data_6I1P
# 
_entry.id   6I1P 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.383 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   6I1P         pdb_00006i1p 10.2210/pdb6i1p/pdb 
WWPDB D_1200012659 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2020-09-02 
2 'Structure model' 1 1 2024-01-24 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Data collection'        
2 2 'Structure model' 'Database references'    
3 2 'Structure model' 'Refinement description' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' chem_comp_atom                
2 2 'Structure model' chem_comp_bond                
3 2 'Structure model' database_2                    
4 2 'Structure model' pdbx_initial_refinement_model 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_database_2.pdbx_DOI'                
2 2 'Structure model' '_database_2.pdbx_database_accession' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6I1P 
_pdbx_database_status.recvd_initial_deposition_date   2018-10-29 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.details        'Submitted PDB 6I0D contains complex I in presence of decyl-ubiquinone' 
_pdbx_database_related.db_id          6I0D 
_pdbx_database_related.content_type   unspecified 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Gutierrez-Fernandez, J.' 1 ?                   
'Minhas, G.S.'            2 ?                   
'Sazanov, L.A.'           3 0000-0002-0977-7989 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nat Commun' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2041-1723 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            11 
_citation.language                  ? 
_citation.page_first                4135 
_citation.page_last                 4135 
_citation.title                     'Key role of quinone in the mechanism of respiratory complex I.' 
_citation.year                      2020 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/s41467-020-17957-0 
_citation.pdbx_database_id_PubMed   32811817 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Gutierrez-Fernandez, J.' 1 ?                   
primary 'Kaszuba, K.'             2 ?                   
primary 'Minhas, G.S.'            3 ?                   
primary 'Baradaran, R.'           4 ?                   
primary 'Tambalo, M.'             5 ?                   
primary 'Gallagher, D.T.'         6 ?                   
primary 'Sazanov, L.A.'           7 0000-0002-0977-7989 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat 'NADH-quinone oxidoreductase subunit 1'        48693.715 2  1.6.5.11 ? ? ? 
2  polymer     nat 'NADH-quinone oxidoreductase subunit 2'        20309.162 2  1.6.5.11 ? ? ? 
3  polymer     nat 'NADH-quinone oxidoreductase subunit 3'        86656.203 2  1.6.5.11 ? ? ? 
4  polymer     nat 'NADH-quinone oxidoreductase subunit 4'        46428.027 2  1.6.5.11 ? ? ? 
5  polymer     nat 'NADH-quinone oxidoreductase subunit 5'        23893.254 2  1.6.5.11 ? ? ? 
6  polymer     nat 'NADH-quinone oxidoreductase subunit 6'        20262.564 2  1.6.5.11 ? ? ? 
7  polymer     nat 'NADH-quinone oxidoreductase subunit 9'        20106.309 2  1.6.5.11 ? ? ? 
8  polymer     nat 'NADH-quinone oxidoreductase subunit 15'       14812.074 2  1.6.5.11 ? ? ? 
9  polymer     nat 'NADH-quinone oxidoreductase subunit 16'       14201.612 2  ?        ? ? ? 
10 polymer     nat 'NADH-quinone oxidoreductase subunit 7'        13154.656 2  1.6.5.11 ? ? ? 
11 polymer     nat 'NADH-quinone oxidoreductase subunit 10'       18563.330 2  1.6.5.11 ? ? ? 
12 polymer     nat 'NADH-quinone oxidoreductase subunit 11'       10002.788 2  1.6.5.11 ? ? ? 
13 polymer     nat 'NADH-quinone oxidoreductase subunit 12'       65189.930 2  1.6.5.11 ? ? ? 
14 polymer     nat 'NADH-quinone oxidoreductase subunit 13'       49247.117 2  1.6.5.11 ? ? ? 
15 polymer     nat 'NADH-quinone oxidoreductase subunit 14'       44463.895 2  1.6.5.11 ? ? ? 
16 polymer     nat 'NADH-quinone oxidoreductase subunit 8'        41034.523 2  1.6.5.11 ? ? ? 
17 non-polymer syn 'IRON/SULFUR CLUSTER'                          351.640   14 ?        ? ? ? 
18 non-polymer syn 'FLAVIN MONONUCLEOTIDE'                        456.344   2  ?        ? ? ? 
19 non-polymer syn '1,4-DIHYDRONICOTINAMIDE ADENINE DINUCLEOTIDE' 665.441   2  ?        ? ? ? 
20 non-polymer syn 'FE2/S2 (INORGANIC) CLUSTER'                   175.820   4  ?        ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1  'NADH dehydrogenase I chain 1,NDH-1 subunit 1'   
2  'NADH dehydrogenase I chain 2,NDH-1 subunit 2'   
3  'NADH dehydrogenase I chain 3,NDH-1 subunit 3'   
4  'NADH dehydrogenase I chain 4,NDH-1 subunit 4'   
5  'NADH dehydrogenase I chain 5,NDH-1 subunit 5'   
6  'NADH dehydrogenase I subunit 6,NDH-1 subunit 6' 
7  'NADH dehydrogenase I subunit 9,NDH-1 subunit 9' 
8  'NADH dehydrogenase I chain 15,NDH-1 subunit 15' 
10 'NADH dehydrogenase I chain 7,NDH-1 subunit 7'   
11 'NADH dehydrogenase I chain 10,NDH-1 subunit 10' 
12 'NADH dehydrogenase I chain 11,NDH-1 subunit 11' 
13 'NADH dehydrogenase I chain 12,NDH-1 subunit 12' 
14 'NADH dehydrogenase I chain 13,NDH-1 subunit 13' 
15 'NADH dehydrogenase I chain 14,NDH-1 subunit 14' 
16 'NADH dehydrogenase I subunit 8,NDH-1 subunit 8' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1  'polypeptide(L)' no no 
;MTGPILSGLDPRFERTLYAHVGKEGSWTLDYYLRHGGYETAKRVLKEKTPDEVIEEVKRSGLRGRGGAGFPTGLKWSFMP
KDDGKQHYLICNADESEPGSFKDRYILEDVPHLLIEGMILAGYAIRATVGYIYVRGEYRRAADRLEQAIKEARARGYLGK
NLFGTDFSFDLHVHRGAGAYICGEETALMNSLEGLRANPRLKPPFPAQSGLWGKPTTINNVETLASVVPIMERGADWFAQ
MGTEQSKGMKLYQISGPVKRPGVYELPMGTTFRELIYEWAGGPLEPIQAIIPGGSSTPPLPFTEEVLDTPMSYEHLQAKG
SMLGTGGVILIPERVSMVDAMWNLTRFYAHESCGKCTPCREGVAGFMVNLFAKIGTGQGEEKDVENLEALLPLIEGRSFC
PLADAAVWPVKGSLRHFKDQYLALAREKRPVPRPSLWR
;
;MTGPILSGLDPRFERTLYAHVGKEGSWTLDYYLRHGGYETAKRVLKEKTPDEVIEEVKRSGLRGRGGAGFPTGLKWSFMP
KDDGKQHYLICNADESEPGSFKDRYILEDVPHLLIEGMILAGYAIRATVGYIYVRGEYRRAADRLEQAIKEARARGYLGK
NLFGTDFSFDLHVHRGAGAYICGEETALMNSLEGLRANPRLKPPFPAQSGLWGKPTTINNVETLASVVPIMERGADWFAQ
MGTEQSKGMKLYQISGPVKRPGVYELPMGTTFRELIYEWAGGPLEPIQAIIPGGSSTPPLPFTEEVLDTPMSYEHLQAKG
SMLGTGGVILIPERVSMVDAMWNLTRFYAHESCGKCTPCREGVAGFMVNLFAKIGTGQGEEKDVENLEALLPLIEGRSFC
PLADAAVWPVKGSLRHFKDQYLALAREKRPVPRPSLWR
;
1,B ? 
2  'polypeptide(L)' no no 
;MGFFDDKQDFLEETFAKYPPEGRRAAIMPLLRRVQQEEGWIRPERIEEIARLVGTTPTEVMGVASFYSYYQFVPTGKYHL
QVCATLSCKLAGAEELWDYLTETLGIGPGEVTPDGLFSVQKVECLGSCHTAPVIQVNDEPYVECVTRARLEALLAGLRAG
KRLEEIELPGKCGHHVHEVEV
;
;MGFFDDKQDFLEETFAKYPPEGRRAAIMPLLRRVQQEEGWIRPERIEEIARLVGTTPTEVMGVASFYSYYQFVPTGKYHL
QVCATLSCKLAGAEELWDYLTETLGIGPGEVTPDGLFSVQKVECLGSCHTAPVIQVNDEPYVECVTRARLEALLAGLRAG
KRLEEIELPGKCGHHVHEVEV
;
2,C ? 
3  'polypeptide(L)' no no 
;MVRVKVNDRIVEVPPGTSVMDAVFHAGYDVPLFCSEKHLSPIGACRMCLVRIGLPKKGPDGKPLLNEKGEPEIQWQPKLA
ASCVTAVADGMVVDTLSDVVREAQAGMVEFTLLNHPLDCPTCDKGGACELQDRTVEYGLYEKYYQKGPLELPVYTRFEFT
RRHVDKHHPLSPFVILDRERCIHCKRCVRYFEEVPGDEVLDFIERGVHTFIGTMDFGLPSGFSGNITDICPVGALLDLTA
RFRARNWEMEETPTTCALCPVGCGITADTRSGELLRIRAREVPEVNEIWICDAGRFGHEWADQNRLKTPLVRKEGRLVEA
TWEEAFLALKEGLKEARGEEVGLYLAHDATLEEGLLASELAKALKTPHLDFQGRTAAPASLFPPASLEDLLQADFALVLG
DPTEEAPILHLRLSEFVRDLKPPHRYNHGTPFADLQIKERMPRRTDKMALFAPYRAPLMKWAAIHEVHRPGEEREILLAL
LGDKEGSEMVAKAKEAWEKAKNPVLILGAGVLQDTVAAERARLLAERKGAKVLAMTPAANARGLEAMGVLPGAKGASWDE
PGALYAYYGFVPPEEALKGKRFVVMHLSHLHPLAERYAHVVLPAPTFYEKRGHLVNLEGRVLPLSPAPIENGEAEGALQV
LALLAEALGVRPPFRLHLEAQKALKARKVPEAMGRLSFRLKELRPKERKGAFYLRPTMWKAHQAVGKAQEAARAELWAHP
ETARAEALPEGAQVAVETPFGRVEARVVHREDVPKGHLYLSALGPAAGLRVEGRVLVPAGGEA
;
;MVRVKVNDRIVEVPPGTSVMDAVFHAGYDVPLFCSEKHLSPIGACRMCLVRIGLPKKGPDGKPLLNEKGEPEIQWQPKLA
ASCVTAVADGMVVDTLSDVVREAQAGMVEFTLLNHPLDCPTCDKGGACELQDRTVEYGLYEKYYQKGPLELPVYTRFEFT
RRHVDKHHPLSPFVILDRERCIHCKRCVRYFEEVPGDEVLDFIERGVHTFIGTMDFGLPSGFSGNITDICPVGALLDLTA
RFRARNWEMEETPTTCALCPVGCGITADTRSGELLRIRAREVPEVNEIWICDAGRFGHEWADQNRLKTPLVRKEGRLVEA
TWEEAFLALKEGLKEARGEEVGLYLAHDATLEEGLLASELAKALKTPHLDFQGRTAAPASLFPPASLEDLLQADFALVLG
DPTEEAPILHLRLSEFVRDLKPPHRYNHGTPFADLQIKERMPRRTDKMALFAPYRAPLMKWAAIHEVHRPGEEREILLAL
LGDKEGSEMVAKAKEAWEKAKNPVLILGAGVLQDTVAAERARLLAERKGAKVLAMTPAANARGLEAMGVLPGAKGASWDE
PGALYAYYGFVPPEEALKGKRFVVMHLSHLHPLAERYAHVVLPAPTFYEKRGHLVNLEGRVLPLSPAPIENGEAEGALQV
LALLAEALGVRPPFRLHLEAQKALKARKVPEAMGRLSFRLKELRPKERKGAFYLRPTMWKAHQAVGKAQEAARAELWAHP
ETARAEALPEGAQVAVETPFGRVEARVVHREDVPKGHLYLSALGPAAGLRVEGRVLVPAGGEA
;
3,D ? 
4  'polypeptide(L)' no no 
;MREEFLEEIPLDAPPEEAKELRTEVMTLNVGPQHPSTHGVLRLMVTLSGEEVLEVVPHIGYLHTGFEKTMEHRTYLQNIT
YTPRMDYLHSFAHDLAYALAVEKLLGAVVPPRAETIRVILNELSRLASHLVFLGTGLLDLGALTPFFYAFRERETILDLF
EWVTGQRFHHNYIRIGGVKEDLPEEFVPELKKLLEVLPHRIDEYEALFAESPIFYERARGVGVIPPEVAIDLGLTGGSLR
ASGVNYDVRKAYPYSGYETYTFDVPLGERGDVFDRMLVRIREMRESVKIIKQALERLEPGPVRDPNPQITPPPRHLLETS
MEAVIYHFKHYTEGFHPPKGEVYVPTESARGELGYYIVSDGGSMPYRVKVRAPSFVNLQSLPYACKGEQVPDMVAIIASL
DPVMGDVDR
;
;MREEFLEEIPLDAPPEEAKELRTEVMTLNVGPQHPSTHGVLRLMVTLSGEEVLEVVPHIGYLHTGFEKTMEHRTYLQNIT
YTPRMDYLHSFAHDLAYALAVEKLLGAVVPPRAETIRVILNELSRLASHLVFLGTGLLDLGALTPFFYAFRERETILDLF
EWVTGQRFHHNYIRIGGVKEDLPEEFVPELKKLLEVLPHRIDEYEALFAESPIFYERARGVGVIPPEVAIDLGLTGGSLR
ASGVNYDVRKAYPYSGYETYTFDVPLGERGDVFDRMLVRIREMRESVKIIKQALERLEPGPVRDPNPQITPPPRHLLETS
MEAVIYHFKHYTEGFHPPKGEVYVPTESARGELGYYIVSDGGSMPYRVKVRAPSFVNLQSLPYACKGEQVPDMVAIIASL
DPVMGDVDR
;
4,E ? 
5  'polypeptide(L)' no no 
;MRLERVLEEARAKGYPIEDNGLGNLWVVLPRERFKEEMAHYKAMGFNFLADIVGLDYLTYPDPRPERFAVVYELVSLPGW
KDGDGSRFFVRVYVPEEDPRLPTVTDLWGSANFLEREVYDLFGIVFEGHPDLRKILTPEDLEGHPLRKDYPLGETPTLFR
EGRYIIPAEFRAALTGKDPGLTFYKGGSRKGYRSLWADLKKAREVKG
;
;MRLERVLEEARAKGYPIEDNGLGNLWVVLPRERFKEEMAHYKAMGFNFLADIVGLDYLTYPDPRPERFAVVYELVSLPGW
KDGDGSRFFVRVYVPEEDPRLPTVTDLWGSANFLEREVYDLFGIVFEGHPDLRKILTPEDLEGHPLRKDYPLGETPTLFR
EGRYIIPAEFRAALTGKDPGLTFYKGGSRKGYRSLWADLKKAREVKG
;
5,F ? 
6  'polypeptide(L)' no no 
;MALKDLFERDVQELEREGILFTTLEKLVAWGRSNSLWPATFGLACCAIEMMASTDARNDLARFGSEVFRASPRQADVMIV
AGRLSKKMAPVMRRVWEQMPDPKWVISMGACASSGGMFNNYAIVQNVDSVVPVDVYVPGCPPRPEALIYAVMQLQKKVRG
QAYNERGERLPPVAAWKRTRG
;
;MALKDLFERDVQELEREGILFTTLEKLVAWGRSNSLWPATFGLACCAIEMMASTDARNDLARFGSEVFRASPRQADVMIV
AGRLSKKMAPVMRRVWEQMPDPKWVISMGACASSGGMFNNYAIVQNVDSVVPVDVYVPGCPPRPEALIYAVMQLQKKVRG
QAYNERGERLPPVAAWKRTRG
;
6,G ? 
7  'polypeptide(L)' no no 
;MTLKALAQSLGITLKYLFSKPVTVPYPDAPVALKPRFHGRHVLTRHPNGLEKCIGCSLCAAACPAYAIYVEPAENDPENP
VSAGERYAKVYEINMLRCIFCGLCEEACPTGAIVLGYDFEMADYEYSDLVYGKEDMLVDVVGTKPQRREAKRTGKPVKVG
YVVPYVRPELEGFKAPTEGGKR
;
;MTLKALAQSLGITLKYLFSKPVTVPYPDAPVALKPRFHGRHVLTRHPNGLEKCIGCSLCAAACPAYAIYVEPAENDPENP
VSAGERYAKVYEINMLRCIFCGLCEEACPTGAIVLGYDFEMADYEYSDLVYGKEDMLVDVVGTKPQRREAKRTGKPVKVG
YVVPYVRPELEGFKAPTEGGKR
;
9,O ? 
8  'polypeptide(L)' no no 
;MSASSERELYEAWVELLSWMREYAQAKGVRFEKEADFPDFIYRMERPYDLPTTIMTASLSDGLGEPFLLADVSPRHAKLK
RIGLRLPRAHIHLHAHYEPGKGLVTGKIPLTKERFFALADRAREALAFA
;
;MSASSERELYEAWVELLSWMREYAQAKGVRFEKEADFPDFIYRMERPYDLPTTIMTASLSDGLGEPFLLADVSPRHAKLK
RIGLRLPRAHIHLHAHYEPGKGLVTGKIPLTKERFFALADRAREALAFA
;
7,I ? 
9  'polypeptide(L)' no no 
;MVRVGMRAAPRVSLEALKAALGGLKLSEAKVYLITDWQDKRDQARYALLLHTGKKDLLVPDAFGPAFPGGEEALSELVGL
LLAQGARRFYEAVVSPGEMTALLDLPPEELLKRVMAIANPTDPGIYLKRAA
;
;MVRVGMRAAPRVSLEALKAALGGLKLSEAKVYLITDWQDKRDQARYALLLHTGKKDLLVPDAFGPAFPGGEEALSELVGL
LLAQGARRFYEAVVSPGEMTALLDLPPEELLKRVMAIANPTDPGIYLKRAA
;
W,X ? 
10 'polypeptide(L)' no no 
;MAPIQEYVGTLIYVGVALFIGVAALLVGALLGPKKPGRAKLMPYESGNDPAGEVKRFPVHFYVVAMLFILFDVEVAFLWP
YAVSAGGLGLYGFLGVLAFTLLLFVGFLYEWWKGVMRWH
;
;MAPIQEYVGTLIYVGVALFIGVAALLVGALLGPKKPGRAKLMPYESGNDPAGEVKRFPVHFYVVAMLFILFDVEVAFLWP
YAVSAGGLGLYGFLGVLAFTLLLFVGFLYEWWKGVMRWH
;
A,P ? 
11 'polypeptide(L)' no no 
;MSLLEGLALFLLLLSGVLVVTLRNAIHAALALILNFLVLAGVYVALDARFLGFIQVIVYAGAIVVLFLFVIMLLFAAQGE
IGFDPLVRSRPLAALLALGVAGILAAGLWGLDLAFTQDLKGGLPQALGPLLYGDWLFVLLAVGFLLMAATVVAVALVEPG
KASRAKEAEKREEVAR
;
;MSLLEGLALFLLLLSGVLVVTLRNAIHAALALILNFLVLAGVYVALDARFLGFIQVIVYAGAIVVLFLFVIMLLFAAQGE
IGFDPLVRSRPLAALLALGVAGILAAGLWGLDLAFTQDLKGGLPQALGPLLYGDWLFVLLAVGFLLMAATVVAVALVEPG
KASRAKEAEKREEVAR
;
J,R ? 
12 'polypeptide(L)' no no 
;MSYLLTSALLFALGVYGVLTRRTAILVFLSIELMLNAANLSLVGFARAYGLDGQVAALMVIAVAAAEVAVGLGLIVAIFR
HRESTAVDDLSELRG
;
;MSYLLTSALLFALGVYGVLTRRTAILVFLSIELMLNAANLSLVGFARAYGLDGQVAALMVIAVAAAEVAVGLGLIVAIFR
HRESTAVDDLSELRG
;
K,S ? 
13 'polypeptide(L)' no no 
;MALLGTILLPLLGFALLGLFGKRMREPLPGVLASGLVLASFLLGAGLLLSGGARFQAEWLPGIPFSLLLDNLSGFMLLIV
TGVGFLIHVYAIGYMGGDPGYSRFFAYFNLFIAMMLTLVLADSYPVMFIGWEGVGLASFLLIGFWYKNPQYADSARKAFI
VNRIGDLGFMLGMAILWALYGTLSISELKEAMEGPLKNPDLLALAGLLLFLGAVGKSAQIPLMVWLPDAMAGPTPVSALI
HAATMVTAGVYLIARSSFLYSVLPDVSYAIAVVGLLTAAYGALSAFGQTDIKKIVAYSTISQLGYMFLAAGVGAYWVALF
HVFTHAFFKALLFLASGSVIHALGGEQDVRKMGGLWKHLPQTRWHALIGALALGGLPLLSGFWSKDAILAATLTYPFGGV
GFYVGALLVAVLTAMYAMRWFVLVFLGEERGHHHPHEAPPVMLWPNHLLALGSVLAGYLALPHPLPNVLEPFLKPALAEV
EAHHLSLGAEWGLIALSAAVALLGLWAGFVFFQRKVFPAWYLAFEAASREAFYVDRAYNALIVNPLKALAEALFYGDRGL
LSGYFGLGGAARSLGQGLARLQTGYLRVYALLFVLGALLLLGVMRW
;
;MALLGTILLPLLGFALLGLFGKRMREPLPGVLASGLVLASFLLGAGLLLSGGARFQAEWLPGIPFSLLLDNLSGFMLLIV
TGVGFLIHVYAIGYMGGDPGYSRFFAYFNLFIAMMLTLVLADSYPVMFIGWEGVGLASFLLIGFWYKNPQYADSARKAFI
VNRIGDLGFMLGMAILWALYGTLSISELKEAMEGPLKNPDLLALAGLLLFLGAVGKSAQIPLMVWLPDAMAGPTPVSALI
HAATMVTAGVYLIARSSFLYSVLPDVSYAIAVVGLLTAAYGALSAFGQTDIKKIVAYSTISQLGYMFLAAGVGAYWVALF
HVFTHAFFKALLFLASGSVIHALGGEQDVRKMGGLWKHLPQTRWHALIGALALGGLPLLSGFWSKDAILAATLTYPFGGV
GFYVGALLVAVLTAMYAMRWFVLVFLGEERGHHHPHEAPPVMLWPNHLLALGSVLAGYLALPHPLPNVLEPFLKPALAEV
EAHHLSLGAEWGLIALSAAVALLGLWAGFVFFQRKVFPAWYLAFEAASREAFYVDRAYNALIVNPLKALAEALFYGDRGL
LSGYFGLGGAARSLGQGLARLQTGYLRVYALLFVLGALLLLGVMRW
;
L,T ? 
14 'polypeptide(L)' no no 
;MVVLAVLLPVVFGALLLLGLPRALGVLGAGLSFLLNLYLFLTHPGGVAHAFQAPLLPGAGVYWAFGLDGLSALFFLTIAL
TVFLGALVARVEGRFLGLALLMEGLLLGLFAARDLLVFYVFFEAALIPALLMLYLYGGEGRTRALYTFVLFTLVGSLPML
AAVLGARLLSGSPTFLLEDLLAHPLQEEAAFWVFLGFALAFAIKTPLFPLHAWLPPFHQENHPSGLADALGTLYKVGVFA
FFRFAIPLAPEGFAQAQGLLLFLAALSALYGAWVAFAAKDFKTLLAYAGLSHMGVAALGVFSGTPEGAMGGLYLLAASGV
YTGGLFLLAGRLYERTGTLEIGRYRGLAQSAPGLAALALILFLAMVGLPGLSGFPGEFLTLLGAYKASPWLAALAFLSVI
ASAAYALTAFQKTFWEEGGSGVKDLAGAEWGFALLSVLALLLMGVFPGYFARGLHPLAEAFAKLLGGGA
;
;MVVLAVLLPVVFGALLLLGLPRALGVLGAGLSFLLNLYLFLTHPGGVAHAFQAPLLPGAGVYWAFGLDGLSALFFLTIAL
TVFLGALVARVEGRFLGLALLMEGLLLGLFAARDLLVFYVFFEAALIPALLMLYLYGGEGRTRALYTFVLFTLVGSLPML
AAVLGARLLSGSPTFLLEDLLAHPLQEEAAFWVFLGFALAFAIKTPLFPLHAWLPPFHQENHPSGLADALGTLYKVGVFA
FFRFAIPLAPEGFAQAQGLLLFLAALSALYGAWVAFAAKDFKTLLAYAGLSHMGVAALGVFSGTPEGAMGGLYLLAASGV
YTGGLFLLAGRLYERTGTLEIGRYRGLAQSAPGLAALALILFLAMVGLPGLSGFPGEFLTLLGAYKASPWLAALAFLSVI
ASAAYALTAFQKTFWEEGGSGVKDLAGAEWGFALLSVLALLLMGVFPGYFARGLHPLAEAFAKLLGGGA
;
M,U ? 
15 'polypeptide(L)' no no 
;MTLAILAVFSVALTLLGFVLPPQGVKRATLLGLALALASLLLTWGKPFAFGPYAVDGVSQVFTLLALLGALWTVGLVRSG
RFEFYLLVLYAALGMHLLASTRHLLLMLVALEALSLPLYALATWRRGQGLEAALKYFLLGALAAAFFLYGAALFYGATGS
LVLGAPGEGPLYALALGLLLVGLGFKAALAPFHFWTPDVYQGSPTPVVLFMATSVKAAAFAALLRVAAPPEALALLVALS
VVVGNLAALAQKEAKRLLAYSSIAHAGYMALALYTGNAQALGFYLLTYVLATGLAFAVLSQISPDRVPLEALRGLYRKDP
LLGLAFLVAMLSLLGLPPLAGFWGKYLAFAEAARAGAWGVLVLALVTSAVSAYYYLGLGLAVFARPEETPFRPGPPWARA
AVVAAGVLLLALGLLPGLVLPALAAGG
;
;MTLAILAVFSVALTLLGFVLPPQGVKRATLLGLALALASLLLTWGKPFAFGPYAVDGVSQVFTLLALLGALWTVGLVRSG
RFEFYLLVLYAALGMHLLASTRHLLLMLVALEALSLPLYALATWRRGQGLEAALKYFLLGALAAAFFLYGAALFYGATGS
LVLGAPGEGPLYALALGLLLVGLGFKAALAPFHFWTPDVYQGSPTPVVLFMATSVKAAAFAALLRVAAPPEALALLVALS
VVVGNLAALAQKEAKRLLAYSSIAHAGYMALALYTGNAQALGFYLLTYVLATGLAFAVLSQISPDRVPLEALRGLYRKDP
LLGLAFLVAMLSLLGLPPLAGFWGKYLAFAEAARAGAWGVLVLALVTSAVSAYYYLGLGLAVFARPEETPFRPGPPWARA
AVVAAGVLLLALGLLPGLVLPALAAGG
;
N,V ? 
16 'polypeptide(L)' no no 
;MTWSYPVDPYWMVALKALLVVVGLLTAFAFMTLIERRLLARFQVRMGPNRVGPFGLLQPLADAIKSIFKEDIVVAQADRF
LFVLAPLISVVFALLAFGLIPFGPPGSFFGYQPWVINLDLGILYLFAVSELAVYGIFLSGWASGSKYSLLGSLRSSASLI
SYELGLGLALLAPVLLVGSLNLNDIVNWQKEHGWLFLYAFPAFLVYLIASMAEAARTPFDLPEAEQELVGGYHTEYSSIK
WALFQMAEYIHFITASALIPTLFLGGWTMPVLEVPYLWMFLKIAFFLFFFIWIRATWFRLRYDQLLRFGWGFLFPLALLW
FLVTALVVALDLPRTYLLYLSALSFLVLLGAVLYTPKPARKGGGA
;
;MTWSYPVDPYWMVALKALLVVVGLLTAFAFMTLIERRLLARFQVRMGPNRVGPFGLLQPLADAIKSIFKEDIVVAQADRF
LFVLAPLISVVFALLAFGLIPFGPPGSFFGYQPWVINLDLGILYLFAVSELAVYGIFLSGWASGSKYSLLGSLRSSASLI
SYELGLGLALLAPVLLVGSLNLNDIVNWQKEHGWLFLYAFPAFLVYLIASMAEAARTPFDLPEAEQELVGGYHTEYSSIK
WALFQMAEYIHFITASALIPTLFLGGWTMPVLEVPYLWMFLKIAFFLFFFIWIRATWFRLRYDQLLRFGWGFLFPLALLW
FLVTALVVALDLPRTYLLYLSALSFLVLLGAVLYTPKPARKGGGA
;
H,Q ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
17 'IRON/SULFUR CLUSTER'                          SF4 
18 'FLAVIN MONONUCLEOTIDE'                        FMN 
19 '1,4-DIHYDRONICOTINAMIDE ADENINE DINUCLEOTIDE' NAI 
20 'FE2/S2 (INORGANIC) CLUSTER'                   FES 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1  1   MET n 
1  2   THR n 
1  3   GLY n 
1  4   PRO n 
1  5   ILE n 
1  6   LEU n 
1  7   SER n 
1  8   GLY n 
1  9   LEU n 
1  10  ASP n 
1  11  PRO n 
1  12  ARG n 
1  13  PHE n 
1  14  GLU n 
1  15  ARG n 
1  16  THR n 
1  17  LEU n 
1  18  TYR n 
1  19  ALA n 
1  20  HIS n 
1  21  VAL n 
1  22  GLY n 
1  23  LYS n 
1  24  GLU n 
1  25  GLY n 
1  26  SER n 
1  27  TRP n 
1  28  THR n 
1  29  LEU n 
1  30  ASP n 
1  31  TYR n 
1  32  TYR n 
1  33  LEU n 
1  34  ARG n 
1  35  HIS n 
1  36  GLY n 
1  37  GLY n 
1  38  TYR n 
1  39  GLU n 
1  40  THR n 
1  41  ALA n 
1  42  LYS n 
1  43  ARG n 
1  44  VAL n 
1  45  LEU n 
1  46  LYS n 
1  47  GLU n 
1  48  LYS n 
1  49  THR n 
1  50  PRO n 
1  51  ASP n 
1  52  GLU n 
1  53  VAL n 
1  54  ILE n 
1  55  GLU n 
1  56  GLU n 
1  57  VAL n 
1  58  LYS n 
1  59  ARG n 
1  60  SER n 
1  61  GLY n 
1  62  LEU n 
1  63  ARG n 
1  64  GLY n 
1  65  ARG n 
1  66  GLY n 
1  67  GLY n 
1  68  ALA n 
1  69  GLY n 
1  70  PHE n 
1  71  PRO n 
1  72  THR n 
1  73  GLY n 
1  74  LEU n 
1  75  LYS n 
1  76  TRP n 
1  77  SER n 
1  78  PHE n 
1  79  MET n 
1  80  PRO n 
1  81  LYS n 
1  82  ASP n 
1  83  ASP n 
1  84  GLY n 
1  85  LYS n 
1  86  GLN n 
1  87  HIS n 
1  88  TYR n 
1  89  LEU n 
1  90  ILE n 
1  91  CYS n 
1  92  ASN n 
1  93  ALA n 
1  94  ASP n 
1  95  GLU n 
1  96  SER n 
1  97  GLU n 
1  98  PRO n 
1  99  GLY n 
1  100 SER n 
1  101 PHE n 
1  102 LYS n 
1  103 ASP n 
1  104 ARG n 
1  105 TYR n 
1  106 ILE n 
1  107 LEU n 
1  108 GLU n 
1  109 ASP n 
1  110 VAL n 
1  111 PRO n 
1  112 HIS n 
1  113 LEU n 
1  114 LEU n 
1  115 ILE n 
1  116 GLU n 
1  117 GLY n 
1  118 MET n 
1  119 ILE n 
1  120 LEU n 
1  121 ALA n 
1  122 GLY n 
1  123 TYR n 
1  124 ALA n 
1  125 ILE n 
1  126 ARG n 
1  127 ALA n 
1  128 THR n 
1  129 VAL n 
1  130 GLY n 
1  131 TYR n 
1  132 ILE n 
1  133 TYR n 
1  134 VAL n 
1  135 ARG n 
1  136 GLY n 
1  137 GLU n 
1  138 TYR n 
1  139 ARG n 
1  140 ARG n 
1  141 ALA n 
1  142 ALA n 
1  143 ASP n 
1  144 ARG n 
1  145 LEU n 
1  146 GLU n 
1  147 GLN n 
1  148 ALA n 
1  149 ILE n 
1  150 LYS n 
1  151 GLU n 
1  152 ALA n 
1  153 ARG n 
1  154 ALA n 
1  155 ARG n 
1  156 GLY n 
1  157 TYR n 
1  158 LEU n 
1  159 GLY n 
1  160 LYS n 
1  161 ASN n 
1  162 LEU n 
1  163 PHE n 
1  164 GLY n 
1  165 THR n 
1  166 ASP n 
1  167 PHE n 
1  168 SER n 
1  169 PHE n 
1  170 ASP n 
1  171 LEU n 
1  172 HIS n 
1  173 VAL n 
1  174 HIS n 
1  175 ARG n 
1  176 GLY n 
1  177 ALA n 
1  178 GLY n 
1  179 ALA n 
1  180 TYR n 
1  181 ILE n 
1  182 CYS n 
1  183 GLY n 
1  184 GLU n 
1  185 GLU n 
1  186 THR n 
1  187 ALA n 
1  188 LEU n 
1  189 MET n 
1  190 ASN n 
1  191 SER n 
1  192 LEU n 
1  193 GLU n 
1  194 GLY n 
1  195 LEU n 
1  196 ARG n 
1  197 ALA n 
1  198 ASN n 
1  199 PRO n 
1  200 ARG n 
1  201 LEU n 
1  202 LYS n 
1  203 PRO n 
1  204 PRO n 
1  205 PHE n 
1  206 PRO n 
1  207 ALA n 
1  208 GLN n 
1  209 SER n 
1  210 GLY n 
1  211 LEU n 
1  212 TRP n 
1  213 GLY n 
1  214 LYS n 
1  215 PRO n 
1  216 THR n 
1  217 THR n 
1  218 ILE n 
1  219 ASN n 
1  220 ASN n 
1  221 VAL n 
1  222 GLU n 
1  223 THR n 
1  224 LEU n 
1  225 ALA n 
1  226 SER n 
1  227 VAL n 
1  228 VAL n 
1  229 PRO n 
1  230 ILE n 
1  231 MET n 
1  232 GLU n 
1  233 ARG n 
1  234 GLY n 
1  235 ALA n 
1  236 ASP n 
1  237 TRP n 
1  238 PHE n 
1  239 ALA n 
1  240 GLN n 
1  241 MET n 
1  242 GLY n 
1  243 THR n 
1  244 GLU n 
1  245 GLN n 
1  246 SER n 
1  247 LYS n 
1  248 GLY n 
1  249 MET n 
1  250 LYS n 
1  251 LEU n 
1  252 TYR n 
1  253 GLN n 
1  254 ILE n 
1  255 SER n 
1  256 GLY n 
1  257 PRO n 
1  258 VAL n 
1  259 LYS n 
1  260 ARG n 
1  261 PRO n 
1  262 GLY n 
1  263 VAL n 
1  264 TYR n 
1  265 GLU n 
1  266 LEU n 
1  267 PRO n 
1  268 MET n 
1  269 GLY n 
1  270 THR n 
1  271 THR n 
1  272 PHE n 
1  273 ARG n 
1  274 GLU n 
1  275 LEU n 
1  276 ILE n 
1  277 TYR n 
1  278 GLU n 
1  279 TRP n 
1  280 ALA n 
1  281 GLY n 
1  282 GLY n 
1  283 PRO n 
1  284 LEU n 
1  285 GLU n 
1  286 PRO n 
1  287 ILE n 
1  288 GLN n 
1  289 ALA n 
1  290 ILE n 
1  291 ILE n 
1  292 PRO n 
1  293 GLY n 
1  294 GLY n 
1  295 SER n 
1  296 SER n 
1  297 THR n 
1  298 PRO n 
1  299 PRO n 
1  300 LEU n 
1  301 PRO n 
1  302 PHE n 
1  303 THR n 
1  304 GLU n 
1  305 GLU n 
1  306 VAL n 
1  307 LEU n 
1  308 ASP n 
1  309 THR n 
1  310 PRO n 
1  311 MET n 
1  312 SER n 
1  313 TYR n 
1  314 GLU n 
1  315 HIS n 
1  316 LEU n 
1  317 GLN n 
1  318 ALA n 
1  319 LYS n 
1  320 GLY n 
1  321 SER n 
1  322 MET n 
1  323 LEU n 
1  324 GLY n 
1  325 THR n 
1  326 GLY n 
1  327 GLY n 
1  328 VAL n 
1  329 ILE n 
1  330 LEU n 
1  331 ILE n 
1  332 PRO n 
1  333 GLU n 
1  334 ARG n 
1  335 VAL n 
1  336 SER n 
1  337 MET n 
1  338 VAL n 
1  339 ASP n 
1  340 ALA n 
1  341 MET n 
1  342 TRP n 
1  343 ASN n 
1  344 LEU n 
1  345 THR n 
1  346 ARG n 
1  347 PHE n 
1  348 TYR n 
1  349 ALA n 
1  350 HIS n 
1  351 GLU n 
1  352 SER n 
1  353 CYS n 
1  354 GLY n 
1  355 LYS n 
1  356 CYS n 
1  357 THR n 
1  358 PRO n 
1  359 CYS n 
1  360 ARG n 
1  361 GLU n 
1  362 GLY n 
1  363 VAL n 
1  364 ALA n 
1  365 GLY n 
1  366 PHE n 
1  367 MET n 
1  368 VAL n 
1  369 ASN n 
1  370 LEU n 
1  371 PHE n 
1  372 ALA n 
1  373 LYS n 
1  374 ILE n 
1  375 GLY n 
1  376 THR n 
1  377 GLY n 
1  378 GLN n 
1  379 GLY n 
1  380 GLU n 
1  381 GLU n 
1  382 LYS n 
1  383 ASP n 
1  384 VAL n 
1  385 GLU n 
1  386 ASN n 
1  387 LEU n 
1  388 GLU n 
1  389 ALA n 
1  390 LEU n 
1  391 LEU n 
1  392 PRO n 
1  393 LEU n 
1  394 ILE n 
1  395 GLU n 
1  396 GLY n 
1  397 ARG n 
1  398 SER n 
1  399 PHE n 
1  400 CYS n 
1  401 PRO n 
1  402 LEU n 
1  403 ALA n 
1  404 ASP n 
1  405 ALA n 
1  406 ALA n 
1  407 VAL n 
1  408 TRP n 
1  409 PRO n 
1  410 VAL n 
1  411 LYS n 
1  412 GLY n 
1  413 SER n 
1  414 LEU n 
1  415 ARG n 
1  416 HIS n 
1  417 PHE n 
1  418 LYS n 
1  419 ASP n 
1  420 GLN n 
1  421 TYR n 
1  422 LEU n 
1  423 ALA n 
1  424 LEU n 
1  425 ALA n 
1  426 ARG n 
1  427 GLU n 
1  428 LYS n 
1  429 ARG n 
1  430 PRO n 
1  431 VAL n 
1  432 PRO n 
1  433 ARG n 
1  434 PRO n 
1  435 SER n 
1  436 LEU n 
1  437 TRP n 
1  438 ARG n 
2  1   MET n 
2  2   GLY n 
2  3   PHE n 
2  4   PHE n 
2  5   ASP n 
2  6   ASP n 
2  7   LYS n 
2  8   GLN n 
2  9   ASP n 
2  10  PHE n 
2  11  LEU n 
2  12  GLU n 
2  13  GLU n 
2  14  THR n 
2  15  PHE n 
2  16  ALA n 
2  17  LYS n 
2  18  TYR n 
2  19  PRO n 
2  20  PRO n 
2  21  GLU n 
2  22  GLY n 
2  23  ARG n 
2  24  ARG n 
2  25  ALA n 
2  26  ALA n 
2  27  ILE n 
2  28  MET n 
2  29  PRO n 
2  30  LEU n 
2  31  LEU n 
2  32  ARG n 
2  33  ARG n 
2  34  VAL n 
2  35  GLN n 
2  36  GLN n 
2  37  GLU n 
2  38  GLU n 
2  39  GLY n 
2  40  TRP n 
2  41  ILE n 
2  42  ARG n 
2  43  PRO n 
2  44  GLU n 
2  45  ARG n 
2  46  ILE n 
2  47  GLU n 
2  48  GLU n 
2  49  ILE n 
2  50  ALA n 
2  51  ARG n 
2  52  LEU n 
2  53  VAL n 
2  54  GLY n 
2  55  THR n 
2  56  THR n 
2  57  PRO n 
2  58  THR n 
2  59  GLU n 
2  60  VAL n 
2  61  MET n 
2  62  GLY n 
2  63  VAL n 
2  64  ALA n 
2  65  SER n 
2  66  PHE n 
2  67  TYR n 
2  68  SER n 
2  69  TYR n 
2  70  TYR n 
2  71  GLN n 
2  72  PHE n 
2  73  VAL n 
2  74  PRO n 
2  75  THR n 
2  76  GLY n 
2  77  LYS n 
2  78  TYR n 
2  79  HIS n 
2  80  LEU n 
2  81  GLN n 
2  82  VAL n 
2  83  CYS n 
2  84  ALA n 
2  85  THR n 
2  86  LEU n 
2  87  SER n 
2  88  CYS n 
2  89  LYS n 
2  90  LEU n 
2  91  ALA n 
2  92  GLY n 
2  93  ALA n 
2  94  GLU n 
2  95  GLU n 
2  96  LEU n 
2  97  TRP n 
2  98  ASP n 
2  99  TYR n 
2  100 LEU n 
2  101 THR n 
2  102 GLU n 
2  103 THR n 
2  104 LEU n 
2  105 GLY n 
2  106 ILE n 
2  107 GLY n 
2  108 PRO n 
2  109 GLY n 
2  110 GLU n 
2  111 VAL n 
2  112 THR n 
2  113 PRO n 
2  114 ASP n 
2  115 GLY n 
2  116 LEU n 
2  117 PHE n 
2  118 SER n 
2  119 VAL n 
2  120 GLN n 
2  121 LYS n 
2  122 VAL n 
2  123 GLU n 
2  124 CYS n 
2  125 LEU n 
2  126 GLY n 
2  127 SER n 
2  128 CYS n 
2  129 HIS n 
2  130 THR n 
2  131 ALA n 
2  132 PRO n 
2  133 VAL n 
2  134 ILE n 
2  135 GLN n 
2  136 VAL n 
2  137 ASN n 
2  138 ASP n 
2  139 GLU n 
2  140 PRO n 
2  141 TYR n 
2  142 VAL n 
2  143 GLU n 
2  144 CYS n 
2  145 VAL n 
2  146 THR n 
2  147 ARG n 
2  148 ALA n 
2  149 ARG n 
2  150 LEU n 
2  151 GLU n 
2  152 ALA n 
2  153 LEU n 
2  154 LEU n 
2  155 ALA n 
2  156 GLY n 
2  157 LEU n 
2  158 ARG n 
2  159 ALA n 
2  160 GLY n 
2  161 LYS n 
2  162 ARG n 
2  163 LEU n 
2  164 GLU n 
2  165 GLU n 
2  166 ILE n 
2  167 GLU n 
2  168 LEU n 
2  169 PRO n 
2  170 GLY n 
2  171 LYS n 
2  172 CYS n 
2  173 GLY n 
2  174 HIS n 
2  175 HIS n 
2  176 VAL n 
2  177 HIS n 
2  178 GLU n 
2  179 VAL n 
2  180 GLU n 
2  181 VAL n 
3  1   MET n 
3  2   VAL n 
3  3   ARG n 
3  4   VAL n 
3  5   LYS n 
3  6   VAL n 
3  7   ASN n 
3  8   ASP n 
3  9   ARG n 
3  10  ILE n 
3  11  VAL n 
3  12  GLU n 
3  13  VAL n 
3  14  PRO n 
3  15  PRO n 
3  16  GLY n 
3  17  THR n 
3  18  SER n 
3  19  VAL n 
3  20  MET n 
3  21  ASP n 
3  22  ALA n 
3  23  VAL n 
3  24  PHE n 
3  25  HIS n 
3  26  ALA n 
3  27  GLY n 
3  28  TYR n 
3  29  ASP n 
3  30  VAL n 
3  31  PRO n 
3  32  LEU n 
3  33  PHE n 
3  34  CYS n 
3  35  SER n 
3  36  GLU n 
3  37  LYS n 
3  38  HIS n 
3  39  LEU n 
3  40  SER n 
3  41  PRO n 
3  42  ILE n 
3  43  GLY n 
3  44  ALA n 
3  45  CYS n 
3  46  ARG n 
3  47  MET n 
3  48  CYS n 
3  49  LEU n 
3  50  VAL n 
3  51  ARG n 
3  52  ILE n 
3  53  GLY n 
3  54  LEU n 
3  55  PRO n 
3  56  LYS n 
3  57  LYS n 
3  58  GLY n 
3  59  PRO n 
3  60  ASP n 
3  61  GLY n 
3  62  LYS n 
3  63  PRO n 
3  64  LEU n 
3  65  LEU n 
3  66  ASN n 
3  67  GLU n 
3  68  LYS n 
3  69  GLY n 
3  70  GLU n 
3  71  PRO n 
3  72  GLU n 
3  73  ILE n 
3  74  GLN n 
3  75  TRP n 
3  76  GLN n 
3  77  PRO n 
3  78  LYS n 
3  79  LEU n 
3  80  ALA n 
3  81  ALA n 
3  82  SER n 
3  83  CYS n 
3  84  VAL n 
3  85  THR n 
3  86  ALA n 
3  87  VAL n 
3  88  ALA n 
3  89  ASP n 
3  90  GLY n 
3  91  MET n 
3  92  VAL n 
3  93  VAL n 
3  94  ASP n 
3  95  THR n 
3  96  LEU n 
3  97  SER n 
3  98  ASP n 
3  99  VAL n 
3  100 VAL n 
3  101 ARG n 
3  102 GLU n 
3  103 ALA n 
3  104 GLN n 
3  105 ALA n 
3  106 GLY n 
3  107 MET n 
3  108 VAL n 
3  109 GLU n 
3  110 PHE n 
3  111 THR n 
3  112 LEU n 
3  113 LEU n 
3  114 ASN n 
3  115 HIS n 
3  116 PRO n 
3  117 LEU n 
3  118 ASP n 
3  119 CYS n 
3  120 PRO n 
3  121 THR n 
3  122 CYS n 
3  123 ASP n 
3  124 LYS n 
3  125 GLY n 
3  126 GLY n 
3  127 ALA n 
3  128 CYS n 
3  129 GLU n 
3  130 LEU n 
3  131 GLN n 
3  132 ASP n 
3  133 ARG n 
3  134 THR n 
3  135 VAL n 
3  136 GLU n 
3  137 TYR n 
3  138 GLY n 
3  139 LEU n 
3  140 TYR n 
3  141 GLU n 
3  142 LYS n 
3  143 TYR n 
3  144 TYR n 
3  145 GLN n 
3  146 LYS n 
3  147 GLY n 
3  148 PRO n 
3  149 LEU n 
3  150 GLU n 
3  151 LEU n 
3  152 PRO n 
3  153 VAL n 
3  154 TYR n 
3  155 THR n 
3  156 ARG n 
3  157 PHE n 
3  158 GLU n 
3  159 PHE n 
3  160 THR n 
3  161 ARG n 
3  162 ARG n 
3  163 HIS n 
3  164 VAL n 
3  165 ASP n 
3  166 LYS n 
3  167 HIS n 
3  168 HIS n 
3  169 PRO n 
3  170 LEU n 
3  171 SER n 
3  172 PRO n 
3  173 PHE n 
3  174 VAL n 
3  175 ILE n 
3  176 LEU n 
3  177 ASP n 
3  178 ARG n 
3  179 GLU n 
3  180 ARG n 
3  181 CYS n 
3  182 ILE n 
3  183 HIS n 
3  184 CYS n 
3  185 LYS n 
3  186 ARG n 
3  187 CYS n 
3  188 VAL n 
3  189 ARG n 
3  190 TYR n 
3  191 PHE n 
3  192 GLU n 
3  193 GLU n 
3  194 VAL n 
3  195 PRO n 
3  196 GLY n 
3  197 ASP n 
3  198 GLU n 
3  199 VAL n 
3  200 LEU n 
3  201 ASP n 
3  202 PHE n 
3  203 ILE n 
3  204 GLU n 
3  205 ARG n 
3  206 GLY n 
3  207 VAL n 
3  208 HIS n 
3  209 THR n 
3  210 PHE n 
3  211 ILE n 
3  212 GLY n 
3  213 THR n 
3  214 MET n 
3  215 ASP n 
3  216 PHE n 
3  217 GLY n 
3  218 LEU n 
3  219 PRO n 
3  220 SER n 
3  221 GLY n 
3  222 PHE n 
3  223 SER n 
3  224 GLY n 
3  225 ASN n 
3  226 ILE n 
3  227 THR n 
3  228 ASP n 
3  229 ILE n 
3  230 CYS n 
3  231 PRO n 
3  232 VAL n 
3  233 GLY n 
3  234 ALA n 
3  235 LEU n 
3  236 LEU n 
3  237 ASP n 
3  238 LEU n 
3  239 THR n 
3  240 ALA n 
3  241 ARG n 
3  242 PHE n 
3  243 ARG n 
3  244 ALA n 
3  245 ARG n 
3  246 ASN n 
3  247 TRP n 
3  248 GLU n 
3  249 MET n 
3  250 GLU n 
3  251 GLU n 
3  252 THR n 
3  253 PRO n 
3  254 THR n 
3  255 THR n 
3  256 CYS n 
3  257 ALA n 
3  258 LEU n 
3  259 CYS n 
3  260 PRO n 
3  261 VAL n 
3  262 GLY n 
3  263 CYS n 
3  264 GLY n 
3  265 ILE n 
3  266 THR n 
3  267 ALA n 
3  268 ASP n 
3  269 THR n 
3  270 ARG n 
3  271 SER n 
3  272 GLY n 
3  273 GLU n 
3  274 LEU n 
3  275 LEU n 
3  276 ARG n 
3  277 ILE n 
3  278 ARG n 
3  279 ALA n 
3  280 ARG n 
3  281 GLU n 
3  282 VAL n 
3  283 PRO n 
3  284 GLU n 
3  285 VAL n 
3  286 ASN n 
3  287 GLU n 
3  288 ILE n 
3  289 TRP n 
3  290 ILE n 
3  291 CYS n 
3  292 ASP n 
3  293 ALA n 
3  294 GLY n 
3  295 ARG n 
3  296 PHE n 
3  297 GLY n 
3  298 HIS n 
3  299 GLU n 
3  300 TRP n 
3  301 ALA n 
3  302 ASP n 
3  303 GLN n 
3  304 ASN n 
3  305 ARG n 
3  306 LEU n 
3  307 LYS n 
3  308 THR n 
3  309 PRO n 
3  310 LEU n 
3  311 VAL n 
3  312 ARG n 
3  313 LYS n 
3  314 GLU n 
3  315 GLY n 
3  316 ARG n 
3  317 LEU n 
3  318 VAL n 
3  319 GLU n 
3  320 ALA n 
3  321 THR n 
3  322 TRP n 
3  323 GLU n 
3  324 GLU n 
3  325 ALA n 
3  326 PHE n 
3  327 LEU n 
3  328 ALA n 
3  329 LEU n 
3  330 LYS n 
3  331 GLU n 
3  332 GLY n 
3  333 LEU n 
3  334 LYS n 
3  335 GLU n 
3  336 ALA n 
3  337 ARG n 
3  338 GLY n 
3  339 GLU n 
3  340 GLU n 
3  341 VAL n 
3  342 GLY n 
3  343 LEU n 
3  344 TYR n 
3  345 LEU n 
3  346 ALA n 
3  347 HIS n 
3  348 ASP n 
3  349 ALA n 
3  350 THR n 
3  351 LEU n 
3  352 GLU n 
3  353 GLU n 
3  354 GLY n 
3  355 LEU n 
3  356 LEU n 
3  357 ALA n 
3  358 SER n 
3  359 GLU n 
3  360 LEU n 
3  361 ALA n 
3  362 LYS n 
3  363 ALA n 
3  364 LEU n 
3  365 LYS n 
3  366 THR n 
3  367 PRO n 
3  368 HIS n 
3  369 LEU n 
3  370 ASP n 
3  371 PHE n 
3  372 GLN n 
3  373 GLY n 
3  374 ARG n 
3  375 THR n 
3  376 ALA n 
3  377 ALA n 
3  378 PRO n 
3  379 ALA n 
3  380 SER n 
3  381 LEU n 
3  382 PHE n 
3  383 PRO n 
3  384 PRO n 
3  385 ALA n 
3  386 SER n 
3  387 LEU n 
3  388 GLU n 
3  389 ASP n 
3  390 LEU n 
3  391 LEU n 
3  392 GLN n 
3  393 ALA n 
3  394 ASP n 
3  395 PHE n 
3  396 ALA n 
3  397 LEU n 
3  398 VAL n 
3  399 LEU n 
3  400 GLY n 
3  401 ASP n 
3  402 PRO n 
3  403 THR n 
3  404 GLU n 
3  405 GLU n 
3  406 ALA n 
3  407 PRO n 
3  408 ILE n 
3  409 LEU n 
3  410 HIS n 
3  411 LEU n 
3  412 ARG n 
3  413 LEU n 
3  414 SER n 
3  415 GLU n 
3  416 PHE n 
3  417 VAL n 
3  418 ARG n 
3  419 ASP n 
3  420 LEU n 
3  421 LYS n 
3  422 PRO n 
3  423 PRO n 
3  424 HIS n 
3  425 ARG n 
3  426 TYR n 
3  427 ASN n 
3  428 HIS n 
3  429 GLY n 
3  430 THR n 
3  431 PRO n 
3  432 PHE n 
3  433 ALA n 
3  434 ASP n 
3  435 LEU n 
3  436 GLN n 
3  437 ILE n 
3  438 LYS n 
3  439 GLU n 
3  440 ARG n 
3  441 MET n 
3  442 PRO n 
3  443 ARG n 
3  444 ARG n 
3  445 THR n 
3  446 ASP n 
3  447 LYS n 
3  448 MET n 
3  449 ALA n 
3  450 LEU n 
3  451 PHE n 
3  452 ALA n 
3  453 PRO n 
3  454 TYR n 
3  455 ARG n 
3  456 ALA n 
3  457 PRO n 
3  458 LEU n 
3  459 MET n 
3  460 LYS n 
3  461 TRP n 
3  462 ALA n 
3  463 ALA n 
3  464 ILE n 
3  465 HIS n 
3  466 GLU n 
3  467 VAL n 
3  468 HIS n 
3  469 ARG n 
3  470 PRO n 
3  471 GLY n 
3  472 GLU n 
3  473 GLU n 
3  474 ARG n 
3  475 GLU n 
3  476 ILE n 
3  477 LEU n 
3  478 LEU n 
3  479 ALA n 
3  480 LEU n 
3  481 LEU n 
3  482 GLY n 
3  483 ASP n 
3  484 LYS n 
3  485 GLU n 
3  486 GLY n 
3  487 SER n 
3  488 GLU n 
3  489 MET n 
3  490 VAL n 
3  491 ALA n 
3  492 LYS n 
3  493 ALA n 
3  494 LYS n 
3  495 GLU n 
3  496 ALA n 
3  497 TRP n 
3  498 GLU n 
3  499 LYS n 
3  500 ALA n 
3  501 LYS n 
3  502 ASN n 
3  503 PRO n 
3  504 VAL n 
3  505 LEU n 
3  506 ILE n 
3  507 LEU n 
3  508 GLY n 
3  509 ALA n 
3  510 GLY n 
3  511 VAL n 
3  512 LEU n 
3  513 GLN n 
3  514 ASP n 
3  515 THR n 
3  516 VAL n 
3  517 ALA n 
3  518 ALA n 
3  519 GLU n 
3  520 ARG n 
3  521 ALA n 
3  522 ARG n 
3  523 LEU n 
3  524 LEU n 
3  525 ALA n 
3  526 GLU n 
3  527 ARG n 
3  528 LYS n 
3  529 GLY n 
3  530 ALA n 
3  531 LYS n 
3  532 VAL n 
3  533 LEU n 
3  534 ALA n 
3  535 MET n 
3  536 THR n 
3  537 PRO n 
3  538 ALA n 
3  539 ALA n 
3  540 ASN n 
3  541 ALA n 
3  542 ARG n 
3  543 GLY n 
3  544 LEU n 
3  545 GLU n 
3  546 ALA n 
3  547 MET n 
3  548 GLY n 
3  549 VAL n 
3  550 LEU n 
3  551 PRO n 
3  552 GLY n 
3  553 ALA n 
3  554 LYS n 
3  555 GLY n 
3  556 ALA n 
3  557 SER n 
3  558 TRP n 
3  559 ASP n 
3  560 GLU n 
3  561 PRO n 
3  562 GLY n 
3  563 ALA n 
3  564 LEU n 
3  565 TYR n 
3  566 ALA n 
3  567 TYR n 
3  568 TYR n 
3  569 GLY n 
3  570 PHE n 
3  571 VAL n 
3  572 PRO n 
3  573 PRO n 
3  574 GLU n 
3  575 GLU n 
3  576 ALA n 
3  577 LEU n 
3  578 LYS n 
3  579 GLY n 
3  580 LYS n 
3  581 ARG n 
3  582 PHE n 
3  583 VAL n 
3  584 VAL n 
3  585 MET n 
3  586 HIS n 
3  587 LEU n 
3  588 SER n 
3  589 HIS n 
3  590 LEU n 
3  591 HIS n 
3  592 PRO n 
3  593 LEU n 
3  594 ALA n 
3  595 GLU n 
3  596 ARG n 
3  597 TYR n 
3  598 ALA n 
3  599 HIS n 
3  600 VAL n 
3  601 VAL n 
3  602 LEU n 
3  603 PRO n 
3  604 ALA n 
3  605 PRO n 
3  606 THR n 
3  607 PHE n 
3  608 TYR n 
3  609 GLU n 
3  610 LYS n 
3  611 ARG n 
3  612 GLY n 
3  613 HIS n 
3  614 LEU n 
3  615 VAL n 
3  616 ASN n 
3  617 LEU n 
3  618 GLU n 
3  619 GLY n 
3  620 ARG n 
3  621 VAL n 
3  622 LEU n 
3  623 PRO n 
3  624 LEU n 
3  625 SER n 
3  626 PRO n 
3  627 ALA n 
3  628 PRO n 
3  629 ILE n 
3  630 GLU n 
3  631 ASN n 
3  632 GLY n 
3  633 GLU n 
3  634 ALA n 
3  635 GLU n 
3  636 GLY n 
3  637 ALA n 
3  638 LEU n 
3  639 GLN n 
3  640 VAL n 
3  641 LEU n 
3  642 ALA n 
3  643 LEU n 
3  644 LEU n 
3  645 ALA n 
3  646 GLU n 
3  647 ALA n 
3  648 LEU n 
3  649 GLY n 
3  650 VAL n 
3  651 ARG n 
3  652 PRO n 
3  653 PRO n 
3  654 PHE n 
3  655 ARG n 
3  656 LEU n 
3  657 HIS n 
3  658 LEU n 
3  659 GLU n 
3  660 ALA n 
3  661 GLN n 
3  662 LYS n 
3  663 ALA n 
3  664 LEU n 
3  665 LYS n 
3  666 ALA n 
3  667 ARG n 
3  668 LYS n 
3  669 VAL n 
3  670 PRO n 
3  671 GLU n 
3  672 ALA n 
3  673 MET n 
3  674 GLY n 
3  675 ARG n 
3  676 LEU n 
3  677 SER n 
3  678 PHE n 
3  679 ARG n 
3  680 LEU n 
3  681 LYS n 
3  682 GLU n 
3  683 LEU n 
3  684 ARG n 
3  685 PRO n 
3  686 LYS n 
3  687 GLU n 
3  688 ARG n 
3  689 LYS n 
3  690 GLY n 
3  691 ALA n 
3  692 PHE n 
3  693 TYR n 
3  694 LEU n 
3  695 ARG n 
3  696 PRO n 
3  697 THR n 
3  698 MET n 
3  699 TRP n 
3  700 LYS n 
3  701 ALA n 
3  702 HIS n 
3  703 GLN n 
3  704 ALA n 
3  705 VAL n 
3  706 GLY n 
3  707 LYS n 
3  708 ALA n 
3  709 GLN n 
3  710 GLU n 
3  711 ALA n 
3  712 ALA n 
3  713 ARG n 
3  714 ALA n 
3  715 GLU n 
3  716 LEU n 
3  717 TRP n 
3  718 ALA n 
3  719 HIS n 
3  720 PRO n 
3  721 GLU n 
3  722 THR n 
3  723 ALA n 
3  724 ARG n 
3  725 ALA n 
3  726 GLU n 
3  727 ALA n 
3  728 LEU n 
3  729 PRO n 
3  730 GLU n 
3  731 GLY n 
3  732 ALA n 
3  733 GLN n 
3  734 VAL n 
3  735 ALA n 
3  736 VAL n 
3  737 GLU n 
3  738 THR n 
3  739 PRO n 
3  740 PHE n 
3  741 GLY n 
3  742 ARG n 
3  743 VAL n 
3  744 GLU n 
3  745 ALA n 
3  746 ARG n 
3  747 VAL n 
3  748 VAL n 
3  749 HIS n 
3  750 ARG n 
3  751 GLU n 
3  752 ASP n 
3  753 VAL n 
3  754 PRO n 
3  755 LYS n 
3  756 GLY n 
3  757 HIS n 
3  758 LEU n 
3  759 TYR n 
3  760 LEU n 
3  761 SER n 
3  762 ALA n 
3  763 LEU n 
3  764 GLY n 
3  765 PRO n 
3  766 ALA n 
3  767 ALA n 
3  768 GLY n 
3  769 LEU n 
3  770 ARG n 
3  771 VAL n 
3  772 GLU n 
3  773 GLY n 
3  774 ARG n 
3  775 VAL n 
3  776 LEU n 
3  777 VAL n 
3  778 PRO n 
3  779 ALA n 
3  780 GLY n 
3  781 GLY n 
3  782 GLU n 
3  783 ALA n 
4  1   MET n 
4  2   ARG n 
4  3   GLU n 
4  4   GLU n 
4  5   PHE n 
4  6   LEU n 
4  7   GLU n 
4  8   GLU n 
4  9   ILE n 
4  10  PRO n 
4  11  LEU n 
4  12  ASP n 
4  13  ALA n 
4  14  PRO n 
4  15  PRO n 
4  16  GLU n 
4  17  GLU n 
4  18  ALA n 
4  19  LYS n 
4  20  GLU n 
4  21  LEU n 
4  22  ARG n 
4  23  THR n 
4  24  GLU n 
4  25  VAL n 
4  26  MET n 
4  27  THR n 
4  28  LEU n 
4  29  ASN n 
4  30  VAL n 
4  31  GLY n 
4  32  PRO n 
4  33  GLN n 
4  34  HIS n 
4  35  PRO n 
4  36  SER n 
4  37  THR n 
4  38  HIS n 
4  39  GLY n 
4  40  VAL n 
4  41  LEU n 
4  42  ARG n 
4  43  LEU n 
4  44  MET n 
4  45  VAL n 
4  46  THR n 
4  47  LEU n 
4  48  SER n 
4  49  GLY n 
4  50  GLU n 
4  51  GLU n 
4  52  VAL n 
4  53  LEU n 
4  54  GLU n 
4  55  VAL n 
4  56  VAL n 
4  57  PRO n 
4  58  HIS n 
4  59  ILE n 
4  60  GLY n 
4  61  TYR n 
4  62  LEU n 
4  63  HIS n 
4  64  THR n 
4  65  GLY n 
4  66  PHE n 
4  67  GLU n 
4  68  LYS n 
4  69  THR n 
4  70  MET n 
4  71  GLU n 
4  72  HIS n 
4  73  ARG n 
4  74  THR n 
4  75  TYR n 
4  76  LEU n 
4  77  GLN n 
4  78  ASN n 
4  79  ILE n 
4  80  THR n 
4  81  TYR n 
4  82  THR n 
4  83  PRO n 
4  84  ARG n 
4  85  MET n 
4  86  ASP n 
4  87  TYR n 
4  88  LEU n 
4  89  HIS n 
4  90  SER n 
4  91  PHE n 
4  92  ALA n 
4  93  HIS n 
4  94  ASP n 
4  95  LEU n 
4  96  ALA n 
4  97  TYR n 
4  98  ALA n 
4  99  LEU n 
4  100 ALA n 
4  101 VAL n 
4  102 GLU n 
4  103 LYS n 
4  104 LEU n 
4  105 LEU n 
4  106 GLY n 
4  107 ALA n 
4  108 VAL n 
4  109 VAL n 
4  110 PRO n 
4  111 PRO n 
4  112 ARG n 
4  113 ALA n 
4  114 GLU n 
4  115 THR n 
4  116 ILE n 
4  117 ARG n 
4  118 VAL n 
4  119 ILE n 
4  120 LEU n 
4  121 ASN n 
4  122 GLU n 
4  123 LEU n 
4  124 SER n 
4  125 ARG n 
4  126 LEU n 
4  127 ALA n 
4  128 SER n 
4  129 HIS n 
4  130 LEU n 
4  131 VAL n 
4  132 PHE n 
4  133 LEU n 
4  134 GLY n 
4  135 THR n 
4  136 GLY n 
4  137 LEU n 
4  138 LEU n 
4  139 ASP n 
4  140 LEU n 
4  141 GLY n 
4  142 ALA n 
4  143 LEU n 
4  144 THR n 
4  145 PRO n 
4  146 PHE n 
4  147 PHE n 
4  148 TYR n 
4  149 ALA n 
4  150 PHE n 
4  151 ARG n 
4  152 GLU n 
4  153 ARG n 
4  154 GLU n 
4  155 THR n 
4  156 ILE n 
4  157 LEU n 
4  158 ASP n 
4  159 LEU n 
4  160 PHE n 
4  161 GLU n 
4  162 TRP n 
4  163 VAL n 
4  164 THR n 
4  165 GLY n 
4  166 GLN n 
4  167 ARG n 
4  168 PHE n 
4  169 HIS n 
4  170 HIS n 
4  171 ASN n 
4  172 TYR n 
4  173 ILE n 
4  174 ARG n 
4  175 ILE n 
4  176 GLY n 
4  177 GLY n 
4  178 VAL n 
4  179 LYS n 
4  180 GLU n 
4  181 ASP n 
4  182 LEU n 
4  183 PRO n 
4  184 GLU n 
4  185 GLU n 
4  186 PHE n 
4  187 VAL n 
4  188 PRO n 
4  189 GLU n 
4  190 LEU n 
4  191 LYS n 
4  192 LYS n 
4  193 LEU n 
4  194 LEU n 
4  195 GLU n 
4  196 VAL n 
4  197 LEU n 
4  198 PRO n 
4  199 HIS n 
4  200 ARG n 
4  201 ILE n 
4  202 ASP n 
4  203 GLU n 
4  204 TYR n 
4  205 GLU n 
4  206 ALA n 
4  207 LEU n 
4  208 PHE n 
4  209 ALA n 
4  210 GLU n 
4  211 SER n 
4  212 PRO n 
4  213 ILE n 
4  214 PHE n 
4  215 TYR n 
4  216 GLU n 
4  217 ARG n 
4  218 ALA n 
4  219 ARG n 
4  220 GLY n 
4  221 VAL n 
4  222 GLY n 
4  223 VAL n 
4  224 ILE n 
4  225 PRO n 
4  226 PRO n 
4  227 GLU n 
4  228 VAL n 
4  229 ALA n 
4  230 ILE n 
4  231 ASP n 
4  232 LEU n 
4  233 GLY n 
4  234 LEU n 
4  235 THR n 
4  236 GLY n 
4  237 GLY n 
4  238 SER n 
4  239 LEU n 
4  240 ARG n 
4  241 ALA n 
4  242 SER n 
4  243 GLY n 
4  244 VAL n 
4  245 ASN n 
4  246 TYR n 
4  247 ASP n 
4  248 VAL n 
4  249 ARG n 
4  250 LYS n 
4  251 ALA n 
4  252 TYR n 
4  253 PRO n 
4  254 TYR n 
4  255 SER n 
4  256 GLY n 
4  257 TYR n 
4  258 GLU n 
4  259 THR n 
4  260 TYR n 
4  261 THR n 
4  262 PHE n 
4  263 ASP n 
4  264 VAL n 
4  265 PRO n 
4  266 LEU n 
4  267 GLY n 
4  268 GLU n 
4  269 ARG n 
4  270 GLY n 
4  271 ASP n 
4  272 VAL n 
4  273 PHE n 
4  274 ASP n 
4  275 ARG n 
4  276 MET n 
4  277 LEU n 
4  278 VAL n 
4  279 ARG n 
4  280 ILE n 
4  281 ARG n 
4  282 GLU n 
4  283 MET n 
4  284 ARG n 
4  285 GLU n 
4  286 SER n 
4  287 VAL n 
4  288 LYS n 
4  289 ILE n 
4  290 ILE n 
4  291 LYS n 
4  292 GLN n 
4  293 ALA n 
4  294 LEU n 
4  295 GLU n 
4  296 ARG n 
4  297 LEU n 
4  298 GLU n 
4  299 PRO n 
4  300 GLY n 
4  301 PRO n 
4  302 VAL n 
4  303 ARG n 
4  304 ASP n 
4  305 PRO n 
4  306 ASN n 
4  307 PRO n 
4  308 GLN n 
4  309 ILE n 
4  310 THR n 
4  311 PRO n 
4  312 PRO n 
4  313 PRO n 
4  314 ARG n 
4  315 HIS n 
4  316 LEU n 
4  317 LEU n 
4  318 GLU n 
4  319 THR n 
4  320 SER n 
4  321 MET n 
4  322 GLU n 
4  323 ALA n 
4  324 VAL n 
4  325 ILE n 
4  326 TYR n 
4  327 HIS n 
4  328 PHE n 
4  329 LYS n 
4  330 HIS n 
4  331 TYR n 
4  332 THR n 
4  333 GLU n 
4  334 GLY n 
4  335 PHE n 
4  336 HIS n 
4  337 PRO n 
4  338 PRO n 
4  339 LYS n 
4  340 GLY n 
4  341 GLU n 
4  342 VAL n 
4  343 TYR n 
4  344 VAL n 
4  345 PRO n 
4  346 THR n 
4  347 GLU n 
4  348 SER n 
4  349 ALA n 
4  350 ARG n 
4  351 GLY n 
4  352 GLU n 
4  353 LEU n 
4  354 GLY n 
4  355 TYR n 
4  356 TYR n 
4  357 ILE n 
4  358 VAL n 
4  359 SER n 
4  360 ASP n 
4  361 GLY n 
4  362 GLY n 
4  363 SER n 
4  364 MET n 
4  365 PRO n 
4  366 TYR n 
4  367 ARG n 
4  368 VAL n 
4  369 LYS n 
4  370 VAL n 
4  371 ARG n 
4  372 ALA n 
4  373 PRO n 
4  374 SER n 
4  375 PHE n 
4  376 VAL n 
4  377 ASN n 
4  378 LEU n 
4  379 GLN n 
4  380 SER n 
4  381 LEU n 
4  382 PRO n 
4  383 TYR n 
4  384 ALA n 
4  385 CYS n 
4  386 LYS n 
4  387 GLY n 
4  388 GLU n 
4  389 GLN n 
4  390 VAL n 
4  391 PRO n 
4  392 ASP n 
4  393 MET n 
4  394 VAL n 
4  395 ALA n 
4  396 ILE n 
4  397 ILE n 
4  398 ALA n 
4  399 SER n 
4  400 LEU n 
4  401 ASP n 
4  402 PRO n 
4  403 VAL n 
4  404 MET n 
4  405 GLY n 
4  406 ASP n 
4  407 VAL n 
4  408 ASP n 
4  409 ARG n 
5  1   MET n 
5  2   ARG n 
5  3   LEU n 
5  4   GLU n 
5  5   ARG n 
5  6   VAL n 
5  7   LEU n 
5  8   GLU n 
5  9   GLU n 
5  10  ALA n 
5  11  ARG n 
5  12  ALA n 
5  13  LYS n 
5  14  GLY n 
5  15  TYR n 
5  16  PRO n 
5  17  ILE n 
5  18  GLU n 
5  19  ASP n 
5  20  ASN n 
5  21  GLY n 
5  22  LEU n 
5  23  GLY n 
5  24  ASN n 
5  25  LEU n 
5  26  TRP n 
5  27  VAL n 
5  28  VAL n 
5  29  LEU n 
5  30  PRO n 
5  31  ARG n 
5  32  GLU n 
5  33  ARG n 
5  34  PHE n 
5  35  LYS n 
5  36  GLU n 
5  37  GLU n 
5  38  MET n 
5  39  ALA n 
5  40  HIS n 
5  41  TYR n 
5  42  LYS n 
5  43  ALA n 
5  44  MET n 
5  45  GLY n 
5  46  PHE n 
5  47  ASN n 
5  48  PHE n 
5  49  LEU n 
5  50  ALA n 
5  51  ASP n 
5  52  ILE n 
5  53  VAL n 
5  54  GLY n 
5  55  LEU n 
5  56  ASP n 
5  57  TYR n 
5  58  LEU n 
5  59  THR n 
5  60  TYR n 
5  61  PRO n 
5  62  ASP n 
5  63  PRO n 
5  64  ARG n 
5  65  PRO n 
5  66  GLU n 
5  67  ARG n 
5  68  PHE n 
5  69  ALA n 
5  70  VAL n 
5  71  VAL n 
5  72  TYR n 
5  73  GLU n 
5  74  LEU n 
5  75  VAL n 
5  76  SER n 
5  77  LEU n 
5  78  PRO n 
5  79  GLY n 
5  80  TRP n 
5  81  LYS n 
5  82  ASP n 
5  83  GLY n 
5  84  ASP n 
5  85  GLY n 
5  86  SER n 
5  87  ARG n 
5  88  PHE n 
5  89  PHE n 
5  90  VAL n 
5  91  ARG n 
5  92  VAL n 
5  93  TYR n 
5  94  VAL n 
5  95  PRO n 
5  96  GLU n 
5  97  GLU n 
5  98  ASP n 
5  99  PRO n 
5  100 ARG n 
5  101 LEU n 
5  102 PRO n 
5  103 THR n 
5  104 VAL n 
5  105 THR n 
5  106 ASP n 
5  107 LEU n 
5  108 TRP n 
5  109 GLY n 
5  110 SER n 
5  111 ALA n 
5  112 ASN n 
5  113 PHE n 
5  114 LEU n 
5  115 GLU n 
5  116 ARG n 
5  117 GLU n 
5  118 VAL n 
5  119 TYR n 
5  120 ASP n 
5  121 LEU n 
5  122 PHE n 
5  123 GLY n 
5  124 ILE n 
5  125 VAL n 
5  126 PHE n 
5  127 GLU n 
5  128 GLY n 
5  129 HIS n 
5  130 PRO n 
5  131 ASP n 
5  132 LEU n 
5  133 ARG n 
5  134 LYS n 
5  135 ILE n 
5  136 LEU n 
5  137 THR n 
5  138 PRO n 
5  139 GLU n 
5  140 ASP n 
5  141 LEU n 
5  142 GLU n 
5  143 GLY n 
5  144 HIS n 
5  145 PRO n 
5  146 LEU n 
5  147 ARG n 
5  148 LYS n 
5  149 ASP n 
5  150 TYR n 
5  151 PRO n 
5  152 LEU n 
5  153 GLY n 
5  154 GLU n 
5  155 THR n 
5  156 PRO n 
5  157 THR n 
5  158 LEU n 
5  159 PHE n 
5  160 ARG n 
5  161 GLU n 
5  162 GLY n 
5  163 ARG n 
5  164 TYR n 
5  165 ILE n 
5  166 ILE n 
5  167 PRO n 
5  168 ALA n 
5  169 GLU n 
5  170 PHE n 
5  171 ARG n 
5  172 ALA n 
5  173 ALA n 
5  174 LEU n 
5  175 THR n 
5  176 GLY n 
5  177 LYS n 
5  178 ASP n 
5  179 PRO n 
5  180 GLY n 
5  181 LEU n 
5  182 THR n 
5  183 PHE n 
5  184 TYR n 
5  185 LYS n 
5  186 GLY n 
5  187 GLY n 
5  188 SER n 
5  189 ARG n 
5  190 LYS n 
5  191 GLY n 
5  192 TYR n 
5  193 ARG n 
5  194 SER n 
5  195 LEU n 
5  196 TRP n 
5  197 ALA n 
5  198 ASP n 
5  199 LEU n 
5  200 LYS n 
5  201 LYS n 
5  202 ALA n 
5  203 ARG n 
5  204 GLU n 
5  205 VAL n 
5  206 LYS n 
5  207 GLY n 
6  1   MET n 
6  2   ALA n 
6  3   LEU n 
6  4   LYS n 
6  5   ASP n 
6  6   LEU n 
6  7   PHE n 
6  8   GLU n 
6  9   ARG n 
6  10  ASP n 
6  11  VAL n 
6  12  GLN n 
6  13  GLU n 
6  14  LEU n 
6  15  GLU n 
6  16  ARG n 
6  17  GLU n 
6  18  GLY n 
6  19  ILE n 
6  20  LEU n 
6  21  PHE n 
6  22  THR n 
6  23  THR n 
6  24  LEU n 
6  25  GLU n 
6  26  LYS n 
6  27  LEU n 
6  28  VAL n 
6  29  ALA n 
6  30  TRP n 
6  31  GLY n 
6  32  ARG n 
6  33  SER n 
6  34  ASN n 
6  35  SER n 
6  36  LEU n 
6  37  TRP n 
6  38  PRO n 
6  39  ALA n 
6  40  THR n 
6  41  PHE n 
6  42  GLY n 
6  43  LEU n 
6  44  ALA n 
6  45  CYS n 
6  46  CYS n 
6  47  ALA n 
6  48  ILE n 
6  49  GLU n 
6  50  MET n 
6  51  MET n 
6  52  ALA n 
6  53  SER n 
6  54  THR n 
6  55  ASP n 
6  56  ALA n 
6  57  ARG n 
6  58  ASN n 
6  59  ASP n 
6  60  LEU n 
6  61  ALA n 
6  62  ARG n 
6  63  PHE n 
6  64  GLY n 
6  65  SER n 
6  66  GLU n 
6  67  VAL n 
6  68  PHE n 
6  69  ARG n 
6  70  ALA n 
6  71  SER n 
6  72  PRO n 
6  73  ARG n 
6  74  GLN n 
6  75  ALA n 
6  76  ASP n 
6  77  VAL n 
6  78  MET n 
6  79  ILE n 
6  80  VAL n 
6  81  ALA n 
6  82  GLY n 
6  83  ARG n 
6  84  LEU n 
6  85  SER n 
6  86  LYS n 
6  87  LYS n 
6  88  MET n 
6  89  ALA n 
6  90  PRO n 
6  91  VAL n 
6  92  MET n 
6  93  ARG n 
6  94  ARG n 
6  95  VAL n 
6  96  TRP n 
6  97  GLU n 
6  98  GLN n 
6  99  MET n 
6  100 PRO n 
6  101 ASP n 
6  102 PRO n 
6  103 LYS n 
6  104 TRP n 
6  105 VAL n 
6  106 ILE n 
6  107 SER n 
6  108 MET n 
6  109 GLY n 
6  110 ALA n 
6  111 CYS n 
6  112 ALA n 
6  113 SER n 
6  114 SER n 
6  115 GLY n 
6  116 GLY n 
6  117 MET n 
6  118 PHE n 
6  119 ASN n 
6  120 ASN n 
6  121 TYR n 
6  122 ALA n 
6  123 ILE n 
6  124 VAL n 
6  125 GLN n 
6  126 ASN n 
6  127 VAL n 
6  128 ASP n 
6  129 SER n 
6  130 VAL n 
6  131 VAL n 
6  132 PRO n 
6  133 VAL n 
6  134 ASP n 
6  135 VAL n 
6  136 TYR n 
6  137 VAL n 
6  138 PRO n 
6  139 GLY n 
6  140 CYS n 
6  141 PRO n 
6  142 PRO n 
6  143 ARG n 
6  144 PRO n 
6  145 GLU n 
6  146 ALA n 
6  147 LEU n 
6  148 ILE n 
6  149 TYR n 
6  150 ALA n 
6  151 VAL n 
6  152 MET n 
6  153 GLN n 
6  154 LEU n 
6  155 GLN n 
6  156 LYS n 
6  157 LYS n 
6  158 VAL n 
6  159 ARG n 
6  160 GLY n 
6  161 GLN n 
6  162 ALA n 
6  163 TYR n 
6  164 ASN n 
6  165 GLU n 
6  166 ARG n 
6  167 GLY n 
6  168 GLU n 
6  169 ARG n 
6  170 LEU n 
6  171 PRO n 
6  172 PRO n 
6  173 VAL n 
6  174 ALA n 
6  175 ALA n 
6  176 TRP n 
6  177 LYS n 
6  178 ARG n 
6  179 THR n 
6  180 ARG n 
6  181 GLY n 
7  1   MET n 
7  2   THR n 
7  3   LEU n 
7  4   LYS n 
7  5   ALA n 
7  6   LEU n 
7  7   ALA n 
7  8   GLN n 
7  9   SER n 
7  10  LEU n 
7  11  GLY n 
7  12  ILE n 
7  13  THR n 
7  14  LEU n 
7  15  LYS n 
7  16  TYR n 
7  17  LEU n 
7  18  PHE n 
7  19  SER n 
7  20  LYS n 
7  21  PRO n 
7  22  VAL n 
7  23  THR n 
7  24  VAL n 
7  25  PRO n 
7  26  TYR n 
7  27  PRO n 
7  28  ASP n 
7  29  ALA n 
7  30  PRO n 
7  31  VAL n 
7  32  ALA n 
7  33  LEU n 
7  34  LYS n 
7  35  PRO n 
7  36  ARG n 
7  37  PHE n 
7  38  HIS n 
7  39  GLY n 
7  40  ARG n 
7  41  HIS n 
7  42  VAL n 
7  43  LEU n 
7  44  THR n 
7  45  ARG n 
7  46  HIS n 
7  47  PRO n 
7  48  ASN n 
7  49  GLY n 
7  50  LEU n 
7  51  GLU n 
7  52  LYS n 
7  53  CYS n 
7  54  ILE n 
7  55  GLY n 
7  56  CYS n 
7  57  SER n 
7  58  LEU n 
7  59  CYS n 
7  60  ALA n 
7  61  ALA n 
7  62  ALA n 
7  63  CYS n 
7  64  PRO n 
7  65  ALA n 
7  66  TYR n 
7  67  ALA n 
7  68  ILE n 
7  69  TYR n 
7  70  VAL n 
7  71  GLU n 
7  72  PRO n 
7  73  ALA n 
7  74  GLU n 
7  75  ASN n 
7  76  ASP n 
7  77  PRO n 
7  78  GLU n 
7  79  ASN n 
7  80  PRO n 
7  81  VAL n 
7  82  SER n 
7  83  ALA n 
7  84  GLY n 
7  85  GLU n 
7  86  ARG n 
7  87  TYR n 
7  88  ALA n 
7  89  LYS n 
7  90  VAL n 
7  91  TYR n 
7  92  GLU n 
7  93  ILE n 
7  94  ASN n 
7  95  MET n 
7  96  LEU n 
7  97  ARG n 
7  98  CYS n 
7  99  ILE n 
7  100 PHE n 
7  101 CYS n 
7  102 GLY n 
7  103 LEU n 
7  104 CYS n 
7  105 GLU n 
7  106 GLU n 
7  107 ALA n 
7  108 CYS n 
7  109 PRO n 
7  110 THR n 
7  111 GLY n 
7  112 ALA n 
7  113 ILE n 
7  114 VAL n 
7  115 LEU n 
7  116 GLY n 
7  117 TYR n 
7  118 ASP n 
7  119 PHE n 
7  120 GLU n 
7  121 MET n 
7  122 ALA n 
7  123 ASP n 
7  124 TYR n 
7  125 GLU n 
7  126 TYR n 
7  127 SER n 
7  128 ASP n 
7  129 LEU n 
7  130 VAL n 
7  131 TYR n 
7  132 GLY n 
7  133 LYS n 
7  134 GLU n 
7  135 ASP n 
7  136 MET n 
7  137 LEU n 
7  138 VAL n 
7  139 ASP n 
7  140 VAL n 
7  141 VAL n 
7  142 GLY n 
7  143 THR n 
7  144 LYS n 
7  145 PRO n 
7  146 GLN n 
7  147 ARG n 
7  148 ARG n 
7  149 GLU n 
7  150 ALA n 
7  151 LYS n 
7  152 ARG n 
7  153 THR n 
7  154 GLY n 
7  155 LYS n 
7  156 PRO n 
7  157 VAL n 
7  158 LYS n 
7  159 VAL n 
7  160 GLY n 
7  161 TYR n 
7  162 VAL n 
7  163 VAL n 
7  164 PRO n 
7  165 TYR n 
7  166 VAL n 
7  167 ARG n 
7  168 PRO n 
7  169 GLU n 
7  170 LEU n 
7  171 GLU n 
7  172 GLY n 
7  173 PHE n 
7  174 LYS n 
7  175 ALA n 
7  176 PRO n 
7  177 THR n 
7  178 GLU n 
7  179 GLY n 
7  180 GLY n 
7  181 LYS n 
7  182 ARG n 
8  1   MET n 
8  2   SER n 
8  3   ALA n 
8  4   SER n 
8  5   SER n 
8  6   GLU n 
8  7   ARG n 
8  8   GLU n 
8  9   LEU n 
8  10  TYR n 
8  11  GLU n 
8  12  ALA n 
8  13  TRP n 
8  14  VAL n 
8  15  GLU n 
8  16  LEU n 
8  17  LEU n 
8  18  SER n 
8  19  TRP n 
8  20  MET n 
8  21  ARG n 
8  22  GLU n 
8  23  TYR n 
8  24  ALA n 
8  25  GLN n 
8  26  ALA n 
8  27  LYS n 
8  28  GLY n 
8  29  VAL n 
8  30  ARG n 
8  31  PHE n 
8  32  GLU n 
8  33  LYS n 
8  34  GLU n 
8  35  ALA n 
8  36  ASP n 
8  37  PHE n 
8  38  PRO n 
8  39  ASP n 
8  40  PHE n 
8  41  ILE n 
8  42  TYR n 
8  43  ARG n 
8  44  MET n 
8  45  GLU n 
8  46  ARG n 
8  47  PRO n 
8  48  TYR n 
8  49  ASP n 
8  50  LEU n 
8  51  PRO n 
8  52  THR n 
8  53  THR n 
8  54  ILE n 
8  55  MET n 
8  56  THR n 
8  57  ALA n 
8  58  SER n 
8  59  LEU n 
8  60  SER n 
8  61  ASP n 
8  62  GLY n 
8  63  LEU n 
8  64  GLY n 
8  65  GLU n 
8  66  PRO n 
8  67  PHE n 
8  68  LEU n 
8  69  LEU n 
8  70  ALA n 
8  71  ASP n 
8  72  VAL n 
8  73  SER n 
8  74  PRO n 
8  75  ARG n 
8  76  HIS n 
8  77  ALA n 
8  78  LYS n 
8  79  LEU n 
8  80  LYS n 
8  81  ARG n 
8  82  ILE n 
8  83  GLY n 
8  84  LEU n 
8  85  ARG n 
8  86  LEU n 
8  87  PRO n 
8  88  ARG n 
8  89  ALA n 
8  90  HIS n 
8  91  ILE n 
8  92  HIS n 
8  93  LEU n 
8  94  HIS n 
8  95  ALA n 
8  96  HIS n 
8  97  TYR n 
8  98  GLU n 
8  99  PRO n 
8  100 GLY n 
8  101 LYS n 
8  102 GLY n 
8  103 LEU n 
8  104 VAL n 
8  105 THR n 
8  106 GLY n 
8  107 LYS n 
8  108 ILE n 
8  109 PRO n 
8  110 LEU n 
8  111 THR n 
8  112 LYS n 
8  113 GLU n 
8  114 ARG n 
8  115 PHE n 
8  116 PHE n 
8  117 ALA n 
8  118 LEU n 
8  119 ALA n 
8  120 ASP n 
8  121 ARG n 
8  122 ALA n 
8  123 ARG n 
8  124 GLU n 
8  125 ALA n 
8  126 LEU n 
8  127 ALA n 
8  128 PHE n 
8  129 ALA n 
9  1   MET n 
9  2   VAL n 
9  3   ARG n 
9  4   VAL n 
9  5   GLY n 
9  6   MET n 
9  7   ARG n 
9  8   ALA n 
9  9   ALA n 
9  10  PRO n 
9  11  ARG n 
9  12  VAL n 
9  13  SER n 
9  14  LEU n 
9  15  GLU n 
9  16  ALA n 
9  17  LEU n 
9  18  LYS n 
9  19  ALA n 
9  20  ALA n 
9  21  LEU n 
9  22  GLY n 
9  23  GLY n 
9  24  LEU n 
9  25  LYS n 
9  26  LEU n 
9  27  SER n 
9  28  GLU n 
9  29  ALA n 
9  30  LYS n 
9  31  VAL n 
9  32  TYR n 
9  33  LEU n 
9  34  ILE n 
9  35  THR n 
9  36  ASP n 
9  37  TRP n 
9  38  GLN n 
9  39  ASP n 
9  40  LYS n 
9  41  ARG n 
9  42  ASP n 
9  43  GLN n 
9  44  ALA n 
9  45  ARG n 
9  46  TYR n 
9  47  ALA n 
9  48  LEU n 
9  49  LEU n 
9  50  LEU n 
9  51  HIS n 
9  52  THR n 
9  53  GLY n 
9  54  LYS n 
9  55  LYS n 
9  56  ASP n 
9  57  LEU n 
9  58  LEU n 
9  59  VAL n 
9  60  PRO n 
9  61  ASP n 
9  62  ALA n 
9  63  PHE n 
9  64  GLY n 
9  65  PRO n 
9  66  ALA n 
9  67  PHE n 
9  68  PRO n 
9  69  GLY n 
9  70  GLY n 
9  71  GLU n 
9  72  GLU n 
9  73  ALA n 
9  74  LEU n 
9  75  SER n 
9  76  GLU n 
9  77  LEU n 
9  78  VAL n 
9  79  GLY n 
9  80  LEU n 
9  81  LEU n 
9  82  LEU n 
9  83  ALA n 
9  84  GLN n 
9  85  GLY n 
9  86  ALA n 
9  87  ARG n 
9  88  ARG n 
9  89  PHE n 
9  90  TYR n 
9  91  GLU n 
9  92  ALA n 
9  93  VAL n 
9  94  VAL n 
9  95  SER n 
9  96  PRO n 
9  97  GLY n 
9  98  GLU n 
9  99  MET n 
9  100 THR n 
9  101 ALA n 
9  102 LEU n 
9  103 LEU n 
9  104 ASP n 
9  105 LEU n 
9  106 PRO n 
9  107 PRO n 
9  108 GLU n 
9  109 GLU n 
9  110 LEU n 
9  111 LEU n 
9  112 LYS n 
9  113 ARG n 
9  114 VAL n 
9  115 MET n 
9  116 ALA n 
9  117 ILE n 
9  118 ALA n 
9  119 ASN n 
9  120 PRO n 
9  121 THR n 
9  122 ASP n 
9  123 PRO n 
9  124 GLY n 
9  125 ILE n 
9  126 TYR n 
9  127 LEU n 
9  128 LYS n 
9  129 ARG n 
9  130 ALA n 
9  131 ALA n 
10 1   MET n 
10 2   ALA n 
10 3   PRO n 
10 4   ILE n 
10 5   GLN n 
10 6   GLU n 
10 7   TYR n 
10 8   VAL n 
10 9   GLY n 
10 10  THR n 
10 11  LEU n 
10 12  ILE n 
10 13  TYR n 
10 14  VAL n 
10 15  GLY n 
10 16  VAL n 
10 17  ALA n 
10 18  LEU n 
10 19  PHE n 
10 20  ILE n 
10 21  GLY n 
10 22  VAL n 
10 23  ALA n 
10 24  ALA n 
10 25  LEU n 
10 26  LEU n 
10 27  VAL n 
10 28  GLY n 
10 29  ALA n 
10 30  LEU n 
10 31  LEU n 
10 32  GLY n 
10 33  PRO n 
10 34  LYS n 
10 35  LYS n 
10 36  PRO n 
10 37  GLY n 
10 38  ARG n 
10 39  ALA n 
10 40  LYS n 
10 41  LEU n 
10 42  MET n 
10 43  PRO n 
10 44  TYR n 
10 45  GLU n 
10 46  SER n 
10 47  GLY n 
10 48  ASN n 
10 49  ASP n 
10 50  PRO n 
10 51  ALA n 
10 52  GLY n 
10 53  GLU n 
10 54  VAL n 
10 55  LYS n 
10 56  ARG n 
10 57  PHE n 
10 58  PRO n 
10 59  VAL n 
10 60  HIS n 
10 61  PHE n 
10 62  TYR n 
10 63  VAL n 
10 64  VAL n 
10 65  ALA n 
10 66  MET n 
10 67  LEU n 
10 68  PHE n 
10 69  ILE n 
10 70  LEU n 
10 71  PHE n 
10 72  ASP n 
10 73  VAL n 
10 74  GLU n 
10 75  VAL n 
10 76  ALA n 
10 77  PHE n 
10 78  LEU n 
10 79  TRP n 
10 80  PRO n 
10 81  TYR n 
10 82  ALA n 
10 83  VAL n 
10 84  SER n 
10 85  ALA n 
10 86  GLY n 
10 87  GLY n 
10 88  LEU n 
10 89  GLY n 
10 90  LEU n 
10 91  TYR n 
10 92  GLY n 
10 93  PHE n 
10 94  LEU n 
10 95  GLY n 
10 96  VAL n 
10 97  LEU n 
10 98  ALA n 
10 99  PHE n 
10 100 THR n 
10 101 LEU n 
10 102 LEU n 
10 103 LEU n 
10 104 PHE n 
10 105 VAL n 
10 106 GLY n 
10 107 PHE n 
10 108 LEU n 
10 109 TYR n 
10 110 GLU n 
10 111 TRP n 
10 112 TRP n 
10 113 LYS n 
10 114 GLY n 
10 115 VAL n 
10 116 MET n 
10 117 ARG n 
10 118 TRP n 
10 119 HIS n 
11 1   MET n 
11 2   SER n 
11 3   LEU n 
11 4   LEU n 
11 5   GLU n 
11 6   GLY n 
11 7   LEU n 
11 8   ALA n 
11 9   LEU n 
11 10  PHE n 
11 11  LEU n 
11 12  LEU n 
11 13  LEU n 
11 14  LEU n 
11 15  SER n 
11 16  GLY n 
11 17  VAL n 
11 18  LEU n 
11 19  VAL n 
11 20  VAL n 
11 21  THR n 
11 22  LEU n 
11 23  ARG n 
11 24  ASN n 
11 25  ALA n 
11 26  ILE n 
11 27  HIS n 
11 28  ALA n 
11 29  ALA n 
11 30  LEU n 
11 31  ALA n 
11 32  LEU n 
11 33  ILE n 
11 34  LEU n 
11 35  ASN n 
11 36  PHE n 
11 37  LEU n 
11 38  VAL n 
11 39  LEU n 
11 40  ALA n 
11 41  GLY n 
11 42  VAL n 
11 43  TYR n 
11 44  VAL n 
11 45  ALA n 
11 46  LEU n 
11 47  ASP n 
11 48  ALA n 
11 49  ARG n 
11 50  PHE n 
11 51  LEU n 
11 52  GLY n 
11 53  PHE n 
11 54  ILE n 
11 55  GLN n 
11 56  VAL n 
11 57  ILE n 
11 58  VAL n 
11 59  TYR n 
11 60  ALA n 
11 61  GLY n 
11 62  ALA n 
11 63  ILE n 
11 64  VAL n 
11 65  VAL n 
11 66  LEU n 
11 67  PHE n 
11 68  LEU n 
11 69  PHE n 
11 70  VAL n 
11 71  ILE n 
11 72  MET n 
11 73  LEU n 
11 74  LEU n 
11 75  PHE n 
11 76  ALA n 
11 77  ALA n 
11 78  GLN n 
11 79  GLY n 
11 80  GLU n 
11 81  ILE n 
11 82  GLY n 
11 83  PHE n 
11 84  ASP n 
11 85  PRO n 
11 86  LEU n 
11 87  VAL n 
11 88  ARG n 
11 89  SER n 
11 90  ARG n 
11 91  PRO n 
11 92  LEU n 
11 93  ALA n 
11 94  ALA n 
11 95  LEU n 
11 96  LEU n 
11 97  ALA n 
11 98  LEU n 
11 99  GLY n 
11 100 VAL n 
11 101 ALA n 
11 102 GLY n 
11 103 ILE n 
11 104 LEU n 
11 105 ALA n 
11 106 ALA n 
11 107 GLY n 
11 108 LEU n 
11 109 TRP n 
11 110 GLY n 
11 111 LEU n 
11 112 ASP n 
11 113 LEU n 
11 114 ALA n 
11 115 PHE n 
11 116 THR n 
11 117 GLN n 
11 118 ASP n 
11 119 LEU n 
11 120 LYS n 
11 121 GLY n 
11 122 GLY n 
11 123 LEU n 
11 124 PRO n 
11 125 GLN n 
11 126 ALA n 
11 127 LEU n 
11 128 GLY n 
11 129 PRO n 
11 130 LEU n 
11 131 LEU n 
11 132 TYR n 
11 133 GLY n 
11 134 ASP n 
11 135 TRP n 
11 136 LEU n 
11 137 PHE n 
11 138 VAL n 
11 139 LEU n 
11 140 LEU n 
11 141 ALA n 
11 142 VAL n 
11 143 GLY n 
11 144 PHE n 
11 145 LEU n 
11 146 LEU n 
11 147 MET n 
11 148 ALA n 
11 149 ALA n 
11 150 THR n 
11 151 VAL n 
11 152 VAL n 
11 153 ALA n 
11 154 VAL n 
11 155 ALA n 
11 156 LEU n 
11 157 VAL n 
11 158 GLU n 
11 159 PRO n 
11 160 GLY n 
11 161 LYS n 
11 162 ALA n 
11 163 SER n 
11 164 ARG n 
11 165 ALA n 
11 166 LYS n 
11 167 GLU n 
11 168 ALA n 
11 169 GLU n 
11 170 LYS n 
11 171 ARG n 
11 172 GLU n 
11 173 GLU n 
11 174 VAL n 
11 175 ALA n 
11 176 ARG n 
12 1   MET n 
12 2   SER n 
12 3   TYR n 
12 4   LEU n 
12 5   LEU n 
12 6   THR n 
12 7   SER n 
12 8   ALA n 
12 9   LEU n 
12 10  LEU n 
12 11  PHE n 
12 12  ALA n 
12 13  LEU n 
12 14  GLY n 
12 15  VAL n 
12 16  TYR n 
12 17  GLY n 
12 18  VAL n 
12 19  LEU n 
12 20  THR n 
12 21  ARG n 
12 22  ARG n 
12 23  THR n 
12 24  ALA n 
12 25  ILE n 
12 26  LEU n 
12 27  VAL n 
12 28  PHE n 
12 29  LEU n 
12 30  SER n 
12 31  ILE n 
12 32  GLU n 
12 33  LEU n 
12 34  MET n 
12 35  LEU n 
12 36  ASN n 
12 37  ALA n 
12 38  ALA n 
12 39  ASN n 
12 40  LEU n 
12 41  SER n 
12 42  LEU n 
12 43  VAL n 
12 44  GLY n 
12 45  PHE n 
12 46  ALA n 
12 47  ARG n 
12 48  ALA n 
12 49  TYR n 
12 50  GLY n 
12 51  LEU n 
12 52  ASP n 
12 53  GLY n 
12 54  GLN n 
12 55  VAL n 
12 56  ALA n 
12 57  ALA n 
12 58  LEU n 
12 59  MET n 
12 60  VAL n 
12 61  ILE n 
12 62  ALA n 
12 63  VAL n 
12 64  ALA n 
12 65  ALA n 
12 66  ALA n 
12 67  GLU n 
12 68  VAL n 
12 69  ALA n 
12 70  VAL n 
12 71  GLY n 
12 72  LEU n 
12 73  GLY n 
12 74  LEU n 
12 75  ILE n 
12 76  VAL n 
12 77  ALA n 
12 78  ILE n 
12 79  PHE n 
12 80  ARG n 
12 81  HIS n 
12 82  ARG n 
12 83  GLU n 
12 84  SER n 
12 85  THR n 
12 86  ALA n 
12 87  VAL n 
12 88  ASP n 
12 89  ASP n 
12 90  LEU n 
12 91  SER n 
12 92  GLU n 
12 93  LEU n 
12 94  ARG n 
12 95  GLY n 
13 1   MET n 
13 2   ALA n 
13 3   LEU n 
13 4   LEU n 
13 5   GLY n 
13 6   THR n 
13 7   ILE n 
13 8   LEU n 
13 9   LEU n 
13 10  PRO n 
13 11  LEU n 
13 12  LEU n 
13 13  GLY n 
13 14  PHE n 
13 15  ALA n 
13 16  LEU n 
13 17  LEU n 
13 18  GLY n 
13 19  LEU n 
13 20  PHE n 
13 21  GLY n 
13 22  LYS n 
13 23  ARG n 
13 24  MET n 
13 25  ARG n 
13 26  GLU n 
13 27  PRO n 
13 28  LEU n 
13 29  PRO n 
13 30  GLY n 
13 31  VAL n 
13 32  LEU n 
13 33  ALA n 
13 34  SER n 
13 35  GLY n 
13 36  LEU n 
13 37  VAL n 
13 38  LEU n 
13 39  ALA n 
13 40  SER n 
13 41  PHE n 
13 42  LEU n 
13 43  LEU n 
13 44  GLY n 
13 45  ALA n 
13 46  GLY n 
13 47  LEU n 
13 48  LEU n 
13 49  LEU n 
13 50  SER n 
13 51  GLY n 
13 52  GLY n 
13 53  ALA n 
13 54  ARG n 
13 55  PHE n 
13 56  GLN n 
13 57  ALA n 
13 58  GLU n 
13 59  TRP n 
13 60  LEU n 
13 61  PRO n 
13 62  GLY n 
13 63  ILE n 
13 64  PRO n 
13 65  PHE n 
13 66  SER n 
13 67  LEU n 
13 68  LEU n 
13 69  LEU n 
13 70  ASP n 
13 71  ASN n 
13 72  LEU n 
13 73  SER n 
13 74  GLY n 
13 75  PHE n 
13 76  MET n 
13 77  LEU n 
13 78  LEU n 
13 79  ILE n 
13 80  VAL n 
13 81  THR n 
13 82  GLY n 
13 83  VAL n 
13 84  GLY n 
13 85  PHE n 
13 86  LEU n 
13 87  ILE n 
13 88  HIS n 
13 89  VAL n 
13 90  TYR n 
13 91  ALA n 
13 92  ILE n 
13 93  GLY n 
13 94  TYR n 
13 95  MET n 
13 96  GLY n 
13 97  GLY n 
13 98  ASP n 
13 99  PRO n 
13 100 GLY n 
13 101 TYR n 
13 102 SER n 
13 103 ARG n 
13 104 PHE n 
13 105 PHE n 
13 106 ALA n 
13 107 TYR n 
13 108 PHE n 
13 109 ASN n 
13 110 LEU n 
13 111 PHE n 
13 112 ILE n 
13 113 ALA n 
13 114 MET n 
13 115 MET n 
13 116 LEU n 
13 117 THR n 
13 118 LEU n 
13 119 VAL n 
13 120 LEU n 
13 121 ALA n 
13 122 ASP n 
13 123 SER n 
13 124 TYR n 
13 125 PRO n 
13 126 VAL n 
13 127 MET n 
13 128 PHE n 
13 129 ILE n 
13 130 GLY n 
13 131 TRP n 
13 132 GLU n 
13 133 GLY n 
13 134 VAL n 
13 135 GLY n 
13 136 LEU n 
13 137 ALA n 
13 138 SER n 
13 139 PHE n 
13 140 LEU n 
13 141 LEU n 
13 142 ILE n 
13 143 GLY n 
13 144 PHE n 
13 145 TRP n 
13 146 TYR n 
13 147 LYS n 
13 148 ASN n 
13 149 PRO n 
13 150 GLN n 
13 151 TYR n 
13 152 ALA n 
13 153 ASP n 
13 154 SER n 
13 155 ALA n 
13 156 ARG n 
13 157 LYS n 
13 158 ALA n 
13 159 PHE n 
13 160 ILE n 
13 161 VAL n 
13 162 ASN n 
13 163 ARG n 
13 164 ILE n 
13 165 GLY n 
13 166 ASP n 
13 167 LEU n 
13 168 GLY n 
13 169 PHE n 
13 170 MET n 
13 171 LEU n 
13 172 GLY n 
13 173 MET n 
13 174 ALA n 
13 175 ILE n 
13 176 LEU n 
13 177 TRP n 
13 178 ALA n 
13 179 LEU n 
13 180 TYR n 
13 181 GLY n 
13 182 THR n 
13 183 LEU n 
13 184 SER n 
13 185 ILE n 
13 186 SER n 
13 187 GLU n 
13 188 LEU n 
13 189 LYS n 
13 190 GLU n 
13 191 ALA n 
13 192 MET n 
13 193 GLU n 
13 194 GLY n 
13 195 PRO n 
13 196 LEU n 
13 197 LYS n 
13 198 ASN n 
13 199 PRO n 
13 200 ASP n 
13 201 LEU n 
13 202 LEU n 
13 203 ALA n 
13 204 LEU n 
13 205 ALA n 
13 206 GLY n 
13 207 LEU n 
13 208 LEU n 
13 209 LEU n 
13 210 PHE n 
13 211 LEU n 
13 212 GLY n 
13 213 ALA n 
13 214 VAL n 
13 215 GLY n 
13 216 LYS n 
13 217 SER n 
13 218 ALA n 
13 219 GLN n 
13 220 ILE n 
13 221 PRO n 
13 222 LEU n 
13 223 MET n 
13 224 VAL n 
13 225 TRP n 
13 226 LEU n 
13 227 PRO n 
13 228 ASP n 
13 229 ALA n 
13 230 MET n 
13 231 ALA n 
13 232 GLY n 
13 233 PRO n 
13 234 THR n 
13 235 PRO n 
13 236 VAL n 
13 237 SER n 
13 238 ALA n 
13 239 LEU n 
13 240 ILE n 
13 241 HIS n 
13 242 ALA n 
13 243 ALA n 
13 244 THR n 
13 245 MET n 
13 246 VAL n 
13 247 THR n 
13 248 ALA n 
13 249 GLY n 
13 250 VAL n 
13 251 TYR n 
13 252 LEU n 
13 253 ILE n 
13 254 ALA n 
13 255 ARG n 
13 256 SER n 
13 257 SER n 
13 258 PHE n 
13 259 LEU n 
13 260 TYR n 
13 261 SER n 
13 262 VAL n 
13 263 LEU n 
13 264 PRO n 
13 265 ASP n 
13 266 VAL n 
13 267 SER n 
13 268 TYR n 
13 269 ALA n 
13 270 ILE n 
13 271 ALA n 
13 272 VAL n 
