DIFFRACTION' 161 ? refined -10.8321 77.7590  349.2718 0.6089  0.2951  0.4237 -0.0149 -0.1103 -0.1744 0.0783  0.0667  0.1133 
0.0035  0.0368  -0.0801 -0.0680 0.0888  -0.0104 0.0183  -0.1049 0.0004  -0.0740 -0.1542 -0.0175 
'X-RAY DIFFRACTION' 162 ? refined 5.3058   74.6118  355.0629 0.2048  0.2267  0.1026 0.0304  -0.0880 0.0666  0.0657  0.0380  0.0503 
0.0092  0.0506  0.0081  -0.0056 -0.0202 -0.0081 0.0250  -0.0163 -0.0360 0.0092  0.0394  -0.0574 
'X-RAY DIFFRACTION' 163 ? refined -9.4612  68.4071  356.6746 0.1790  0.2513  0.3515 -0.0361 -0.0874 -0.1759 0.0118  0.0865  0.0191 
0.0287  0.0022  0.0167  0.0353  0.0314  -0.0504 0.0428  -0.0272 -0.0091 0.0044  0.0203  -0.0226 
'X-RAY DIFFRACTION' 164 ? refined -2.4364  80.3821  359.7045 0.2916  0.0867  0.3330 -0.0671 -0.0526 -0.1390 0.0036  0.0162  0.0123 
-0.0106 -0.0073 0.0149  0.0113  0.0102  -0.0159 -0.0194 -0.0298 -0.0148 0.0214  -0.0277 -0.0408 
'X-RAY DIFFRACTION' 165 ? refined -0.8602  75.2385  340.6531 0.3484  0.0278  0.3260 0.0515  0.0098  -0.0822 0.1774  0.0322  0.0380 
-0.0101 0.0245  -0.0352 0.0077  -0.0057 0.0178  0.0053  -0.0349 -0.0029 -0.0030 -0.0190 -0.1283 
'X-RAY DIFFRACTION' 166 ? refined -1.5999  81.5861  351.6318 0.3017  0.0644  0.2553 -0.0357 0.0266  0.1324  0.0908  0.1247  0.0840 
-0.1061 0.0810  -0.0939 -0.0362 -0.0270 -0.0407 0.0093  0.0605  0.0288  -0.0392 -0.0590 0.1620  
'X-RAY DIFFRACTION' 167 ? refined -20.6201 96.7523  389.0677 0.0546  0.1584  0.2281 0.0449  0.0143  -0.1277 0.0684  0.0904  0.0899 
-0.0704 0.0399  0.0079  0.0284  -0.0158 -0.1248 -0.0217 0.0347  -0.0687 -0.0217 -0.0514 0.2100  
'X-RAY DIFFRACTION' 168 ? refined -11.4646 119.9904 403.6532 0.3153  0.1370  0.1883 0.1915  -0.0217 -0.0189 0.0099  0.0072  0.0121 
-0.0098 0.0107  -0.0107 -0.0162 0.0201  -0.0002 0.0094  -0.0275 -0.0283 -0.0101 0.0059  -0.0894 
'X-RAY DIFFRACTION' 169 ? refined -10.8838 131.8768 408.5120 0.4657  0.3514  0.5214 0.1218  -0.2893 -0.1529 0.0605  0.0163  0.1122 
0.0050  0.0350  -0.0377 -0.0071 0.0261  -0.0056 0.0116  0.0465  -0.0270 -0.0028 -0.0195 0.1543  
'X-RAY DIFFRACTION' 170 ? refined 2.6824   123.3953 392.6375 1.3055  1.2092  1.2395 -0.0079 0.1119  -0.1436 0.0145  0.0043  0.0261 
-0.0006 0.0030  0.0103  -0.0036 -0.0110 0.0112  0.0041  0.0158  0.0040  0.0149  -0.0131 0.0005  
'X-RAY DIFFRACTION' 171 ? refined -18.2588 93.4279  412.5574 0.6032  0.6458  0.2732 0.0438  0.1207  0.0851  0.0030  0.0026  0.0146 
-0.0008 0.0058  -0.0008 0.0311  0.0616  0.0246  -0.0836 -0.0635 0.0275  0.0607  0.1065  -0.0012 
'X-RAY DIFFRACTION' 172 ? refined -19.2994 106.1416 409.4083 0.4691  0.0360  0.4581 0.0252  -0.2878 -0.0652 0.2539  0.2005  0.3370 
-0.1357 -0.2895 0.1579  -0.1061 0.0015  0.0431  0.0056  -0.0166 0.1065  0.0157  -0.0565 -0.3212 
'X-RAY DIFFRACTION' 173 ? refined -6.5085  106.0261 397.9248 0.2279  0.2191  0.2081 -0.0990 -0.0853 -0.1109 0.0125  0.0036  0.0126 
0.0071  -0.0127 -0.0069 0.0141  -0.0232 0.0108  0.0049  -0.0128 -0.0105 -0.0153 0.0045  -0.0425 
'X-RAY DIFFRACTION' 174 ? refined 4.0761   91.2205  401.1754 1.2317  0.9171  1.0890 0.2517  -0.0467 0.0533  0.0040  0.0090  0.0084 
-0.0045 0.0045  0.0015  -0.0276 0.0142  -0.0096 -0.0246 0.0127  0.0000  0.0108  0.0319  -0.0002 
'X-RAY DIFFRACTION' 175 ? refined -3.4353  90.6352  423.5660 0.3195  0.2958  0.0594 0.0272  -0.0612 -0.0266 0.0032  0.0454  0.0246 
-0.0006 0.0025  -0.0326 -0.0041 0.0078  0.0042  0.0247  0.0481  0.0004  -0.0475 -0.0213 0.0840  
'X-RAY DIFFRACTION' 176 ? refined -25.8353 107.3429 429.0053 0.5745  0.6280  0.4161 0.3716  -0.0751 -0.1691 0.0485  0.0437  0.0063 
-0.0356 -0.0130 -0.0003 -0.1082 -0.0396 -0.0101 0.0135  -0.0767 0.0344  0.0150  -0.0431 -0.0376 
'X-RAY DIFFRACTION' 177 ? refined -7.9302  123.5897 413.4979 0.4960  0.2319  0.4553 0.1845  -0.1641 0.0354  0.0265  0.0650  0.0342 
0.0237  0.0212  -0.0104 0.0748  0.0868  0.0162  0.0481  0.0458  0.0669  0.0679  0.0517  0.0593  
'X-RAY DIFFRACTION' 178 ? refined -8.7541  96.5063  418.0085 0.8756  0.6006  0.2801 -0.0146 -0.0016 -0.1463 0.0041  0.0036  0.0070 
0.0048  -0.0070 -0.0056 -0.0390 -0.0337 0.0769  0.0055  -0.0032 0.0395  0.0180  -0.0144 0.0002  
'X-RAY DIFFRACTION' 179 ? refined -10.1504 109.5751 415.7772 0.2301  0.1379  0.2521 0.0919  -0.2090 -0.1376 0.0144  0.0168  0.0302 
-0.0030 -0.0025 0.0182  0.0119  0.0063  -0.0013 0.0302  0.0307  -0.0013 -0.0212 0.0176  0.3280  
'X-RAY DIFFRACTION' 180 ? refined 10.4158  104.1655 399.3669 0.8658  1.0296  0.7791 0.2604  -0.2359 -0.0385 0.0039  0.0033  0.0002 
-0.0012 -0.0002 0.0009  -0.0031 -0.0144 -0.0156 -0.0035 0.0172  -0.0099 -0.0242 0.0212  0.0001  
'X-RAY DIFFRACTION' 181 ? refined 16.5195  99.2417  409.4118 0.7070  0.8106  0.8189 0.2065  -0.0704 0.0252  0.0046  0.0010  0.0007 
0.0018  -0.0006 -0.0006 0.0257  -0.0038 0.0238  0.0132  0.0342  -0.0155 -0.0074 -0.0125 -0.0001 
'X-RAY DIFFRACTION' 182 ? refined 71.4797  114.7334 477.9680 0.5337  0.3827  0.5417 0.1131  -0.2289 0.1836  0.0398  0.0226  0.0011 
0.0001  -0.0111 0.0057  -0.1262 -0.1384 -0.0359 -0.0274 0.0150  -0.0008 0.0838  0.0661  -0.0801 
'X-RAY DIFFRACTION' 183 ? refined 66.9375  95.8927  475.7388 0.3278  0.3869  0.1968 0.1797  -0.1043 -0.0853 0.2238  0.3980  0.3721 
-0.1441 0.2004  -0.2310 -0.0413 0.1324  0.0796  -0.1215 -0.1751 0.0669  0.0231  0.1436  -0.3741 
'X-RAY DIFFRACTION' 184 ? refined 82.8164  85.2768  481.0057 1.0407  1.2817  0.7101 0.4662  -0.1759 0.2637  0.0457  0.2258  0.1669 
-0.0994 -0.0844 0.1928  0.1977  0.1273  0.0264  -0.0847 0.0183  -0.1152 0.0926  0.0844  0.0667  
'X-RAY DIFFRACTION' 185 ? refined 96.4816  94.7006  473.8338 0.8285  0.4518  0.7021 0.1171  0.1156  0.0483  0.0003  0.0006  0.0014 
0.0018  -0.0041 -0.0012 0.0043  0.1274  -0.0021 -0.0443 0.0112  -0.0482 0.0051  0.0910  0.0004  
'X-RAY DIFFRACTION' 186 ? refined 72.2290  91.2929  500.3368 1.4669  1.6980  1.0856 0.0087  -0.1650 0.2316  0.0016  -0.0007 0.0116 
0.0006  0.0049  0.0009  -0.0219 0.0147  0.0004  0.0480  -0.0382 0.0509  -0.0116 0.0047  -0.0001 
'X-RAY DIFFRACTION' 187 ? refined 81.7004  73.1691  475.6316 1.3462  1.4449  1.0759 0.2955  0.0586  0.0919  0.0068  0.0033  0.0001 
-0.0092 -0.0017 0.0035  -0.0089 -0.0181 -0.0569 -0.0202 0.0005  -0.0959 -0.0478 -0.0015 -0.0001 
'X-RAY DIFFRACTION' 188 ? refined 26.3731  93.2380  433.8545 0.2891  0.1973  0.2734 0.1476  -0.1107 0.0679  0.0690  0.1050  0.0377 
-0.0763 0.0120  0.0129  0.0013  0.0043  -0.0097 -0.0934 -0.0435 0.0617  -0.0584 -0.0499 -0.2142 
'X-RAY DIFFRACTION' 189 ? refined 42.7166  127.1454 453.2161 0.4335  0.0560  0.6434 -0.0478 -0.1921 -0.1054 0.0172  0.0057  0.0048 
-0.0020 -0.0079 -0.0010 0.0262  -0.0477 0.0693  0.0455  -0.0183 0.0633  -0.0427 -0.0266 -0.0377 
'X-RAY DIFFRACTION' 190 ? refined 36.3079  107.6291 452.3305 0.3190  0.1545  0.2545 -0.0456 -0.0671 -0.1554 0.2878  0.0161  0.3016 
0.0532  0.0009  -0.0502 -0.0548 -0.0836 0.2421  0.0039  -0.0007 0.1450  -0.0536 0.0876  -0.3579 
'X-RAY DIFFRACTION' 191 ? refined 56.3462  104.4103 458.0148 0.5978  0.5768  0.4477 0.4056  -0.1270 0.1622  0.0068  0.0075  0.0111 
-0.0038 0.0046  0.0051  -0.1077 0.0595  0.1200  -0.0051 -0.0586 -0.0414 0.0185  0.0970  -0.4543 
'X-RAY DIFFRACTION' 192 ? refined 54.4288  114.5196 462.4327 0.7811  0.9762  0.8341 0.3623  -0.0880 -0.2571 0.0381  0.0309  0.0384 
-0.0153 0.0366  -0.0116 -0.1507 0.0792  0.0540  0.1437  -0.1440 0.0960  0.1199  0.0869  -0.0103 
'X-RAY DIFFRACTION' 193 ? refined 8.1218   136.2094 414.5637 0.5058  0.0422  0.5596 -0.0149 -0.0595 -0.0449 0.0393  0.0152  0.0274 
0.0208  0.0005  -0.0086 0.0172  -0.0021 0.0632  0.0551  -0.0623 0.0383  -0.0203 0.0119  -0.0772 
'X-RAY DIFFRACTION' 194 ? refined 6.1343   130.4130 428.8767 0.6719  0.4629  0.5591 0.0677  -0.0800 -0.1422 -0.0009 0.0080  0.0033 
0.0004  -0.0026 0.0065  0.0910  -0.0443 -0.0288 0.0581  0.1472  0.0198  -0.0501 -0.0151 0.0020  
'X-RAY DIFFRACTION' 195 ? refined 6.8665   121.5443 415.6436 0.3667  0.1381  0.2435 0.0202  -0.0370 -0.1371 0.1538  0.0954  0.1288 
-0.0548 -0.0117 -0.0952 -0.0853 0.0120  0.0080  -0.0183 0.1373  -0.0017 -0.0576 0.0761  0.0942  
'X-RAY DIFFRACTION' 196 ? refined 3.7032   110.5805 424.8980 0.5651  0.2844  0.3745 0.0662  0.0336  -0.2468 0.0069  0.0149  0.0004 
-0.0077 0.0016  0.0065  -0.0146 0.0618  -0.0643 -0.0932 0.0144  -0.0103 0.0512  0.0643  0.0172  
'X-RAY DIFFRACTION' 197 ? refined 21.6564  114.3390 431.6521 0.6180  0.3778  0.4447 0.3543  -0.0198 -0.2926 0.0536  0.0151  0.0332 
-0.0366 -0.0075 0.0087  0.0048  0.1412  -0.1167 0.0896  -0.0232 0.1159  0.2046  0.0639  0.1019  
'X-RAY DIFFRACTION' 198 ? refined 27.6180  119.5421 431.2392 0.3116  0.3162  0.2563 0.0815  -0.0493 -0.2355 0.0146  0.2023  0.1452 
0.0066  -0.0442 -0.0963 -0.0044 -0.0736 0.0309  0.3137  -0.0366 0.0777  0.0332  -0.0008 0.1366  
'X-RAY DIFFRACTION' 199 ? refined -33.3895 106.0151 385.4738 0.2386  0.7007  0.3845 0.0385  0.0468  -0.3177 0.3123  0.1402  0.1749 
-0.1071 -0.2257 0.0111  -0.1965 -0.1533 -0.0182 0.0882  -0.1021 0.0895  0.0363  -0.1270 -0.4504 
'X-RAY DIFFRACTION' 200 ? refined -27.5693 117.6780 391.4577 0.4343  0.3430  0.2508 0.1844  -0.1959 -0.2419 0.0951  0.1347  0.3180 
-0.0090 -0.0736 0.1284  -0.1164 0.0009  0.0188  0.1015  -0.1192 0.0609  -0.1080 -0.3874 -0.8230 
'X-RAY DIFFRACTION' 201 ? refined -19.0373 134.6606 393.7963 0.5043  0.2061  0.4924 0.0925  -0.2297 -0.0168 0.1259  0.0204  0.0058 
0.0437  -0.0210 -0.0034 -0.0339 -0.0804 0.0804  0.1232  0.0623  0.0176  0.0165  0.0147  0.0414  
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1   1   ? ? ? ? ? ? ? ? ? 
;chain '1' and (resid 2 through 38 )
;
'X-RAY DIFFRACTION' 2   2   ? ? ? ? ? ? ? ? ? 
;chain '1' and (resid 39 through 60 )
;
'X-RAY DIFFRACTION' 3   3   ? ? ? ? ? ? ? ? ? 
;chain '1' and (resid 61 through 86 )
;
'X-RAY DIFFRACTION' 4   4   ? ? ? ? ? ? ? ? ? 
;chain '1' and (resid 87 through 155 )
;
'X-RAY DIFFRACTION' 5   5   ? ? ? ? ? ? ? ? ? 
;chain '1' and (resid 156 through 232 )
;
'X-RAY DIFFRACTION' 6   6   ? ? ? ? ? ? ? ? ? 
;chain '1' and (resid 233 through 366 )
;
'X-RAY DIFFRACTION' 7   7   ? ? ? ? ? ? ? ? ? 
;chain '1' and (resid 367 through 438 )
;
'X-RAY DIFFRACTION' 8   8   ? ? ? ? ? ? ? ? ? 
;chain '2' and (resid 3 through 22 )
;
'X-RAY DIFFRACTION' 9   9   ? ? ? ? ? ? ? ? ? 
;chain '2' and (resid 23 through 38 )
;
'X-RAY DIFFRACTION' 10  10  ? ? ? ? ? ? ? ? ? 
;chain '2' and (resid 39 through 66 )
;
'X-RAY DIFFRACTION' 11  11  ? ? ? ? ? ? ? ? ? 
;chain '2' and (resid 67 through 77 )
;
'X-RAY DIFFRACTION' 12  12  ? ? ? ? ? ? ? ? ? 
;chain '2' and (resid 78 through 92 )
;
'X-RAY DIFFRACTION' 13  13  ? ? ? ? ? ? ? ? ? 
;chain '2' and (resid 93 through 104 )
;
'X-RAY DIFFRACTION' 14  14  ? ? ? ? ? ? ? ? ? 
;chain '2' and (resid 105 through 116 )
;
'X-RAY DIFFRACTION' 15  15  ? ? ? ? ? ? ? ? ? 
;chain '2' and (resid 117 through 132 )
;
'X-RAY DIFFRACTION' 16  16  ? ? ? ? ? ? ? ? ? 
;chain '2' and (resid 133 through 146 )
;
'X-RAY DIFFRACTION' 17  17  ? ? ? ? ? ? ? ? ? 
;chain '2' and (resid 147 through 158 )
;
'X-RAY DIFFRACTION' 18  18  ? ? ? ? ? ? ? ? ? 
;chain '2' and (resid 159 through 165 )
;
'X-RAY DIFFRACTION' 19  19  ? ? ? ? ? ? ? ? ? 
;chain '2' and (resid 166 through 180 )
;
'X-RAY DIFFRACTION' 20  20  ? ? ? ? ? ? ? ? ? 
;chain '3' and (resid 1 through 137 )
;
'X-RAY DIFFRACTION' 21  21  ? ? ? ? ? ? ? ? ? 
;chain '3' and (resid 138 through 193 )
;
'X-RAY DIFFRACTION' 22  22  ? ? ? ? ? ? ? ? ? 
;chain '3' and (resid 194 through 309 )
;
'X-RAY DIFFRACTION' 23  23  ? ? ? ? ? ? ? ? ? 
;chain '3' and (resid 310 through 350 )
;
'X-RAY DIFFRACTION' 24  24  ? ? ? ? ? ? ? ? ? 
;chain '3' and (resid 351 through 460 )
;
'X-RAY DIFFRACTION' 25  25  ? ? ? ? ? ? ? ? ? 
;chain '3' and (resid 461 through 595 )
;
'X-RAY DIFFRACTION' 26  26  ? ? ? ? ? ? ? ? ? 
;chain '3' and (resid 596 through 667 )
;
'X-RAY DIFFRACTION' 27  27  ? ? ? ? ? ? ? ? ? 
;chain '3' and (resid 668 through 719 )
;
'X-RAY DIFFRACTION' 28  28  ? ? ? ? ? ? ? ? ? 
;chain '3' and (resid 720 through 777 )
;
'X-RAY DIFFRACTION' 29  29  ? ? ? ? ? ? ? ? ? 
;chain '4' and (resid 26 through 139 )
;
'X-RAY DIFFRACTION' 30  30  ? ? ? ? ? ? ? ? ? 
;chain '4' and (resid 140 through 208 )
;
'X-RAY DIFFRACTION' 31  31  ? ? ? ? ? ? ? ? ? 
;chain '4' and (resid 209 through 247 )
;
'X-RAY DIFFRACTION' 32  32  ? ? ? ? ? ? ? ? ? 
;chain '4' and (resid 248 through 409 )
;
'X-RAY DIFFRACTION' 33  33  ? ? ? ? ? ? ? ? ? 
;chain '5' and (resid 1 through 13 )
;
'X-RAY DIFFRACTION' 34  34  ? ? ? ? ? ? ? ? ? 
;chain '5' and (resid 14 through 31 )
;
'X-RAY DIFFRACTION' 35  35  ? ? ? ? ? ? ? ? ? 
;chain '5' and (resid 32 through 43 )
;
'X-RAY DIFFRACTION' 36  36  ? ? ? ? ? ? ? ? ? 
;chain '5' and (resid 44 through 67 )
;
'X-RAY DIFFRACTION' 37  37  ? ? ? ? ? ? ? ? ? 
;chain '5' and (resid 68 through 86 )
;
'X-RAY DIFFRACTION' 38  38  ? ? ? ? ? ? ? ? ? 
;chain '5' and (resid 87 through 109 )
;
'X-RAY DIFFRACTION' 39  39  ? ? ? ? ? ? ? ? ? 
;chain '5' and (resid 110 through 121 )
;
'X-RAY DIFFRACTION' 40  40  ? ? ? ? ? ? ? ? ? 
;chain '5' and (resid 122 through 141 )
;
'X-RAY DIFFRACTION' 41  41  ? ? ? ? ? ? ? ? ? 
;chain '5' and (resid 142 through 175 )
;
'X-RAY DIFFRACTION' 42  42  ? ? ? ? ? ? ? ? ? 
;chain '5' and (resid 176 through 185 )
;
'X-RAY DIFFRACTION' 43  43  ? ? ? ? ? ? ? ? ? 
;chain '5' and (resid 186 through 196 )
;
'X-RAY DIFFRACTION' 44  44  ? ? ? ? ? ? ? ? ? 
;chain '6' and (resid 20 through 34 )
;
'X-RAY DIFFRACTION' 45  45  ? ? ? ? ? ? ? ? ? 
;chain '6' and (resid 35 through 56 )
;
'X-RAY DIFFRACTION' 46  46  ? ? ? ? ? ? ? ? ? 
;chain '6' and (resid 57 through 77 )
;
'X-RAY DIFFRACTION' 47  47  ? ? ? ? ? ? ? ? ? 
;chain '6' and (resid 78 through 181 )
;
'X-RAY DIFFRACTION' 48  48  ? ? ? ? ? ? ? ? ? 
;chain '9' and (resid 2 through 18 )
;
'X-RAY DIFFRACTION' 49  49  ? ? ? ? ? ? ? ? ? 
;chain '9' and (resid 19 through 38 )
;
'X-RAY DIFFRACTION' 50  50  ? ? ? ? ? ? ? ? ? 
;chain '9' and (resid 39 through 48 )
;
'X-RAY DIFFRACTION' 51  51  ? ? ? ? ? ? ? ? ? 
;chain '9' and (resid 49 through 74 )
;
'X-RAY DIFFRACTION' 52  52  ? ? ? ? ? ? ? ? ? 
;chain '9' and (resid 75 through 112 )
;
'X-RAY DIFFRACTION' 53  53  ? ? ? ? ? ? ? ? ? 
;chain '9' and (resid 113 through 135 )
;
'X-RAY DIFFRACTION' 54  54  ? ? ? ? ? ? ? ? ? 
;chain '9' and (resid 136 through 167 )
;
'X-RAY DIFFRACTION' 55  55  ? ? ? ? ? ? ? ? ? 
;chain '9' and (resid 168 through 181 )
;
'X-RAY DIFFRACTION' 56  56  ? ? ? ? ? ? ? ? ? 
;chain '7' and (resid 3 through 27 )
;
'X-RAY DIFFRACTION' 57  57  ? ? ? ? ? ? ? ? ? 
;chain '7' and (resid 28 through 60 )
;
'X-RAY DIFFRACTION' 58  58  ? ? ? ? ? ? ? ? ? 
;chain '7' and (resid 61 through 81 )
;
'X-RAY DIFFRACTION' 59  59  ? ? ? ? ? ? ? ? ? 
;chain '7' and (resid 82 through 111 )
;
'X-RAY DIFFRACTION' 60  60  ? ? ? ? ? ? ? ? ? 
;chain '7' and (resid 112 through 129 )
;
'X-RAY DIFFRACTION' 61  61  ? ? ? ? ? ? ? ? ? 
;chain 'W' and (resid 1 through 9 )
;
'X-RAY DIFFRACTION' 62  62  ? ? ? ? ? ? ? ? ? 
;chain 'W' and (resid 10 through 35 )
;
'X-RAY DIFFRACTION' 63  63  ? ? ? ? ? ? ? ? ? 
;chain 'W' and (resid 36 through 46 )
;
'X-RAY DIFFRACTION' 64  64  ? ? ? ? ? ? ? ? ? 
;chain 'W' and (resid 47 through 69 )
;
'X-RAY DIFFRACTION' 65  65  ? ? ? ? ? ? ? ? ? 
;chain 'W' and (resid 70 through 95 )
;
'X-RAY DIFFRACTION' 66  66  ? ? ? ? ? ? ? ? ? 
;chain 'W' and (resid 96 through 106 )
;
'X-RAY DIFFRACTION' 67  67  ? ? ? ? ? ? ? ? ? 
;chain 'W' and (resid 107 through 117 )
;
'X-RAY DIFFRACTION' 68  68  ? ? ? ? ? ? ? ? ? 
;chain 'W' and (resid 118 through 127 )
;
'X-RAY DIFFRACTION' 69  69  ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 2 through 88 )
;
'X-RAY DIFFRACTION' 70  70  ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 89 through 117 )
;
'X-RAY DIFFRACTION' 71  71  ? ? ? ? ? ? ? ? ? 
;chain 'J' and (resid 1 through 24 )
;
'X-RAY DIFFRACTION' 72  72  ? ? ? ? ? ? ? ? ? 
;chain 'J' and (resid 25 through 73 )
;
'X-RAY DIFFRACTION' 73  73  ? ? ? ? ? ? ? ? ? 
;chain 'J' and (resid 74 through 108 )
;
'X-RAY DIFFRACTION' 74  74  ? ? ? ? ? ? ? ? ? 
;chain 'J' and (resid 109 through 160 )
;
'X-RAY DIFFRACTION' 75  75  ? ? ? ? ? ? ? ? ? 
;chain 'K' and (resid 1 through 23 )
;
'X-RAY DIFFRACTION' 76  76  ? ? ? ? ? ? ? ? ? 
;chain 'K' and (resid 24 through 51 )
;
'X-RAY DIFFRACTION' 77  77  ? ? ? ? ? ? ? ? ? 
;chain 'K' and (resid 52 through 78 )
;
'X-RAY DIFFRACTION' 78  78  ? ? ? ? ? ? ? ? ? 
;chain 'K' and (resid 79 through 86 )
;
'X-RAY DIFFRACTION' 79  79  ? ? ? ? ? ? ? ? ? 
;chain 'K' and (resid 87 through 95 )
;
'X-RAY DIFFRACTION' 80  80  ? ? ? ? ? ? ? ? ? 
;chain 'L' and (resid 1 through 70 )
;
'X-RAY DIFFRACTION' 81  81  ? ? ? ? ? ? ? ? ? 
;chain 'L' and (resid 71 through 425 )
;
'X-RAY DIFFRACTION' 82  82  ? ? ? ? ? ? ? ? ? 
;chain 'L' and (resid 426 through 458 )
;
'X-RAY DIFFRACTION' 83  83  ? ? ? ? ? ? ? ? ? 
;chain 'L' and (resid 459 through 510 )
;
'X-RAY DIFFRACTION' 84  84  ? ? ? ? ? ? ? ? ? 
;chain 'L' and (resid 511 through 542 )
;
'X-RAY DIFFRACTION' 85  85  ? ? ? ? ? ? ? ? ? 
;chain 'L' and (resid 543 through 605 )
;
'X-RAY DIFFRACTION' 86  86  ? ? ? ? ? ? ? ? ? 
;chain 'M' and (resid 1 through 114 )
;
'X-RAY DIFFRACTION' 87  87  ? ? ? ? ? ? ? ? ? 
;chain 'M' and (resid 115 through 414 )
;
'X-RAY DIFFRACTION' 88  88  ? ? ? ? ? ? ? ? ? 
;chain 'M' and (resid 415 through 467 )
;
'X-RAY DIFFRACTION' 89  89  ? ? ? ? ? ? ? ? ? 
;chain 'N' and (resid 1 through 127 )
;
'X-RAY DIFFRACTION' 90  90  ? ? ? ? ? ? ? ? ? 
;chain 'N' and (resid 128 through 187 )
;
'X-RAY DIFFRACTION' 91  91  ? ? ? ? ? ? ? ? ? 
;chain 'N' and (resid 188 through 357 )
;
'X-RAY DIFFRACTION' 92  92  ? ? ? ? ? ? ? ? ? 
;chain 'N' and (resid 358 through 395 )
;
'X-RAY DIFFRACTION' 93  93  ? ? ? ? ? ? ? ? ? 
;chain 'N' and (resid 396 through 427 )
;
'X-RAY DIFFRACTION' 94  94  ? ? ? ? ? ? ? ? ? 
;chain 'H' and (resid 2 through 42 )
;
'X-RAY DIFFRACTION' 95  95  ? ? ? ? ? ? ? ? ? 
;chain 'H' and (resid 43 through 104 )
;
'X-RAY DIFFRACTION' 96  96  ? ? ? ? ? ? ? ? ? 
;chain 'H' and (resid 105 through 147 )
;
'X-RAY DIFFRACTION' 97  97  ? ? ? ? ? ? ? ? ? 
;chain 'H' and (resid 148 through 262 )
;
'X-RAY DIFFRACTION' 98  98  ? ? ? ? ? ? ? ? ? 
;chain 'H' and (resid 263 through 296 )
;
'X-RAY DIFFRACTION' 99  99  ? ? ? ? ? ? ? ? ? 
;chain 'H' and (resid 297 through 334 )
;
'X-RAY DIFFRACTION' 100 100 ? ? ? ? ? ? ? ? ? 
;chain 'H' and (resid 335 through 354 )
;
'X-RAY DIFFRACTION' 101 101 ? ? ? ? ? ? ? ? ? 
;chain 'B' and (resid 2 through 38 )
;
'X-RAY DIFFRACTION' 102 102 ? ? ? ? ? ? ? ? ? 
;chain 'B' and (resid 39 through 60 )
;
'X-RAY DIFFRACTION' 103 103 ? ? ? ? ? ? ? ? ? 
;chain 'B' and (resid 61 through 124 )
;
'X-RAY DIFFRACTION' 104 104 ? ? ? ? ? ? ? ? ? 
;chain 'B' and (resid 125 through 267 )
;
'X-RAY DIFFRACTION' 105 105 ? ? ? ? ? ? ? ? ? 
;chain 'B' and (resid 268 through 366 )
;
'X-RAY DIFFRACTION' 106 106 ? ? ? ? ? ? ? ? ? 
;chain 'B' and (resid 367 through 395 )
;
'X-RAY DIFFRACTION' 107 107 ? ? ? ? ? ? ? ? ? 
;chain 'B' and (resid 396 through 438 )
;
'X-RAY DIFFRACTION' 108 108 ? ? ? ? ? ? ? ? ? 
;chain 'C' and (resid 3 through 22 )
;
'X-RAY DIFFRACTION' 109 109 ? ? ? ? ? ? ? ? ? 
;chain 'C' and (resid 23 through 38 )
;
'X-RAY DIFFRACTION' 110 110 ? ? ? ? ? ? ? ? ? 
;chain 'C' and (resid 39 through 53 )
;
'X-RAY DIFFRACTION' 111 111 ? ? ? ? ? ? ? ? ? 
;chain 'C' and (resid 54 through 66 )
;
'X-RAY DIFFRACTION' 112 112 ? ? ? ? ? ? ? ? ? 
;chain 'C' and (resid 67 through 77 )
;
'X-RAY DIFFRACTION' 113 113 ? ? ? ? ? ? ? ? ? 
;chain 'C' and (resid 78 through 92 )
;
'X-RAY DIFFRACTION' 114 114 ? ? ? ? ? ? ? ? ? 
;chain 'C' and (resid 93 through 104 )
;
'X-RAY DIFFRACTION' 115 115 ? ? ? ? ? ? ? ? ? 
;chain 'C' and (resid 105 through 116 )
;
'X-RAY DIFFRACTION' 116 116 ? ? ? ? ? ? ? ? ? 
;chain 'C' and (resid 117 through 146 )
;
'X-RAY DIFFRACTION' 117 117 ? ? ? ? ? ? ? ? ? 
;chain 'C' and (resid 147 through 158 )
;
'X-RAY DIFFRACTION' 118 118 ? ? ? ? ? ? ? ? ? 
;chain 'C' and (resid 159 through 180 )
;
'X-RAY DIFFRACTION' 119 119 ? ? ? ? ? ? ? ? ? 
;chain 'D' and (resid 1 through 128 )
;
'X-RAY DIFFRACTION' 120 120 ? ? ? ? ? ? ? ? ? 
;chain 'D' and (resid 129 through 193 )
;
'X-RAY DIFFRACTION' 121 121 ? ? ? ? ? ? ? ? ? 
;chain 'D' and (resid 194 through 309 )
;
'X-RAY DIFFRACTION' 122 122 ? ? ? ? ? ? ? ? ? 
;chain 'D' and (resid 310 through 350 )
;
'X-RAY DIFFRACTION' 123 123 ? ? ? ? ? ? ? ? ? 
;chain 'D' and (resid 351 through 546 )
;
'X-RAY DIFFRACTION' 124 124 ? ? ? ? ? ? ? ? ? 
;chain 'D' and (resid 547 through 594 )
;
'X-RAY DIFFRACTION' 125 125 ? ? ? ? ? ? ? ? ? 
;chain 'D' and (resid 595 through 667 )
;
'X-RAY DIFFRACTION' 126 126 ? ? ? ? ? ? ? ? ? 
;chain 'D' and (resid 668 through 719 )
;
'X-RAY DIFFRACTION' 127 127 ? ? ? ? ? ? ? ? ? 
;chain 'D' and (resid 720 through 777 )
;
'X-RAY DIFFRACTION' 128 128 ? ? ? ? ? ? ? ? ? 
;chain 'E' and (resid 26 through 53 )
;
'X-RAY DIFFRACTION' 129 129 ? ? ? ? ? ? ? ? ? 
;chain 'E' and (resid 54 through 139 )
;
'X-RAY DIFFRACTION' 130 130 ? ? ? ? ? ? ? ? ? 
;chain 'E' and (resid 140 through 208 )
;
'X-RAY DIFFRACTION' 131 131 ? ? ? ? ? ? ? ? ? 
;chain 'E' and (resid 209 through 232 )
;
'X-RAY DIFFRACTION' 132 132 ? ? ? ? ? ? ? ? ? 
;chain 'E' and (resid 233 through 409 )
;
'X-RAY DIFFRACTION' 133 133 ? ? ? ? ? ? ? ? ? 
;chain 'F' and (resid 1 through 13 )
;
'X-RAY DIFFRACTION' 134 134 ? ? ? ? ? ? ? ? ? 
;chain 'F' and (resid 14 through 31 )
;
'X-RAY DIFFRACTION' 135 135 ? ? ? ? ? ? ? ? ? 
;chain 'F' and (resid 32 through 86 )
;
'X-RAY DIFFRACTION' 136 136 ? ? ? ? ? ? ? ? ? 
;chain 'F' and (resid 87 through 121 )
;
'X-RAY DIFFRACTION' 137 137 ? ? ? ? ? ? ? ? ? 
;chain 'F' and (resid 122 through 175 )
;
'X-RAY DIFFRACTION' 138 138 ? ? ? ? ? ? ? ? ? 
;chain 'F' and (resid 176 through 196 )
;
'X-RAY DIFFRACTION' 139 139 ? ? ? ? ? ? ? ? ? 
;chain 'G' and (resid 20 through 34 )
;
'X-RAY DIFFRACTION' 140 140 ? ? ? ? ? ? ? ? ? 
;chain 'G' and (resid 35 through 56 )
;
'X-RAY DIFFRACTION' 141 141 ? ? ? ? ? ? ? ? ? 
;chain 'G' and (resid 57 through 88 )
;
'X-RAY DIFFRACTION' 142 142 ? ? ? ? ? ? ? ? ? 
;chain 'G' and (resid 89 through 158 )
;
'X-RAY DIFFRACTION' 143 143 ? ? ? ? ? ? ? ? ? 
;chain 'G' and (resid 159 through 168 )
;
'X-RAY DIFFRACTION' 144 144 ? ? ? ? ? ? ? ? ? 
;chain 'G' and (resid 169 through 181 )
;
'X-RAY DIFFRACTION' 145 145 ? ? ? ? ? ? ? ? ? 
;chain 'O' and (resid 2 through 18 )
;
'X-RAY DIFFRACTION' 146 146 ? ? ? ? ? ? ? ? ? 
;chain 'O' and (resid 19 through 30 )
;
'X-RAY DIFFRACTION' 147 147 ? ? ? ? ? ? ? ? ? 
;chain 'O' and (resid 31 through 48 )
;
'X-RAY DIFFRACTION' 148 148 ? ? ? ? ? ? ? ? ? 
;chain 'O' and (resid 49 through 74 )
;
'X-RAY DIFFRACTION' 149 149 ? ? ? ? ? ? ? ? ? 
;chain 'O' and (resid 75 through 112 )
;
'X-RAY DIFFRACTION' 150 150 ? ? ? ? ? ? ? ? ? 
;chain 'O' and (resid 113 through 125 )
;
'X-RAY DIFFRACTION' 151 151 ? ? ? ? ? ? ? ? ? 
;chain 'O' and (resid 126 through 168 )
;
'X-RAY DIFFRACTION' 152 152 ? ? ? ? ? ? ? ? ? 
;chain 'O' and (resid 169 through 181 )
;
'X-RAY DIFFRACTION' 153 153 ? ? ? ? ? ? ? ? ? 
;chain 'I' and (resid 3 through 27 )
;
'X-RAY DIFFRACTION' 154 154 ? ? ? ? ? ? ? ? ? 
;chain 'I' and (resid 28 through 60 )
;
'X-RAY DIFFRACTION' 155 155 ? ? ? ? ? ? ? ? ? 
;chain 'I' and (resid 61 through 81 )
;
'X-RAY DIFFRACTION' 156 156 ? ? ? ? ? ? ? ? ? 
;chain 'I' and (resid 82 through 111 )
;
'X-RAY DIFFRACTION' 157 157 ? ? ? ? ? ? ? ? ? 
;chain 'I' and (resid 112 through 129 )
;
'X-RAY DIFFRACTION' 158 158 ? ? ? ? ? ? ? ? ? 
;chain 'X' and (resid 1 through 9 )
;
'X-RAY DIFFRACTION' 159 159 ? ? ? ? ? ? ? ? ? 
;chain 'X' and (resid 10 through 21 )
;
'X-RAY DIFFRACTION' 160 160 ? ? ? ? ? ? ? ? ? 
;chain 'X' and (resid 22 through 29 )
;
'X-RAY DIFFRACTION' 161 161 ? ? ? ? ? ? ? ? ? 
;chain 'X' and (resid 30 through 46 )
;
'X-RAY DIFFRACTION' 162 162 ? ? ? ? ? ? ? ? ? 
;chain 'X' and (resid 47 through 59 )
;
'X-RAY DIFFRACTION' 163 163 ? ? ? ? ? ? ? ? ? 
;chain 'X' and (resid 60 through 83 )
;
'X-RAY DIFFRACTION' 164 164 ? ? ? ? ? ? ? ? ? 
;chain 'X' and (resid 84 through 93 )
;
'X-RAY DIFFRACTION' 165 165 ? ? ? ? ? ? ? ? ? 
;chain 'X' and (resid 94 through 106 )
;
'X-RAY DIFFRACTION' 166 166 ? ? ? ? ? ? ? ? ? 
;chain 'X' and (resid 107 through 127 )
;
'X-RAY DIFFRACTION' 167 167 ? ? ? ? ? ? ? ? ? 
;chain 'P' and (resid 2 through 58 )
;
'X-RAY DIFFRACTION' 168 168 ? ? ? ? ? ? ? ? ? 
;chain 'P' and (resid 59 through 83 )
;
'X-RAY DIFFRACTION' 169 169 ? ? ? ? ? ? ? ? ? 
;chain 'P' and (resid 84 through 112 )
;
'X-RAY DIFFRACTION' 170 170 ? ? ? ? ? ? ? ? ? 
;chain 'P' and (resid 113 through 117 )
;
'X-RAY DIFFRACTION' 171 171 ? ? ? ? ? ? ? ? ? 
;chain 'R' and (resid 1 through 24 )
;
'X-RAY DIFFRACTION' 172 172 ? ? ? ? ? ? ? ? ? 
;chain 'R' and (resid 25 through 62 )
;
'X-RAY DIFFRACTION' 173 173 ? ? ? ? ? ? ? ? ? 
;chain 'R' and (resid 63 through 73 )
;
'X-RAY DIFFRACTION' 174 174 ? ? ? ? ? ? ? ? ? 
;chain 'R' and (resid 74 through 87 )
;
'X-RAY DIFFRACTION' 175 175 ? ? ? ? ? ? ? ? ? 
;chain 'R' and (resid 88 through 108 )
;
'X-RAY DIFFRACTION' 176 176 ? ? ? ? ? ? ? ? ? 
;chain 'R' and (resid 109 through 123 )
;
'X-RAY DIFFRACTION' 177 177 ? ? ? ? ? ? ? ? ? 
;chain 'R' and (resid 124 through 160 )
;
'X-RAY DIFFRACTION' 178 178 ? ? ? ? ? ? ? ? ? 
;chain 'S' and (resid 1 through 23 )
;
'X-RAY DIFFRACTION' 179 179 ? ? ? ? ? ? ? ? ? 
;chain 'S' and (resid 24 through 76 )
;
'X-RAY DIFFRACTION' 180 180 ? ? ? ? ? ? ? ? ? 
;chain 'S' and (resid 77 through 86 )
;
'X-RAY DIFFRACTION' 181 181 ? ? ? ? ? ? ? ? ? 
;chain 'S' and (resid 87 through 95 )
;
'X-RAY DIFFRACTION' 182 182 ? ? ? ? ? ? ? ? ? 
;chain 'T' and (resid 1 through 70 )
;
'X-RAY DIFFRACTION' 183 183 ? ? ? ? ? ? ? ? ? 
;chain 'T' and (resid 71 through 290 )
;
'X-RAY DIFFRACTION' 184 184 ? ? ? ? ? ? ? ? ? 
;chain 'T' and (resid 291 through 425 )
;
'X-RAY DIFFRACTION' 185 185 ? ? ? ? ? ? ? ? ? 
;chain 'T' and (resid 426 through 455 )
;
'X-RAY DIFFRACTION' 186 186 ? ? ? ? ? ? ? ? ? 
;chain 'T' and (resid 456 through 488 )
;
'X-RAY DIFFRACTION' 187 187 ? ? ? ? ? ? ? ? ? 
;chain 'T' and (resid 489 through 542 )
;
'X-RAY DIFFRACTION' 188 188 ? ? ? ? ? ? ? ? ? 
;chain 'T' and (resid 543 through 605 )
;
'X-RAY DIFFRACTION' 189 189 ? ? ? ? ? ? ? ? ? 
;chain 'U' and (resid 1 through 95 )
;
'X-RAY DIFFRACTION' 190 190 ? ? ? ? ? ? ? ? ? 
;chain 'U' and (resid 96 through 304 )
;
'X-RAY DIFFRACTION' 191 191 ? ? ? ? ? ? ? ? ? 
;chain 'U' and (resid 305 through 414 )
;
'X-RAY DIFFRACTION' 192 192 ? ? ? ? ? ? ? ? ? 
;chain 'U' and (resid 415 through 467 )
;
'X-RAY DIFFRACTION' 193 193 ? ? ? ? ? ? ? ? ? 
;chain 'V' and (resid 1 through 42 )
;
'X-RAY DIFFRACTION' 194 194 ? ? ? ? ? ? ? ? ? 
;chain 'V' and (resid 43 through 75 )
;
'X-RAY DIFFRACTION' 195 195 ? ? ? ? ? ? ? ? ? 
;chain 'V' and (resid 76 through 127 )
;
'X-RAY DIFFRACTION' 196 196 ? ? ? ? ? ? ? ? ? 
;chain 'V' and (resid 128 through 225 )
;
'X-RAY DIFFRACTION' 197 197 ? ? ? ? ? ? ? ? ? 
;chain 'V' and (resid 226 through 357 )
;
'X-RAY DIFFRACTION' 198 198 ? ? ? ? ? ? ? ? ? 
;chain 'V' and (resid 358 through 427 )
;
'X-RAY DIFFRACTION' 199 199 ? ? ? ? ? ? ? ? ? 
;chain 'Q' and (resid 2 through 104 )
;
'X-RAY DIFFRACTION' 200 200 ? ? ? ? ? ? ? ? ? 
;chain 'Q' and (resid 105 through 296 )
;
'X-RAY DIFFRACTION' 201 201 ? ? ? ? ? ? ? ? ? 
;chain 'Q' and (resid 297 through 354 )
;
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 1 MET 1   ? A  MET 1   
2   1 Y 1 2 MET 1   ? B  MET 1   
3   1 Y 1 2 GLY 2   ? B  GLY 2   
4   1 Y 1 2 VAL 181 ? B  VAL 181 
5   1 Y 1 3 LYS 56  ? C  LYS 56  
6   1 Y 1 3 LYS 57  ? C  LYS 57  
7   1 Y 1 3 GLY 58  ? C  GLY 58  
8   1 Y 1 3 PRO 59  ? C  PRO 59  
9   1 Y 1 3 ASP 60  ? C  ASP 60  
10  1 Y 1 3 GLY 61  ? C  GLY 61  
11  1 Y 1 3 LYS 62  ? C  LYS 62  
12  1 Y 1 3 PRO 63  ? C  PRO 63  
13  1 Y 1 3 LEU 64  ? C  LEU 64  
14  1 Y 1 3 LEU 65  ? C  LEU 65  
15  1 Y 1 3 ASN 66  ? C  ASN 66  
16  1 Y 1 3 GLU 67  ? C  GLU 67  
17  1 Y 1 3 LYS 68  ? C  LYS 68  
18  1 Y 1 3 GLY 69  ? C  GLY 69  
19  1 Y 1 3 GLU 70  ? C  GLU 70  
20  1 Y 1 3 PRO 71  ? C  PRO 71  
21  1 Y 1 3 GLU 72  ? C  GLU 72  
22  1 Y 1 3 TYR 144 ? C  TYR 144 
23  1 Y 1 3 GLN 145 ? C  GLN 145 
24  1 Y 1 3 LYS 146 ? C  LYS 146 
25  1 Y 1 3 GLY 147 ? C  GLY 147 
26  1 Y 1 3 PRO 778 ? C  PRO 778 
27  1 Y 1 3 ALA 779 ? C  ALA 779 
28  1 Y 1 3 GLY 780 ? C  GLY 780 
29  1 Y 1 3 GLY 781 ? C  GLY 781 
30  1 Y 1 3 GLU 782 ? C  GLU 782 
31  1 Y 1 3 ALA 783 ? C  ALA 783 
32  1 Y 1 4 MET 1   ? D  MET 1   
33  1 Y 1 4 ARG 2   ? D  ARG 2   
34  1 Y 1 4 GLU 3   ? D  GLU 3   
35  1 Y 1 4 GLU 4   ? D  GLU 4   
36  1 Y 1 4 PHE 5   ? D  PHE 5   
37  1 Y 1 4 LEU 6   ? D  LEU 6   
38  1 Y 1 4 GLU 7   ? D  GLU 7   
39  1 Y 1 4 GLU 8   ? D  GLU 8   
40  1 Y 1 4 ILE 9   ? D  ILE 9   
41  1 Y 1 4 PRO 10  ? D  PRO 10  
42  1 Y 1 4 LEU 11  ? D  LEU 11  
43  1 Y 1 4 ASP 12  ? D  ASP 12  
44  1 Y 1 4 ALA 13  ? D  ALA 13  
45  1 Y 1 4 PRO 14  ? D  PRO 14  
46  1 Y 1 4 PRO 15  ? D  PRO 15  
47  1 Y 1 4 GLU 16  ? D  GLU 16  
48  1 Y 1 4 GLU 17  ? D  GLU 17  
49  1 Y 1 4 ALA 18  ? D  ALA 18  
50  1 Y 1 4 LYS 19  ? D  LYS 19  
51  1 Y 1 4 GLU 20  ? D  GLU 20  
52  1 Y 1 4 LEU 21  ? D  LEU 21  
53  1 Y 1 4 ARG 22  ? D  ARG 22  
54  1 Y 1 4 THR 23  ? D  THR 23  
55  1 Y 1 4 GLU 24  ? D  GLU 24  
56  1 Y 1 4 VAL 25  ? D  VAL 25  
57  1 Y 1 5 ALA 197 ? E  ALA 197 
58  1 Y 1 5 ASP 198 ? E  ASP 198 
59  1 Y 1 5 LEU 199 ? E  LEU 199 
60  1 Y 1 5 LYS 200 ? E  LYS 200 
61  1 Y 1 5 LYS 201 ? E  LYS 201 
62  1 Y 1 5 ALA 202 ? E  ALA 202 
63  1 Y 1 5 ARG 203 ? E  ARG 203 
64  1 Y 1 5 GLU 204 ? E  GLU 204 
65  1 Y 1 5 VAL 205 ? E  VAL 205 
66  1 Y 1 5 LYS 206 ? E  LYS 206 
67  1 Y 1 5 GLY 207 ? E  GLY 207 
68  1 Y 1 6 MET 1   ? F  MET 1   
69  1 Y 1 6 ALA 2   ? F  ALA 2   
70  1 Y 1 6 LEU 3   ? F  LEU 3   
71  1 Y 1 6 LYS 4   ? F  LYS 4   
72  1 Y 1 6 ASP 5   ? F  ASP 5   
73  1 Y 1 6 LEU 6   ? F  LEU 6   
74  1 Y 1 6 PHE 7   ? F  PHE 7   
75  1 Y 1 6 GLU 8   ? F  GLU 8   
76  1 Y 1 6 ARG 9   ? F  ARG 9   
77  1 Y 1 6 ASP 10  ? F  ASP 10  
78  1 Y 1 6 VAL 11  ? F  VAL 11  
79  1 Y 1 6 GLN 12  ? F  GLN 12  
80  1 Y 1 6 GLU 13  ? F  GLU 13  
81  1 Y 1 6 LEU 14  ? F  LEU 14  
82  1 Y 1 6 GLU 15  ? F  GLU 15  
83  1 Y 1 9 MET 1   ? G  MET 1   
84  1 Y 1 9 ARG 182 ? G  ARG 182 
85  1 Y 1 7 MET 1   ? H  MET 1   
86  1 Y 1 7 SER 2   ? H  SER 2   
87  1 Y 1 W LYS 128 ? I  LYS 128 
88  1 Y 1 W ARG 129 ? I  ARG 129 
89  1 Y 1 W ALA 130 ? I  ALA 130 
90  1 Y 1 W ALA 131 ? I  ALA 131 
91  1 Y 1 A TRP 118 ? J  TRP 118 
92  1 Y 1 A HIS 119 ? J  HIS 119 
93  1 Y 1 J LYS 161 ? K  LYS 161 
94  1 Y 1 J ALA 162 ? K  ALA 162 
95  1 Y 1 J SER 163 ? K  SER 163 
96  1 Y 1 J ARG 164 ? K  ARG 164 
97  1 Y 1 J ALA 165 ? K  ALA 165 
98  1 Y 1 J LYS 166 ? K  LYS 166 
99  1 Y 1 J GLU 167 ? K  GLU 167 
100 1 Y 1 J ALA 168 ? K  ALA 168 
101 1 Y 1 J GLU 169 ? K  GLU 169 
102 1 Y 1 J LYS 170 ? K  LYS 170 
103 1 Y 1 J ARG 171 ? K  ARG 171 
104 1 Y 1 J GLU 172 ? K  GLU 172 
105 1 Y 1 J GLU 173 ? K  GLU 173 
106 1 Y 1 J VAL 174 ? K  VAL 174 
107 1 Y 1 J ALA 175 ? K  ALA 175 
108 1 Y 1 J ARG 176 ? K  ARG 176 
109 1 Y 1 L TRP 606 ? M  TRP 606 
110 1 Y 1 M GLY 468 ? N  GLY 468 
111 1 Y 1 M ALA 469 ? N  ALA 469 
112 1 Y 1 H MET 1   ? P  MET 1   
113 1 Y 1 H THR 355 ? P  THR 355 
114 1 Y 1 H PRO 356 ? P  PRO 356 
115 1 Y 1 H LYS 357 ? P  LYS 357 
116 1 Y 1 H PRO 358 ? P  PRO 358 
117 1 Y 1 H ALA 359 ? P  ALA 359 
118 1 Y 1 H ARG 360 ? P  ARG 360 
119 1 Y 1 H LYS 361 ? P  LYS 361 
120 1 Y 1 H GLY 362 ? P  GLY 362 
121 1 Y 1 H GLY 363 ? P  GLY 363 
122 1 Y 1 H GLY 364 ? P  GLY 364 
123 1 Y 1 H ALA 365 ? P  ALA 365 
124 1 Y 1 B MET 1   ? Q  MET 1   
125 1 Y 1 C MET 1   ? R  MET 1   
126 1 Y 1 C GLY 2   ? R  GLY 2   
127 1 Y 1 C VAL 181 ? R  VAL 181 
128 1 Y 1 D LYS 56  ? S  LYS 56  
129 1 Y 1 D LYS 57  ? S  LYS 57  
130 1 Y 1 D GLY 58  ? S  GLY 58  
131 1 Y 1 D PRO 59  ? S  PRO 59  
132 1 Y 1 D ASP 60  ? S  ASP 60  
133 1 Y 1 D GLY 61  ? S  GLY 61  
134 1 Y 1 D LYS 62  ? S  LYS 62  
135 1 Y 1 D PRO 63  ? S  PRO 63  
136 1 Y 1 D LEU 64  ? S  LEU 64  
137 1 Y 1 D LEU 65  ? S  LEU 65  
138 1 Y 1 D ASN 66  ? S  ASN 66  
139 1 Y 1 D GLU 67  ? S  GLU 67  
140 1 Y 1 D LYS 68  ? S  LYS 68  
141 1 Y 1 D GLY 69  ? S  GLY 69  
142 1 Y 1 D GLU 70  ? S  GLU 70  
143 1 Y 1 D PRO 71  ? S  PRO 71  
144 1 Y 1 D GLU 72  ? S  GLU 72  
145 1 Y 1 D TYR 144 ? S  TYR 144 
146 1 Y 1 D GLN 145 ? S  GLN 145 
147 1 Y 1 D LYS 146 ? S  LYS 146 
148 1 Y 1 D GLY 147 ? S  GLY 147 
149 1 Y 1 D PRO 778 ? S  PRO 778 
150 1 Y 1 D ALA 779 ? S  ALA 779 
151 1 Y 1 D GLY 780 ? S  GLY 780 
152 1 Y 1 D GLY 781 ? S  GLY 781 
153 1 Y 1 D GLU 782 ? S  GLU 782 
154 1 Y 1 D ALA 783 ? S  ALA 783 
155 1 Y 1 E MET 1   ? T  MET 1   
156 1 Y 1 E ARG 2   ? T  ARG 2   
157 1 Y 1 E GLU 3   ? T  GLU 3   
158 1 Y 1 E GLU 4   ? T  GLU 4   
159 1 Y 1 E PHE 5   ? T  PHE 5   
160 1 Y 1 E LEU 6   ? T  LEU 6   
161 1 Y 1 E GLU 7   ? T  GLU 7   
162 1 Y 1 E GLU 8   ? T  GLU 8   
163 1 Y 1 E ILE 9   ? T  ILE 9   
164 1 Y 1 E PRO 10  ? T  PRO 10  
165 1 Y 1 E LEU 11  ? T  LEU 11  
166 1 Y 1 E ASP 12  ? T  ASP 12  
167 1 Y 1 E ALA 13  ? T  ALA 13  
168 1 Y 1 E PRO 14  ? T  PRO 14  
169 1 Y 1 E PRO 15  ? T  PRO 15  
170 1 Y 1 E GLU 16  ? T  GLU 16  
171 1 Y 1 E GLU 17  ? T  GLU 17  
172 1 Y 1 E ALA 18  ? T  ALA 18  
173 1 Y 1 E LYS 19  ? T  LYS 19  
174 1 Y 1 E GLU 20  ? T  GLU 20  
175 1 Y 1 E LEU 21  ? T  LEU 21  
176 1 Y 1 E ARG 22  ? T  ARG 22  
177 1 Y 1 E THR 23  ? T  THR 23  
178 1 Y 1 E GLU 24  ? T  GLU 24  
179 1 Y 1 E VAL 25  ? T  VAL 25  
180 1 Y 1 F ALA 197 ? U  ALA 197 
181 1 Y 1 F ASP 198 ? U  ASP 198 
182 1 Y 1 F LEU 199 ? U  LEU 199 
183 1 Y 1 F LYS 200 ? U  LYS 200 
184 1 Y 1 F LYS 201 ? U  LYS 201 
185 1 Y 1 F ALA 202 ? U  ALA 202 
186 1 Y 1 F ARG 203 ? U  ARG 203 
187 1 Y 1 F GLU 204 ? U  GLU 204 
188 1 Y 1 F VAL 205 ? U  VAL 205 
189 1 Y 1 F LYS 206 ? U  LYS 206 
190 1 Y 1 F GLY 207 ? U  GLY 207 
191 1 Y 1 G MET 1   ? V  MET 1   
192 1 Y 1 G ALA 2   ? V  ALA 2   
193 1 Y 1 G LEU 3   ? V  LEU 3   
194 1 Y 1 G LYS 4   ? V  LYS 4   
195 1 Y 1 G ASP 5   ? V  ASP 5   
196 1 Y 1 G LEU 6   ? V  LEU 6   
197 1 Y 1 G PHE 7   ? V  PHE 7   
198 1 Y 1 G GLU 8   ? V  GLU 8   
199 1 Y 1 G ARG 9   ? V  ARG 9   
200 1 Y 1 G ASP 10  ? V  ASP 10  
201 1 Y 1 G VAL 11  ? V  VAL 11  
202 1 Y 1 G GLN 12  ? V  GLN 12  
203 1 Y 1 G GLU 13  ? V  GLU 13  
204 1 Y 1 G LEU 14  ? V  LEU 14  
205 1 Y 1 G GLU 15  ? V  GLU 15  
206 1 Y 1 O MET 1   ? W  MET 1   
207 1 Y 1 O ARG 182 ? W  ARG 182 
208 1 Y 1 I MET 1   ? X  MET 1   
209 1 Y 1 I SER 2   ? X  SER 2   
210 1 Y 1 X LYS 128 ? Y  LYS 128 
211 1 Y 1 X ARG 129 ? Y  ARG 129 
212 1 Y 1 X ALA 130 ? Y  ALA 130 
213 1 Y 1 X ALA 131 ? Y  ALA 131 
214 1 Y 1 P TRP 118 ? Z  TRP 118 
215 1 Y 1 P HIS 119 ? Z  HIS 119 
216 1 Y 1 R LYS 161 ? AA LYS 161 
217 1 Y 1 R ALA 162 ? AA ALA 162 
218 1 Y 1 R SER 163 ? AA SER 163 
219 1 Y 1 R ARG 164 ? AA ARG 164 
220 1 Y 1 R ALA 165 ? AA ALA 165 
221 1 Y 1 R LYS 166 ? AA LYS 166 
222 1 Y 1 R GLU 167 ? AA GLU 167 
223 1 Y 1 R ALA 168 ? AA ALA 168 
224 1 Y 1 R GLU 169 ? AA GLU 169 
225 1 Y 1 R LYS 170 ? AA LYS 170 
226 1 Y 1 R ARG 171 ? AA ARG 171 
227 1 Y 1 R GLU 172 ? AA GLU 172 
228 1 Y 1 R GLU 173 ? AA GLU 173 
229 1 Y 1 R VAL 174 ? AA VAL 174 
230 1 Y 1 R ALA 175 ? AA ALA 175 
231 1 Y 1 R ARG 176 ? AA ARG 176 
232 1 Y 1 T TRP 606 ? CA TRP 606 
233 1 Y 1 U GLY 468 ? DA GLY 468 
234 1 Y 1 U ALA 469 ? DA ALA 469 
235 1 Y 1 Q MET 1   ? FA MET 1   
236 1 Y 1 Q THR 355 ? FA THR 355 
237 1 Y 1 Q PRO 356 ? FA PRO 356 
238 1 Y 1 Q LYS 357 ? FA LYS 357 
239 1 Y 1 Q PRO 358 ? FA PRO 358 
240 1 Y 1 Q ALA 359 ? FA ALA 359 
241 1 Y 1 Q ARG 360 ? FA ARG 360 
242 1 Y 1 Q LYS 361 ? FA LYS 361 
243 1 Y 1 Q GLY 362 ? FA GLY 362 
244 1 Y 1 Q GLY 363 ? FA GLY 363 
245 1 Y 1 Q GLY 364 ? FA GLY 364 
246 1 Y 1 Q ALA 365 ? FA ALA 365 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N      N  N N 1   
ALA CA     C  N S 2   
ALA C      C  N N 3   
ALA O      O  N N 4   
ALA CB     C  N N 5   
ALA OXT    O  N N 6   
ALA H      H  N N 7   
ALA H2     H  N N 8   
ALA HA     H  N N 9   
ALA HB1    H  N N 10  
ALA HB2    H  N N 11  
ALA HB3    H  N N 12  
ALA HXT    H  N N 13  
ARG N      N  N N 14  
ARG CA     C  N S 15  
ARG C      C  N N 16  
ARG O      O  N N 17  
ARG CB     C  N N 18  
ARG CG     C  N N 19  
ARG CD     C  N N 20  
ARG NE     N  N N 21  
ARG CZ     C  N N 22  
ARG NH1    N  N N 23  
ARG NH2    N  N N 24  
ARG OXT    O  N N 25  
ARG H      H  N N 26  
ARG H2     H  N N 27  
ARG HA     H  N N 28  
ARG HB2    H  N N 29  
ARG HB3    H  N N 30  
ARG HG2    H  N N 31  
ARG HG3    H  N N 32  
ARG HD2    H  N N 33  
ARG HD3    H  N N 34  
ARG HE     H  N N 35  
ARG HH11   H  N N 36  
ARG HH12   H  N N 37  
ARG HH21   H  N N 38  
ARG HH22   H  N N 39  
ARG HXT    H  N N 40  
ASN N      N  N N 41  
ASN CA     C  N S 42  
ASN C      C  N N 43  
ASN O      O  N N 44  
ASN CB     C  N N 45  
ASN CG     C  N N 46  
ASN OD1    O  N N 47  
ASN ND2    N  N N 48  
ASN OXT    O  N N 49  
ASN H      H  N N 50  
ASN H2     H  N N 51  
ASN HA     H  N N 52  
ASN HB2    H  N N 53  
ASN HB3    H  N N 54  
ASN HD21   H  N N 55  
ASN HD22   H  N N 56  
ASN HXT    H  N N 57  
ASP N      N  N N 58  
ASP CA     C  N S 59  
ASP C      C  N N 60  
ASP O      O  N N 61  
ASP CB     C  N N 62  
ASP CG     C  N N 63  
ASP OD1    O  N N 64  
ASP OD2    O  N N 65  
ASP OXT    O  N N 66  
ASP H      H  N N 67  
ASP H2     H  N N 68  
ASP HA     H  N N 69  
ASP HB2    H  N N 70  
ASP HB3    H  N N 71  
ASP HD2    H  N N 72  
ASP HXT    H  N N 73  
CYS N      N  N N 74  
CYS CA     C  N R 75  
CYS C      C  N N 76  
CYS O      O  N N 77  
CYS CB     C  N N 78  
CYS SG     S  N N 79  
CYS OXT    O  N N 80  
CYS H      H  N N 81  
CYS H2     H  N N 82  
CYS HA     H  N N 83  
CYS HB2    H  N N 84  
CYS HB3    H  N N 85  
CYS HG     H  N N 86  
CYS HXT    H  N N 87  
DCQ O2     O  N N 88  
DCQ C2     C  N N 89  
DCQ C3     C  N N 90  
DCQ O3     O  N N 91  
DCQ C3M    C  N N 92  
DCQ C4     C  N N 93  
DCQ O4     O  N N 94  
DCQ C4M    C  N N 95  
DCQ C5     C  N N 96  
DCQ O5     O  N N 97  
DCQ C1     C  N N 98  
DCQ C1M    C  N N 99  
DCQ C6     C  N N 100 
DCQ C7     C  N N 101 
DCQ C8     C  N N 102 
DCQ C9     C  N N 103 
DCQ C10    C  N N 104 
DCQ C11    C  N N 105 
DCQ C12    C  N N 106 
DCQ C13    C  N N 107 
DCQ C14    C  N N 108 
DCQ C15    C  N N 109 
DCQ C16    C  N N 110 
DCQ H3M    H  N N 111 
DCQ H3MA   H  N N 112 
DCQ H3MB   H  N N 113 
DCQ H4M    H  N N 114 
DCQ H4MA   H  N N 115 
DCQ H4MB   H  N N 116 
DCQ H1M    H  N N 117 
DCQ H1MA   H  N N 118 
DCQ H1MB   H  N N 119 
DCQ H7     H  N N 120 
DCQ H7A    H  N N 121 
DCQ H8     H  N N 122 
DCQ H8A    H  N N 123 
DCQ H9     H  N N 124 
DCQ H9A    H  N N 125 
DCQ H10    H  N N 126 
DCQ H10A   H  N N 127 
DCQ H11    H  N N 128 
DCQ H11A   H  N N 129 
DCQ H12    H  N N 130 
DCQ H12A   H  N N 131 
DCQ H13    H  N N 132 
DCQ H13A   H  N N 133 
DCQ H14    H  N N 134 
DCQ H14A   H  N N 135 
DCQ H15    H  N N 136 
DCQ H15A   H  N N 137 
DCQ H16    H  N N 138 
DCQ H16A   H  N N 139 
DCQ H16B   H  N N 140 
FES FE1    FE N N 141 
FES FE2    FE N N 142 
FES S1     S  N N 143 
FES S2     S  N N 144 
FMN N1     N  N N 145 
FMN C2     C  N N 146 
FMN O2     O  N N 147 
FMN N3     N  N N 148 
FMN C4     C  N N 149 
FMN O4     O  N N 150 
FMN C4A    C  N N 151 
FMN N5     N  N N 152 
FMN C5A    C  Y N 153 
FMN C6     C  Y N 154 
FMN C7     C  Y N 155 
FMN C7M    C  N N 156 
FMN C8     C  Y N 157 
FMN C8M    C  N N 158 
FMN C9     C  Y N 159 
FMN C9A    C  Y N 160 
FMN N10    N  N N 161 
FMN C10    C  N N 162 
FMN "C1'"  C  N N 163 
FMN "C2'"  C  N S 164 
FMN "O2'"  O  N N 165 
FMN "C3'"  C  N S 166 
FMN "O3'"  O  N N 167 
FMN "C4'"  C  N R 168 
FMN "O4'"  O  N N 169 
FMN "C5'"  C  N N 170 
FMN "O5'"  O  N N 171 
FMN P      P  N N 172 
FMN O1P    O  N N 173 
FMN O2P    O  N N 174 
FMN O3P    O  N N 175 
FMN HN3    H  N N 176 
FMN H6     H  N N 177 
FMN HM71   H  N N 178 
FMN HM72   H  N N 179 
FMN HM73   H  N N 180 
FMN HM81   H  N N 181 
FMN HM82   H  N N 182 
FMN HM83   H  N N 183 
FMN H9     H  N N 184 
FMN "H1'1" H  N N 185 
FMN "H1'2" H  N N 186 
FMN "H2'"  H  N N 187 
FMN "HO2'" H  N N 188 
FMN "H3'"  H  N N 189 
FMN "HO3'" H  N N 190 
FMN "H4'"  H  N N 191 
FMN "HO4'" H  N N 192 
FMN "H5'1" H  N N 193 
FMN "H5'2" H  N N 194 
FMN HOP2   H  N N 195 
FMN HOP3   H  N N 196 
GLN N      N  N N 197 
GLN CA     C  N S 198 
GLN C      C  N N 199 
GLN O      O  N N 200 
GLN CB     C  N N 201 
GLN CG     C  N N 202 
GLN CD     C  N N 203 
GLN OE1    O  N N 204 
GLN NE2    N  N N 205 
GLN OXT    O  N N 206 
GLN H      H  N N 207 
GLN H2     H  N N 208 
GLN HA     H  N N 209 
GLN HB2    H  N N 210 
GLN HB3    H  N N 211 
GLN HG2    H  N N 212 
GLN HG3    H  N N 213 
GLN HE21   H  N N 214 
GLN HE22   H  N N 215 
GLN HXT    H  N N 216 
GLU N      N  N N 217 
GLU CA     C  N S 218 
GLU C      C  N N 219 
GLU O      O  N N 220 
GLU CB     C  N N 221 
GLU CG     C  N N 222 
GLU CD     C  N N 223 
GLU OE1    O  N N 224 
GLU OE2    O  N N 225 
GLU OXT    O  N N 226 
GLU H      H  N N 227 
GLU H2     H  N N 228 
GLU HA     H  N N 229 
GLU HB2    H  N N 230 
GLU HB3    H  N N 231 
GLU HG2    H  N N 232 
GLU HG3    H  N N 233 
GLU HE2    H  N N 234 
GLU HXT    H  N N 235 
GLY N      N  N N 236 
GLY CA     C  N N 237 
GLY C      C  N N 238 
GLY O      O  N N 239 
GLY OXT    O  N N 240 
GLY H      H  N N 241 
GLY H2     H  N N 242 
GLY HA2    H  N N 243 
GLY HA3    H  N N 244 
GLY HXT    H  N N 245 
HIS N      N  N N 246 
HIS CA     C  N S 247 
HIS C      C  N N 248 
HIS O      O  N N 249 
HIS CB     C  N N 250 
HIS CG     C  Y N 251 
HIS ND1    N  Y N 252 
HIS CD2    C  Y N 253 
HIS CE1    C  Y N 254 
HIS NE2    N  Y N 255 
HIS OXT    O  N N 256 
HIS H      H  N N 257 
HIS H2     H  N N 258 
HIS HA     H  N N 259 
HIS HB2    H  N N 260 
HIS HB3    H  N N 261 
HIS HD1    H  N N 262 
HIS HD2    H  N N 263 
HIS HE1    H  N N 264 
HIS HE2    H  N N 265 
HIS HXT    H  N N 266 
ILE N      N  N N 267 
ILE CA     C  N S 268 
ILE C      C  N N 269 
ILE O      O  N N 270 
ILE CB     C  N S 271 
ILE CG1    C  N N 272 
ILE CG2    C  N N 273 
ILE CD1    C  N N 274 
ILE OXT    O  N N 275 
ILE H      H  N N 276 
ILE H2     H  N N 277 
ILE HA     H  N N 278 
ILE HB     H  N N 279 
ILE HG12   H  N N 280 
ILE HG13   H  N N 281 
ILE HG21   H  N N 282 
ILE HG22   H  N N 283 
ILE HG23   H  N N 284 
ILE HD11   H  N N 285 
ILE HD12   H  N N 286 
ILE HD13   H  N N 287 
ILE HXT    H  N N 288 
LEU N      N  N N 289 
LEU CA     C  N S 290 
LEU C      C  N N 291 
LEU O      O  N N 292 
LEU CB     C  N N 293 
LEU CG     C  N N 294 
LEU CD1    C  N N 295 
LEU CD2    C  N N 296 
LEU OXT    O  N N 297 
LEU H      H  N N 298 
LEU H2     H  N N 299 
LEU HA     H  N N 300 
LEU HB2    H  N N 301 
LEU HB3    H  N N 302 
LEU HG     H  N N 303 
LEU HD11   H  N N 304 
LEU HD12   H  N N 305 
LEU HD13   H  N N 306 