13 273 VAL n 
13 274 GLY n 
13 275 LEU n 
13 276 LEU n 
13 277 THR n 
13 278 ALA n 
13 279 ALA n 
13 280 TYR n 
13 281 GLY n 
13 282 ALA n 
13 283 LEU n 
13 284 SER n 
13 285 ALA n 
13 286 PHE n 
13 287 GLY n 
13 288 GLN n 
13 289 THR n 
13 290 ASP n 
13 291 ILE n 
13 292 LYS n 
13 293 LYS n 
13 294 ILE n 
13 295 VAL n 
13 296 ALA n 
13 297 TYR n 
13 298 SER n 
13 299 THR n 
13 300 ILE n 
13 301 SER n 
13 302 GLN n 
13 303 LEU n 
13 304 GLY n 
13 305 TYR n 
13 306 MET n 
13 307 PHE n 
13 308 LEU n 
13 309 ALA n 
13 310 ALA n 
13 311 GLY n 
13 312 VAL n 
13 313 GLY n 
13 314 ALA n 
13 315 TYR n 
13 316 TRP n 
13 317 VAL n 
13 318 ALA n 
13 319 LEU n 
13 320 PHE n 
13 321 HIS n 
13 322 VAL n 
13 323 PHE n 
13 324 THR n 
13 325 HIS n 
13 326 ALA n 
13 327 PHE n 
13 328 PHE n 
13 329 LYS n 
13 330 ALA n 
13 331 LEU n 
13 332 LEU n 
13 333 PHE n 
13 334 LEU n 
13 335 ALA n 
13 336 SER n 
13 337 GLY n 
13 338 SER n 
13 339 VAL n 
13 340 ILE n 
13 341 HIS n 
13 342 ALA n 
13 343 LEU n 
13 344 GLY n 
13 345 GLY n 
13 346 GLU n 
13 347 GLN n 
13 348 ASP n 
13 349 VAL n 
13 350 ARG n 
13 351 LYS n 
13 352 MET n 
13 353 GLY n 
13 354 GLY n 
13 355 LEU n 
13 356 TRP n 
13 357 LYS n 
13 358 HIS n 
13 359 LEU n 
13 360 PRO n 
13 361 GLN n 
13 362 THR n 
13 363 ARG n 
13 364 TRP n 
13 365 HIS n 
13 366 ALA n 
13 367 LEU n 
13 368 ILE n 
13 369 GLY n 
13 370 ALA n 
13 371 LEU n 
13 372 ALA n 
13 373 LEU n 
13 374 GLY n 
13 375 GLY n 
13 376 LEU n 
13 377 PRO n 
13 378 LEU n 
13 379 LEU n 
13 380 SER n 
13 381 GLY n 
13 382 PHE n 
13 383 TRP n 
13 384 SER n 
13 385 LYS n 
13 386 ASP n 
13 387 ALA n 
13 388 ILE n 
13 389 LEU n 
13 390 ALA n 
13 391 ALA n 
13 392 THR n 
13 393 LEU n 
13 394 THR n 
13 395 TYR n 
13 396 PRO n 
13 397 PHE n 
13 398 GLY n 
13 399 GLY n 
13 400 VAL n 
13 401 GLY n 
13 402 PHE n 
13 403 TYR n 
13 404 VAL n 
13 405 GLY n 
13 406 ALA n 
13 407 LEU n 
13 408 LEU n 
13 409 VAL n 
13 410 ALA n 
13 411 VAL n 
13 412 LEU n 
13 413 THR n 
13 414 ALA n 
13 415 MET n 
13 416 TYR n 
13 417 ALA n 
13 418 MET n 
13 419 ARG n 
13 420 TRP n 
13 421 PHE n 
13 422 VAL n 
13 423 LEU n 
13 424 VAL n 
13 425 PHE n 
13 426 LEU n 
13 427 GLY n 
13 428 GLU n 
13 429 GLU n 
13 430 ARG n 
13 431 GLY n 
13 432 HIS n 
13 433 HIS n 
13 434 HIS n 
13 435 PRO n 
13 436 HIS n 
13 437 GLU n 
13 438 ALA n 
13 439 PRO n 
13 440 PRO n 
13 441 VAL n 
13 442 MET n 
13 443 LEU n 
13 444 TRP n 
13 445 PRO n 
13 446 ASN n 
13 447 HIS n 
13 448 LEU n 
13 449 LEU n 
13 450 ALA n 
13 451 LEU n 
13 452 GLY n 
13 453 SER n 
13 454 VAL n 
13 455 LEU n 
13 456 ALA n 
13 457 GLY n 
13 458 TYR n 
13 459 LEU n 
13 460 ALA n 
13 461 LEU n 
13 462 PRO n 
13 463 HIS n 
13 464 PRO n 
13 465 LEU n 
13 466 PRO n 
13 467 ASN n 
13 468 VAL n 
13 469 LEU n 
13 470 GLU n 
13 471 PRO n 
13 472 PHE n 
13 473 LEU n 
13 474 LYS n 
13 475 PRO n 
13 476 ALA n 
13 477 LEU n 
13 478 ALA n 
13 479 GLU n 
13 480 VAL n 
13 481 GLU n 
13 482 ALA n 
13 483 HIS n 
13 484 HIS n 
13 485 LEU n 
13 486 SER n 
13 487 LEU n 
13 488 GLY n 
13 489 ALA n 
13 490 GLU n 
13 491 TRP n 
13 492 GLY n 
13 493 LEU n 
13 494 ILE n 
13 495 ALA n 
13 496 LEU n 
13 497 SER n 
13 498 ALA n 
13 499 ALA n 
13 500 VAL n 
13 501 ALA n 
13 502 LEU n 
13 503 LEU n 
13 504 GLY n 
13 505 LEU n 
13 506 TRP n 
13 507 ALA n 
13 508 GLY n 
13 509 PHE n 
13 510 VAL n 
13 511 PHE n 
13 512 PHE n 
13 513 GLN n 
13 514 ARG n 
13 515 LYS n 
13 516 VAL n 
13 517 PHE n 
13 518 PRO n 
13 519 ALA n 
13 520 TRP n 
13 521 TYR n 
13 522 LEU n 
13 523 ALA n 
13 524 PHE n 
13 525 GLU n 
13 526 ALA n 
13 527 ALA n 
13 528 SER n 
13 529 ARG n 
13 530 GLU n 
13 531 ALA n 
13 532 PHE n 
13 533 TYR n 
13 534 VAL n 
13 535 ASP n 
13 536 ARG n 
13 537 ALA n 
13 538 TYR n 
13 539 ASN n 
13 540 ALA n 
13 541 LEU n 
13 542 ILE n 
13 543 VAL n 
13 544 ASN n 
13 545 PRO n 
13 546 LEU n 
13 547 LYS n 
13 548 ALA n 
13 549 LEU n 
13 550 ALA n 
13 551 GLU n 
13 552 ALA n 
13 553 LEU n 
13 554 PHE n 
13 555 TYR n 
13 556 GLY n 
13 557 ASP n 
13 558 ARG n 
13 559 GLY n 
13 560 LEU n 
13 561 LEU n 
13 562 SER n 
13 563 GLY n 
13 564 TYR n 
13 565 PHE n 
13 566 GLY n 
13 567 LEU n 
13 568 GLY n 
13 569 GLY n 
13 570 ALA n 
13 571 ALA n 
13 572 ARG n 
13 573 SER n 
13 574 LEU n 
13 575 GLY n 
13 576 GLN n 
13 577 GLY n 
13 578 LEU n 
13 579 ALA n 
13 580 ARG n 
13 581 LEU n 
13 582 GLN n 
13 583 THR n 
13 584 GLY n 
13 585 TYR n 
13 586 LEU n 
13 587 ARG n 
13 588 VAL n 
13 589 TYR n 
13 590 ALA n 
13 591 LEU n 
13 592 LEU n 
13 593 PHE n 
13 594 VAL n 
13 595 LEU n 
13 596 GLY n 
13 597 ALA n 
13 598 LEU n 
13 599 LEU n 
13 600 LEU n 
13 601 LEU n 
13 602 GLY n 
13 603 VAL n 
13 604 MET n 
13 605 ARG n 
13 606 TRP n 
14 1   MET n 
14 2   VAL n 
14 3   VAL n 
14 4   LEU n 
14 5   ALA n 
14 6   VAL n 
14 7   LEU n 
14 8   LEU n 
14 9   PRO n 
14 10  VAL n 
14 11  VAL n 
14 12  PHE n 
14 13  GLY n 
14 14  ALA n 
14 15  LEU n 
14 16  LEU n 
14 17  LEU n 
14 18  LEU n 
14 19  GLY n 
14 20  LEU n 
14 21  PRO n 
14 22  ARG n 
14 23  ALA n 
14 24  LEU n 
14 25  GLY n 
14 26  VAL n 
14 27  LEU n 
14 28  GLY n 
14 29  ALA n 
14 30  GLY n 
14 31  LEU n 
14 32  SER n 
14 33  PHE n 
14 34  LEU n 
14 35  LEU n 
14 36  ASN n 
14 37  LEU n 
14 38  TYR n 
14 39  LEU n 
14 40  PHE n 
14 41  LEU n 
14 42  THR n 
14 43  HIS n 
14 44  PRO n 
14 45  GLY n 
14 46  GLY n 
14 47  VAL n 
14 48  ALA n 
14 49  HIS n 
14 50  ALA n 
14 51  PHE n 
14 52  GLN n 
14 53  ALA n 
14 54  PRO n 
14 55  LEU n 
14 56  LEU n 
14 57  PRO n 
14 58  GLY n 
14 59  ALA n 
14 60  GLY n 
14 61  VAL n 
14 62  TYR n 
14 63  TRP n 
14 64  ALA n 
14 65  PHE n 
14 66  GLY n 
14 67  LEU n 
14 68  ASP n 
14 69  GLY n 
14 70  LEU n 
14 71  SER n 
14 72  ALA n 
14 73  LEU n 
14 74  PHE n 
14 75  PHE n 
14 76  LEU n 
14 77  THR n 
14 78  ILE n 
14 79  ALA n 
14 80  LEU n 
14 81  THR n 
14 82  VAL n 
14 83  PHE n 
14 84  LEU n 
14 85  GLY n 
14 86  ALA n 
14 87  LEU n 
14 88  VAL n 
14 89  ALA n 
14 90  ARG n 
14 91  VAL n 
14 92  GLU n 
14 93  GLY n 
14 94  ARG n 
14 95  PHE n 
14 96  LEU n 
14 97  GLY n 
14 98  LEU n 
14 99  ALA n 
14 100 LEU n 
14 101 LEU n 
14 102 MET n 
14 103 GLU n 
14 104 GLY n 
14 105 LEU n 
14 106 LEU n 
14 107 LEU n 
14 108 GLY n 
14 109 LEU n 
14 110 PHE n 
14 111 ALA n 
14 112 ALA n 
14 113 ARG n 
14 114 ASP n 
14 115 LEU n 
14 116 LEU n 
14 117 VAL n 
14 118 PHE n 
14 119 TYR n 
14 120 VAL n 
14 121 PHE n 
14 122 PHE n 
14 123 GLU n 
14 124 ALA n 
14 125 ALA n 
14 126 LEU n 
14 127 ILE n 
14 128 PRO n 
14 129 ALA n 
14 130 LEU n 
14 131 LEU n 
14 132 MET n 
14 133 LEU n 
14 134 TYR n 
14 135 LEU n 
14 136 TYR n 
14 137 GLY n 
14 138 GLY n 
14 139 GLU n 
14 140 GLY n 
14 141 ARG n 
14 142 THR n 
14 143 ARG n 
14 144 ALA n 
14 145 LEU n 
14 146 TYR n 
14 147 THR n 
14 148 PHE n 
14 149 VAL n 
14 150 LEU n 
14 151 PHE n 
14 152 THR n 
14 153 LEU n 
14 154 VAL n 
14 155 GLY n 
14 156 SER n 
14 157 LEU n 
14 158 PRO n 
14 159 MET n 
14 160 LEU n 
14 161 ALA n 
14 162 ALA n 
14 163 VAL n 
14 164 LEU n 
14 165 GLY n 
14 166 ALA n 
14 167 ARG n 
14 168 LEU n 
14 169 LEU n 
14 170 SER n 
14 171 GLY n 
14 172 SER n 
14 173 PRO n 
14 174 THR n 
14 175 PHE n 
14 176 LEU n 
14 177 LEU n 
14 178 GLU n 
14 179 ASP n 
14 180 LEU n 
14 181 LEU n 
14 182 ALA n 
14 183 HIS n 
14 184 PRO n 
14 185 LEU n 
14 186 GLN n 
14 187 GLU n 
14 188 GLU n 
14 189 ALA n 
14 190 ALA n 
14 191 PHE n 
14 192 TRP n 
14 193 VAL n 
14 194 PHE n 
14 195 LEU n 
14 196 GLY n 
14 197 PHE n 
14 198 ALA n 
14 199 LEU n 
14 200 ALA n 
14 201 PHE n 
14 202 ALA n 
14 203 ILE n 
14 204 LYS n 
14 205 THR n 
14 206 PRO n 
14 207 LEU n 
14 208 PHE n 
14 209 PRO n 
14 210 LEU n 
14 211 HIS n 
14 212 ALA n 
14 213 TRP n 
14 214 LEU n 
14 215 PRO n 
14 216 PRO n 
14 217 PHE n 
14 218 HIS n 
14 219 GLN n 
14 220 GLU n 
14 221 ASN n 
14 222 HIS n 
14 223 PRO n 
14 224 SER n 
14 225 GLY n 
14 226 LEU n 
14 227 ALA n 
14 228 ASP n 
14 229 ALA n 
14 230 LEU n 
14 231 GLY n 
14 232 THR n 
14 233 LEU n 
14 234 TYR n 
14 235 LYS n 
14 236 VAL n 
14 237 GLY n 
14 238 VAL n 
14 239 PHE n 
14 240 ALA n 
14 241 PHE n 
14 242 PHE n 
14 243 ARG n 
14 244 PHE n 
14 245 ALA n 
14 246 ILE n 
14 247 PRO n 
14 248 LEU n 
14 249 ALA n 
14 250 PRO n 
14 251 GLU n 
14 252 GLY n 
14 253 PHE n 
14 254 ALA n 
14 255 GLN n 
14 256 ALA n 
14 257 GLN n 
14 258 GLY n 
14 259 LEU n 
14 260 LEU n 
14 261 LEU n 
14 262 PHE n 
14 263 LEU n 
14 264 ALA n 
14 265 ALA n 
14 266 LEU n 
14 267 SER n 
14 268 ALA n 
14 269 LEU n 
14 270 TYR n 
14 271 GLY n 
14 272 ALA n 
14 273 TRP n 
14 274 VAL n 
14 275 ALA n 
14 276 PHE n 
14 277 ALA n 
14 278 ALA n 
14 279 LYS n 
14 280 ASP n 
14 281 PHE n 
14 282 LYS n 
14 283 THR n 
14 284 LEU n 
14 285 LEU n 
14 286 ALA n 
14 287 TYR n 
14 288 ALA n 
14 289 GLY n 
14 290 LEU n 
14 291 SER n 
14 292 HIS n 
14 293 MET n 
14 294 GLY n 
14 295 VAL n 
14 296 ALA n 
14 297 ALA n 
14 298 LEU n 
14 299 GLY n 
14 300 VAL n 
14 301 PHE n 
14 302 SER n 
14 303 GLY n 
14 304 THR n 
14 305 PRO n 
14 306 GLU n 
14 307 GLY n 
14 308 ALA n 
14 309 MET n 
14 310 GLY n 
14 311 GLY n 
14 312 LEU n 
14 313 TYR n 
14 314 LEU n 
14 315 LEU n 
14 316 ALA n 
14 317 ALA n 
14 318 SER n 
14 319 GLY n 
14 320 VAL n 
14 321 TYR n 
14 322 THR n 
14 323 GLY n 
14 324 GLY n 
14 325 LEU n 
14 326 PHE n 
14 327 LEU n 
14 328 LEU n 
14 329 ALA n 
14 330 GLY n 
14 331 ARG n 
14 332 LEU n 
14 333 TYR n 
14 334 GLU n 
14 335 ARG n 
14 336 THR n 
14 337 GLY n 
14 338 THR n 
14 339 LEU n 
14 340 GLU n 
14 341 ILE n 
14 342 GLY n 
14 343 ARG n 
14 344 TYR n 
14 345 ARG n 
14 346 GLY n 
14 347 LEU n 
14 348 ALA n 
14 349 GLN n 
14 350 SER n 
14 351 ALA n 
14 352 PRO n 
14 353 GLY n 
14 354 LEU n 
14 355 ALA n 
14 356 ALA n 
14 357 LEU n 
14 358 ALA n 
14 359 LEU n 
14 360 ILE n 
14 361 LEU n 
14 362 PHE n 
14 363 LEU n 
14 364 ALA n 
14 365 MET n 
14 366 VAL n 
14 367 GLY n 
14 368 LEU n 
14 369 PRO n 
14 370 GLY n 
14 371 LEU n 
14 372 SER n 
14 373 GLY n 
14 374 PHE n 
14 375 PRO n 
14 376 GLY n 
14 377 GLU n 
14 378 PHE n 
14 379 LEU n 
14 380 THR n 
14 381 LEU n 
14 382 LEU n 
14 383 GLY n 
14 384 ALA n 
14 385 TYR n 
14 386 LYS n 
14 387 ALA n 
14 388 SER n 
14 389 PRO n 
14 390 TRP n 
14 391 LEU n 
14 392 ALA n 
14 393 ALA n 
14 394 LEU n 
14 395 ALA n 
14 396 PHE n 
14 397 LEU n 
14 398 SER n 
14 399 VAL n 
14 400 ILE n 
14 401 ALA n 
14 402 SER n 
14 403 ALA n 
14 404 ALA n 
14 405 TYR n 
14 406 ALA n 
14 407 LEU n 
14 408 THR n 
14 409 ALA n 
14 410 PHE n 
14 411 GLN n 
14 412 LYS n 
14 413 THR n 
14 414 PHE n 
14 415 TRP n 
14 416 GLU n 
14 417 GLU n 
14 418 GLY n 
14 419 GLY n 
14 420 SER n 
14 421 GLY n 
14 422 VAL n 
14 423 LYS n 
14 424 ASP n 
14 425 LEU n 
14 426 ALA n 
14 427 GLY n 
14 428 ALA n 
14 429 GLU n 
14 430 TRP n 
14 431 GLY n 
14 432 PHE n 
14 433 ALA n 
14 434 LEU n 
14 435 LEU n 
14 436 SER n 
14 437 VAL n 
14 438 LEU n 
14 439 ALA n 
14 440 LEU n 
14 441 LEU n 
14 442 LEU n 
14 443 MET n 
14 444 GLY n 
14 445 VAL n 
14 446 PHE n 
14 447 PRO n 
14 448 GLY n 
14 449 TYR n 
14 450 PHE n 
14 451 ALA n 
14 452 ARG n 
14 453 GLY n 
14 454 LEU n 
14 455 HIS n 
14 456 PRO n 
14 457 LEU n 
14 458 ALA n 
14 459 GLU n 
14 460 ALA n 
14 461 PHE n 
14 462 ALA n 
14 463 LYS n 
14 464 LEU n 
14 465 LEU n 
14 466 GLY n 
14 467 GLY n 
14 468 GLY n 
14 469 ALA n 
15 1   MET n 
15 2   THR n 
15 3   LEU n 
15 4   ALA n 
15 5   ILE n 
15 6   LEU n 
15 7   ALA n 
15 8   VAL n 
15 9   PHE n 
15 10  SER n 
15 11  VAL n 
15 12  ALA n 
15 13  LEU n 
15 14  THR n 
15 15  LEU n 
15 16  LEU n 
15 17  GLY n 
15 18  PHE n 
15 19  VAL n 
15 20  LEU n 
15 21  PRO n 
15 22  PRO n 
15 23  GLN n 
15 24  GLY n 
15 25  VAL n 
15 26  LYS n 
15 27  ARG n 
15 28  ALA n 
15 29  THR n 
15 30  LEU n 
15 31  LEU n 
15 32  GLY n 
15 33  LEU n 
15 34  ALA n 
15 35  LEU n 
15 36  ALA n 
15 37  LEU n 
15 38  ALA n 
15 39  SER n 
15 40  LEU n 
15 41  LEU n 
15 42  LEU n 
15 43  THR n 
15 44  TRP n 
15 45  GLY n 
15 46  LYS n 
15 47  PRO n 
15 48  PHE n 
15 49  ALA n 
15 50  PHE n 
15 51  GLY n 
15 52  PRO n 
15 53  TYR n 
15 54  ALA n 
15 55  VAL n 
15 56  ASP n 
15 57  GLY n 
15 58  VAL n 
15 59  SER n 
15 60  GLN n 
15 61  VAL n 
15 62  PHE n 
15 63  THR n 
15 64  LEU n 
15 65  LEU n 
15 66  ALA n 
15 67  LEU n 
15 68  LEU n 
15 69  GLY n 
15 70  ALA n 
15 71  LEU n 
15 72  TRP n 
15 73  THR n 
15 74  VAL n 
15 75  GLY n 
15 76  LEU n 
15 77  VAL n 
15 78  ARG n 
15 79  SER n 
15 80  GLY n 
15 81  ARG n 
15 82  PHE n 
15 83  GLU n 
15 84  PHE n 
15 85  TYR n 
15 86  LEU n 
15 87  LEU n 
15 88  VAL n 
15 89  LEU n 
15 90  TYR n 
15 91  ALA n 
15 92  ALA n 
15 93  LEU n 
15 94  GLY n 
15 95  MET n 
15 96  HIS n 
15 97  LEU n 
15 98  LEU n 
15 99  ALA n 
15 100 SER n 
15 101 THR n 
15 102 ARG n 
15 103 HIS n 
15 104 LEU n 
15 105 LEU n 
15 106 LEU n 
15 107 MET n 
15 108 LEU n 
15 109 VAL n 
15 110 ALA n 
15 111 LEU n 
15 112 GLU n 
15 113 ALA n 
15 114 LEU n 
15 115 SER n 
15 116 LEU n 
15 117 PRO n 
15 118 LEU n 
15 119 TYR n 
15 120 ALA n 
15 121 LEU n 
15 122 ALA n 
15 123 THR n 
15 124 TRP n 
15 125 ARG n 
15 126 ARG n 
15 127 GLY n 
15 128 GLN n 
15 129 GLY n 
15 130 LEU n 
15 131 GLU n 
15 132 ALA n 
15 133 ALA n 
15 134 LEU n 
15 135 LYS n 
15 136 TYR n 
15 137 PHE n 
15 138 LEU n 
15 139 LEU n 
15 140 GLY n 
15 141 ALA n 
15 142 LEU n 
15 143 ALA n 
15 144 ALA n 
15 145 ALA n 
15 146 PHE n 
15 147 PHE n 
15 148 LEU n 
15 149 TYR n 
15 150 GLY n 
15 151 ALA n 
15 152 ALA n 
15 153 LEU n 
15 154 PHE n 
15 155 TYR n 
15 156 GLY n 
15 157 ALA n 
15 158 THR n 
15 159 GLY n 
15 160 SER n 
15 161 LEU n 
15 162 VAL n 
15 163 LEU n 
15 164 GLY n 
15 165 ALA n 
15 166 PRO n 
15 167 GLY n 
15 168 GLU n 
15 169 GLY n 
15 170 PRO n 
15 171 LEU n 
15 172 TYR n 
15 173 ALA n 
15 174 LEU n 
15 175 ALA n 
15 176 LEU n 
15 177 GLY n 
15 178 LEU n 
15 179 LEU n 
15 180 LEU n 
15 181 VAL n 
15 182 GLY n 
15 183 LEU n 
15 184 GLY n 
15 185 PHE n 
15 186 LYS n 
15 187 ALA n 
15 188 ALA n 
15 189 LEU n 
15 190 ALA n 
15 191 PRO n 
15 192 PHE n 
15 193 HIS n 
15 194 PHE n 
15 195 TRP n 
15 196 THR n 
15 197 PRO n 
15 198 ASP n 
15 199 VAL n 
15 200 TYR n 
15 201 GLN n 
15 202 GLY n 
15 203 SER n 
15 204 PRO n 
15 205 THR n 
15 206 PRO n 
15 207 VAL n 
15 208 VAL n 
15 209 LEU n 
15 210 PHE n 
15 211 MET n 
15 212 ALA n 
15 213 THR n 
15 214 SER n 
15 215 VAL n 
15 216 LYS n 
15 217 ALA n 
15 218 ALA n 
15 219 ALA n 
15 220 PHE n 
15 221 ALA n 
15 222 ALA n 
15 223 LEU n 
15 224 LEU n 
15 225 ARG n 
15 226 VAL n 
15 227 ALA n 
15 228 ALA n 
15 229 PRO n 
15 230 PRO n 
15 231 GLU n 
15 232 ALA n 
15 233 LEU n 
15 234 ALA n 
15 235 LEU n 
15 236 LEU n 
15 237 VAL n 
15 238 ALA n 
15 239 LEU n 
15 240 SER n 
15 241 VAL n 
15 242 VAL n 
15 243 VAL n 
15 244 GLY n 
15 245 ASN n 
15 246 LEU n 
15 247 ALA n 
15 248 ALA n 
15 249 LEU n 
15 250 ALA n 
15 251 GLN n 
15 252 LYS n 
15 253 GLU n 
15 254 ALA n 
15 255 LYS n 
15 256 ARG n 
15 257 LEU n 
15 258 LEU n 
15 259 ALA n 
15 260 TYR n 
15 261 SER n 
15 262 SER n 
15 263 ILE n 
15 264 ALA n 
15 265 HIS n 
15 266 ALA n 
15 267 GLY n 
15 268 TYR n 
15 269 MET n 
15 270 ALA n 
15 271 LEU n 
15 272 ALA n 
15 273 LEU n 
15 274 TYR n 
15 275 THR n 
15 276 GLY n 
15 277 ASN n 
15 278 ALA n 
15 279 GLN n 
15 280 ALA n 
15 281 LEU n 
15 282 GLY n 
15 283 PHE n 
15 284 TYR n 
15 285 LEU n 
15 286 LEU n 
15 287 THR n 
15 288 TYR n 
15 289 VAL n 
15 290 LEU n 
15 291 ALA n 
15 292 THR n 
15 293 GLY n 
15 294 LEU n 
15 295 ALA n 
15 296 PHE n 
15 297 ALA n 
15 298 VAL n 
15 299 LEU n 
15 300 SER n 
15 301 GLN n 
15 302 ILE n 
15 303 SER n 
15 304 PRO n 
15 305 ASP n 
15 306 ARG n 
15 307 VAL n 
15 308 PRO n 
15 309 LEU n 
15 310 GLU n 
15 311 ALA n 
15 312 LEU n 
15 313 ARG n 
15 314 GLY n 
15 315 LEU n 
15 316 TYR n 
15 317 ARG n 
15 318 LYS n 
15 319 ASP n 
15 320 PRO n 
15 321 LEU n 
15 322 LEU n 
15 323 GLY n 
15 324 LEU n 
15 325 ALA n 
15 326 PHE n 
15 327 LEU n 
15 328 VAL n 
15 329 ALA n 
15 330 MET n 
15 331 LEU n 
15 332 SER n 
15 333 LEU n 
15 334 LEU n 
15 335 GLY n 
15 336 LEU n 
15 337 PRO n 
15 338 PRO n 
15 339 LEU n 
15 340 ALA n 
15 341 GLY n 
15 342 PHE n 
15 343 TRP n 
15 344 GLY n 
15 345 LYS n 
15 346 TYR n 
15 347 LEU n 
15 348 ALA n 
15 349 PHE n 
15 350 ALA n 
15 351 GLU n 
15 352 ALA n 
15 353 ALA n 
15 354 ARG n 
15 355 ALA n 
15 356 GLY n 
15 357 ALA n 
15 358 TRP n 
15 359 GLY n 
15 360 VAL n 
15 361 LEU n 
15 362 VAL n 
15 363 LEU n 
15 364 ALA n 
15 365 LEU n 
15 366 VAL n 
15 367 THR n 
15 368 SER n 
15 369 ALA n 
15 370 VAL n 
15 371 SER n 
15 372 ALA n 
15 373 TYR n 
15 374 TYR n 
15 375 TYR n 
15 376 LEU n 
15 377 GLY n 
15 378 LEU n 
15 379 GLY n 
15 380 LEU n 
15 381 ALA n 
15 382 VAL n 
15 383 PHE n 
15 384 ALA n 
15 385 ARG n 
15 386 PRO n 
15 387 GLU n 
15 388 GLU n 
15 389 THR n 
15 390 PRO n 
15 391 PHE n 
15 392 ARG n 
15 393 PRO n 
15 394 GLY n 
15 395 PRO n 
15 396 PRO n 
15 397 TRP n 
15 398 ALA n 
15 399 ARG n 
15 400 ALA n 
15 401 ALA n 
15 402 VAL n 
15 403 VAL n 
15 404 ALA n 
15 405 ALA n 
15 406 GLY n 
15 407 VAL n 
15 408 LEU n 
15 409 LEU n 
15 410 LEU n 
15 411 ALA n 
15 412 LEU n 
15 413 GLY n 
15 414 LEU n 
15 415 LEU n 
15 416 PRO n 
15 417 GLY n 
15 418 LEU n 
15 419 VAL n 
15 420 LEU n 
15 421 PRO n 
15 422 ALA n 
15 423 LEU n 
15 424 ALA n 
15 425 ALA n 
15 426 GLY n 
15 427 GLY n 
16 1   MET n 
16 2   THR n 
16 3   TRP n 
16 4   SER n 
16 5   TYR n 
16 6   PRO n 
16 7   VAL n 
16 8   ASP n 
16 9   PRO n 
16 10  TYR n 
16 11  TRP n 
16 12  MET n 
16 13  VAL n 
16 14  ALA n 
16 15  LEU n 
16 16  LYS n 
16 17  ALA n 
16 18  LEU n 
16 19  LEU n 
16 20  VAL n 
16 21  VAL n 
16 22  VAL n 
16 23  GLY n 
16 24  LEU n 
16 25  LEU n 
16 26  THR n 
16 27  ALA n 
16 28  PHE n 
16 29  ALA n 
16 30  PHE n 
16 31  MET n 
16 32  THR n 
16 33  LEU n 
16 34  ILE n 
16 35  GLU n 
16 36  ARG n 
16 37  ARG n 
16 38  LEU n 
16 39  LEU n 
16 40  ALA n 
16 41  ARG n 
16 42  PHE n 
16 43  GLN n 
16 44  VAL n 
16 45  ARG n 
16 46  MET n 
16 47  GLY n 
16 48  PRO n 
16 49  ASN n 
16 50  ARG n 
16 51  VAL n 
16 52  GLY n 
16 53  PRO n 
16 54  PHE n 
16 55  GLY n 
16 56  LEU n 
16 57  LEU n 
16 58  GLN n 
16 59  PRO n 
16 60  LEU n 
16 61  ALA n 
16 62  ASP n 
16 63  ALA n 
16 64  ILE n 
16 65  LYS n 
16 66  SER n 
16 67  ILE n 
16 68  PHE n 
16 69  LYS n 
16 70  GLU n 
16 71  ASP n 
16 72  ILE n 
16 73  VAL n 
16 74  VAL n 
16 75  ALA n 
16 76  GLN n 
16 77  ALA n 
16 78  ASP n 
16 79  ARG n 
16 80  PHE n 
16 81  LEU n 
16 82  PHE n 
16 83  VAL n 
16 84  LEU n 
16 85  ALA n 
16 86  PRO n 
16 87  LEU n 
16 88  ILE n 
16 89  SER n 
16 90  VAL n 
16 91  VAL n 
16 92  PHE n 
16 93  ALA n 
16 94  LEU n 
16 95  LEU n 
16 96  ALA n 
16 97  PHE n 
16 98  GLY n 
16 99  LEU n 
16 100 ILE n 
16 101 PRO n 
16 102 PHE n 
16 103 GLY n 
16 104 PRO n 
16 105 PRO n 
16 106 GLY n 
16 107 SER n 
16 108 PHE n 
16 109 PHE n 
16 110 GLY n 
16 111 TYR n 
16 112 GLN n 
16 113 PRO n 
16 114 TRP n 
16 115 VAL n 
16 116 ILE n 
16 117 ASN n 
16 118 LEU n 
16 119 ASP n 
16 120 LEU n 
16 121 GLY n 
16 122 ILE n 
16 123 LEU n 
16 124 TYR n 
16 125 LEU n 
16 126 PHE n 
16 127 ALA n 
16 128 VAL n 
16 129 SER n 
16 130 GLU n 
16 131 LEU n 
16 132 ALA n 
16 133 VAL n 
16 134 TYR n 
16 135 GLY n 
16 136 ILE n 
16 137 PHE n 
16 138 LEU n 
16 139 SER n 
16 140 GLY n 
16 141 TRP n 
16 142 ALA n 
16 143 SER n 
16 144 GLY n 
16 145 SER n 
16 146 LYS n 
16 147 TYR n 
16 148 SER n 
16 149 LEU n 
16 150 LEU n 
16 151 GLY n 
16 152 SER n 
16 153 LEU n 
16 154 ARG n 
16 155 SER n 
16 156 SER n 
16 157 ALA n 
16 158 SER n 
16 159 LEU n 
16 160 ILE n 
16 161 SER n 
16 162 TYR n 
16 163 GLU n 
16 164 LEU n 
16 165 GLY n 
16 166 LEU n 
16 167 GLY n 
16 168 LEU n 
16 169 ALA n 
16 170 LEU n 
16 171 LEU n 
16 172 ALA n 
16 173 PRO n 
16 174 VAL n 
16 175 LEU n 
16 176 LEU n 
16 177 VAL n 
16 178 GLY n 
16 179 SER n 
16 180 LEU n 
16 181 ASN n 
16 182 LEU n 
16 183 ASN n 
16 184 ASP n 
16 185 ILE n 
16 186 VAL n 
16 187 ASN n 
16 188 TRP n 
16 189 GLN n 
16 190 LYS n 
16 191 GLU n 
16 192 HIS n 
16 193 GLY n 
16 194 TRP n 
16 195 LEU n 
16 196 PHE n 
16 197 LEU n 
16 198 TYR n 
16 199 ALA n 
16 200 PHE n 
16 201 PRO n 
16 202 ALA n 
16 203 PHE n 
16 204 LEU n 
16 205 VAL n 
16 206 TYR n 
16 207 LEU n 
16 208 ILE n 
16 209 ALA n 
16 210 SER n 
16 211 MET n 
16 212 ALA n 
16 213 GLU n 
16 214 ALA n 
16 215 ALA n 
16 216 ARG n 
16 217 THR n 
16 218 PRO n 
16 219 PHE n 
16 220 ASP n 
16 221 LEU n 
16 222 PRO n 
16 223 GLU n 
16 224 ALA n 
16 225 GLU n 
16 226 GLN n 
16 227 GLU n 
16 228 LEU n 
16 229 VAL n 
16 230 GLY n 
16 231 GLY n 
16 232 TYR n 
16 233 HIS n 
16 234 THR n 
16 235 GLU n 
16 236 TYR n 
16 237 SER n 
16 238 SER n 
16 239 ILE n 
16 240 LYS n 
16 241 TRP n 
16 242 ALA n 
16 243 LEU n 
16 244 PHE n 
16 245 GLN n 
16 246 MET n 
16 247 ALA n 
16 248 GLU n 
16 249 TYR n 
16 250 ILE n 
16 251 HIS n 
16 252 PHE n 
16 253 ILE n 
16 254 THR n 
16 255 ALA n 
16 256 SER n 
16 257 ALA n 
16 258 LEU n 
16 259 ILE n 
16 260 PRO n 
16 261 THR n 
16 262 LEU n 
16 263 PHE n 
16 264 LEU n 
16 265 GLY n 
16 266 GLY n 
16 267 TRP n 
16 268 THR n 
16 269 MET n 
16 270 PRO n 
16 271 VAL n 
16 272 LEU n 
16 273 GLU n 
16 274 VAL n 
16 275 PRO n 
16 276 TYR n 
16 277 LEU n 
16 278 TRP n 
16 279 MET n 
16 280 PHE n 
16 281 LEU n 
16 282 LYS n 
16 283 ILE n 
16 284 ALA n 
16 285 PHE n 
16 286 PHE n 
16 287 LEU n 
16 288 PHE n 
16 289 PHE n 
16 290 PHE n 
16 291 ILE n 
16 292 TRP n 
16 293 ILE n 
16 294 ARG n 
16 295 ALA n 
16 296 THR n 
16 297 TRP n 
16 298 PHE n 
16 299 ARG n 
16 300 LEU n 
16 301 ARG n 
16 302 TYR n 
16 303 ASP n 
16 304 GLN n 
16 305 LEU n 
16 306 LEU n 
16 307 ARG n 
16 308 PHE n 
16 309 GLY n 
16 310 TRP n 
16 311 GLY n 
16 312 PHE n 
16 313 LEU n 
16 314 PHE n 
16 315 PRO n 
16 316 LEU n 
16 317 ALA n 
16 318 LEU n 
16 319 LEU n 
16 320 TRP n 
16 321 PHE n 
16 322 LEU n 
16 323 VAL n 
16 324 THR n 
16 325 ALA n 
16 326 LEU n 
16 327 VAL n 
16 328 VAL n 
16 329 ALA n 
16 330 LEU n 
16 331 ASP n 
16 332 LEU n 
16 333 PRO n 
16 334 ARG n 
16 335 THR n 
16 336 TYR n 
16 337 LEU n 
16 338 LEU n 
16 339 TYR n 
16 340 LEU n 
16 341 SER n 
16 342 ALA n 
16 343 LEU n 
16 344 SER n 
16 345 PHE n 
16 346 LEU n 
16 347 VAL n 
16 348 LEU n 
16 349 LEU n 
16 350 GLY n 
16 351 ALA n 
16 352 VAL n 
16 353 LEU n 
16 354 TYR n 
16 355 THR n 
16 356 PRO n 
16 357 LYS n 
16 358 PRO n 
16 359 ALA n 
16 360 ARG n 
16 361 LYS n 
16 362 GLY n 
16 363 GLY n 
16 364 GLY n 
16 365 ALA n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1  1 sample 1 438 ? 'Thermus thermophilus HB8' 300852 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2  1 sample 1 181 ? 'Thermus thermophilus HB8' 300852 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3  1 sample 1 783 ? 'Thermus thermophilus HB8' 300852 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4  1 sample 1 409 ? 'Thermus thermophilus HB8' 300852 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5  1 sample 1 207 ? 'Thermus thermophilus HB8' 300852 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6  1 sample 1 181 ? 'Thermus thermophilus HB8' 300852 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
7  1 sample 1 182 ? 'Thermus thermophilus HB8' 300852 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
8  1 sample 1 129 ? 'Thermus thermophilus HB8' 300852 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
9  1 sample 1 131 ? 'Thermus thermophilus HB8' 300852 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
10 1 sample 1 119 ? 'Thermus thermophilus HB8' 300852 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
11 1 sample 1 176 ? 'Thermus thermophilus HB8' 300852 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
12 1 sample 1 95  ? 'Thermus thermophilus HB8' 300852 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
13 1 sample 1 606 ? 'Thermus thermophilus HB8' 300852 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
14 1 sample 1 469 ? 'Thermus thermophilus HB8' 300852 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
15 1 sample 1 427 ? 'Thermus thermophilus HB8' 300852 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
16 1 sample 1 365 ? 'Thermus thermophilus HB8' 300852 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                        ?                          'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                       ?                          'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                     ?                          'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                ?                          'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                                       ?                          'C3 H7 N O2 S'      121.158 
FES non-polymer         . 'FE2/S2 (INORGANIC) CLUSTER'                   ?                          'Fe2 S2'            175.820 
FMN non-polymer         . 'FLAVIN MONONUCLEOTIDE'                        'RIBOFLAVIN MONOPHOSPHATE' 'C17 H21 N4 O9 P'   456.344 
GLN 'L-peptide linking' y GLUTAMINE                                      ?                          'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                ?                          'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                        ?                          'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                      ?                          'C6 H10 N3 O2 1'    156.162 
ILE 'L-peptide linking' y ISOLEUCINE                                     ?                          'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                        ?                          'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                         ?                          'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                     ?                          'C5 H11 N O2 S'     149.211 
NAI non-polymer         . '1,4-DIHYDRONICOTINAMIDE ADENINE DINUCLEOTIDE' NADH                       'C21 H29 N7 O14 P2' 665.441 
PHE 'L-peptide linking' y PHENYLALANINE                                  ?                          'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                        ?                          'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                         ?                          'C3 H7 N O3'        105.093 
SF4 non-polymer         . 'IRON/SULFUR CLUSTER'                          ?                          'Fe4 S4'            351.640 
THR 'L-peptide linking' y THREONINE                                      ?                          'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                     ?                          'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                       ?                          'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                         ?                          'C5 H11 N O2'       117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A  1  1   MET 1   1   ?   ?   ?   1 . n 
A  1  2   THR 2   2   2   THR THR 1 . n 
A  1  3   GLY 3   3   3   GLY GLY 1 . n 
A  1  4   PRO 4   4   4   PRO PRO 1 . n 
A  1  5   ILE 5   5   5   ILE ILE 1 . n 
A  1  6   LEU 6   6   6   LEU LEU 1 . n 
A  1  7   SER 7   7   7   SER SER 1 . n 
A  1  8   GLY 8   8   8   GLY GLY 1 . n 
A  1  9   LEU 9   9   9   LEU LEU 1 . n 
A  1  10  ASP 10  10  10  ASP ASP 1 . n 
A  1  11  PRO 11  11  11  PRO PRO 1 . n 
A  1  12  ARG 12  12  12  ARG ARG 1 . n 
A  1  13  PHE 13  13  13  PHE PHE 1 . n 
A  1  14  GLU 14  14  14  GLU GLU 1 . n 
A  1  15  ARG 15  15  15  ARG ARG 1 . n 
A  1  16  THR 16  16  16  THR THR 1 . n 
A  1  17  LEU 17  17  17  LEU LEU 1 . n 
A  1  18  TYR 18  18  18  TYR TYR 1 . n 
A  1  19  ALA 19  19  19  ALA ALA 1 . n 
A  1  20  HIS 20  20  20  HIS HIS 1 . n 
A  1  21  VAL 21  21  21  VAL VAL 1 . n 
A  1  22  GLY 22  22  22  GLY GLY 1 . n 
A  1  23  LYS 23  23  23  LYS LYS 1 . n 
A  1  24  GLU 24  24  24  GLU GLU 1 . n 
A  1  25  GLY 25  25  25  GLY GLY 1 . n 
A  1  26  SER 26  26  26  SER SER 1 . n 
A  1  27  TRP 27  27  27  TRP TRP 1 . n 
A  1  28  THR 28  28  28  THR THR 1 . n 
A  1  29  LEU 29  29  29  LEU LEU 1 . n 
A  1  30  ASP 30  30  30  ASP ASP 1 . n 
A  1  31  TYR 31  31  31  TYR TYR 1 . n 
A  1  32  TYR 32  32  32  TYR TYR 1 . n 
A  1  33  LEU 33  33  33  LEU LEU 1 . n 
A  1  34  ARG 34  34  34  ARG ARG 1 . n 
A  1  35  HIS 35  35  35  HIS HIS 1 . n 
A  1  36  GLY 36  36  36  GLY GLY 1 . n 
A  1  37  GLY 37  37  37  GLY GLY 1 . n 
A  1  38  TYR 38  38  38  TYR TYR 1 . n 
A  1  39  GLU 39  39  39  GLU GLU 1 . n 
A  1  40  THR 40  40  40  THR THR 1 . n 
A  1  41  ALA 41  41  41  ALA ALA 1 . n 
A  1  42  LYS 42  42  42  LYS LYS 1 . n 
A  1  43  ARG 43  43  43  ARG ARG 1 . n 
A  1  44  VAL 44  44  44  VAL VAL 1 . n 
A  1  45  LEU 45  45  45  LEU LEU 1 . n 
A  1  46  LYS 46  46  46  LYS LYS 1 . n 
A  1  47  GLU 47  47  47  GLU GLU 1 . n 
A  1  48  LYS 48  48  48  LYS LYS 1 . n 
A  1  49  THR 49  49  49  THR THR 1 . n 
A  1  50  PRO 50  50  50  PRO PRO 1 . n 
A  1  51  ASP 51  51  51  ASP ASP 1 . n 
A  1  52  GLU 52  52  52  GLU GLU 1 . n 
A  1  53  VAL 53  53  53  VAL VAL 1 . n 
A  1  54  ILE 54  54  54  ILE ILE 1 . n 
A  1  55  GLU 55  55  55  GLU GLU 1 . n 
A  1  56  GLU 56  56  56  GLU GLU 1 . n 
A  1  57  VAL 57  57  57  VAL VAL 1 . n 
A  1  58  LYS 58  58  58  LYS LYS 1 . n 
A  1  59  ARG 59  59  59  ARG ARG 1 . n 
A  1  60  SER 60  60  60  SER SER 1 . n 
A  1  61  GLY 61  61  61  GLY GLY 1 . n 
A  1  62  LEU 62  62  62  LEU LEU 1 . n 
A  1  63  ARG 63  63  63  ARG ARG 1 . n 
A  1  64  GLY 64  64  64  GLY GLY 1 . n 
A  1  65  ARG 65  65  65  ARG ARG 1 . n 
A  1  66  GLY 66  66  66  GLY GLY 1 . n 
A  1  67  GLY 67  67  67  GLY GLY 1 . n 
A  1  68  ALA 68  68  68  ALA ALA 1 . n 
A  1  69  GLY 69  69  69  GLY GLY 1 . n 
A  1  70  PHE 70  70  70  PHE PHE 1 . n 
A  1  71  PRO 71  71  71  PRO PRO 1 . n 
A  1  72  THR 72  72  72  THR THR 1 . n 
A  1  73  GLY 73  73  73  GLY GLY 1 . n 
A  1  74  LEU 74  74  74  LEU LEU 1 . n 
A  1  75  LYS 75  75  75  LYS LYS 1 . n 
A  1  76  TRP 76  76  76  TRP TRP 1 . n 
A  1  77  SER 77  77  77  SER SER 1 . n 
A  1  78  PHE 78  78  78  PHE PHE 1 . n 
A  1  79  MET 79  79  79  MET MET 1 . n 
A  1  80  PRO 80  80  80  PRO PRO 1 . n 
A  1  81  LYS 81  81  81  LYS LYS 1 . n 
A  1  82  ASP 82  82  82  ASP ASP 1 . n 
A  1  83  ASP 83  83  83  ASP ASP 1 . n 
A  1  84  GLY 84  84  84  GLY GLY 1 . n 
A  1  85  LYS 85  85  85  LYS LYS 1 . n 
A  1  86  GLN 86  86  86  GLN GLN 1 . n 
A  1  87  HIS 87  87  87  HIS HIS 1 . n 
A  1  88  TYR 88  88  88  TYR TYR 1 . n 
A  1  89  LEU 89  89  89  LEU LEU 1 . n 
A  1  90  ILE 90  90  90  ILE ILE 1 . n 
A  1  91  CYS 91  91  91  CYS CYS 1 . n 
A  1  92  ASN 92  92  92  ASN ASN 1 . n 
A  1  93  ALA 93  93  93  ALA ALA 1 . n 
A  1  94  ASP 94  94  94  ASP ASP 1 . n 
A  1  95  GLU 95  95  95  GLU GLU 1 . n 
A  1  96  SER 96  96  96  SER SER 1 . n 
A  1  97  GLU 97  97  97  GLU GLU 1 . n 
A  1  98  PRO 98  98  98  PRO PRO 1 . n 
A  1  99  GLY 99  99  99  GLY GLY 1 . n 
A  1  100 SER 100 100 100 SER SER 1 . n 
A  1  101 PHE 101 101 101 PHE PHE 1 . n 
A  1  102 LYS 102 102 102 LYS LYS 1 . n 
A  1  103 ASP 103 103 103 ASP ASP 1 . n 
A  1  104 ARG 104 104 104 ARG ARG 1 . n 
A  1  105 TYR 105 105 105 TYR TYR 1 . n 
A  1  106 ILE 106 106 106 ILE ILE 1 . n 
A  1  107 LEU 107 107 107 LEU LEU 1 . n 
A  1  108 GLU 108 108 108 GLU GLU 1 . n 
A  1  109 ASP 109 109 109 ASP ASP 1 . n 
A  1  110 VAL 110 110 110 VAL VAL 1 . n 
A  1  111 PRO 111 111 111 PRO PRO 1 . n 
A  1  112 HIS 112 112 112 HIS HIS 1 . n 
A  1  113 LEU 113 113 113 LEU LEU 1 . n 
A  1  114 LEU 114 114 114 LEU LEU 1 . n 
A  1  115 ILE 115 115 115 ILE ILE 1 . n 
A  1  116 GLU 116 116 116 GLU GLU 1 . n 
A  1  117 GLY 117 117 117 GLY GLY 1 . n 
A  1  118 MET 118 118 118 MET MET 1 . n 
A  1  119 ILE 119 119 119 ILE ILE 1 . n 
A  1  120 LEU 120 120 120 LEU LEU 1 . n 
A  1  121 ALA 121 121 121 ALA ALA 1 . n 
A  1  122 GLY 122 122 122 GLY GLY 1 . n 
A  1  123 TYR 123 123 123 TYR TYR 1 . n 
A  1  124 ALA 124 124 124 ALA ALA 1 . n 
A  1  125 ILE 125 125 125 ILE ILE 1 . n 
A  1  126 ARG 126 126 126 ARG ARG 1 . n 
A  1  127 ALA 127 127 127 ALA ALA 1 . n 
A  1  128 THR 128 128 128 THR THR 1 . n 
A  1  129 VAL 129 129 129 VAL VAL 1 . n 
A  1  130 GLY 130 130 130 GLY GLY 1 . n 
A  1  131 TYR 131 131 131 TYR TYR 1 . n 
A  1  132 ILE 132 132 132 ILE ILE 1 . n 
A  1  133 TYR 133 133 133 TYR TYR 1 . n 
A  1  134 VAL 134 134 134 VAL VAL 1 . n 
A  1  135 ARG 135 135 135 ARG ARG 1 . n 
A  1  136 GLY 136 136 136 GLY GLY 1 . n 
A  1  137 GLU 137 137 137 GLU GLU 1 . n 
A  1  138 TYR 138 138 138 TYR TYR 1 . n 
A  1  139 ARG 139 139 139 ARG ARG 1 . n 
A  1  140 ARG 140 140 140 ARG ARG 1 . n 
A  1  141 ALA 141 141 141 ALA ALA 1 . n 
A  1  142 ALA 142 142 142 ALA ALA 1 . n 
A  1  143 ASP 143 143 143 ASP ASP 1 . n 
A  1  144 ARG 144 144 144 ARG ARG 1 . n 
A  1  145 LEU 145 145 145 LEU LEU 1 . n 
A  1  146 GLU 146 146 146 GLU GLU 1 . n 
A  1  147 GLN 147 147 147 GLN GLN 1 . n 
A  1  148 ALA 148 148 148 ALA ALA 1 . n 
A  1  149 ILE 149 149 149 ILE ILE 1 . n 
A  1  150 LYS 150 150 150 LYS LYS 1 . n 
A  1  151 GLU 151 151 151 GLU GLU 1 . n 
A  1  152 ALA 152 152 152 ALA ALA 1 . n 
A  1  153 ARG 153 153 153 ARG ARG 1 . n 
A  1  154 ALA 154 154 154 ALA ALA 1 . n 
A  1  155 ARG 155 155 155 ARG ARG 1 . n 
A  1  156 GLY 156 156 156 GLY GLY 1 . n 
A  1  157 TYR 157 157 157 TYR TYR 1 . n 
A  1  158 LEU 158 158 158 LEU LEU 1 . n 
A  1  159 GLY 159 159 159 GLY GLY 1 . n 
A  1  160 LYS 160 160 160 LYS LYS 1 . n 
A  1  161 ASN 161 161 161 ASN ASN 1 . n 
A  1  162 LEU 162 162 162 LEU LEU 1 . n 
A  1  163 PHE 163 163 163 PHE PHE 1 . n 
A  1  164 GLY 164 164 164 GLY GLY 1 . n 
A  1  165 THR 165 165 165 THR THR 1 . n 
A  1  166 ASP 166 166 166 ASP ASP 1 . n 
A  1  167 PHE 167 167 167 PHE PHE 1 . n 
A  1  168 SER 168 168 168 SER SER 1 . n 
A  1  169 PHE 169 169 169 PHE PHE 1 . n 
A  1  170 ASP 170 170 170 ASP ASP 1 . n 
A  1  171 LEU 171 171 171 LEU LEU 1 . n 
A  1  172 HIS 172 172 172 HIS HIS 1 . n 
A  1  173 VAL 173 173 173 VAL VAL 1 . n 
A  1  174 HIS 174 174 174 HIS HIS 1 . n 
A  1  175 ARG 175 175 175 ARG ARG 1 . n 
A  1  176 GLY 176 176 176 GLY GLY 1 . n 
A  1  177 ALA 177 177 177 ALA ALA 1 . n 
A  1  178 GLY 178 178 178 GLY GLY 1 . n 
A  1  179 ALA 179 179 179 ALA ALA 1 . n 
A  1  180 TYR 180 180 180 TYR TYR 1 . n 
A  1  181 ILE 181 181 181 ILE ILE 1 . n 
A  1  182 CYS 182 182 182 CYS CYS 1 . n 
A  1  183 GLY 183 183 183 GLY GLY 1 . n 
A  1  184 GLU 184 184 184 GLU GLU 1 . n 
A  1  185 GLU 185 185 185 GLU GLU 1 . n 
A  1  186 THR 186 186 186 THR THR 1 . n 
A  1  187 ALA 187 187 187 ALA ALA 1 . n 
A  1  188 LEU 188 188 188 LEU LEU 1 . n 
A  1  189 MET 189 189 189 MET MET 1 . n 
A  1  190 ASN 190 190 190 ASN ASN 1 . n 
A  1  191 SER 191 191 191 SER SER 1 . n 
A  1  192 LEU 192 192 192 LEU LEU 1 . n 
A  1  193 GLU 193 193 193 GLU GLU 1 . n 
A  1  194 GLY 194 194 194 GLY GLY 1 . n 
A  1  195 LEU 195 195 195 LEU LEU 1 . n 
A  1  196 ARG 196 196 196 ARG ARG 1 . n 
A  1  197 ALA 197 197 197 ALA ALA 1 . n 
A  1  198 ASN 198 198 198 ASN ASN 1 . n 
A  1  199 PRO 199 199 199 PRO PRO 1 . n 
A  1  200 ARG 200 200 200 ARG ARG 1 . n 
A  1  201 LEU 201 201 201 LEU LEU 1 . n 
A  1  202 LYS 202 202 202 LYS LYS 1 . n 
A  1  203 PRO 203 203 203 PRO PRO 1 . n 
A  1  204 PRO 204 204 204 PRO PRO 1 . n 
A  1  205 PHE 205 205 205 PHE PHE 1 . n 
A  1  206 PRO 206 206 206 PRO PRO 1 . n 
A  1  207 ALA 207 207 207 ALA ALA 1 . n 
A  1  208 GLN 208 208 208 GLN GLN 1 . n 
A  1  209 SER 209 209 209 SER SER 1 . n 
A  1  210 GLY 210 210 210 GLY GLY 1 . n 
A  1  211 LEU 211 211 211 LEU LEU 1 . n 
A  1  212 TRP 212 212 212 TRP TRP 1 . n 
A  1  213 GLY 213 213 213 GLY GLY 1 . n 
A  1  214 LYS 214 214 214 LYS LYS 1 . n 
A  1  215 PRO 215 215 215 PRO PRO 1 . n 
A  1  216 THR 216 216 216 THR THR 1 . n 
A  1  217 THR 217 217 217 THR THR 1 . n 
A  1  218 ILE 218 218 218 ILE ILE 1 . n 
A  1  219 ASN 219 219 219 ASN ASN 1 . n 
A  1  220 ASN 220 220 220 ASN ASN 1 . n 
A  1  221 VAL 221 221 221 VAL VAL 1 . n 
A  1  222 GLU 222 222 222 GLU GLU 1 . n 
A  1  223 THR 223 223 223 THR THR 1 . n 
A  1  224 LEU 224 224 224 LEU LEU 1 . n 
A  1  225 ALA 225 225 225 ALA ALA 1 . n 
A  1  226 SER 226 226 226 SER SER 1 . n 
A  1  227 VAL 227 227 227 VAL VAL 1 . n 
A  1  228 VAL 228 228 228 VAL VAL 1 . n 
A  1  229 PRO 229 229 229 PRO PRO 1 . n 
A  1  230 ILE 230 230 230 ILE ILE 1 . n 
A  1  231 MET 231 231 231 MET MET 1 . n 
A  1  232 GLU 232 232 232 GLU GLU 1 . n 
A  1  233 ARG 233 233 233 ARG ARG 1 . n 
A  1  234 GLY 234 234 234 GLY GLY 1 . n 
A  1  235 ALA 235 235 235 ALA ALA 1 . n 
A  1  236 ASP 236 236 236 ASP ASP 1 . n 
A  1  237 TRP 237 237 237 TRP TRP 1 . n 
A  1  238 PHE 238 238 238 PHE PHE 1 . n 
A  1  239 ALA 239 239 239 ALA ALA 1 . n 
A  1  240 GLN 240 240 240 GLN GLN 1 . n 
A  1  241 MET 241 241 241 MET MET 1 . n 
A  1  242 GLY 242 242 242 GLY GLY 1 . n 
A  1  243 THR 243 243 243 THR THR 1 . n 
A  1  244 GLU 244 244 244 GLU GLU 1 . n 
A  1  245 GLN 245 245 245 GLN GLN 1 . n 
A  1  246 SER 246 246 246 SER SER 1 . n 
A  1  247 LYS 247 247 247 LYS LYS 1 . n 
A  1  248 GLY 248 248 248 GLY GLY 1 . n 
A  1  249 MET 249 249 249 MET MET 1 . n 
A  1  250 LYS 250 250 250 LYS LYS 1 . n 
A  1  251 LEU 251 251 251 LEU LEU 1 . n 
A  1  252 TYR 252 252 252 TYR TYR 1 . n 
A  1  253 GLN 253 253 253 GLN GLN 1 . n 
A  1  254 ILE 254 254 254 ILE ILE 1 . n 
A  1  255 SER 255 255 255 SER SER 1 . n 
A  1  256 GLY 256 256 256 GLY GLY 1 . n 
A  1  257 PRO 257 257 257 PRO PRO 1 . n 
A  1  258 VAL 258 258 258 VAL VAL 1 . n 
A  1  259 LYS 259 259 259 LYS LYS 1 . n 
A  1  260 ARG 260 260 260 ARG ARG 1 . n 
A  1  261 PRO 261 261 261 PRO PRO 1 . n 
A  1  262 GLY 262 262 262 GLY GLY 1 . n 
A  1  263 VAL 263 263 263 VAL VAL 1 . n 
A  1  264 TYR 264 264 264 TYR TYR 1 . n 
A  1  265 GLU 265 265 265 GLU GLU 1 . n 
A  1  266 LEU 266 266 266 LEU LEU 1 . n 
A  1  267 PRO 267 267 267 PRO PRO 1 . n 
A  1  268 MET 268 268 268 MET MET 1 . n 
A  1  269 GLY 269 269 269 GLY GLY 1 . n 
A  1  270 THR 270 270 270 THR THR 1 . n 
A  1  271 THR 271 271 271 THR THR 1 . n 
A  1  272 PHE 272 272 272 PHE PHE 1 . n 
A  1  273 ARG 273 273 273 ARG ARG 1 . n 
A  1  274 GLU 274 274 274 GLU GLU 1 . n 
A  1  275 LEU 275 275 275 LEU LEU 1 . n 
A  1  276 ILE 276 276 276 ILE ILE 1 . n 
A  1  277 TYR 277 277 277 TYR TYR 1 . n 
A  1  278 GLU 278 278 278 GLU GLU 1 . n 
A  1  279 TRP 279 279 279 TRP TRP 1 . n 
A  1  280 ALA 280 280 280 ALA ALA 1 . n 
A  1  281 GLY 281 281 281 GLY GLY 1 . n 
A  1  282 GLY 282 282 282 GLY GLY 1 . n 
A  1  283 PRO 283 283 283 PRO PRO 1 . n 
A  1  284 LEU 284 284 284 LEU LEU 1 . n 
A  1  285 GLU 285 285 285 GLU GLU 1 . n 
A  1  286 PRO 286 286 286 PRO PRO 1 . n 
A  1  287 ILE 287 287 287 ILE ILE 1 . n 
A  1  288 GLN 288 288 288 GLN GLN 1 . n 
A  1  289 ALA 289 289 289 ALA ALA 1 . n 
A  1  290 ILE 290 290 290 ILE ILE 1 . n 
A  1  291 ILE 291 291 291 ILE ILE 1 . n 
A  1  292 PRO 292 292 292 PRO PRO 1 . n 
A  1  293 GLY 293 293 293 GLY GLY 1 . n 
A  1  294 GLY 294 294 294 GLY GLY 1 . n 
A  1  295 SER 295 295 295 SER SER 1 . n 
A  1  296 SER 296 296 296 SER SER 1 . n 
A  1  297 THR 297 297 297 THR THR 1 . n 
A  1  298 PRO 298 298 298 PRO PRO 1 . n 
A  1  299 PRO 299 299 299 PRO PRO 1 . n 
A  1  300 LEU 300 300 300 LEU LEU 1 . n 
A  1  301 PRO 301 301 301 PRO PRO 1 . n 
A  1  302 PHE 302 302 302 PHE PHE 1 . n 
A  1  303 THR 303 303 303 THR THR 1 . n 
A  1  304 GLU 304 304 304 GLU GLU 1 . n 
A  1  305 GLU 305 305 305 GLU GLU 1 . n 
A  1  306 VAL 306 306 306 VAL VAL 1 . n 
A  1  307 LEU 307 307 307 LEU LEU 1 . n 
A  1  308 ASP 308 308 308 ASP ASP 1 . n 
A  1  309 THR 309 309 309 THR THR 1 . n 
A  1  310 PRO 310 310 310 PRO PRO 1 . n 
A  1  311 MET 311 311 311 MET MET 1 . n 
A  1  312 SER 312 312 312 SER SER 1 . n 
A  1  313 TYR 313 313 313 TYR TYR 1 . n 
A  1  314 GLU 314 314 314 GLU GLU 1 . n 
A  1  315 HIS 315 315 315 HIS HIS 1 . n 
A  1  316 LEU 316 316 316 LEU LEU 1 . n 
A  1  317 GLN 317 317 317 GLN GLN 1 . n 
A  1  318 ALA 318 318 318 ALA ALA 1 . n 
A  1  319 LYS 319 319 319 LYS LYS 1 . n 
A  1  320 GLY 320 320 320 GLY GLY 1 . n 
A  1  321 SER 321 321 321 SER SER 1 . n 
A  1  322 MET 322 322 322 MET MET 1 . n 
A  1  323 LEU 323 323 323 LEU LEU 1 . n 
A  1  324 GLY 324 324 324 GLY GLY 1 . n 
A  1  325 THR 325 325 325 THR THR 1 . n 
A  1  326 GLY 326 326 326 GLY GLY 1 . n 
A  1  327 GLY 327 327 327 GLY GLY 1 . n 
A  1  328 VAL 328 328 328 VAL VAL 1 . n 
A  1  329 ILE 329 329 329 ILE ILE 1 . n 
A  1  330 LEU 330 330 330 LEU LEU 1 . n 
A  1  331 ILE 331 331 331 ILE ILE 1 . n 
A  1  332 PRO 332 332 332 PRO PRO 1 . n 
A  1  333 GLU 333 333 333 GLU GLU 1 . n 
A  1  334 ARG 334 334 334 ARG ARG 1 . n 
A  1  335 VAL 335 335 335 VAL VAL 1 . n 
A  1  336 SER 336 336 336 SER SER 1 . n 
A  1  337 MET 337 337 337 MET MET 1 . n 
A  1  338 VAL 338 338 338 VAL VAL 1 . n 
A  1  339 ASP 339 339 339 ASP ASP 1 . n 
A  1  340 ALA 340 340 340 ALA ALA 1 . n 
A  1  341 MET 341 341 341 MET MET 1 . n 
A  1  342 TRP 342 342 342 TRP TRP 1 . n 
A  1  343 ASN 343 343 343 ASN ASN 1 . n 
A  1  344 LEU 344 344 344 LEU LEU 1 . n 
A  1  345 THR 345 345 345 THR THR 1 . n 
A  1  346 ARG 346 346 346 ARG ARG 1 . n 
A  1  347 PHE 347 347 347 PHE PHE 1 . n 
A  1  348 TYR 348 348 348 TYR TYR 1 . n 
A  1  349 ALA 349 349 349 ALA ALA 1 . n 
A  1  350 HIS 350 350 350 HIS HIS 1 . n 
A  1  351 GLU 351 351 351 GLU GLU 1 . n 
A  1  352 SER 352 352 352 SER SER 1 . n 
A  1  353 CYS 353 353 353 CYS CYS 1 . n 
A  1  354 GLY 354 354 354 GLY GLY 1 . n 
A  1  355 LYS 355 355 355 LYS LYS 1 . n 
A  1  356 CYS 356 356 356 CYS CYS 1 . n 
A  1  357 THR 357 357 357 THR THR 1 . n 
A  1  358 PRO 358 358 358 PRO PRO 1 . n 
A  1  359 CYS 359 359 359 CYS CYS 1 . n 
A  1  360 ARG 360 360 360 ARG ARG 1 . n 
A  1  361 GLU 361 361 361 GLU GLU 1 . n 
A  1  362 GLY 362 362 362 GLY GLY 1 . n 
A  1  363 VAL 363 363 363 VAL VAL 1 . n 
A  1  364 ALA 364 364 364 ALA ALA 1 . n 
A  1  365 GLY 365 365 365 GLY GLY 1 . n 
A  1  366 PHE 366 366 366 PHE PHE 1 . n 
A  1  367 MET 367 367 367 MET MET 1 . n 
A  1  368 VAL 368 368 368 VAL VAL 1 . n 
A  1  369 ASN 369 369 369 ASN ASN 1 . n 
A  1  370 LEU 370 370 370 LEU LEU 1 . n 
A  1  371 PHE 371 371 371 PHE PHE 1 . n 
A  1  372 ALA 372 372 372 ALA ALA 1 . n 
A  1  373 LYS 373 373 373 LYS LYS 1 . n 
A  1  374 ILE 374 374 374 ILE ILE 1 . n 
A  1  375 GLY 375 375 375 GLY GLY 1 . n 
A  1  376 THR 376 376 376 THR THR 1 . n 
A  1  377 GLY 377 377 377 GLY GLY 1 . n 
A  1  378 GLN 378 378 378 GLN GLN 1 . n 
A  1  379 GLY 379 379 379 GLY GLY 1 . n 
A  1  380 GLU 380 380 380 GLU GLU 1 . n 
A  1  381 GLU 381 381 381 GLU GLU 1 . n 
A  1  382 LYS 382 382 382 LYS LYS 1 . n 
A  1  383 ASP 383 383 383 ASP ASP 1 . n 
A  1  384 VAL 384 384 384 VAL VAL 1 . n 
A  1  385 GLU 385 385 385 GLU GLU 1 . n 
A  1  386 ASN 386 386 386 ASN ASN 1 . n 
A  1  387 LEU 387 387 387 LEU LEU 1 . n 
A  1  388 GLU 388 388 388 GLU GLU 1 . n 
A  1  389 ALA 389 389 389 ALA ALA 1 . n 
A  1  390 LEU 390 390 390 LEU LEU 1 . n 
A  1  391 LEU 391 391 391 LEU LEU 1 . n 
A  1  392 PRO 392 392 392 PRO PRO 1 . n 
A  1  393 LEU 393 393 393 LEU LEU 1 . n 
A  1  394 ILE 394 394 394 ILE ILE 1 . n 
A  1  395 GLU 395 395 395 GLU GLU 1 . n 
A  1  396 GLY 396 396 396 GLY GLY 1 . n 
A  1  397 ARG 397 397 397 ARG ARG 1 . n 
A  1  398 SER 398 398 398 SER SER 1 . n 
A  1  399 PHE 399 399 399 PHE PHE 1 . n 
A  1  400 CYS 400 400 400 CYS CYS 1 . n 
A  1  401 PRO 401 401 401 PRO PRO 1 . n 
A  1  402 LEU 402 402 402 LEU LEU 1 . n 
A  1  403 ALA 403 403 403 ALA ALA 1 . n 
A  1  404 ASP 404 404 404 ASP ASP 1 . n 
A  1  405 ALA 405 405 405 ALA ALA 1 . n 
A  1  406 ALA 406 406 406 ALA ALA 1 . n 
A  1  407 VAL 407 407 407 VAL VAL 1 . n 
A  1  408 TRP 408 408 408 TRP TRP 1 . n 
A  1  409 PRO 409 409 409 PRO PRO 1 . n 
A  1  410 VAL 410 410 410 VAL VAL 1 . n 
A  1  411 LYS 411 411 411 LYS LYS 1 . n 
A  1  412 GLY 412 412 412 GLY GLY 1 . n 
A  1  413 SER 413 413 413 SER SER 1 . n 
A  1  414 LEU 414 414 414 LEU LEU 1 . n 
A  1  415 ARG 415 415 415 ARG ARG 1 . n 
A  1  416 HIS 416 416 416 HIS HIS 1 . n 
A  1  417 PHE 417 417 417 PHE PHE 1 . n 
A  1  418 LYS 418 418 418 LYS LYS 1 . n 
A  1  419 ASP 419 419 419 ASP ASP 1 . n 
A  1  420 GLN 420 420 420 GLN GLN 1 . n 
A  1  421 TYR 421 421 421 TYR TYR 1 . n 
A  1  422 LEU 422 422 422 LEU LEU 1 . n 
A  1  423 ALA 423 423 423 ALA ALA 1 . n 
A  1  424 LEU 424 424 424 LEU LEU 1 . n 
A  1  425 ALA 425 425 425 ALA ALA 1 . n 
A  1  426 ARG 426 426 426 ARG ARG 1 . n 
A  1  427 GLU 427 427 427 GLU GLU 1 . n 
A  1  428 LYS 428 428 428 LYS LYS 1 . n 
A  1  429 ARG 429 429 429 ARG ARG 1 . n 
A  1  430 PRO 430 430 430 PRO PRO 1 . n 
A  1  431 VAL 431 431 431 VAL VAL 1 . n 
A  1  432 PRO 432 432 432 PRO PRO 1 . n 
A  1  433 ARG 433 433 433 ARG ARG 1 . n 
A  1  434 PRO 434 434 434 PRO PRO 1 . n 
A  1  435 SER 435 435 435 SER SER 1 . n 
A  1  436 LEU 436 436 436 LEU LEU 1 . n 
A  1  437 TRP 437 437 437 TRP TRP 1 . n 
A  1  438 ARG 438 438 438 ARG ARG 1 . n 
B  2  1   MET 1   1   ?   ?   ?   2 . n 
B  2  2   GLY 2   2   ?   ?   ?   2 . n 
B  2  3   PHE 3   3   3   PHE PHE 2 . n 
B  2  4   PHE 4   4   4   PHE PHE 2 . n 
B  2  5   ASP 5   5   5   ASP ASP 2 . n 
B  2  6   ASP 6   6   6   ASP ASP 2 . n 
B  2  7   LYS 7   7   7   LYS LYS 2 . n 
B  2  8   GLN 8   8   8   GLN GLN 2 . n 
B  2  9   ASP 9   9   9   ASP ASP 2 . n 
B  2  10  PHE 10  10  10  PHE PHE 2 . n 
B  2  11  LEU 11  11  11  LEU LEU 2 . n 
B  2  12  GLU 12  12  12  GLU GLU 2 . n 
B  2  13  GLU 13  13  13  GLU GLU 2 . n 
B  2  14  THR 14  14  14  THR THR 2 . n 
B  2  15  PHE 15  15  15  PHE PHE 2 . n 
B  2  16  ALA 16  16  16  ALA ALA 2 . n 
B  2  17  LYS 17  17  17  LYS LYS 2 . n 
B  2  18  TYR 18  18  18  TYR TYR 2 . n 
B  2  19  PRO 19  19  19  PRO PRO 2 . n 
B  2  20  PRO 20  20  20  PRO PRO 2 . n 
B  2  21  GLU 21  21  21  GLU GLU 2 . n 
B  2  22  GLY 22  22  22  GLY GLY 2 . n 
B  2  23  ARG 23  23  23  ARG ARG 2 . n 
B  2  24  ARG 24  24  24  ARG ARG 2 . n 
B  2  25  ALA 25  25  25  ALA ALA 2 . n 
B  2  26  ALA 26  26  26  ALA ALA 2 . n 
B  2  27  ILE 27  27  27  ILE ILE 2 . n 
B  2  28  MET 28  28  28  MET MET 2 . n 
B  2  29  PRO 29  29  29  PRO PRO 2 . n 
B  2  30  LEU 30  30  30  LEU LEU 2 . n 
B  2  31  LEU 31  31  31  LEU LEU 2 . n 
B  2  32  ARG 32  32  32  ARG ARG 2 . n 
B  2  33  ARG 33  33  33  ARG ARG 2 . n 
B  2  34  VAL 34  34  34  VAL VAL 2 . n 
B  2  35  GLN 35  35  35  GLN GLN 2 . n 
B  2  36  GLN 36  36  36  GLN GLN 2 . n 
B  2  37  GLU 37  37  37  GLU GLU 2 . n 
B  2  38  GLU 38  38  38  GLU GLU 2 . n 
B  2  39  GLY 39  39  39  GLY GLY 2 . n 
B  2  40  TRP 40  40  40  TRP TRP 2 . n 
B  2  41  ILE 41  41  41  ILE ILE 2 . n 
B  2  42  ARG 42  42  42  ARG ARG 2 . n 
B  2  43  PRO 43  43  43  PRO PRO 2 . n 
B  2  44  GLU 44  44  44  GLU GLU 2 . n 
B  2  45  ARG 45  45  45  ARG ARG 2 . n 
B  2  46  ILE 46  46  46  ILE ILE 2 . n 
B  2  47  GLU 47  47  47  GLU GLU 2 . n 
B  2  48  GLU 48  48  48  GLU GLU 2 . n 
B  2  49  ILE 49  49  49  ILE ILE 2 . n 
B  2  50  ALA 50  50  50  ALA ALA 2 . n 
B  2  51  ARG 51  51  51  ARG ARG 2 . n 
B  2  52  LEU 52  52  52  LEU LEU 2 . n 
B  2  53  VAL 53  53  53  VAL VAL 2 . n 
B  2  54  GLY 54  54  54  GLY GLY 2 . n 
B  2  55  THR 55  55  55  THR THR 2 . n 
B  2  56  THR 56  56  56  THR THR 2 . n 
B  2  57  PRO 57  57  57  PRO PRO 2 . n 
B  2  58  THR 58  58  58  THR THR 2 . n 
B  2  59  GLU 59  59  59  GLU GLU 2 . n 
B  2  60  VAL 60  60  60  VAL VAL 2 . n 
B  2  61  MET 61  61  61  MET MET 2 . n 
B  2  62  GLY 62  62  62  GLY GLY 2 . n 
B  2  63  VAL 63  63  63  VAL VAL 2 . n 
B  2  64  ALA 64  64  64  ALA ALA 2 . n 
B  2  65  SER 65  65  65  SER SER 2 . n 
B  2  66  PHE 66  66  66  PHE PHE 2 . n 
B  2  67  TYR 67  67  67  TYR TYR 2 . n 
B  2  68  SER 68  68  68  SER SER 2 . n 
B  2  69  TYR 69  69  69  TYR TYR 2 . n 
B  2  70  TYR 70  70  70  TYR TYR 2 . n 
B  2  71  GLN 71  71  71  GLN GLN 2 . n 
B  2  72  PHE 72  72  72  PHE PHE 2 . n 
B  2  73  VAL 73  73  73  VAL VAL 2 . n 
B  2  74  PRO 74  74  74  PRO PRO 2 . n 
B  2  75  THR 75  75  75  THR THR 2 . n 
B  2  76  GLY 76  76  76  GLY GLY 2 . n 
B  2  77  LYS 77  77  77  LYS LYS 2 . n 
B  2  78  TYR 78  78  78  TYR TYR 2 . n 
B  2  79  HIS 79  79  79  HIS HIS 2 . n 
B  2  80  LEU 80  80  80  LEU LEU 2 . n 
B  2  81  GLN 81  81  81  GLN GLN 2 . n 
B  2  82  VAL 82  82  82  VAL VAL 2 . n 
B  2  83  CYS 83  83  83  CYS CYS 2 . n 
B  2  84  ALA 84  84  84  ALA ALA 2 . n 
B  2  85  THR 85  85  85  THR THR 2 . n 
B  2  86  LEU 86  86  86  LEU LEU 2 . n 
B  2  87  SER 87  87  87  SER SER 2 . n 
B  2  88  CYS 88  88  88  CYS CYS 2 . n 
B  2  89  LYS 89  89  89  LYS LYS 2 . n 
B  2  90  LEU 90  90  90  LEU LEU 2 . n 
B  2  91  ALA 91  91  91  ALA ALA 2 . n 
B  2  92  GLY 92  92  92  GLY GLY 2 . n 
B  2  93  ALA 93  93  93  ALA ALA 2 . n 
B  2  94  GLU 94  94  94  GLU GLU 2 . n 
B  2  95  GLU 95  95  95  GLU GLU 2 . n 
B  2  96  LEU 96  96  96  LEU LEU 2 . n 
B  2  97  TRP 97  97  97  TRP TRP 2 . n 
B  2  98  ASP 98  98  98  ASP ASP 2 . n 
B  2  99  TYR 99  99  99  TYR TYR 2 . n 
B  2  100 LEU 100 100 100 LEU LEU 2 . n 
B  2  101 THR 101 101 101 THR THR 2 . n 
B  2  102 GLU 102 102 102 GLU GLU 2 . n 
B  2  103 THR 103 103 103 THR THR 2 . n 
B  2  104 LEU 104 104 104 LEU LEU 2 . n 
B  2  105 GLY 105 105 105 GLY GLY 2 . n 
B  2  106 ILE 106 106 106 ILE ILE 2 . n 
B  2  107 GLY 107 107 107 GLY GLY 2 . n 
B  2  108 PRO 108 108 108 PRO PRO 2 . n 
B  2  109 GLY 109 109 109 GLY GLY 2 . n 
B  2  110 GLU 110 110 110 GLU GLU 2 . n 
B  2  111 VAL 111 111 111 VAL VAL 2 . n 
B  2  112 THR 112 112 112 THR THR 2 . n 
B  2  113 PRO 113 113 113 PRO PRO 2 . n 
B  2  114 ASP 114 114 114 ASP ASP 2 . n 
B  2  115 GLY 115 115 115 GLY GLY 2 . n 
B  2  116 LEU 116 116 116 LEU LEU 2 . n 
B  2  117 PHE 117 117 117 PHE PHE 2 . n 
B  2  118 SER 118 118 118 SER SER 2 . n 
B  2  119 VAL 119 119 119 VAL VAL 2 . n 
B  2  120 GLN 120 120 120 GLN GLN 2 . n 
B  2  121 LYS 121 121 121 LYS LYS 2 . n 
B  2  122 VAL 122 122 122 VAL VAL 2 . n 
B  2  123 GLU 123 123 123 GLU GLU 2 . n 
B  2  124 CYS 124 124 124 CYS CYS 2 . n 
B  2  125 LEU 125 125 125 LEU LEU 2 . n 
B  2  126 GLY 126 126 126 GLY GLY 2 . n 
B  2  127 SER 127 127 127 SER SER 2 . n 
B  2  128 CYS 128 128 128 CYS CYS 2 . n 
B  2  129 HIS 129 129 129 HIS HIS 2 . n 
B  2  130 THR 130 130 130 THR THR 2 . n 
B  2  131 ALA 131 131 131 ALA ALA 2 . n 
B  2  132 PRO 132 132 132 PRO PRO 2 . n 
B  2  133 VAL 133 133 133 VAL VAL 2 . n 
B  2  134 ILE 134 134 134 ILE ILE 2 . n 
B  2  135 GLN 135 135 135 GLN GLN 2 . n 
B  2  136 VAL 136 136 136 VAL VAL 2 . n 
B  2  137 ASN 137 137 137 ASN ASN 2 . n 
B  2  138 ASP 138 138 138 ASP ASP 2 . n 
B  2  139 GLU 139 139 139 GLU GLU 2 . n 
B  2  140 PRO 140 140 140 PRO PRO 2 . n 
B  2  141 TYR 141 141 141 TYR TYR 2 . n 
B  2  142 VAL 142 142 142 VAL VAL 2 . n 
B  2  143 GLU 143 143 143 GLU GLU 2 . n 
B  2  144 CYS 144 144 144 CYS CYS 2 . n 
B  2  145 VAL 145 145 145 VAL VAL 2 . n 
B  2  146 THR 146 146 146 THR THR 2 . n 
B  2  147 ARG 147 147 147 ARG ARG 2 . n 
B  2  148 ALA 148 148 148 ALA ALA 2 . n 
B  2  149 ARG 149 149 149 ARG ARG 2 . n 
B  2  150 LEU 150 150 150 LEU LEU 2 . n 
B  2  151 GLU 151 151 151 GLU GLU 2 . n 
B  2  152 ALA 152 152 152 ALA ALA 2 . n 
B  2  153 LEU 153 153 153 LEU LEU 2 . n 
B  2  154 LEU 154 154 154 LEU LEU 2 . n 
B  2  155 ALA 155 155 155 ALA ALA 2 . n 
B  2  156 GLY 156 156 156 GLY GLY 2 . n 
B  2  157 LEU 157 157 157 LEU LEU 2 . n 
B  2  158 ARG 158 158 158 ARG ARG 2 . n 
B  2  159 ALA 159 159 159 ALA ALA 2 . n 
B  2  160 GLY 160 160 160 GLY GLY 2 . n 
B  2  161 LYS 161 161 161 LYS LYS 2 . n 
B  2  162 ARG 162 162 162 ARG ARG 2 . n 
B  2  163 LEU 163 163 163 LEU LEU 2 . n 
B  2  164 GLU 164 164 164 GLU GLU 2 . n 
B  2  165 GLU 165 165 165 GLU GLU 2 . n 
B  2  166 ILE 166 166 166 ILE ILE 2 . n 
B  2  167 GLU 167 167 167 GLU GLU 2 . n 
B  2  168 LEU 168 168 168 LEU LEU 2 . n 
B  2  169 PRO 169 169 169 PRO PRO 2 . n 
B  2  170 GLY 170 170 170 GLY GLY 2 . n 
B  2  171 LYS 171 171 171 LYS LYS 2 . n 
B  2  172 CYS 172 172 172 CYS CYS 2 . n 
B  2  173 GLY 173 173 173 GLY GLY 2 . n 
B  2  174 HIS 174 174 174 HIS HIS 2 . n 
B  2  175 HIS 175 175 175 HIS HIS 2 . n 
B  2  176 VAL 176 176 176 VAL VAL 2 . n 
B  2  177 HIS 177 177 177 HIS HIS 2 . n 
B  2  178 GLU 178 178 178 GLU GLU 2 . n 
B  2  179 VAL 179 179 179 VAL VAL 2 . n 
B  2  180 GLU 180 180 180 GLU GLU 2 . n 
B  2  181 VAL 181 181 ?   ?   ?   2 . n 
C  3  1   MET 1   1   1   MET MET 3 . n 
C  3  2   VAL 2   2   2   VAL VAL 3 . n 
C  3  3   ARG 3   3   3   ARG ARG 3 . n 
C  3  4   VAL 4   4   4   VAL VAL 3 . n 
C  3  5   LYS 5   5   5   LYS LYS 3 . n 
C  3  6   VAL 6   6   6   VAL VAL 3 . n 
C  3  7   ASN 7   7   7   ASN ASN 3 . n 
C  3  8   ASP 8   8   8   ASP ASP 3 . n 
C  3  9   ARG 9   9   9   ARG ARG 3 . n 
C  3  10  ILE 10  10  10  ILE ILE 3 . n 
C  3  11  VAL 11  11  11  VAL VAL 3 . n 
C  3  12  GLU 12  12  12  GLU GLU 3 . n 
C  3  13  VAL 13  13  13  VAL VAL 3 . n 
C  3  14  PRO 14  14  14  PRO PRO 3 . n 
C  3  15  PRO 15  15  15  PRO PRO 3 . n 
C  3  16  GLY 16  16  16  GLY GLY 3 . n 
C  3  17  THR 17  17  17  THR THR 3 . n 
C  3  18  SER 18  18  18  SER SER 3 . n 
C  3  19  VAL 19  19  19  VAL VAL 3 . n 
C  3  20  MET 20  20  20  MET MET 3 . n 
C  3  21  ASP 21  21  21  ASP ASP 3 . n 
C  3  22  ALA 22  22  22  ALA ALA 3 . n 
C  3  23  VAL 23  23  23  VAL VAL 3 . n 
C  3  24  PHE 24  24  24  PHE PHE 3 . n 
C  3  25  HIS 25  25  25  HIS HIS 3 . n 
C  3  26  ALA 26  26  26  ALA ALA 3 . n 
C  3  27  GLY 27  27  27  GLY GLY 3 . n 
C  3  28  TYR 28  28  28  TYR TYR 3 . n 
C  3  29  ASP 29  29  29  ASP ASP 3 . n 
C  3  30  VAL 30  30  30  VAL VAL 3 . n 
C  3  31  PRO 31  31  31  PRO PRO 3 . n 
C  3  32  LEU 32  32  32  LEU LEU 3 . n 
C  3  33  PHE 33  33  33  PHE PHE 3 . n 
C  3  34  CYS 34  34  34  CYS CYS 3 . n 
C  3  35  SER 35  35  35  SER SER 3 . n 
C  3  36  GLU 36  36  36  GLU GLU 3 . n 
C  3  37  LYS 37  37  37  LYS LYS 3 . n 
C  3  38  HIS 38  38  38  HIS HIS 3 . n 
C  3  39  LEU 39  39  39  LEU LEU 3 . n 
C  3  40  SER 40  40  40  SER SER 3 . n 
C  3  41  PRO 41  41  41  PRO PRO 3 . n 
C  3  42  ILE 42  42  42  ILE ILE 3 . n 
C  3  43  GLY 43  43  43  GLY GLY 3 . n 
C  3  44  ALA 44  44  44  ALA ALA 3 . n 
C  3  45  CYS 45  45  45  CYS CYS 3 . n 
C  3  46  ARG 46  46  46  ARG ARG 3 . n 
C  3  47  MET 47  47  47  MET MET 3 . n 
C  3  48  CYS 48  48  48  CYS CYS 3 . n 
C  3  49  LEU 49  49  49  LEU LEU 3 . n 
C  3  50  VAL 50  50  50  VAL VAL 3 . n 
C  3  51  ARG 51  51  51  ARG ARG 3 . n 
C  3  52  ILE 52  52  52  ILE ILE 3 . n 
C  3  53  GLY 53  53  53  GLY GLY 3 . n 
C  3  54  LEU 54  54  54  LEU LEU 3 . n 
C  3  55  PRO 55  55  55  PRO PRO 3 . n 
C  3  56  LYS 56  56  ?   ?   ?   3 . n 
C  3  57  LYS 57  57  ?   ?   ?   3 . n 
C  3  58  GLY 58  58  ?   ?   ?   3 . n 
C  3  59  PRO 59  59  ?   ?   ?   3 . n 
C  3  60  ASP 60  60  ?   ?   ?   3 . n 
C  3  61  GLY 61  61  ?   ?   ?   3 . n 
C  3  62  LYS 62  62  ?   ?   ?   3 . n 
C  3  63  PRO 63  63  ?   ?   ?   3 . n 
C  3  64  LEU 64  64  ?   ?   ?   3 . n 
C  3  65  LEU 65  65  ?   ?   ?   3 . n 
C  3  66  ASN 66  66  ?   ?   ?   3 . n 
C  3  67  GLU 67  67  ?   ?   ?   3 . n 
C  3  68  LYS 68  68  ?   ?   ?   3 . n 
C  3  69  GLY 69  69  ?   ?   ?   3 . n 
C  3  70  GLU 70  70  ?   ?   ?   3 . n 
C  3  71  PRO 71  71  ?   ?   ?   3 . n 
C  3  72  GLU 72  72  ?   ?   ?   3 . n 
C  3  73  ILE 73  73  73  ILE ILE 3 . n 
C  3  74  GLN 74  74  74  GLN GLN 3 . n 
C  3  75  TRP 75  75  75  TRP TRP 3 . n 
C  3  76  GLN 76  76  76  GLN GLN 3 . n 
C  3  77  PRO 77  77  77  PRO PRO 3 . n 
C  3  78  LYS 78  78  78  LYS LYS 3 . n 
C  3  79  LEU 79  79  79  LEU LEU 3 . n 
C  3  80  ALA 80  80  80  ALA ALA 3 . n 
C  3  81  ALA 81  81  81  ALA ALA 3 . n 
C  3  82  SER 82  82  82  SER SER 3 . n 
C  3  83  CYS 83  83  83  CYS CYS 3 . n 
C  3  84  VAL 84  84  84  VAL VAL 3 . n 
C  3  85  THR 85  85  85  THR THR 3 . n 
C  3  86  ALA 86  86  86  ALA ALA 3 . n 
C  3  87  VAL 87  87  87  VAL VAL 3 . n 
C  3  88  ALA 88  88  88  ALA ALA 3 . n 
C  3  89  ASP 89  89  89  ASP ASP 3 . n 
C  3  90  GLY 90  90  90  GLY GLY 3 . n 
C  3  91  MET 91  91  91  MET MET 3 . n 
C  3  92  VAL 92  92  92  VAL VAL 3 . n 
C  3  93  VAL 93  93  93  VAL VAL 3 . n 
C  3  94  ASP 94  94  94  ASP ASP 3 . n 
C  3  95  THR 95  95  95  THR THR 3 . n 
C  3  96  LEU 96  96  96  LEU LEU 3 . n 
C  3  97  SER 97  97  97  SER SER 3 . n 
C  3  98  ASP 98  98  98  ASP ASP 3 . n 
C  3  99  VAL 99  99  99  VAL VAL 3 . n 
C  3  100 VAL 100 100 100 VAL VAL 3 . n 
C  3  101 ARG 101 101 101 ARG ARG 3 . n 
C  3  102 GLU 102 102 102 GLU GLU 3 . n 
C  3  103 ALA 103 103 103 ALA ALA 3 . n 
C  3  104 GLN 104 104 104 GLN GLN 3 . n 
C  3  105 ALA 105 105 105 ALA ALA 3 . n 
C  3  106 GLY 106 106 106 GLY GLY 3 . n 
C  3  107 MET 107 107 107 MET MET 3 . n 
C  3  108 VAL 108 108 108 VAL VAL 3 . n 
C  3  109 GLU 109 109 109 GLU GLU 3 . n 
C  3  110 PHE 110 110 110 PHE PHE 3 . n 
C  3  111 THR 111 111 111 THR THR 3 . n 
C  3  112 LEU 112 112 112 LEU LEU 3 . n 
C  3  113 LEU 113 113 113 LEU LEU 3 . n 
C  3  114 ASN 114 114 114 ASN ASN 3 . n 
C  3  115 HIS 115 115 115 HIS HIS 3 . n 
C  3  116 PRO 116 116 116 PRO PRO 3 . n 
C  3  117 LEU 117 117 117 LEU LEU 3 . n 
C  3  118 ASP 118 118 118 ASP ASP 3 . n 
C  3  119 CYS 119 119 119 CYS CYS 3 . n 
C  3  120 PRO 120 120 120 PRO PRO 3 . n 
C  3  121 THR 121 121 121 THR THR 3 . n 
C  3  122 CYS 122 122 122 CYS CYS 3 . n 
C  3  123 ASP 123 123 123 ASP ASP 3 . n 
C  3  124 LYS 124 124 124 LYS LYS 3 . n 
C  3  125 GLY 125 125 125 GLY GLY 3 . n 
C  3  126 GLY 126 126 126 GLY GLY 3 . n 
C  3  127 ALA 127 127 127 ALA ALA 3 . n 
C  3  128 CYS 128 128 128 CYS CYS 3 . n 
C  3  129 GLU 129 129 129 GLU GLU 3 . n 
C  3  130 LEU 130 130 130 LEU LEU 3 . n 
C  3  131 GLN 131 131 131 GLN GLN 3 . n 
C  3  132 ASP 132 132 132 ASP ASP 3 . n 
C  3  133 ARG 133 133 133 ARG ARG 3 . n 
C  3  134 THR 134 134 134 THR THR 3 . n 
C  3  135 VAL 135 135 135 VAL VAL 3 . n 
C  3  136 GLU 136 136 136 GLU GLU 3 . n 
C  3  137 TYR 137 137 137 TYR TYR 3 . n 
C  3  138 GLY 138 138 138 GLY GLY 3 . n 
C  3  139 LEU 139 139 139 LEU LEU 3 . n 
C  3  140 TYR 140 140 140 TYR TYR 3 . n 
C  3  141 GLU 141 141 141 GLU GLU 3 . n 
C  3  142 LYS 142 142 142 LYS LYS 3 . n 
C  3  143 TYR 143 143 143 TYR TYR 3 . n 
C  3  144 TYR 144 144 ?   ?   ?   3 . n 
C  3  145 GLN 145 145 ?   ?   ?   3 . n 
C  3  146 LYS 146 146 ?   ?   ?   3 . n 
C  3  147 GLY 147 147 ?   ?   ?   3 . n 
C  3  148 PRO 148 148 148 PRO PRO 3 . n 
C  3  149 LEU 149 149 149 LEU LEU 3 . n 
C  3  150 GLU 150 150 150 GLU GLU 3 . n 
C  3  151 LEU 151 151 151 LEU LEU 3 . n 
C  3  152 PRO 152 152 152 PRO PRO 3 . n 
C  3  153 VAL 153 153 153 VAL VAL 3 . n 
C  3  154 TYR 154 154 154 TYR TYR 3 . n 
C  3  155 THR 155 155 155 THR THR 3 . n 
C  3  156 ARG 156 156 156 ARG ARG 3 . n 
C  3  157 PHE 157 157 157 PHE PHE 3 . n 
C  3  158 GLU 158 158 158 GLU GLU 3 . n 
C  3  159 PHE 159 159 159 PHE PHE 3 . n 
C  3  160 THR 160 160 160 THR THR 3 . n 
C  3  161 ARG 161 161 161 ARG ARG 3 . n 
C  3  162 ARG 162 162 162 ARG ARG 3 . n 
C  3  163 HIS 163 163 163 HIS HIS 3 . n 
C  3  164 VAL 164 164 164 VAL VAL 3 . n 
C  3  165 ASP 165 165 165 ASP ASP 3 . n 
C  3  166 LYS 166 166 166 LYS LYS 3 . n 
C  3  167 HIS 167 167 167 HIS HIS 3 . n 
C  3  168 HIS 168 168 168 HIS HIS 3 . n 
C  3  169 PRO 169 169 169 PRO PRO 3 . n 
C  3  170 LEU 170 170 170 LEU LEU 3 . n 
C  3  171 SER 171 171 171 SER SER 3 . n 
C  3  172 PRO 172 172 172 PRO PRO 3 . n 
C  3  173 PHE 173 173 173 PHE PHE 3 . n 
C  3  174 VAL 174 174 174 VAL VAL 3 . n 
C  3  175 ILE 175 175 175 ILE ILE 3 . n 
C  3  176 LEU 176 176 176 LEU LEU 3 . n 
C  3  177 ASP 177 177 177 ASP ASP 3 . n 
C  3  178 ARG 178 178 178 ARG ARG 3 . n 
C  3  179 GLU 179 179 179 GLU GLU 3 . n 
C  3  180 ARG 180 180 180 ARG ARG 3 . n 
C  3  181 CYS 181 181 181 CYS CYS 3 . n 
C  3  182 ILE 182 182 182 ILE ILE 3 . n 
C  3  183 HIS 183 183 183 HIS HIS 3 . n 
C  3  184 CYS 184 184 184 CYS CYS 3 . n 
C  3  185 LYS 185 185 185 LYS LYS 3 . n 
C  3  186 ARG 186 186 186 ARG ARG 3 . n 
C  3  187 CYS 187 187 187 CYS CYS 3 . n 
C  3  188 VAL 188 188 188 VAL VAL 3 . n 
C  3  189 ARG 189 189 189 ARG ARG 3 . n 
C  3  190 TYR 190 190 190 TYR TYR 3 . n 
C  3  191 PHE 191 191 191 PHE PHE 3 . n 
C  3  192 GLU 192 192 192 GLU GLU 3 . n 
C  3  193 GLU 193 193 193 GLU GLU 3 . n 
C  3  194 VAL 194 194 194 VAL VAL 3 . n 
C  3  195 PRO 195 195 195 PRO PRO 3 . n 
C  3  196 GLY 196 196 196 GLY GLY 3 . n 
C  3  197 ASP 197 197 197 ASP ASP 3 . n 
C  3  198 GLU 198 198 198 GLU GLU 3 . n 
C  3  199 VAL 199 199 199 VAL VAL 3 . n 
C  3  200 LEU 200 200 200 LEU LEU 3 . n 
C  3  201 ASP 201 201 201 ASP ASP 3 . n 
C  3  202 PHE 202 202 202 PHE PHE 3 . n 
C  3  203 ILE 203 203 203 ILE ILE 3 . n 
C  3  204 GLU 204 204 204 GLU GLU 3 . n 
C  3  205 ARG 205 205 205 ARG ARG 3 . n 
C  3  206 GLY 206 206 206 GLY GLY 3 . n 
C  3  207 VAL 207 207 207 VAL VAL 3 . n 
C  3  208 HIS 208 208 208 HIS HIS 3 . n 
C  3  209 THR 209 209 209 THR THR 3 . n 
C  3  210 PHE 210 210 210 PHE PHE 3 . n 
C  3  211 ILE 211 211 211 ILE ILE 3 . n 
C  3  212 GLY 212 212 212 GLY GLY 3 . n 
C  3  213 THR 213 213 213 THR THR 3 . n 
C  3  214 MET 214 214 214 MET MET 3 . n 
C  3  215 ASP 215 215 215 ASP ASP 3 . n 
C  3  216 PHE 216 216 216 PHE PHE 3 . n 
C  3  217 GLY 217 217 217 GLY GLY 3 . n 
C  3  218 LEU 218 218 218 LEU LEU 3 . n 
C  3  219 PRO 219 219 219 PRO PRO 3 . n 
C  3  220 SER 220 220 220 SER SER 3 . n 
C  3  221 GLY 221 221 221 GLY GLY 3 . n 
C  3  222 PHE 222 222 222 PHE PHE 3 . n 
C  3  223 SER 223 223 223 SER SER 3 . n 
C  3  224 GLY 224 224 224 GLY GLY 3 . n 
C  3  225 ASN 225 225 225 ASN ASN 3 . n 
C  3  226 ILE 226 226 226 ILE ILE 3 . n 
C  3  227 THR 227 227 227 THR THR 3 . n 
C  3  228 ASP 228 228 228 ASP ASP 3 . n 
C  3  229 ILE 229 229 229 ILE ILE 3 . n 
C  3  230 CYS 230 230 230 CYS CYS 3 . n 
C  3  231 PRO 231 231 231 PRO PRO 3 . n 
C  3  232 VAL 232 232 232 VAL VAL 3 . n 
C  3  233 GLY 233 233 233 GLY GLY 3 . n 
C  3  234 ALA 234 234 234 ALA ALA 3 . n 
C  3  235 LEU 235 235 235 LEU LEU 3 . n 
C  3  236 LEU 236 236 236 LEU LEU 3 . n 
C  3  237 ASP 237 237 237 ASP ASP 3 . n 
C  3  238 LEU 238 238 238 LEU LEU 3 . n 
C  3  239 THR 239 239 239 THR THR 3 . n 
C  3  240 ALA 240 240 240 ALA ALA 3 . n 
C  3  241 ARG 241 241 241 ARG ARG 3 . n 
C  3  242 PHE 242 242 242 PHE PHE 3 . n 
C  3  243 ARG 243 243 243 ARG ARG 3 . n 
C  3  244 ALA 244 244 244 ALA ALA 3 . n 
C  3  245 ARG 245 245 245 ARG ARG 3 . n 
C  3  246 ASN 246 246 246 ASN ASN 3 . n 
C  3  247 TRP 247 247 247 TRP TRP 3 . n 
C  3  248 GLU 248 248 248 GLU GLU 3 . n 
C  3  249 MET 249 249 249 MET MET 3 . n 
C  3  250 GLU 250 250 250 GLU GLU 3 . n 
C  3  251 GLU 251 251 251 GLU GLU 3 . n 
C  3  252 THR 252 252 252 THR THR 3 . n 
C  3  253 PRO 253 253 253 PRO PRO 3 . n 
C  3  254 THR 254 254 254 THR THR 3 . n 
C  3  255 THR 255 255 255 THR THR 3 . n 
C  3  256 CYS 256 256 256 CYS CYS 3 . n 
C  3  257 ALA 257 257 257 ALA ALA 3 . n 
C  3  258 LEU 258 258 258 LEU LEU 3 . n 
C  3  259 CYS 259 259 259 CYS CYS 3 . n 
C  3  260 PRO 260 260 260 PRO PRO 3 . n 
C  3  261 VAL 261 261 261 VAL VAL 3 . n 
C  3  262 GLY 262 262 262 GLY GLY 3 . n 
C  3  263 CYS 263 263 263 CYS CYS 3 . n 
C  3  264 GLY 264 264 264 GLY GLY 3 . n 
C  3  265 ILE 265 265 265 ILE ILE 3 . n 
C  3  266 THR 266 266 266 THR THR 3 . n 
C  3  267 ALA 267 267 267 ALA ALA 3 . n 
C  3  268 ASP 268 268 268 ASP ASP 3 . n 
C  3  269 THR 269 269 269 THR THR 3 . n 
C  3  270 ARG 270 270 270 ARG ARG 3 . n 
C  3  271 SER 271 271 271 SER SER 3 . n 
C  3  272 GLY 272 272 272 GLY GLY 3 . n 
C  3  273 GLU 273 273 273 GLU GLU 3 . n 
C  3  274 LEU 274 274 274 LEU LEU 3 . n 
C  3  275 LEU 275 275 275 LEU LEU 3 . n 
C  3  276 ARG 276 276 276 ARG ARG 3 . n 
C  3  277 ILE 277 277 277 ILE ILE 3 . n 
C  3  278 ARG 278 278 278 ARG ARG 3 . n 
C  3  279 ALA 279 279 279 ALA ALA 3 . n 
C  3  280 ARG 280 280 280 ARG ARG 3 . n 
C  3  281 GLU 281 281 281 GLU GLU 3 . n 
C  3  282 VAL 282 282 282 VAL VAL 3 . n 
C  3  283 PRO 283 283 283 PRO PRO 3 . n 
C  3  284 GLU 284 284 284 GLU GLU 3 . n 
C  3  285 VAL 285 285 285 VAL VAL 3 . n 
C  3  286 ASN 286 286 286 ASN ASN 3 . n 
C  3  287 GLU 287 287 287 GLU GLU 3 . n 
C  3  288 ILE 288 288 288 ILE ILE 3 . n 
C  3  289 TRP 289 289 289 TRP TRP 3 . n 
C  3  290 ILE 290 290 290 ILE ILE 3 . n 
C  3  291 CYS 291 291 291 CYS CYS 3 . n 
C  3  292 ASP 292 292 292 ASP ASP 3 . n 
C  3  293 ALA 293 293 293 ALA ALA 3 . n 
C  3  294 GLY 294 294 294 GLY GLY 3 . n 
C  3  295 ARG 295 295 295 ARG ARG 3 . n 
C  3  296 PHE 296 296 296 PHE PHE 3 . n 
C  3  297 GLY 297 297 297 GLY GLY 3 . n 
C  3  298 HIS 298 298 298 HIS HIS 3 . n 
C  3  299 GLU 299 299 299 GLU GLU 3 . n 
C  3  300 TRP 300 300 300 TRP TRP 3 . n 
C  3  301 ALA 301 301 301 ALA ALA 3 . n 
C  3  302 ASP 302 302 302 ASP ASP 3 . n 
C  3  303 GLN 303 303 303 GLN GLN 3 . n 
C  3  304 ASN 304 304 304 ASN ASN 3 . n 
C  3  305 ARG 305 305 305 ARG ARG 3 . n 
C  3  306 LEU 306 306 306 LEU LEU 3 . n 
C  3  307 LYS 307 307 307 LYS LYS 3 . n 
C  3  308 THR 308 308 308 THR THR 3 . n 
C  3  309 PRO 309 309 309 PRO PRO 3 . n 
C  3  310 LEU 310 310 310 LEU LEU 3 . n 
C  3  311 VAL 311 311 311 VAL VAL 3 . n 
C  3  312 ARG 312 312 312 ARG ARG 3 . n 
C  3  313 LYS 313 313 313 LYS LYS 3 . n 
C  3  314 GLU 314 314 314 GLU GLU 3 . n 
C  3  315 GLY 315 315 315 GLY GLY 3 . n 
C  3  316 ARG 316 316 316 ARG ARG 3 . n 
C  3  317 LEU 317 317 317 LEU LEU 3 . n 
C  3  318 VAL 318 318 318 VAL VAL 3 . n 
C  3  319 GLU 319 319 319 GLU GLU 3 . n 
C  3  320 ALA 320 320 320 ALA ALA 3 . n 
C  3  321 THR 321 321 321 THR THR 3 . n 
C  3  322 TRP 322 322 322 TRP TRP 3 . n 
C  3  323 GLU 323 323 323 GLU GLU 3 . n 
C  3  324 GLU 324 324 324 GLU GLU 3 . n 
C  3  325 ALA 325 325 325 ALA ALA 3 . n 
C  3  326 PHE 326 326 326 PHE PHE 3 . n 
C  3  327 LEU 327 327 327 LEU LEU 3 . n 
C  3  328 ALA 328 328 328 ALA ALA 3 . n 
C  3  329 LEU 329 329 329 LEU LEU 3 . n 
C  3  330 LYS 330 330 330 LYS LYS 3 . n 
C  3  331 GLU 331 331 331 GLU GLU 3 . n 
C  3  332 GLY 332 332 332 GLY GLY 3 . n 
C  3  333 LEU 333 333 333 LEU LEU 3 . n 
C  3  334 LYS 334 334 334 LYS LYS 3 . n 
C  3  335 GLU 335 335 335 GLU GLU 3 . n 
C  3  336 ALA 336 336 336 ALA ALA 3 . n 
C  3  337 ARG 337 337 337 ARG ARG 3 . n 
C  3  338 GLY 338 338 338 GLY GLY 3 . n 
C  3  339 GLU 339 339 339 GLU GLU 3 . n 
C  3  340 GLU 340 340 340 GLU GLU 3 . n 
C  3  341 VAL 341 341 341 VAL VAL 3 . n 
C  3  342 GLY 342 342 342 GLY GLY 3 . n 
C  3  343 LEU 343 343 343 LEU LEU 3 . n 
C  3  344 TYR 344 344 344 TYR TYR 3 . n 
C  3  345 LEU 345 345 345 LEU LEU 3 . n 
C  3  346 ALA 346 346 346 ALA ALA 3 . n 
C  3  347 HIS 347 347 347 HIS HIS 3 . n 
C  3  348 ASP 348 348 348 ASP ASP 3 . n 
C  3  349 ALA 349 349 349 ALA ALA 3 . n 
C  3  350 THR 350 350 350 THR THR 3 . n 
C  3  351 LEU 351 351 351 LEU LEU 3 . n 
C  3  352 GLU 352 352 352 GLU GLU 3 . n 
C  3  353 GLU 353 353 353 GLU GLU 3 . n 
C  3  354 GLY 354 354 354 GLY GLY 3 . n 
C  3  355 LEU 355 355 355 LEU LEU 3 . n 
C  3  356 LEU 356 356 356 LEU LEU 3 . n 
C  3  357 ALA 357 357 357 ALA ALA 3 . n 
C  3  358 SER 358 358 358 SER SER 3 . n 
C  3  359 GLU 359 359 359 GLU GLU 3 . n 
C  3  360 LEU 360 360 360 LEU LEU 3 . n 
C  3  361 ALA 361 361 361 ALA ALA 3 . n 
C  3  362 LYS 362 362 362 LYS LYS 3 . n 
C  3  363 ALA 363 363 363 ALA ALA 3 . n 
C  3  364 LEU 364 364 364 LEU LEU 3 . n 
C  3  365 LYS 365 365 365 LYS LYS 3 . n 
C  3  366 THR 366 366 366 THR THR 3 . n 
C  3  367 PRO 367 367 367 PRO PRO 3 . n 
C  3  368 HIS 368 368 368 HIS HIS 3 . n 
C  3  369 LEU 369 369 369 LEU LEU 3 . n 
C  3  370 ASP 370 370 370 ASP ASP 3 . n 
C  3  371 PHE 371 371 371 PHE PHE 3 . n 
C  3  372 GLN 372 372 372 GLN GLN 3 . n 
C  3  373 GLY 373 373 373 GLY GLY 3 . n 
C  3  374 ARG 374 374 374 ARG ARG 3 . n 
C  3  375 THR 375 375 375 THR THR 3 . n 
C  3  376 ALA 376 376 376 ALA ALA 3 . n 
C  3  377 ALA 377 377 377 ALA ALA 3 . n 
C  3  378 PRO 378 378 378 PRO PRO 3 . n 
C  3  379 ALA 379 379 379 ALA ALA 3 . n 
C  3  380 SER 380 380 380 SER SER 3 . n 
C  3  381 LEU 381 381 381 LEU LEU 3 . n 
C  3  382 PHE 382 382 382 PHE PHE 3 . n 
C  3  383 PRO 383 383 383 PRO PRO 3 . n 
C  3  384 PRO 384 384 384 PRO PRO 3 . n 
C  3  385 ALA 385 385 385 ALA ALA 3 . n 
C  3  386 SER 386 386 386 SER SER 3 . n 
C  3  387 LEU 387 387 387 LEU LEU 3 . n 
C  3  388 GLU 388 388 388 GLU GLU 3 . n 
C  3  389 ASP 389 389 389 ASP ASP 3 . n 
C  3  390 LEU 390 390 390 LEU LEU 3 . n 
C  3  391 LEU 391 391 391 LEU LEU 3 . n 
C  3  392 GLN 392 392 392 GLN GLN 3 . n 
C  3  393 ALA 393 393 393 ALA ALA 3 . n 
C  3  394 ASP 394 394 394 ASP ASP 3 . n 
C  3  395 PHE 395 395 395 PHE PHE 3 . n 
C  3  396 ALA 396 396 396 ALA ALA 3 . n 
C  3  397 LEU 397 397 397 LEU LEU 3 . n 
C  3  398 VAL 398 398 398 VAL VAL 3 . n 
C  3  399 LEU 399 399 399 LEU LEU 3 . n 
C  3  400 GLY 400 400 400 GLY GLY 3 . n 
C  3  401 ASP 401 401 401 ASP ASP 3 . n 
C  3  402 PRO 402 402 402 PRO PRO 3 . n 
C  3  403 THR 403 403 403 THR THR 3 . n 
C  3  404 GLU 404 404 404 GLU GLU 3 . n 
C  3  405 GLU 405 405 405 GLU GLU 3 . n 
C  3  406 ALA 406 406 406 ALA ALA 3 . n 
C  3  407 PRO 407 407 407 PRO PRO 3 . n 
C  3  408 ILE 408 408 408 ILE ILE 3 . n 
C  3  409 LEU 409 409 409 LEU LEU 3 . n 
C  3  410 HIS 410 410 410 HIS HIS 3 . n 
C  3  411 LEU 411 411 411 LEU LEU 3 . n 
C  3  412 ARG 412 412 412 ARG ARG 3 . n 
C  3  413 LEU 413 413 413 LEU LEU 3 . n 
C  3  414 SER 414 414 414 SER SER 3 . n 
C  3  415 GLU 415 415 415 GLU GLU 3 . n 
C  3  416 PHE 416 416 416 PHE PHE 3 . n 
C  3  417 VAL 417 417 417 VAL VAL 3 . n 
C  3  418 ARG 418 418 418 ARG ARG 3 . n 
C  3  419 ASP 419 419 419 ASP ASP 3 . n 
C  3  420 LEU 420 420 420 LEU LEU 3 . n 
C  3  421 LYS 421 421 421 LYS LYS 3 . n 
C  3  422 PRO 422 422 422 PRO PRO 3 . n 
C  3  423 PRO 423 423 423 PRO PRO 3 . n 
C  3  424 HIS 424 424 424 HIS HIS 3 . n 
C  3  425 ARG 425 425 425 ARG ARG 3 . n 
C  3  426 TYR 426 426 426 TYR TYR 3 . n 
C  3  427 ASN 427 427 427 ASN ASN 3 . n 
C  3  428 HIS 428 428 428 HIS HIS 3 . n 
C  3  429 GLY 429 429 429 GLY GLY 3 . n 
C  3  430 THR 430 430 430 THR THR 3 . n 
C  3  431 PRO 431 431 431 PRO PRO 3 . n 
C  3  432 PHE 432 432 432 PHE PHE 3 . n 
C  3  433 ALA 433 433 433 ALA ALA 3 . n 
C  3  434 ASP 434 434 434 ASP ASP 3 . n 
C  3  435 LEU 435 435 435 LEU LEU 3 . n 
C  3  436 GLN 436 436 436 GLN GLN 3 . n 
C  3  437 ILE 437 437 437 ILE ILE 3 . n 
C  3  438 LYS 438 438 438 LYS LYS 3 . n 
C  3  439 GLU 439 439 439 GLU GLU 3 . n 
C  3  440 ARG 440 440 440 ARG ARG 3 . n 
C  3  441 MET 441 441 441 MET MET 3 . n 
C  3  442 PRO 442 442 442 PRO PRO 3 . n 
C  3  443 ARG 443 443 443 ARG ARG 3 . n 
C  3  444 ARG 444 444 444 ARG ARG 3 . n 
C  3  445 THR 445 445 445 THR THR 3 . n 
C  3  446 ASP 446 446 446 ASP ASP 3 . n 
C  3  447 LYS 447 447 447 LYS LYS 3 . n 
C  3  448 MET 448 448 448 MET MET 3 . n 
C  3  449 ALA 449 449 449 ALA ALA 3 . n 
C  3  450 LEU 450 450 450 LEU LEU 3 . n 
C  3  451 PHE 451 451 451 PHE PHE 3 . n 
C  3  452 ALA 452 452 452 ALA ALA 3 . n 
C  3  453 PRO 453 453 453 PRO PRO 3 . n 
C  3  454 TYR 454 454 454 TYR TYR 3 . n 
C  3  455 ARG 455 455 455 ARG ARG 3 . n 
C  3  456 ALA 456 456 456 ALA ALA 3 . n 
C  3  457 PRO 457 457 457 PRO PRO 3 . n 
C  3  458 LEU 458 458 458 LEU LEU 3 . n 
C  3  459 MET 459 459 459 MET MET 3 . n 
C  3  460 LYS 460 460 460 LYS LYS 3 . n 
C  3  461 TRP 461 461 461 TRP TRP 3 . n 
C  3  462 ALA 462 462 462 ALA ALA 3 . n 
C  3  463 ALA 463 463 463 ALA ALA 3 . n 
C  3  464 ILE 464 464 464 ILE ILE 3 . n 
C  3  465 HIS 465 465 465 HIS HIS 3 . n 
C  3  466 GLU 466 466 466 GLU GLU 3 . n 
C  3  467 VAL 467 467 467 VAL VAL 3 . n 
C  3  468 HIS 468 468 468 HIS HIS 3 . n 
C  3  469 ARG 469 469 469 ARG ARG 3 . n 
C  3  470 PRO 470 470 470 PRO PRO 3 . n 
C  3  471 GLY 471 471 471 GLY GLY 3 . n 
C  3  472 GLU 472 472 472 GLU GLU 3 . n 
C  3  473 GLU 473 473 473 GLU GLU 3 . n 
C  3  474 ARG 474 474 474 ARG ARG 3 . n 
C  3  475 GLU 475 475 475 GLU GLU 3 . n 
C  3  476 ILE 476 476 476 ILE ILE 3 . n 
C  3  477 LEU 477 477 477 LEU LEU 3 . n 
C  3  478 LEU 478 478 478 LEU LEU 3 . n 
C  3  479 ALA 479 479 479 ALA ALA 3 . n 
C  3  480 LEU 480 480 480 LEU LEU 3 . n 
C  3  481 LEU 481 481 481 LEU LEU 3 . n 
C  3  482 GLY 482 482 482 GLY GLY 3 . n 
C  3  483 ASP 483 483 483 ASP ASP 3 . n 
C  3  484 LYS 484 484 484 LYS LYS 3 . n 
C  3  485 GLU 485 485 485 GLU GLU 3 . n 
C  3  486 GLY 486 486 486 GLY GLY 3 . n 
C  3  487 SER 487 487 487 SER SER 3 . n 
C  3  488 GLU 488 488 488 GLU GLU 3 . n 
C  3  489 MET 489 489 489 MET MET 3 . n 
C  3  490 VAL 490 490 490 VAL VAL 3 . n 
C  3  491 ALA 491 491 491 ALA ALA 3 . n 
C  3  492 LYS 492 492 492 LYS LYS 3 . n 
C  3  493 ALA 493 493 493 ALA ALA 3 . n 
C  3  494 LYS 494 494 494 LYS LYS 3 . n 
C  3  495 GLU 495 495 495 GLU GLU 3 . n 
C  3  496 ALA 496 496 496 ALA ALA 3 . n 
C  3  497 TRP 497 497 497 TRP TRP 3 . n 
C  3  498 GLU 498 498 498 GLU GLU 3 . n 
C  3  499 LYS 499 499 499 LYS LYS 3 . n 
C  3  500 ALA 500 500 500 ALA ALA 3 . n 
C  3  501 LYS 501 501 501 LYS LYS 3 . n 
C  3  502 ASN 502 502 502 ASN ASN 3 . n 
C  3  503 PRO 503 503 503 PRO PRO 3 . n 
C  3  504 VAL 504 504 504 VAL VAL 3 . n 
C  3  505 LEU 505 505 505 LEU LEU 3 . n 
C  3  506 ILE 506 506 506 ILE ILE 3 . n 
C  3  507 LEU 507 507 507 LEU LEU 3 . n 
C  3  508 GLY 508 508 508 GLY GLY 3 . n 
C  3  509 ALA 509 509 509 ALA ALA 3 . n 
C  3  510 GLY 510 510 510 GLY GLY 3 . n 
C  3  511 VAL 511 511 511 VAL VAL 3 . n 
C  3  512 LEU 512 512 512 LEU LEU 3 . n 
C  3  513 GLN 513 513 513 GLN GLN 3 . n 
C  3  514 ASP 514 514 514 ASP ASP 3 . n 
C  3  515 THR 515 515 515 THR THR 3 . n 
C  3  516 VAL 516 516 516 VAL VAL 3 . n 
C  3  517 ALA 517 517 517 ALA ALA 3 . n 
C  3  518 ALA 518 518 518 ALA ALA 3 . n 
C  3  519 GLU 519 519 519 GLU GLU 3 . n 
C  3  520 ARG 520 520 520 ARG ARG 3 . n 
C  3  521 ALA 521 521 521 ALA ALA 3 . n 
C  3  522 ARG 522 522 522 ARG ARG 3 . n 
C  3  523 LEU 523 523 523 LEU LEU 3 . n 
C  3  524 LEU 524 524 524 LEU LEU 3 . n 
C  3  525 ALA 525 525 525 ALA ALA 3 . n 
C  3  526 GLU 526 526 526 GLU GLU 3 . n 
C  3  527 ARG 527 527 527 ARG ARG 3 . n 
C  3  528 LYS 528 528 528 LYS LYS 3 . n 
C  3  529 GLY 529 529 529 GLY GLY 3 . n 
C  3  530 ALA 530 530 530 ALA ALA 3 . n 
C  3  531 LYS 531 531 531 LYS LYS 3 . n 
C  3  532 VAL 532 532 532 VAL VAL 3 . n 
C  3  533 LEU 533 533 533 LEU LEU 3 . n 
C  3  534 ALA 534 534 534 ALA ALA 3 . n 
C  3  535 MET 535 535 535 MET MET 3 . n 
C  3  536 THR 536 536 536 THR THR 3 . n 
C  3  537 PRO 537 537 537 PRO PRO 3 . n 
C  3  538 ALA 538 538 538 ALA ALA 3 . n 
C  3  539 ALA 539 539 539 ALA ALA 3 . n 
C  3  540 ASN 540 540 540 ASN ASN 3 . n 
C  3  541 ALA 541 541 541 ALA ALA 3 . n 
C  3  542 ARG 542 542 542 ARG ARG 3 . n 
C  3  543 GLY 543 543 543 GLY GLY 3 . n 
C  3  544 LEU 544 544 544 LEU LEU 3 . n 
C  3  545 GLU 545 545 545 GLU GLU 3 . n 
C  3  546 ALA 546 546 546 ALA ALA 3 . n 
C  3  547 MET 547 547 547 MET MET 3 . n 
C  3  548 GLY 548 548 548 GLY GLY 3 . n 
C  3  549 VAL 549 549 549 VAL VAL 3 . n 
C  3  550 LEU 550 550 550 LEU LEU 3 . n 
C  3  551 PRO 551 551 551 PRO PRO 3 . n 
C  3  552 GLY 552 552 552 GLY GLY 3 . n 
C  3  553 ALA 553 553 553 ALA ALA 3 . n 
C  3  554 LYS 554 554 554 LYS LYS 3 . n 
C  3  555 GLY 555 555 555 GLY GLY 3 . n 
C  3  556 ALA 556 556 556 ALA ALA 3 . n 
C  3  557 SER 557 557 557 SER SER 3 . n 
C  3  558 TRP 558 558 558 TRP TRP 3 . n 
C  3  559 ASP 559 559 559 ASP ASP 3 . n 
C  3  560 GLU 560 560 560 GLU GLU 3 . n 
C  3  561 PRO 561 561 561 PRO PRO 3 . n 
C  3  562 GLY 562 562 562 GLY GLY 3 . n 
C  3  563 ALA 563 563 563 ALA ALA 3 . n 
C  3  564 LEU 564 564 564 LEU LEU 3 . n 
C  3  565 TYR 565 565 565 TYR TYR 3 . n 
C  3  566 ALA 566 566 566 ALA ALA 3 . n 
C  3  567 TYR 567 567 567 TYR TYR 3 . n 
C  3  568 TYR 568 568 568 TYR TYR 3 . n 
C  3  569 GLY 569 569 569 GLY GLY 3 . n 
C  3  570 PHE 570 570 570 PHE PHE 3 . n 
C  3  571 VAL 571 571 571 VAL VAL 3 . n 
C  3  572 PRO 572 572 572 PRO PRO 3 . n 
C  3  573 PRO 573 573 573 PRO PRO 3 . n 
C  3  574 GLU 574 574 574 GLU GLU 3 . n 
C  3  575 GLU 575 575 575 GLU GLU 3 . n 
C  3  576 ALA 576 576 576 ALA ALA 3 . n 
C  3  577 LEU 577 577 577 LEU LEU 3 . n 
C  3  578 LYS 578 578 578 LYS LYS 3 . n 
C  3  579 GLY 579 579 579 GLY GLY 3 . n 
C  3  580 LYS 580 580 580 LYS LYS 3 . n 
C  3  581 ARG 581 581 581 ARG ARG 3 . n 
C  3  582 PHE 582 582 582 PHE PHE 3 . n 
C  3  583 VAL 583 583 583 VAL VAL 3 . n 
C  3  584 VAL 584 584 584 VAL VAL 3 . n 
C  3  585 MET 585 585 585 MET MET 3 . n 
C  3  586 HIS 586 586 586 HIS HIS 3 . n 
C  3  587 LEU 587 587 587 LEU LEU 3 . n 
C  3  588 SER 588 588 588 SER SER 3 . n 
C  3  589 HIS 589 589 589 HIS HIS 3 . n 
C  3  590 LEU 590 590 590 LEU LEU 3 . n 
C  3  591 HIS 591 591 591 HIS HIS 3 . n 
C  3  592 PRO 592 592 592 PRO PRO 3 . n 
C  3  593 LEU 593 593 593 LEU LEU 3 . n 
C  3  594 ALA 594 594 594 ALA ALA 3 . n 
C  3  595 GLU 595 595 595 GLU GLU 3 . n 
C  3  596 ARG 596 596 596 ARG ARG 3 . n 
C  3  597 TYR 597 597 597 TYR TYR 3 . n 
C  3  598 ALA 598 598 598 ALA ALA 3 . n 
C  3  599 HIS 599 599 599 HIS HIS 3 . n 
C  3  600 VAL 600 600 600 VAL VAL 3 . n 
C  3  601 VAL 601 601 601 VAL VAL 3 . n 
C  3  602 LEU 602 602 602 LEU LEU 3 . n 
C  3  603 PRO 603 603 603 PRO PRO 3 . n 
C  3  604 ALA 604 604 604 ALA ALA 3 . n 
C  3  605 PRO 605 605 605 PRO PRO 3 . n 
C  3  606 THR 606 606 606 THR THR 3 . n 
C  3  607 PHE 607 607 607 PHE PHE 3 . n 
C  3  608 TYR 608 608 608 TYR TYR 3 . n 
C  3  609 GLU 609 609 609 GLU GLU 3 . n 
C  3  610 LYS 610 610 610 LYS LYS 3 . n 
C  3  611 ARG 611 611 611 ARG ARG 3 . n 
C  3  612 GLY 612 612 612 GLY GLY 3 . n 
C  3  613 HIS 613 613 613 HIS HIS 3 . n 
C  3  614 LEU 614 614 614 LEU LEU 3 . n 
C  3  615 VAL 615 615 615 VAL VAL 3 . n 
C  3  616 ASN 616 616 616 ASN ASN 3 . n 
C  3  617 LEU 617 617 617 LEU LEU 3 . n 
C  3  618 GLU 618 618 618 GLU GLU 3 . n 
C  3  619 GLY 619 619 619 GLY GLY 3 . n 
C  3  620 ARG 620 620 620 ARG ARG 3 . n 
C  3  621 VAL 621 621 621 VAL VAL 3 . n 
C  3  622 LEU 622 622 622 LEU LEU 3 . n 
C  3  623 PRO 623 623 623 PRO PRO 3 . n 
C  3  624 LEU 624 624 624 LEU LEU 3 . n 
C  3  625 SER 625 625 625 SER SER 3 . n 
C  3  626 PRO 626 626 626 PRO PRO 3 . n 
C  3  627 ALA 627 627 627 ALA ALA 3 . n 
C  3  628 PRO 628 628 628 PRO PRO 3 . n 
C  3  629 ILE 629 629 629 ILE ILE 3 . n 
C  3  630 GLU 630 630 630 GLU GLU 3 . n 
C  3  631 ASN 631 631 631 ASN ASN 3 . n 
C  3  632 GLY 632 632 632 GLY GLY 3 . n 
C  3  633 GLU 633 633 633 GLU GLU 3 . n 
C  3  634 ALA 634 634 634 ALA ALA 3 . n 
C  3  635 GLU 635 635 635 GLU GLU 3 . n 
C  3  636 GLY 636 636 636 GLY GLY 3 . n 
C  3  637 ALA 637 637 637 ALA ALA 3 . n 
C  3  638 LEU 638 638 638 LEU LEU 3 . n 
C  3  639 GLN 639 639 639 GLN GLN 3 . n 
C  3  640 VAL 640 640 640 VAL VAL 3 . n 
C  3  641 LEU 641 641 641 LEU LEU 3 . n 
C  3  642 ALA 642 642 642 ALA ALA 3 . n 
C  3  643 LEU 643 643 643 LEU LEU 3 . n 
C  3  644 LEU 644 644 644 LEU LEU 3 . n 
C  3  645 ALA 645 645 645 ALA ALA 3 . n 
C  3  646 GLU 646 646 646 GLU GLU 3 . n 
C  3  647 ALA 647 647 647 ALA ALA 3 . n 
C  3  648 LEU 648 648 648 LEU LEU 3 . n 
C  3  649 GLY 649 649 649 GLY GLY 3 . n 
C  3  650 VAL 650 650 650 VAL VAL 3 . n 
C  3  651 ARG 651 651 651 ARG ARG 3 . n 
C  3  652 PRO 652 652 652 PRO PRO 3 . n 
C  3  653 PRO 653 653 653 PRO PRO 3 . n 
C  3  654 PHE 654 654 654 PHE PHE 3 . n 
C  3  655 ARG 655 655 655 ARG ARG 3 . n 
C  3  656 LEU 656 656 656 LEU LEU 3 . n 
C  3  657 HIS 657 657 657 HIS HIS 3 . n 
C  3  658 LEU 658 658 658 LEU LEU 3 . n 
C  3  659 GLU 659 659 659 GLU GLU 3 . n 
C  3  660 ALA 660 660 660 ALA ALA 3 . n 
C  3  661 GLN 661 661 661 GLN GLN 3 . n 
C  3  662 LYS 662 662 662 LYS LYS 3 . n 
C  3  663 ALA 663 663 663 ALA ALA 3 . n 
C  3  664 LEU 664 664 664 LEU LEU 3 . n 
C  3  665 LYS 665 665 665 LYS LYS 3 . n 
C  3  666 ALA 666 666 666 ALA ALA 3 . n 
C  3  667 ARG 667 667 667 ARG ARG 3 . n 
C  3  668 LYS 668 668 668 LYS LYS 3 . n 
C  3  669 VAL 669 669 669 VAL VAL 3 . n 
C  3  670 PRO 670 670 670 PRO PRO 3 . n 
C  3  671 GLU 671 671 671 GLU GLU 3 . n 
C  3  672 ALA 672 672 672 ALA ALA 3 . n 
C  3  673 MET 673 673 673 MET MET 3 . n 
C  3  674 GLY 674 674 674 GLY GLY 3 . n 
C  3  675 ARG 675 675 675 ARG ARG 3 . n 
C  3  676 LEU 676 676 676 LEU LEU 3 . n 
C  3  677 SER 677 677 677 SER SER 3 . n 
C  3  678 PHE 678 678 678 PHE PHE 3 . n 
C  3  679 ARG 679 679 679 ARG ARG 3 . n 
C  3  680 LEU 680 680 680 LEU LEU 3 . n 
C  3  681 LYS 681 681 681 LYS LYS 3 . n 
C  3  682 GLU 682 682 682 GLU GLU 3 . n 
C  3  683 LEU 683 683 683 LEU LEU 3 . n 
C  3  684 ARG 684 684 684 ARG ARG 3 . n 
C  3  685 PRO 685 685 685 PRO PRO 3 . n 
C  3  686 LYS 686 686 686 LYS LYS 3 . n 
C  3  687 GLU 687 687 687 GLU GLU 3 . n 
C  3  688 ARG 688 688 688 ARG ARG 3 . n 
C  3  689 LYS 689 689 689 LYS LYS 3 . n 
C  3  690 GLY 690 690 690 GLY GLY 3 . n 
C  3  691 ALA 691 691 691 ALA ALA 3 . n 
C  3  692 PHE 692 692 692 PHE PHE 3 . n 
C  3  693 TYR 693 693 693 TYR TYR 3 . n 
C  3  694 LEU 694 694 694 LEU LEU 3 . n 
C  3  695 ARG 695 695 695 ARG ARG 3 . n 
C  3  696 PRO 696 696 696 PRO PRO 3 . n 
C  3  697 THR 697 697 697 THR THR 3 . n 
C  3  698 MET 698 698 698 MET MET 3 . n 
C  3  699 TRP 699 699 699 TRP TRP 3 . n 
C  3  700 LYS 700 700 700 LYS LYS 3 . n 
C  3  701 ALA 701 701 701 ALA ALA 3 . n 
C  3  702 HIS 702 702 702 HIS HIS 3 . n 
C  3  703 GLN 703 703 703 GLN GLN 3 . n 
C  3  704 ALA 704 704 704 ALA ALA 3 . n 
C  3  705 VAL 705 705 705 VAL VAL 3 . n 
C  3  706 GLY 706 706 706 GLY GLY 3 . n 
C  3  707 LYS 707 707 707 LYS LYS 3 . n 
C  3  708 ALA 708 708 708 ALA ALA 3 . n 
C  3  709 GLN 709 709 709 GLN GLN 3 . n 
C  3  710 GLU 710 710 710 GLU GLU 3 . n 
C  3  711 ALA 711 711 711 ALA ALA 3 . n 
C  3  712 ALA 712 712 712 ALA ALA 3 . n 
C  3  713 ARG 713 713 713 ARG ARG 3 . n 
C  3  714 ALA 714 714 714 ALA ALA 3 . n 
C  3  715 GLU 715 715 715 GLU GLU 3 . n 
C  3  716 LEU 716 716 716 LEU LEU 3 . n 
C  3  717 TRP 717 717 717 TRP TRP 3 . n 
C  3  718 ALA 718 718 718 ALA ALA 3 . n 
C  3  719 HIS 719 719 719 HIS HIS 3 . n 
C  3  720 PRO 720 720 720 PRO PRO 3 . n 
C  3  721 GLU 721 721 721 GLU GLU 3 . n 
C  3  722 THR 722 722 722 THR THR 3 . n 
C  3  723 ALA 723 723 723 ALA ALA 3 . n 
C  3  724 ARG 724 724 724 ARG ARG 3 . n 
C  3  725 ALA 725 725 725 ALA ALA 3 . n 
C  3  726 GLU 726 726 726 GLU GLU 3 . n 
C  3  727 ALA 727 727 727 ALA ALA 3 . n 
C  3  728 LEU 728 728 728 LEU LEU 3 . n 
C  3  729 PRO 729 729 729 PRO PRO 3 . n 
C  3  730 GLU 730 730 730 GLU GLU 3 . n 
C  3  731 GLY 731 731 731 GLY GLY 3 . n 
C  3  732 ALA 732 732 732 ALA ALA 3 . n 
C  3  733 GLN 733 733 733 GLN GLN 3 . n 
C  3  734 VAL 734 734 734 VAL VAL 3 . n 
C  3  735 ALA 735 735 735 ALA ALA 3 . n 
C  3  736 VAL 736 736 736 VAL VAL 3 . n 
C  3  737 GLU 737 737 737 GLU GLU 3 . n 
C  3  738 THR 738 738 738 THR THR 3 . n 
C  3  739 PRO 739 739 739 PRO PRO 3 . n 
C  3  740 PHE 740 740 740 PHE PHE 3 . n 
C  3  741 GLY 741 741 741 GLY GLY 3 . n 
C  3  742 ARG 742 742 742 ARG ARG 3 . n 
C  3  743 VAL 743 743 743 VAL VAL 3 . n 
C  3  744 GLU 744 744 744 GLU GLU 3 . n 
C  3  745 ALA 745 745 745 ALA ALA 3 . n 
C  3  746 ARG 746 746 746 ARG ARG 3 . n 
C  3  747 VAL 747 747 747 VAL VAL 3 . n 
C  3  748 VAL 748 748 748 VAL VAL 3 . n 
C  3  749 HIS 749 749 749 HIS HIS 3 . n 
C  3  750 ARG 750 750 750 ARG ARG 3 . n 
C  3  751 GLU 751 751 751 GLU GLU 3 . n 
C  3  752 ASP 752 752 752 ASP ASP 3 . n 
C  3  753 VAL 753 753 753 VAL VAL 3 . n 
C  3  754 PRO 754 754 754 PRO PRO 3 . n 
C  3  755 LYS 755 755 755 LYS LYS 3 . n 
C  3  756 GLY 756 756 756 GLY GLY 3 . n 
C  3  757 HIS 757 757 757 HIS HIS 3 . n 
C  3  758 LEU 758 758 758 LEU LEU 3 . n 
C  3  759 TYR 759 759 759 TYR TYR 3 . n 
C  3  760 LEU 760 760 760 LEU LEU 3 . n 
C  3  761 SER 761 761 761 SER SER 3 . n 
C  3  762 ALA 762 762 762 ALA ALA 3 . n 
C  3  763 LEU 763 763 763 LEU LEU 3 . n 
C  3  764 GLY 764 764 764 GLY GLY 3 . n 
C  3  765 PRO 765 765 765 PRO PRO 3 . n 
C  3  766 ALA 766 766 766 ALA ALA 3 . n 
C  3  767 ALA 767 767 767 ALA ALA 3 . n 
C  3  768 GLY 768 768 768 GLY GLY 3 . n 
C  3  769 LEU 769 769 769 LEU LEU 3 . n 
C  3  770 ARG 770 770 770 ARG ARG 3 . n 
C  3  771 VAL 771 771 771 VAL VAL 3 . n 
C  3  772 GLU 772 772 772 GLU GLU 3 . n 
C  3  773 GLY 773 773 773 GLY GLY 3 . n 
C  3  774 ARG 774 774 774 ARG ARG 3 . n 
C  3  775 VAL 775 775 775 VAL VAL 3 . n 
C  3  776 LEU 776 776 776 LEU LEU 3 . n 
C  3  777 VAL 777 777 777 VAL VAL 3 . n 
C  3  778 PRO 778 778 ?   ?   ?   3 . n 
C  3  779 ALA 779 779 ?   ?   ?   3 . n 
C  3  780 GLY 780 780 ?   ?   ?   3 . n 
C  3  781 GLY 781 781 ?   ?   ?   3 . n 
C  3  782 GLU 782 782 ?   ?   ?   3 . n 
C  3  783 ALA 783 783 ?   ?   ?   3 . n 
D  4  1   MET 1   1   ?   ?   ?   4 . n 
D  4  2   ARG 2   2   ?   ?   ?   4 . n 
D  4  3   GLU 3   3   ?   ?   ?   4 . n 
D  4  4   GLU 4   4   ?   ?   ?   4 . n 
D  4  5   PHE 5   5   ?   ?   ?   4 . n 
D  4  6   LEU 6   6   ?   ?   ?   4 . n 
D  4  7   GLU 7   7   ?   ?   ?   4 . n 
D  4  8   GLU 8   8   ?   ?   ?   4 . n 
D  4  9   ILE 9   9   ?   ?   ?   4 . n 
D  4  10  PRO 10  10  ?   ?   ?   4 . n 
D  4  11  LEU 11  11  ?   ?   ?   4 . n 
D  4  12  ASP 12  12  ?   ?   ?   4 . n 
D  4  13  ALA 13  13  ?   ?   ?   4 . n 
D  4  14  PRO 14  14  ?   ?   ?   4 . n 
D  4  15  PRO 15  15  ?   ?   ?   4 . n 
D  4  16  GLU 16  16  ?   ?   ?   4 . n 
D  4  17  GLU 17  17  ?   ?   ?   4 . n 
D  4  18  ALA 18  18  ?   ?   ?   4 . n 
D  4  19  LYS 19  19  ?   ?   ?   4 . n 
D  4  20  GLU 20  20  ?   ?   ?   4 . n 
D  4  21  LEU 21  21  ?   ?   ?   4 . n 
D  4  22  ARG 22  22  ?   ?   ?   4 . n 
D  4  23  THR 23  23  ?   ?   ?   4 . n 
D  4  24  GLU 24  24  ?   ?   ?   4 . n 
D  4  25  VAL 25  25  ?   ?   ?   4 . n 
D  4  26  MET 26  26  26  MET MET 4 . n 
D  4  27  THR 27  27  27  THR THR 4 . n 
D  4  28  LEU 28  28  28  LEU LEU 4 . n 
D  4  29  ASN 29  29  29  ASN ASN 4 . n 
D  4  30  VAL 30  30  30  VAL VAL 4 . n 
D  4  31  GLY 31  31  31  GLY GLY 4 . n 
D  4  32  PRO 32  32  32  PRO PRO 4 . n 
D  4  33  GLN 33  33  33  GLN GLN 4 . n 
D  4  34  HIS 34  34  34  HIS HIS 4 . n 
D  4  35  PRO 35  35  35  PRO PRO 4 . n 
D  4  36  SER 36  36  36  SER SER 4 . n 
D  4  37  THR 37  37  37  THR THR 4 . n 
D  4  38  HIS 38  38  38  HIS HIS 4 . n 
D  4  39  GLY 39  39  39  GLY GLY 4 . n 
D  4  40  VAL 40  40  40  VAL VAL 4 . n 
D  4  41  LEU 41  41  41  LEU LEU 4 . n 
D  4  42  ARG 42  42  42  ARG ARG 4 . n 
D  4  43  LEU 43  43  43  LEU LEU 4 . n 
D  4  44  MET 44  44  44  MET MET 4 . n 
D  4  45  VAL 45  45  45  VAL VAL 4 . n 
D  4  46  THR 46  46  46  THR THR 4 . n 
D  4  47  LEU 47  47  47  LEU LEU 4 . n 
D  4  48  SER 48  48  48  SER SER 4 . n 
D  4  49  GLY 49  49  49  GLY GLY 4 . n 
D  4  50  GLU 50  50  50  GLU GLU 4 . n 
D  4  51  GLU 51  51  51  GLU GLU 4 . n 
D  4  52  VAL 52  52  52  VAL VAL 4 . n 
D  4  53  LEU 53  53  53  LEU LEU 4 . n 
D  4  54  GLU 54  54  54  GLU GLU 4 . n 
D  4  55  VAL 55  55  55  VAL VAL 4 . n 
D  4  56  VAL 56  56  56  VAL VAL 4 . n 
D  4  57  PRO 57  57  57  PRO PRO 4 . n 
D  4  58  HIS 58  58  58  HIS HIS 4 . n 
D  4  59  ILE 59  59  59  ILE ILE 4 . n 
D  4  60  GLY 60  60  60  GLY GLY 4 . n 
D  4  61  TYR 61  61  61  TYR TYR 4 . n 
D  4  62  LEU 62  62  62  LEU LEU 4 . n 
D  4  63  HIS 63  63  63  HIS HIS 4 . n 
D  4  64  THR 64  64  64  THR THR 4 . n 
D  4  65  GLY 65  65  65  GLY GLY 4 . n 
D  4  66  PHE 66  66  66  PHE PHE 4 . n 
D  4  67  GLU 67  67  67  GLU GLU 4 . n 
D  4  68  LYS 68  68  68  LYS LYS 4 . n 
D  4  69  THR 69  69  69  THR THR 4 . n 
D  4  70  MET 70  70  70  MET MET 4 . n 
D  4  71  GLU 71  71  71  GLU GLU 4 . n 
D  4  72  HIS 72  72  72  HIS HIS 4 . n 
D  4  73  ARG 73  73  73  ARG ARG 4 . n 
D  4  74  THR 74  74  74  THR THR 4 . n 
D  4  75  TYR 75  75  75  TYR TYR 4 . n 
D  4  76  LEU 76  76  76  LEU LEU 4 . n 
D  4  77  GLN 77  77  77  GLN GLN 4 . n 
D  4  78  ASN 78  78  78  ASN ASN 4 . n 
D  4  79  ILE 79  79  79  ILE ILE 4 . n 
D  4  80  THR 80  80  80  THR THR 4 . n 
D  4  81  TYR 81  81  81  TYR TYR 4 . n 
D  4  82  THR 82  82  82  THR THR 4 . n 
D  4  83  PRO 83  83  83  PRO PRO 4 . n 
D  4  84  ARG 84  84  84  ARG ARG 4 . n 
D  4  85  MET 85  85  85  MET MET 4 . n 
D  4  86  ASP 86  86  86  ASP ASP 4 . n 
D  4  87  TYR 87  87  87  TYR TYR 4 . n 
D  4  88  LEU 88  88  88  LEU LEU 4 . n 
D  4  89  HIS 89  89  89  HIS HIS 4 . n 
D  4  90  SER 90  90  90  SER SER 4 . n 
D  4  91  PHE 91  91  91  PHE PHE 4 . n 
D  4  92  ALA 92  92  92  ALA ALA 4 . n 
D  4  93  HIS 93  93  93  HIS HIS 4 . n 
D  4  94  ASP 94  94  94  ASP ASP 4 . n 
D  4  95  LEU 95  95  95  LEU LEU 4 . n 
D  4  96  ALA 96  96  96  ALA ALA 4 . n 
D  4  97  TYR 97  97  97  TYR TYR 4 . n 
D  4  98  ALA 98  98  98  ALA ALA 4 . n 
D  4  99  LEU 99  99  99  LEU LEU 4 . n 
D  4  100 ALA 100 100 100 ALA ALA 4 . n 
D  4  101 VAL 101 101 101 VAL VAL 4 . n 
D  4  102 GLU 102 102 102 GLU GLU 4 . n 
D  4  103 LYS 103 103 103 LYS LYS 4 . n 
D  4  104 LEU 104 104 104 LEU LEU 4 . n 
D  4  105 LEU 105 105 105 LEU LEU 4 . n 
D  4  106 GLY 106 106 106 GLY GLY 4 . n 
D  4  107 ALA 107 107 107 ALA ALA 4 . n 
D  4  108 VAL 108 108 108 VAL VAL 4 . n 
D  4  109 VAL 109 109 109 VAL VAL 4 . n 
D  4  110 PRO 110 110 110 PRO PRO 4 . n 
D  4  111 PRO 111 111 111 PRO PRO 4 . n 
D  4  112 ARG 112 112 112 ARG ARG 4 . n 
D  4  113 ALA 113 113 113 ALA ALA 4 . n 
D  4  114 GLU 114 114 114 GLU GLU 4 . n 
D  4  115 THR 115 115 115 THR THR 4 . n 
D  4  116 ILE 116 116 116 ILE ILE 4 . n 
D  4  117 ARG 117 117 117 ARG ARG 4 . n 
D  4  118 VAL 118 118 118 VAL VAL 4 . n 
D  4  119 ILE 119 119 119 ILE ILE 4 . n 
D  4  120 LEU 120 120 120 LEU LEU 4 . n 
D  4  121 ASN 121 121 121 ASN ASN 4 . n 
D  4  122 GLU 122 122 122 GLU GLU 4 . n 
D  4  123 LEU 123 123 123 LEU LEU 4 . n 
D  4  124 SER 124 124 124 SER SER 4 . n 
D  4  125 ARG 125 125 125 ARG ARG 4 . n 
D  4  126 LEU 126 126 126 LEU LEU 4 . n 
D  4  127 ALA 127 127 127 ALA ALA 4 . n 
D  4  128 SER 128 128 128 SER SER 4 . n 
D  4  129 HIS 129 129 129 HIS HIS 4 . n 
D  4  130 LEU 130 130 130 LEU LEU 4 . n 
D  4  131 VAL 131 131 131 VAL VAL 4 . n 
D  4  132 PHE 132 132 132 PHE PHE 4 . n 
D  4  133 LEU 133 133 133 LEU LEU 4 . n 
D  4  134 GLY 134 134 134 GLY GLY 4 . n 
D  4  135 THR 135 135 135 THR THR 4 . n 
D  4  136 GLY 136 136 136 GLY GLY 4 . n 
D  4  137 LEU 137 137 137 LEU LEU 4 . n 
D  4  138 LEU 138 138 138 LEU LEU 4 . n 
D  4  139 ASP 139 139 139 ASP ASP 4 . n 
D  4  140 LEU 140 140 140 LEU LEU 4 . n 
D  4  141 GLY 141 141 141 GLY GLY 4 . n 
D  4  142 ALA 142 142 142 ALA ALA 4 . n 
D  4  143 LEU 143 143 143 LEU LEU 4 . n 
D  4  144 THR 144 144 144 THR THR 4 . n 
D  4  145 PRO 145 145 145 PRO PRO 4 . n 
D  4  146 PHE 146 146 146 PHE PHE 4 . n 
D  4  147 PHE 147 147 147 PHE PHE 4 . n 
D  4  148 TYR 148 148 148 TYR TYR 4 . n 
D  4  149 ALA 149 149 149 ALA ALA 4 . n 
D  4  150 PHE 150 150 150 PHE PHE 4 . n 
D  4  151 ARG 151 151 151 ARG ARG 4 . n 
D  4  152 GLU 152 152 152 GLU GLU 4 . n 
D  4  153 ARG 153 153 153 ARG ARG 4 . n 
D  4  154 GLU 154 154 154 GLU GLU 4 . n 
D  4  155 THR 155 155 155 THR THR 4 . n 
D  4  156 ILE 156 156 156 ILE ILE 4 . n 
D  4  157 LEU 157 157 157 LEU LEU 4 . n 
D  4  158 ASP 158 158 158 ASP ASP 4 . n 
D  4  159 LEU 159 159 159 LEU LEU 4 . n 
D  4  160 PHE 160 160 160 PHE PHE 4 . n 
D  4  161 GLU 161 161 161 GLU GLU 4 . n 
D  4  162 TRP 162 162 162 TRP TRP 4 . n 
D  4  163 VAL 163 163 163 VAL VAL 4 . n 
D  4  164 THR 164 164 164 THR THR 4 . n 
D  4  165 GLY 165 165 165 GLY GLY 4 . n 
D  4  166 GLN 166 166 166 GLN GLN 4 . n 
D  4  167 ARG 167 167 167 ARG ARG 4 . n 
D  4  168 PHE 168 168 168 PHE PHE 4 . n 
D  4  169 HIS 169 169 169 HIS HIS 4 . n 
D  4  170 HIS 170 170 170 HIS HIS 4 . n 
D  4  171 ASN 171 171 171 ASN ASN 4 . n 
D  4  172 TYR 172 172 172 TYR TYR 4 . n 
D  4  173 ILE 173 173 173 ILE ILE 4 . n 
D  4  174 ARG 174 174 174 ARG ARG 4 . n 
D  4  175 ILE 175 175 175 ILE ILE 4 . n 
D  4  176 GLY 176 176 176 GLY GLY 4 . n 
D  4  177 GLY 177 177 177 GLY GLY 4 . n 
D  4  178 VAL 178 178 178 VAL VAL 4 . n 
D  4  179 LYS 179 179 179 LYS LYS 4 . n 
D  4  180 GLU 180 180 180 GLU GLU 4 . n 
D  4  181 ASP 181 181 181 ASP ASP 4 . n 
D  4  182 LEU 182 182 182 LEU LEU 4 . n 
D  4  183 PRO 183 183 183 PRO PRO 4 . n 
D  4  184 GLU 184 184 184 GLU GLU 4 . n 
D  4  185 GLU 185 185 185 GLU GLU 4 . n 
D  4  186 PHE 186 186 186 PHE PHE 4 . n 
D  4  187 VAL 187 187 187 VAL VAL 4 . n 
D  4  188 PRO 188 188 188 PRO PRO 4 . n 
D  4  189 GLU 189 189 189 GLU GLU 4 . n 
D  4  190 LEU 190 190 190 LEU LEU 4 . n 
D  4  191 LYS 191 191 191 LYS LYS 4 . n 
D  4  192 LYS 192 192 192 LYS LYS 4 . n 
D  4  193 LEU 193 193 193 LEU LEU 4 . n 
D  4  194 LEU 194 194 194 LEU LEU 4 . n 
D  4  195 GLU 195 195 195 GLU GLU 4 . n 
D  4  196 VAL 196 196 196 VAL VAL 4 . n 
D  4  197 LEU 197 197 197 LEU LEU 4 . n 
D  4  198 PRO 198 198 198 PRO PRO 4 . n 
D  4  199 HIS 199 199 199 HIS HIS 4 . n 
D  4  200 ARG 200 200 200 ARG ARG 4 . n 
D  4  201 ILE 201 201 201 ILE ILE 4 . n 
D  4  202 ASP 202 202 202 ASP ASP 4 . n 
D  4  203 GLU 203 203 203 GLU GLU 4 . n 
D  4  204 TYR 204 204 204 TYR TYR 4 . n 
D  4  205 GLU 205 205 205 GLU GLU 4 . n 
D  4  206 ALA 206 206 206 ALA ALA 4 . n 
D  4  207 LEU 207 207 207 LEU LEU 4 . n 
D  4  208 PHE 208 208 208 PHE PHE 4 . n 
D  4  209 ALA 209 209 209 ALA ALA 4 . n 
D  4  210 GLU 210 210 210 GLU GLU 4 . n 
D  4  211 SER 211 211 211 SER SER 4 . n 
D  4  212 PRO 212 212 212 PRO PRO 4 . n 
D  4  213 ILE 213 213 213 ILE ILE 4 . n 
D  4  214 PHE 214 214 214 PHE PHE 4 . n 
D  4  215 TYR 215 215 215 TYR TYR 4 . n 
D  4  216 GLU 216 216 216 GLU GLU 4 . n 
D  4  217 ARG 217 217 217 ARG ARG 4 . n 
D  4  218 ALA 218 218 218 ALA ALA 4 . n 
D  4  219 ARG 219 219 219 ARG ARG 4 . n 
D  4  220 GLY 220 220 220 GLY GLY 4 . n 
D  4  221 VAL 221 221 221 VAL VAL 4 . n 
D  4  222 GLY 222 222 222 GLY GLY 4 . n 
D  4  223 VAL 223 223 223 VAL VAL 4 . n 
D  4  224 ILE 224 224 224 ILE ILE 4 . n 
D  4  225 PRO 225 225 225 PRO PRO 4 . n 
D  4  226 PRO 226 226 226 PRO PRO 4 . n 
D  4  227 GLU 227 227 227 GLU GLU 4 . n 
D  4  228 VAL 228 228 228 VAL VAL 4 . n 
D  4  229 ALA 229 229 229 ALA ALA 4 . n 
D  4  230 ILE 230 230 230 ILE ILE 4 . n 
D  4  231 ASP 231 231 231 ASP ASP 4 . n 
D  4  232 LEU 232 232 232 LEU LEU 4 . n 
D  4  233 GLY 233 233 233 GLY GLY 4 . n 
D  4  234 LEU 234 234 234 LEU LEU 4 . n 
D  4  235 THR 235 235 235 THR THR 4 . n 
D  4  236 GLY 236 236 236 GLY GLY 4 . n 
D  4  237 GLY 237 237 237 GLY GLY 4 . n 
D  4  238 SER 238 238 238 SER SER 4 . n 
D  4  239 LEU 239 239 239 LEU LEU 4 . n 
D  4  240 ARG 240 240 240 ARG ARG 4 . n 
D  4  241 ALA 241 241 241 ALA ALA 4 . n 
D  4  242 SER 242 242 242 SER SER 4 . n 
D  4  243 GLY 243 243 243 GLY GLY 4 . n 
D  4  244 VAL 244 244 244 VAL VAL 4 . n 
D  4  245 ASN 245 245 245 ASN ASN 4 . n 
D  4  246 TYR 246 246 246 TYR TYR 4 . n 
D  4  247 ASP 247 247 247 ASP ASP 4 . n 
D  4  248 VAL 248 248 248 VAL VAL 4 . n 
D  4  249 ARG 249 249 249 ARG ARG 4 . n 
D  4  250 LYS 250 250 250 LYS LYS 4 . n 
D  4  251 ALA 251 251 251 ALA ALA 4 . n 
D  4  252 TYR 252 252 252 TYR TYR 4 . n 
D  4  253 PRO 253 253 253 PRO PRO 4 . n 
D  4  254 TYR 254 254 254 TYR TYR 4 . n 
D  4  255 SER 255 255 255 SER SER 4 . n 
D  4  256 GLY 256 256 256 GLY GLY 4 . n 
D  4  257 TYR 257 257 257 TYR TYR 4 . n 
D  4  258 GLU 258 258 258 GLU GLU 4 . n 
D  4  259 THR 259 259 259 THR THR 4 . n 
D  4  260 TYR 260 260 260 TYR TYR 4 . n 
D  4  261 THR 261 261 261 THR THR 4 . n 
D  4  262 PHE 262 262 262 PHE PHE 4 . n 
D  4  263 ASP 263 263 263 ASP ASP 4 . n 
D  4  264 VAL 264 264 264 VAL VAL 4 . n 
D  4  265 PRO 265 265 265 PRO PRO 4 . n 
D  4  266 LEU 266 266 266 LEU LEU 4 . n 
D  4  267 GLY 267 267 267 GLY GLY 4 . n 
D  4  268 GLU 268 268 268 GLU GLU 4 . n 
D  4  269 ARG 269 269 269 ARG ARG 4 . n 
D  4  270 GLY 270 270 270 GLY GLY 4 . n 
D  4  271 ASP 271 271 271 ASP ASP 4 . n 
D  4  272 VAL 272 272 272 VAL VAL 4 . n 
D  4  273 PHE 273 273 273 PHE PHE 4 . n 
D  4  274 ASP 274 274 274 ASP ASP 4 . n 
D  4  275 ARG 275 275 275 ARG ARG 4 . n 
D  4  276 MET 276 276 276 MET MET 4 . n 
D  4  277 LEU 277 277 277 LEU LEU 4 . n 
D  4  278 VAL 278 278 278 VAL VAL 4 . n 
D  4  279 ARG 279 279 279 ARG ARG 4 . n 
D  4  280 ILE 280 280 280 ILE ILE 4 . n 
D  4  281 ARG 281 281 281 ARG ARG 4 . n 
D  4  282 GLU 282 282 282 GLU GLU 4 . n 
D  4  283 MET 283 283 283 MET MET 4 . n 
D  4  284 ARG 284 284 284 ARG ARG 4 . n 
D  4  285 GLU 285 285 285 GLU GLU 4 . n 
D  4  286 SER 286 286 286 SER SER 4 . n 
D  4  287 VAL 287 287 287 VAL VAL 4 . n 
D  4  288 LYS 288 288 288 LYS LYS 4 . n 
D  4  289 ILE 289 289 289 ILE ILE 4 . n 
D  4  290 ILE 290 290 290 ILE ILE 4 . n 
D  4  291 LYS 291 291 291 LYS LYS 4 . n 
D  4  292 GLN 292 292 292 GLN GLN 4 . n 
D  4  293 ALA 293 293 293 ALA ALA 4 . n 
D  4  294 LEU 294 294 294 LEU LEU 4 . n 
D  4  295 GLU 295 295 295 GLU GLU 4 . n 
D  4  296 ARG 296 296 296 ARG ARG 4 . n 
D  4  297 LEU 297 297 297 LEU LEU 4 . n 
D  4  298 GLU 298 298 298 GLU GLU 4 . n 
D  4  299 PRO 299 299 299 PRO PRO 4 . n 
D  4  300 GLY 300 300 300 GLY GLY 4 . n 
D  4  301 PRO 301 301 301 PRO PRO 4 . n 
D  4  302 VAL 302 302 302 VAL VAL 4 . n 
D  4  303 ARG 303 303 303 ARG ARG 4 . n 
D  4  304 ASP 304 304 304 ASP ASP 4 . n 
D  4  305 PRO 305 305 305 PRO PRO 4 . n 
D  4  306 ASN 306 306 306 ASN ASN 4 . n 
D  4  307 PRO 307 307 307 PRO PRO 4 . n 
D  4  308 GLN 308 308 308 GLN GLN 4 . n 
D  4  309 ILE 309 309 309 ILE ILE 4 . n 
D  4  310 THR 310 310 310 THR THR 4 . n 
D  4  311 PRO 311 311 311 PRO PRO 4 . n 
D  4  312 PRO 312 312 312 PRO PRO 4 . n 
D  4  313 PRO 313 313 313 PRO PRO 4 . n 
D  4  314 ARG 314 314 314 ARG ARG 4 . n 
D  4  315 HIS 315 315 315 HIS HIS 4 . n 
D  4  316 LEU 316 316 316 LEU LEU 4 . n 
D  4  317 LEU 317 317 317 LEU LEU 4 . n 
D  4  318 GLU 318 318 318 GLU GLU 4 . n 
D  4  319 THR 319 319 319 THR THR 4 . n 
D  4  320 SER 320 320 320 SER SER 4 . n 
D  4  321 MET 321 321 321 MET MET 4 . n 
D  4  322 GLU 322 322 322 GLU GLU 4 . n 
D  4  323 ALA 323 323 323 ALA ALA 4 . n 
D  4  324 VAL 324 324 324 VAL VAL 4 . n 
D  4  325 ILE 325 325 325 ILE ILE 4 . n 
D  4  326 TYR 326 326 326 TYR TYR 4 . n 
D  4  327 HIS 327 327 327 HIS HIS 4 . n 
D  4  328 PHE 328 328 328 PHE PHE 4 . n 
D  4  329 LYS 329 329 329 LYS LYS 4 . n 
D  4  330 HIS 330 330 330 HIS HIS 4 . n 
D  4  331 TYR 331 331 331 TYR TYR 4 . n 
D  4  332 THR 332 332 332 THR THR 4 . n 
D  4  333 GLU 333 333 333 GLU GLU 4 . n 
D  4  334 GLY 334 334 334 GLY GLY 4 . n 
D  4  335 PHE 335 335 335 PHE PHE 4 . n 
D  4  336 HIS 336 336 336 HIS HIS 4 . n 
D  4  337 PRO 337 337 337 PRO PRO 4 . n 
D  4  338 PRO 338 338 338 PRO PRO 4 . n 
D  4  339 LYS 339 339 339 LYS LYS 4 . n 
D  4  340 GLY 340 340 340 GLY GLY 4 . n 
D  4  341 GLU 341 341 341 GLU GLU 4 . n 
D  4  342 VAL 342 342 342 VAL VAL 4 . n 
D  4  343 TYR 343 343 343 TYR TYR 4 . n 
D  4  344 VAL 344 344 344 VAL VAL 4 . n 
D  4  345 PRO 345 345 345 PRO PRO 4 . n 
D  4  346 THR 346 346 346 THR THR 4 . n 
D  4  347 GLU 347 347 347 GLU GLU 4 . n 
D  4  348 SER 348 348 348 SER SER 4 . n 
D  4  349 ALA 349 349 349 ALA ALA 4 . n 
D  4  350 ARG 350 350 350 ARG ARG 4 . n 
D  4  351 GLY 351 351 351 GLY GLY 4 . n 
D  4  352 GLU 352 352 352 GLU GLU 4 . n 
D  4  353 LEU 353 353 353 LEU LEU 4 . n 
D  4  354 GLY 354 354 354 GLY GLY 4 . n 
D  4  355 TYR 355 355 355 TYR TYR 4 . n 
D  4  356 TYR 356 356 356 TYR TYR 4 . n 
D  4  357 ILE 357 357 357 ILE ILE 4 . n 
D  4  358 VAL 358 358 358 VAL VAL 4 . n 
D  4  359 SER 359 359 359 SER SER 4 . n 
D  4  360 ASP 360 360 360 ASP ASP 4 . n 
D  4  361 GLY 361 361 361 GLY GLY 4 . n 
D  4  362 GLY 362 362 362 GLY GLY 4 . n 
D  4  363 SER 363 363 363 SER SER 4 . n 
D  4  364 MET 364 364 364 MET MET 4 . n 
D  4  365 PRO 365 365 365 PRO PRO 4 . n 
D  4  366 TYR 366 366 366 TYR TYR 4 . n 
D  4  367 ARG 367 367 367 ARG ARG 4 . n 
D  4  368 VAL 368 368 368 VAL VAL 4 . n 
D  4  369 LYS 369 369 369 LYS LYS 4 . n 
D  4  370 VAL 370 370 370 VAL VAL 4 . n 
D  4  371 ARG 371 371 371 ARG ARG 4 . n 
D  4  372 ALA 372 372 372 ALA ALA 4 . n 
D  4  373 PRO 373 373 373 PRO PRO 4 . n 
D  4  374 SER 374 374 374 SER SER 4 . n 
D  4  375 PHE 375 375 375 PHE PHE 4 . n 
D  4  376 VAL 376 376 376 VAL VAL 4 . n 
D  4  377 ASN 377 377 377 ASN ASN 4 . n 
D  4  378 LEU 378 378 378 LEU LEU 4 . n 
D  4  379 GLN 379 379 379 GLN GLN 4 . n 
D  4  380 SER 380 380 380 SER SER 4 . n 
D  4  381 LEU 381 381 381 LEU LEU 4 . n 
D  4  382 PRO 382 382 382 PRO PRO 4 . n 
D  4  383 TYR 383 383 383 TYR TYR 4 . n 
D  4  384 ALA 384 384 384 ALA ALA 4 . n 
D  4  385 CYS 385 385 385 CYS CYS 4 . n 
D  4  386 LYS 386 386 386 LYS LYS 4 . n 
D  4  387 GLY 387 387 387 GLY GLY 4 . n 
D  4  388 GLU 388 388 388 GLU GLU 4 . n 
D  4  389 GLN 389 389 389 GLN GLN 4 . n 
D  4  390 VAL 390 390 390 VAL VAL 4 . n 
D  4  391 PRO 391 391 391 PRO PRO 4 . n 
D  4  392 ASP 392 392 392 ASP ASP 4 . n 
D  4  393 MET 393 393 393 MET MET 4 . n 
D  4  394 VAL 394 394 394 VAL VAL 4 . n 
D  4  395 ALA 395 395 395 ALA ALA 4 . n 
D  4  396 ILE 396 396 396 ILE ILE 4 . n 
D  4  397 ILE 397 397 397 ILE ILE 4 . n 
D  4  398 ALA 398 398 398 ALA ALA 4 . n 
D  4  399 SER 399 399 399 SER SER 4 . n 
D  4  400 LEU 400 400 400 LEU LEU 4 . n 
D  4  401 ASP 401 401 401 ASP ASP 4 . n 
D  4  402 PRO 402 402 402 PRO PRO 4 . n 
D  4  403 VAL 403 403 403 VAL VAL 4 . n 
D  4  404 MET 404 404 404 MET MET 4 . n 
D  4  405 GLY 405 405 405 GLY GLY 4 . n 
D  4  406 ASP 406 406 406 ASP ASP 4 . n 
D  4  407 VAL 407 407 407 VAL VAL 4 . n 
D  4  408 ASP 408 408 408 ASP ASP 4 . n 
D  4  409 ARG 409 409 409 ARG ARG 4 . n 
E  5  1   MET 1   1   1   MET MET 5 . n 
E  5  2   ARG 2   2   2   ARG ARG 5 . n 
E  5  3   LEU 3   3   3   LEU LEU 5 . n 
E  5  4   GLU 4   4   4   GLU GLU 5 . n 
E  5  5   ARG 5   5   5   ARG ARG 5 . n 
E  5  6   VAL 6   6   6   VAL VAL 5 . n 
E  5  7   LEU 7   7   7   LEU LEU 5 . n 
E  5  8   GLU 8   8   8   GLU GLU 5 . n 
E  5  9   GLU 9   9   9   GLU GLU 5 . n 
E  5  10  ALA 10  10  10  ALA ALA 5 . n 
E  5  11  ARG 11  11  11  ARG ARG 5 . n 
E  5  12  ALA 12  12  12  ALA ALA 5 . n 
E  5  13  LYS 13  13  13  LYS LYS 5 . n 
E  5  14  GLY 14  14  14  GLY GLY 5 . n 
E  5  15  TYR 15  15  15  TYR TYR 5 . n 
E  5  16  PRO 16  16  16  PRO PRO 5 . n 
E  5  17  ILE 17  17  17  ILE ILE 5 . n 
E  5  18  GLU 18  18  18  GLU GLU 5 . n 
E  5  19  ASP 19  19  19  ASP ASP 5 . n 
E  5  20  ASN 20  20  20  ASN ASN 5 . n 
E  5  21  GLY 21  21  21  GLY GLY 5 . n 
E  5  22  LEU 22  22  22  LEU LEU 5 . n 
E  5  23  GLY 23  23  23  GLY GLY 5 . n 
E  5  24  ASN 24  24  24  ASN ASN 5 . n 
E  5  25  LEU 25  25  25  LEU LEU 5 . n 
E  5  26  TRP 26  26  26  TRP TRP 5 . n 
E  5  27  VAL 27  27  27  VAL VAL 5 . n 
E  5  28  VAL 28  28  28  VAL VAL 5 . n 
E  5  29  LEU 29  29  29  LEU LEU 5 . n 
E  5  30  PRO 30  30  30  PRO PRO 5 . n 
E  5  31  ARG 31  31  31  ARG ARG 5 . n 
E  5  32  GLU 32  32  32  GLU GLU 5 . n 
E  5  33  ARG 33  33  33  ARG ARG 5 . n 
E  5  34  PHE 34  34  34  PHE PHE 5 . n 
E  5  35  LYS 35  35  35  LYS LYS 5 . n 
E  5  36  GLU 36  36  36  GLU GLU 5 . n 
E  5  37  GLU 37  37  37  GLU GLU 5 . n 
E  5  38  MET 38  38  38  MET MET 5 . n 
E  5  39  ALA 39  39  39  ALA ALA 5 . n 
E  5  40  HIS 40  40  40  HIS HIS 5 . n 
E  5  41  TYR 41  41  41  TYR TYR 5 . n 
E  5  42  LYS 42  42  42  LYS LYS 5 . n 
E  5  43  ALA 43  43  43  ALA ALA 5 . n 
E  5  44  MET 44  44  44  MET MET 5 . n 
E  5  45  GLY 45  45  45  GLY GLY 5 . n 
E  5  46  PHE 46  46  46  PHE PHE 5 . n 
E  5  47  ASN 47  47  47  ASN ASN 5 . n 
E  5  48  PHE 48  48  48  PHE PHE 5 . n 
E  5  49  LEU 49  49  49  LEU LEU 5 . n 
E  5  50  ALA 50  50  50  ALA ALA 5 . n 
E  5  51  ASP 51  51  51  ASP ASP 5 . n 
E  5  52  ILE 52  52  52  ILE ILE 5 . n 
E  5  53  VAL 53  53  53  VAL VAL 5 . n 
E  5  54  GLY 54  54  54  GLY GLY 5 . n 
E  5  55  LEU 55  55  55  LEU LEU 5 . n 
E  5  56  ASP 56  56  56  ASP ASP 5 . n 
E  5  57  TYR 57  57  57  TYR TYR 5 . n 
E  5  58  LEU 58  58  58  LEU LEU 5 . n 
E  5  59  THR 59  59  59  THR THR 5 . n 
E  5  60  TYR 60  60  60  TYR TYR 5 . n 
E  5  61  PRO 61  61  61  PRO PRO 5 . n 
E  5  62  ASP 62  62  62  ASP ASP 5 . n 
E  5  63  PRO 63  63  63  PRO PRO 5 . n 
E  5  64  ARG 64  64  64  ARG ARG 5 . n 
E  5  65  PRO 65  65  65  PRO PRO 5 . n 
E  5  66  GLU 66  66  66  GLU GLU 5 . n 
E  5  67  ARG 67  67  67  ARG ARG 5 . n 
E  5  68  PHE 68  68  68  PHE PHE 5 . n 
E  5  69  ALA 69  69  69  ALA ALA 5 . n 
E  5  70  VAL 70  70  70  VAL VAL 5 . n 
E  5  71  VAL 71  71  71  VAL VAL 5 . n 
E  5  72  TYR 72  72  72  TYR TYR 5 . n 
E  5  73  GLU 73  73  73  GLU GLU 5 . n 
E  5  74  LEU 74  74  74  LEU LEU 5 . n 
E  5  75  VAL 75  75  75  VAL VAL 5 . n 
E  5  76  SER 76  76  76  SER SER 5 . n 
E  5  77  LEU 77  77  77  LEU LEU 5 . n 
E  5  78  PRO 78  78  78  PRO PRO 5 . n 
E  5  79  GLY 79  79  79  GLY GLY 5 . n 
E  5  80  TRP 80  80  80  TRP TRP 5 . n 
E  5  81  LYS 81  81  81  LYS LYS 5 . n 
E  5  82  ASP 82  82  82  ASP ASP 5 . n 
E  5  83  GLY 83  83  83  GLY GLY 5 . n 
E  5  84  ASP 84  84  84  ASP ASP 5 . n 
E  5  85  GLY 85  85  85  GLY GLY 5 . n 
E  5  86  SER 86  86  86  SER SER 5 . n 
E  5  87  ARG 87  87  87  ARG ARG 5 . n 
E  5  88  PHE 88  88  88  PHE PHE 5 . n 
E  5  89  PHE 89  89  89  PHE PHE 5 . n 
E  5  90  VAL 90  90  90  VAL VAL 5 . n 
E  5  91  ARG 91  91  91  ARG ARG 5 . n 
E  5  92  VAL 92  92  92  VAL VAL 5 . n 
E  5  93  TYR 93  93  93  TYR TYR 5 . n 
E  5  94  VAL 94  94  94  VAL VAL 5 . n 
E  5  95  PRO 95  95  95  PRO PRO 5 . n 
E  5  96  GLU 96  96  96  GLU GLU 5 . n 
E  5  97  GLU 97  97  97  GLU GLU 5 . n 
E  5  98  ASP 98  98  98  ASP ASP 5 . n 
E  5  99  PRO 99  99  99  PRO PRO 5 . n 
E  5  100 ARG 100 100 100 ARG ARG 5 . n 
E  5  101 LEU 101 101 101 LEU LEU 5 . n 
E  5  102 PRO 102 102 102 PRO PRO 5 . n 
E  5  103 THR 103 103 103 THR THR 5 . n 
E  5  104 VAL 104 104 104 VAL VAL 5 . n 
E  5  105 THR 105 105 105 THR THR 5 . n 
E  5  106 ASP 106 106 106 ASP ASP 5 . n 
E  5  107 LEU 107 107 107 LEU LEU 5 . n 
E  5  108 TRP 108 108 108 TRP TRP 5 . n 
E  5  109 GLY 109 109 109 GLY GLY 5 . n 
E  5  110 SER 110 110 110 SER SER 5 . n 
E  5  111 ALA 111 111 111 ALA ALA 5 . n 
E  5  112 ASN 112 112 112 ASN ASN 5 . n 
E  5  113 PHE 113 113 113 PHE PHE 5 . n 
E  5  114 LEU 114 114 114 LEU LEU 5 . n 
E  5  115 GLU 115 115 115 GLU GLU 5 . n 
E  5  116 ARG 116 116 116 ARG ARG 5 . n 
E  5  117 GLU 117 117 117 GLU GLU 5 . n 
E  5  118 VAL 118 118 118 VAL VAL 5 . n 
E  5  119 TYR 119 119 119 TYR TYR 5 . n 
E  5  120 ASP 120 120 120 ASP ASP 5 . n 
E  5  121 LEU 121 121 121 LEU LEU 5 . n 
E  5  122 PHE 122 122 122 PHE PHE 5 . n 
E  5  123 GLY 123 123 123 GLY GLY 5 . n 
E  5  124 ILE 124 124 124 ILE ILE 5 . n 
E  5  125 VAL 125 125 125 VAL VAL 5 . n 
E  5  126 PHE 126 126 126 PHE PHE 5 . n 
E  5  127 GLU 127 127 127 GLU GLU 5 . n 
E  5  128 GLY 128 128 128 GLY GLY 5 . n 
E  5  129 HIS 129 129 129 HIS HIS 5 . n 
E  5  130 PRO 130 130 130 PRO PRO 5 . n 
E  5  131 ASP 131 131 131 ASP ASP 5 . n 
E  5  132 LEU 132 132 132 LEU LEU 5 . n 
E  5  133 ARG 133 133 133 ARG ARG 5 . n 
E  5  134 LYS 134 134 134 LYS LYS 5 . n 
E  5  135 ILE 135 135 135 ILE ILE 5 . n 
E  5  136 LEU 136 136 136 LEU LEU 5 . n 
E  5  137 THR 137 137 137 THR THR 5 . n 
E  5  138 PRO 138 138 138 PRO PRO 5 . n 
E  5  139 GLU 139 139 139 GLU GLU 5 . n 
E  5  140 ASP 140 140 140 ASP ASP 5 . n 
E  5  141 LEU 141 141 141 LEU LEU 5 . n 
E  5  142 GLU 142 142 142 GLU GLU 5 . n 
E  5  143 GLY 143 143 143 GLY GLY 5 . n 
E  5  144 HIS 144 144 144 HIS HIS 5 . n 
E  5  145 PRO 145 145 145 PRO PRO 5 . n 
E  5  146 LEU 146 146 146 LEU LEU 5 . n 
E  5  147 ARG 147 147 147 ARG ARG 5 . n 
E  5  148 LYS 148 148 148 LYS LYS 5 . n 
E  5  149 ASP 149 149 149 ASP ASP 5 . n 
E  5  150 TYR 150 150 150 TYR TYR 5 . n 
E  5  151 PRO 151 151 151 PRO PRO 5 . n 
E  5  152 LEU 152 152 152 LEU LEU 5 . n 
E  5  153 GLY 153 153 153 GLY GLY 5 . n 
E  5  154 GLU 154 154 154 GLU GLU 5 . n 
E  5  155 THR 155 155 155 THR THR 5 . n 
E  5  156 PRO 156 156 156 PRO PRO 5 . n 
E  5  157 THR 157 157 157 THR THR 5 . n 
E  5  158 LEU 158 158 158 LEU LEU 5 . n 
E  5  159 PHE 159 159 159 PHE PHE 5 . n 
E  5  160 ARG 160 160 160 ARG ARG 5 . n 
E  5  161 GLU 161 161 161 GLU GLU 5 . n 
E  5  162 GLY 162 162 162 GLY GLY 5 . n 
E  5  163 ARG 163 163 163 ARG ARG 5 . n 
E  5  164 TYR 164 164 164 TYR TYR 5 . n 
E  5  165 ILE 165 165 165 ILE ILE 5 . n 
E  5  166 ILE 166 166 166 ILE ILE 5 . n 
E  5  167 PRO 167 167 167 PRO PRO 5 . n 
E  5  168 ALA 168 168 168 ALA ALA 5 . n 
E  5  169 GLU 169 169 169 GLU GLU 5 . n 
E  5  170 PHE 170 170 170 PHE PHE 5 . n 
E  5  171 ARG 171 171 171 ARG ARG 5 . n 
E  5  172 ALA 172 172 172 ALA ALA 5 . n 
E  5  173 ALA 173 173 173 ALA ALA 5 . n 
E  5  174 LEU 174 174 174 LEU LEU 5 . n 
E  5  175 THR 175 175 175 THR THR 5 . n 
E  5  176 GLY 176 176 176 GLY GLY 5 . n 
E  5  177 LYS 177 177 177 LYS LYS 5 . n 
E  5  178 ASP 178 178 178 ASP ASP 5 . n 
E  5  179 PRO 179 179 179 PRO PRO 5 . n 
E  5  180 GLY 180 180 180 GLY GLY 5 . n 
E  5  181 LEU 181 181 181 LEU LEU 5 . n 
E  5  182 THR 182 182 182 THR THR 5 . n 
E  5  183 PHE 183 183 183 PHE PHE 5 . n 
E  5  184 TYR 184 184 184 TYR TYR 5 . n 
E  5  185 LYS 185 185 185 LYS LYS 5 . n 
E  5  186 GLY 186 186 186 GLY GLY 5 . n 
E  5  187 GLY 187 187 187 GLY GLY 5 . n 
E  5  188 SER 188 188 188 SER SER 5 . n 
E  5  189 ARG 189 189 189 ARG ARG 5 . n 
E  5  190 LYS 190 190 190 LYS LYS 5 . n 
E  5  191 GLY 191 191 191 GLY GLY 5 . n 
E  5  192 TYR 192 192 192 TYR TYR 5 . n 
E  5  193 ARG 193 193 193 ARG ARG 5 . n 
E  5  194 SER 194 194 194 SER SER 5 . n 
E  5  195 LEU 195 195 195 LEU LEU 5 . n 
E  5  196 TRP 196 196 196 TRP TRP 5 . n 
E  5  197 ALA 197 197 ?   ?   ?   5 . n 
E  5  198 ASP 198 198 ?   ?   ?   5 . n 
E  5  199 LEU 199 199 ?   ?   ?   5 . n 
E  5  200 LYS 200 200 ?   ?   ?   5 . n 
E  5  201 LYS 201 201 ?   ?   ?   5 . n 
E  5  202 ALA 202 202 ?   ?   ?   5 . n 
E  5  203 ARG 203 203 ?   ?   ?   5 . n 
E  5  204 GLU 204 204 ?   ?   ?   5 . n 
E  5  205 VAL 205 205 ?   ?   ?   5 . n 
E  5  206 LYS 206 206 ?   ?   ?   5 . n 
E  5  207 GLY 207 207 ?   ?   ?   5 . n 
F  6  1   MET 1   1   ?   ?   ?   6 . n 
F  6  2   ALA 2   2   ?   ?   ?   6 . n 
F  6  3   LEU 3   3   ?   ?   ?   6 . n 
F  6  4   LYS 4   4   ?   ?   ?   6 . n 
F  6  5   ASP 5   5   ?   ?   ?   6 . n 
F  6  6   LEU 6   6   ?   ?   ?   6 . n 
F  6  7   PHE 7   7   ?   ?   ?   6 . n 
F  6  8   GLU 8   8   ?   ?   ?   6 . n 
F  6  9   ARG 9   9   ?   ?   ?   6 . n 
F  6  10  ASP 10  10  ?   ?   ?   6 . n 
F  6  11  VAL 11  11  ?   ?   ?   6 . n 
F  6  12  GLN 12  12  ?   ?   ?   6 . n 
F  6  13  GLU 13  13  ?   ?   ?   6 . n 
F  6  14  LEU 14  14  ?   ?   ?   6 . n 
F  6  15  GLU 15  15  ?   ?   ?   6 . n 
F  6  16  ARG 16  16  16  ARG ARG 6 . n 
F  6  17  GLU 17  17  17  GLU GLU 6 . n 
F  6  18  GLY 18  18  18  GLY GLY 6 . n 
F  6  19  ILE 19  19  19  ILE ILE 6 . n 
F  6  20  LEU 20  20  20  LEU LEU 6 . n 
F  6  21  PHE 21  21  21  PHE PHE 6 . n 
F  6  22  THR 22  22  22  THR THR 6 . n 
F  6  23  THR 23  23  23  THR THR 6 . n 
F  6  24  LEU 24  24  24  LEU LEU 6 . n 
F  6  25  GLU 25  25  25  GLU GLU 6 . n 
F  6  26  LYS 26  26  26  LYS LYS 6 . n 
F  6  27  LEU 27  27  27  LEU LEU 6 . n 
F  6  28  VAL 28  28  28  VAL VAL 6 . n 
F  6  29  ALA 29  29  29  ALA ALA 6 . n 
F  6  30  TRP 30  30  30  TRP TRP 6 . n 
F  6  31  GLY 31  31  31  GLY GLY 6 . n 
F  6  32  ARG 32  32  32  ARG ARG 6 . n 
F  6  33  SER 33  33  33  SER SER 6 . n 
F  6  34  ASN 34  34  34  ASN ASN 6 . n 
F  6  35  SER 35  35  35  SER SER 6 . n 
F  6  36  LEU 36  36  36  LEU LEU 6 . n 
F  6  37  TRP 37  37  37  TRP TRP 6 . n 
F  6  38  PRO 38  38  38  PRO PRO 6 . n 
F  6  39  ALA 39  39  39  ALA ALA 6 . n 
F  6  40  THR 40  40  40  THR THR 6 . n 
F  6  41  PHE 41  41  41  PHE PHE 6 . n 
F  6  42  GLY 42  42  42  GLY GLY 6 . n 
F  6  43  LEU 43  43  43  LEU LEU 6 . n 
F  6  44  ALA 44  44  44  ALA ALA 6 . n 
F  6  45  CYS 45  45  45  CYS CYS 6 . n 
F  6  46  CYS 46  46  46  CYS CYS 6 . n 
F  6  47  ALA 47  47  47  ALA ALA 6 . n 
F  6  48  ILE 48  48  48  ILE ILE 6 . n 
F  6  49  GLU 49  49  49  GLU GLU 6 . n 
F  6  50  MET 50  50  50  MET MET 6 . n 
F  6  51  MET 51  51  51  MET MET 6 . n 
F  6  52  ALA 52  52  52  ALA ALA 6 . n 
F  6  53  SER 53  53  53  SER SER 6 . n 
F  6  54  THR 54  54  54  THR THR 6 . n 
F  6  55  ASP 55  55  55  ASP ASP 6 . n 
F  6  56  ALA 56  56  56  ALA ALA 6 . n 
F  6  57  ARG 57  57  57  ARG ARG 6 . n 
F  6  58  ASN 58  58  58  ASN ASN 6 . n 
F  6  59  ASP 59  59  59  ASP ASP 6 . n 
F  6  60  LEU 60  60  60  LEU LEU 6 . n 
F  6  61  ALA 61  61  61  ALA ALA 6 . n 
F  6  62  ARG 62  62  62  ARG ARG 6 . n 
F  6  63  PHE 63  63  63  PHE PHE 6 . n 
F  6  64  GLY 64  64  64  GLY GLY 6 . n 
F  6  65  SER 65  65  65  SER SER 6 . n 
F  6  66  GLU 66  66  66  GLU GLU 6 . n 
F  6  67  VAL 67  67  67  VAL VAL 6 . n 
F  6  68  PHE 68  68  68  PHE PHE 6 . n 
F  6  69  ARG 69  69  69  ARG ARG 6 . n 
F  6  70  ALA 70  70  70  ALA ALA 6 . n 
F  6  71  SER 71  71  71  SER SER 6 . n 
F  6  72  PRO 72  72  72  PRO PRO 6 . n 
F  6  73  ARG 73  73  73  ARG ARG 6 . n 
F  6  74  GLN 74  74  74  GLN GLN 6 . n 
F  6  75  ALA 75  75  75  ALA ALA 6 . n 
F  6  76  ASP 76  76  76  ASP ASP 6 . n 
F  6  77  VAL 77  77  77  VAL VAL 6 . n 
F  6  78  MET 78  78  78  MET MET 6 . n 
F  6  79  ILE 79  79  79  ILE ILE 6 . n 
F  6  80  VAL 80  80  80  VAL VAL 6 . n 
F  6  81  ALA 81  81  81  ALA ALA 6 . n 
F  6  82  GLY 82  82  82  GLY GLY 6 . n 
F  6  83  ARG 83  83  83  ARG ARG 6 . n 
F  6  84  LEU 84  84  84  LEU LEU 6 . n 
F  6  85  SER 85  85  85  SER SER 6 . n 
F  6  86  LYS 86  86  86  LYS LYS 6 . n 
F  6  87  LYS 87  87  87  LYS LYS 6 . n 
F  6  88  MET 88  88  88  MET MET 6 . n 
F  6  89  ALA 89  89  89  ALA ALA 6 . n 
F  6  90  PRO 90  90  90  PRO PRO 6 . n 
F  6  91  VAL 91  91  91  VAL VAL 6 . n 
F  6  92  MET 92  92  92  MET MET 6 . n 
F  6  93  ARG 93  93  93  ARG ARG 6 . n 
F  6  94  ARG 94  94  94  ARG ARG 6 . n 
F  6  95  VAL 95  95  95  VAL VAL 6 . n 
F  6  96  TRP 96  96  96  TRP TRP 6 . n 
F  6  97  GLU 97  97  97  GLU GLU 6 . n 
F  6  98  GLN 98  98  98  GLN GLN 6 . n 
F  6  99  MET 99  99  99  MET MET 6 . n 
F  6  100 PRO 100 100 100 PRO PRO 6 . n 
F  6  101 ASP 101 101 101 ASP ASP 6 . n 
F  6  102 PRO 102 102 102 PRO PRO 6 . n 
F  6  103 LYS 103 103 103 LYS LYS 6 . n 
F  6  104 TRP 104 104 104 TRP TRP 6 . n 
F  6  105 VAL 105 105 105 VAL VAL 6 . n 
F  6  106 ILE 106 106 106 ILE ILE 6 . n 
F  6  107 SER 107 107 107 SER SER 6 . n 
F  6  108 MET 108 108 108 MET MET 6 . n 
F  6  109 GLY 109 109 109 GLY GLY 6 . n 
F  6  110 ALA 110 110 110 ALA ALA 6 . n 
F  6  111 CYS 111 111 111 CYS CYS 6 . n 
F  6  112 ALA 112 112 112 ALA ALA 6 . n 
F  6  113 SER 113 113 113 SER SER 6 . n 
F  6  114 SER 114 114 114 SER SER 6 . n 
F  6  115 GLY 115 115 115 GLY GLY 6 . n 
F  6  116 GLY 116 116 116 GLY GLY 6 . n 
F  6  117 MET 117 117 117 MET MET 6 . n 
F  6  118 PHE 118 118 118 PHE PHE 6 . n 
F  6  119 ASN 119 119 119 ASN ASN 6 . n 
F  6  120 ASN 120 120 120 ASN ASN 6 . n 
F  6  121 TYR 121 121 121 TYR TYR 6 . n 
F  6  122 ALA 122 122 122 ALA ALA 6 . n 
F  6  123 ILE 123 123 123 ILE ILE 6 . n 
F  6  124 VAL 124 124 124 VAL VAL 6 . n 
F  6  125 GLN 125 125 125 GLN GLN 6 . n 
F  6  126 ASN 126 126 126 ASN ASN 6 . n 
F  6  127 VAL 127 127 127 VAL VAL 6 . n 
F  6  128 ASP 128 128 128 ASP ASP 6 . n 
F  6  129 SER 129 129 129 SER SER 6 . n 
F  6  130 VAL 130 130 130 VAL VAL 6 . n 
F  6  131 VAL 131 131 131 VAL VAL 6 . n 
F  6  132 PRO 132 132 132 PRO PRO 6 . n 
F  6  133 VAL 133 133 133 VAL VAL 6 . n 
F  6  134 ASP 134 134 134 ASP ASP 6 . n 
F  6  135 VAL 135 135 135 VAL VAL 6 . n 
F  6  136 TYR 136 136 136 TYR TYR 6 . n 
F  6  137 VAL 137 137 137 VAL VAL 6 . n 
F  6  138 PRO 138 138 138 PRO PRO 6 . n 
F  6  139 GLY 139 139 139 GLY GLY 6 . n 
F  6  140 CYS 140 140 140 CYS CYS 6 . n 
F  6  141 PRO 141 141 141 PRO PRO 6 . n 
F  6  142 PRO 142 142 142 PRO PRO 6 . n 
F  6  143 ARG 143 143 143 ARG ARG 6 . n 
F  6  144 PRO 144 144 144 PRO PRO 6 . n 
F  6  145 GLU 145 145 145 GLU GLU 6 . n 
F  6  146 ALA 146 146 146 ALA ALA 6 . n 
F  6  147 LEU 147 147 147 LEU LEU 6 . n 
F  6  148 ILE 148 148 148 ILE ILE 6 . n 
F  6  149 TYR 149 149 149 TYR TYR 6 . n 
F  6  150 ALA 150 150 150 ALA ALA 6 . n 
F  6  151 VAL 151 151 151 VAL VAL 6 . n 
F  6  152 MET 152 152 152 MET MET 6 . n 
F  6  153 GLN 153 153 153 GLN GLN 6 . n 
F  6  154 LEU 154 154 154 LEU LEU 6 . n 
F  6  155 GLN 155 155 155 GLN GLN 6 . n 
F  6  156 LYS 156 156 156 LYS LYS 6 . n 
F  6  157 LYS 157 157 157 LYS LYS 6 . n 
F  6  158 VAL 158 158 158 VAL VAL 6 . n 
F  6  159 ARG 159 159 159 ARG ARG 6 . n 
F  6  160 GLY 160 160 160 GLY GLY 6 . n 
F  6  161 GLN 161 161 161 GLN GLN 6 . n 
F  6  162 ALA 162 162 162 ALA ALA 6 . n 
F  6  163 TYR 163 163 163 TYR TYR 6 . n 
F  6  164 ASN 164 164 164 ASN ASN 6 . n 
F  6  165 GLU 165 165 165 GLU GLU 6 . n 
F  6  166 ARG 166 166 166 ARG ARG 6 . n 
F  6  167 GLY 167 167 167 GLY GLY 6 . n 
F  6  168 GLU 168 168 168 GLU GLU 6 . n 
F  6  169 ARG 169 169 169 ARG ARG 6 . n 
F  6  170 LEU 170 170 170 LEU LEU 6 . n 
F  6  171 PRO 171 171 171 PRO PRO 6 . n 
F  6  172 PRO 172 172 172 PRO PRO 6 . n 
F  6  173 VAL 173 173 173 VAL VAL 6 . n 
F  6  174 ALA 174 174 174 ALA ALA 6 . n 
F  6  175 ALA 175 175 175 ALA ALA 6 . n 
F  6  176 TRP 176 176 176 TRP TRP 6 . n 
F  6  177 LYS 177 177 177 LYS LYS 6 . n 
F  6  178 ARG 178 178 178 ARG ARG 6 . n 
F  6  179 THR 179 179 179 THR THR 6 . n 
F  6  180 ARG 180 180 180 ARG ARG 6 . n 
F  6  181 GLY 181 181 181 GLY GLY 6 . n 
G  7  1   MET 1   1   ?   ?   ?   9 . n 
G  7  2   THR 2   2   2   THR THR 9 . n 
G  7  3   LEU 3   3   3   LEU LEU 9 . n 
G  7  4   LYS 4   4   4   LYS LYS 9 . n 
G  7  5   ALA 5   5   5   ALA ALA 9 . n 
G  7  6   LEU 6   6   6   LEU LEU 9 . n 
G  7  7   ALA 7   7   7   ALA ALA 9 . n 
G  7  8   GLN 8   8   8   GLN GLN 9 . n 
G  7  9   SER 9   9   9   SER SER 9 . n 
G  7  10  LEU 10  10  10  LEU LEU 9 . n 
G  7  11  GLY 11  11  11  GLY GLY 9 . n 
G  7  12  ILE 12  12  12  ILE ILE 9 . n 
G  7  13  THR 13  13  13  THR THR 9 . n 
G  7  14  LEU 14  14  14  LEU LEU 9 . n 
G  7  15  LYS 15  15  15  LYS LYS 9 . n 
G  7  16  TYR 16  16  16  TYR TYR 9 . n 
G  7  17  LEU 17  17  17  LEU LEU 9 . n 
G  7  18  PHE 18  18  18  PHE PHE 9 . n 
G  7  19  SER 19  19  19  SER SER 9 . n 
G  7  20  LYS 20  20  20  LYS LYS 9 . n 
G  7  21  PRO 21  21  21  PRO PRO 9 . n 
G  7  22  VAL 22  22  22  VAL VAL 9 . n 
G  7  23  THR 23  23  23  THR THR 9 . n 
G  7  24  VAL 24  24  24  VAL VAL 9 . n 
G  7  25  PRO 25  25  25  PRO PRO 9 . n 
G  7  26  TYR 26  26  26  TYR TYR 9 . n 
G  7  27  PRO 27  27  27  PRO PRO 9 . n 
G  7  28  ASP 28  28  28  ASP ASP 9 . n 
G  7  29  ALA 29  29  29  ALA ALA 9 . n 
G  7  30  PRO 30  30  30  PRO PRO 9 . n 
G  7  31  VAL 31  31  31  VAL VAL 9 . n 
G  7  32  ALA 32  32  32  ALA ALA 9 . n 
G  7  33  LEU 33  33  33  LEU LEU 9 . n 
G  7  34  LYS 34  34  34  LYS LYS 9 . n 
G  7  35  PRO 35  35  35  PRO PRO 9 . n 
G  7  36  ARG 36  36  36  ARG ARG 9 . n 
G  7  37  PHE 37  37  37  PHE PHE 9 . n 
G  7  38  HIS 38  38  38  HIS HIS 9 . n 
G  7  39  GLY 39  39  39  GLY GLY 9 . n 
G  7  40  ARG 40  40  40  ARG ARG 9 . n 
G  7  41  HIS 41  41  41  HIS HIS 9 . n 
G  7  42  VAL 42  42  42  VAL VAL 9 . n 
G  7  43  LEU 43  43  43  LEU LEU 9 . n 
G  7  44  THR 44  44  44  THR THR 9 . n 
G  7  45  ARG 45  45  45  ARG ARG 9 . n 
G  7  46  HIS 46  46  46  HIS HIS 9 . n 
G  7  47  PRO 47  47  47  PRO PRO 9 . n 
G  7  48  ASN 48  48  48  ASN ASN 9 . n 
G  7  49  GLY 49  49  49  GLY GLY 9 . n 
G  7  50  LEU 50  50  50  LEU LEU 9 . n 
G  7  51  GLU 51  51  51  GLU GLU 9 . n 
G  7  52  LYS 52  52  52  LYS LYS 9 . n 
G  7  53  CYS 53  53  53  CYS CYS 9 . n 
G  7  54  ILE 54  54  54  ILE ILE 9 . n 
G  7  55  GLY 55  55  55  GLY GLY 9 . n 
G  7  56  CYS 56  56  56  CYS CYS 9 . n 
G  7  57  SER 57  57  57  SER SER 9 . n 
G  7  58  LEU 58  58  58  LEU LEU 9 . n 
G  7  59  CYS 59  59  59  CYS CYS 9 . n 
G  7  60  ALA 60  60  60  ALA ALA 9 . n 
G  7  61  ALA 61  61  61  ALA ALA 9 . n 
G  7  62  ALA 62  62  62  ALA ALA 9 . n 
G  7  63  CYS 63  63  63  CYS CYS 9 . n 
G  7  64  PRO 64  64  64  PRO PRO 9 . n 
G  7  65  ALA 65  65  65  ALA ALA 9 . n 
G  7  66  TYR 66  66  66  TYR TYR 9 . n 
G  7  67  ALA 67  67  67  ALA ALA 9 . n 
G  7  68  ILE 68  68  68  ILE ILE 9 . n 
G  7  69  TYR 69  69  69  TYR TYR 9 . n 
G  7  70  VAL 70  70  70  VAL VAL 9 . n 
G  7  71  GLU 71  71  71  GLU GLU 9 . n 
G  7  72  PRO 72  72  72  PRO PRO 9 . n 
G  7  73  ALA 73  73  73  ALA ALA 9 . n 
G  7  74  GLU 74  74  74  GLU GLU 9 . n 
G  7  75  ASN 75  75  75  ASN ASN 9 . n 
G  7  76  ASP 76  76  76  ASP ASP 9 . n 
G  7  77  PRO 77  77  77  PRO PRO 9 . n 
G  7  78  GLU 78  78  78  GLU GLU 9 . n 
G  7  79  ASN 79  79  79  ASN ASN 9 . n 
G  7  80  PRO 80  80  80  PRO PRO 9 . n 
G  7  81  VAL 81  81  81  VAL VAL 9 . n 
G  7  82  SER 82  82  82  SER SER 9 . n 
G  7  83  ALA 83  83  83  ALA ALA 9 . n 
G  7  84  GLY 84  84  84  GLY GLY 9 . n 
G  7  85  GLU 85  85  85  GLU GLU 9 . n 
G  7  86  ARG 86  86  86  ARG ARG 9 . n 
G  7  87  TYR 87  87  87  TYR TYR 9 . n 
G  7  88  ALA 88  88  88  ALA ALA 9 . n 
G  7  89  LYS 89  89  89  LYS LYS 9 . n 
G  7  90  VAL 90  90  90  VAL VAL 9 . n 
G  7  91  TYR 91  91  91  TYR TYR 9 . n 
G  7  92  GLU 92  92  92  GLU GLU 9 . n 
G  7  93  ILE 93  93  93  ILE ILE 9 . n 
G  7  94  ASN 94  94  94  ASN ASN 9 . n 
G  7  95  MET 95  95  95  MET MET 9 . n 
G  7  96  LEU 96  96  96  LEU LEU 9 . n 
G  7  97  ARG 97  97  97  ARG ARG 9 . n 
G  7  98  CYS 98  98  98  CYS CYS 9 . n 
G  7  99  ILE 99  99  99  ILE ILE 9 . n 
G  7  100 PHE 100 100 100 PHE PHE 9 . n 
G  7  101 CYS 101 101 101 CYS CYS 9 . n 
G  7  102 GLY 102 102 102 GLY GLY 9 . n 
G  7  103 LEU 103 103 103 LEU LEU 9 . n 
G  7  104 CYS 104 104 104 CYS CYS 9 . n 
G  7  105 GLU 105 105 105 GLU GLU 9 . n 
G  7  106 GLU 106 106 106 GLU GLU 9 . n 
G  7  107 ALA 107 107 107 ALA ALA 9 . n 
G  7  108 CYS 108 108 108 CYS CYS 9 . n 
G  7  109 PRO 109 109 109 PRO PRO 9 . n 
G  7  110 THR 110 110 110 THR THR 9 . n 
G  7  111 GLY 111 111 111 GLY GLY 9 . n 
G  7  112 ALA 112 112 112 ALA ALA 9 . n 
G  7  113 ILE 113 113 113 ILE ILE 9 . n 
G  7  114 VAL 114 114 114 VAL VAL 9 . n 
G  7  115 LEU 115 115 115 LEU LEU 9 . n 
G  7  116 GLY 116 116 116 GLY GLY 9 . n 
G  7  117 TYR 117 117 117 TYR TYR 9 . n 
G  7  118 ASP 118 118 118 ASP ASP 9 . n 
G  7  119 PHE 119 119 119 PHE PHE 9 . n 
G  7  120 GLU 120 120 120 GLU GLU 9 . n 
G  7  121 MET 121 121 121 MET MET 9 . n 
G  7  122 ALA 122 122 122 ALA ALA 9 . n 
G  7  123 ASP 123 123 123 ASP ASP 9 . n 
G  7  124 TYR 124 124 124 TYR TYR 9 . n 
G  7  125 GLU 125 125 125 GLU GLU 9 . n 
G  7  126 TYR 126 126 126 TYR TYR 9 . n 
G  7  127 SER 127 127 127 SER SER 9 . n 
G  7  128 ASP 128 128 128 ASP ASP 9 . n 
G  7  129 LEU 129 129 129 LEU LEU 9 . n 
G  7  130 VAL 130 130 130 VAL VAL 9 . n 
G  7  131 TYR 131 131 131 TYR TYR 9 . n 
G  7  132 GLY 132 132 132 GLY GLY 9 . n 
G  7  133 LYS 133 133 133 LYS LYS 9 . n 
G  7  134 GLU 134 134 134 GLU GLU 9 . n 
G  7  135 ASP 135 135 135 ASP ASP 9 . n 
G  7  136 MET 136 136 136 MET MET 9 . n 
G  7  137 LEU 137 137 137 LEU LEU 9 . n 
G  7  138 VAL 138 138 138 VAL VAL 9 . n 
G  7  139 ASP 139 139 139 ASP ASP 9 . n 
G  7  140 VAL 140 140 140 VAL VAL 9 . n 
G  7  141 VAL 141 141 141 VAL VAL 9 . n 
G  7  142 GLY 142 142 142 GLY GLY 9 . n 
G  7  143 THR 143 143 143 THR THR 9 . n 
G  7  144 LYS 144 144 144 LYS LYS 9 . n 
G  7  145 PRO 145 145 145 PRO PRO 9 . n 
G  7  146 GLN 146 146 146 GLN GLN 9 . n 
G  7  147 ARG 147 147 147 ARG ARG 9 . n 
G  7  148 ARG 148 148 148 ARG ARG 9 . n 
G  7  149 GLU 149 149 149 GLU GLU 9 . n 
G  7  150 ALA 150 150 150 ALA ALA 9 . n 
G  7  151 LYS 151 151 151 LYS LYS 9 . n 
G  7  152 ARG 152 152 152 ARG ARG 9 . n 
G  7  153 THR 153 153 153 THR THR 9 . n 
G  7  154 GLY 154 154 154 GLY GLY 9 . n 
G  7  155 LYS 155 155 155 LYS LYS 9 . n 
G  7  156 PRO 156 156 156 PRO PRO 9 . n 
G  7  157 VAL 157 157 157 VAL VAL 9 . n 
G  7  158 LYS 158 158 158 LYS LYS 9 . n 
G  7  159 VAL 159 159 159 VAL VAL 9 . n 
G  7  160 GLY 160 160 160 GLY GLY 9 . n 
G  7  161 TYR 161 161 161 TYR TYR 9 . n 
G  7  162 VAL 162 162 162 VAL VAL 9 . n 
G  7  163 VAL 163 163 163 VAL VAL 9 . n 
G  7  164 PRO 164 164 164 PRO PRO 9 . n 
G  7  165 TYR 165 165 165 TYR TYR 9 . n 
G  7  166 VAL 166 166 166 VAL VAL 9 . n 
G  7  167 ARG 167 167 167 ARG ARG 9 . n 
G  7  168 PRO 168 168 168 PRO PRO 9 . n 
G  7  169 GLU 169 169 169 GLU GLU 9 . n 
G  7  170 LEU 170 170 170 LEU LEU 9 . n 
G  7  171 GLU 171 171 171 GLU GLU 9 . n 
G  7  172 GLY 172 172 172 GLY GLY 9 . n 
G  7  173 PHE 173 173 173 PHE PHE 9 . n 
G  7  174 LYS 174 174 174 LYS LYS 9 . n 
G  7  175 ALA 175 175 175 ALA ALA 9 . n 
G  7  176 PRO 176 176 176 PRO PRO 9 . n 
G  7  177 THR 177 177 177 THR THR 9 . n 
G  7  178 GLU 178 178 178 GLU GLU 9 . n 
G  7  179 GLY 179 179 179 GLY GLY 9 . n 
G  7  180 GLY 180 180 180 GLY GLY 9 . n 
G  7  181 LYS 181 181 181 LYS LYS 9 . n 
G  7  182 ARG 182 182 ?   ?   ?   9 . n 
H  8  1   MET 1   1   ?   ?   ?   7 . n 
H  8  2   SER 2   2   ?   ?   ?   7 . n 
H  8  3   ALA 3   3   3   ALA ALA 7 . n 
H  8  4   SER 4   4   4   SER SER 7 . n 
H  8  5   SER 5   5   5   SER SER 7 . n 
H  8  6   GLU 6   6   6   GLU GLU 7 . n 
H  8  7   ARG 7   7   7   ARG ARG 7 . n 
H  8  8   GLU 8   8   8   GLU GLU 7 . n 
H  8  9   LEU 9   9   9   LEU LEU 7 . n 
H  8  10  TYR 10  10  10  TYR TYR 7 . n 