LEU HD21   H  N N 307 
LEU HD22   H  N N 308 
LEU HD23   H  N N 309 
LEU HXT    H  N N 310 
LYS N      N  N N 311 
LYS CA     C  N S 312 
LYS C      C  N N 313 
LYS O      O  N N 314 
LYS CB     C  N N 315 
LYS CG     C  N N 316 
LYS CD     C  N N 317 
LYS CE     C  N N 318 
LYS NZ     N  N N 319 
LYS OXT    O  N N 320 
LYS H      H  N N 321 
LYS H2     H  N N 322 
LYS HA     H  N N 323 
LYS HB2    H  N N 324 
LYS HB3    H  N N 325 
LYS HG2    H  N N 326 
LYS HG3    H  N N 327 
LYS HD2    H  N N 328 
LYS HD3    H  N N 329 
LYS HE2    H  N N 330 
LYS HE3    H  N N 331 
LYS HZ1    H  N N 332 
LYS HZ2    H  N N 333 
LYS HZ3    H  N N 334 
LYS HXT    H  N N 335 
MET N      N  N N 336 
MET CA     C  N S 337 
MET C      C  N N 338 
MET O      O  N N 339 
MET CB     C  N N 340 
MET CG     C  N N 341 
MET SD     S  N N 342 
MET CE     C  N N 343 
MET OXT    O  N N 344 
MET H      H  N N 345 
MET H2     H  N N 346 
MET HA     H  N N 347 
MET HB2    H  N N 348 
MET HB3    H  N N 349 
MET HG2    H  N N 350 
MET HG3    H  N N 351 
MET HE1    H  N N 352 
MET HE2    H  N N 353 
MET HE3    H  N N 354 
MET HXT    H  N N 355 
PHE N      N  N N 356 
PHE CA     C  N S 357 
PHE C      C  N N 358 
PHE O      O  N N 359 
PHE CB     C  N N 360 
PHE CG     C  Y N 361 
PHE CD1    C  Y N 362 
PHE CD2    C  Y N 363 
PHE CE1    C  Y N 364 
PHE CE2    C  Y N 365 
PHE CZ     C  Y N 366 
PHE OXT    O  N N 367 
PHE H      H  N N 368 
PHE H2     H  N N 369 
PHE HA     H  N N 370 
PHE HB2    H  N N 371 
PHE HB3    H  N N 372 
PHE HD1    H  N N 373 
PHE HD2    H  N N 374 
PHE HE1    H  N N 375 
PHE HE2    H  N N 376 
PHE HZ     H  N N 377 
PHE HXT    H  N N 378 
PRO N      N  N N 379 
PRO CA     C  N S 380 
PRO C      C  N N 381 
PRO O      O  N N 382 
PRO CB     C  N N 383 
PRO CG     C  N N 384 
PRO CD     C  N N 385 
PRO OXT    O  N N 386 
PRO H      H  N N 387 
PRO HA     H  N N 388 
PRO HB2    H  N N 389 
PRO HB3    H  N N 390 
PRO HG2    H  N N 391 
PRO HG3    H  N N 392 
PRO HD2    H  N N 393 
PRO HD3    H  N N 394 
PRO HXT    H  N N 395 
SER N      N  N N 396 
SER CA     C  N S 397 
SER C      C  N N 398 
SER O      O  N N 399 
SER CB     C  N N 400 
SER OG     O  N N 401 
SER OXT    O  N N 402 
SER H      H  N N 403 
SER H2     H  N N 404 
SER HA     H  N N 405 
SER HB2    H  N N 406 
SER HB3    H  N N 407 
SER HG     H  N N 408 
SER HXT    H  N N 409 
SF4 FE1    FE N N 410 
SF4 FE2    FE N N 411 
SF4 FE3    FE N N 412 
SF4 FE4    FE N N 413 
SF4 S1     S  N N 414 
SF4 S2     S  N N 415 
SF4 S3     S  N N 416 
SF4 S4     S  N N 417 
THR N      N  N N 418 
THR CA     C  N S 419 
THR C      C  N N 420 
THR O      O  N N 421 
THR CB     C  N R 422 
THR OG1    O  N N 423 
THR CG2    C  N N 424 
THR OXT    O  N N 425 
THR H      H  N N 426 
THR H2     H  N N 427 
THR HA     H  N N 428 
THR HB     H  N N 429 
THR HG1    H  N N 430 
THR HG21   H  N N 431 
THR HG22   H  N N 432 
THR HG23   H  N N 433 
THR HXT    H  N N 434 
TRP N      N  N N 435 
TRP CA     C  N S 436 
TRP C      C  N N 437 
TRP O      O  N N 438 
TRP CB     C  N N 439 
TRP CG     C  Y N 440 
TRP CD1    C  Y N 441 
TRP CD2    C  Y N 442 
TRP NE1    N  Y N 443 
TRP CE2    C  Y N 444 
TRP CE3    C  Y N 445 
TRP CZ2    C  Y N 446 
TRP CZ3    C  Y N 447 
TRP CH2    C  Y N 448 
TRP OXT    O  N N 449 
TRP H      H  N N 450 
TRP H2     H  N N 451 
TRP HA     H  N N 452 
TRP HB2    H  N N 453 
TRP HB3    H  N N 454 
TRP HD1    H  N N 455 
TRP HE1    H  N N 456 
TRP HE3    H  N N 457 
TRP HZ2    H  N N 458 
TRP HZ3    H  N N 459 
TRP HH2    H  N N 460 
TRP HXT    H  N N 461 
TYR N      N  N N 462 
TYR CA     C  N S 463 
TYR C      C  N N 464 
TYR O      O  N N 465 
TYR CB     C  N N 466 
TYR CG     C  Y N 467 
TYR CD1    C  Y N 468 
TYR CD2    C  Y N 469 
TYR CE1    C  Y N 470 
TYR CE2    C  Y N 471 
TYR CZ     C  Y N 472 
TYR OH     O  N N 473 
TYR OXT    O  N N 474 
TYR H      H  N N 475 
TYR H2     H  N N 476 
TYR HA     H  N N 477 
TYR HB2    H  N N 478 
TYR HB3    H  N N 479 
TYR HD1    H  N N 480 
TYR HD2    H  N N 481 
TYR HE1    H  N N 482 
TYR HE2    H  N N 483 
TYR HH     H  N N 484 
TYR HXT    H  N N 485 
VAL N      N  N N 486 
VAL CA     C  N S 487 
VAL C      C  N N 488 
VAL O      O  N N 489 
VAL CB     C  N N 490 
VAL CG1    C  N N 491 
VAL CG2    C  N N 492 
VAL OXT    O  N N 493 
VAL H      H  N N 494 
VAL H2     H  N N 495 
VAL HA     H  N N 496 
VAL HB     H  N N 497 
VAL HG11   H  N N 498 
VAL HG12   H  N N 499 
VAL HG13   H  N N 500 
VAL HG21   H  N N 501 
VAL HG22   H  N N 502 
VAL HG23   H  N N 503 
VAL HXT    H  N N 504 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N     CA     sing N N 1   
ALA N     H      sing N N 2   
ALA N     H2     sing N N 3   
ALA CA    C      sing N N 4   
ALA CA    CB     sing N N 5   
ALA CA    HA     sing N N 6   
ALA C     O      doub N N 7   
ALA C     OXT    sing N N 8   
ALA CB    HB1    sing N N 9   
ALA CB    HB2    sing N N 10  
ALA CB    HB3    sing N N 11  
ALA OXT   HXT    sing N N 12  
ARG N     CA     sing N N 13  
ARG N     H      sing N N 14  
ARG N     H2     sing N N 15  
ARG CA    C      sing N N 16  
ARG CA    CB     sing N N 17  
ARG CA    HA     sing N N 18  
ARG C     O      doub N N 19  
ARG C     OXT    sing N N 20  
ARG CB    CG     sing N N 21  
ARG CB    HB2    sing N N 22  
ARG CB    HB3    sing N N 23  
ARG CG    CD     sing N N 24  
ARG CG    HG2    sing N N 25  
ARG CG    HG3    sing N N 26  
ARG CD    NE     sing N N 27  
ARG CD    HD2    sing N N 28  
ARG CD    HD3    sing N N 29  
ARG NE    CZ     sing N N 30  
ARG NE    HE     sing N N 31  
ARG CZ    NH1    sing N N 32  
ARG CZ    NH2    doub N N 33  
ARG NH1   HH11   sing N N 34  
ARG NH1   HH12   sing N N 35  
ARG NH2   HH21   sing N N 36  
ARG NH2   HH22   sing N N 37  
ARG OXT   HXT    sing N N 38  
ASN N     CA     sing N N 39  
ASN N     H      sing N N 40  
ASN N     H2     sing N N 41  
ASN CA    C      sing N N 42  
ASN CA    CB     sing N N 43  
ASN CA    HA     sing N N 44  
ASN C     O      doub N N 45  
ASN C     OXT    sing N N 46  
ASN CB    CG     sing N N 47  
ASN CB    HB2    sing N N 48  
ASN CB    HB3    sing N N 49  
ASN CG    OD1    doub N N 50  
ASN CG    ND2    sing N N 51  
ASN ND2   HD21   sing N N 52  
ASN ND2   HD22   sing N N 53  
ASN OXT   HXT    sing N N 54  
ASP N     CA     sing N N 55  
ASP N     H      sing N N 56  
ASP N     H2     sing N N 57  
ASP CA    C      sing N N 58  
ASP CA    CB     sing N N 59  
ASP CA    HA     sing N N 60  
ASP C     O      doub N N 61  
ASP C     OXT    sing N N 62  
ASP CB    CG     sing N N 63  
ASP CB    HB2    sing N N 64  
ASP CB    HB3    sing N N 65  
ASP CG    OD1    doub N N 66  
ASP CG    OD2    sing N N 67  
ASP OD2   HD2    sing N N 68  
ASP OXT   HXT    sing N N 69  
CYS N     CA     sing N N 70  
CYS N     H      sing N N 71  
CYS N     H2     sing N N 72  
CYS CA    C      sing N N 73  
CYS CA    CB     sing N N 74  
CYS CA    HA     sing N N 75  
CYS C     O      doub N N 76  
CYS C     OXT    sing N N 77  
CYS CB    SG     sing N N 78  
CYS CB    HB2    sing N N 79  
CYS CB    HB3    sing N N 80  
CYS SG    HG     sing N N 81  
CYS OXT   HXT    sing N N 82  
DCQ O2    C2     doub N N 83  
DCQ C2    C3     sing N N 84  
DCQ C2    C1     sing N N 85  
DCQ C3    O3     sing N N 86  
DCQ C3    C4     doub N N 87  
DCQ O3    C3M    sing N N 88  
DCQ C4    O4     sing N N 89  
DCQ C4    C5     sing N N 90  
DCQ O4    C4M    sing N N 91  
DCQ C5    O5     doub N N 92  
DCQ C5    C6     sing N N 93  
DCQ C1    C1M    sing N N 94  
DCQ C1    C6     doub N N 95  
DCQ C6    C7     sing N N 96  
DCQ C7    C8     sing N N 97  
DCQ C8    C9     sing N N 98  
DCQ C9    C10    sing N N 99  
DCQ C10   C11    sing N N 100 
DCQ C11   C12    sing N N 101 
DCQ C12   C13    sing N N 102 
DCQ C13   C14    sing N N 103 
DCQ C14   C15    sing N N 104 
DCQ C15   C16    sing N N 105 
DCQ C3M   H3M    sing N N 106 
DCQ C3M   H3MA   sing N N 107 
DCQ C3M   H3MB   sing N N 108 
DCQ C4M   H4M    sing N N 109 
DCQ C4M   H4MA   sing N N 110 
DCQ C4M   H4MB   sing N N 111 
DCQ C1M   H1M    sing N N 112 
DCQ C1M   H1MA   sing N N 113 
DCQ C1M   H1MB   sing N N 114 
DCQ C7    H7     sing N N 115 
DCQ C7    H7A    sing N N 116 
DCQ C8    H8     sing N N 117 
DCQ C8    H8A    sing N N 118 
DCQ C9    H9     sing N N 119 
DCQ C9    H9A    sing N N 120 
DCQ C10   H10    sing N N 121 
DCQ C10   H10A   sing N N 122 
DCQ C11   H11    sing N N 123 
DCQ C11   H11A   sing N N 124 
DCQ C12   H12    sing N N 125 
DCQ C12   H12A   sing N N 126 
DCQ C13   H13    sing N N 127 
DCQ C13   H13A   sing N N 128 
DCQ C14   H14    sing N N 129 
DCQ C14   H14A   sing N N 130 
DCQ C15   H15    sing N N 131 
DCQ C15   H15A   sing N N 132 
DCQ C16   H16    sing N N 133 
DCQ C16   H16A   sing N N 134 
DCQ C16   H16B   sing N N 135 
FES FE1   S1     sing N N 136 
FES FE1   S2     sing N N 137 
FES FE2   S1     sing N N 138 
FES FE2   S2     sing N N 139 
FMN N1    C2     sing N N 140 
FMN N1    C10    doub N N 141 
FMN C2    O2     doub N N 142 
FMN C2    N3     sing N N 143 
FMN N3    C4     sing N N 144 
FMN N3    HN3    sing N N 145 
FMN C4    O4     doub N N 146 
FMN C4    C4A    sing N N 147 
FMN C4A   N5     doub N N 148 
FMN C4A   C10    sing N N 149 
FMN N5    C5A    sing N N 150 
FMN C5A   C6     doub Y N 151 
FMN C5A   C9A    sing Y N 152 
FMN C6    C7     sing Y N 153 
FMN C6    H6     sing N N 154 
FMN C7    C7M    sing N N 155 
FMN C7    C8     doub Y N 156 
FMN C7M   HM71   sing N N 157 
FMN C7M   HM72   sing N N 158 
FMN C7M   HM73   sing N N 159 
FMN C8    C8M    sing N N 160 
FMN C8    C9     sing Y N 161 
FMN C8M   HM81   sing N N 162 
FMN C8M   HM82   sing N N 163 
FMN C8M   HM83   sing N N 164 
FMN C9    C9A    doub Y N 165 
FMN C9    H9     sing N N 166 
FMN C9A   N10    sing N N 167 
FMN N10   C10    sing N N 168 
FMN N10   "C1'"  sing N N 169 
FMN "C1'" "C2'"  sing N N 170 
FMN "C1'" "H1'1" sing N N 171 
FMN "C1'" "H1'2" sing N N 172 
FMN "C2'" "O2'"  sing N N 173 
FMN "C2'" "C3'"  sing N N 174 
FMN "C2'" "H2'"  sing N N 175 
FMN "O2'" "HO2'" sing N N 176 
FMN "C3'" "O3'"  sing N N 177 
FMN "C3'" "C4'"  sing N N 178 
FMN "C3'" "H3'"  sing N N 179 
FMN "O3'" "HO3'" sing N N 180 
FMN "C4'" "O4'"  sing N N 181 
FMN "C4'" "C5'"  sing N N 182 
FMN "C4'" "H4'"  sing N N 183 
FMN "O4'" "HO4'" sing N N 184 
FMN "C5'" "O5'"  sing N N 185 
FMN "C5'" "H5'1" sing N N 186 
FMN "C5'" "H5'2" sing N N 187 
FMN "O5'" P      sing N N 188 
FMN P     O1P    doub N N 189 
FMN P     O2P    sing N N 190 
FMN P     O3P    sing N N 191 
FMN O2P   HOP2   sing N N 192 
FMN O3P   HOP3   sing N N 193 
GLN N     CA     sing N N 194 
GLN N     H      sing N N 195 
GLN N     H2     sing N N 196 
GLN CA    C      sing N N 197 
GLN CA    CB     sing N N 198 
GLN CA    HA     sing N N 199 
GLN C     O      doub N N 200 
GLN C     OXT    sing N N 201 
GLN CB    CG     sing N N 202 
GLN CB    HB2    sing N N 203 
GLN CB    HB3    sing N N 204 
GLN CG    CD     sing N N 205 
GLN CG    HG2    sing N N 206 
GLN CG    HG3    sing N N 207 
GLN CD    OE1    doub N N 208 
GLN CD    NE2    sing N N 209 
GLN NE2   HE21   sing N N 210 
GLN NE2   HE22   sing N N 211 
GLN OXT   HXT    sing N N 212 
GLU N     CA     sing N N 213 
GLU N     H      sing N N 214 
GLU N     H2     sing N N 215 
GLU CA    C      sing N N 216 
GLU CA    CB     sing N N 217 
GLU CA    HA     sing N N 218 
GLU C     O      doub N N 219 
GLU C     OXT    sing N N 220 
GLU CB    CG     sing N N 221 
GLU CB    HB2    sing N N 222 
GLU CB    HB3    sing N N 223 
GLU CG    CD     sing N N 224 
GLU CG    HG2    sing N N 225 
GLU CG    HG3    sing N N 226 
GLU CD    OE1    doub N N 227 
GLU CD    OE2    sing N N 228 
GLU OE2   HE2    sing N N 229 
GLU OXT   HXT    sing N N 230 
GLY N     CA     sing N N 231 
GLY N     H      sing N N 232 
GLY N     H2     sing N N 233 
GLY CA    C      sing N N 234 
GLY CA    HA2    sing N N 235 
GLY CA    HA3    sing N N 236 
GLY C     O      doub N N 237 
GLY C     OXT    sing N N 238 
GLY OXT   HXT    sing N N 239 
HIS N     CA     sing N N 240 
HIS N     H      sing N N 241 
HIS N     H2     sing N N 242 
HIS CA    C      sing N N 243 
HIS CA    CB     sing N N 244 
HIS CA    HA     sing N N 245 
HIS C     O      doub N N 246 
HIS C     OXT    sing N N 247 
HIS CB    CG     sing N N 248 
HIS CB    HB2    sing N N 249 
HIS CB    HB3    sing N N 250 
HIS CG    ND1    sing Y N 251 
HIS CG    CD2    doub Y N 252 
HIS ND1   CE1    doub Y N 253 
HIS ND1   HD1    sing N N 254 
HIS CD2   NE2    sing Y N 255 
HIS CD2   HD2    sing N N 256 
HIS CE1   NE2    sing Y N 257 
HIS CE1   HE1    sing N N 258 
HIS NE2   HE2    sing N N 259 
HIS OXT   HXT    sing N N 260 
ILE N     CA     sing N N 261 
ILE N     H      sing N N 262 
ILE N     H2     sing N N 263 
ILE CA    C      sing N N 264 
ILE CA    CB     sing N N 265 
ILE CA    HA     sing N N 266 
ILE C     O      doub N N 267 
ILE C     OXT    sing N N 268 
ILE CB    CG1    sing N N 269 
ILE CB    CG2    sing N N 270 
ILE CB    HB     sing N N 271 
ILE CG1   CD1    sing N N 272 
ILE CG1   HG12   sing N N 273 
ILE CG1   HG13   sing N N 274 
ILE CG2   HG21   sing N N 275 
ILE CG2   HG22   sing N N 276 
ILE CG2   HG23   sing N N 277 
ILE CD1   HD11   sing N N 278 
ILE CD1   HD12   sing N N 279 
ILE CD1   HD13   sing N N 280 
ILE OXT   HXT    sing N N 281 
LEU N     CA     sing N N 282 
LEU N     H      sing N N 283 
LEU N     H2     sing N N 284 
LEU CA    C      sing N N 285 
LEU CA    CB     sing N N 286 
LEU CA    HA     sing N N 287 
LEU C     O      doub N N 288 
LEU C     OXT    sing N N 289 
LEU CB    CG     sing N N 290 
LEU CB    HB2    sing N N 291 
LEU CB    HB3    sing N N 292 
LEU CG    CD1    sing N N 293 
LEU CG    CD2    sing N N 294 
LEU CG    HG     sing N N 295 
LEU CD1   HD11   sing N N 296 
LEU CD1   HD12   sing N N 297 
LEU CD1   HD13   sing N N 298 
LEU CD2   HD21   sing N N 299 
LEU CD2   HD22   sing N N 300 
LEU CD2   HD23   sing N N 301 
LEU OXT   HXT    sing N N 302 
LYS N     CA     sing N N 303 
LYS N     H      sing N N 304 
LYS N     H2     sing N N 305 
LYS CA    C      sing N N 306 
LYS CA    CB     sing N N 307 
LYS CA    HA     sing N N 308 
LYS C     O      doub N N 309 
LYS C     OXT    sing N N 310 
LYS CB    CG     sing N N 311 
LYS CB    HB2    sing N N 312 
LYS CB    HB3    sing N N 313 
LYS CG    CD     sing N N 314 
LYS CG    HG2    sing N N 315 
LYS CG    HG3    sing N N 316 
LYS CD    CE     sing N N 317 
LYS CD    HD2    sing N N 318 
LYS CD    HD3    sing N N 319 
LYS CE    NZ     sing N N 320 
LYS CE    HE2    sing N N 321 
LYS CE    HE3    sing N N 322 
LYS NZ    HZ1    sing N N 323 
LYS NZ    HZ2    sing N N 324 
LYS NZ    HZ3    sing N N 325 
LYS OXT   HXT    sing N N 326 
MET N     CA     sing N N 327 
MET N     H      sing N N 328 
MET N     H2     sing N N 329 
MET CA    C      sing N N 330 
MET CA    CB     sing N N 331 
MET CA    HA     sing N N 332 
MET C     O      doub N N 333 
MET C     OXT    sing N N 334 
MET CB    CG     sing N N 335 
MET CB    HB2    sing N N 336 
MET CB    HB3    sing N N 337 
MET CG    SD     sing N N 338 
MET CG    HG2    sing N N 339 
MET CG    HG3    sing N N 340 
MET SD    CE     sing N N 341 
MET CE    HE1    sing N N 342 
MET CE    HE2    sing N N 343 
MET CE    HE3    sing N N 344 
MET OXT   HXT    sing N N 345 
PHE N     CA     sing N N 346 
PHE N     H      sing N N 347 
PHE N     H2     sing N N 348 
PHE CA    C      sing N N 349 
PHE CA    CB     sing N N 350 
PHE CA    HA     sing N N 351 
PHE C     O      doub N N 352 
PHE C     OXT    sing N N 353 
PHE CB    CG     sing N N 354 
PHE CB    HB2    sing N N 355 
PHE CB    HB3    sing N N 356 
PHE CG    CD1    doub Y N 357 
PHE CG    CD2    sing Y N 358 
PHE CD1   CE1    sing Y N 359 
PHE CD1   HD1    sing N N 360 
PHE CD2   CE2    doub Y N 361 
PHE CD2   HD2    sing N N 362 
PHE CE1   CZ     doub Y N 363 
PHE CE1   HE1    sing N N 364 
PHE CE2   CZ     sing Y N 365 
PHE CE2   HE2    sing N N 366 
PHE CZ    HZ     sing N N 367 
PHE OXT   HXT    sing N N 368 
PRO N     CA     sing N N 369 
PRO N     CD     sing N N 370 
PRO N     H      sing N N 371 
PRO CA    C      sing N N 372 
PRO CA    CB     sing N N 373 
PRO CA    HA     sing N N 374 
PRO C     O      doub N N 375 
PRO C     OXT    sing N N 376 
PRO CB    CG     sing N N 377 
PRO CB    HB2    sing N N 378 
PRO CB    HB3    sing N N 379 
PRO CG    CD     sing N N 380 
PRO CG    HG2    sing N N 381 
PRO CG    HG3    sing N N 382 
PRO CD    HD2    sing N N 383 
PRO CD    HD3    sing N N 384 
PRO OXT   HXT    sing N N 385 
SER N     CA     sing N N 386 
SER N     H      sing N N 387 
SER N     H2     sing N N 388 
SER CA    C      sing N N 389 
SER CA    CB     sing N N 390 
SER CA    HA     sing N N 391 
SER C     O      doub N N 392 
SER C     OXT    sing N N 393 
SER CB    OG     sing N N 394 
SER CB    HB2    sing N N 395 
SER CB    HB3    sing N N 396 
SER OG    HG     sing N N 397 
SER OXT   HXT    sing N N 398 
SF4 FE1   S2     sing N N 399 
SF4 FE1   S3     sing N N 400 
SF4 FE1   S4     sing N N 401 
SF4 FE2   S1     sing N N 402 
SF4 FE2   S3     sing N N 403 
SF4 FE2   S4     sing N N 404 
SF4 FE3   S1     sing N N 405 
SF4 FE3   S2     sing N N 406 
SF4 FE3   S4     sing N N 407 
SF4 FE4   S1     sing N N 408 
SF4 FE4   S2     sing N N 409 
SF4 FE4   S3     sing N N 410 
THR N     CA     sing N N 411 
THR N     H      sing N N 412 
THR N     H2     sing N N 413 
THR CA    C      sing N N 414 
THR CA    CB     sing N N 415 
THR CA    HA     sing N N 416 
THR C     O      doub N N 417 
THR C     OXT    sing N N 418 
THR CB    OG1    sing N N 419 
THR CB    CG2    sing N N 420 
THR CB    HB     sing N N 421 
THR OG1   HG1    sing N N 422 
THR CG2   HG21   sing N N 423 
THR CG2   HG22   sing N N 424 
THR CG2   HG23   sing N N 425 
THR OXT   HXT    sing N N 426 
TRP N     CA     sing N N 427 
TRP N     H      sing N N 428 
TRP N     H2     sing N N 429 
TRP CA    C      sing N N 430 
TRP CA    CB     sing N N 431 
TRP CA    HA     sing N N 432 
TRP C     O      doub N N 433 
TRP C     OXT    sing N N 434 
TRP CB    CG     sing N N 435 
TRP CB    HB2    sing N N 436 
TRP CB    HB3    sing N N 437 
TRP CG    CD1    doub Y N 438 
TRP CG    CD2    sing Y N 439 
TRP CD1   NE1    sing Y N 440 
TRP CD1   HD1    sing N N 441 
TRP CD2   CE2    doub Y N 442 
TRP CD2   CE3    sing Y N 443 
TRP NE1   CE2    sing Y N 444 
TRP NE1   HE1    sing N N 445 
TRP CE2   CZ2    sing Y N 446 
TRP CE3   CZ3    doub Y N 447 
TRP CE3   HE3    sing N N 448 
TRP CZ2   CH2    doub Y N 449 
TRP CZ2   HZ2    sing N N 450 
TRP CZ3   CH2    sing Y N 451 
TRP CZ3   HZ3    sing N N 452 
TRP CH2   HH2    sing N N 453 
TRP OXT   HXT    sing N N 454 
TYR N     CA     sing N N 455 
TYR N     H      sing N N 456 
TYR N     H2     sing N N 457 
TYR CA    C      sing N N 458 
TYR CA    CB     sing N N 459 
TYR CA    HA     sing N N 460 
TYR C     O      doub N N 461 
TYR C     OXT    sing N N 462 
TYR CB    CG     sing N N 463 
TYR CB    HB2    sing N N 464 
TYR CB    HB3    sing N N 465 
TYR CG    CD1    doub Y N 466 
TYR CG    CD2    sing Y N 467 
TYR CD1   CE1    sing Y N 468 
TYR CD1   HD1    sing N N 469 
TYR CD2   CE2    doub Y N 470 
TYR CD2   HD2    sing N N 471 
TYR CE1   CZ     doub Y N 472 
TYR CE1   HE1    sing N N 473 
TYR CE2   CZ     sing Y N 474 
TYR CE2   HE2    sing N N 475 
TYR CZ    OH     sing N N 476 
TYR OH    HH     sing N N 477 
TYR OXT   HXT    sing N N 478 
VAL N     CA     sing N N 479 
VAL N     H      sing N N 480 
VAL N     H2     sing N N 481 
VAL CA    C      sing N N 482 
VAL CA    CB     sing N N 483 
VAL CA    HA     sing N N 484 
VAL C     O      doub N N 485 
VAL C     OXT    sing N N 486 
VAL CB    CG1    sing N N 487 
VAL CB    CG2    sing N N 488 
VAL CB    HB     sing N N 489 
VAL CG1   HG11   sing N N 490 
VAL CG1   HG12   sing N N 491 
VAL CG1   HG13   sing N N 492 
VAL CG2   HG21   sing N N 493 
VAL CG2   HG22   sing N N 494 
VAL CG2   HG23   sing N N 495 
VAL OXT   HXT    sing N N 496 
# 
_pdbx_audit_support.funding_organization   'Medical Research Council (United Kingdom)' 
_pdbx_audit_support.country                'United Kingdom' 
_pdbx_audit_support.grant_number           MC_U105674180 
_pdbx_audit_support.ordinal                1 
# 
_pdbx_entity_instance_feature.ordinal        1 
_pdbx_entity_instance_feature.comp_id        DCQ 
_pdbx_entity_instance_feature.asym_id        ? 
_pdbx_entity_instance_feature.seq_num        ? 
_pdbx_entity_instance_feature.auth_comp_id   DCQ 
_pdbx_entity_instance_feature.auth_asym_id   ? 
_pdbx_entity_instance_feature.auth_seq_num   ? 
_pdbx_entity_instance_feature.feature_type   'SUBJECT OF INVESTIGATION' 
_pdbx_entity_instance_feature.details        ? 
# 
_pdbx_initial_refinement_model.id               1 
_pdbx_initial_refinement_model.entity_id_list   ? 
_pdbx_initial_refinement_model.type             'experimental model' 
_pdbx_initial_refinement_model.source_name      PDB 
_pdbx_initial_refinement_model.accession_code   4HEA 
_pdbx_initial_refinement_model.details          ? 
# 
_pdbx_reflns_twin.domain_id    1 
_pdbx_reflns_twin.crystal_id   1 
_pdbx_reflns_twin.diffrn_id    1 
_pdbx_reflns_twin.type         ? 
_pdbx_reflns_twin.operator     -H,-K,H+L 
_pdbx_reflns_twin.fraction     0.490 
# 
_atom_sites.entry_id                    6I0D 
_atom_sites.fract_transf_matrix[1][1]   0.010560 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001938 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.003049 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003897 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
FE 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . THR A  1  2   ? 64.696  -5.755  405.415 1.00 121.36 ? 2   THR 1 N     1 
ATOM   2     C  CA    . THR A  1  2   ? 64.216  -5.957  404.051 1.00 120.39 ? 2   THR 1 CA    1 
ATOM   3     C  C     . THR A  1  2   ? 65.224  -5.375  403.062 1.00 118.46 ? 2   THR 1 C     1 
ATOM   4     O  O     . THR A  1  2   ? 65.990  -4.477  403.410 1.00 119.49 ? 2   THR 1 O     1 
ATOM   5     C  CB    . THR A  1  2   ? 62.831  -5.306  403.836 1.00 120.64 ? 2   THR 1 CB    1 
ATOM   6     O  OG1   . THR A  1  2   ? 62.035  -5.471  405.016 1.00 120.44 ? 2   THR 1 OG1   1 
ATOM   7     C  CG2   . THR A  1  2   ? 62.109  -5.952  402.661 1.00 120.63 ? 2   THR 1 CG2   1 
ATOM   8     N  N     . GLY A  1  3   ? 65.234  -5.897  401.837 1.00 115.83 ? 3   GLY 1 N     1 
ATOM   9     C  CA    . GLY A  1  3   ? 66.118  -5.394  400.813 1.00 113.21 ? 3   GLY 1 CA    1 
ATOM   10    C  C     . GLY A  1  3   ? 65.899  -3.924  400.522 1.00 111.81 ? 3   GLY 1 C     1 
ATOM   11    O  O     . GLY A  1  3   ? 64.766  -3.453  400.373 1.00 111.24 ? 3   GLY 1 O     1 
ATOM   12    N  N     . PRO A  1  4   ? 66.998  -3.163  400.435 1.00 110.49 ? 4   PRO 1 N     1 
ATOM   13    C  CA    . PRO A  1  4   ? 66.882  -1.705  400.285 1.00 114.64 ? 4   PRO 1 CA    1 
ATOM   14    C  C     . PRO A  1  4   ? 66.369  -1.277  398.917 1.00 118.66 ? 4   PRO 1 C     1 
ATOM   15    O  O     . PRO A  1  4   ? 67.142  -0.754  398.108 1.00 120.52 ? 4   PRO 1 O     1 
ATOM   16    C  CB    . PRO A  1  4   ? 68.317  -1.211  400.523 1.00 111.50 ? 4   PRO 1 CB    1 
ATOM   17    C  CG    . PRO A  1  4   ? 69.016  -2.339  401.225 1.00 108.73 ? 4   PRO 1 CG    1 
ATOM   18    C  CD    . PRO A  1  4   ? 68.381  -3.588  400.705 1.00 108.40 ? 4   PRO 1 CD    1 
ATOM   19    N  N     . ILE A  1  5   ? 65.076  -1.473  398.658 1.00 119.31 ? 5   ILE 1 N     1 
ATOM   20    C  CA    . ILE A  1  5   ? 64.433  -1.023  397.422 1.00 118.14 ? 5   ILE 1 CA    1 
ATOM   21    C  C     . ILE A  1  5   ? 62.972  -0.719  397.722 1.00 119.58 ? 5   ILE 1 C     1 
ATOM   22    O  O     . ILE A  1  5   ? 62.255  -1.563  398.267 1.00 121.30 ? 5   ILE 1 O     1 
ATOM   23    C  CB    . ILE A  1  5   ? 64.526  -2.071  396.290 1.00 114.88 ? 5   ILE 1 CB    1 
ATOM   24    C  CG1   . ILE A  1  5   ? 65.909  -2.072  395.639 1.00 112.76 ? 5   ILE 1 CG1   1 
ATOM   25    C  CG2   . ILE A  1  5   ? 63.460  -1.817  395.233 1.00 114.42 ? 5   ILE 1 CG2   1 
ATOM   26    C  CD1   . ILE A  1  5   ? 66.135  -3.227  394.680 1.00 110.20 ? 5   ILE 1 CD1   1 
ATOM   27    N  N     . LEU A  1  6   ? 62.533  0.490   397.377 1.00 120.51 ? 6   LEU 1 N     1 
ATOM   28    C  CA    . LEU A  1  6   ? 61.156  0.911   397.606 1.00 121.61 ? 6   LEU 1 CA    1 
ATOM   29    C  C     . LEU A  1  6   ? 60.347  0.679   396.335 1.00 115.78 ? 6   LEU 1 C     1 
ATOM   30    O  O     . LEU A  1  6   ? 60.630  1.282   395.293 1.00 114.89 ? 6   LEU 1 O     1 
ATOM   31    C  CB    . LEU A  1  6   ? 61.096  2.379   398.024 1.00 130.82 ? 6   LEU 1 CB    1 
ATOM   32    C  CG    . LEU A  1  6   ? 61.741  2.742   399.361 1.00 134.82 ? 6   LEU 1 CG    1 
ATOM   33    C  CD1   . LEU A  1  6   ? 61.932  4.246   399.490 1.00 139.27 ? 6   LEU 1 CD1   1 
ATOM   34    C  CD2   . LEU A  1  6   ? 60.895  2.212   400.505 1.00 137.44 ? 6   LEU 1 CD2   1 
ATOM   35    N  N     . SER A  1  7   ? 59.349  -0.203  396.418 1.00 109.59 ? 7   SER 1 N     1 
ATOM   36    C  CA    . SER A  1  7   ? 58.495  -0.500  395.276 1.00 103.44 ? 7   SER 1 CA    1 
ATOM   37    C  C     . SER A  1  7   ? 57.011  -0.516  395.629 1.00 101.95 ? 7   SER 1 C     1 
ATOM   38    O  O     . SER A  1  7   ? 56.202  -0.962  394.807 1.00 101.19 ? 7   SER 1 O     1 
ATOM   39    C  CB    . SER A  1  7   ? 58.895  -1.839  394.643 1.00 98.98  ? 7   SER 1 CB    1 
ATOM   40    O  OG    . SER A  1  7   ? 60.272  -1.852  394.310 1.00 96.01  ? 7   SER 1 OG    1 
ATOM   41    N  N     . GLY A  1  8   ? 56.630  -0.049  396.816 1.00 100.47 ? 8   GLY 1 N     1 
ATOM   42    C  CA    . GLY A  1  8   ? 55.230  -0.063  397.199 1.00 96.59  ? 8   GLY 1 CA    1 
ATOM   43    C  C     . GLY A  1  8   ? 54.936  0.435   398.599 1.00 92.34  ? 8   GLY 1 C     1 
ATOM   44    O  O     . GLY A  1  8   ? 55.442  1.478   399.023 1.00 87.90  ? 8   GLY 1 O     1 
ATOM   45    N  N     . LEU A  1  9   ? 54.113  -0.318  399.332 1.00 94.58  ? 9   LEU 1 N     1 
ATOM   46    C  CA    . LEU A  1  9   ? 53.655  0.062   400.663 1.00 95.29  ? 9   LEU 1 CA    1 
ATOM   47    C  C     . LEU A  1  9   ? 54.521  -0.532  401.774 1.00 101.98 ? 9   LEU 1 C     1 
ATOM   48    O  O     . LEU A  1  9   ? 54.013  -0.856  402.856 1.00 104.57 ? 9   LEU 1 O     1 
ATOM   49    C  CB    . LEU A  1  9   ? 52.186  -0.334  400.834 1.00 91.75  ? 9   LEU 1 CB    1 
ATOM   50    C  CG    . LEU A  1  9   ? 51.389  0.215   402.023 1.00 89.26  ? 9   LEU 1 CG    1 
ATOM   51    C  CD1   . LEU A  1  9   ? 51.701  1.685   402.256 1.00 88.47  ? 9   LEU 1 CD1   1 
ATOM   52    C  CD2   . LEU A  1  9   ? 49.895  -0.006  401.827 1.00 88.27  ? 9   LEU 1 CD2   1 
ATOM   53    N  N     . ASP A  1  10  ? 55.811  -0.713  401.525 1.00 106.12 ? 10  ASP 1 N     1 
ATOM   54    C  CA    . ASP A  1  10  ? 56.719  -1.094  402.594 1.00 108.90 ? 10  ASP 1 CA    1 
ATOM   55    C  C     . ASP A  1  10  ? 56.664  -0.031  403.691 1.00 115.32 ? 10  ASP 1 C     1 
ATOM   56    O  O     . ASP A  1  10  ? 56.603  1.167   403.385 1.00 115.09 ? 10  ASP 1 O     1 
ATOM   57    C  CB    . ASP A  1  10  ? 58.144  -1.245  402.054 1.00 102.93 ? 10  ASP 1 CB    1 
ATOM   58    C  CG    . ASP A  1  10  ? 58.945  -2.305  402.792 1.00 96.50  ? 10  ASP 1 CG    1 
ATOM   59    O  OD1   . ASP A  1  10  ? 58.378  -3.376  403.093 1.00 93.75  ? 10  ASP 1 OD1   1 
ATOM   60    O  OD2   . ASP A  1  10  ? 60.143  -2.077  403.063 1.00 94.05  ? 10  ASP 1 OD2   1 
ATOM   61    N  N     . PRO A  1  11  ? 56.671  -0.421  404.971 1.00 121.30 ? 11  PRO 1 N     1 
ATOM   62    C  CA    . PRO A  1  11  ? 56.399  0.559   406.038 1.00 127.40 ? 11  PRO 1 CA    1 
ATOM   63    C  C     . PRO A  1  11  ? 57.436  1.668   406.138 1.00 137.80 ? 11  PRO 1 C     1 
ATOM   64    O  O     . PRO A  1  11  ? 57.230  2.617   406.907 1.00 139.52 ? 11  PRO 1 O     1 
ATOM   65    C  CB    . PRO A  1  11  ? 56.370  -0.300  407.308 1.00 125.57 ? 11  PRO 1 CB    1 
ATOM   66    C  CG    . PRO A  1  11  ? 57.195  -1.490  406.980 1.00 123.46 ? 11  PRO 1 CG    1 
ATOM   67    C  CD    . PRO A  1  11  ? 57.013  -1.749  405.510 1.00 122.05 ? 11  PRO 1 CD    1 
ATOM   68    N  N     . ARG A  1  12  ? 58.524  1.588   405.377 1.00 145.76 ? 12  ARG 1 N     1 
ATOM   69    C  CA    . ARG A  1  12  ? 59.509  2.655   405.292 1.00 156.08 ? 12  ARG 1 CA    1 
ATOM   70    C  C     . ARG A  1  12  ? 59.103  3.728   404.292 1.00 167.47 ? 12  ARG 1 C     1 
ATOM   71    O  O     . ARG A  1  12  ? 59.884  4.654   404.042 1.00 168.40 ? 12  ARG 1 O     1 
ATOM   72    C  CB    . ARG A  1  12  ? 60.873  2.071   404.916 1.00 152.59 ? 12  ARG 1 CB    1 
ATOM   73    C  CG    . ARG A  1  12  ? 60.774  0.868   403.990 1.00 147.02 ? 12  ARG 1 CG    1 
ATOM   74    C  CD    . ARG A  1  12  ? 62.132  0.431   403.471 1.00 140.69 ? 12  ARG 1 CD    1 
ATOM   75    N  NE    . ARG A  1  12  ? 62.010  -0.569  402.414 1.00 133.95 ? 12  ARG 1 NE    1 
ATOM   76    C  CZ    . ARG A  1  12  ? 62.986  -0.889  401.572 1.00 129.82 ? 12  ARG 1 CZ    1 
ATOM   77    N  NH1   . ARG A  1  12  ? 64.164  -0.288  401.662 1.00 129.67 ? 12  ARG 1 NH1   1 
ATOM   78    N  NH2   . ARG A  1  12  ? 62.787  -1.815  400.644 1.00 127.55 ? 12  ARG 1 NH2   1 
ATOM   79    N  N     . PHE A  1  13  ? 57.907  3.613   403.717 1.00 178.48 ? 13  PHE 1 N     1 
ATOM   80    C  CA    . PHE A  1  13  ? 57.396  4.618   402.795 1.00 185.43 ? 13  PHE 1 CA    1 
ATOM   81    C  C     . PHE A  1  13  ? 56.991  5.887   403.538 1.00 187.76 ? 13  PHE 1 C     1 
ATOM   82    O  O     . PHE A  1  13  ? 56.308  5.833   404.566 1.00 187.62 ? 13  PHE 1 O     1 
ATOM   83    C  CB    . PHE A  1  13  ? 56.204  4.066   402.018 1.00 191.78 ? 13  PHE 1 CB    1 
ATOM   84    C  CG    . PHE A  1  13  ? 55.475  5.106   401.228 1.00 195.72 ? 13  PHE 1 CG    1 
ATOM   85    C  CD1   . PHE A  1  13  ? 56.099  5.756   400.178 1.00 197.66 ? 13  PHE 1 CD1   1 
ATOM   86    C  CD2   . PHE A  1  13  ? 54.174  5.450   401.546 1.00 196.78 ? 13  PHE 1 CD2   1 
ATOM   87    C  CE1   . PHE A  1  13  ? 55.434  6.720   399.455 1.00 198.82 ? 13  PHE 1 CE1   1 
ATOM   88    C  CE2   . PHE A  1  13  ? 53.507  6.413   400.822 1.00 197.16 ? 13  PHE 1 CE2   1 
ATOM   89    C  CZ    . PHE A  1  13  ? 54.140  7.050   399.782 1.00 197.10 ? 13  PHE 1 CZ    1 
ATOM   90    N  N     . GLU A  1  14  ? 57.421  7.032   403.010 1.00 188.00 ? 14  GLU 1 N     1 
ATOM   91    C  CA    . GLU A  1  14  ? 57.238  8.333   403.646 1.00 191.06 ? 14  GLU 1 CA    1 
ATOM   92    C  C     . GLU A  1  14  ? 56.376  9.217   402.751 1.00 191.28 ? 14  GLU 1 C     1 
ATOM   93    O  O     . GLU A  1  14  ? 56.809  9.603   401.659 1.00 192.78 ? 14  GLU 1 O     1 
ATOM   94    C  CB    . GLU A  1  14  ? 58.592  8.987   403.916 1.00 195.16 ? 14  GLU 1 CB    1 
ATOM   95    C  CG    . GLU A  1  14  ? 59.357  8.375   405.077 1.00 198.52 ? 14  GLU 1 CG    1 
ATOM   96    C  CD    . GLU A  1  14  ? 60.608  9.157   405.426 1.00 201.16 ? 14  GLU 1 CD    1 
ATOM   97    O  OE1   . GLU A  1  14  ? 61.536  9.193   404.591 1.00 201.91 ? 14  GLU 1 OE1   1 
ATOM   98    O  OE2   . GLU A  1  14  ? 60.664  9.737   406.531 1.00 202.21 ? 14  GLU 1 OE2   1 
ATOM   99    N  N     . ARG A  1  15  ? 55.156  9.522   403.197 1.00 189.47 ? 15  ARG 1 N     1 
ATOM   100   C  CA    . ARG A  1  15  ? 54.313  10.467  402.472 1.00 185.99 ? 15  ARG 1 CA    1 
ATOM   101   C  C     . ARG A  1  15  ? 54.993  11.830  402.445 1.00 178.61 ? 15  ARG 1 C     1 
ATOM   102   O  O     . ARG A  1  15  ? 55.283  12.403  403.500 1.00 188.06 ? 15  ARG 1 O     1 
ATOM   103   C  CB    . ARG A  1  15  ? 52.941  10.592  403.138 1.00 188.14 ? 15  ARG 1 CB    1 
ATOM   104   C  CG    . ARG A  1  15  ? 52.357  9.318   403.729 1.00 190.71 ? 15  ARG 1 CG    1 
ATOM   105   C  CD    . ARG A  1  15  ? 51.534  8.528   402.728 1.00 192.05 ? 15  ARG 1 CD    1 
ATOM   106   N  NE    . ARG A  1  15  ? 51.472  7.120   403.102 1.00 191.88 ? 15  ARG 1 NE    1 
ATOM   107   C  CZ    . ARG A  1  15  ? 50.545  6.269   402.677 1.00 191.49 ? 15  ARG 1 CZ    1 
ATOM   108   N  NH1   . ARG A  1  15  ? 49.588  6.679   401.853 1.00 191.00 ? 15  ARG 1 NH1   1 
ATOM   109   N  NH2   . ARG A  1  15  ? 50.573  5.007   403.080 1.00 192.18 ? 15  ARG 1 NH2   1 
ATOM   110   N  N     . THR A  1  16  ? 55.249  12.358  401.249 1.00 162.91 ? 16  THR 1 N     1 
ATOM   111   C  CA    . THR A  1  16  ? 55.991  13.607  401.114 1.00 144.59 ? 16  THR 1 CA    1 
ATOM   112   C  C     . THR A  1  16  ? 55.148  14.734  400.530 1.00 127.05 ? 16  THR 1 C     1 
ATOM   113   O  O     . THR A  1  16  ? 54.990  15.780  401.167 1.00 130.38 ? 16  THR 1 O     1 
ATOM   114   C  CB    . THR A  1  16  ? 57.243  13.389  400.254 1.00 142.22 ? 16  THR 1 CB    1 
ATOM   115   O  OG1   . THR A  1  16  ? 57.994  12.284  400.771 1.00 140.19 ? 16  THR 1 OG1   1 
ATOM   116   C  CG2   . THR A  1  16  ? 58.104  14.629  400.289 1.00 142.05 ? 16  THR 1 CG2   1 
ATOM   117   N  N     . LEU A  1  17  ? 54.597  14.553  399.328 1.00 105.19 ? 17  LEU 1 N     1 
ATOM   118   C  CA    . LEU A  1  17  ? 53.860  15.635  398.679 1.00 80.89  ? 17  LEU 1 CA    1 
ATOM   119   C  C     . LEU A  1  17  ? 52.439  15.728  399.225 1.00 73.97  ? 17  LEU 1 C     1 
ATOM   120   O  O     . LEU A  1  17  ? 52.047  16.745  399.808 1.00 64.81  ? 17  LEU 1 O     1 
ATOM   121   C  CB    . LEU A  1  17  ? 53.853  15.428  397.160 1.00 72.60  ? 17  LEU 1 CB    1 
ATOM   122   C  CG    . LEU A  1  17  ? 55.235  15.218  396.535 1.00 52.30  ? 17  LEU 1 CG    1 
ATOM   123   C  CD1   . LEU A  1  17  ? 55.151  15.216  395.020 1.00 49.50  ? 17  LEU 1 CD1   1 
ATOM   124   C  CD2   . LEU A  1  17  ? 56.213  16.274  397.022 1.00 47.02  ? 17  LEU 1 CD2   1 
ATOM   125   N  N     . TYR A  1  18  ? 51.658  14.666  399.046 1.00 76.19  ? 18  TYR 1 N     1 
ATOM   126   C  CA    . TYR A  1  18  ? 50.279  14.587  399.512 1.00 85.94  ? 18  TYR 1 CA    1 
ATOM   127   C  C     . TYR A  1  18  ? 50.180  14.348  401.014 1.00 96.57  ? 18  TYR 1 C     1 
ATOM   128   O  O     . TYR A  1  18  ? 49.086  14.045  401.505 1.00 98.54  ? 18  TYR 1 O     1 
ATOM   129   C  CB    . TYR A  1  18  ? 49.536  13.478  398.757 1.00 85.11  ? 18  TYR 1 CB    1 
ATOM   130   C  CG    . TYR A  1  18  ? 48.715  13.976  397.587 1.00 84.73  ? 18  TYR 1 CG    1 
ATOM   131   C  CD1   . TYR A  1  18  ? 49.326  14.521  396.470 1.00 82.90  ? 18  TYR 1 CD1   1 
ATOM   132   C  CD2   . TYR A  1  18  ? 47.330  13.877  397.588 1.00 83.65  ? 18  TYR 1 CD2   1 
ATOM   133   C  CE1   . TYR A  1  18  ? 48.580  14.979  395.402 1.00 81.10  ? 18  TYR 1 CE1   1 
ATOM   134   C  CE2   . TYR A  1  18  ? 46.577  14.335  396.517 1.00 82.75  ? 18  TYR 1 CE2   1 
ATOM   135   C  CZ    . TYR A  1  18  ? 47.212  14.882  395.424 1.00 79.86  ? 18  TYR 1 CZ    1 
ATOM   136   O  OH    . TYR A  1  18  ? 46.487  15.337  394.347 1.00 76.53  ? 18  TYR 1 OH    1 
ATOM   137   N  N     . ALA A  1  19  ? 51.298  14.457  401.738 1.00 105.02 ? 19  ALA 1 N     1 
ATOM   138   C  CA    . ALA A  1  19  ? 51.310  14.242  403.183 1.00 108.16 ? 19  ALA 1 CA    1 
ATOM   139   C  C     . ALA A  1  19  ? 50.214  15.044  403.876 1.00 112.79 ? 19  ALA 1 C     1 
ATOM   140   O  O     . ALA A  1  19  ? 49.387  14.491  404.608 1.00 107.58 ? 19  ALA 1 O     1 
ATOM   141   C  CB    . ALA A  1  19  ? 52.685  14.605  403.746 1.00 108.36 ? 19  ALA 1 CB    1 
ATOM   142   N  N     . HIS A  1  20  ? 50.197  16.356  403.653 1.00 124.88 ? 20  HIS 1 N     1 
ATOM   143   C  CA    . HIS A  1  20  ? 49.263  17.253  404.318 1.00 138.73 ? 20  HIS 1 CA    1 
ATOM   144   C  C     . HIS A  1  20  ? 47.913  17.345  403.609 1.00 118.89 ? 20  HIS 1 C     1 
ATOM   145   O  O     . HIS A  1  20  ? 47.080  18.173  403.994 1.00 118.96 ? 20  HIS 1 O     1 
ATOM   146   C  CB    . HIS A  1  20  ? 49.879  18.649  404.435 1.00 166.50 ? 20  HIS 1 CB    1 
ATOM   147   C  CG    . HIS A  1  20  ? 51.219  18.665  405.105 1.00 192.53 ? 20  HIS 1 CG    1 
ATOM   148   N  ND1   . HIS A  1  20  ? 52.303  19.340  404.584 1.00 199.77 ? 20  HIS 1 ND1   1 
ATOM   149   C  CD2   . HIS A  1  20  ? 51.652  18.083  406.249 1.00 200.01 ? 20  HIS 1 CD2   1 
ATOM   150   C  CE1   . HIS A  1  20  ? 53.344  19.177  405.380 1.00 199.86 ? 20  HIS 1 CE1   1 
ATOM   151   N  NE2   . HIS A  1  20  ? 52.976  18.418  406.397 1.00 199.18 ? 20  HIS 1 NE2   1 
ATOM   152   N  N     . VAL A  1  21  ? 47.675  16.516  402.592 1.00 98.99  ? 21  VAL 1 N     1 
ATOM   153   C  CA    . VAL A  1  21  ? 46.444  16.609  401.814 1.00 80.02  ? 21  VAL 1 CA    1 
ATOM   154   C  C     . VAL A  1  21  ? 45.274  16.091  402.637 1.00 63.73  ? 21  VAL 1 C     1 
ATOM   155   O  O     . VAL A  1  21  ? 45.344  15.016  403.247 1.00 61.74  ? 21  VAL 1 O     1 
ATOM   156   C  CB    . VAL A  1  21  ? 46.584  15.856  400.483 1.00 81.56  ? 21  VAL 1 CB    1 
ATOM   157   C  CG1   . VAL A  1  21  ? 45.218  15.558  399.887 1.00 82.68  ? 21  VAL 1 CG1   1 
ATOM   158   C  CG2   . VAL A  1  21  ? 47.398  16.694  399.512 1.00 81.17  ? 21  VAL 1 CG2   1 
ATOM   159   N  N     . GLY A  1  22  ? 44.192  16.868  402.667 1.00 55.14  ? 22  GLY 1 N     1 
ATOM   160   C  CA    . GLY A  1  22  ? 42.983  16.529  403.368 1.00 47.77  ? 22  GLY 1 CA    1 
ATOM   161   C  C     . GLY A  1  22  ? 42.891  17.154  404.744 1.00 40.45  ? 22  GLY 1 C     1 
ATOM   162   O  O     . GLY A  1  22  ? 41.781  17.394  405.231 1.00 34.49  ? 22  GLY 1 O     1 
ATOM   163   N  N     . LYS A  1  23  ? 44.031  17.425  405.375 1.00 42.69  ? 23  LYS 1 N     1 
ATOM   164   C  CA    . LYS A  1  23  ? 44.033  18.026  406.701 1.00 45.33  ? 23  LYS 1 CA    1 
ATOM   165   C  C     . LYS A  1  23  ? 43.464  19.432  406.592 1.00 58.14  ? 23  LYS 1 C     1 
ATOM   166   O  O     . LYS A  1  23  ? 43.946  20.237  405.788 1.00 61.03  ? 23  LYS 1 O     1 
ATOM   167   C  CB    . LYS A  1  23  ? 45.450  18.070  407.268 1.00 39.47  ? 23  LYS 1 CB    1 
ATOM   168   C  CG    . LYS A  1  23  ? 46.182  16.741  407.254 1.00 36.02  ? 23  LYS 1 CG    1 
ATOM   169   C  CD    . LYS A  1  23  ? 45.439  15.679  408.036 1.00 37.35  ? 23  LYS 1 CD    1 
ATOM   170   C  CE    . LYS A  1  23  ? 46.144  14.333  407.944 1.00 37.50  ? 23  LYS 1 CE    1 
ATOM   171   N  NZ    . LYS A  1  23  ? 45.209  13.198  408.202 1.00 38.32  ? 23  LYS 1 NZ    1 
ATOM   172   N  N     . GLU A  1  24  ? 42.416  19.717  407.358 1.00 65.63  ? 24  GLU 1 N     1 
ATOM   173   C  CA    . GLU A  1  24  ? 41.775  21.022  407.270 1.00 68.67  ? 24  GLU 1 CA    1 
ATOM   174   C  C     . GLU A  1  24  ? 42.771  22.116  407.640 1.00 65.93  ? 24  GLU 1 C     1 
ATOM   175   O  O     . GLU A  1  24  ? 43.572  21.961  408.565 1.00 62.36  ? 24  GLU 1 O     1 
ATOM   176   C  CB    . GLU A  1  24  ? 40.548  21.073  408.181 1.00 70.72  ? 24  GLU 1 CB    1 
ATOM   177   C  CG    . GLU A  1  24  ? 39.638  22.257  407.924 1.00 73.38  ? 24  GLU 1 CG    1 
ATOM   178   C  CD    . GLU A  1  24  ? 38.794  22.603  409.130 1.00 78.72  ? 24  GLU 1 CD    1 
ATOM   179   O  OE1   . GLU A  1  24  ? 38.873  21.872  410.139 1.00 79.48  ? 24  GLU 1 OE1   1 
ATOM   180   O  OE2   . GLU A  1  24  ? 38.048  23.604  409.069 1.00 81.50  ? 24  GLU 1 OE2   1 
ATOM   181   N  N     . GLY A  1  25  ? 42.717  23.231  406.915 1.00 63.40  ? 25  GLY 1 N     1 
ATOM   182   C  CA    . GLY A  1  25  ? 43.697  24.275  407.136 1.00 59.26  ? 25  GLY 1 CA    1 
ATOM   183   C  C     . GLY A  1  25  ? 45.072  23.974  406.587 1.00 52.06  ? 25  GLY 1 C     1 
ATOM   184   O  O     . GLY A  1  25  ? 46.056  24.565  407.041 1.00 51.01  ? 25  GLY 1 O     1 
ATOM   185   N  N     . SER A  1  26  ? 45.175  23.044  405.635 1.00 51.43  ? 26  SER 1 N     1 
ATOM   186   C  CA    . SER A  1  26  ? 46.465  22.733  405.030 1.00 50.87  ? 26  SER 1 CA    1 
ATOM   187   C  C     . SER A  1  26  ? 47.017  23.867  404.173 1.00 53.34  ? 26  SER 1 C     1 
ATOM   188   O  O     . SER A  1  26  ? 48.237  23.937  403.983 1.00 51.09  ? 26  SER 1 O     1 
ATOM   189   C  CB    . SER A  1  26  ? 46.348  21.460  404.186 1.00 54.24  ? 26  SER 1 CB    1 
ATOM   190   O  OG    . SER A  1  26  ? 45.194  21.505  403.356 1.00 54.28  ? 26  SER 1 OG    1 
ATOM   191   N  N     . TRP A  1  27  ? 46.170  24.770  403.677 1.00 52.42  ? 27  TRP 1 N     1 
ATOM   192   C  CA    . TRP A  1  27  ? 46.655  25.896  402.888 1.00 50.67  ? 27  TRP 1 CA    1 
ATOM   193   C  C     . TRP A  1  27  ? 47.011  27.103  403.745 1.00 53.48  ? 27  TRP 1 C     1 
ATOM   194   O  O     . TRP A  1  27  ? 47.458  28.117  403.201 1.00 53.35  ? 27  TRP 1 O     1 
ATOM   195   C  CB    . TRP A  1  27  ? 45.637  26.310  401.814 1.00 47.17  ? 27  TRP 1 CB    1 
ATOM   196   C  CG    . TRP A  1  27  ? 44.314  26.774  402.330 1.00 48.62  ? 27  TRP 1 CG    1 
ATOM   197   C  CD1   . TRP A  1  27  ? 43.970  28.051  402.661 1.00 52.10  ? 27  TRP 1 CD1   1 
ATOM   198   C  CD2   . TRP A  1  27  ? 43.140  25.978  402.534 1.00 49.86  ? 27  TRP 1 CD2   1 
ATOM   199   N  NE1   . TRP A  1  27  ? 42.663  28.097  403.079 1.00 53.84  ? 27  TRP 1 NE1   1 
ATOM   200   C  CE2   . TRP A  1  27  ? 42.131  26.837  403.008 1.00 51.72  ? 27  TRP 1 CE2   1 
ATOM   201   C  CE3   . TRP A  1  27  ? 42.847  24.622  402.372 1.00 52.61  ? 27  TRP 1 CE3   1 
ATOM   202   C  CZ2   . TRP A  1  27  ? 40.853  26.386  403.322 1.00 52.97  ? 27  TRP 1 CZ2   1 
ATOM   203   C  CZ3   . TRP A  1  27  ? 41.578  24.177  402.687 1.00 55.39  ? 27  TRP 1 CZ3   1 
ATOM   204   C  CH2   . TRP A  1  27  ? 40.597  25.056  403.154 1.00 53.89  ? 27  TRP 1 CH2   1 
ATOM   205   N  N     . THR A  1  28  ? 46.814  27.027  405.060 1.00 56.31  ? 28  THR 1 N     1 
ATOM   206   C  CA    . THR A  1  28  ? 47.229  28.115  405.933 1.00 53.91  ? 28  THR 1 CA    1 
ATOM   207   C  C     . THR A  1  28  ? 48.748  28.111  406.030 1.00 58.35  ? 28  THR 1 C     1 
ATOM   208   O  O     . THR A  1  28  ? 49.360  27.068  406.281 1.00 62.17  ? 28  THR 1 O     1 
ATOM   209   C  CB    . THR A  1  28  ? 46.612  27.965  407.326 1.00 44.73  ? 28  THR 1 CB    1 
ATOM   210   O  OG1   . THR A  1  28  ? 46.955  26.685  407.868 1.00 46.81  ? 28  THR 1 OG1   1 
ATOM   211   C  CG2   . THR A  1  28  ? 45.102  28.080  407.259 1.00 40.22  ? 28  THR 1 CG2   1 
ATOM   212   N  N     . LEU A  1  29  ? 49.357  29.279  405.800 1.00 55.45  ? 29  LEU 1 N     1 
ATOM   213   C  CA    . LEU A  1  29  ? 50.815  29.382  405.823 1.00 54.17  ? 29  LEU 1 CA    1 
ATOM   214   C  C     . LEU A  1  29  ? 51.402  28.906  407.149 1.00 45.34  ? 29  LEU 1 C     1 
ATOM   215   O  O     . LEU A  1  29  ? 52.503  28.345  407.173 1.00 29.79  ? 29  LEU 1 O     1 
ATOM   216   C  CB    . LEU A  1  29  ? 51.245  30.819  405.520 1.00 51.25  ? 29  LEU 1 CB    1 