H  8  11  GLU 11  11  11  GLU GLU 7 . n 
H  8  12  ALA 12  12  12  ALA ALA 7 . n 
H  8  13  TRP 13  13  13  TRP TRP 7 . n 
H  8  14  VAL 14  14  14  VAL VAL 7 . n 
H  8  15  GLU 15  15  15  GLU GLU 7 . n 
H  8  16  LEU 16  16  16  LEU LEU 7 . n 
H  8  17  LEU 17  17  17  LEU LEU 7 . n 
H  8  18  SER 18  18  18  SER SER 7 . n 
H  8  19  TRP 19  19  19  TRP TRP 7 . n 
H  8  20  MET 20  20  20  MET MET 7 . n 
H  8  21  ARG 21  21  21  ARG ARG 7 . n 
H  8  22  GLU 22  22  22  GLU GLU 7 . n 
H  8  23  TYR 23  23  23  TYR TYR 7 . n 
H  8  24  ALA 24  24  24  ALA ALA 7 . n 
H  8  25  GLN 25  25  25  GLN GLN 7 . n 
H  8  26  ALA 26  26  26  ALA ALA 7 . n 
H  8  27  LYS 27  27  27  LYS LYS 7 . n 
H  8  28  GLY 28  28  28  GLY GLY 7 . n 
H  8  29  VAL 29  29  29  VAL VAL 7 . n 
H  8  30  ARG 30  30  30  ARG ARG 7 . n 
H  8  31  PHE 31  31  31  PHE PHE 7 . n 
H  8  32  GLU 32  32  32  GLU GLU 7 . n 
H  8  33  LYS 33  33  33  LYS LYS 7 . n 
H  8  34  GLU 34  34  34  GLU GLU 7 . n 
H  8  35  ALA 35  35  35  ALA ALA 7 . n 
H  8  36  ASP 36  36  36  ASP ASP 7 . n 
H  8  37  PHE 37  37  37  PHE PHE 7 . n 
H  8  38  PRO 38  38  38  PRO PRO 7 . n 
H  8  39  ASP 39  39  39  ASP ASP 7 . n 
H  8  40  PHE 40  40  40  PHE PHE 7 . n 
H  8  41  ILE 41  41  41  ILE ILE 7 . n 
H  8  42  TYR 42  42  42  TYR TYR 7 . n 
H  8  43  ARG 43  43  43  ARG ARG 7 . n 
H  8  44  MET 44  44  44  MET MET 7 . n 
H  8  45  GLU 45  45  45  GLU GLU 7 . n 
H  8  46  ARG 46  46  46  ARG ARG 7 . n 
H  8  47  PRO 47  47  47  PRO PRO 7 . n 
H  8  48  TYR 48  48  48  TYR TYR 7 . n 
H  8  49  ASP 49  49  49  ASP ASP 7 . n 
H  8  50  LEU 50  50  50  LEU LEU 7 . n 
H  8  51  PRO 51  51  51  PRO PRO 7 . n 
H  8  52  THR 52  52  52  THR THR 7 . n 
H  8  53  THR 53  53  53  THR THR 7 . n 
H  8  54  ILE 54  54  54  ILE ILE 7 . n 
H  8  55  MET 55  55  55  MET MET 7 . n 
H  8  56  THR 56  56  56  THR THR 7 . n 
H  8  57  ALA 57  57  57  ALA ALA 7 . n 
H  8  58  SER 58  58  58  SER SER 7 . n 
H  8  59  LEU 59  59  59  LEU LEU 7 . n 
H  8  60  SER 60  60  60  SER SER 7 . n 
H  8  61  ASP 61  61  61  ASP ASP 7 . n 
H  8  62  GLY 62  62  62  GLY GLY 7 . n 
H  8  63  LEU 63  63  63  LEU LEU 7 . n 
H  8  64  GLY 64  64  64  GLY GLY 7 . n 
H  8  65  GLU 65  65  65  GLU GLU 7 . n 
H  8  66  PRO 66  66  66  PRO PRO 7 . n 
H  8  67  PHE 67  67  67  PHE PHE 7 . n 
H  8  68  LEU 68  68  68  LEU LEU 7 . n 
H  8  69  LEU 69  69  69  LEU LEU 7 . n 
H  8  70  ALA 70  70  70  ALA ALA 7 . n 
H  8  71  ASP 71  71  71  ASP ASP 7 . n 
H  8  72  VAL 72  72  72  VAL VAL 7 . n 
H  8  73  SER 73  73  73  SER SER 7 . n 
H  8  74  PRO 74  74  74  PRO PRO 7 . n 
H  8  75  ARG 75  75  75  ARG ARG 7 . n 
H  8  76  HIS 76  76  76  HIS HIS 7 . n 
H  8  77  ALA 77  77  77  ALA ALA 7 . n 
H  8  78  LYS 78  78  78  LYS LYS 7 . n 
H  8  79  LEU 79  79  79  LEU LEU 7 . n 
H  8  80  LYS 80  80  80  LYS LYS 7 . n 
H  8  81  ARG 81  81  81  ARG ARG 7 . n 
H  8  82  ILE 82  82  82  ILE ILE 7 . n 
H  8  83  GLY 83  83  83  GLY GLY 7 . n 
H  8  84  LEU 84  84  84  LEU LEU 7 . n 
H  8  85  ARG 85  85  85  ARG ARG 7 . n 
H  8  86  LEU 86  86  86  LEU LEU 7 . n 
H  8  87  PRO 87  87  87  PRO PRO 7 . n 
H  8  88  ARG 88  88  88  ARG ARG 7 . n 
H  8  89  ALA 89  89  89  ALA ALA 7 . n 
H  8  90  HIS 90  90  90  HIS HIS 7 . n 
H  8  91  ILE 91  91  91  ILE ILE 7 . n 
H  8  92  HIS 92  92  92  HIS HIS 7 . n 
H  8  93  LEU 93  93  93  LEU LEU 7 . n 
H  8  94  HIS 94  94  94  HIS HIS 7 . n 
H  8  95  ALA 95  95  95  ALA ALA 7 . n 
H  8  96  HIS 96  96  96  HIS HIS 7 . n 
H  8  97  TYR 97  97  97  TYR TYR 7 . n 
H  8  98  GLU 98  98  98  GLU GLU 7 . n 
H  8  99  PRO 99  99  99  PRO PRO 7 . n 
H  8  100 GLY 100 100 100 GLY GLY 7 . n 
H  8  101 LYS 101 101 101 LYS LYS 7 . n 
H  8  102 GLY 102 102 102 GLY GLY 7 . n 
H  8  103 LEU 103 103 103 LEU LEU 7 . n 
H  8  104 VAL 104 104 104 VAL VAL 7 . n 
H  8  105 THR 105 105 105 THR THR 7 . n 
H  8  106 GLY 106 106 106 GLY GLY 7 . n 
H  8  107 LYS 107 107 107 LYS LYS 7 . n 
H  8  108 ILE 108 108 108 ILE ILE 7 . n 
H  8  109 PRO 109 109 109 PRO PRO 7 . n 
H  8  110 LEU 110 110 110 LEU LEU 7 . n 
H  8  111 THR 111 111 111 THR THR 7 . n 
H  8  112 LYS 112 112 112 LYS LYS 7 . n 
H  8  113 GLU 113 113 113 GLU GLU 7 . n 
H  8  114 ARG 114 114 114 ARG ARG 7 . n 
H  8  115 PHE 115 115 115 PHE PHE 7 . n 
H  8  116 PHE 116 116 116 PHE PHE 7 . n 
H  8  117 ALA 117 117 117 ALA ALA 7 . n 
H  8  118 LEU 118 118 118 LEU LEU 7 . n 
H  8  119 ALA 119 119 119 ALA ALA 7 . n 
H  8  120 ASP 120 120 120 ASP ASP 7 . n 
H  8  121 ARG 121 121 121 ARG ARG 7 . n 
H  8  122 ALA 122 122 122 ALA ALA 7 . n 
H  8  123 ARG 123 123 123 ARG ARG 7 . n 
H  8  124 GLU 124 124 124 GLU GLU 7 . n 
H  8  125 ALA 125 125 125 ALA ALA 7 . n 
H  8  126 LEU 126 126 126 LEU LEU 7 . n 
H  8  127 ALA 127 127 127 ALA ALA 7 . n 
H  8  128 PHE 128 128 128 PHE PHE 7 . n 
H  8  129 ALA 129 129 129 ALA ALA 7 . n 
I  9  1   MET 1   1   1   MET MET W . n 
I  9  2   VAL 2   2   2   VAL VAL W . n 
I  9  3   ARG 3   3   3   ARG ARG W . n 
I  9  4   VAL 4   4   4   VAL VAL W . n 
I  9  5   GLY 5   5   5   GLY GLY W . n 
I  9  6   MET 6   6   6   MET MET W . n 
I  9  7   ARG 7   7   7   ARG ARG W . n 
I  9  8   ALA 8   8   8   ALA ALA W . n 
I  9  9   ALA 9   9   9   ALA ALA W . n 
I  9  10  PRO 10  10  10  PRO PRO W . n 
I  9  11  ARG 11  11  11  ARG ARG W . n 
I  9  12  VAL 12  12  12  VAL VAL W . n 
I  9  13  SER 13  13  13  SER SER W . n 
I  9  14  LEU 14  14  14  LEU LEU W . n 
I  9  15  GLU 15  15  15  GLU GLU W . n 
I  9  16  ALA 16  16  16  ALA ALA W . n 
I  9  17  LEU 17  17  17  LEU LEU W . n 
I  9  18  LYS 18  18  18  LYS LYS W . n 
I  9  19  ALA 19  19  19  ALA ALA W . n 
I  9  20  ALA 20  20  20  ALA ALA W . n 
I  9  21  LEU 21  21  21  LEU LEU W . n 
I  9  22  GLY 22  22  22  GLY GLY W . n 
I  9  23  GLY 23  23  23  GLY GLY W . n 
I  9  24  LEU 24  24  24  LEU LEU W . n 
I  9  25  LYS 25  25  25  LYS LYS W . n 
I  9  26  LEU 26  26  26  LEU LEU W . n 
I  9  27  SER 27  27  27  SER SER W . n 
I  9  28  GLU 28  28  28  GLU GLU W . n 
I  9  29  ALA 29  29  29  ALA ALA W . n 
I  9  30  LYS 30  30  30  LYS LYS W . n 
I  9  31  VAL 31  31  31  VAL VAL W . n 
I  9  32  TYR 32  32  32  TYR TYR W . n 
I  9  33  LEU 33  33  33  LEU LEU W . n 
I  9  34  ILE 34  34  34  ILE ILE W . n 
I  9  35  THR 35  35  35  THR THR W . n 
I  9  36  ASP 36  36  36  ASP ASP W . n 
I  9  37  TRP 37  37  37  TRP TRP W . n 
I  9  38  GLN 38  38  38  GLN GLN W . n 
I  9  39  ASP 39  39  39  ASP ASP W . n 
I  9  40  LYS 40  40  40  LYS LYS W . n 
I  9  41  ARG 41  41  41  ARG ARG W . n 
I  9  42  ASP 42  42  42  ASP ASP W . n 
I  9  43  GLN 43  43  43  GLN GLN W . n 
I  9  44  ALA 44  44  44  ALA ALA W . n 
I  9  45  ARG 45  45  45  ARG ARG W . n 
I  9  46  TYR 46  46  46  TYR TYR W . n 
I  9  47  ALA 47  47  47  ALA ALA W . n 
I  9  48  LEU 48  48  48  LEU LEU W . n 
I  9  49  LEU 49  49  49  LEU LEU W . n 
I  9  50  LEU 50  50  50  LEU LEU W . n 
I  9  51  HIS 51  51  51  HIS HIS W . n 
I  9  52  THR 52  52  52  THR THR W . n 
I  9  53  GLY 53  53  53  GLY GLY W . n 
I  9  54  LYS 54  54  54  LYS LYS W . n 
I  9  55  LYS 55  55  55  LYS LYS W . n 
I  9  56  ASP 56  56  56  ASP ASP W . n 
I  9  57  LEU 57  57  57  LEU LEU W . n 
I  9  58  LEU 58  58  58  LEU LEU W . n 
I  9  59  VAL 59  59  59  VAL VAL W . n 
I  9  60  PRO 60  60  60  PRO PRO W . n 
I  9  61  ASP 61  61  61  ASP ASP W . n 
I  9  62  ALA 62  62  62  ALA ALA W . n 
I  9  63  PHE 63  63  63  PHE PHE W . n 
I  9  64  GLY 64  64  64  GLY GLY W . n 
I  9  65  PRO 65  65  65  PRO PRO W . n 
I  9  66  ALA 66  66  66  ALA ALA W . n 
I  9  67  PHE 67  67  67  PHE PHE W . n 
I  9  68  PRO 68  68  68  PRO PRO W . n 
I  9  69  GLY 69  69  69  GLY GLY W . n 
I  9  70  GLY 70  70  70  GLY GLY W . n 
I  9  71  GLU 71  71  71  GLU GLU W . n 
I  9  72  GLU 72  72  72  GLU GLU W . n 
I  9  73  ALA 73  73  73  ALA ALA W . n 
I  9  74  LEU 74  74  74  LEU LEU W . n 
I  9  75  SER 75  75  75  SER SER W . n 
I  9  76  GLU 76  76  76  GLU GLU W . n 
I  9  77  LEU 77  77  77  LEU LEU W . n 
I  9  78  VAL 78  78  78  VAL VAL W . n 
I  9  79  GLY 79  79  79  GLY GLY W . n 
I  9  80  LEU 80  80  80  LEU LEU W . n 
I  9  81  LEU 81  81  81  LEU LEU W . n 
I  9  82  LEU 82  82  82  LEU LEU W . n 
I  9  83  ALA 83  83  83  ALA ALA W . n 
I  9  84  GLN 84  84  84  GLN GLN W . n 
I  9  85  GLY 85  85  85  GLY GLY W . n 
I  9  86  ALA 86  86  86  ALA ALA W . n 
I  9  87  ARG 87  87  87  ARG ARG W . n 
I  9  88  ARG 88  88  88  ARG ARG W . n 
I  9  89  PHE 89  89  89  PHE PHE W . n 
I  9  90  TYR 90  90  90  TYR TYR W . n 
I  9  91  GLU 91  91  91  GLU GLU W . n 
I  9  92  ALA 92  92  92  ALA ALA W . n 
I  9  93  VAL 93  93  93  VAL VAL W . n 
I  9  94  VAL 94  94  94  VAL VAL W . n 
I  9  95  SER 95  95  95  SER SER W . n 
I  9  96  PRO 96  96  96  PRO PRO W . n 
I  9  97  GLY 97  97  97  GLY GLY W . n 
I  9  98  GLU 98  98  98  GLU GLU W . n 
I  9  99  MET 99  99  99  MET MET W . n 
I  9  100 THR 100 100 100 THR THR W . n 
I  9  101 ALA 101 101 101 ALA ALA W . n 
I  9  102 LEU 102 102 102 LEU LEU W . n 
I  9  103 LEU 103 103 103 LEU LEU W . n 
I  9  104 ASP 104 104 104 ASP ASP W . n 
I  9  105 LEU 105 105 105 LEU LEU W . n 
I  9  106 PRO 106 106 106 PRO PRO W . n 
I  9  107 PRO 107 107 107 PRO PRO W . n 
I  9  108 GLU 108 108 108 GLU GLU W . n 
I  9  109 GLU 109 109 109 GLU GLU W . n 
I  9  110 LEU 110 110 110 LEU LEU W . n 
I  9  111 LEU 111 111 111 LEU LEU W . n 
I  9  112 LYS 112 112 112 LYS LYS W . n 
I  9  113 ARG 113 113 113 ARG ARG W . n 
I  9  114 VAL 114 114 114 VAL VAL W . n 
I  9  115 MET 115 115 115 MET MET W . n 
I  9  116 ALA 116 116 116 ALA ALA W . n 
I  9  117 ILE 117 117 117 ILE ILE W . n 
I  9  118 ALA 118 118 118 ALA ALA W . n 
I  9  119 ASN 119 119 119 ASN ASN W . n 
I  9  120 PRO 120 120 120 PRO PRO W . n 
I  9  121 THR 121 121 121 THR THR W . n 
I  9  122 ASP 122 122 122 ASP ASP W . n 
I  9  123 PRO 123 123 123 PRO PRO W . n 
I  9  124 GLY 124 124 124 GLY GLY W . n 
I  9  125 ILE 125 125 125 ILE ILE W . n 
I  9  126 TYR 126 126 126 TYR TYR W . n 
I  9  127 LEU 127 127 127 LEU LEU W . n 
I  9  128 LYS 128 128 ?   ?   ?   W . n 
I  9  129 ARG 129 129 ?   ?   ?   W . n 
I  9  130 ALA 130 130 ?   ?   ?   W . n 
I  9  131 ALA 131 131 ?   ?   ?   W . n 
J  10 1   MET 1   1   1   MET MET A . n 
J  10 2   ALA 2   2   2   ALA ALA A . n 
J  10 3   PRO 3   3   3   PRO PRO A . n 
J  10 4   ILE 4   4   4   ILE ILE A . n 
J  10 5   GLN 5   5   5   GLN GLN A . n 
J  10 6   GLU 6   6   6   GLU GLU A . n 
J  10 7   TYR 7   7   7   TYR TYR A . n 
J  10 8   VAL 8   8   8   VAL VAL A . n 
J  10 9   GLY 9   9   9   GLY GLY A . n 
J  10 10  THR 10  10  10  THR THR A . n 
J  10 11  LEU 11  11  11  LEU LEU A . n 
J  10 12  ILE 12  12  12  ILE ILE A . n 
J  10 13  TYR 13  13  13  TYR TYR A . n 
J  10 14  VAL 14  14  14  VAL VAL A . n 
J  10 15  GLY 15  15  15  GLY GLY A . n 
J  10 16  VAL 16  16  16  VAL VAL A . n 
J  10 17  ALA 17  17  17  ALA ALA A . n 
J  10 18  LEU 18  18  18  LEU LEU A . n 
J  10 19  PHE 19  19  19  PHE PHE A . n 
J  10 20  ILE 20  20  20  ILE ILE A . n 
J  10 21  GLY 21  21  21  GLY GLY A . n 
J  10 22  VAL 22  22  22  VAL VAL A . n 
J  10 23  ALA 23  23  23  ALA ALA A . n 
J  10 24  ALA 24  24  24  ALA ALA A . n 
J  10 25  LEU 25  25  25  LEU LEU A . n 
J  10 26  LEU 26  26  26  LEU LEU A . n 
J  10 27  VAL 27  27  27  VAL VAL A . n 
J  10 28  GLY 28  28  28  GLY GLY A . n 
J  10 29  ALA 29  29  29  ALA ALA A . n 
J  10 30  LEU 30  30  30  LEU LEU A . n 
J  10 31  LEU 31  31  31  LEU LEU A . n 
J  10 32  GLY 32  32  32  GLY GLY A . n 
J  10 33  PRO 33  33  33  PRO PRO A . n 
J  10 34  LYS 34  34  34  LYS LYS A . n 
J  10 35  LYS 35  35  35  LYS LYS A . n 
J  10 36  PRO 36  36  36  PRO PRO A . n 
J  10 37  GLY 37  37  37  GLY GLY A . n 
J  10 38  ARG 38  38  38  ARG ARG A . n 
J  10 39  ALA 39  39  39  ALA ALA A . n 
J  10 40  LYS 40  40  40  LYS LYS A . n 
J  10 41  LEU 41  41  41  LEU LEU A . n 
J  10 42  MET 42  42  42  MET MET A . n 
J  10 43  PRO 43  43  43  PRO PRO A . n 
J  10 44  TYR 44  44  44  TYR TYR A . n 
J  10 45  GLU 45  45  45  GLU GLU A . n 
J  10 46  SER 46  46  46  SER SER A . n 
J  10 47  GLY 47  47  47  GLY GLY A . n 
J  10 48  ASN 48  48  48  ASN ASN A . n 
J  10 49  ASP 49  49  49  ASP ASP A . n 
J  10 50  PRO 50  50  50  PRO PRO A . n 
J  10 51  ALA 51  51  51  ALA ALA A . n 
J  10 52  GLY 52  52  52  GLY GLY A . n 
J  10 53  GLU 53  53  53  GLU GLU A . n 
J  10 54  VAL 54  54  54  VAL VAL A . n 
J  10 55  LYS 55  55  55  LYS LYS A . n 
J  10 56  ARG 56  56  56  ARG ARG A . n 
J  10 57  PHE 57  57  57  PHE PHE A . n 
J  10 58  PRO 58  58  58  PRO PRO A . n 
J  10 59  VAL 59  59  59  VAL VAL A . n 
J  10 60  HIS 60  60  60  HIS HIS A . n 
J  10 61  PHE 61  61  61  PHE PHE A . n 
J  10 62  TYR 62  62  62  TYR TYR A . n 
J  10 63  VAL 63  63  63  VAL VAL A . n 
J  10 64  VAL 64  64  64  VAL VAL A . n 
J  10 65  ALA 65  65  65  ALA ALA A . n 
J  10 66  MET 66  66  66  MET MET A . n 
J  10 67  LEU 67  67  67  LEU LEU A . n 
J  10 68  PHE 68  68  68  PHE PHE A . n 
J  10 69  ILE 69  69  69  ILE ILE A . n 
J  10 70  LEU 70  70  70  LEU LEU A . n 
J  10 71  PHE 71  71  71  PHE PHE A . n 
J  10 72  ASP 72  72  72  ASP ASP A . n 
J  10 73  VAL 73  73  73  VAL VAL A . n 
J  10 74  GLU 74  74  74  GLU GLU A . n 
J  10 75  VAL 75  75  75  VAL VAL A . n 
J  10 76  ALA 76  76  76  ALA ALA A . n 
J  10 77  PHE 77  77  77  PHE PHE A . n 
J  10 78  LEU 78  78  78  LEU LEU A . n 
J  10 79  TRP 79  79  79  TRP TRP A . n 
J  10 80  PRO 80  80  80  PRO PRO A . n 
J  10 81  TYR 81  81  81  TYR TYR A . n 
J  10 82  ALA 82  82  82  ALA ALA A . n 
J  10 83  VAL 83  83  83  VAL VAL A . n 
J  10 84  SER 84  84  84  SER SER A . n 
J  10 85  ALA 85  85  85  ALA ALA A . n 
J  10 86  GLY 86  86  86  GLY GLY A . n 
J  10 87  GLY 87  87  87  GLY GLY A . n 
J  10 88  LEU 88  88  88  LEU LEU A . n 
J  10 89  GLY 89  89  89  GLY GLY A . n 
J  10 90  LEU 90  90  90  LEU LEU A . n 
J  10 91  TYR 91  91  91  TYR TYR A . n 
J  10 92  GLY 92  92  92  GLY GLY A . n 
J  10 93  PHE 93  93  93  PHE PHE A . n 
J  10 94  LEU 94  94  94  LEU LEU A . n 
J  10 95  GLY 95  95  95  GLY GLY A . n 
J  10 96  VAL 96  96  96  VAL VAL A . n 
J  10 97  LEU 97  97  97  LEU LEU A . n 
J  10 98  ALA 98  98  98  ALA ALA A . n 
J  10 99  PHE 99  99  99  PHE PHE A . n 
J  10 100 THR 100 100 100 THR THR A . n 
J  10 101 LEU 101 101 101 LEU LEU A . n 
J  10 102 LEU 102 102 102 LEU LEU A . n 
J  10 103 LEU 103 103 103 LEU LEU A . n 
J  10 104 PHE 104 104 104 PHE PHE A . n 
J  10 105 VAL 105 105 105 VAL VAL A . n 
J  10 106 GLY 106 106 106 GLY GLY A . n 
J  10 107 PHE 107 107 107 PHE PHE A . n 
J  10 108 LEU 108 108 108 LEU LEU A . n 
J  10 109 TYR 109 109 109 TYR TYR A . n 
J  10 110 GLU 110 110 110 GLU GLU A . n 
J  10 111 TRP 111 111 111 TRP TRP A . n 
J  10 112 TRP 112 112 112 TRP TRP A . n 
J  10 113 LYS 113 113 113 LYS LYS A . n 
J  10 114 GLY 114 114 114 GLY GLY A . n 
J  10 115 VAL 115 115 115 VAL VAL A . n 
J  10 116 MET 116 116 116 MET MET A . n 
J  10 117 ARG 117 117 117 ARG ARG A . n 
J  10 118 TRP 118 118 ?   ?   ?   A . n 
J  10 119 HIS 119 119 ?   ?   ?   A . n 
K  11 1   MET 1   1   1   MET MET J . n 
K  11 2   SER 2   2   2   SER SER J . n 
K  11 3   LEU 3   3   3   LEU LEU J . n 
K  11 4   LEU 4   4   4   LEU LEU J . n 
K  11 5   GLU 5   5   5   GLU GLU J . n 
K  11 6   GLY 6   6   6   GLY GLY J . n 
K  11 7   LEU 7   7   7   LEU LEU J . n 
K  11 8   ALA 8   8   8   ALA ALA J . n 
K  11 9   LEU 9   9   9   LEU LEU J . n 
K  11 10  PHE 10  10  10  PHE PHE J . n 
K  11 11  LEU 11  11  11  LEU LEU J . n 
K  11 12  LEU 12  12  12  LEU LEU J . n 
K  11 13  LEU 13  13  13  LEU LEU J . n 
K  11 14  LEU 14  14  14  LEU LEU J . n 
K  11 15  SER 15  15  15  SER SER J . n 
K  11 16  GLY 16  16  16  GLY GLY J . n 
K  11 17  VAL 17  17  17  VAL VAL J . n 
K  11 18  LEU 18  18  18  LEU LEU J . n 
K  11 19  VAL 19  19  19  VAL VAL J . n 
K  11 20  VAL 20  20  20  VAL VAL J . n 
K  11 21  THR 21  21  21  THR THR J . n 
K  11 22  LEU 22  22  22  LEU LEU J . n 
K  11 23  ARG 23  23  23  ARG ARG J . n 
K  11 24  ASN 24  24  24  ASN ASN J . n 
K  11 25  ALA 25  25  25  ALA ALA J . n 
K  11 26  ILE 26  26  26  ILE ILE J . n 
K  11 27  HIS 27  27  27  HIS HIS J . n 
K  11 28  ALA 28  28  28  ALA ALA J . n 
K  11 29  ALA 29  29  29  ALA ALA J . n 
K  11 30  LEU 30  30  30  LEU LEU J . n 
K  11 31  ALA 31  31  31  ALA ALA J . n 
K  11 32  LEU 32  32  32  LEU LEU J . n 
K  11 33  ILE 33  33  33  ILE ILE J . n 
K  11 34  LEU 34  34  34  LEU LEU J . n 
K  11 35  ASN 35  35  35  ASN ASN J . n 
K  11 36  PHE 36  36  36  PHE PHE J . n 
K  11 37  LEU 37  37  37  LEU LEU J . n 
K  11 38  VAL 38  38  38  VAL VAL J . n 
K  11 39  LEU 39  39  39  LEU LEU J . n 
K  11 40  ALA 40  40  40  ALA ALA J . n 
K  11 41  GLY 41  41  41  GLY GLY J . n 
K  11 42  VAL 42  42  42  VAL VAL J . n 
K  11 43  TYR 43  43  43  TYR TYR J . n 
K  11 44  VAL 44  44  44  VAL VAL J . n 
K  11 45  ALA 45  45  45  ALA ALA J . n 
K  11 46  LEU 46  46  46  LEU LEU J . n 
K  11 47  ASP 47  47  47  ASP ASP J . n 
K  11 48  ALA 48  48  48  ALA ALA J . n 
K  11 49  ARG 49  49  49  ARG ARG J . n 
K  11 50  PHE 50  50  50  PHE PHE J . n 
K  11 51  LEU 51  51  51  LEU LEU J . n 
K  11 52  GLY 52  52  52  GLY GLY J . n 
K  11 53  PHE 53  53  53  PHE PHE J . n 
K  11 54  ILE 54  54  54  ILE ILE J . n 
K  11 55  GLN 55  55  55  GLN GLN J . n 
K  11 56  VAL 56  56  56  VAL VAL J . n 
K  11 57  ILE 57  57  57  ILE ILE J . n 
K  11 58  VAL 58  58  58  VAL VAL J . n 
K  11 59  TYR 59  59  59  TYR TYR J . n 
K  11 60  ALA 60  60  60  ALA ALA J . n 
K  11 61  GLY 61  61  61  GLY GLY J . n 
K  11 62  ALA 62  62  62  ALA ALA J . n 
K  11 63  ILE 63  63  63  ILE ILE J . n 
K  11 64  VAL 64  64  64  VAL VAL J . n 
K  11 65  VAL 65  65  65  VAL VAL J . n 
K  11 66  LEU 66  66  66  LEU LEU J . n 
K  11 67  PHE 67  67  67  PHE PHE J . n 
K  11 68  LEU 68  68  68  LEU LEU J . n 
K  11 69  PHE 69  69  69  PHE PHE J . n 
K  11 70  VAL 70  70  70  VAL VAL J . n 
K  11 71  ILE 71  71  71  ILE ILE J . n 
K  11 72  MET 72  72  72  MET MET J . n 
K  11 73  LEU 73  73  73  LEU LEU J . n 
K  11 74  LEU 74  74  74  LEU LEU J . n 
K  11 75  PHE 75  75  75  PHE PHE J . n 
K  11 76  ALA 76  76  76  ALA ALA J . n 
K  11 77  ALA 77  77  77  ALA ALA J . n 
K  11 78  GLN 78  78  78  GLN GLN J . n 
K  11 79  GLY 79  79  79  GLY GLY J . n 
K  11 80  GLU 80  80  80  GLU GLU J . n 
K  11 81  ILE 81  81  81  ILE ILE J . n 
K  11 82  GLY 82  82  82  GLY GLY J . n 
K  11 83  PHE 83  83  83  PHE PHE J . n 
K  11 84  ASP 84  84  84  ASP ASP J . n 
K  11 85  PRO 85  85  85  PRO PRO J . n 
K  11 86  LEU 86  86  86  LEU LEU J . n 
K  11 87  VAL 87  87  87  VAL VAL J . n 
K  11 88  ARG 88  88  88  ARG ARG J . n 
K  11 89  SER 89  89  89  SER SER J . n 
K  11 90  ARG 90  90  90  ARG ARG J . n 
K  11 91  PRO 91  91  91  PRO PRO J . n 
K  11 92  LEU 92  92  92  LEU LEU J . n 
K  11 93  ALA 93  93  93  ALA ALA J . n 
K  11 94  ALA 94  94  94  ALA ALA J . n 
K  11 95  LEU 95  95  95  LEU LEU J . n 
K  11 96  LEU 96  96  96  LEU LEU J . n 
K  11 97  ALA 97  97  97  ALA ALA J . n 
K  11 98  LEU 98  98  98  LEU LEU J . n 
K  11 99  GLY 99  99  99  GLY GLY J . n 
K  11 100 VAL 100 100 100 VAL VAL J . n 
K  11 101 ALA 101 101 101 ALA ALA J . n 
K  11 102 GLY 102 102 102 GLY GLY J . n 
K  11 103 ILE 103 103 103 ILE ILE J . n 
K  11 104 LEU 104 104 104 LEU LEU J . n 
K  11 105 ALA 105 105 105 ALA ALA J . n 
K  11 106 ALA 106 106 106 ALA ALA J . n 
K  11 107 GLY 107 107 107 GLY GLY J . n 
K  11 108 LEU 108 108 108 LEU LEU J . n 
K  11 109 TRP 109 109 109 TRP TRP J . n 
K  11 110 GLY 110 110 110 GLY GLY J . n 
K  11 111 LEU 111 111 111 LEU LEU J . n 
K  11 112 ASP 112 112 112 ASP ASP J . n 
K  11 113 LEU 113 113 113 LEU LEU J . n 
K  11 114 ALA 114 114 114 ALA ALA J . n 
K  11 115 PHE 115 115 115 PHE PHE J . n 
K  11 116 THR 116 116 116 THR THR J . n 
K  11 117 GLN 117 117 117 GLN GLN J . n 
K  11 118 ASP 118 118 118 ASP ASP J . n 
K  11 119 LEU 119 119 119 LEU LEU J . n 
K  11 120 LYS 120 120 120 LYS LYS J . n 
K  11 121 GLY 121 121 121 GLY GLY J . n 
K  11 122 GLY 122 122 122 GLY GLY J . n 
K  11 123 LEU 123 123 123 LEU LEU J . n 
K  11 124 PRO 124 124 124 PRO PRO J . n 
K  11 125 GLN 125 125 125 GLN GLN J . n 
K  11 126 ALA 126 126 126 ALA ALA J . n 
K  11 127 LEU 127 127 127 LEU LEU J . n 
K  11 128 GLY 128 128 128 GLY GLY J . n 
K  11 129 PRO 129 129 129 PRO PRO J . n 
K  11 130 LEU 130 130 130 LEU LEU J . n 
K  11 131 LEU 131 131 131 LEU LEU J . n 
K  11 132 TYR 132 132 132 TYR TYR J . n 
K  11 133 GLY 133 133 133 GLY GLY J . n 
K  11 134 ASP 134 134 134 ASP ASP J . n 
K  11 135 TRP 135 135 135 TRP TRP J . n 
K  11 136 LEU 136 136 136 LEU LEU J . n 
K  11 137 PHE 137 137 137 PHE PHE J . n 
K  11 138 VAL 138 138 138 VAL VAL J . n 
K  11 139 LEU 139 139 139 LEU LEU J . n 
K  11 140 LEU 140 140 140 LEU LEU J . n 
K  11 141 ALA 141 141 141 ALA ALA J . n 
K  11 142 VAL 142 142 142 VAL VAL J . n 
K  11 143 GLY 143 143 143 GLY GLY J . n 
K  11 144 PHE 144 144 144 PHE PHE J . n 
K  11 145 LEU 145 145 145 LEU LEU J . n 
K  11 146 LEU 146 146 146 LEU LEU J . n 
K  11 147 MET 147 147 147 MET MET J . n 
K  11 148 ALA 148 148 148 ALA ALA J . n 
K  11 149 ALA 149 149 149 ALA ALA J . n 
K  11 150 THR 150 150 150 THR THR J . n 
K  11 151 VAL 151 151 151 VAL VAL J . n 
K  11 152 VAL 152 152 152 VAL VAL J . n 
K  11 153 ALA 153 153 153 ALA ALA J . n 
K  11 154 VAL 154 154 154 VAL VAL J . n 
K  11 155 ALA 155 155 155 ALA ALA J . n 
K  11 156 LEU 156 156 156 LEU LEU J . n 
K  11 157 VAL 157 157 157 VAL VAL J . n 
K  11 158 GLU 158 158 158 GLU GLU J . n 
K  11 159 PRO 159 159 159 PRO PRO J . n 
K  11 160 GLY 160 160 160 GLY GLY J . n 
K  11 161 LYS 161 161 ?   ?   ?   J . n 
K  11 162 ALA 162 162 ?   ?   ?   J . n 
K  11 163 SER 163 163 ?   ?   ?   J . n 
K  11 164 ARG 164 164 ?   ?   ?   J . n 
K  11 165 ALA 165 165 ?   ?   ?   J . n 
K  11 166 LYS 166 166 ?   ?   ?   J . n 
K  11 167 GLU 167 167 ?   ?   ?   J . n 
K  11 168 ALA 168 168 ?   ?   ?   J . n 
K  11 169 GLU 169 169 ?   ?   ?   J . n 
K  11 170 LYS 170 170 ?   ?   ?   J . n 
K  11 171 ARG 171 171 ?   ?   ?   J . n 
K  11 172 GLU 172 172 ?   ?   ?   J . n 
K  11 173 GLU 173 173 ?   ?   ?   J . n 
K  11 174 VAL 174 174 ?   ?   ?   J . n 
K  11 175 ALA 175 175 ?   ?   ?   J . n 
K  11 176 ARG 176 176 ?   ?   ?   J . n 
L  12 1   MET 1   1   1   MET MET K . n 
L  12 2   SER 2   2   2   SER SER K . n 
L  12 3   TYR 3   3   3   TYR TYR K . n 
L  12 4   LEU 4   4   4   LEU LEU K . n 
L  12 5   LEU 5   5   5   LEU LEU K . n 
L  12 6   THR 6   6   6   THR THR K . n 
L  12 7   SER 7   7   7   SER SER K . n 
L  12 8   ALA 8   8   8   ALA ALA K . n 
L  12 9   LEU 9   9   9   LEU LEU K . n 
L  12 10  LEU 10  10  10  LEU LEU K . n 
L  12 11  PHE 11  11  11  PHE PHE K . n 
L  12 12  ALA 12  12  12  ALA ALA K . n 
L  12 13  LEU 13  13  13  LEU LEU K . n 
L  12 14  GLY 14  14  14  GLY GLY K . n 
L  12 15  VAL 15  15  15  VAL VAL K . n 
L  12 16  TYR 16  16  16  TYR TYR K . n 
L  12 17  GLY 17  17  17  GLY GLY K . n 
L  12 18  VAL 18  18  18  VAL VAL K . n 
L  12 19  LEU 19  19  19  LEU LEU K . n 
L  12 20  THR 20  20  20  THR THR K . n 
L  12 21  ARG 21  21  21  ARG ARG K . n 
L  12 22  ARG 22  22  22  ARG ARG K . n 
L  12 23  THR 23  23  23  THR THR K . n 
L  12 24  ALA 24  24  24  ALA ALA K . n 
L  12 25  ILE 25  25  25  ILE ILE K . n 
L  12 26  LEU 26  26  26  LEU LEU K . n 
L  12 27  VAL 27  27  27  VAL VAL K . n 
L  12 28  PHE 28  28  28  PHE PHE K . n 
L  12 29  LEU 29  29  29  LEU LEU K . n 
L  12 30  SER 30  30  30  SER SER K . n 
L  12 31  ILE 31  31  31  ILE ILE K . n 
L  12 32  GLU 32  32  32  GLU GLU K . n 
L  12 33  LEU 33  33  33  LEU LEU K . n 
L  12 34  MET 34  34  34  MET MET K . n 
L  12 35  LEU 35  35  35  LEU LEU K . n 
L  12 36  ASN 36  36  36  ASN ASN K . n 
L  12 37  ALA 37  37  37  ALA ALA K . n 
L  12 38  ALA 38  38  38  ALA ALA K . n 
L  12 39  ASN 39  39  39  ASN ASN K . n 
L  12 40  LEU 40  40  40  LEU LEU K . n 
L  12 41  SER 41  41  41  SER SER K . n 
L  12 42  LEU 42  42  42  LEU LEU K . n 
L  12 43  VAL 43  43  43  VAL VAL K . n 
L  12 44  GLY 44  44  44  GLY GLY K . n 
L  12 45  PHE 45  45  45  PHE PHE K . n 
L  12 46  ALA 46  46  46  ALA ALA K . n 
L  12 47  ARG 47  47  47  ARG ARG K . n 
L  12 48  ALA 48  48  48  ALA ALA K . n 
L  12 49  TYR 49  49  49  TYR TYR K . n 
L  12 50  GLY 50  50  50  GLY GLY K . n 
L  12 51  LEU 51  51  51  LEU LEU K . n 
L  12 52  ASP 52  52  52  ASP ASP K . n 
L  12 53  GLY 53  53  53  GLY GLY K . n 
L  12 54  GLN 54  54  54  GLN GLN K . n 
L  12 55  VAL 55  55  55  VAL VAL K . n 
L  12 56  ALA 56  56  56  ALA ALA K . n 
L  12 57  ALA 57  57  57  ALA ALA K . n 
L  12 58  LEU 58  58  58  LEU LEU K . n 
L  12 59  MET 59  59  59  MET MET K . n 
L  12 60  VAL 60  60  60  VAL VAL K . n 
L  12 61  ILE 61  61  61  ILE ILE K . n 
L  12 62  ALA 62  62  62  ALA ALA K . n 
L  12 63  VAL 63  63  63  VAL VAL K . n 
L  12 64  ALA 64  64  64  ALA ALA K . n 
L  12 65  ALA 65  65  65  ALA ALA K . n 
L  12 66  ALA 66  66  66  ALA ALA K . n 
L  12 67  GLU 67  67  67  GLU GLU K . n 
L  12 68  VAL 68  68  68  VAL VAL K . n 
L  12 69  ALA 69  69  69  ALA ALA K . n 
L  12 70  VAL 70  70  70  VAL VAL K . n 
L  12 71  GLY 71  71  71  GLY GLY K . n 
L  12 72  LEU 72  72  72  LEU LEU K . n 
L  12 73  GLY 73  73  73  GLY GLY K . n 
L  12 74  LEU 74  74  74  LEU LEU K . n 
L  12 75  ILE 75  75  75  ILE ILE K . n 
L  12 76  VAL 76  76  76  VAL VAL K . n 
L  12 77  ALA 77  77  77  ALA ALA K . n 
L  12 78  ILE 78  78  78  ILE ILE K . n 
L  12 79  PHE 79  79  79  PHE PHE K . n 
L  12 80  ARG 80  80  80  ARG ARG K . n 
L  12 81  HIS 81  81  81  HIS HIS K . n 
L  12 82  ARG 82  82  82  ARG ARG K . n 
L  12 83  GLU 83  83  83  GLU GLU K . n 
L  12 84  SER 84  84  84  SER SER K . n 
L  12 85  THR 85  85  85  THR THR K . n 
L  12 86  ALA 86  86  86  ALA ALA K . n 
L  12 87  VAL 87  87  87  VAL VAL K . n 
L  12 88  ASP 88  88  88  ASP ASP K . n 
L  12 89  ASP 89  89  89  ASP ASP K . n 
L  12 90  LEU 90  90  90  LEU LEU K . n 
L  12 91  SER 91  91  91  SER SER K . n 
L  12 92  GLU 92  92  92  GLU GLU K . n 
L  12 93  LEU 93  93  93  LEU LEU K . n 
L  12 94  ARG 94  94  94  ARG ARG K . n 
L  12 95  GLY 95  95  95  GLY GLY K . n 
M  13 1   MET 1   1   1   MET MET L . n 
M  13 2   ALA 2   2   2   ALA ALA L . n 
M  13 3   LEU 3   3   3   LEU LEU L . n 
M  13 4   LEU 4   4   4   LEU LEU L . n 
M  13 5   GLY 5   5   5   GLY GLY L . n 
M  13 6   THR 6   6   6   THR THR L . n 
M  13 7   ILE 7   7   7   ILE ILE L . n 
M  13 8   LEU 8   8   8   LEU LEU L . n 
M  13 9   LEU 9   9   9   LEU LEU L . n 
M  13 10  PRO 10  10  10  PRO PRO L . n 
M  13 11  LEU 11  11  11  LEU LEU L . n 
M  13 12  LEU 12  12  12  LEU LEU L . n 
M  13 13  GLY 13  13  13  GLY GLY L . n 
M  13 14  PHE 14  14  14  PHE PHE L . n 
M  13 15  ALA 15  15  15  ALA ALA L . n 
M  13 16  LEU 16  16  16  LEU LEU L . n 
M  13 17  LEU 17  17  17  LEU LEU L . n 
M  13 18  GLY 18  18  18  GLY GLY L . n 
M  13 19  LEU 19  19  19  LEU LEU L . n 
M  13 20  PHE 20  20  20  PHE PHE L . n 
M  13 21  GLY 21  21  21  GLY GLY L . n 
M  13 22  LYS 22  22  22  LYS LYS L . n 
M  13 23  ARG 23  23  23  ARG ARG L . n 
M  13 24  MET 24  24  24  MET MET L . n 
M  13 25  ARG 25  25  25  ARG ARG L . n 
M  13 26  GLU 26  26  26  GLU GLU L . n 
M  13 27  PRO 27  27  27  PRO PRO L . n 
M  13 28  LEU 28  28  28  LEU LEU L . n 
M  13 29  PRO 29  29  29  PRO PRO L . n 
M  13 30  GLY 30  30  30  GLY GLY L . n 
M  13 31  VAL 31  31  31  VAL VAL L . n 
M  13 32  LEU 32  32  32  LEU LEU L . n 
M  13 33  ALA 33  33  33  ALA ALA L . n 
M  13 34  SER 34  34  34  SER SER L . n 
M  13 35  GLY 35  35  35  GLY GLY L . n 
M  13 36  LEU 36  36  36  LEU LEU L . n 
M  13 37  VAL 37  37  37  VAL VAL L . n 
M  13 38  LEU 38  38  38  LEU LEU L . n 
M  13 39  ALA 39  39  39  ALA ALA L . n 
M  13 40  SER 40  40  40  SER SER L . n 
M  13 41  PHE 41  41  41  PHE PHE L . n 
M  13 42  LEU 42  42  42  LEU LEU L . n 
M  13 43  LEU 43  43  43  LEU LEU L . n 
M  13 44  GLY 44  44  44  GLY GLY L . n 
M  13 45  ALA 45  45  45  ALA ALA L . n 
M  13 46  GLY 46  46  46  GLY GLY L . n 
M  13 47  LEU 47  47  47  LEU LEU L . n 
M  13 48  LEU 48  48  48  LEU LEU L . n 
M  13 49  LEU 49  49  49  LEU LEU L . n 
M  13 50  SER 50  50  50  SER SER L . n 
M  13 51  GLY 51  51  51  GLY GLY L . n 
M  13 52  GLY 52  52  52  GLY GLY L . n 
M  13 53  ALA 53  53  53  ALA ALA L . n 
M  13 54  ARG 54  54  54  ARG ARG L . n 
M  13 55  PHE 55  55  55  PHE PHE L . n 
M  13 56  GLN 56  56  56  GLN GLN L . n 
M  13 57  ALA 57  57  57  ALA ALA L . n 
M  13 58  GLU 58  58  58  GLU GLU L . n 
M  13 59  TRP 59  59  59  TRP TRP L . n 
M  13 60  LEU 60  60  60  LEU LEU L . n 
M  13 61  PRO 61  61  61  PRO PRO L . n 
M  13 62  GLY 62  62  62  GLY GLY L . n 
M  13 63  ILE 63  63  63  ILE ILE L . n 
M  13 64  PRO 64  64  64  PRO PRO L . n 
M  13 65  PHE 65  65  65  PHE PHE L . n 
M  13 66  SER 66  66  66  SER SER L . n 
M  13 67  LEU 67  67  67  LEU LEU L . n 
M  13 68  LEU 68  68  68  LEU LEU L . n 
M  13 69  LEU 69  69  69  LEU LEU L . n 
M  13 70  ASP 70  70  70  ASP ASP L . n 
M  13 71  ASN 71  71  71  ASN ASN L . n 
M  13 72  LEU 72  72  72  LEU LEU L . n 
M  13 73  SER 73  73  73  SER SER L . n 
M  13 74  GLY 74  74  74  GLY GLY L . n 
M  13 75  PHE 75  75  75  PHE PHE L . n 
M  13 76  MET 76  76  76  MET MET L . n 
M  13 77  LEU 77  77  77  LEU LEU L . n 
M  13 78  LEU 78  78  78  LEU LEU L . n 
M  13 79  ILE 79  79  79  ILE ILE L . n 
M  13 80  VAL 80  80  80  VAL VAL L . n 
M  13 81  THR 81  81  81  THR THR L . n 
M  13 82  GLY 82  82  82  GLY GLY L . n 
M  13 83  VAL 83  83  83  VAL VAL L . n 
M  13 84  GLY 84  84  84  GLY GLY L . n 
M  13 85  PHE 85  85  85  PHE PHE L . n 
M  13 86  LEU 86  86  86  LEU LEU L . n 
M  13 87  ILE 87  87  87  ILE ILE L . n 
M  13 88  HIS 88  88  88  HIS HIS L . n 
M  13 89  VAL 89  89  89  VAL VAL L . n 
M  13 90  TYR 90  90  90  TYR TYR L . n 
M  13 91  ALA 91  91  91  ALA ALA L . n 
M  13 92  ILE 92  92  92  ILE ILE L . n 
M  13 93  GLY 93  93  93  GLY GLY L . n 
M  13 94  TYR 94  94  94  TYR TYR L . n 
M  13 95  MET 95  95  95  MET MET L . n 
M  13 96  GLY 96  96  96  GLY GLY L . n 
M  13 97  GLY 97  97  97  GLY GLY L . n 
M  13 98  ASP 98  98  98  ASP ASP L . n 
M  13 99  PRO 99  99  99  PRO PRO L . n 
M  13 100 GLY 100 100 100 GLY GLY L . n 
M  13 101 TYR 101 101 101 TYR TYR L . n 
M  13 102 SER 102 102 102 SER SER L . n 
M  13 103 ARG 103 103 103 ARG ARG L . n 
M  13 104 PHE 104 104 104 PHE PHE L . n 
M  13 105 PHE 105 105 105 PHE PHE L . n 
M  13 106 ALA 106 106 106 ALA ALA L . n 
M  13 107 TYR 107 107 107 TYR TYR L . n 
M  13 108 PHE 108 108 108 PHE PHE L . n 
M  13 109 ASN 109 109 109 ASN ASN L . n 
M  13 110 LEU 110 110 110 LEU LEU L . n 
M  13 111 PHE 111 111 111 PHE PHE L . n 
M  13 112 ILE 112 112 112 ILE ILE L . n 
M  13 113 ALA 113 113 113 ALA ALA L . n 
M  13 114 MET 114 114 114 MET MET L . n 
M  13 115 MET 115 115 115 MET MET L . n 
M  13 116 LEU 116 116 116 LEU LEU L . n 
M  13 117 THR 117 117 117 THR THR L . n 
M  13 118 LEU 118 118 118 LEU LEU L . n 
M  13 119 VAL 119 119 119 VAL VAL L . n 
M  13 120 LEU 120 120 120 LEU LEU L . n 
M  13 121 ALA 121 121 121 ALA ALA L . n 
M  13 122 ASP 122 122 122 ASP ASP L . n 
M  13 123 SER 123 123 123 SER SER L . n 
M  13 124 TYR 124 124 124 TYR TYR L . n 
M  13 125 PRO 125 125 125 PRO PRO L . n 
M  13 126 VAL 126 126 126 VAL VAL L . n 
M  13 127 MET 127 127 127 MET MET L . n 
M  13 128 PHE 128 128 128 PHE PHE L . n 
M  13 129 ILE 129 129 129 ILE ILE L . n 
M  13 130 GLY 130 130 130 GLY GLY L . n 
M  13 131 TRP 131 131 131 TRP TRP L . n 
M  13 132 GLU 132 132 132 GLU GLU L . n 
M  13 133 GLY 133 133 133 GLY GLY L . n 
M  13 134 VAL 134 134 134 VAL VAL L . n 
M  13 135 GLY 135 135 135 GLY GLY L . n 
M  13 136 LEU 136 136 136 LEU LEU L . n 
M  13 137 ALA 137 137 137 ALA ALA L . n 
M  13 138 SER 138 138 138 SER SER L . n 
M  13 139 PHE 139 139 139 PHE PHE L . n 
M  13 140 LEU 140 140 140 LEU LEU L . n 
M  13 141 LEU 141 141 141 LEU LEU L . n 
M  13 142 ILE 142 142 142 ILE ILE L . n 
M  13 143 GLY 143 143 143 GLY GLY L . n 
M  13 144 PHE 144 144 144 PHE PHE L . n 
M  13 145 TRP 145 145 145 TRP TRP L . n 
M  13 146 TYR 146 146 146 TYR TYR L . n 
M  13 147 LYS 147 147 147 LYS LYS L . n 
M  13 148 ASN 148 148 148 ASN ASN L . n 
M  13 149 PRO 149 149 149 PRO PRO L . n 
M  13 150 GLN 150 150 150 GLN GLN L . n 
M  13 151 TYR 151 151 151 TYR TYR L . n 
M  13 152 ALA 152 152 152 ALA ALA L . n 
M  13 153 ASP 153 153 153 ASP ASP L . n 
M  13 154 SER 154 154 154 SER SER L . n 
M  13 155 ALA 155 155 155 ALA ALA L . n 
M  13 156 ARG 156 156 156 ARG ARG L . n 
M  13 157 LYS 157 157 157 LYS LYS L . n 
M  13 158 ALA 158 158 158 ALA ALA L . n 
M  13 159 PHE 159 159 159 PHE PHE L . n 
M  13 160 ILE 160 160 160 ILE ILE L . n 
M  13 161 VAL 161 161 161 VAL VAL L . n 
M  13 162 ASN 162 162 162 ASN ASN L . n 
M  13 163 ARG 163 163 163 ARG ARG L . n 
M  13 164 ILE 164 164 164 ILE ILE L . n 
M  13 165 GLY 165 165 165 GLY GLY L . n 
M  13 166 ASP 166 166 166 ASP ASP L . n 
M  13 167 LEU 167 167 167 LEU LEU L . n 
M  13 168 GLY 168 168 168 GLY GLY L . n 
M  13 169 PHE 169 169 169 PHE PHE L . n 
M  13 170 MET 170 170 170 MET MET L . n 
M  13 171 LEU 171 171 171 LEU LEU L . n 
M  13 172 GLY 172 172 172 GLY GLY L . n 
M  13 173 MET 173 173 173 MET MET L . n 
M  13 174 ALA 174 174 174 ALA ALA L . n 
M  13 175 ILE 175 175 175 ILE ILE L . n 
M  13 176 LEU 176 176 176 LEU LEU L . n 
M  13 177 TRP 177 177 177 TRP TRP L . n 
M  13 178 ALA 178 178 178 ALA ALA L . n 
M  13 179 LEU 179 179 179 LEU LEU L . n 
M  13 180 TYR 180 180 180 TYR TYR L . n 
M  13 181 GLY 181 181 181 GLY GLY L . n 
M  13 182 THR 182 182 182 THR THR L . n 
M  13 183 LEU 183 183 183 LEU LEU L . n 
M  13 184 SER 184 184 184 SER SER L . n 
M  13 185 ILE 185 185 185 ILE ILE L . n 
M  13 186 SER 186 186 186 SER SER L . n 
M  13 187 GLU 187 187 187 GLU GLU L . n 
M  13 188 LEU 188 188 188 LEU LEU L . n 
M  13 189 LYS 189 189 189 LYS LYS L . n 
M  13 190 GLU 190 190 190 GLU GLU L . n 
M  13 191 ALA 191 191 191 ALA ALA L . n 
M  13 192 MET 192 192 192 MET MET L . n 
M  13 193 GLU 193 193 193 GLU GLU L . n 
M  13 194 GLY 194 194 194 GLY GLY L . n 
M  13 195 PRO 195 195 195 PRO PRO L . n 
M  13 196 LEU 196 196 196 LEU LEU L . n 
M  13 197 LYS 197 197 197 LYS LYS L . n 
M  13 198 ASN 198 198 198 ASN ASN L . n 
M  13 199 PRO 199 199 199 PRO PRO L . n 
M  13 200 ASP 200 200 200 ASP ASP L . n 
M  13 201 LEU 201 201 201 LEU LEU L . n 
M  13 202 LEU 202 202 202 LEU LEU L . n 
M  13 203 ALA 203 203 203 ALA ALA L . n 
M  13 204 LEU 204 204 204 LEU LEU L . n 
M  13 205 ALA 205 205 205 ALA ALA L . n 
M  13 206 GLY 206 206 206 GLY GLY L . n 
M  13 207 LEU 207 207 207 LEU LEU L . n 
M  13 208 LEU 208 208 208 LEU LEU L . n 
M  13 209 LEU 209 209 209 LEU LEU L . n 
M  13 210 PHE 210 210 210 PHE PHE L . n 
M  13 211 LEU 211 211 211 LEU LEU L . n 
M  13 212 GLY 212 212 212 GLY GLY L . n 
M  13 213 ALA 213 213 213 ALA ALA L . n 
M  13 214 VAL 214 214 214 VAL VAL L . n 
M  13 215 GLY 215 215 215 GLY GLY L . n 
M  13 216 LYS 216 216 216 LYS LYS L . n 
M  13 217 SER 217 217 217 SER SER L . n 
M  13 218 ALA 218 218 218 ALA ALA L . n 
M  13 219 GLN 219 219 219 GLN GLN L . n 
M  13 220 ILE 220 220 220 ILE ILE L . n 
M  13 221 PRO 221 221 221 PRO PRO L . n 
M  13 222 LEU 222 222 222 LEU LEU L . n 
M  13 223 MET 223 223 223 MET MET L . n 
M  13 224 VAL 224 224 224 VAL VAL L . n 
M  13 225 TRP 225 225 225 TRP TRP L . n 
M  13 226 LEU 226 226 226 LEU LEU L . n 
M  13 227 PRO 227 227 227 PRO PRO L . n 
M  13 228 ASP 228 228 228 ASP ASP L . n 
M  13 229 ALA 229 229 229 ALA ALA L . n 
M  13 230 MET 230 230 230 MET MET L . n 
M  13 231 ALA 231 231 231 ALA ALA L . n 
M  13 232 GLY 232 232 232 GLY GLY L . n 
M  13 233 PRO 233 233 233 PRO PRO L . n 
M  13 234 THR 234 234 234 THR THR L . n 
M  13 235 PRO 235 235 235 PRO PRO L . n 
M  13 236 VAL 236 236 236 VAL VAL L . n 
M  13 237 SER 237 237 237 SER SER L . n 
M  13 238 ALA 238 238 238 ALA ALA L . n 
M  13 239 LEU 239 239 239 LEU LEU L . n 
M  13 240 ILE 240 240 240 ILE ILE L . n 
M  13 241 HIS 241 241 241 HIS HIS L . n 
M  13 242 ALA 242 242 242 ALA ALA L . n 
M  13 243 ALA 243 243 243 ALA ALA L . n 
M  13 244 THR 244 244 244 THR THR L . n 
M  13 245 MET 245 245 245 MET MET L . n 
M  13 246 VAL 246 246 246 VAL VAL L . n 
M  13 247 THR 247 247 247 THR THR L . n 
M  13 248 ALA 248 248 248 ALA ALA L . n 
M  13 249 GLY 249 249 249 GLY GLY L . n 
M  13 250 VAL 250 250 250 VAL VAL L . n 
M  13 251 TYR 251 251 251 TYR TYR L . n 
M  13 252 LEU 252 252 252 LEU LEU L . n 
M  13 253 ILE 253 253 253 ILE ILE L . n 
M  13 254 ALA 254 254 254 ALA ALA L . n 
M  13 255 ARG 255 255 255 ARG ARG L . n 
M  13 256 SER 256 256 256 SER SER L . n 
M  13 257 SER 257 257 257 SER SER L . n 
M  13 258 PHE 258 258 258 PHE PHE L . n 
M  13 259 LEU 259 259 259 LEU LEU L . n 
M  13 260 TYR 260 260 260 TYR TYR L . n 
M  13 261 SER 261 261 261 SER SER L . n 
M  13 262 VAL 262 262 262 VAL VAL L . n 
M  13 263 LEU 263 263 263 LEU LEU L . n 
M  13 264 PRO 264 264 264 PRO PRO L . n 
M  13 265 ASP 265 265 265 ASP ASP L . n 
M  13 266 VAL 266 266 266 VAL VAL L . n 
M  13 267 SER 267 267 267 SER SER L . n 
M  13 268 TYR 268 268 268 TYR TYR L . n 
M  13 269 ALA 269 269 269 ALA ALA L . n 
M  13 270 ILE 270 270 270 ILE ILE L . n 
M  13 271 ALA 271 271 271 ALA ALA L . n 
M  13 272 VAL 272 272 272 VAL VAL L . n 
M  13 273 VAL 273 273 273 VAL VAL L . n 
M  13 274 GLY 274 274 274 GLY GLY L . n 
M  13 275 LEU 275 275 275 LEU LEU L . n 
M  13 276 LEU 276 276 276 LEU LEU L . n 
M  13 277 THR 277 277 277 THR THR L . n 
M  13 278 ALA 278 278 278 ALA ALA L . n 
M  13 279 ALA 279 279 279 ALA ALA L . n 
M  13 280 TYR 280 280 280 TYR TYR L . n 
M  13 281 GLY 281 281 281 GLY GLY L . n 
M  13 282 ALA 282 282 282 ALA ALA L . n 
M  13 283 LEU 283 283 283 LEU LEU L . n 
M  13 284 SER 284 284 284 SER SER L . n 
M  13 285 ALA 285 285 285 ALA ALA L . n 
M  13 286 PHE 286 286 286 PHE PHE L . n 
M  13 287 GLY 287 287 287 GLY GLY L . n 
M  13 288 GLN 288 288 288 GLN GLN L . n 
M  13 289 THR 289 289 289 THR THR L . n 
M  13 290 ASP 290 290 290 ASP ASP L . n 
M  13 291 ILE 291 291 291 ILE ILE L . n 
M  13 292 LYS 292 292 292 LYS LYS L . n 
M  13 293 LYS 293 293 293 LYS LYS L . n 
M  13 294 ILE 294 294 294 ILE ILE L . n 
M  13 295 VAL 295 295 295 VAL VAL L . n 
M  13 296 ALA 296 296 296 ALA ALA L . n 
M  13 297 TYR 297 297 297 TYR TYR L . n 
M  13 298 SER 298 298 298 SER SER L . n 
M  13 299 THR 299 299 299 THR THR L . n 
M  13 300 ILE 300 300 300 ILE ILE L . n 
M  13 301 SER 301 301 301 SER SER L . n 
M  13 302 GLN 302 302 302 GLN GLN L . n 
M  13 303 LEU 303 303 303 LEU LEU L . n 
M  13 304 GLY 304 304 304 GLY GLY L . n 
M  13 305 TYR 305 305 305 TYR TYR L . n 
M  13 306 MET 306 306 306 MET MET L . n 
M  13 307 PHE 307 307 307 PHE PHE L . n 
M  13 308 LEU 308 308 308 LEU LEU L . n 
M  13 309 ALA 309 309 309 ALA ALA L . n 
M  13 310 ALA 310 310 310 ALA ALA L . n 
M  13 311 GLY 311 311 311 GLY GLY L . n 
M  13 312 VAL 312 312 312 VAL VAL L . n 
M  13 313 GLY 313 313 313 GLY GLY L . n 
M  13 314 ALA 314 314 314 ALA ALA L . n 
M  13 315 TYR 315 315 315 TYR TYR L . n 
M  13 316 TRP 316 316 316 TRP TRP L . n 
M  13 317 VAL 317 317 317 VAL VAL L . n 
M  13 318 ALA 318 318 318 ALA ALA L . n 
M  13 319 LEU 319 319 319 LEU LEU L . n 
M  13 320 PHE 320 320 320 PHE PHE L . n 
M  13 321 HIS 321 321 321 HIS HIS L . n 
M  13 322 VAL 322 322 322 VAL VAL L . n 
M  13 323 PHE 323 323 323 PHE PHE L . n 
M  13 324 THR 324 324 324 THR THR L . n 
M  13 325 HIS 325 325 325 HIS HIS L . n 
M  13 326 ALA 326 326 326 ALA ALA L . n 
M  13 327 PHE 327 327 327 PHE PHE L . n 
M  13 328 PHE 328 328 328 PHE PHE L . n 
M  13 329 LYS 329 329 329 LYS LYS L . n 
M  13 330 ALA 330 330 330 ALA ALA L . n 
M  13 331 LEU 331 331 331 LEU LEU L . n 
M  13 332 LEU 332 332 332 LEU LEU L . n 
M  13 333 PHE 333 333 333 PHE PHE L . n 
M  13 334 LEU 334 334 334 LEU LEU L . n 
M  13 335 ALA 335 335 335 ALA ALA L . n 
M  13 336 SER 336 336 336 SER SER L . n 
M  13 337 GLY 337 337 337 GLY GLY L . n 
M  13 338 SER 338 338 338 SER SER L . n 
M  13 339 VAL 339 339 339 VAL VAL L . n 
M  13 340 ILE 340 340 340 ILE ILE L . n 
M  13 341 HIS 341 341 341 HIS HIS L . n 
M  13 342 ALA 342 342 342 ALA ALA L . n 
M  13 343 LEU 343 343 343 LEU LEU L . n 
M  13 344 GLY 344 344 344 GLY GLY L . n 
M  13 345 GLY 345 345 345 GLY GLY L . n 
M  13 346 GLU 346 346 346 GLU GLU L . n 
M  13 347 GLN 347 347 347 GLN GLN L . n 
M  13 348 ASP 348 348 348 ASP ASP L . n 
M  13 349 VAL 349 349 349 VAL VAL L . n 
M  13 350 ARG 350 350 350 ARG ARG L . n 
M  13 351 LYS 351 351 351 LYS LYS L . n 
M  13 352 MET 352 352 352 MET MET L . n 
M  13 353 GLY 353 353 353 GLY GLY L . n 
M  13 354 GLY 354 354 354 GLY GLY L . n 
M  13 355 LEU 355 355 355 LEU LEU L . n 
M  13 356 TRP 356 356 356 TRP TRP L . n 
M  13 357 LYS 357 357 357 LYS LYS L . n 
M  13 358 HIS 358 358 358 HIS HIS L . n 
M  13 359 LEU 359 359 359 LEU LEU L . n 
M  13 360 PRO 360 360 360 PRO PRO L . n 
M  13 361 GLN 361 361 361 GLN GLN L . n 
M  13 362 THR 362 362 362 THR THR L . n 
M  13 363 ARG 363 363 363 ARG ARG L . n 
M  13 364 TRP 364 364 364 TRP TRP L . n 
M  13 365 HIS 365 365 365 HIS HIS L . n 
M  13 366 ALA 366 366 366 ALA ALA L . n 
M  13 367 LEU 367 367 367 LEU LEU L . n 
M  13 368 ILE 368 368 368 ILE ILE L . n 
M  13 369 GLY 369 369 369 GLY GLY L . n 
M  13 370 ALA 370 370 370 ALA ALA L . n 
M  13 371 LEU 371 371 371 LEU LEU L . n 
M  13 372 ALA 372 372 372 ALA ALA L . n 
M  13 373 LEU 373 373 373 LEU LEU L . n 
M  13 374 GLY 374 374 374 GLY GLY L . n 
M  13 375 GLY 375 375 375 GLY GLY L . n 
M  13 376 LEU 376 376 376 LEU LEU L . n 
M  13 377 PRO 377 377 377 PRO PRO L . n 
M  13 378 LEU 378 378 378 LEU LEU L . n 
M  13 379 LEU 379 379 379 LEU LEU L . n 
M  13 380 SER 380 380 380 SER SER L . n 
M  13 381 GLY 381 381 381 GLY GLY L . n 
M  13 382 PHE 382 382 382 PHE PHE L . n 
M  13 383 TRP 383 383 383 TRP TRP L . n 
M  13 384 SER 384 384 384 SER SER L . n 
M  13 385 LYS 385 385 385 LYS LYS L . n 
M  13 386 ASP 386 386 386 ASP ASP L . n 
M  13 387 ALA 387 387 387 ALA ALA L . n 
M  13 388 ILE 388 388 388 ILE ILE L . n 
M  13 389 LEU 389 389 389 LEU LEU L . n 
M  13 390 ALA 390 390 390 ALA ALA L . n 
M  13 391 ALA 391 391 391 ALA ALA L . n 
M  13 392 THR 392 392 392 THR THR L . n 
M  13 393 LEU 393 393 393 LEU LEU L . n 
M  13 394 THR 394 394 394 THR THR L . n 
M  13 395 TYR 395 395 395 TYR TYR L . n 
M  13 396 PRO 396 396 396 PRO PRO L . n 
M  13 397 PHE 397 397 397 PHE PHE L . n 
M  13 398 GLY 398 398 398 GLY GLY L . n 
M  13 399 GLY 399 399 399 GLY GLY L . n 
M  13 400 VAL 400 400 400 VAL VAL L . n 
M  13 401 GLY 401 401 401 GLY GLY L . n 
M  13 402 PHE 402 402 402 PHE PHE L . n 
M  13 403 TYR 403 403 403 TYR TYR L . n 
M  13 404 VAL 404 404 404 VAL VAL L . n 
M  13 405 GLY 405 405 405 GLY GLY L . n 
M  13 406 ALA 406 406 406 ALA ALA L . n 
M  13 407 LEU 407 407 407 LEU LEU L . n 
M  13 408 LEU 408 408 408 LEU LEU L . n 
M  13 409 VAL 409 409 409 VAL VAL L . n 
M  13 410 ALA 410 410 410 ALA ALA L . n 
M  13 411 VAL 411 411 411 VAL VAL L . n 
M  13 412 LEU 412 412 412 LEU LEU L . n 
M  13 413 THR 413 413 413 THR THR L . n 
M  13 414 ALA 414 414 414 ALA ALA L . n 
M  13 415 MET 415 415 415 MET MET L . n 
M  13 416 TYR 416 416 416 TYR TYR L . n 
M  13 417 ALA 417 417 417 ALA ALA L . n 
M  13 418 MET 418 418 418 MET MET L . n 
M  13 419 ARG 419 419 419 ARG ARG L . n 
M  13 420 TRP 420 420 420 TRP TRP L . n 
M  13 421 PHE 421 421 421 PHE PHE L . n 
M  13 422 VAL 422 422 422 VAL VAL L . n 
M  13 423 LEU 423 423 423 LEU LEU L . n 
M  13 424 VAL 424 424 424 VAL VAL L . n 
M  13 425 PHE 425 425 425 PHE PHE L . n 
M  13 426 LEU 426 426 426 LEU LEU L . n 
M  13 427 GLY 427 427 427 GLY GLY L . n 
M  13 428 GLU 428 428 428 GLU GLU L . n 
M  13 429 GLU 429 429 429 GLU GLU L . n 
M  13 430 ARG 430 430 430 ARG ARG L . n 
M  13 431 GLY 431 431 431 GLY GLY L . n 
M  13 432 HIS 432 432 432 HIS HIS L . n 
M  13 433 HIS 433 433 433 HIS HIS L . n 
M  13 434 HIS 434 434 434 HIS HIS L . n 
M  13 435 PRO 435 435 435 PRO PRO L . n 
M  13 436 HIS 436 436 436 HIS HIS L . n 
M  13 437 GLU 437 437 437 GLU GLU L . n 
M  13 438 ALA 438 438 438 ALA ALA L . n 
M  13 439 PRO 439 439 439 PRO PRO L . n 
M  13 440 PRO 440 440 440 PRO PRO L . n 
M  13 441 VAL 441 441 441 VAL VAL L . n 
M  13 442 MET 442 442 442 MET MET L . n 
M  13 443 LEU 443 443 443 LEU LEU L . n 
M  13 444 TRP 444 444 444 TRP TRP L . n 
M  13 445 PRO 445 445 445 PRO PRO L . n 
M  13 446 ASN 446 446 446 ASN ASN L . n 
M  13 447 HIS 447 447 447 HIS HIS L . n 
M  13 448 LEU 448 448 448 LEU LEU L . n 
M  13 449 LEU 449 449 449 LEU LEU L . n 
M  13 450 ALA 450 450 450 ALA ALA L . n 
M  13 451 LEU 451 451 451 LEU LEU L . n 
M  13 452 GLY 452 452 452 GLY GLY L . n 
M  13 453 SER 453 453 453 SER SER L . n 
M  13 454 VAL 454 454 454 VAL VAL L . n 
M  13 455 LEU 455 455 455 LEU LEU L . n 
M  13 456 ALA 456 456 456 ALA ALA L . n 
M  13 457 GLY 457 457 457 GLY GLY L . n 
M  13 458 TYR 458 458 458 TYR TYR L . n 
M  13 459 LEU 459 459 459 LEU LEU L . n 
M  13 460 ALA 460 460 460 ALA ALA L . n 
M  13 461 LEU 461 461 461 LEU LEU L . n 
M  13 462 PRO 462 462 462 PRO PRO L . n 
M  13 463 HIS 463 463 463 HIS HIS L . n 
M  13 464 PRO 464 464 464 PRO PRO L . n 
M  13 465 LEU 465 465 465 LEU LEU L . n 
M  13 466 PRO 466 466 466 PRO PRO L . n 
M  13 467 ASN 467 467 467 ASN ASN L . n 
M  13 468 VAL 468 468 468 VAL VAL L . n 
M  13 469 LEU 469 469 469 LEU LEU L . n 
M  13 470 GLU 470 470 470 GLU GLU L . n 
M  13 471 PRO 471 471 471 PRO PRO L . n 
M  13 472 PHE 472 472 472 PHE PHE L . n 
M  13 473 LEU 473 473 473 LEU LEU L . n 
M  13 474 LYS 474 474 474 LYS LYS L . n 
M  13 475 PRO 475 475 475 PRO PRO L . n 
M  13 476 ALA 476 476 476 ALA ALA L . n 
M  13 477 LEU 477 477 477 LEU LEU L . n 
M  13 478 ALA 478 478 478 ALA ALA L . n 
M  13 479 GLU 479 479 479 GLU GLU L . n 
M  13 480 VAL 480 480 480 VAL VAL L . n 
M  13 481 GLU 481 481 481 GLU GLU L . n 
M  13 482 ALA 482 482 482 ALA ALA L . n 
M  13 483 HIS 483 483 483 HIS HIS L . n 
M  13 484 HIS 484 484 484 HIS HIS L . n 
M  13 485 LEU 485 485 485 LEU LEU L . n 
M  13 486 SER 486 486 486 SER SER L . n 
M  13 487 LEU 487 487 487 LEU LEU L . n 
M  13 488 GLY 488 488 488 GLY GLY L . n 
M  13 489 ALA 489 489 489 ALA ALA L . n 
M  13 490 GLU 490 490 490 GLU GLU L . n 
M  13 491 TRP 491 491 491 TRP TRP L . n 
M  13 492 GLY 492 492 492 GLY GLY L . n 
M  13 493 LEU 493 493 493 LEU LEU L . n 
M  13 494 ILE 494 494 494 ILE ILE L . n 
M  13 495 ALA 495 495 495 ALA ALA L . n 
M  13 496 LEU 496 496 496 LEU LEU L . n 
M  13 497 SER 497 497 497 SER SER L . n 
M  13 498 ALA 498 498 498 ALA ALA L . n 
M  13 499 ALA 499 499 499 ALA ALA L . n 
M  13 500 VAL 500 500 500 VAL VAL L . n 
M  13 501 ALA 501 501 501 ALA ALA L . n 
M  13 502 LEU 502 502 502 LEU LEU L . n 
M  13 503 LEU 503 503 503 LEU LEU L . n 
M  13 504 GLY 504 504 504 GLY GLY L . n 
M  13 505 LEU 505 505 505 LEU LEU L . n 
M  13 506 TRP 506 506 506 TRP TRP L . n 
M  13 507 ALA 507 507 507 ALA ALA L . n 
M  13 508 GLY 508 508 508 GLY GLY L . n 
M  13 509 PHE 509 509 509 PHE PHE L . n 
M  13 510 VAL 510 510 510 VAL VAL L . n 
M  13 511 PHE 511 511 511 PHE PHE L . n 
M  13 512 PHE 512 512 512 PHE PHE L . n 
M  13 513 GLN 513 513 513 GLN GLN L . n 
M  13 514 ARG 514 514 514 ARG ARG L . n 
M  13 515 LYS 515 515 515 LYS LYS L . n 
M  13 516 VAL 516 516 516 VAL VAL L . n 
M  13 517 PHE 517 517 517 PHE PHE L . n 
M  13 518 PRO 518 518 518 PRO PRO L . n 
M  13 519 ALA 519 519 519 ALA ALA L . n 
M  13 520 TRP 520 520 520 TRP TRP L . n 
M  13 521 TYR 521 521 521 TYR TYR L . n 
M  13 522 LEU 522 522 522 LEU LEU L . n 
M  13 523 ALA 523 523 523 ALA ALA L . n 
M  13 524 PHE 524 524 524 PHE PHE L . n 
M  13 525 GLU 525 525 525 GLU GLU L . n 
M  13 526 ALA 526 526 526 ALA ALA L . n 
M  13 527 ALA 527 527 527 ALA ALA L . n 
M  13 528 SER 528 528 528 SER SER L . n 
M  13 529 ARG 529 529 529 ARG ARG L . n 
M  13 530 GLU 530 530 530 GLU GLU L . n 
M  13 531 ALA 531 531 531 ALA ALA L . n 
M  13 532 PHE 532 532 532 PHE PHE L . n 
M  13 533 TYR 533 533 533 TYR TYR L . n 
M  13 534 VAL 534 534 534 VAL VAL L . n 
M  13 535 ASP 535 535 535 ASP ASP L . n 
M  13 536 ARG 536 536 536 ARG ARG L . n 
M  13 537 ALA 537 537 537 ALA ALA L . n 
M  13 538 TYR 538 538 538 TYR TYR L . n 
M  13 539 ASN 539 539 539 ASN ASN L . n 
M  13 540 ALA 540 540 540 ALA ALA L . n 
M  13 541 LEU 541 541 541 LEU LEU L . n 
M  13 542 ILE 542 542 542 ILE ILE L . n 
M  13 543 VAL 543 543 543 VAL VAL L . n 
M  13 544 ASN 544 544 544 ASN ASN L . n 
M  13 545 PRO 545 545 545 PRO PRO L . n 
M  13 546 LEU 546 546 546 LEU LEU L . n 
M  13 547 LYS 547 547 547 LYS LYS L . n 
M  13 548 ALA 548 548 548 ALA ALA L . n 
M  13 549 LEU 549 549 549 LEU LEU L . n 
M  13 550 ALA 550 550 550 ALA ALA L . n 
M  13 551 GLU 551 551 551 GLU GLU L . n 
M  13 552 ALA 552 552 552 ALA ALA L . n 
M  13 553 LEU 553 553 553 LEU LEU L . n 
M  13 554 PHE 554 554 554 PHE PHE L . n 
M  13 555 TYR 555 555 555 TYR TYR L . n 
M  13 556 GLY 556 556 556 GLY GLY L . n 
M  13 557 ASP 557 557 557 ASP ASP L . n 
M  13 558 ARG 558 558 558 ARG ARG L . n 
M  13 559 GLY 559 559 559 GLY GLY L . n 
M  13 560 LEU 560 560 560 LEU LEU L . n 
M  13 561 LEU 561 561 561 LEU LEU L . n 
M  13 562 SER 562 562 562 SER SER L . n 
M  13 563 GLY 563 563 563 GLY GLY L . n 
M  13 564 TYR 564 564 564 TYR TYR L . n 
M  13 565 PHE 565 565 565 PHE PHE L . n 
M  13 566 GLY 566 566 566 GLY GLY L . n 
M  13 567 LEU 567 567 567 LEU LEU L . n 
M  13 568 GLY 568 568 568 GLY GLY L . n 
M  13 569 GLY 569 569 569 GLY GLY L . n 
M  13 570 ALA 570 570 570 ALA ALA L . n 
M  13 571 ALA 571 571 571 ALA ALA L . n 
M  13 572 ARG 572 572 572 ARG ARG L . n 
M  13 573 SER 573 573 573 SER SER L . n 
M  13 574 LEU 574 574 574 LEU LEU L . n 
M  13 575 GLY 575 575 575 GLY GLY L . n 
M  13 576 GLN 576 576 576 GLN GLN L . n 
M  13 577 GLY 577 577 577 GLY GLY L . n 
M  13 578 LEU 578 578 578 LEU LEU L . n 
M  13 579 ALA 579 579 579 ALA ALA L . n 
M  13 580 ARG 580 580 580 ARG ARG L . n 
M  13 581 LEU 581 581 581 LEU LEU L . n 
M  13 582 GLN 582 582 582 GLN GLN L . n 
M  13 583 THR 583 583 583 THR THR L . n 
M  13 584 GLY 584 584 584 GLY GLY L . n 
M  13 585 TYR 585 585 585 TYR TYR L . n 
M  13 586 LEU 586 586 586 LEU LEU L . n 
M  13 587 ARG 587 587 587 ARG ARG L . n 
M  13 588 VAL 588 588 588 VAL VAL L . n 
M  13 589 TYR 589 589 589 TYR TYR L . n 
M  13 590 ALA 590 590 590 ALA ALA L . n 
M  13 591 LEU 591 591 591 LEU LEU L . n 
M  13 592 LEU 592 592 592 LEU LEU L . n 
M  13 593 PHE 593 593 593 PHE PHE L . n 
M  13 594 VAL 594 594 594 VAL VAL L . n 
M  13 595 LEU 595 595 595 LEU LEU L . n 
M  13 596 GLY 596 596 596 GLY GLY L . n 
M  13 597 ALA 597 597 597 ALA ALA L . n 
M  13 598 LEU 598 598 598 LEU LEU L . n 
M  13 599 LEU 599 599 599 LEU LEU L . n 
M  13 600 LEU 600 600 600 LEU LEU L . n 
M  13 601 LEU 601 601 601 LEU LEU L . n 
M  13 602 GLY 602 602 602 GLY GLY L . n 
M  13 603 VAL 603 603 603 VAL VAL L . n 
M  13 604 MET 604 604 604 MET MET L . n 
M  13 605 ARG 605 605 605 ARG ARG L . n 
M  13 606 TRP 606 606 ?   ?   ?   L . n 
N  14 1   MET 1   1   1   MET MET M . n 
N  14 2   VAL 2   2   2   VAL VAL M . n 
N  14 3   VAL 3   3   3   VAL VAL M . n 
N  14 4   LEU 4   4   4   LEU LEU M . n 
N  14 5   ALA 5   5   5   ALA ALA M . n 
N  14 6   VAL 6   6   6   VAL VAL M . n 
N  14 7   LEU 7   7   7   LEU LEU M . n 
N  14 8   LEU 8   8   8   LEU LEU M . n 
N  14 9   PRO 9   9   9   PRO PRO M . n 
N  14 10  VAL 10  10  10  VAL VAL M . n 
N  14 11  VAL 11  11  11  VAL VAL M . n 
N  14 12  PHE 12  12  12  PHE PHE M . n 
N  14 13  GLY 13  13  13  GLY GLY M . n 
N  14 14  ALA 14  14  14  ALA ALA M . n 
N  14 15  LEU 15  15  15  LEU LEU M . n 
N  14 16  LEU 16  16  16  LEU LEU M . n 
N  14 17  LEU 17  17  17  LEU LEU M . n 
N  14 18  LEU 18  18  18  LEU LEU M . n 
N  14 19  GLY 19  19  19  GLY GLY M . n 
N  14 20  LEU 20  20  20  LEU LEU M . n 
N  14 21  PRO 21  21  21  PRO PRO M . n 
N  14 22  ARG 22  22  22  ARG ARG M . n 
N  14 23  ALA 23  23  23  ALA ALA M . n 
N  14 24  LEU 24  24  24  LEU LEU M . n 
N  14 25  GLY 25  25  25  GLY GLY M . n 
N  14 26  VAL 26  26  26  VAL VAL M . n 
N  14 27  LEU 27  27  27  LEU LEU M . n 
N  14 28  GLY 28  28  28  GLY GLY M . n 
N  14 29  ALA 29  29  29  ALA ALA M . n 
N  14 30  GLY 30  30  30  GLY GLY M . n 
N  14 31  LEU 31  31  31  LEU LEU M . n 
N  14 32  SER 32  32  32  SER SER M . n 
N  14 33  PHE 33  33  33  PHE PHE M . n 
N  14 34  LEU 34  34  34  LEU LEU M . n 
N  14 35  LEU 35  35  35  LEU LEU M . n 
N  14 36  ASN 36  36  36  ASN ASN M . n 
N  14 37  LEU 37  37  37  LEU LEU M . n 
N  14 38  TYR 38  38  38  TYR TYR M . n 
N  14 39  LEU 39  39  39  LEU LEU M . n 
N  14 40  PHE 40  40  40  PHE PHE M . n 
N  14 41  LEU 41  41  41  LEU LEU M . n 
N  14 42  THR 42  42  42  THR THR M . n 
N  14 43  HIS 43  43  43  HIS HIS M . n 
N  14 44  PRO 44  44  44  PRO PRO M . n 
N  14 45  GLY 45  45  45  GLY GLY M . n 
N  14 46  GLY 46  46  46  GLY GLY M . n 
N  14 47  VAL 47  47  47  VAL VAL M . n 
N  14 48  ALA 48  48  48  ALA ALA M . n 
N  14 49  HIS 49  49  49  HIS HIS M . n 
N  14 50  ALA 50  50  50  ALA ALA M . n 
N  14 51  PHE 51  51  51  PHE PHE M . n 
N  14 52  GLN 52  52  52  GLN GLN M . n 
N  14 53  ALA 53  53  53  ALA ALA M . n 
N  14 54  PRO 54  54  54  PRO PRO M . n 
N  14 55  LEU 55  55  55  LEU LEU M . n 
N  14 56  LEU 56  56  56  LEU LEU M . n 
N  14 57  PRO 57  57  57  PRO PRO M . n 
N  14 58  GLY 58  58  58  GLY GLY M . n 
N  14 59  ALA 59  59  59  ALA ALA M . n 
N  14 60  GLY 60  60  60  GLY GLY M . n 
N  14 61  VAL 61  61  61  VAL VAL M . n 
N  14 62  TYR 62  62  62  TYR TYR M . n 
N  14 63  TRP 63  63  63  TRP TRP M . n 
N  14 64  ALA 64  64  64  ALA ALA M . n 
N  14 65  PHE 65  65  65  PHE PHE M . n 
N  14 66  GLY 66  66  66  GLY GLY M . n 
N  14 67  LEU 67  67  67  LEU LEU M . n 
N  14 68  ASP 68  68  68  ASP ASP M . n 
N  14 69  GLY 69  69  69  GLY GLY M . n 
N  14 70  LEU 70  70  70  LEU LEU M . n 
N  14 71  SER 71  71  71  SER SER M . n 
N  14 72  ALA 72  72  72  ALA ALA M . n 
N  14 73  LEU 73  73  73  LEU LEU M . n 
N  14 74  PHE 74  74  74  PHE PHE M . n 
N  14 75  PHE 75  75  75  PHE PHE M . n 
N  14 76  LEU 76  76  76  LEU LEU M . n 
N  14 77  THR 77  77  77  THR THR M . n 
N  14 78  ILE 78  78  78  ILE ILE M . n 
N  14 79  ALA 79  79  79  ALA ALA M . n 
N  14 80  LEU 80  80  80  LEU LEU M . n 
N  14 81  THR 81  81  81  THR THR M . n 
N  14 82  VAL 82  82  82  VAL VAL M . n 
N  14 83  PHE 83  83  83  PHE PHE M . n 
N  14 84  LEU 84  84  84  LEU LEU M . n 
N  14 85  GLY 85  85  85  GLY GLY M . n 
N  14 86  ALA 86  86  86  ALA ALA M . n 
N  14 87  LEU 87  87  87  LEU LEU M . n 
N  14 88  VAL 88  88  88  VAL VAL M . n 
N  14 89  ALA 89  89  89  ALA ALA M . n 
N  14 90  ARG 90  90  90  ARG ARG M . n 
N  14 91  VAL 91  91  91  VAL VAL M . n 
N  14 92  GLU 92  92  92  GLU GLU M . n 
N  14 93  GLY 93  93  93  GLY GLY M . n 
N  14 94  ARG 94  94  94  ARG ARG M . n 
N  14 95  PHE 95  95  95  PHE PHE M . n 
N  14 96  LEU 96  96  96  LEU LEU M . n 
N  14 97  GLY 97  97  97  GLY GLY M . n 
N  14 98  LEU 98  98  98  LEU LEU M . n 
N  14 99  ALA 99  99  99  ALA ALA M . n 
N  14 100 LEU 100 100 100 LEU LEU M . n 
N  14 101 LEU 101 101 101 LEU LEU M . n 
N  14 102 MET 102 102 102 MET MET M . n 
N  14 103 GLU 103 103 103 GLU GLU M . n 
N  14 104 GLY 104 104 104 GLY GLY M . n 
N  14 105 LEU 105 105 105 LEU LEU M . n 
N  14 106 LEU 106 106 106 LEU LEU M . n 
N  14 107 LEU 107 107 107 LEU LEU M . n 
N  14 108 GLY 108 108 108 GLY GLY M . n 
N  14 109 LEU 109 109 109 LEU LEU M . n 
N  14 110 PHE 110 110 110 PHE PHE M . n 
N  14 111 ALA 111 111 111 ALA ALA M . n 
N  14 112 ALA 112 112 112 ALA ALA M . n 
N  14 113 ARG 113 113 113 ARG ARG M . n 
N  14 114 ASP 114 114 114 ASP ASP M . n 
N  14 115 LEU 115 115 115 LEU LEU M . n 
N  14 116 LEU 116 116 116 LEU LEU M . n 
N  14 117 VAL 117 117 117 VAL VAL M . n 
N  14 118 PHE 118 118 118 PHE PHE M . n 
N  14 119 TYR 119 119 119 TYR TYR M . n 
N  14 120 VAL 120 120 120 VAL VAL M . n 
N  14 121 PHE 121 121 121 PHE PHE M . n 
N  14 122 PHE 122 122 122 PHE PHE M . n 
N  14 123 GLU 123 123 123 GLU GLU M . n 
N  14 124 ALA 124 124 124 ALA ALA M . n 
N  14 125 ALA 125 125 125 ALA ALA M . n 
N  14 126 LEU 126 126 126 LEU LEU M . n 
N  14 127 ILE 127 127 127 ILE ILE M . n 
N  14 128 PRO 128 128 128 PRO PRO M . n 
N  14 129 ALA 129 129 129 ALA ALA M . n 
N  14 130 LEU 130 130 130 LEU LEU M . n 
N  14 131 LEU 131 131 131 LEU LEU M . n 
N  14 132 MET 132 132 132 MET MET M . n 
N  14 133 LEU 133 133 133 LEU LEU M . n 
N  14 134 TYR 134 134 134 TYR TYR M . n 
N  14 135 LEU 135 135 135 LEU LEU M . n 
N  14 136 TYR 136 136 136 TYR TYR M . n 
N  14 137 GLY 137 137 137 GLY GLY M . n 
N  14 138 GLY 138 138 138 GLY GLY M . n 
N  14 139 GLU 139 139 139 GLU GLU M . n 
N  14 140 GLY 140 140 140 GLY GLY M . n 
N  14 141 ARG 141 141 141 ARG ARG M . n 
N  14 142 THR 142 142 142 THR THR M . n 
N  14 143 ARG 143 143 143 ARG ARG M . n 
N  14 144 ALA 144 144 144 ALA ALA M . n 
N  14 145 LEU 145 145 145 LEU LEU M . n 
N  14 146 TYR 146 146 146 TYR TYR M . n 
N  14 147 THR 147 147 147 THR THR M . n 
N  14 148 PHE 148 148 148 PHE PHE M . n 
N  14 149 VAL 149 149 149 VAL VAL M . n 
N  14 150 LEU 150 150 150 LEU LEU M . n 
N  14 151 PHE 151 151 151 PHE PHE M . n 
N  14 152 THR 152 152 152 THR THR M . n 
N  14 153 LEU 153 153 153 LEU LEU M . n 
N  14 154 VAL 154 154 154 VAL VAL M . n 
N  14 155 GLY 155 155 155 GLY GLY M . n 
N  14 156 SER 156 156 156 SER SER M . n 
N  14 157 LEU 157 157 157 LEU LEU M . n 
N  14 158 PRO 158 158 158 PRO PRO M . n 
N  14 159 MET 159 159 159 MET MET M . n 
N  14 160 LEU 160 160 160 LEU LEU M . n 
N  14 161 ALA 161 161 161 ALA ALA M . n 
N  14 162 ALA 162 162 162 ALA ALA M . n 
N  14 163 VAL 163 163 163 VAL VAL M . n 
N  14 164 LEU 164 164 164 LEU LEU M . n 
N  14 165 GLY 165 165 165 GLY GLY M . n 
N  14 166 ALA 166 166 166 ALA ALA M . n 
N  14 167 ARG 167 167 167 ARG ARG M . n 
N  14 168 LEU 168 168 168 LEU LEU M . n 
N  14 169 LEU 169 169 169 LEU LEU M . n 
N  14 170 SER 170 170 170 SER SER M . n 
N  14 171 GLY 171 171 171 GLY GLY M . n 
N  14 172 SER 172 172 172 SER SER M . n 
N  14 173 PRO 173 173 173 PRO PRO M . n 
N  14 174 THR 174 174 174 THR THR M . n 
N  14 175 PHE 175 175 175 PHE PHE M . n 
N  14 176 LEU 176 176 176 LEU LEU M . n 
N  14 177 LEU 177 177 177 LEU LEU M . n 
N  14 178 GLU 178 178 178 GLU GLU M . n 
N  14 179 ASP 179 179 179 ASP ASP M . n 
N  14 180 LEU 180 180 180 LEU LEU M . n 
N  14 181 LEU 181 181 181 LEU LEU M . n 
N  14 182 ALA 182 182 182 ALA ALA M . n 
N  14 183 HIS 183 183 183 HIS HIS M . n 
N  14 184 PRO 184 184 184 PRO PRO M . n 
N  14 185 LEU 185 185 185 LEU LEU M . n 
N  14 186 GLN 186 186 186 GLN GLN M . n 
N  14 187 GLU 187 187 187 GLU GLU M . n 
N  14 188 GLU 188 188 188 GLU GLU M . n 
N  14 189 ALA 189 189 189 ALA ALA M . n 
N  14 190 ALA 190 190 190 ALA ALA M . n 
N  14 191 PHE 191 191 191 PHE PHE M . n 
N  14 192 TRP 192 192 192 TRP TRP M . n 
N  14 193 VAL 193 193 193 VAL VAL M . n 
N  14 194 PHE 194 194 194 PHE PHE M . n 
N  14 195 LEU 195 195 195 LEU LEU M . n 
N  14 196 GLY 196 196 196 GLY GLY M . n 
N  14 197 PHE 197 197 197 PHE PHE M . n 
N  14 198 ALA 198 198 198 ALA ALA M . n 
N  14 199 LEU 199 199 199 LEU LEU M . n 
N  14 200 ALA 200 200 200 ALA ALA M . n 
N  14 201 PHE 201 201 201 PHE PHE M . n 
N  14 202 ALA 202 202 202 ALA ALA M . n 
N  14 203 ILE 203 203 203 ILE ILE M . n 
N  14 204 LYS 204 204 204 LYS LYS M . n 
N  14 205 THR 205 205 205 THR THR M . n 
N  14 206 PRO 206 206 206 PRO PRO M . n 
N  14 207 LEU 207 207 207 LEU LEU M . n 
N  14 208 PHE 208 208 208 PHE PHE M . n 
N  14 209 PRO 209 209 209 PRO PRO M . n 
N  14 210 LEU 210 210 210 LEU LEU M . n 
N  14 211 HIS 211 211 211 HIS HIS M . n 
N  14 212 ALA 212 212 212 ALA ALA M . n 
N  14 213 TRP 213 213 213 TRP TRP M . n 
N  14 214 LEU 214 214 214 LEU LEU M . n 
N  14 215 PRO 215 215 215 PRO PRO M . n 
N  14 216 PRO 216 216 216 PRO PRO M . n 
N  14 217 PHE 217 217 217 PHE PHE M . n 
N  14 218 HIS 218 218 218 HIS HIS M . n 
N  14 219 GLN 219 219 219 GLN GLN M . n 
N  14 220 GLU 220 220 220 GLU GLU M . n 
N  14 221 ASN 221 221 221 ASN ASN M . n 
N  14 222 HIS 222 222 222 HIS HIS M . n 
N  14 223 PRO 223 223 223 PRO PRO M . n 
N  14 224 SER 224 224 224 SER SER M . n 
N  14 225 GLY 225 225 225 GLY GLY M . n 
N  14 226 LEU 226 226 226 LEU LEU M . n 
N  14 227 ALA 227 227 227 ALA ALA M . n 
N  14 228 ASP 228 228 228 ASP ASP M . n 
N  14 229 ALA 229 229 229 ALA ALA M . n 
N  14 230 LEU 230 230 230 LEU LEU M . n 
N  14 231 GLY 231 231 231 GLY GLY M . n 
N  14 232 THR 232 232 232 THR THR M . n 
N  14 233 LEU 233 233 233 LEU LEU M . n 
N  14 234 TYR 234 234 234 TYR TYR M . n 
N  14 235 LYS 235 235 235 LYS LYS M . n 
N  14 236 VAL 236 236 236 VAL VAL M . n 
N  14 237 GLY 237 237 237 GLY GLY M . n 
N  14 238 VAL 238 238 238 VAL VAL M . n 
N  14 239 PHE 239 239 239 PHE PHE M . n 
N  14 240 ALA 240 240 240 ALA ALA M . n 
N  14 241 PHE 241 241 241 PHE PHE M . n 
N  14 242 PHE 242 242 242 PHE PHE M . n 
N  14 243 ARG 243 243 243 ARG ARG M . n 
N  14 244 PHE 244 244 244 PHE PHE M . n 
N  14 245 ALA 245 245 245 ALA ALA M . n 
N  14 246 ILE 246 246 246 ILE ILE M . n 
N  14 247 PRO 247 247 247 PRO PRO M . n 
N  14 248 LEU 248 248 248 LEU LEU M . n 
N  14 249 ALA 249 249 249 ALA ALA M . n 
N  14 250 PRO 250 250 250 PRO PRO M . n 
N  14 251 GLU 251 251 251 GLU GLU M . n 
N  14 252 GLY 252 252 252 GLY GLY M . n 
N  14 253 PHE 253 253 253 PHE PHE M . n 
N  14 254 ALA 254 254 254 ALA ALA M . n 
N  14 255 GLN 255 255 255 GLN GLN M . n 
N  14 256 ALA 256 256 256 ALA ALA M . n 
N  14 257 GLN 257 257 257 GLN GLN M . n 
N  14 258 GLY 258 258 258 GLY GLY M . n 
N  14 259 LEU 259 259 259 LEU LEU M . n 
N  14 260 LEU 260 260 260 LEU LEU M . n 
N  14 261 LEU 261 261 261 LEU LEU M . n 
N  14 262 PHE 262 262 262 PHE PHE M . n 
N  14 263 LEU 263 263 263 LEU LEU M . n 
N  14 264 ALA 264 264 264 ALA ALA M . n 
N  14 265 ALA 265 265 265 ALA ALA M . n 
N  14 266 LEU 266 266 266 LEU LEU M . n 
N  14 267 SER 267 267 267 SER SER M . n 
N  14 268 ALA 268 268 268 ALA ALA M . n 
N  14 269 LEU 269 269 269 LEU LEU M . n 
N  14 270 TYR 270 270 270 TYR TYR M . n 
N  14 271 GLY 271 271 271 GLY GLY M . n 
N  14 272 ALA 272 272 272 ALA ALA M . n 
N  14 273 TRP 273 273 273 TRP TRP M . n 
N  14 274 VAL 274 274 274 VAL VAL M . n 
N  14 275 ALA 275 275 275 ALA ALA M . n 
N  14 276 PHE 276 276 276 PHE PHE M . n 
N  14 277 ALA 277 277 277 ALA ALA M . n 