ATOM   217   C  CG    . LEU A  1  29  ? 52.744  31.104  405.631 1.00 55.60  ? 29  LEU 1 CG    1 
ATOM   218   C  CD1   . LEU A  1  29  ? 53.539  30.134  404.766 1.00 54.16  ? 29  LEU 1 CD1   1 
ATOM   219   C  CD2   . LEU A  1  29  ? 53.058  32.544  405.248 1.00 57.20  ? 29  LEU 1 CD2   1 
ATOM   220   N  N     . ASP A  1  30  ? 50.698  29.141  408.258 1.00 58.63  ? 30  ASP 1 N     1 
ATOM   221   C  CA    . ASP A  1  30  ? 51.201  28.717  409.561 1.00 65.70  ? 30  ASP 1 CA    1 
ATOM   222   C  C     . ASP A  1  30  ? 51.358  27.203  409.618 1.00 72.63  ? 30  ASP 1 C     1 
ATOM   223   O  O     . ASP A  1  30  ? 52.331  26.692  410.184 1.00 76.25  ? 30  ASP 1 O     1 
ATOM   224   C  CB    . ASP A  1  30  ? 50.258  29.200  410.663 1.00 71.65  ? 30  ASP 1 CB    1 
ATOM   225   C  CG    . ASP A  1  30  ? 49.948  30.685  410.555 1.00 79.09  ? 30  ASP 1 CG    1 
ATOM   226   O  OD1   . ASP A  1  30  ? 49.290  31.090  409.573 1.00 81.49  ? 30  ASP 1 OD1   1 
ATOM   227   O  OD2   . ASP A  1  30  ? 50.357  31.452  411.451 1.00 83.17  ? 30  ASP 1 OD2   1 
ATOM   228   N  N     . TYR A  1  31  ? 50.413  26.474  409.018 1.00 71.75  ? 31  TYR 1 N     1 
ATOM   229   C  CA    . TYR A  1  31  ? 50.520  25.022  408.926 1.00 71.02  ? 31  TYR 1 CA    1 
ATOM   230   C  C     . TYR A  1  31  ? 51.780  24.622  408.166 1.00 74.28  ? 31  TYR 1 C     1 
ATOM   231   O  O     . TYR A  1  31  ? 52.541  23.753  408.608 1.00 70.77  ? 31  TYR 1 O     1 
ATOM   232   C  CB    . TYR A  1  31  ? 49.267  24.460  408.246 1.00 69.35  ? 31  TYR 1 CB    1 
ATOM   233   C  CG    . TYR A  1  31  ? 49.203  22.951  408.160 1.00 71.50  ? 31  TYR 1 CG    1 
ATOM   234   C  CD1   . TYR A  1  31  ? 49.918  22.255  407.198 1.00 72.36  ? 31  TYR 1 CD1   1 
ATOM   235   C  CD2   . TYR A  1  31  ? 48.406  22.222  409.030 1.00 72.56  ? 31  TYR 1 CD2   1 
ATOM   236   C  CE1   . TYR A  1  31  ? 49.858  20.877  407.120 1.00 69.29  ? 31  TYR 1 CE1   1 
ATOM   237   C  CE2   . TYR A  1  31  ? 48.339  20.839  408.955 1.00 70.03  ? 31  TYR 1 CE2   1 
ATOM   238   C  CZ    . TYR A  1  31  ? 49.067  20.173  407.997 1.00 66.24  ? 31  TYR 1 CZ    1 
ATOM   239   O  OH    . TYR A  1  31  ? 49.006  18.802  407.915 1.00 62.93  ? 31  TYR 1 OH    1 
ATOM   240   N  N     . TYR A  1  32  ? 52.006  25.251  407.011 1.00 83.60  ? 32  TYR 1 N     1 
ATOM   241   C  CA    . TYR A  1  32  ? 53.167  24.942  406.183 1.00 94.08  ? 32  TYR 1 CA    1 
ATOM   242   C  C     . TYR A  1  32  ? 54.473  25.214  406.924 1.00 99.86  ? 32  TYR 1 C     1 
ATOM   243   O  O     . TYR A  1  32  ? 55.385  24.380  406.924 1.00 99.35  ? 32  TYR 1 O     1 
ATOM   244   C  CB    . TYR A  1  32  ? 53.085  25.755  404.888 1.00 99.59  ? 32  TYR 1 CB    1 
ATOM   245   C  CG    . TYR A  1  32  ? 54.091  25.387  403.821 1.00 104.49 ? 32  TYR 1 CG    1 
ATOM   246   C  CD1   . TYR A  1  32  ? 54.051  24.147  403.199 1.00 106.00 ? 32  TYR 1 CD1   1 
ATOM   247   C  CD2   . TYR A  1  32  ? 55.049  26.300  403.399 1.00 104.46 ? 32  TYR 1 CD2   1 
ATOM   248   C  CE1   . TYR A  1  32  ? 54.963  23.813  402.214 1.00 104.15 ? 32  TYR 1 CE1   1 
ATOM   249   C  CE2   . TYR A  1  32  ? 55.958  25.977  402.408 1.00 103.07 ? 32  TYR 1 CE2   1 
ATOM   250   C  CZ    . TYR A  1  32  ? 55.912  24.731  401.823 1.00 102.60 ? 32  TYR 1 CZ    1 
ATOM   251   O  OH    . TYR A  1  32  ? 56.814  24.398  400.841 1.00 97.97  ? 32  TYR 1 OH    1 
ATOM   252   N  N     . LEU A  1  33  ? 54.575  26.377  407.572 1.00 106.05 ? 33  LEU 1 N     1 
ATOM   253   C  CA    . LEU A  1  33  ? 55.789  26.718  408.311 1.00 109.93 ? 33  LEU 1 CA    1 
ATOM   254   C  C     . LEU A  1  33  ? 56.024  25.753  409.466 1.00 112.66 ? 33  LEU 1 C     1 
ATOM   255   O  O     . LEU A  1  33  ? 57.108  25.170  409.591 1.00 112.76 ? 33  LEU 1 O     1 
ATOM   256   C  CB    . LEU A  1  33  ? 55.713  28.159  408.814 1.00 108.94 ? 33  LEU 1 CB    1 
ATOM   257   C  CG    . LEU A  1  33  ? 55.945  29.248  407.764 1.00 107.34 ? 33  LEU 1 CG    1 
ATOM   258   C  CD1   . LEU A  1  33  ? 55.890  30.627  408.400 1.00 106.81 ? 33  LEU 1 CD1   1 
ATOM   259   C  CD2   . LEU A  1  33  ? 57.280  29.030  407.064 1.00 106.96 ? 33  LEU 1 CD2   1 
ATOM   260   N  N     . ARG A  1  34  ? 55.021  25.583  410.332 1.00 115.47 ? 34  ARG 1 N     1 
ATOM   261   C  CA    . ARG A  1  34  ? 55.160  24.693  411.481 1.00 120.19 ? 34  ARG 1 CA    1 
ATOM   262   C  C     . ARG A  1  34  ? 55.530  23.272  411.078 1.00 117.18 ? 34  ARG 1 C     1 
ATOM   263   O  O     . ARG A  1  34  ? 56.047  22.519  411.911 1.00 118.52 ? 34  ARG 1 O     1 
ATOM   264   C  CB    . ARG A  1  34  ? 53.864  24.672  412.293 1.00 128.86 ? 34  ARG 1 CB    1 
ATOM   265   C  CG    . ARG A  1  34  ? 53.761  25.765  413.348 1.00 136.43 ? 34  ARG 1 CG    1 
ATOM   266   C  CD    . ARG A  1  34  ? 52.384  26.409  413.349 1.00 142.65 ? 34  ARG 1 CD    1 
ATOM   267   N  NE    . ARG A  1  34  ? 51.325  25.422  413.543 1.00 147.06 ? 34  ARG 1 NE    1 
ATOM   268   C  CZ    . ARG A  1  34  ? 50.034  25.660  413.336 1.00 150.49 ? 34  ARG 1 CZ    1 
ATOM   269   N  NH1   . ARG A  1  34  ? 49.633  26.859  412.936 1.00 150.90 ? 34  ARG 1 NH1   1 
ATOM   270   N  NH2   . ARG A  1  34  ? 49.142  24.700  413.537 1.00 151.78 ? 34  ARG 1 NH2   1 
ATOM   271   N  N     . HIS A  1  35  ? 55.283  22.892  409.825 1.00 110.96 ? 35  HIS 1 N     1 
ATOM   272   C  CA    . HIS A  1  35  ? 55.630  21.574  409.319 1.00 107.03 ? 35  HIS 1 CA    1 
ATOM   273   C  C     . HIS A  1  35  ? 56.925  21.574  408.517 1.00 103.49 ? 35  HIS 1 C     1 
ATOM   274   O  O     . HIS A  1  35  ? 57.240  20.573  407.865 1.00 100.84 ? 35  HIS 1 O     1 
ATOM   275   C  CB    . HIS A  1  35  ? 54.477  21.036  408.470 1.00 106.69 ? 35  HIS 1 CB    1 
ATOM   276   C  CG    . HIS A  1  35  ? 53.261  20.688  409.270 1.00 108.54 ? 35  HIS 1 CG    1 
ATOM   277   N  ND1   . HIS A  1  35  ? 52.319  21.627  409.633 1.00 106.78 ? 35  HIS 1 ND1   1 
ATOM   278   C  CD2   . HIS A  1  35  ? 52.841  19.512  409.794 1.00 107.18 ? 35  HIS 1 CD2   1 
ATOM   279   C  CE1   . HIS A  1  35  ? 51.368  21.043  410.339 1.00 107.51 ? 35  HIS 1 CE1   1 
ATOM   280   N  NE2   . HIS A  1  35  ? 51.660  19.760  410.451 1.00 106.53 ? 35  HIS 1 NE2   1 
ATOM   281   N  N     . GLY A  1  36  ? 57.678  22.667  408.549 1.00 103.75 ? 36  GLY 1 N     1 
ATOM   282   C  CA    . GLY A  1  36  ? 58.960  22.738  407.883 1.00 102.84 ? 36  GLY 1 CA    1 
ATOM   283   C  C     . GLY A  1  36  ? 58.942  23.372  406.512 1.00 100.92 ? 36  GLY 1 C     1 
ATOM   284   O  O     . GLY A  1  36  ? 59.888  23.162  405.743 1.00 99.58  ? 36  GLY 1 O     1 
ATOM   285   N  N     . GLY A  1  37  ? 57.900  24.129  406.178 1.00 100.62 ? 37  GLY 1 N     1 
ATOM   286   C  CA    . GLY A  1  37  ? 57.849  24.773  404.884 1.00 100.27 ? 37  GLY 1 CA    1 
ATOM   287   C  C     . GLY A  1  37  ? 58.912  25.843  404.741 1.00 102.15 ? 37  GLY 1 C     1 
ATOM   288   O  O     . GLY A  1  37  ? 59.397  26.408  405.722 1.00 100.73 ? 37  GLY 1 O     1 
ATOM   289   N  N     . TYR A  1  38  ? 59.282  26.115  403.490 1.00 105.54 ? 38  TYR 1 N     1 
ATOM   290   C  CA    . TYR A  1  38  ? 60.255  27.131  403.095 1.00 110.38 ? 38  TYR 1 CA    1 
ATOM   291   C  C     . TYR A  1  38  ? 61.662  26.816  403.584 1.00 111.99 ? 38  TYR 1 C     1 
ATOM   292   O  O     . TYR A  1  38  ? 62.573  27.623  403.359 1.00 111.80 ? 38  TYR 1 O     1 
ATOM   293   C  CB    . TYR A  1  38  ? 59.864  28.540  403.565 1.00 109.40 ? 38  TYR 1 CB    1 
ATOM   294   C  CG    . TYR A  1  38  ? 58.777  29.171  402.726 1.00 109.82 ? 38  TYR 1 CG    1 
ATOM   295   C  CD1   . TYR A  1  38  ? 59.037  29.601  401.433 1.00 110.02 ? 38  TYR 1 CD1   1 
ATOM   296   C  CD2   . TYR A  1  38  ? 57.492  29.327  403.222 1.00 110.36 ? 38  TYR 1 CD2   1 
ATOM   297   C  CE1   . TYR A  1  38  ? 58.047  30.174  400.659 1.00 111.59 ? 38  TYR 1 CE1   1 
ATOM   298   C  CE2   . TYR A  1  38  ? 56.496  29.899  402.455 1.00 111.25 ? 38  TYR 1 CE2   1 
ATOM   299   C  CZ    . TYR A  1  38  ? 56.778  30.320  401.175 1.00 110.84 ? 38  TYR 1 CZ    1 
ATOM   300   O  OH    . TYR A  1  38  ? 55.787  30.890  400.409 1.00 108.80 ? 38  TYR 1 OH    1 
ATOM   301   N  N     . GLU A  1  39  ? 61.876  25.676  404.245 1.00 125.24 ? 39  GLU 1 N     1 
ATOM   302   C  CA    . GLU A  1  39  ? 63.232  25.267  404.593 1.00 124.14 ? 39  GLU 1 CA    1 
ATOM   303   C  C     . GLU A  1  39  ? 64.048  24.986  403.338 1.00 115.94 ? 39  GLU 1 C     1 
ATOM   304   O  O     . GLU A  1  39  ? 65.190  25.446  403.206 1.00 117.65 ? 39  GLU 1 O     1 
ATOM   305   C  CB    . GLU A  1  39  ? 63.186  24.027  405.489 1.00 128.49 ? 39  GLU 1 CB    1 
ATOM   306   C  CG    . GLU A  1  39  ? 63.639  24.253  406.920 1.00 132.67 ? 39  GLU 1 CG    1 
ATOM   307   C  CD    . GLU A  1  39  ? 63.746  22.956  407.698 1.00 135.50 ? 39  GLU 1 CD    1 
ATOM   308   O  OE1   . GLU A  1  39  ? 63.029  21.994  407.350 1.00 135.73 ? 39  GLU 1 OE1   1 
ATOM   309   O  OE2   . GLU A  1  39  ? 64.547  22.896  408.654 1.00 137.62 ? 39  GLU 1 OE2   1 
ATOM   310   N  N     . THR A  1  40  ? 63.459  24.243  402.395 1.00 105.84 ? 40  THR 1 N     1 
ATOM   311   C  CA    . THR A  1  40  ? 64.183  23.812  401.204 1.00 96.03  ? 40  THR 1 CA    1 
ATOM   312   C  C     . THR A  1  40  ? 64.577  25.002  400.336 1.00 91.08  ? 40  THR 1 C     1 
ATOM   313   O  O     . THR A  1  40  ? 65.726  25.107  399.889 1.00 89.37  ? 40  THR 1 O     1 
ATOM   314   C  CB    . THR A  1  40  ? 63.326  22.821  400.410 1.00 91.61  ? 40  THR 1 CB    1 
ATOM   315   O  OG1   . THR A  1  40  ? 62.757  21.857  401.305 1.00 86.49  ? 40  THR 1 OG1   1 
ATOM   316   C  CG2   . THR A  1  40  ? 64.158  22.103  399.366 1.00 93.94  ? 40  THR 1 CG2   1 
ATOM   317   N  N     . ALA A  1  41  ? 63.633  25.910  400.085 1.00 87.73  ? 41  ALA 1 N     1 
ATOM   318   C  CA    . ALA A  1  41  ? 63.950  27.114  399.323 1.00 85.80  ? 41  ALA 1 CA    1 
ATOM   319   C  C     . ALA A  1  41  ? 65.056  27.911  400.001 1.00 82.77  ? 41  ALA 1 C     1 
ATOM   320   O  O     . ALA A  1  41  ? 66.022  28.336  399.354 1.00 88.31  ? 41  ALA 1 O     1 
ATOM   321   C  CB    . ALA A  1  41  ? 62.695  27.969  399.151 1.00 85.48  ? 41  ALA 1 CB    1 
ATOM   322   N  N     . LYS A  1  42  ? 64.927  28.122  401.312 1.00 73.99  ? 42  LYS 1 N     1 
ATOM   323   C  CA    . LYS A  1  42  ? 65.882  28.953  402.037 1.00 67.65  ? 42  LYS 1 CA    1 
ATOM   324   C  C     . LYS A  1  42  ? 67.290  28.368  401.977 1.00 68.90  ? 42  LYS 1 C     1 
ATOM   325   O  O     . LYS A  1  42  ? 68.262  29.100  401.756 1.00 64.35  ? 42  LYS 1 O     1 
ATOM   326   C  CB    . LYS A  1  42  ? 65.415  29.135  403.481 1.00 65.74  ? 42  LYS 1 CB    1 
ATOM   327   C  CG    . LYS A  1  42  ? 66.451  29.705  404.429 1.00 62.87  ? 42  LYS 1 CG    1 
ATOM   328   C  CD    . LYS A  1  42  ? 65.942  29.630  405.859 1.00 57.22  ? 42  LYS 1 CD    1 
ATOM   329   C  CE    . LYS A  1  42  ? 65.137  30.868  406.206 1.00 50.17  ? 42  LYS 1 CE    1 
ATOM   330   N  NZ    . LYS A  1  42  ? 64.389  30.700  407.479 1.00 48.64  ? 42  LYS 1 NZ    1 
ATOM   331   N  N     . ARG A  1  43  ? 67.422  27.050  402.170 1.00 73.51  ? 43  ARG 1 N     1 
ATOM   332   C  CA    . ARG A  1  43  ? 68.745  26.428  402.106 1.00 75.92  ? 43  ARG 1 CA    1 
ATOM   333   C  C     . ARG A  1  43  ? 69.312  26.478  400.688 1.00 70.46  ? 43  ARG 1 C     1 
ATOM   334   O  O     . ARG A  1  43  ? 70.464  26.892  400.486 1.00 70.97  ? 43  ARG 1 O     1 
ATOM   335   C  CB    . ARG A  1  43  ? 68.697  24.985  402.626 1.00 81.86  ? 43  ARG 1 CB    1 
ATOM   336   C  CG    . ARG A  1  43  ? 67.658  24.091  401.967 1.00 89.48  ? 43  ARG 1 CG    1 
ATOM   337   C  CD    . ARG A  1  43  ? 67.789  22.625  402.356 1.00 98.82  ? 43  ARG 1 CD    1 
ATOM   338   N  NE    . ARG A  1  43  ? 68.886  21.956  401.660 1.00 106.91 ? 43  ARG 1 NE    1 
ATOM   339   C  CZ    . ARG A  1  43  ? 69.205  20.677  401.832 1.00 109.70 ? 43  ARG 1 CZ    1 
ATOM   340   N  NH1   . ARG A  1  43  ? 68.505  19.927  402.674 1.00 111.60 ? 43  ARG 1 NH1   1 
ATOM   341   N  NH2   . ARG A  1  43  ? 70.217  20.144  401.162 1.00 108.73 ? 43  ARG 1 NH2   1 
ATOM   342   N  N     . VAL A  1  44  ? 68.525  26.049  399.691 1.00 64.89  ? 44  VAL 1 N     1 
ATOM   343   C  CA    . VAL A  1  44  ? 69.045  25.936  398.328 1.00 59.56  ? 44  VAL 1 CA    1 
ATOM   344   C  C     . VAL A  1  44  ? 69.456  27.300  397.783 1.00 62.22  ? 44  VAL 1 C     1 
ATOM   345   O  O     . VAL A  1  44  ? 70.497  27.429  397.125 1.00 60.36  ? 44  VAL 1 O     1 
ATOM   346   C  CB    . VAL A  1  44  ? 68.015  25.248  397.412 1.00 48.63  ? 44  VAL 1 CB    1 
ATOM   347   C  CG1   . VAL A  1  44  ? 68.547  25.165  395.991 1.00 44.53  ? 44  VAL 1 CG1   1 
ATOM   348   C  CG2   . VAL A  1  44  ? 67.705  23.848  397.919 1.00 47.38  ? 44  VAL 1 CG2   1 
ATOM   349   N  N     . LEU A  1  45  ? 68.655  28.340  398.043 1.00 67.50  ? 45  LEU 1 N     1 
ATOM   350   C  CA    . LEU A  1  45  ? 68.904  29.637  397.416 1.00 71.30  ? 45  LEU 1 CA    1 
ATOM   351   C  C     . LEU A  1  45  ? 70.264  30.202  397.805 1.00 79.15  ? 45  LEU 1 C     1 
ATOM   352   O  O     . LEU A  1  45  ? 70.946  30.821  396.979 1.00 78.00  ? 45  LEU 1 O     1 
ATOM   353   C  CB    . LEU A  1  45  ? 67.794  30.620  397.786 1.00 70.92  ? 45  LEU 1 CB    1 
ATOM   354   C  CG    . LEU A  1  45  ? 66.499  30.493  396.984 1.00 72.11  ? 45  LEU 1 CG    1 
ATOM   355   C  CD1   . LEU A  1  45  ? 65.456  31.474  397.489 1.00 73.29  ? 45  LEU 1 CD1   1 
ATOM   356   C  CD2   . LEU A  1  45  ? 66.769  30.711  395.503 1.00 72.23  ? 45  LEU 1 CD2   1 
ATOM   357   N  N     . LYS A  1  46  ? 70.677  30.003  399.056 1.00 87.09  ? 46  LYS 1 N     1 
ATOM   358   C  CA    . LYS A  1  46  ? 71.918  30.587  399.542 1.00 95.16  ? 46  LYS 1 CA    1 
ATOM   359   C  C     . LYS A  1  46  ? 73.106  29.635  399.517 1.00 97.23  ? 46  LYS 1 C     1 
ATOM   360   O  O     . LYS A  1  46  ? 74.248  30.107  399.498 1.00 97.60  ? 46  LYS 1 O     1 
ATOM   361   C  CB    . LYS A  1  46  ? 71.722  31.132  400.960 1.00 95.16  ? 46  LYS 1 CB    1 
ATOM   362   C  CG    . LYS A  1  46  ? 70.377  31.806  401.117 1.00 97.48  ? 46  LYS 1 CG    1 
ATOM   363   C  CD    . LYS A  1  46  ? 70.458  33.047  401.974 1.00 99.48  ? 46  LYS 1 CD    1 
ATOM   364   C  CE    . LYS A  1  46  ? 69.180  33.228  402.762 1.00 103.25 ? 46  LYS 1 CE    1 
ATOM   365   N  NZ    . LYS A  1  46  ? 69.399  34.066  403.961 1.00 106.04 ? 46  LYS 1 NZ    1 
ATOM   366   N  N     . GLU A  1  47  ? 72.886  28.319  399.508 1.00 102.20 ? 47  GLU 1 N     1 
ATOM   367   C  CA    . GLU A  1  47  ? 74.032  27.420  399.398 1.00 103.88 ? 47  GLU 1 CA    1 
ATOM   368   C  C     . GLU A  1  47  ? 74.366  27.113  397.942 1.00 103.58 ? 47  GLU 1 C     1 
ATOM   369   O  O     . GLU A  1  47  ? 75.457  27.439  397.460 1.00 106.39 ? 47  GLU 1 O     1 
ATOM   370   C  CB    . GLU A  1  47  ? 73.777  26.104  400.142 1.00 106.58 ? 47  GLU 1 CB    1 
ATOM   371   C  CG    . GLU A  1  47  ? 73.545  26.213  401.630 1.00 106.40 ? 47  GLU 1 CG    1 
ATOM   372   C  CD    . GLU A  1  47  ? 73.085  24.895  402.218 1.00 105.57 ? 47  GLU 1 CD    1 
ATOM   373   O  OE1   . GLU A  1  47  ? 72.647  24.020  401.440 1.00 104.43 ? 47  GLU 1 OE1   1 
ATOM   374   O  OE2   . GLU A  1  47  ? 73.171  24.726  403.451 1.00 105.95 ? 47  GLU 1 OE2   1 
ATOM   375   N  N     . LYS A  1  48  ? 73.425  26.506  397.230 1.00 96.65  ? 48  LYS 1 N     1 
ATOM   376   C  CA    . LYS A  1  48  ? 73.719  25.864  395.961 1.00 92.18  ? 48  LYS 1 CA    1 
ATOM   377   C  C     . LYS A  1  48  ? 73.709  26.866  394.815 1.00 96.22  ? 48  LYS 1 C     1 
ATOM   378   O  O     . LYS A  1  48  ? 72.926  27.819  394.802 1.00 96.33  ? 48  LYS 1 O     1 
ATOM   379   C  CB    . LYS A  1  48  ? 72.706  24.751  395.694 1.00 83.41  ? 48  LYS 1 CB    1 
ATOM   380   C  CG    . LYS A  1  48  ? 72.728  23.655  396.744 1.00 74.30  ? 48  LYS 1 CG    1 
ATOM   381   C  CD    . LYS A  1  48  ? 71.627  22.642  396.525 1.00 66.00  ? 48  LYS 1 CD    1 
ATOM   382   C  CE    . LYS A  1  48  ? 71.936  21.370  397.279 1.00 60.82  ? 48  LYS 1 CE    1 
ATOM   383   N  NZ    . LYS A  1  48  ? 73.262  20.837  396.868 1.00 60.03  ? 48  LYS 1 NZ    1 
ATOM   384   N  N     . THR A  1  49  ? 74.596  26.638  393.848 1.00 102.54 ? 49  THR 1 N     1 
ATOM   385   C  CA    . THR A  1  49  ? 74.586  27.401  392.613 1.00 105.80 ? 49  THR 1 CA    1 
ATOM   386   C  C     . THR A  1  49  ? 73.572  26.791  391.647 1.00 104.47 ? 49  THR 1 C     1 
ATOM   387   O  O     . THR A  1  49  ? 73.149  25.646  391.823 1.00 107.57 ? 49  THR 1 O     1 
ATOM   388   C  CB    . THR A  1  49  ? 75.983  27.423  391.990 1.00 108.23 ? 49  THR 1 CB    1 
ATOM   389   O  OG1   . THR A  1  49  ? 76.368  26.098  391.614 1.00 108.27 ? 49  THR 1 OG1   1 
ATOM   390   C  CG2   . THR A  1  49  ? 77.001  27.967  392.983 1.00 110.54 ? 49  THR 1 CG2   1 
ATOM   391   N  N     . PRO A  1  50  ? 73.147  27.540  390.621 1.00 100.82 ? 50  PRO 1 N     1 
ATOM   392   C  CA    . PRO A  1  50  ? 72.145  26.981  389.693 1.00 98.13  ? 50  PRO 1 CA    1 
ATOM   393   C  C     . PRO A  1  50  ? 72.613  25.723  388.978 1.00 93.96  ? 50  PRO 1 C     1 
ATOM   394   O  O     . PRO A  1  50  ? 71.821  24.788  388.788 1.00 88.95  ? 50  PRO 1 O     1 
ATOM   395   C  CB    . PRO A  1  50  ? 71.893  28.138  388.718 1.00 99.78  ? 50  PRO 1 CB    1 
ATOM   396   C  CG    . PRO A  1  50  ? 72.261  29.364  389.485 1.00 99.07  ? 50  PRO 1 CG    1 
ATOM   397   C  CD    . PRO A  1  50  ? 73.405  28.968  390.360 1.00 98.36  ? 50  PRO 1 CD    1 
ATOM   398   N  N     . ASP A  1  51  ? 73.874  25.677  388.547 1.00 95.58  ? 51  ASP 1 N     1 
ATOM   399   C  CA    . ASP A  1  51  ? 74.380  24.460  387.921 1.00 97.83  ? 51  ASP 1 CA    1 
ATOM   400   C  C     . ASP A  1  51  ? 74.344  23.285  388.892 1.00 99.19  ? 51  ASP 1 C     1 
ATOM   401   O  O     . ASP A  1  51  ? 74.119  22.143  388.475 1.00 102.18 ? 51  ASP 1 O     1 
ATOM   402   C  CB    . ASP A  1  51  ? 75.796  24.686  387.389 1.00 98.79  ? 51  ASP 1 CB    1 
ATOM   403   C  CG    . ASP A  1  51  ? 75.808  25.452  386.077 1.00 98.77  ? 51  ASP 1 CG    1 
ATOM   404   O  OD1   . ASP A  1  51  ? 75.122  25.020  385.126 1.00 98.65  ? 51  ASP 1 OD1   1 
ATOM   405   O  OD2   . ASP A  1  51  ? 76.509  26.482  385.994 1.00 98.40  ? 51  ASP 1 OD2   1 
ATOM   406   N  N     . GLU A  1  52  ? 74.547  23.546  390.187 1.00 96.90  ? 52  GLU 1 N     1 
ATOM   407   C  CA    . GLU A  1  52  ? 74.486  22.475  391.178 1.00 94.75  ? 52  GLU 1 CA    1 
ATOM   408   C  C     . GLU A  1  52  ? 73.069  21.931  391.321 1.00 91.77  ? 52  GLU 1 C     1 
ATOM   409   O  O     . GLU A  1  52  ? 72.876  20.711  391.384 1.00 91.86  ? 52  GLU 1 O     1 
ATOM   410   C  CB    . GLU A  1  52  ? 75.009  22.964  392.527 1.00 95.43  ? 52  GLU 1 CB    1 
ATOM   411   C  CG    . GLU A  1  52  ? 76.503  23.215  392.569 1.00 97.14  ? 52  GLU 1 CG    1 
ATOM   412   C  CD    . GLU A  1  52  ? 76.968  23.640  393.945 1.00 100.17 ? 52  GLU 1 CD    1 
ATOM   413   O  OE1   . GLU A  1  52  ? 76.411  23.139  394.946 1.00 100.54 ? 52  GLU 1 OE1   1 
ATOM   414   O  OE2   . GLU A  1  52  ? 77.885  24.483  394.027 1.00 101.19 ? 52  GLU 1 OE2   1 
ATOM   415   N  N     . VAL A  1  53  ? 72.065  22.812  391.385 1.00 87.88  ? 53  VAL 1 N     1 
ATOM   416   C  CA    . VAL A  1  53  ? 70.692  22.332  391.498 1.00 85.74  ? 53  VAL 1 CA    1 
ATOM   417   C  C     . VAL A  1  53  ? 70.239  21.692  390.190 1.00 92.10  ? 53  VAL 1 C     1 
ATOM   418   O  O     . VAL A  1  53  ? 69.317  20.872  390.190 1.00 94.76  ? 53  VAL 1 O     1 
ATOM   419   C  CB    . VAL A  1  53  ? 69.731  23.464  391.933 1.00 76.89  ? 53  VAL 1 CB    1 
ATOM   420   C  CG1   . VAL A  1  53  ? 69.654  24.561  390.891 1.00 74.45  ? 53  VAL 1 CG1   1 
ATOM   421   C  CG2   . VAL A  1  53  ? 68.339  22.917  392.260 1.00 73.13  ? 53  VAL 1 CG2   1 
ATOM   422   N  N     . ILE A  1  54  ? 70.887  22.020  389.070 1.00 96.19  ? 54  ILE 1 N     1 
ATOM   423   C  CA    . ILE A  1  54  ? 70.599  21.317  387.823 1.00 101.76 ? 54  ILE 1 CA    1 
ATOM   424   C  C     . ILE A  1  54  ? 71.168  19.903  387.873 1.00 101.90 ? 54  ILE 1 C     1 
ATOM   425   O  O     . ILE A  1  54  ? 70.480  18.923  387.558 1.00 101.59 ? 54  ILE 1 O     1 
ATOM   426   C  CB    . ILE A  1  54  ? 71.159  22.103  386.623 1.00 112.23 ? 54  ILE 1 CB    1 
ATOM   427   C  CG1   . ILE A  1  54  ? 70.289  23.327  386.326 1.00 116.64 ? 54  ILE 1 CG1   1 
ATOM   428   C  CG2   . ILE A  1  54  ? 71.258  21.206  385.390 1.00 111.91 ? 54  ILE 1 CG2   1 
ATOM   429   C  CD1   . ILE A  1  54  ? 70.877  24.258  385.276 1.00 118.46 ? 54  ILE 1 CD1   1 
ATOM   430   N  N     . GLU A  1  55  ? 72.442  19.783  388.261 1.00 103.17 ? 55  GLU 1 N     1 
ATOM   431   C  CA    . GLU A  1  55  ? 73.100  18.480  388.316 1.00 102.41 ? 55  GLU 1 CA    1 
ATOM   432   C  C     . GLU A  1  55  ? 72.436  17.566  389.340 1.00 89.73  ? 55  GLU 1 C     1 
ATOM   433   O  O     . GLU A  1  55  ? 72.359  16.347  389.140 1.00 90.35  ? 55  GLU 1 O     1 
ATOM   434   C  CB    . GLU A  1  55  ? 74.584  18.660  388.644 1.00 110.68 ? 55  GLU 1 CB    1 
ATOM   435   C  CG    . GLU A  1  55  ? 75.466  19.020  387.453 1.00 116.42 ? 55  GLU 1 CG    1 
ATOM   436   C  CD    . GLU A  1  55  ? 75.515  17.930  386.401 1.00 121.31 ? 55  GLU 1 CD    1 
ATOM   437   O  OE1   . GLU A  1  55  ? 74.856  18.090  385.353 1.00 123.51 ? 55  GLU 1 OE1   1 
ATOM   438   O  OE2   . GLU A  1  55  ? 76.210  16.914  386.619 1.00 122.74 ? 55  GLU 1 OE2   1 
ATOM   439   N  N     . GLU A  1  56  ? 71.976  18.135  390.457 1.00 74.60  ? 56  GLU 1 N     1 
ATOM   440   C  CA    . GLU A  1  56  ? 71.291  17.340  391.469 1.00 64.72  ? 56  GLU 1 CA    1 
ATOM   441   C  C     . GLU A  1  56  ? 70.031  16.697  390.907 1.00 52.39  ? 56  GLU 1 C     1 
ATOM   442   O  O     . GLU A  1  56  ? 69.756  15.522  391.170 1.00 48.47  ? 56  GLU 1 O     1 
ATOM   443   C  CB    . GLU A  1  56  ? 70.955  18.205  392.682 1.00 73.36  ? 56  GLU 1 CB    1 
ATOM   444   C  CG    . GLU A  1  56  ? 70.451  17.419  393.883 1.00 83.91  ? 56  GLU 1 CG    1 
ATOM   445   C  CD    . GLU A  1  56  ? 71.578  16.809  394.690 1.00 92.18  ? 56  GLU 1 CD    1 
ATOM   446   O  OE1   . GLU A  1  56  ? 72.678  17.395  394.705 1.00 97.82  ? 56  GLU 1 OE1   1 
ATOM   447   O  OE2   . GLU A  1  56  ? 71.368  15.749  395.313 1.00 95.30  ? 56  GLU 1 OE2   1 
ATOM   448   N  N     . VAL A  1  57  ? 69.251  17.450  390.128 1.00 49.10  ? 57  VAL 1 N     1 
ATOM   449   C  CA    . VAL A  1  57  ? 68.051  16.866  389.536 1.00 46.98  ? 57  VAL 1 CA    1 
ATOM   450   C  C     . VAL A  1  57  ? 68.420  15.894  388.420 1.00 46.52  ? 57  VAL 1 C     1 
ATOM   451   O  O     . VAL A  1  57  ? 67.725  14.892  388.207 1.00 41.04  ? 57  VAL 1 O     1 
ATOM   452   C  CB    . VAL A  1  57  ? 67.087  17.961  389.038 1.00 39.62  ? 57  VAL 1 CB    1 
ATOM   453   C  CG1   . VAL A  1  57  ? 65.745  17.351  388.659 1.00 38.32  ? 57  VAL 1 CG1   1 
ATOM   454   C  CG2   . VAL A  1  57  ? 66.880  19.009  390.112 1.00 38.46  ? 57  VAL 1 CG2   1 
ATOM   455   N  N     . LYS A  1  58  ? 69.501  16.168  387.683 1.00 54.65  ? 58  LYS 1 N     1 
ATOM   456   C  CA    . LYS A  1  58  ? 69.954  15.204  386.683 1.00 63.36  ? 58  LYS 1 CA    1 
ATOM   457   C  C     . LYS A  1  58  ? 70.267  13.858  387.326 1.00 73.44  ? 58  LYS 1 C     1 
ATOM   458   O  O     . LYS A  1  58  ? 69.881  12.804  386.805 1.00 79.69  ? 58  LYS 1 O     1 
ATOM   459   C  CB    . LYS A  1  58  ? 71.181  15.729  385.936 1.00 66.19  ? 58  LYS 1 CB    1 
ATOM   460   C  CG    . LYS A  1  58  ? 71.459  14.971  384.645 1.00 71.04  ? 58  LYS 1 CG    1 
ATOM   461   C  CD    . LYS A  1  58  ? 72.659  15.519  383.887 1.00 74.36  ? 58  LYS 1 CD    1 
ATOM   462   C  CE    . LYS A  1  58  ? 72.395  16.905  383.331 1.00 77.75  ? 58  LYS 1 CE    1 
ATOM   463   N  NZ    . LYS A  1  58  ? 73.535  17.366  382.491 1.00 80.15  ? 58  LYS 1 NZ    1 
ATOM   464   N  N     . ARG A  1  59  ? 70.960  13.878  388.466 1.00 74.89  ? 59  ARG 1 N     1 
ATOM   465   C  CA    . ARG A  1  59  ? 71.213  12.643  389.202 1.00 74.18  ? 59  ARG 1 CA    1 
ATOM   466   C  C     . ARG A  1  59  ? 69.940  12.088  389.831 1.00 75.54  ? 59  ARG 1 C     1 
ATOM   467   O  O     . ARG A  1  59  ? 69.838  10.875  390.051 1.00 74.15  ? 59  ARG 1 O     1 
ATOM   468   C  CB    . ARG A  1  59  ? 72.275  12.873  390.277 1.00 71.43  ? 59  ARG 1 CB    1 
ATOM   469   C  CG    . ARG A  1  59  ? 73.694  12.893  389.741 1.00 71.02  ? 59  ARG 1 CG    1 
ATOM   470   C  CD    . ARG A  1  59  ? 74.697  13.177  390.841 1.00 72.05  ? 59  ARG 1 CD    1 
ATOM   471   N  NE    . ARG A  1  59  ? 75.867  13.888  390.337 1.00 73.65  ? 59  ARG 1 NE    1 
ATOM   472   C  CZ    . ARG A  1  59  ? 77.102  13.711  390.796 1.00 72.08  ? 59  ARG 1 CZ    1 
ATOM   473   N  NH1   . ARG A  1  59  ? 77.331  12.840  391.770 1.00 71.53  ? 59  ARG 1 NH1   1 
ATOM   474   N  NH2   . ARG A  1  59  ? 78.109  14.404  390.282 1.00 70.59  ? 59  ARG 1 NH2   1 
ATOM   475   N  N     . SER A  1  60  ? 68.972  12.955  390.132 1.00 77.59  ? 60  SER 1 N     1 
ATOM   476   C  CA    . SER A  1  60  ? 67.749  12.534  390.808 1.00 83.16  ? 60  SER 1 CA    1 
ATOM   477   C  C     . SER A  1  60  ? 66.919  11.561  389.982 1.00 88.29  ? 60  SER 1 C     1 
ATOM   478   O  O     . SER A  1  60  ? 66.119  10.810  390.550 1.00 90.18  ? 60  SER 1 O     1 
ATOM   479   C  CB    . SER A  1  60  ? 66.890  13.752  391.147 1.00 82.00  ? 60  SER 1 CB    1 
ATOM   480   O  OG    . SER A  1  60  ? 66.307  14.305  389.977 1.00 83.00  ? 60  SER 1 OG    1 
ATOM   481   N  N     . GLY A  1  61  ? 67.077  11.565  388.662 1.00 105.96 ? 61  GLY 1 N     1 
ATOM   482   C  CA    . GLY A  1  61  ? 66.209  10.769  387.820 1.00 105.40 ? 61  GLY 1 CA    1 
ATOM   483   C  C     . GLY A  1  61  ? 64.795  11.297  387.751 1.00 102.80 ? 61  GLY 1 C     1 
ATOM   484   O  O     . GLY A  1  61  ? 63.851  10.513  387.616 1.00 97.79  ? 61  GLY 1 O     1 
ATOM   485   N  N     . LEU A  1  62  ? 64.622  12.612  387.842 1.00 108.59 ? 62  LEU 1 N     1 
ATOM   486   C  CA    . LEU A  1  62  ? 63.304  13.216  387.695 1.00 114.42 ? 62  LEU 1 CA    1 
ATOM   487   C  C     . LEU A  1  62  ? 62.957  13.215  386.214 1.00 123.62 ? 62  LEU 1 C     1 
ATOM   488   O  O     . LEU A  1  62  ? 63.607  13.894  385.412 1.00 126.41 ? 62  LEU 1 O     1 
ATOM   489   C  CB    . LEU A  1  62  ? 63.287  14.630  388.271 1.00 111.77 ? 62  LEU 1 CB    1 
ATOM   490   C  CG    . LEU A  1  62  ? 62.019  15.459  388.034 1.00 108.51 ? 62  LEU 1 CG    1 
ATOM   491   C  CD1   . LEU A  1  62  ? 60.782  14.754  388.561 1.00 107.31 ? 62  LEU 1 CD1   1 
ATOM   492   C  CD2   . LEU A  1  62  ? 62.139  16.851  388.636 1.00 107.56 ? 62  LEU 1 CD2   1 
ATOM   493   N  N     . ARG A  1  63  ? 61.948  12.437  385.847 1.00 126.47 ? 63  ARG 1 N     1 
ATOM   494   C  CA    . ARG A  1  63  ? 61.466  12.370  384.479 1.00 129.50 ? 63  ARG 1 CA    1 
ATOM   495   C  C     . ARG A  1  63  ? 60.148  13.126  384.381 1.00 130.69 ? 63  ARG 1 C     1 
ATOM   496   O  O     . ARG A  1  63  ? 59.362  13.156  385.333 1.00 132.76 ? 63  ARG 1 O     1 
ATOM   497   C  CB    . ARG A  1  63  ? 61.312  10.912  384.041 1.00 131.57 ? 63  ARG 1 CB    1 
ATOM   498   C  CG    . ARG A  1  63  ? 62.662  10.199  383.939 1.00 134.66 ? 63  ARG 1 CG    1 
ATOM   499   C  CD    . ARG A  1  63  ? 62.554  8.710   383.619 1.00 135.53 ? 63  ARG 1 CD    1 
ATOM   500   N  NE    . ARG A  1  63  ? 62.508  8.427   382.187 1.00 132.97 ? 63  ARG 1 NE    1 
ATOM   501   C  CZ    . ARG A  1  63  ? 62.348  7.210   381.675 1.00 127.60 ? 63  ARG 1 CZ    1 
ATOM   502   N  NH1   . ARG A  1  63  ? 62.224  6.161   382.478 1.00 124.05 ? 63  ARG 1 NH1   1 
ATOM   503   N  NH2   . ARG A  1  63  ? 62.317  7.040   380.360 1.00 126.75 ? 63  ARG 1 NH2   1 
ATOM   504   N  N     . GLY A  1  64  ? 59.926  13.755  383.227 1.00 129.02 ? 64  GLY 1 N     1 
ATOM   505   C  CA    . GLY A  1  64  ? 58.770  14.611  383.022 1.00 127.06 ? 64  GLY 1 CA    1 
ATOM   506   C  C     . GLY A  1  64  ? 57.458  13.995  383.459 1.00 124.32 ? 64  GLY 1 C     1 
ATOM   507   O  O     . GLY A  1  64  ? 57.103  12.900  383.016 1.00 122.47 ? 64  GLY 1 O     1 
ATOM   508   N  N     . ARG A  1  65  ? 56.727  14.690  384.332 1.00 122.93 ? 65  ARG 1 N     1 
ATOM   509   C  CA    . ARG A  1  65  ? 55.506  14.149  384.911 1.00 122.14 ? 65  ARG 1 CA    1 
ATOM   510   C  C     . ARG A  1  65  ? 54.251  14.587  384.169 1.00 122.28 ? 65  ARG 1 C     1 
ATOM   511   O  O     . ARG A  1  65  ? 53.152  14.151  384.528 1.00 127.01 ? 65  ARG 1 O     1 
ATOM   512   C  CB    . ARG A  1  65  ? 55.395  14.556  386.384 1.00 119.95 ? 65  ARG 1 CB    1 
ATOM   513   C  CG    . ARG A  1  65  ? 56.591  14.146  387.220 1.00 122.19 ? 65  ARG 1 CG    1 
ATOM   514   C  CD    . ARG A  1  65  ? 56.715  12.639  387.292 1.00 127.31 ? 65  ARG 1 CD    1 
ATOM   515   N  NE    . ARG A  1  65  ? 58.109  12.207  387.226 1.00 131.38 ? 65  ARG 1 NE    1 
ATOM   516   C  CZ    . ARG A  1  65  ? 58.868  11.958  388.288 1.00 131.21 ? 65  ARG 1 CZ    1 
ATOM   517   N  NH1   . ARG A  1  65  ? 58.372  12.111  389.509 1.00 131.25 ? 65  ARG 1 NH1   1 
ATOM   518   N  NH2   . ARG A  1  65  ? 60.127  11.565  388.131 1.00 130.01 ? 65  ARG 1 NH2   1 
ATOM   519   N  N     . GLY A  1  66  ? 54.381  15.438  383.151 1.00 115.35 ? 66  GLY 1 N     1 
ATOM   520   C  CA    . GLY A  1  66  ? 53.219  15.811  382.367 1.00 107.40 ? 66  GLY 1 CA    1 
ATOM   521   C  C     . GLY A  1  66  ? 52.733  14.727  381.433 1.00 103.79 ? 66  GLY 1 C     1 
ATOM   522   O  O     . GLY A  1  66  ? 51.639  14.862  380.873 1.00 102.96 ? 66  GLY 1 O     1 
ATOM   523   N  N     . GLY A  1  67  ? 53.506  13.656  381.267 1.00 102.96 ? 67  GLY 1 N     1 
ATOM   524   C  CA    . GLY A  1  67  ? 53.197  12.587  380.335 1.00 99.85  ? 67  GLY 1 CA    1 
ATOM   525   C  C     . GLY A  1  67  ? 54.291  12.304  379.328 1.00 95.03  ? 67  GLY 1 C     1 
ATOM   526   O  O     . GLY A  1  67  ? 54.334  11.199  378.767 1.00 95.39  ? 67  GLY 1 O     1 
ATOM   527   N  N     . ALA A  1  68  ? 55.186  13.263  379.086 1.00 88.67  ? 68  ALA 1 N     1 
ATOM   528   C  CA    . ALA A  1  68  ? 56.247  13.069  378.102 1.00 81.29  ? 68  ALA 1 CA    1 
ATOM   529   C  C     . ALA A  1  68  ? 57.244  12.010  378.559 1.00 77.79  ? 68  ALA 1 C     1 
ATOM   530   O  O     . ALA A  1  68  ? 57.417  10.975  377.903 1.00 74.33  ? 68  ALA 1 O     1 
ATOM   531   C  CB    . ALA A  1  68  ? 56.952  14.402  377.832 1.00 77.56  ? 68  ALA 1 CB    1 
ATOM   532   N  N     . GLY A  1  69  ? 57.907  12.247  379.685 1.00 79.41  ? 69  GLY 1 N     1 
ATOM   533   C  CA    . GLY A  1  69  ? 58.963  11.374  380.147 1.00 78.10  ? 69  GLY 1 CA    1 
ATOM   534   C  C     . GLY A  1  69  ? 60.363  11.883  379.888 1.00 77.03  ? 69  GLY 1 C     1 
ATOM   535   O  O     . GLY A  1  69  ? 61.315  11.100  379.983 1.00 75.25  ? 69  GLY 1 O     1 
ATOM   536   N  N     . PHE A  1  70  ? 60.516  13.162  379.558 1.00 78.91  ? 70  PHE 1 N     1 
ATOM   537   C  CA    . PHE A  1  70  ? 61.834  13.718  379.298 1.00 79.90  ? 70  PHE 1 CA    1 
ATOM   538   C  C     . PHE A  1  70  ? 62.584  13.938  380.610 1.00 82.97  ? 70  PHE 1 C     1 
ATOM   539   O  O     . PHE A  1  70  ? 61.981  14.338  381.612 1.00 83.35  ? 70  PHE 1 O     1 
ATOM   540   C  CB    . PHE A  1  70  ? 61.710  15.044  378.546 1.00 78.06  ? 70  PHE 1 CB    1 
ATOM   541   C  CG    . PHE A  1  70  ? 62.928  15.406  377.745 1.00 76.53  ? 70  PHE 1 CG    1 
ATOM   542   C  CD1   . PHE A  1  70  ? 63.876  16.276  378.255 1.00 75.08  ? 70  PHE 1 CD1   1 
ATOM   543   C  CD2   . PHE A  1  70  ? 63.121  14.884  376.477 1.00 76.64  ? 70  PHE 1 CD2   1 
ATOM   544   C  CE1   . PHE A  1  70  ? 65.000  16.610  377.519 1.00 75.11  ? 70  PHE 1 CE1   1 
ATOM   545   C  CE2   . PHE A  1  70  ? 64.243  15.218  375.737 1.00 76.41  ? 70  PHE 1 CE2   1 
ATOM   546   C  CZ    . PHE A  1  70  ? 65.181  16.081  376.259 1.00 75.61  ? 70  PHE 1 CZ    1 
ATOM   547   N  N     . PRO A  1  71  ? 63.899  13.679  380.640 1.00 84.36  ? 71  PRO 1 N     1 
ATOM   548   C  CA    . PRO A  1  71  ? 64.692  14.030  381.827 1.00 82.67  ? 71  PRO 1 CA    1 
ATOM   549   C  C     . PRO A  1  71  ? 64.736  15.535  382.053 1.00 82.67  ? 71  PRO 1 C     1 
ATOM   550   O  O     . PRO A  1  71  ? 65.319  16.268  381.248 1.00 78.59  ? 71  PRO 1 O     1 
ATOM   551   C  CB    . PRO A  1  71  ? 66.080  13.466  381.499 1.00 81.47  ? 71  PRO 1 CB    1 
ATOM   552   C  CG    . PRO A  1  71  ? 65.809  12.353  380.536 1.00 83.27  ? 71  PRO 1 CG    1 
ATOM   553   C  CD    . PRO A  1  71  ? 64.667  12.853  379.692 1.00 85.57  ? 71  PRO 1 CD    1 
ATOM   554   N  N     . THR A  1  72  ? 64.111  16.002  383.141 1.00 85.81  ? 72  THR 1 N     1 
ATOM   555   C  CA    . THR A  1  72  ? 63.983  17.439  383.378 1.00 82.54  ? 72  THR 1 CA    1 
ATOM   556   C  C     . THR A  1  72  ? 65.340  18.115  383.551 1.00 85.86  ? 72  THR 1 C     1 
ATOM   557   O  O     . THR A  1  72  ? 65.481  19.312  383.262 1.00 87.67  ? 72  THR 1 O     1 
ATOM   558   C  CB    . THR A  1  72  ? 63.101  17.692  384.602 1.00 72.78  ? 72  THR 1 CB    1 
ATOM   559   O  OG1   . THR A  1  72  ? 63.893  17.604  385.792 1.00 69.91  ? 72  THR 1 OG1   1 
ATOM   560   C  CG2   . THR A  1  72  ? 61.971  16.675  384.669 1.00 69.09  ? 72  THR 1 CG2   1 
ATOM   561   N  N     . GLY A  1  73  ? 66.347  17.368  383.998 1.00 87.28  ? 73  GLY 1 N     1 
ATOM   562   C  CA    . GLY A  1  73  ? 67.683  17.909  384.142 1.00 90.81  ? 73  GLY 1 CA    1 
ATOM   563   C  C     . GLY A  1  73  ? 68.233  18.393  382.818 1.00 95.51  ? 73  GLY 1 C     1 
ATOM   564   O  O     . GLY A  1  73  ? 68.600  19.563  382.677 1.00 93.06  ? 73  GLY 1 O     1 
ATOM   565   N  N     . LEU A  1  74  ? 68.295  17.491  381.835 1.00 103.92 ? 74  LEU 1 N     1 
ATOM   566   C  CA    . LEU A  1  74  ? 68.738  17.872  380.498 1.00 108.61 ? 74  LEU 1 CA    1 
ATOM   567   C  C     . LEU A  1  74  ? 67.796  18.897  379.876 1.00 107.85 ? 74  LEU 1 C     1 
ATOM   568   O  O     . LEU A  1  74  ? 68.236  19.773  379.118 1.00 104.45 ? 74  LEU 1 O     1 
ATOM   569   C  CB    . LEU A  1  74  ? 68.841  16.624  379.618 1.00 114.67 ? 74  LEU 1 CB    1 
ATOM   570   C  CG    . LEU A  1  74  ? 69.263  16.784  378.158 1.00 118.08 ? 74  LEU 1 CG    1 
ATOM   571   C  CD1   . LEU A  1  74  ? 70.719  17.211  378.060 1.00 119.24 ? 74  LEU 1 CD1   1 
ATOM   572   C  CD2   . LEU A  1  74  ? 69.020  15.496  377.380 1.00 119.28 ? 74  LEU 1 CD2   1 
ATOM   573   N  N     . LYS A  1  75  ? 66.503  18.800  380.195 1.00 112.87 ? 75  LYS 1 N     1 
ATOM   574   C  CA    . LYS A  1  75  ? 65.518  19.774  379.733 1.00 118.83 ? 75  LYS 1 CA    1 
ATOM   575   C  C     . LYS A  1  75  ? 65.932  21.192  380.101 1.00 106.26 ? 75  LYS 1 C     1 
ATOM   576   O  O     . LYS A  1  75  ? 65.879  22.109  379.273 1.00 101.56 ? 75  LYS 1 O     1 
ATOM   577   C  CB    . LYS A  1  75  ? 64.157  19.436  380.347 1.00 133.76 ? 75  LYS 1 CB    1 
ATOM   578   C  CG    . LYS A  1  75  ? 62.967  20.199  379.805 1.00 147.69 ? 75  LYS 1 CG    1 
ATOM   579   C  CD    . LYS A  1  75  ? 61.726  19.836  380.610 1.00 160.90 ? 75  LYS 1 CD    1 
ATOM   580   C  CE    . LYS A  1  75  ? 60.451  20.080  379.829 1.00 171.98 ? 75  LYS 1 CE    1 
ATOM   581   N  NZ    . LYS A  1  75  ? 59.252  19.728  380.638 1.00 182.01 ? 75  LYS 1 NZ    1 
ATOM   582   N  N     . TRP A  1  76  ? 66.344  21.387  381.353 1.00 98.87  ? 76  TRP 1 N     1 
ATOM   583   C  CA    . TRP A  1  76  ? 66.825  22.694  381.785 1.00 89.53  ? 76  TRP 1 CA    1 
ATOM   584   C  C     . TRP A  1  76  ? 68.226  22.982  381.259 1.00 87.03  ? 76  TRP 1 C     1 
ATOM   585   O  O     . TRP A  1  76  ? 68.567  24.144  381.015 1.00 82.16  ? 76  TRP 1 O     1 
ATOM   586   C  CB    . TRP A  1  76  ? 66.798  22.780  383.313 1.00 80.69  ? 76  TRP 1 CB    1 
ATOM   587   C  CG    . TRP A  1  76  ? 65.438  22.533  383.901 1.00 70.42  ? 76  TRP 1 CG    1 
ATOM   588   C  CD1   . TRP A  1  76  ? 64.291  22.237  383.223 1.00 65.98  ? 76  TRP 1 CD1   1 
ATOM   589   C  CD2   . TRP A  1  76  ? 65.094  22.523  385.288 1.00 63.62  ? 76  TRP 1 CD2   1 
ATOM   590   N  NE1   . TRP A  1  76  ? 63.254  22.058  384.099 1.00 62.41  ? 76  TRP 1 NE1   1 
ATOM   591   C  CE2   . TRP A  1  76  ? 63.720  22.228  385.375 1.00 62.45  ? 76  TRP 1 CE2   1 
ATOM   592   C  CE3   . TRP A  1  76  ? 65.811  22.740  386.466 1.00 61.81  ? 76  TRP 1 CE3   1 
ATOM   593   C  CZ2   . TRP A  1  76  ? 63.051  22.148  386.591 1.00 64.23  ? 76  TRP 1 CZ2   1 
ATOM   594   C  CZ3   . TRP A  1  76  ? 65.145  22.659  387.671 1.00 61.84  ? 76  TRP 1 CZ3   1 
ATOM   595   C  CH2   . TRP A  1  76  ? 63.780  22.367  387.725 1.00 64.48  ? 76  TRP 1 CH2   1 
ATOM   596   N  N     . SER A  1  77  ? 69.045  21.942  381.079 1.00 91.68  ? 77  SER 1 N     1 
ATOM   597   C  CA    . SER A  1  77  ? 70.401  22.139  380.583 1.00 98.89  ? 77  SER 1 CA    1 
ATOM   598   C  C     . SER A  1  77  ? 70.424  22.587  379.128 1.00 105.10 ? 77  SER 1 C     1 
ATOM   599   O  O     . SER A  1  77  ? 71.459  23.073  378.659 1.00 108.58 ? 77  SER 1 O     1 
ATOM   600   C  CB    . SER A  1  77  ? 71.214  20.851  380.744 1.00 97.52  ? 77  SER 1 CB    1 
ATOM   601   O  OG    . SER A  1  77  ? 71.030  19.990  379.633 1.00 98.11  ? 77  SER 1 OG    1 
ATOM   602   N  N     . PHE A  1  78  ? 69.313  22.431  378.405 1.00 107.12 ? 78  PHE 1 N     1 
ATOM   603   C  CA    . PHE A  1  78  ? 69.204  22.973  377.054 1.00 106.95 ? 78  PHE 1 CA    1 
ATOM   604   C  C     . PHE A  1  78  ? 68.932  24.473  377.028 1.00 103.94 ? 78  PHE 1 C     1 
ATOM   605   O  O     . PHE A  1  78  ? 69.078  25.092  375.968 1.00 103.32 ? 78  PHE 1 O     1 
ATOM   606   C  CB    . PHE A  1  78  ? 68.114  22.243  376.266 1.00 106.86 ? 78  PHE 1 CB    1 
ATOM   607   C  CG    . PHE A  1  78  ? 68.522  20.874  375.801 1.00 102.48 ? 78  PHE 1 CG    1 
ATOM   608   C  CD1   . PHE A  1  78  ? 69.806  20.642  375.339 1.00 100.11 ? 78  PHE 1 CD1   1 
ATOM   609   C  CD2   . PHE A  1  78  ? 67.620  19.823  375.813 1.00 99.54  ? 78  PHE 1 CD2   1 
ATOM   610   C  CE1   . PHE A  1  78  ? 70.187  19.389  374.908 1.00 99.40  ? 78  PHE 1 CE1   1 
ATOM   611   C  CE2   . PHE A  1  78  ? 67.997  18.565  375.381 1.00 97.68  ? 78  PHE 1 CE2   1 
ATOM   612   C  CZ    . PHE A  1  78  ? 69.282  18.350  374.929 1.00 98.87  ? 78  PHE 1 CZ    1 
ATOM   613   N  N     . MET A  1  79  ? 68.534  25.064  378.152 1.00 101.71 ? 79  MET 1 N     1 
ATOM   614   C  CA    . MET A  1  79  ? 68.194  26.478  378.194 1.00 103.11 ? 79  MET 1 CA    1 
ATOM   615   C  C     . MET A  1  79  ? 69.412  27.341  377.860 1.00 106.56 ? 79  MET 1 C     1 
ATOM   616   O  O     . MET A  1  79  ? 70.556  26.919  378.061 1.00 105.63 ? 79  MET 1 O     1 
ATOM   617   C  CB    . MET A  1  79  ? 67.658  26.838  379.578 1.00 103.41 ? 79  MET 1 CB    1 
ATOM   618   C  CG    . MET A  1  79  ? 66.287  26.265  379.883 1.00 103.98 ? 79  MET 1 CG    1 
ATOM   619   S  SD    . MET A  1  79  ? 65.001  27.225  379.074 1.00 102.30 ? 79  MET 1 SD    1 
ATOM   620   C  CE    . MET A  1  79  ? 65.206  28.780  379.933 1.00 98.43  ? 79  MET 1 CE    1 
ATOM   621   N  N     . PRO A  1  80  ? 69.193  28.554  377.333 1.00 111.71 ? 80  PRO 1 N     1 
ATOM   622   C  CA    . PRO A  1  80  ? 70.331  29.394  376.919 1.00 112.29 ? 80  PRO 1 CA    1 
ATOM   623   C  C     . PRO A  1  80  ? 71.330  29.646  378.032 1.00 109.50 ? 80  PRO 1 C     1 
ATOM   624   O  O     . PRO A  1  80  ? 72.516  29.867  377.752 1.00 107.12 ? 80  PRO 1 O     1 
ATOM   625   C  CB    . PRO A  1  80  ? 69.643  30.690  376.470 1.00 113.36 ? 80  PRO 1 CB    1 
ATOM   626   C  CG    . PRO A  1  80  ? 68.337  30.204  375.932 1.00 113.78 ? 80  PRO 1 CG    1 
ATOM   627   C  CD    . PRO A  1  80  ? 67.913  29.186  376.965 1.00 113.93 ? 80  PRO 1 CD    1 
ATOM   628   N  N     . LYS A  1  81  ? 70.863  29.671  379.284 1.00 110.21 ? 81  LYS 1 N     1 
ATOM   629   C  CA    . LYS A  1  81  ? 71.694  29.661  380.483 1.00 109.73 ? 81  LYS 1 CA    1 
ATOM   630   C  C     . LYS A  1  81  ? 72.413  30.988  380.700 1.00 106.52 ? 81  LYS 1 C     1 
ATOM   631   O  O     . LYS A  1  81  ? 72.969  31.226  381.777 1.00 102.53 ? 81  LYS 1 O     1 
ATOM   632   C  CB    . LYS A  1  81  ? 72.702  28.508  380.393 1.00 111.26 ? 81  LYS 1 CB    1 
ATOM   633   C  CG    . LYS A  1  81  ? 73.381  28.111  381.689 1.00 111.81 ? 81  LYS 1 CG    1 
ATOM   634   C  CD    . LYS A  1  81  ? 74.232  26.861  381.486 1.00 111.76 ? 81  LYS 1 CD    1 
ATOM   635   C  CE    . LYS A  1  81  ? 73.434  25.577  381.709 1.00 109.17 ? 81  LYS 1 CE    1 
ATOM   636   N  NZ    . LYS A  1  81  ? 72.322  25.383  380.734 1.00 105.50 ? 81  LYS 1 NZ    1 
ATOM   637   N  N     . ASP A  1  82  ? 72.386  31.868  379.698 1.00 105.41 ? 82  ASP 1 N     1 
ATOM   638   C  CA    . ASP A  1  82  ? 72.849  33.241  379.856 1.00 104.58 ? 82  ASP 1 CA    1 
ATOM   639   C  C     . ASP A  1  82  ? 72.395  34.093  378.678 1.00 106.09 ? 82  ASP 1 C     1 
ATOM   640   O  O     . ASP A  1  82  ? 72.815  33.850  377.542 1.00 108.84 ? 82  ASP 1 O     1 
ATOM   641   C  CB    . ASP A  1  82  ? 74.372  33.294  379.991 1.00 102.29 ? 82  ASP 1 CB    1 
ATOM   642   C  CG    . ASP A  1  82  ? 74.841  34.506  380.768 1.00 97.89  ? 82  ASP 1 CG    1 
ATOM   643   O  OD1   . ASP A  1  82  ? 74.263  35.597  380.580 1.00 97.57  ? 82  ASP 1 OD1   1 
ATOM   644   O  OD2   . ASP A  1  82  ? 75.790  34.368  381.567 1.00 97.80  ? 82  ASP 1 OD2   1 
ATOM   645   N  N     . ASP A  1  83  ? 71.533  35.079  378.924 1.00 103.98 ? 83  ASP 1 N     1 
ATOM   646   C  CA    . ASP A  1  83  ? 71.093  35.956  377.843 1.00 97.30  ? 83  ASP 1 CA    1 
ATOM   647   C  C     . ASP A  1  83  ? 71.059  37.434  378.201 1.00 90.29  ? 83  ASP 1 C     1 
ATOM   648   O  O     . ASP A  1  83  ? 71.177  38.263  377.294 1.00 87.96  ? 83  ASP 1 O     1 
ATOM   649   C  CB    . ASP A  1  83  ? 69.698  35.548  377.361 1.00 97.70  ? 83  ASP 1 CB    1 
ATOM   650   C  CG    . ASP A  1  83  ? 68.664  35.606  378.467 1.00 95.40  ? 83  ASP 1 CG    1 
ATOM   651   O  OD1   . ASP A  1  83  ? 69.048  35.739  379.649 1.00 94.56  ? 83  ASP 1 OD1   1 
ATOM   652   O  OD2   . ASP A  1  83  ? 67.459  35.515  378.159 1.00 96.24  ? 83  ASP 1 OD2   1 
ATOM   653   N  N     . GLY A  1  84  ? 70.918  37.802  379.473 1.00 87.27  ? 84  GLY 1 N     1 
ATOM   654   C  CA    . GLY A  1  84  ? 70.568  39.153  379.840 1.00 84.00  ? 84  GLY 1 CA    1 
ATOM   655   C  C     . GLY A  1  84  ? 69.107  39.492  379.646 1.00 79.22  ? 84  GLY 1 C     1 
ATOM   656   O  O     . GLY A  1  84  ? 68.638  40.495  380.199 1.00 73.87  ? 84  GLY 1 O     1 
ATOM   657   N  N     . LYS A  1  85  ? 68.373  38.693  378.874 1.00 78.91  ? 85  LYS 1 N     1 
ATOM   658   C  CA    . LYS A  1  85  ? 66.945  38.888  378.682 1.00 77.92  ? 85  LYS 1 CA    1 
ATOM   659   C  C     . LYS A  1  85  ? 66.152  38.178  379.771 1.00 70.56  ? 85  LYS 1 C     1 
ATOM   660   O  O     . LYS A  1  85  ? 66.573  37.154  380.316 1.00 67.08  ? 85  LYS 1 O     1 
ATOM   661   C  CB    . LYS A  1  85  ? 66.493  38.390  377.305 1.00 79.53  ? 85  LYS 1 CB    1 
ATOM   662   C  CG    . LYS A  1  85  ? 67.019  39.208  376.135 1.00 79.15  ? 85  LYS 1 CG    1 
ATOM   663   C  CD    . LYS A  1  85  ? 66.378  38.779  374.819 1.00 76.13  ? 85  LYS 1 CD    1 
ATOM   664   C  CE    . LYS A  1  85  ? 66.633  39.807  373.724 1.00 70.53  ? 85  LYS 1 CE    1 
ATOM   665   N  NZ    . LYS A  1  85  ? 65.787  39.571  372.521 1.00 66.31  ? 85  LYS 1 NZ    1 
ATOM   666   N  N     . GLN A  1  86  ? 64.990  38.744  380.079 1.00 68.44  ? 86  GLN 1 N     1 
ATOM   667   C  CA    . GLN A  1  86  ? 64.081  38.135  381.037 1.00 67.90  ? 86  GLN 1 CA    1 
ATOM   668   C  C     . GLN A  1  86  ? 63.634  36.761  380.554 1.00 69.42  ? 86  GLN 1 C     1 
ATOM   669   O  O     . GLN A  1  86  ? 63.360  36.556  379.368 1.00 65.75  ? 86  GLN 1 O     1 
ATOM   670   C  CB    . GLN A  1  86  ? 62.867  39.046  381.246 1.00 62.77  ? 86  GLN 1 CB    1 
ATOM   671   C  CG    . GLN A  1  86  ? 61.657  38.374  381.877 1.00 56.51  ? 86  GLN 1 CG    1 
ATOM   672   C  CD    . GLN A  1  86  ? 61.761  38.281  383.381 1.00 53.40  ? 86  GLN 1 CD    1 
ATOM   673   O  OE1   . GLN A  1  86  ? 62.677  37.658  383.916 1.00 53.20  ? 86  GLN 1 OE1   1 
ATOM   674   N  NE2   . GLN A  1  86  ? 60.818  38.903  384.076 1.00 52.62  ? 86  GLN 1 NE2   1 
ATOM   675   N  N     . HIS A  1  87  ? 63.573  35.813  381.481 1.00 50.65  ? 87  HIS 1 N     1 
ATOM   676   C  CA    . HIS A  1  87  ? 62.990  34.502  381.244 1.00 60.15  ? 87  HIS 1 CA    1 
ATOM   677   C  C     . HIS A  1  87  ? 61.648  34.384  381.951 1.00 65.56  ? 87  HIS 1 C     1 
ATOM   678   O  O     . HIS A  1  87  ? 61.246  35.244  382.741 1.00 68.48  ? 87  HIS 1 O     1 
ATOM   679   C  CB    . HIS A  1  87  ? 63.920  33.374  381.706 1.00 66.95  ? 87  HIS 1 CB    1 
ATOM   680   C  CG    . HIS A  1  87  ? 65.246  33.357  381.018 1.00 74.89  ? 87  HIS 1 CG    1 
ATOM   681   N  ND1   . HIS A  1  87  ? 66.365  32.775  381.573 1.00 80.30  ? 87  HIS 1 ND1   1 
ATOM   682   C  CD2   . HIS A  1  87  ? 65.628  33.828  379.808 1.00 79.79  ? 87  HIS 1 CD2   1 
ATOM   683   C  CE1   . HIS A  1  87  ? 67.382  32.897  380.738 1.00 79.80  ? 87  HIS 1 CE1   1 
ATOM   684   N  NE2   . HIS A  1  87  ? 66.960  33.530  379.659 1.00 79.56  ? 87  HIS 1 NE2   1 
ATOM   685   N  N     . TYR A  1  88  ? 60.953  33.297  381.642 1.00 67.42  ? 88  TYR 1 N     1 
ATOM   686   C  CA    . TYR A  1  88  ? 59.686  32.972  382.273 1.00 67.85  ? 88  TYR 1 CA    1 
ATOM   687   C  C     . TYR A  1  88  ? 59.710  31.520  382.723 1.00 70.22  ? 88  TYR 1 C     1 
ATOM   688   O  O     . TYR A  1  88  ? 60.382  30.670  382.126 1.00 65.61  ? 88  TYR 1 O     1 
ATOM   689   C  CB    . TYR A  1  88  ? 58.496  33.195  381.327 1.00 66.40  ? 88  TYR 1 CB    1 
ATOM   690   C  CG    . TYR A  1  88  ? 58.134  34.643  381.082 1.00 62.70  ? 88  TYR 1 CG    1 
ATOM   691   C  CD1   . TYR A  1  88  ? 57.319  35.333  381.968 1.00 61.53  ? 88  TYR 1 CD1   1 
ATOM   692   C  CD2   . TYR A  1  88  ? 58.581  35.312  379.952 1.00 60.93  ? 88  TYR 1 CD2   1 
ATOM   693   C  CE1   . TYR A  1  88  ? 56.971  36.655  381.744 1.00 59.77  ? 88  TYR 1 CE1   1 
ATOM   694   C  CE2   . TYR A  1  88  ? 58.238  36.633  379.721 1.00 60.24  ? 88  TYR 1 CE2   1 
ATOM   695   C  CZ    . TYR A  1  88  ? 57.433  37.298  380.621 1.00 58.82  ? 88  TYR 1 CZ    1 
ATOM   696   O  OH    . TYR A  1  88  ? 57.086  38.610  380.399 1.00 57.59  ? 88  TYR 1 OH    1 
ATOM   697   N  N     . LEU A  1  89  ? 58.965  31.250  383.786 1.00 75.87  ? 89  LEU 1 N     1 
ATOM   698   C  CA    . LEU A  1  89  ? 58.717  29.904  384.279 1.00 80.20  ? 89  LEU 1 CA    1 
ATOM   699   C  C     . LEU A  1  89  ? 57.252  29.587  384.033 1.00 83.39  ? 89  LEU 1 C     1 
ATOM   700   O  O     . LEU A  1  89  ? 56.384  30.427  384.301 1.00 83.37  ? 89  LEU 1 O     1 
ATOM   701   C  CB    . LEU A  1  89  ? 59.036  29.793  385.771 1.00 81.51  ? 89  LEU 1 CB    1 
ATOM   702   C  CG    . LEU A  1  89  ? 58.808  28.411  386.384 1.00 84.29  ? 89  LEU 1 CG    1 
ATOM   703   C  CD1   . LEU A  1  89  ? 59.468  27.317  385.554 1.00 86.16  ? 89  LEU 1 CD1   1 
ATOM   704   C  CD2   . LEU A  1  89  ? 59.278  28.383  387.822 1.00 85.62  ? 89  LEU 1 CD2   1 
ATOM   705   N  N     . ILE A  1  90  ? 56.965  28.389  383.531 1.00 89.68  ? 90  ILE 1 N     1 
ATOM   706   C  CA    . ILE A  1  90  ? 55.595  28.015  383.217 1.00 96.69  ? 90  ILE 1 CA    1 
ATOM   707   C  C     . ILE A  1  90  ? 55.251  26.744  383.971 1.00 97.58  ? 90  ILE 1 C     1 
ATOM   708   O  O     . ILE A  1  90  ? 55.922  25.716  383.812 1.00 94.77  ? 90  ILE 1 O     1 
ATOM   709   C  CB    . ILE A  1  90  ? 55.394  27.829  381.707 1.00 103.25 ? 90  ILE 1 CB    1 
ATOM   710   C  CG1   . ILE A  1  90  ? 55.626  29.160  380.990 1.00 106.55 ? 90  ILE 1 CG1   1 
ATOM   711   C  CG2   . ILE A  1  90  ? 54.000  27.291  381.419 1.00 102.61 ? 90  ILE 1 CG2   1 
ATOM   712   C  CD1   . ILE A  1  90  ? 55.428  29.103  379.500 1.00 107.98 ? 90  ILE 1 CD1   1 
ATOM   713   N  N     . CYS A  1  91  ? 54.206  26.820  384.788 1.00 101.03 ? 91  CYS 1 N     1 
ATOM   714   C  CA    . CYS A  1  91  ? 53.656  25.671  385.487 1.00 109.72 ? 91  CYS 1 CA    1 
ATOM   715   C  C     . CYS A  1  91  ? 52.501  25.137  384.657 1.00 116.10 ? 91  CYS 1 C     1 
ATOM   716   O  O     . CYS A  1  91  ? 51.536  25.861  384.392 1.00 112.52 ? 91  CYS 1 O     1 
ATOM   717   C  CB    . CYS A  1  91  ? 53.180  26.057  386.885 1.00 115.99 ? 91  CYS 1 CB    1 
ATOM   718   S  SG    . CYS A  1  91  ? 52.505  24.699  387.865 1.00 122.66 ? 91  CYS 1 SG    1 
ATOM   719   N  N     . ASN A  1  92  ? 52.597  23.874  384.253 1.00 126.80 ? 92  ASN 1 N     1 
ATOM   720   C  CA    . ASN A  1  92  ? 51.591  23.263  383.388 1.00 135.88 ? 92  ASN 1 CA    1 
ATOM   721   C  C     . ASN A  1  92  ? 50.518  22.642  384.280 1.00 125.62 ? 92  ASN 1 C     1 
ATOM   722   O  O     . ASN A  1  92  ? 50.523  21.449  384.588 1.00 126.03 ? 92  ASN 1 O     1 
ATOM   723   C  CB    . ASN A  1  92  ? 52.244  22.256  382.450 1.00 151.12 ? 92  ASN 1 CB    1 
ATOM   724   C  CG    . ASN A  1  92  ? 51.321  21.808  381.341 1.00 165.41 ? 92  ASN 1 CG    1 
ATOM   725   O  OD1   . ASN A  1  92  ? 50.205  22.304  381.205 1.00 167.79 ? 92  ASN 1 OD1   1 
ATOM   726   N  ND2   . ASN A  1  92  ? 51.803  20.895  380.508 1.00 179.73 ? 92  ASN 1 ND2   1 
ATOM   727   N  N     . ALA A  1  93  ? 49.587  23.493  384.714 1.00 116.52 ? 93  ALA 1 N     1 
ATOM   728   C  CA    . ALA A  1  93  ? 48.517  23.100  385.620 1.00 105.78 ? 93  ALA 1 CA    1 
ATOM   729   C  C     . ALA A  1  93  ? 47.228  22.719  384.905 1.00 95.99  ? 93  ALA 1 C     1 
ATOM   730   O  O     . ALA A  1  93  ? 46.191  22.568  385.559 1.00 86.02  ? 93  ALA 1 O     1 
ATOM   731   C  CB    . ALA A  1  93  ? 48.239  24.222  386.623 1.00 107.21 ? 93  ALA 1 CB    1 
ATOM   732   N  N     . ASP A  1  94  ? 47.260  22.565  383.585 1.00 96.43  ? 94  ASP 1 N     1 
ATOM   733   C  CA    . ASP A  1  94  ? 46.089  22.087  382.855 1.00 95.07  ? 94  ASP 1 CA    1 
ATOM   734   C  C     . ASP A  1  94  ? 46.013  20.577  383.016 1.00 94.12  ? 94  ASP 1 C     1 
ATOM   735   O  O     . ASP A  1  94  ? 46.719  19.828  382.336 1.00 92.77  ? 94  ASP 1 O     1 
ATOM   736   C  CB    . ASP A  1  94  ? 46.160  22.475  381.384 1.00 95.75  ? 94  ASP 1 CB    1 
ATOM   737   C  CG    . ASP A  1  94  ? 44.905  22.087  380.621 1.00 95.65  ? 94  ASP 1 CG    1 
ATOM   738   O  OD1   . ASP A  1  94  ? 43.931  22.868  380.633 1.00 95.60  ? 94  ASP 1 OD1   1 
ATOM   739   O  OD2   . ASP A  1  94  ? 44.879  20.989  380.029 1.00 97.19  ? 94  ASP 1 OD2   1 
ATOM   740   N  N     . GLU A  1  95  ? 45.161  20.120  383.924 1.00 90.50  ? 95  GLU 1 N     1 
ATOM   741   C  CA    . GLU A  1  95  ? 44.932  18.696  384.134 1.00 82.75  ? 95  GLU 1 CA    1 
ATOM   742   C  C     . GLU A  1  95  ? 43.562  18.387  383.542 1.00 74.30  ? 95  GLU 1 C     1 
ATOM   743   O  O     . GLU A  1  95  ? 42.535  18.480  384.217 1.00 76.30  ? 95  GLU 1 O     1 
ATOM   744   C  CB    . GLU A  1  95  ? 45.002  18.330  385.601 1.00 77.12  ? 95  GLU 1 CB    1 
ATOM   745   C  CG    . GLU A  1  95  ? 44.658  16.891  385.864 1.00 70.11  ? 95  GLU 1 CG    1 
ATOM   746   C  CD    . GLU A  1  95  ? 44.651  16.570  387.330 1.00 68.76  ? 95  GLU 1 CD    1 
ATOM   747   O  OE1   . GLU A  1  95  ? 43.916  17.241  388.083 1.00 69.40  ? 95  GLU 1 OE1   1 
ATOM   748   O  OE2   . GLU A  1  95  ? 45.388  15.652  387.732 1.00 68.28  ? 95  GLU 1 OE2   1 
ATOM   749   N  N     . SER A  1  96  ? 43.558  18.009  382.266 1.00 68.09  ? 96  SER 1 N     1 
ATOM   750   C  CA    . SER A  1  96  ? 42.326  17.756  381.539 1.00 67.90  ? 96  SER 1 CA    1 
ATOM   751   C  C     . SER A  1  96  ? 42.214  16.336  381.017 1.00 63.04  ? 96  SER 1 C     1 
ATOM   752   O  O     . SER A  1  96  ? 41.099  15.897  380.715 1.00 57.76  ? 96  SER 1 O     1 
ATOM   753   C  CB    . SER A  1  96  ? 42.190  18.730  380.357 1.00 76.55  ? 96  SER 1 CB    1 
ATOM   754   O  OG    . SER A  1  96  ? 42.293  20.080  380.781 1.00 78.33  ? 96  SER 1 OG    1 
ATOM   755   N  N     . GLU A  1  97  ? 43.320  15.613  380.915 1.00 65.36  ? 97  GLU 1 N     1 
ATOM   756   C  CA    . GLU A  1  97  ? 43.292  14.275  380.355 1.00 74.01  ? 97  GLU 1 CA    1 
ATOM   757   C  C     . GLU A  1  97  ? 42.397  13.378  381.209 1.00 82.85  ? 97  GLU 1 C     1 
ATOM   758   O  O     . GLU A  1  97  ? 42.468  13.424  382.444 1.00 82.37  ? 97  GLU 1 O     1 
ATOM   759   C  CB    . GLU A  1  97  ? 44.713  13.714  380.280 1.00 70.32  ? 97  GLU 1 CB    1 
ATOM   760   C  CG    . GLU A  1  97  ? 44.826  12.377  379.598 1.00 60.73  ? 97  GLU 1 CG    1 
ATOM   761   C  CD    . GLU A  1  97  ? 46.146  12.221  378.884 1.00 51.41  ? 97  GLU 1 CD    1 
ATOM   762   O  OE1   . GLU A  1  97  ? 46.993  13.135  378.983 1.00 47.96  ? 97  GLU 1 OE1   1 
ATOM   763   O  OE2   . GLU A  1  97  ? 46.329  11.195  378.210 1.00 47.50  ? 97  GLU 1 OE2   1 
ATOM   764   N  N     . PRO A  1  98  ? 41.535  12.569  380.592 1.00 94.66  ? 98  PRO 1 N     1 
ATOM   765   C  CA    . PRO A  1  98  ? 40.575  11.779  381.373 1.00 102.49 ? 98  PRO 1 CA    1 
ATOM   766   C  C     . PRO A  1  98  ? 41.266  10.889  382.395 1.00 103.50 ? 98  PRO 1 C     1 
ATOM   767   O  O     . PRO A  1  98  ? 42.366  10.377  382.170 1.00 103.66 ? 98  PRO 1 O     1 
ATOM   768   C  CB    . PRO A  1  98  ? 39.850  10.952  380.308 1.00 103.45 ? 98  PRO 1 CB    1 
ATOM   769   C  CG    . PRO A  1  98  ? 39.980  11.768  379.057 1.00 101.45 ? 98  PRO 1 CG    1 
ATOM   770   C  CD    . PRO A  1  98  ? 41.329  12.416  379.140 1.00 97.89  ? 98  PRO 1 CD    1 
ATOM   771   N  N     . GLY A  1  99  ? 40.607  10.722  383.540 1.00 106.95 ? 99  GLY 1 N     1 
ATOM   772   C  CA    . GLY A  1  99  ? 41.147  9.896   384.600 1.00 107.24 ? 99  GLY 1 CA    1 
ATOM   773   C  C     . GLY A  1  99  ? 42.291  10.506  385.378 1.00 107.09 ? 99  GLY 1 C     1 
ATOM   774   O  O     . GLY A  1  99  ? 42.931  9.797   386.162 1.00 111.34 ? 99  GLY 1 O     1 
ATOM   775   N  N     . SER A  1  100 ? 42.578  11.792  385.187 1.00 98.76  ? 100 SER 1 N     1 
ATOM   776   C  CA    . SER A  1  100 ? 43.678  12.470  385.869 1.00 91.02  ? 100 SER 1 CA    1 
ATOM   777   C  C     . SER A  1  100 ? 43.097  13.579  386.738 1.00 81.37  ? 100 SER 1 C     1 
ATOM   778   O  O     . SER A  1  100 ? 42.526  14.546  386.220 1.00 84.86  ? 100 SER 1 O     1 
ATOM   779   C  CB    . SER A  1  100 ? 44.687  13.025  384.865 1.00 93.02  ? 100 SER 1 CB    1 
ATOM   780   O  OG    . SER A  1  100 ? 45.629  13.872  385.499 1.00 95.04  ? 100 SER 1 OG    1 
ATOM   781   N  N     . PHE A  1  101 ? 43.216  13.423  388.058 1.00 70.19  ? 101 PHE 1 N     1 
ATOM   782   C  CA    . PHE A  1  101 ? 42.750  14.410  389.025 1.00 61.07  ? 101 PHE 1 CA    1 
ATOM   783   C  C     . PHE A  1  101 ? 43.793  14.651  390.118 1.00 53.89  ? 101 PHE 1 C     1 
ATOM   784   O  O     . PHE A  1  101 ? 43.442  14.951  391.263 1.00 53.60  ? 101 PHE 1 O     1 
ATOM   785   C  CB    . PHE A  1  101 ? 41.411  13.978  389.625 1.00 59.55  ? 101 PHE 1 CB    1 
ATOM   786   C  CG    . PHE A  1  101 ? 41.293  12.492  389.830 1.00 63.58  ? 101 PHE 1 CG    1 
ATOM   787   C  CD1   . PHE A  1  101 ? 41.725  11.906  391.004 1.00 64.89  ? 101 PHE 1 CD1   1 
ATOM   788   C  CD2   . PHE A  1  101 ? 40.759  11.678  388.844 1.00 65.53  ? 101 PHE 1 CD2   1 
ATOM   789   C  CE1   . PHE A  1  101 ? 41.625  10.541  391.196 1.00 63.07  ? 101 PHE 1 CE1   1 
ATOM   790   C  CE2   . PHE A  1  101 ? 40.660  10.306  389.035 1.00 65.82  ? 101 PHE 1 CE2   1 
ATOM   791   C  CZ    . PHE A  1  101 ? 41.094  9.742   390.212 1.00 63.83  ? 101 PHE 1 CZ    1 
ATOM   792   N  N     . LYS A  1  102 ? 45.081  14.540  389.773 1.00 45.74  ? 102 LYS 1 N     1 
ATOM   793   C  CA    . LYS A  1  102 ? 46.141  14.628  390.775 1.00 41.17  ? 102 LYS 1 CA    1 
ATOM   794   C  C     . LYS A  1  102 ? 46.472  16.068  391.155 1.00 48.30  ? 102 LYS 1 C     1 
ATOM   795   O  O     . LYS A  1  102 ? 46.560  16.394  392.344 1.00 51.43  ? 102 LYS 1 O     1 
ATOM   796   C  CB    . LYS A  1  102 ? 47.400  13.901  390.287 1.00 38.30  ? 102 LYS 1 CB    1 
ATOM   797   C  CG    . LYS A  1  102 ? 47.958  14.377  388.945 1.00 40.07  ? 102 LYS 1 CG    1 
ATOM   798   C  CD    . LYS A  1  102 ? 49.459  14.140  388.847 1.00 38.76  ? 102 LYS 1 CD    1 
ATOM   799   C  CE    . LYS A  1  102 ? 50.007  14.444  387.451 1.00 33.48  ? 102 LYS 1 CE    1 
ATOM   800   N  NZ    . LYS A  1  102 ? 49.896  15.867  387.044 1.00 28.62  ? 102 LYS 1 NZ    1 
ATOM   801   N  N     . ASP A  1  103 ? 46.652  16.947  390.162 1.00 53.66  ? 103 ASP 1 N     1 
ATOM   802   C  CA    . ASP A  1  103 ? 47.153  18.295  390.441 1.00 61.26  ? 103 ASP 1 CA    1 
ATOM   803   C  C     . ASP A  1  103 ? 46.108  19.162  391.131 1.00 64.14  ? 103 ASP 1 C     1 
ATOM   804   O  O     . ASP A  1  103 ? 46.459  20.131  391.827 1.00 63.61  ? 103 ASP 1 O     1 
ATOM   805   C  CB    . ASP A  1  103 ? 47.610  18.948  389.139 1.00 61.87  ? 103 ASP 1 CB    1 
ATOM   806   C  CG    . ASP A  1  103 ? 48.760  18.208  388.499 1.00 66.52  ? 103 ASP 1 CG    1 
ATOM   807   O  OD1   . ASP A  1  103 ? 49.488  17.502  389.230 1.00 68.34  ? 103 ASP 1 OD1   1 
ATOM   808   O  OD2   . ASP A  1  103 ? 48.938  18.314  387.269 1.00 68.27  ? 103 ASP 1 OD2   1 
ATOM   809   N  N     . ARG A  1  104 ? 44.829  18.834  390.934 1.00 68.47  ? 104 ARG 1 N     1 
ATOM   810   C  CA    . ARG A  1  104 ? 43.748  19.580  391.563 1.00 66.65  ? 104 ARG 1 CA    1 
ATOM   811   C  C     . ARG A  1  104 ? 43.952  19.666  393.068 1.00 64.05  ? 104 ARG 1 C     1 
ATOM   812   O  O     . ARG A  1  104 ? 43.843  20.742  393.658 1.00 59.79  ? 104 ARG 1 O     1 
ATOM   813   C  CB    . ARG A  1  104 ? 42.401  18.931  391.253 1.00 71.50  ? 104 ARG 1 CB    1 
ATOM   814   C  CG    . ARG A  1  104 ? 41.251  19.622  391.957 1.00 75.01  ? 104 ARG 1 CG    1 
ATOM   815   C  CD    . ARG A  1  104 ? 39.905  19.263  391.357 1.00 80.98  ? 104 ARG 1 CD    1 
ATOM   816   N  NE    . ARG A  1  104 ? 39.299  18.131  392.057 1.00 83.10  ? 104 ARG 1 NE    1 
ATOM   817   C  CZ    . ARG A  1  104 ? 38.449  18.251  393.072 1.00 83.27  ? 104 ARG 1 CZ    1 
ATOM   818   N  NH1   . ARG A  1  104 ? 38.104  19.454  393.510 1.00 86.44  ? 104 ARG 1 NH1   1 
ATOM   819   N  NH2   . ARG A  1  104 ? 37.946  17.171  393.651 1.00 80.25  ? 104 ARG 1 NH2   1 
ATOM   820   N  N     . TYR A  1  105 ? 44.243  18.532  393.708 1.00 65.05  ? 105 TYR 1 N     1 
ATOM   821   C  CA    . TYR A  1  105 ? 44.334  18.506  395.164 1.00 63.09  ? 105 TYR 1 CA    1 
ATOM   822   C  C     . TYR A  1  105 ? 45.625  19.131  395.673 1.00 70.45  ? 105 TYR 1 C     1 
ATOM   823   O  O     . TYR A  1  105 ? 45.638  19.682  396.780 1.00 75.51  ? 105 TYR 1 O     1 
ATOM   824   C  CB    . TYR A  1  105 ? 44.196  17.072  395.681 1.00 50.15  ? 105 TYR 1 CB    1 
ATOM   825   C  CG    . TYR A  1  105 ? 42.853  16.483  395.348 1.00 37.69  ? 105 TYR 1 CG    1 
ATOM   826   C  CD1   . TYR A  1  105 ? 41.707  16.994  395.925 1.00 35.17  ? 105 TYR 1 CD1   1 
ATOM   827   C  CD2   . TYR A  1  105 ? 42.722  15.452  394.431 1.00 29.45  ? 105 TYR 1 CD2   1 
ATOM   828   C  CE1   . TYR A  1  105 ? 40.475  16.492  395.620 1.00 33.65  ? 105 TYR 1 CE1   1 
ATOM   829   C  CE2   . TYR A  1  105 ? 41.482  14.938  394.118 1.00 27.51  ? 105 TYR 1 CE2   1 
ATOM   830   C  CZ    . TYR A  1  105 ? 40.363  15.468  394.719 1.00 30.28  ? 105 TYR 1 CZ    1 
ATOM   831   O  OH    . TYR A  1  105 ? 39.109  14.992  394.441 1.00 32.94  ? 105 TYR 1 OH    1 
ATOM   832   N  N     . ILE A  1  106 ? 46.709  19.071  394.893 1.00 71.80  ? 106 ILE 1 N     1 
ATOM   833   C  CA    . ILE A  1  106 ? 47.886  19.865  395.233 1.00 79.20  ? 106 ILE 1 CA    1 
ATOM   834   C  C     . ILE A  1  106 ? 47.522  21.340  395.300 1.00 87.07  ? 106 ILE 1 C     1 
ATOM   835   O  O     . ILE A  1  106 ? 47.871  22.042  396.256 1.00 87.86  ? 106 ILE 1 O     1 
ATOM   836   C  CB    . ILE A  1  106 ? 49.030  19.621  394.231 1.00 81.41  ? 106 ILE 1 CB    1 
ATOM   837   C  CG1   . ILE A  1  106 ? 49.641  18.234  394.419 1.00 86.25  ? 106 ILE 1 CG1   1 
ATOM   838   C  CG2   . ILE A  1  106 ? 50.109  20.687  394.389 1.00 81.88  ? 106 ILE 1 CG2   1 
ATOM   839   C  CD1   . ILE A  1  106 ? 50.954  18.061  393.679 1.00 88.85  ? 106 ILE 1 CD1   1 
ATOM   840   N  N     . LEU A  1  107 ? 46.789  21.828  394.296 1.00 96.44  ? 107 LEU 1 N     1 
ATOM   841   C  CA    . LEU A  1  107 ? 46.401  23.240  394.308 1.00 102.34 ? 107 LEU 1 CA    1 
ATOM   842   C  C     . LEU A  1  107 ? 45.396  23.546  395.417 1.00 100.58 ? 107 LEU 1 C     1 
ATOM   843   O  O     . LEU A  1  107 ? 45.441  24.624  396.021 1.00 101.00 ? 107 LEU 1 O     1 
ATOM   844   C  CB    . LEU A  1  107 ? 45.840  23.650  392.948 1.00 105.79 ? 107 LEU 1 CB    1 
ATOM   845   C  CG    . LEU A  1  107 ? 46.800  23.518  391.767 1.00 105.92 ? 107 LEU 1 CG    1 
ATOM   846   C  CD1   . LEU A  1  107 ? 46.178  24.091  390.505 1.00 106.66 ? 107 LEU 1 CD1   1 
ATOM   847   C  CD2   . LEU A  1  107 ? 48.109  24.215  392.090 1.00 105.88 ? 107 LEU 1 CD2   1 
ATOM   848   N  N     . GLU A  1  108 ? 44.482  22.618  395.695 1.00 93.12  ? 108 GLU 1 N     1 
ATOM   849   C  CA    . GLU A  1  108 ? 43.416  22.896  396.651 1.00 82.06  ? 108 GLU 1 CA    1 
ATOM   850   C  C     . GLU A  1  108 ? 43.929  22.895  398.086 1.00 77.58  ? 108 GLU 1 C     1 
ATOM   851   O  O     . GLU A  1  108 ? 43.528  23.744  398.889 1.00 79.48  ? 108 GLU 1 O     1 
ATOM   852   C  CB    . GLU A  1  108 ? 42.278  21.890  396.494 1.00 76.51  ? 108 GLU 1 CB    1 
ATOM   853   C  CG    . GLU A  1  108 ? 41.503  22.026  395.203 1.00 73.53  ? 108 GLU 1 CG    1 
ATOM   854   C  CD    . GLU A  1  108 ? 40.236  21.207  395.212 1.00 70.52  ? 108 GLU 1 CD    1 
ATOM   855   O  OE1   . GLU A  1  108 ? 39.877  20.681  396.286 1.00 71.09  ? 108 GLU 1 OE1   1 
ATOM   856   O  OE2   . GLU A  1  108 ? 39.592  21.099  394.151 1.00 71.90  ? 108 GLU 1 OE2   1 
ATOM   857   N  N     . ASP A  1  109 ? 44.798  21.946  398.438 1.00 71.63  ? 109 ASP 1 N     1 
ATOM   858   C  CA    . ASP A  1  109 ? 45.177  21.769  399.834 1.00 64.03  ? 109 ASP 1 CA    1 
ATOM   859   C  C     . ASP A  1  109 ? 46.616  22.145  400.150 1.00 59.53  ? 109 ASP 1 C     1 
ATOM   860   O  O     . ASP A  1  109 ? 46.896  22.526  401.287 1.00 59.97  ? 109 ASP 1 O     1 
ATOM   861   C  CB    . ASP A  1  109 ? 44.954  20.312  400.264 1.00 62.72  ? 109 ASP 1 CB    1 
ATOM   862   C  CG    . ASP A  1  109 ? 43.624  19.756  399.788 1.00 63.14  ? 109 ASP 1 CG    1 
ATOM   863   O  OD1   . ASP A  1  109 ? 42.621  20.499  399.819 1.00 64.47  ? 109 ASP 1 OD1   1 
ATOM   864   O  OD2   . ASP A  1  109 ? 43.584  18.579  399.369 1.00 61.98  ? 109 ASP 1 OD2   1 
ATOM   865   N  N     . VAL A  1  110 ? 47.527  22.076  399.183 1.00 51.47  ? 110 VAL 1 N     1 
ATOM   866   C  CA    . VAL A  1  110 ? 48.940  22.327  399.463 1.00 46.17  ? 110 VAL 1 CA    1 
ATOM   867   C  C     . VAL A  1  110 ? 49.585  23.161  398.358 1.00 38.07  ? 110 VAL 1 C     1 
ATOM   868   O  O     . VAL A  1  110 ? 50.528  22.691  397.703 1.00 38.02  ? 110 VAL 1 O     1 
ATOM   869   C  CB    . VAL A  1  110 ? 49.697  21.003  399.675 1.00 40.46  ? 110 VAL 1 CB    1 
ATOM   870   C  CG1   . VAL A  1  110 ? 49.421  20.444  401.070 1.00 37.96  ? 110 VAL 1 CG1   1 
ATOM   871   C  CG2   . VAL A  1  110 ? 49.292  19.978  398.620 1.00 43.33  ? 110 VAL 1 CG2   1 
ATOM   872   N  N     . PRO A  1  111 ? 49.139  24.400  398.122 1.00 40.09  ? 111 PRO 1 N     1 
ATOM   873   C  CA    . PRO A  1  111 ? 49.760  25.181  397.038 1.00 37.78  ? 111 PRO 1 CA    1 
ATOM   874   C  C     . PRO A  1  111 ? 51.210  25.530  397.318 1.00 36.71  ? 111 PRO 1 C     1 
ATOM   875   O  O     . PRO A  1  111 ? 52.033  25.539  396.394 1.00 25.95  ? 111 PRO 1 O     1 
ATOM   876   C  CB    . PRO A  1  111 ? 48.875  26.438  396.954 1.00 36.72  ? 111 PRO 1 CB    1 
ATOM   877   C  CG    . PRO A  1  111 ? 47.632  26.102  397.731 1.00 34.85  ? 111 PRO 1 CG    1 
ATOM   878   C  CD    . PRO A  1  111 ? 48.079  25.165  398.800 1.00 36.68  ? 111 PRO 1 CD    1 
ATOM   879   N  N     . HIS A  1  112 ? 51.550  25.809  398.579 1.00 48.22  ? 112 HIS 1 N     1 
ATOM   880   C  CA    . HIS A  1  112 ? 52.887  26.294  398.910 1.00 63.64  ? 112 HIS 1 CA    1 
ATOM   881   C  C     . HIS A  1  112 ? 53.967  25.273  398.571 1.00 66.49  ? 112 HIS 1 C     1 
ATOM   882   O  O     . HIS A  1  112 ? 55.117  25.649  398.315 1.00 71.20  ? 112 HIS 1 O     1 
ATOM   883   C  CB    . HIS A  1  112 ? 52.934  26.676  400.388 1.00 69.54  ? 112 HIS 1 CB    1 
ATOM   884   C  CG    . HIS A  1  112 ? 52.036  27.824  400.731 1.00 77.28  ? 112 HIS 1 CG    1 
ATOM   885   N  ND1   . HIS A  1  112 ? 52.266  29.107  400.282 1.00 79.35  ? 112 HIS 1 ND1   1 
ATOM   886   C  CD2   . HIS A  1  112 ? 50.892  27.876  401.455 1.00 78.53  ? 112 HIS 1 CD2   1 
ATOM   887   C  CE1   . HIS A  1  112 ? 51.310  29.904  400.727 1.00 80.02  ? 112 HIS 1 CE1   1 
ATOM   888   N  NE2   . HIS A  1  112 ? 50.464  29.182  401.441 1.00 78.26  ? 112 HIS 1 NE2   1 
ATOM   889   N  N     . LEU A  1  113 ? 53.619  23.986  398.547 1.00 64.52  ? 113 LEU 1 N     1 
ATOM   890   C  CA    . LEU A  1  113 ? 54.531  22.976  398.018 1.00 59.13  ? 113 LEU 1 CA    1 
ATOM   891   C  C     . LEU A  1  113 ? 54.911  23.288  396.573 1.00 62.56  ? 113 LEU 1 C     1 
ATOM   892   O  O     . LEU A  1  113 ? 56.097  23.311  396.211 1.00 65.90  ? 113 LEU 1 O     1 
ATOM   893   C  CB    . LEU A  1  113 ? 53.878  21.597  398.124 1.00 56.33  ? 113 LEU 1 CB    1 
ATOM   894   C  CG    . LEU A  1  113 ? 54.453  20.501  397.232 1.00 55.11  ? 113 LEU 1 CG    1 
ATOM   895   C  CD1   . LEU A  1  113 ? 55.864  20.170  397.664 1.00 57.94  ? 113 LEU 1 CD1   1 
ATOM   896   C  CD2   . LEU A  1  113 ? 53.564  19.268  397.264 1.00 55.76  ? 113 LEU 1 CD2   1 
ATOM   897   N  N     . LEU A  1  114 ? 53.903  23.526  395.727 1.00 55.42  ? 114 LEU 1 N     1 
ATOM   898   C  CA    . LEU A  1  114 ? 54.162  23.890  394.337 1.00 42.96  ? 114 LEU 1 CA    1 
ATOM   899   C  C     . LEU A  1  114 ? 54.889  25.226  394.238 1.00 30.58  ? 114 LEU 1 C     1 
ATOM   900   O  O     . LEU A  1  114 ? 55.728  25.418  393.353 1.00 29.61  ? 114 LEU 1 O     1 
ATOM   901   C  CB    . LEU A  1  114 ? 52.851  23.928  393.547 1.00 36.06  ? 114 LEU 1 CB    1 
ATOM   902   C  CG    . LEU A  1  114 ? 52.951  24.502  392.129 1.00 27.17  ? 114 LEU 1 CG    1 
ATOM   903   C  CD1   . LEU A  1  114 ? 53.776  23.592  391.255 1.00 30.21  ? 114 LEU 1 CD1   1 
ATOM   904   C  CD2   . LEU A  1  114 ? 51.582  24.720  391.512 1.00 26.16  ? 114 LEU 1 CD2   1 
ATOM   905   N  N     . ILE A  1  115 ? 54.574  26.167  395.130 1.00 21.98  ? 115 ILE 1 N     1 
ATOM   906   C  CA    . ILE A  1  115 ? 55.244  27.465  395.095 1.00 20.03  ? 115 ILE 1 CA    1 
ATOM   907   C  C     . ILE A  1  115 ? 56.733  27.304  395.379 1.00 18.81  ? 115 ILE 1 C     1 
ATOM   908   O  O     . ILE A  1  115 ? 57.573  27.911  394.709 1.00 21.27  ? 115 ILE 1 O     1 
ATOM   909   C  CB    . ILE A  1  115 ? 54.575  28.447  396.075 1.00 28.10  ? 115 ILE 1 CB    1 
ATOM   910   C  CG1   . ILE A  1  115 ? 53.163  28.796  395.596 1.00 32.41  ? 115 ILE 1 CG1   1 
ATOM   911   C  CG2   . ILE A  1  115 ? 55.400  29.719  396.219 1.00 30.36  ? 115 ILE 1 CG2   1 
ATOM   912   C  CD1   . ILE A  1  115 ? 52.338  29.570  396.603 1.00 33.13  ? 115 ILE 1 CD1   1 
ATOM   913   N  N     . GLU A  1  116 ? 57.083  26.481  396.367 1.00 30.19  ? 116 GLU 1 N     1 
ATOM   914   C  CA    . GLU A  1  116 ? 58.492  26.235  396.669 1.00 47.92  ? 116 GLU 1 CA    1 
ATOM   915   C  C     . GLU A  1  116 ? 59.188  25.508  395.519 1.00 48.78  ? 116 GLU 1 C     1 
ATOM   916   O  O     . GLU A  1  116 ? 60.332  25.836  395.166 1.00 43.97  ? 116 GLU 1 O     1 
ATOM   917   C  CB    . GLU A  1  116 ? 58.608  25.444  397.973 1.00 64.23  ? 116 GLU 1 CB    1 
ATOM   918   C  CG    . GLU A  1  116 ? 60.010  25.382  398.548 1.00 74.79  ? 116 GLU 1 CG    1 
ATOM   919   C  CD    . GLU A  1  116 ? 60.011  25.038  400.025 1.00 82.91  ? 116 GLU 1 CD    1 
ATOM   920   O  OE1   . GLU A  1  116 ? 58.918  24.813  400.586 1.00 87.59  ? 116 GLU 1 OE1   1 
ATOM   921   O  OE2   . GLU A  1  116 ? 61.101  25.012  400.629 1.00 86.92  ? 116 GLU 1 OE2   1 
ATOM   922   N  N     . GLY A  1  117 ? 58.518  24.512  394.931 1.00 49.20  ? 117 GLY 1 N     1 
ATOM   923   C  CA    . GLY A  1  117 ? 59.079  23.852  393.760 1.00 43.94  ? 117 GLY 1 CA    1 
ATOM   924   C  C     . GLY A  1  117 ? 59.337  24.816  392.617 1.00 41.53  ? 117 GLY 1 C     1 
ATOM   925   O  O     . GLY A  1  117 ? 60.364  24.735  391.937 1.00 42.36  ? 117 GLY 1 O     1 
ATOM   926   N  N     . MET A  1  118 ? 58.407  25.746  392.390 1.00 43.13  ? 118 MET 1 N     1 
ATOM   927   C  CA    . MET A  1  118 ? 58.590  26.745  391.343 1.00 45.62  ? 118 MET 1 CA    1 
ATOM   928   C  C     . MET A  1  118 ? 59.675  27.751  391.694 1.00 50.52  ? 118 MET 1 C     1 
ATOM   929   O  O     . MET A  1  118 ? 60.344  28.264  390.795 1.00 54.12  ? 118 MET 1 O     1 
ATOM   930   C  CB    . MET A  1  118 ? 57.283  27.475  391.054 1.00 47.40  ? 118 MET 1 CB    1 
ATOM   931   C  CG    . MET A  1  118 ? 56.225  26.624  390.399 1.00 53.43  ? 118 MET 1 CG    1 
ATOM   932   S  SD    . MET A  1  118 ? 54.773  27.612  390.029 1.00 61.55  ? 118 MET 1 SD    1 
ATOM   933   C  CE    . MET A  1  118 ? 55.306  28.415  388.523 1.00 61.59  ? 118 MET 1 CE    1 
ATOM   934   N  N     . ILE A  1  119 ? 59.840  28.082  392.975 1.00 49.48  ? 119 ILE 1 N     1 
ATOM   935   C  CA    . ILE A  1  119 ? 60.958  28.936  393.367 1.00 48.61  ? 119 ILE 1 CA    1 
ATOM   936   C  C     . ILE A  1  119 ? 62.274  28.261  393.009 1.00 51.55  ? 119 ILE 1 C     1 
ATOM   937   O  O     . ILE A  1  119 ? 63.187  28.890  392.458 1.00 52.28  ? 119 ILE 1 O     1 
ATOM   938   C  CB    . ILE A  1  119 ? 60.885  29.278  394.869 1.00 45.18  ? 119 ILE 1 CB    1 
ATOM   939   C  CG1   . ILE A  1  119 ? 59.758  30.270  395.150 1.00 43.05  ? 119 ILE 1 CG1   1 
ATOM   940   C  CG2   . ILE A  1  119 ? 62.205  29.852  395.359 1.00 45.18  ? 119 ILE 1 CG2   1 
ATOM   941   C  CD1   . ILE A  1  119 ? 59.550  30.541  396.626 1.00 37.61  ? 119 ILE 1 CD1   1 
ATOM   942   N  N     . LEU A  1  120 ? 62.384  26.962  393.304 1.00 54.79  ? 120 LEU 1 N     1 
ATOM   943   C  CA    . LEU A  1  120 ? 63.575  26.210  392.909 1.00 61.15  ? 120 LEU 1 CA    1 
ATOM   944   C  C     . LEU A  1  120 ? 63.770  26.230  391.394 1.00 60.97  ? 120 LEU 1 C     1 
ATOM   945   O  O     . LEU A  1  120 ? 64.893  26.408  390.905 1.00 66.73  ? 120 LEU 1 O     1 
ATOM   946   C  CB    . LEU A  1  120 ? 63.492  24.775  393.427 1.00 71.19  ? 120 LEU 1 CB    1 
ATOM   947   C  CG    . LEU A  1  120 ? 63.381  24.638  394.947 1.00 82.54  ? 120 LEU 1 CG    1 
ATOM   948   C  CD1   . LEU A  1  120 ? 62.931  23.236  395.345 1.00 88.30  ? 120 LEU 1 CD1   1 
ATOM   949   C  CD2   . LEU A  1  120 ? 64.702  24.999  395.611 1.00 88.59  ? 120 LEU 1 CD2   1 
ATOM   950   N  N     . ALA A  1  121 ? 62.690  26.025  390.637 1.00 55.17  ? 121 ALA 1 N     1 
ATOM   951   C  CA    . ALA A  1  121 ? 62.790  26.030  389.178 1.00 44.96  ? 121 ALA 1 CA    1 
ATOM   952   C  C     . ALA A  1  121 ? 63.260  27.387  388.661 1.00 42.49  ? 121 ALA 1 C     1 
ATOM   953   O  O     . ALA A  1  121 ? 64.122  27.468  387.776 1.00 45.51  ? 121 ALA 1 O     1 
ATOM   954   C  CB    . ALA A  1  121 ? 61.447  25.647  388.558 1.00 41.45  ? 121 ALA 1 CB    1 
ATOM   955   N  N     . GLY A  1  122 ? 62.675  28.467  389.183 1.00 38.18  ? 122 GLY 1 N     1 
ATOM   956   C  CA    . GLY A  1  122 ? 63.097  29.798  388.785 1.00 38.17  ? 122 GLY 1 CA    1 
ATOM   957   C  C     . GLY A  1  122 ? 64.548  30.066  389.126 1.00 36.97  ? 122 GLY 1 C     1 
ATOM   958   O  O     . GLY A  1  122 ? 65.260  30.733  388.372 1.00 35.34  ? 122 GLY 1 O     1 
ATOM   959   N  N     . TYR A  1  123 ? 64.995  29.578  390.286 1.00 39.41  ? 123 TYR 1 N     1 
ATOM   960   C  CA    . TYR A  1  123 ? 66.412  29.655  390.627 1.00 45.82  ? 123 TYR 1 CA    1 
ATOM   961   C  C     . TYR A  1  123 ? 67.264  28.916  389.606 1.00 43.49  ? 123 TYR 1 C     1 
ATOM   962   O  O     . TYR A  1  123 ? 68.360  29.365  389.252 1.00 53.40  ? 123 TYR 1 O     1 
ATOM   963   C  CB    . TYR A  1  123 ? 66.659  29.075  392.018 1.00 53.35  ? 123 TYR 1 CB    1 
ATOM   964   C  CG    . TYR A  1  123 ? 68.119  29.087  392.391 1.00 61.29  ? 123 TYR 1 CG    1 
ATOM   965   C  CD1   . TYR A  1  123 ? 68.796  30.280  392.563 1.00 65.72  ? 123 TYR 1 CD1   1 
ATOM   966   C  CD2   . TYR A  1  123 ? 68.834  27.903  392.513 1.00 66.86  ? 123 TYR 1 CD2   1 
ATOM   967   C  CE1   . TYR A  1  123 ? 70.133  30.297  392.883 1.00 70.38  ? 123 TYR 1 CE1   1 
ATOM   968   C  CE2   . TYR A  1  123 ? 70.177  27.912  392.831 1.00 70.72  ? 123 TYR 1 CE2   1 
ATOM   969   C  CZ    . TYR A  1  123 ? 70.818  29.114  393.014 1.00 73.31  ? 123 TYR 1 CZ    1 
ATOM   970   O  OH    . TYR A  1  123 ? 72.151  29.150  393.331 1.00 81.42  ? 123 TYR 1 OH    1 
ATOM   971   N  N     . ALA A  1  124 ? 66.778  27.771  389.133 1.00 32.17  ? 124 ALA 1 N     1 
ATOM   972   C  CA    . ALA A  1  124 ? 67.528  26.999  388.147 1.00 26.79  ? 124 ALA 1 CA    1 
ATOM   973   C  C     . ALA A  1  124 ? 67.637  27.737  386.816 1.00 28.13  ? 124 ALA 1 C     1 
ATOM   974   O  O     . ALA A  1  124 ? 68.715  27.774  386.211 1.00 23.22  ? 124 ALA 1 O     1 
ATOM   975   C  CB    . ALA A  1  124 ? 66.875  25.636  387.947 1.00 27.51  ? 124 ALA 1 CB    1 
ATOM   976   N  N     . ILE A  1  125 ? 66.539  28.326  386.340 1.00 32.97  ? 125 ILE 1 N     1 
ATOM   977   C  CA    . ILE A  1  125 ? 66.484  28.866  384.985 1.00 33.84  ? 125 ILE 1 CA    1 
ATOM   978   C  C     . ILE A  1  125 ? 66.471  30.396  384.965 1.00 36.87  ? 125 ILE 1 C     1 
ATOM   979   O  O     . ILE A  1  125 ? 66.196  30.994  383.918 1.00 39.81  ? 125 ILE 1 O     1 
ATOM   980   C  CB    . ILE A  1  125 ? 65.285  28.292  384.207 1.00 28.57  ? 125 ILE 1 CB    1 
ATOM   981   C  CG1   . ILE A  1  125 ? 63.958  28.784  384.799 1.00 28.80  ? 125 ILE 1 CG1   1 
ATOM   982   C  CG2   . ILE A  1  125 ? 65.337  26.770  384.198 1.00 24.99  ? 125 ILE 1 CG2   1 
ATOM   983   C  CD1   . ILE A  1  125 ? 62.724  28.219  384.116 1.00 18.65  ? 125 ILE 1 CD1   1 
ATOM   984   N  N     . ARG A  1  126 ? 66.781  31.047  386.091 1.00 37.21  ? 126 ARG 1 N     1 
ATOM   985   C  CA    . ARG A  1  126 ? 66.909  32.507  386.154 1.00 39.94  ? 126 ARG 1 CA    1 
ATOM   986   C  C     . ARG A  1  126 ? 65.644  33.208  385.663 1.00 38.88  ? 126 ARG 1 C     1 
ATOM   987   O  O     . ARG A  1  126 ? 65.706  34.199  384.933 1.00 38.82  ? 126 ARG 1 O     1 
ATOM   988   C  CB    . ARG A  1  126 ? 68.127  32.998  385.366 1.00 52.76  ? 126 ARG 1 CB    1 
ATOM   989   C  CG    . ARG A  1  126 ? 69.484  32.559  385.905 1.00 63.16  ? 126 ARG 1 CG    1 
ATOM   990   C  CD    . ARG A  1  126 ? 69.883  31.182  385.388 1.00 71.89  ? 126 ARG 1 CD    1 
ATOM   991   N  NE    . ARG A  1  126 ? 71.270  30.865  385.714 1.00 79.26  ? 126 ARG 1 NE    1 
ATOM   992   C  CZ    . ARG A  1  126 ? 71.801  29.649  385.633 1.00 85.25  ? 126 ARG 1 CZ    1 
ATOM   993   N  NH1   . ARG A  1  126 ? 71.062  28.617  385.243 1.00 86.92  ? 126 ARG 1 NH1   1 
ATOM   994   N  NH2   . ARG A  1  126 ? 73.076  29.465  385.950 1.00 86.26  ? 126 ARG 1 NH2   1 
ATOM   995   N  N     . ALA A  1  127 ? 64.488  32.673  386.039 1.00 38.61  ? 127 ALA 1 N     1 
ATOM   996   C  CA    . ALA A  1  127 ? 63.202  33.257  385.678 1.00 41.95  ? 127 ALA 1 CA    1 
ATOM   997   C  C     . ALA A  1  127 ? 62.741  34.173  386.807 1.00 39.84  ? 127 ALA 1 C     1 
ATOM   998   O  O     . ALA A  1  127 ? 62.419  33.700  387.902 1.00 43.25  ? 127 ALA 1 O     1 
ATOM   999   C  CB    . ALA A  1  127 ? 62.174  32.166  385.395 1.00 41.39  ? 127 ALA 1 CB    1 
ATOM   1000  N  N     . THR A  1  128 ? 62.707  35.484  386.545 1.00 34.99  ? 128 THR 1 N     1 
ATOM   1001  C  CA    . THR A  1  128 ? 62.351  36.445  387.583 1.00 28.27  ? 128 THR 1 CA    1 
ATOM   1002  C  C     . THR A  1  128 ? 60.844  36.603  387.755 1.00 33.62  ? 128 THR 1 C     1 
ATOM   1003  O  O     . THR A  1  128 ? 60.410  37.132  388.785 1.00 34.18  ? 128 THR 1 O     1 
ATOM   1004  C  CB    . THR A  1  128 ? 62.963  37.818  387.288 1.00 24.87  ? 128 THR 1 CB    1 
ATOM   1005  O  OG1   . THR A  1  128 ? 62.074  38.560  386.447 1.00 24.31  ? 128 THR 1 OG1   1 
ATOM   1006  C  CG2   . THR A  1  128 ? 64.318  37.681  386.608 1.00 20.09  ? 128 THR 1 CG2   1 
ATOM   1007  N  N     . VAL A  1  129 ? 60.045  36.181  386.772 1.00 35.96  ? 129 VAL 1 N     1 
ATOM   1008  C  CA    . VAL A  1  129 ? 58.590  36.190  386.876 1.00 35.69  ? 129 VAL 1 CA    1 
ATOM   1009  C  C     . VAL A  1  129 ? 58.063  34.867  386.332 1.00 27.81  ? 129 VAL 1 C     1 
ATOM   1010  O  O     . VAL A  1  129 ? 58.594  34.314  385.364 1.00 19.51  ? 129 VAL 1 O     1 
ATOM   1011  C  CB    . VAL A  1  129 ? 57.951  37.391  386.123 1.00 39.73  ? 129 VAL 1 CB    1 
ATOM   1012  C  CG1   . VAL A  1  129 ? 56.431  37.423  386.311 1.00 41.09  ? 129 VAL 1 CG1   1 
ATOM   1013  C  CG2   . VAL A  1  129 ? 58.560  38.714  386.582 1.00 39.44  ? 129 VAL 1 CG2   1 
ATOM   1014  N  N     . GLY A  1  130 ? 57.000  34.373  386.950 1.00 34.94  ? 130 GLY 1 N     1 
ATOM   1015  C  CA    . GLY A  1  130 ? 56.401  33.118  386.540 1.00 45.28  ? 130 GLY 1 CA    1 
ATOM   1016  C  C     . GLY A  1  130 ? 54.895  33.246  386.483 1.00 56.04  ? 130 GLY 1 C     1 
ATOM   1017  O  O     . GLY A  1  130 ? 54.291  34.067  387.179 1.00 60.68  ? 130 GLY 1 O     1 
ATOM   1018  N  N     . TYR A  1  131 ? 54.289  32.419  385.635 1.00 58.12  ? 131 TYR 1 N     1 
ATOM   1019  C  CA    . TYR A  1  131 ? 52.844  32.383  385.472 1.00 56.69  ? 131 TYR 1 CA    1 
ATOM   1020  C  C     . TYR A  1  131 ? 52.319  30.989  385.766 1.00 52.19  ? 131 TYR 1 C     1 
ATOM   1021  O  O     . TYR A  1  131 ? 52.935  29.987  385.387 1.00 51.90  ? 131 TYR 1 O     1 
ATOM   1022  C  CB    . TYR A  1  131 ? 52.424  32.781  384.053 1.00 55.45  ? 131 TYR 1 CB    1 
ATOM   1023  C  CG    . TYR A  1  131 ? 52.526  34.257  383.768 1.00 56.94  ? 131 TYR 1 CG    1 
ATOM   1024  C  CD1   . TYR A  1  131 ? 53.753  34.852  383.534 1.00 58.12  ? 131 TYR 1 CD1   1 
ATOM   1025  C  CD2   . TYR A  1  131 ? 51.391  35.054  383.716 1.00 57.17  ? 131 TYR 1 CD2   1 
ATOM   1026  C  CE1   . TYR A  1  131 ? 53.851  36.199  383.268 1.00 59.11  ? 131 TYR 1 CE1   1 
ATOM   1027  C  CE2   . TYR A  1  131 ? 51.481  36.406  383.448 1.00 57.77  ? 131 TYR 1 CE2   1 
ATOM   1028  C  CZ    . TYR A  1  131 ? 52.717  36.971  383.226 1.00 58.30  ? 131 TYR 1 CZ    1 
ATOM   1029  O  OH    . TYR A  1  131 ? 52.837  38.312  382.955 1.00 58.30  ? 131 TYR 1 OH    1 
ATOM   1030  N  N     . ILE A  1  132 ? 51.173  30.934  386.430 1.00 47.79  ? 132 ILE 1 N     1 
ATOM   1031  C  CA    . ILE A  1  132 ? 50.477  29.685  386.689 1.00 46.11  ? 132 ILE 1 CA    1 
ATOM   1032  C  C     . ILE A  1  132 ? 49.215  29.702  385.842 1.00 56.48  ? 132 ILE 1 C     1 
ATOM   1033  O  O     . ILE A  1  132 ? 48.377  30.604  385.978 1.00 60.13  ? 132 ILE 1 O     1 
ATOM   1034  C  CB    . ILE A  1  132 ? 50.152  29.516  388.179 1.00 29.26  ? 132 ILE 1 CB    1 
ATOM   1035  C  CG1   . ILE A  1  132 ? 51.418  29.696  389.014 1.00 19.73  ? 132 ILE 1 CG1   1 
ATOM   1036  C  CG2   . ILE A  1  132 ? 49.546  28.151  388.427 1.00 30.40  ? 132 ILE 1 CG2   1 
ATOM   1037  C  CD1   . ILE A  1  132 ? 51.263  29.278  390.459 1.00 20.92  ? 132 ILE 1 CD1   1 
ATOM   1038  N  N     . TYR A  1  133 ? 49.085  28.715  384.964 1.00 55.92  ? 133 TYR 1 N     1 
ATOM   1039  C  CA    . TYR A  1  133 ? 47.952  28.619  384.055 1.00 49.52  ? 133 TYR 1 CA    1 
ATOM   1040  C  C     . TYR A  1  133 ? 46.997  27.589  384.635 1.00 37.99  ? 133 TYR 1 C     1 
ATOM   1041  O  O     . TYR A  1  133 ? 47.288  26.390  384.621 1.00 28.51  ? 133 TYR 1 O     1 
ATOM   1042  C  CB    . TYR A  1  133 ? 48.412  28.231  382.648 1.00 52.00  ? 133 TYR 1 CB    1 
ATOM   1043  C  CG    . TYR A  1  133 ? 47.298  28.102  381.625 1.00 51.84  ? 133 TYR 1 CG    1 
ATOM   1044  C  CD1   . TYR A  1  133 ? 46.535  26.947  381.530 1.00 52.29  ? 133 TYR 1 CD1   1 
ATOM   1045  C  CD2   . TYR A  1  133 ? 47.022  29.134  380.742 1.00 46.12  ? 133 TYR 1 CD2   1 
ATOM   1046  C  CE1   . TYR A  1  133 ? 45.523  26.833  380.595 1.00 49.74  ? 133 TYR 1 CE1   1 
ATOM   1047  C  CE2   . TYR A  1  133 ? 46.012  29.024  379.803 1.00 44.12  ? 133 TYR 1 CE2   1 
ATOM   1048  C  CZ    . TYR A  1  133 ? 45.268  27.873  379.734 1.00 46.01  ? 133 TYR 1 CZ    1 
ATOM   1049  O  OH    . TYR A  1  133 ? 44.265  27.764  378.800 1.00 50.37  ? 133 TYR 1 OH    1 
ATOM   1050  N  N     . VAL A  1  134 ? 45.865  28.059  385.148 1.00 41.93  ? 134 VAL 1 N     1 
ATOM   1051  C  CA    . VAL A  1  134 ? 44.823  27.193  385.681 1.00 50.21  ? 134 VAL 1 CA    1 
ATOM   1052  C  C     . VAL A  1  134 ? 43.701  27.117  384.656 1.00 48.41  ? 134 VAL 1 C     1 
ATOM   1053  O  O     . VAL A  1  134 ? 43.375  28.112  383.995 1.00 45.24  ? 134 VAL 1 O     1 
ATOM   1054  C  CB    . VAL A  1  134 ? 44.314  27.696  387.049 1.00 60.54  ? 134 VAL 1 CB    1 
ATOM   1055  C  CG1   . VAL A  1  134 ? 45.463  27.773  388.048 1.00 65.43  ? 134 VAL 1 CG1   1 
ATOM   1056  C  CG2   . VAL A  1  134 ? 43.630  29.055  386.931 1.00 62.02  ? 134 VAL 1 CG2   1 
ATOM   1057  N  N     . ARG A  1  135 ? 43.147  25.923  384.477 1.00 51.49  ? 135 ARG 1 N     1 
ATOM   1058  C  CA    . ARG A  1  135 ? 42.020  25.775  383.571 1.00 58.10  ? 135 ARG 1 CA    1 
ATOM   1059  C  C     . ARG A  1  135 ? 40.782  26.421  384.184 1.00 67.89  ? 135 ARG 1 C     1 
ATOM   1060  O  O     . ARG A  1  135 ? 40.614  26.459  385.406 1.00 68.78  ? 135 ARG 1 O     1 
ATOM   1061  C  CB    . ARG A  1  135 ? 41.767  24.302  383.270 1.00 55.85  ? 135 ARG 1 CB    1 
ATOM   1062  C  CG    . ARG A  1  135 ? 41.493  23.466  384.499 1.00 54.70  ? 135 ARG 1 CG    1 
ATOM   1063  C  CD    . ARG A  1  135 ? 41.217  22.036  384.099 1.00 54.87  ? 135 ARG 1 CD    1 
ATOM   1064  N  NE    . ARG A  1  135 ? 39.967  21.916  383.362 1.00 54.51  ? 135 ARG 1 NE    1 
ATOM   1065  C  CZ    . ARG A  1  135 ? 39.463  20.762  382.938 1.00 56.28  ? 135 ARG 1 CZ    1 
ATOM   1066  N  NH1   . ARG A  1  135 ? 40.101  19.625  383.182 1.00 55.58  ? 135 ARG 1 NH1   1 
ATOM   1067  N  NH2   . ARG A  1  135 ? 38.317  20.743  382.271 1.00 59.08  ? 135 ARG 1 NH2   1 
ATOM   1068  N  N     . GLY A  1  136 ? 39.907  26.930  383.317 1.00 75.38  ? 136 GLY 1 N     1 
ATOM   1069  C  CA    . GLY A  1  136 ? 38.840  27.812  383.741 1.00 80.11  ? 136 GLY 1 CA    1 
ATOM   1070  C  C     . GLY A  1  136 ? 37.656  27.183  384.438 1.00 83.28  ? 136 GLY 1 C     1 
ATOM   1071  O  O     . GLY A  1  136 ? 36.665  27.876  384.687 1.00 85.37  ? 136 GLY 1 O     1 
ATOM   1072  N  N     . GLU A  1  137 ? 37.722  25.896  384.775 1.00 81.87  ? 137 GLU 1 N     1 
ATOM   1073  C  CA    . GLU A  1  137 ? 36.699  25.261  385.594 1.00 76.99  ? 137 GLU 1 CA    1 
ATOM   1074  C  C     . GLU A  1  137 ? 37.120  25.105  387.049 1.00 82.41  ? 137 GLU 1 C     1 
ATOM   1075  O  O     . GLU A  1  137 ? 36.283  24.745  387.883 1.00 81.96  ? 137 GLU 1 O     1 
ATOM   1076  C  CB    . GLU A  1  137 ? 36.333  23.881  385.030 1.00 66.17  ? 137 GLU 1 CB    1 
ATOM   1077  C  CG    . GLU A  1  137 ? 35.337  23.903  383.881 1.00 57.67  ? 137 GLU 1 CG    1 
ATOM   1078  C  CD    . GLU A  1  137 ? 35.978  24.220  382.548 1.00 48.50  ? 137 GLU 1 CD    1 
ATOM   1079  O  OE1   . GLU A  1  137 ? 37.196  23.992  382.406 1.00 44.39  ? 137 GLU 1 OE1   1 
ATOM   1080  O  OE2   . GLU A  1  137 ? 35.263  24.685  381.637 1.00 46.42  ? 137 GLU 1 OE2   1 
ATOM   1081  N  N     . TYR A  1  138 ? 38.387  25.365  387.370 1.00 87.21  ? 138 TYR 1 N     1 
ATOM   1082  C  CA    . TYR A  1  138 ? 38.908  25.225  388.730 1.00 91.07  ? 138 TYR 1 CA    1 
ATOM   1083  C  C     . TYR A  1  138 ? 38.742  26.563  389.439 1.00 88.70  ? 138 TYR 1 C     1 
ATOM   1084  O  O     . TYR A  1  138 ? 39.595  27.446  389.342 1.00 93.59  ? 138 TYR 1 O     1 
ATOM   1085  C  CB    . TYR A  1  138 ? 40.376  24.809  388.703 1.00 94.58  ? 138 TYR 1 CB    1 
ATOM   1086  C  CG    . TYR A  1  138 ? 40.642  23.363  388.343 1.00 97.65  ? 138 TYR 1 CG    1 
ATOM   1087  C  CD1   . TYR A  1  138 ? 39.627  22.535  387.890 1.00 97.42  ? 138 TYR 1 CD1   1 
ATOM   1088  C  CD2   . TYR A  1  138 ? 41.920  22.832  388.438 1.00 99.35  ? 138 TYR 1 CD2   1 
ATOM   1089  C  CE1   . TYR A  1  138 ? 39.873  21.216  387.554 1.00 98.07  ? 138 TYR 1 CE1   1 
ATOM   1090  C  CE2   . TYR A  1  138 ? 42.176  21.512  388.104 1.00 98.99  ? 138 TYR 1 CE2   1 
ATOM   1091  C  CZ    . TYR A  1  138 ? 41.150  20.709  387.662 1.00 96.62  ? 138 TYR 1 CZ    1 
ATOM   1092  O  OH    . TYR A  1  138 ? 41.406  19.396  387.329 1.00 92.95  ? 138 TYR 1 OH    1 
ATOM   1093  N  N     . ARG A  1  139 ? 37.635  26.729  390.166 1.00 80.13  ? 139 ARG 1 N     1 
ATOM   1094  C  CA    . ARG A  1  139 ? 37.486  27.973  390.913 1.00 73.58  ? 139 ARG 1 CA    1 