N  14 278 ALA 278 278 278 ALA ALA M . n 
N  14 279 LYS 279 279 279 LYS LYS M . n 
N  14 280 ASP 280 280 280 ASP ASP M . n 
N  14 281 PHE 281 281 281 PHE PHE M . n 
N  14 282 LYS 282 282 282 LYS LYS M . n 
N  14 283 THR 283 283 283 THR THR M . n 
N  14 284 LEU 284 284 284 LEU LEU M . n 
N  14 285 LEU 285 285 285 LEU LEU M . n 
N  14 286 ALA 286 286 286 ALA ALA M . n 
N  14 287 TYR 287 287 287 TYR TYR M . n 
N  14 288 ALA 288 288 288 ALA ALA M . n 
N  14 289 GLY 289 289 289 GLY GLY M . n 
N  14 290 LEU 290 290 290 LEU LEU M . n 
N  14 291 SER 291 291 291 SER SER M . n 
N  14 292 HIS 292 292 292 HIS HIS M . n 
N  14 293 MET 293 293 293 MET MET M . n 
N  14 294 GLY 294 294 294 GLY GLY M . n 
N  14 295 VAL 295 295 295 VAL VAL M . n 
N  14 296 ALA 296 296 296 ALA ALA M . n 
N  14 297 ALA 297 297 297 ALA ALA M . n 
N  14 298 LEU 298 298 298 LEU LEU M . n 
N  14 299 GLY 299 299 299 GLY GLY M . n 
N  14 300 VAL 300 300 300 VAL VAL M . n 
N  14 301 PHE 301 301 301 PHE PHE M . n 
N  14 302 SER 302 302 302 SER SER M . n 
N  14 303 GLY 303 303 303 GLY GLY M . n 
N  14 304 THR 304 304 304 THR THR M . n 
N  14 305 PRO 305 305 305 PRO PRO M . n 
N  14 306 GLU 306 306 306 GLU GLU M . n 
N  14 307 GLY 307 307 307 GLY GLY M . n 
N  14 308 ALA 308 308 308 ALA ALA M . n 
N  14 309 MET 309 309 309 MET MET M . n 
N  14 310 GLY 310 310 310 GLY GLY M . n 
N  14 311 GLY 311 311 311 GLY GLY M . n 
N  14 312 LEU 312 312 312 LEU LEU M . n 
N  14 313 TYR 313 313 313 TYR TYR M . n 
N  14 314 LEU 314 314 314 LEU LEU M . n 
N  14 315 LEU 315 315 315 LEU LEU M . n 
N  14 316 ALA 316 316 316 ALA ALA M . n 
N  14 317 ALA 317 317 317 ALA ALA M . n 
N  14 318 SER 318 318 318 SER SER M . n 
N  14 319 GLY 319 319 319 GLY GLY M . n 
N  14 320 VAL 320 320 320 VAL VAL M . n 
N  14 321 TYR 321 321 321 TYR TYR M . n 
N  14 322 THR 322 322 322 THR THR M . n 
N  14 323 GLY 323 323 323 GLY GLY M . n 
N  14 324 GLY 324 324 324 GLY GLY M . n 
N  14 325 LEU 325 325 325 LEU LEU M . n 
N  14 326 PHE 326 326 326 PHE PHE M . n 
N  14 327 LEU 327 327 327 LEU LEU M . n 
N  14 328 LEU 328 328 328 LEU LEU M . n 
N  14 329 ALA 329 329 329 ALA ALA M . n 
N  14 330 GLY 330 330 330 GLY GLY M . n 
N  14 331 ARG 331 331 331 ARG ARG M . n 
N  14 332 LEU 332 332 332 LEU LEU M . n 
N  14 333 TYR 333 333 333 TYR TYR M . n 
N  14 334 GLU 334 334 334 GLU GLU M . n 
N  14 335 ARG 335 335 335 ARG ARG M . n 
N  14 336 THR 336 336 336 THR THR M . n 
N  14 337 GLY 337 337 337 GLY GLY M . n 
N  14 338 THR 338 338 338 THR THR M . n 
N  14 339 LEU 339 339 339 LEU LEU M . n 
N  14 340 GLU 340 340 340 GLU GLU M . n 
N  14 341 ILE 341 341 341 ILE ILE M . n 
N  14 342 GLY 342 342 342 GLY GLY M . n 
N  14 343 ARG 343 343 343 ARG ARG M . n 
N  14 344 TYR 344 344 344 TYR TYR M . n 
N  14 345 ARG 345 345 345 ARG ARG M . n 
N  14 346 GLY 346 346 346 GLY GLY M . n 
N  14 347 LEU 347 347 347 LEU LEU M . n 
N  14 348 ALA 348 348 348 ALA ALA M . n 
N  14 349 GLN 349 349 349 GLN GLN M . n 
N  14 350 SER 350 350 350 SER SER M . n 
N  14 351 ALA 351 351 351 ALA ALA M . n 
N  14 352 PRO 352 352 352 PRO PRO M . n 
N  14 353 GLY 353 353 353 GLY GLY M . n 
N  14 354 LEU 354 354 354 LEU LEU M . n 
N  14 355 ALA 355 355 355 ALA ALA M . n 
N  14 356 ALA 356 356 356 ALA ALA M . n 
N  14 357 LEU 357 357 357 LEU LEU M . n 
N  14 358 ALA 358 358 358 ALA ALA M . n 
N  14 359 LEU 359 359 359 LEU LEU M . n 
N  14 360 ILE 360 360 360 ILE ILE M . n 
N  14 361 LEU 361 361 361 LEU LEU M . n 
N  14 362 PHE 362 362 362 PHE PHE M . n 
N  14 363 LEU 363 363 363 LEU LEU M . n 
N  14 364 ALA 364 364 364 ALA ALA M . n 
N  14 365 MET 365 365 365 MET MET M . n 
N  14 366 VAL 366 366 366 VAL VAL M . n 
N  14 367 GLY 367 367 367 GLY GLY M . n 
N  14 368 LEU 368 368 368 LEU LEU M . n 
N  14 369 PRO 369 369 369 PRO PRO M . n 
N  14 370 GLY 370 370 370 GLY GLY M . n 
N  14 371 LEU 371 371 371 LEU LEU M . n 
N  14 372 SER 372 372 372 SER SER M . n 
N  14 373 GLY 373 373 373 GLY GLY M . n 
N  14 374 PHE 374 374 374 PHE PHE M . n 
N  14 375 PRO 375 375 375 PRO PRO M . n 
N  14 376 GLY 376 376 376 GLY GLY M . n 
N  14 377 GLU 377 377 377 GLU GLU M . n 
N  14 378 PHE 378 378 378 PHE PHE M . n 
N  14 379 LEU 379 379 379 LEU LEU M . n 
N  14 380 THR 380 380 380 THR THR M . n 
N  14 381 LEU 381 381 381 LEU LEU M . n 
N  14 382 LEU 382 382 382 LEU LEU M . n 
N  14 383 GLY 383 383 383 GLY GLY M . n 
N  14 384 ALA 384 384 384 ALA ALA M . n 
N  14 385 TYR 385 385 385 TYR TYR M . n 
N  14 386 LYS 386 386 386 LYS LYS M . n 
N  14 387 ALA 387 387 387 ALA ALA M . n 
N  14 388 SER 388 388 388 SER SER M . n 
N  14 389 PRO 389 389 389 PRO PRO M . n 
N  14 390 TRP 390 390 390 TRP TRP M . n 
N  14 391 LEU 391 391 391 LEU LEU M . n 
N  14 392 ALA 392 392 392 ALA ALA M . n 
N  14 393 ALA 393 393 393 ALA ALA M . n 
N  14 394 LEU 394 394 394 LEU LEU M . n 
N  14 395 ALA 395 395 395 ALA ALA M . n 
N  14 396 PHE 396 396 396 PHE PHE M . n 
N  14 397 LEU 397 397 397 LEU LEU M . n 
N  14 398 SER 398 398 398 SER SER M . n 
N  14 399 VAL 399 399 399 VAL VAL M . n 
N  14 400 ILE 400 400 400 ILE ILE M . n 
N  14 401 ALA 401 401 401 ALA ALA M . n 
N  14 402 SER 402 402 402 SER SER M . n 
N  14 403 ALA 403 403 403 ALA ALA M . n 
N  14 404 ALA 404 404 404 ALA ALA M . n 
N  14 405 TYR 405 405 405 TYR TYR M . n 
N  14 406 ALA 406 406 406 ALA ALA M . n 
N  14 407 LEU 407 407 407 LEU LEU M . n 
N  14 408 THR 408 408 408 THR THR M . n 
N  14 409 ALA 409 409 409 ALA ALA M . n 
N  14 410 PHE 410 410 410 PHE PHE M . n 
N  14 411 GLN 411 411 411 GLN GLN M . n 
N  14 412 LYS 412 412 412 LYS LYS M . n 
N  14 413 THR 413 413 413 THR THR M . n 
N  14 414 PHE 414 414 414 PHE PHE M . n 
N  14 415 TRP 415 415 415 TRP TRP M . n 
N  14 416 GLU 416 416 416 GLU GLU M . n 
N  14 417 GLU 417 417 417 GLU GLU M . n 
N  14 418 GLY 418 418 418 GLY GLY M . n 
N  14 419 GLY 419 419 419 GLY GLY M . n 
N  14 420 SER 420 420 420 SER SER M . n 
N  14 421 GLY 421 421 421 GLY GLY M . n 
N  14 422 VAL 422 422 422 VAL VAL M . n 
N  14 423 LYS 423 423 423 LYS LYS M . n 
N  14 424 ASP 424 424 424 ASP ASP M . n 
N  14 425 LEU 425 425 425 LEU LEU M . n 
N  14 426 ALA 426 426 426 ALA ALA M . n 
N  14 427 GLY 427 427 427 GLY GLY M . n 
N  14 428 ALA 428 428 428 ALA ALA M . n 
N  14 429 GLU 429 429 429 GLU GLU M . n 
N  14 430 TRP 430 430 430 TRP TRP M . n 
N  14 431 GLY 431 431 431 GLY GLY M . n 
N  14 432 PHE 432 432 432 PHE PHE M . n 
N  14 433 ALA 433 433 433 ALA ALA M . n 
N  14 434 LEU 434 434 434 LEU LEU M . n 
N  14 435 LEU 435 435 435 LEU LEU M . n 
N  14 436 SER 436 436 436 SER SER M . n 
N  14 437 VAL 437 437 437 VAL VAL M . n 
N  14 438 LEU 438 438 438 LEU LEU M . n 
N  14 439 ALA 439 439 439 ALA ALA M . n 
N  14 440 LEU 440 440 440 LEU LEU M . n 
N  14 441 LEU 441 441 441 LEU LEU M . n 
N  14 442 LEU 442 442 442 LEU LEU M . n 
N  14 443 MET 443 443 443 MET MET M . n 
N  14 444 GLY 444 444 444 GLY GLY M . n 
N  14 445 VAL 445 445 445 VAL VAL M . n 
N  14 446 PHE 446 446 446 PHE PHE M . n 
N  14 447 PRO 447 447 447 PRO PRO M . n 
N  14 448 GLY 448 448 448 GLY GLY M . n 
N  14 449 TYR 449 449 449 TYR TYR M . n 
N  14 450 PHE 450 450 450 PHE PHE M . n 
N  14 451 ALA 451 451 451 ALA ALA M . n 
N  14 452 ARG 452 452 452 ARG ARG M . n 
N  14 453 GLY 453 453 453 GLY GLY M . n 
N  14 454 LEU 454 454 454 LEU LEU M . n 
N  14 455 HIS 455 455 455 HIS HIS M . n 
N  14 456 PRO 456 456 456 PRO PRO M . n 
N  14 457 LEU 457 457 457 LEU LEU M . n 
N  14 458 ALA 458 458 458 ALA ALA M . n 
N  14 459 GLU 459 459 459 GLU GLU M . n 
N  14 460 ALA 460 460 460 ALA ALA M . n 
N  14 461 PHE 461 461 461 PHE PHE M . n 
N  14 462 ALA 462 462 462 ALA ALA M . n 
N  14 463 LYS 463 463 463 LYS LYS M . n 
N  14 464 LEU 464 464 464 LEU LEU M . n 
N  14 465 LEU 465 465 465 LEU LEU M . n 
N  14 466 GLY 466 466 466 GLY GLY M . n 
N  14 467 GLY 467 467 467 GLY GLY M . n 
N  14 468 GLY 468 468 ?   ?   ?   M . n 
N  14 469 ALA 469 469 ?   ?   ?   M . n 
O  15 1   MET 1   1   1   MET MET N . n 
O  15 2   THR 2   2   2   THR THR N . n 
O  15 3   LEU 3   3   3   LEU LEU N . n 
O  15 4   ALA 4   4   4   ALA ALA N . n 
O  15 5   ILE 5   5   5   ILE ILE N . n 
O  15 6   LEU 6   6   6   LEU LEU N . n 
O  15 7   ALA 7   7   7   ALA ALA N . n 
O  15 8   VAL 8   8   8   VAL VAL N . n 
O  15 9   PHE 9   9   9   PHE PHE N . n 
O  15 10  SER 10  10  10  SER SER N . n 
O  15 11  VAL 11  11  11  VAL VAL N . n 
O  15 12  ALA 12  12  12  ALA ALA N . n 
O  15 13  LEU 13  13  13  LEU LEU N . n 
O  15 14  THR 14  14  14  THR THR N . n 
O  15 15  LEU 15  15  15  LEU LEU N . n 
O  15 16  LEU 16  16  16  LEU LEU N . n 
O  15 17  GLY 17  17  17  GLY GLY N . n 
O  15 18  PHE 18  18  18  PHE PHE N . n 
O  15 19  VAL 19  19  19  VAL VAL N . n 
O  15 20  LEU 20  20  20  LEU LEU N . n 
O  15 21  PRO 21  21  21  PRO PRO N . n 
O  15 22  PRO 22  22  22  PRO PRO N . n 
O  15 23  GLN 23  23  23  GLN GLN N . n 
O  15 24  GLY 24  24  24  GLY GLY N . n 
O  15 25  VAL 25  25  25  VAL VAL N . n 
O  15 26  LYS 26  26  26  LYS LYS N . n 
O  15 27  ARG 27  27  27  ARG ARG N . n 
O  15 28  ALA 28  28  28  ALA ALA N . n 
O  15 29  THR 29  29  29  THR THR N . n 
O  15 30  LEU 30  30  30  LEU LEU N . n 
O  15 31  LEU 31  31  31  LEU LEU N . n 
O  15 32  GLY 32  32  32  GLY GLY N . n 
O  15 33  LEU 33  33  33  LEU LEU N . n 
O  15 34  ALA 34  34  34  ALA ALA N . n 
O  15 35  LEU 35  35  35  LEU LEU N . n 
O  15 36  ALA 36  36  36  ALA ALA N . n 
O  15 37  LEU 37  37  37  LEU LEU N . n 
O  15 38  ALA 38  38  38  ALA ALA N . n 
O  15 39  SER 39  39  39  SER SER N . n 
O  15 40  LEU 40  40  40  LEU LEU N . n 
O  15 41  LEU 41  41  41  LEU LEU N . n 
O  15 42  LEU 42  42  42  LEU LEU N . n 
O  15 43  THR 43  43  43  THR THR N . n 
O  15 44  TRP 44  44  44  TRP TRP N . n 
O  15 45  GLY 45  45  45  GLY GLY N . n 
O  15 46  LYS 46  46  46  LYS LYS N . n 
O  15 47  PRO 47  47  47  PRO PRO N . n 
O  15 48  PHE 48  48  48  PHE PHE N . n 
O  15 49  ALA 49  49  49  ALA ALA N . n 
O  15 50  PHE 50  50  50  PHE PHE N . n 
O  15 51  GLY 51  51  51  GLY GLY N . n 
O  15 52  PRO 52  52  52  PRO PRO N . n 
O  15 53  TYR 53  53  53  TYR TYR N . n 
O  15 54  ALA 54  54  54  ALA ALA N . n 
O  15 55  VAL 55  55  55  VAL VAL N . n 
O  15 56  ASP 56  56  56  ASP ASP N . n 
O  15 57  GLY 57  57  57  GLY GLY N . n 
O  15 58  VAL 58  58  58  VAL VAL N . n 
O  15 59  SER 59  59  59  SER SER N . n 
O  15 60  GLN 60  60  60  GLN GLN N . n 
O  15 61  VAL 61  61  61  VAL VAL N . n 
O  15 62  PHE 62  62  62  PHE PHE N . n 
O  15 63  THR 63  63  63  THR THR N . n 
O  15 64  LEU 64  64  64  LEU LEU N . n 
O  15 65  LEU 65  65  65  LEU LEU N . n 
O  15 66  ALA 66  66  66  ALA ALA N . n 
O  15 67  LEU 67  67  67  LEU LEU N . n 
O  15 68  LEU 68  68  68  LEU LEU N . n 
O  15 69  GLY 69  69  69  GLY GLY N . n 
O  15 70  ALA 70  70  70  ALA ALA N . n 
O  15 71  LEU 71  71  71  LEU LEU N . n 
O  15 72  TRP 72  72  72  TRP TRP N . n 
O  15 73  THR 73  73  73  THR THR N . n 
O  15 74  VAL 74  74  74  VAL VAL N . n 
O  15 75  GLY 75  75  75  GLY GLY N . n 
O  15 76  LEU 76  76  76  LEU LEU N . n 
O  15 77  VAL 77  77  77  VAL VAL N . n 
O  15 78  ARG 78  78  78  ARG ARG N . n 
O  15 79  SER 79  79  79  SER SER N . n 
O  15 80  GLY 80  80  80  GLY GLY N . n 
O  15 81  ARG 81  81  81  ARG ARG N . n 
O  15 82  PHE 82  82  82  PHE PHE N . n 
O  15 83  GLU 83  83  83  GLU GLU N . n 
O  15 84  PHE 84  84  84  PHE PHE N . n 
O  15 85  TYR 85  85  85  TYR TYR N . n 
O  15 86  LEU 86  86  86  LEU LEU N . n 
O  15 87  LEU 87  87  87  LEU LEU N . n 
O  15 88  VAL 88  88  88  VAL VAL N . n 
O  15 89  LEU 89  89  89  LEU LEU N . n 
O  15 90  TYR 90  90  90  TYR TYR N . n 
O  15 91  ALA 91  91  91  ALA ALA N . n 
O  15 92  ALA 92  92  92  ALA ALA N . n 
O  15 93  LEU 93  93  93  LEU LEU N . n 
O  15 94  GLY 94  94  94  GLY GLY N . n 
O  15 95  MET 95  95  95  MET MET N . n 
O  15 96  HIS 96  96  96  HIS HIS N . n 
O  15 97  LEU 97  97  97  LEU LEU N . n 
O  15 98  LEU 98  98  98  LEU LEU N . n 
O  15 99  ALA 99  99  99  ALA ALA N . n 
O  15 100 SER 100 100 100 SER SER N . n 
O  15 101 THR 101 101 101 THR THR N . n 
O  15 102 ARG 102 102 102 ARG ARG N . n 
O  15 103 HIS 103 103 103 HIS HIS N . n 
O  15 104 LEU 104 104 104 LEU LEU N . n 
O  15 105 LEU 105 105 105 LEU LEU N . n 
O  15 106 LEU 106 106 106 LEU LEU N . n 
O  15 107 MET 107 107 107 MET MET N . n 
O  15 108 LEU 108 108 108 LEU LEU N . n 
O  15 109 VAL 109 109 109 VAL VAL N . n 
O  15 110 ALA 110 110 110 ALA ALA N . n 
O  15 111 LEU 111 111 111 LEU LEU N . n 
O  15 112 GLU 112 112 112 GLU GLU N . n 
O  15 113 ALA 113 113 113 ALA ALA N . n 
O  15 114 LEU 114 114 114 LEU LEU N . n 
O  15 115 SER 115 115 115 SER SER N . n 
O  15 116 LEU 116 116 116 LEU LEU N . n 
O  15 117 PRO 117 117 117 PRO PRO N . n 
O  15 118 LEU 118 118 118 LEU LEU N . n 
O  15 119 TYR 119 119 119 TYR TYR N . n 
O  15 120 ALA 120 120 120 ALA ALA N . n 
O  15 121 LEU 121 121 121 LEU LEU N . n 
O  15 122 ALA 122 122 122 ALA ALA N . n 
O  15 123 THR 123 123 123 THR THR N . n 
O  15 124 TRP 124 124 124 TRP TRP N . n 
O  15 125 ARG 125 125 125 ARG ARG N . n 
O  15 126 ARG 126 126 126 ARG ARG N . n 
O  15 127 GLY 127 127 127 GLY GLY N . n 
O  15 128 GLN 128 128 128 GLN GLN N . n 
O  15 129 GLY 129 129 129 GLY GLY N . n 
O  15 130 LEU 130 130 130 LEU LEU N . n 
O  15 131 GLU 131 131 131 GLU GLU N . n 
O  15 132 ALA 132 132 132 ALA ALA N . n 
O  15 133 ALA 133 133 133 ALA ALA N . n 
O  15 134 LEU 134 134 134 LEU LEU N . n 
O  15 135 LYS 135 135 135 LYS LYS N . n 
O  15 136 TYR 136 136 136 TYR TYR N . n 
O  15 137 PHE 137 137 137 PHE PHE N . n 
O  15 138 LEU 138 138 138 LEU LEU N . n 
O  15 139 LEU 139 139 139 LEU LEU N . n 
O  15 140 GLY 140 140 140 GLY GLY N . n 
O  15 141 ALA 141 141 141 ALA ALA N . n 
O  15 142 LEU 142 142 142 LEU LEU N . n 
O  15 143 ALA 143 143 143 ALA ALA N . n 
O  15 144 ALA 144 144 144 ALA ALA N . n 
O  15 145 ALA 145 145 145 ALA ALA N . n 
O  15 146 PHE 146 146 146 PHE PHE N . n 
O  15 147 PHE 147 147 147 PHE PHE N . n 
O  15 148 LEU 148 148 148 LEU LEU N . n 
O  15 149 TYR 149 149 149 TYR TYR N . n 
O  15 150 GLY 150 150 150 GLY GLY N . n 
O  15 151 ALA 151 151 151 ALA ALA N . n 
O  15 152 ALA 152 152 152 ALA ALA N . n 
O  15 153 LEU 153 153 153 LEU LEU N . n 
O  15 154 PHE 154 154 154 PHE PHE N . n 
O  15 155 TYR 155 155 155 TYR TYR N . n 
O  15 156 GLY 156 156 156 GLY GLY N . n 
O  15 157 ALA 157 157 157 ALA ALA N . n 
O  15 158 THR 158 158 158 THR THR N . n 
O  15 159 GLY 159 159 159 GLY GLY N . n 
O  15 160 SER 160 160 160 SER SER N . n 
O  15 161 LEU 161 161 161 LEU LEU N . n 
O  15 162 VAL 162 162 162 VAL VAL N . n 
O  15 163 LEU 163 163 163 LEU LEU N . n 
O  15 164 GLY 164 164 164 GLY GLY N . n 
O  15 165 ALA 165 165 165 ALA ALA N . n 
O  15 166 PRO 166 166 166 PRO PRO N . n 
O  15 167 GLY 167 167 167 GLY GLY N . n 
O  15 168 GLU 168 168 168 GLU GLU N . n 
O  15 169 GLY 169 169 169 GLY GLY N . n 
O  15 170 PRO 170 170 170 PRO PRO N . n 
O  15 171 LEU 171 171 171 LEU LEU N . n 
O  15 172 TYR 172 172 172 TYR TYR N . n 
O  15 173 ALA 173 173 173 ALA ALA N . n 
O  15 174 LEU 174 174 174 LEU LEU N . n 
O  15 175 ALA 175 175 175 ALA ALA N . n 
O  15 176 LEU 176 176 176 LEU LEU N . n 
O  15 177 GLY 177 177 177 GLY GLY N . n 
O  15 178 LEU 178 178 178 LEU LEU N . n 
O  15 179 LEU 179 179 179 LEU LEU N . n 
O  15 180 LEU 180 180 180 LEU LEU N . n 
O  15 181 VAL 181 181 181 VAL VAL N . n 
O  15 182 GLY 182 182 182 GLY GLY N . n 
O  15 183 LEU 183 183 183 LEU LEU N . n 
O  15 184 GLY 184 184 184 GLY GLY N . n 
O  15 185 PHE 185 185 185 PHE PHE N . n 
O  15 186 LYS 186 186 186 LYS LYS N . n 
O  15 187 ALA 187 187 187 ALA ALA N . n 
O  15 188 ALA 188 188 188 ALA ALA N . n 
O  15 189 LEU 189 189 189 LEU LEU N . n 
O  15 190 ALA 190 190 190 ALA ALA N . n 
O  15 191 PRO 191 191 191 PRO PRO N . n 
O  15 192 PHE 192 192 192 PHE PHE N . n 
O  15 193 HIS 193 193 193 HIS HIS N . n 
O  15 194 PHE 194 194 194 PHE PHE N . n 
O  15 195 TRP 195 195 195 TRP TRP N . n 
O  15 196 THR 196 196 196 THR THR N . n 
O  15 197 PRO 197 197 197 PRO PRO N . n 
O  15 198 ASP 198 198 198 ASP ASP N . n 
O  15 199 VAL 199 199 199 VAL VAL N . n 
O  15 200 TYR 200 200 200 TYR TYR N . n 
O  15 201 GLN 201 201 201 GLN GLN N . n 
O  15 202 GLY 202 202 202 GLY GLY N . n 
O  15 203 SER 203 203 203 SER SER N . n 
O  15 204 PRO 204 204 204 PRO PRO N . n 
O  15 205 THR 205 205 205 THR THR N . n 
O  15 206 PRO 206 206 206 PRO PRO N . n 
O  15 207 VAL 207 207 207 VAL VAL N . n 
O  15 208 VAL 208 208 208 VAL VAL N . n 
O  15 209 LEU 209 209 209 LEU LEU N . n 
O  15 210 PHE 210 210 210 PHE PHE N . n 
O  15 211 MET 211 211 211 MET MET N . n 
O  15 212 ALA 212 212 212 ALA ALA N . n 
O  15 213 THR 213 213 213 THR THR N . n 
O  15 214 SER 214 214 214 SER SER N . n 
O  15 215 VAL 215 215 215 VAL VAL N . n 
O  15 216 LYS 216 216 216 LYS LYS N . n 
O  15 217 ALA 217 217 217 ALA ALA N . n 
O  15 218 ALA 218 218 218 ALA ALA N . n 
O  15 219 ALA 219 219 219 ALA ALA N . n 
O  15 220 PHE 220 220 220 PHE PHE N . n 
O  15 221 ALA 221 221 221 ALA ALA N . n 
O  15 222 ALA 222 222 222 ALA ALA N . n 
O  15 223 LEU 223 223 223 LEU LEU N . n 
O  15 224 LEU 224 224 224 LEU LEU N . n 
O  15 225 ARG 225 225 225 ARG ARG N . n 
O  15 226 VAL 226 226 226 VAL VAL N . n 
O  15 227 ALA 227 227 227 ALA ALA N . n 
O  15 228 ALA 228 228 228 ALA ALA N . n 
O  15 229 PRO 229 229 229 PRO PRO N . n 
O  15 230 PRO 230 230 230 PRO PRO N . n 
O  15 231 GLU 231 231 231 GLU GLU N . n 
O  15 232 ALA 232 232 232 ALA ALA N . n 
O  15 233 LEU 233 233 233 LEU LEU N . n 
O  15 234 ALA 234 234 234 ALA ALA N . n 
O  15 235 LEU 235 235 235 LEU LEU N . n 
O  15 236 LEU 236 236 236 LEU LEU N . n 
O  15 237 VAL 237 237 237 VAL VAL N . n 
O  15 238 ALA 238 238 238 ALA ALA N . n 
O  15 239 LEU 239 239 239 LEU LEU N . n 
O  15 240 SER 240 240 240 SER SER N . n 
O  15 241 VAL 241 241 241 VAL VAL N . n 
O  15 242 VAL 242 242 242 VAL VAL N . n 
O  15 243 VAL 243 243 243 VAL VAL N . n 
O  15 244 GLY 244 244 244 GLY GLY N . n 
O  15 245 ASN 245 245 245 ASN ASN N . n 
O  15 246 LEU 246 246 246 LEU LEU N . n 
O  15 247 ALA 247 247 247 ALA ALA N . n 
O  15 248 ALA 248 248 248 ALA ALA N . n 
O  15 249 LEU 249 249 249 LEU LEU N . n 
O  15 250 ALA 250 250 250 ALA ALA N . n 
O  15 251 GLN 251 251 251 GLN GLN N . n 
O  15 252 LYS 252 252 252 LYS LYS N . n 
O  15 253 GLU 253 253 253 GLU GLU N . n 
O  15 254 ALA 254 254 254 ALA ALA N . n 
O  15 255 LYS 255 255 255 LYS LYS N . n 
O  15 256 ARG 256 256 256 ARG ARG N . n 
O  15 257 LEU 257 257 257 LEU LEU N . n 
O  15 258 LEU 258 258 258 LEU LEU N . n 
O  15 259 ALA 259 259 259 ALA ALA N . n 
O  15 260 TYR 260 260 260 TYR TYR N . n 
O  15 261 SER 261 261 261 SER SER N . n 
O  15 262 SER 262 262 262 SER SER N . n 
O  15 263 ILE 263 263 263 ILE ILE N . n 
O  15 264 ALA 264 264 264 ALA ALA N . n 
O  15 265 HIS 265 265 265 HIS HIS N . n 
O  15 266 ALA 266 266 266 ALA ALA N . n 
O  15 267 GLY 267 267 267 GLY GLY N . n 
O  15 268 TYR 268 268 268 TYR TYR N . n 
O  15 269 MET 269 269 269 MET MET N . n 
O  15 270 ALA 270 270 270 ALA ALA N . n 
O  15 271 LEU 271 271 271 LEU LEU N . n 
O  15 272 ALA 272 272 272 ALA ALA N . n 
O  15 273 LEU 273 273 273 LEU LEU N . n 
O  15 274 TYR 274 274 274 TYR TYR N . n 
O  15 275 THR 275 275 275 THR THR N . n 
O  15 276 GLY 276 276 276 GLY GLY N . n 
O  15 277 ASN 277 277 277 ASN ASN N . n 
O  15 278 ALA 278 278 278 ALA ALA N . n 
O  15 279 GLN 279 279 279 GLN GLN N . n 
O  15 280 ALA 280 280 280 ALA ALA N . n 
O  15 281 LEU 281 281 281 LEU LEU N . n 
O  15 282 GLY 282 282 282 GLY GLY N . n 
O  15 283 PHE 283 283 283 PHE PHE N . n 
O  15 284 TYR 284 284 284 TYR TYR N . n 
O  15 285 LEU 285 285 285 LEU LEU N . n 
O  15 286 LEU 286 286 286 LEU LEU N . n 
O  15 287 THR 287 287 287 THR THR N . n 
O  15 288 TYR 288 288 288 TYR TYR N . n 
O  15 289 VAL 289 289 289 VAL VAL N . n 
O  15 290 LEU 290 290 290 LEU LEU N . n 
O  15 291 ALA 291 291 291 ALA ALA N . n 
O  15 292 THR 292 292 292 THR THR N . n 
O  15 293 GLY 293 293 293 GLY GLY N . n 
O  15 294 LEU 294 294 294 LEU LEU N . n 
O  15 295 ALA 295 295 295 ALA ALA N . n 
O  15 296 PHE 296 296 296 PHE PHE N . n 
O  15 297 ALA 297 297 297 ALA ALA N . n 
O  15 298 VAL 298 298 298 VAL VAL N . n 
O  15 299 LEU 299 299 299 LEU LEU N . n 
O  15 300 SER 300 300 300 SER SER N . n 
O  15 301 GLN 301 301 301 GLN GLN N . n 
O  15 302 ILE 302 302 302 ILE ILE N . n 
O  15 303 SER 303 303 303 SER SER N . n 
O  15 304 PRO 304 304 304 PRO PRO N . n 
O  15 305 ASP 305 305 305 ASP ASP N . n 
O  15 306 ARG 306 306 306 ARG ARG N . n 
O  15 307 VAL 307 307 307 VAL VAL N . n 
O  15 308 PRO 308 308 308 PRO PRO N . n 
O  15 309 LEU 309 309 309 LEU LEU N . n 
O  15 310 GLU 310 310 310 GLU GLU N . n 
O  15 311 ALA 311 311 311 ALA ALA N . n 
O  15 312 LEU 312 312 312 LEU LEU N . n 
O  15 313 ARG 313 313 313 ARG ARG N . n 
O  15 314 GLY 314 314 314 GLY GLY N . n 
O  15 315 LEU 315 315 315 LEU LEU N . n 
O  15 316 TYR 316 316 316 TYR TYR N . n 
O  15 317 ARG 317 317 317 ARG ARG N . n 
O  15 318 LYS 318 318 318 LYS LYS N . n 
O  15 319 ASP 319 319 319 ASP ASP N . n 
O  15 320 PRO 320 320 320 PRO PRO N . n 
O  15 321 LEU 321 321 321 LEU LEU N . n 
O  15 322 LEU 322 322 322 LEU LEU N . n 
O  15 323 GLY 323 323 323 GLY GLY N . n 
O  15 324 LEU 324 324 324 LEU LEU N . n 
O  15 325 ALA 325 325 325 ALA ALA N . n 
O  15 326 PHE 326 326 326 PHE PHE N . n 
O  15 327 LEU 327 327 327 LEU LEU N . n 
O  15 328 VAL 328 328 328 VAL VAL N . n 
O  15 329 ALA 329 329 329 ALA ALA N . n 
O  15 330 MET 330 330 330 MET MET N . n 
O  15 331 LEU 331 331 331 LEU LEU N . n 
O  15 332 SER 332 332 332 SER SER N . n 
O  15 333 LEU 333 333 333 LEU LEU N . n 
O  15 334 LEU 334 334 334 LEU LEU N . n 
O  15 335 GLY 335 335 335 GLY GLY N . n 
O  15 336 LEU 336 336 336 LEU LEU N . n 
O  15 337 PRO 337 337 337 PRO PRO N . n 
O  15 338 PRO 338 338 338 PRO PRO N . n 
O  15 339 LEU 339 339 339 LEU LEU N . n 
O  15 340 ALA 340 340 340 ALA ALA N . n 
O  15 341 GLY 341 341 341 GLY GLY N . n 
O  15 342 PHE 342 342 342 PHE PHE N . n 
O  15 343 TRP 343 343 343 TRP TRP N . n 
O  15 344 GLY 344 344 344 GLY GLY N . n 
O  15 345 LYS 345 345 345 LYS LYS N . n 
O  15 346 TYR 346 346 346 TYR TYR N . n 
O  15 347 LEU 347 347 347 LEU LEU N . n 
O  15 348 ALA 348 348 348 ALA ALA N . n 
O  15 349 PHE 349 349 349 PHE PHE N . n 
O  15 350 ALA 350 350 350 ALA ALA N . n 
O  15 351 GLU 351 351 351 GLU GLU N . n 
O  15 352 ALA 352 352 352 ALA ALA N . n 
O  15 353 ALA 353 353 353 ALA ALA N . n 
O  15 354 ARG 354 354 354 ARG ARG N . n 
O  15 355 ALA 355 355 355 ALA ALA N . n 
O  15 356 GLY 356 356 356 GLY GLY N . n 
O  15 357 ALA 357 357 357 ALA ALA N . n 
O  15 358 TRP 358 358 358 TRP TRP N . n 
O  15 359 GLY 359 359 359 GLY GLY N . n 
O  15 360 VAL 360 360 360 VAL VAL N . n 
O  15 361 LEU 361 361 361 LEU LEU N . n 
O  15 362 VAL 362 362 362 VAL VAL N . n 
O  15 363 LEU 363 363 363 LEU LEU N . n 
O  15 364 ALA 364 364 364 ALA ALA N . n 
O  15 365 LEU 365 365 365 LEU LEU N . n 
O  15 366 VAL 366 366 366 VAL VAL N . n 
O  15 367 THR 367 367 367 THR THR N . n 
O  15 368 SER 368 368 368 SER SER N . n 
O  15 369 ALA 369 369 369 ALA ALA N . n 
O  15 370 VAL 370 370 370 VAL VAL N . n 
O  15 371 SER 371 371 371 SER SER N . n 
O  15 372 ALA 372 372 372 ALA ALA N . n 
O  15 373 TYR 373 373 373 TYR TYR N . n 
O  15 374 TYR 374 374 374 TYR TYR N . n 
O  15 375 TYR 375 375 375 TYR TYR N . n 
O  15 376 LEU 376 376 376 LEU LEU N . n 
O  15 377 GLY 377 377 377 GLY GLY N . n 
O  15 378 LEU 378 378 378 LEU LEU N . n 
O  15 379 GLY 379 379 379 GLY GLY N . n 
O  15 380 LEU 380 380 380 LEU LEU N . n 
O  15 381 ALA 381 381 381 ALA ALA N . n 
O  15 382 VAL 382 382 382 VAL VAL N . n 
O  15 383 PHE 383 383 383 PHE PHE N . n 
O  15 384 ALA 384 384 384 ALA ALA N . n 
O  15 385 ARG 385 385 385 ARG ARG N . n 
O  15 386 PRO 386 386 386 PRO PRO N . n 
O  15 387 GLU 387 387 387 GLU GLU N . n 
O  15 388 GLU 388 388 388 GLU GLU N . n 
O  15 389 THR 389 389 389 THR THR N . n 
O  15 390 PRO 390 390 390 PRO PRO N . n 
O  15 391 PHE 391 391 391 PHE PHE N . n 
O  15 392 ARG 392 392 392 ARG ARG N . n 
O  15 393 PRO 393 393 393 PRO PRO N . n 
O  15 394 GLY 394 394 394 GLY GLY N . n 
O  15 395 PRO 395 395 395 PRO PRO N . n 
O  15 396 PRO 396 396 396 PRO PRO N . n 
O  15 397 TRP 397 397 397 TRP TRP N . n 
O  15 398 ALA 398 398 398 ALA ALA N . n 
O  15 399 ARG 399 399 399 ARG ARG N . n 
O  15 400 ALA 400 400 400 ALA ALA N . n 
O  15 401 ALA 401 401 401 ALA ALA N . n 
O  15 402 VAL 402 402 402 VAL VAL N . n 
O  15 403 VAL 403 403 403 VAL VAL N . n 
O  15 404 ALA 404 404 404 ALA ALA N . n 
O  15 405 ALA 405 405 405 ALA ALA N . n 
O  15 406 GLY 406 406 406 GLY GLY N . n 
O  15 407 VAL 407 407 407 VAL VAL N . n 
O  15 408 LEU 408 408 408 LEU LEU N . n 
O  15 409 LEU 409 409 409 LEU LEU N . n 
O  15 410 LEU 410 410 410 LEU LEU N . n 
O  15 411 ALA 411 411 411 ALA ALA N . n 
O  15 412 LEU 412 412 412 LEU LEU N . n 
O  15 413 GLY 413 413 413 GLY GLY N . n 
O  15 414 LEU 414 414 414 LEU LEU N . n 
O  15 415 LEU 415 415 415 LEU LEU N . n 
O  15 416 PRO 416 416 416 PRO PRO N . n 
O  15 417 GLY 417 417 417 GLY GLY N . n 
O  15 418 LEU 418 418 418 LEU LEU N . n 
O  15 419 VAL 419 419 419 VAL VAL N . n 
O  15 420 LEU 420 420 420 LEU LEU N . n 
O  15 421 PRO 421 421 421 PRO PRO N . n 
O  15 422 ALA 422 422 422 ALA ALA N . n 
O  15 423 LEU 423 423 423 LEU LEU N . n 
O  15 424 ALA 424 424 424 ALA ALA N . n 
O  15 425 ALA 425 425 425 ALA ALA N . n 
O  15 426 GLY 426 426 426 GLY GLY N . n 
O  15 427 GLY 427 427 427 GLY GLY N . n 
P  16 1   MET 1   1   ?   ?   ?   H . n 
P  16 2   THR 2   2   2   THR THR H . n 
P  16 3   TRP 3   3   3   TRP TRP H . n 
P  16 4   SER 4   4   4   SER SER H . n 
P  16 5   TYR 5   5   5   TYR TYR H . n 
P  16 6   PRO 6   6   6   PRO PRO H . n 
P  16 7   VAL 7   7   7   VAL VAL H . n 
P  16 8   ASP 8   8   8   ASP ASP H . n 
P  16 9   PRO 9   9   9   PRO PRO H . n 
P  16 10  TYR 10  10  10  TYR TYR H . n 
P  16 11  TRP 11  11  11  TRP TRP H . n 
P  16 12  MET 12  12  12  MET MET H . n 
P  16 13  VAL 13  13  13  VAL VAL H . n 
P  16 14  ALA 14  14  14  ALA ALA H . n 
P  16 15  LEU 15  15  15  LEU LEU H . n 
P  16 16  LYS 16  16  16  LYS LYS H . n 
P  16 17  ALA 17  17  17  ALA ALA H . n 
P  16 18  LEU 18  18  18  LEU LEU H . n 
P  16 19  LEU 19  19  19  LEU LEU H . n 
P  16 20  VAL 20  20  20  VAL VAL H . n 
P  16 21  VAL 21  21  21  VAL VAL H . n 
P  16 22  VAL 22  22  22  VAL VAL H . n 
P  16 23  GLY 23  23  23  GLY GLY H . n 
P  16 24  LEU 24  24  24  LEU LEU H . n 
P  16 25  LEU 25  25  25  LEU LEU H . n 
P  16 26  THR 26  26  26  THR THR H . n 
P  16 27  ALA 27  27  27  ALA ALA H . n 
P  16 28  PHE 28  28  28  PHE PHE H . n 
P  16 29  ALA 29  29  29  ALA ALA H . n 
P  16 30  PHE 30  30  30  PHE PHE H . n 
P  16 31  MET 31  31  31  MET MET H . n 
P  16 32  THR 32  32  32  THR THR H . n 
P  16 33  LEU 33  33  33  LEU LEU H . n 
P  16 34  ILE 34  34  34  ILE ILE H . n 
P  16 35  GLU 35  35  35  GLU GLU H . n 
P  16 36  ARG 36  36  36  ARG ARG H . n 
P  16 37  ARG 37  37  37  ARG ARG H . n 
P  16 38  LEU 38  38  38  LEU LEU H . n 
P  16 39  LEU 39  39  39  LEU LEU H . n 
P  16 40  ALA 40  40  40  ALA ALA H . n 
P  16 41  ARG 41  41  41  ARG ARG H . n 
P  16 42  PHE 42  42  42  PHE PHE H . n 
P  16 43  GLN 43  43  43  GLN GLN H . n 
P  16 44  VAL 44  44  44  VAL VAL H . n 
P  16 45  ARG 45  45  45  ARG ARG H . n 
P  16 46  MET 46  46  46  MET MET H . n 
P  16 47  GLY 47  47  47  GLY GLY H . n 
P  16 48  PRO 48  48  48  PRO PRO H . n 
P  16 49  ASN 49  49  49  ASN ASN H . n 
P  16 50  ARG 50  50  50  ARG ARG H . n 
P  16 51  VAL 51  51  51  VAL VAL H . n 
P  16 52  GLY 52  52  52  GLY GLY H . n 
P  16 53  PRO 53  53  53  PRO PRO H . n 
P  16 54  PHE 54  54  54  PHE PHE H . n 
P  16 55  GLY 55  55  55  GLY GLY H . n 
P  16 56  LEU 56  56  56  LEU LEU H . n 
P  16 57  LEU 57  57  57  LEU LEU H . n 
P  16 58  GLN 58  58  58  GLN GLN H . n 
P  16 59  PRO 59  59  59  PRO PRO H . n 
P  16 60  LEU 60  60  60  LEU LEU H . n 
P  16 61  ALA 61  61  61  ALA ALA H . n 
P  16 62  ASP 62  62  62  ASP ASP H . n 
P  16 63  ALA 63  63  63  ALA ALA H . n 
P  16 64  ILE 64  64  64  ILE ILE H . n 
P  16 65  LYS 65  65  65  LYS LYS H . n 
P  16 66  SER 66  66  66  SER SER H . n 
P  16 67  ILE 67  67  67  ILE ILE H . n 
P  16 68  PHE 68  68  68  PHE PHE H . n 
P  16 69  LYS 69  69  69  LYS LYS H . n 
P  16 70  GLU 70  70  70  GLU GLU H . n 
P  16 71  ASP 71  71  71  ASP ASP H . n 
P  16 72  ILE 72  72  72  ILE ILE H . n 
P  16 73  VAL 73  73  73  VAL VAL H . n 
P  16 74  VAL 74  74  74  VAL VAL H . n 
P  16 75  ALA 75  75  75  ALA ALA H . n 
P  16 76  GLN 76  76  76  GLN GLN H . n 
P  16 77  ALA 77  77  77  ALA ALA H . n 
P  16 78  ASP 78  78  78  ASP ASP H . n 
P  16 79  ARG 79  79  79  ARG ARG H . n 
P  16 80  PHE 80  80  80  PHE PHE H . n 
P  16 81  LEU 81  81  81  LEU LEU H . n 
P  16 82  PHE 82  82  82  PHE PHE H . n 
P  16 83  VAL 83  83  83  VAL VAL H . n 
P  16 84  LEU 84  84  84  LEU LEU H . n 
P  16 85  ALA 85  85  85  ALA ALA H . n 
P  16 86  PRO 86  86  86  PRO PRO H . n 
P  16 87  LEU 87  87  87  LEU LEU H . n 
P  16 88  ILE 88  88  88  ILE ILE H . n 
P  16 89  SER 89  89  89  SER SER H . n 
P  16 90  VAL 90  90  90  VAL VAL H . n 
P  16 91  VAL 91  91  91  VAL VAL H . n 
P  16 92  PHE 92  92  92  PHE PHE H . n 
P  16 93  ALA 93  93  93  ALA ALA H . n 
P  16 94  LEU 94  94  94  LEU LEU H . n 
P  16 95  LEU 95  95  95  LEU LEU H . n 
P  16 96  ALA 96  96  96  ALA ALA H . n 
P  16 97  PHE 97  97  97  PHE PHE H . n 
P  16 98  GLY 98  98  98  GLY GLY H . n 
P  16 99  LEU 99  99  99  LEU LEU H . n 
P  16 100 ILE 100 100 100 ILE ILE H . n 
P  16 101 PRO 101 101 101 PRO PRO H . n 
P  16 102 PHE 102 102 102 PHE PHE H . n 
P  16 103 GLY 103 103 103 GLY GLY H . n 
P  16 104 PRO 104 104 104 PRO PRO H . n 
P  16 105 PRO 105 105 105 PRO PRO H . n 
P  16 106 GLY 106 106 106 GLY GLY H . n 
P  16 107 SER 107 107 107 SER SER H . n 
P  16 108 PHE 108 108 108 PHE PHE H . n 
P  16 109 PHE 109 109 109 PHE PHE H . n 
P  16 110 GLY 110 110 110 GLY GLY H . n 
P  16 111 TYR 111 111 111 TYR TYR H . n 
P  16 112 GLN 112 112 112 GLN GLN H . n 
P  16 113 PRO 113 113 113 PRO PRO H . n 
P  16 114 TRP 114 114 114 TRP TRP H . n 
P  16 115 VAL 115 115 115 VAL VAL H . n 
P  16 116 ILE 116 116 116 ILE ILE H . n 
P  16 117 ASN 117 117 117 ASN ASN H . n 
P  16 118 LEU 118 118 118 LEU LEU H . n 
P  16 119 ASP 119 119 119 ASP ASP H . n 
P  16 120 LEU 120 120 120 LEU LEU H . n 
P  16 121 GLY 121 121 121 GLY GLY H . n 
P  16 122 ILE 122 122 122 ILE ILE H . n 
P  16 123 LEU 123 123 123 LEU LEU H . n 
P  16 124 TYR 124 124 124 TYR TYR H . n 
P  16 125 LEU 125 125 125 LEU LEU H . n 
P  16 126 PHE 126 126 126 PHE PHE H . n 
P  16 127 ALA 127 127 127 ALA ALA H . n 
P  16 128 VAL 128 128 128 VAL VAL H . n 
P  16 129 SER 129 129 129 SER SER H . n 
P  16 130 GLU 130 130 130 GLU GLU H . n 
P  16 131 LEU 131 131 131 LEU LEU H . n 
P  16 132 ALA 132 132 132 ALA ALA H . n 
P  16 133 VAL 133 133 133 VAL VAL H . n 
P  16 134 TYR 134 134 134 TYR TYR H . n 
P  16 135 GLY 135 135 135 GLY GLY H . n 
P  16 136 ILE 136 136 136 ILE ILE H . n 
P  16 137 PHE 137 137 137 PHE PHE H . n 
P  16 138 LEU 138 138 138 LEU LEU H . n 
P  16 139 SER 139 139 139 SER SER H . n 
P  16 140 GLY 140 140 140 GLY GLY H . n 
P  16 141 TRP 141 141 141 TRP TRP H . n 
P  16 142 ALA 142 142 142 ALA ALA H . n 
P  16 143 SER 143 143 143 SER SER H . n 
P  16 144 GLY 144 144 144 GLY GLY H . n 
P  16 145 SER 145 145 145 SER SER H . n 
P  16 146 LYS 146 146 146 LYS LYS H . n 
P  16 147 TYR 147 147 147 TYR TYR H . n 
P  16 148 SER 148 148 148 SER SER H . n 
P  16 149 LEU 149 149 149 LEU LEU H . n 
P  16 150 LEU 150 150 150 LEU LEU H . n 
P  16 151 GLY 151 151 151 GLY GLY H . n 
P  16 152 SER 152 152 152 SER SER H . n 
P  16 153 LEU 153 153 153 LEU LEU H . n 
P  16 154 ARG 154 154 154 ARG ARG H . n 
P  16 155 SER 155 155 155 SER SER H . n 
P  16 156 SER 156 156 156 SER SER H . n 
P  16 157 ALA 157 157 157 ALA ALA H . n 
P  16 158 SER 158 158 158 SER SER H . n 
P  16 159 LEU 159 159 159 LEU LEU H . n 
P  16 160 ILE 160 160 160 ILE ILE H . n 
P  16 161 SER 161 161 161 SER SER H . n 
P  16 162 TYR 162 162 162 TYR TYR H . n 
P  16 163 GLU 163 163 163 GLU GLU H . n 
P  16 164 LEU 164 164 164 LEU LEU H . n 
P  16 165 GLY 165 165 165 GLY GLY H . n 
P  16 166 LEU 166 166 166 LEU LEU H . n 
P  16 167 GLY 167 167 167 GLY GLY H . n 
P  16 168 LEU 168 168 168 LEU LEU H . n 
P  16 169 ALA 169 169 169 ALA ALA H . n 
P  16 170 LEU 170 170 170 LEU LEU H . n 
P  16 171 LEU 171 171 171 LEU LEU H . n 
P  16 172 ALA 172 172 172 ALA ALA H . n 
P  16 173 PRO 173 173 173 PRO PRO H . n 
P  16 174 VAL 174 174 174 VAL VAL H . n 
P  16 175 LEU 175 175 175 LEU LEU H . n 
P  16 176 LEU 176 176 176 LEU LEU H . n 
P  16 177 VAL 177 177 177 VAL VAL H . n 
P  16 178 GLY 178 178 178 GLY GLY H . n 
P  16 179 SER 179 179 179 SER SER H . n 
P  16 180 LEU 180 180 180 LEU LEU H . n 
P  16 181 ASN 181 181 181 ASN ASN H . n 
P  16 182 LEU 182 182 182 LEU LEU H . n 
P  16 183 ASN 183 183 183 ASN ASN H . n 
P  16 184 ASP 184 184 184 ASP ASP H . n 
P  16 185 ILE 185 185 185 ILE ILE H . n 
P  16 186 VAL 186 186 186 VAL VAL H . n 
P  16 187 ASN 187 187 187 ASN ASN H . n 
P  16 188 TRP 188 188 188 TRP TRP H . n 
P  16 189 GLN 189 189 189 GLN GLN H . n 
P  16 190 LYS 190 190 190 LYS LYS H . n 
P  16 191 GLU 191 191 191 GLU GLU H . n 
P  16 192 HIS 192 192 192 HIS HIS H . n 
P  16 193 GLY 193 193 193 GLY GLY H . n 
P  16 194 TRP 194 194 194 TRP TRP H . n 
P  16 195 LEU 195 195 195 LEU LEU H . n 
P  16 196 PHE 196 196 196 PHE PHE H . n 
P  16 197 LEU 197 197 197 LEU LEU H . n 
P  16 198 TYR 198 198 198 TYR TYR H . n 
P  16 199 ALA 199 199 199 ALA ALA H . n 
P  16 200 PHE 200 200 200 PHE PHE H . n 
P  16 201 PRO 201 201 201 PRO PRO H . n 
P  16 202 ALA 202 202 202 ALA ALA H . n 
P  16 203 PHE 203 203 203 PHE PHE H . n 
P  16 204 LEU 204 204 204 LEU LEU H . n 
P  16 205 VAL 205 205 205 VAL VAL H . n 
P  16 206 TYR 206 206 206 TYR TYR H . n 
P  16 207 LEU 207 207 207 LEU LEU H . n 
P  16 208 ILE 208 208 208 ILE ILE H . n 
P  16 209 ALA 209 209 209 ALA ALA H . n 
P  16 210 SER 210 210 210 SER SER H . n 
P  16 211 MET 211 211 211 MET MET H . n 
P  16 212 ALA 212 212 212 ALA ALA H . n 
P  16 213 GLU 213 213 213 GLU GLU H . n 
P  16 214 ALA 214 214 214 ALA ALA H . n 
P  16 215 ALA 215 215 215 ALA ALA H . n 
P  16 216 ARG 216 216 216 ARG ARG H . n 
P  16 217 THR 217 217 217 THR THR H . n 
P  16 218 PRO 218 218 218 PRO PRO H . n 
P  16 219 PHE 219 219 219 PHE PHE H . n 
P  16 220 ASP 220 220 220 ASP ASP H . n 
P  16 221 LEU 221 221 221 LEU LEU H . n 
P  16 222 PRO 222 222 222 PRO PRO H . n 
P  16 223 GLU 223 223 223 GLU GLU H . n 
P  16 224 ALA 224 224 224 ALA ALA H . n 
P  16 225 GLU 225 225 225 GLU GLU H . n 
P  16 226 GLN 226 226 226 GLN GLN H . n 
P  16 227 GLU 227 227 227 GLU GLU H . n 
P  16 228 LEU 228 228 228 LEU LEU H . n 
P  16 229 VAL 229 229 229 VAL VAL H . n 
P  16 230 GLY 230 230 230 GLY GLY H . n 
P  16 231 GLY 231 231 231 GLY GLY H . n 
P  16 232 TYR 232 232 232 TYR TYR H . n 
P  16 233 HIS 233 233 233 HIS HIS H . n 
P  16 234 THR 234 234 234 THR THR H . n 
P  16 235 GLU 235 235 235 GLU GLU H . n 
P  16 236 TYR 236 236 236 TYR TYR H . n 
P  16 237 SER 237 237 237 SER SER H . n 
P  16 238 SER 238 238 238 SER SER H . n 
P  16 239 ILE 239 239 239 ILE ILE H . n 
P  16 240 LYS 240 240 240 LYS LYS H . n 
P  16 241 TRP 241 241 241 TRP TRP H . n 
P  16 242 ALA 242 242 242 ALA ALA H . n 
P  16 243 LEU 243 243 243 LEU LEU H . n 
P  16 244 PHE 244 244 244 PHE PHE H . n 
P  16 245 GLN 245 245 245 GLN GLN H . n 
P  16 246 MET 246 246 246 MET MET H . n 
P  16 247 ALA 247 247 247 ALA ALA H . n 
P  16 248 GLU 248 248 248 GLU GLU H . n 
P  16 249 TYR 249 249 249 TYR TYR H . n 
P  16 250 ILE 250 250 250 ILE ILE H . n 
P  16 251 HIS 251 251 251 HIS HIS H . n 
P  16 252 PHE 252 252 252 PHE PHE H . n 
P  16 253 ILE 253 253 253 ILE ILE H . n 
P  16 254 THR 254 254 254 THR THR H . n 
P  16 255 ALA 255 255 255 ALA ALA H . n 
P  16 256 SER 256 256 256 SER SER H . n 
P  16 257 ALA 257 257 257 ALA ALA H . n 
P  16 258 LEU 258 258 258 LEU LEU H . n 
P  16 259 ILE 259 259 259 ILE ILE H . n 
P  16 260 PRO 260 260 260 PRO PRO H . n 
P  16 261 THR 261 261 261 THR THR H . n 
P  16 262 LEU 262 262 262 LEU LEU H . n 
P  16 263 PHE 263 263 263 PHE PHE H . n 
P  16 264 LEU 264 264 264 LEU LEU H . n 
P  16 265 GLY 265 265 265 GLY GLY H . n 
P  16 266 GLY 266 266 266 GLY GLY H . n 
P  16 267 TRP 267 267 267 TRP TRP H . n 
P  16 268 THR 268 268 268 THR THR H . n 
P  16 269 MET 269 269 269 MET MET H . n 
P  16 270 PRO 270 270 270 PRO PRO H . n 
P  16 271 VAL 271 271 271 VAL VAL H . n 
P  16 272 LEU 272 272 272 LEU LEU H . n 
P  16 273 GLU 273 273 273 GLU GLU H . n 
P  16 274 VAL 274 274 274 VAL VAL H . n 
P  16 275 PRO 275 275 275 PRO PRO H . n 
P  16 276 TYR 276 276 276 TYR TYR H . n 
P  16 277 LEU 277 277 277 LEU LEU H . n 
P  16 278 TRP 278 278 278 TRP TRP H . n 
P  16 279 MET 279 279 279 MET MET H . n 
P  16 280 PHE 280 280 280 PHE PHE H . n 
P  16 281 LEU 281 281 281 LEU LEU H . n 
P  16 282 LYS 282 282 282 LYS LYS H . n 
P  16 283 ILE 283 283 283 ILE ILE H . n 
P  16 284 ALA 284 284 284 ALA ALA H . n 
P  16 285 PHE 285 285 285 PHE PHE H . n 
P  16 286 PHE 286 286 286 PHE PHE H . n 
P  16 287 LEU 287 287 287 LEU LEU H . n 
P  16 288 PHE 288 288 288 PHE PHE H . n 
P  16 289 PHE 289 289 289 PHE PHE H . n 
P  16 290 PHE 290 290 290 PHE PHE H . n 
P  16 291 ILE 291 291 291 ILE ILE H . n 
P  16 292 TRP 292 292 292 TRP TRP H . n 
P  16 293 ILE 293 293 293 ILE ILE H . n 
P  16 294 ARG 294 294 294 ARG ARG H . n 
P  16 295 ALA 295 295 295 ALA ALA H . n 
P  16 296 THR 296 296 296 THR THR H . n 
P  16 297 TRP 297 297 297 TRP TRP H . n 
P  16 298 PHE 298 298 298 PHE PHE H . n 
P  16 299 ARG 299 299 299 ARG ARG H . n 
P  16 300 LEU 300 300 300 LEU LEU H . n 
P  16 301 ARG 301 301 301 ARG ARG H . n 
P  16 302 TYR 302 302 302 TYR TYR H . n 
P  16 303 ASP 303 303 303 ASP ASP H . n 
P  16 304 GLN 304 304 304 GLN GLN H . n 
P  16 305 LEU 305 305 305 LEU LEU H . n 
P  16 306 LEU 306 306 306 LEU LEU H . n 
P  16 307 ARG 307 307 307 ARG ARG H . n 
P  16 308 PHE 308 308 308 PHE PHE H . n 
P  16 309 GLY 309 309 309 GLY GLY H . n 
P  16 310 TRP 310 310 310 TRP TRP H . n 
P  16 311 GLY 311 311 311 GLY GLY H . n 
P  16 312 PHE 312 312 312 PHE PHE H . n 
P  16 313 LEU 313 313 313 LEU LEU H . n 
P  16 314 PHE 314 314 314 PHE PHE H . n 
P  16 315 PRO 315 315 315 PRO PRO H . n 
P  16 316 LEU 316 316 316 LEU LEU H . n 
P  16 317 ALA 317 317 317 ALA ALA H . n 
P  16 318 LEU 318 318 318 LEU LEU H . n 
P  16 319 LEU 319 319 319 LEU LEU H . n 
P  16 320 TRP 320 320 320 TRP TRP H . n 
P  16 321 PHE 321 321 321 PHE PHE H . n 
P  16 322 LEU 322 322 322 LEU LEU H . n 
P  16 323 VAL 323 323 323 VAL VAL H . n 
P  16 324 THR 324 324 324 THR THR H . n 
P  16 325 ALA 325 325 325 ALA ALA H . n 
P  16 326 LEU 326 326 326 LEU LEU H . n 
P  16 327 VAL 327 327 327 VAL VAL H . n 
P  16 328 VAL 328 328 328 VAL VAL H . n 
P  16 329 ALA 329 329 329 ALA ALA H . n 
P  16 330 LEU 330 330 330 LEU LEU H . n 
P  16 331 ASP 331 331 331 ASP ASP H . n 
P  16 332 LEU 332 332 332 LEU LEU H . n 
P  16 333 PRO 333 333 333 PRO PRO H . n 
P  16 334 ARG 334 334 334 ARG ARG H . n 
P  16 335 THR 335 335 335 THR THR H . n 
P  16 336 TYR 336 336 336 TYR TYR H . n 
P  16 337 LEU 337 337 337 LEU LEU H . n 
P  16 338 LEU 338 338 338 LEU LEU H . n 
P  16 339 TYR 339 339 339 TYR TYR H . n 
P  16 340 LEU 340 340 340 LEU LEU H . n 
P  16 341 SER 341 341 341 SER SER H . n 
P  16 342 ALA 342 342 342 ALA ALA H . n 
P  16 343 LEU 343 343 343 LEU LEU H . n 
P  16 344 SER 344 344 344 SER SER H . n 
P  16 345 PHE 345 345 345 PHE PHE H . n 
P  16 346 LEU 346 346 346 LEU LEU H . n 
P  16 347 VAL 347 347 347 VAL VAL H . n 
P  16 348 LEU 348 348 348 LEU LEU H . n 
P  16 349 LEU 349 349 349 LEU LEU H . n 
P  16 350 GLY 350 350 350 GLY GLY H . n 
P  16 351 ALA 351 351 351 ALA ALA H . n 
P  16 352 VAL 352 352 352 VAL VAL H . n 
P  16 353 LEU 353 353 353 LEU LEU H . n 
P  16 354 TYR 354 354 354 TYR TYR H . n 
P  16 355 THR 355 355 ?   ?   ?   H . n 
P  16 356 PRO 356 356 ?   ?   ?   H . n 
P  16 357 LYS 357 357 ?   ?   ?   H . n 
P  16 358 PRO 358 358 ?   ?   ?   H . n 
P  16 359 ALA 359 359 ?   ?   ?   H . n 
P  16 360 ARG 360 360 ?   ?   ?   H . n 
P  16 361 LYS 361 361 ?   ?   ?   H . n 
P  16 362 GLY 362 362 ?   ?   ?   H . n 
P  16 363 GLY 363 363 ?   ?   ?   H . n 
P  16 364 GLY 364 364 ?   ?   ?   H . n 
P  16 365 ALA 365 365 ?   ?   ?   H . n 
Q  1  1   MET 1   1   ?   ?   ?   B . n 
Q  1  2   THR 2   2   2   THR THR B . n 
Q  1  3   GLY 3   3   3   GLY GLY B . n 
Q  1  4   PRO 4   4   4   PRO PRO B . n 
Q  1  5   ILE 5   5   5   ILE ILE B . n 
Q  1  6   LEU 6   6   6   LEU LEU B . n 
Q  1  7   SER 7   7   7   SER SER B . n 
Q  1  8   GLY 8   8   8   GLY GLY B . n 
Q  1  9   LEU 9   9   9   LEU LEU B . n 
Q  1  10  ASP 10  10  10  ASP ASP B . n 
Q  1  11  PRO 11  11  11  PRO PRO B . n 
Q  1  12  ARG 12  12  12  ARG ARG B . n 
Q  1  13  PHE 13  13  13  PHE PHE B . n 
Q  1  14  GLU 14  14  14  GLU GLU B . n 
Q  1  15  ARG 15  15  15  ARG ARG B . n 
Q  1  16  THR 16  16  16  THR THR B . n 
Q  1  17  LEU 17  17  17  LEU LEU B . n 
Q  1  18  TYR 18  18  18  TYR TYR B . n 
Q  1  19  ALA 19  19  19  ALA ALA B . n 
Q  1  20  HIS 20  20  20  HIS HIS B . n 
Q  1  21  VAL 21  21  21  VAL VAL B . n 
Q  1  22  GLY 22  22  22  GLY GLY B . n 
Q  1  23  LYS 23  23  23  LYS LYS B . n 
Q  1  24  GLU 24  24  24  GLU GLU B . n 
Q  1  25  GLY 25  25  25  GLY GLY B . n 
Q  1  26  SER 26  26  26  SER SER B . n 
Q  1  27  TRP 27  27  27  TRP TRP B . n 
Q  1  28  THR 28  28  28  THR THR B . n 
Q  1  29  LEU 29  29  29  LEU LEU B . n 
Q  1  30  ASP 30  30  30  ASP ASP B . n 
Q  1  31  TYR 31  31  31  TYR TYR B . n 
Q  1  32  TYR 32  32  32  TYR TYR B . n 
Q  1  33  LEU 33  33  33  LEU LEU B . n 
Q  1  34  ARG 34  34  34  ARG ARG B . n 
Q  1  35  HIS 35  35  35  HIS HIS B . n 
Q  1  36  GLY 36  36  36  GLY GLY B . n 
Q  1  37  GLY 37  37  37  GLY GLY B . n 
Q  1  38  TYR 38  38  38  TYR TYR B . n 
Q  1  39  GLU 39  39  39  GLU GLU B . n 
Q  1  40  THR 40  40  40  THR THR B . n 
Q  1  41  ALA 41  41  41  ALA ALA B . n 
Q  1  42  LYS 42  42  42  LYS LYS B . n 
Q  1  43  ARG 43  43  43  ARG ARG B . n 
Q  1  44  VAL 44  44  44  VAL VAL B . n 
Q  1  45  LEU 45  45  45  LEU LEU B . n 
Q  1  46  LYS 46  46  46  LYS LYS B . n 
Q  1  47  GLU 47  47  47  GLU GLU B . n 
Q  1  48  LYS 48  48  48  LYS LYS B . n 
Q  1  49  THR 49  49  49  THR THR B . n 
Q  1  50  PRO 50  50  50  PRO PRO B . n 
Q  1  51  ASP 51  51  51  ASP ASP B . n 
Q  1  52  GLU 52  52  52  GLU GLU B . n 
Q  1  53  VAL 53  53  53  VAL VAL B . n 
Q  1  54  ILE 54  54  54  ILE ILE B . n 
Q  1  55  GLU 55  55  55  GLU GLU B . n 
Q  1  56  GLU 56  56  56  GLU GLU B . n 
Q  1  57  VAL 57  57  57  VAL VAL B . n 
Q  1  58  LYS 58  58  58  LYS LYS B . n 
Q  1  59  ARG 59  59  59  ARG ARG B . n 
Q  1  60  SER 60  60  60  SER SER B . n 
Q  1  61  GLY 61  61  61  GLY GLY B . n 
Q  1  62  LEU 62  62  62  LEU LEU B . n 
Q  1  63  ARG 63  63  63  ARG ARG B . n 
Q  1  64  GLY 64  64  64  GLY GLY B . n 
Q  1  65  ARG 65  65  65  ARG ARG B . n 
Q  1  66  GLY 66  66  66  GLY GLY B . n 
Q  1  67  GLY 67  67  67  GLY GLY B . n 
Q  1  68  ALA 68  68  68  ALA ALA B . n 
Q  1  69  GLY 69  69  69  GLY GLY B . n 
Q  1  70  PHE 70  70  70  PHE PHE B . n 
Q  1  71  PRO 71  71  71  PRO PRO B . n 
Q  1  72  THR 72  72  72  THR THR B . n 
Q  1  73  GLY 73  73  73  GLY GLY B . n 
Q  1  74  LEU 74  74  74  LEU LEU B . n 
Q  1  75  LYS 75  75  75  LYS LYS B . n 
Q  1  76  TRP 76  76  76  TRP TRP B . n 
Q  1  77  SER 77  77  77  SER SER B . n 
Q  1  78  PHE 78  78  78  PHE PHE B . n 
Q  1  79  MET 79  79  79  MET MET B . n 
Q  1  80  PRO 80  80  80  PRO PRO B . n 
Q  1  81  LYS 81  81  81  LYS LYS B . n 
Q  1  82  ASP 82  82  82  ASP ASP B . n 
Q  1  83  ASP 83  83  83  ASP ASP B . n 
Q  1  84  GLY 84  84  84  GLY GLY B . n 
Q  1  85  LYS 85  85  85  LYS LYS B . n 
Q  1  86  GLN 86  86  86  GLN GLN B . n 
Q  1  87  HIS 87  87  87  HIS HIS B . n 
Q  1  88  TYR 88  88  88  TYR TYR B . n 
Q  1  89  LEU 89  89  89  LEU LEU B . n 
Q  1  90  ILE 90  90  90  ILE ILE B . n 
Q  1  91  CYS 91  91  91  CYS CYS B . n 
Q  1  92  ASN 92  92  92  ASN ASN B . n 
Q  1  93  ALA 93  93  93  ALA ALA B . n 
Q  1  94  ASP 94  94  94  ASP ASP B . n 
Q  1  95  GLU 95  95  95  GLU GLU B . n 
Q  1  96  SER 96  96  96  SER SER B . n 
Q  1  97  GLU 97  97  97  GLU GLU B . n 
Q  1  98  PRO 98  98  98  PRO PRO B . n 
Q  1  99  GLY 99  99  99  GLY GLY B . n 
Q  1  100 SER 100 100 100 SER SER B . n 
Q  1  101 PHE 101 101 101 PHE PHE B . n 
Q  1  102 LYS 102 102 102 LYS LYS B . n 
Q  1  103 ASP 103 103 103 ASP ASP B . n 
Q  1  104 ARG 104 104 104 ARG ARG B . n 
Q  1  105 TYR 105 105 105 TYR TYR B . n 
Q  1  106 ILE 106 106 106 ILE ILE B . n 
Q  1  107 LEU 107 107 107 LEU LEU B . n 
Q  1  108 GLU 108 108 108 GLU GLU B . n 
Q  1  109 ASP 109 109 109 ASP ASP B . n 
Q  1  110 VAL 110 110 110 VAL VAL B . n 
Q  1  111 PRO 111 111 111 PRO PRO B . n 
Q  1  112 HIS 112 112 112 HIS HIS B . n 
Q  1  113 LEU 113 113 113 LEU LEU B . n 
Q  1  114 LEU 114 114 114 LEU LEU B . n 
Q  1  115 ILE 115 115 115 ILE ILE B . n 
Q  1  116 GLU 116 116 116 GLU GLU B . n 
Q  1  117 GLY 117 117 117 GLY GLY B . n 
Q  1  118 MET 118 118 118 MET MET B . n 
Q  1  119 ILE 119 119 119 ILE ILE B . n 
Q  1  120 LEU 120 120 120 LEU LEU B . n 
Q  1  121 ALA 121 121 121 ALA ALA B . n 
Q  1  122 GLY 122 122 122 GLY GLY B . n 
Q  1  123 TYR 123 123 123 TYR TYR B . n 
Q  1  124 ALA 124 124 124 ALA ALA B . n 
Q  1  125 ILE 125 125 125 ILE ILE B . n 
Q  1  126 ARG 126 126 126 ARG ARG B . n 
Q  1  127 ALA 127 127 127 ALA ALA B . n 
Q  1  128 THR 128 128 128 THR THR B . n 
Q  1  129 VAL 129 129 129 VAL VAL B . n 
Q  1  130 GLY 130 130 130 GLY GLY B . n 
Q  1  131 TYR 131 131 131 TYR TYR B . n 
Q  1  132 ILE 132 132 132 ILE ILE B . n 
Q  1  133 TYR 133 133 133 TYR TYR B . n 
Q  1  134 VAL 134 134 134 VAL VAL B . n 
Q  1  135 ARG 135 135 135 ARG ARG B . n 
Q  1  136 GLY 136 136 136 GLY GLY B . n 
Q  1  137 GLU 137 137 137 GLU GLU B . n 
Q  1  138 TYR 138 138 138 TYR TYR B . n 
Q  1  139 ARG 139 139 139 ARG ARG B . n 
Q  1  140 ARG 140 140 140 ARG ARG B . n 
Q  1  141 ALA 141 141 141 ALA ALA B . n 
Q  1  142 ALA 142 142 142 ALA ALA B . n 
Q  1  143 ASP 143 143 143 ASP ASP B . n 
Q  1  144 ARG 144 144 144 ARG ARG B . n 
Q  1  145 LEU 145 145 145 LEU LEU B . n 
Q  1  146 GLU 146 146 146 GLU GLU B . n 
Q  1  147 GLN 147 147 147 GLN GLN B . n 
Q  1  148 ALA 148 148 148 ALA ALA B . n 
Q  1  149 ILE 149 149 149 ILE ILE B . n 
Q  1  150 LYS 150 150 150 LYS LYS B . n 
Q  1  151 GLU 151 151 151 GLU GLU B . n 
Q  1  152 ALA 152 152 152 ALA ALA B . n 
Q  1  153 ARG 153 153 153 ARG ARG B . n 
Q  1  154 ALA 154 154 154 ALA ALA B . n 
Q  1  155 ARG 155 155 155 ARG ARG B . n 
Q  1  156 GLY 156 156 156 GLY GLY B . n 
Q  1  157 TYR 157 157 157 TYR TYR B . n 
Q  1  158 LEU 158 158 158 LEU LEU B . n 
Q  1  159 GLY 159 159 159 GLY GLY B . n 
Q  1  160 LYS 160 160 160 LYS LYS B . n 
Q  1  161 ASN 161 161 161 ASN ASN B . n 
Q  1  162 LEU 162 162 162 LEU LEU B . n 
Q  1  163 PHE 163 163 163 PHE PHE B . n 
Q  1  164 GLY 164 164 164 GLY GLY B . n 
Q  1  165 THR 165 165 165 THR THR B . n 
Q  1  166 ASP 166 166 166 ASP ASP B . n 
Q  1  167 PHE 167 167 167 PHE PHE B . n 
Q  1  168 SER 168 168 168 SER SER B . n 
Q  1  169 PHE 169 169 169 PHE PHE B . n 
Q  1  170 ASP 170 170 170 ASP ASP B . n 
Q  1  171 LEU 171 171 171 LEU LEU B . n 
Q  1  172 HIS 172 172 172 HIS HIS B . n 
Q  1  173 VAL 173 173 173 VAL VAL B . n 
Q  1  174 HIS 174 174 174 HIS HIS B . n 
Q  1  175 ARG 175 175 175 ARG ARG B . n 
Q  1  176 GLY 176 176 176 GLY GLY B . n 
Q  1  177 ALA 177 177 177 ALA ALA B . n 
Q  1  178 GLY 178 178 178 GLY GLY B . n 
Q  1  179 ALA 179 179 179 ALA ALA B . n 
Q  1  180 TYR 180 180 180 TYR TYR B . n 
Q  1  181 ILE 181 181 181 ILE ILE B . n 
Q  1  182 CYS 182 182 182 CYS CYS B . n 
Q  1  183 GLY 183 183 183 GLY GLY B . n 
Q  1  184 GLU 184 184 184 GLU GLU B . n 
Q  1  185 GLU 185 185 185 GLU GLU B . n 
Q  1  186 THR 186 186 186 THR THR B . n 
Q  1  187 ALA 187 187 187 ALA ALA B . n 
Q  1  188 LEU 188 188 188 LEU LEU B . n 
Q  1  189 MET 189 189 189 MET MET B . n 
Q  1  190 ASN 190 190 190 ASN ASN B . n 
Q  1  191 SER 191 191 191 SER SER B . n 
Q  1  192 LEU 192 192 192 LEU LEU B . n 
Q  1  193 GLU 193 193 193 GLU GLU B . n 
Q  1  194 GLY 194 194 194 GLY GLY B . n 
Q  1  195 LEU 195 195 195 LEU LEU B . n 
Q  1  196 ARG 196 196 196 ARG ARG B . n 
Q  1  197 ALA 197 197 197 ALA ALA B . n 
Q  1  198 ASN 198 198 198 ASN ASN B . n 
Q  1  199 PRO 199 199 199 PRO PRO B . n 
Q  1  200 ARG 200 200 200 ARG ARG B . n 
Q  1  201 LEU 201 201 201 LEU LEU B . n 
Q  1  202 LYS 202 202 202 LYS LYS B . n 
Q  1  203 PRO 203 203 203 PRO PRO B . n 
Q  1  204 PRO 204 204 204 PRO PRO B . n 
Q  1  205 PHE 205 205 205 PHE PHE B . n 
Q  1  206 PRO 206 206 206 PRO PRO B . n 
Q  1  207 ALA 207 207 207 ALA ALA B . n 
Q  1  208 GLN 208 208 208 GLN GLN B . n 
Q  1  209 SER 209 209 209 SER SER B . n 
Q  1  210 GLY 210 210 210 GLY GLY B . n 
Q  1  211 LEU 211 211 211 LEU LEU B . n 
Q  1  212 TRP 212 212 212 TRP TRP B . n 
Q  1  213 GLY 213 213 213 GLY GLY B . n 
Q  1  214 LYS 214 214 214 LYS LYS B . n 
Q  1  215 PRO 215 215 215 PRO PRO B . n 
Q  1  216 THR 216 216 216 THR THR B . n 
Q  1  217 THR 217 217 217 THR THR B . n 
Q  1  218 ILE 218 218 218 ILE ILE B . n 
Q  1  219 ASN 219 219 219 ASN ASN B . n 
Q  1  220 ASN 220 220 220 ASN ASN B . n 
Q  1  221 VAL 221 221 221 VAL VAL B . n 
Q  1  222 GLU 222 222 222 GLU GLU B . n 
Q  1  223 THR 223 223 223 THR THR B . n 
Q  1  224 LEU 224 224 224 LEU LEU B . n 
Q  1  225 ALA 225 225 225 ALA ALA B . n 
Q  1  226 SER 226 226 226 SER SER B . n 
Q  1  227 VAL 227 227 227 VAL VAL B . n 
Q  1  228 VAL 228 228 228 VAL VAL B . n 
Q  1  229 PRO 229 229 229 PRO PRO B . n 
Q  1  230 ILE 230 230 230 ILE ILE B . n 
Q  1  231 MET 231 231 231 MET MET B . n 
Q  1  232 GLU 232 232 232 GLU GLU B . n 
Q  1  233 ARG 233 233 233 ARG ARG B . n 
Q  1  234 GLY 234 234 234 GLY GLY B . n 
Q  1  235 ALA 235 235 235 ALA ALA B . n 
Q  1  236 ASP 236 236 236 ASP ASP B . n 
Q  1  237 TRP 237 237 237 TRP TRP B . n 
Q  1  238 PHE 238 238 238 PHE PHE B . n 
Q  1  239 ALA 239 239 239 ALA ALA B . n 
Q  1  240 GLN 240 240 240 GLN GLN B . n 
Q  1  241 MET 241 241 241 MET MET B . n 
Q  1  242 GLY 242 242 242 GLY GLY B . n 
Q  1  243 THR 243 243 243 THR THR B . n 
Q  1  244 GLU 244 244 244 GLU GLU B . n 
Q  1  245 GLN 245 245 245 GLN GLN B . n 
Q  1  246 SER 246 246 246 SER SER B . n 
Q  1  247 LYS 247 247 247 LYS LYS B . n 
Q  1  248 GLY 248 248 248 GLY GLY B . n 
Q  1  249 MET 249 249 249 MET MET B . n 
Q  1  250 LYS 250 250 250 LYS LYS B . n 
Q  1  251 LEU 251 251 251 LEU LEU B . n 
Q  1  252 TYR 252 252 252 TYR TYR B . n 
Q  1  253 GLN 253 253 253 GLN GLN B . n 
Q  1  254 ILE 254 254 254 ILE ILE B . n 
Q  1  255 SER 255 255 255 SER SER B . n 
Q  1  256 GLY 256 256 256 GLY GLY B . n 
Q  1  257 PRO 257 257 257 PRO PRO B . n 
Q  1  258 VAL 258 258 258 VAL VAL B . n 
Q  1  259 LYS 259 259 259 LYS LYS B . n 
Q  1  260 ARG 260 260 260 ARG ARG B . n 
Q  1  261 PRO 261 261 261 PRO PRO B . n 
Q  1  262 GLY 262 262 262 GLY GLY B . n 
Q  1  263 VAL 263 263 263 VAL VAL B . n 
Q  1  264 TYR 264 264 264 TYR TYR B . n 
Q  1  265 GLU 265 265 265 GLU GLU B . n 
Q  1  266 LEU 266 266 266 LEU LEU B . n 
Q  1  267 PRO 267 267 267 PRO PRO B . n 
Q  1  268 MET 268 268 268 MET MET B . n 
Q  1  269 GLY 269 269 269 GLY GLY B . n 
Q  1  270 THR 270 270 270 THR THR B . n 
Q  1  271 THR 271 271 271 THR THR B . n 
Q  1  272 PHE 272 272 272 PHE PHE B . n 
Q  1  273 ARG 273 273 273 ARG ARG B . n 
Q  1  274 GLU 274 274 274 GLU GLU B . n 
Q  1  275 LEU 275 275 275 LEU LEU B . n 
Q  1  276 ILE 276 276 276 ILE ILE B . n 
Q  1  277 TYR 277 277 277 TYR TYR B . n 
Q  1  278 GLU 278 278 278 GLU GLU B . n 
Q  1  279 TRP 279 279 279 TRP TRP B . n 
Q  1  280 ALA 280 280 280 ALA ALA B . n 
Q  1  281 GLY 281 281 281 GLY GLY B . n 
Q  1  282 GLY 282 282 282 GLY GLY B . n 
Q  1  283 PRO 283 283 283 PRO PRO B . n 
Q  1  284 LEU 284 284 284 LEU LEU B . n 
Q  1  285 GLU 285 285 285 GLU GLU B . n 
Q  1  286 PRO 286 286 286 PRO PRO B . n 
Q  1  287 ILE 287 287 287 ILE ILE B . n 
Q  1  288 GLN 288 288 288 GLN GLN B . n 
Q  1  289 ALA 289 289 289 ALA ALA B . n 
Q  1  290 ILE 290 290 290 ILE ILE B . n 
Q  1  291 ILE 291 291 291 ILE ILE B . n 
Q  1  292 PRO 292 292 292 PRO PRO B . n 
Q  1  293 GLY 293 293 293 GLY GLY B . n 
Q  1  294 GLY 294 294 294 GLY GLY B . n 
Q  1  295 SER 295 295 295 SER SER B . n 
Q  1  296 SER 296 296 296 SER SER B . n 
Q  1  297 THR 297 297 297 THR THR B . n 
Q  1  298 PRO 298 298 298 PRO PRO B . n 
Q  1  299 PRO 299 299 299 PRO PRO B . n 
Q  1  300 LEU 300 300 300 LEU LEU B . n 
Q  1  301 PRO 301 301 301 PRO PRO B . n 
Q  1  302 PHE 302 302 302 PHE PHE B . n 
Q  1  303 THR 303 303 303 THR THR B . n 
Q  1  304 GLU 304 304 304 GLU GLU B . n 
Q  1  305 GLU 305 305 305 GLU GLU B . n 
Q  1  306 VAL 306 306 306 VAL VAL B . n 
Q  1  307 LEU 307 307 307 LEU LEU B . n 
Q  1  308 ASP 308 308 308 ASP ASP B . n 
Q  1  309 THR 309 309 309 THR THR B . n 
Q  1  310 PRO 310 310 310 PRO PRO B . n 
Q  1  311 MET 311 311 311 MET MET B . n 
Q  1  312 SER 312 312 312 SER SER B . n 
Q  1  313 TYR 313 313 313 TYR TYR B . n 
Q  1  314 GLU 314 314 314 GLU GLU B . n 
Q  1  315 HIS 315 315 315 HIS HIS B . n 
Q  1  316 LEU 316 316 316 LEU LEU B . n 
Q  1  317 GLN 317 317 317 GLN GLN B . n 
Q  1  318 ALA 318 318 318 ALA ALA B . n 
Q  1  319 LYS 319 319 319 LYS LYS B . n 
Q  1  320 GLY 320 320 320 GLY GLY B . n 
Q  1  321 SER 321 321 321 SER SER B . n 
Q  1  322 MET 322 322 322 MET MET B . n 
Q  1  323 LEU 323 323 323 LEU LEU B . n 
Q  1  324 GLY 324 324 324 GLY GLY B . n 
Q  1  325 THR 325 325 325 THR THR B . n 
Q  1  326 GLY 326 326 326 GLY GLY B . n 
Q  1  327 GLY 327 327 327 GLY GLY B . n 
Q  1  328 VAL 328 328 328 VAL VAL B . n 
Q  1  329 ILE 329 329 329 ILE ILE B . n 
Q  1  330 LEU 330 330 330 LEU LEU B . n 
Q  1  331 ILE 331 331 331 ILE ILE B . n 
Q  1  332 PRO 332 332 332 PRO PRO B . n 
Q  1  333 GLU 333 333 333 GLU GLU B . n 
Q  1  334 ARG 334 334 334 ARG ARG B . n 
Q  1  335 VAL 335 335 335 VAL VAL B . n 
Q  1  336 SER 336 336 336 SER SER B . n 
Q  1  337 MET 337 337 337 MET MET B . n 
Q  1  338 VAL 338 338 338 VAL VAL B . n 
Q  1  339 ASP 339 339 339 ASP ASP B . n 
Q  1  340 ALA 340 340 340 ALA ALA B . n 
Q  1  341 MET 341 341 341 MET MET B . n 
Q  1  342 TRP 342 342 342 TRP TRP B . n 
Q  1  343 ASN 343 343 343 ASN ASN B . n 
Q  1  344 LEU 344 344 344 LEU LEU B . n 
Q  1  345 THR 345 345 345 THR THR B . n 
Q  1  346 ARG 346 346 346 ARG ARG B . n 
Q  1  347 PHE 347 347 347 PHE PHE B . n 
Q  1  348 TYR 348 348 348 TYR TYR B . n 
Q  1  349 ALA 349 349 349 ALA ALA B . n 
Q  1  350 HIS 350 350 350 HIS HIS B . n 
Q  1  351 GLU 351 351 351 GLU GLU B . n 
Q  1  352 SER 352 352 352 SER SER B . n 
Q  1  353 CYS 353 353 353 CYS CYS B . n 
Q  1  354 GLY 354 354 354 GLY GLY B . n 
Q  1  355 LYS 355 355 355 LYS LYS B . n 
Q  1  356 CYS 356 356 356 CYS CYS B . n 
Q  1  357 THR 357 357 357 THR THR B . n 
Q  1  358 PRO 358 358 358 PRO PRO B . n 
Q  1  359 CYS 359 359 359 CYS CYS B . n 
Q  1  360 ARG 360 360 360 ARG ARG B . n 
Q  1  361 GLU 361 361 361 GLU GLU B . n 
Q  1  362 GLY 362 362 362 GLY GLY B . n 
Q  1  363 VAL 363 363 363 VAL VAL B . n 
Q  1  364 ALA 364 364 364 ALA ALA B . n 
Q  1  365 GLY 365 365 365 GLY GLY B . n 
Q  1  366 PHE 366 366 366 PHE PHE B . n 
Q  1  367 MET 367 367 367 MET MET B . n 
Q  1  368 VAL 368 368 368 VAL VAL B . n 
Q  1  369 ASN 369 369 369 ASN ASN B . n 
Q  1  370 LEU 370 370 370 LEU LEU B . n 
Q  1  371 PHE 371 371 371 PHE PHE B . n 
Q  1  372 ALA 372 372 372 ALA ALA B . n 
Q  1  373 LYS 373 373 373 LYS LYS B . n 
Q  1  374 ILE 374 374 374 ILE ILE B . n 
Q  1  375 GLY 375 375 375 GLY GLY B . n 
Q  1  376 THR 376 376 376 THR THR B . n 
Q  1  377 GLY 377 377 377 GLY GLY B . n 
Q  1  378 GLN 378 378 378 GLN GLN B . n 
Q  1  379 GLY 379 379 379 GLY GLY B . n 
Q  1  380 GLU 380 380 380 GLU GLU B . n 
Q  1  381 GLU 381 381 381 GLU GLU B . n 
Q  1  382 LYS 382 382 382 LYS LYS B . n 
Q  1  383 ASP 383 383 383 ASP ASP B . n 
Q  1  384 VAL 384 384 384 VAL VAL B . n 
Q  1  385 GLU 385 385 385 GLU GLU B . n 
Q  1  386 ASN 386 386 386 ASN ASN B . n 
Q  1  387 LEU 387 387 387 LEU LEU B . n 
Q  1  388 GLU 388 388 388 GLU GLU B . n 
Q  1  389 ALA 389 389 389 ALA ALA B . n 
Q  1  390 LEU 390 390 390 LEU LEU B . n 
Q  1  391 LEU 391 391 391 LEU LEU B . n 
Q  1  392 PRO 392 392 392 PRO PRO B . n 
Q  1  393 LEU 393 393 393 LEU LEU B . n 
Q  1  394 ILE 394 394 394 ILE ILE B . n 
Q  1  395 GLU 395 395 395 GLU GLU B . n 
Q  1  396 GLY 396 396 396 GLY GLY B . n 
Q  1  397 ARG 397 397 397 ARG ARG B . n 
Q  1  398 SER 398 398 398 SER SER B . n 
Q  1  399 PHE 399 399 399 PHE PHE B . n 
Q  1  400 CYS 400 400 400 CYS CYS B . n 
Q  1  401 PRO 401 401 401 PRO PRO B . n 
Q  1  402 LEU 402 402 402 LEU LEU B . n 
Q  1  403 ALA 403 403 403 ALA ALA B . n 
Q  1  404 ASP 404 404 404 ASP ASP B . n 
Q  1  405 ALA 405 405 405 ALA ALA B . n 
Q  1  406 ALA 406 406 406 ALA ALA B . n 
Q  1  407 VAL 407 407 407 VAL VAL B . n 
Q  1  408 TRP 408 408 408 TRP TRP B . n 
Q  1  409 PRO 409 409 409 PRO PRO B . n 
Q  1  410 VAL 410 410 410 VAL VAL B . n 
Q  1  411 LYS 411 411 411 LYS LYS B . n 
Q  1  412 GLY 412 412 412 GLY GLY B . n 
Q  1  413 SER 413 413 413 SER SER B . n 
Q  1  414 LEU 414 414 414 LEU LEU B . n 
Q  1  415 ARG 415 415 415 ARG ARG B . n 
Q  1  416 HIS 416 416 416 HIS HIS B . n 
Q  1  417 PHE 417 417 417 PHE PHE B . n 
Q  1  418 LYS 418 418 418 LYS LYS B . n 
Q  1  419 ASP 419 419 419 ASP ASP B . n 
Q  1  420 GLN 420 420 420 GLN GLN B . n 
Q  1  421 TYR 421 421 421 TYR TYR B . n 
Q  1  422 LEU 422 422 422 LEU LEU B . n 
Q  1  423 ALA 423 423 423 ALA ALA B . n 
Q  1  424 LEU 424 424 424 LEU LEU B . n 
Q  1  425 ALA 425 425 425 ALA ALA B . n 
Q  1  426 ARG 426 426 426 ARG ARG B . n 
Q  1  427 GLU 427 427 427 GLU GLU B . n 
Q  1  428 LYS 428 428 428 LYS LYS B . n 
Q  1  429 ARG 429 429 429 ARG ARG B . n 
Q  1  430 PRO 430 430 430 PRO PRO B . n 
Q  1  431 VAL 431 431 431 VAL VAL B . n 
Q  1  432 PRO 432 432 432 PRO PRO B . n 
Q  1  433 ARG 433 433 433 ARG ARG B . n 
Q  1  434 PRO 434 434 434 PRO PRO B . n 
Q  1  435 SER 435 435 435 SER SER B . n 
Q  1  436 LEU 436 436 436 LEU LEU B . n 
Q  1  437 TRP 437 437 437 TRP TRP B . n 
Q  1  438 ARG 438 438 438 ARG ARG B . n 
R  2  1   MET 1   1   ?   ?   ?   C . n 
R  2  2   GLY 2   2   ?   ?   ?   C . n 
R  2  3   PHE 3   3   3   PHE PHE C . n 
R  2  4   PHE 4   4   4   PHE PHE C . n 
R  2  5   ASP 5   5   5   ASP ASP C . n 
R  2  6   ASP 6   6   6   ASP ASP C . n 
R  2  7   LYS 7   7   7   LYS LYS C . n 
R  2  8   GLN 8   8   8   GLN GLN C . n 
R  2  9   ASP 9   9   9   ASP ASP C . n 
R  2  10  PHE 10  10  10  PHE PHE C . n 
R  2  11  LEU 11  11  11  LEU LEU C . n 
R  2  12  GLU 12  12  12  GLU GLU C . n 
R  2  13  GLU 13  13  13  GLU GLU C . n 
R  2  14  THR 14  14  14  THR THR C . n 
R  2  15  PHE 15  15  15  PHE PHE C . n 
R  2  16  ALA 16  16  16  ALA ALA C . n 
R  2  17  LYS 17  17  17  LYS LYS C . n 
R  2  18  TYR 18  18  18  TYR TYR C . n 
R  2  19  PRO 19  19  19  PRO PRO C . n 
R  2  20  PRO 20  20  20  PRO PRO C . n 
R  2  21  GLU 21  21  21  GLU GLU C . n 
R  2  22  GLY 22  22  22  GLY GLY C . n 
R  2  23  ARG 23  23  23  ARG ARG C . n 
R  2  24  ARG 24  24  24  ARG ARG C . n 
R  2  25  ALA 25  25  25  ALA ALA C . n 
R  2  26  ALA 26  26  26  ALA ALA C . n 
R  2  27  ILE 27  27  27  ILE ILE C . n 
R  2  28  MET 28  28  28  MET MET C . n 
R  2  29  PRO 29  29  29  PRO PRO C . n 
R  2  30  LEU 30  30  30  LEU LEU C . n 
R  2  31  LEU 31  31  31  LEU LEU C . n 
R  2  32  ARG 32  32  32  ARG ARG C . n 
R  2  33  ARG 33  33  33  ARG ARG C . n 
R  2  34  VAL 34  34  34  VAL VAL C . n 
R  2  35  GLN 35  35  35  GLN GLN C . n 
R  2  36  GLN 36  36  36  GLN GLN C . n 
R  2  37  GLU 37  37  37  GLU GLU C . n 
R  2  38  GLU 38  38  38  GLU GLU C . n 
R  2  39  GLY 39  39  39  GLY GLY C . n 
R  2  40  TRP 40  40  40  TRP TRP C . n 
R  2  41  ILE 41  41  41  ILE ILE C . n 
R  2  42  ARG 42  42  42  ARG ARG C . n 
R  2  43  PRO 43  43  43  PRO PRO C . n 
R  2  44  GLU 44  44  44  GLU GLU C . n 
R  2  45  ARG 45  45  45  ARG ARG C . n 
R  2  46  ILE 46  46  46  ILE ILE C . n 
R  2  47  GLU 47  47  47  GLU GLU C . n 
R  2  48  GLU 48  48  48  GLU GLU C . n 
R  2  49  ILE 49  49  49  ILE ILE C . n 
R  2  50  ALA 50  50  50  ALA ALA C . n 
R  2  51  ARG 51  51  51  ARG ARG C . n 
R  2  52  LEU 52  52  52  LEU LEU C . n 
R  2  53  VAL 53  53  53  VAL VAL C . n 
R  2  54  GLY 54  54  54  GLY GLY C . n 
R  2  55  THR 55  55  55  THR THR C . n 
R  2  56  THR 56  56  56  THR THR C . n 
R  2  57  PRO 57  57  57  PRO PRO C . n 
R  2  58  THR 58  58  58  THR THR C . n 
R  2  59  GLU 59  59  59  GLU GLU C . n 
R  2  60  VAL 60  60  60  VAL VAL C . n 
R  2  61  MET 61  61  61  MET MET C . n 
R  2  62  GLY 62  62  62  GLY GLY C . n 
R  2  63  VAL 63  63  63  VAL VAL C . n 
R  2  64  ALA 64  64  64  ALA ALA C . n 
R  2  65  SER 65  65  65  SER SER C . n 
R  2  66  PHE 66  66  66  PHE PHE C . n 
R  2  67  TYR 67  67  67  TYR TYR C . n 
R  2  68  SER 68  68  68  SER SER C . n 
R  2  69  TYR 69  69  69  TYR TYR C . n 
R  2  70  TYR 70  70  70  TYR TYR C . n 
R  2  71  GLN 71  71  71  GLN GLN C . n 
R  2  72  PHE 72  72  72  PHE PHE C . n 
R  2  73  VAL 73  73  73  VAL VAL C . n 
R  2  74  PRO 74  74  74  PRO PRO C . n 
R  2  75  THR 75  75  75  THR THR C . n 
R  2  76  GLY 76  76  76  GLY GLY C . n 
R  2  77  LYS 77  77  77  LYS LYS C . n 
R  2  78  TYR 78  78  78  TYR TYR C . n 
R  2  79  HIS 79  79  79  HIS HIS C . n 
R  2  80  LEU 80  80  80  LEU LEU C . n 
R  2  81  GLN 81  81  81  GLN GLN C . n 
R  2  82  VAL 82  82  82  VAL VAL C . n 
R  2  83  CYS 83  83  83  CYS CYS C . n 
R  2  84  ALA 84  84  84  ALA ALA C . n 
R  2  85  THR 85  85  85  THR THR C . n 
R  2  86  LEU 86  86  86  LEU LEU C . n 
R  2  87  SER 87  87  87  SER SER C . n 
R  2  88  CYS 88  88  88  CYS CYS C . n 
R  2  89  LYS 89  89  89  LYS LYS C . n 
R  2  90  LEU 90  90  90  LEU LEU C . n 
R  2  91  ALA 91  91  91  ALA ALA C . n 
R  2  92  GLY 92  92  92  GLY GLY C . n 
R  2  93  ALA 93  93  93  ALA ALA C . n 
R  2  94  GLU 94  94  94  GLU GLU C . n 
R  2  95  GLU 95  95  95  GLU GLU C . n 
R  2  96  LEU 96  96  96  LEU LEU C . n 
R  2  97  TRP 97  97  97  TRP TRP C . n 
R  2  98  ASP 98  98  98  ASP ASP C . n 
R  2  99  TYR 99  99  99  TYR TYR C . n 
R  2  100 LEU 100 100 100 LEU LEU C . n 