ATOM   1095  C  C     . ARG A  1  139 ? 38.129  27.901  392.289 1.00 70.92  ? 139 ARG 1 C     1 
ATOM   1096  O  O     . ARG A  1  139 ? 38.769  28.867  392.723 1.00 73.70  ? 139 ARG 1 O     1 
ATOM   1097  C  CB    . ARG A  1  139 ? 36.013  28.352  391.078 1.00 72.18  ? 139 ARG 1 CB    1 
ATOM   1098  C  CG    . ARG A  1  139 ? 35.854  29.751  391.663 1.00 72.63  ? 139 ARG 1 CG    1 
ATOM   1099  C  CD    . ARG A  1  139 ? 34.410  30.144  391.891 1.00 74.83  ? 139 ARG 1 CD    1 
ATOM   1100  N  NE    . ARG A  1  139 ? 34.222  31.584  391.747 1.00 78.97  ? 139 ARG 1 NE    1 
ATOM   1101  C  CZ    . ARG A  1  139 ? 34.351  32.458  392.740 1.00 83.06  ? 139 ARG 1 CZ    1 
ATOM   1102  N  NH1   . ARG A  1  139 ? 34.675  32.045  393.957 1.00 86.02  ? 139 ARG 1 NH1   1 
ATOM   1103  N  NH2   . ARG A  1  139 ? 34.161  33.751  392.513 1.00 84.93  ? 139 ARG 1 NH2   1 
ATOM   1104  N  N     . ARG A  1  140 ? 37.979  26.773  392.985 1.00 66.21  ? 140 ARG 1 N     1 
ATOM   1105  C  CA    . ARG A  1  140 ? 38.559  26.662  394.318 1.00 59.96  ? 140 ARG 1 CA    1 
ATOM   1106  C  C     . ARG A  1  140 ? 40.075  26.760  394.252 1.00 48.42  ? 140 ARG 1 C     1 
ATOM   1107  O  O     . ARG A  1  140 ? 40.691  27.507  395.017 1.00 44.94  ? 140 ARG 1 O     1 
ATOM   1108  C  CB    . ARG A  1  140 ? 38.138  25.350  394.982 1.00 66.64  ? 140 ARG 1 CB    1 
ATOM   1109  C  CG    . ARG A  1  140 ? 38.730  25.163  396.377 1.00 70.38  ? 140 ARG 1 CG    1 
ATOM   1110  C  CD    . ARG A  1  140 ? 37.887  24.242  397.248 1.00 72.79  ? 140 ARG 1 CD    1 
ATOM   1111  N  NE    . ARG A  1  140 ? 36.558  24.776  397.523 1.00 75.50  ? 140 ARG 1 NE    1 
ATOM   1112  C  CZ    . ARG A  1  140 ? 35.481  24.020  397.710 1.00 77.49  ? 140 ARG 1 CZ    1 
ATOM   1113  N  NH1   . ARG A  1  140 ? 35.580  22.699  397.651 1.00 76.29  ? 140 ARG 1 NH1   1 
ATOM   1114  N  NH2   . ARG A  1  140 ? 34.304  24.580  397.955 1.00 80.17  ? 140 ARG 1 NH2   1 
ATOM   1115  N  N     . ALA A  1  141 ? 40.692  26.020  393.326 1.00 41.32  ? 141 ALA 1 N     1 
ATOM   1116  C  CA    . ALA A  1  141 ? 42.144  26.068  393.177 1.00 38.34  ? 141 ALA 1 CA    1 
ATOM   1117  C  C     . ALA A  1  141 ? 42.619  27.458  392.766 1.00 40.73  ? 141 ALA 1 C     1 
ATOM   1118  O  O     . ALA A  1  141 ? 43.656  27.933  393.245 1.00 44.06  ? 141 ALA 1 O     1 
ATOM   1119  C  CB    . ALA A  1  141 ? 42.601  25.023  392.160 1.00 32.76  ? 141 ALA 1 CB    1 
ATOM   1120  N  N     . ALA A  1  142 ? 41.878  28.126  391.878 1.00 36.63  ? 142 ALA 1 N     1 
ATOM   1121  C  CA    . ALA A  1  142 ? 42.276  29.464  391.447 1.00 27.79  ? 142 ALA 1 CA    1 
ATOM   1122  C  C     . ALA A  1  142 ? 42.228  30.453  392.605 1.00 26.87  ? 142 ALA 1 C     1 
ATOM   1123  O  O     . ALA A  1  142 ? 43.135  31.277  392.764 1.00 28.69  ? 142 ALA 1 O     1 
ATOM   1124  C  CB    . ALA A  1  142 ? 41.385  29.940  390.300 1.00 23.97  ? 142 ALA 1 CB    1 
ATOM   1125  N  N     . ASP A  1  143 ? 41.176  30.389  393.425 1.00 29.81  ? 143 ASP 1 N     1 
ATOM   1126  C  CA    . ASP A  1  143 ? 41.092  31.275  394.584 1.00 33.03  ? 143 ASP 1 CA    1 
ATOM   1127  C  C     . ASP A  1  143 ? 42.166  30.940  395.614 1.00 37.99  ? 143 ASP 1 C     1 
ATOM   1128  O  O     . ASP A  1  143 ? 42.715  31.841  396.259 1.00 33.23  ? 143 ASP 1 O     1 
ATOM   1129  C  CB    . ASP A  1  143 ? 39.699  31.209  395.208 1.00 28.39  ? 143 ASP 1 CB    1 
ATOM   1130  C  CG    . ASP A  1  143 ? 38.665  31.974  394.401 1.00 20.59  ? 143 ASP 1 CG    1 
ATOM   1131  O  OD1   . ASP A  1  143 ? 39.053  32.875  393.631 1.00 20.67  ? 143 ASP 1 OD1   1 
ATOM   1132  O  OD2   . ASP A  1  143 ? 37.462  31.683  394.544 1.00 20.73  ? 143 ASP 1 OD2   1 
ATOM   1133  N  N     . ARG A  1  144 ? 42.476  29.651  395.786 1.00 52.28  ? 144 ARG 1 N     1 
ATOM   1134  C  CA    . ARG A  1  144 ? 43.558  29.266  396.689 1.00 70.62  ? 144 ARG 1 CA    1 
ATOM   1135  C  C     . ARG A  1  144 ? 44.887  29.841  396.223 1.00 70.78  ? 144 ARG 1 C     1 
ATOM   1136  O  O     . ARG A  1  144 ? 45.681  30.328  397.033 1.00 73.55  ? 144 ARG 1 O     1 
ATOM   1137  C  CB    . ARG A  1  144 ? 43.668  27.744  396.770 1.00 91.19  ? 144 ARG 1 CB    1 
ATOM   1138  C  CG    . ARG A  1  144 ? 42.482  27.019  397.371 1.00 105.88 ? 144 ARG 1 CG    1 
ATOM   1139  C  CD    . ARG A  1  144 ? 42.670  26.677  398.828 1.00 115.66 ? 144 ARG 1 CD    1 
ATOM   1140  N  NE    . ARG A  1  144 ? 41.856  25.512  399.164 1.00 122.15 ? 144 ARG 1 NE    1 
ATOM   1141  C  CZ    . ARG A  1  144 ? 40.671  25.568  399.760 1.00 126.41 ? 144 ARG 1 CZ    1 
ATOM   1142  N  NH1   . ARG A  1  144 ? 40.148  26.737  400.101 1.00 129.26 ? 144 ARG 1 NH1   1 
ATOM   1143  N  NH2   . ARG A  1  144 ? 40.009  24.447  400.014 1.00 130.83 ? 144 ARG 1 NH2   1 
ATOM   1144  N  N     . LEU A  1  145 ? 45.147  29.783  394.914 1.00 70.41  ? 145 LEU 1 N     1 
ATOM   1145  C  CA    . LEU A  1  145 ? 46.387  30.333  394.375 1.00 71.44  ? 145 LEU 1 CA    1 
ATOM   1146  C  C     . LEU A  1  145 ? 46.429  31.848  394.517 1.00 73.40  ? 145 LEU 1 C     1 
ATOM   1147  O  O     . LEU A  1  145 ? 47.472  32.415  394.866 1.00 72.85  ? 145 LEU 1 O     1 
ATOM   1148  C  CB    . LEU A  1  145 ? 46.559  29.918  392.915 1.00 73.19  ? 145 LEU 1 CB    1 
ATOM   1149  C  CG    . LEU A  1  145 ? 47.240  28.560  392.740 1.00 73.16  ? 145 LEU 1 CG    1 
ATOM   1150  C  CD1   . LEU A  1  145 ? 47.421  28.228  391.270 1.00 70.92  ? 145 LEU 1 CD1   1 
ATOM   1151  C  CD2   . LEU A  1  145 ? 48.579  28.542  393.469 1.00 72.82  ? 145 LEU 1 CD2   1 
ATOM   1152  N  N     . GLU A  1  146 ? 45.314  32.520  394.226 1.00 75.08  ? 146 GLU 1 N     1 
ATOM   1153  C  CA    . GLU A  1  146 ? 45.231  33.964  394.425 1.00 75.68  ? 146 GLU 1 CA    1 
ATOM   1154  C  C     . GLU A  1  146 ? 45.570  34.336  395.864 1.00 78.76  ? 146 GLU 1 C     1 
ATOM   1155  O  O     . GLU A  1  146 ? 46.392  35.225  396.117 1.00 78.11  ? 146 GLU 1 O     1 
ATOM   1156  C  CB    . GLU A  1  146 ? 43.828  34.451  394.062 1.00 74.49  ? 146 GLU 1 CB    1 
ATOM   1157  C  CG    . GLU A  1  146 ? 43.741  35.919  393.722 1.00 75.94  ? 146 GLU 1 CG    1 
ATOM   1158  C  CD    . GLU A  1  146 ? 43.972  36.174  392.251 1.00 78.37  ? 146 GLU 1 CD    1 
ATOM   1159  O  OE1   . GLU A  1  146 ? 45.015  36.763  391.901 1.00 79.31  ? 146 GLU 1 OE1   1 
ATOM   1160  O  OE2   . GLU A  1  146 ? 43.108  35.778  391.441 1.00 78.83  ? 146 GLU 1 OE2   1 
ATOM   1161  N  N     . GLN A  1  147 ? 44.946  33.645  396.821 1.00 81.79  ? 147 GLN 1 N     1 
ATOM   1162  C  CA    . GLN A  1  147 ? 45.174  33.924  398.235 1.00 83.44  ? 147 GLN 1 CA    1 
ATOM   1163  C  C     . GLN A  1  147 ? 46.617  33.644  398.640 1.00 76.14  ? 147 GLN 1 C     1 
ATOM   1164  O  O     . GLN A  1  147 ? 47.229  34.435  399.368 1.00 79.35  ? 147 GLN 1 O     1 
ATOM   1165  C  CB    . GLN A  1  147 ? 44.209  33.092  399.077 1.00 90.92  ? 147 GLN 1 CB    1 
ATOM   1166  C  CG    . GLN A  1  147 ? 44.301  33.316  400.572 1.00 97.95  ? 147 GLN 1 CG    1 
ATOM   1167  C  CD    . GLN A  1  147 ? 43.291  32.479  401.333 1.00 104.46 ? 147 GLN 1 CD    1 
ATOM   1168  O  OE1   . GLN A  1  147 ? 42.476  31.772  400.735 1.00 110.22 ? 147 GLN 1 OE1   1 
ATOM   1169  N  NE2   . GLN A  1  147 ? 43.342  32.548  402.657 1.00 106.41 ? 147 GLN 1 NE2   1 
ATOM   1170  N  N     . ALA A  1  148 ? 47.171  32.512  398.196 1.00 68.35  ? 148 ALA 1 N     1 
ATOM   1171  C  CA    . ALA A  1  148 ? 48.546  32.169  398.549 1.00 58.11  ? 148 ALA 1 CA    1 
ATOM   1172  C  C     . ALA A  1  148 ? 49.530  33.191  397.997 1.00 46.08  ? 148 ALA 1 C     1 
ATOM   1173  O  O     . ALA A  1  148 ? 50.466  33.604  398.694 1.00 39.12  ? 148 ALA 1 O     1 
ATOM   1174  C  CB    . ALA A  1  148 ? 48.885  30.768  398.040 1.00 59.93  ? 148 ALA 1 CB    1 
ATOM   1175  N  N     . ILE A  1  149 ? 49.335  33.609  396.744 1.00 48.88  ? 149 ILE 1 N     1 
ATOM   1176  C  CA    . ILE A  1  149 ? 50.242  34.577  396.139 1.00 54.76  ? 149 ILE 1 CA    1 
ATOM   1177  C  C     . ILE A  1  149 ? 50.110  35.930  396.829 1.00 65.07  ? 149 ILE 1 C     1 
ATOM   1178  O  O     . ILE A  1  149 ? 51.113  36.611  397.066 1.00 69.20  ? 149 ILE 1 O     1 
ATOM   1179  C  CB    . ILE A  1  149 ? 49.998  34.681  394.622 1.00 52.97  ? 149 ILE 1 CB    1 
ATOM   1180  C  CG1   . ILE A  1  149 ? 50.335  33.360  393.931 1.00 43.96  ? 149 ILE 1 CG1   1 
ATOM   1181  C  CG2   . ILE A  1  149 ? 50.853  35.777  394.016 1.00 53.08  ? 149 ILE 1 CG2   1 
ATOM   1182  C  CD1   . ILE A  1  149 ? 50.365  33.449  392.424 1.00 35.42  ? 149 ILE 1 CD1   1 
ATOM   1183  N  N     . LYS A  1  150 ? 48.881  36.339  397.173 1.00 65.14  ? 150 LYS 1 N     1 
ATOM   1184  C  CA    . LYS A  1  150 ? 48.709  37.595  397.903 1.00 65.17  ? 150 LYS 1 CA    1 
ATOM   1185  C  C     . LYS A  1  150 ? 49.408  37.544  399.257 1.00 73.35  ? 150 LYS 1 C     1 
ATOM   1186  O  O     . LYS A  1  150 ? 50.088  38.502  399.650 1.00 76.18  ? 150 LYS 1 O     1 
ATOM   1187  C  CB    . LYS A  1  150 ? 47.224  37.914  398.098 1.00 56.02  ? 150 LYS 1 CB    1 
ATOM   1188  C  CG    . LYS A  1  150 ? 46.479  38.397  396.861 1.00 50.60  ? 150 LYS 1 CG    1 
ATOM   1189  C  CD    . LYS A  1  150 ? 45.328  39.324  397.276 1.00 45.19  ? 150 LYS 1 CD    1 
ATOM   1190  C  CE    . LYS A  1  150 ? 44.337  39.579  396.141 1.00 38.40  ? 150 LYS 1 CE    1 
ATOM   1191  N  NZ    . LYS A  1  150 ? 43.273  38.546  396.056 1.00 35.04  ? 150 LYS 1 NZ    1 
ATOM   1192  N  N     . GLU A  1  151 ? 49.260  36.429  399.981 1.00 75.14  ? 151 GLU 1 N     1 
ATOM   1193  C  CA    . GLU A  1  151 ? 49.922  36.278  401.274 1.00 69.86  ? 151 GLU 1 CA    1 
ATOM   1194  C  C     . GLU A  1  151 ? 51.436  36.360  401.133 1.00 66.93  ? 151 GLU 1 C     1 
ATOM   1195  O  O     . GLU A  1  151 ? 52.098  37.136  401.835 1.00 67.45  ? 151 GLU 1 O     1 
ATOM   1196  C  CB    . GLU A  1  151 ? 49.518  34.952  401.920 1.00 66.10  ? 151 GLU 1 CB    1 
ATOM   1197  C  CG    . GLU A  1  151 ? 48.125  34.946  402.526 1.00 67.43  ? 151 GLU 1 CG    1 
ATOM   1198  C  CD    . GLU A  1  151 ? 47.804  33.634  403.211 1.00 69.19  ? 151 GLU 1 CD    1 
ATOM   1199  O  OE1   . GLU A  1  151 ? 47.958  33.553  404.449 1.00 69.78  ? 151 GLU 1 OE1   1 
ATOM   1200  O  OE2   . GLU A  1  151 ? 47.393  32.684  402.514 1.00 71.44  ? 151 GLU 1 OE2   1 
ATOM   1201  N  N     . ALA A  1  152 ? 52.003  35.553  400.235 1.00 63.88  ? 152 ALA 1 N     1 
ATOM   1202  C  CA    . ALA A  1  152 ? 53.452  35.529  400.078 1.00 66.44  ? 152 ALA 1 CA    1 
ATOM   1203  C  C     . ALA A  1  152 ? 53.982  36.882  399.611 1.00 72.87  ? 152 ALA 1 C     1 
ATOM   1204  O  O     . ALA A  1  152 ? 55.048  37.325  400.055 1.00 76.79  ? 152 ALA 1 O     1 
ATOM   1205  C  CB    . ALA A  1  152 ? 53.855  34.420  399.108 1.00 67.05  ? 152 ALA 1 CB    1 
ATOM   1206  N  N     . ARG A  1  153 ? 53.250  37.559  398.719 1.00 74.39  ? 153 ARG 1 N     1 
ATOM   1207  C  CA    . ARG A  1  153 ? 53.668  38.882  398.271 1.00 79.59  ? 153 ARG 1 CA    1 
ATOM   1208  C  C     . ARG A  1  153 ? 53.651  39.879  399.420 1.00 81.74  ? 153 ARG 1 C     1 
ATOM   1209  O  O     . ARG A  1  153 ? 54.560  40.706  399.549 1.00 84.82  ? 153 ARG 1 O     1 
ATOM   1210  C  CB    . ARG A  1  153 ? 52.748  39.373  397.151 1.00 82.20  ? 153 ARG 1 CB    1 
ATOM   1211  C  CG    . ARG A  1  153 ? 53.247  39.151  395.731 1.00 81.70  ? 153 ARG 1 CG    1 
ATOM   1212  C  CD    . ARG A  1  153 ? 52.337  39.870  394.736 1.00 78.49  ? 153 ARG 1 CD    1 
ATOM   1213  N  NE    . ARG A  1  153 ? 51.411  38.974  394.051 1.00 75.90  ? 153 ARG 1 NE    1 
ATOM   1214  C  CZ    . ARG A  1  153 ? 50.657  39.335  393.017 1.00 73.98  ? 153 ARG 1 CZ    1 
ATOM   1215  N  NH1   . ARG A  1  153 ? 50.723  40.573  392.548 1.00 75.66  ? 153 ARG 1 NH1   1 
ATOM   1216  N  NH2   . ARG A  1  153 ? 49.833  38.462  392.449 1.00 71.43  ? 153 ARG 1 NH2   1 
ATOM   1217  N  N     . ALA A  1  154 ? 52.622  39.813  400.267 1.00 84.79  ? 154 ALA 1 N     1 
ATOM   1218  C  CA    . ALA A  1  154 ? 52.541  40.713  401.411 1.00 91.90  ? 154 ALA 1 CA    1 
ATOM   1219  C  C     . ALA A  1  154 ? 53.697  40.486  402.376 1.00 100.38 ? 154 ALA 1 C     1 
ATOM   1220  O  O     . ALA A  1  154 ? 54.407  41.429  402.747 1.00 102.13 ? 154 ALA 1 O     1 
ATOM   1221  C  CB    . ALA A  1  154 ? 51.199  40.538  402.122 1.00 94.03  ? 154 ALA 1 CB    1 
ATOM   1222  N  N     . ARG A  1  155 ? 53.916  39.235  402.779 1.00 103.73 ? 155 ARG 1 N     1 
ATOM   1223  C  CA    . ARG A  1  155 ? 54.885  38.930  403.825 1.00 111.74 ? 155 ARG 1 CA    1 
ATOM   1224  C  C     . ARG A  1  155 ? 56.327  38.878  403.317 1.00 113.57 ? 155 ARG 1 C     1 
ATOM   1225  O  O     . ARG A  1  155 ? 57.198  38.336  404.013 1.00 114.93 ? 155 ARG 1 O     1 
ATOM   1226  C  CB    . ARG A  1  155 ? 54.512  37.616  404.518 1.00 110.31 ? 155 ARG 1 CB    1 
ATOM   1227  C  CG    . ARG A  1  155 ? 53.318  37.765  405.450 1.00 110.42 ? 155 ARG 1 CG    1 
ATOM   1228  C  CD    . ARG A  1  155 ? 53.004  36.499  406.231 1.00 108.56 ? 155 ARG 1 CD    1 
ATOM   1229  N  NE    . ARG A  1  155 ? 51.577  36.398  406.527 1.00 107.16 ? 155 ARG 1 NE    1 
ATOM   1230  C  CZ    . ARG A  1  155 ? 51.007  35.365  407.140 1.00 103.95 ? 155 ARG 1 CZ    1 
ATOM   1231  N  NH1   . ARG A  1  155 ? 51.742  34.341  407.551 1.00 100.24 ? 155 ARG 1 NH1   1 
ATOM   1232  N  NH2   . ARG A  1  155 ? 49.699  35.365  407.360 1.00 104.88 ? 155 ARG 1 NH2   1 
ATOM   1233  N  N     . GLY A  1  156 ? 56.595  39.413  402.129 1.00 118.23 ? 156 GLY 1 N     1 
ATOM   1234  C  CA    . GLY A  1  156 ? 57.959  39.555  401.660 1.00 123.43 ? 156 GLY 1 CA    1 
ATOM   1235  C  C     . GLY A  1  156 ? 58.602  38.284  401.162 1.00 130.66 ? 156 GLY 1 C     1 
ATOM   1236  O  O     . GLY A  1  156 ? 59.830  38.233  401.039 1.00 130.05 ? 156 GLY 1 O     1 
ATOM   1237  N  N     . TYR A  1  157 ? 57.813  37.250  400.877 1.00 137.17 ? 157 TYR 1 N     1 
ATOM   1238  C  CA    . TYR A  1  157 ? 58.345  36.012  400.321 1.00 139.76 ? 157 TYR 1 CA    1 
ATOM   1239  C  C     . TYR A  1  157 ? 58.389  36.029  398.802 1.00 136.30 ? 157 TYR 1 C     1 
ATOM   1240  O  O     . TYR A  1  157 ? 59.162  35.270  398.209 1.00 137.75 ? 157 TYR 1 O     1 
ATOM   1241  C  CB    . TYR A  1  157 ? 57.520  34.824  400.822 1.00 145.65 ? 157 TYR 1 CB    1 
ATOM   1242  C  CG    . TYR A  1  157 ? 57.748  34.560  402.291 1.00 153.38 ? 157 TYR 1 CG    1 
ATOM   1243  C  CD1   . TYR A  1  157 ? 58.707  33.648  402.711 1.00 157.76 ? 157 TYR 1 CD1   1 
ATOM   1244  C  CD2   . TYR A  1  157 ? 57.028  35.247  403.259 1.00 156.85 ? 157 TYR 1 CD2   1 
ATOM   1245  C  CE1   . TYR A  1  157 ? 58.929  33.414  404.058 1.00 160.77 ? 157 TYR 1 CE1   1 
ATOM   1246  C  CE2   . TYR A  1  157 ? 57.243  35.020  404.605 1.00 159.46 ? 157 TYR 1 CE2   1 
ATOM   1247  C  CZ    . TYR A  1  157 ? 58.194  34.104  404.999 1.00 161.25 ? 157 TYR 1 CZ    1 
ATOM   1248  O  OH    . TYR A  1  157 ? 58.410  33.876  406.338 1.00 161.77 ? 157 TYR 1 OH    1 
ATOM   1249  N  N     . LEU A  1  158 ? 57.572  36.872  398.170 1.00 129.45 ? 158 LEU 1 N     1 
ATOM   1250  C  CA    . LEU A  1  158 ? 57.607  37.131  396.731 1.00 120.12 ? 158 LEU 1 CA    1 
ATOM   1251  C  C     . LEU A  1  158 ? 57.676  38.648  396.586 1.00 105.78 ? 158 LEU 1 C     1 
ATOM   1252  O  O     . LEU A  1  158 ? 56.655  39.331  396.708 1.00 101.91 ? 158 LEU 1 O     1 
ATOM   1253  C  CB    . LEU A  1  158 ? 56.387  36.549  396.025 1.00 125.62 ? 158 LEU 1 CB    1 
ATOM   1254  C  CG    . LEU A  1  158 ? 56.017  35.091  396.317 1.00 129.60 ? 158 LEU 1 CG    1 
ATOM   1255  C  CD1   . LEU A  1  158 ? 54.835  34.662  395.463 1.00 132.57 ? 158 LEU 1 CD1   1 
ATOM   1256  C  CD2   . LEU A  1  158 ? 57.200  34.166  396.068 1.00 128.20 ? 158 LEU 1 CD2   1 
ATOM   1257  N  N     . GLY A  1  159 ? 58.861  39.176  396.318 1.00 97.40  ? 159 GLY 1 N     1 
ATOM   1258  C  CA    . GLY A  1  159 ? 59.060  40.604  396.397 1.00 92.38  ? 159 GLY 1 CA    1 
ATOM   1259  C  C     . GLY A  1  159 ? 60.323  41.074  395.717 1.00 89.81  ? 159 GLY 1 C     1 
ATOM   1260  O  O     . GLY A  1  159 ? 60.848  40.416  394.819 1.00 90.15  ? 159 GLY 1 O     1 
ATOM   1261  N  N     . LYS A  1  160 ? 60.804  42.239  396.163 1.00 89.25  ? 160 LYS 1 N     1 
ATOM   1262  C  CA    . LYS A  1  160 ? 61.913  42.908  395.489 1.00 88.62  ? 160 LYS 1 CA    1 
ATOM   1263  C  C     . LYS A  1  160 ? 63.172  42.050  395.511 1.00 89.25  ? 160 LYS 1 C     1 
ATOM   1264  O  O     . LYS A  1  160 ? 63.684  41.642  394.463 1.00 92.00  ? 160 LYS 1 O     1 
ATOM   1265  C  CB    . LYS A  1  160 ? 62.187  44.262  396.151 1.00 85.18  ? 160 LYS 1 CB    1 
ATOM   1266  C  CG    . LYS A  1  160 ? 61.002  44.879  396.874 1.00 81.43  ? 160 LYS 1 CG    1 
ATOM   1267  C  CD    . LYS A  1  160 ? 59.937  45.371  395.912 1.00 77.98  ? 160 LYS 1 CD    1 
ATOM   1268  C  CE    . LYS A  1  160 ? 58.731  45.875  396.674 1.00 76.54  ? 160 LYS 1 CE    1 
ATOM   1269  N  NZ    . LYS A  1  160 ? 59.103  47.023  397.539 1.00 77.68  ? 160 LYS 1 NZ    1 
ATOM   1270  N  N     . ASN A  1  161 ? 63.682  41.759  396.703 1.00 85.75  ? 161 ASN 1 N     1 
ATOM   1271  C  CA    . ASN A  1  161 ? 64.854  40.912  396.859 1.00 83.88  ? 161 ASN 1 CA    1 
ATOM   1272  C  C     . ASN A  1  161 ? 64.538  39.861  397.910 1.00 82.36  ? 161 ASN 1 C     1 
ATOM   1273  O  O     . ASN A  1  161 ? 64.074  40.197  399.004 1.00 84.92  ? 161 ASN 1 O     1 
ATOM   1274  C  CB    . ASN A  1  161 ? 66.088  41.729  397.268 1.00 84.65  ? 161 ASN 1 CB    1 
ATOM   1275  C  CG    . ASN A  1  161 ? 66.586  42.647  396.155 1.00 84.67  ? 161 ASN 1 CG    1 
ATOM   1276  O  OD1   . ASN A  1  161 ? 67.600  42.372  395.512 1.00 83.27  ? 161 ASN 1 OD1   1 
ATOM   1277  N  ND2   . ASN A  1  161 ? 65.875  43.748  395.933 1.00 83.88  ? 161 ASN 1 ND2   1 
ATOM   1278  N  N     . LEU A  1  162 ? 64.788  38.598  397.581 1.00 80.81  ? 162 LEU 1 N     1 
ATOM   1279  C  CA    . LEU A  1  162 ? 64.465  37.497  398.478 1.00 81.79  ? 162 LEU 1 CA    1 
ATOM   1280  C  C     . LEU A  1  162 ? 65.622  37.238  399.433 1.00 86.94  ? 162 LEU 1 C     1 
ATOM   1281  O  O     . LEU A  1  162 ? 66.759  37.030  398.999 1.00 90.69  ? 162 LEU 1 O     1 
ATOM   1282  C  CB    . LEU A  1  162 ? 64.137  36.230  397.686 1.00 73.74  ? 162 LEU 1 CB    1 
ATOM   1283  C  CG    . LEU A  1  162 ? 62.949  36.355  396.734 1.00 64.94  ? 162 LEU 1 CG    1 
ATOM   1284  C  CD1   . LEU A  1  162 ? 62.656  35.028  396.061 1.00 62.14  ? 162 LEU 1 CD1   1 
ATOM   1285  C  CD2   . LEU A  1  162 ? 61.737  36.865  397.485 1.00 61.75  ? 162 LEU 1 CD2   1 
ATOM   1286  N  N     . PHE A  1  163 ? 65.323  37.265  400.735 1.00 85.80  ? 163 PHE 1 N     1 
ATOM   1287  C  CA    . PHE A  1  163 ? 66.268  36.884  401.785 1.00 82.03  ? 163 PHE 1 CA    1 
ATOM   1288  C  C     . PHE A  1  163 ? 67.571  37.678  401.708 1.00 85.18  ? 163 PHE 1 C     1 
ATOM   1289  O  O     . PHE A  1  163 ? 68.633  37.188  402.099 1.00 83.60  ? 163 PHE 1 O     1 
ATOM   1290  C  CB    . PHE A  1  163 ? 66.549  35.379  401.740 1.00 77.36  ? 163 PHE 1 CB    1 
ATOM   1291  C  CG    . PHE A  1  163 ? 65.314  34.538  401.555 1.00 74.59  ? 163 PHE 1 CG    1 
ATOM   1292  C  CD1   . PHE A  1  163 ? 64.175  34.782  402.303 1.00 75.01  ? 163 PHE 1 CD1   1 
ATOM   1293  C  CD2   . PHE A  1  163 ? 65.288  33.509  400.629 1.00 72.57  ? 163 PHE 1 CD2   1 
ATOM   1294  C  CE1   . PHE A  1  163 ? 63.035  34.015  402.133 1.00 73.24  ? 163 PHE 1 CE1   1 
ATOM   1295  C  CE2   . PHE A  1  163 ? 64.148  32.739  400.459 1.00 70.98  ? 163 PHE 1 CE2   1 
ATOM   1296  C  CZ    . PHE A  1  163 ? 63.024  32.993  401.211 1.00 71.73  ? 163 PHE 1 CZ    1 
ATOM   1297  N  N     . GLY A  1  164 ? 67.502  38.906  401.191 1.00 86.13  ? 164 GLY 1 N     1 
ATOM   1298  C  CA    . GLY A  1  164 ? 68.666  39.753  401.056 1.00 83.13  ? 164 GLY 1 CA    1 
ATOM   1299  C  C     . GLY A  1  164 ? 69.526  39.482  399.843 1.00 79.70  ? 164 GLY 1 C     1 
ATOM   1300  O  O     . GLY A  1  164 ? 70.268  40.375  399.420 1.00 73.58  ? 164 GLY 1 O     1 
ATOM   1301  N  N     . THR A  1  165 ? 69.458  38.281  399.272 1.00 86.68  ? 165 THR 1 N     1 
ATOM   1302  C  CA    . THR A  1  165 ? 70.259  37.972  398.100 1.00 92.70  ? 165 THR 1 CA    1 
ATOM   1303  C  C     . THR A  1  165 ? 69.823  38.844  396.925 1.00 101.17 ? 165 THR 1 C     1 
ATOM   1304  O  O     . THR A  1  165 ? 68.755  39.467  396.937 1.00 103.56 ? 165 THR 1 O     1 
ATOM   1305  C  CB    . THR A  1  165 ? 70.150  36.485  397.744 1.00 88.60  ? 165 THR 1 CB    1 
ATOM   1306  O  OG1   . THR A  1  165 ? 71.318  36.078  397.023 1.00 88.78  ? 165 THR 1 OG1   1 
ATOM   1307  C  CG2   . THR A  1  165 ? 68.924  36.211  396.890 1.00 85.88  ? 165 THR 1 CG2   1 
ATOM   1308  N  N     . ASP A  1  166 ? 70.670  38.885  395.900 1.00 105.69 ? 166 ASP 1 N     1 
ATOM   1309  C  CA    . ASP A  1  166 ? 70.459  39.735  394.735 1.00 108.75 ? 166 ASP 1 CA    1 
ATOM   1310  C  C     . ASP A  1  166 ? 69.386  39.202  393.788 1.00 104.51 ? 166 ASP 1 C     1 
ATOM   1311  O  O     . ASP A  1  166 ? 69.239  39.735  392.681 1.00 104.25 ? 166 ASP 1 O     1 
ATOM   1312  C  CB    . ASP A  1  166 ? 71.781  39.912  393.981 1.00 113.71 ? 166 ASP 1 CB    1 
ATOM   1313  C  CG    . ASP A  1  166 ? 72.366  38.591  393.513 1.00 114.16 ? 166 ASP 1 CG    1 
ATOM   1314  O  OD1   . ASP A  1  166 ? 72.222  37.586  394.241 1.00 114.33 ? 166 ASP 1 OD1   1 
ATOM   1315  O  OD2   . ASP A  1  166 ? 72.971  38.558  392.421 1.00 114.23 ? 166 ASP 1 OD2   1 
ATOM   1316  N  N     . PHE A  1  167 ? 68.636  38.180  394.190 1.00 98.07  ? 167 PHE 1 N     1 
ATOM   1317  C  CA    . PHE A  1  167 ? 67.631  37.561  393.339 1.00 92.20  ? 167 PHE 1 CA    1 
ATOM   1318  C  C     . PHE A  1  167 ? 66.244  38.133  393.620 1.00 79.75  ? 167 PHE 1 C     1 
ATOM   1319  O  O     . PHE A  1  167 ? 65.939  38.566  394.735 1.00 79.17  ? 167 PHE 1 O     1 
ATOM   1320  C  CB    . PHE A  1  167 ? 67.634  36.041  393.540 1.00 96.71  ? 167 PHE 1 CB    1 
ATOM   1321  C  CG    . PHE A  1  167 ? 66.692  35.299  392.633 1.00 99.45  ? 167 PHE 1 CG    1 
ATOM   1322  C  CD1   . PHE A  1  167 ? 67.047  35.022  391.323 1.00 100.16 ? 167 PHE 1 CD1   1 
ATOM   1323  C  CD2   . PHE A  1  167 ? 65.467  34.850  393.098 1.00 100.10 ? 167 PHE 1 CD2   1 
ATOM   1324  C  CE1   . PHE A  1  167 ? 66.186  34.334  390.486 1.00 100.37 ? 167 PHE 1 CE1   1 
ATOM   1325  C  CE2   . PHE A  1  167 ? 64.606  34.156  392.265 1.00 100.75 ? 167 PHE 1 CE2   1 
ATOM   1326  C  CZ    . PHE A  1  167 ? 64.967  33.901  390.959 1.00 100.84 ? 167 PHE 1 CZ    1 
ATOM   1327  N  N     . SER A  1  168 ? 65.407  38.129  392.583 1.00 68.24  ? 168 SER 1 N     1 
ATOM   1328  C  CA    . SER A  1  168 ? 64.028  38.588  392.665 1.00 54.42  ? 168 SER 1 CA    1 
ATOM   1329  C  C     . SER A  1  168 ? 63.101  37.521  392.099 1.00 50.44  ? 168 SER 1 C     1 
ATOM   1330  O  O     . SER A  1  168 ? 63.480  36.763  391.203 1.00 50.93  ? 168 SER 1 O     1 
ATOM   1331  C  CB    . SER A  1  168 ? 63.832  39.899  391.895 1.00 51.42  ? 168 SER 1 CB    1 
ATOM   1332  O  OG    . SER A  1  168 ? 64.626  40.934  392.443 1.00 50.63  ? 168 SER 1 OG    1 
ATOM   1333  N  N     . PHE A  1  169 ? 61.868  37.489  392.598 1.00 46.23  ? 169 PHE 1 N     1 
ATOM   1334  C  CA    . PHE A  1  169 ? 60.912  36.503  392.113 1.00 47.16  ? 169 PHE 1 CA    1 
ATOM   1335  C  C     . PHE A  1  169 ? 59.490  36.959  392.401 1.00 55.34  ? 169 PHE 1 C     1 
ATOM   1336  O  O     . PHE A  1  169 ? 59.233  37.669  393.378 1.00 58.10  ? 169 PHE 1 O     1 
ATOM   1337  C  CB    . PHE A  1  169 ? 61.155  35.124  392.735 1.00 42.88  ? 169 PHE 1 CB    1 
ATOM   1338  C  CG    . PHE A  1  169 ? 60.435  34.015  392.027 1.00 42.22  ? 169 PHE 1 CG    1 
ATOM   1339  C  CD1   . PHE A  1  169 ? 60.947  33.474  390.862 1.00 45.56  ? 169 PHE 1 CD1   1 
ATOM   1340  C  CD2   . PHE A  1  169 ? 59.246  33.515  392.523 1.00 41.10  ? 169 PHE 1 CD2   1 
ATOM   1341  C  CE1   . PHE A  1  169 ? 60.283  32.457  390.201 1.00 45.92  ? 169 PHE 1 CE1   1 
ATOM   1342  C  CE2   . PHE A  1  169 ? 58.582  32.495  391.867 1.00 42.94  ? 169 PHE 1 CE2   1 
ATOM   1343  C  CZ    . PHE A  1  169 ? 59.104  31.968  390.706 1.00 45.83  ? 169 PHE 1 CZ    1 
ATOM   1344  N  N     . ASP A  1  170 ? 58.573  36.530  391.536 1.00 62.65  ? 170 ASP 1 N     1 
ATOM   1345  C  CA    . ASP A  1  170 ? 57.154  36.823  391.671 1.00 72.56  ? 170 ASP 1 CA    1 
ATOM   1346  C  C     . ASP A  1  170 ? 56.384  35.855  390.780 1.00 78.44  ? 170 ASP 1 C     1 
ATOM   1347  O  O     . ASP A  1  170 ? 56.908  35.369  389.774 1.00 84.14  ? 170 ASP 1 O     1 
ATOM   1348  C  CB    . ASP A  1  170 ? 56.836  38.274  391.287 1.00 77.53  ? 170 ASP 1 CB    1 
ATOM   1349  C  CG    . ASP A  1  170 ? 55.473  38.725  391.784 1.00 85.03  ? 170 ASP 1 CG    1 
ATOM   1350  O  OD1   . ASP A  1  170 ? 54.623  37.859  392.083 1.00 86.84  ? 170 ASP 1 OD1   1 
ATOM   1351  O  OD2   . ASP A  1  170 ? 55.247  39.952  391.864 1.00 87.07  ? 170 ASP 1 OD2   1 
ATOM   1352  N  N     . LEU A  1  171 ? 55.140  35.577  391.165 1.00 79.64  ? 171 LEU 1 N     1 
ATOM   1353  C  CA    . LEU A  1  171 ? 54.235  34.760  390.369 1.00 83.87  ? 171 LEU 1 CA    1 
ATOM   1354  C  C     . LEU A  1  171 ? 52.959  35.531  390.049 1.00 91.89  ? 171 LEU 1 C     1 
ATOM   1355  O  O     . LEU A  1  171 ? 52.579  36.475  390.750 1.00 96.32  ? 171 LEU 1 O     1 
ATOM   1356  C  CB    . LEU A  1  171 ? 53.885  33.444  391.085 1.00 80.51  ? 171 LEU 1 CB    1 
ATOM   1357  C  CG    . LEU A  1  171 ? 55.032  32.446  391.264 1.00 74.04  ? 171 LEU 1 CG    1 
ATOM   1358  C  CD1   . LEU A  1  171 ? 54.561  31.191  391.985 1.00 70.36  ? 171 LEU 1 CD1   1 
ATOM   1359  C  CD2   . LEU A  1  171 ? 55.621  32.094  389.909 1.00 72.77  ? 171 LEU 1 CD2   1 
ATOM   1360  N  N     . HIS A  1  172 ? 52.294  35.107  388.973 1.00 91.17  ? 172 HIS 1 N     1 
ATOM   1361  C  CA    . HIS A  1  172 ? 51.013  35.674  388.574 1.00 88.67  ? 172 HIS 1 CA    1 
ATOM   1362  C  C     . HIS A  1  172 ? 50.097  34.577  388.052 1.00 81.36  ? 172 HIS 1 C     1 
ATOM   1363  O  O     . HIS A  1  172 ? 50.536  33.682  387.323 1.00 76.88  ? 172 HIS 1 O     1 
ATOM   1364  C  CB    . HIS A  1  172 ? 51.205  36.772  387.520 1.00 92.24  ? 172 HIS 1 CB    1 
ATOM   1365  C  CG    . HIS A  1  172 ? 51.985  37.947  388.021 1.00 93.80  ? 172 HIS 1 CG    1 
ATOM   1366  N  ND1   . HIS A  1  172 ? 51.535  38.752  389.047 1.00 97.04  ? 172 HIS 1 ND1   1 
ATOM   1367  C  CD2   . HIS A  1  172 ? 53.190  38.443  387.653 1.00 96.06  ? 172 HIS 1 CD2   1 
ATOM   1368  C  CE1   . HIS A  1  172 ? 52.424  39.701  389.281 1.00 95.45  ? 172 HIS 1 CE1   1 
ATOM   1369  N  NE2   . HIS A  1  172 ? 53.438  39.535  388.449 1.00 97.05  ? 172 HIS 1 NE2   1 
ATOM   1370  N  N     . VAL A  1  173 ? 48.823  34.652  388.441 1.00 82.82  ? 173 VAL 1 N     1 
ATOM   1371  C  CA    . VAL A  1  173 ? 47.822  33.634  388.136 1.00 85.63  ? 173 VAL 1 CA    1 
ATOM   1372  C  C     . VAL A  1  173 ? 47.196  33.937  386.783 1.00 88.56  ? 173 VAL 1 C     1 
ATOM   1373  O  O     . VAL A  1  173 ? 47.065  35.098  386.385 1.00 92.61  ? 173 VAL 1 O     1 
ATOM   1374  C  CB    . VAL A  1  173 ? 46.746  33.573  389.242 1.00 88.57  ? 173 VAL 1 CB    1 
ATOM   1375  C  CG1   . VAL A  1  173 ? 45.975  32.262  389.171 1.00 88.87  ? 173 VAL 1 CG1   1 
ATOM   1376  C  CG2   . VAL A  1  173 ? 47.366  33.770  390.618 1.00 90.57  ? 173 VAL 1 CG2   1 
ATOM   1377  N  N     . HIS A  1  174 ? 46.806  32.882  386.066 1.00 85.39  ? 174 HIS 1 N     1 
ATOM   1378  C  CA    . HIS A  1  174 ? 46.091  33.021  384.798 1.00 83.41  ? 174 HIS 1 CA    1 
ATOM   1379  C  C     . HIS A  1  174 ? 44.948  32.016  384.770 1.00 85.91  ? 174 HIS 1 C     1 
ATOM   1380  O  O     . HIS A  1  174 ? 45.190  30.806  384.743 1.00 85.15  ? 174 HIS 1 O     1 
ATOM   1381  C  CB    . HIS A  1  174 ? 47.017  32.807  383.601 1.00 75.46  ? 174 HIS 1 CB    1 
ATOM   1382  C  CG    . HIS A  1  174 ? 46.401  33.191  382.291 1.00 66.51  ? 174 HIS 1 CG    1 
ATOM   1383  N  ND1   . HIS A  1  174 ? 46.553  34.445  381.738 1.00 66.62  ? 174 HIS 1 ND1   1 
ATOM   1384  C  CD2   . HIS A  1  174 ? 45.611  32.497  381.439 1.00 66.25  ? 174 HIS 1 CD2   1 
ATOM   1385  C  CE1   . HIS A  1  174 ? 45.895  34.502  380.593 1.00 63.23  ? 174 HIS 1 CE1   1 
ATOM   1386  N  NE2   . HIS A  1  174 ? 45.314  33.333  380.390 1.00 63.19  ? 174 HIS 1 NE2   1 
ATOM   1387  N  N     . ARG A  1  175 ? 43.710  32.510  384.779 1.00 90.53  ? 175 ARG 1 N     1 
ATOM   1388  C  CA    . ARG A  1  175 ? 42.552  31.636  384.652 1.00 97.28  ? 175 ARG 1 CA    1 
ATOM   1389  C  C     . ARG A  1  175 ? 42.303  31.331  383.179 1.00 104.55 ? 175 ARG 1 C     1 
ATOM   1390  O  O     . ARG A  1  175 ? 42.295  32.236  382.340 1.00 104.58 ? 175 ARG 1 O     1 
ATOM   1391  C  CB    . ARG A  1  175 ? 41.321  32.282  385.288 1.00 101.91 ? 175 ARG 1 CB    1 
ATOM   1392  C  CG    . ARG A  1  175 ? 41.396  32.378  386.812 1.00 106.54 ? 175 ARG 1 CG    1 
ATOM   1393  C  CD    . ARG A  1  175 ? 40.046  32.712  387.442 1.00 111.51 ? 175 ARG 1 CD    1 
ATOM   1394  N  NE    . ARG A  1  175 ? 39.069  31.638  387.272 1.00 114.52 ? 175 ARG 1 NE    1 
ATOM   1395  C  CZ    . ARG A  1  175 ? 37.794  31.726  387.637 1.00 115.48 ? 175 ARG 1 CZ    1 
ATOM   1396  N  NH1   . ARG A  1  175 ? 37.337  32.838  388.197 1.00 117.84 ? 175 ARG 1 NH1   1 
ATOM   1397  N  NH2   . ARG A  1  175 ? 36.974  30.702  387.445 1.00 113.69 ? 175 ARG 1 NH2   1 
ATOM   1398  N  N     . GLY A  1  176 ? 42.103  30.053  382.870 1.00 110.49 ? 176 GLY 1 N     1 
ATOM   1399  C  CA    . GLY A  1  176 ? 41.908  29.597  381.509 1.00 114.94 ? 176 GLY 1 CA    1 
ATOM   1400  C  C     . GLY A  1  176 ? 40.458  29.614  381.074 1.00 116.66 ? 176 GLY 1 C     1 
ATOM   1401  O  O     . GLY A  1  176 ? 39.603  30.265  381.682 1.00 120.04 ? 176 GLY 1 O     1 
ATOM   1402  N  N     . ALA A  1  177 ? 40.179  28.879  379.987 1.00 112.75 ? 177 ALA 1 N     1 
ATOM   1403  C  CA    . ALA A  1  177 ? 38.811  28.783  379.492 1.00 104.40 ? 177 ALA 1 CA    1 
ATOM   1404  C  C     . ALA A  1  177 ? 38.430  27.376  379.030 1.00 96.63  ? 177 ALA 1 C     1 
ATOM   1405  O  O     . ALA A  1  177 ? 37.468  27.228  378.265 1.00 93.85  ? 177 ALA 1 O     1 
ATOM   1406  C  CB    . ALA A  1  177 ? 38.587  29.775  378.348 1.00 103.62 ? 177 ALA 1 CB    1 
ATOM   1407  N  N     . GLY A  1  178 ? 39.137  26.341  379.478 1.00 91.31  ? 178 GLY 1 N     1 
ATOM   1408  C  CA    . GLY A  1  178 ? 38.689  24.984  379.243 1.00 91.75  ? 178 GLY 1 CA    1 
ATOM   1409  C  C     . GLY A  1  178 ? 38.754  24.467  377.818 1.00 95.99  ? 178 GLY 1 C     1 
ATOM   1410  O  O     . GLY A  1  178 ? 37.713  24.287  377.177 1.00 97.21  ? 178 GLY 1 O     1 
ATOM   1411  N  N     . ALA A  1  179 ? 39.959  24.234  377.299 1.00 97.14  ? 179 ALA 1 N     1 
ATOM   1412  C  CA    . ALA A  1  179 ? 40.141  23.511  376.042 1.00 93.07  ? 179 ALA 1 CA    1 
ATOM   1413  C  C     . ALA A  1  179 ? 41.261  22.503  376.234 1.00 90.24  ? 179 ALA 1 C     1 
ATOM   1414  O  O     . ALA A  1  179 ? 42.377  22.887  376.597 1.00 89.86  ? 179 ALA 1 O     1 
ATOM   1415  C  CB    . ALA A  1  179 ? 40.458  24.454  374.879 1.00 88.51  ? 179 ALA 1 CB    1 
ATOM   1416  N  N     . TYR A  1  180 ? 40.957  21.218  376.008 1.00 86.55  ? 180 TYR 1 N     1 
ATOM   1417  C  CA    . TYR A  1  180 ? 41.932  20.155  376.246 1.00 82.06  ? 180 TYR 1 CA    1 
ATOM   1418  C  C     . TYR A  1  180 ? 43.261  20.458  375.564 1.00 88.23  ? 180 TYR 1 C     1 
ATOM   1419  O  O     . TYR A  1  180 ? 44.331  20.206  376.133 1.00 90.20  ? 180 TYR 1 O     1 
ATOM   1420  C  CB    . TYR A  1  180 ? 41.374  18.809  375.766 1.00 74.44  ? 180 TYR 1 CB    1 
ATOM   1421  C  CG    . TYR A  1  180 ? 42.402  17.693  375.671 1.00 67.26  ? 180 TYR 1 CG    1 
ATOM   1422  C  CD1   . TYR A  1  180 ? 43.348  17.493  376.668 1.00 66.57  ? 180 TYR 1 CD1   1 
ATOM   1423  C  CD2   . TYR A  1  180 ? 42.457  16.874  374.555 1.00 63.84  ? 180 TYR 1 CD2   1 
ATOM   1424  C  CE1   . TYR A  1  180 ? 44.297  16.492  376.567 1.00 64.38  ? 180 TYR 1 CE1   1 
ATOM   1425  C  CE2   . TYR A  1  180 ? 43.406  15.871  374.448 1.00 62.45  ? 180 TYR 1 CE2   1 
ATOM   1426  C  CZ    . TYR A  1  180 ? 44.322  15.684  375.456 1.00 62.19  ? 180 TYR 1 CZ    1 
ATOM   1427  O  OH    . TYR A  1  180 ? 45.266  14.685  375.352 1.00 60.86  ? 180 TYR 1 OH    1 
ATOM   1428  N  N     . ILE A  1  181 ? 43.217  20.996  374.342 1.00 89.98  ? 181 ILE 1 N     1 
ATOM   1429  C  CA    . ILE A  1  181 ? 44.447  21.202  373.580 1.00 91.54  ? 181 ILE 1 CA    1 
ATOM   1430  C  C     . ILE A  1  181 ? 45.407  22.110  374.338 1.00 92.16  ? 181 ILE 1 C     1 
ATOM   1431  O  O     . ILE A  1  181 ? 46.631  21.963  374.230 1.00 91.26  ? 181 ILE 1 O     1 
ATOM   1432  C  CB    . ILE A  1  181 ? 44.124  21.755  372.177 1.00 94.93  ? 181 ILE 1 CB    1 
ATOM   1433  C  CG1   . ILE A  1  181 ? 45.412  21.975  371.381 1.00 95.45  ? 181 ILE 1 CG1   1 
ATOM   1434  C  CG2   . ILE A  1  181 ? 43.318  23.042  372.271 1.00 94.88  ? 181 ILE 1 CG2   1 
ATOM   1435  C  CD1   . ILE A  1  181 ? 46.170  20.697  371.095 1.00 95.57  ? 181 ILE 1 CD1   1 
ATOM   1436  N  N     . CYS A  1  182 ? 44.872  23.033  375.144 1.00 91.08  ? 182 CYS 1 N     1 
ATOM   1437  C  CA    . CYS A  1  182 ? 45.705  23.955  375.909 1.00 94.27  ? 182 CYS 1 CA    1 
ATOM   1438  C  C     . CYS A  1  182 ? 46.665  23.230  376.843 1.00 101.28 ? 182 CYS 1 C     1 
ATOM   1439  O  O     . CYS A  1  182 ? 47.658  23.823  377.280 1.00 104.99 ? 182 CYS 1 O     1 
ATOM   1440  C  CB    . CYS A  1  182 ? 44.822  24.900  376.728 1.00 87.41  ? 182 CYS 1 CB    1 
ATOM   1441  S  SG    . CYS A  1  182 ? 43.693  25.930  375.771 1.00 81.40  ? 182 CYS 1 SG    1 
ATOM   1442  N  N     . GLY A  1  183 ? 46.394  21.960  377.153 1.00 105.33 ? 183 GLY 1 N     1 
ATOM   1443  C  CA    . GLY A  1  183 ? 47.284  21.204  378.013 1.00 105.86 ? 183 GLY 1 CA    1 
ATOM   1444  C  C     . GLY A  1  183 ? 48.568  20.772  377.346 1.00 103.66 ? 183 GLY 1 C     1 
ATOM   1445  O  O     . GLY A  1  183 ? 49.574  20.549  378.026 1.00 104.55 ? 183 GLY 1 O     1 
ATOM   1446  N  N     . GLU A  1  184 ? 48.558  20.629  376.024 1.00 97.08  ? 184 GLU 1 N     1 
ATOM   1447  C  CA    . GLU A  1  184 ? 49.804  20.441  375.297 1.00 90.62  ? 184 GLU 1 CA    1 
ATOM   1448  C  C     . GLU A  1  184 ? 50.666  21.684  375.481 1.00 90.88  ? 184 GLU 1 C     1 
ATOM   1449  O  O     . GLU A  1  184 ? 50.215  22.805  375.228 1.00 88.43  ? 184 GLU 1 O     1 
ATOM   1450  C  CB    . GLU A  1  184 ? 49.517  20.176  373.817 1.00 86.14  ? 184 GLU 1 CB    1 
ATOM   1451  C  CG    . GLU A  1  184 ? 50.555  19.310  373.108 1.00 84.68  ? 184 GLU 1 CG    1 
ATOM   1452  C  CD    . GLU A  1  184 ? 51.828  20.067  372.797 1.00 83.59  ? 184 GLU 1 CD    1 
ATOM   1453  O  OE1   . GLU A  1  184 ? 51.758  21.304  372.680 1.00 81.69  ? 184 GLU 1 OE1   1 
ATOM   1454  O  OE2   . GLU A  1  184 ? 52.896  19.430  372.672 1.00 83.10  ? 184 GLU 1 OE2   1 
ATOM   1455  N  N     . GLU A  1  185 ? 51.906  21.479  375.943 1.00 92.67  ? 185 GLU 1 N     1 
ATOM   1456  C  CA    . GLU A  1  185 ? 52.746  22.585  376.404 1.00 92.55  ? 185 GLU 1 CA    1 
ATOM   1457  C  C     . GLU A  1  185 ? 52.889  23.696  375.368 1.00 84.79  ? 185 GLU 1 C     1 
ATOM   1458  O  O     . GLU A  1  185 ? 53.030  24.870  375.734 1.00 79.78  ? 185 GLU 1 O     1 
ATOM   1459  C  CB    . GLU A  1  185 ? 54.130  22.061  376.795 1.00 99.19  ? 185 GLU 1 CB    1 
ATOM   1460  C  CG    . GLU A  1  185 ? 54.886  21.406  375.653 1.00 106.82 ? 185 GLU 1 CG    1 
ATOM   1461  C  CD    . GLU A  1  185 ? 56.309  21.045  376.021 1.00 112.32 ? 185 GLU 1 CD    1 
ATOM   1462  O  OE1   . GLU A  1  185 ? 57.010  21.900  376.602 1.00 116.21 ? 185 GLU 1 OE1   1 
ATOM   1463  O  OE2   . GLU A  1  185 ? 56.729  19.909  375.723 1.00 116.83 ? 185 GLU 1 OE2   1 
ATOM   1464  N  N     . THR A  1  186 ? 52.856  23.355  374.078 1.00 81.61  ? 186 THR 1 N     1 
ATOM   1465  C  CA    . THR A  1  186 ? 53.069  24.363  373.047 1.00 73.28  ? 186 THR 1 CA    1 
ATOM   1466  C  C     . THR A  1  186 ? 51.794  25.143  372.771 1.00 65.25  ? 186 THR 1 C     1 
ATOM   1467  O  O     . THR A  1  186 ? 51.857  26.313  372.374 1.00 57.52  ? 186 THR 1 O     1 
ATOM   1468  C  CB    . THR A  1  186 ? 53.582  23.711  371.758 1.00 75.75  ? 186 THR 1 CB    1 
ATOM   1469  O  OG1   . THR A  1  186 ? 52.673  22.684  371.348 1.00 75.29  ? 186 THR 1 OG1   1 
ATOM   1470  C  CG2   . THR A  1  186 ? 54.952  23.085  371.979 1.00 75.66  ? 186 THR 1 CG2   1 
ATOM   1471  N  N     . ALA A  1  187 ? 50.636  24.521  372.993 1.00 65.00  ? 187 ALA 1 N     1 
ATOM   1472  C  CA    . ALA A  1  187 ? 49.369  25.223  372.857 1.00 63.43  ? 187 ALA 1 CA    1 
ATOM   1473  C  C     . ALA A  1  187 ? 49.106  26.130  374.050 1.00 61.26  ? 187 ALA 1 C     1 
ATOM   1474  O  O     . ALA A  1  187 ? 48.366  27.111  373.922 1.00 63.24  ? 187 ALA 1 O     1 
ATOM   1475  C  CB    . ALA A  1  187 ? 48.225  24.224  372.687 1.00 61.28  ? 187 ALA 1 CB    1 
ATOM   1476  N  N     . LEU A  1  188 ? 49.676  25.803  375.213 1.00 58.86  ? 188 LEU 1 N     1 
ATOM   1477  C  CA    . LEU A  1  188 ? 49.435  26.588  376.422 1.00 59.32  ? 188 LEU 1 CA    1 
ATOM   1478  C  C     . LEU A  1  188 ? 49.954  28.016  376.265 1.00 66.76  ? 188 LEU 1 C     1 
ATOM   1479  O  O     . LEU A  1  188 ? 49.281  28.979  376.652 1.00 67.45  ? 188 LEU 1 O     1 
ATOM   1480  C  CB    . LEU A  1  188 ? 50.081  25.898  377.628 1.00 56.85  ? 188 LEU 1 CB    1 
ATOM   1481  C  CG    . LEU A  1  188 ? 49.686  26.338  379.045 1.00 56.02  ? 188 LEU 1 CG    1 
ATOM   1482  C  CD1   . LEU A  1  188 ? 49.987  25.232  380.034 1.00 55.48  ? 188 LEU 1 CD1   1 
ATOM   1483  C  CD2   . LEU A  1  188 ? 50.407  27.615  379.479 1.00 55.33  ? 188 LEU 1 CD2   1 
ATOM   1484  N  N     . MET A  1  189 ? 51.170  28.169  375.731 1.00 67.42  ? 189 MET 1 N     1 
ATOM   1485  C  CA    . MET A  1  189 ? 51.753  29.502  375.598 1.00 65.23  ? 189 MET 1 CA    1 
ATOM   1486  C  C     . MET A  1  189 ? 50.956  30.356  374.619 1.00 53.16  ? 189 MET 1 C     1 
ATOM   1487  O  O     . MET A  1  189 ? 50.734  31.548  374.861 1.00 44.32  ? 189 MET 1 O     1 
ATOM   1488  C  CB    . MET A  1  189 ? 53.213  29.396  375.155 1.00 75.83  ? 189 MET 1 CB    1 
ATOM   1489  C  CG    . MET A  1  189 ? 54.129  28.745  376.180 1.00 86.42  ? 189 MET 1 CG    1 
ATOM   1490  S  SD    . MET A  1  189 ? 55.852  29.252  375.985 1.00 96.99  ? 189 MET 1 SD    1 
ATOM   1491  C  CE    . MET A  1  189 ? 56.291  28.410  374.465 1.00 100.40 ? 189 MET 1 CE    1 
ATOM   1492  N  N     . ASN A  1  190 ? 50.515  29.756  373.511 1.00 56.32  ? 190 ASN 1 N     1 
ATOM   1493  C  CA    . ASN A  1  190 ? 49.624  30.446  372.582 1.00 58.89  ? 190 ASN 1 CA    1 
ATOM   1494  C  C     . ASN A  1  190 ? 48.330  30.861  373.271 1.00 54.29  ? 190 ASN 1 C     1 
ATOM   1495  O  O     . ASN A  1  190 ? 47.926  32.028  373.206 1.00 54.87  ? 190 ASN 1 O     1 
ATOM   1496  C  CB    . ASN A  1  190 ? 49.332  29.550  371.377 1.00 59.52  ? 190 ASN 1 CB    1 
ATOM   1497  C  CG    . ASN A  1  190 ? 50.548  29.346  370.497 1.00 56.25  ? 190 ASN 1 CG    1 
ATOM   1498  O  OD1   . ASN A  1  190 ? 51.494  30.132  370.539 1.00 61.21  ? 190 ASN 1 OD1   1 
ATOM   1499  N  ND2   . ASN A  1  190 ? 50.537  28.283  369.706 1.00 50.29  ? 190 ASN 1 ND2   1 
ATOM   1500  N  N     . SER A  1  191 ? 47.662  29.908  373.927 1.00 48.17  ? 191 SER 1 N     1 
ATOM   1501  C  CA    . SER A  1  191 ? 46.412  30.193  374.620 1.00 42.48  ? 191 SER 1 CA    1 
ATOM   1502  C  C     . SER A  1  191 ? 46.573  31.370  375.569 1.00 53.34  ? 191 SER 1 C     1 
ATOM   1503  O  O     . SER A  1  191 ? 45.770  32.308  375.563 1.00 59.32  ? 191 SER 1 O     1 
ATOM   1504  C  CB    . SER A  1  191 ? 45.956  28.950  375.385 1.00 30.37  ? 191 SER 1 CB    1 
ATOM   1505  O  OG    . SER A  1  191 ? 44.679  29.135  375.962 1.00 27.71  ? 191 SER 1 OG    1 
ATOM   1506  N  N     . LEU A  1  192 ? 47.648  31.359  376.354 1.00 59.92  ? 192 LEU 1 N     1 
ATOM   1507  C  CA    . LEU A  1  192 ? 47.882  32.439  377.306 1.00 69.54  ? 192 LEU 1 CA    1 
ATOM   1508  C  C     . LEU A  1  192 ? 48.123  33.764  376.591 1.00 71.44  ? 192 LEU 1 C     1 
ATOM   1509  O  O     . LEU A  1  192 ? 47.568  34.797  376.983 1.00 72.67  ? 192 LEU 1 O     1 
ATOM   1510  C  CB    . LEU A  1  192 ? 49.061  32.086  378.213 1.00 74.38  ? 192 LEU 1 CB    1 
ATOM   1511  C  CG    . LEU A  1  192 ? 49.353  33.051  379.363 1.00 79.30  ? 192 LEU 1 CG    1 
ATOM   1512  C  CD1   . LEU A  1  192 ? 49.653  32.274  380.634 1.00 81.95  ? 192 LEU 1 CD1   1 
ATOM   1513  C  CD2   . LEU A  1  192 ? 50.514  33.982  379.014 1.00 80.49  ? 192 LEU 1 CD2   1 
ATOM   1514  N  N     . GLU A  1  193 ? 48.942  33.754  375.536 1.00 69.93  ? 193 GLU 1 N     1 
ATOM   1515  C  CA    . GLU A  1  193 ? 49.352  34.984  374.866 1.00 67.60  ? 193 GLU 1 CA    1 
ATOM   1516  C  C     . GLU A  1  193 ? 48.183  35.779  374.295 1.00 58.09  ? 193 GLU 1 C     1 
ATOM   1517  O  O     . GLU A  1  193 ? 48.384  36.923  373.876 1.00 55.43  ? 193 GLU 1 O     1 
ATOM   1518  C  CB    . GLU A  1  193 ? 50.346  34.650  373.749 1.00 70.37  ? 193 GLU 1 CB    1 
ATOM   1519  C  CG    . GLU A  1  193 ? 51.513  35.618  373.632 1.00 72.45  ? 193 GLU 1 CG    1 
ATOM   1520  C  CD    . GLU A  1  193 ? 52.636  35.073  372.768 1.00 71.97  ? 193 GLU 1 CD    1 
ATOM   1521  O  OE1   . GLU A  1  193 ? 53.225  34.038  373.141 1.00 71.59  ? 193 GLU 1 OE1   1 
ATOM   1522  O  OE2   . GLU A  1  193 ? 52.935  35.682  371.720 1.00 73.32  ? 193 GLU 1 OE2   1 
ATOM   1523  N  N     . GLY A  1  194 ? 46.985  35.211  374.259 1.00 58.88  ? 194 GLY 1 N     1 
ATOM   1524  C  CA    . GLY A  1  194 ? 45.825  35.891  373.723 1.00 64.77  ? 194 GLY 1 CA    1 
ATOM   1525  C  C     . GLY A  1  194 ? 45.394  35.437  372.348 1.00 70.64  ? 194 GLY 1 C     1 
ATOM   1526  O  O     . GLY A  1  194 ? 44.708  36.196  371.651 1.00 68.17  ? 194 GLY 1 O     1 
ATOM   1527  N  N     . LEU A  1  195 ? 45.771  34.234  371.939 1.00 78.76  ? 195 LEU 1 N     1 
ATOM   1528  C  CA    . LEU A  1  195 ? 45.444  33.660  370.643 1.00 84.00  ? 195 LEU 1 CA    1 
ATOM   1529  C  C     . LEU A  1  195 ? 44.585  32.415  370.838 1.00 79.40  ? 195 LEU 1 C     1 
ATOM   1530  O  O     . LEU A  1  195 ? 44.253  32.026  371.962 1.00 79.94  ? 195 LEU 1 O     1 
ATOM   1531  C  CB    . LEU A  1  195 ? 46.722  33.315  369.871 1.00 92.96  ? 195 LEU 1 CB    1 
ATOM   1532  C  CG    . LEU A  1  195 ? 47.875  34.311  370.000 1.00 98.01  ? 195 LEU 1 CG    1 
ATOM   1533  C  CD1   . LEU A  1  195 ? 49.186  33.697  369.524 1.00 99.40  ? 195 LEU 1 CD1   1 
ATOM   1534  C  CD2   . LEU A  1  195 ? 47.558  35.576  369.222 1.00 99.03  ? 195 LEU 1 CD2   1 
ATOM   1535  N  N     . ARG A  1  196 ? 44.214  31.795  369.722 1.00 69.69  ? 196 ARG 1 N     1 
ATOM   1536  C  CA    . ARG A  1  196 ? 43.654  30.457  369.782 1.00 58.30  ? 196 ARG 1 CA    1 
ATOM   1537  C  C     . ARG A  1  196 ? 44.725  29.467  370.229 1.00 52.63  ? 196 ARG 1 C     1 
ATOM   1538  O  O     . ARG A  1  196 ? 45.929  29.742  370.185 1.00 51.65  ? 196 ARG 1 O     1 
ATOM   1539  C  CB    . ARG A  1  196 ? 43.096  30.038  368.424 1.00 52.71  ? 196 ARG 1 CB    1 
ATOM   1540  C  CG    . ARG A  1  196 ? 41.827  30.747  368.004 1.00 51.67  ? 196 ARG 1 CG    1 
ATOM   1541  C  CD    . ARG A  1  196 ? 41.603  30.546  366.519 1.00 52.57  ? 196 ARG 1 CD    1 
ATOM   1542  N  NE    . ARG A  1  196 ? 40.665  29.463  366.269 1.00 51.45  ? 196 ARG 1 NE    1 
ATOM   1543  C  CZ    . ARG A  1  196 ? 41.029  28.250  365.868 1.00 53.53  ? 196 ARG 1 CZ    1 
ATOM   1544  N  NH1   . ARG A  1  196 ? 42.311  27.971  365.675 1.00 50.02  ? 196 ARG 1 NH1   1 
ATOM   1545  N  NH2   . ARG A  1  196 ? 40.115  27.315  365.663 1.00 63.74  ? 196 ARG 1 NH2   1 
ATOM   1546  N  N     . ALA A  1  197 ? 44.268  28.299  370.679 1.00 50.68  ? 197 ALA 1 N     1 
ATOM   1547  C  CA    . ALA A  1  197 ? 45.164  27.277  371.221 1.00 48.49  ? 197 ALA 1 CA    1 
ATOM   1548  C  C     . ALA A  1  197 ? 45.596  26.312  370.116 1.00 47.51  ? 197 ALA 1 C     1 
ATOM   1549  O  O     . ALA A  1  197 ? 45.211  25.141  370.075 1.00 45.62  ? 197 ALA 1 O     1 
ATOM   1550  C  CB    . ALA A  1  197 ? 44.490  26.540  372.370 1.00 50.39  ? 197 ALA 1 CB    1 
ATOM   1551  N  N     . ASN A  1  198 ? 46.402  26.836  369.191 1.00 47.05  ? 198 ASN 1 N     1 
ATOM   1552  C  CA    . ASN A  1  198 ? 47.057  25.983  368.211 1.00 36.91  ? 198 ASN 1 CA    1 
ATOM   1553  C  C     . ASN A  1  198 ? 48.539  25.877  368.526 1.00 40.23  ? 198 ASN 1 C     1 
ATOM   1554  O  O     . ASN A  1  198 ? 49.207  26.907  368.689 1.00 45.26  ? 198 ASN 1 O     1 
ATOM   1555  C  CB    . ASN A  1  198 ? 46.864  26.530  366.797 1.00 31.05  ? 198 ASN 1 CB    1 
ATOM   1556  C  CG    . ASN A  1  198 ? 45.421  26.512  366.371 1.00 25.56  ? 198 ASN 1 CG    1 
ATOM   1557  O  OD1   . ASN A  1  198 ? 44.575  25.941  367.054 1.00 21.00  ? 198 ASN 1 OD1   1 
ATOM   1558  N  ND2   . ASN A  1  198 ? 45.132  27.105  365.221 1.00 30.20  ? 198 ASN 1 ND2   1 
ATOM   1559  N  N     . PRO A  1  199 ? 49.085  24.665  368.597 1.00 35.83  ? 199 PRO 1 N     1 
ATOM   1560  C  CA    . PRO A  1  199 ? 50.485  24.496  369.012 1.00 40.00  ? 199 PRO 1 CA    1 
ATOM   1561  C  C     . PRO A  1  199 ? 51.463  25.234  368.105 1.00 52.35  ? 199 PRO 1 C     1 
ATOM   1562  O  O     . PRO A  1  199 ? 51.176  25.547  366.947 1.00 56.05  ? 199 PRO 1 O     1 
ATOM   1563  C  CB    . PRO A  1  199 ? 50.708  22.979  368.934 1.00 35.03  ? 199 PRO 1 CB    1 
ATOM   1564  C  CG    . PRO A  1  199 ? 49.445  22.395  368.414 1.00 31.28  ? 199 PRO 1 CG    1 
ATOM   1565  C  CD    . PRO A  1  199 ? 48.356  23.391  368.522 1.00 31.05  ? 199 PRO 1 CD    1 
ATOM   1566  N  N     . ARG A  1  200 ? 52.635  25.527  368.663 1.00 57.50  ? 200 ARG 1 N     1 
ATOM   1567  C  CA    . ARG A  1  200 ? 53.720  26.136  367.911 1.00 59.67  ? 200 ARG 1 CA    1 
ATOM   1568  C  C     . ARG A  1  200 ? 54.607  25.055  367.296 1.00 64.22  ? 200 ARG 1 C     1 
ATOM   1569  O  O     . ARG A  1  200 ? 54.434  23.857  367.533 1.00 64.21  ? 200 ARG 1 O     1 
ATOM   1570  C  CB    . ARG A  1  200 ? 54.557  27.056  368.802 1.00 58.52  ? 200 ARG 1 CB    1 
ATOM   1571  C  CG    . ARG A  1  200 ? 53.764  28.085  369.575 1.00 60.62  ? 200 ARG 1 CG    1 
ATOM   1572  C  CD    . ARG A  1  200 ? 54.692  28.958  370.407 1.00 65.18  ? 200 ARG 1 CD    1 
ATOM   1573  N  NE    . ARG A  1  200 ? 54.106  30.265  370.692 1.00 70.00  ? 200 ARG 1 NE    1 
ATOM   1574  C  CZ    . ARG A  1  200 ? 54.788  31.300  371.173 1.00 70.13  ? 200 ARG 1 CZ    1 
ATOM   1575  N  NH1   . ARG A  1  200 ? 56.085  31.184  371.426 1.00 67.95  ? 200 ARG 1 NH1   1 
ATOM   1576  N  NH2   . ARG A  1  200 ? 54.176  32.455  371.396 1.00 71.12  ? 200 ARG 1 NH2   1 
ATOM   1577  N  N     . LEU A  1  201 ? 55.565  25.494  366.487 1.00 68.30  ? 201 LEU 1 N     1 
ATOM   1578  C  CA    . LEU A  1  201 ? 56.492  24.577  365.841 1.00 74.86  ? 201 LEU 1 CA    1 
ATOM   1579  C  C     . LEU A  1  201 ? 57.575  24.143  366.825 1.00 76.82  ? 201 LEU 1 C     1 
ATOM   1580  O  O     . LEU A  1  201 ? 58.231  24.983  367.451 1.00 77.81  ? 201 LEU 1 O     1 
ATOM   1581  C  CB    . LEU A  1  201 ? 57.117  25.239  364.613 1.00 75.85  ? 201 LEU 1 CB    1 
ATOM   1582  C  CG    . LEU A  1  201 ? 57.802  24.328  363.593 1.00 76.39  ? 201 LEU 1 CG    1 
ATOM   1583  C  CD1   . LEU A  1  201 ? 56.792  23.434  362.908 1.00 76.96  ? 201 LEU 1 CD1   1 
ATOM   1584  C  CD2   . LEU A  1  201 ? 58.569  25.152  362.568 1.00 75.63  ? 201 LEU 1 CD2   1 
ATOM   1585  N  N     . LYS A  1  202 ? 57.743  22.827  366.980 1.00 78.80  ? 202 LYS 1 N     1 
ATOM   1586  C  CA    . LYS A  1  202 ? 58.751  22.253  367.871 1.00 82.80  ? 202 LYS 1 CA    1 
ATOM   1587  C  C     . LYS A  1  202 ? 60.187  22.342  367.347 1.00 81.19  ? 202 LYS 1 C     1 
ATOM   1588  O  O     . LYS A  1  202 ? 61.109  22.466  368.165 1.00 81.20  ? 202 LYS 1 O     1 
ATOM   1589  C  CB    . LYS A  1  202 ? 58.421  20.796  368.199 1.00 85.81  ? 202 LYS 1 CB    1 
ATOM   1590  C  CG    . LYS A  1  202 ? 58.656  20.445  369.665 1.00 87.07  ? 202 LYS 1 CG    1 
ATOM   1591  C  CD    . LYS A  1  202 ? 57.736  19.331  370.124 1.00 89.74  ? 202 LYS 1 CD    1 
ATOM   1592  C  CE    . LYS A  1  202 ? 57.652  19.274  371.638 1.00 90.35  ? 202 LYS 1 CE    1 
ATOM   1593  N  NZ    . LYS A  1  202 ? 56.527  18.406  372.079 1.00 90.55  ? 202 LYS 1 NZ    1 
ATOM   1594  N  N     . PRO A  1  203 ? 60.438  22.230  366.038 1.00 79.83  ? 203 PRO 1 N     1 
ATOM   1595  C  CA    . PRO A  1  203 ? 61.818  22.360  365.533 1.00 79.93  ? 203 PRO 1 CA    1 
ATOM   1596  C  C     . PRO A  1  203 ? 62.527  23.586  366.088 1.00 82.99  ? 203 PRO 1 C     1 
ATOM   1597  O  O     . PRO A  1  203 ? 63.738  23.524  366.356 1.00 82.54  ? 203 PRO 1 O     1 
ATOM   1598  C  CB    . PRO A  1  203 ? 61.623  22.445  364.014 1.00 80.48  ? 203 PRO 1 CB    1 
ATOM   1599  C  CG    . PRO A  1  203 ? 60.435  21.569  363.768 1.00 78.95  ? 203 PRO 1 CG    1 
ATOM   1600  C  CD    . PRO A  1  203 ? 59.587  21.561  365.031 1.00 78.72  ? 203 PRO 1 CD    1 
ATOM   1601  N  N     . PRO A  1  204 ? 61.827  24.736  366.278 1.00 85.47  ? 204 PRO 1 N     1 
ATOM   1602  C  CA    . PRO A  1  204 ? 62.333  25.729  367.239 1.00 83.25  ? 204 PRO 1 CA    1 
ATOM   1603  C  C     . PRO A  1  204 ? 61.915  25.302  368.638 1.00 78.86  ? 204 PRO 1 C     1 
ATOM   1604  O  O     . PRO A  1  204 ? 60.730  25.337  368.985 1.00 80.72  ? 204 PRO 1 O     1 
ATOM   1605  C  CB    . PRO A  1  204 ? 61.644  27.033  366.800 1.00 83.01  ? 204 PRO 1 CB    1 
ATOM   1606  C  CG    . PRO A  1  204 ? 60.956  26.749  365.518 1.00 84.16  ? 204 PRO 1 CG    1 
ATOM   1607  C  CD    . PRO A  1  204 ? 60.722  25.285  365.472 1.00 86.18  ? 204 PRO 1 CD    1 
ATOM   1608  N  N     . PHE A  1  205 ? 62.890  24.891  369.448 1.00 70.42  ? 205 PHE 1 N     1 
ATOM   1609  C  CA    . PHE A  1  205 ? 62.506  24.359  370.745 1.00 64.63  ? 205 PHE 1 CA    1 
ATOM   1610  C  C     . PHE A  1  205 ? 62.218  25.482  371.743 1.00 58.64  ? 205 PHE 1 C     1 
ATOM   1611  O  O     . PHE A  1  205 ? 62.848  26.543  371.701 1.00 53.83  ? 205 PHE 1 O     1 
ATOM   1612  C  CB    . PHE A  1  205 ? 63.594  23.428  371.285 1.00 68.59  ? 205 PHE 1 CB    1 
ATOM   1613  C  CG    . PHE A  1  205 ? 63.705  22.128  370.527 1.00 70.20  ? 205 PHE 1 CG    1 
ATOM   1614  C  CD1   . PHE A  1  205 ? 62.727  21.154  370.651 1.00 70.98  ? 205 PHE 1 CD1   1 
ATOM   1615  C  CD2   . PHE A  1  205 ? 64.778  21.882  369.686 1.00 71.32  ? 205 PHE 1 CD2   1 
ATOM   1616  C  CE1   . PHE A  1  205 ? 62.817  19.960  369.956 1.00 69.31  ? 205 PHE 1 CE1   1 
ATOM   1617  C  CE2   . PHE A  1  205 ? 64.869  20.686  368.988 1.00 71.12  ? 205 PHE 1 CE2   1 
ATOM   1618  C  CZ    . PHE A  1  205 ? 63.887  19.728  369.125 1.00 68.95  ? 205 PHE 1 CZ    1 
ATOM   1619  N  N     . PRO A  1  206 ? 61.258  25.266  372.648 1.00 56.62  ? 206 PRO 1 N     1 
ATOM   1620  C  CA    . PRO A  1  206 ? 60.840  26.349  373.557 1.00 57.04  ? 206 PRO 1 CA    1 
ATOM   1621  C  C     . PRO A  1  206 ? 61.920  26.794  374.517 1.00 53.73  ? 206 PRO 1 C     1 
ATOM   1622  O  O     . PRO A  1  206 ? 61.824  27.901  375.059 1.00 55.04  ? 206 PRO 1 O     1 
ATOM   1623  C  CB    . PRO A  1  206 ? 59.640  25.750  374.303 1.00 58.43  ? 206 PRO 1 CB    1 
ATOM   1624  C  CG    . PRO A  1  206 ? 59.746  24.280  374.127 1.00 61.79  ? 206 PRO 1 CG    1 
ATOM   1625  C  CD    . PRO A  1  206 ? 60.530  24.008  372.886 1.00 61.73  ? 206 PRO 1 CD    1 
ATOM   1626  N  N     . ALA A  1  207 ? 62.931  25.962  374.765 1.00 59.15  ? 207 ALA 1 N     1 
ATOM   1627  C  CA    . ALA A  1  207 ? 64.049  26.376  375.604 1.00 65.69  ? 207 ALA 1 CA    1 
ATOM   1628  C  C     . ALA A  1  207 ? 64.691  27.662  375.105 1.00 66.36  ? 207 ALA 1 C     1 
ATOM   1629  O  O     . ALA A  1  207 ? 65.149  28.477  375.911 1.00 66.15  ? 207 ALA 1 O     1 
ATOM   1630  C  CB    . ALA A  1  207 ? 65.094  25.261  375.673 1.00 70.86  ? 207 ALA 1 CB    1 
ATOM   1631  N  N     . GLN A  1  208 ? 64.715  27.876  373.788 1.00 66.91  ? 208 GLN 1 N     1 
ATOM   1632  C  CA    . GLN A  1  208 ? 65.426  29.007  373.208 1.00 67.32  ? 208 GLN 1 CA    1 
ATOM   1633  C  C     . GLN A  1  208 ? 64.528  30.186  372.845 1.00 61.07  ? 208 GLN 1 C     1 
ATOM   1634  O  O     . GLN A  1  208 ? 65.024  31.318  372.775 1.00 61.35  ? 208 GLN 1 O     1 
ATOM   1635  C  CB    . GLN A  1  208 ? 66.191  28.554  371.956 1.00 74.03  ? 208 GLN 1 CB    1 
ATOM   1636  C  CG    . GLN A  1  208 ? 66.982  27.269  372.161 1.00 82.00  ? 208 GLN 1 CG    1 
ATOM   1637  C  CD    . GLN A  1  208 ? 66.231  26.039  371.680 1.00 90.52  ? 208 GLN 1 CD    1 
ATOM   1638  O  OE1   . GLN A  1  208 ? 65.460  26.102  370.723 1.00 95.25  ? 208 GLN 1 OE1   1 
ATOM   1639  N  NE2   . GLN A  1  208 ? 66.438  24.916  372.360 1.00 92.19  ? 208 GLN 1 NE2   1 
ATOM   1640  N  N     . SER A  1  209 ? 63.230  29.970  372.628 1.00 53.83  ? 209 SER 1 N     1 
ATOM   1641  C  CA    . SER A  1  209 ? 62.345  31.084  372.286 1.00 45.73  ? 209 SER 1 CA    1 
ATOM   1642  C  C     . SER A  1  209 ? 60.910  30.696  372.615 1.00 33.42  ? 209 SER 1 C     1 
ATOM   1643  O  O     . SER A  1  209 ? 60.306  29.892  371.900 1.00 18.64  ? 209 SER 1 O     1 
ATOM   1644  C  CB    . SER A  1  209 ? 62.487  31.453  370.813 1.00 59.30  ? 209 SER 1 CB    1 
ATOM   1645  O  OG    . SER A  1  209 ? 62.082  32.792  370.576 1.00 67.15  ? 209 SER 1 OG    1 
ATOM   1646  N  N     . GLY A  1  210 ? 60.360  31.298  373.663 1.00 40.40  ? 210 GLY 1 N     1 
ATOM   1647  C  CA    . GLY A  1  210 ? 58.991  31.034  374.060 1.00 56.65  ? 210 GLY 1 CA    1 
ATOM   1648  C  C     . GLY A  1  210 ? 58.156  32.291  374.182 1.00 72.12  ? 210 GLY 1 C     1 
ATOM   1649  O  O     . GLY A  1  210 ? 58.141  33.129  373.275 1.00 79.85  ? 210 GLY 1 O     1 
ATOM   1650  N  N     . LEU A  1  211 ? 57.436  32.406  375.297 1.00 75.14  ? 211 LEU 1 N     1 
ATOM   1651  C  CA    . LEU A  1  211 ? 56.605  33.571  375.583 1.00 77.38  ? 211 LEU 1 CA    1 
ATOM   1652  C  C     . LEU A  1  211 ? 57.373  34.875  375.380 1.00 79.37  ? 211 LEU 1 C     1 
ATOM   1653  O  O     . LEU A  1  211 ? 58.455  35.066  375.943 1.00 78.02  ? 211 LEU 1 O     1 
ATOM   1654  C  CB    . LEU A  1  211 ? 56.085  33.475  377.019 1.00 82.16  ? 211 LEU 1 CB    1 
ATOM   1655  C  CG    . LEU A  1  211 ? 54.646  33.906  377.284 1.00 86.05  ? 211 LEU 1 CG    1 
ATOM   1656  C  CD1   . LEU A  1  211 ? 53.717  33.300  376.247 1.00 89.50  ? 211 LEU 1 CD1   1 
ATOM   1657  C  CD2   . LEU A  1  211 ? 54.228  33.507  378.692 1.00 83.89  ? 211 LEU 1 CD2   1 
ATOM   1658  N  N     . TRP A  1  212 ? 56.789  35.777  374.585 1.00 81.22  ? 212 TRP 1 N     1 
ATOM   1659  C  CA    . TRP A  1  212 ? 57.392  37.074  374.248 1.00 82.79  ? 212 TRP 1 CA    1 
ATOM   1660  C  C     . TRP A  1  212 ? 58.829  36.929  373.752 1.00 76.16  ? 212 TRP 1 C     1 
ATOM   1661  O  O     . TRP A  1  212 ? 59.715  37.708  374.110 1.00 71.40  ? 212 TRP 1 O     1 
ATOM   1662  C  CB    . TRP A  1  212 ? 57.324  38.039  375.436 1.00 86.88  ? 212 TRP 1 CB    1 
ATOM   1663  C  CG    . TRP A  1  212 ? 55.932  38.473  375.753 1.00 89.55  ? 212 TRP 1 CG    1 
ATOM   1664  C  CD1   . TRP A  1  212 ? 55.157  39.318  375.018 1.00 89.99  ? 212 TRP 1 CD1   1 
ATOM   1665  C  CD2   . TRP A  1  212 ? 55.143  38.088  376.886 1.00 92.47  ? 212 TRP 1 CD2   1 
ATOM   1666  N  NE1   . TRP A  1  212 ? 53.935  39.479  375.616 1.00 92.13  ? 212 TRP 1 NE1   1 
ATOM   1667  C  CE2   . TRP A  1  212 ? 53.900  38.736  376.766 1.00 93.65  ? 212 TRP 1 CE2   1 
ATOM   1668  C  CE3   . TRP A  1  212 ? 55.365  37.258  377.987 1.00 94.36  ? 212 TRP 1 CE3   1 
ATOM   1669  C  CZ2   . TRP A  1  212 ? 52.883  38.581  377.705 1.00 96.35  ? 212 TRP 1 CZ2   1 
ATOM   1670  C  CZ3   . TRP A  1  212 ? 54.353  37.106  378.920 1.00 95.11  ? 212 TRP 1 CZ3   1 
ATOM   1671  C  CH2   . TRP A  1  212 ? 53.129  37.763  378.772 1.00 95.51  ? 212 TRP 1 CH2   1 
ATOM   1672  N  N     . GLY A  1  213 ? 59.069  35.913  372.925 1.00 74.99  ? 213 GLY 1 N     1 
ATOM   1673  C  CA    . GLY A  1  213 ? 60.399  35.696  372.404 1.00 76.60  ? 213 GLY 1 CA    1 
ATOM   1674  C  C     . GLY A  1  213 ? 61.418  35.277  373.436 1.00 82.09  ? 213 GLY 1 C     1 
ATOM   1675  O  O     . GLY A  1  213 ? 62.569  35.011  373.072 1.00 87.84  ? 213 GLY 1 O     1 
ATOM   1676  N  N     . LYS A  1  214 ? 61.040  35.227  374.712 1.00 82.18  ? 214 LYS 1 N     1 
ATOM   1677  C  CA    . LYS A  1  214 ? 61.957  34.942  375.799 1.00 79.97  ? 214 LYS 1 CA    1 
ATOM   1678  C  C     . LYS A  1  214 ? 62.086  33.436  376.022 1.00 74.09  ? 214 LYS 1 C     1 
ATOM   1679  O  O     . LYS A  1  214 ? 61.143  32.677  375.772 1.00 67.52  ? 214 LYS 1 O     1 
ATOM   1680  C  CB    . LYS A  1  214 ? 61.479  35.623  377.078 1.00 85.73  ? 214 LYS 1 CB    1 
ATOM   1681  C  CG    . LYS A  1  214 ? 61.325  37.129  376.927 1.00 90.97  ? 214 LYS 1 CG    1 
ATOM   1682  C  CD    . LYS A  1  214 ? 62.563  37.744  376.283 1.00 95.77  ? 214 LYS 1 CD    1 
ATOM   1683  C  CE    . LYS A  1  214 ? 62.623  39.251  376.490 1.00 102.50 ? 214 LYS 1 CE    1 
ATOM   1684  N  NZ    . LYS A  1  214 ? 61.364  39.922  376.063 1.00 107.45 ? 214 LYS 1 NZ    1 
ATOM   1685  N  N     . PRO A  1  215 ? 63.247  32.993  376.498 1.00 73.38  ? 215 PRO 1 N     1 
ATOM   1686  C  CA    . PRO A  1  215 ? 63.490  31.553  376.653 1.00 74.35  ? 215 PRO 1 CA    1 
ATOM   1687  C  C     . PRO A  1  215 ? 62.723  30.954  377.821 1.00 80.90  ? 215 PRO 1 C     1 
ATOM   1688  O  O     . PRO A  1  215 ? 63.234  30.908  378.943 1.00 79.23  ? 215 PRO 1 O     1 
ATOM   1689  C  CB    . PRO A  1  215 ? 65.006  31.476  376.878 1.00 73.20  ? 215 PRO 1 CB    1 
ATOM   1690  C  CG    . PRO A  1  215 ? 65.544  32.760  376.325 1.00 73.77  ? 215 PRO 1 CG    1 
ATOM   1691  C  CD    . PRO A  1  215 ? 64.489  33.774  376.630 1.00 75.74  ? 215 PRO 1 CD    1 
ATOM   1692  N  N     . THR A  1  216 ? 61.481  30.542  377.586 1.00 92.30  ? 216 THR 1 N     1 
ATOM   1693  C  CA    . THR A  1  216 ? 60.635  30.011  378.644 1.00 104.38 ? 216 THR 1 CA    1 
ATOM   1694  C  C     . THR A  1  216 ? 60.756  28.491  378.718 1.00 117.56 ? 216 THR 1 C     1 
ATOM   1695  O  O     . THR A  1  216 ? 61.112  27.822  377.744 1.00 115.67 ? 216 THR 1 O     1 
ATOM   1696  C  CB    . THR A  1  216 ? 59.172  30.404  378.415 1.00 105.03 ? 216 THR 1 CB    1 
ATOM   1697  O  OG1   . THR A  1  216 ? 58.643  29.662  377.310 1.00 104.72 ? 216 THR 1 OG1   1 
ATOM   1698  C  CG2   . THR A  1  216 ? 59.068  31.883  378.109 1.00 105.71 ? 216 THR 1 CG2   1 
ATOM   1699  N  N     . THR A  1  217 ? 60.454  27.947  379.897 1.00 130.90 ? 217 THR 1 N     1 
ATOM   1700  C  CA    . THR A  1  217 ? 60.472  26.508  380.115 1.00 147.24 ? 217 THR 1 CA    1 
ATOM   1701  C  C     . THR A  1  217 ? 59.248  26.115  380.932 1.00 157.27 ? 217 THR 1 C     1 
ATOM   1702  O  O     . THR A  1  217 ? 58.841  26.839  381.849 1.00 159.82 ? 217 THR 1 O     1 
ATOM   1703  C  CB    . THR A  1  217 ? 61.772  26.066  380.810 1.00 143.08 ? 217 THR 1 CB    1 
ATOM   1704  O  OG1   . THR A  1  217 ? 62.878  26.329  379.940 1.00 143.93 ? 217 THR 1 OG1   1 
ATOM   1705  C  CG2   . THR A  1  217 ? 61.753  24.575  381.119 1.00 145.46 ? 217 THR 1 CG2   1 
ATOM   1706  N  N     . ILE A  1  218 ? 58.671  24.963  380.587 1.00 165.35 ? 218 ILE 1 N     1 
ATOM   1707  C  CA    . ILE A  1  218 ? 57.395  24.500  381.118 1.00 173.07 ? 218 ILE 1 CA    1 
ATOM   1708  C  C     . ILE A  1  218 ? 57.608  23.192  381.867 1.00 174.67 ? 218 ILE 1 C     1 
ATOM   1709  O  O     . ILE A  1  218 ? 58.407  22.347  381.446 1.00 175.70 ? 218 ILE 1 O     1 
ATOM   1710  C  CB    . ILE A  1  218 ? 56.363  24.301  379.988 1.00 174.95 ? 218 ILE 1 CB    1 
ATOM   1711  C  CG1   . ILE A  1  218 ? 56.239  25.566  379.141 1.00 177.49 ? 218 ILE 1 CG1   1 
ATOM   1712  C  CG2   . ILE A  1  218 ? 55.007  23.907  380.556 1.00 176.16 ? 218 ILE 1 CG2   1 
ATOM   1713  C  CD1   . ILE A  1  218 ? 55.962  25.302  377.679 1.00 177.65 ? 218 ILE 1 CD1   1 
ATOM   1714  N  N     . ASN A  1  219 ? 56.896  23.032  382.980 1.00 178.81 ? 219 ASN 1 N     1 
ATOM   1715  C  CA    . ASN A  1  219 ? 56.812  21.762  383.685 1.00 180.27 ? 219 ASN 1 CA    1 
ATOM   1716  C  C     . ASN A  1  219 ? 55.409  21.618  384.260 1.00 169.24 ? 219 ASN 1 C     1 
ATOM   1717  O  O     . ASN A  1  219 ? 54.767  22.607  384.621 1.00 169.02 ? 219 ASN 1 O     1 
ATOM   1718  C  CB    . ASN A  1  219 ? 57.864  21.649  384.799 1.00 194.75 ? 219 ASN 1 CB    1 
ATOM   1719  C  CG    . ASN A  1  219 ? 59.192  21.104  384.298 1.00 205.07 ? 219 ASN 1 CG    1 
ATOM   1720  O  OD1   . ASN A  1  219 ? 60.245  21.706  384.511 1.00 215.38 ? 219 ASN 1 OD1   1 
ATOM   1721  N  ND2   . ASN A  1  219 ? 59.148  19.960  383.630 1.00 207.86 ? 219 ASN 1 ND2   1 
ATOM   1722  N  N     . ASN A  1  220 ? 54.940  20.376  384.352 1.00 157.03 ? 220 ASN 1 N     1 
ATOM   1723  C  CA    . ASN A  1  220 ? 53.634  20.120  384.939 1.00 146.23 ? 220 ASN 1 CA    1 
ATOM   1724  C  C     . ASN A  1  220 ? 53.693  20.286  386.457 1.00 126.58 ? 220 ASN 1 C     1 
ATOM   1725  O  O     . ASN A  1  220 ? 54.765  20.335  387.063 1.00 125.65 ? 220 ASN 1 O     1 
ATOM   1726  C  CB    . ASN A  1  220 ? 53.140  18.721  384.564 1.00 154.73 ? 220 ASN 1 CB    1 
ATOM   1727  C  CG    . ASN A  1  220 ? 51.688  18.491  384.940 1.00 162.66 ? 220 ASN 1 CG    1 
ATOM   1728  O  OD1   . ASN A  1  220 ? 51.381  17.668  385.802 1.00 164.61 ? 220 ASN 1 OD1   1 
ATOM   1729  N  ND2   . ASN A  1  220 ? 50.791  19.236  384.313 1.00 170.96 ? 220 ASN 1 ND2   1 
ATOM   1730  N  N     . VAL A  1  221 ? 52.508  20.395  387.064 1.00 111.81 ? 221 VAL 1 N     1 
ATOM   1731  C  CA    . VAL A  1  221 ? 52.411  20.643  388.502 1.00 102.68 ? 221 VAL 1 CA    1 
ATOM   1732  C  C     . VAL A  1  221 ? 53.159  19.579  389.292 1.00 98.71  ? 221 VAL 1 C     1 
ATOM   1733  O  O     . VAL A  1  221 ? 53.960  19.896  390.178 1.00 95.92  ? 221 VAL 1 O     1 
ATOM   1734  C  CB    . VAL A  1  221 ? 50.939  20.717  388.940 1.00 102.02 ? 221 VAL 1 CB    1 
ATOM   1735  C  CG1   . VAL A  1  221 ? 50.836  20.752  390.456 1.00 102.15 ? 221 VAL 1 CG1   1 
ATOM   1736  C  CG2   . VAL A  1  221 ? 50.293  21.940  388.363 1.00 101.92 ? 221 VAL 1 CG2   1 
ATOM   1737  N  N     . GLU A  1  222 ? 52.887  18.302  389.011 1.00 99.99  ? 222 GLU 1 N     1 
ATOM   1738  C  CA    . GLU A  1  222 ? 53.468  17.251  389.840 1.00 99.36  ? 222 GLU 1 CA    1 
ATOM   1739  C  C     . GLU A  1  222 ? 54.986  17.250  389.745 1.00 101.01 ? 222 GLU 1 C     1 
ATOM   1740  O  O     . GLU A  1  222 ? 55.670  16.962  390.731 1.00 101.75 ? 222 GLU 1 O     1 
ATOM   1741  C  CB    . GLU A  1  222 ? 52.902  15.882  389.485 1.00 96.73  ? 222 GLU 1 CB    1 
ATOM   1742  C  CG    . GLU A  1  222 ? 53.193  14.902  390.603 1.00 95.19  ? 222 GLU 1 CG    1 
ATOM   1743  C  CD    . GLU A  1  222 ? 53.179  13.468  390.166 1.00 96.19  ? 222 GLU 1 CD    1 
ATOM   1744  O  OE1   . GLU A  1  222 ? 52.354  13.124  389.299 1.00 97.46  ? 222 GLU 1 OE1   1 
ATOM   1745  O  OE2   . GLU A  1  222 ? 53.984  12.681  390.708 1.00 95.75  ? 222 GLU 1 OE2   1 
ATOM   1746  N  N     . THR A  1  223 ? 55.531  17.547  388.563 1.00 100.38 ? 223 THR 1 N     1 
ATOM   1747  C  CA    . THR A  1  223 ? 56.981  17.645  388.420 1.00 100.07 ? 223 THR 1 CA    1 
ATOM   1748  C  C     . THR A  1  223 ? 57.540  18.718  389.350 1.00 98.09  ? 223 THR 1 C     1 
ATOM   1749  O  O     . THR A  1  223 ? 58.454  18.465  390.148 1.00 99.08  ? 223 THR 1 O     1 
ATOM   1750  C  CB    . THR A  1  223 ? 57.344  17.976  386.970 1.00 102.81 ? 223 THR 1 CB    1 
ATOM   1751  O  OG1   . THR A  1  223 ? 56.436  17.324  386.076 1.00 102.81 ? 223 THR 1 OG1   1 
ATOM   1752  C  CG2   . THR A  1  223 ? 58.761  17.523  386.653 1.00 104.39 ? 223 THR 1 CG2   1 
ATOM   1753  N  N     . LEU A  1  224 ? 56.991  19.931  389.250 1.00 94.06  ? 224 LEU 1 N     1 
ATOM   1754  C  CA    . LEU A  1  224 ? 57.462  21.052  390.056 1.00 92.76  ? 224 LEU 1 CA    1 
ATOM   1755  C  C     . LEU A  1  224 ? 57.311  20.775  391.548 1.00 90.52  ? 224 LEU 1 C     1 
ATOM   1756  O  O     . LEU A  1  224 ? 58.166  21.170  392.350 1.00 90.48  ? 224 LEU 1 O     1 
ATOM   1757  C  CB    . LEU A  1  224 ? 56.702  22.313  389.653 1.00 89.23  ? 224 LEU 1 CB    1 
ATOM   1758  C  CG    . LEU A  1  224 ? 56.938  22.715  388.198 1.00 88.12  ? 224 LEU 1 CG    1 
ATOM   1759  C  CD1   . LEU A  1  224 ? 55.997  23.827  387.776 1.00 88.12  ? 224 LEU 1 CD1   1 
ATOM   1760  C  CD2   . LEU A  1  224 ? 58.390  23.129  388.003 1.00 87.45  ? 224 LEU 1 CD2   1 
ATOM   1761  N  N     . ALA A  1  225 ? 56.220  20.117  391.941 1.00 91.89  ? 225 ALA 1 N     1 
ATOM   1762  C  CA    . ALA A  1  225 ? 56.031  19.756  393.342 1.00 89.68  ? 225 ALA 1 CA    1 
ATOM   1763  C  C     . ALA A  1  225 ? 57.069  18.730  393.788 1.00 94.24  ? 225 ALA 1 C     1 
ATOM   1764  O  O     . ALA A  1  225 ? 57.679  18.871  394.855 1.00 98.83  ? 225 ALA 1 O     1 
ATOM   1765  C  CB    . ALA A  1  225 ? 54.610  19.233  393.559 1.00 88.28  ? 225 ALA 1 CB    1 
ATOM   1766  N  N     . SER A  1  226 ? 57.294  17.694  392.971 1.00 88.76  ? 226 SER 1 N     1 
ATOM   1767  C  CA    . SER A  1  226 ? 58.262  16.652  393.294 1.00 85.55  ? 226 SER 1 CA    1 
ATOM   1768  C  C     . SER A  1  226 ? 59.686  17.189  393.342 1.00 81.96  ? 226 SER 1 C     1 
ATOM   1769  O  O     . SER A  1  226 ? 60.572  16.515  393.882 1.00 77.71  ? 226 SER 1 O     1 
ATOM   1770  C  CB    . SER A  1  226 ? 58.169  15.510  392.275 1.00 84.98  ? 226 SER 1 CB    1 
ATOM   1771  O  OG    . SER A  1  226 ? 56.926  14.828  392.358 1.00 83.19  ? 226 SER 1 OG    1 
ATOM   1772  N  N     . VAL A  1  227 ? 59.928  18.366  392.754 1.00 86.54  ? 227 VAL 1 N     1 
ATOM   1773  C  CA    . VAL A  1  227 ? 61.230  19.022  392.902 1.00 91.26  ? 227 VAL 1 CA    1 
ATOM   1774  C  C     . VAL A  1  227 ? 61.600  19.201  394.374 1.00 92.67  ? 227 VAL 1 C     1 
ATOM   1775  O  O     . VAL A  1  227 ? 62.778  19.113  394.742 1.00 94.91  ? 227 VAL 1 O     1 
ATOM   1776  C  CB    . VAL A  1  227 ? 61.245  20.381  392.161 1.00 93.03  ? 227 VAL 1 CB    1 
ATOM   1777  C  CG1   . VAL A  1  227 ? 62.592  21.076  392.327 1.00 91.33  ? 227 VAL 1 CG1   1 
ATOM   1778  C  CG2   . VAL A  1  227 ? 60.949  20.194  390.686 1.00 95.64  ? 227 VAL 1 CG2   1 
ATOM   1779  N  N     . VAL A  1  228 ? 60.614  19.441  395.234 1.00 89.54  ? 228 VAL 1 N     1 
ATOM   1780  C  CA    . VAL A  1  228 ? 60.853  19.844  396.624 1.00 85.25  ? 228 VAL 1 CA    1 
ATOM   1781  C  C     . VAL A  1  228 ? 61.524  18.744  397.452 1.00 83.23  ? 228 VAL 1 C     1 
ATOM   1782  O  O     . VAL A  1  228 ? 62.557  19.020  398.082 1.00 82.31  ? 228 VAL 1 O     1 
ATOM   1783  C  CB    . VAL A  1  228 ? 59.547  20.325  397.285 1.00 80.36  ? 228 VAL 1 CB    1 
ATOM   1784  C  CG1   . VAL A  1  228 ? 59.792  20.733  398.730 1.00 82.49  ? 228 VAL 1 CG1   1 
ATOM   1785  C  CG2   . VAL A  1  228 ? 58.952  21.484  396.498 1.00 74.54  ? 228 VAL 1 CG2   1 
ATOM   1786  N  N     . PRO A  1  229 ? 60.999  17.509  397.515 1.00 80.62  ? 229 PRO 1 N     1 
ATOM   1787  C  CA    . PRO A  1  229 ? 61.647  16.502  398.388 1.00 78.01  ? 229 PRO 1 CA    1 
ATOM   1788  C  C     . PRO A  1  229 ? 63.096  16.213  398.038 1.00 76.93  ? 229 PRO 1 C     1 
ATOM   1789  O  O     . PRO A  1  229 ? 63.941  16.113  398.938 1.00 77.96  ? 229 PRO 1 O     1 
ATOM   1790  C  CB    . PRO A  1  229 ? 60.778  15.253  398.202 1.00 79.90  ? 229 PRO 1 CB    1 
ATOM   1791  C  CG    . PRO A  1  229 ? 59.879  15.531  397.069 1.00 80.34  ? 229 PRO 1 CG    1 
ATOM   1792  C  CD    . PRO A  1  229 ? 59.747  16.995  396.931 1.00 80.44  ? 229 PRO 1 CD    1 
ATOM   1793  N  N     . ILE A  1  230 ? 63.390  16.027  396.748 1.00 74.65  ? 230 ILE 1 N     1 
ATOM   1794  C  CA    . ILE A  1  230 ? 64.745  15.705  396.299 1.00 75.19  ? 230 ILE 1 CA    1 
ATOM   1795  C  C     . ILE A  1  230 ? 65.745  16.691  396.884 1.00 75.37  ? 230 ILE 1 C     1 
ATOM   1796  O  O     . ILE A  1  230 ? 66.778  16.307  397.445 1.00 74.44  ? 230 ILE 1 O     1 
ATOM   1797  C  CB    . ILE A  1  230 ? 64.801  15.705  394.762 1.00 76.68  ? 230 ILE 1 CB    1 
ATOM   1798  C  CG1   . ILE A  1  230 ? 63.963  14.553  394.213 1.00 81.91  ? 230 ILE 1 CG1   1 
ATOM   1799  C  CG2   . ILE A  1  230 ? 66.245  15.596  394.288 1.00 77.09  ? 230 ILE 1 CG2   1 
ATOM   1800  C  CD1   . ILE A  1  230 ? 63.856  14.531  392.707 1.00 83.18  ? 230 ILE 1 CD1   1 
ATOM   1801  N  N     . MET A  1  231 ? 65.448  17.986  396.749 1.00 81.66  ? 231 MET 1 N     1 
ATOM   1802  C  CA    . MET A  1  231 ? 66.300  19.019  397.325 1.00 84.32  ? 231 MET 1 CA    1 
ATOM   1803  C  C     . MET A  1  231 ? 66.213  19.026  398.846 1.00 94.96  ? 231 MET 1 C     1 
ATOM   1804  O  O     . MET A  1  231 ? 67.151  19.469  399.519 1.00 95.89  ? 231 MET 1 O     1 
ATOM   1805  C  CB    . MET A  1  231 ? 65.914  20.392  396.767 1.00 73.78  ? 231 MET 1 CB    1 
ATOM   1806  C  CG    . MET A  1  231 ? 66.033  20.523  395.259 1.00 67.93  ? 231 MET 1 CG    1 
ATOM   1807  S  SD    . MET A  1  231 ? 67.528  19.770  394.595 1.00 66.03  ? 231 MET 1 SD    1 
ATOM   1808  C  CE    . MET A  1  231 ? 68.795  20.832  395.283 1.00 64.57  ? 231 MET 1 CE    1 
ATOM   1809  N  N     . GLU A  1  232 ? 65.101  18.537  399.401 1.00 104.36 ? 232 GLU 1 N     1 
ATOM   1810  C  CA    . GLU A  1  232 ? 64.912  18.549  400.848 1.00 106.99 ? 232 GLU 1 CA    1 
ATOM   1811  C  C     . GLU A  1  232 ? 65.779  17.497  401.534 1.00 113.60 ? 232 GLU 1 C     1 
ATOM   1812  O  O     . GLU A  1  232 ? 66.659  17.830  402.336 1.00 113.64 ? 232 GLU 1 O     1 
ATOM   1813  C  CB    . GLU A  1  232 ? 63.432  18.330  401.176 1.00 107.99 ? 232 GLU 1 CB    1 
ATOM   1814  C  CG    . GLU A  1  232 ? 63.128  18.176  402.659 1.00 104.78 ? 232 GLU 1 CG    1 
ATOM   1815  C  CD    . GLU A  1  232 ? 61.669  17.846  402.918 1.00 101.32 ? 232 GLU 1 CD    1 
ATOM   1816  O  OE1   . GLU A  1  232 ? 61.124  16.967  402.216 1.00 99.46  ? 232 GLU 1 OE1   1 
ATOM   1817  O  OE2   . GLU A  1  232 ? 61.067  18.460  403.824 1.00 100.41 ? 232 GLU 1 OE2   1 
ATOM   1818  N  N     . ARG A  1  233 ? 65.550  16.212  401.232 1.00 124.43 ? 233 ARG 1 N     1 
ATOM   1819  C  CA    . ARG A  1  233 ? 66.322  15.126  401.847 1.00 132.67 ? 233 ARG 1 CA    1 
ATOM   1820  C  C     . ARG A  1  233 ? 66.912  14.231  400.752 1.00 137.16 ? 233 ARG 1 C     1 
ATOM   1821  O  O     . ARG A  1  233 ? 66.351  13.183  400.420 1.00 139.88 ? 233 ARG 1 O     1 
ATOM   1822  C  CB    . ARG A  1  233 ? 65.456  14.316  402.827 1.00 128.45 ? 233 ARG 1 CB    1 
ATOM   1823  C  CG    . ARG A  1  233 ? 64.110  13.858  402.273 1.00 126.60 ? 233 ARG 1 CG    1 
ATOM   1824  C  CD    . ARG A  1  233 ? 63.108  13.564  403.373 1.00 124.09 ? 233 ARG 1 CD    1 
ATOM   1825  N  NE    . ARG A  1  233 ? 61.762  13.387  402.840 1.00 122.90 ? 233 ARG 1 NE    1 
ATOM   1826  C  CZ    . ARG A  1  233 ? 60.825  12.651  403.426 1.00 120.52 ? 233 ARG 1 CZ    1 
ATOM   1827  N  NH1   . ARG A  1  233 ? 61.092  12.031  404.567 1.00 118.79 ? 233 ARG 1 NH1   1 
ATOM   1828  N  NH2   . ARG A  1  233 ? 59.622  12.533  402.878 1.00 120.53 ? 233 ARG 1 NH2   1 
ATOM   1829  N  N     . GLY A  1  234 ? 68.061  14.627  400.209 1.00 143.07 ? 234 GLY 1 N     1 
ATOM   1830  C  CA    . GLY A  1  234 ? 68.820  13.717  399.370 1.00 148.10 ? 234 GLY 1 CA    1 
ATOM   1831  C  C     . GLY A  1  234 ? 68.227  13.459  397.998 1.00 154.11 ? 234 GLY 1 C     1 
ATOM   1832  O  O     . GLY A  1  234 ? 67.005  13.490  397.823 1.00 156.85 ? 234 GLY 1 O     1 
ATOM   1833  N  N     . ALA A  1  235 ? 69.082  13.204  397.010 1.00 156.87 ? 235 ALA 1 N     1 
ATOM   1834  C  CA    . ALA A  1  235 ? 68.601  12.765  395.704 1.00 157.31 ? 235 ALA 1 CA    1 
ATOM   1835  C  C     . ALA A  1  235 ? 68.624  11.248  395.552 1.00 159.02 ? 235 ALA 1 C     1 
ATOM   1836  O  O     . ALA A  1  235 ? 67.679  10.666  395.009 1.00 156.50 ? 235 ALA 1 O     1 
ATOM   1837  C  CB    . ALA A  1  235 ? 69.430  13.408  394.589 1.00 157.63 ? 235 ALA 1 CB    1 
ATOM   1838  N  N     . ASP A  1  236 ? 69.692  10.590  396.006 1.00 163.96 ? 236 ASP 1 N     1 
ATOM   1839  C  CA    . ASP A  1  236 ? 69.771  9.141   395.855 1.00 170.82 ? 236 ASP 1 CA    1 
ATOM   1840  C  C     . ASP A  1  236 ? 68.743  8.421   396.721 1.00 185.31 ? 236 ASP 1 C     1 
ATOM   1841  O  O     . ASP A  1  236 ? 68.325  7.307   396.384 1.00 181.59 ? 236 ASP 1 O     1 
ATOM   1842  C  CB    . ASP A  1  236 ? 71.185  8.659   396.182 1.00 163.60 ? 236 ASP 1 CB    1 
ATOM   1843  C  CG    . ASP A  1  236 ? 72.149  8.861   395.027 1.00 157.92 ? 236 ASP 1 CG    1 
ATOM   1844  O  OD1   . ASP A  1  236 ? 71.962  8.218   393.972 1.00 156.21 ? 236 ASP 1 OD1   1 
ATOM   1845  O  OD2   . ASP A  1  236 ? 73.093  9.666   395.171 1.00 155.76 ? 236 ASP 1 OD2   1 
ATOM   1846  N  N     . TRP A  1  237 ? 68.337  9.027   397.840 1.00 203.89 ? 237 TRP 1 N     1 
ATOM   1847  C  CA    . TRP A  1  237 ? 67.198  8.504   398.590 1.00 220.89 ? 237 TRP 1 CA    1 
ATOM   1848  C  C     . TRP A  1  237 ? 65.923  8.553   397.756 1.00 228.99 ? 237 TRP 1 C     1 
ATOM   1849  O  O     . TRP A  1  237 ? 65.099  7.633   397.810 1.00 229.23 ? 237 TRP 1 O     1 
ATOM   1850  C  CB    . TRP A  1  237 ? 67.017  9.275   399.896 1.00 228.36 ? 237 TRP 1 CB    1 
ATOM   1851  C  CG    . TRP A  1  237 ? 65.692  9.013   400.534 1.00 236.09 ? 237 TRP 1 CG    1 
ATOM   1852  C  CD1   . TRP A  1  237 ? 65.352  7.945   401.311 1.00 239.50 ? 237 TRP 1 CD1   1 
ATOM   1853  C  CD2   . TRP A  1  237 ? 64.518  9.826   400.431 1.00 242.60 ? 237 TRP 1 CD2   1 
ATOM   1854  N  NE1   . TRP A  1  237 ? 64.039  8.046   401.706 1.00 242.97 ? 237 TRP 1 NE1   1 
ATOM   1855  C  CE2   . TRP A  1  237 ? 63.505  9.193   401.178 1.00 244.13 ? 237 TRP 1 CE2   1 
ATOM   1856  C  CE3   . TRP A  1  237 ? 64.227  11.029  399.783 1.00 244.97 ? 237 TRP 1 CE3   1 
ATOM   1857  C  CZ2   . TRP A  1  237 ? 62.224  9.725   401.295 1.00 246.43 ? 237 TRP 1 CZ2   1 
ATOM   1858  C  CZ3   . TRP A  1  237 ? 62.954  11.555  399.900 1.00 246.23 ? 237 TRP 1 CZ3   1 
ATOM   1859  C  CH2   . TRP A  1  237 ? 61.969  10.903  400.650 1.00 247.53 ? 237 TRP 1 CH2   1 
ATOM   1860  N  N     . PHE A  1  238 ? 65.731  9.635   396.997 1.00 236.96 ? 238 PHE 1 N     1 
ATOM   1861  C  CA    . PHE A  1  238 ? 64.643  9.671   396.023 1.00 244.66 ? 238 PHE 1 CA    1 
ATOM   1862  C  C     . PHE A  1  238 ? 64.809  8.557   394.999 1.00 247.65 ? 238 PHE 1 C     1 
ATOM   1863  O  O     . PHE A  1  238 ? 63.831  7.915   394.601 1.00 246.50 ? 238 PHE 1 O     1 
ATOM   1864  C  CB    . PHE A  1  238 ? 64.602  11.042  395.347 1.00 251.57 ? 238 PHE 1 CB    1 
ATOM   1865  C  CG    . PHE A  1  238 ? 63.491  11.209  394.346 1.00 258.23 ? 238 PHE 1 CG    1 
ATOM   1866  C  CD1   . PHE A  1  238 ? 62.223  11.590  394.751 1.00 261.30 ? 238 PHE 1 CD1   1 
ATOM   1867  C  CD2   . PHE A  1  238 ? 63.728  11.021  392.993 1.00 261.16 ? 238 PHE 1 CD2   1 
ATOM   1868  C  CE1   . PHE A  1  238 ? 61.208  11.762  393.825 1.00 263.21 ? 238 PHE 1 CE1   1 
ATOM   1869  C  CE2   . PHE A  1  238 ? 62.717  11.193  392.065 1.00 263.11 ? 238 PHE 1 CE2   1 
ATOM   1870  C  CZ    . PHE A  1  238 ? 61.455  11.564  392.483 1.00 263.70 ? 238 PHE 1 CZ    1 
ATOM   1871  N  N     . ALA A  1  239 ? 66.048  8.304   394.575 1.00 250.09 ? 239 ALA 1 N     1 
ATOM   1872  C  CA    . ALA A  1  239 ? 66.351  7.187   393.686 1.00 253.09 ? 239 ALA 1 CA    1 
ATOM   1873  C  C     . ALA A  1  239 ? 66.071  5.826   394.314 1.00 254.27 ? 239 ALA 1 C     1 
ATOM   1874  O  O     . ALA A  1  239 ? 66.158  4.814   393.610 1.00 257.07 ? 239 ALA 1 O     1 
ATOM   1875  C  CB    . ALA A  1  239 ? 67.811  7.258   393.235 1.00 251.86 ? 239 ALA 1 CB    1 
ATOM   1876  N  N     . GLN A  1  240 ? 65.742  5.767   395.607 1.00 255.51 ? 240 GLN 1 N     1 
ATOM   1877  C  CA    . GLN A  1  240 ? 65.395  4.498   396.239 1.00 255.28 ? 240 GLN 1 CA    1 
ATOM   1878  C  C     . GLN A  1  240 ? 63.978  4.051   395.894 1.00 243.09 ? 240 GLN 1 C     1 
ATOM   1879  O  O     . GLN A  1  240 ? 63.588  2.934   396.251 1.00 241.65 ? 240 GLN 1 O     1 
ATOM   1880  C  CB    . GLN A  1  240 ? 65.572  4.608   397.761 1.00 272.68 ? 240 GLN 1 CB    1 
ATOM   1881  C  CG    . GLN A  1  240 ? 65.502  3.296   398.537 1.00 288.60 ? 240 GLN 1 CG    1 
ATOM   1882  C  CD    . GLN A  1  240 ? 65.629  3.493   400.038 1.00 301.39 ? 240 GLN 1 CD    1 
ATOM   1883  O  OE1   . GLN A  1  240 ? 66.581  4.110   400.515 1.00 312.40 ? 240 GLN 1 OE1   1 
ATOM   1884  N  NE2   . GLN A  1  240 ? 64.680  2.951   400.791 1.00 307.03 ? 240 GLN 1 NE2   1 
ATOM   1885  N  N     . MET A  1  241 ? 63.214  4.874   395.182 1.00 228.87 ? 241 MET 1 N     1 
ATOM   1886  C  CA    . MET A  1  241 ? 61.875  4.526   394.734 1.00 214.38 ? 241 MET 1 CA    1 
ATOM   1887  C  C     . MET A  1  241 ? 61.876  4.390   393.218 1.00 202.98 ? 241 MET 1 C     1 
ATOM   1888  O  O     . MET A  1  241 ? 62.502  5.189   392.515 1.00 203.93 ? 241 MET 1 O     1 
ATOM   1889  C  CB    . MET A  1  241 ? 60.851  5.587   395.156 1.00 210.38 ? 241 MET 1 CB    1 
ATOM   1890  C  CG    . MET A  1  241 ? 60.328  5.451   396.569 1.00 208.25 ? 241 MET 1 CG    1 
ATOM   1891  S  SD    . MET A  1  241 ? 59.391  6.893   397.103 1.00 207.85 ? 241 MET 1 SD    1 
ATOM   1892  C  CE    . MET A  1  241 ? 60.715  7.937   397.707 1.00 208.01 ? 241 MET 1 CE    1 
ATOM   1893  N  N     . GLY A  1  242 ? 61.182  3.373   392.717 1.00 190.21 ? 242 GLY 1 N     1 
ATOM   1894  C  CA    . GLY A  1  242 ? 61.056  3.177   391.287 1.00 179.83 ? 242 GLY 1 CA    1 
ATOM   1895  C  C     . GLY A  1  242 ? 62.093  2.247   390.687 1.00 169.27 ? 242 GLY 1 C     1 
ATOM   1896  O  O     . GLY A  1  242 ? 62.984  1.714   391.356 1.00 170.31 ? 242 GLY 1 O     1 
ATOM   1897  N  N     . THR A  1  243 ? 61.967  2.069   389.373 1.00 160.31 ? 243 THR 1 N     1 
ATOM   1898  C  CA    . THR A  1  243 ? 62.780  1.134   388.608 1.00 145.25 ? 243 THR 1 CA    1 
ATOM   1899  C  C     . THR A  1  243 ? 64.191  1.694   388.408 1.00 138.79 ? 243 THR 1 C     1 
ATOM   1900  O  O     . THR A  1  243 ? 64.518  2.804   388.837 1.00 140.57 ? 243 THR 1 O     1 
ATOM   1901  C  CB    . THR A  1  243 ? 62.101  0.823   387.272 1.00 139.23 ? 243 THR 1 CB    1 
ATOM   1902  O  OG1   . THR A  1  243 ? 60.680  0.823   387.448 1.00 137.65 ? 243 THR 1 OG1   1 
ATOM   1903  C  CG2   . THR A  1  243 ? 62.506  -0.555  386.757 1.00 134.64 ? 243 THR 1 CG2   1 
ATOM   1904  N  N     . GLU A  1  244 ? 65.043  0.901   387.751 1.00 128.16 ? 244 GLU 1 N     1 
ATOM   1905  C  CA    . GLU A  1  244 ? 66.426  1.288   387.496 1.00 120.40 ? 244 GLU 1 CA    1 
ATOM   1906  C  C     . GLU A  1  244 ? 66.550  2.539   386.633 1.00 121.76 ? 244 GLU 1 C     1 
ATOM   1907  O  O     . GLU A  1  244 ? 67.606  3.184   386.645 1.00 118.73 ? 244 GLU 1 O     1 
ATOM   1908  C  CB    . GLU A  1  244 ? 67.160  0.129   386.819 1.00 112.90 ? 244 GLU 1 CB    1 
ATOM   1909  C  CG    . GLU A  1  244 ? 68.675  0.241   386.812 1.00 105.02 ? 244 GLU 1 CG    1 
ATOM   1910  C  CD    . GLU A  1  244 ? 69.344  -1.043  386.364 1.00 98.84  ? 244 GLU 1 CD    1 
ATOM   1911  O  OE1   . GLU A  1  244 ? 68.768  -2.128  386.594 1.00 97.13  ? 244 GLU 1 OE1   1 
ATOM   1912  O  OE2   . GLU A  1  244 ? 70.440  -0.968  385.770 1.00 96.47  ? 244 GLU 1 OE2   1 
ATOM   1913  N  N     . GLN A  1  245 ? 65.505  2.904   385.889 1.00 125.93 ? 245 GLN 1 N     1 
ATOM   1914  C  CA    . GLN A  1  245 ? 65.543  4.091   385.050 1.00 128.43 ? 245 GLN 1 CA    1 
ATOM   1915  C  C     . GLN A  1  245 ? 64.497  5.134   385.405 1.00 129.23 ? 245 GLN 1 C     1 
ATOM   1916  O  O     . GLN A  1  245 ? 64.623  6.279   384.960 1.00 126.38 ? 245 GLN 1 O     1 
ATOM   1917  C  CB    . GLN A  1  245 ? 65.371  3.704   383.572 1.00 127.90 ? 245 GLN 1 CB    1 
ATOM   1918  C  CG    . GLN A  1  245 ? 66.648  3.216   382.911 1.00 126.51 ? 245 GLN 1 CG    1 
ATOM   1919  C  CD    . GLN A  1  245 ? 66.642  3.421   381.412 1.00 125.96 ? 245 GLN 1 CD    1 
ATOM   1920  O  OE1   . GLN A  1  245 ? 65.693  3.041   380.727 1.00 126.04 ? 245 GLN 1 OE1   1 
ATOM   1921  N  NE2   . GLN A  1  245 ? 67.707  4.016   380.892 1.00 125.63 ? 245 GLN 1 NE2   1 
ATOM   1922  N  N     . SER A  1  246 ? 63.483  4.783   386.192 1.00 134.28 ? 246 SER 1 N     1 
ATOM   1923  C  CA    . SER A  1  246 ? 62.433  5.710   386.608 1.00 140.77 ? 246 SER 1 CA    1 
ATOM   1924  C  C     . SER A  1  246 ? 62.462  5.782   388.131 1.00 149.86 ? 246 SER 1 C     1 
ATOM   1925  O  O     . SER A  1  246 ? 61.864  4.950   388.816 1.00 149.55 ? 246 SER 1 O     1 
ATOM   1926  C  CB    . SER A  1  246 ? 61.070  5.266   386.085 1.00 140.39 ? 246 SER 1 CB    1 
ATOM   1927  O  OG    . SER A  1  246 ? 61.011  5.394   384.675 1.00 140.56 ? 246 SER 1 OG    1 
ATOM   1928  N  N     . LYS A  1  247 ? 63.157  6.786   388.654 1.00 160.69 ? 247 LYS 1 N     1 
ATOM   1929  C  CA    . LYS A  1  247 ? 63.408  6.890   390.082 1.00 167.92 ? 247 LYS 1 CA    1 
ATOM   1930  C  C     . LYS A  1  247 ? 62.319  7.706   390.771 1.00 171.95 ? 247 LYS 1 C     1 
ATOM   1931  O  O     . LYS A  1  247 ? 61.666  8.556   390.159 1.00 177.28 ? 247 LYS 1 O     1 
ATOM   1932  C  CB    . LYS A  1  247 ? 64.778  7.517   390.345 1.00 173.18 ? 247 LYS 1 CB    1 
ATOM   1933  C  CG    . LYS A  1  247 ? 65.936  6.804   389.658 1.00 174.46 ? 247 LYS 1 CG    1 
ATOM   1934  C  CD    . LYS A  1  247 ? 66.137  5.399   390.208 1.00 175.78 ? 247 LYS 1 CD    1 
ATOM   1935  C  CE    . LYS A  1  247 ? 67.299  4.698   389.518 1.00 176.54 ? 247 LYS 1 CE    1 
ATOM   1936  N  NZ    . LYS A  1  247 ? 67.435  3.276   389.941 1.00 176.05 ? 247 LYS 1 NZ    1 
ATOM   1937  N  N     . GLY A  1  248 ? 62.128  7.432   392.059 1.00 167.93 ? 248 GLY 1 N     1 
ATOM   1938  C  CA    . GLY A  1  248 ? 61.264  8.240   392.896 1.00 163.23 ? 248 GLY 1 CA    1 
ATOM   1939  C  C     . GLY A  1  248 ? 59.811  7.820   392.877 1.00 157.49 ? 248 GLY 1 C     1 
ATOM   1940  O  O     . GLY A  1  248 ? 59.417  6.795   392.314 1.00 157.68 ? 248 GLY 1 O     1 
ATOM   1941  N  N     . MET A  1  249 ? 58.994  8.647   393.521 1.00 152.05 ? 249 MET 1 N     1 
ATOM   1942  C  CA    . MET A  1  249 ? 57.565  8.401   393.612 1.00 146.43 ? 249 MET 1 CA    1 
ATOM   1943  C  C     . MET A  1  249 ? 56.816  9.203   392.553 1.00 141.63 ? 249 MET 1 C     1 
ATOM   1944  O  O     . MET A  1  249 ? 57.390  9.978   391.783 1.00 144.61 ? 249 MET 1 O     1 
ATOM   1945  C  CB    . MET A  1  249 ? 57.041  8.732   395.012 1.00 145.70 ? 249 MET 1 CB    1 
ATOM   1946  C  CG    . MET A  1  249 ? 57.238  10.175  395.431 1.00 145.33 ? 249 MET 1 CG    1 
ATOM   1947  S  SD    . MET A  1  249 ? 58.930  10.503  395.955 1.00 145.80 ? 249 MET 1 SD    1 
ATOM   1948  C  CE    . MET A  1  249 ? 58.814  12.227  396.417 1.00 144.18 ? 249 MET 1 CE    1 
ATOM   1949  N  N     . LYS A  1  250 ? 55.501  9.007   392.532 1.00 135.00 ? 250 LYS 1 N     1 
ATOM   1950  C  CA    . LYS A  1  250 ? 54.600  9.590   391.556 1.00 129.37 ? 250 LYS 1 CA    1 
ATOM   1951  C  C     . LYS A  1  250 ? 53.231  9.692   392.214 1.00 123.07 ? 250 LYS 1 C     1 
ATOM   1952  O  O     . LYS A  1  250 ? 52.893  8.899   393.101 1.00 122.43 ? 250 LYS 1 O     1 
ATOM   1953  C  CB    . LYS A  1  250 ? 54.563  8.727   390.282 1.00 133.33 ? 250 LYS 1 CB    1 
ATOM   1954  C  CG    . LYS A  1  250 ? 53.497  9.058   389.243 1.00 134.30 ? 250 LYS 1 CG    1 
ATOM   1955  C  CD    . LYS A  1  250 ? 53.706  10.417  388.609 1.00 134.39 ? 250 LYS 1 CD    1 
ATOM   1956  C  CE    . LYS A  1  250 ? 52.737  10.644  387.454 1.00 134.42 ? 250 LYS 1 CE    1 
ATOM   1957  N  NZ    . LYS A  1  250 ? 51.321  10.574  387.914 1.00 134.66 ? 250 LYS 1 NZ    1 
ATOM   1958  N  N     . LEU A  1  251 ? 52.448  10.678  391.789 1.00 118.87 ? 251 LEU 1 N     1 
ATOM   1959  C  CA    . LEU A  1  251 ? 51.078  10.825  392.275 1.00 116.19 ? 251 LEU 1 CA    1 
ATOM   1960  C  C     . LEU A  1  251 ? 50.184  9.979   391.380 1.00 103.99 ? 251 LEU 1 C     1 
ATOM   1961  O  O     . LEU A  1  251 ? 49.731  10.419  390.322 1.00 101.49 ? 251 LEU 1 O     1 
ATOM   1962  C  CB    . LEU A  1  251 ? 50.650  12.286  392.289 1.00 123.01 ? 251 LEU 1 CB    1 
ATOM   1963  C  CG    . LEU A  1  251 ? 51.097  13.209  393.428 1.00 125.82 ? 251 LEU 1 CG    1 
ATOM   1964  C  CD1   . LEU A  1  251 ? 52.559  13.031  393.819 1.00 127.27 ? 251 LEU 1 CD1   1 
ATOM   1965  C  CD2   . LEU A  1  251 ? 50.831  14.639  393.025 1.00 125.39 ? 251 LEU 1 CD2   1 
ATOM   1966  N  N     . TYR A  1  252 ? 49.962  8.731   391.788 1.00 94.94  ? 252 TYR 1 N     1 
ATOM   1967  C  CA    . TYR A  1  252 ? 49.086  7.844   391.043 1.00 86.47  ? 252 TYR 1 CA    1 
ATOM   1968  C  C     . TYR A  1  252 ? 47.633  8.167   391.374 1.00 91.67  ? 252 TYR 1 C     1 
ATOM   1969  O  O     . TYR A  1  252 ? 47.320  8.674   392.451 1.00 91.83  ? 252 TYR 1 O     1 
ATOM   1970  C  CB    . TYR A  1  252 ? 49.393  6.375   391.360 1.00 70.24  ? 252 TYR 1 CB    1 
ATOM   1971  C  CG    . TYR A  1  252 ? 50.714  5.894   390.793 1.00 50.67  ? 252 TYR 1 CG    1 
ATOM   1972  C  CD1   . TYR A  1  252 ? 51.909  6.183   391.432 1.00 44.16  ? 252 TYR 1 CD1   1 