R  2  101 THR 101 101 101 THR THR C . n 
R  2  102 GLU 102 102 102 GLU GLU C . n 
R  2  103 THR 103 103 103 THR THR C . n 
R  2  104 LEU 104 104 104 LEU LEU C . n 
R  2  105 GLY 105 105 105 GLY GLY C . n 
R  2  106 ILE 106 106 106 ILE ILE C . n 
R  2  107 GLY 107 107 107 GLY GLY C . n 
R  2  108 PRO 108 108 108 PRO PRO C . n 
R  2  109 GLY 109 109 109 GLY GLY C . n 
R  2  110 GLU 110 110 110 GLU GLU C . n 
R  2  111 VAL 111 111 111 VAL VAL C . n 
R  2  112 THR 112 112 112 THR THR C . n 
R  2  113 PRO 113 113 113 PRO PRO C . n 
R  2  114 ASP 114 114 114 ASP ASP C . n 
R  2  115 GLY 115 115 115 GLY GLY C . n 
R  2  116 LEU 116 116 116 LEU LEU C . n 
R  2  117 PHE 117 117 117 PHE PHE C . n 
R  2  118 SER 118 118 118 SER SER C . n 
R  2  119 VAL 119 119 119 VAL VAL C . n 
R  2  120 GLN 120 120 120 GLN GLN C . n 
R  2  121 LYS 121 121 121 LYS LYS C . n 
R  2  122 VAL 122 122 122 VAL VAL C . n 
R  2  123 GLU 123 123 123 GLU GLU C . n 
R  2  124 CYS 124 124 124 CYS CYS C . n 
R  2  125 LEU 125 125 125 LEU LEU C . n 
R  2  126 GLY 126 126 126 GLY GLY C . n 
R  2  127 SER 127 127 127 SER SER C . n 
R  2  128 CYS 128 128 128 CYS CYS C . n 
R  2  129 HIS 129 129 129 HIS HIS C . n 
R  2  130 THR 130 130 130 THR THR C . n 
R  2  131 ALA 131 131 131 ALA ALA C . n 
R  2  132 PRO 132 132 132 PRO PRO C . n 
R  2  133 VAL 133 133 133 VAL VAL C . n 
R  2  134 ILE 134 134 134 ILE ILE C . n 
R  2  135 GLN 135 135 135 GLN GLN C . n 
R  2  136 VAL 136 136 136 VAL VAL C . n 
R  2  137 ASN 137 137 137 ASN ASN C . n 
R  2  138 ASP 138 138 138 ASP ASP C . n 
R  2  139 GLU 139 139 139 GLU GLU C . n 
R  2  140 PRO 140 140 140 PRO PRO C . n 
R  2  141 TYR 141 141 141 TYR TYR C . n 
R  2  142 VAL 142 142 142 VAL VAL C . n 
R  2  143 GLU 143 143 143 GLU GLU C . n 
R  2  144 CYS 144 144 144 CYS CYS C . n 
R  2  145 VAL 145 145 145 VAL VAL C . n 
R  2  146 THR 146 146 146 THR THR C . n 
R  2  147 ARG 147 147 147 ARG ARG C . n 
R  2  148 ALA 148 148 148 ALA ALA C . n 
R  2  149 ARG 149 149 149 ARG ARG C . n 
R  2  150 LEU 150 150 150 LEU LEU C . n 
R  2  151 GLU 151 151 151 GLU GLU C . n 
R  2  152 ALA 152 152 152 ALA ALA C . n 
R  2  153 LEU 153 153 153 LEU LEU C . n 
R  2  154 LEU 154 154 154 LEU LEU C . n 
R  2  155 ALA 155 155 155 ALA ALA C . n 
R  2  156 GLY 156 156 156 GLY GLY C . n 
R  2  157 LEU 157 157 157 LEU LEU C . n 
R  2  158 ARG 158 158 158 ARG ARG C . n 
R  2  159 ALA 159 159 159 ALA ALA C . n 
R  2  160 GLY 160 160 160 GLY GLY C . n 
R  2  161 LYS 161 161 161 LYS LYS C . n 
R  2  162 ARG 162 162 162 ARG ARG C . n 
R  2  163 LEU 163 163 163 LEU LEU C . n 
R  2  164 GLU 164 164 164 GLU GLU C . n 
R  2  165 GLU 165 165 165 GLU GLU C . n 
R  2  166 ILE 166 166 166 ILE ILE C . n 
R  2  167 GLU 167 167 167 GLU GLU C . n 
R  2  168 LEU 168 168 168 LEU LEU C . n 
R  2  169 PRO 169 169 169 PRO PRO C . n 
R  2  170 GLY 170 170 170 GLY GLY C . n 
R  2  171 LYS 171 171 171 LYS LYS C . n 
R  2  172 CYS 172 172 172 CYS CYS C . n 
R  2  173 GLY 173 173 173 GLY GLY C . n 
R  2  174 HIS 174 174 174 HIS HIS C . n 
R  2  175 HIS 175 175 175 HIS HIS C . n 
R  2  176 VAL 176 176 176 VAL VAL C . n 
R  2  177 HIS 177 177 177 HIS HIS C . n 
R  2  178 GLU 178 178 178 GLU GLU C . n 
R  2  179 VAL 179 179 179 VAL VAL C . n 
R  2  180 GLU 180 180 180 GLU GLU C . n 
R  2  181 VAL 181 181 ?   ?   ?   C . n 
S  3  1   MET 1   1   1   MET MET D . n 
S  3  2   VAL 2   2   2   VAL VAL D . n 
S  3  3   ARG 3   3   3   ARG ARG D . n 
S  3  4   VAL 4   4   4   VAL VAL D . n 
S  3  5   LYS 5   5   5   LYS LYS D . n 
S  3  6   VAL 6   6   6   VAL VAL D . n 
S  3  7   ASN 7   7   7   ASN ASN D . n 
S  3  8   ASP 8   8   8   ASP ASP D . n 
S  3  9   ARG 9   9   9   ARG ARG D . n 
S  3  10  ILE 10  10  10  ILE ILE D . n 
S  3  11  VAL 11  11  11  VAL VAL D . n 
S  3  12  GLU 12  12  12  GLU GLU D . n 
S  3  13  VAL 13  13  13  VAL VAL D . n 
S  3  14  PRO 14  14  14  PRO PRO D . n 
S  3  15  PRO 15  15  15  PRO PRO D . n 
S  3  16  GLY 16  16  16  GLY GLY D . n 
S  3  17  THR 17  17  17  THR THR D . n 
S  3  18  SER 18  18  18  SER SER D . n 
S  3  19  VAL 19  19  19  VAL VAL D . n 
S  3  20  MET 20  20  20  MET MET D . n 
S  3  21  ASP 21  21  21  ASP ASP D . n 
S  3  22  ALA 22  22  22  ALA ALA D . n 
S  3  23  VAL 23  23  23  VAL VAL D . n 
S  3  24  PHE 24  24  24  PHE PHE D . n 
S  3  25  HIS 25  25  25  HIS HIS D . n 
S  3  26  ALA 26  26  26  ALA ALA D . n 
S  3  27  GLY 27  27  27  GLY GLY D . n 
S  3  28  TYR 28  28  28  TYR TYR D . n 
S  3  29  ASP 29  29  29  ASP ASP D . n 
S  3  30  VAL 30  30  30  VAL VAL D . n 
S  3  31  PRO 31  31  31  PRO PRO D . n 
S  3  32  LEU 32  32  32  LEU LEU D . n 
S  3  33  PHE 33  33  33  PHE PHE D . n 
S  3  34  CYS 34  34  34  CYS CYS D . n 
S  3  35  SER 35  35  35  SER SER D . n 
S  3  36  GLU 36  36  36  GLU GLU D . n 
S  3  37  LYS 37  37  37  LYS LYS D . n 
S  3  38  HIS 38  38  38  HIS HIS D . n 
S  3  39  LEU 39  39  39  LEU LEU D . n 
S  3  40  SER 40  40  40  SER SER D . n 
S  3  41  PRO 41  41  41  PRO PRO D . n 
S  3  42  ILE 42  42  42  ILE ILE D . n 
S  3  43  GLY 43  43  43  GLY GLY D . n 
S  3  44  ALA 44  44  44  ALA ALA D . n 
S  3  45  CYS 45  45  45  CYS CYS D . n 
S  3  46  ARG 46  46  46  ARG ARG D . n 
S  3  47  MET 47  47  47  MET MET D . n 
S  3  48  CYS 48  48  48  CYS CYS D . n 
S  3  49  LEU 49  49  49  LEU LEU D . n 
S  3  50  VAL 50  50  50  VAL VAL D . n 
S  3  51  ARG 51  51  51  ARG ARG D . n 
S  3  52  ILE 52  52  52  ILE ILE D . n 
S  3  53  GLY 53  53  53  GLY GLY D . n 
S  3  54  LEU 54  54  54  LEU LEU D . n 
S  3  55  PRO 55  55  55  PRO PRO D . n 
S  3  56  LYS 56  56  ?   ?   ?   D . n 
S  3  57  LYS 57  57  ?   ?   ?   D . n 
S  3  58  GLY 58  58  ?   ?   ?   D . n 
S  3  59  PRO 59  59  ?   ?   ?   D . n 
S  3  60  ASP 60  60  ?   ?   ?   D . n 
S  3  61  GLY 61  61  ?   ?   ?   D . n 
S  3  62  LYS 62  62  ?   ?   ?   D . n 
S  3  63  PRO 63  63  ?   ?   ?   D . n 
S  3  64  LEU 64  64  ?   ?   ?   D . n 
S  3  65  LEU 65  65  ?   ?   ?   D . n 
S  3  66  ASN 66  66  ?   ?   ?   D . n 
S  3  67  GLU 67  67  ?   ?   ?   D . n 
S  3  68  LYS 68  68  ?   ?   ?   D . n 
S  3  69  GLY 69  69  ?   ?   ?   D . n 
S  3  70  GLU 70  70  ?   ?   ?   D . n 
S  3  71  PRO 71  71  ?   ?   ?   D . n 
S  3  72  GLU 72  72  ?   ?   ?   D . n 
S  3  73  ILE 73  73  73  ILE ILE D . n 
S  3  74  GLN 74  74  74  GLN GLN D . n 
S  3  75  TRP 75  75  75  TRP TRP D . n 
S  3  76  GLN 76  76  76  GLN GLN D . n 
S  3  77  PRO 77  77  77  PRO PRO D . n 
S  3  78  LYS 78  78  78  LYS LYS D . n 
S  3  79  LEU 79  79  79  LEU LEU D . n 
S  3  80  ALA 80  80  80  ALA ALA D . n 
S  3  81  ALA 81  81  81  ALA ALA D . n 
S  3  82  SER 82  82  82  SER SER D . n 
S  3  83  CYS 83  83  83  CYS CYS D . n 
S  3  84  VAL 84  84  84  VAL VAL D . n 
S  3  85  THR 85  85  85  THR THR D . n 
S  3  86  ALA 86  86  86  ALA ALA D . n 
S  3  87  VAL 87  87  87  VAL VAL D . n 
S  3  88  ALA 88  88  88  ALA ALA D . n 
S  3  89  ASP 89  89  89  ASP ASP D . n 
S  3  90  GLY 90  90  90  GLY GLY D . n 
S  3  91  MET 91  91  91  MET MET D . n 
S  3  92  VAL 92  92  92  VAL VAL D . n 
S  3  93  VAL 93  93  93  VAL VAL D . n 
S  3  94  ASP 94  94  94  ASP ASP D . n 
S  3  95  THR 95  95  95  THR THR D . n 
S  3  96  LEU 96  96  96  LEU LEU D . n 
S  3  97  SER 97  97  97  SER SER D . n 
S  3  98  ASP 98  98  98  ASP ASP D . n 
S  3  99  VAL 99  99  99  VAL VAL D . n 
S  3  100 VAL 100 100 100 VAL VAL D . n 
S  3  101 ARG 101 101 101 ARG ARG D . n 
S  3  102 GLU 102 102 102 GLU GLU D . n 
S  3  103 ALA 103 103 103 ALA ALA D . n 
S  3  104 GLN 104 104 104 GLN GLN D . n 
S  3  105 ALA 105 105 105 ALA ALA D . n 
S  3  106 GLY 106 106 106 GLY GLY D . n 
S  3  107 MET 107 107 107 MET MET D . n 
S  3  108 VAL 108 108 108 VAL VAL D . n 
S  3  109 GLU 109 109 109 GLU GLU D . n 
S  3  110 PHE 110 110 110 PHE PHE D . n 
S  3  111 THR 111 111 111 THR THR D . n 
S  3  112 LEU 112 112 112 LEU LEU D . n 
S  3  113 LEU 113 113 113 LEU LEU D . n 
S  3  114 ASN 114 114 114 ASN ASN D . n 
S  3  115 HIS 115 115 115 HIS HIS D . n 
S  3  116 PRO 116 116 116 PRO PRO D . n 
S  3  117 LEU 117 117 117 LEU LEU D . n 
S  3  118 ASP 118 118 118 ASP ASP D . n 
S  3  119 CYS 119 119 119 CYS CYS D . n 
S  3  120 PRO 120 120 120 PRO PRO D . n 
S  3  121 THR 121 121 121 THR THR D . n 
S  3  122 CYS 122 122 122 CYS CYS D . n 
S  3  123 ASP 123 123 123 ASP ASP D . n 
S  3  124 LYS 124 124 124 LYS LYS D . n 
S  3  125 GLY 125 125 125 GLY GLY D . n 
S  3  126 GLY 126 126 126 GLY GLY D . n 
S  3  127 ALA 127 127 127 ALA ALA D . n 
S  3  128 CYS 128 128 128 CYS CYS D . n 
S  3  129 GLU 129 129 129 GLU GLU D . n 
S  3  130 LEU 130 130 130 LEU LEU D . n 
S  3  131 GLN 131 131 131 GLN GLN D . n 
S  3  132 ASP 132 132 132 ASP ASP D . n 
S  3  133 ARG 133 133 133 ARG ARG D . n 
S  3  134 THR 134 134 134 THR THR D . n 
S  3  135 VAL 135 135 135 VAL VAL D . n 
S  3  136 GLU 136 136 136 GLU GLU D . n 
S  3  137 TYR 137 137 137 TYR TYR D . n 
S  3  138 GLY 138 138 138 GLY GLY D . n 
S  3  139 LEU 139 139 139 LEU LEU D . n 
S  3  140 TYR 140 140 140 TYR TYR D . n 
S  3  141 GLU 141 141 141 GLU GLU D . n 
S  3  142 LYS 142 142 142 LYS LYS D . n 
S  3  143 TYR 143 143 143 TYR TYR D . n 
S  3  144 TYR 144 144 ?   ?   ?   D . n 
S  3  145 GLN 145 145 ?   ?   ?   D . n 
S  3  146 LYS 146 146 ?   ?   ?   D . n 
S  3  147 GLY 147 147 ?   ?   ?   D . n 
S  3  148 PRO 148 148 148 PRO PRO D . n 
S  3  149 LEU 149 149 149 LEU LEU D . n 
S  3  150 GLU 150 150 150 GLU GLU D . n 
S  3  151 LEU 151 151 151 LEU LEU D . n 
S  3  152 PRO 152 152 152 PRO PRO D . n 
S  3  153 VAL 153 153 153 VAL VAL D . n 
S  3  154 TYR 154 154 154 TYR TYR D . n 
S  3  155 THR 155 155 155 THR THR D . n 
S  3  156 ARG 156 156 156 ARG ARG D . n 
S  3  157 PHE 157 157 157 PHE PHE D . n 
S  3  158 GLU 158 158 158 GLU GLU D . n 
S  3  159 PHE 159 159 159 PHE PHE D . n 
S  3  160 THR 160 160 160 THR THR D . n 
S  3  161 ARG 161 161 161 ARG ARG D . n 
S  3  162 ARG 162 162 162 ARG ARG D . n 
S  3  163 HIS 163 163 163 HIS HIS D . n 
S  3  164 VAL 164 164 164 VAL VAL D . n 
S  3  165 ASP 165 165 165 ASP ASP D . n 
S  3  166 LYS 166 166 166 LYS LYS D . n 
S  3  167 HIS 167 167 167 HIS HIS D . n 
S  3  168 HIS 168 168 168 HIS HIS D . n 
S  3  169 PRO 169 169 169 PRO PRO D . n 
S  3  170 LEU 170 170 170 LEU LEU D . n 
S  3  171 SER 171 171 171 SER SER D . n 
S  3  172 PRO 172 172 172 PRO PRO D . n 
S  3  173 PHE 173 173 173 PHE PHE D . n 
S  3  174 VAL 174 174 174 VAL VAL D . n 
S  3  175 ILE 175 175 175 ILE ILE D . n 
S  3  176 LEU 176 176 176 LEU LEU D . n 
S  3  177 ASP 177 177 177 ASP ASP D . n 
S  3  178 ARG 178 178 178 ARG ARG D . n 
S  3  179 GLU 179 179 179 GLU GLU D . n 
S  3  180 ARG 180 180 180 ARG ARG D . n 
S  3  181 CYS 181 181 181 CYS CYS D . n 
S  3  182 ILE 182 182 182 ILE ILE D . n 
S  3  183 HIS 183 183 183 HIS HIS D . n 
S  3  184 CYS 184 184 184 CYS CYS D . n 
S  3  185 LYS 185 185 185 LYS LYS D . n 
S  3  186 ARG 186 186 186 ARG ARG D . n 
S  3  187 CYS 187 187 187 CYS CYS D . n 
S  3  188 VAL 188 188 188 VAL VAL D . n 
S  3  189 ARG 189 189 189 ARG ARG D . n 
S  3  190 TYR 190 190 190 TYR TYR D . n 
S  3  191 PHE 191 191 191 PHE PHE D . n 
S  3  192 GLU 192 192 192 GLU GLU D . n 
S  3  193 GLU 193 193 193 GLU GLU D . n 
S  3  194 VAL 194 194 194 VAL VAL D . n 
S  3  195 PRO 195 195 195 PRO PRO D . n 
S  3  196 GLY 196 196 196 GLY GLY D . n 
S  3  197 ASP 197 197 197 ASP ASP D . n 
S  3  198 GLU 198 198 198 GLU GLU D . n 
S  3  199 VAL 199 199 199 VAL VAL D . n 
S  3  200 LEU 200 200 200 LEU LEU D . n 
S  3  201 ASP 201 201 201 ASP ASP D . n 
S  3  202 PHE 202 202 202 PHE PHE D . n 
S  3  203 ILE 203 203 203 ILE ILE D . n 
S  3  204 GLU 204 204 204 GLU GLU D . n 
S  3  205 ARG 205 205 205 ARG ARG D . n 
S  3  206 GLY 206 206 206 GLY GLY D . n 
S  3  207 VAL 207 207 207 VAL VAL D . n 
S  3  208 HIS 208 208 208 HIS HIS D . n 
S  3  209 THR 209 209 209 THR THR D . n 
S  3  210 PHE 210 210 210 PHE PHE D . n 
S  3  211 ILE 211 211 211 ILE ILE D . n 
S  3  212 GLY 212 212 212 GLY GLY D . n 
S  3  213 THR 213 213 213 THR THR D . n 
S  3  214 MET 214 214 214 MET MET D . n 
S  3  215 ASP 215 215 215 ASP ASP D . n 
S  3  216 PHE 216 216 216 PHE PHE D . n 
S  3  217 GLY 217 217 217 GLY GLY D . n 
S  3  218 LEU 218 218 218 LEU LEU D . n 
S  3  219 PRO 219 219 219 PRO PRO D . n 
S  3  220 SER 220 220 220 SER SER D . n 
S  3  221 GLY 221 221 221 GLY GLY D . n 
S  3  222 PHE 222 222 222 PHE PHE D . n 
S  3  223 SER 223 223 223 SER SER D . n 
S  3  224 GLY 224 224 224 GLY GLY D . n 
S  3  225 ASN 225 225 225 ASN ASN D . n 
S  3  226 ILE 226 226 226 ILE ILE D . n 
S  3  227 THR 227 227 227 THR THR D . n 
S  3  228 ASP 228 228 228 ASP ASP D . n 
S  3  229 ILE 229 229 229 ILE ILE D . n 
S  3  230 CYS 230 230 230 CYS CYS D . n 
S  3  231 PRO 231 231 231 PRO PRO D . n 
S  3  232 VAL 232 232 232 VAL VAL D . n 
S  3  233 GLY 233 233 233 GLY GLY D . n 
S  3  234 ALA 234 234 234 ALA ALA D . n 
S  3  235 LEU 235 235 235 LEU LEU D . n 
S  3  236 LEU 236 236 236 LEU LEU D . n 
S  3  237 ASP 237 237 237 ASP ASP D . n 
S  3  238 LEU 238 238 238 LEU LEU D . n 
S  3  239 THR 239 239 239 THR THR D . n 
S  3  240 ALA 240 240 240 ALA ALA D . n 
S  3  241 ARG 241 241 241 ARG ARG D . n 
S  3  242 PHE 242 242 242 PHE PHE D . n 
S  3  243 ARG 243 243 243 ARG ARG D . n 
S  3  244 ALA 244 244 244 ALA ALA D . n 
S  3  245 ARG 245 245 245 ARG ARG D . n 
S  3  246 ASN 246 246 246 ASN ASN D . n 
S  3  247 TRP 247 247 247 TRP TRP D . n 
S  3  248 GLU 248 248 248 GLU GLU D . n 
S  3  249 MET 249 249 249 MET MET D . n 
S  3  250 GLU 250 250 250 GLU GLU D . n 
S  3  251 GLU 251 251 251 GLU GLU D . n 
S  3  252 THR 252 252 252 THR THR D . n 
S  3  253 PRO 253 253 253 PRO PRO D . n 
S  3  254 THR 254 254 254 THR THR D . n 
S  3  255 THR 255 255 255 THR THR D . n 
S  3  256 CYS 256 256 256 CYS CYS D . n 
S  3  257 ALA 257 257 257 ALA ALA D . n 
S  3  258 LEU 258 258 258 LEU LEU D . n 
S  3  259 CYS 259 259 259 CYS CYS D . n 
S  3  260 PRO 260 260 260 PRO PRO D . n 
S  3  261 VAL 261 261 261 VAL VAL D . n 
S  3  262 GLY 262 262 262 GLY GLY D . n 
S  3  263 CYS 263 263 263 CYS CYS D . n 
S  3  264 GLY 264 264 264 GLY GLY D . n 
S  3  265 ILE 265 265 265 ILE ILE D . n 
S  3  266 THR 266 266 266 THR THR D . n 
S  3  267 ALA 267 267 267 ALA ALA D . n 
S  3  268 ASP 268 268 268 ASP ASP D . n 
S  3  269 THR 269 269 269 THR THR D . n 
S  3  270 ARG 270 270 270 ARG ARG D . n 
S  3  271 SER 271 271 271 SER SER D . n 
S  3  272 GLY 272 272 272 GLY GLY D . n 
S  3  273 GLU 273 273 273 GLU GLU D . n 
S  3  274 LEU 274 274 274 LEU LEU D . n 
S  3  275 LEU 275 275 275 LEU LEU D . n 
S  3  276 ARG 276 276 276 ARG ARG D . n 
S  3  277 ILE 277 277 277 ILE ILE D . n 
S  3  278 ARG 278 278 278 ARG ARG D . n 
S  3  279 ALA 279 279 279 ALA ALA D . n 
S  3  280 ARG 280 280 280 ARG ARG D . n 
S  3  281 GLU 281 281 281 GLU GLU D . n 
S  3  282 VAL 282 282 282 VAL VAL D . n 
S  3  283 PRO 283 283 283 PRO PRO D . n 
S  3  284 GLU 284 284 284 GLU GLU D . n 
S  3  285 VAL 285 285 285 VAL VAL D . n 
S  3  286 ASN 286 286 286 ASN ASN D . n 
S  3  287 GLU 287 287 287 GLU GLU D . n 
S  3  288 ILE 288 288 288 ILE ILE D . n 
S  3  289 TRP 289 289 289 TRP TRP D . n 
S  3  290 ILE 290 290 290 ILE ILE D . n 
S  3  291 CYS 291 291 291 CYS CYS D . n 
S  3  292 ASP 292 292 292 ASP ASP D . n 
S  3  293 ALA 293 293 293 ALA ALA D . n 
S  3  294 GLY 294 294 294 GLY GLY D . n 
S  3  295 ARG 295 295 295 ARG ARG D . n 
S  3  296 PHE 296 296 296 PHE PHE D . n 
S  3  297 GLY 297 297 297 GLY GLY D . n 
S  3  298 HIS 298 298 298 HIS HIS D . n 
S  3  299 GLU 299 299 299 GLU GLU D . n 
S  3  300 TRP 300 300 300 TRP TRP D . n 
S  3  301 ALA 301 301 301 ALA ALA D . n 
S  3  302 ASP 302 302 302 ASP ASP D . n 
S  3  303 GLN 303 303 303 GLN GLN D . n 
S  3  304 ASN 304 304 304 ASN ASN D . n 
S  3  305 ARG 305 305 305 ARG ARG D . n 
S  3  306 LEU 306 306 306 LEU LEU D . n 
S  3  307 LYS 307 307 307 LYS LYS D . n 
S  3  308 THR 308 308 308 THR THR D . n 
S  3  309 PRO 309 309 309 PRO PRO D . n 
S  3  310 LEU 310 310 310 LEU LEU D . n 
S  3  311 VAL 311 311 311 VAL VAL D . n 
S  3  312 ARG 312 312 312 ARG ARG D . n 
S  3  313 LYS 313 313 313 LYS LYS D . n 
S  3  314 GLU 314 314 314 GLU GLU D . n 
S  3  315 GLY 315 315 315 GLY GLY D . n 
S  3  316 ARG 316 316 316 ARG ARG D . n 
S  3  317 LEU 317 317 317 LEU LEU D . n 
S  3  318 VAL 318 318 318 VAL VAL D . n 
S  3  319 GLU 319 319 319 GLU GLU D . n 
S  3  320 ALA 320 320 320 ALA ALA D . n 
S  3  321 THR 321 321 321 THR THR D . n 
S  3  322 TRP 322 322 322 TRP TRP D . n 
S  3  323 GLU 323 323 323 GLU GLU D . n 
S  3  324 GLU 324 324 324 GLU GLU D . n 
S  3  325 ALA 325 325 325 ALA ALA D . n 
S  3  326 PHE 326 326 326 PHE PHE D . n 
S  3  327 LEU 327 327 327 LEU LEU D . n 
S  3  328 ALA 328 328 328 ALA ALA D . n 
S  3  329 LEU 329 329 329 LEU LEU D . n 
S  3  330 LYS 330 330 330 LYS LYS D . n 
S  3  331 GLU 331 331 331 GLU GLU D . n 
S  3  332 GLY 332 332 332 GLY GLY D . n 
S  3  333 LEU 333 333 333 LEU LEU D . n 
S  3  334 LYS 334 334 334 LYS LYS D . n 
S  3  335 GLU 335 335 335 GLU GLU D . n 
S  3  336 ALA 336 336 336 ALA ALA D . n 
S  3  337 ARG 337 337 337 ARG ARG D . n 
S  3  338 GLY 338 338 338 GLY GLY D . n 
S  3  339 GLU 339 339 339 GLU GLU D . n 
S  3  340 GLU 340 340 340 GLU GLU D . n 
S  3  341 VAL 341 341 341 VAL VAL D . n 
S  3  342 GLY 342 342 342 GLY GLY D . n 
S  3  343 LEU 343 343 343 LEU LEU D . n 
S  3  344 TYR 344 344 344 TYR TYR D . n 
S  3  345 LEU 345 345 345 LEU LEU D . n 
S  3  346 ALA 346 346 346 ALA ALA D . n 
S  3  347 HIS 347 347 347 HIS HIS D . n 
S  3  348 ASP 348 348 348 ASP ASP D . n 
S  3  349 ALA 349 349 349 ALA ALA D . n 
S  3  350 THR 350 350 350 THR THR D . n 
S  3  351 LEU 351 351 351 LEU LEU D . n 
S  3  352 GLU 352 352 352 GLU GLU D . n 
S  3  353 GLU 353 353 353 GLU GLU D . n 
S  3  354 GLY 354 354 354 GLY GLY D . n 
S  3  355 LEU 355 355 355 LEU LEU D . n 
S  3  356 LEU 356 356 356 LEU LEU D . n 
S  3  357 ALA 357 357 357 ALA ALA D . n 
S  3  358 SER 358 358 358 SER SER D . n 
S  3  359 GLU 359 359 359 GLU GLU D . n 
S  3  360 LEU 360 360 360 LEU LEU D . n 
S  3  361 ALA 361 361 361 ALA ALA D . n 
S  3  362 LYS 362 362 362 LYS LYS D . n 
S  3  363 ALA 363 363 363 ALA ALA D . n 
S  3  364 LEU 364 364 364 LEU LEU D . n 
S  3  365 LYS 365 365 365 LYS LYS D . n 
S  3  366 THR 366 366 366 THR THR D . n 
S  3  367 PRO 367 367 367 PRO PRO D . n 
S  3  368 HIS 368 368 368 HIS HIS D . n 
S  3  369 LEU 369 369 369 LEU LEU D . n 
S  3  370 ASP 370 370 370 ASP ASP D . n 
S  3  371 PHE 371 371 371 PHE PHE D . n 
S  3  372 GLN 372 372 372 GLN GLN D . n 
S  3  373 GLY 373 373 373 GLY GLY D . n 
S  3  374 ARG 374 374 374 ARG ARG D . n 
S  3  375 THR 375 375 375 THR THR D . n 
S  3  376 ALA 376 376 376 ALA ALA D . n 
S  3  377 ALA 377 377 377 ALA ALA D . n 
S  3  378 PRO 378 378 378 PRO PRO D . n 
S  3  379 ALA 379 379 379 ALA ALA D . n 
S  3  380 SER 380 380 380 SER SER D . n 
S  3  381 LEU 381 381 381 LEU LEU D . n 
S  3  382 PHE 382 382 382 PHE PHE D . n 
S  3  383 PRO 383 383 383 PRO PRO D . n 
S  3  384 PRO 384 384 384 PRO PRO D . n 
S  3  385 ALA 385 385 385 ALA ALA D . n 
S  3  386 SER 386 386 386 SER SER D . n 
S  3  387 LEU 387 387 387 LEU LEU D . n 
S  3  388 GLU 388 388 388 GLU GLU D . n 
S  3  389 ASP 389 389 389 ASP ASP D . n 
S  3  390 LEU 390 390 390 LEU LEU D . n 
S  3  391 LEU 391 391 391 LEU LEU D . n 
S  3  392 GLN 392 392 392 GLN GLN D . n 
S  3  393 ALA 393 393 393 ALA ALA D . n 
S  3  394 ASP 394 394 394 ASP ASP D . n 
S  3  395 PHE 395 395 395 PHE PHE D . n 
S  3  396 ALA 396 396 396 ALA ALA D . n 
S  3  397 LEU 397 397 397 LEU LEU D . n 
S  3  398 VAL 398 398 398 VAL VAL D . n 
S  3  399 LEU 399 399 399 LEU LEU D . n 
S  3  400 GLY 400 400 400 GLY GLY D . n 
S  3  401 ASP 401 401 401 ASP ASP D . n 
S  3  402 PRO 402 402 402 PRO PRO D . n 
S  3  403 THR 403 403 403 THR THR D . n 
S  3  404 GLU 404 404 404 GLU GLU D . n 
S  3  405 GLU 405 405 405 GLU GLU D . n 
S  3  406 ALA 406 406 406 ALA ALA D . n 
S  3  407 PRO 407 407 407 PRO PRO D . n 
S  3  408 ILE 408 408 408 ILE ILE D . n 
S  3  409 LEU 409 409 409 LEU LEU D . n 
S  3  410 HIS 410 410 410 HIS HIS D . n 
S  3  411 LEU 411 411 411 LEU LEU D . n 
S  3  412 ARG 412 412 412 ARG ARG D . n 
S  3  413 LEU 413 413 413 LEU LEU D . n 
S  3  414 SER 414 414 414 SER SER D . n 
S  3  415 GLU 415 415 415 GLU GLU D . n 
S  3  416 PHE 416 416 416 PHE PHE D . n 
S  3  417 VAL 417 417 417 VAL VAL D . n 
S  3  418 ARG 418 418 418 ARG ARG D . n 
S  3  419 ASP 419 419 419 ASP ASP D . n 
S  3  420 LEU 420 420 420 LEU LEU D . n 
S  3  421 LYS 421 421 421 LYS LYS D . n 
S  3  422 PRO 422 422 422 PRO PRO D . n 
S  3  423 PRO 423 423 423 PRO PRO D . n 
S  3  424 HIS 424 424 424 HIS HIS D . n 
S  3  425 ARG 425 425 425 ARG ARG D . n 
S  3  426 TYR 426 426 426 TYR TYR D . n 
S  3  427 ASN 427 427 427 ASN ASN D . n 
S  3  428 HIS 428 428 428 HIS HIS D . n 
S  3  429 GLY 429 429 429 GLY GLY D . n 
S  3  430 THR 430 430 430 THR THR D . n 
S  3  431 PRO 431 431 431 PRO PRO D . n 
S  3  432 PHE 432 432 432 PHE PHE D . n 
S  3  433 ALA 433 433 433 ALA ALA D . n 
S  3  434 ASP 434 434 434 ASP ASP D . n 
S  3  435 LEU 435 435 435 LEU LEU D . n 
S  3  436 GLN 436 436 436 GLN GLN D . n 
S  3  437 ILE 437 437 437 ILE ILE D . n 
S  3  438 LYS 438 438 438 LYS LYS D . n 
S  3  439 GLU 439 439 439 GLU GLU D . n 
S  3  440 ARG 440 440 440 ARG ARG D . n 
S  3  441 MET 441 441 441 MET MET D . n 
S  3  442 PRO 442 442 442 PRO PRO D . n 
S  3  443 ARG 443 443 443 ARG ARG D . n 
S  3  444 ARG 444 444 444 ARG ARG D . n 
S  3  445 THR 445 445 445 THR THR D . n 
S  3  446 ASP 446 446 446 ASP ASP D . n 
S  3  447 LYS 447 447 447 LYS LYS D . n 
S  3  448 MET 448 448 448 MET MET D . n 
S  3  449 ALA 449 449 449 ALA ALA D . n 
S  3  450 LEU 450 450 450 LEU LEU D . n 
S  3  451 PHE 451 451 451 PHE PHE D . n 
S  3  452 ALA 452 452 452 ALA ALA D . n 
S  3  453 PRO 453 453 453 PRO PRO D . n 
S  3  454 TYR 454 454 454 TYR TYR D . n 
S  3  455 ARG 455 455 455 ARG ARG D . n 
S  3  456 ALA 456 456 456 ALA ALA D . n 
S  3  457 PRO 457 457 457 PRO PRO D . n 
S  3  458 LEU 458 458 458 LEU LEU D . n 
S  3  459 MET 459 459 459 MET MET D . n 
S  3  460 LYS 460 460 460 LYS LYS D . n 
S  3  461 TRP 461 461 461 TRP TRP D . n 
S  3  462 ALA 462 462 462 ALA ALA D . n 
S  3  463 ALA 463 463 463 ALA ALA D . n 
S  3  464 ILE 464 464 464 ILE ILE D . n 
S  3  465 HIS 465 465 465 HIS HIS D . n 
S  3  466 GLU 466 466 466 GLU GLU D . n 
S  3  467 VAL 467 467 467 VAL VAL D . n 
S  3  468 HIS 468 468 468 HIS HIS D . n 
S  3  469 ARG 469 469 469 ARG ARG D . n 
S  3  470 PRO 470 470 470 PRO PRO D . n 
S  3  471 GLY 471 471 471 GLY GLY D . n 
S  3  472 GLU 472 472 472 GLU GLU D . n 
S  3  473 GLU 473 473 473 GLU GLU D . n 
S  3  474 ARG 474 474 474 ARG ARG D . n 
S  3  475 GLU 475 475 475 GLU GLU D . n 
S  3  476 ILE 476 476 476 ILE ILE D . n 
S  3  477 LEU 477 477 477 LEU LEU D . n 
S  3  478 LEU 478 478 478 LEU LEU D . n 
S  3  479 ALA 479 479 479 ALA ALA D . n 
S  3  480 LEU 480 480 480 LEU LEU D . n 
S  3  481 LEU 481 481 481 LEU LEU D . n 
S  3  482 GLY 482 482 482 GLY GLY D . n 
S  3  483 ASP 483 483 483 ASP ASP D . n 
S  3  484 LYS 484 484 484 LYS LYS D . n 
S  3  485 GLU 485 485 485 GLU GLU D . n 
S  3  486 GLY 486 486 486 GLY GLY D . n 
S  3  487 SER 487 487 487 SER SER D . n 
S  3  488 GLU 488 488 488 GLU GLU D . n 
S  3  489 MET 489 489 489 MET MET D . n 
S  3  490 VAL 490 490 490 VAL VAL D . n 
S  3  491 ALA 491 491 491 ALA ALA D . n 
S  3  492 LYS 492 492 492 LYS LYS D . n 
S  3  493 ALA 493 493 493 ALA ALA D . n 
S  3  494 LYS 494 494 494 LYS LYS D . n 
S  3  495 GLU 495 495 495 GLU GLU D . n 
S  3  496 ALA 496 496 496 ALA ALA D . n 
S  3  497 TRP 497 497 497 TRP TRP D . n 
S  3  498 GLU 498 498 498 GLU GLU D . n 
S  3  499 LYS 499 499 499 LYS LYS D . n 
S  3  500 ALA 500 500 500 ALA ALA D . n 
S  3  501 LYS 501 501 501 LYS LYS D . n 
S  3  502 ASN 502 502 502 ASN ASN D . n 
S  3  503 PRO 503 503 503 PRO PRO D . n 
S  3  504 VAL 504 504 504 VAL VAL D . n 
S  3  505 LEU 505 505 505 LEU LEU D . n 
S  3  506 ILE 506 506 506 ILE ILE D . n 
S  3  507 LEU 507 507 507 LEU LEU D . n 
S  3  508 GLY 508 508 508 GLY GLY D . n 
S  3  509 ALA 509 509 509 ALA ALA D . n 
S  3  510 GLY 510 510 510 GLY GLY D . n 
S  3  511 VAL 511 511 511 VAL VAL D . n 
S  3  512 LEU 512 512 512 LEU LEU D . n 
S  3  513 GLN 513 513 513 GLN GLN D . n 
S  3  514 ASP 514 514 514 ASP ASP D . n 
S  3  515 THR 515 515 515 THR THR D . n 
S  3  516 VAL 516 516 516 VAL VAL D . n 
S  3  517 ALA 517 517 517 ALA ALA D . n 
S  3  518 ALA 518 518 518 ALA ALA D . n 
S  3  519 GLU 519 519 519 GLU GLU D . n 
S  3  520 ARG 520 520 520 ARG ARG D . n 
S  3  521 ALA 521 521 521 ALA ALA D . n 
S  3  522 ARG 522 522 522 ARG ARG D . n 
S  3  523 LEU 523 523 523 LEU LEU D . n 
S  3  524 LEU 524 524 524 LEU LEU D . n 
S  3  525 ALA 525 525 525 ALA ALA D . n 
S  3  526 GLU 526 526 526 GLU GLU D . n 
S  3  527 ARG 527 527 527 ARG ARG D . n 
S  3  528 LYS 528 528 528 LYS LYS D . n 
S  3  529 GLY 529 529 529 GLY GLY D . n 
S  3  530 ALA 530 530 530 ALA ALA D . n 
S  3  531 LYS 531 531 531 LYS LYS D . n 
S  3  532 VAL 532 532 532 VAL VAL D . n 
S  3  533 LEU 533 533 533 LEU LEU D . n 
S  3  534 ALA 534 534 534 ALA ALA D . n 
S  3  535 MET 535 535 535 MET MET D . n 
S  3  536 THR 536 536 536 THR THR D . n 
S  3  537 PRO 537 537 537 PRO PRO D . n 
S  3  538 ALA 538 538 538 ALA ALA D . n 
S  3  539 ALA 539 539 539 ALA ALA D . n 
S  3  540 ASN 540 540 540 ASN ASN D . n 
S  3  541 ALA 541 541 541 ALA ALA D . n 
S  3  542 ARG 542 542 542 ARG ARG D . n 
S  3  543 GLY 543 543 543 GLY GLY D . n 
S  3  544 LEU 544 544 544 LEU LEU D . n 
S  3  545 GLU 545 545 545 GLU GLU D . n 
S  3  546 ALA 546 546 546 ALA ALA D . n 
S  3  547 MET 547 547 547 MET MET D . n 
S  3  548 GLY 548 548 548 GLY GLY D . n 
S  3  549 VAL 549 549 549 VAL VAL D . n 
S  3  550 LEU 550 550 550 LEU LEU D . n 
S  3  551 PRO 551 551 551 PRO PRO D . n 
S  3  552 GLY 552 552 552 GLY GLY D . n 
S  3  553 ALA 553 553 553 ALA ALA D . n 
S  3  554 LYS 554 554 554 LYS LYS D . n 
S  3  555 GLY 555 555 555 GLY GLY D . n 
S  3  556 ALA 556 556 556 ALA ALA D . n 
S  3  557 SER 557 557 557 SER SER D . n 
S  3  558 TRP 558 558 558 TRP TRP D . n 
S  3  559 ASP 559 559 559 ASP ASP D . n 
S  3  560 GLU 560 560 560 GLU GLU D . n 
S  3  561 PRO 561 561 561 PRO PRO D . n 
S  3  562 GLY 562 562 562 GLY GLY D . n 
S  3  563 ALA 563 563 563 ALA ALA D . n 
S  3  564 LEU 564 564 564 LEU LEU D . n 
S  3  565 TYR 565 565 565 TYR TYR D . n 
S  3  566 ALA 566 566 566 ALA ALA D . n 
S  3  567 TYR 567 567 567 TYR TYR D . n 
S  3  568 TYR 568 568 568 TYR TYR D . n 
S  3  569 GLY 569 569 569 GLY GLY D . n 
S  3  570 PHE 570 570 570 PHE PHE D . n 
S  3  571 VAL 571 571 571 VAL VAL D . n 
S  3  572 PRO 572 572 572 PRO PRO D . n 
S  3  573 PRO 573 573 573 PRO PRO D . n 
S  3  574 GLU 574 574 574 GLU GLU D . n 
S  3  575 GLU 575 575 575 GLU GLU D . n 
S  3  576 ALA 576 576 576 ALA ALA D . n 
S  3  577 LEU 577 577 577 LEU LEU D . n 
S  3  578 LYS 578 578 578 LYS LYS D . n 
S  3  579 GLY 579 579 579 GLY GLY D . n 
S  3  580 LYS 580 580 580 LYS LYS D . n 
S  3  581 ARG 581 581 581 ARG ARG D . n 
S  3  582 PHE 582 582 582 PHE PHE D . n 
S  3  583 VAL 583 583 583 VAL VAL D . n 
S  3  584 VAL 584 584 584 VAL VAL D . n 
S  3  585 MET 585 585 585 MET MET D . n 
S  3  586 HIS 586 586 586 HIS HIS D . n 
S  3  587 LEU 587 587 587 LEU LEU D . n 
S  3  588 SER 588 588 588 SER SER D . n 
S  3  589 HIS 589 589 589 HIS HIS D . n 
S  3  590 LEU 590 590 590 LEU LEU D . n 
S  3  591 HIS 591 591 591 HIS HIS D . n 
S  3  592 PRO 592 592 592 PRO PRO D . n 
S  3  593 LEU 593 593 593 LEU LEU D . n 
S  3  594 ALA 594 594 594 ALA ALA D . n 
S  3  595 GLU 595 595 595 GLU GLU D . n 
S  3  596 ARG 596 596 596 ARG ARG D . n 
S  3  597 TYR 597 597 597 TYR TYR D . n 
S  3  598 ALA 598 598 598 ALA ALA D . n 
S  3  599 HIS 599 599 599 HIS HIS D . n 
S  3  600 VAL 600 600 600 VAL VAL D . n 
S  3  601 VAL 601 601 601 VAL VAL D . n 
S  3  602 LEU 602 602 602 LEU LEU D . n 
S  3  603 PRO 603 603 603 PRO PRO D . n 
S  3  604 ALA 604 604 604 ALA ALA D . n 
S  3  605 PRO 605 605 605 PRO PRO D . n 
S  3  606 THR 606 606 606 THR THR D . n 
S  3  607 PHE 607 607 607 PHE PHE D . n 
S  3  608 TYR 608 608 608 TYR TYR D . n 
S  3  609 GLU 609 609 609 GLU GLU D . n 
S  3  610 LYS 610 610 610 LYS LYS D . n 
S  3  611 ARG 611 611 611 ARG ARG D . n 
S  3  612 GLY 612 612 612 GLY GLY D . n 
S  3  613 HIS 613 613 613 HIS HIS D . n 
S  3  614 LEU 614 614 614 LEU LEU D . n 
S  3  615 VAL 615 615 615 VAL VAL D . n 
S  3  616 ASN 616 616 616 ASN ASN D . n 
S  3  617 LEU 617 617 617 LEU LEU D . n 
S  3  618 GLU 618 618 618 GLU GLU D . n 
S  3  619 GLY 619 619 619 GLY GLY D . n 
S  3  620 ARG 620 620 620 ARG ARG D . n 
S  3  621 VAL 621 621 621 VAL VAL D . n 
S  3  622 LEU 622 622 622 LEU LEU D . n 
S  3  623 PRO 623 623 623 PRO PRO D . n 
S  3  624 LEU 624 624 624 LEU LEU D . n 
S  3  625 SER 625 625 625 SER SER D . n 
S  3  626 PRO 626 626 626 PRO PRO D . n 
S  3  627 ALA 627 627 627 ALA ALA D . n 
S  3  628 PRO 628 628 628 PRO PRO D . n 
S  3  629 ILE 629 629 629 ILE ILE D . n 
S  3  630 GLU 630 630 630 GLU GLU D . n 
S  3  631 ASN 631 631 631 ASN ASN D . n 
S  3  632 GLY 632 632 632 GLY GLY D . n 
S  3  633 GLU 633 633 633 GLU GLU D . n 
S  3  634 ALA 634 634 634 ALA ALA D . n 
S  3  635 GLU 635 635 635 GLU GLU D . n 
S  3  636 GLY 636 636 636 GLY GLY D . n 
S  3  637 ALA 637 637 637 ALA ALA D . n 
S  3  638 LEU 638 638 638 LEU LEU D . n 
S  3  639 GLN 639 639 639 GLN GLN D . n 
S  3  640 VAL 640 640 640 VAL VAL D . n 
S  3  641 LEU 641 641 641 LEU LEU D . n 
S  3  642 ALA 642 642 642 ALA ALA D . n 
S  3  643 LEU 643 643 643 LEU LEU D . n 
S  3  644 LEU 644 644 644 LEU LEU D . n 
S  3  645 ALA 645 645 645 ALA ALA D . n 
S  3  646 GLU 646 646 646 GLU GLU D . n 
S  3  647 ALA 647 647 647 ALA ALA D . n 
S  3  648 LEU 648 648 648 LEU LEU D . n 
S  3  649 GLY 649 649 649 GLY GLY D . n 
S  3  650 VAL 650 650 650 VAL VAL D . n 
S  3  651 ARG 651 651 651 ARG ARG D . n 
S  3  652 PRO 652 652 652 PRO PRO D . n 
S  3  653 PRO 653 653 653 PRO PRO D . n 
S  3  654 PHE 654 654 654 PHE PHE D . n 
S  3  655 ARG 655 655 655 ARG ARG D . n 
S  3  656 LEU 656 656 656 LEU LEU D . n 
S  3  657 HIS 657 657 657 HIS HIS D . n 
S  3  658 LEU 658 658 658 LEU LEU D . n 
S  3  659 GLU 659 659 659 GLU GLU D . n 
S  3  660 ALA 660 660 660 ALA ALA D . n 
S  3  661 GLN 661 661 661 GLN GLN D . n 
S  3  662 LYS 662 662 662 LYS LYS D . n 
S  3  663 ALA 663 663 663 ALA ALA D . n 
S  3  664 LEU 664 664 664 LEU LEU D . n 
S  3  665 LYS 665 665 665 LYS LYS D . n 
S  3  666 ALA 666 666 666 ALA ALA D . n 
S  3  667 ARG 667 667 667 ARG ARG D . n 
S  3  668 LYS 668 668 668 LYS LYS D . n 
S  3  669 VAL 669 669 669 VAL VAL D . n 
S  3  670 PRO 670 670 670 PRO PRO D . n 
S  3  671 GLU 671 671 671 GLU GLU D . n 
S  3  672 ALA 672 672 672 ALA ALA D . n 
S  3  673 MET 673 673 673 MET MET D . n 
S  3  674 GLY 674 674 674 GLY GLY D . n 
S  3  675 ARG 675 675 675 ARG ARG D . n 
S  3  676 LEU 676 676 676 LEU LEU D . n 
S  3  677 SER 677 677 677 SER SER D . n 
S  3  678 PHE 678 678 678 PHE PHE D . n 
S  3  679 ARG 679 679 679 ARG ARG D . n 
S  3  680 LEU 680 680 680 LEU LEU D . n 
S  3  681 LYS 681 681 681 LYS LYS D . n 
S  3  682 GLU 682 682 682 GLU GLU D . n 
S  3  683 LEU 683 683 683 LEU LEU D . n 
S  3  684 ARG 684 684 684 ARG ARG D . n 
S  3  685 PRO 685 685 685 PRO PRO D . n 
S  3  686 LYS 686 686 686 LYS LYS D . n 
S  3  687 GLU 687 687 687 GLU GLU D . n 
S  3  688 ARG 688 688 688 ARG ARG D . n 
S  3  689 LYS 689 689 689 LYS LYS D . n 
S  3  690 GLY 690 690 690 GLY GLY D . n 
S  3  691 ALA 691 691 691 ALA ALA D . n 
S  3  692 PHE 692 692 692 PHE PHE D . n 
S  3  693 TYR 693 693 693 TYR TYR D . n 
S  3  694 LEU 694 694 694 LEU LEU D . n 
S  3  695 ARG 695 695 695 ARG ARG D . n 
S  3  696 PRO 696 696 696 PRO PRO D . n 
S  3  697 THR 697 697 697 THR THR D . n 
S  3  698 MET 698 698 698 MET MET D . n 
S  3  699 TRP 699 699 699 TRP TRP D . n 
S  3  700 LYS 700 700 700 LYS LYS D . n 
S  3  701 ALA 701 701 701 ALA ALA D . n 
S  3  702 HIS 702 702 702 HIS HIS D . n 
S  3  703 GLN 703 703 703 GLN GLN D . n 
S  3  704 ALA 704 704 704 ALA ALA D . n 
S  3  705 VAL 705 705 705 VAL VAL D . n 
S  3  706 GLY 706 706 706 GLY GLY D . n 
S  3  707 LYS 707 707 707 LYS LYS D . n 
S  3  708 ALA 708 708 708 ALA ALA D . n 
S  3  709 GLN 709 709 709 GLN GLN D . n 
S  3  710 GLU 710 710 710 GLU GLU D . n 
S  3  711 ALA 711 711 711 ALA ALA D . n 
S  3  712 ALA 712 712 712 ALA ALA D . n 
S  3  713 ARG 713 713 713 ARG ARG D . n 
S  3  714 ALA 714 714 714 ALA ALA D . n 
S  3  715 GLU 715 715 715 GLU GLU D . n 
S  3  716 LEU 716 716 716 LEU LEU D . n 
S  3  717 TRP 717 717 717 TRP TRP D . n 
S  3  718 ALA 718 718 718 ALA ALA D . n 
S  3  719 HIS 719 719 719 HIS HIS D . n 
S  3  720 PRO 720 720 720 PRO PRO D . n 
S  3  721 GLU 721 721 721 GLU GLU D . n 
S  3  722 THR 722 722 722 THR THR D . n 
S  3  723 ALA 723 723 723 ALA ALA D . n 
S  3  724 ARG 724 724 724 ARG ARG D . n 
S  3  725 ALA 725 725 725 ALA ALA D . n 
S  3  726 GLU 726 726 726 GLU GLU D . n 
S  3  727 ALA 727 727 727 ALA ALA D . n 
S  3  728 LEU 728 728 728 LEU LEU D . n 
S  3  729 PRO 729 729 729 PRO PRO D . n 
S  3  730 GLU 730 730 730 GLU GLU D . n 
S  3  731 GLY 731 731 731 GLY GLY D . n 
S  3  732 ALA 732 732 732 ALA ALA D . n 
S  3  733 GLN 733 733 733 GLN GLN D . n 
S  3  734 VAL 734 734 734 VAL VAL D . n 
S  3  735 ALA 735 735 735 ALA ALA D . n 
S  3  736 VAL 736 736 736 VAL VAL D . n 
S  3  737 GLU 737 737 737 GLU GLU D . n 
S  3  738 THR 738 738 738 THR THR D . n 
S  3  739 PRO 739 739 739 PRO PRO D . n 
S  3  740 PHE 740 740 740 PHE PHE D . n 
S  3  741 GLY 741 741 741 GLY GLY D . n 
S  3  742 ARG 742 742 742 ARG ARG D . n 
S  3  743 VAL 743 743 743 VAL VAL D . n 
S  3  744 GLU 744 744 744 GLU GLU D . n 
S  3  745 ALA 745 745 745 ALA ALA D . n 
S  3  746 ARG 746 746 746 ARG ARG D . n 
S  3  747 VAL 747 747 747 VAL VAL D . n 
S  3  748 VAL 748 748 748 VAL VAL D . n 
S  3  749 HIS 749 749 749 HIS HIS D . n 
S  3  750 ARG 750 750 750 ARG ARG D . n 
S  3  751 GLU 751 751 751 GLU GLU D . n 
S  3  752 ASP 752 752 752 ASP ASP D . n 
S  3  753 VAL 753 753 753 VAL VAL D . n 
S  3  754 PRO 754 754 754 PRO PRO D . n 
S  3  755 LYS 755 755 755 LYS LYS D . n 
S  3  756 GLY 756 756 756 GLY GLY D . n 
S  3  757 HIS 757 757 757 HIS HIS D . n 
S  3  758 LEU 758 758 758 LEU LEU D . n 
S  3  759 TYR 759 759 759 TYR TYR D . n 
S  3  760 LEU 760 760 760 LEU LEU D . n 
S  3  761 SER 761 761 761 SER SER D . n 
S  3  762 ALA 762 762 762 ALA ALA D . n 
S  3  763 LEU 763 763 763 LEU LEU D . n 
S  3  764 GLY 764 764 764 GLY GLY D . n 
S  3  765 PRO 765 765 765 PRO PRO D . n 
S  3  766 ALA 766 766 766 ALA ALA D . n 
S  3  767 ALA 767 767 767 ALA ALA D . n 
S  3  768 GLY 768 768 768 GLY GLY D . n 
S  3  769 LEU 769 769 769 LEU LEU D . n 
S  3  770 ARG 770 770 770 ARG ARG D . n 
S  3  771 VAL 771 771 771 VAL VAL D . n 
S  3  772 GLU 772 772 772 GLU GLU D . n 
S  3  773 GLY 773 773 773 GLY GLY D . n 
S  3  774 ARG 774 774 774 ARG ARG D . n 
S  3  775 VAL 775 775 775 VAL VAL D . n 
S  3  776 LEU 776 776 776 LEU LEU D . n 
S  3  777 VAL 777 777 777 VAL VAL D . n 
S  3  778 PRO 778 778 ?   ?   ?   D . n 
S  3  779 ALA 779 779 ?   ?   ?   D . n 
S  3  780 GLY 780 780 ?   ?   ?   D . n 
S  3  781 GLY 781 781 ?   ?   ?   D . n 
S  3  782 GLU 782 782 ?   ?   ?   D . n 
S  3  783 ALA 783 783 ?   ?   ?   D . n 
T  4  1   MET 1   1   ?   ?   ?   E . n 
T  4  2   ARG 2   2   ?   ?   ?   E . n 
T  4  3   GLU 3   3   ?   ?   ?   E . n 
T  4  4   GLU 4   4   ?   ?   ?   E . n 
T  4  5   PHE 5   5   ?   ?   ?   E . n 
T  4  6   LEU 6   6   ?   ?   ?   E . n 
T  4  7   GLU 7   7   ?   ?   ?   E . n 
T  4  8   GLU 8   8   ?   ?   ?   E . n 
T  4  9   ILE 9   9   ?   ?   ?   E . n 
T  4  10  PRO 10  10  ?   ?   ?   E . n 
T  4  11  LEU 11  11  ?   ?   ?   E . n 
T  4  12  ASP 12  12  ?   ?   ?   E . n 
T  4  13  ALA 13  13  ?   ?   ?   E . n 
T  4  14  PRO 14  14  ?   ?   ?   E . n 
T  4  15  PRO 15  15  ?   ?   ?   E . n 
T  4  16  GLU 16  16  ?   ?   ?   E . n 
T  4  17  GLU 17  17  ?   ?   ?   E . n 
T  4  18  ALA 18  18  ?   ?   ?   E . n 
T  4  19  LYS 19  19  ?   ?   ?   E . n 
T  4  20  GLU 20  20  ?   ?   ?   E . n 
T  4  21  LEU 21  21  ?   ?   ?   E . n 
T  4  22  ARG 22  22  ?   ?   ?   E . n 
T  4  23  THR 23  23  ?   ?   ?   E . n 
T  4  24  GLU 24  24  ?   ?   ?   E . n 
T  4  25  VAL 25  25  ?   ?   ?   E . n 
T  4  26  MET 26  26  26  MET MET E . n 
T  4  27  THR 27  27  27  THR THR E . n 
T  4  28  LEU 28  28  28  LEU LEU E . n 
T  4  29  ASN 29  29  29  ASN ASN E . n 
T  4  30  VAL 30  30  30  VAL VAL E . n 
T  4  31  GLY 31  31  31  GLY GLY E . n 
T  4  32  PRO 32  32  32  PRO PRO E . n 
T  4  33  GLN 33  33  33  GLN GLN E . n 
T  4  34  HIS 34  34  34  HIS HIS E . n 
T  4  35  PRO 35  35  35  PRO PRO E . n 
T  4  36  SER 36  36  36  SER SER E . n 
T  4  37  THR 37  37  37  THR THR E . n 
T  4  38  HIS 38  38  38  HIS HIS E . n 
T  4  39  GLY 39  39  39  GLY GLY E . n 
T  4  40  VAL 40  40  40  VAL VAL E . n 
T  4  41  LEU 41  41  41  LEU LEU E . n 
T  4  42  ARG 42  42  42  ARG ARG E . n 
T  4  43  LEU 43  43  43  LEU LEU E . n 
T  4  44  MET 44  44  44  MET MET E . n 
T  4  45  VAL 45  45  45  VAL VAL E . n 
T  4  46  THR 46  46  46  THR THR E . n 
T  4  47  LEU 47  47  47  LEU LEU E . n 
T  4  48  SER 48  48  48  SER SER E . n 
T  4  49  GLY 49  49  49  GLY GLY E . n 
T  4  50  GLU 50  50  50  GLU GLU E . n 
T  4  51  GLU 51  51  51  GLU GLU E . n 
T  4  52  VAL 52  52  52  VAL VAL E . n 
T  4  53  LEU 53  53  53  LEU LEU E . n 
T  4  54  GLU 54  54  54  GLU GLU E . n 
T  4  55  VAL 55  55  55  VAL VAL E . n 
T  4  56  VAL 56  56  56  VAL VAL E . n 
T  4  57  PRO 57  57  57  PRO PRO E . n 
T  4  58  HIS 58  58  58  HIS HIS E . n 
T  4  59  ILE 59  59  59  ILE ILE E . n 
T  4  60  GLY 60  60  60  GLY GLY E . n 
T  4  61  TYR 61  61  61  TYR TYR E . n 
T  4  62  LEU 62  62  62  LEU LEU E . n 
T  4  63  HIS 63  63  63  HIS HIS E . n 
T  4  64  THR 64  64  64  THR THR E . n 
T  4  65  GLY 65  65  65  GLY GLY E . n 
T  4  66  PHE 66  66  66  PHE PHE E . n 
T  4  67  GLU 67  67  67  GLU GLU E . n 
T  4  68  LYS 68  68  68  LYS LYS E . n 
T  4  69  THR 69  69  69  THR THR E . n 
T  4  70  MET 70  70  70  MET MET E . n 
T  4  71  GLU 71  71  71  GLU GLU E . n 
T  4  72  HIS 72  72  72  HIS HIS E . n 
T  4  73  ARG 73  73  73  ARG ARG E . n 
T  4  74  THR 74  74  74  THR THR E . n 
T  4  75  TYR 75  75  75  TYR TYR E . n 
T  4  76  LEU 76  76  76  LEU LEU E . n 
T  4  77  GLN 77  77  77  GLN GLN E . n 
T  4  78  ASN 78  78  78  ASN ASN E . n 
T  4  79  ILE 79  79  79  ILE ILE E . n 
T  4  80  THR 80  80  80  THR THR E . n 
T  4  81  TYR 81  81  81  TYR TYR E . n 
T  4  82  THR 82  82  82  THR THR E . n 
T  4  83  PRO 83  83  83  PRO PRO E . n 
T  4  84  ARG 84  84  84  ARG ARG E . n 
T  4  85  MET 85  85  85  MET MET E . n 
T  4  86  ASP 86  86  86  ASP ASP E . n 
T  4  87  TYR 87  87  87  TYR TYR E . n 
T  4  88  LEU 88  88  88  LEU LEU E . n 
T  4  89  HIS 89  89  89  HIS HIS E . n 
T  4  90  SER 90  90  90  SER SER E . n 
T  4  91  PHE 91  91  91  PHE PHE E . n 
T  4  92  ALA 92  92  92  ALA ALA E . n 
T  4  93  HIS 93  93  93  HIS HIS E . n 
T  4  94  ASP 94  94  94  ASP ASP E . n 
T  4  95  LEU 95  95  95  LEU LEU E . n 
T  4  96  ALA 96  96  96  ALA ALA E . n 
T  4  97  TYR 97  97  97  TYR TYR E . n 
T  4  98  ALA 98  98  98  ALA ALA E . n 
T  4  99  LEU 99  99  99  LEU LEU E . n 
T  4  100 ALA 100 100 100 ALA ALA E . n 
T  4  101 VAL 101 101 101 VAL VAL E . n 
T  4  102 GLU 102 102 102 GLU GLU E . n 
T  4  103 LYS 103 103 103 LYS LYS E . n 
T  4  104 LEU 104 104 104 LEU LEU E . n 
T  4  105 LEU 105 105 105 LEU LEU E . n 
T  4  106 GLY 106 106 106 GLY GLY E . n 
T  4  107 ALA 107 107 107 ALA ALA E . n 
T  4  108 VAL 108 108 108 VAL VAL E . n 
T  4  109 VAL 109 109 109 VAL VAL E . n 
T  4  110 PRO 110 110 110 PRO PRO E . n 
T  4  111 PRO 111 111 111 PRO PRO E . n 
T  4  112 ARG 112 112 112 ARG ARG E . n 
T  4  113 ALA 113 113 113 ALA ALA E . n 
T  4  114 GLU 114 114 114 GLU GLU E . n 
T  4  115 THR 115 115 115 THR THR E . n 
T  4  116 ILE 116 116 116 ILE ILE E . n 
T  4  117 ARG 117 117 117 ARG ARG E . n 
T  4  118 VAL 118 118 118 VAL VAL E . n 
T  4  119 ILE 119 119 119 ILE ILE E . n 
T  4  120 LEU 120 120 120 LEU LEU E . n 
T  4  121 ASN 121 121 121 ASN ASN E . n 
T  4  122 GLU 122 122 122 GLU GLU E . n 
T  4  123 LEU 123 123 123 LEU LEU E . n 
T  4  124 SER 124 124 124 SER SER E . n 
T  4  125 ARG 125 125 125 ARG ARG E . n 
T  4  126 LEU 126 126 126 LEU LEU E . n 
T  4  127 ALA 127 127 127 ALA ALA E . n 
T  4  128 SER 128 128 128 SER SER E . n 
T  4  129 HIS 129 129 129 HIS HIS E . n 
T  4  130 LEU 130 130 130 LEU LEU E . n 
T  4  131 VAL 131 131 131 VAL VAL E . n 
T  4  132 PHE 132 132 132 PHE PHE E . n 
T  4  133 LEU 133 133 133 LEU LEU E . n 
T  4  134 GLY 134 134 134 GLY GLY E . n 
T  4  135 THR 135 135 135 THR THR E . n 
T  4  136 GLY 136 136 136 GLY GLY E . n 
T  4  137 LEU 137 137 137 LEU LEU E . n 
T  4  138 LEU 138 138 138 LEU LEU E . n 
T  4  139 ASP 139 139 139 ASP ASP E . n 
T  4  140 LEU 140 140 140 LEU LEU E . n 
T  4  141 GLY 141 141 141 GLY GLY E . n 
T  4  142 ALA 142 142 142 ALA ALA E . n 
T  4  143 LEU 143 143 143 LEU LEU E . n 
T  4  144 THR 144 144 144 THR THR E . n 
T  4  145 PRO 145 145 145 PRO PRO E . n 
T  4  146 PHE 146 146 146 PHE PHE E . n 
T  4  147 PHE 147 147 147 PHE PHE E . n 
T  4  148 TYR 148 148 148 TYR TYR E . n 
T  4  149 ALA 149 149 149 ALA ALA E . n 
T  4  150 PHE 150 150 150 PHE PHE E . n 
T  4  151 ARG 151 151 151 ARG ARG E . n 
T  4  152 GLU 152 152 152 GLU GLU E . n 
T  4  153 ARG 153 153 153 ARG ARG E . n 
T  4  154 GLU 154 154 154 GLU GLU E . n 
T  4  155 THR 155 155 155 THR THR E . n 
T  4  156 ILE 156 156 156 ILE ILE E . n 
T  4  157 LEU 157 157 157 LEU LEU E . n 
T  4  158 ASP 158 158 158 ASP ASP E . n 
T  4  159 LEU 159 159 159 LEU LEU E . n 
T  4  160 PHE 160 160 160 PHE PHE E . n 
T  4  161 GLU 161 161 161 GLU GLU E . n 
T  4  162 TRP 162 162 162 TRP TRP E . n 
T  4  163 VAL 163 163 163 VAL VAL E . n 
T  4  164 THR 164 164 164 THR THR E . n 
T  4  165 GLY 165 165 165 GLY GLY E . n 
T  4  166 GLN 166 166 166 GLN GLN E . n 
T  4  167 ARG 167 167 167 ARG ARG E . n 
T  4  168 PHE 168 168 168 PHE PHE E . n 
T  4  169 HIS 169 169 169 HIS HIS E . n 
T  4  170 HIS 170 170 170 HIS HIS E . n 
T  4  171 ASN 171 171 171 ASN ASN E . n 
T  4  172 TYR 172 172 172 TYR TYR E . n 
T  4  173 ILE 173 173 173 ILE ILE E . n 
T  4  174 ARG 174 174 174 ARG ARG E . n 
T  4  175 ILE 175 175 175 ILE ILE E . n 
T  4  176 GLY 176 176 176 GLY GLY E . n 
T  4  177 GLY 177 177 177 GLY GLY E . n 
T  4  178 VAL 178 178 178 VAL VAL E . n 
T  4  179 LYS 179 179 179 LYS LYS E . n 
T  4  180 GLU 180 180 180 GLU GLU E . n 
T  4  181 ASP 181 181 181 ASP ASP E . n 
T  4  182 LEU 182 182 182 LEU LEU E . n 
T  4  183 PRO 183 183 183 PRO PRO E . n 
T  4  184 GLU 184 184 184 GLU GLU E . n 
T  4  185 GLU 185 185 185 GLU GLU E . n 
T  4  186 PHE 186 186 186 PHE PHE E . n 
T  4  187 VAL 187 187 187 VAL VAL E . n 
T  4  188 PRO 188 188 188 PRO PRO E . n 
T  4  189 GLU 189 189 189 GLU GLU E . n 
T  4  190 LEU 190 190 190 LEU LEU E . n 
T  4  191 LYS 191 191 191 LYS LYS E . n 
T  4  192 LYS 192 192 192 LYS LYS E . n 
T  4  193 LEU 193 193 193 LEU LEU E . n 
T  4  194 LEU 194 194 194 LEU LEU E . n 
T  4  195 GLU 195 195 195 GLU GLU E . n 
T  4  196 VAL 196 196 196 VAL VAL E . n 
T  4  197 LEU 197 197 197 LEU LEU E . n 
T  4  198 PRO 198 198 198 PRO PRO E . n 
T  4  199 HIS 199 199 199 HIS HIS E . n 
T  4  200 ARG 200 200 200 ARG ARG E . n 
T  4  201 ILE 201 201 201 ILE ILE E . n 
T  4  202 ASP 202 202 202 ASP ASP E . n 
T  4  203 GLU 203 203 203 GLU GLU E . n 
T  4  204 TYR 204 204 204 TYR TYR E . n 
T  4  205 GLU 205 205 205 GLU GLU E . n 
T  4  206 ALA 206 206 206 ALA ALA E . n 
T  4  207 LEU 207 207 207 LEU LEU E . n 
T  4  208 PHE 208 208 208 PHE PHE E . n 
T  4  209 ALA 209 209 209 ALA ALA E . n 
T  4  210 GLU 210 210 210 GLU GLU E . n 
T  4  211 SER 211 211 211 SER SER E . n 
T  4  212 PRO 212 212 212 PRO PRO E . n 
T  4  213 ILE 213 213 213 ILE ILE E . n 
T  4  214 PHE 214 214 214 PHE PHE E . n 
T  4  215 TYR 215 215 215 TYR TYR E . n 
T  4  216 GLU 216 216 216 GLU GLU E . n 
T  4  217 ARG 217 217 217 ARG ARG E . n 
T  4  218 ALA 218 218 218 ALA ALA E . n 
T  4  219 ARG 219 219 219 ARG ARG E . n 
T  4  220 GLY 220 220 220 GLY GLY E . n 
T  4  221 VAL 221 221 221 VAL VAL E . n 
T  4  222 GLY 222 222 222 GLY GLY E . n 
T  4  223 VAL 223 223 223 VAL VAL E . n 
T  4  224 ILE 224 224 224 ILE ILE E . n 
T  4  225 PRO 225 225 225 PRO PRO E . n 
T  4  226 PRO 226 226 226 PRO PRO E . n 
T  4  227 GLU 227 227 227 GLU GLU E . n 
T  4  228 VAL 228 228 228 VAL VAL E . n 
T  4  229 ALA 229 229 229 ALA ALA E . n 
T  4  230 ILE 230 230 230 ILE ILE E . n 
T  4  231 ASP 231 231 231 ASP ASP E . n 
T  4  232 LEU 232 232 232 LEU LEU E . n 
T  4  233 GLY 233 233 233 GLY GLY E . n 
T  4  234 LEU 234 234 234 LEU LEU E . n 
T  4  235 THR 235 235 235 THR THR E . n 
T  4  236 GLY 236 236 236 GLY GLY E . n 
T  4  237 GLY 237 237 237 GLY GLY E . n 
T  4  238 SER 238 238 238 SER SER E . n 
T  4  239 LEU 239 239 239 LEU LEU E . n 
T  4  240 ARG 240 240 240 ARG ARG E . n 
T  4  241 ALA 241 241 241 ALA ALA E . n 
T  4  242 SER 242 242 242 SER SER E . n 
T  4  243 GLY 243 243 243 GLY GLY E . n 
T  4  244 VAL 244 244 244 VAL VAL E . n 
T  4  245 ASN 245 245 245 ASN ASN E . n 
T  4  246 TYR 246 246 246 TYR TYR E . n 
T  4  247 ASP 247 247 247 ASP ASP E . n 
T  4  248 VAL 248 248 248 VAL VAL E . n 
T  4  249 ARG 249 249 249 ARG ARG E . n 
T  4  250 LYS 250 250 250 LYS LYS E . n 
T  4  251 ALA 251 251 251 ALA ALA E . n 
T  4  252 TYR 252 252 252 TYR TYR E . n 
T  4  253 PRO 253 253 253 PRO PRO E . n 
T  4  254 TYR 254 254 254 TYR TYR E . n 
T  4  255 SER 255 255 255 SER SER E . n 
T  4  256 GLY 256 256 256 GLY GLY E . n 
T  4  257 TYR 257 257 257 TYR TYR E . n 
T  4  258 GLU 258 258 258 GLU GLU E . n 
T  4  259 THR 259 259 259 THR THR E . n 
T  4  260 TYR 260 260 260 TYR TYR E . n 
T  4  261 THR 261 261 261 THR THR E . n 
T  4  262 PHE 262 262 262 PHE PHE E . n 
T  4  263 ASP 263 263 263 ASP ASP E . n 
T  4  264 VAL 264 264 264 VAL VAL E . n 
T  4  265 PRO 265 265 265 PRO PRO E . n 
T  4  266 LEU 266 266 266 LEU LEU E . n 
T  4  267 GLY 267 267 267 GLY GLY E . n 
T  4  268 GLU 268 268 268 GLU GLU E . n 
T  4  269 ARG 269 269 269 ARG ARG E . n 
T  4  270 GLY 270 270 270 GLY GLY E . n 
T  4  271 ASP 271 271 271 ASP ASP E . n 
T  4  272 VAL 272 272 272 VAL VAL E . n 
T  4  273 PHE 273 273 273 PHE PHE E . n 
T  4  274 ASP 274 274 274 ASP ASP E . n 
T  4  275 ARG 275 275 275 ARG ARG E . n 
T  4  276 MET 276 276 276 MET MET E . n 
T  4  277 LEU 277 277 277 LEU LEU E . n 
T  4  278 VAL 278 278 278 VAL VAL E . n 
T  4  279 ARG 279 279 279 ARG ARG E . n 
T  4  280 ILE 280 280 280 ILE ILE E . n 
T  4  281 ARG 281 281 281 ARG ARG E . n 
T  4  282 GLU 282 282 282 GLU GLU E . n 
T  4  283 MET 283 283 283 MET MET E . n 
T  4  284 ARG 284 284 284 ARG ARG E . n 
T  4  285 GLU 285 285 285 GLU GLU E . n 
T  4  286 SER 286 286 286 SER SER E . n 
T  4  287 VAL 287 287 287 VAL VAL E . n 
T  4  288 LYS 288 288 288 LYS LYS E . n 
T  4  289 ILE 289 289 289 ILE ILE E . n 
T  4  290 ILE 290 290 290 ILE ILE E . n 
T  4  291 LYS 291 291 291 LYS LYS E . n 
T  4  292 GLN 292 292 292 GLN GLN E . n 
T  4  293 ALA 293 293 293 ALA ALA E . n 
T  4  294 LEU 294 294 294 LEU LEU E . n 
T  4  295 GLU 295 295 295 GLU GLU E . n 
T  4  296 ARG 296 296 296 ARG ARG E . n 
T  4  297 LEU 297 297 297 LEU LEU E . n 
T  4  298 GLU 298 298 298 GLU GLU E . n 
T  4  299 PRO 299 299 299 PRO PRO E . n 
T  4  300 GLY 300 300 300 GLY GLY E . n 
T  4  301 PRO 301 301 301 PRO PRO E . n 
T  4  302 VAL 302 302 302 VAL VAL E . n 
T  4  303 ARG 303 303 303 ARG ARG E . n 
T  4  304 ASP 304 304 304 ASP ASP E . n 
T  4  305 PRO 305 305 305 PRO PRO E . n 
T  4  306 ASN 306 306 306 ASN ASN E . n 
T  4  307 PRO 307 307 307 PRO PRO E . n 
T  4  308 GLN 308 308 308 GLN GLN E . n 
T  4  309 ILE 309 309 309 ILE ILE E . n 
T  4  310 THR 310 310 310 THR THR E . n 
T  4  311 PRO 311 311 311 PRO PRO E . n 
T  4  312 PRO 312 312 312 PRO PRO E . n 
T  4  313 PRO 313 313 313 PRO PRO E . n 
T  4  314 ARG 314 314 314 ARG ARG E . n 
T  4  315 HIS 315 315 315 HIS HIS E . n 
T  4  316 LEU 316 316 316 LEU LEU E . n 
T  4  317 LEU 317 317 317 LEU LEU E . n 
T  4  318 GLU 318 318 318 GLU GLU E . n 
T  4  319 THR 319 319 319 THR THR E . n 
T  4  320 SER 320 320 320 SER SER E . n 
T  4  321 MET 321 321 321 MET MET E . n 
T  4  322 GLU 322 322 322 GLU GLU E . n 
T  4  323 ALA 323 323 323 ALA ALA E . n 
T  4  324 VAL 324 324 324 VAL VAL E . n 
T  4  325 ILE 325 325 325 ILE ILE E . n 
T  4  326 TYR 326 326 326 TYR TYR E . n 
T  4  327 HIS 327 327 327 HIS HIS E . n 
T  4  328 PHE 328 328 328 PHE PHE E . n 
T  4  329 LYS 329 329 329 LYS LYS E . n 
T  4  330 HIS 330 330 330 HIS HIS E . n 
T  4  331 TYR 331 331 331 TYR TYR E . n 
T  4  332 THR 332 332 332 THR THR E . n 
T  4  333 GLU 333 333 333 GLU GLU E . n 
T  4  334 GLY 334 334 334 GLY GLY E . n 
T  4  335 PHE 335 335 335 PHE PHE E . n 
T  4  336 HIS 336 336 336 HIS HIS E . n 
T  4  337 PRO 337 337 337 PRO PRO E . n 
T  4  338 PRO 338 338 338 PRO PRO E . n 
T  4  339 LYS 339 339 339 LYS LYS E . n 
T  4  340 GLY 340 340 340 GLY GLY E . n 
T  4  341 GLU 341 341 341 GLU GLU E . n 
T  4  342 VAL 342 342 342 VAL VAL E . n 
T  4  343 TYR 343 343 343 TYR TYR E . n 
T  4  344 VAL 344 344 344 VAL VAL E . n 
T  4  345 PRO 345 345 345 PRO PRO E . n 
T  4  346 THR 346 346 346 THR THR E . n 
T  4  347 GLU 347 347 347 GLU GLU E . n 
T  4  348 SER 348 348 348 SER SER E . n 
T  4  349 ALA 349 349 349 ALA ALA E . n 
T  4  350 ARG 350 350 350 ARG ARG E . n 
T  4  351 GLY 351 351 351 GLY GLY E . n 
T  4  352 GLU 352 352 352 GLU GLU E . n 
T  4  353 LEU 353 353 353 LEU LEU E . n 
T  4  354 GLY 354 354 354 GLY GLY E . n 
T  4  355 TYR 355 355 355 TYR TYR E . n 
T  4  356 TYR 356 356 356 TYR TYR E . n 
T  4  357 ILE 357 357 357 ILE ILE E . n 
T  4  358 VAL 358 358 358 VAL VAL E . n 
T  4  359 SER 359 359 359 SER SER E . n 
T  4  360 ASP 360 360 360 ASP ASP E . n 
T  4  361 GLY 361 361 361 GLY GLY E . n 
T  4  362 GLY 362 362 362 GLY GLY E . n 
T  4  363 SER 363 363 363 SER SER E . n 
T  4  364 MET 364 364 364 MET MET E . n 
T  4  365 PRO 365 365 365 PRO PRO E . n 
T  4  366 TYR 366 366 366 TYR TYR E . n 
T  4  367 ARG 367 367 367 ARG ARG E . n 
T  4  368 VAL 368 368 368 VAL VAL E . n 
T  4  369 LYS 369 369 369 LYS LYS E . n 
T  4  370 VAL 370 370 370 VAL VAL E . n 
T  4  371 ARG 371 371 371 ARG ARG E . n 
T  4  372 ALA 372 372 372 ALA ALA E . n 
T  4  373 PRO 373 373 373 PRO PRO E . n 
T  4  374 SER 374 374 374 SER SER E . n 
T  4  375 PHE 375 375 375 PHE PHE E . n 
T  4  376 VAL 376 376 376 VAL VAL E . n 
T  4  377 ASN 377 377 377 ASN ASN E . n 
T  4  378 LEU 378 378 378 LEU LEU E . n 
T  4  379 GLN 379 379 379 GLN GLN E . n 
T  4  380 SER 380 380 380 SER SER E . n 
T  4  381 LEU 381 381 381 LEU LEU E . n 
T  4  382 PRO 382 382 382 PRO PRO E . n 
T  4  383 TYR 383 383 383 TYR TYR E . n 
T  4  384 ALA 384 384 384 ALA ALA E . n 
T  4  385 CYS 385 385 385 CYS CYS E . n 
T  4  386 LYS 386 386 386 LYS LYS E . n 
T  4  387 GLY 387 387 387 GLY GLY E . n 
T  4  388 GLU 388 388 388 GLU GLU E . n 
T  4  389 GLN 389 389 389 GLN GLN E . n 
T  4  390 VAL 390 390 390 VAL VAL E . n 
T  4  391 PRO 391 391 391 PRO PRO E . n 
T  4  392 ASP 392 392 392 ASP ASP E . n 
T  4  393 MET 393 393 393 MET MET E . n 
T  4  394 VAL 394 394 394 VAL VAL E . n 
T  4  395 ALA 395 395 395 ALA ALA E . n 
T  4  396 ILE 396 396 396 ILE ILE E . n 
T  4  397 ILE 397 397 397 ILE ILE E . n 
T  4  398 ALA 398 398 398 ALA ALA E . n 
T  4  399 SER 399 399 399 SER SER E . n 
T  4  400 LEU 400 400 400 LEU LEU E . n 
T  4  401 ASP 401 401 401 ASP ASP E . n 
T  4  402 PRO 402 402 402 PRO PRO E . n 
T  4  403 VAL 403 403 403 VAL VAL E . n 
T  4  404 MET 404 404 404 MET MET E . n 
T  4  405 GLY 405 405 405 GLY GLY E . n 
T  4  406 ASP 406 406 406 ASP ASP E . n 
T  4  407 VAL 407 407 407 VAL VAL E . n 
T  4  408 ASP 408 408 408 ASP ASP E . n 
T  4  409 ARG 409 409 409 ARG ARG E . n 
U  5  1   MET 1   1   1   MET MET F . n 
U  5  2   ARG 2   2   2   ARG ARG F . n 
U  5  3   LEU 3   3   3   LEU LEU F . n 
U  5  4   GLU 4   4   4   GLU GLU F . n 
U  5  5   ARG 5   5   5   ARG ARG F . n 
U  5  6   VAL 6   6   6   VAL VAL F . n 
U  5  7   LEU 7   7   7   LEU LEU F . n 
U  5  8   GLU 8   8   8   GLU GLU F . n 
U  5  9   GLU 9   9   9   GLU GLU F . n 
U  5  10  ALA 10  10  10  ALA ALA F . n 
U  5  11  ARG 11  11  11  ARG ARG F . n 
U  5  12  ALA 12  12  12  ALA ALA F . n 
U  5  13  LYS 13  13  13  LYS LYS F . n 
U  5  14  GLY 14  14  14  GLY GLY F . n 
U  5  15  TYR 15  15  15  TYR TYR F . n 
U  5  16  PRO 16  16  16  PRO PRO F . n 
U  5  17  ILE 17  17  17  ILE ILE F . n 
U  5  18  GLU 18  18  18  GLU GLU F . n 
U  5  19  ASP 19  19  19  ASP ASP F . n 
U  5  20  ASN 20  20  20  ASN ASN F . n 
U  5  21  GLY 21  21  21  GLY GLY F . n 
U  5  22  LEU 22  22  22  LEU LEU F . n 
U  5  23  GLY 23  23  23  GLY GLY F . n 
U  5  24  ASN 24  24  24  ASN ASN F . n 
U  5  25  LEU 25  25  25  LEU LEU F . n 
U  5  26  TRP 26  26  26  TRP TRP F . n 
U  5  27  VAL 27  27  27  VAL VAL F . n 
U  5  28  VAL 28  28  28  VAL VAL F . n 
U  5  29  LEU 29  29  29  LEU LEU F . n 
U  5  30  PRO 30  30  30  PRO PRO F . n 
U  5  31  ARG 31  31  31  ARG ARG F . n 
U  5  32  GLU 32  32  32  GLU GLU F . n 
U  5  33  ARG 33  33  33  ARG ARG F . n 
U  5  34  PHE 34  34  34  PHE PHE F . n 
U  5  35  LYS 35  35  35  LYS LYS F . n 
U  5  36  GLU 36  36  36  GLU GLU F . n 
U  5  37  GLU 37  37  37  GLU GLU F . n 
U  5  38  MET 38  38  38  MET MET F . n 
U  5  39  ALA 39  39  39  ALA ALA F . n 
U  5  40  HIS 40  40  40  HIS HIS F . n 
U  5  41  TYR 41  41  41  TYR TYR F . n 
U  5  42  LYS 42  42  42  LYS LYS F . n 
U  5  43  ALA 43  43  43  ALA ALA F . n 
U  5  44  MET 44  44  44  MET MET F . n 
U  5  45  GLY 45  45  45  GLY GLY F . n 
U  5  46  PHE 46  46  46  PHE PHE F . n 
U  5  47  ASN 47  47  47  ASN ASN F . n 
U  5  48  PHE 48  48  48  PHE PHE F . n 
U  5  49  LEU 49  49  49  LEU LEU F . n 
U  5  50  ALA 50  50  50  ALA ALA F . n 
U  5  51  ASP 51  51  51  ASP ASP F . n 
U  5  52  ILE 52  52  52  ILE ILE F . n 
U  5  53  VAL 53  53  53  VAL VAL F . n 
U  5  54  GLY 54  54  54  GLY GLY F . n 
U  5  55  LEU 55  55  55  LEU LEU F . n 
U  5  56  ASP 56  56  56  ASP ASP F . n 
U  5  57  TYR 57  57  57  TYR TYR F . n 
U  5  58  LEU 58  58  58  LEU LEU F . n 
U  5  59  THR 59  59  59  THR THR F . n 
U  5  60  TYR 60  60  60  TYR TYR F . n 
U  5  61  PRO 61  61  61  PRO PRO F . n 
U  5  62  ASP 62  62  62  ASP ASP F . n 
U  5  63  PRO 63  63  63  PRO PRO F . n 
U  5  64  ARG 64  64  64  ARG ARG F . n 
U  5  65  PRO 65  65  65  PRO PRO F . n 
U  5  66  GLU 66  66  66  GLU GLU F . n 
U  5  67  ARG 67  67  67  ARG ARG F . n 
U  5  68  PHE 68  68  68  PHE PHE F . n 
U  5  69  ALA 69  69  69  ALA ALA F . n 
U  5  70  VAL 70  70  70  VAL VAL F . n 
U  5  71  VAL 71  71  71  VAL VAL F . n 
U  5  72  TYR 72  72  72  TYR TYR F . n 
U  5  73  GLU 73  73  73  GLU GLU F . n 
U  5  74  LEU 74  74  74  LEU LEU F . n 
U  5  75  VAL 75  75  75  VAL VAL F . n 
U  5  76  SER 76  76  76  SER SER F . n 
U  5  77  LEU 77  77  77  LEU LEU F . n 
U  5  78  PRO 78  78  78  PRO PRO F . n 
U  5  79  GLY 79  79  79  GLY GLY F . n 
U  5  80  TRP 80  80  80  TRP TRP F . n 
U  5  81  LYS 81  81  81  LYS LYS F . n 
U  5  82  ASP 82  82  82  ASP ASP F . n 
U  5  83  GLY 83  83  83  GLY GLY F . n 
U  5  84  ASP 84  84  84  ASP ASP F . n 
U  5  85  GLY 85  85  85  GLY GLY F . n 
U  5  86  SER 86  86  86  SER SER F . n 
U  5  87  ARG 87  87  87  ARG ARG F . n 
U  5  88  PHE 88  88  88  PHE PHE F . n 
U  5  89  PHE 89  89  89  PHE PHE F . n 
U  5  90  VAL 90  90  90  VAL VAL F . n 
U  5  91  ARG 91  91  91  ARG ARG F . n 
U  5  92  VAL 92  92  92  VAL VAL F . n 
U  5  93  TYR 93  93  93  TYR TYR F . n 
U  5  94  VAL 94  94  94  VAL VAL F . n 
U  5  95  PRO 95  95  95  PRO PRO F . n 
U  5  96  GLU 96  96  96  GLU GLU F . n 
U  5  97  GLU 97  97  97  GLU GLU F . n 
U  5  98  ASP 98  98  98  ASP ASP F . n 
U  5  99  PRO 99  99  99  PRO PRO F . n 
U  5  100 ARG 100 100 100 ARG ARG F . n 
U  5  101 LEU 101 101 101 LEU LEU F . n 
U  5  102 PRO 102 102 102 PRO PRO F . n 
U  5  103 THR 103 103 103 THR THR F . n 
U  5  104 VAL 104 104 104 VAL VAL F . n 
U  5  105 THR 105 105 105 THR THR F . n 
U  5  106 ASP 106 106 106 ASP ASP F . n 
U  5  107 LEU 107 107 107 LEU LEU F . n 
U  5  108 TRP 108 108 108 TRP TRP F . n 
U  5  109 GLY 109 109 109 GLY GLY F . n 
U  5  110 SER 110 110 110 SER SER F . n 
U  5  111 ALA 111 111 111 ALA ALA F . n 
U  5  112 ASN 112 112 112 ASN ASN F . n 
U  5  113 PHE 113 113 113 PHE PHE F . n 
U  5  114 LEU 114 114 114 LEU LEU F . n 
U  5  115 GLU 115 115 115 GLU GLU F . n 
U  5  116 ARG 116 116 116 ARG ARG F . n 
U  5  117 GLU 117 117 117 GLU GLU F . n 
U  5  118 VAL 118 118 118 VAL VAL F . n 
U  5  119 TYR 119 119 119 TYR TYR F . n 
U  5  120 ASP 120 120 120 ASP ASP F . n 
U  5  121 LEU 121 121 121 LEU LEU F . n 
U  5  122 PHE 122 122 122 PHE PHE F . n 
U  5  123 GLY 123 123 123 GLY GLY F . n 
U  5  124 ILE 124 124 124 ILE ILE F . n 
U  5  125 VAL 125 125 125 VAL VAL F . n 
U  5  126 PHE 126 126 126 PHE PHE F . n 
U  5  127 GLU 127 127 127 GLU GLU F . n 
U  5  128 GLY 128 128 128 GLY GLY F . n 
U  5  129 HIS 129 129 129 HIS HIS F . n 
U  5  130 PRO 130 130 130 PRO PRO F . n 
U  5  131 ASP 131 131 131 ASP ASP F . n 
U  5  132 LEU 132 132 132 LEU LEU F . n 
U  5  133 ARG 133 133 133 ARG ARG F . n 
U  5  134 LYS 134 134 134 LYS LYS F . n 
U  5  135 ILE 135 135 135 ILE ILE F . n 
U  5  136 LEU 136 136 136 LEU LEU F . n 
U  5  137 THR 137 137 137 THR THR F . n 
U  5  138 PRO 138 138 138 PRO PRO F . n 
U  5  139 GLU 139 139 139 GLU GLU F . n 
U  5  140 ASP 140 140 140 ASP ASP F . n 
U  5  141 LEU 141 141 141 LEU LEU F . n 
U  5  142 GLU 142 142 142 GLU GLU F . n 
U  5  143 GLY 143 143 143 GLY GLY F . n 
U  5  144 HIS 144 144 144 HIS HIS F . n 
U  5  145 PRO 145 145 145 PRO PRO F . n 
U  5  146 LEU 146 146 146 LEU LEU F . n 
U  5  147 ARG 147 147 147 ARG ARG F . n 
U  5  148 LYS 148 148 148 LYS LYS F . n 
U  5  149 ASP 149 149 149 ASP ASP F . n 
U  5  150 TYR 150 150 150 TYR TYR F . n 
U  5  151 PRO 151 151 151 PRO PRO F . n 
U  5  152 LEU 152 152 152 LEU LEU F . n 
U  5  153 GLY 153 153 153 GLY GLY F . n 
U  5  154 GLU 154 154 154 GLU GLU F . n 
U  5  155 THR 155 155 155 THR THR F . n 
U  5  156 PRO 156 156 156 PRO PRO F . n 
U  5  157 THR 157 157 157 THR THR F . n 
U  5  158 LEU 158 158 158 LEU LEU F . n 
U  5  159 PHE 159 159 159 PHE PHE F . n 
U  5  160 ARG 160 160 160 ARG ARG F . n 
U  5  161 GLU 161 161 161 GLU GLU F . n 
U  5  162 GLY 162 162 162 GLY GLY F . n 
U  5  163 ARG 163 163 163 ARG ARG F . n 
U  5  164 TYR 164 164 164 TYR TYR F . n 
U  5  165 ILE 165 165 165 ILE ILE F . n 
U  5  166 ILE 166 166 166 ILE ILE F . n 
U  5  167 PRO 167 167 167 PRO PRO F . n 
U  5  168 ALA 168 168 168 ALA ALA F . n 
U  5  169 GLU 169 169 169 GLU GLU F . n 
U  5  170 PHE 170 170 170 PHE PHE F . n 
U  5  171 ARG 171 171 171 ARG ARG F . n 
U  5  172 ALA 172 172 172 ALA ALA F . n 
U  5  173 ALA 173 173 173 ALA ALA F . n 
U  5  174 LEU 174 174 174 LEU LEU F . n 
U  5  175 THR 175 175 175 THR THR F . n 
U  5  176 GLY 176 176 176 GLY GLY F . n 
U  5  177 LYS 177 177 177 LYS LYS F . n 
U  5  178 ASP 178 178 178 ASP ASP F . n 
U  5  179 PRO 179 179 179 PRO PRO F . n 
U  5  180 GLY 180 180 180 GLY GLY F . n 
U  5  181 LEU 181 181 181 LEU LEU F . n 
U  5  182 THR 182 182 182 THR THR F . n 
U  5  183 PHE 183 183 183 PHE PHE F . n 
U  5  184 TYR 184 184 184 TYR TYR F . n 
U  5  185 LYS 185 185 185 LYS LYS F . n 
U  5  186 GLY 186 186 186 GLY GLY F . n 
U  5  187 GLY 187 187 187 GLY GLY F . n 
U  5  188 SER 188 188 188 SER SER F . n 
U  5  189 ARG 189 189 189 ARG ARG F . n 
U  5  190 LYS 190 190 190 LYS LYS F . n 
U  5  191 GLY 191 191 191 GLY GLY F . n 
U  5  192 TYR 192 192 192 TYR TYR F . n 
U  5  193 ARG 193 193 193 ARG ARG F . n 
U  5  194 SER 194 194 194 SER SER F . n 
U  5  195 LEU 195 195 195 LEU LEU F . n 
U  5  196 TRP 196 196 196 TRP TRP F . n 
U  5  197 ALA 197 197 ?   ?   ?   F . n 
U  5  198 ASP 198 198 ?   ?   ?   F . n 
U  5  199 LEU 199 199 ?   ?   ?   F . n 
U  5  200 LYS 200 200 ?   ?   ?   F . n 
U  5  201 LYS 201 201 ?   ?   ?   F . n 
U  5  202 ALA 202 202 ?   ?   ?   F . n 
U  5  203 ARG 203 203 ?   ?   ?   F . n 
U  5  204 GLU 204 204 ?   ?   ?   F . n 
U  5  205 VAL 205 205 ?   ?   ?   F . n 
U  5  206 LYS 206 206 ?   ?   ?   F . n 
U  5  207 GLY 207 207 ?   ?   ?   F . n 
V  6  1   MET 1   1   ?   ?   ?   G . n 
V  6  2   ALA 2   2   ?   ?   ?   G . n 
V  6  3   LEU 3   3   ?   ?   ?   G . n 
V  6  4   LYS 4   4   ?   ?   ?   G . n 
V  6  5   ASP 5   5   ?   ?   ?   G . n 
V  6  6   LEU 6   6   ?   ?   ?   G . n 
V  6  7   PHE 7   7   ?   ?   ?   G . n 
V  6  8   GLU 8   8   ?   ?   ?   G . n 
V  6  9   ARG 9   9   ?   ?   ?   G . n 
V  6  10  ASP 10  10  ?   ?   ?   G . n 
V  6  11  VAL 11  11  ?   ?   ?   G . n 
V  6  12  GLN 12  12  ?   ?   ?   G . n 
V  6  13  GLU 13  13  ?   ?   ?   G . n 
V  6  14  LEU 14  14  ?   ?   ?   G . n 
V  6  15  GLU 15  15  ?   ?   ?   G . n 
V  6  16  ARG 16  16  16  ARG ARG G . n 
V  6  17  GLU 17  17  17  GLU GLU G . n 
V  6  18  GLY 18  18  18  GLY GLY G . n 
V  6  19  ILE 19  19  19  ILE ILE G . n 
V  6  20  LEU 20  20  20  LEU LEU G . n 
V  6  21  PHE 21  21  21  PHE PHE G . n 
V  6  22  THR 22  22  22  THR THR G . n 
V  6  23  THR 23  23  23  THR THR G . n 
V  6  24  LEU 24  24  24  LEU LEU G . n 
V  6  25  GLU 25  25  25  GLU GLU G . n 
V  6  26  LYS 26  26  26  LYS LYS G . n 
V  6  27  LEU 27  27  27  LEU LEU G . n 
V  6  28  VAL 28  28  28  VAL VAL G . n 
V  6  29  ALA 29  29  29  ALA ALA G . n 
V  6  30  TRP 30  30  30  TRP TRP G . n 
V  6  31  GLY 31  31  31  GLY GLY G . n 
V  6  32  ARG 32  32  32  ARG ARG G . n 
V  6  33  SER 33  33  33  SER SER G . n 
V  6  34  ASN 34  34  34  ASN ASN G . n 
V  6  35  SER 35  35  35  SER SER G . n 
V  6  36  LEU 36  36  36  LEU LEU G . n 
V  6  37  TRP 37  37  37  TRP TRP G . n 
V  6  38  PRO 38  38  38  PRO PRO G . n 
V  6  39  ALA 39  39  39  ALA ALA G . n 
V  6  40  THR 40  40  40  THR THR G . n 
V  6  41  PHE 41  41  41  PHE PHE G . n 
V  6  42  GLY 42  42  42  GLY GLY G . n 
V  6  43  LEU 43  43  43  LEU LEU G . n 