ATOM   1973  C  CD2   . TYR A  1  252 ? 50.769  5.188   389.603 1.00 40.50  ? 252 TYR 1 CD2   1 
ATOM   1974  C  CE1   . TYR A  1  252 ? 53.117  5.756   390.917 1.00 38.10  ? 252 TYR 1 CE1   1 
ATOM   1975  C  CE2   . TYR A  1  252 ? 51.978  4.764   389.077 1.00 36.31  ? 252 TYR 1 CE2   1 
ATOM   1976  C  CZ    . TYR A  1  252 ? 53.148  5.055   389.739 1.00 30.29  ? 252 TYR 1 CZ    1 
ATOM   1977  O  OH    . TYR A  1  252 ? 54.361  4.644   389.234 1.00 24.40  ? 252 TYR 1 OH    1 
ATOM   1978  N  N     . GLN A  1  253 ? 46.749  7.919   390.413 1.00 94.34  ? 253 GLN 1 N     1 
ATOM   1979  C  CA    . GLN A  1  253 ? 45.315  8.029   390.641 1.00 96.00  ? 253 GLN 1 CA    1 
ATOM   1980  C  C     . GLN A  1  253 ? 44.586  6.938   389.869 1.00 102.34 ? 253 GLN 1 C     1 
ATOM   1981  O  O     . GLN A  1  253 ? 45.054  6.467   388.833 1.00 102.04 ? 253 GLN 1 O     1 
ATOM   1982  C  CB    . GLN A  1  253 ? 44.769  9.422   390.278 1.00 90.31  ? 253 GLN 1 CB    1 
ATOM   1983  C  CG    . GLN A  1  253 ? 45.101  9.907   388.882 1.00 86.08  ? 253 GLN 1 CG    1 
ATOM   1984  C  CD    . GLN A  1  253 ? 46.475  10.545  388.812 1.00 83.38  ? 253 GLN 1 CD    1 
ATOM   1985  O  OE1   . GLN A  1  253 ? 47.153  10.688  389.828 1.00 82.48  ? 253 GLN 1 OE1   1 
ATOM   1986  N  NE2   . GLN A  1  253 ? 46.898  10.913  387.609 1.00 82.30  ? 253 GLN 1 NE2   1 
ATOM   1987  N  N     . ILE A  1  254 ? 43.441  6.526   390.406 1.00 106.99 ? 254 ILE 1 N     1 
ATOM   1988  C  CA    . ILE A  1  254 ? 42.668  5.415   389.868 1.00 108.57 ? 254 ILE 1 CA    1 
ATOM   1989  C  C     . ILE A  1  254 ? 41.195  5.810   389.834 1.00 113.39 ? 254 ILE 1 C     1 
ATOM   1990  O  O     . ILE A  1  254 ? 40.727  6.611   390.650 1.00 113.48 ? 254 ILE 1 O     1 
ATOM   1991  C  CB    . ILE A  1  254 ? 42.886  4.119   390.690 1.00 103.22 ? 254 ILE 1 CB    1 
ATOM   1992  C  CG1   . ILE A  1  254 ? 42.218  2.920   390.008 1.00 100.81 ? 254 ILE 1 CG1   1 
ATOM   1993  C  CG2   . ILE A  1  254 ? 42.394  4.294   392.123 1.00 101.32 ? 254 ILE 1 CG2   1 
ATOM   1994  C  CD1   . ILE A  1  254 ? 42.390  1.619   390.750 1.00 100.08 ? 254 ILE 1 CD1   1 
ATOM   1995  N  N     . SER A  1  255 ? 40.472  5.272   388.851 1.00 118.48 ? 255 SER 1 N     1 
ATOM   1996  C  CA    . SER A  1  255 ? 39.057  5.562   388.676 1.00 121.74 ? 255 SER 1 CA    1 
ATOM   1997  C  C     . SER A  1  255 ? 38.357  4.361   388.046 1.00 124.29 ? 255 SER 1 C     1 
ATOM   1998  O  O     . SER A  1  255 ? 38.971  3.538   387.355 1.00 126.11 ? 255 SER 1 O     1 
ATOM   1999  C  CB    . SER A  1  255 ? 38.846  6.817   387.817 1.00 121.96 ? 255 SER 1 CB    1 
ATOM   2000  O  OG    . SER A  1  255 ? 39.748  6.847   386.723 1.00 121.78 ? 255 SER 1 OG    1 
ATOM   2001  N  N     . GLY A  1  256 ? 37.048  4.288   388.281 1.00 122.81 ? 256 GLY 1 N     1 
ATOM   2002  C  CA    . GLY A  1  256 ? 36.227  3.215   387.772 1.00 123.12 ? 256 GLY 1 CA    1 
ATOM   2003  C  C     . GLY A  1  256 ? 35.323  2.643   388.843 1.00 122.86 ? 256 GLY 1 C     1 
ATOM   2004  O  O     . GLY A  1  256 ? 35.221  3.177   389.952 1.00 121.70 ? 256 GLY 1 O     1 
ATOM   2005  N  N     . PRO A  1  257 ? 34.639  1.540   388.529 1.00 127.15 ? 257 PRO 1 N     1 
ATOM   2006  C  CA    . PRO A  1  257 ? 33.805  0.862   389.547 1.00 128.03 ? 257 PRO 1 CA    1 
ATOM   2007  C  C     . PRO A  1  257 ? 34.651  0.039   390.513 1.00 130.33 ? 257 PRO 1 C     1 
ATOM   2008  O  O     . PRO A  1  257 ? 34.602  -1.196  390.569 1.00 128.56 ? 257 PRO 1 O     1 
ATOM   2009  C  CB    . PRO A  1  257 ? 32.866  0.000   388.689 1.00 128.61 ? 257 PRO 1 CB    1 
ATOM   2010  C  CG    . PRO A  1  257 ? 33.047  0.470   387.262 1.00 127.90 ? 257 PRO 1 CG    1 
ATOM   2011  C  CD    . PRO A  1  257 ? 34.444  0.970   387.189 1.00 127.75 ? 257 PRO 1 CD    1 
ATOM   2012  N  N     . VAL A  1  258 ? 35.464  0.744   391.300 1.00 129.21 ? 258 VAL 1 N     1 
ATOM   2013  C  CA    . VAL A  1  258 ? 36.322  0.138   392.308 1.00 125.83 ? 258 VAL 1 CA    1 
ATOM   2014  C  C     . VAL A  1  258 ? 35.884  0.671   393.667 1.00 122.13 ? 258 VAL 1 C     1 
ATOM   2015  O  O     . VAL A  1  258 ? 35.167  1.670   393.767 1.00 126.78 ? 258 VAL 1 O     1 
ATOM   2016  C  CB    . VAL A  1  258 ? 37.822  0.422   392.050 1.00 124.11 ? 258 VAL 1 CB    1 
ATOM   2017  C  CG1   . VAL A  1  258 ? 38.211  1.809   392.549 1.00 125.52 ? 258 VAL 1 CG1   1 
ATOM   2018  C  CG2   . VAL A  1  258 ? 38.698  -0.658  392.666 1.00 122.45 ? 258 VAL 1 CG2   1 
ATOM   2019  N  N     . LYS A  1  259 ? 36.317  -0.021  394.724 1.00 114.94 ? 259 LYS 1 N     1 
ATOM   2020  C  CA    . LYS A  1  259 ? 35.807  0.270   396.061 1.00 107.92 ? 259 LYS 1 CA    1 
ATOM   2021  C  C     . LYS A  1  259 ? 36.126  1.704   396.477 1.00 100.13 ? 259 LYS 1 C     1 
ATOM   2022  O  O     . LYS A  1  259 ? 35.254  2.423   396.980 1.00 92.60  ? 259 LYS 1 O     1 
ATOM   2023  C  CB    . LYS A  1  259 ? 36.379  -0.730  397.068 1.00 111.17 ? 259 LYS 1 CB    1 
ATOM   2024  C  CG    . LYS A  1  259 ? 35.937  -0.489  398.503 1.00 112.32 ? 259 LYS 1 CG    1 
ATOM   2025  C  CD    . LYS A  1  259 ? 36.280  -1.677  399.390 1.00 112.59 ? 259 LYS 1 CD    1 
ATOM   2026  C  CE    . LYS A  1  259 ? 35.846  -1.434  400.827 1.00 113.07 ? 259 LYS 1 CE    1 
ATOM   2027  N  NZ    . LYS A  1  259 ? 34.488  -0.835  400.898 1.00 114.45 ? 259 LYS 1 NZ    1 
ATOM   2028  N  N     . ARG A  1  260 ? 37.370  2.139   396.281 1.00 95.46  ? 260 ARG 1 N     1 
ATOM   2029  C  CA    . ARG A  1  260 ? 37.766  3.510   396.597 1.00 88.11  ? 260 ARG 1 CA    1 
ATOM   2030  C  C     . ARG A  1  260 ? 38.750  4.049   395.564 1.00 83.00  ? 260 ARG 1 C     1 
ATOM   2031  O  O     . ARG A  1  260 ? 39.971  3.895   395.694 1.00 80.58  ? 260 ARG 1 O     1 
ATOM   2032  C  CB    . ARG A  1  260 ? 38.320  3.606   398.021 1.00 86.32  ? 260 ARG 1 CB    1 
ATOM   2033  C  CG    . ARG A  1  260 ? 39.496  2.702   398.330 1.00 87.08  ? 260 ARG 1 CG    1 
ATOM   2034  C  CD    . ARG A  1  260 ? 39.816  2.700   399.811 1.00 92.07  ? 260 ARG 1 CD    1 
ATOM   2035  N  NE    . ARG A  1  260 ? 39.122  1.618   400.500 1.00 98.34  ? 260 ARG 1 NE    1 
ATOM   2036  C  CZ    . ARG A  1  260 ? 39.606  0.385   400.622 1.00 104.41 ? 260 ARG 1 CZ    1 
ATOM   2037  N  NH1   . ARG A  1  260 ? 40.787  0.081   400.102 1.00 107.33 ? 260 ARG 1 NH1   1 
ATOM   2038  N  NH2   . ARG A  1  260 ? 38.909  -0.543  401.262 1.00 105.61 ? 260 ARG 1 NH2   1 
ATOM   2039  N  N     . PRO A  1  261 ? 38.244  4.677   394.505 1.00 82.22  ? 261 PRO 1 N     1 
ATOM   2040  C  CA    . PRO A  1  261 ? 39.128  5.352   393.548 1.00 86.60  ? 261 PRO 1 CA    1 
ATOM   2041  C  C     . PRO A  1  261 ? 39.705  6.622   394.155 1.00 86.97  ? 261 PRO 1 C     1 
ATOM   2042  O  O     . PRO A  1  261 ? 39.274  7.088   395.209 1.00 88.13  ? 261 PRO 1 O     1 
ATOM   2043  C  CB    . PRO A  1  261 ? 38.202  5.666   392.370 1.00 85.05  ? 261 PRO 1 CB    1 
ATOM   2044  C  CG    . PRO A  1  261 ? 36.849  5.777   392.987 1.00 81.80  ? 261 PRO 1 CG    1 
ATOM   2045  C  CD    . PRO A  1  261 ? 36.823  4.804   394.135 1.00 80.32  ? 261 PRO 1 CD    1 
ATOM   2046  N  N     . GLY A  1  262 ? 40.704  7.182   393.485 1.00 85.99  ? 262 GLY 1 N     1 
ATOM   2047  C  CA    . GLY A  1  262 ? 41.198  8.475   393.895 1.00 85.27  ? 262 GLY 1 CA    1 
ATOM   2048  C  C     . GLY A  1  262 ? 42.697  8.596   393.725 1.00 86.81  ? 262 GLY 1 C     1 
ATOM   2049  O  O     . GLY A  1  262 ? 43.300  7.895   392.918 1.00 90.56  ? 262 GLY 1 O     1 
ATOM   2050  N  N     . VAL A  1  263 ? 43.290  9.495   394.521 1.00 80.51  ? 263 VAL 1 N     1 
ATOM   2051  C  CA    . VAL A  1  263 ? 44.704  9.851   394.424 1.00 71.72  ? 263 VAL 1 CA    1 
ATOM   2052  C  C     . VAL A  1  263 ? 45.481  9.168   395.540 1.00 82.23  ? 263 VAL 1 C     1 
ATOM   2053  O  O     . VAL A  1  263 ? 44.993  9.052   396.672 1.00 91.69  ? 263 VAL 1 O     1 
ATOM   2054  C  CB    . VAL A  1  263 ? 44.893  11.378  394.495 1.00 50.08  ? 263 VAL 1 CB    1 
ATOM   2055  C  CG1   . VAL A  1  263 ? 46.322  11.750  394.147 1.00 49.01  ? 263 VAL 1 CG1   1 
ATOM   2056  C  CG2   . VAL A  1  263 ? 43.902  12.086  393.599 1.00 43.52  ? 263 VAL 1 CG2   1 
ATOM   2057  N  N     . TYR A  1  264 ? 46.705  8.735   395.227 1.00 80.17  ? 264 TYR 1 N     1 
ATOM   2058  C  CA    . TYR A  1  264 ? 47.630  8.187   396.211 1.00 73.23  ? 264 TYR 1 CA    1 
ATOM   2059  C  C     . TYR A  1  264 ? 49.060  8.512   395.801 1.00 73.98  ? 264 TYR 1 C     1 
ATOM   2060  O  O     . TYR A  1  264 ? 49.441  8.340   394.638 1.00 75.53  ? 264 TYR 1 O     1 
ATOM   2061  C  CB    . TYR A  1  264 ? 47.458  6.670   396.365 1.00 64.53  ? 264 TYR 1 CB    1 
ATOM   2062  C  CG    . TYR A  1  264 ? 46.065  6.266   396.769 1.00 62.71  ? 264 TYR 1 CG    1 
ATOM   2063  C  CD1   . TYR A  1  264 ? 45.666  6.315   398.096 1.00 62.15  ? 264 TYR 1 CD1   1 
ATOM   2064  C  CD2   . TYR A  1  264 ? 45.144  5.841   395.824 1.00 63.74  ? 264 TYR 1 CD2   1 
ATOM   2065  C  CE1   . TYR A  1  264 ? 44.385  5.954   398.470 1.00 65.90  ? 264 TYR 1 CE1   1 
ATOM   2066  C  CE2   . TYR A  1  264 ? 43.863  5.476   396.189 1.00 65.68  ? 264 TYR 1 CE2   1 
ATOM   2067  C  CZ    . TYR A  1  264 ? 43.490  5.532   397.512 1.00 69.49  ? 264 TYR 1 CZ    1 
ATOM   2068  O  OH    . TYR A  1  264 ? 42.215  5.163   397.873 1.00 76.20  ? 264 TYR 1 OH    1 
ATOM   2069  N  N     . GLU A  1  265 ? 49.837  8.995   396.766 1.00 68.31  ? 265 GLU 1 N     1 
ATOM   2070  C  CA    . GLU A  1  265 ? 51.268  9.221   396.601 1.00 59.35  ? 265 GLU 1 CA    1 
ATOM   2071  C  C     . GLU A  1  265 ? 51.964  7.868   396.690 1.00 65.20  ? 265 GLU 1 C     1 
ATOM   2072  O  O     . GLU A  1  265 ? 52.036  7.280   397.774 1.00 61.17  ? 265 GLU 1 O     1 
ATOM   2073  C  CB    . GLU A  1  265 ? 51.765  10.159  397.697 1.00 46.57  ? 265 GLU 1 CB    1 
ATOM   2074  C  CG    . GLU A  1  265 ? 53.238  10.508  397.640 1.00 42.48  ? 265 GLU 1 CG    1 
ATOM   2075  C  CD    . GLU A  1  265 ? 53.703  11.231  398.895 1.00 42.07  ? 265 GLU 1 CD    1 
ATOM   2076  O  OE1   . GLU A  1  265 ? 52.850  11.692  399.685 1.00 23.72  ? 265 GLU 1 OE1   1 
ATOM   2077  O  OE2   . GLU A  1  265 ? 54.928  11.339  399.097 1.00 23.78  ? 265 GLU 1 OE2   1 
ATOM   2078  N  N     . LEU A  1  266 ? 52.432  7.337   395.560 1.00 75.32  ? 266 LEU 1 N     1 
ATOM   2079  C  CA    . LEU A  1  266 ? 52.972  5.984   395.559 1.00 80.10  ? 266 LEU 1 CA    1 
ATOM   2080  C  C     . LEU A  1  266 ? 54.281  5.931   394.787 1.00 86.67  ? 266 LEU 1 C     1 
ATOM   2081  O  O     . LEU A  1  266 ? 54.460  6.666   393.810 1.00 87.65  ? 266 LEU 1 O     1 
ATOM   2082  C  CB    . LEU A  1  266 ? 51.984  4.984   394.935 1.00 76.14  ? 266 LEU 1 CB    1 
ATOM   2083  C  CG    . LEU A  1  266 ? 50.560  5.038   395.486 1.00 74.06  ? 266 LEU 1 CG    1 
ATOM   2084  C  CD1   . LEU A  1  266 ? 49.584  4.324   394.562 1.00 75.08  ? 266 LEU 1 CD1   1 
ATOM   2085  C  CD2   . LEU A  1  266 ? 50.516  4.458   396.887 1.00 72.85  ? 266 LEU 1 CD2   1 
ATOM   2086  N  N     . PRO A  1  267 ? 55.209  5.069   395.194 1.00 86.90  ? 267 PRO 1 N     1 
ATOM   2087  C  CA    . PRO A  1  267 ? 56.456  4.925   394.439 1.00 89.63  ? 267 PRO 1 CA    1 
ATOM   2088  C  C     . PRO A  1  267 ? 56.193  4.265   393.095 1.00 92.15  ? 267 PRO 1 C     1 
ATOM   2089  O  O     . PRO A  1  267 ? 55.143  3.667   392.856 1.00 94.24  ? 267 PRO 1 O     1 
ATOM   2090  C  CB    . PRO A  1  267 ? 57.323  4.040   395.342 1.00 86.71  ? 267 PRO 1 CB    1 
ATOM   2091  C  CG    . PRO A  1  267 ? 56.347  3.293   396.182 1.00 87.74  ? 267 PRO 1 CG    1 
ATOM   2092  C  CD    . PRO A  1  267 ? 55.198  4.234   396.408 1.00 88.83  ? 267 PRO 1 CD    1 
ATOM   2093  N  N     . MET A  1  268 ? 57.168  4.399   392.201 1.00 98.08  ? 268 MET 1 N     1 
ATOM   2094  C  CA    . MET A  1  268 ? 57.052  3.840   390.861 1.00 102.37 ? 268 MET 1 CA    1 
ATOM   2095  C  C     . MET A  1  268 ? 57.270  2.333   390.889 1.00 112.32 ? 268 MET 1 C     1 
ATOM   2096  O  O     . MET A  1  268 ? 58.256  1.850   391.453 1.00 114.81 ? 268 MET 1 O     1 
ATOM   2097  C  CB    . MET A  1  268 ? 58.060  4.498   389.922 1.00 100.16 ? 268 MET 1 CB    1 
ATOM   2098  C  CG    . MET A  1  268 ? 57.600  4.595   388.482 1.00 100.19 ? 268 MET 1 CG    1 
ATOM   2099  S  SD    . MET A  1  268 ? 56.810  6.176   388.150 1.00 102.92 ? 268 MET 1 SD    1 
ATOM   2100  C  CE    . MET A  1  268 ? 58.221  7.151   387.634 1.00 103.65 ? 268 MET 1 CE    1 
ATOM   2101  N  N     . GLY A  1  269 ? 56.341  1.589   390.297 1.00 117.92 ? 269 GLY 1 N     1 
ATOM   2102  C  CA    . GLY A  1  269 ? 56.478  0.150   390.157 1.00 121.88 ? 269 GLY 1 CA    1 
ATOM   2103  C  C     . GLY A  1  269 ? 55.399  -0.683  390.814 1.00 123.95 ? 269 GLY 1 C     1 
ATOM   2104  O  O     . GLY A  1  269 ? 55.391  -1.907  390.613 1.00 130.06 ? 269 GLY 1 O     1 
ATOM   2105  N  N     . THR A  1  270 ? 54.501  -0.097  391.607 1.00 123.42 ? 270 THR 1 N     1 
ATOM   2106  C  CA    . THR A  1  270 ? 53.438  -0.879  392.227 1.00 122.27 ? 270 THR 1 CA    1 
ATOM   2107  C  C     . THR A  1  270 ? 52.621  -1.600  391.161 1.00 122.38 ? 270 THR 1 C     1 
ATOM   2108  O  O     . THR A  1  270 ? 52.293  -1.030  390.119 1.00 124.73 ? 270 THR 1 O     1 
ATOM   2109  C  CB    . THR A  1  270 ? 52.521  0.021   393.060 1.00 119.77 ? 270 THR 1 CB    1 
ATOM   2110  O  OG1   . THR A  1  270 ? 51.729  0.836   392.188 1.00 121.02 ? 270 THR 1 OG1   1 
ATOM   2111  C  CG2   . THR A  1  270 ? 53.332  0.920   393.983 1.00 118.54 ? 270 THR 1 CG2   1 
ATOM   2112  N  N     . THR A  1  271 ? 52.300  -2.865  391.421 1.00 118.65 ? 271 THR 1 N     1 
ATOM   2113  C  CA    . THR A  1  271 ? 51.578  -3.672  390.449 1.00 110.43 ? 271 THR 1 CA    1 
ATOM   2114  C  C     . THR A  1  271 ? 50.124  -3.216  390.357 1.00 101.69 ? 271 THR 1 C     1 
ATOM   2115  O  O     . THR A  1  271 ? 49.586  -2.582  391.270 1.00 98.42  ? 271 THR 1 O     1 
ATOM   2116  C  CB    . THR A  1  271 ? 51.636  -5.156  390.818 1.00 111.40 ? 271 THR 1 CB    1 
ATOM   2117  O  OG1   . THR A  1  271 ? 51.056  -5.349  392.112 1.00 113.09 ? 271 THR 1 OG1   1 
ATOM   2118  C  CG2   . THR A  1  271 ? 53.076  -5.648  390.838 1.00 110.86 ? 271 THR 1 CG2   1 
ATOM   2119  N  N     . PHE A  1  272 ? 49.489  -3.528  389.223 1.00 97.12  ? 272 PHE 1 N     1 
ATOM   2120  C  CA    . PHE A  1  272 ? 48.055  -3.281  389.109 1.00 96.41  ? 272 PHE 1 CA    1 
ATOM   2121  C  C     . PHE A  1  272 ? 47.310  -4.001  390.222 1.00 100.67 ? 272 PHE 1 C     1 
ATOM   2122  O  O     . PHE A  1  272 ? 46.392  -3.441  390.835 1.00 98.27  ? 272 PHE 1 O     1 
ATOM   2123  C  CB    . PHE A  1  272 ? 47.531  -3.750  387.749 1.00 92.44  ? 272 PHE 1 CB    1 
ATOM   2124  C  CG    . PHE A  1  272 ? 48.240  -3.146  386.572 1.00 91.55  ? 272 PHE 1 CG    1 
ATOM   2125  C  CD1   . PHE A  1  272 ? 49.444  -3.666  386.131 1.00 91.97  ? 272 PHE 1 CD1   1 
ATOM   2126  C  CD2   . PHE A  1  272 ? 47.689  -2.078  385.885 1.00 92.14  ? 272 PHE 1 CD2   1 
ATOM   2127  C  CE1   . PHE A  1  272 ? 50.096  -3.123  385.044 1.00 93.27  ? 272 PHE 1 CE1   1 
ATOM   2128  C  CE2   . PHE A  1  272 ? 48.341  -1.530  384.795 1.00 93.91  ? 272 PHE 1 CE2   1 
ATOM   2129  C  CZ    . PHE A  1  272 ? 49.544  -2.055  384.376 1.00 94.77  ? 272 PHE 1 CZ    1 
ATOM   2130  N  N     . ARG A  1  273 ? 47.717  -5.240  390.509 1.00 107.12 ? 273 ARG 1 N     1 
ATOM   2131  C  CA    . ARG A  1  273 ? 47.173  -5.977  391.642 1.00 109.97 ? 273 ARG 1 CA    1 
ATOM   2132  C  C     . ARG A  1  273 ? 47.270  -5.157  392.920 1.00 111.84 ? 273 ARG 1 C     1 
ATOM   2133  O  O     . ARG A  1  273 ? 46.270  -4.943  393.613 1.00 106.89 ? 273 ARG 1 O     1 
ATOM   2134  C  CB    . ARG A  1  273 ? 47.909  -7.310  391.806 1.00 111.66 ? 273 ARG 1 CB    1 
ATOM   2135  C  CG    . ARG A  1  273 ? 47.453  -8.118  393.018 1.00 114.34 ? 273 ARG 1 CG    1 
ATOM   2136  C  CD    . ARG A  1  273 ? 48.352  -9.318  393.292 1.00 116.69 ? 273 ARG 1 CD    1 
ATOM   2137  N  NE    . ARG A  1  273 ? 48.475  -10.215 392.148 1.00 121.04 ? 273 ARG 1 NE    1 
ATOM   2138  C  CZ    . ARG A  1  273 ? 47.545  -11.091 391.776 1.00 121.33 ? 273 ARG 1 CZ    1 
ATOM   2139  N  NH1   . ARG A  1  273 ? 46.412  -11.199 392.460 1.00 119.96 ? 273 ARG 1 NH1   1 
ATOM   2140  N  NH2   . ARG A  1  273 ? 47.751  -11.868 390.721 1.00 121.00 ? 273 ARG 1 NH2   1 
ATOM   2141  N  N     . GLU A  1  274 ? 48.472  -4.675  393.240 1.00 117.99 ? 274 GLU 1 N     1 
ATOM   2142  C  CA    . GLU A  1  274 ? 48.663  -3.931  394.481 1.00 124.30 ? 274 GLU 1 CA    1 
ATOM   2143  C  C     . GLU A  1  274 ? 47.814  -2.667  394.504 1.00 124.59 ? 274 GLU 1 C     1 
ATOM   2144  O  O     . GLU A  1  274 ? 47.088  -2.414  395.471 1.00 128.75 ? 274 GLU 1 O     1 
ATOM   2145  C  CB    . GLU A  1  274 ? 50.143  -3.596  394.670 1.00 122.96 ? 274 GLU 1 CB    1 
ATOM   2146  C  CG    . GLU A  1  274 ? 50.405  -2.574  395.764 1.00 125.10 ? 274 GLU 1 CG    1 
ATOM   2147  C  CD    . GLU A  1  274 ? 51.856  -2.545  396.198 1.00 127.24 ? 274 GLU 1 CD    1 
ATOM   2148  O  OE1   . GLU A  1  274 ? 52.552  -3.566  396.013 1.00 127.51 ? 274 GLU 1 OE1   1 
ATOM   2149  O  OE2   . GLU A  1  274 ? 52.299  -1.503  396.725 1.00 128.75 ? 274 GLU 1 OE2   1 
ATOM   2150  N  N     . LEU A  1  275 ? 47.886  -1.860  393.443 1.00 125.73 ? 275 LEU 1 N     1 
ATOM   2151  C  CA    . LEU A  1  275 ? 47.169  -0.588  393.437 1.00 121.87 ? 275 LEU 1 CA    1 
ATOM   2152  C  C     . LEU A  1  275 ? 45.666  -0.804  393.591 1.00 117.36 ? 275 LEU 1 C     1 
ATOM   2153  O  O     . LEU A  1  275 ? 45.025  -0.183  394.447 1.00 114.94 ? 275 LEU 1 O     1 
ATOM   2154  C  CB    . LEU A  1  275 ? 47.485  0.198   392.161 1.00 125.46 ? 275 LEU 1 CB    1 
ATOM   2155  C  CG    . LEU A  1  275 ? 47.411  1.734   392.244 1.00 129.23 ? 275 LEU 1 CG    1 
ATOM   2156  C  CD1   . LEU A  1  275 ? 47.934  2.380   390.973 1.00 129.87 ? 275 LEU 1 CD1   1 
ATOM   2157  C  CD2   . LEU A  1  275 ? 46.004  2.253   392.534 1.00 132.23 ? 275 LEU 1 CD2   1 
ATOM   2158  N  N     . ILE A  1  276 ? 45.083  -1.680  392.767 1.00 112.86 ? 276 ILE 1 N     1 
ATOM   2159  C  CA    . ILE A  1  276 ? 43.633  -1.862  392.797 1.00 108.42 ? 276 ILE 1 CA    1 
ATOM   2160  C  C     . ILE A  1  276 ? 43.193  -2.546  394.088 1.00 101.32 ? 276 ILE 1 C     1 
ATOM   2161  O  O     . ILE A  1  276 ? 42.147  -2.209  394.657 1.00 102.48 ? 276 ILE 1 O     1 
ATOM   2162  C  CB    . ILE A  1  276 ? 43.157  -2.638  391.554 1.00 107.66 ? 276 ILE 1 CB    1 
ATOM   2163  C  CG1   . ILE A  1  276 ? 43.641  -1.955  390.272 1.00 109.35 ? 276 ILE 1 CG1   1 
ATOM   2164  C  CG2   . ILE A  1  276 ? 41.641  -2.768  391.548 1.00 107.28 ? 276 ILE 1 CG2   1 
ATOM   2165  C  CD1   . ILE A  1  276 ? 43.811  -2.896  389.094 1.00 110.57 ? 276 ILE 1 CD1   1 
ATOM   2166  N  N     . TYR A  1  277 ? 43.980  -3.499  394.585 1.00 96.00  ? 277 TYR 1 N     1 
ATOM   2167  C  CA    . TYR A  1  277 ? 43.555  -4.302  395.727 1.00 91.38  ? 277 TYR 1 CA    1 
ATOM   2168  C  C     . TYR A  1  277 ? 43.914  -3.636  397.055 1.00 86.47  ? 277 TYR 1 C     1 
ATOM   2169  O  O     . TYR A  1  277 ? 43.033  -3.383  397.883 1.00 80.77  ? 277 TYR 1 O     1 
ATOM   2170  C  CB    . TYR A  1  277 ? 44.162  -5.710  395.639 1.00 93.14  ? 277 TYR 1 CB    1 
ATOM   2171  C  CG    . TYR A  1  277 ? 43.482  -6.610  394.623 1.00 92.14  ? 277 TYR 1 CG    1 
ATOM   2172  C  CD1   . TYR A  1  277 ? 42.186  -7.063  394.824 1.00 91.63  ? 277 TYR 1 CD1   1 
ATOM   2173  C  CD2   . TYR A  1  277 ? 44.140  -7.014  393.469 1.00 90.31  ? 277 TYR 1 CD2   1 
ATOM   2174  C  CE1   . TYR A  1  277 ? 41.564  -7.883  393.899 1.00 89.86  ? 277 TYR 1 CE1   1 
ATOM   2175  C  CE2   . TYR A  1  277 ? 43.526  -7.833  392.542 1.00 87.09  ? 277 TYR 1 CE2   1 
ATOM   2176  C  CZ    . TYR A  1  277 ? 42.240  -8.264  392.761 1.00 87.49  ? 277 TYR 1 CZ    1 
ATOM   2177  O  OH    . TYR A  1  277 ? 41.628  -9.080  391.837 1.00 87.05  ? 277 TYR 1 OH    1 
ATOM   2178  N  N     . GLU A  1  278 ? 45.203  -3.358  397.273 1.00 86.58  ? 278 GLU 1 N     1 
ATOM   2179  C  CA    . GLU A  1  278 ? 45.641  -2.774  398.539 1.00 85.11  ? 278 GLU 1 CA    1 
ATOM   2180  C  C     . GLU A  1  278 ? 44.924  -1.457  398.818 1.00 84.59  ? 278 GLU 1 C     1 
ATOM   2181  O  O     . GLU A  1  278 ? 44.268  -1.300  399.855 1.00 82.94  ? 278 GLU 1 O     1 
ATOM   2182  C  CB    . GLU A  1  278 ? 47.158  -2.563  398.531 1.00 84.28  ? 278 GLU 1 CB    1 
ATOM   2183  C  CG    . GLU A  1  278 ? 47.977  -3.795  398.187 1.00 89.36  ? 278 GLU 1 CG    1 
ATOM   2184  C  CD    . GLU A  1  278 ? 48.169  -4.721  399.369 1.00 98.60  ? 278 GLU 1 CD    1 
ATOM   2185  O  OE1   . GLU A  1  278 ? 47.160  -5.194  399.933 1.00 102.49 ? 278 GLU 1 OE1   1 
ATOM   2186  O  OE2   . GLU A  1  278 ? 49.334  -4.971  399.741 1.00 102.42 ? 278 GLU 1 OE2   1 
ATOM   2187  N  N     . TRP A  1  279 ? 45.029  -0.501  397.894 1.00 86.59  ? 279 TRP 1 N     1 
ATOM   2188  C  CA    . TRP A  1  279 ? 44.464  0.830   398.109 1.00 84.42  ? 279 TRP 1 CA    1 
ATOM   2189  C  C     . TRP A  1  279 ? 43.013  0.919   397.650 1.00 80.16  ? 279 TRP 1 C     1 
ATOM   2190  O  O     . TRP A  1  279 ? 42.112  1.136   398.462 1.00 77.90  ? 279 TRP 1 O     1 
ATOM   2191  C  CB    . TRP A  1  279 ? 45.294  1.886   397.369 1.00 89.39  ? 279 TRP 1 CB    1 
ATOM   2192  C  CG    . TRP A  1  279 ? 46.731  1.910   397.735 1.00 93.72  ? 279 TRP 1 CG    1 
ATOM   2193  C  CD1   . TRP A  1  279 ? 47.762  1.354   397.040 1.00 96.17  ? 279 TRP 1 CD1   1 
ATOM   2194  C  CD2   . TRP A  1  279 ? 47.310  2.543   398.880 1.00 96.63  ? 279 TRP 1 CD2   1 
ATOM   2195  N  NE1   . TRP A  1  279 ? 48.950  1.593   397.687 1.00 98.06  ? 279 TRP 1 NE1   1 
ATOM   2196  C  CE2   . TRP A  1  279 ? 48.698  2.321   398.820 1.00 96.69  ? 279 TRP 1 CE2   1 
ATOM   2197  C  CE3   . TRP A  1  279 ? 46.789  3.272   399.953 1.00 95.77  ? 279 TRP 1 CE3   1 
ATOM   2198  C  CZ2   . TRP A  1  279 ? 49.570  2.803   399.788 1.00 96.26  ? 279 TRP 1 CZ2   1 
ATOM   2199  C  CZ3   . TRP A  1  279 ? 47.658  3.747   400.914 1.00 95.47  ? 279 TRP 1 CZ3   1 
ATOM   2200  C  CH2   . TRP A  1  279 ? 49.032  3.511   400.825 1.00 95.08  ? 279 TRP 1 CH2   1 
ATOM   2201  N  N     . ALA A  1  280 ? 42.774  0.731   396.350 1.00 76.35  ? 280 ALA 1 N     1 
ATOM   2202  C  CA    . ALA A  1  280 ? 41.446  0.940   395.785 1.00 74.68  ? 280 ALA 1 CA    1 
ATOM   2203  C  C     . ALA A  1  280 ? 40.425  -0.087  396.253 1.00 76.74  ? 280 ALA 1 C     1 
ATOM   2204  O  O     . ALA A  1  280 ? 39.231  0.100   395.997 1.00 76.48  ? 280 ALA 1 O     1 
ATOM   2205  C  CB    . ALA A  1  280 ? 41.522  0.941   394.259 1.00 72.22  ? 280 ALA 1 CB    1 
ATOM   2206  N  N     . GLY A  1  281 ? 40.857  -1.162  396.912 1.00 82.07  ? 281 GLY 1 N     1 
ATOM   2207  C  CA    . GLY A  1  281 ? 39.934  -2.110  397.502 1.00 82.56  ? 281 GLY 1 CA    1 
ATOM   2208  C  C     . GLY A  1  281 ? 39.373  -3.153  396.565 1.00 84.17  ? 281 GLY 1 C     1 
ATOM   2209  O  O     . GLY A  1  281 ? 38.399  -3.822  396.928 1.00 82.95  ? 281 GLY 1 O     1 
ATOM   2210  N  N     . GLY A  1  282 ? 39.943  -3.315  395.374 1.00 87.72  ? 282 GLY 1 N     1 
ATOM   2211  C  CA    . GLY A  1  282 ? 39.522  -4.356  394.466 1.00 90.98  ? 282 GLY 1 CA    1 
ATOM   2212  C  C     . GLY A  1  282 ? 38.270  -3.984  393.696 1.00 97.05  ? 282 GLY 1 C     1 
ATOM   2213  O  O     . GLY A  1  282 ? 37.452  -3.175  394.147 1.00 100.92 ? 282 GLY 1 O     1 
ATOM   2214  N  N     . PRO A  1  283 ? 38.096  -4.574  392.515 1.00 100.99 ? 283 PRO 1 N     1 
ATOM   2215  C  CA    . PRO A  1  283 ? 36.962  -4.201  391.660 1.00 100.75 ? 283 PRO 1 CA    1 
ATOM   2216  C  C     . PRO A  1  283 ? 35.629  -4.653  392.242 1.00 96.66  ? 283 PRO 1 C     1 
ATOM   2217  O  O     . PRO A  1  283 ? 35.552  -5.523  393.115 1.00 94.13  ? 283 PRO 1 O     1 
ATOM   2218  C  CB    . PRO A  1  283 ? 37.260  -4.922  390.339 1.00 104.37 ? 283 PRO 1 CB    1 
ATOM   2219  C  CG    . PRO A  1  283 ? 38.743  -5.191  390.378 1.00 104.12 ? 283 PRO 1 CG    1 
ATOM   2220  C  CD    . PRO A  1  283 ? 39.054  -5.449  391.818 1.00 101.79 ? 283 PRO 1 CD    1 
ATOM   2221  N  N     . LEU A  1  284 ? 34.560  -4.039  391.727 1.00 91.74  ? 284 LEU 1 N     1 
ATOM   2222  C  CA    . LEU A  1  284 ? 33.190  -4.378  392.094 1.00 85.85  ? 284 LEU 1 CA    1 
ATOM   2223  C  C     . LEU A  1  284 ? 32.421  -5.086  390.987 1.00 84.25  ? 284 LEU 1 C     1 
ATOM   2224  O  O     . LEU A  1  284 ? 31.356  -5.653  391.258 1.00 79.11  ? 284 LEU 1 O     1 
ATOM   2225  C  CB    . LEU A  1  284 ? 32.435  -3.108  392.510 1.00 82.05  ? 284 LEU 1 CB    1 
ATOM   2226  C  CG    . LEU A  1  284 ? 33.289  -2.201  393.401 1.00 75.88  ? 284 LEU 1 CG    1 
ATOM   2227  C  CD1   . LEU A  1  284 ? 32.743  -0.787  393.410 1.00 76.59  ? 284 LEU 1 CD1   1 
ATOM   2228  C  CD2   . LEU A  1  284 ? 33.379  -2.761  394.814 1.00 72.07  ? 284 LEU 1 CD2   1 
ATOM   2229  N  N     . GLU A  1  285 ? 32.924  -5.059  389.763 1.00 85.78  ? 285 GLU 1 N     1 
ATOM   2230  C  CA    . GLU A  1  285 ? 32.368  -5.747  388.610 1.00 83.73  ? 285 GLU 1 CA    1 
ATOM   2231  C  C     . GLU A  1  285 ? 33.489  -6.534  387.953 1.00 75.91  ? 285 GLU 1 C     1 
ATOM   2232  O  O     . GLU A  1  285 ? 34.668  -6.297  388.237 1.00 77.99  ? 285 GLU 1 O     1 
ATOM   2233  C  CB    . GLU A  1  285 ? 31.757  -4.756  387.607 1.00 86.67  ? 285 GLU 1 CB    1 
ATOM   2234  C  CG    . GLU A  1  285 ? 30.430  -4.160  388.043 1.00 88.35  ? 285 GLU 1 CG    1 
ATOM   2235  C  CD    . GLU A  1  285 ? 29.251  -5.029  387.655 1.00 89.37  ? 285 GLU 1 CD    1 
ATOM   2236  O  OE1   . GLU A  1  285 ? 29.184  -5.454  386.481 1.00 88.74  ? 285 GLU 1 OE1   1 
ATOM   2237  O  OE2   . GLU A  1  285 ? 28.391  -5.287  388.522 1.00 89.97  ? 285 GLU 1 OE2   1 
ATOM   2238  N  N     . PRO A  1  286 ? 33.165  -7.495  387.088 1.00 65.36  ? 286 PRO 1 N     1 
ATOM   2239  C  CA    . PRO A  1  286 ? 34.238  -8.171  386.342 1.00 61.87  ? 286 PRO 1 CA    1 
ATOM   2240  C  C     . PRO A  1  286 ? 34.798  -7.226  385.289 1.00 54.73  ? 286 PRO 1 C     1 
ATOM   2241  O  O     . PRO A  1  286 ? 34.064  -6.737  384.428 1.00 51.81  ? 286 PRO 1 O     1 
ATOM   2242  C  CB    . PRO A  1  286 ? 33.532  -9.378  385.711 1.00 66.82  ? 286 PRO 1 CB    1 
ATOM   2243  C  CG    . PRO A  1  286 ? 32.203  -9.482  386.416 1.00 68.95  ? 286 PRO 1 CG    1 
ATOM   2244  C  CD    . PRO A  1  286 ? 31.848  -8.094  386.819 1.00 66.24  ? 286 PRO 1 CD    1 
ATOM   2245  N  N     . ILE A  1  287 ? 36.105  -6.985  385.347 1.00 55.72  ? 287 ILE 1 N     1 
ATOM   2246  C  CA    . ILE A  1  287 ? 36.739  -5.981  384.500 1.00 61.59  ? 287 ILE 1 CA    1 
ATOM   2247  C  C     . ILE A  1  287 ? 37.235  -6.655  383.232 1.00 65.81  ? 287 ILE 1 C     1 
ATOM   2248  O  O     . ILE A  1  287 ? 37.866  -7.719  383.281 1.00 71.25  ? 287 ILE 1 O     1 
ATOM   2249  C  CB    . ILE A  1  287 ? 37.886  -5.266  385.239 1.00 62.66  ? 287 ILE 1 CB    1 
ATOM   2250  C  CG1   . ILE A  1  287 ? 37.416  -3.926  385.807 1.00 72.22  ? 287 ILE 1 CG1   1 
ATOM   2251  C  CG2   . ILE A  1  287 ? 39.054  -4.991  384.308 1.00 58.86  ? 287 ILE 1 CG2   1 
ATOM   2252  C  CD1   . ILE A  1  287 ? 36.264  -4.012  386.777 1.00 78.11  ? 287 ILE 1 CD1   1 
ATOM   2253  N  N     . GLN A  1  288 ? 36.933  -6.042  382.089 1.00 64.39  ? 288 GLN 1 N     1 
ATOM   2254  C  CA    . GLN A  1  288 ? 37.414  -6.532  380.808 1.00 63.24  ? 288 GLN 1 CA    1 
ATOM   2255  C  C     . GLN A  1  288 ? 38.725  -5.888  380.402 1.00 54.81  ? 288 GLN 1 C     1 
ATOM   2256  O  O     . GLN A  1  288 ? 39.509  -6.508  379.674 1.00 57.33  ? 288 GLN 1 O     1 
ATOM   2257  C  CB    . GLN A  1  288 ? 36.372  -6.290  379.716 1.00 70.63  ? 288 GLN 1 CB    1 
ATOM   2258  C  CG    . GLN A  1  288 ? 36.105  -4.827  379.456 1.00 81.13  ? 288 GLN 1 CG    1 
ATOM   2259  C  CD    . GLN A  1  288 ? 34.936  -4.604  378.530 1.00 92.86  ? 288 GLN 1 CD    1 
ATOM   2260  O  OE1   . GLN A  1  288 ? 34.661  -5.414  377.644 1.00 98.52  ? 288 GLN 1 OE1   1 
ATOM   2261  N  NE2   . GLN A  1  288 ? 34.235  -3.500  378.733 1.00 96.14  ? 288 GLN 1 NE2   1 
ATOM   2262  N  N     . ALA A  1  289 ? 38.994  -4.668  380.864 1.00 48.23  ? 289 ALA 1 N     1 
ATOM   2263  C  CA    . ALA A  1  289 ? 40.207  -3.983  380.439 1.00 42.65  ? 289 ALA 1 CA    1 
ATOM   2264  C  C     . ALA A  1  289 ? 40.563  -2.900  381.448 1.00 43.49  ? 289 ALA 1 C     1 
ATOM   2265  O  O     . ALA A  1  289 ? 39.766  -2.530  382.312 1.00 43.58  ? 289 ALA 1 O     1 
ATOM   2266  C  CB    . ALA A  1  289 ? 40.049  -3.383  379.038 1.00 39.48  ? 289 ALA 1 CB    1 
ATOM   2267  N  N     . ILE A  1  290 ? 41.784  -2.393  381.318 1.00 41.74  ? 290 ILE 1 N     1 
ATOM   2268  C  CA    . ILE A  1  290 ? 42.295  -1.322  382.161 1.00 39.47  ? 290 ILE 1 CA    1 
ATOM   2269  C  C     . ILE A  1  290 ? 43.051  -0.350  381.269 1.00 34.76  ? 290 ILE 1 C     1 
ATOM   2270  O  O     . ILE A  1  290 ? 43.744  -0.764  380.334 1.00 30.97  ? 290 ILE 1 O     1 
ATOM   2271  C  CB    . ILE A  1  290 ? 43.202  -1.857  383.295 1.00 37.26  ? 290 ILE 1 CB    1 
ATOM   2272  C  CG1   . ILE A  1  290 ? 44.328  -2.737  382.736 1.00 32.23  ? 290 ILE 1 CG1   1 
ATOM   2273  C  CG2   . ILE A  1  290 ? 42.386  -2.613  384.339 1.00 38.87  ? 290 ILE 1 CG2   1 
ATOM   2274  C  CD1   . ILE A  1  290 ? 45.659  -2.032  382.558 1.00 24.85  ? 290 ILE 1 CD1   1 
ATOM   2275  N  N     . ILE A  1  291 ? 42.910  0.941   381.549 1.00 37.50  ? 291 ILE 1 N     1 
ATOM   2276  C  CA    . ILE A  1  291 ? 43.639  1.969   380.816 1.00 42.49  ? 291 ILE 1 CA    1 
ATOM   2277  C  C     . ILE A  1  291 ? 44.596  2.590   381.826 1.00 49.05  ? 291 ILE 1 C     1 
ATOM   2278  O  O     . ILE A  1  291 ? 44.160  3.372   382.684 1.00 48.11  ? 291 ILE 1 O     1 
ATOM   2279  C  CB    . ILE A  1  291 ? 42.684  3.003   380.205 1.00 46.10  ? 291 ILE 1 CB    1 
ATOM   2280  C  CG1   . ILE A  1  291 ? 41.625  2.309   379.353 1.00 51.55  ? 291 ILE 1 CG1   1 
ATOM   2281  C  CG2   . ILE A  1  291 ? 43.444  3.931   379.311 1.00 48.20  ? 291 ILE 1 CG2   1 
ATOM   2282  C  CD1   . ILE A  1  291 ? 40.562  3.249   378.821 1.00 56.15  ? 291 ILE 1 CD1   1 
ATOM   2283  N  N     . PRO A  1  292 ? 45.887  2.229   381.794 1.00 55.87  ? 292 PRO 1 N     1 
ATOM   2284  C  CA    . PRO A  1  292 ? 46.792  2.570   382.904 1.00 59.43  ? 292 PRO 1 CA    1 
ATOM   2285  C  C     . PRO A  1  292 ? 47.099  4.047   383.084 1.00 64.05  ? 292 PRO 1 C     1 
ATOM   2286  O  O     . PRO A  1  292 ? 46.818  4.619   384.141 1.00 68.49  ? 292 PRO 1 O     1 
ATOM   2287  C  CB    . PRO A  1  292 ? 48.073  1.796   382.554 1.00 57.73  ? 292 PRO 1 CB    1 
ATOM   2288  C  CG    . PRO A  1  292 ? 47.989  1.553   381.084 1.00 56.31  ? 292 PRO 1 CG    1 
ATOM   2289  C  CD    . PRO A  1  292 ? 46.540  1.389   380.776 1.00 57.69  ? 292 PRO 1 CD    1 
ATOM   2290  N  N     . GLY A  1  293 ? 47.674  4.676   382.063 1.00 64.95  ? 293 GLY 1 N     1 
ATOM   2291  C  CA    . GLY A  1  293 ? 48.257  5.993   382.242 1.00 69.55  ? 293 GLY 1 CA    1 
ATOM   2292  C  C     . GLY A  1  293 ? 47.247  7.108   382.391 1.00 75.26  ? 293 GLY 1 C     1 
ATOM   2293  O  O     . GLY A  1  293 ? 47.102  7.698   383.465 1.00 82.28  ? 293 GLY 1 O     1 
ATOM   2294  N  N     . GLY A  1  294 ? 46.554  7.410   381.300 1.00 71.81  ? 294 GLY 1 N     1 
ATOM   2295  C  CA    . GLY A  1  294 ? 45.458  8.355   381.286 1.00 66.40  ? 294 GLY 1 CA    1 
ATOM   2296  C  C     . GLY A  1  294 ? 44.417  7.816   380.336 1.00 60.29  ? 294 GLY 1 C     1 
ATOM   2297  O  O     . GLY A  1  294 ? 44.057  6.641   380.422 1.00 59.76  ? 294 GLY 1 O     1 
ATOM   2298  N  N     . SER A  1  295 ? 43.908  8.652   379.440 1.00 54.27  ? 295 SER 1 N     1 
ATOM   2299  C  CA    . SER A  1  295 ? 43.231  8.114   378.269 1.00 49.63  ? 295 SER 1 CA    1 
ATOM   2300  C  C     . SER A  1  295 ? 44.220  7.748   377.168 1.00 41.31  ? 295 SER 1 C     1 
ATOM   2301  O  O     . SER A  1  295 ? 43.921  6.888   376.330 1.00 30.11  ? 295 SER 1 O     1 
ATOM   2302  C  CB    . SER A  1  295 ? 42.200  9.110   377.743 1.00 52.10  ? 295 SER 1 CB    1 
ATOM   2303  O  OG    . SER A  1  295 ? 41.587  8.607   376.572 1.00 56.40  ? 295 SER 1 OG    1 
ATOM   2304  N  N     . SER A  1  296 ? 45.393  8.392   377.151 1.00 50.05  ? 296 SER 1 N     1 
ATOM   2305  C  CA    . SER A  1  296 ? 46.407  8.169   376.124 1.00 56.46  ? 296 SER 1 CA    1 
ATOM   2306  C  C     . SER A  1  296 ? 47.014  6.776   376.174 1.00 60.26  ? 296 SER 1 C     1 
ATOM   2307  O  O     . SER A  1  296 ? 47.722  6.395   375.234 1.00 58.44  ? 296 SER 1 O     1 
ATOM   2308  C  CB    . SER A  1  296 ? 47.536  9.193   376.258 1.00 57.36  ? 296 SER 1 CB    1 
ATOM   2309  O  OG    . SER A  1  296 ? 47.044  10.519  376.206 1.00 62.54  ? 296 SER 1 OG    1 
ATOM   2310  N  N     . THR A  1  297 ? 46.772  6.020   377.236 1.00 71.95  ? 297 THR 1 N     1 
ATOM   2311  C  CA    . THR A  1  297 ? 47.540  4.799   377.079 1.00 79.28  ? 297 THR 1 CA    1 
ATOM   2312  C  C     . THR A  1  297 ? 46.642  3.679   376.571 1.00 82.29  ? 297 THR 1 C     1 
ATOM   2313  O  O     . THR A  1  297 ? 45.473  3.597   376.961 1.00 76.39  ? 297 THR 1 O     1 
ATOM   2314  C  CB    . THR A  1  297 ? 48.177  4.403   378.409 1.00 84.15  ? 297 THR 1 CB    1 
ATOM   2315  O  OG1   . THR A  1  297 ? 47.155  4.164   379.383 1.00 85.09  ? 297 THR 1 OG1   1 
ATOM   2316  C  CG2   . THR A  1  297 ? 49.035  5.548   378.894 1.00 86.80  ? 297 THR 1 CG2   1 
ATOM   2317  N  N     . PRO A  1  298 ? 47.162  2.823   375.697 1.00 93.94  ? 298 PRO 1 N     1 
ATOM   2318  C  CA    . PRO A  1  298 ? 46.342  1.750   375.125 1.00 99.57  ? 298 PRO 1 CA    1 
ATOM   2319  C  C     . PRO A  1  298 ? 45.782  0.856   376.216 1.00 104.58 ? 298 PRO 1 C     1 
ATOM   2320  O  O     . PRO A  1  298 ? 46.510  0.443   377.132 1.00 111.20 ? 298 PRO 1 O     1 
ATOM   2321  C  CB    . PRO A  1  298 ? 47.334  0.990   374.232 1.00 101.50 ? 298 PRO 1 CB    1 
ATOM   2322  C  CG    . PRO A  1  298 ? 48.368  2.025   373.884 1.00 102.26 ? 298 PRO 1 CG    1 
ATOM   2323  C  CD    . PRO A  1  298 ? 48.516  2.855   375.119 1.00 98.80  ? 298 PRO 1 CD    1 
ATOM   2324  N  N     . PRO A  1  299 ? 44.485  0.549   376.164 1.00 101.49 ? 299 PRO 1 N     1 
ATOM   2325  C  CA    . PRO A  1  299 ? 43.902  -0.325  377.189 1.00 100.47 ? 299 PRO 1 CA    1 
ATOM   2326  C  C     . PRO A  1  299 ? 44.490  -1.728  377.123 1.00 91.34  ? 299 PRO 1 C     1 
ATOM   2327  O  O     . PRO A  1  299 ? 44.857  -2.226  376.056 1.00 85.99  ? 299 PRO 1 O     1 
ATOM   2328  C  CB    . PRO A  1  299 ? 42.406  -0.319  376.849 1.00 105.19 ? 299 PRO 1 CB    1 
ATOM   2329  C  CG    . PRO A  1  299 ? 42.352  0.069   375.397 1.00 103.42 ? 299 PRO 1 CG    1 
ATOM   2330  C  CD    . PRO A  1  299 ? 43.470  1.048   375.220 1.00 99.72  ? 299 PRO 1 CD    1 
ATOM   2331  N  N     . LEU A  1  300 ? 44.573  -2.366  378.287 1.00 89.03  ? 300 LEU 1 N     1 
ATOM   2332  C  CA    . LEU A  1  300 ? 45.110  -3.710  378.415 1.00 91.93  ? 300 LEU 1 CA    1 
ATOM   2333  C  C     . LEU A  1  300 ? 44.113  -4.621  379.116 1.00 92.30  ? 300 LEU 1 C     1 
ATOM   2334  O  O     . LEU A  1  300 ? 43.381  -4.176  380.006 1.00 93.13  ? 300 LEU 1 O     1 
ATOM   2335  C  CB    . LEU A  1  300 ? 46.444  -3.694  379.180 1.00 87.92  ? 300 LEU 1 CB    1 
ATOM   2336  C  CG    . LEU A  1  300 ? 47.494  -2.783  378.533 1.00 82.06  ? 300 LEU 1 CG    1 
ATOM   2337  C  CD1   . LEU A  1  300 ? 48.759  -2.708  379.371 1.00 79.55  ? 300 LEU 1 CD1   1 
ATOM   2338  C  CD2   . LEU A  1  300 ? 47.813  -3.246  377.115 1.00 81.93  ? 300 LEU 1 CD2   1 
ATOM   2339  N  N     . PRO A  1  301 ? 44.056  -5.898  378.731 1.00 92.07  ? 301 PRO 1 N     1 
ATOM   2340  C  CA    . PRO A  1  301 ? 43.090  -6.817  379.347 1.00 90.60  ? 301 PRO 1 CA    1 
ATOM   2341  C  C     . PRO A  1  301 ? 43.392  -7.031  380.823 1.00 101.91 ? 301 PRO 1 C     1 
ATOM   2342  O  O     . PRO A  1  301 ? 44.465  -6.700  381.332 1.00 100.09 ? 301 PRO 1 O     1 
ATOM   2343  C  CB    . PRO A  1  301 ? 43.261  -8.113  378.542 1.00 85.31  ? 301 PRO 1 CB    1 
ATOM   2344  C  CG    . PRO A  1  301 ? 43.927  -7.686  377.268 1.00 83.46  ? 301 PRO 1 CG    1 
ATOM   2345  C  CD    . PRO A  1  301 ? 44.821  -6.554  377.656 1.00 86.34  ? 301 PRO 1 CD    1 
ATOM   2346  N  N     . PHE A  1  302 ? 42.407  -7.586  381.526 1.00 114.17 ? 302 PHE 1 N     1 
ATOM   2347  C  CA    . PHE A  1  302 ? 42.547  -7.904  382.948 1.00 129.99 ? 302 PHE 1 CA    1 
ATOM   2348  C  C     . PHE A  1  302 ? 43.023  -9.344  383.099 1.00 139.40 ? 302 PHE 1 C     1 
ATOM   2349  O  O     . PHE A  1  302 ? 42.228  -10.272 383.250 1.00 144.14 ? 302 PHE 1 O     1 
ATOM   2350  C  CB    . PHE A  1  302 ? 41.237  -7.677  383.687 1.00 135.38 ? 302 PHE 1 CB    1 
ATOM   2351  C  CG    . PHE A  1  302 ? 41.420  -7.266  385.118 1.00 141.46 ? 302 PHE 1 CG    1 
ATOM   2352  C  CD1   . PHE A  1  302 ? 42.193  -6.164  385.438 1.00 142.26 ? 302 PHE 1 CD1   1 
ATOM   2353  C  CD2   . PHE A  1  302 ? 40.836  -7.988  386.144 1.00 144.02 ? 302 PHE 1 CD2   1 
ATOM   2354  C  CE1   . PHE A  1  302 ? 42.368  -5.781  386.752 1.00 143.98 ? 302 PHE 1 CE1   1 
ATOM   2355  C  CE2   . PHE A  1  302 ? 41.013  -7.610  387.463 1.00 144.86 ? 302 PHE 1 CE2   1 
ATOM   2356  C  CZ    . PHE A  1  302 ? 41.778  -6.505  387.765 1.00 143.89 ? 302 PHE 1 CZ    1 
ATOM   2357  N  N     . THR A  1  303 ? 44.338  -9.531  383.052 1.00 141.98 ? 303 THR 1 N     1 
ATOM   2358  C  CA    . THR A  1  303 ? 44.958  -10.844 383.128 1.00 139.59 ? 303 THR 1 CA    1 
ATOM   2359  C  C     . THR A  1  303 ? 45.968  -10.854 384.269 1.00 139.15 ? 303 THR 1 C     1 
ATOM   2360  O  O     . THR A  1  303 ? 46.470  -9.803  384.680 1.00 139.89 ? 303 THR 1 O     1 
ATOM   2361  C  CB    . THR A  1  303 ? 45.651  -11.215 381.801 1.00 138.18 ? 303 THR 1 CB    1 
ATOM   2362  O  OG1   . THR A  1  303 ? 44.795  -10.881 380.702 1.00 138.45 ? 303 THR 1 OG1   1 
ATOM   2363  C  CG2   . THR A  1  303 ? 45.955  -12.704 381.737 1.00 136.65 ? 303 THR 1 CG2   1 
ATOM   2364  N  N     . GLU A  1  304 ? 46.221  -12.043 384.822 1.00 133.81 ? 304 GLU 1 N     1 
ATOM   2365  C  CA    . GLU A  1  304 ? 47.250  -12.167 385.850 1.00 127.35 ? 304 GLU 1 CA    1 
ATOM   2366  C  C     . GLU A  1  304 ? 48.602  -11.729 385.302 1.00 118.55 ? 304 GLU 1 C     1 
ATOM   2367  O  O     . GLU A  1  304 ? 49.388  -11.080 386.004 1.00 119.44 ? 304 GLU 1 O     1 
ATOM   2368  C  CB    . GLU A  1  304 ? 47.318  -13.600 386.375 1.00 127.80 ? 304 GLU 1 CB    1 
ATOM   2369  C  CG    . GLU A  1  304 ? 46.076  -14.061 387.119 1.00 129.99 ? 304 GLU 1 CG    1 
ATOM   2370  C  CD    . GLU A  1  304 ? 45.901  -13.363 388.455 1.00 130.90 ? 304 GLU 1 CD    1 
ATOM   2371  O  OE1   . GLU A  1  304 ? 46.706  -13.617 389.374 1.00 131.73 ? 304 GLU 1 OE1   1 
ATOM   2372  O  OE2   . GLU A  1  304 ? 44.945  -12.573 388.591 1.00 130.87 ? 304 GLU 1 OE2   1 
ATOM   2373  N  N     . GLU A  1  305 ? 48.889  -12.085 384.047 1.00 107.43 ? 305 GLU 1 N     1 
ATOM   2374  C  CA    . GLU A  1  305 ? 50.066  -11.562 383.360 1.00 92.04  ? 305 GLU 1 CA    1 
ATOM   2375  C  C     . GLU A  1  305 ? 50.051  -10.040 383.309 1.00 84.59  ? 305 GLU 1 C     1 
ATOM   2376  O  O     . GLU A  1  305 ? 51.111  -9.409  383.234 1.00 83.71  ? 305 GLU 1 O     1 
ATOM   2377  C  CB    . GLU A  1  305 ? 50.116  -12.130 381.942 1.00 84.30  ? 305 GLU 1 CB    1 
ATOM   2378  C  CG    . GLU A  1  305 ? 51.425  -11.947 381.214 1.00 79.31  ? 305 GLU 1 CG    1 
ATOM   2379  C  CD    . GLU A  1  305 ? 51.258  -12.134 379.720 1.00 80.13  ? 305 GLU 1 CD    1 
ATOM   2380  O  OE1   . GLU A  1  305 ? 50.761  -11.199 379.058 1.00 80.69  ? 305 GLU 1 OE1   1 
ATOM   2381  O  OE2   . GLU A  1  305 ? 51.608  -13.218 379.208 1.00 81.15  ? 305 GLU 1 OE2   1 
ATOM   2382  N  N     . VAL A  1  306 ? 48.865  -9.437  383.340 1.00 78.25  ? 306 VAL 1 N     1 
ATOM   2383  C  CA    . VAL A  1  306 ? 48.729  -7.986  383.433 1.00 70.83  ? 306 VAL 1 CA    1 
ATOM   2384  C  C     . VAL A  1  306 ? 48.760  -7.527  384.883 1.00 63.71  ? 306 VAL 1 C     1 
ATOM   2385  O  O     . VAL A  1  306 ? 49.448  -6.565  385.228 1.00 61.42  ? 306 VAL 1 O     1 
ATOM   2386  C  CB    . VAL A  1  306 ? 47.429  -7.531  382.730 1.00 70.27  ? 306 VAL 1 CB    1 
ATOM   2387  C  CG1   . VAL A  1  306 ? 47.115  -6.080  383.066 1.00 70.72  ? 306 VAL 1 CG1   1 
ATOM   2388  C  CG2   . VAL A  1  306 ? 47.527  -7.738  381.223 1.00 70.80  ? 306 VAL 1 CG2   1 
ATOM   2389  N  N     . LEU A  1  307 ? 48.013  -8.219  385.747 1.00 64.42  ? 307 LEU 1 N     1 
ATOM   2390  C  CA    . LEU A  1  307 ? 47.929  -7.845  387.156 1.00 69.38  ? 307 LEU 1 CA    1 
ATOM   2391  C  C     . LEU A  1  307 ? 49.292  -7.820  387.834 1.00 79.59  ? 307 LEU 1 C     1 
ATOM   2392  O  O     . LEU A  1  307 ? 49.513  -7.017  388.748 1.00 81.06  ? 307 LEU 1 O     1 
ATOM   2393  C  CB    . LEU A  1  307 ? 46.981  -8.793  387.884 1.00 68.76  ? 307 LEU 1 CB    1 
ATOM   2394  C  CG    . LEU A  1  307 ? 45.528  -8.428  387.590 1.00 72.70  ? 307 LEU 1 CG    1 
ATOM   2395  C  CD1   . LEU A  1  307 ? 44.580  -9.559  387.922 1.00 75.51  ? 307 LEU 1 CD1   1 
ATOM   2396  C  CD2   . LEU A  1  307 ? 45.163  -7.180  388.369 1.00 74.98  ? 307 LEU 1 CD2   1 
ATOM   2397  N  N     . ASP A  1  308 ? 50.210  -8.688  387.422 1.00 89.45  ? 308 ASP 1 N     1 
ATOM   2398  C  CA    . ASP A  1  308 ? 51.543  -8.722  388.006 1.00 102.50 ? 308 ASP 1 CA    1 
ATOM   2399  C  C     . ASP A  1  308 ? 52.536  -7.843  387.254 1.00 105.05 ? 308 ASP 1 C     1 
ATOM   2400  O  O     . ASP A  1  308 ? 53.738  -7.906  387.532 1.00 106.27 ? 308 ASP 1 O     1 
ATOM   2401  C  CB    . ASP A  1  308 ? 52.056  -10.163 388.057 1.00 111.14 ? 308 ASP 1 CB    1 
ATOM   2402  C  CG    . ASP A  1  308 ? 51.378  -10.987 389.136 1.00 118.67 ? 308 ASP 1 CG    1 
ATOM   2403  O  OD1   . ASP A  1  308 ? 51.584  -10.686 390.331 1.00 121.01 ? 308 ASP 1 OD1   1 
ATOM   2404  O  OD2   . ASP A  1  308 ? 50.644  -11.938 388.790 1.00 120.68 ? 308 ASP 1 OD2   1 
ATOM   2405  N  N     . THR A  1  309 ? 52.063  -7.030  386.317 1.00 108.25 ? 309 THR 1 N     1 
ATOM   2406  C  CA    . THR A  1  309 ? 52.953  -6.158  385.561 1.00 109.35 ? 309 THR 1 CA    1 
ATOM   2407  C  C     . THR A  1  309 ? 53.233  -4.886  386.358 1.00 104.06 ? 309 THR 1 C     1 
ATOM   2408  O  O     . THR A  1  309 ? 52.305  -4.303  386.929 1.00 99.83  ? 309 THR 1 O     1 
ATOM   2409  C  CB    . THR A  1  309 ? 52.333  -5.817  384.204 1.00 119.18 ? 309 THR 1 CB    1 
ATOM   2410  O  OG1   . THR A  1  309 ? 52.024  -7.029  383.502 1.00 119.91 ? 309 THR 1 OG1   1 
ATOM   2411  C  CG2   . THR A  1  309 ? 53.283  -4.983  383.357 1.00 122.12 ? 309 THR 1 CG2   1 
ATOM   2412  N  N     . PRO A  1  310 ? 54.488  -4.444  386.440 1.00 99.14  ? 310 PRO 1 N     1 