V  6  44  ALA 44  44  44  ALA ALA G . n 
V  6  45  CYS 45  45  45  CYS CYS G . n 
V  6  46  CYS 46  46  46  CYS CYS G . n 
V  6  47  ALA 47  47  47  ALA ALA G . n 
V  6  48  ILE 48  48  48  ILE ILE G . n 
V  6  49  GLU 49  49  49  GLU GLU G . n 
V  6  50  MET 50  50  50  MET MET G . n 
V  6  51  MET 51  51  51  MET MET G . n 
V  6  52  ALA 52  52  52  ALA ALA G . n 
V  6  53  SER 53  53  53  SER SER G . n 
V  6  54  THR 54  54  54  THR THR G . n 
V  6  55  ASP 55  55  55  ASP ASP G . n 
V  6  56  ALA 56  56  56  ALA ALA G . n 
V  6  57  ARG 57  57  57  ARG ARG G . n 
V  6  58  ASN 58  58  58  ASN ASN G . n 
V  6  59  ASP 59  59  59  ASP ASP G . n 
V  6  60  LEU 60  60  60  LEU LEU G . n 
V  6  61  ALA 61  61  61  ALA ALA G . n 
V  6  62  ARG 62  62  62  ARG ARG G . n 
V  6  63  PHE 63  63  63  PHE PHE G . n 
V  6  64  GLY 64  64  64  GLY GLY G . n 
V  6  65  SER 65  65  65  SER SER G . n 
V  6  66  GLU 66  66  66  GLU GLU G . n 
V  6  67  VAL 67  67  67  VAL VAL G . n 
V  6  68  PHE 68  68  68  PHE PHE G . n 
V  6  69  ARG 69  69  69  ARG ARG G . n 
V  6  70  ALA 70  70  70  ALA ALA G . n 
V  6  71  SER 71  71  71  SER SER G . n 
V  6  72  PRO 72  72  72  PRO PRO G . n 
V  6  73  ARG 73  73  73  ARG ARG G . n 
V  6  74  GLN 74  74  74  GLN GLN G . n 
V  6  75  ALA 75  75  75  ALA ALA G . n 
V  6  76  ASP 76  76  76  ASP ASP G . n 
V  6  77  VAL 77  77  77  VAL VAL G . n 
V  6  78  MET 78  78  78  MET MET G . n 
V  6  79  ILE 79  79  79  ILE ILE G . n 
V  6  80  VAL 80  80  80  VAL VAL G . n 
V  6  81  ALA 81  81  81  ALA ALA G . n 
V  6  82  GLY 82  82  82  GLY GLY G . n 
V  6  83  ARG 83  83  83  ARG ARG G . n 
V  6  84  LEU 84  84  84  LEU LEU G . n 
V  6  85  SER 85  85  85  SER SER G . n 
V  6  86  LYS 86  86  86  LYS LYS G . n 
V  6  87  LYS 87  87  87  LYS LYS G . n 
V  6  88  MET 88  88  88  MET MET G . n 
V  6  89  ALA 89  89  89  ALA ALA G . n 
V  6  90  PRO 90  90  90  PRO PRO G . n 
V  6  91  VAL 91  91  91  VAL VAL G . n 
V  6  92  MET 92  92  92  MET MET G . n 
V  6  93  ARG 93  93  93  ARG ARG G . n 
V  6  94  ARG 94  94  94  ARG ARG G . n 
V  6  95  VAL 95  95  95  VAL VAL G . n 
V  6  96  TRP 96  96  96  TRP TRP G . n 
V  6  97  GLU 97  97  97  GLU GLU G . n 
V  6  98  GLN 98  98  98  GLN GLN G . n 
V  6  99  MET 99  99  99  MET MET G . n 
V  6  100 PRO 100 100 100 PRO PRO G . n 
V  6  101 ASP 101 101 101 ASP ASP G . n 
V  6  102 PRO 102 102 102 PRO PRO G . n 
V  6  103 LYS 103 103 103 LYS LYS G . n 
V  6  104 TRP 104 104 104 TRP TRP G . n 
V  6  105 VAL 105 105 105 VAL VAL G . n 
V  6  106 ILE 106 106 106 ILE ILE G . n 
V  6  107 SER 107 107 107 SER SER G . n 
V  6  108 MET 108 108 108 MET MET G . n 
V  6  109 GLY 109 109 109 GLY GLY G . n 
V  6  110 ALA 110 110 110 ALA ALA G . n 
V  6  111 CYS 111 111 111 CYS CYS G . n 
V  6  112 ALA 112 112 112 ALA ALA G . n 
V  6  113 SER 113 113 113 SER SER G . n 
V  6  114 SER 114 114 114 SER SER G . n 
V  6  115 GLY 115 115 115 GLY GLY G . n 
V  6  116 GLY 116 116 116 GLY GLY G . n 
V  6  117 MET 117 117 117 MET MET G . n 
V  6  118 PHE 118 118 118 PHE PHE G . n 
V  6  119 ASN 119 119 119 ASN ASN G . n 
V  6  120 ASN 120 120 120 ASN ASN G . n 
V  6  121 TYR 121 121 121 TYR TYR G . n 
V  6  122 ALA 122 122 122 ALA ALA G . n 
V  6  123 ILE 123 123 123 ILE ILE G . n 
V  6  124 VAL 124 124 124 VAL VAL G . n 
V  6  125 GLN 125 125 125 GLN GLN G . n 
V  6  126 ASN 126 126 126 ASN ASN G . n 
V  6  127 VAL 127 127 127 VAL VAL G . n 
V  6  128 ASP 128 128 128 ASP ASP G . n 
V  6  129 SER 129 129 129 SER SER G . n 
V  6  130 VAL 130 130 130 VAL VAL G . n 
V  6  131 VAL 131 131 131 VAL VAL G . n 
V  6  132 PRO 132 132 132 PRO PRO G . n 
V  6  133 VAL 133 133 133 VAL VAL G . n 
V  6  134 ASP 134 134 134 ASP ASP G . n 
V  6  135 VAL 135 135 135 VAL VAL G . n 
V  6  136 TYR 136 136 136 TYR TYR G . n 
V  6  137 VAL 137 137 137 VAL VAL G . n 
V  6  138 PRO 138 138 138 PRO PRO G . n 
V  6  139 GLY 139 139 139 GLY GLY G . n 
V  6  140 CYS 140 140 140 CYS CYS G . n 
V  6  141 PRO 141 141 141 PRO PRO G . n 
V  6  142 PRO 142 142 142 PRO PRO G . n 
V  6  143 ARG 143 143 143 ARG ARG G . n 
V  6  144 PRO 144 144 144 PRO PRO G . n 
V  6  145 GLU 145 145 145 GLU GLU G . n 
V  6  146 ALA 146 146 146 ALA ALA G . n 
V  6  147 LEU 147 147 147 LEU LEU G . n 
V  6  148 ILE 148 148 148 ILE ILE G . n 
V  6  149 TYR 149 149 149 TYR TYR G . n 
V  6  150 ALA 150 150 150 ALA ALA G . n 
V  6  151 VAL 151 151 151 VAL VAL G . n 
V  6  152 MET 152 152 152 MET MET G . n 
V  6  153 GLN 153 153 153 GLN GLN G . n 
V  6  154 LEU 154 154 154 LEU LEU G . n 
V  6  155 GLN 155 155 155 GLN GLN G . n 
V  6  156 LYS 156 156 156 LYS LYS G . n 
V  6  157 LYS 157 157 157 LYS LYS G . n 
V  6  158 VAL 158 158 158 VAL VAL G . n 
V  6  159 ARG 159 159 159 ARG ARG G . n 
V  6  160 GLY 160 160 160 GLY GLY G . n 
V  6  161 GLN 161 161 161 GLN GLN G . n 
V  6  162 ALA 162 162 162 ALA ALA G . n 
V  6  163 TYR 163 163 163 TYR TYR G . n 
V  6  164 ASN 164 164 164 ASN ASN G . n 
V  6  165 GLU 165 165 165 GLU GLU G . n 
V  6  166 ARG 166 166 166 ARG ARG G . n 
V  6  167 GLY 167 167 167 GLY GLY G . n 
V  6  168 GLU 168 168 168 GLU GLU G . n 
V  6  169 ARG 169 169 169 ARG ARG G . n 
V  6  170 LEU 170 170 170 LEU LEU G . n 
V  6  171 PRO 171 171 171 PRO PRO G . n 
V  6  172 PRO 172 172 172 PRO PRO G . n 
V  6  173 VAL 173 173 173 VAL VAL G . n 
V  6  174 ALA 174 174 174 ALA ALA G . n 
V  6  175 ALA 175 175 175 ALA ALA G . n 
V  6  176 TRP 176 176 176 TRP TRP G . n 
V  6  177 LYS 177 177 177 LYS LYS G . n 
V  6  178 ARG 178 178 178 ARG ARG G . n 
V  6  179 THR 179 179 179 THR THR G . n 
V  6  180 ARG 180 180 180 ARG ARG G . n 
V  6  181 GLY 181 181 181 GLY GLY G . n 
W  7  1   MET 1   1   ?   ?   ?   O . n 
W  7  2   THR 2   2   2   THR THR O . n 
W  7  3   LEU 3   3   3   LEU LEU O . n 
W  7  4   LYS 4   4   4   LYS LYS O . n 
W  7  5   ALA 5   5   5   ALA ALA O . n 
W  7  6   LEU 6   6   6   LEU LEU O . n 
W  7  7   ALA 7   7   7   ALA ALA O . n 
W  7  8   GLN 8   8   8   GLN GLN O . n 
W  7  9   SER 9   9   9   SER SER O . n 
W  7  10  LEU 10  10  10  LEU LEU O . n 
W  7  11  GLY 11  11  11  GLY GLY O . n 
W  7  12  ILE 12  12  12  ILE ILE O . n 
W  7  13  THR 13  13  13  THR THR O . n 
W  7  14  LEU 14  14  14  LEU LEU O . n 
W  7  15  LYS 15  15  15  LYS LYS O . n 
W  7  16  TYR 16  16  16  TYR TYR O . n 
W  7  17  LEU 17  17  17  LEU LEU O . n 
W  7  18  PHE 18  18  18  PHE PHE O . n 
W  7  19  SER 19  19  19  SER SER O . n 
W  7  20  LYS 20  20  20  LYS LYS O . n 
W  7  21  PRO 21  21  21  PRO PRO O . n 
W  7  22  VAL 22  22  22  VAL VAL O . n 
W  7  23  THR 23  23  23  THR THR O . n 
W  7  24  VAL 24  24  24  VAL VAL O . n 
W  7  25  PRO 25  25  25  PRO PRO O . n 
W  7  26  TYR 26  26  26  TYR TYR O . n 
W  7  27  PRO 27  27  27  PRO PRO O . n 
W  7  28  ASP 28  28  28  ASP ASP O . n 
W  7  29  ALA 29  29  29  ALA ALA O . n 
W  7  30  PRO 30  30  30  PRO PRO O . n 
W  7  31  VAL 31  31  31  VAL VAL O . n 
W  7  32  ALA 32  32  32  ALA ALA O . n 
W  7  33  LEU 33  33  33  LEU LEU O . n 
W  7  34  LYS 34  34  34  LYS LYS O . n 
W  7  35  PRO 35  35  35  PRO PRO O . n 
W  7  36  ARG 36  36  36  ARG ARG O . n 
W  7  37  PHE 37  37  37  PHE PHE O . n 
W  7  38  HIS 38  38  38  HIS HIS O . n 
W  7  39  GLY 39  39  39  GLY GLY O . n 
W  7  40  ARG 40  40  40  ARG ARG O . n 
W  7  41  HIS 41  41  41  HIS HIS O . n 
W  7  42  VAL 42  42  42  VAL VAL O . n 
W  7  43  LEU 43  43  43  LEU LEU O . n 
W  7  44  THR 44  44  44  THR THR O . n 
W  7  45  ARG 45  45  45  ARG ARG O . n 
W  7  46  HIS 46  46  46  HIS HIS O . n 
W  7  47  PRO 47  47  47  PRO PRO O . n 
W  7  48  ASN 48  48  48  ASN ASN O . n 
W  7  49  GLY 49  49  49  GLY GLY O . n 
W  7  50  LEU 50  50  50  LEU LEU O . n 
W  7  51  GLU 51  51  51  GLU GLU O . n 
W  7  52  LYS 52  52  52  LYS LYS O . n 
W  7  53  CYS 53  53  53  CYS CYS O . n 
W  7  54  ILE 54  54  54  ILE ILE O . n 
W  7  55  GLY 55  55  55  GLY GLY O . n 
W  7  56  CYS 56  56  56  CYS CYS O . n 
W  7  57  SER 57  57  57  SER SER O . n 
W  7  58  LEU 58  58  58  LEU LEU O . n 
W  7  59  CYS 59  59  59  CYS CYS O . n 
W  7  60  ALA 60  60  60  ALA ALA O . n 
W  7  61  ALA 61  61  61  ALA ALA O . n 
W  7  62  ALA 62  62  62  ALA ALA O . n 
W  7  63  CYS 63  63  63  CYS CYS O . n 
W  7  64  PRO 64  64  64  PRO PRO O . n 
W  7  65  ALA 65  65  65  ALA ALA O . n 
W  7  66  TYR 66  66  66  TYR TYR O . n 
W  7  67  ALA 67  67  67  ALA ALA O . n 
W  7  68  ILE 68  68  68  ILE ILE O . n 
W  7  69  TYR 69  69  69  TYR TYR O . n 
W  7  70  VAL 70  70  70  VAL VAL O . n 
W  7  71  GLU 71  71  71  GLU GLU O . n 
W  7  72  PRO 72  72  72  PRO PRO O . n 
W  7  73  ALA 73  73  73  ALA ALA O . n 
W  7  74  GLU 74  74  74  GLU GLU O . n 
W  7  75  ASN 75  75  75  ASN ASN O . n 
W  7  76  ASP 76  76  76  ASP ASP O . n 
W  7  77  PRO 77  77  77  PRO PRO O . n 
W  7  78  GLU 78  78  78  GLU GLU O . n 
W  7  79  ASN 79  79  79  ASN ASN O . n 
W  7  80  PRO 80  80  80  PRO PRO O . n 
W  7  81  VAL 81  81  81  VAL VAL O . n 
W  7  82  SER 82  82  82  SER SER O . n 
W  7  83  ALA 83  83  83  ALA ALA O . n 
W  7  84  GLY 84  84  84  GLY GLY O . n 
W  7  85  GLU 85  85  85  GLU GLU O . n 
W  7  86  ARG 86  86  86  ARG ARG O . n 
W  7  87  TYR 87  87  87  TYR TYR O . n 
W  7  88  ALA 88  88  88  ALA ALA O . n 
W  7  89  LYS 89  89  89  LYS LYS O . n 
W  7  90  VAL 90  90  90  VAL VAL O . n 
W  7  91  TYR 91  91  91  TYR TYR O . n 
W  7  92  GLU 92  92  92  GLU GLU O . n 
W  7  93  ILE 93  93  93  ILE ILE O . n 
W  7  94  ASN 94  94  94  ASN ASN O . n 
W  7  95  MET 95  95  95  MET MET O . n 
W  7  96  LEU 96  96  96  LEU LEU O . n 
W  7  97  ARG 97  97  97  ARG ARG O . n 
W  7  98  CYS 98  98  98  CYS CYS O . n 
W  7  99  ILE 99  99  99  ILE ILE O . n 
W  7  100 PHE 100 100 100 PHE PHE O . n 
W  7  101 CYS 101 101 101 CYS CYS O . n 
W  7  102 GLY 102 102 102 GLY GLY O . n 
W  7  103 LEU 103 103 103 LEU LEU O . n 
W  7  104 CYS 104 104 104 CYS CYS O . n 
W  7  105 GLU 105 105 105 GLU GLU O . n 
W  7  106 GLU 106 106 106 GLU GLU O . n 
W  7  107 ALA 107 107 107 ALA ALA O . n 
W  7  108 CYS 108 108 108 CYS CYS O . n 
W  7  109 PRO 109 109 109 PRO PRO O . n 
W  7  110 THR 110 110 110 THR THR O . n 
W  7  111 GLY 111 111 111 GLY GLY O . n 
W  7  112 ALA 112 112 112 ALA ALA O . n 
W  7  113 ILE 113 113 113 ILE ILE O . n 
W  7  114 VAL 114 114 114 VAL VAL O . n 
W  7  115 LEU 115 115 115 LEU LEU O . n 
W  7  116 GLY 116 116 116 GLY GLY O . n 
W  7  117 TYR 117 117 117 TYR TYR O . n 
W  7  118 ASP 118 118 118 ASP ASP O . n 
W  7  119 PHE 119 119 119 PHE PHE O . n 
W  7  120 GLU 120 120 120 GLU GLU O . n 
W  7  121 MET 121 121 121 MET MET O . n 
W  7  122 ALA 122 122 122 ALA ALA O . n 
W  7  123 ASP 123 123 123 ASP ASP O . n 
W  7  124 TYR 124 124 124 TYR TYR O . n 
W  7  125 GLU 125 125 125 GLU GLU O . n 
W  7  126 TYR 126 126 126 TYR TYR O . n 
W  7  127 SER 127 127 127 SER SER O . n 
W  7  128 ASP 128 128 128 ASP ASP O . n 
W  7  129 LEU 129 129 129 LEU LEU O . n 
W  7  130 VAL 130 130 130 VAL VAL O . n 
W  7  131 TYR 131 131 131 TYR TYR O . n 
W  7  132 GLY 132 132 132 GLY GLY O . n 
W  7  133 LYS 133 133 133 LYS LYS O . n 
W  7  134 GLU 134 134 134 GLU GLU O . n 
W  7  135 ASP 135 135 135 ASP ASP O . n 
W  7  136 MET 136 136 136 MET MET O . n 
W  7  137 LEU 137 137 137 LEU LEU O . n 
W  7  138 VAL 138 138 138 VAL VAL O . n 
W  7  139 ASP 139 139 139 ASP ASP O . n 
W  7  140 VAL 140 140 140 VAL VAL O . n 
W  7  141 VAL 141 141 141 VAL VAL O . n 
W  7  142 GLY 142 142 142 GLY GLY O . n 
W  7  143 THR 143 143 143 THR THR O . n 
W  7  144 LYS 144 144 144 LYS LYS O . n 
W  7  145 PRO 145 145 145 PRO PRO O . n 
W  7  146 GLN 146 146 146 GLN GLN O . n 
W  7  147 ARG 147 147 147 ARG ARG O . n 
W  7  148 ARG 148 148 148 ARG ARG O . n 
W  7  149 GLU 149 149 149 GLU GLU O . n 
W  7  150 ALA 150 150 150 ALA ALA O . n 
W  7  151 LYS 151 151 151 LYS LYS O . n 
W  7  152 ARG 152 152 152 ARG ARG O . n 
W  7  153 THR 153 153 153 THR THR O . n 
W  7  154 GLY 154 154 154 GLY GLY O . n 
W  7  155 LYS 155 155 155 LYS LYS O . n 
W  7  156 PRO 156 156 156 PRO PRO O . n 
W  7  157 VAL 157 157 157 VAL VAL O . n 
W  7  158 LYS 158 158 158 LYS LYS O . n 
W  7  159 VAL 159 159 159 VAL VAL O . n 
W  7  160 GLY 160 160 160 GLY GLY O . n 
W  7  161 TYR 161 161 161 TYR TYR O . n 
W  7  162 VAL 162 162 162 VAL VAL O . n 
W  7  163 VAL 163 163 163 VAL VAL O . n 
W  7  164 PRO 164 164 164 PRO PRO O . n 
W  7  165 TYR 165 165 165 TYR TYR O . n 
W  7  166 VAL 166 166 166 VAL VAL O . n 
W  7  167 ARG 167 167 167 ARG ARG O . n 
W  7  168 PRO 168 168 168 PRO PRO O . n 
W  7  169 GLU 169 169 169 GLU GLU O . n 
W  7  170 LEU 170 170 170 LEU LEU O . n 
W  7  171 GLU 171 171 171 GLU GLU O . n 
W  7  172 GLY 172 172 172 GLY GLY O . n 
W  7  173 PHE 173 173 173 PHE PHE O . n 
W  7  174 LYS 174 174 174 LYS LYS O . n 
W  7  175 ALA 175 175 175 ALA ALA O . n 
W  7  176 PRO 176 176 176 PRO PRO O . n 
W  7  177 THR 177 177 177 THR THR O . n 
W  7  178 GLU 178 178 178 GLU GLU O . n 
W  7  179 GLY 179 179 179 GLY GLY O . n 
W  7  180 GLY 180 180 180 GLY GLY O . n 
W  7  181 LYS 181 181 181 LYS LYS O . n 
W  7  182 ARG 182 182 ?   ?   ?   O . n 
X  8  1   MET 1   1   ?   ?   ?   I . n 
X  8  2   SER 2   2   ?   ?   ?   I . n 
X  8  3   ALA 3   3   3   ALA ALA I . n 
X  8  4   SER 4   4   4   SER SER I . n 
X  8  5   SER 5   5   5   SER SER I . n 
X  8  6   GLU 6   6   6   GLU GLU I . n 
X  8  7   ARG 7   7   7   ARG ARG I . n 
X  8  8   GLU 8   8   8   GLU GLU I . n 
X  8  9   LEU 9   9   9   LEU LEU I . n 
X  8  10  TYR 10  10  10  TYR TYR I . n 
X  8  11  GLU 11  11  11  GLU GLU I . n 
X  8  12  ALA 12  12  12  ALA ALA I . n 
X  8  13  TRP 13  13  13  TRP TRP I . n 
X  8  14  VAL 14  14  14  VAL VAL I . n 
X  8  15  GLU 15  15  15  GLU GLU I . n 
X  8  16  LEU 16  16  16  LEU LEU I . n 
X  8  17  LEU 17  17  17  LEU LEU I . n 
X  8  18  SER 18  18  18  SER SER I . n 
X  8  19  TRP 19  19  19  TRP TRP I . n 
X  8  20  MET 20  20  20  MET MET I . n 
X  8  21  ARG 21  21  21  ARG ARG I . n 
X  8  22  GLU 22  22  22  GLU GLU I . n 
X  8  23  TYR 23  23  23  TYR TYR I . n 
X  8  24  ALA 24  24  24  ALA ALA I . n 
X  8  25  GLN 25  25  25  GLN GLN I . n 
X  8  26  ALA 26  26  26  ALA ALA I . n 
X  8  27  LYS 27  27  27  LYS LYS I . n 
X  8  28  GLY 28  28  28  GLY GLY I . n 
X  8  29  VAL 29  29  29  VAL VAL I . n 
X  8  30  ARG 30  30  30  ARG ARG I . n 
X  8  31  PHE 31  31  31  PHE PHE I . n 
X  8  32  GLU 32  32  32  GLU GLU I . n 
X  8  33  LYS 33  33  33  LYS LYS I . n 
X  8  34  GLU 34  34  34  GLU GLU I . n 
X  8  35  ALA 35  35  35  ALA ALA I . n 
X  8  36  ASP 36  36  36  ASP ASP I . n 
X  8  37  PHE 37  37  37  PHE PHE I . n 
X  8  38  PRO 38  38  38  PRO PRO I . n 
X  8  39  ASP 39  39  39  ASP ASP I . n 
X  8  40  PHE 40  40  40  PHE PHE I . n 
X  8  41  ILE 41  41  41  ILE ILE I . n 
X  8  42  TYR 42  42  42  TYR TYR I . n 
X  8  43  ARG 43  43  43  ARG ARG I . n 
X  8  44  MET 44  44  44  MET MET I . n 
X  8  45  GLU 45  45  45  GLU GLU I . n 
X  8  46  ARG 46  46  46  ARG ARG I . n 
X  8  47  PRO 47  47  47  PRO PRO I . n 
X  8  48  TYR 48  48  48  TYR TYR I . n 
X  8  49  ASP 49  49  49  ASP ASP I . n 
X  8  50  LEU 50  50  50  LEU LEU I . n 
X  8  51  PRO 51  51  51  PRO PRO I . n 
X  8  52  THR 52  52  52  THR THR I . n 
X  8  53  THR 53  53  53  THR THR I . n 
X  8  54  ILE 54  54  54  ILE ILE I . n 
X  8  55  MET 55  55  55  MET MET I . n 
X  8  56  THR 56  56  56  THR THR I . n 
X  8  57  ALA 57  57  57  ALA ALA I . n 
X  8  58  SER 58  58  58  SER SER I . n 
X  8  59  LEU 59  59  59  LEU LEU I . n 
X  8  60  SER 60  60  60  SER SER I . n 
X  8  61  ASP 61  61  61  ASP ASP I . n 
X  8  62  GLY 62  62  62  GLY GLY I . n 
X  8  63  LEU 63  63  63  LEU LEU I . n 
X  8  64  GLY 64  64  64  GLY GLY I . n 
X  8  65  GLU 65  65  65  GLU GLU I . n 
X  8  66  PRO 66  66  66  PRO PRO I . n 
X  8  67  PHE 67  67  67  PHE PHE I . n 
X  8  68  LEU 68  68  68  LEU LEU I . n 
X  8  69  LEU 69  69  69  LEU LEU I . n 
X  8  70  ALA 70  70  70  ALA ALA I . n 
X  8  71  ASP 71  71  71  ASP ASP I . n 
X  8  72  VAL 72  72  72  VAL VAL I . n 
X  8  73  SER 73  73  73  SER SER I . n 
X  8  74  PRO 74  74  74  PRO PRO I . n 
X  8  75  ARG 75  75  75  ARG ARG I . n 
X  8  76  HIS 76  76  76  HIS HIS I . n 
X  8  77  ALA 77  77  77  ALA ALA I . n 
X  8  78  LYS 78  78  78  LYS LYS I . n 
X  8  79  LEU 79  79  79  LEU LEU I . n 
X  8  80  LYS 80  80  80  LYS LYS I . n 
X  8  81  ARG 81  81  81  ARG ARG I . n 
X  8  82  ILE 82  82  82  ILE ILE I . n 
X  8  83  GLY 83  83  83  GLY GLY I . n 
X  8  84  LEU 84  84  84  LEU LEU I . n 
X  8  85  ARG 85  85  85  ARG ARG I . n 
X  8  86  LEU 86  86  86  LEU LEU I . n 
X  8  87  PRO 87  87  87  PRO PRO I . n 
X  8  88  ARG 88  88  88  ARG ARG I . n 
X  8  89  ALA 89  89  89  ALA ALA I . n 
X  8  90  HIS 90  90  90  HIS HIS I . n 
X  8  91  ILE 91  91  91  ILE ILE I . n 
X  8  92  HIS 92  92  92  HIS HIS I . n 
X  8  93  LEU 93  93  93  LEU LEU I . n 
X  8  94  HIS 94  94  94  HIS HIS I . n 
X  8  95  ALA 95  95  95  ALA ALA I . n 
X  8  96  HIS 96  96  96  HIS HIS I . n 
X  8  97  TYR 97  97  97  TYR TYR I . n 
X  8  98  GLU 98  98  98  GLU GLU I . n 
X  8  99  PRO 99  99  99  PRO PRO I . n 
X  8  100 GLY 100 100 100 GLY GLY I . n 
X  8  101 LYS 101 101 101 LYS LYS I . n 
X  8  102 GLY 102 102 102 GLY GLY I . n 
X  8  103 LEU 103 103 103 LEU LEU I . n 
X  8  104 VAL 104 104 104 VAL VAL I . n 
X  8  105 THR 105 105 105 THR THR I . n 
X  8  106 GLY 106 106 106 GLY GLY I . n 
X  8  107 LYS 107 107 107 LYS LYS I . n 
X  8  108 ILE 108 108 108 ILE ILE I . n 
X  8  109 PRO 109 109 109 PRO PRO I . n 
X  8  110 LEU 110 110 110 LEU LEU I . n 
X  8  111 THR 111 111 111 THR THR I . n 
X  8  112 LYS 112 112 112 LYS LYS I . n 
X  8  113 GLU 113 113 113 GLU GLU I . n 
X  8  114 ARG 114 114 114 ARG ARG I . n 
X  8  115 PHE 115 115 115 PHE PHE I . n 
X  8  116 PHE 116 116 116 PHE PHE I . n 
X  8  117 ALA 117 117 117 ALA ALA I . n 
X  8  118 LEU 118 118 118 LEU LEU I . n 
X  8  119 ALA 119 119 119 ALA ALA I . n 
X  8  120 ASP 120 120 120 ASP ASP I . n 
X  8  121 ARG 121 121 121 ARG ARG I . n 
X  8  122 ALA 122 122 122 ALA ALA I . n 
X  8  123 ARG 123 123 123 ARG ARG I . n 
X  8  124 GLU 124 124 124 GLU GLU I . n 
X  8  125 ALA 125 125 125 ALA ALA I . n 
X  8  126 LEU 126 126 126 LEU LEU I . n 
X  8  127 ALA 127 127 127 ALA ALA I . n 
X  8  128 PHE 128 128 128 PHE PHE I . n 
X  8  129 ALA 129 129 129 ALA ALA I . n 
Y  9  1   MET 1   1   1   MET MET X . n 
Y  9  2   VAL 2   2   2   VAL VAL X . n 
Y  9  3   ARG 3   3   3   ARG ARG X . n 
Y  9  4   VAL 4   4   4   VAL VAL X . n 
Y  9  5   GLY 5   5   5   GLY GLY X . n 
Y  9  6   MET 6   6   6   MET MET X . n 
Y  9  7   ARG 7   7   7   ARG ARG X . n 
Y  9  8   ALA 8   8   8   ALA ALA X . n 
Y  9  9   ALA 9   9   9   ALA ALA X . n 
Y  9  10  PRO 10  10  10  PRO PRO X . n 
Y  9  11  ARG 11  11  11  ARG ARG X . n 
Y  9  12  VAL 12  12  12  VAL VAL X . n 
Y  9  13  SER 13  13  13  SER SER X . n 
Y  9  14  LEU 14  14  14  LEU LEU X . n 
Y  9  15  GLU 15  15  15  GLU GLU X . n 
Y  9  16  ALA 16  16  16  ALA ALA X . n 
Y  9  17  LEU 17  17  17  LEU LEU X . n 
Y  9  18  LYS 18  18  18  LYS LYS X . n 
Y  9  19  ALA 19  19  19  ALA ALA X . n 
Y  9  20  ALA 20  20  20  ALA ALA X . n 
Y  9  21  LEU 21  21  21  LEU LEU X . n 
Y  9  22  GLY 22  22  22  GLY GLY X . n 
Y  9  23  GLY 23  23  23  GLY GLY X . n 
Y  9  24  LEU 24  24  24  LEU LEU X . n 
Y  9  25  LYS 25  25  25  LYS LYS X . n 
Y  9  26  LEU 26  26  26  LEU LEU X . n 
Y  9  27  SER 27  27  27  SER SER X . n 
Y  9  28  GLU 28  28  28  GLU GLU X . n 
Y  9  29  ALA 29  29  29  ALA ALA X . n 
Y  9  30  LYS 30  30  30  LYS LYS X . n 
Y  9  31  VAL 31  31  31  VAL VAL X . n 
Y  9  32  TYR 32  32  32  TYR TYR X . n 
Y  9  33  LEU 33  33  33  LEU LEU X . n 
Y  9  34  ILE 34  34  34  ILE ILE X . n 
Y  9  35  THR 35  35  35  THR THR X . n 
Y  9  36  ASP 36  36  36  ASP ASP X . n 
Y  9  37  TRP 37  37  37  TRP TRP X . n 
Y  9  38  GLN 38  38  38  GLN GLN X . n 
Y  9  39  ASP 39  39  39  ASP ASP X . n 
Y  9  40  LYS 40  40  40  LYS LYS X . n 
Y  9  41  ARG 41  41  41  ARG ARG X . n 
Y  9  42  ASP 42  42  42  ASP ASP X . n 
Y  9  43  GLN 43  43  43  GLN GLN X . n 
Y  9  44  ALA 44  44  44  ALA ALA X . n 
Y  9  45  ARG 45  45  45  ARG ARG X . n 
Y  9  46  TYR 46  46  46  TYR TYR X . n 
Y  9  47  ALA 47  47  47  ALA ALA X . n 
Y  9  48  LEU 48  48  48  LEU LEU X . n 
Y  9  49  LEU 49  49  49  LEU LEU X . n 
Y  9  50  LEU 50  50  50  LEU LEU X . n 
Y  9  51  HIS 51  51  51  HIS HIS X . n 
Y  9  52  THR 52  52  52  THR THR X . n 
Y  9  53  GLY 53  53  53  GLY GLY X . n 
Y  9  54  LYS 54  54  54  LYS LYS X . n 
Y  9  55  LYS 55  55  55  LYS LYS X . n 
Y  9  56  ASP 56  56  56  ASP ASP X . n 
Y  9  57  LEU 57  57  57  LEU LEU X . n 
Y  9  58  LEU 58  58  58  LEU LEU X . n 
Y  9  59  VAL 59  59  59  VAL VAL X . n 
Y  9  60  PRO 60  60  60  PRO PRO X . n 
Y  9  61  ASP 61  61  61  ASP ASP X . n 
Y  9  62  ALA 62  62  62  ALA ALA X . n 
Y  9  63  PHE 63  63  63  PHE PHE X . n 
Y  9  64  GLY 64  64  64  GLY GLY X . n 
Y  9  65  PRO 65  65  65  PRO PRO X . n 
Y  9  66  ALA 66  66  66  ALA ALA X . n 
Y  9  67  PHE 67  67  67  PHE PHE X . n 
Y  9  68  PRO 68  68  68  PRO PRO X . n 
Y  9  69  GLY 69  69  69  GLY GLY X . n 
Y  9  70  GLY 70  70  70  GLY GLY X . n 
Y  9  71  GLU 71  71  71  GLU GLU X . n 
Y  9  72  GLU 72  72  72  GLU GLU X . n 
Y  9  73  ALA 73  73  73  ALA ALA X . n 
Y  9  74  LEU 74  74  74  LEU LEU X . n 
Y  9  75  SER 75  75  75  SER SER X . n 
Y  9  76  GLU 76  76  76  GLU GLU X . n 
Y  9  77  LEU 77  77  77  LEU LEU X . n 
Y  9  78  VAL 78  78  78  VAL VAL X . n 
Y  9  79  GLY 79  79  79  GLY GLY X . n 
Y  9  80  LEU 80  80  80  LEU LEU X . n 
Y  9  81  LEU 81  81  81  LEU LEU X . n 
Y  9  82  LEU 82  82  82  LEU LEU X . n 
Y  9  83  ALA 83  83  83  ALA ALA X . n 
Y  9  84  GLN 84  84  84  GLN GLN X . n 
Y  9  85  GLY 85  85  85  GLY GLY X . n 
Y  9  86  ALA 86  86  86  ALA ALA X . n 
Y  9  87  ARG 87  87  87  ARG ARG X . n 
Y  9  88  ARG 88  88  88  ARG ARG X . n 
Y  9  89  PHE 89  89  89  PHE PHE X . n 
Y  9  90  TYR 90  90  90  TYR TYR X . n 
Y  9  91  GLU 91  91  91  GLU GLU X . n 
Y  9  92  ALA 92  92  92  ALA ALA X . n 
Y  9  93  VAL 93  93  93  VAL VAL X . n 
Y  9  94  VAL 94  94  94  VAL VAL X . n 
Y  9  95  SER 95  95  95  SER SER X . n 
Y  9  96  PRO 96  96  96  PRO PRO X . n 
Y  9  97  GLY 97  97  97  GLY GLY X . n 
Y  9  98  GLU 98  98  98  GLU GLU X . n 
Y  9  99  MET 99  99  99  MET MET X . n 
Y  9  100 THR 100 100 100 THR THR X . n 
Y  9  101 ALA 101 101 101 ALA ALA X . n 
Y  9  102 LEU 102 102 102 LEU LEU X . n 
Y  9  103 LEU 103 103 103 LEU LEU X . n 
Y  9  104 ASP 104 104 104 ASP ASP X . n 
Y  9  105 LEU 105 105 105 LEU LEU X . n 
Y  9  106 PRO 106 106 106 PRO PRO X . n 
Y  9  107 PRO 107 107 107 PRO PRO X . n 
Y  9  108 GLU 108 108 108 GLU GLU X . n 
Y  9  109 GLU 109 109 109 GLU GLU X . n 
Y  9  110 LEU 110 110 110 LEU LEU X . n 
Y  9  111 LEU 111 111 111 LEU LEU X . n 
Y  9  112 LYS 112 112 112 LYS LYS X . n 
Y  9  113 ARG 113 113 113 ARG ARG X . n 
Y  9  114 VAL 114 114 114 VAL VAL X . n 
Y  9  115 MET 115 115 115 MET MET X . n 
Y  9  116 ALA 116 116 116 ALA ALA X . n 
Y  9  117 ILE 117 117 117 ILE ILE X . n 
Y  9  118 ALA 118 118 118 ALA ALA X . n 
Y  9  119 ASN 119 119 119 ASN ASN X . n 
Y  9  120 PRO 120 120 120 PRO PRO X . n 
Y  9  121 THR 121 121 121 THR THR X . n 
Y  9  122 ASP 122 122 122 ASP ASP X . n 
Y  9  123 PRO 123 123 123 PRO PRO X . n 
Y  9  124 GLY 124 124 124 GLY GLY X . n 
Y  9  125 ILE 125 125 125 ILE ILE X . n 
Y  9  126 TYR 126 126 126 TYR TYR X . n 
Y  9  127 LEU 127 127 127 LEU LEU X . n 
Y  9  128 LYS 128 128 ?   ?   ?   X . n 
Y  9  129 ARG 129 129 ?   ?   ?   X . n 
Y  9  130 ALA 130 130 ?   ?   ?   X . n 
Y  9  131 ALA 131 131 ?   ?   ?   X . n 
Z  10 1   MET 1   1   1   MET MET P . n 
Z  10 2   ALA 2   2   2   ALA ALA P . n 
Z  10 3   PRO 3   3   3   PRO PRO P . n 
Z  10 4   ILE 4   4   4   ILE ILE P . n 
Z  10 5   GLN 5   5   5   GLN GLN P . n 
Z  10 6   GLU 6   6   6   GLU GLU P . n 
Z  10 7   TYR 7   7   7   TYR TYR P . n 
Z  10 8   VAL 8   8   8   VAL VAL P . n 
Z  10 9   GLY 9   9   9   GLY GLY P . n 
Z  10 10  THR 10  10  10  THR THR P . n 
Z  10 11  LEU 11  11  11  LEU LEU P . n 
Z  10 12  ILE 12  12  12  ILE ILE P . n 
Z  10 13  TYR 13  13  13  TYR TYR P . n 
Z  10 14  VAL 14  14  14  VAL VAL P . n 
Z  10 15  GLY 15  15  15  GLY GLY P . n 
Z  10 16  VAL 16  16  16  VAL VAL P . n 
Z  10 17  ALA 17  17  17  ALA ALA P . n 
Z  10 18  LEU 18  18  18  LEU LEU P . n 
Z  10 19  PHE 19  19  19  PHE PHE P . n 
Z  10 20  ILE 20  20  20  ILE ILE P . n 
Z  10 21  GLY 21  21  21  GLY GLY P . n 
Z  10 22  VAL 22  22  22  VAL VAL P . n 
Z  10 23  ALA 23  23  23  ALA ALA P . n 
Z  10 24  ALA 24  24  24  ALA ALA P . n 
Z  10 25  LEU 25  25  25  LEU LEU P . n 
Z  10 26  LEU 26  26  26  LEU LEU P . n 
Z  10 27  VAL 27  27  27  VAL VAL P . n 
Z  10 28  GLY 28  28  28  GLY GLY P . n 
Z  10 29  ALA 29  29  29  ALA ALA P . n 
Z  10 30  LEU 30  30  30  LEU LEU P . n 
Z  10 31  LEU 31  31  31  LEU LEU P . n 
Z  10 32  GLY 32  32  32  GLY GLY P . n 
Z  10 33  PRO 33  33  33  PRO PRO P . n 
Z  10 34  LYS 34  34  34  LYS LYS P . n 
Z  10 35  LYS 35  35  35  LYS LYS P . n 
Z  10 36  PRO 36  36  36  PRO PRO P . n 
Z  10 37  GLY 37  37  37  GLY GLY P . n 
Z  10 38  ARG 38  38  38  ARG ARG P . n 
Z  10 39  ALA 39  39  39  ALA ALA P . n 
Z  10 40  LYS 40  40  40  LYS LYS P . n 
Z  10 41  LEU 41  41  41  LEU LEU P . n 
Z  10 42  MET 42  42  42  MET MET P . n 
Z  10 43  PRO 43  43  43  PRO PRO P . n 
Z  10 44  TYR 44  44  44  TYR TYR P . n 
Z  10 45  GLU 45  45  45  GLU GLU P . n 
Z  10 46  SER 46  46  46  SER SER P . n 
Z  10 47  GLY 47  47  47  GLY GLY P . n 
Z  10 48  ASN 48  48  48  ASN ASN P . n 
Z  10 49  ASP 49  49  49  ASP ASP P . n 
Z  10 50  PRO 50  50  50  PRO PRO P . n 
Z  10 51  ALA 51  51  51  ALA ALA P . n 
Z  10 52  GLY 52  52  52  GLY GLY P . n 
Z  10 53  GLU 53  53  53  GLU GLU P . n 
Z  10 54  VAL 54  54  54  VAL VAL P . n 
Z  10 55  LYS 55  55  55  LYS LYS P . n 
Z  10 56  ARG 56  56  56  ARG ARG P . n 
Z  10 57  PHE 57  57  57  PHE PHE P . n 
Z  10 58  PRO 58  58  58  PRO PRO P . n 
Z  10 59  VAL 59  59  59  VAL VAL P . n 
Z  10 60  HIS 60  60  60  HIS HIS P . n 
Z  10 61  PHE 61  61  61  PHE PHE P . n 
Z  10 62  TYR 62  62  62  TYR TYR P . n 
Z  10 63  VAL 63  63  63  VAL VAL P . n 
Z  10 64  VAL 64  64  64  VAL VAL P . n 
Z  10 65  ALA 65  65  65  ALA ALA P . n 
Z  10 66  MET 66  66  66  MET MET P . n 
Z  10 67  LEU 67  67  67  LEU LEU P . n 
Z  10 68  PHE 68  68  68  PHE PHE P . n 
Z  10 69  ILE 69  69  69  ILE ILE P . n 
Z  10 70  LEU 70  70  70  LEU LEU P . n 
Z  10 71  PHE 71  71  71  PHE PHE P . n 
Z  10 72  ASP 72  72  72  ASP ASP P . n 
Z  10 73  VAL 73  73  73  VAL VAL P . n 
Z  10 74  GLU 74  74  74  GLU GLU P . n 
Z  10 75  VAL 75  75  75  VAL VAL P . n 
Z  10 76  ALA 76  76  76  ALA ALA P . n 
Z  10 77  PHE 77  77  77  PHE PHE P . n 
Z  10 78  LEU 78  78  78  LEU LEU P . n 
Z  10 79  TRP 79  79  79  TRP TRP P . n 
Z  10 80  PRO 80  80  80  PRO PRO P . n 
Z  10 81  TYR 81  81  81  TYR TYR P . n 
Z  10 82  ALA 82  82  82  ALA ALA P . n 
Z  10 83  VAL 83  83  83  VAL VAL P . n 
Z  10 84  SER 84  84  84  SER SER P . n 
Z  10 85  ALA 85  85  85  ALA ALA P . n 
Z  10 86  GLY 86  86  86  GLY GLY P . n 
Z  10 87  GLY 87  87  87  GLY GLY P . n 
Z  10 88  LEU 88  88  88  LEU LEU P . n 
Z  10 89  GLY 89  89  89  GLY GLY P . n 
Z  10 90  LEU 90  90  90  LEU LEU P . n 
Z  10 91  TYR 91  91  91  TYR TYR P . n 
Z  10 92  GLY 92  92  92  GLY GLY P . n 
Z  10 93  PHE 93  93  93  PHE PHE P . n 
Z  10 94  LEU 94  94  94  LEU LEU P . n 
Z  10 95  GLY 95  95  95  GLY GLY P . n 
Z  10 96  VAL 96  96  96  VAL VAL P . n 
Z  10 97  LEU 97  97  97  LEU LEU P . n 
Z  10 98  ALA 98  98  98  ALA ALA P . n 
Z  10 99  PHE 99  99  99  PHE PHE P . n 
Z  10 100 THR 100 100 100 THR THR P . n 
Z  10 101 LEU 101 101 101 LEU LEU P . n 
Z  10 102 LEU 102 102 102 LEU LEU P . n 
Z  10 103 LEU 103 103 103 LEU LEU P . n 
Z  10 104 PHE 104 104 104 PHE PHE P . n 
Z  10 105 VAL 105 105 105 VAL VAL P . n 
Z  10 106 GLY 106 106 106 GLY GLY P . n 
Z  10 107 PHE 107 107 107 PHE PHE P . n 
Z  10 108 LEU 108 108 108 LEU LEU P . n 
Z  10 109 TYR 109 109 109 TYR TYR P . n 
Z  10 110 GLU 110 110 110 GLU GLU P . n 
Z  10 111 TRP 111 111 111 TRP TRP P . n 
Z  10 112 TRP 112 112 112 TRP TRP P . n 
Z  10 113 LYS 113 113 113 LYS LYS P . n 
Z  10 114 GLY 114 114 114 GLY GLY P . n 
Z  10 115 VAL 115 115 115 VAL VAL P . n 
Z  10 116 MET 116 116 116 MET MET P . n 
Z  10 117 ARG 117 117 117 ARG ARG P . n 
Z  10 118 TRP 118 118 ?   ?   ?   P . n 
Z  10 119 HIS 119 119 ?   ?   ?   P . n 
AA 11 1   MET 1   1   1   MET MET R . n 
AA 11 2   SER 2   2   2   SER SER R . n 
AA 11 3   LEU 3   3   3   LEU LEU R . n 
AA 11 4   LEU 4   4   4   LEU LEU R . n 
AA 11 5   GLU 5   5   5   GLU GLU R . n 
AA 11 6   GLY 6   6   6   GLY GLY R . n 
AA 11 7   LEU 7   7   7   LEU LEU R . n 
AA 11 8   ALA 8   8   8   ALA ALA R . n 
AA 11 9   LEU 9   9   9   LEU LEU R . n 
AA 11 10  PHE 10  10  10  PHE PHE R . n 
AA 11 11  LEU 11  11  11  LEU LEU R . n 
AA 11 12  LEU 12  12  12  LEU LEU R . n 
AA 11 13  LEU 13  13  13  LEU LEU R . n 
AA 11 14  LEU 14  14  14  LEU LEU R . n 
AA 11 15  SER 15  15  15  SER SER R . n 
AA 11 16  GLY 16  16  16  GLY GLY R . n 
AA 11 17  VAL 17  17  17  VAL VAL R . n 
AA 11 18  LEU 18  18  18  LEU LEU R . n 
AA 11 19  VAL 19  19  19  VAL VAL R . n 
AA 11 20  VAL 20  20  20  VAL VAL R . n 
AA 11 21  THR 21  21  21  THR THR R . n 
AA 11 22  LEU 22  22  22  LEU LEU R . n 
AA 11 23  ARG 23  23  23  ARG ARG R . n 
AA 11 24  ASN 24  24  24  ASN ASN R . n 
AA 11 25  ALA 25  25  25  ALA ALA R . n 
AA 11 26  ILE 26  26  26  ILE ILE R . n 
AA 11 27  HIS 27  27  27  HIS HIS R . n 
AA 11 28  ALA 28  28  28  ALA ALA R . n 
AA 11 29  ALA 29  29  29  ALA ALA R . n 
AA 11 30  LEU 30  30  30  LEU LEU R . n 
AA 11 31  ALA 31  31  31  ALA ALA R . n 
AA 11 32  LEU 32  32  32  LEU LEU R . n 
AA 11 33  ILE 33  33  33  ILE ILE R . n 
AA 11 34  LEU 34  34  34  LEU LEU R . n 
AA 11 35  ASN 35  35  35  ASN ASN R . n 
AA 11 36  PHE 36  36  36  PHE PHE R . n 
AA 11 37  LEU 37  37  37  LEU LEU R . n 
AA 11 38  VAL 38  38  38  VAL VAL R . n 
AA 11 39  LEU 39  39  39  LEU LEU R . n 
AA 11 40  ALA 40  40  40  ALA ALA R . n 
AA 11 41  GLY 41  41  41  GLY GLY R . n 
AA 11 42  VAL 42  42  42  VAL VAL R . n 
AA 11 43  TYR 43  43  43  TYR TYR R . n 
AA 11 44  VAL 44  44  44  VAL VAL R . n 
AA 11 45  ALA 45  45  45  ALA ALA R . n 
AA 11 46  LEU 46  46  46  LEU LEU R . n 
AA 11 47  ASP 47  47  47  ASP ASP R . n 
AA 11 48  ALA 48  48  48  ALA ALA R . n 
AA 11 49  ARG 49  49  49  ARG ARG R . n 
AA 11 50  PHE 50  50  50  PHE PHE R . n 
AA 11 51  LEU 51  51  51  LEU LEU R . n 
AA 11 52  GLY 52  52  52  GLY GLY R . n 
AA 11 53  PHE 53  53  53  PHE PHE R . n 
AA 11 54  ILE 54  54  54  ILE ILE R . n 
AA 11 55  GLN 55  55  55  GLN GLN R . n 
AA 11 56  VAL 56  56  56  VAL VAL R . n 
AA 11 57  ILE 57  57  57  ILE ILE R . n 
AA 11 58  VAL 58  58  58  VAL VAL R . n 
AA 11 59  TYR 59  59  59  TYR TYR R . n 
AA 11 60  ALA 60  60  60  ALA ALA R . n 
AA 11 61  GLY 61  61  61  GLY GLY R . n 
AA 11 62  ALA 62  62  62  ALA ALA R . n 
AA 11 63  ILE 63  63  63  ILE ILE R . n 
AA 11 64  VAL 64  64  64  VAL VAL R . n 
AA 11 65  VAL 65  65  65  VAL VAL R . n 
AA 11 66  LEU 66  66  66  LEU LEU R . n 
AA 11 67  PHE 67  67  67  PHE PHE R . n 
AA 11 68  LEU 68  68  68  LEU LEU R . n 
AA 11 69  PHE 69  69  69  PHE PHE R . n 
AA 11 70  VAL 70  70  70  VAL VAL R . n 
AA 11 71  ILE 71  71  71  ILE ILE R . n 
AA 11 72  MET 72  72  72  MET MET R . n 
AA 11 73  LEU 73  73  73  LEU LEU R . n 
AA 11 74  LEU 74  74  74  LEU LEU R . n 
AA 11 75  PHE 75  75  75  PHE PHE R . n 
AA 11 76  ALA 76  76  76  ALA ALA R . n 
AA 11 77  ALA 77  77  77  ALA ALA R . n 
AA 11 78  GLN 78  78  78  GLN GLN R . n 
AA 11 79  GLY 79  79  79  GLY GLY R . n 
AA 11 80  GLU 80  80  80  GLU GLU R . n 
AA 11 81  ILE 81  81  81  ILE ILE R . n 
AA 11 82  GLY 82  82  82  GLY GLY R . n 
AA 11 83  PHE 83  83  83  PHE PHE R . n 
AA 11 84  ASP 84  84  84  ASP ASP R . n 
AA 11 85  PRO 85  85  85  PRO PRO R . n 
AA 11 86  LEU 86  86  86  LEU LEU R . n 
AA 11 87  VAL 87  87  87  VAL VAL R . n 
AA 11 88  ARG 88  88  88  ARG ARG R . n 
AA 11 89  SER 89  89  89  SER SER R . n 
AA 11 90  ARG 90  90  90  ARG ARG R . n 
AA 11 91  PRO 91  91  91  PRO PRO R . n 
AA 11 92  LEU 92  92  92  LEU LEU R . n 
AA 11 93  ALA 93  93  93  ALA ALA R . n 
AA 11 94  ALA 94  94  94  ALA ALA R . n 
AA 11 95  LEU 95  95  95  LEU LEU R . n 
AA 11 96  LEU 96  96  96  LEU LEU R . n 
AA 11 97  ALA 97  97  97  ALA ALA R . n 
AA 11 98  LEU 98  98  98  LEU LEU R . n 
AA 11 99  GLY 99  99  99  GLY GLY R . n 
AA 11 100 VAL 100 100 100 VAL VAL R . n 
AA 11 101 ALA 101 101 101 ALA ALA R . n 
AA 11 102 GLY 102 102 102 GLY GLY R . n 
AA 11 103 ILE 103 103 103 ILE ILE R . n 
AA 11 104 LEU 104 104 104 LEU LEU R . n 
AA 11 105 ALA 105 105 105 ALA ALA R . n 
AA 11 106 ALA 106 106 106 ALA ALA R . n 
AA 11 107 GLY 107 107 107 GLY GLY R . n 
AA 11 108 LEU 108 108 108 LEU LEU R . n 
AA 11 109 TRP 109 109 109 TRP TRP R . n 
AA 11 110 GLY 110 110 110 GLY GLY R . n 
AA 11 111 LEU 111 111 111 LEU LEU R . n 
AA 11 112 ASP 112 112 112 ASP ASP R . n 
AA 11 113 LEU 113 113 113 LEU LEU R . n 
AA 11 114 ALA 114 114 114 ALA ALA R . n 
AA 11 115 PHE 115 115 115 PHE PHE R . n 
AA 11 116 THR 116 116 116 THR THR R . n 
AA 11 117 GLN 117 117 117 GLN GLN R . n 
AA 11 118 ASP 118 118 118 ASP ASP R . n 
AA 11 119 LEU 119 119 119 LEU LEU R . n 
AA 11 120 LYS 120 120 120 LYS LYS R . n 
AA 11 121 GLY 121 121 121 GLY GLY R . n 
AA 11 122 GLY 122 122 122 GLY GLY R . n 
AA 11 123 LEU 123 123 123 LEU LEU R . n 
AA 11 124 PRO 124 124 124 PRO PRO R . n 
AA 11 125 GLN 125 125 125 GLN GLN R . n 
AA 11 126 ALA 126 126 126 ALA ALA R . n 
AA 11 127 LEU 127 127 127 LEU LEU R . n 
AA 11 128 GLY 128 128 128 GLY GLY R . n 
AA 11 129 PRO 129 129 129 PRO PRO R . n 
AA 11 130 LEU 130 130 130 LEU LEU R . n 
AA 11 131 LEU 131 131 131 LEU LEU R . n 
AA 11 132 TYR 132 132 132 TYR TYR R . n 
AA 11 133 GLY 133 133 133 GLY GLY R . n 
AA 11 134 ASP 134 134 134 ASP ASP R . n 
AA 11 135 TRP 135 135 135 TRP TRP R . n 
AA 11 136 LEU 136 136 136 LEU LEU R . n 
AA 11 137 PHE 137 137 137 PHE PHE R . n 
AA 11 138 VAL 138 138 138 VAL VAL R . n 
AA 11 139 LEU 139 139 139 LEU LEU R . n 
AA 11 140 LEU 140 140 140 LEU LEU R . n 
AA 11 141 ALA 141 141 141 ALA ALA R . n 
AA 11 142 VAL 142 142 142 VAL VAL R . n 
AA 11 143 GLY 143 143 143 GLY GLY R . n 
AA 11 144 PHE 144 144 144 PHE PHE R . n 
AA 11 145 LEU 145 145 145 LEU LEU R . n 
AA 11 146 LEU 146 146 146 LEU LEU R . n 
AA 11 147 MET 147 147 147 MET MET R . n 
AA 11 148 ALA 148 148 148 ALA ALA R . n 
AA 11 149 ALA 149 149 149 ALA ALA R . n 
AA 11 150 THR 150 150 150 THR THR R . n 
AA 11 151 VAL 151 151 151 VAL VAL R . n 
AA 11 152 VAL 152 152 152 VAL VAL R . n 
AA 11 153 ALA 153 153 153 ALA ALA R . n 
AA 11 154 VAL 154 154 154 VAL VAL R . n 
AA 11 155 ALA 155 155 155 ALA ALA R . n 
AA 11 156 LEU 156 156 156 LEU LEU R . n 
AA 11 157 VAL 157 157 157 VAL VAL R . n 
AA 11 158 GLU 158 158 158 GLU GLU R . n 
AA 11 159 PRO 159 159 159 PRO PRO R . n 
AA 11 160 GLY 160 160 160 GLY GLY R . n 
AA 11 161 LYS 161 161 ?   ?   ?   R . n 
AA 11 162 ALA 162 162 ?   ?   ?   R . n 
AA 11 163 SER 163 163 ?   ?   ?   R . n 
AA 11 164 ARG 164 164 ?   ?   ?   R . n 
AA 11 165 ALA 165 165 ?   ?   ?   R . n 
AA 11 166 LYS 166 166 ?   ?   ?   R . n 
AA 11 167 GLU 167 167 ?   ?   ?   R . n 
AA 11 168 ALA 168 168 ?   ?   ?   R . n 
AA 11 169 GLU 169 169 ?   ?   ?   R . n 
AA 11 170 LYS 170 170 ?   ?   ?   R . n 
AA 11 171 ARG 171 171 ?   ?   ?   R . n 
AA 11 172 GLU 172 172 ?   ?   ?   R . n 
AA 11 173 GLU 173 173 ?   ?   ?   R . n 
AA 11 174 VAL 174 174 ?   ?   ?   R . n 
AA 11 175 ALA 175 175 ?   ?   ?   R . n 
AA 11 176 ARG 176 176 ?   ?   ?   R . n 
BA 12 1   MET 1   1   1   MET MET S . n 
BA 12 2   SER 2   2   2   SER SER S . n 
BA 12 3   TYR 3   3   3   TYR TYR S . n 
BA 12 4   LEU 4   4   4   LEU LEU S . n 
BA 12 5   LEU 5   5   5   LEU LEU S . n 
BA 12 6   THR 6   6   6   THR THR S . n 
BA 12 7   SER 7   7   7   SER SER S . n 
BA 12 8   ALA 8   8   8   ALA ALA S . n 
BA 12 9   LEU 9   9   9   LEU LEU S . n 
BA 12 10  LEU 10  10  10  LEU LEU S . n 
BA 12 11  PHE 11  11  11  PHE PHE S . n 
BA 12 12  ALA 12  12  12  ALA ALA S . n 
BA 12 13  LEU 13  13  13  LEU LEU S . n 
BA 12 14  GLY 14  14  14  GLY GLY S . n 
BA 12 15  VAL 15  15  15  VAL VAL S . n 
BA 12 16  TYR 16  16  16  TYR TYR S . n 
BA 12 17  GLY 17  17  17  GLY GLY S . n 
BA 12 18  VAL 18  18  18  VAL VAL S . n 
BA 12 19  LEU 19  19  19  LEU LEU S . n 
BA 12 20  THR 20  20  20  THR THR S . n 
BA 12 21  ARG 21  21  21  ARG ARG S . n 
BA 12 22  ARG 22  22  22  ARG ARG S . n 
BA 12 23  THR 23  23  23  THR THR S . n 
BA 12 24  ALA 24  24  24  ALA ALA S . n 
BA 12 25  ILE 25  25  25  ILE ILE S . n 
BA 12 26  LEU 26  26  26  LEU LEU S . n 
BA 12 27  VAL 27  27  27  VAL VAL S . n 
BA 12 28  PHE 28  28  28  PHE PHE S . n 
BA 12 29  LEU 29  29  29  LEU LEU S . n 
BA 12 30  SER 30  30  30  SER SER S . n 
BA 12 31  ILE 31  31  31  ILE ILE S . n 
BA 12 32  GLU 32  32  32  GLU GLU S . n 
BA 12 33  LEU 33  33  33  LEU LEU S . n 
BA 12 34  MET 34  34  34  MET MET S . n 
BA 12 35  LEU 35  35  35  LEU LEU S . n 
BA 12 36  ASN 36  36  36  ASN ASN S . n 
BA 12 37  ALA 37  37  37  ALA ALA S . n 
BA 12 38  ALA 38  38  38  ALA ALA S . n 
BA 12 39  ASN 39  39  39  ASN ASN S . n 
BA 12 40  LEU 40  40  40  LEU LEU S . n 
BA 12 41  SER 41  41  41  SER SER S . n 
BA 12 42  LEU 42  42  42  LEU LEU S . n 
BA 12 43  VAL 43  43  43  VAL VAL S . n 
BA 12 44  GLY 44  44  44  GLY GLY S . n 
BA 12 45  PHE 45  45  45  PHE PHE S . n 
BA 12 46  ALA 46  46  46  ALA ALA S . n 
BA 12 47  ARG 47  47  47  ARG ARG S . n 
BA 12 48  ALA 48  48  48  ALA ALA S . n 
BA 12 49  TYR 49  49  49  TYR TYR S . n 
BA 12 50  GLY 50  50  50  GLY GLY S . n 
BA 12 51  LEU 51  51  51  LEU LEU S . n 
BA 12 52  ASP 52  52  52  ASP ASP S . n 
BA 12 53  GLY 53  53  53  GLY GLY S . n 
BA 12 54  GLN 54  54  54  GLN GLN S . n 
BA 12 55  VAL 55  55  55  VAL VAL S . n 
BA 12 56  ALA 56  56  56  ALA ALA S . n 
BA 12 57  ALA 57  57  57  ALA ALA S . n 
BA 12 58  LEU 58  58  58  LEU LEU S . n 
BA 12 59  MET 59  59  59  MET MET S . n 
BA 12 60  VAL 60  60  60  VAL VAL S . n 
BA 12 61  ILE 61  61  61  ILE ILE S . n 
BA 12 62  ALA 62  62  62  ALA ALA S . n 
BA 12 63  VAL 63  63  63  VAL VAL S . n 
BA 12 64  ALA 64  64  64  ALA ALA S . n 
BA 12 65  ALA 65  65  65  ALA ALA S . n 
BA 12 66  ALA 66  66  66  ALA ALA S . n 
BA 12 67  GLU 67  67  67  GLU GLU S . n 
BA 12 68  VAL 68  68  68  VAL VAL S . n 
BA 12 69  ALA 69  69  69  ALA ALA S . n 
BA 12 70  VAL 70  70  70  VAL VAL S . n 
BA 12 71  GLY 71  71  71  GLY GLY S . n 
BA 12 72  LEU 72  72  72  LEU LEU S . n 
BA 12 73  GLY 73  73  73  GLY GLY S . n 
BA 12 74  LEU 74  74  74  LEU LEU S . n 
BA 12 75  ILE 75  75  75  ILE ILE S . n 
BA 12 76  VAL 76  76  76  VAL VAL S . n 
BA 12 77  ALA 77  77  77  ALA ALA S . n 
BA 12 78  ILE 78  78  78  ILE ILE S . n 
BA 12 79  PHE 79  79  79  PHE PHE S . n 
BA 12 80  ARG 80  80  80  ARG ARG S . n 
BA 12 81  HIS 81  81  81  HIS HIS S . n 
BA 12 82  ARG 82  82  82  ARG ARG S . n 
BA 12 83  GLU 83  83  83  GLU GLU S . n 
BA 12 84  SER 84  84  84  SER SER S . n 
BA 12 85  THR 85  85  85  THR THR S . n 
BA 12 86  ALA 86  86  86  ALA ALA S . n 
BA 12 87  VAL 87  87  87  VAL VAL S . n 
BA 12 88  ASP 88  88  88  ASP ASP S . n 
BA 12 89  ASP 89  89  89  ASP ASP S . n 
BA 12 90  LEU 90  90  90  LEU LEU S . n 
BA 12 91  SER 91  91  91  SER SER S . n 
BA 12 92  GLU 92  92  92  GLU GLU S . n 
BA 12 93  LEU 93  93  93  LEU LEU S . n 
BA 12 94  ARG 94  94  94  ARG ARG S . n 
BA 12 95  GLY 95  95  95  GLY GLY S . n 
CA 13 1   MET 1   1   1   MET MET T . n 
CA 13 2   ALA 2   2   2   ALA ALA T . n 
CA 13 3   LEU 3   3   3   LEU LEU T . n 
CA 13 4   LEU 4   4   4   LEU LEU T . n 
CA 13 5   GLY 5   5   5   GLY GLY T . n 
CA 13 6   THR 6   6   6   THR THR T . n 
CA 13 7   ILE 7   7   7   ILE ILE T . n 
CA 13 8   LEU 8   8   8   LEU LEU T . n 
CA 13 9   LEU 9   9   9   LEU LEU T . n 
CA 13 10  PRO 10  10  10  PRO PRO T . n 
CA 13 11  LEU 11  11  11  LEU LEU T . n 
CA 13 12  LEU 12  12  12  LEU LEU T . n 
CA 13 13  GLY 13  13  13  GLY GLY T . n 
CA 13 14  PHE 14  14  14  PHE PHE T . n 
CA 13 15  ALA 15  15  15  ALA ALA T . n 
CA 13 16  LEU 16  16  16  LEU LEU T . n 
CA 13 17  LEU 17  17  17  LEU LEU T . n 
CA 13 18  GLY 18  18  18  GLY GLY T . n 
CA 13 19  LEU 19  19  19  LEU LEU T . n 
CA 13 20  PHE 20  20  20  PHE PHE T . n 
CA 13 21  GLY 21  21  21  GLY GLY T . n 
CA 13 22  LYS 22  22  22  LYS LYS T . n 
CA 13 23  ARG 23  23  23  ARG ARG T . n 
CA 13 24  MET 24  24  24  MET MET T . n 
CA 13 25  ARG 25  25  25  ARG ARG T . n 
CA 13 26  GLU 26  26  26  GLU GLU T . n 
CA 13 27  PRO 27  27  27  PRO PRO T . n 
CA 13 28  LEU 28  28  28  LEU LEU T . n 
CA 13 29  PRO 29  29  29  PRO PRO T . n 
CA 13 30  GLY 30  30  30  GLY GLY T . n 
CA 13 31  VAL 31  31  31  VAL VAL T . n 
CA 13 32  LEU 32  32  32  LEU LEU T . n 
CA 13 33  ALA 33  33  33  ALA ALA T . n 
CA 13 34  SER 34  34  34  SER SER T . n 
CA 13 35  GLY 35  35  35  GLY GLY T . n 
CA 13 36  LEU 36  36  36  LEU LEU T . n 
CA 13 37  VAL 37  37  37  VAL VAL T . n 
CA 13 38  LEU 38  38  38  LEU LEU T . n 
CA 13 39  ALA 39  39  39  ALA ALA T . n 
CA 13 40  SER 40  40  40  SER SER T . n 
CA 13 41  PHE 41  41  41  PHE PHE T . n 
CA 13 42  LEU 42  42  42  LEU LEU T . n 
CA 13 43  LEU 43  43  43  LEU LEU T . n 
CA 13 44  GLY 44  44  44  GLY GLY T . n 
CA 13 45  ALA 45  45  45  ALA ALA T . n 
CA 13 46  GLY 46  46  46  GLY GLY T . n 
CA 13 47  LEU 47  47  47  LEU LEU T . n 
CA 13 48  LEU 48  48  48  LEU LEU T . n 
CA 13 49  LEU 49  49  49  LEU LEU T . n 
CA 13 50  SER 50  50  50  SER SER T . n 
CA 13 51  GLY 51  51  51  GLY GLY T . n 
CA 13 52  GLY 52  52  52  GLY GLY T . n 
CA 13 53  ALA 53  53  53  ALA ALA T . n 
CA 13 54  ARG 54  54  54  ARG ARG T . n 
CA 13 55  PHE 55  55  55  PHE PHE T . n 
CA 13 56  GLN 56  56  56  GLN GLN T . n 
CA 13 57  ALA 57  57  57  ALA ALA T . n 
CA 13 58  GLU 58  58  58  GLU GLU T . n 
CA 13 59  TRP 59  59  59  TRP TRP T . n 
CA 13 60  LEU 60  60  60  LEU LEU T . n 
CA 13 61  PRO 61  61  61  PRO PRO T . n 
CA 13 62  GLY 62  62  62  GLY GLY T . n 
CA 13 63  ILE 63  63  63  ILE ILE T . n 
CA 13 64  PRO 64  64  64  PRO PRO T . n 
CA 13 65  PHE 65  65  65  PHE PHE T . n 
CA 13 66  SER 66  66  66  SER SER T . n 
CA 13 67  LEU 67  67  67  LEU LEU T . n 
CA 13 68  LEU 68  68  68  LEU LEU T . n 
CA 13 69  LEU 69  69  69  LEU LEU T . n 
CA 13 70  ASP 70  70  70  ASP ASP T . n 
CA 13 71  ASN 71  71  71  ASN ASN T . n 
CA 13 72  LEU 72  72  72  LEU LEU T . n 
CA 13 73  SER 73  73  73  SER SER T . n 
CA 13 74  GLY 74  74  74  GLY GLY T . n 
CA 13 75  PHE 75  75  75  PHE PHE T . n 
CA 13 76  MET 76  76  76  MET MET T . n 
CA 13 77  LEU 77  77  77  LEU LEU T . n 
CA 13 78  LEU 78  78  78  LEU LEU T . n 
CA 13 79  ILE 79  79  79  ILE ILE T . n 
CA 13 80  VAL 80  80  80  VAL VAL T . n 
CA 13 81  THR 81  81  81  THR THR T . n 
CA 13 82  GLY 82  82  82  GLY GLY T . n 
CA 13 83  VAL 83  83  83  VAL VAL T . n 
CA 13 84  GLY 84  84  84  GLY GLY T . n 
CA 13 85  PHE 85  85  85  PHE PHE T . n 
CA 13 86  LEU 86  86  86  LEU LEU T . n 
CA 13 87  ILE 87  87  87  ILE ILE T . n 
CA 13 88  HIS 88  88  88  HIS HIS T . n 
CA 13 89  VAL 89  89  89  VAL VAL T . n 
CA 13 90  TYR 90  90  90  TYR TYR T . n 
CA 13 91  ALA 91  91  91  ALA ALA T . n 
CA 13 92  ILE 92  92  92  ILE ILE T . n 
CA 13 93  GLY 93  93  93  GLY GLY T . n 
CA 13 94  TYR 94  94  94  TYR TYR T . n 
CA 13 95  MET 95  95  95  MET MET T . n 
CA 13 96  GLY 96  96  96  GLY GLY T . n 
CA 13 97  GLY 97  97  97  GLY GLY T . n 
CA 13 98  ASP 98  98  98  ASP ASP T . n 
CA 13 99  PRO 99  99  99  PRO PRO T . n 
CA 13 100 GLY 100 100 100 GLY GLY T . n 
CA 13 101 TYR 101 101 101 TYR TYR T . n 
CA 13 102 SER 102 102 102 SER SER T . n 
CA 13 103 ARG 103 103 103 ARG ARG T . n 
CA 13 104 PHE 104 104 104 PHE PHE T . n 
CA 13 105 PHE 105 105 105 PHE PHE T . n 
CA 13 106 ALA 106 106 106 ALA ALA T . n 
CA 13 107 TYR 107 107 107 TYR TYR T . n 
CA 13 108 PHE 108 108 108 PHE PHE T . n 
CA 13 109 ASN 109 109 109 ASN ASN T . n 
CA 13 110 LEU 110 110 110 LEU LEU T . n 
CA 13 111 PHE 111 111 111 PHE PHE T . n 
CA 13 112 ILE 112 112 112 ILE ILE T . n 
CA 13 113 ALA 113 113 113 ALA ALA T . n 
CA 13 114 MET 114 114 114 MET MET T . n 
CA 13 115 MET 115 115 115 MET MET T . n 
CA 13 116 LEU 116 116 116 LEU LEU T . n 
CA 13 117 THR 117 117 117 THR THR T . n 
CA 13 118 LEU 118 118 118 LEU LEU T . n 
CA 13 119 VAL 119 119 119 VAL VAL T . n 
CA 13 120 LEU 120 120 120 LEU LEU T . n 
CA 13 121 ALA 121 121 121 ALA ALA T . n 
CA 13 122 ASP 122 122 122 ASP ASP T . n 
CA 13 123 SER 123 123 123 SER SER T . n 
CA 13 124 TYR 124 124 124 TYR TYR T . n 
CA 13 125 PRO 125 125 125 PRO PRO T . n 
CA 13 126 VAL 126 126 126 VAL VAL T . n 
CA 13 127 MET 127 127 127 MET MET T . n 
CA 13 128 PHE 128 128 128 PHE PHE T . n 
CA 13 129 ILE 129 129 129 ILE ILE T . n 
CA 13 130 GLY 130 130 130 GLY GLY T . n 
CA 13 131 TRP 131 131 131 TRP TRP T . n 
CA 13 132 GLU 132 132 132 GLU GLU T . n 
CA 13 133 GLY 133 133 133 GLY GLY T . n 
CA 13 134 VAL 134 134 134 VAL VAL T . n 
CA 13 135 GLY 135 135 135 GLY GLY T . n 
CA 13 136 LEU 136 136 136 LEU LEU T . n 
CA 13 137 ALA 137 137 137 ALA ALA T . n 
CA 13 138 SER 138 138 138 SER SER T . n 
CA 13 139 PHE 139 139 139 PHE PHE T . n 
CA 13 140 LEU 140 140 140 LEU LEU T . n 
CA 13 141 LEU 141 141 141 LEU LEU T . n 
CA 13 142 ILE 142 142 142 ILE ILE T . n 
CA 13 143 GLY 143 143 143 GLY GLY T . n 
CA 13 144 PHE 144 144 144 PHE PHE T . n 
CA 13 145 TRP 145 145 145 TRP TRP T . n 
CA 13 146 TYR 146 146 146 TYR TYR T . n 
CA 13 147 LYS 147 147 147 LYS LYS T . n 
CA 13 148 ASN 148 148 148 ASN ASN T . n 
CA 13 149 PRO 149 149 149 PRO PRO T . n 
CA 13 150 GLN 150 150 150 GLN GLN T . n 
CA 13 151 TYR 151 151 151 TYR TYR T . n 
CA 13 152 ALA 152 152 152 ALA ALA T . n 
CA 13 153 ASP 153 153 153 ASP ASP T . n 
CA 13 154 SER 154 154 154 SER SER T . n 
CA 13 155 ALA 155 155 155 ALA ALA T . n 
CA 13 156 ARG 156 156 156 ARG ARG T . n 
CA 13 157 LYS 157 157 157 LYS LYS T . n 
CA 13 158 ALA 158 158 158 ALA ALA T . n 
CA 13 159 PHE 159 159 159 PHE PHE T . n 
CA 13 160 ILE 160 160 160 ILE ILE T . n 
CA 13 161 VAL 161 161 161 VAL VAL T . n 
CA 13 162 ASN 162 162 162 ASN ASN T . n 
CA 13 163 ARG 163 163 163 ARG ARG T . n 
CA 13 164 ILE 164 164 164 ILE ILE T . n 
CA 13 165 GLY 165 165 165 GLY GLY T . n 
CA 13 166 ASP 166 166 166 ASP ASP T . n 
CA 13 167 LEU 167 167 167 LEU LEU T . n 
CA 13 168 GLY 168 168 168 GLY GLY T . n 
CA 13 169 PHE 169 169 169 PHE PHE T . n 
CA 13 170 MET 170 170 170 MET MET T . n 
CA 13 171 LEU 171 171 171 LEU LEU T . n 
CA 13 172 GLY 172 172 172 GLY GLY T . n 
CA 13 173 MET 173 173 173 MET MET T . n 
CA 13 174 ALA 174 174 174 ALA ALA T . n 
CA 13 175 ILE 175 175 175 ILE ILE T . n 
CA 13 176 LEU 176 176 176 LEU LEU T . n 
CA 13 177 TRP 177 177 177 TRP TRP T . n 
CA 13 178 ALA 178 178 178 ALA ALA T . n 
CA 13 179 LEU 179 179 179 LEU LEU T . n 
CA 13 180 TYR 180 180 180 TYR TYR T . n 
CA 13 181 GLY 181 181 181 GLY GLY T . n 
CA 13 182 THR 182 182 182 THR THR T . n 
CA 13 183 LEU 183 183 183 LEU LEU T . n 
CA 13 184 SER 184 184 184 SER SER T . n 
CA 13 185 ILE 185 185 185 ILE ILE T . n 
CA 13 186 SER 186 186 186 SER SER T . n 
CA 13 187 GLU 187 187 187 GLU GLU T . n 
CA 13 188 LEU 188 188 188 LEU LEU T . n 
CA 13 189 LYS 189 189 189 LYS LYS T . n 
CA 13 190 GLU 190 190 190 GLU GLU T . n 
CA 13 191 ALA 191 191 191 ALA ALA T . n 
CA 13 192 MET 192 192 192 MET MET T . n 
CA 13 193 GLU 193 193 193 GLU GLU T . n 
CA 13 194 GLY 194 194 194 GLY GLY T . n 
CA 13 195 PRO 195 195 195 PRO PRO T . n 
CA 13 196 LEU 196 196 196 LEU LEU T . n 
CA 13 197 LYS 197 197 197 LYS LYS T . n 
CA 13 198 ASN 198 198 198 ASN ASN T . n 
CA 13 199 PRO 199 199 199 PRO PRO T . n 
CA 13 200 ASP 200 200 200 ASP ASP T . n 
CA 13 201 LEU 201 201 201 LEU LEU T . n 
CA 13 202 LEU 202 202 202 LEU LEU T . n 
CA 13 203 ALA 203 203 203 ALA ALA T . n 
CA 13 204 LEU 204 204 204 LEU LEU T . n 
CA 13 205 ALA 205 205 205 ALA ALA T . n 
CA 13 206 GLY 206 206 206 GLY GLY T . n 
CA 13 207 LEU 207 207 207 LEU LEU T . n 
CA 13 208 LEU 208 208 208 LEU LEU T . n 
CA 13 209 LEU 209 209 209 LEU LEU T . n 
CA 13 210 PHE 210 210 210 PHE PHE T . n 
CA 13 211 LEU 211 211 211 LEU LEU T . n 
CA 13 212 GLY 212 212 212 GLY GLY T . n 
CA 13 213 ALA 213 213 213 ALA ALA T . n 
CA 13 214 VAL 214 214 214 VAL VAL T . n 
CA 13 215 GLY 215 215 215 GLY GLY T . n 
CA 13 216 LYS 216 216 216 LYS LYS T . n 
CA 13 217 SER 217 217 217 SER SER T . n 
CA 13 218 ALA 218 218 218 ALA ALA T . n 
CA 13 219 GLN 219 219 219 GLN GLN T . n 
CA 13 220 ILE 220 220 220 ILE ILE T . n 
CA 13 221 PRO 221 221 221 PRO PRO T . n 
CA 13 222 LEU 222 222 222 LEU LEU T . n 
CA 13 223 MET 223 223 223 MET MET T . n 
CA 13 224 VAL 224 224 224 VAL VAL T . n 
CA 13 225 TRP 225 225 225 TRP TRP T . n 
CA 13 226 LEU 226 226 226 LEU LEU T . n 
CA 13 227 PRO 227 227 227 PRO PRO T . n 
CA 13 228 ASP 228 228 228 ASP ASP T . n 
CA 13 229 ALA 229 229 229 ALA ALA T . n 
CA 13 230 MET 230 230 230 MET MET T . n 
CA 13 231 ALA 231 231 231 ALA ALA T . n 
CA 13 232 GLY 232 232 232 GLY GLY T . n 
CA 13 233 PRO 233 233 233 PRO PRO T . n 
CA 13 234 THR 234 234 234 THR THR T . n 
CA 13 235 PRO 235 235 235 PRO PRO T . n 
CA 13 236 VAL 236 236 236 VAL VAL T . n 
CA 13 237 SER 237 237 237 SER SER T . n 
CA 13 238 ALA 238 238 238 ALA ALA T . n 
CA 13 239 LEU 239 239 239 LEU LEU T . n 
CA 13 240 ILE 240 240 240 ILE ILE T . n 
CA 13 241 HIS 241 241 241 HIS HIS T . n 
CA 13 242 ALA 242 242 242 ALA ALA T . n 
CA 13 243 ALA 243 243 243 ALA ALA T . n 
CA 13 244 THR 244 244 244 THR THR T . n 
CA 13 245 MET 245 245 245 MET MET T . n 
CA 13 246 VAL 246 246 246 VAL VAL T . n 
CA 13 247 THR 247 247 247 THR THR T . n 
CA 13 248 ALA 248 248 248 ALA ALA T . n 
CA 13 249 GLY 249 249 249 GLY GLY T . n 
CA 13 250 VAL 250 250 250 VAL VAL T . n 
CA 13 251 TYR 251 251 251 TYR TYR T . n 
CA 13 252 LEU 252 252 252 LEU LEU T . n 
CA 13 253 ILE 253 253 253 ILE ILE T . n 
CA 13 254 ALA 254 254 254 ALA ALA T . n 
CA 13 255 ARG 255 255 255 ARG ARG T . n 
CA 13 256 SER 256 256 256 SER SER T . n 
CA 13 257 SER 257 257 257 SER SER T . n 
CA 13 258 PHE 258 258 258 PHE PHE T . n 
CA 13 259 LEU 259 259 259 LEU LEU T . n 
CA 13 260 TYR 260 260 260 TYR TYR T . n 
CA 13 261 SER 261 261 261 SER SER T . n 
CA 13 262 VAL 262 262 262 VAL VAL T . n 
CA 13 263 LEU 263 263 263 LEU LEU T . n 
CA 13 264 PRO 264 264 264 PRO PRO T . n 
CA 13 265 ASP 265 265 265 ASP ASP T . n 
CA 13 266 VAL 266 266 266 VAL VAL T . n 
CA 13 267 SER 267 267 267 SER SER T . n 
CA 13 268 TYR 268 268 268 TYR TYR T . n 
CA 13 269 ALA 269 269 269 ALA ALA T . n 
CA 13 270 ILE 270 270 270 ILE ILE T . n 
CA 13 271 ALA 271 271 271 ALA ALA T . n 
CA 13 272 VAL 272 272 272 VAL VAL T . n 
CA 13 273 VAL 273 273 273 VAL VAL T . n 
CA 13 274 GLY 274 274 274 GLY GLY T . n 
CA 13 275 LEU 275 275 275 LEU LEU T . n 
CA 13 276 LEU 276 276 276 LEU LEU T . n 
CA 13 277 THR 277 277 277 THR THR T . n 
CA 13 278 ALA 278 278 278 ALA ALA T . n 
CA 13 279 ALA 279 279 279 ALA ALA T . n 
CA 13 280 TYR 280 280 280 TYR TYR T . n 
CA 13 281 GLY 281 281 281 GLY GLY T . n 
CA 13 282 ALA 282 282 282 ALA ALA T . n 
CA 13 283 LEU 283 283 283 LEU LEU T . n 
CA 13 284 SER 284 284 284 SER SER T . n 
CA 13 285 ALA 285 285 285 ALA ALA T . n 
CA 13 286 PHE 286 286 286 PHE PHE T . n 
CA 13 287 GLY 287 287 287 GLY GLY T . n 
CA 13 288 GLN 288 288 288 GLN GLN T . n 
CA 13 289 THR 289 289 289 THR THR T . n 
CA 13 290 ASP 290 290 290 ASP ASP T . n 
CA 13 291 ILE 291 291 291 ILE ILE T . n 
CA 13 292 LYS 292 292 292 LYS LYS T . n 
CA 13 293 LYS 293 293 293 LYS LYS T . n 
CA 13 294 ILE 294 294 294 ILE ILE T . n 
CA 13 295 VAL 295 295 295 VAL VAL T . n 
CA 13 296 ALA 296 296 296 ALA ALA T . n 
CA 13 297 TYR 297 297 297 TYR TYR T . n 
CA 13 298 SER 298 298 298 SER SER T . n 
CA 13 299 THR 299 299 299 THR THR T . n 
CA 13 300 ILE 300 300 300 ILE ILE T . n 
CA 13 301 SER 301 301 301 SER SER T . n 
CA 13 302 GLN 302 302 302 GLN GLN T . n 
CA 13 303 LEU 303 303 303 LEU LEU T . n 
CA 13 304 GLY 304 304 304 GLY GLY T . n 
CA 13 305 TYR 305 305 305 TYR TYR T . n 
CA 13 306 MET 306 306 306 MET MET T . n 
CA 13 307 PHE 307 307 307 PHE PHE T . n 
CA 13 308 LEU 308 308 308 LEU LEU T . n 
CA 13 309 ALA 309 309 309 ALA ALA T . n 
CA 13 310 ALA 310 310 310 ALA ALA T . n 
CA 13 311 GLY 311 311 311 GLY GLY T . n 
CA 13 312 VAL 312 312 312 VAL VAL T . n 
CA 13 313 GLY 313 313 313 GLY GLY T . n 
CA 13 314 ALA 314 314 314 ALA ALA T . n 
CA 13 315 TYR 315 315 315 TYR TYR T . n 
CA 13 316 TRP 316 316 316 TRP TRP T . n 
CA 13 317 VAL 317 317 317 VAL VAL T . n 
CA 13 318 ALA 318 318 318 ALA ALA T . n 
CA 13 319 LEU 319 319 319 LEU LEU T . n 
CA 13 320 PHE 320 320 320 PHE PHE T . n 
CA 13 321 HIS 321 321 321 HIS HIS T . n 
CA 13 322 VAL 322 322 322 VAL VAL T . n 
CA 13 323 PHE 323 323 323 PHE PHE T . n 
CA 13 324 THR 324 324 324 THR THR T . n 
CA 13 325 HIS 325 325 325 HIS HIS T . n 
CA 13 326 ALA 326 326 326 ALA ALA T . n 
CA 13 327 PHE 327 327 327 PHE PHE T . n 
CA 13 328 PHE 328 328 328 PHE PHE T . n 
CA 13 329 LYS 329 329 329 LYS LYS T . n 
CA 13 330 ALA 330 330 330 ALA ALA T . n 
CA 13 331 LEU 331 331 331 LEU LEU T . n 
CA 13 332 LEU 332 332 332 LEU LEU T . n 
CA 13 333 PHE 333 333 333 PHE PHE T . n 
CA 13 334 LEU 334 334 334 LEU LEU T . n 
CA 13 335 ALA 335 335 335 ALA ALA T . n 
CA 13 336 SER 336 336 336 SER SER T . n 
CA 13 337 GLY 337 337 337 GLY GLY T . n 
CA 13 338 SER 338 338 338 SER SER T . n 
CA 13 339 VAL 339 339 339 VAL VAL T . n 
CA 13 340 ILE 340 340 340 ILE ILE T . n 
CA 13 341 HIS 341 341 341 HIS HIS T . n 
CA 13 342 ALA 342 342 342 ALA ALA T . n 
CA 13 343 LEU 343 343 343 LEU LEU T . n 
CA 13 344 GLY 344 344 344 GLY GLY T . n 
CA 13 345 GLY 345 345 345 GLY GLY T . n 
CA 13 346 GLU 346 346 346 GLU GLU T . n 
CA 13 347 GLN 347 347 347 GLN GLN T . n 
CA 13 348 ASP 348 348 348 ASP ASP T . n 
CA 13 349 VAL 349 349 349 VAL VAL T . n 
CA 13 350 ARG 350 350 350 ARG ARG T . n 
CA 13 351 LYS 351 351 351 LYS LYS T . n 
CA 13 352 MET 352 352 352 MET MET T . n 
CA 13 353 GLY 353 353 353 GLY GLY T . n 
CA 13 354 GLY 354 354 354 GLY GLY T . n 
CA 13 355 LEU 355 355 355 LEU LEU T . n 
CA 13 356 TRP 356 356 356 TRP TRP T . n 
CA 13 357 LYS 357 357 357 LYS LYS T . n 
CA 13 358 HIS 358 358 358 HIS HIS T . n 
CA 13 359 LEU 359 359 359 LEU LEU T . n 
CA 13 360 PRO 360 360 360 PRO PRO T . n 
CA 13 361 GLN 361 361 361 GLN GLN T . n 
CA 13 362 THR 362 362 362 THR THR T . n 
CA 13 363 ARG 363 363 363 ARG ARG T . n 
CA 13 364 TRP 364 364 364 TRP TRP T . n 
CA 13 365 HIS 365 365 365 HIS HIS T . n 
CA 13 366 ALA 366 366 366 ALA ALA T . n 
CA 13 367 LEU 367 367 367 LEU LEU T . n 
CA 13 368 ILE 368 368 368 ILE ILE T . n 
CA 13 369 GLY 369 369 369 GLY GLY T . n 
CA 13 370 ALA 370 370 370 ALA ALA T . n 
CA 13 371 LEU 371 371 371 LEU LEU T . n 
CA 13 372 ALA 372 372 372 ALA ALA T . n 
CA 13 373 LEU 373 373 373 LEU LEU T . n 
CA 13 374 GLY 374 374 374 GLY GLY T . n 
CA 13 375 GLY 375 375 375 GLY GLY T . n 
CA 13 376 LEU 376 376 376 LEU LEU T . n 
CA 13 377 PRO 377 377 377 PRO PRO T . n 
CA 13 378 LEU 378 378 378 LEU LEU T . n 
CA 13 379 LEU 379 379 379 LEU LEU T . n 
CA 13 380 SER 380 380 380 SER SER T . n 
CA 13 381 GLY 381 381 381 GLY GLY T . n 
CA 13 382 PHE 382 382 382 PHE PHE T . n 
CA 13 383 TRP 383 383 383 TRP TRP T . n 
CA 13 384 SER 384 384 384 SER SER T . n 
CA 13 385 LYS 385 385 385 LYS LYS T . n 
CA 13 386 ASP 386 386 386 ASP ASP T . n 
CA 13 387 ALA 387 387 387 ALA ALA T . n 
CA 13 388 ILE 388 388 388 ILE ILE T . n 
CA 13 389 LEU 389 389 389 LEU LEU T . n 
CA 13 390 ALA 390 390 390 ALA ALA T . n 
CA 13 391 ALA 391 391 391 ALA ALA T . n 
CA 13 392 THR 392 392 392 THR THR T . n 
CA 13 393 LEU 393 393 393 LEU LEU T . n 
CA 13 394 THR 394 394 394 THR THR T . n 
CA 13 395 TYR 395 395 395 TYR TYR T . n 
CA 13 396 PRO 396 396 396 PRO PRO T . n 
CA 13 397 PHE 397 397 397 PHE PHE T . n 
CA 13 398 GLY 398 398 398 GLY GLY T . n 
CA 13 399 GLY 399 399 399 GLY GLY T . n 
CA 13 400 VAL 400 400 400 VAL VAL T . n 
CA 13 401 GLY 401 401 401 GLY GLY T . n 
CA 13 402 PHE 402 402 402 PHE PHE T . n 
CA 13 403 TYR 403 403 403 TYR TYR T . n 
CA 13 404 VAL 404 404 404 VAL VAL T . n 
CA 13 405 GLY 405 405 405 GLY GLY T . n 
CA 13 406 ALA 406 406 406 ALA ALA T . n 
CA 13 407 LEU 407 407 407 LEU LEU T . n 
CA 13 408 LEU 408 408 408 LEU LEU T . n 
CA 13 409 VAL 409 409 409 VAL VAL T . n 
CA 13 410 ALA 410 410 410 ALA ALA T . n 
CA 13 411 VAL 411 411 411 VAL VAL T . n 
CA 13 412 LEU 412 412 412 LEU LEU T . n 
CA 13 413 THR 413 413 413 THR THR T . n 
CA 13 414 ALA 414 414 414 ALA ALA T . n 
CA 13 415 MET 415 415 415 MET MET T . n 
CA 13 416 TYR 416 416 416 TYR TYR T . n 
CA 13 417 ALA 417 417 417 ALA ALA T . n 
CA 13 418 MET 418 418 418 MET MET T . n 
CA 13 419 ARG 419 419 419 ARG ARG T . n 
CA 13 420 TRP 420 420 420 TRP TRP T . n 
CA 13 421 PHE 421 421 421 PHE PHE T . n 
CA 13 422 VAL 422 422 422 VAL VAL T . n 
CA 13 423 LEU 423 423 423 LEU LEU T . n 
CA 13 424 VAL 424 424 424 VAL VAL T . n 
CA 13 425 PHE 425 425 425 PHE PHE T . n 
CA 13 426 LEU 426 426 426 LEU LEU T . n 
CA 13 427 GLY 427 427 427 GLY GLY T . n 
CA 13 428 GLU 428 428 428 GLU GLU T . n 
CA 13 429 GLU 429 429 429 GLU GLU T . n 
CA 13 430 ARG 430 430 430 ARG ARG T . n 
CA 13 431 GLY 431 431 431 GLY GLY T . n 
CA 13 432 HIS 432 432 432 HIS HIS T . n 
CA 13 433 HIS 433 433 433 HIS HIS T . n 
CA 13 434 HIS 434 434 434 HIS HIS T . n 
CA 13 435 PRO 435 435 435 PRO PRO T . n 
CA 13 436 HIS 436 436 436 HIS HIS T . n 
CA 13 437 GLU 437 437 437 GLU GLU T . n 
CA 13 438 ALA 438 438 438 ALA ALA T . n 
CA 13 439 PRO 439 439 439 PRO PRO T . n 
CA 13 440 PRO 440 440 440 PRO PRO T . n 
CA 13 441 VAL 441 441 441 VAL VAL T . n 
CA 13 442 MET 442 442 442 MET MET T . n 
CA 13 443 LEU 443 443 443 LEU LEU T . n 
CA 13 444 TRP 444 444 444 TRP TRP T . n 
CA 13 445 PRO 445 445 445 PRO PRO T . n 
CA 13 446 ASN 446 446 446 ASN ASN T . n 
CA 13 447 HIS 447 447 447 HIS HIS T . n 
CA 13 448 LEU 448 448 448 LEU LEU T . n 
CA 13 449 LEU 449 449 449 LEU LEU T . n 
CA 13 450 ALA 450 450 450 ALA ALA T . n 
CA 13 451 LEU 451 451 451 LEU LEU T . n 
CA 13 452 GLY 452 452 452 GLY GLY T . n 
CA 13 453 SER 453 453 453 SER SER T . n 
CA 13 454 VAL 454 454 454 VAL VAL T . n 
CA 13 455 LEU 455 455 455 LEU LEU T . n 
CA 13 456 ALA 456 456 456 ALA ALA T . n 
CA 13 457 GLY 457 457 457 GLY GLY T . n 
CA 13 458 TYR 458 458 458 TYR TYR T . n 
CA 13 459 LEU 459 459 459 LEU LEU T . n 
CA 13 460 ALA 460 460 460 ALA ALA T . n 
CA 13 461 LEU 461 461 461 LEU LEU T . n 
CA 13 462 PRO 462 462 462 PRO PRO T . n 
CA 13 463 HIS 463 463 463 HIS HIS T . n 
CA 13 464 PRO 464 464 464 PRO PRO T . n 
CA 13 465 LEU 465 465 465 LEU LEU T . n 
CA 13 466 PRO 466 466 466 PRO PRO T . n 
CA 13 467 ASN 467 467 467 ASN ASN T . n 
CA 13 468 VAL 468 468 468 VAL VAL T . n 
CA 13 469 LEU 469 469 469 LEU LEU T . n 
CA 13 470 GLU 470 470 470 GLU GLU T . n 
CA 13 471 PRO 471 471 471 PRO PRO T . n 
CA 13 472 PHE 472 472 472 PHE PHE T . n 
CA 13 473 LEU 473 473 473 LEU LEU T . n 
CA 13 474 LYS 474 474 474 LYS LYS T . n 
CA 13 475 PRO 475 475 475 PRO PRO T . n 
CA 13 476 ALA 476 476 476 ALA ALA T . n 
CA 13 477 LEU 477 477 477 LEU LEU T . n 
CA 13 478 ALA 478 478 478 ALA ALA T . n 
CA 13 479 GLU 479 479 479 GLU GLU T . n 
CA 13 480 VAL 480 480 480 VAL VAL T . n 
CA 13 481 GLU 481 481 481 GLU GLU T . n 
CA 13 482 ALA 482 482 482 ALA ALA T . n 
CA 13 483 HIS 483 483 483 HIS HIS T . n 
CA 13 484 HIS 484 484 484 HIS HIS T . n 
CA 13 485 LEU 485 485 485 LEU LEU T . n 
CA 13 486 SER 486 486 486 SER SER T . n 
CA 13 487 LEU 487 487 487 LEU LEU T . n 
CA 13 488 GLY 488 488 488 GLY GLY T . n 
CA 13 489 ALA 489 489 489 ALA ALA T . n 
CA 13 490 GLU 490 490 490 GLU GLU T . n 
CA 13 491 TRP 491 491 491 TRP TRP T . n 
CA 13 492 GLY 492 492 492 GLY GLY T . n 
CA 13 493 LEU 493 493 493 LEU LEU T . n 
CA 13 494 ILE 494 494 494 ILE ILE T . n 
CA 13 495 ALA 495 495 495 ALA ALA T . n 
CA 13 496 LEU 496 496 496 LEU LEU T . n 
CA 13 497 SER 497 497 497 SER SER T . n 
CA 13 498 ALA 498 498 498 ALA ALA T . n 
CA 13 499 ALA 499 499 499 ALA ALA T . n 
CA 13 500 VAL 500 500 500 VAL VAL T . n 
CA 13 501 ALA 501 501 501 ALA ALA T . n 
CA 13 502 LEU 502 502 502 LEU LEU T . n 
CA 13 503 LEU 503 503 503 LEU LEU T . n 
CA 13 504 GLY 504 504 504 GLY GLY T . n 
CA 13 505 LEU 505 505 505 LEU LEU T . n 
CA 13 506 TRP 506 506 506 TRP TRP T . n 
CA 13 507 ALA 507 507 507 ALA ALA T . n 
CA 13 508 GLY 508 508 508 GLY GLY T . n 
CA 13 509 PHE 509 509 509 PHE PHE T . n 
CA 13 510 VAL 510 510 510 VAL VAL T . n 
CA 13 511 PHE 511 511 511 PHE PHE T . n 
CA 13 512 PHE 512 512 512 PHE PHE T . n 
CA 13 513 GLN 513 513 513 GLN GLN T . n 
CA 13 514 ARG 514 514 514 ARG ARG T . n 
CA 13 515 LYS 515 515 515 LYS LYS T . n 
CA 13 516 VAL 516 516 516 VAL VAL T . n 
CA 13 517 PHE 517 517 517 PHE PHE T . n 
CA 13 518 PRO 518 518 518 PRO PRO T . n 
CA 13 519 ALA 519 519 519 ALA ALA T . n 
CA 13 520 TRP 520 520 520 TRP TRP T . n 
CA 13 521 TYR 521 521 521 TYR TYR T . n 
CA 13 522 LEU 522 522 522 LEU LEU T . n 
CA 13 523 ALA 523 523 523 ALA ALA T . n 
CA 13 524 PHE 524 524 524 PHE PHE T . n 
CA 13 525 GLU 525 525 525 GLU GLU T . n 
CA 13 526 ALA 526 526 526 ALA ALA T . n 
CA 13 527 ALA 527 527 527 ALA ALA T . n 
CA 13 528 SER 528 528 528 SER SER T . n 
CA 13 529 ARG 529 529 529 ARG ARG T . n 
CA 13 530 GLU 530 530 530 GLU GLU T . n 
CA 13 531 ALA 531 531 531 ALA ALA T . n 
CA 13 532 PHE 532 532 532 PHE PHE T . n 
CA 13 533 TYR 533 533 533 TYR TYR T . n 
CA 13 534 VAL 534 534 534 VAL VAL T . n 
CA 13 535 ASP 535 535 535 ASP ASP T . n 
CA 13 536 ARG 536 536 536 ARG ARG T . n 
CA 13 537 ALA 537 537 537 ALA ALA T . n 
CA 13 538 TYR 538 538 538 TYR TYR T . n 
CA 13 539 ASN 539 539 539 ASN ASN T . n 
CA 13 540 ALA 540 540 540 ALA ALA T . n 
CA 13 541 LEU 541 541 541 LEU LEU T . n 
CA 13 542 ILE 542 542 542 ILE ILE T . n 
CA 13 543 VAL 543 543 543 VAL VAL T . n 
CA 13 544 ASN 544 544 544 ASN ASN T . n 
CA 13 545 PRO 545 545 545 PRO PRO T . n 
CA 13 546 LEU 546 546 546 LEU LEU T . n 
CA 13 547 LYS 547 547 547 LYS LYS T . n 
CA 13 548 ALA 548 548 548 ALA ALA T . n 
CA 13 549 LEU 549 549 549 LEU LEU T . n 
CA 13 550 ALA 550 550 550 ALA ALA T . n 
CA 13 551 GLU 551 551 551 GLU GLU T . n 
CA 13 552 ALA 552 552 552 ALA ALA T . n 