ATOM   2413  C  CA    . PRO A  1  310 ? 54.803  -3.223  387.202 1.00 93.71  ? 310 PRO 1 CA    1 
ATOM   2414  C  C     . PRO A  1  310 ? 54.468  -1.964  386.410 1.00 81.74  ? 310 PRO 1 C     1 
ATOM   2415  O  O     . PRO A  1  310 ? 54.818  -1.840  385.235 1.00 79.09  ? 310 PRO 1 O     1 
ATOM   2416  C  CB    . PRO A  1  310 ? 56.313  -3.338  387.462 1.00 96.11  ? 310 PRO 1 CB    1 
ATOM   2417  C  CG    . PRO A  1  310 ? 56.717  -4.715  386.979 1.00 96.89  ? 310 PRO 1 CG    1 
ATOM   2418  C  CD    . PRO A  1  310 ? 55.699  -5.146  385.986 1.00 98.82  ? 310 PRO 1 CD    1 
ATOM   2419  N  N     . MET A  1  311 ? 53.768  -1.035  387.057 1.00 73.21  ? 311 MET 1 N     1 
ATOM   2420  C  CA    . MET A  1  311 ? 53.471  0.264   386.456 1.00 66.90  ? 311 MET 1 CA    1 
ATOM   2421  C  C     . MET A  1  311 ? 54.726  1.125   386.481 1.00 72.16  ? 311 MET 1 C     1 
ATOM   2422  O  O     . MET A  1  311 ? 55.190  1.521   387.553 1.00 76.58  ? 311 MET 1 O     1 
ATOM   2423  C  CB    . MET A  1  311 ? 52.343  0.957   387.209 1.00 58.30  ? 311 MET 1 CB    1 
ATOM   2424  C  CG    . MET A  1  311 ? 51.187  0.067   387.560 1.00 54.85  ? 311 MET 1 CG    1 
ATOM   2425  S  SD    . MET A  1  311 ? 50.082  0.950   388.663 1.00 50.50  ? 311 MET 1 SD    1 
ATOM   2426  C  CE    . MET A  1  311 ? 49.155  1.928   387.487 1.00 49.61  ? 311 MET 1 CE    1 
ATOM   2427  N  N     . SER A  1  312 ? 55.281  1.416   385.309 1.00 73.81  ? 312 SER 1 N     1 
ATOM   2428  C  CA    . SER A  1  312 ? 56.459  2.270   385.223 1.00 74.70  ? 312 SER 1 CA    1 
ATOM   2429  C  C     . SER A  1  312 ? 56.552  2.840   383.815 1.00 73.96  ? 312 SER 1 C     1 
ATOM   2430  O  O     . SER A  1  312 ? 55.745  2.524   382.935 1.00 73.68  ? 312 SER 1 O     1 
ATOM   2431  C  CB    . SER A  1  312 ? 57.734  1.505   385.584 1.00 74.79  ? 312 SER 1 CB    1 
ATOM   2432  O  OG    . SER A  1  312 ? 58.153  0.701   384.497 1.00 73.15  ? 312 SER 1 OG    1 
ATOM   2433  N  N     . TYR A  1  313 ? 57.560  3.691   383.609 1.00 70.94  ? 313 TYR 1 N     1 
ATOM   2434  C  CA    . TYR A  1  313 ? 57.821  4.275   382.300 1.00 63.72  ? 313 TYR 1 CA    1 
ATOM   2435  C  C     . TYR A  1  313 ? 58.384  3.277   381.302 1.00 63.78  ? 313 TYR 1 C     1 
ATOM   2436  O  O     . TYR A  1  313 ? 58.488  3.610   380.116 1.00 67.91  ? 313 TYR 1 O     1 
ATOM   2437  C  CB    . TYR A  1  313 ? 58.817  5.429   382.429 1.00 56.61  ? 313 TYR 1 CB    1 
ATOM   2438  C  CG    . TYR A  1  313 ? 58.221  6.745   382.851 1.00 55.62  ? 313 TYR 1 CG    1 
ATOM   2439  C  CD1   . TYR A  1  313 ? 56.865  6.871   383.112 1.00 55.77  ? 313 TYR 1 CD1   1 
ATOM   2440  C  CD2   . TYR A  1  313 ? 59.017  7.872   382.972 1.00 57.16  ? 313 TYR 1 CD2   1 
ATOM   2441  C  CE1   . TYR A  1  313 ? 56.324  8.087   383.493 1.00 58.92  ? 313 TYR 1 CE1   1 
ATOM   2442  C  CE2   . TYR A  1  313 ? 58.486  9.088   383.349 1.00 57.54  ? 313 TYR 1 CE2   1 
ATOM   2443  C  CZ    . TYR A  1  313 ? 57.142  9.192   383.609 1.00 59.50  ? 313 TYR 1 CZ    1 
ATOM   2444  O  OH    . TYR A  1  313 ? 56.622  10.410  383.985 1.00 60.94  ? 313 TYR 1 OH    1 
ATOM   2445  N  N     . GLU A  1  314 ? 58.744  2.076   381.737 1.00 57.00  ? 314 GLU 1 N     1 
ATOM   2446  C  CA    . GLU A  1  314 ? 59.385  1.111   380.853 1.00 53.86  ? 314 GLU 1 CA    1 
ATOM   2447  C  C     . GLU A  1  314 ? 58.608  -0.185  380.696 1.00 60.30  ? 314 GLU 1 C     1 
ATOM   2448  O  O     . GLU A  1  314 ? 58.534  -0.710  379.581 1.00 59.07  ? 314 GLU 1 O     1 
ATOM   2449  C  CB    . GLU A  1  314 ? 60.818  0.821   381.329 1.00 48.97  ? 314 GLU 1 CB    1 
ATOM   2450  C  CG    . GLU A  1  314 ? 61.003  0.775   382.834 1.00 45.38  ? 314 GLU 1 CG    1 
ATOM   2451  C  CD    . GLU A  1  314 ? 62.434  1.089   383.239 1.00 38.92  ? 314 GLU 1 CD    1 
ATOM   2452  O  OE1   . GLU A  1  314 ? 63.364  0.692   382.507 1.00 37.00  ? 314 GLU 1 OE1   1 
ATOM   2453  O  OE2   . GLU A  1  314 ? 62.631  1.734   384.286 1.00 36.38  ? 314 GLU 1 OE2   1 
ATOM   2454  N  N     . HIS A  1  315 ? 58.028  -0.724  381.773 1.00 72.24  ? 315 HIS 1 N     1 
ATOM   2455  C  CA    . HIS A  1  315 ? 57.337  -2.007  381.655 1.00 81.75  ? 315 HIS 1 CA    1 
ATOM   2456  C  C     . HIS A  1  315 ? 56.134  -1.894  380.727 1.00 85.36  ? 315 HIS 1 C     1 
ATOM   2457  O  O     . HIS A  1  315 ? 55.814  -2.839  379.996 1.00 82.41  ? 315 HIS 1 O     1 
ATOM   2458  C  CB    . HIS A  1  315 ? 56.906  -2.514  383.030 1.00 89.32  ? 315 HIS 1 CB    1 
ATOM   2459  C  CG    . HIS A  1  315 ? 58.021  -2.595  384.025 1.00 89.92  ? 315 HIS 1 CG    1 
ATOM   2460  N  ND1   . HIS A  1  315 ? 58.540  -1.484  384.654 1.00 97.00  ? 315 HIS 1 ND1   1 
ATOM   2461  C  CD2   . HIS A  1  315 ? 58.725  -3.654  384.492 1.00 96.70  ? 315 HIS 1 CD2   1 
ATOM   2462  C  CE1   . HIS A  1  315 ? 59.509  -1.855  385.472 1.00 93.18  ? 315 HIS 1 CE1   1 
ATOM   2463  N  NE2   . HIS A  1  315 ? 59.641  -3.167  385.392 1.00 95.88  ? 315 HIS 1 NE2   1 
ATOM   2464  N  N     . LEU A  1  316 ? 55.455  -0.747  380.743 1.00 90.19  ? 316 LEU 1 N     1 
ATOM   2465  C  CA    . LEU A  1  316 ? 54.332  -0.555  379.835 1.00 92.49  ? 316 LEU 1 CA    1 
ATOM   2466  C  C     . LEU A  1  316 ? 54.832  -0.304  378.420 1.00 95.44  ? 316 LEU 1 C     1 
ATOM   2467  O  O     . LEU A  1  316 ? 54.267  -0.828  377.454 1.00 94.72  ? 316 LEU 1 O     1 
ATOM   2468  C  CB    . LEU A  1  316 ? 53.455  0.608   380.304 1.00 93.30  ? 316 LEU 1 CB    1 
ATOM   2469  C  CG    . LEU A  1  316 ? 52.473  0.325   381.439 1.00 94.20  ? 316 LEU 1 CG    1 
ATOM   2470  C  CD1   . LEU A  1  316 ? 52.234  1.582   382.260 1.00 95.07  ? 316 LEU 1 CD1   1 
ATOM   2471  C  CD2   . LEU A  1  316 ? 51.164  -0.226  380.893 1.00 95.46  ? 316 LEU 1 CD2   1 
ATOM   2472  N  N     . GLN A  1  317 ? 55.888  0.506   378.295 1.00 95.66  ? 317 GLN 1 N     1 
ATOM   2473  C  CA    . GLN A  1  317 ? 56.550  0.715   377.012 1.00 96.53  ? 317 GLN 1 CA    1 
ATOM   2474  C  C     . GLN A  1  317 ? 56.915  -0.610  376.352 1.00 93.06  ? 317 GLN 1 C     1 
ATOM   2475  O  O     . GLN A  1  317 ? 56.559  -0.861  375.195 1.00 91.25  ? 317 GLN 1 O     1 
ATOM   2476  C  CB    . GLN A  1  317 ? 57.793  1.587   377.217 1.00 101.24 ? 317 GLN 1 CB    1 
ATOM   2477  C  CG    . GLN A  1  317 ? 58.855  1.439   376.142 1.00 107.11 ? 317 GLN 1 CG    1 
ATOM   2478  C  CD    . GLN A  1  317 ? 58.487  2.162   374.864 1.00 113.45 ? 317 GLN 1 CD    1 
ATOM   2479  O  OE1   . GLN A  1  317 ? 57.775  3.165   374.887 1.00 118.21 ? 317 GLN 1 OE1   1 
ATOM   2480  N  NE2   . GLN A  1  317 ? 58.967  1.649   373.736 1.00 113.94 ? 317 GLN 1 NE2   1 
ATOM   2481  N  N     . ALA A  1  318 ? 57.619  -1.479  377.084 1.00 92.32  ? 318 ALA 1 N     1 
ATOM   2482  C  CA    . ALA A  1  318 ? 57.992  -2.797  376.579 1.00 90.91  ? 318 ALA 1 CA    1 
ATOM   2483  C  C     . ALA A  1  318 ? 56.799  -3.730  376.417 1.00 92.68  ? 318 ALA 1 C     1 
ATOM   2484  O  O     . ALA A  1  318 ? 56.972  -4.845  375.912 1.00 93.26  ? 318 ALA 1 O     1 
ATOM   2485  C  CB    . ALA A  1  318 ? 59.033  -3.437  377.500 1.00 88.43  ? 318 ALA 1 CB    1 
ATOM   2486  N  N     . LYS A  1  319 ? 55.604  -3.307  376.831 1.00 92.89  ? 319 LYS 1 N     1 
ATOM   2487  C  CA    . LYS A  1  319 ? 54.365  -4.026  376.566 1.00 92.91  ? 319 LYS 1 CA    1 
ATOM   2488  C  C     . LYS A  1  319 ? 53.508  -3.338  375.509 1.00 98.55  ? 319 LYS 1 C     1 
ATOM   2489  O  O     . LYS A  1  319 ? 52.386  -3.785  375.247 1.00 99.28  ? 319 LYS 1 O     1 
ATOM   2490  C  CB    . LYS A  1  319 ? 53.570  -4.191  377.864 1.00 87.32  ? 319 LYS 1 CB    1 
ATOM   2491  C  CG    . LYS A  1  319 ? 52.621  -5.384  377.893 1.00 81.21  ? 319 LYS 1 CG    1 
ATOM   2492  C  CD    . LYS A  1  319 ? 53.367  -6.709  377.951 1.00 72.70  ? 319 LYS 1 CD    1 
ATOM   2493  C  CE    . LYS A  1  319 ? 52.409  -7.883  377.798 1.00 64.16  ? 319 LYS 1 CE    1 
ATOM   2494  N  NZ    . LYS A  1  319 ? 53.101  -9.127  377.369 1.00 61.49  ? 319 LYS 1 NZ    1 
ATOM   2495  N  N     . GLY A  1  320 ? 54.012  -2.275  374.883 1.00 102.75 ? 320 GLY 1 N     1 
ATOM   2496  C  CA    . GLY A  1  320 ? 53.284  -1.549  373.868 1.00 107.18 ? 320 GLY 1 CA    1 
ATOM   2497  C  C     . GLY A  1  320 ? 52.516  -0.346  374.381 1.00 109.64 ? 320 GLY 1 C     1 
ATOM   2498  O  O     . GLY A  1  320 ? 52.259  0.588   373.612 1.00 110.66 ? 320 GLY 1 O     1 
ATOM   2499  N  N     . SER A  1  321 ? 52.148  -0.341  375.658 1.00 114.19 ? 321 SER 1 N     1 
ATOM   2500  C  CA    . SER A  1  321 ? 51.430  0.773   376.255 1.00 115.70 ? 321 SER 1 CA    1 
ATOM   2501  C  C     . SER A  1  321 ? 52.434  1.770   376.829 1.00 119.05 ? 321 SER 1 C     1 
ATOM   2502  O  O     . SER A  1  321 ? 53.632  1.714   376.546 1.00 115.11 ? 321 SER 1 O     1 
ATOM   2503  C  CB    . SER A  1  321 ? 50.453  0.265   377.314 1.00 115.76 ? 321 SER 1 CB    1 
ATOM   2504  O  OG    . SER A  1  321 ? 49.531  1.274   377.691 1.00 114.28 ? 321 SER 1 OG    1 
ATOM   2505  N  N     . MET A  1  322 ? 51.946  2.720   377.621 1.00 122.06 ? 322 MET 1 N     1 
ATOM   2506  C  CA    . MET A  1  322 ? 52.804  3.688   378.289 1.00 122.14 ? 322 MET 1 CA    1 
ATOM   2507  C  C     . MET A  1  322 ? 52.152  4.084   379.608 1.00 121.32 ? 322 MET 1 C     1 
ATOM   2508  O  O     . MET A  1  322 ? 51.064  3.613   379.954 1.00 122.29 ? 322 MET 1 O     1 
ATOM   2509  C  CB    . MET A  1  322 ? 53.069  4.901   377.392 1.00 116.42 ? 322 MET 1 CB    1 
ATOM   2510  C  CG    . MET A  1  322 ? 51.829  5.485   376.757 1.00 110.61 ? 322 MET 1 CG    1 
ATOM   2511  S  SD    . MET A  1  322 ? 52.208  6.354   375.229 1.00 108.61 ? 322 MET 1 SD    1 
ATOM   2512  C  CE    . MET A  1  322 ? 52.370  4.979   374.092 1.00 106.21 ? 322 MET 1 CE    1 
ATOM   2513  N  N     . LEU A  1  323 ? 52.857  4.910   380.375 1.00 121.77 ? 323 LEU 1 N     1 
ATOM   2514  C  CA    . LEU A  1  323 ? 52.333  5.472   381.617 1.00 120.29 ? 323 LEU 1 CA    1 
ATOM   2515  C  C     . LEU A  1  323 ? 52.342  6.992   381.473 1.00 113.50 ? 323 LEU 1 C     1 
ATOM   2516  O  O     . LEU A  1  323 ? 53.367  7.638   381.716 1.00 114.19 ? 323 LEU 1 O     1 
ATOM   2517  C  CB    . LEU A  1  323 ? 53.152  5.018   382.820 1.00 127.86 ? 323 LEU 1 CB    1 
ATOM   2518  C  CG    . LEU A  1  323 ? 52.540  5.414   384.162 1.00 132.31 ? 323 LEU 1 CG    1 
ATOM   2519  C  CD1   . LEU A  1  323 ? 51.199  4.724   384.328 1.00 133.82 ? 323 LEU 1 CD1   1 
ATOM   2520  C  CD2   . LEU A  1  323 ? 53.471  5.082   385.315 1.00 139.57 ? 323 LEU 1 CD2   1 
ATOM   2521  N  N     . GLY A  1  324 ? 51.207  7.560   381.072 1.00 103.02 ? 324 GLY 1 N     1 
ATOM   2522  C  CA    . GLY A  1  324 ? 51.111  8.996   380.900 1.00 89.44  ? 324 GLY 1 CA    1 
ATOM   2523  C  C     . GLY A  1  324 ? 51.012  9.763   382.203 1.00 74.49  ? 324 GLY 1 C     1 
ATOM   2524  O  O     . GLY A  1  324 ? 51.935  10.495  382.574 1.00 68.84  ? 324 GLY 1 O     1 
ATOM   2525  N  N     . THR A  1  325 ? 49.897  9.591   382.916 1.00 66.91  ? 325 THR 1 N     1 
ATOM   2526  C  CA    . THR A  1  325 ? 49.647  10.298  384.165 1.00 61.64  ? 325 THR 1 CA    1 
ATOM   2527  C  C     . THR A  1  325 ? 49.475  9.362   385.352 1.00 61.55  ? 325 THR 1 C     1 
ATOM   2528  O  O     . THR A  1  325 ? 49.327  9.842   386.483 1.00 60.03  ? 325 THR 1 O     1 
ATOM   2529  C  CB    . THR A  1  325 ? 48.395  11.183  384.044 1.00 55.58  ? 325 THR 1 CB    1 
ATOM   2530  O  OG1   . THR A  1  325 ? 47.356  10.464  383.371 1.00 50.39  ? 325 THR 1 OG1   1 
ATOM   2531  C  CG2   . THR A  1  325 ? 48.704  12.439  383.254 1.00 58.66  ? 325 THR 1 CG2   1 
ATOM   2532  N  N     . GLY A  1  326 ? 49.507  8.046   385.132 1.00 60.35  ? 326 GLY 1 N     1 
ATOM   2533  C  CA    . GLY A  1  326 ? 49.199  7.075   386.161 1.00 54.76  ? 326 GLY 1 CA    1 
ATOM   2534  C  C     . GLY A  1  326 ? 47.739  7.004   386.540 1.00 48.89  ? 326 GLY 1 C     1 
ATOM   2535  O  O     . GLY A  1  326 ? 47.389  6.250   387.455 1.00 42.03  ? 326 GLY 1 O     1 
ATOM   2536  N  N     . GLY A  1  327 ? 46.875  7.746   385.851 1.00 51.86  ? 327 GLY 1 N     1 
ATOM   2537  C  CA    . GLY A  1  327 ? 45.459  7.736   386.144 1.00 52.02  ? 327 GLY 1 CA    1 
ATOM   2538  C  C     . GLY A  1  327 ? 44.770  6.595   385.440 1.00 54.34  ? 327 GLY 1 C     1 
ATOM   2539  O  O     . GLY A  1  327 ? 44.397  6.687   384.266 1.00 48.58  ? 327 GLY 1 O     1 
ATOM   2540  N  N     . VAL A  1  328 ? 44.576  5.520   386.181 1.00 65.65  ? 328 VAL 1 N     1 
ATOM   2541  C  CA    . VAL A  1  328 ? 44.016  4.293   385.638 1.00 74.51  ? 328 VAL 1 CA    1 
ATOM   2542  C  C     . VAL A  1  328 ? 42.508  4.451   385.554 1.00 83.73  ? 328 VAL 1 C     1 
ATOM   2543  O  O     . VAL A  1  328 ? 41.887  5.105   386.398 1.00 81.85  ? 328 VAL 1 O     1 
ATOM   2544  C  CB    . VAL A  1  328 ? 44.406  3.081   386.506 1.00 68.37  ? 328 VAL 1 CB    1 
ATOM   2545  C  CG1   . VAL A  1  328 ? 44.144  1.777   385.760 1.00 63.81  ? 328 VAL 1 CG1   1 
ATOM   2546  C  CG2   . VAL A  1  328 ? 45.861  3.171   386.939 1.00 67.37  ? 328 VAL 1 CG2   1 
ATOM   2547  N  N     . ILE A  1  329 ? 41.923  3.905   384.497 1.00 93.86  ? 329 ILE 1 N     1 
ATOM   2548  C  CA    . ILE A  1  329 ? 40.475  3.801   384.368 1.00 99.94  ? 329 ILE 1 CA    1 
ATOM   2549  C  C     . ILE A  1  329 ? 40.138  2.338   384.125 1.00 101.86 ? 329 ILE 1 C     1 
ATOM   2550  O  O     . ILE A  1  329 ? 40.665  1.720   383.193 1.00 102.98 ? 329 ILE 1 O     1 
ATOM   2551  C  CB    . ILE A  1  329 ? 39.930  4.698   383.240 1.00 102.92 ? 329 ILE 1 CB    1 
ATOM   2552  C  CG1   . ILE A  1  329 ? 40.437  6.134   383.412 1.00 100.03 ? 329 ILE 1 CG1   1 
ATOM   2553  C  CG2   . ILE A  1  329 ? 38.409  4.675   383.228 1.00 102.57 ? 329 ILE 1 CG2   1 
ATOM   2554  C  CD1   . ILE A  1  329 ? 40.021  7.074   382.300 1.00 99.69  ? 329 ILE 1 CD1   1 
ATOM   2555  N  N     . LEU A  1  330 ? 39.272  1.784   384.966 1.00 102.31 ? 330 LEU 1 N     1 
ATOM   2556  C  CA    . LEU A  1  330 ? 38.902  0.379   384.855 1.00 103.11 ? 330 LEU 1 CA    1 
ATOM   2557  C  C     . LEU A  1  330 ? 37.650  0.246   383.996 1.00 109.36 ? 330 LEU 1 C     1 
ATOM   2558  O  O     . LEU A  1  330 ? 36.681  0.984   384.191 1.00 115.09 ? 330 LEU 1 O     1 
ATOM   2559  C  CB    . LEU A  1  330 ? 38.674  -0.218  386.242 1.00 102.85 ? 330 LEU 1 CB    1 
ATOM   2560  C  CG    . LEU A  1  330 ? 39.644  0.308   387.304 1.00 103.84 ? 330 LEU 1 CG    1 
ATOM   2561  C  CD1   . LEU A  1  330 ? 39.307  -0.254  388.673 1.00 108.37 ? 330 LEU 1 CD1   1 
ATOM   2562  C  CD2   . LEU A  1  330 ? 41.083  -0.023  386.924 1.00 104.32 ? 330 LEU 1 CD2   1 
ATOM   2563  N  N     . ILE A  1  331 ? 37.671  -0.686  383.048 1.00 107.03 ? 331 ILE 1 N     1 
ATOM   2564  C  CA    . ILE A  1  331 ? 36.548  -0.942  382.155 1.00 106.42 ? 331 ILE 1 CA    1 
ATOM   2565  C  C     . ILE A  1  331 ? 36.008  -2.335  382.469 1.00 105.08 ? 331 ILE 1 C     1 
ATOM   2566  O  O     . ILE A  1  331 ? 36.707  -3.337  382.237 1.00 107.81 ? 331 ILE 1 O     1 
ATOM   2567  C  CB    . ILE A  1  331 ? 36.962  -0.829  380.682 1.00 107.50 ? 331 ILE 1 CB    1 
ATOM   2568  C  CG1   . ILE A  1  331 ? 37.806  0.427   380.465 1.00 107.97 ? 331 ILE 1 CG1   1 
ATOM   2569  C  CG2   . ILE A  1  331 ? 35.735  -0.828  379.784 1.00 107.63 ? 331 ILE 1 CG2   1 
ATOM   2570  C  CD1   . ILE A  1  331 ? 37.937  0.828   379.019 1.00 109.14 ? 331 ILE 1 CD1   1 
ATOM   2571  N  N     . PRO A  1  332 ? 34.787  -2.449  382.984 1.00 103.65 ? 332 PRO 1 N     1 
ATOM   2572  C  CA    . PRO A  1  332 ? 34.206  -3.766  383.253 1.00 110.17 ? 332 PRO 1 CA    1 
ATOM   2573  C  C     . PRO A  1  332 ? 33.631  -4.402  381.993 1.00 113.44 ? 332 PRO 1 C     1 
ATOM   2574  O  O     . PRO A  1  332 ? 33.375  -3.741  380.985 1.00 112.38 ? 332 PRO 1 O     1 
ATOM   2575  C  CB    . PRO A  1  332 ? 33.100  -3.457  384.269 1.00 110.29 ? 332 PRO 1 CB    1 
ATOM   2576  C  CG    . PRO A  1  332 ? 32.698  -2.058  383.943 1.00 105.55 ? 332 PRO 1 CG    1 
ATOM   2577  C  CD    . PRO A  1  332 ? 33.955  -1.355  383.517 1.00 101.71 ? 332 PRO 1 CD    1 
ATOM   2578  N  N     . GLU A  1  333 ? 33.421  -5.722  382.077 1.00 115.66 ? 333 GLU 1 N     1 
ATOM   2579  C  CA    . GLU A  1  333 ? 32.939  -6.477  380.922 1.00 114.49 ? 333 GLU 1 CA    1 
ATOM   2580  C  C     . GLU A  1  333 ? 31.520  -6.096  380.521 1.00 117.14 ? 333 GLU 1 C     1 
ATOM   2581  O  O     . GLU A  1  333 ? 31.177  -6.179  379.336 1.00 117.91 ? 333 GLU 1 O     1 
ATOM   2582  C  CB    . GLU A  1  333 ? 32.997  -7.980  381.195 1.00 112.05 ? 333 GLU 1 CB    1 
ATOM   2583  C  CG    . GLU A  1  333 ? 34.355  -8.504  381.601 1.00 112.38 ? 333 GLU 1 CG    1 
ATOM   2584  C  CD    . GLU A  1  333 ? 34.253  -9.786  382.395 1.00 115.74 ? 333 GLU 1 CD    1 
ATOM   2585  O  OE1   . GLU A  1  333 ? 33.116  -10.232 382.653 1.00 117.18 ? 333 GLU 1 OE1   1 
ATOM   2586  O  OE2   . GLU A  1  333 ? 35.306  -10.348 382.762 1.00 117.54 ? 333 GLU 1 OE2   1 
ATOM   2587  N  N     . ARG A  1  334 ? 30.682  -5.689  381.478 1.00 115.35 ? 334 ARG 1 N     1 
ATOM   2588  C  CA    . ARG A  1  334 ? 29.273  -5.460  381.172 1.00 113.26 ? 334 ARG 1 CA    1 
ATOM   2589  C  C     . ARG A  1  334 ? 29.065  -4.329  380.170 1.00 109.77 ? 334 ARG 1 C     1 
ATOM   2590  O  O     . ARG A  1  334 ? 27.970  -4.215  379.609 1.00 110.70 ? 334 ARG 1 O     1 
ATOM   2591  C  CB    . ARG A  1  334 ? 28.487  -5.176  382.456 1.00 107.79 ? 334 ARG 1 CB    1 
ATOM   2592  C  CG    . ARG A  1  334 ? 26.988  -5.431  382.320 1.00 104.01 ? 334 ARG 1 CG    1 
ATOM   2593  C  CD    . ARG A  1  334 ? 26.318  -5.622  383.670 1.00 100.62 ? 334 ARG 1 CD    1 
ATOM   2594  N  NE    . ARG A  1  334 ? 26.602  -4.522  384.581 1.00 97.94  ? 334 ARG 1 NE    1 
ATOM   2595  C  CZ    . ARG A  1  334 ? 25.754  -3.528  384.831 1.00 96.02  ? 334 ARG 1 CZ    1 
ATOM   2596  N  NH1   . ARG A  1  334 ? 24.565  -3.505  384.241 1.00 94.91  ? 334 ARG 1 NH1   1 
ATOM   2597  N  NH2   . ARG A  1  334 ? 26.092  -2.561  385.672 1.00 99.18  ? 334 ARG 1 NH2   1 
ATOM   2598  N  N     . VAL A  1  335 ? 30.081  -3.506  379.923 1.00 107.86 ? 335 VAL 1 N     1 
ATOM   2599  C  CA    . VAL A  1  335 ? 30.049  -2.489  378.879 1.00 105.31 ? 335 VAL 1 CA    1 
ATOM   2600  C  C     . VAL A  1  335 ? 31.067  -2.884  377.820 1.00 101.16 ? 335 VAL 1 C     1 
ATOM   2601  O  O     . VAL A  1  335 ? 32.245  -3.092  378.132 1.00 98.89  ? 335 VAL 1 O     1 
ATOM   2602  C  CB    . VAL A  1  335 ? 30.349  -1.087  379.439 1.00 109.08 ? 335 VAL 1 CB    1 
ATOM   2603  C  CG1   . VAL A  1  335 ? 30.416  -0.067  378.308 1.00 109.73 ? 335 VAL 1 CG1   1 
ATOM   2604  C  CG2   . VAL A  1  335 ? 29.295  -0.686  380.461 1.00 110.02 ? 335 VAL 1 CG2   1 
ATOM   2605  N  N     . SER A  1  336 ? 30.618  -2.982  376.573 1.00 97.57  ? 336 SER 1 N     1 
ATOM   2606  C  CA    . SER A  1  336 ? 31.478  -3.444  375.493 1.00 94.43  ? 336 SER 1 CA    1 
ATOM   2607  C  C     . SER A  1  336 ? 32.479  -2.365  375.093 1.00 89.21  ? 336 SER 1 C     1 
ATOM   2608  O  O     . SER A  1  336 ? 32.158  -1.173  375.084 1.00 87.73  ? 336 SER 1 O     1 
ATOM   2609  C  CB    . SER A  1  336 ? 30.640  -3.855  374.282 1.00 97.77  ? 336 SER 1 CB    1 
ATOM   2610  O  OG    . SER A  1  336 ? 31.451  -4.425  373.269 1.00 100.63 ? 336 SER 1 OG    1 
ATOM   2611  N  N     . MET A  1  337 ? 33.704  -2.802  374.778 1.00 86.51  ? 337 MET 1 N     1 
ATOM   2612  C  CA    . MET A  1  337 ? 34.763  -1.903  374.319 1.00 84.44  ? 337 MET 1 CA    1 
ATOM   2613  C  C     . MET A  1  337 ? 34.297  -0.942  373.234 1.00 84.05  ? 337 MET 1 C     1 
ATOM   2614  O  O     . MET A  1  337 ? 34.855  0.157   373.101 1.00 82.55  ? 337 MET 1 O     1 
ATOM   2615  C  CB    . MET A  1  337 ? 35.954  -2.713  373.807 1.00 80.70  ? 337 MET 1 CB    1 
ATOM   2616  C  CG    . MET A  1  337 ? 37.121  -2.763  374.762 1.00 77.11  ? 337 MET 1 CG    1 
ATOM   2617  S  SD    . MET A  1  337 ? 38.158  -1.310  374.521 1.00 74.96  ? 337 MET 1 SD    1 
ATOM   2618  C  CE    . MET A  1  337 ? 38.897  -1.151  376.143 1.00 77.40  ? 337 MET 1 CE    1 
ATOM   2619  N  N     . VAL A  1  338 ? 33.315  -1.349  372.424 1.00 86.88  ? 338 VAL 1 N     1 
ATOM   2620  C  CA    . VAL A  1  338 ? 32.837  -0.492  371.342 1.00 89.33  ? 338 VAL 1 CA    1 
ATOM   2621  C  C     . VAL A  1  338 ? 32.414  0.862   371.897 1.00 92.46  ? 338 VAL 1 C     1 
ATOM   2622  O  O     . VAL A  1  338 ? 32.827  1.912   371.399 1.00 93.00  ? 338 VAL 1 O     1 
ATOM   2623  C  CB    . VAL A  1  338 ? 31.687  -1.173  370.578 1.00 90.53  ? 338 VAL 1 CB    1 
ATOM   2624  C  CG1   . VAL A  1  338 ? 31.064  -0.196  369.590 1.00 93.11  ? 338 VAL 1 CG1   1 
ATOM   2625  C  CG2   . VAL A  1  338 ? 32.183  -2.424  369.862 1.00 88.54  ? 338 VAL 1 CG2   1 
ATOM   2626  N  N     . ASP A  1  339 ? 31.600  0.851   372.956 1.00 92.06  ? 339 ASP 1 N     1 
ATOM   2627  C  CA    . ASP A  1  339 ? 31.131  2.099   373.551 1.00 93.01  ? 339 ASP 1 CA    1 
ATOM   2628  C  C     . ASP A  1  339 ? 32.262  2.874   374.224 1.00 82.07  ? 339 ASP 1 C     1 
ATOM   2629  O  O     . ASP A  1  339 ? 32.266  4.112   374.204 1.00 80.97  ? 339 ASP 1 O     1 
ATOM   2630  C  CB    . ASP A  1  339 ? 30.011  1.805   374.547 1.00 101.53 ? 339 ASP 1 CB    1 
ATOM   2631  C  CG    . ASP A  1  339 ? 29.335  3.059   375.046 1.00 110.00 ? 339 ASP 1 CG    1 
ATOM   2632  O  OD1   . ASP A  1  339 ? 28.766  3.804   374.218 1.00 113.45 ? 339 ASP 1 OD1   1 
ATOM   2633  O  OD2   . ASP A  1  339 ? 29.366  3.294   376.270 1.00 111.44 ? 339 ASP 1 OD2   1 
ATOM   2634  N  N     . ALA A  1  340 ? 33.228  2.170   374.818 1.00 73.99  ? 340 ALA 1 N     1 
ATOM   2635  C  CA    . ALA A  1  340 ? 34.356  2.845   375.455 1.00 67.81  ? 340 ALA 1 CA    1 
ATOM   2636  C  C     . ALA A  1  340 ? 35.159  3.645   374.436 1.00 68.26  ? 340 ALA 1 C     1 
ATOM   2637  O  O     . ALA A  1  340 ? 35.418  4.841   374.627 1.00 71.15  ? 340 ALA 1 O     1 
ATOM   2638  C  CB    . ALA A  1  340 ? 35.245  1.824   376.164 1.00 67.69  ? 340 ALA 1 CB    1 
ATOM   2639  N  N     . MET A  1  341 ? 35.570  2.999   373.344 1.00 67.63  ? 341 MET 1 N     1 
ATOM   2640  C  CA    . MET A  1  341 ? 36.332  3.716   372.328 1.00 74.64  ? 341 MET 1 CA    1 
ATOM   2641  C  C     . MET A  1  341 ? 35.453  4.699   371.565 1.00 80.21  ? 341 MET 1 C     1 
ATOM   2642  O  O     . MET A  1  341 ? 35.952  5.715   371.066 1.00 83.32  ? 341 MET 1 O     1 
ATOM   2643  C  CB    . MET A  1  341 ? 37.002  2.724   371.383 1.00 79.96  ? 341 MET 1 CB    1 
ATOM   2644  C  CG    . MET A  1  341 ? 37.564  1.522   372.105 1.00 86.00  ? 341 MET 1 CG    1 
ATOM   2645  S  SD    . MET A  1  341 ? 38.469  2.031   373.578 1.00 88.20  ? 341 MET 1 SD    1 
ATOM   2646  C  CE    . MET A  1  341 ? 39.975  2.663   372.846 1.00 87.04  ? 341 MET 1 CE    1 
ATOM   2647  N  N     . TRP A  1  342 ? 34.151  4.420   371.479 1.00 87.06  ? 342 TRP 1 N     1 
ATOM   2648  C  CA    . TRP A  1  342 ? 33.176  5.398   371.017 1.00 97.70  ? 342 TRP 1 CA    1 
ATOM   2649  C  C     . TRP A  1  342 ? 33.347  6.709   371.772 1.00 99.60  ? 342 TRP 1 C     1 
ATOM   2650  O  O     . TRP A  1  342 ? 33.534  7.776   371.177 1.00 101.04 ? 342 TRP 1 O     1 
ATOM   2651  C  CB    . TRP A  1  342 ? 31.765  4.842   371.229 1.00 107.01 ? 342 TRP 1 CB    1 
ATOM   2652  C  CG    . TRP A  1  342 ? 30.746  5.261   370.222 1.00 118.46 ? 342 TRP 1 CG    1 
ATOM   2653  C  CD1   . TRP A  1  342 ? 30.166  4.471   369.272 1.00 122.97 ? 342 TRP 1 CD1   1 
ATOM   2654  C  CD2   . TRP A  1  342 ? 30.216  6.578   370.022 1.00 125.62 ? 342 TRP 1 CD2   1 
ATOM   2655  N  NE1   . TRP A  1  342 ? 29.283  5.206   368.519 1.00 126.03 ? 342 TRP 1 NE1   1 
ATOM   2656  C  CE2   . TRP A  1  342 ? 29.301  6.503   368.954 1.00 126.84 ? 342 TRP 1 CE2   1 
ATOM   2657  C  CE3   . TRP A  1  342 ? 30.417  7.812   370.649 1.00 126.10 ? 342 TRP 1 CE3   1 
ATOM   2658  C  CZ2   . TRP A  1  342 ? 28.590  7.612   368.500 1.00 127.49 ? 342 TRP 1 CZ2   1 
ATOM   2659  C  CZ3   . TRP A  1  342 ? 29.711  8.909   370.193 1.00 125.72 ? 342 TRP 1 CZ3   1 
ATOM   2660  C  CH2   . TRP A  1  342 ? 28.810  8.803   369.132 1.00 126.53 ? 342 TRP 1 CH2   1 
ATOM   2661  N  N     . ASN A  1  343 ? 33.272  6.630   373.102 1.00 95.13  ? 343 ASN 1 N     1 
ATOM   2662  C  CA    . ASN A  1  343 ? 33.402  7.817   373.937 1.00 89.00  ? 343 ASN 1 CA    1 
ATOM   2663  C  C     . ASN A  1  343 ? 34.784  8.448   373.807 1.00 76.05  ? 343 ASN 1 C     1 
ATOM   2664  O  O     . ASN A  1  343 ? 34.907  9.678   373.745 1.00 74.58  ? 343 ASN 1 O     1 
ATOM   2665  C  CB    . ASN A  1  343 ? 33.116  7.470   375.398 1.00 96.04  ? 343 ASN 1 CB    1 
ATOM   2666  C  CG    . ASN A  1  343 ? 33.074  8.695   376.291 1.00 103.64 ? 343 ASN 1 CG    1 
ATOM   2667  O  OD1   . ASN A  1  343 ? 34.112  9.242   376.664 1.00 105.84 ? 343 ASN 1 OD1   1 
ATOM   2668  N  ND2   . ASN A  1  343 ? 31.868  9.139   376.628 1.00 106.97 ? 343 ASN 1 ND2   1 
ATOM   2669  N  N     . LEU A  1  344 ? 35.837  7.629   373.783 1.00 66.92  ? 344 LEU 1 N     1 
ATOM   2670  C  CA    . LEU A  1  344 ? 37.187  8.172   373.643 1.00 58.91  ? 344 LEU 1 CA    1 
ATOM   2671  C  C     . LEU A  1  344 ? 37.302  9.029   372.389 1.00 55.08  ? 344 LEU 1 C     1 
ATOM   2672  O  O     . LEU A  1  344 ? 37.760  10.178  372.442 1.00 52.87  ? 344 LEU 1 O     1 
ATOM   2673  C  CB    . LEU A  1  344 ? 38.216  7.040   373.606 1.00 58.28  ? 344 LEU 1 CB    1 
ATOM   2674  C  CG    . LEU A  1  344 ? 38.524  6.289   374.902 1.00 61.14  ? 344 LEU 1 CG    1 
ATOM   2675  C  CD1   . LEU A  1  344 ? 39.904  5.656   374.824 1.00 60.75  ? 344 LEU 1 CD1   1 
ATOM   2676  C  CD2   . LEU A  1  344 ? 38.429  7.226   376.096 1.00 64.45  ? 344 LEU 1 CD2   1 
ATOM   2677  N  N     . THR A  1  345 ? 36.858  8.492   371.251 1.00 55.95  ? 345 THR 1 N     1 
ATOM   2678  C  CA    . THR A  1  345 ? 36.994  9.223   369.999 1.00 58.68  ? 345 THR 1 CA    1 
ATOM   2679  C  C     . THR A  1  345 ? 36.027  10.396  369.918 1.00 67.33  ? 345 THR 1 C     1 
ATOM   2680  O  O     . THR A  1  345 ? 36.378  11.430  369.344 1.00 73.34  ? 345 THR 1 O     1 
ATOM   2681  C  CB    . THR A  1  345 ? 36.799  8.286   368.809 1.00 56.75  ? 345 THR 1 CB    1 
ATOM   2682  O  OG1   . THR A  1  345 ? 35.484  7.720   368.850 1.00 60.49  ? 345 THR 1 OG1   1 
ATOM   2683  C  CG2   . THR A  1  345 ? 37.841  7.174   368.829 1.00 53.21  ? 345 THR 1 CG2   1 
ATOM   2684  N  N     . ARG A  1  346 ? 34.828  10.282  370.498 1.00 71.00  ? 346 ARG 1 N     1 
ATOM   2685  C  CA    . ARG A  1  346 ? 33.918  11.425  370.475 1.00 80.62  ? 346 ARG 1 CA    1 
ATOM   2686  C  C     . ARG A  1  346 ? 34.467  12.575  371.313 1.00 84.61  ? 346 ARG 1 C     1 
ATOM   2687  O  O     . ARG A  1  346 ? 34.336  13.748  370.936 1.00 85.66  ? 346 ARG 1 O     1 
ATOM   2688  C  CB    . ARG A  1  346 ? 32.523  11.011  370.962 1.00 85.68  ? 346 ARG 1 CB    1 
ATOM   2689  C  CG    . ARG A  1  346 ? 32.369  10.927  372.480 1.00 89.31  ? 346 ARG 1 CG    1 
ATOM   2690  C  CD    . ARG A  1  346 ? 30.986  10.462  372.914 1.00 91.29  ? 346 ARG 1 CD    1 
ATOM   2691  N  NE    . ARG A  1  346 ? 29.930  11.252  372.290 1.00 94.47  ? 346 ARG 1 NE    1 
ATOM   2692  C  CZ    . ARG A  1  346 ? 29.459  12.394  372.782 1.00 96.49  ? 346 ARG 1 CZ    1 
ATOM   2693  N  NH1   . ARG A  1  346 ? 29.956  12.896  373.906 1.00 98.44  ? 346 ARG 1 NH1   1 
ATOM   2694  N  NH2   . ARG A  1  346 ? 28.496  13.044  372.141 1.00 95.67  ? 346 ARG 1 NH2   1 
ATOM   2695  N  N     . PHE A  1  347 ? 35.140  12.256  372.421 1.00 86.95  ? 347 PHE 1 N     1 
ATOM   2696  C  CA    . PHE A  1  347 ? 35.768  13.290  373.234 1.00 88.06  ? 347 PHE 1 CA    1 
ATOM   2697  C  C     . PHE A  1  347 ? 36.928  13.934  372.488 1.00 78.90  ? 347 PHE 1 C     1 
ATOM   2698  O  O     . PHE A  1  347 ? 36.995  15.162  372.371 1.00 76.27  ? 347 PHE 1 O     1 
ATOM   2699  C  CB    . PHE A  1  347 ? 36.235  12.702  374.566 1.00 104.10 ? 347 PHE 1 CB    1 
ATOM   2700  C  CG    . PHE A  1  347 ? 37.403  13.428  375.170 1.00 116.97 ? 347 PHE 1 CG    1 
ATOM   2701  C  CD1   . PHE A  1  347 ? 38.669  12.867  375.150 1.00 125.98 ? 347 PHE 1 CD1   1 
ATOM   2702  C  CD2   . PHE A  1  347 ? 37.237  14.673  375.754 1.00 123.84 ? 347 PHE 1 CD2   1 
ATOM   2703  C  CE1   . PHE A  1  347 ? 39.748  13.535  375.701 1.00 129.28 ? 347 PHE 1 CE1   1 
ATOM   2704  C  CE2   . PHE A  1  347 ? 38.313  15.345  376.306 1.00 129.58 ? 347 PHE 1 CE2   1 
ATOM   2705  C  CZ    . PHE A  1  347 ? 39.569  14.774  376.280 1.00 128.83 ? 347 PHE 1 CZ    1 
ATOM   2706  N  N     . TYR A  1  348 ? 37.858  13.120  371.980 1.00 75.47  ? 348 TYR 1 N     1 
ATOM   2707  C  CA    . TYR A  1  348 ? 39.004  13.682  371.264 1.00 73.22  ? 348 TYR 1 CA    1 
ATOM   2708  C  C     . TYR A  1  348 ? 38.576  14.451  370.018 1.00 67.45  ? 348 TYR 1 C     1 
ATOM   2709  O  O     . TYR A  1  348 ? 39.268  15.386  369.601 1.00 70.14  ? 348 TYR 1 O     1 
ATOM   2710  C  CB    . TYR A  1  348 ? 40.011  12.582  370.925 1.00 75.53  ? 348 TYR 1 CB    1 
ATOM   2711  C  CG    . TYR A  1  348 ? 40.826  12.180  372.135 1.00 74.23  ? 348 TYR 1 CG    1 
ATOM   2712  C  CD1   . TYR A  1  348 ? 41.854  12.987  372.595 1.00 76.23  ? 348 TYR 1 CD1   1 
ATOM   2713  C  CD2   . TYR A  1  348 ? 40.545  11.021  372.839 1.00 73.47  ? 348 TYR 1 CD2   1 
ATOM   2714  C  CE1   . TYR A  1  348 ? 42.591  12.642  373.709 1.00 76.06  ? 348 TYR 1 CE1   1 
ATOM   2715  C  CE2   . TYR A  1  348 ? 41.277  10.669  373.957 1.00 76.04  ? 348 TYR 1 CE2   1 
ATOM   2716  C  CZ    . TYR A  1  348 ? 42.300  11.485  374.386 1.00 75.66  ? 348 TYR 1 CZ    1 
ATOM   2717  O  OH    . TYR A  1  348 ? 43.042  11.155  375.495 1.00 77.59  ? 348 TYR 1 OH    1 
ATOM   2718  N  N     . ALA A  1  349 ? 37.448  14.079  369.413 1.00 62.92  ? 349 ALA 1 N     1 
ATOM   2719  C  CA    . ALA A  1  349 ? 36.876  14.888  368.342 1.00 64.67  ? 349 ALA 1 CA    1 
ATOM   2720  C  C     . ALA A  1  349 ? 36.360  16.219  368.876 1.00 63.51  ? 349 ALA 1 C     1 
ATOM   2721  O  O     . ALA A  1  349 ? 36.518  17.260  368.228 1.00 65.82  ? 349 ALA 1 O     1 
ATOM   2722  C  CB    . ALA A  1  349 ? 35.759  14.113  367.645 1.00 67.91  ? 349 ALA 1 CB    1 
ATOM   2723  N  N     . HIS A  1  350 ? 35.722  16.196  370.051 1.00 58.11  ? 350 HIS 1 N     1 
ATOM   2724  C  CA    . HIS A  1  350 ? 35.188  17.417  370.652 1.00 48.92  ? 350 HIS 1 CA    1 
ATOM   2725  C  C     . HIS A  1  350 ? 36.270  18.468  370.885 1.00 38.14  ? 350 HIS 1 C     1 
ATOM   2726  O  O     . HIS A  1  350 ? 35.974  19.668  370.912 1.00 29.14  ? 350 HIS 1 O     1 
ATOM   2727  C  CB    . HIS A  1  350 ? 34.498  17.075  371.975 1.00 52.63  ? 350 HIS 1 CB    1 
ATOM   2728  C  CG    . HIS A  1  350 ? 33.802  18.231  372.623 1.00 50.03  ? 350 HIS 1 CG    1 
ATOM   2729  N  ND1   . HIS A  1  350 ? 32.492  18.563  372.344 1.00 57.80  ? 350 HIS 1 ND1   1 
ATOM   2730  C  CD2   . HIS A  1  350 ? 34.228  19.122  373.548 1.00 54.84  ? 350 HIS 1 CD2   1 
ATOM   2731  C  CE1   . HIS A  1  350 ? 32.144  19.613  373.067 1.00 54.92  ? 350 HIS 1 CE1   1 
ATOM   2732  N  NE2   . HIS A  1  350 ? 33.180  19.972  373.806 1.00 56.29  ? 350 HIS 1 NE2   1 
ATOM   2733  N  N     . GLU A  1  351 ? 37.524  18.045  371.055 1.00 36.69  ? 351 GLU 1 N     1 
ATOM   2734  C  CA    . GLU A  1  351 ? 38.591  18.927  371.504 1.00 35.63  ? 351 GLU 1 CA    1 
ATOM   2735  C  C     . GLU A  1  351 ? 39.606  19.299  370.431 1.00 31.77  ? 351 GLU 1 C     1 
ATOM   2736  O  O     . GLU A  1  351 ? 40.536  20.055  370.730 1.00 31.19  ? 351 GLU 1 O     1 
ATOM   2737  C  CB    . GLU A  1  351 ? 39.328  18.281  372.682 1.00 42.33  ? 351 GLU 1 CB    1 
ATOM   2738  C  CG    . GLU A  1  351 ? 38.475  18.135  373.928 1.00 54.43  ? 351 GLU 1 CG    1 
ATOM   2739  C  CD    . GLU A  1  351 ? 38.135  19.467  374.564 1.00 62.65  ? 351 GLU 1 CD    1 
ATOM   2740  O  OE1   . GLU A  1  351 ? 38.825  20.466  374.270 1.00 66.73  ? 351 GLU 1 OE1   1 
ATOM   2741  O  OE2   . GLU A  1  351 ? 37.177  19.515  375.364 1.00 64.06  ? 351 GLU 1 OE2   1 
ATOM   2742  N  N     . SER A  1  352 ? 39.473  18.802  369.205 1.00 32.05  ? 352 SER 1 N     1 
ATOM   2743  C  CA    . SER A  1  352 ? 40.498  19.068  368.205 1.00 28.36  ? 352 SER 1 CA    1 
ATOM   2744  C  C     . SER A  1  352 ? 40.444  20.533  367.787 1.00 34.45  ? 352 SER 1 C     1 
ATOM   2745  O  O     . SER A  1  352 ? 39.367  21.123  367.661 1.00 35.37  ? 352 SER 1 O     1 
ATOM   2746  C  CB    . SER A  1  352 ? 40.312  18.154  366.994 1.00 28.49  ? 352 SER 1 CB    1 
ATOM   2747  O  OG    . SER A  1  352 ? 41.188  18.494  365.936 1.00 28.69  ? 352 SER 1 OG    1 
ATOM   2748  N  N     . CYS A  1  353 ? 41.619  21.119  367.557 1.00 39.98  ? 353 CYS 1 N     1 
ATOM   2749  C  CA    . CYS A  1  353 ? 41.701  22.550  367.282 1.00 40.22  ? 353 CYS 1 CA    1 
ATOM   2750  C  C     . CYS A  1  353 ? 41.452  22.884  365.818 1.00 38.98  ? 353 CYS 1 C     1 
ATOM   2751  O  O     . CYS A  1  353 ? 41.006  23.994  365.510 1.00 29.24  ? 353 CYS 1 O     1 
ATOM   2752  C  CB    . CYS A  1  353 ? 43.063  23.080  367.724 1.00 34.54  ? 353 CYS 1 CB    1 
ATOM   2753  S  SG    . CYS A  1  353 ? 44.290  23.068  366.423 1.00 32.15  ? 353 CYS 1 SG    1 
ATOM   2754  N  N     . GLY A  1  354 ? 41.727  21.954  364.906 1.00 46.12  ? 354 GLY 1 N     1 
ATOM   2755  C  CA    . GLY A  1  354 ? 41.368  22.122  363.516 1.00 54.62  ? 354 GLY 1 CA    1 
ATOM   2756  C  C     . GLY A  1  354 ? 42.498  22.522  362.593 1.00 63.92  ? 354 GLY 1 C     1 
ATOM   2757  O  O     . GLY A  1  354 ? 42.286  22.556  361.374 1.00 69.06  ? 354 GLY 1 O     1 
ATOM   2758  N  N     . LYS A  1  355 ? 43.677  22.853  363.126 1.00 64.62  ? 355 LYS 1 N     1 
ATOM   2759  C  CA    . LYS A  1  355 ? 44.781  23.266  362.264 1.00 63.04  ? 355 LYS 1 CA    1 
ATOM   2760  C  C     . LYS A  1  355 ? 45.097  22.196  361.231 1.00 59.79  ? 355 LYS 1 C     1 
ATOM   2761  O  O     . LYS A  1  355 ? 45.173  22.476  360.028 1.00 62.32  ? 355 LYS 1 O     1 
ATOM   2762  C  CB    . LYS A  1  355 ? 46.027  23.581  363.093 1.00 63.45  ? 355 LYS 1 CB    1 
ATOM   2763  C  CG    . LYS A  1  355 ? 46.764  24.831  362.643 1.00 67.41  ? 355 LYS 1 CG    1 
ATOM   2764  C  CD    . LYS A  1  355 ? 47.895  25.165  363.600 1.00 62.34  ? 355 LYS 1 CD    1 
ATOM   2765  C  CE    . LYS A  1  355 ? 49.153  25.545  362.836 1.00 83.40  ? 355 LYS 1 CE    1 
ATOM   2766  N  NZ    . LYS A  1  355 ? 50.232  26.106  363.698 1.00 29.78  ? 355 LYS 1 NZ    1 
ATOM   2767  N  N     . CYS A  1  356 ? 45.278  20.959  361.681 1.00 59.31  ? 356 CYS 1 N     1 
ATOM   2768  C  CA    . CYS A  1  356 ? 45.642  19.886  360.771 1.00 63.99  ? 356 CYS 1 CA    1 
ATOM   2769  C  C     . CYS A  1  356 ? 44.396  19.388  360.062 1.00 61.49  ? 356 CYS 1 C     1 
ATOM   2770  O  O     . CYS A  1  356 ? 43.388  19.077  360.708 1.00 60.13  ? 356 CYS 1 O     1 
ATOM   2771  C  CB    . CYS A  1  356 ? 46.287  18.723  361.521 1.00 71.31  ? 356 CYS 1 CB    1 
ATOM   2772  S  SG    . CYS A  1  356 ? 47.683  19.164  362.521 1.00 79.76  ? 356 CYS 1 SG    1 
ATOM   2773  N  N     . THR A  1  357 ? 44.460  19.324  358.738 1.00 61.40  ? 357 THR 1 N     1 
ATOM   2774  C  CA    . THR A  1  357 ? 43.459  18.562  357.997 1.00 61.56  ? 357 THR 1 CA    1 
ATOM   2775  C  C     . THR A  1  357 ? 43.380  17.113  358.470 1.00 61.59  ? 357 THR 1 C     1 
ATOM   2776  O  O     . THR A  1  357 ? 42.257  16.621  358.682 1.00 62.75  ? 357 THR 1 O     1 
ATOM   2777  C  CB    . THR A  1  357 ? 43.747  18.654  356.496 1.00 65.58  ? 357 THR 1 CB    1 
ATOM   2778  O  OG1   . THR A  1  357 ? 44.125  19.997  356.170 1.00 73.51  ? 357 THR 1 OG1   1 
ATOM   2779  C  CG2   . THR A  1  357 ? 42.508  18.302  355.703 1.00 61.55  ? 357 THR 1 CG2   1 
ATOM   2780  N  N     . PRO A  1  358 ? 44.512  16.374  358.688 1.00 58.68  ? 358 PRO 1 N     1 
ATOM   2781  C  CA    . PRO A  1  358 ? 44.387  14.988  359.164 1.00 56.32  ? 358 PRO 1 CA    1 
ATOM   2782  C  C     . PRO A  1  358 ? 43.622  14.864  360.470 1.00 55.84  ? 358 PRO 1 C     1 
ATOM   2783  O  O     . PRO A  1  358 ? 42.577  14.215  360.493 1.00 59.12  ? 358 PRO 1 O     1 
ATOM   2784  C  CB    . PRO A  1  358 ? 45.848  14.537  359.329 1.00 53.88  ? 358 PRO 1 CB    1 
ATOM   2785  C  CG    . PRO A  1  358 ? 46.632  15.794  359.416 1.00 54.87  ? 358 PRO 1 CG    1 
ATOM   2786  C  CD    . PRO A  1  358 ? 45.929  16.725  358.480 1.00 57.59  ? 358 PRO 1 CD    1 
ATOM   2787  N  N     . CYS A  1  359 ? 44.082  15.507  361.542 1.00 51.84  ? 359 CYS 1 N     1 
ATOM   2788  C  CA    . CYS A  1  359 ? 43.396  15.366  362.821 1.00 46.79  ? 359 CYS 1 CA    1 
ATOM   2789  C  C     . CYS A  1  359 ? 41.939  15.793  362.721 1.00 52.87  ? 359 CYS 1 C     1 
ATOM   2790  O  O     . CYS A  1  359 ? 41.050  14.947  362.843 1.00 56.28  ? 359 CYS 1 O     1 
ATOM   2791  C  CB    . CYS A  1  359 ? 44.115  16.156  363.904 1.00 37.50  ? 359 CYS 1 CB    1 
ATOM   2792  S  SG    . CYS A  1  359 ? 43.174  16.539  365.396 1.00 29.17  ? 359 CYS 1 SG    1 
ATOM   2793  N  N     . ARG A  1  360 ? 41.682  17.078  362.454 1.00 50.09  ? 360 ARG 1 N     1 
ATOM   2794  C  CA    . ARG A  1  360 ? 40.305  17.567  362.387 1.00 45.49  ? 360 ARG 1 CA    1 
ATOM   2795  C  C     . ARG A  1  360 ? 39.446  16.676  361.497 1.00 44.32  ? 360 ARG 1 C     1 
ATOM   2796  O  O     . ARG A  1  360 ? 38.515  16.018  361.969 1.00 47.71  ? 360 ARG 1 O     1 
ATOM   2797  C  CB    . ARG A  1  360 ? 40.263  19.005  361.872 1.00 40.80  ? 360 ARG 1 CB    1 
ATOM   2798  C  CG    . ARG A  1  360 ? 38.851  19.447  361.507 1.00 43.72  ? 360 ARG 1 CG    1 
ATOM   2799  C  CD    . ARG A  1  360 ? 38.822  20.843  360.921 1.00 50.64  ? 360 ARG 1 CD    1 
ATOM   2800  N  NE    . ARG A  1  360 ? 39.062  20.803  359.483 1.00 57.57  ? 360 ARG 1 NE    1 
ATOM   2801  C  CZ    . ARG A  1  360 ? 40.215  21.127  358.906 1.00 61.19  ? 360 ARG 1 CZ    1 
ATOM   2802  N  NH1   . ARG A  1  360 ? 41.242  21.525  359.643 1.00 67.83  ? 360 ARG 1 NH1   1 
ATOM   2803  N  NH2   . ARG A  1  360 ? 40.338  21.048  357.588 1.00 59.39  ? 360 ARG 1 NH2   1 
ATOM   2804  N  N     . GLU A  1  361 ? 39.775  16.610  360.206 1.00 42.79  ? 361 GLU 1 N     1 
ATOM   2805  C  CA    . GLU A  1  361 ? 38.910  15.913  359.263 1.00 45.08  ? 361 GLU 1 CA    1 
ATOM   2806  C  C     . GLU A  1  361 ? 38.825  14.422  359.574 1.00 44.09  ? 361 GLU 1 C     1 
ATOM   2807  O  O     . GLU A  1  361 ? 37.737  13.900  359.829 1.00 47.76  ? 361 GLU 1 O     1 
ATOM   2808  C  CB    . GLU A  1  361 ? 39.383  16.160  357.830 1.00 52.63  ? 361 GLU 1 CB    1 
ATOM   2809  C  CG    . GLU A  1  361 ? 39.476  17.639  357.467 1.00 51.79  ? 361 GLU 1 CG    1 
ATOM   2810  C  CD    . GLU A  1  361 ? 38.130  18.348  357.534 1.00 45.08  ? 361 GLU 1 CD    1 
ATOM   2811  O  OE1   . GLU A  1  361 ? 37.084  17.673  357.441 1.00 41.82  ? 361 GLU 1 OE1   1 
ATOM   2812  O  OE2   . GLU A  1  361 ? 38.114  19.585  357.675 1.00 41.41  ? 361 GLU 1 OE2   1 
ATOM   2813  N  N     . GLY A  1  362 ? 39.955  13.713  359.555 1.00 38.84  ? 362 GLY 1 N     1 
ATOM   2814  C  CA    . GLY A  1  362 ? 39.911  12.271  359.752 1.00 39.75  ? 362 GLY 1 CA    1 
ATOM   2815  C  C     . GLY A  1  362 ? 39.262  11.864  361.064 1.00 35.85  ? 362 GLY 1 C     1 
ATOM   2816  O  O     . GLY A  1  362 ? 38.400  10.984  361.091 1.00 32.84  ? 362 GLY 1 O     1 
ATOM   2817  N  N     . VAL A  1  363 ? 39.677  12.478  362.176 1.00 35.20  ? 363 VAL 1 N     1 
ATOM   2818  C  CA    . VAL A  1  363 ? 39.149  12.072  363.474 1.00 30.02  ? 363 VAL 1 CA    1 
ATOM   2819  C  C     . VAL A  1  363 ? 37.696  12.512  363.622 1.00 37.91  ? 363 VAL 1 C     1 
ATOM   2820  O  O     . VAL A  1  363 ? 36.801  11.679  363.802 1.00 41.45  ? 363 VAL 1 O     1 
ATOM   2821  C  CB    . VAL A  1  363 ? 40.028  12.619  364.611 1.00 28.47  ? 363 VAL 1 CB    1 
ATOM   2822  C  CG1   . VAL A  1  363 ? 39.557  12.078  365.951 1.00 28.21  ? 363 VAL 1 CG1   1 
ATOM   2823  C  CG2   . VAL A  1  363 ? 41.485  12.238  364.378 1.00 28.46  ? 363 VAL 1 CG2   1 
ATOM   2824  N  N     . ALA A  1  364 ? 37.433  13.825  363.530 1.00 40.52  ? 364 ALA 1 N     1 
ATOM   2825  C  CA    . ALA A  1  364 ? 36.109  14.361  363.838 1.00 39.40  ? 364 ALA 1 CA    1 
ATOM   2826  C  C     . ALA A  1  364 ? 35.070  14.055  362.763 1.00 38.69  ? 364 ALA 1 C     1 
ATOM   2827  O  O     . ALA A  1  364 ? 33.870  14.166  363.031 1.00 29.02  ? 364 ALA 1 O     1 
ATOM   2828  C  CB    . ALA A  1  364 ? 36.203  15.873  364.046 1.00 28.90  ? 364 ALA 1 CB    1 
ATOM   2829  N  N     . GLY A  1  365 ? 35.492  13.699  361.556 1.00 39.47  ? 365 GLY 1 N     1 
ATOM   2830  C  CA    . GLY A  1  365 ? 34.569  13.361  360.495 1.00 48.93  ? 365 GLY 1 CA    1 
ATOM   2831  C  C     . GLY A  1  365 ? 34.505  11.879  360.177 1.00 61.66  ? 365 GLY 1 C     1 
ATOM   2832  O  O     . GLY A  1  365 ? 33.425  11.346  359.907 1.00 66.12  ? 365 GLY 1 O     1 
ATOM   2833  N  N     . PHE A  1  366 ? 35.655  11.206  360.154 1.00 61.19  ? 366 PHE 1 N     1 
ATOM   2834  C  CA    . PHE A  1  366 ? 35.692  9.818   359.701 1.00 60.29  ? 366 PHE 1 CA    1 
ATOM   2835  C  C     . PHE A  1  366 ? 35.600  8.828   360.862 1.00 61.26  ? 366 PHE 1 C     1 
ATOM   2836  O  O     . PHE A  1  366 ? 34.639  8.057   360.952 1.00 65.71  ? 366 PHE 1 O     1 
ATOM   2837  C  CB    . PHE A  1  366 ? 36.966  9.567   358.884 1.00 49.21  ? 366 PHE 1 CB    1 
ATOM   2838  C  CG    . PHE A  1  366 ? 36.770  8.641   357.722 1.00 42.29  ? 366 PHE 1 CG    1 
ATOM   2839  C  CD1   . PHE A  1  366 ? 35.646  7.837   357.640 1.00 32.37  ? 366 PHE 1 CD1   1 
ATOM   2840  C  CD2   . PHE A  1  366 ? 37.713  8.569   356.714 1.00 43.96  ? 366 PHE 1 CD2   1 
ATOM   2841  C  CE1   . PHE A  1  366 ? 35.463  6.984   356.573 1.00 32.87  ? 366 PHE 1 CE1   1 
ATOM   2842  C  CE2   . PHE A  1  366 ? 37.533  7.714   355.643 1.00 45.85  ? 366 PHE 1 CE2   1 
ATOM   2843  C  CZ    . PHE A  1  366 ? 36.406  6.921   355.575 1.00 41.05  ? 366 PHE 1 CZ    1 
ATOM   2844  N  N     . MET A  1  367 ? 36.581  8.856   361.767 1.00 58.12  ? 367 MET 1 N     1 
ATOM   2845  C  CA    . MET A  1  367 ? 36.714  7.788   362.756 1.00 58.06  ? 367 MET 1 CA    1 
ATOM   2846  C  C     . MET A  1  367 ? 35.520  7.755   363.703 1.00 61.68  ? 367 MET 1 C     1 
ATOM   2847  O  O     . MET A  1  367 ? 34.892  6.705   363.897 1.00 61.32  ? 367 MET 1 O     1 
ATOM   2848  C  CB    . MET A  1  367 ? 38.029  7.956   363.520 1.00 52.44  ? 367 MET 1 CB    1 
ATOM   2849  C  CG    . MET A  1  367 ? 39.270  7.710   362.662 1.00 46.97  ? 367 MET 1 CG    1 
ATOM   2850  S  SD    . MET A  1  367 ? 40.834  7.871   363.549 1.00 36.55  ? 367 MET 1 SD    1 
ATOM   2851  C  CE    . MET A  1  367 ? 40.615  6.694   364.87