CA 13 553 LEU 553 553 553 LEU LEU T . n 
CA 13 554 PHE 554 554 554 PHE PHE T . n 
CA 13 555 TYR 555 555 555 TYR TYR T . n 
CA 13 556 GLY 556 556 556 GLY GLY T . n 
CA 13 557 ASP 557 557 557 ASP ASP T . n 
CA 13 558 ARG 558 558 558 ARG ARG T . n 
CA 13 559 GLY 559 559 559 GLY GLY T . n 
CA 13 560 LEU 560 560 560 LEU LEU T . n 
CA 13 561 LEU 561 561 561 LEU LEU T . n 
CA 13 562 SER 562 562 562 SER SER T . n 
CA 13 563 GLY 563 563 563 GLY GLY T . n 
CA 13 564 TYR 564 564 564 TYR TYR T . n 
CA 13 565 PHE 565 565 565 PHE PHE T . n 
CA 13 566 GLY 566 566 566 GLY GLY T . n 
CA 13 567 LEU 567 567 567 LEU LEU T . n 
CA 13 568 GLY 568 568 568 GLY GLY T . n 
CA 13 569 GLY 569 569 569 GLY GLY T . n 
CA 13 570 ALA 570 570 570 ALA ALA T . n 
CA 13 571 ALA 571 571 571 ALA ALA T . n 
CA 13 572 ARG 572 572 572 ARG ARG T . n 
CA 13 573 SER 573 573 573 SER SER T . n 
CA 13 574 LEU 574 574 574 LEU LEU T . n 
CA 13 575 GLY 575 575 575 GLY GLY T . n 
CA 13 576 GLN 576 576 576 GLN GLN T . n 
CA 13 577 GLY 577 577 577 GLY GLY T . n 
CA 13 578 LEU 578 578 578 LEU LEU T . n 
CA 13 579 ALA 579 579 579 ALA ALA T . n 
CA 13 580 ARG 580 580 580 ARG ARG T . n 
CA 13 581 LEU 581 581 581 LEU LEU T . n 
CA 13 582 GLN 582 582 582 GLN GLN T . n 
CA 13 583 THR 583 583 583 THR THR T . n 
CA 13 584 GLY 584 584 584 GLY GLY T . n 
CA 13 585 TYR 585 585 585 TYR TYR T . n 
CA 13 586 LEU 586 586 586 LEU LEU T . n 
CA 13 587 ARG 587 587 587 ARG ARG T . n 
CA 13 588 VAL 588 588 588 VAL VAL T . n 
CA 13 589 TYR 589 589 589 TYR TYR T . n 
CA 13 590 ALA 590 590 590 ALA ALA T . n 
CA 13 591 LEU 591 591 591 LEU LEU T . n 
CA 13 592 LEU 592 592 592 LEU LEU T . n 
CA 13 593 PHE 593 593 593 PHE PHE T . n 
CA 13 594 VAL 594 594 594 VAL VAL T . n 
CA 13 595 LEU 595 595 595 LEU LEU T . n 
CA 13 596 GLY 596 596 596 GLY GLY T . n 
CA 13 597 ALA 597 597 597 ALA ALA T . n 
CA 13 598 LEU 598 598 598 LEU LEU T . n 
CA 13 599 LEU 599 599 599 LEU LEU T . n 
CA 13 600 LEU 600 600 600 LEU LEU T . n 
CA 13 601 LEU 601 601 601 LEU LEU T . n 
CA 13 602 GLY 602 602 602 GLY GLY T . n 
CA 13 603 VAL 603 603 603 VAL VAL T . n 
CA 13 604 MET 604 604 604 MET MET T . n 
CA 13 605 ARG 605 605 605 ARG ARG T . n 
CA 13 606 TRP 606 606 ?   ?   ?   T . n 
DA 14 1   MET 1   1   1   MET MET U . n 
DA 14 2   VAL 2   2   2   VAL VAL U . n 
DA 14 3   VAL 3   3   3   VAL VAL U . n 
DA 14 4   LEU 4   4   4   LEU LEU U . n 
DA 14 5   ALA 5   5   5   ALA ALA U . n 
DA 14 6   VAL 6   6   6   VAL VAL U . n 
DA 14 7   LEU 7   7   7   LEU LEU U . n 
DA 14 8   LEU 8   8   8   LEU LEU U . n 
DA 14 9   PRO 9   9   9   PRO PRO U . n 
DA 14 10  VAL 10  10  10  VAL VAL U . n 
DA 14 11  VAL 11  11  11  VAL VAL U . n 
DA 14 12  PHE 12  12  12  PHE PHE U . n 
DA 14 13  GLY 13  13  13  GLY GLY U . n 
DA 14 14  ALA 14  14  14  ALA ALA U . n 
DA 14 15  LEU 15  15  15  LEU LEU U . n 
DA 14 16  LEU 16  16  16  LEU LEU U . n 
DA 14 17  LEU 17  17  17  LEU LEU U . n 
DA 14 18  LEU 18  18  18  LEU LEU U . n 
DA 14 19  GLY 19  19  19  GLY GLY U . n 
DA 14 20  LEU 20  20  20  LEU LEU U . n 
DA 14 21  PRO 21  21  21  PRO PRO U . n 
DA 14 22  ARG 22  22  22  ARG ARG U . n 
DA 14 23  ALA 23  23  23  ALA ALA U . n 
DA 14 24  LEU 24  24  24  LEU LEU U . n 
DA 14 25  GLY 25  25  25  GLY GLY U . n 
DA 14 26  VAL 26  26  26  VAL VAL U . n 
DA 14 27  LEU 27  27  27  LEU LEU U . n 
DA 14 28  GLY 28  28  28  GLY GLY U . n 
DA 14 29  ALA 29  29  29  ALA ALA U . n 
DA 14 30  GLY 30  30  30  GLY GLY U . n 
DA 14 31  LEU 31  31  31  LEU LEU U . n 
DA 14 32  SER 32  32  32  SER SER U . n 
DA 14 33  PHE 33  33  33  PHE PHE U . n 
DA 14 34  LEU 34  34  34  LEU LEU U . n 
DA 14 35  LEU 35  35  35  LEU LEU U . n 
DA 14 36  ASN 36  36  36  ASN ASN U . n 
DA 14 37  LEU 37  37  37  LEU LEU U . n 
DA 14 38  TYR 38  38  38  TYR TYR U . n 
DA 14 39  LEU 39  39  39  LEU LEU U . n 
DA 14 40  PHE 40  40  40  PHE PHE U . n 
DA 14 41  LEU 41  41  41  LEU LEU U . n 
DA 14 42  THR 42  42  42  THR THR U . n 
DA 14 43  HIS 43  43  43  HIS HIS U . n 
DA 14 44  PRO 44  44  44  PRO PRO U . n 
DA 14 45  GLY 45  45  45  GLY GLY U . n 
DA 14 46  GLY 46  46  46  GLY GLY U . n 
DA 14 47  VAL 47  47  47  VAL VAL U . n 
DA 14 48  ALA 48  48  48  ALA ALA U . n 
DA 14 49  HIS 49  49  49  HIS HIS U . n 
DA 14 50  ALA 50  50  50  ALA ALA U . n 
DA 14 51  PHE 51  51  51  PHE PHE U . n 
DA 14 52  GLN 52  52  52  GLN GLN U . n 
DA 14 53  ALA 53  53  53  ALA ALA U . n 
DA 14 54  PRO 54  54  54  PRO PRO U . n 
DA 14 55  LEU 55  55  55  LEU LEU U . n 
DA 14 56  LEU 56  56  56  LEU LEU U . n 
DA 14 57  PRO 57  57  57  PRO PRO U . n 
DA 14 58  GLY 58  58  58  GLY GLY U . n 
DA 14 59  ALA 59  59  59  ALA ALA U . n 
DA 14 60  GLY 60  60  60  GLY GLY U . n 
DA 14 61  VAL 61  61  61  VAL VAL U . n 
DA 14 62  TYR 62  62  62  TYR TYR U . n 
DA 14 63  TRP 63  63  63  TRP TRP U . n 
DA 14 64  ALA 64  64  64  ALA ALA U . n 
DA 14 65  PHE 65  65  65  PHE PHE U . n 
DA 14 66  GLY 66  66  66  GLY GLY U . n 
DA 14 67  LEU 67  67  67  LEU LEU U . n 
DA 14 68  ASP 68  68  68  ASP ASP U . n 
DA 14 69  GLY 69  69  69  GLY GLY U . n 
DA 14 70  LEU 70  70  70  LEU LEU U . n 
DA 14 71  SER 71  71  71  SER SER U . n 
DA 14 72  ALA 72  72  72  ALA ALA U . n 
DA 14 73  LEU 73  73  73  LEU LEU U . n 
DA 14 74  PHE 74  74  74  PHE PHE U . n 
DA 14 75  PHE 75  75  75  PHE PHE U . n 
DA 14 76  LEU 76  76  76  LEU LEU U . n 
DA 14 77  THR 77  77  77  THR THR U . n 
DA 14 78  ILE 78  78  78  ILE ILE U . n 
DA 14 79  ALA 79  79  79  ALA ALA U . n 
DA 14 80  LEU 80  80  80  LEU LEU U . n 
DA 14 81  THR 81  81  81  THR THR U . n 
DA 14 82  VAL 82  82  82  VAL VAL U . n 
DA 14 83  PHE 83  83  83  PHE PHE U . n 
DA 14 84  LEU 84  84  84  LEU LEU U . n 
DA 14 85  GLY 85  85  85  GLY GLY U . n 
DA 14 86  ALA 86  86  86  ALA ALA U . n 
DA 14 87  LEU 87  87  87  LEU LEU U . n 
DA 14 88  VAL 88  88  88  VAL VAL U . n 
DA 14 89  ALA 89  89  89  ALA ALA U . n 
DA 14 90  ARG 90  90  90  ARG ARG U . n 
DA 14 91  VAL 91  91  91  VAL VAL U . n 
DA 14 92  GLU 92  92  92  GLU GLU U . n 
DA 14 93  GLY 93  93  93  GLY GLY U . n 
DA 14 94  ARG 94  94  94  ARG ARG U . n 
DA 14 95  PHE 95  95  95  PHE PHE U . n 
DA 14 96  LEU 96  96  96  LEU LEU U . n 
DA 14 97  GLY 97  97  97  GLY GLY U . n 
DA 14 98  LEU 98  98  98  LEU LEU U . n 
DA 14 99  ALA 99  99  99  ALA ALA U . n 
DA 14 100 LEU 100 100 100 LEU LEU U . n 
DA 14 101 LEU 101 101 101 LEU LEU U . n 
DA 14 102 MET 102 102 102 MET MET U . n 
DA 14 103 GLU 103 103 103 GLU GLU U . n 
DA 14 104 GLY 104 104 104 GLY GLY U . n 
DA 14 105 LEU 105 105 105 LEU LEU U . n 
DA 14 106 LEU 106 106 106 LEU LEU U . n 
DA 14 107 LEU 107 107 107 LEU LEU U . n 
DA 14 108 GLY 108 108 108 GLY GLY U . n 
DA 14 109 LEU 109 109 109 LEU LEU U . n 
DA 14 110 PHE 110 110 110 PHE PHE U . n 
DA 14 111 ALA 111 111 111 ALA ALA U . n 
DA 14 112 ALA 112 112 112 ALA ALA U . n 
DA 14 113 ARG 113 113 113 ARG ARG U . n 
DA 14 114 ASP 114 114 114 ASP ASP U . n 
DA 14 115 LEU 115 115 115 LEU LEU U . n 
DA 14 116 LEU 116 116 116 LEU LEU U . n 
DA 14 117 VAL 117 117 117 VAL VAL U . n 
DA 14 118 PHE 118 118 118 PHE PHE U . n 
DA 14 119 TYR 119 119 119 TYR TYR U . n 
DA 14 120 VAL 120 120 120 VAL VAL U . n 
DA 14 121 PHE 121 121 121 PHE PHE U . n 
DA 14 122 PHE 122 122 122 PHE PHE U . n 
DA 14 123 GLU 123 123 123 GLU GLU U . n 
DA 14 124 ALA 124 124 124 ALA ALA U . n 
DA 14 125 ALA 125 125 125 ALA ALA U . n 
DA 14 126 LEU 126 126 126 LEU LEU U . n 
DA 14 127 ILE 127 127 127 ILE ILE U . n 
DA 14 128 PRO 128 128 128 PRO PRO U . n 
DA 14 129 ALA 129 129 129 ALA ALA U . n 
DA 14 130 LEU 130 130 130 LEU LEU U . n 
DA 14 131 LEU 131 131 131 LEU LEU U . n 
DA 14 132 MET 132 132 132 MET MET U . n 
DA 14 133 LEU 133 133 133 LEU LEU U . n 
DA 14 134 TYR 134 134 134 TYR TYR U . n 
DA 14 135 LEU 135 135 135 LEU LEU U . n 
DA 14 136 TYR 136 136 136 TYR TYR U . n 
DA 14 137 GLY 137 137 137 GLY GLY U . n 
DA 14 138 GLY 138 138 138 GLY GLY U . n 
DA 14 139 GLU 139 139 139 GLU GLU U . n 
DA 14 140 GLY 140 140 140 GLY GLY U . n 
DA 14 141 ARG 141 141 141 ARG ARG U . n 
DA 14 142 THR 142 142 142 THR THR U . n 
DA 14 143 ARG 143 143 143 ARG ARG U . n 
DA 14 144 ALA 144 144 144 ALA ALA U . n 
DA 14 145 LEU 145 145 145 LEU LEU U . n 
DA 14 146 TYR 146 146 146 TYR TYR U . n 
DA 14 147 THR 147 147 147 THR THR U . n 
DA 14 148 PHE 148 148 148 PHE PHE U . n 
DA 14 149 VAL 149 149 149 VAL VAL U . n 
DA 14 150 LEU 150 150 150 LEU LEU U . n 
DA 14 151 PHE 151 151 151 PHE PHE U . n 
DA 14 152 THR 152 152 152 THR THR U . n 
DA 14 153 LEU 153 153 153 LEU LEU U . n 
DA 14 154 VAL 154 154 154 VAL VAL U . n 
DA 14 155 GLY 155 155 155 GLY GLY U . n 
DA 14 156 SER 156 156 156 SER SER U . n 
DA 14 157 LEU 157 157 157 LEU LEU U . n 
DA 14 158 PRO 158 158 158 PRO PRO U . n 
DA 14 159 MET 159 159 159 MET MET U . n 
DA 14 160 LEU 160 160 160 LEU LEU U . n 
DA 14 161 ALA 161 161 161 ALA ALA U . n 
DA 14 162 ALA 162 162 162 ALA ALA U . n 
DA 14 163 VAL 163 163 163 VAL VAL U . n 
DA 14 164 LEU 164 164 164 LEU LEU U . n 
DA 14 165 GLY 165 165 165 GLY GLY U . n 
DA 14 166 ALA 166 166 166 ALA ALA U . n 
DA 14 167 ARG 167 167 167 ARG ARG U . n 
DA 14 168 LEU 168 168 168 LEU LEU U . n 
DA 14 169 LEU 169 169 169 LEU LEU U . n 
DA 14 170 SER 170 170 170 SER SER U . n 
DA 14 171 GLY 171 171 171 GLY GLY U . n 
DA 14 172 SER 172 172 172 SER SER U . n 
DA 14 173 PRO 173 173 173 PRO PRO U . n 
DA 14 174 THR 174 174 174 THR THR U . n 
DA 14 175 PHE 175 175 175 PHE PHE U . n 
DA 14 176 LEU 176 176 176 LEU LEU U . n 
DA 14 177 LEU 177 177 177 LEU LEU U . n 
DA 14 178 GLU 178 178 178 GLU GLU U . n 
DA 14 179 ASP 179 179 179 ASP ASP U . n 
DA 14 180 LEU 180 180 180 LEU LEU U . n 
DA 14 181 LEU 181 181 181 LEU LEU U . n 
DA 14 182 ALA 182 182 182 ALA ALA U . n 
DA 14 183 HIS 183 183 183 HIS HIS U . n 
DA 14 184 PRO 184 184 184 PRO PRO U . n 
DA 14 185 LEU 185 185 185 LEU LEU U . n 
DA 14 186 GLN 186 186 186 GLN GLN U . n 
DA 14 187 GLU 187 187 187 GLU GLU U . n 
DA 14 188 GLU 188 188 188 GLU GLU U . n 
DA 14 189 ALA 189 189 189 ALA ALA U . n 
DA 14 190 ALA 190 190 190 ALA ALA U . n 
DA 14 191 PHE 191 191 191 PHE PHE U . n 
DA 14 192 TRP 192 192 192 TRP TRP U . n 
DA 14 193 VAL 193 193 193 VAL VAL U . n 
DA 14 194 PHE 194 194 194 PHE PHE U . n 
DA 14 195 LEU 195 195 195 LEU LEU U . n 
DA 14 196 GLY 196 196 196 GLY GLY U . n 
DA 14 197 PHE 197 197 197 PHE PHE U . n 
DA 14 198 ALA 198 198 198 ALA ALA U . n 
DA 14 199 LEU 199 199 199 LEU LEU U . n 
DA 14 200 ALA 200 200 200 ALA ALA U . n 
DA 14 201 PHE 201 201 201 PHE PHE U . n 
DA 14 202 ALA 202 202 202 ALA ALA U . n 
DA 14 203 ILE 203 203 203 ILE ILE U . n 
DA 14 204 LYS 204 204 204 LYS LYS U . n 
DA 14 205 THR 205 205 205 THR THR U . n 
DA 14 206 PRO 206 206 206 PRO PRO U . n 
DA 14 207 LEU 207 207 207 LEU LEU U . n 
DA 14 208 PHE 208 208 208 PHE PHE U . n 
DA 14 209 PRO 209 209 209 PRO PRO U . n 
DA 14 210 LEU 210 210 210 LEU LEU U . n 
DA 14 211 HIS 211 211 211 HIS HIS U . n 
DA 14 212 ALA 212 212 212 ALA ALA U . n 
DA 14 213 TRP 213 213 213 TRP TRP U . n 
DA 14 214 LEU 214 214 214 LEU LEU U . n 
DA 14 215 PRO 215 215 215 PRO PRO U . n 
DA 14 216 PRO 216 216 216 PRO PRO U . n 
DA 14 217 PHE 217 217 217 PHE PHE U . n 
DA 14 218 HIS 218 218 218 HIS HIS U . n 
DA 14 219 GLN 219 219 219 GLN GLN U . n 
DA 14 220 GLU 220 220 220 GLU GLU U . n 
DA 14 221 ASN 221 221 221 ASN ASN U . n 
DA 14 222 HIS 222 222 222 HIS HIS U . n 
DA 14 223 PRO 223 223 223 PRO PRO U . n 
DA 14 224 SER 224 224 224 SER SER U . n 
DA 14 225 GLY 225 225 225 GLY GLY U . n 
DA 14 226 LEU 226 226 226 LEU LEU U . n 
DA 14 227 ALA 227 227 227 ALA ALA U . n 
DA 14 228 ASP 228 228 228 ASP ASP U . n 
DA 14 229 ALA 229 229 229 ALA ALA U . n 
DA 14 230 LEU 230 230 230 LEU LEU U . n 
DA 14 231 GLY 231 231 231 GLY GLY U . n 
DA 14 232 THR 232 232 232 THR THR U . n 
DA 14 233 LEU 233 233 233 LEU LEU U . n 
DA 14 234 TYR 234 234 234 TYR TYR U . n 
DA 14 235 LYS 235 235 235 LYS LYS U . n 
DA 14 236 VAL 236 236 236 VAL VAL U . n 
DA 14 237 GLY 237 237 237 GLY GLY U . n 
DA 14 238 VAL 238 238 238 VAL VAL U . n 
DA 14 239 PHE 239 239 239 PHE PHE U . n 
DA 14 240 ALA 240 240 240 ALA ALA U . n 
DA 14 241 PHE 241 241 241 PHE PHE U . n 
DA 14 242 PHE 242 242 242 PHE PHE U . n 
DA 14 243 ARG 243 243 243 ARG ARG U . n 
DA 14 244 PHE 244 244 244 PHE PHE U . n 
DA 14 245 ALA 245 245 245 ALA ALA U . n 
DA 14 246 ILE 246 246 246 ILE ILE U . n 
DA 14 247 PRO 247 247 247 PRO PRO U . n 
DA 14 248 LEU 248 248 248 LEU LEU U . n 
DA 14 249 ALA 249 249 249 ALA ALA U . n 
DA 14 250 PRO 250 250 250 PRO PRO U . n 
DA 14 251 GLU 251 251 251 GLU GLU U . n 
DA 14 252 GLY 252 252 252 GLY GLY U . n 
DA 14 253 PHE 253 253 253 PHE PHE U . n 
DA 14 254 ALA 254 254 254 ALA ALA U . n 
DA 14 255 GLN 255 255 255 GLN GLN U . n 
DA 14 256 ALA 256 256 256 ALA ALA U . n 
DA 14 257 GLN 257 257 257 GLN GLN U . n 
DA 14 258 GLY 258 258 258 GLY GLY U . n 
DA 14 259 LEU 259 259 259 LEU LEU U . n 
DA 14 260 LEU 260 260 260 LEU LEU U . n 
DA 14 261 LEU 261 261 261 LEU LEU U . n 
DA 14 262 PHE 262 262 262 PHE PHE U . n 
DA 14 263 LEU 263 263 263 LEU LEU U . n 
DA 14 264 ALA 264 264 264 ALA ALA U . n 
DA 14 265 ALA 265 265 265 ALA ALA U . n 
DA 14 266 LEU 266 266 266 LEU LEU U . n 
DA 14 267 SER 267 267 267 SER SER U . n 
DA 14 268 ALA 268 268 268 ALA ALA U . n 
DA 14 269 LEU 269 269 269 LEU LEU U . n 
DA 14 270 TYR 270 270 270 TYR TYR U . n 
DA 14 271 GLY 271 271 271 GLY GLY U . n 
DA 14 272 ALA 272 272 272 ALA ALA U . n 
DA 14 273 TRP 273 273 273 TRP TRP U . n 
DA 14 274 VAL 274 274 274 VAL VAL U . n 
DA 14 275 ALA 275 275 275 ALA ALA U . n 
DA 14 276 PHE 276 276 276 PHE PHE U . n 
DA 14 277 ALA 277 277 277 ALA ALA U . n 
DA 14 278 ALA 278 278 278 ALA ALA U . n 
DA 14 279 LYS 279 279 279 LYS LYS U . n 
DA 14 280 ASP 280 280 280 ASP ASP U . n 
DA 14 281 PHE 281 281 281 PHE PHE U . n 
DA 14 282 LYS 282 282 282 LYS LYS U . n 
DA 14 283 THR 283 283 283 THR THR U . n 
DA 14 284 LEU 284 284 284 LEU LEU U . n 
DA 14 285 LEU 285 285 285 LEU LEU U . n 
DA 14 286 ALA 286 286 286 ALA ALA U . n 
DA 14 287 TYR 287 287 287 TYR TYR U . n 
DA 14 288 ALA 288 288 288 ALA ALA U . n 
DA 14 289 GLY 289 289 289 GLY GLY U . n 
DA 14 290 LEU 290 290 290 LEU LEU U . n 
DA 14 291 SER 291 291 291 SER SER U . n 
DA 14 292 HIS 292 292 292 HIS HIS U . n 
DA 14 293 MET 293 293 293 MET MET U . n 
DA 14 294 GLY 294 294 294 GLY GLY U . n 
DA 14 295 VAL 295 295 295 VAL VAL U . n 
DA 14 296 ALA 296 296 296 ALA ALA U . n 
DA 14 297 ALA 297 297 297 ALA ALA U . n 
DA 14 298 LEU 298 298 298 LEU LEU U . n 
DA 14 299 GLY 299 299 299 GLY GLY U . n 
DA 14 300 VAL 300 300 300 VAL VAL U . n 
DA 14 301 PHE 301 301 301 PHE PHE U . n 
DA 14 302 SER 302 302 302 SER SER U . n 
DA 14 303 GLY 303 303 303 GLY GLY U . n 
DA 14 304 THR 304 304 304 THR THR U . n 
DA 14 305 PRO 305 305 305 PRO PRO U . n 
DA 14 306 GLU 306 306 306 GLU GLU U . n 
DA 14 307 GLY 307 307 307 GLY GLY U . n 
DA 14 308 ALA 308 308 308 ALA ALA U . n 
DA 14 309 MET 309 309 309 MET MET U . n 
DA 14 310 GLY 310 310 310 GLY GLY U . n 
DA 14 311 GLY 311 311 311 GLY GLY U . n 
DA 14 312 LEU 312 312 312 LEU LEU U . n 
DA 14 313 TYR 313 313 313 TYR TYR U . n 
DA 14 314 LEU 314 314 314 LEU LEU U . n 
DA 14 315 LEU 315 315 315 LEU LEU U . n 
DA 14 316 ALA 316 316 316 ALA ALA U . n 
DA 14 317 ALA 317 317 317 ALA ALA U . n 
DA 14 318 SER 318 318 318 SER SER U . n 
DA 14 319 GLY 319 319 319 GLY GLY U . n 
DA 14 320 VAL 320 320 320 VAL VAL U . n 
DA 14 321 TYR 321 321 321 TYR TYR U . n 
DA 14 322 THR 322 322 322 THR THR U . n 
DA 14 323 GLY 323 323 323 GLY GLY U . n 
DA 14 324 GLY 324 324 324 GLY GLY U . n 
DA 14 325 LEU 325 325 325 LEU LEU U . n 
DA 14 326 PHE 326 326 326 PHE PHE U . n 
DA 14 327 LEU 327 327 327 LEU LEU U . n 
DA 14 328 LEU 328 328 328 LEU LEU U . n 
DA 14 329 ALA 329 329 329 ALA ALA U . n 
DA 14 330 GLY 330 330 330 GLY GLY U . n 
DA 14 331 ARG 331 331 331 ARG ARG U . n 
DA 14 332 LEU 332 332 332 LEU LEU U . n 
DA 14 333 TYR 333 333 333 TYR TYR U . n 
DA 14 334 GLU 334 334 334 GLU GLU U . n 
DA 14 335 ARG 335 335 335 ARG ARG U . n 
DA 14 336 THR 336 336 336 THR THR U . n 
DA 14 337 GLY 337 337 337 GLY GLY U . n 
DA 14 338 THR 338 338 338 THR THR U . n 
DA 14 339 LEU 339 339 339 LEU LEU U . n 
DA 14 340 GLU 340 340 340 GLU GLU U . n 
DA 14 341 ILE 341 341 341 ILE ILE U . n 
DA 14 342 GLY 342 342 342 GLY GLY U . n 
DA 14 343 ARG 343 343 343 ARG ARG U . n 
DA 14 344 TYR 344 344 344 TYR TYR U . n 
DA 14 345 ARG 345 345 345 ARG ARG U . n 
DA 14 346 GLY 346 346 346 GLY GLY U . n 
DA 14 347 LEU 347 347 347 LEU LEU U . n 
DA 14 348 ALA 348 348 348 ALA ALA U . n 
DA 14 349 GLN 349 349 349 GLN GLN U . n 
DA 14 350 SER 350 350 350 SER SER U . n 
DA 14 351 ALA 351 351 351 ALA ALA U . n 
DA 14 352 PRO 352 352 352 PRO PRO U . n 
DA 14 353 GLY 353 353 353 GLY GLY U . n 
DA 14 354 LEU 354 354 354 LEU LEU U . n 
DA 14 355 ALA 355 355 355 ALA ALA U . n 
DA 14 356 ALA 356 356 356 ALA ALA U . n 
DA 14 357 LEU 357 357 357 LEU LEU U . n 
DA 14 358 ALA 358 358 358 ALA ALA U . n 
DA 14 359 LEU 359 359 359 LEU LEU U . n 
DA 14 360 ILE 360 360 360 ILE ILE U . n 
DA 14 361 LEU 361 361 361 LEU LEU U . n 
DA 14 362 PHE 362 362 362 PHE PHE U . n 
DA 14 363 LEU 363 363 363 LEU LEU U . n 
DA 14 364 ALA 364 364 364 ALA ALA U . n 
DA 14 365 MET 365 365 365 MET MET U . n 
DA 14 366 VAL 366 366 366 VAL VAL U . n 
DA 14 367 GLY 367 367 367 GLY GLY U . n 
DA 14 368 LEU 368 368 368 LEU LEU U . n 
DA 14 369 PRO 369 369 369 PRO PRO U . n 
DA 14 370 GLY 370 370 370 GLY GLY U . n 
DA 14 371 LEU 371 371 371 LEU LEU U . n 
DA 14 372 SER 372 372 372 SER SER U . n 
DA 14 373 GLY 373 373 373 GLY GLY U . n 
DA 14 374 PHE 374 374 374 PHE PHE U . n 
DA 14 375 PRO 375 375 375 PRO PRO U . n 
DA 14 376 GLY 376 376 376 GLY GLY U . n 
DA 14 377 GLU 377 377 377 GLU GLU U . n 
DA 14 378 PHE 378 378 378 PHE PHE U . n 
DA 14 379 LEU 379 379 379 LEU LEU U . n 
DA 14 380 THR 380 380 380 THR THR U . n 
DA 14 381 LEU 381 381 381 LEU LEU U . n 
DA 14 382 LEU 382 382 382 LEU LEU U . n 
DA 14 383 GLY 383 383 383 GLY GLY U . n 
DA 14 384 ALA 384 384 384 ALA ALA U . n 
DA 14 385 TYR 385 385 385 TYR TYR U . n 
DA 14 386 LYS 386 386 386 LYS LYS U . n 
DA 14 387 ALA 387 387 387 ALA ALA U . n 
DA 14 388 SER 388 388 388 SER SER U . n 
DA 14 389 PRO 389 389 389 PRO PRO U . n 
DA 14 390 TRP 390 390 390 TRP TRP U . n 
DA 14 391 LEU 391 391 391 LEU LEU U . n 
DA 14 392 ALA 392 392 392 ALA ALA U . n 
DA 14 393 ALA 393 393 393 ALA ALA U . n 
DA 14 394 LEU 394 394 394 LEU LEU U . n 
DA 14 395 ALA 395 395 395 ALA ALA U . n 
DA 14 396 PHE 396 396 396 PHE PHE U . n 
DA 14 397 LEU 397 397 397 LEU LEU U . n 
DA 14 398 SER 398 398 398 SER SER U . n 
DA 14 399 VAL 399 399 399 VAL VAL U . n 
DA 14 400 ILE 400 400 400 ILE ILE U . n 
DA 14 401 ALA 401 401 401 ALA ALA U . n 
DA 14 402 SER 402 402 402 SER SER U . n 
DA 14 403 ALA 403 403 403 ALA ALA U . n 
DA 14 404 ALA 404 404 404 ALA ALA U . n 
DA 14 405 TYR 405 405 405 TYR TYR U . n 
DA 14 406 ALA 406 406 406 ALA ALA U . n 
DA 14 407 LEU 407 407 407 LEU LEU U . n 
DA 14 408 THR 408 408 408 THR THR U . n 
DA 14 409 ALA 409 409 409 ALA ALA U . n 
DA 14 410 PHE 410 410 410 PHE PHE U . n 
DA 14 411 GLN 411 411 411 GLN GLN U . n 
DA 14 412 LYS 412 412 412 LYS LYS U . n 
DA 14 413 THR 413 413 413 THR THR U . n 
DA 14 414 PHE 414 414 414 PHE PHE U . n 
DA 14 415 TRP 415 415 415 TRP TRP U . n 
DA 14 416 GLU 416 416 416 GLU GLU U . n 
DA 14 417 GLU 417 417 417 GLU GLU U . n 
DA 14 418 GLY 418 418 418 GLY GLY U . n 
DA 14 419 GLY 419 419 419 GLY GLY U . n 
DA 14 420 SER 420 420 420 SER SER U . n 
DA 14 421 GLY 421 421 421 GLY GLY U . n 
DA 14 422 VAL 422 422 422 VAL VAL U . n 
DA 14 423 LYS 423 423 423 LYS LYS U . n 
DA 14 424 ASP 424 424 424 ASP ASP U . n 
DA 14 425 LEU 425 425 425 LEU LEU U . n 
DA 14 426 ALA 426 426 426 ALA ALA U . n 
DA 14 427 GLY 427 427 427 GLY GLY U . n 
DA 14 428 ALA 428 428 428 ALA ALA U . n 
DA 14 429 GLU 429 429 429 GLU GLU U . n 
DA 14 430 TRP 430 430 430 TRP TRP U . n 
DA 14 431 GLY 431 431 431 GLY GLY U . n 
DA 14 432 PHE 432 432 432 PHE PHE U . n 
DA 14 433 ALA 433 433 433 ALA ALA U . n 
DA 14 434 LEU 434 434 434 LEU LEU U . n 
DA 14 435 LEU 435 435 435 LEU LEU U . n 
DA 14 436 SER 436 436 436 SER SER U . n 
DA 14 437 VAL 437 437 437 VAL VAL U . n 
DA 14 438 LEU 438 438 438 LEU LEU U . n 
DA 14 439 ALA 439 439 439 ALA ALA U . n 
DA 14 440 LEU 440 440 440 LEU LEU U . n 
DA 14 441 LEU 441 441 441 LEU LEU U . n 
DA 14 442 LEU 442 442 442 LEU LEU U . n 
DA 14 443 MET 443 443 443 MET MET U . n 
DA 14 444 GLY 444 444 444 GLY GLY U . n 
DA 14 445 VAL 445 445 445 VAL VAL U . n 
DA 14 446 PHE 446 446 446 PHE PHE U . n 
DA 14 447 PRO 447 447 447 PRO PRO U . n 
DA 14 448 GLY 448 448 448 GLY GLY U . n 
DA 14 449 TYR 449 449 449 TYR TYR U . n 
DA 14 450 PHE 450 450 450 PHE PHE U . n 
DA 14 451 ALA 451 451 451 ALA ALA U . n 
DA 14 452 ARG 452 452 452 ARG ARG U . n 
DA 14 453 GLY 453 453 453 GLY GLY U . n 
DA 14 454 LEU 454 454 454 LEU LEU U . n 
DA 14 455 HIS 455 455 455 HIS HIS U . n 
DA 14 456 PRO 456 456 456 PRO PRO U . n 
DA 14 457 LEU 457 457 457 LEU LEU U . n 
DA 14 458 ALA 458 458 458 ALA ALA U . n 
DA 14 459 GLU 459 459 459 GLU GLU U . n 
DA 14 460 ALA 460 460 460 ALA ALA U . n 
DA 14 461 PHE 461 461 461 PHE PHE U . n 
DA 14 462 ALA 462 462 462 ALA ALA U . n 
DA 14 463 LYS 463 463 463 LYS LYS U . n 
DA 14 464 LEU 464 464 464 LEU LEU U . n 
DA 14 465 LEU 465 465 465 LEU LEU U . n 
DA 14 466 GLY 466 466 466 GLY GLY U . n 
DA 14 467 GLY 467 467 467 GLY GLY U . n 
DA 14 468 GLY 468 468 ?   ?   ?   U . n 
DA 14 469 ALA 469 469 ?   ?   ?   U . n 
EA 15 1   MET 1   1   1   MET MET V . n 
EA 15 2   THR 2   2   2   THR THR V . n 
EA 15 3   LEU 3   3   3   LEU LEU V . n 
EA 15 4   ALA 4   4   4   ALA ALA V . n 
EA 15 5   ILE 5   5   5   ILE ILE V . n 
EA 15 6   LEU 6   6   6   LEU LEU V . n 
EA 15 7   ALA 7   7   7   ALA ALA V . n 
EA 15 8   VAL 8   8   8   VAL VAL V . n 
EA 15 9   PHE 9   9   9   PHE PHE V . n 
EA 15 10  SER 10  10  10  SER SER V . n 
EA 15 11  VAL 11  11  11  VAL VAL V . n 
EA 15 12  ALA 12  12  12  ALA ALA V . n 
EA 15 13  LEU 13  13  13  LEU LEU V . n 
EA 15 14  THR 14  14  14  THR THR V . n 
EA 15 15  LEU 15  15  15  LEU LEU V . n 
EA 15 16  LEU 16  16  16  LEU LEU V . n 
EA 15 17  GLY 17  17  17  GLY GLY V . n 
EA 15 18  PHE 18  18  18  PHE PHE V . n 
EA 15 19  VAL 19  19  19  VAL VAL V . n 
EA 15 20  LEU 20  20  20  LEU LEU V . n 
EA 15 21  PRO 21  21  21  PRO PRO V . n 
EA 15 22  PRO 22  22  22  PRO PRO V . n 
EA 15 23  GLN 23  23  23  GLN GLN V . n 
EA 15 24  GLY 24  24  24  GLY GLY V . n 
EA 15 25  VAL 25  25  25  VAL VAL V . n 
EA 15 26  LYS 26  26  26  LYS LYS V . n 
EA 15 27  ARG 27  27  27  ARG ARG V . n 
EA 15 28  ALA 28  28  28  ALA ALA V . n 
EA 15 29  THR 29  29  29  THR THR V . n 
EA 15 30  LEU 30  30  30  LEU LEU V . n 
EA 15 31  LEU 31  31  31  LEU LEU V . n 
EA 15 32  GLY 32  32  32  GLY GLY V . n 
EA 15 33  LEU 33  33  33  LEU LEU V . n 
EA 15 34  ALA 34  34  34  ALA ALA V . n 
EA 15 35  LEU 35  35  35  LEU LEU V . n 
EA 15 36  ALA 36  36  36  ALA ALA V . n 
EA 15 37  LEU 37  37  37  LEU LEU V . n 
EA 15 38  ALA 38  38  38  ALA ALA V . n 
EA 15 39  SER 39  39  39  SER SER V . n 
EA 15 40  LEU 40  40  40  LEU LEU V . n 
EA 15 41  LEU 41  41  41  LEU LEU V . n 
EA 15 42  LEU 42  42  42  LEU LEU V . n 
EA 15 43  THR 43  43  43  THR THR V . n 
EA 15 44  TRP 44  44  44  TRP TRP V . n 
EA 15 45  GLY 45  45  45  GLY GLY V . n 
EA 15 46  LYS 46  46  46  LYS LYS V . n 
EA 15 47  PRO 47  47  47  PRO PRO V . n 
EA 15 48  PHE 48  48  48  PHE PHE V . n 
EA 15 49  ALA 49  49  49  ALA ALA V . n 
EA 15 50  PHE 50  50  50  PHE PHE V . n 
EA 15 51  GLY 51  51  51  GLY GLY V . n 
EA 15 52  PRO 52  52  52  PRO PRO V . n 
EA 15 53  TYR 53  53  53  TYR TYR V . n 
EA 15 54  ALA 54  54  54  ALA ALA V . n 
EA 15 55  VAL 55  55  55  VAL VAL V . n 
EA 15 56  ASP 56  56  56  ASP ASP V . n 
EA 15 57  GLY 57  57  57  GLY GLY V . n 
EA 15 58  VAL 58  58  58  VAL VAL V . n 
EA 15 59  SER 59  59  59  SER SER V . n 
EA 15 60  GLN 60  60  60  GLN GLN V . n 
EA 15 61  VAL 61  61  61  VAL VAL V . n 
EA 15 62  PHE 62  62  62  PHE PHE V . n 
EA 15 63  THR 63  63  63  THR THR V . n 
EA 15 64  LEU 64  64  64  LEU LEU V . n 
EA 15 65  LEU 65  65  65  LEU LEU V . n 
EA 15 66  ALA 66  66  66  ALA ALA V . n 
EA 15 67  LEU 67  67  67  LEU LEU V . n 
EA 15 68  LEU 68  68  68  LEU LEU V . n 
EA 15 69  GLY 69  69  69  GLY GLY V . n 
EA 15 70  ALA 70  70  70  ALA ALA V . n 
EA 15 71  LEU 71  71  71  LEU LEU V . n 
EA 15 72  TRP 72  72  72  TRP TRP V . n 
EA 15 73  THR 73  73  73  THR THR V . n 
EA 15 74  VAL 74  74  74  VAL VAL V . n 
EA 15 75  GLY 75  75  75  GLY GLY V . n 
EA 15 76  LEU 76  76  76  LEU LEU V . n 
EA 15 77  VAL 77  77  77  VAL VAL V . n 
EA 15 78  ARG 78  78  78  ARG ARG V . n 
EA 15 79  SER 79  79  79  SER SER V . n 
EA 15 80  GLY 80  80  80  GLY GLY V . n 
EA 15 81  ARG 81  81  81  ARG ARG V . n 
EA 15 82  PHE 82  82  82  PHE PHE V . n 
EA 15 83  GLU 83  83  83  GLU GLU V . n 
EA 15 84  PHE 84  84  84  PHE PHE V . n 
EA 15 85  TYR 85  85  85  TYR TYR V . n 
EA 15 86  LEU 86  86  86  LEU LEU V . n 
EA 15 87  LEU 87  87  87  LEU LEU V . n 
EA 15 88  VAL 88  88  88  VAL VAL V . n 
EA 15 89  LEU 89  89  89  LEU LEU V . n 
EA 15 90  TYR 90  90  90  TYR TYR V . n 
EA 15 91  ALA 91  91  91  ALA ALA V . n 
EA 15 92  ALA 92  92  92  ALA ALA V . n 
EA 15 93  LEU 93  93  93  LEU LEU V . n 
EA 15 94  GLY 94  94  94  GLY GLY V . n 
EA 15 95  MET 95  95  95  MET MET V . n 
EA 15 96  HIS 96  96  96  HIS HIS V . n 
EA 15 97  LEU 97  97  97  LEU LEU V . n 
EA 15 98  LEU 98  98  98  LEU LEU V . n 
EA 15 99  ALA 99  99  99  ALA ALA V . n 
EA 15 100 SER 100 100 100 SER SER V . n 
EA 15 101 THR 101 101 101 THR THR V . n 
EA 15 102 ARG 102 102 102 ARG ARG V . n 
EA 15 103 HIS 103 103 103 HIS HIS V . n 
EA 15 104 LEU 104 104 104 LEU LEU V . n 
EA 15 105 LEU 105 105 105 LEU LEU V . n 
EA 15 106 LEU 106 106 106 LEU LEU V . n 
EA 15 107 MET 107 107 107 MET MET V . n 
EA 15 108 LEU 108 108 108 LEU LEU V . n 
EA 15 109 VAL 109 109 109 VAL VAL V . n 
EA 15 110 ALA 110 110 110 ALA ALA V . n 
EA 15 111 LEU 111 111 111 LEU LEU V . n 
EA 15 112 GLU 112 112 112 GLU GLU V . n 
EA 15 113 ALA 113 113 113 ALA ALA V . n 
EA 15 114 LEU 114 114 114 LEU LEU V . n 
EA 15 115 SER 115 115 115 SER SER V . n 
EA 15 116 LEU 116 116 116 LEU LEU V . n 
EA 15 117 PRO 117 117 117 PRO PRO V . n 
EA 15 118 LEU 118 118 118 LEU LEU V . n 
EA 15 119 TYR 119 119 119 TYR TYR V . n 
EA 15 120 ALA 120 120 120 ALA ALA V . n 
EA 15 121 LEU 121 121 121 LEU LEU V . n 
EA 15 122 ALA 122 122 122 ALA ALA V . n 
EA 15 123 THR 123 123 123 THR THR V . n 
EA 15 124 TRP 124 124 124 TRP TRP V . n 
EA 15 125 ARG 125 125 125 ARG ARG V . n 
EA 15 126 ARG 126 126 126 ARG ARG V . n 
EA 15 127 GLY 127 127 127 GLY GLY V . n 
EA 15 128 GLN 128 128 128 GLN GLN V . n 
EA 15 129 GLY 129 129 129 GLY GLY V . n 
EA 15 130 LEU 130 130 130 LEU LEU V . n 
EA 15 131 GLU 131 131 131 GLU GLU V . n 
EA 15 132 ALA 132 132 132 ALA ALA V . n 
EA 15 133 ALA 133 133 133 ALA ALA V . n 
EA 15 134 LEU 134 134 134 LEU LEU V . n 
EA 15 135 LYS 135 135 135 LYS LYS V . n 
EA 15 136 TYR 136 136 136 TYR TYR V . n 
EA 15 137 PHE 137 137 137 PHE PHE V . n 
EA 15 138 LEU 138 138 138 LEU LEU V . n 
EA 15 139 LEU 139 139 139 LEU LEU V . n 
EA 15 140 GLY 140 140 140 GLY GLY V . n 
EA 15 141 ALA 141 141 141 ALA ALA V . n 
EA 15 142 LEU 142 142 142 LEU LEU V . n 
EA 15 143 ALA 143 143 143 ALA ALA V . n 
EA 15 144 ALA 144 144 144 ALA ALA V . n 
EA 15 145 ALA 145 145 145 ALA ALA V . n 
EA 15 146 PHE 146 146 146 PHE PHE V . n 
EA 15 147 PHE 147 147 147 PHE PHE V . n 
EA 15 148 LEU 148 148 148 LEU LEU V . n 
EA 15 149 TYR 149 149 149 TYR TYR V . n 
EA 15 150 GLY 150 150 150 GLY GLY V . n 
EA 15 151 ALA 151 151 151 ALA ALA V . n 
EA 15 152 ALA 152 152 152 ALA ALA V . n 
EA 15 153 LEU 153 153 153 LEU LEU V . n 
EA 15 154 PHE 154 154 154 PHE PHE V . n 
EA 15 155 TYR 155 155 155 TYR TYR V . n 
EA 15 156 GLY 156 156 156 GLY GLY V . n 
EA 15 157 ALA 157 157 157 ALA ALA V . n 
EA 15 158 THR 158 158 158 THR THR V . n 
EA 15 159 GLY 159 159 159 GLY GLY V . n 
EA 15 160 SER 160 160 160 SER SER V . n 
EA 15 161 LEU 161 161 161 LEU LEU V . n 
EA 15 162 VAL 162 162 162 VAL VAL V . n 
EA 15 163 LEU 163 163 163 LEU LEU V . n 
EA 15 164 GLY 164 164 164 GLY GLY V . n 
EA 15 165 ALA 165 165 165 ALA ALA V . n 
EA 15 166 PRO 166 166 166 PRO PRO V . n 
EA 15 167 GLY 167 167 167 GLY GLY V . n 
EA 15 168 GLU 168 168 168 GLU GLU V . n 
EA 15 169 GLY 169 169 169 GLY GLY V . n 
EA 15 170 PRO 170 170 170 PRO PRO V . n 
EA 15 171 LEU 171 171 171 LEU LEU V . n 
EA 15 172 TYR 172 172 172 TYR TYR V . n 
EA 15 173 ALA 173 173 173 ALA ALA V . n 
EA 15 174 LEU 174 174 174 LEU LEU V . n 
EA 15 175 ALA 175 175 175 ALA ALA V . n 
EA 15 176 LEU 176 176 176 LEU LEU V . n 
EA 15 177 GLY 177 177 177 GLY GLY V . n 
EA 15 178 LEU 178 178 178 LEU LEU V . n 
EA 15 179 LEU 179 179 179 LEU LEU V . n 
EA 15 180 LEU 180 180 180 LEU LEU V . n 
EA 15 181 VAL 181 181 181 VAL VAL V . n 
EA 15 182 GLY 182 182 182 GLY GLY V . n 
EA 15 183 LEU 183 183 183 LEU LEU V . n 
EA 15 184 GLY 184 184 184 GLY GLY V . n 
EA 15 185 PHE 185 185 185 PHE PHE V . n 
EA 15 186 LYS 186 186 186 LYS LYS V . n 
EA 15 187 ALA 187 187 187 ALA ALA V . n 
EA 15 188 ALA 188 188 188 ALA ALA V . n 
EA 15 189 LEU 189 189 189 LEU LEU V . n 
EA 15 190 ALA 190 190 190 ALA ALA V . n 
EA 15 191 PRO 191 191 191 PRO PRO V . n 
EA 15 192 PHE 192 192 192 PHE PHE V . n 
EA 15 193 HIS 193 193 193 HIS HIS V . n 
EA 15 194 PHE 194 194 194 PHE PHE V . n 
EA 15 195 TRP 195 195 195 TRP TRP V . n 
EA 15 196 THR 196 196 196 THR THR V . n 
EA 15 197 PRO 197 197 197 PRO PRO V . n 
EA 15 198 ASP 198 198 198 ASP ASP V . n 
EA 15 199 VAL 199 199 199 VAL VAL V . n 
EA 15 200 TYR 200 200 200 TYR TYR V . n 
EA 15 201 GLN 201 201 201 GLN GLN V . n 
EA 15 202 GLY 202 202 202 GLY GLY V . n 
EA 15 203 SER 203 203 203 SER SER V . n 
EA 15 204 PRO 204 204 204 PRO PRO V . n 
EA 15 205 THR 205 205 205 THR THR V . n 
EA 15 206 PRO 206 206 206 PRO PRO V . n 
EA 15 207 VAL 207 207 207 VAL VAL V . n 
EA 15 208 VAL 208 208 208 VAL VAL V . n 
EA 15 209 LEU 209 209 209 LEU LEU V . n 
EA 15 210 PHE 210 210 210 PHE PHE V . n 
EA 15 211 MET 211 211 211 MET MET V . n 
EA 15 212 ALA 212 212 212 ALA ALA V . n 
EA 15 213 THR 213 213 213 THR THR V . n 
EA 15 214 SER 214 214 214 SER SER V . n 
EA 15 215 VAL 215 215 215 VAL VAL V . n 
EA 15 216 LYS 216 216 216 LYS LYS V . n 
EA 15 217 ALA 217 217 217 ALA ALA V . n 
EA 15 218 ALA 218 218 218 ALA ALA V . n 
EA 15 219 ALA 219 219 219 ALA ALA V . n 
EA 15 220 PHE 220 220 220 PHE PHE V . n 
EA 15 221 ALA 221 221 221 ALA ALA V . n 
EA 15 222 ALA 222 222 222 ALA ALA V . n 
EA 15 223 LEU 223 223 223 LEU LEU V . n 
EA 15 224 LEU 224 224 224 LEU LEU V . n 
EA 15 225 ARG 225 225 225 ARG ARG V . n 
EA 15 226 VAL 226 226 226 VAL VAL V . n 
EA 15 227 ALA 227 227 227 ALA ALA V . n 
EA 15 228 ALA 228 228 228 ALA ALA V . n 
EA 15 229 PRO 229 229 229 PRO PRO V . n 
EA 15 230 PRO 230 230 230 PRO PRO V . n 
EA 15 231 GLU 231 231 231 GLU GLU V . n 
EA 15 232 ALA 232 232 232 ALA ALA V . n 
EA 15 233 LEU 233 233 233 LEU LEU V . n 
EA 15 234 ALA 234 234 234 ALA ALA V . n 
EA 15 235 LEU 235 235 235 LEU LEU V . n 
EA 15 236 LEU 236 236 236 LEU LEU V . n 
EA 15 237 VAL 237 237 237 VAL VAL V . n 
EA 15 238 ALA 238 238 238 ALA ALA V . n 
EA 15 239 LEU 239 239 239 LEU LEU V . n 
EA 15 240 SER 240 240 240 SER SER V . n 
EA 15 241 VAL 241 241 241 VAL VAL V . n 
EA 15 242 VAL 242 242 242 VAL VAL V . n 
EA 15 243 VAL 243 243 243 VAL VAL V . n 
EA 15 244 GLY 244 244 244 GLY GLY V . n 
EA 15 245 ASN 245 245 245 ASN ASN V . n 
EA 15 246 LEU 246 246 246 LEU LEU V . n 
EA 15 247 ALA 247 247 247 ALA ALA V . n 
EA 15 248 ALA 248 248 248 ALA ALA V . n 
EA 15 249 LEU 249 249 249 LEU LEU V . n 
EA 15 250 ALA 250 250 250 ALA ALA V . n 
EA 15 251 GLN 251 251 251 GLN GLN V . n 
EA 15 252 LYS 252 252 252 LYS LYS V . n 
EA 15 253 GLU 253 253 253 GLU GLU V . n 
EA 15 254 ALA 254 254 254 ALA ALA V . n 
EA 15 255 LYS 255 255 255 LYS LYS V . n 
EA 15 256 ARG 256 256 256 ARG ARG V . n 
EA 15 257 LEU 257 257 257 LEU LEU V . n 
EA 15 258 LEU 258 258 258 LEU LEU V . n 
EA 15 259 ALA 259 259 259 ALA ALA V . n 
EA 15 260 TYR 260 260 260 TYR TYR V . n 
EA 15 261 SER 261 261 261 SER SER V . n 
EA 15 262 SER 262 262 262 SER SER V . n 
EA 15 263 ILE 263 263 263 ILE ILE V . n 
EA 15 264 ALA 264 264 264 ALA ALA V . n 
EA 15 265 HIS 265 265 265 HIS HIS V . n 
EA 15 266 ALA 266 266 266 ALA ALA V . n 
EA 15 267 GLY 267 267 267 GLY GLY V . n 
EA 15 268 TYR 268 268 268 TYR TYR V . n 
EA 15 269 MET 269 269 269 MET MET V . n 
EA 15 270 ALA 270 270 270 ALA ALA V . n 
EA 15 271 LEU 271 271 271 LEU LEU V . n 
EA 15 272 ALA 272 272 272 ALA ALA V . n 
EA 15 273 LEU 273 273 273 LEU LEU V . n 
EA 15 274 TYR 274 274 274 TYR TYR V . n 
EA 15 275 THR 275 275 275 THR THR V . n 
EA 15 276 GLY 276 276 276 GLY GLY V . n 
EA 15 277 ASN 277 277 277 ASN ASN V . n 
EA 15 278 ALA 278 278 278 ALA ALA V . n 
EA 15 279 GLN 279 279 279 GLN GLN V . n 
EA 15 280 ALA 280 280 280 ALA ALA V . n 
EA 15 281 LEU 281 281 281 LEU LEU V . n 
EA 15 282 GLY 282 282 282 GLY GLY V . n 
EA 15 283 PHE 283 283 283 PHE PHE V . n 
EA 15 284 TYR 284 284 284 TYR TYR V . n 
EA 15 285 LEU 285 285 285 LEU LEU V . n 
EA 15 286 LEU 286 286 286 LEU LEU V . n 
EA 15 287 THR 287 287 287 THR THR V . n 
EA 15 288 TYR 288 288 288 TYR TYR V . n 
EA 15 289 VAL 289 289 289 VAL VAL V . n 
EA 15 290 LEU 290 290 290 LEU LEU V . n 
EA 15 291 ALA 291 291 291 ALA ALA V . n 
EA 15 292 THR 292 292 292 THR THR V . n 
EA 15 293 GLY 293 293 293 GLY GLY V . n 
EA 15 294 LEU 294 294 294 LEU LEU V . n 
EA 15 295 ALA 295 295 295 ALA ALA V . n 
EA 15 296 PHE 296 296 296 PHE PHE V . n 
EA 15 297 ALA 297 297 297 ALA ALA V . n 
EA 15 298 VAL 298 298 298 VAL VAL V . n 
EA 15 299 LEU 299 299 299 LEU LEU V . n 
EA 15 300 SER 300 300 300 SER SER V . n 
EA 15 301 GLN 301 301 301 GLN GLN V . n 
EA 15 302 ILE 302 302 302 ILE ILE V . n 
EA 15 303 SER 303 303 303 SER SER V . n 
EA 15 304 PRO 304 304 304 PRO PRO V . n 
EA 15 305 ASP 305 305 305 ASP ASP V . n 
EA 15 306 ARG 306 306 306 ARG ARG V . n 
EA 15 307 VAL 307 307 307 VAL VAL V . n 
EA 15 308 PRO 308 308 308 PRO PRO V . n 
EA 15 309 LEU 309 309 309 LEU LEU V . n 
EA 15 310 GLU 310 310 310 GLU GLU V . n 
EA 15 311 ALA 311 311 311 ALA ALA V . n 
EA 15 312 LEU 312 312 312 LEU LEU V . n 
EA 15 313 ARG 313 313 313 ARG ARG V . n 
EA 15 314 GLY 314 314 314 GLY GLY V . n 
EA 15 315 LEU 315 315 315 LEU LEU V . n 
EA 15 316 TYR 316 316 316 TYR TYR V . n 
EA 15 317 ARG 317 317 317 ARG ARG V . n 
EA 15 318 LYS 318 318 318 LYS LYS V . n 
EA 15 319 ASP 319 319 319 ASP ASP V . n 
EA 15 320 PRO 320 320 320 PRO PRO V . n 
EA 15 321 LEU 321 321 321 LEU LEU V . n 
EA 15 322 LEU 322 322 322 LEU LEU V . n 
EA 15 323 GLY 323 323 323 GLY GLY V . n 
EA 15 324 LEU 324 324 324 LEU LEU V . n 
EA 15 325 ALA 325 325 325 ALA ALA V . n 
EA 15 326 PHE 326 326 326 PHE PHE V . n 
EA 15 327 LEU 327 327 327 LEU LEU V . n 
EA 15 328 VAL 328 328 328 VAL VAL V . n 
EA 15 329 ALA 329 329 329 ALA ALA V . n 
EA 15 330 MET 330 330 330 MET MET V . n 
EA 15 331 LEU 331 331 331 LEU LEU V . n 
EA 15 332 SER 332 332 332 SER SER V . n 
EA 15 333 LEU 333 333 333 LEU LEU V . n 
EA 15 334 LEU 334 334 334 LEU LEU V . n 
EA 15 335 GLY 335 335 335 GLY GLY V . n 
EA 15 336 LEU 336 336 336 LEU LEU V . n 
EA 15 337 PRO 337 337 337 PRO PRO V . n 
EA 15 338 PRO 338 338 338 PRO PRO V . n 
EA 15 339 LEU 339 339 339 LEU LEU V . n 
EA 15 340 ALA 340 340 340 ALA ALA V . n 
EA 15 341 GLY 341 341 341 GLY GLY V . n 
EA 15 342 PHE 342 342 342 PHE PHE V . n 
EA 15 343 TRP 343 343 343 TRP TRP V . n 
EA 15 344 GLY 344 344 344 GLY GLY V . n 
EA 15 345 LYS 345 345 345 LYS LYS V . n 
EA 15 346 TYR 346 346 346 TYR TYR V . n 
EA 15 347 LEU 347 347 347 LEU LEU V . n 
EA 15 348 ALA 348 348 348 ALA ALA V . n 
EA 15 349 PHE 349 349 349 PHE PHE V . n 
EA 15 350 ALA 350 350 350 ALA ALA V . n 
EA 15 351 GLU 351 351 351 GLU GLU V . n 
EA 15 352 ALA 352 352 352 ALA ALA V . n 
EA 15 353 ALA 353 353 353 ALA ALA V . n 
EA 15 354 ARG 354 354 354 ARG ARG V . n 
EA 15 355 ALA 355 355 355 ALA ALA V . n 
EA 15 356 GLY 356 356 356 GLY GLY V . n 
EA 15 357 ALA 357 357 357 ALA ALA V . n 
EA 15 358 TRP 358 358 358 TRP TRP V . n 
EA 15 359 GLY 359 359 359 GLY GLY V . n 
EA 15 360 VAL 360 360 360 VAL VAL V . n 
EA 15 361 LEU 361 361 361 LEU LEU V . n 
EA 15 362 VAL 362 362 362 VAL VAL V . n 
EA 15 363 LEU 363 363 363 LEU LEU V . n 
EA 15 364 ALA 364 364 364 ALA ALA V . n 
EA 15 365 LEU 365 365 365 LEU LEU V . n 
EA 15 366 VAL 366 366 366 VAL VAL V . n 
EA 15 367 THR 367 367 367 THR THR V . n 
EA 15 368 SER 368 368 368 SER SER V . n 
EA 15 369 ALA 369 369 369 ALA ALA V . n 
EA 15 370 VAL 370 370 370 VAL VAL V . n 
EA 15 371 SER 371 371 371 SER SER V . n 
EA 15 372 ALA 372 372 372 ALA ALA V . n 
EA 15 373 TYR 373 373 373 TYR TYR V . n 
EA 15 374 TYR 374 374 374 TYR TYR V . n 
EA 15 375 TYR 375 375 375 TYR TYR V . n 
EA 15 376 LEU 376 376 376 LEU LEU V . n 
EA 15 377 GLY 377 377 377 GLY GLY V . n 
EA 15 378 LEU 378 378 378 LEU LEU V . n 
EA 15 379 GLY 379 379 379 GLY GLY V . n 
EA 15 380 LEU 380 380 380 LEU LEU V . n 
EA 15 381 ALA 381 381 381 ALA ALA V . n 
EA 15 382 VAL 382 382 382 VAL VAL V . n 
EA 15 383 PHE 383 383 383 PHE PHE V . n 
EA 15 384 ALA 384 384 384 ALA ALA V . n 
EA 15 385 ARG 385 385 385 ARG ARG V . n 
EA 15 386 PRO 386 386 386 PRO PRO V . n 
EA 15 387 GLU 387 387 387 GLU GLU V . n 
EA 15 388 GLU 388 388 388 GLU GLU V . n 
EA 15 389 THR 389 389 389 THR THR V . n 
EA 15 390 PRO 390 390 390 PRO PRO V . n 
EA 15 391 PHE 391 391 391 PHE PHE V . n 
EA 15 392 ARG 392 392 392 ARG ARG V . n 
EA 15 393 PRO 393 393 393 PRO PRO V . n 
EA 15 394 GLY 394 394 394 GLY GLY V . n 
EA 15 395 PRO 395 395 395 PRO PRO V . n 
EA 15 396 PRO 396 396 396 PRO PRO V . n 
EA 15 397 TRP 397 397 397 TRP TRP V . n 
EA 15 398 ALA 398 398 398 ALA ALA V . n 
EA 15 399 ARG 399 399 399 ARG ARG V . n 
EA 15 400 ALA 400 400 400 ALA ALA V . n 
EA 15 401 ALA 401 401 401 ALA ALA V . n 
EA 15 402 VAL 402 402 402 VAL VAL V . n 
EA 15 403 VAL 403 403 403 VAL VAL V . n 
EA 15 404 ALA 404 404 404 ALA ALA V . n 
EA 15 405 ALA 405 405 405 ALA ALA V . n 
EA 15 406 GLY 406 406 406 GLY GLY V . n 
EA 15 407 VAL 407 407 407 VAL VAL V . n 
EA 15 408 LEU 408 408 408 LEU LEU V . n 
EA 15 409 LEU 409 409 409 LEU LEU V . n 
EA 15 410 LEU 410 410 410 LEU LEU V . n 
EA 15 411 ALA 411 411 411 ALA ALA V . n 
EA 15 412 LEU 412 412 412 LEU LEU V . n 
EA 15 413 GLY 413 413 413 GLY GLY V . n 
EA 15 414 LEU 414 414 414 LEU LEU V . n 
EA 15 415 LEU 415 415 415 LEU LEU V . n 
EA 15 416 PRO 416 416 416 PRO PRO V . n 
EA 15 417 GLY 417 417 417 GLY GLY V . n 
EA 15 418 LEU 418 418 418 LEU LEU V . n 
EA 15 419 VAL 419 419 419 VAL VAL V . n 
EA 15 420 LEU 420 420 420 LEU LEU V . n 
EA 15 421 PRO 421 421 421 PRO PRO V . n 
EA 15 422 ALA 422 422 422 ALA ALA V . n 
EA 15 423 LEU 423 423 423 LEU LEU V . n 
EA 15 424 ALA 424 424 424 ALA ALA V . n 
EA 15 425 ALA 425 425 425 ALA ALA V . n 
EA 15 426 GLY 426 426 426 GLY GLY V . n 
EA 15 427 GLY 427 427 427 GLY GLY V . n 
FA 16 1   MET 1   1   ?   ?   ?   Q . n 
FA 16 2   THR 2   2   2   THR THR Q . n 
FA 16 3   TRP 3   3   3   TRP TRP Q . n 
FA 16 4   SER 4   4   4   SER SER Q . n 
FA 16 5   TYR 5   5   5   TYR TYR Q . n 
FA 16 6   PRO 6   6   6   PRO PRO Q . n 
FA 16 7   VAL 7   7   7   VAL VAL Q . n 
FA 16 8   ASP 8   8   8   ASP ASP Q . n 
FA 16 9   PRO 9   9   9   PRO PRO Q . n 
FA 16 10  TYR 10  10  10  TYR TYR Q . n 
FA 16 11  TRP 11  11  11  TRP TRP Q . n 
FA 16 12  MET 12  12  12  MET MET Q . n 
FA 16 13  VAL 13  13  13  VAL VAL Q . n 
FA 16 14  ALA 14  14  14  ALA ALA Q . n 
FA 16 15  LEU 15  15  15  LEU LEU Q . n 
FA 16 16  LYS 16  16  16  LYS LYS Q . n 
FA 16 17  ALA 17  17  17  ALA ALA Q . n 
FA 16 18  LEU 18  18  18  LEU LEU Q . n 
FA 16 19  LEU 19  19  19  LEU LEU Q . n 
FA 16 20  VAL 20  20  20  VAL VAL Q . n 
FA 16 21  VAL 21  21  21  VAL VAL Q . n 
FA 16 22  VAL 22  22  22  VAL VAL Q . n 
FA 16 23  GLY 23  23  23  GLY GLY Q . n 
FA 16 24  LEU 24  24  24  LEU LEU Q . n 
FA 16 25  LEU 25  25  25  LEU LEU Q . n 
FA 16 26  THR 26  26  26  THR THR Q . n 
FA 16 27  ALA 27  27  27  ALA ALA Q . n 
FA 16 28  PHE 28  28  28  PHE PHE Q . n 
FA 16 29  ALA 29  29  29  ALA ALA Q . n 
FA 16 30  PHE 30  30  30  PHE PHE Q . n 
FA 16 31  MET 31  31  31  MET MET Q . n 
FA 16 32  THR 32  32  32  THR THR Q . n 
FA 16 33  LEU 33  33  33  LEU LEU Q . n 
FA 16 34  ILE 34  34  34  ILE ILE Q . n 
FA 16 35  GLU 35  35  35  GLU GLU Q . n 
FA 16 36  ARG 36  36  36  ARG ARG Q . n 
FA 16 37  ARG 37  37  37  ARG ARG Q . n 
FA 16 38  LEU 38  38  38  LEU LEU Q . n 
FA 16 39  LEU 39  39  39  LEU LEU Q . n 
FA 16 40  ALA 40  40  40  ALA ALA Q . n 
FA 16 41  ARG 41  41  41  ARG ARG Q . n 
FA 16 42  PHE 42  42  42  PHE PHE Q . n 
FA 16 43  GLN 43  43  43  GLN GLN Q . n 
FA 16 44  VAL 44  44  44  VAL VAL Q . n 
FA 16 45  ARG 45  45  45  ARG ARG Q . n 
FA 16 46  MET 46  46  46  MET MET Q . n 
FA 16 47  GLY 47  47  47  GLY GLY Q . n 
FA 16 48  PRO 48  48  48  PRO PRO Q . n 
FA 16 49  ASN 49  49  49  ASN ASN Q . n 
FA 16 50  ARG 50  50  50  ARG ARG Q . n 
FA 16 51  VAL 51  51  51  VAL VAL Q . n 
FA 16 52  GLY 52  52  52  GLY GLY Q . n 
FA 16 53  PRO 53  53  53  PRO PRO Q . n 
FA 16 54  PHE 54  54  54  PHE PHE Q . n 
FA 16 55  GLY 55  55  55  GLY GLY Q . n 
FA 16 56  LEU 56  56  56  LEU LEU Q . n 
FA 16 57  LEU 57  57  57  LEU LEU Q . n 
FA 16 58  GLN 58  58  58  GLN GLN Q . n 
FA 16 59  PRO 59  59  59  PRO PRO Q . n 
FA 16 60  LEU 60  60  60  LEU LEU Q . n 
FA 16 61  ALA 61  61  61  ALA ALA Q . n 
FA 16 62  ASP 62  62  62  ASP ASP Q . n 
FA 16 63  ALA 63  63  63  ALA ALA Q . n 
FA 16 64  ILE 64  64  64  ILE ILE Q . n 
FA 16 65  LYS 65  65  65  LYS LYS Q . n 
FA 16 66  SER 66  66  66  SER SER Q . n 
FA 16 67  ILE 67  67  67  ILE ILE Q . n 
FA 16 68  PHE 68  68  68  PHE PHE Q . n 
FA 16 69  LYS 69  69  69  LYS LYS Q . n 
FA 16 70  GLU 70  70  70  GLU GLU Q . n 
FA 16 71  ASP 71  71  71  ASP ASP Q . n 
FA 16 72  ILE 72  72  72  ILE ILE Q . n 
FA 16 73  VAL 73  73  73  VAL VAL Q . n 
FA 16 74  VAL 74  74  74  VAL VAL Q . n 
FA 16 75  ALA 75  75  75  ALA ALA Q . n 
FA 16 76  GLN 76  76  76  GLN GLN Q . n 
FA 16 77  ALA 77  77  77  ALA ALA Q . n 
FA 16 78  ASP 78  78  78  ASP ASP Q . n 
FA 16 79  ARG 79  79  79  ARG ARG Q . n 
FA 16 80  PHE 80  80  80  PHE PHE Q . n 
FA 16 81  LEU 81  81  81  LEU LEU Q . n 
FA 16 82  PHE 82  82  82  PHE PHE Q . n 
FA 16 83  VAL 83  83  83  VAL VAL Q . n 
FA 16 84  LEU 84  84  84  LEU LEU Q . n 
FA 16 85  ALA 85  85  85  ALA ALA Q . n 
FA 16 86  PRO 86  86  86  PRO PRO Q . n 
FA 16 87  LEU 87  87  87  LEU LEU Q . n 
FA 16 88  ILE 88  88  88  ILE ILE Q . n 
FA 16 89  SER 89  89  89  SER SER Q . n 
FA 16 90  VAL 90  90  90  VAL VAL Q . n 
FA 16 91  VAL 91  91  91  VAL VAL Q . n 
FA 16 92  PHE 92  92  92  PHE PHE Q . n 
FA 16 93  ALA 93  93  93  ALA ALA Q . n 
FA 16 94  LEU 94  94  94  LEU LEU Q . n 
FA 16 95  LEU 95  95  95  LEU LEU Q . n 
FA 16 96  ALA 96  96  96  ALA ALA Q . n 
FA 16 97  PHE 97  97  97  PHE PHE Q . n 
FA 16 98  GLY 98  98  98  GLY GLY Q . n 
FA 16 99  LEU 99  99  99  LEU LEU Q . n 
FA 16 100 ILE 100 100 100 ILE ILE Q . n 
FA 16 101 PRO 101 101 101 PRO PRO Q . n 
FA 16 102 PHE 102 102 102 PHE PHE Q . n 
FA 16 103 GLY 103 103 103 GLY GLY Q . n 
FA 16 104 PRO 104 104 104 PRO PRO Q . n 
FA 16 105 PRO 105 105 105 PRO PRO Q . n 
FA 16 106 GLY 106 106 106 GLY GLY Q . n 
FA 16 107 SER 107 107 107 SER SER Q . n 
FA 16 108 PHE 108 108 108 PHE PHE Q . n 
FA 16 109 PHE 109 109 109 PHE PHE Q . n 
FA 16 110 GLY 110 110 110 GLY GLY Q . n 
FA 16 111 TYR 111 111 111 TYR TYR Q . n 
FA 16 112 GLN 112 112 112 GLN GLN Q . n 
FA 16 113 PRO 113 113 113 PRO PRO Q . n 
FA 16 114 TRP 114 114 114 TRP TRP Q . n 
FA 16 115 VAL 115 115 115 VAL VAL Q . n 
FA 16 116 ILE 116 116 116 ILE ILE Q . n 
FA 16 117 ASN 117 117 117 ASN ASN Q . n 
FA 16 118 LEU 118 118 118 LEU LEU Q . n 
FA 16 119 ASP 119 119 119 ASP ASP Q . n 
FA 16 120 LEU 120 120 120 LEU LEU Q . n 
FA 16 121 GLY 121 121 121 GLY GLY Q . n 
FA 16 122 ILE 122 122 122 ILE ILE Q . n 
FA 16 123 LEU 123 123 123 LEU LEU Q . n 
FA 16 124 TYR 124 124 124 TYR TYR Q . n 
FA 16 125 LEU 125 125 125 LEU LEU Q . n 
FA 16 126 PHE 126 126 126 PHE PHE Q . n 
FA 16 127 ALA 127 127 127 ALA ALA Q . n 
FA 16 128 VAL 128 128 128 VAL VAL Q . n 
FA 16 129 SER 129 129 129 SER SER Q . n 
FA 16 130 GLU 130 130 130 GLU GLU Q . n 
FA 16 131 LEU 131 131 131 LEU LEU Q . n 
FA 16 132 ALA 132 132 132 ALA ALA Q . n 
FA 16 133 VAL 133 133 133 VAL VAL Q . n 
FA 16 134 TYR 134 134 134 TYR TYR Q . n 
FA 16 135 GLY 135 135 135 GLY GLY Q . n 
FA 16 136 ILE 136 136 136 ILE ILE Q . n 
FA 16 137 PHE 137 137 137 PHE PHE Q . n 
FA 16 138 LEU 138 138 138 LEU LEU Q . n 
FA 16 139 SER 139 139 139 SER SER Q . n 
FA 16 140 GLY 140 140 140 GLY GLY Q . n 
FA 16 141 TRP 141 141 141 TRP TRP Q . n 
FA 16 142 ALA 142 142 142 ALA ALA Q . n 
FA 16 143 SER 143 143 143 SER SER Q . n 
FA 16 144 GLY 144 144 144 GLY GLY Q . n 
FA 16 145 SER 145 145 145 SER SER Q . n 
FA 16 146 LYS 146 146 146 LYS LYS Q . n 
FA 16 147 TYR 147 147 147 TYR TYR Q . n 
FA 16 148 SER 148 148 148 SER SER Q . n 
FA 16 149 LEU 149 149 149 LEU LEU Q . n 
FA 16 150 LEU 150 150 150 LEU LEU Q . n 
FA 16 151 GLY 151 151 151 GLY GLY Q . n 
FA 16 152 SER 152 152 152 SER SER Q . n 
FA 16 153 LEU 153 153 153 LEU LEU Q . n 
FA 16 154 ARG 154 154 154 ARG ARG Q . n 
FA 16 155 SER 155 155 155 SER SER Q . n 
FA 16 156 SER 156 156 156 SER SER Q . n 
FA 16 157 ALA 157 157 157 ALA ALA Q . n 
FA 16 158 SER 158 158 158 SER SER Q . n 
FA 16 159 LEU 159 159 159 LEU LEU Q . n 
FA 16 160 ILE 160 160 160 ILE ILE Q . n 
FA 16 161 SER 161 161 161 SER SER Q . n 
FA 16 162 TYR 162 162 162 TYR TYR Q . n 
FA 16 163 GLU 163 163 163 GLU GLU Q . n 
FA 16 164 LEU 164 164 164 LEU LEU Q . n 
FA 16 165 GLY 165 165 165 GLY GLY Q . n 
FA 16 166 LEU 166 166 166 LEU LEU Q . n 
FA 16 167 GLY 167 167 167 GLY GLY Q . n 
FA 16 168 LEU 168 168 168 LEU LEU Q . n 
FA 16 169 ALA 169 169 169 ALA ALA Q . n 
FA 16 170 LEU 170 170 170 LEU LEU Q . n 
FA 16 171 LEU 171 171 171 LEU LEU Q . n 
FA 16 172 ALA 172 172 172 ALA ALA Q . n 
FA 16 173 PRO 173 173 173 PRO PRO Q . n 
FA 16 174 VAL 174 174 174 VAL VAL Q . n 
FA 16 175 LEU 175 175 175 LEU LEU Q . n 
FA 16 176 LEU 176 176 176 LEU LEU Q . n 
FA 16 177 VAL 177 177 177 VAL VAL Q . n 
FA 16 178 GLY 178 178 178 GLY GLY Q . n 
FA 16 179 SER 179 179 179 SER SER Q . n 
FA 16 180 LEU 180 180 180 LEU LEU Q . n 
FA 16 181 ASN 181 181 181 ASN ASN Q . n 
FA 16 182 LEU 182 182 182 LEU LEU Q . n 
FA 16 183 ASN 183 183 183 ASN ASN Q . n 
FA 16 184 ASP 184 184 184 ASP ASP Q . n 
FA 16 185 ILE 185 185 185 ILE ILE Q . n 
FA 16 186 VAL 186 186 186 VAL VAL Q . n 
FA 16 187 ASN 187 187 187 ASN ASN Q . n 
FA 16 188 TRP 188 188 188 TRP TRP Q . n 
FA 16 189 GLN 189 189 189 GLN GLN Q . n 
FA 16 190 LYS 190 190 190 LYS LYS Q . n 
FA 16 191 GLU 191 191 191 GLU GLU Q . n 
FA 16 192 HIS 192 192 192 HIS HIS Q . n 
FA 16 193 GLY 193 193 193 GLY GLY Q . n 
FA 16 194 TRP 194 194 194 TRP TRP Q . n 
FA 16 195 LEU 195 195 195 LEU LEU Q . n 
FA 16 196 PHE 196 196 196 PHE PHE Q . n 
FA 16 197 LEU 197 197 197 LEU LEU Q . n 
FA 16 198 TYR 198 198 198 TYR TYR Q . n 
FA 16 199 ALA 199 199 199 ALA ALA Q . n 
FA 16 200 PHE 200 200 200 PHE PHE Q . n 
FA 16 201 PRO 201 201 201 PRO PRO Q . n 
FA 16 202 ALA 202 202 202 ALA ALA Q . n 
FA 16 203 PHE 203 203 203 PHE PHE Q . n 
FA 16 204 LEU 204 204 204 LEU LEU Q . n 
FA 16 205 VAL 205 205 205 VAL VAL Q . n 
FA 16 206 TYR 206 206 206 TYR TYR Q . n 
FA 16 207 LEU 207 207 207 LEU LEU Q . n 
FA 16 208 ILE 208 208 208 ILE ILE Q . n 
FA 16 209 ALA 209 209 209 ALA ALA Q . n 
FA 16 210 SER 210 210 210 SER SER Q . n 
FA 16 211 MET 211 211 211 MET MET Q . n 
FA 16 212 ALA 212 212 212 ALA ALA Q . n 
FA 16 213 GLU 213 213 213 GLU GLU Q . n 
FA 16 214 ALA 214 214 214 ALA ALA Q . n 
FA 16 215 ALA 215 215 215 ALA ALA Q . n 
FA 16 216 ARG 216 216 216 ARG ARG Q . n 
FA 16 217 THR 217 217 217 THR THR Q . n 
FA 16 218 PRO 218 218 218 PRO PRO Q . n 
FA 16 219 PHE 219 219 219 PHE PHE Q . n 
FA 16 220 ASP 220 220 220 ASP ASP Q . n 
FA 16 221 LEU 221 221 221 LEU LEU Q . n 
FA 16 222 PRO 222 222 222 PRO PRO Q . n 
FA 16 223 GLU 223 223 223 GLU GLU Q . n 
FA 16 224 ALA 224 224 224 ALA ALA Q . n 
FA 16 225 GLU 225 225 225 GLU GLU Q . n 
FA 16 226 GLN 226 226 226 GLN GLN Q . n 
FA 16 227 GLU 227 227 227 GLU GLU Q . n 
FA 16 228 LEU 228 228 228 LEU LEU Q . n 
FA 16 229 VAL 229 229 229 VAL VAL Q . n 
FA 16 230 GLY 230 230 230 GLY GLY Q . n 
FA 16 231 GLY 231 231 231 GLY GLY Q . n 
FA 16 232 TYR 232 232 232 TYR TYR Q . n 
FA 16 233 HIS 233 233 233 HIS HIS Q . n 
FA 16 234 THR 234 234 234 THR THR Q . n 
FA 16 235 GLU 235 235 235 GLU GLU Q . n 
FA 16 236 TYR 236 236 236 TYR TYR Q . n 
FA 16 237 SER 237 237 237 SER SER Q . n 
FA 16 238 SER 238 238 238 SER SER Q . n 
FA 16 239 ILE 239 239 239 ILE ILE Q . n 
FA 16 240 LYS 240 240 240 LYS LYS Q . n 
FA 16 241 TRP 241 241 241 TRP TRP Q . n 
FA 16 242 ALA 242 242 242 ALA ALA Q . n 
FA 16 243 LEU 243 243 243 LEU LEU Q . n 
FA 16 244 PHE 244 244 244 PHE PHE Q . n 
FA 16 245 GLN 245 245 245 GLN GLN Q . n 
FA 16 246 MET 246 246 246 MET MET Q . n 
FA 16 247 ALA 247 247 247 ALA ALA Q . n 
FA 16 248 GLU 248 248 248 GLU GLU Q . n 
FA 16 249 TYR 249 249 249 TYR TYR Q . n 
FA 16 250 ILE 250 250 250 ILE ILE Q . n 
FA 16 251 HIS 251 251 251 HIS HIS Q . n 
FA 16 252 PHE 252 252 252 PHE PHE Q . n 
FA 16 253 ILE 253 253 253 ILE ILE Q . n 
FA 16 254 THR 254 254 254 THR THR Q . n 
FA 16 255 ALA 255 255 255 ALA ALA Q . n 
FA 16 256 SER 256 256 256 SER SER Q . n 
FA 16 257 ALA 257 257 257 ALA ALA Q . n 
FA 16 258 LEU 258 258 258 LEU LEU Q . n 
FA 16 259 ILE 259 259 259 ILE ILE Q . n 
FA 16 260 PRO 260 260 260 PRO PRO Q . n 
FA 16 261 THR 261 261 261 THR THR Q . n 
FA 16 262 LEU 262 262 262 LEU LEU Q . n 
FA 16 263 PHE 263 263 263 PHE PHE Q . n 
FA 16 264 LEU 264 264 264 LEU LEU Q . n 
FA 16 265 GLY 265 265 265 GLY GLY Q . n 
FA 16 266 GLY 266 266 266 GLY GLY Q . n 
FA 16 267 TRP 267 267 267 TRP TRP Q . n 
FA 16 268 THR 268 268 268 THR THR Q . n 
FA 16 269 MET 269 269 269 MET MET Q . n 
FA 16 270 PRO 270 270 270 PRO PRO Q . n 
FA 16 271 VAL 271 271 271 VAL VAL Q . n 
FA 16 272 LEU 272 272 272 LEU LEU Q . n 
FA 16 273 GLU 273 273 273 GLU GLU Q . n 
FA 16 274 VAL 274 274 274 VAL VAL Q . n 
FA 16 275 PRO 275 275 275 PRO PRO Q . n 
FA 16 276 TYR 276 276 276 TYR TYR Q . n 
FA 16 277 LEU 277 277 277 LEU LEU Q . n 
FA 16 278 TRP 278 278 278 TRP TRP Q . n 
FA 16 279 MET 279 279 279 MET MET Q . n 
FA 16 280 PHE 280 280 280 PHE PHE Q . n 
FA 16 281 LEU 281 281 281 LEU LEU Q . n 
FA 16 282 LYS 282 282 282 LYS LYS Q . n 
FA 16 283 ILE 283 283 283 ILE ILE Q . n 
FA 16 284 ALA 284 284 284 ALA ALA Q . n 
FA 16 285 PHE 285 285 285 PHE PHE Q . n 
FA 16 286 PHE 286 286 286 PHE PHE Q . n 
FA 16 287 LEU 287 287 287 LEU LEU Q . n 
FA 16 288 PHE 288 288 288 PHE PHE Q . n 
FA 16 289 PHE 289 289 289 PHE PHE Q . n 
FA 16 290 PHE 290 290 290 PHE PHE Q . n 
FA 16 291 ILE 291 291 291 ILE ILE Q . n 
FA 16 292 TRP 292 292 292 TRP TRP Q . n 
FA 16 293 ILE 293 293 293 ILE ILE Q . n 
FA 16 294 ARG 294 294 294 ARG ARG Q . n 
FA 16 295 ALA 295 295 295 ALA ALA Q . n 
FA 16 296 THR 296 296 296 THR THR Q . n 
FA 16 297 TRP 297 297 297 TRP TRP Q . n 
FA 16 298 PHE 298 298 298 PHE PHE Q . n 
FA 16 299 ARG 299 299 299 ARG ARG Q . n 
FA 16 300 LEU 300 300 300 LEU LEU Q . n 
FA 16 301 ARG 301 301 301 ARG ARG Q . n 
FA 16 302 TYR 302 302 302 TYR TYR Q . n 
FA 16 303 ASP 303 303 303 ASP ASP Q . n 
FA 16 304 GLN 304 304 304 GLN GLN Q . n 
FA 16 305 LEU 305 305 305 LEU LEU Q . n 
FA 16 306 LEU 306 306 306 LEU LEU Q . n 
FA 16 307 ARG 307 307 307 ARG ARG Q . n 
FA 16 308 PHE 308 308 308 PHE PHE Q . n 
FA 16 309 GLY 309 309 309 GLY GLY Q . n 
FA 16 310 TRP 310 310 310 TRP TRP Q . n 
FA 16 311 GLY 311 311 311 GLY GLY Q . n 
FA 16 312 PHE 312 312 312 PHE PHE Q . n 
FA 16 313 LEU 313 313 313 LEU LEU Q . n 
FA 16 314 PHE 314 314 314 PHE PHE Q . n 
FA 16 315 PRO 315 315 315 PRO PRO Q . n 
FA 16 316 LEU 316 316 316 LEU LEU Q . n 
FA 16 317 ALA 317 317 317 ALA ALA Q . n 
FA 16 318 LEU 318 318 318 LEU LEU Q . n 
FA 16 319 LEU 319 319 319 LEU LEU Q . n 
FA 16 320 TRP 320 320 320 TRP TRP Q . n 
FA 16 321 PHE 321 321 321 PHE PHE Q . n 
FA 16 322 LEU 322 322 322 LEU LEU Q . n 
FA 16 323 VAL 323 323 323 VAL VAL Q . n 
FA 16 324 THR 324 324 324 THR THR Q . n 
FA 16 325 ALA 325 325 325 ALA ALA Q . n 
FA 16 326 LEU 326 326 326 LEU LEU Q . n 
FA 16 327 VAL 327 327 327 VAL VAL Q . n 
FA 16 328 VAL 328 328 328 VAL VAL Q . n 
FA 16 329 ALA 329 329 329 ALA ALA Q . n 
FA 16 330 LEU 330 330 330 LEU LEU Q . n 
FA 16 331 ASP 331 331 331 ASP ASP Q . n 
FA 16 332 LEU 332 332 332 LEU LEU Q . n 
FA 16 333 PRO 333 333 333 PRO PRO Q . n 
FA 16 334 ARG 334 334 334 ARG ARG Q . n 
FA 16 335 THR 335 335 335 THR THR Q . n 
FA 16 336 TYR 336 336 336 TYR TYR Q . n 
FA 16 337 LEU 337 337 337 LEU LEU Q . n 
FA 16 338 LEU 338 338 338 LEU LEU Q . n 
FA 16 339 TYR 339 339 339 TYR TYR Q . n 
FA 16 340 LEU 340 340 340 LEU LEU Q . n 
FA 16 341 SER 341 341 341 SER SER Q . n 
FA 16 342 ALA 342 342 342 ALA ALA Q . n 
FA 16 343 LEU 343 343 343 LEU LEU Q . n 
FA 16 344 SER 344 344 344 SER SER Q . n 
FA 16 345 PHE 345 345 345 PHE PHE Q . n 
FA 16 346 LEU 346 346 346 LEU LEU Q . n 
FA 16 347 VAL 347 347 347 VAL VAL Q . n 
FA 16 348 LEU 348 348 348 LEU LEU Q . n 
FA 16 349 LEU 349 349 349 LEU LEU Q . n 
FA 16 350 GLY 350 350 350 GLY GLY Q . n 
FA 16 351 ALA 351 351 351 ALA ALA Q . n 
FA 16 352 VAL 352 352 352 VAL VAL Q . n 
FA 16 353 LEU 353 353 353 LEU LEU Q . n 
FA 16 354 TYR 354 354 354 TYR TYR Q . n 
FA 16 355 THR 355 355 ?   ?   ?   Q . n 
FA 16 356 PRO 356 356 ?   ?   ?   Q . n 
FA 16 357 LYS 357 357 ?   ?   ?   Q . n 
FA 16 358 PRO 358 358 ?   ?   ?   Q . n 
FA 16 359 ALA 359 359 ?   ?   ?   Q . n 
FA 16 360 ARG 360 360 ?   ?   ?   Q . n 
FA 16 361 LYS 361 361 ?   ?   ?   Q . n 
FA 16 362 GLY 362 362 ?   ?   ?   Q . n 
FA 16 363 GLY 363 363 ?   ?   ?   Q . n 
FA 16 364 GLY 364 364 ?   ?   ?   Q . n 
FA 16 365 ALA 365 365 ?   ?   ?   Q . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
GA 17 SF4 1 501 501 SF4 SF4 1 . 
HA 18 FMN 1 502 502 FMN FMN 1 . 
IA 19 NAI 1 503 503 NAI NAI 1 . 
JA 20 FES 1 201 201 FES FES 2 . 
KA 17 SF4 1 801 801 SF4 SF4 3 . 
LA 17 SF4 1 802 802 SF4 SF4 3 . 
MA 17 SF4 1 803 803 SF4 SF4 3 . 
NA 20 FES 1 804 804 FES FES 3 . 
OA 17 SF4 1 201 201 SF4 SF4 6 . 
PA 17 SF4 1 201 201 SF4 SF4 9 . 
QA 17 SF4 1 202 202 SF4 SF4 9 . 
RA 17 SF4 1 501 501 SF4 SF4 B . 
SA 18 FMN 1 502 502 FMN FMN B . 
TA 19 NAI 1 503 503 NAI NAI B . 
UA 20 FES 1 201 201 FES FES C . 
VA 17 SF4 1 801 801 SF4 SF4 D . 
WA 17 SF4 1 802 802 SF4 SF4 D . 
XA 17 SF4 1 803 803 SF4 SF4 D . 
YA 20 FES 1 804 804 FES FES D . 
ZA 17 SF4 1 201 201 SF4 SF4 G . 
AB 17 SF4 1 201 201 SF4 SF4 O . 
BB 17 SF4 1 202 202 SF4 SF4 O . 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.13rc1_2961: ???)' 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS    ? ? ? .                     2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? .                     3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? .                     4 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   100.52 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6I1P 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     96.110 
_cell.length_a_esd                 ? 
_cell.length_b                     341.450 
_cell.length_b_esd                 ? 
_cell.length_c                     263.890 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        4 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6I1P 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6I1P 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            4.07 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         69.76 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            296 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
'100 mM Bis-Tris pH 6.0, 23% (w/v) PEG 4000, 100 mM KCl, 100 mM glutaric acid pH 6.0 and 0.01 mM n-tetradecyl-beta-D-maltopyranoside' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-05-12 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.900 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'DIAMOND BEAMLINE I03' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.900 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   I03 
_diffrn_source.pdbx_synchrotron_site       Diamond 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6I1P 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                3.2 
_reflns.d_resolution_low                 58.712 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       260997 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             95.5 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  2.7 
_reflns.pdbx_Rmerge_I_obs                0.157 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            5.3 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  0.112 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  3.20 
_reflns_shell.d_res_low                   3.37 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         0.5 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           35816 
_reflns_shell.percent_possible_all        90.1 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                2.644 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             2.5 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             1.911 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               74.2 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  
;TLS refinement.

Twin refinement.
TWINNING INFORMATION:                                              
FRACTION: 0.470                                                   
OPERATOR: -h,-k,h+l 

Data cut anisotropically to limits (Angstrom) along a*, b* and c*:
3.4, 3.8, 3.2
;
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6I1P 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            3.207 
_refine.ls_d_res_low                             58.712 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     207039 
_refine.ls_number_reflns_R_free                  2226 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    76.09 
_refine.ls_percent_reflns_R_free                 1.08 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2190 
_refine.ls_R_factor_R_free                       0.2310 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2101 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4HEA 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 21.71 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        73896 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         278 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               74174 
_refine_hist.d_res_high                       3.207 
_refine_hist.d_res_low                        58.712 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.007 ? 76286  ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.996 ? 104056 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 6.758 ? 44682  ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.055 ? 11660  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.007 ? 13106  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 3.2106 3.2853  . . 8   739   4.00  . . . 0.6513 . 0.4267 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.2853 3.3673  . . 23  2584  14.00 . . . 0.4483 . 0.3419 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.3673 3.4583  . . 64  6034  33.00 . . . 0.3207 . 0.2853 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.4583 3.5600  . . 92  9741  54.00 . . . 0.2794 . 0.2622 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.5600 3.6747  . . 130 12732 71.00 . . . 0.2612 . 0.2478 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.6747 3.8059  . . 183 15760 87.00 . . . 0.2697 . 0.2375 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.8059 3.9581  . . 171 17163 95.00 . . . 0.2337 . 0.2291 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.9581 4.1379  . . 175 17365 96.00 . . . 0.2443 . 0.2209 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.1379 4.3557  . . 189 17503 97.00 . . . 0.2529 . 0.2155 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.3557 4.6279  . . 175 17402 97.00 . . . 0.2250 . 0.2123 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.6279 4.9842  . . 202 17497 97.00 . . . 0.2281 . 0.2061 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.9842 5.4840  . . 183 17585 97.00 . . . 0.2020 . 0.2074 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.4840 6.2732  . . 192 17631 97.00 . . . 0.2589 . 0.2179 . . . . . . . . . . 
'X-RAY DIFFRACTION' 6.2732 7.8872  . . 161 17577 97.00 . . . 0.2128 . 0.1996 . . . . . . . . . . 
'X-RAY DIFFRACTION' 7.8872 34.0002 . . 192 17410 95.00 . . . 0.2302 . 0.2055 . . . . . . . . . . 
# 
_struct.entry_id                     6I1P 
_struct.title                        'Respiratory complex I from Thermus thermophilus with bound NADH' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6I1P 
_struct_keywords.text            
'Respiratory chain, complex I, NADH:ubiquinone oxidoreductase, electron transfer, proton translocation, MEMBRANE PROTEIN' 
_struct_keywords.pdbx_keywords   'MEMBRANE PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1  ? 
B  N N 2  ? 
C  N N 3  ? 
D  N N 4  ? 
E  N N 5  ? 
F  N N 6  ? 
G  N N 7  ? 
H  N N 8  ? 
I  N N 9  ? 
J  N N 10 ? 
K  N N 11 ? 
L  N N 12 ? 
M  N N 13 ? 
N  N N 14 ? 
O  N N 15 ? 
P  N N 16 ? 
Q  N N 1  ? 
R  N N 2  ? 
S  N N 3  ? 
T  N N 4  ? 
U  N N 5  ? 
V  N N 6  ? 
W  N N 7  ? 
X  N N 8  ? 
Y  N N 9  ? 
Z  N N 10 ? 
AA N N 11 ? 
BA N N 12 ? 
CA N N 13 ? 
DA N N 14 ? 
EA N N 15 ? 
FA N N 16 ? 
GA N N 17 ? 
HA N N 18 ? 
IA N N 19 ? 
JA N N 20 ? 
KA N N 17 ? 
LA N N 17 ? 
MA N N 17 ? 
NA N N 20 ? 
OA N N 17 ? 
PA N N 17 ? 
QA N N 17 ? 
RA N N 17 ? 
SA N N 18 ? 
TA N N 19 ? 
UA N N 20 ? 
VA N N 17 ? 
WA N N 17 ? 
XA N N 17 ? 
YA N N 20 ? 
ZA N N 17 ? 
AB N N 17 ? 
BB N N 17 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1  UNP NQO1_THET8   Q56222 ? 1  
;MTGPILSGLDPRFERTLYAHVGKEGSWTLDYYLRHGGYETAKRVLKEKTPDEVIEEVKRSGLRGRGGAGFPTGLKWSFMP
KDDGKQHYLICNADESEPGSFKDRYILEDVPHLLIEGMILAGYAIRATVGYIYVRGEYRRAADRLEQAIKEARARGYLGK
NLFGTDFSFDLHVHRGAGAYICGEETALMNSLEGLRANPRLKPPFPAQSGLWGKPTTINNVETLASVVPIMERGADWFAQ
MGTEQSKGMKLYQISGPVKRPGVYELPMGTTFRELIYEWAGGPLEPIQAIIPGGSSTPPLPFTEEVLDTPMSYEHLQAKG
SMLGTGGVILIPERVSMVDAMWNLTRFYAHESCGKCTPCREGVAGFMVNLFAKIGTGQGEEKDVENLEALLPLIEGRSFC
PLADAAVWPVKGSLRHFKDQYLALAREKRPVPRPSLWR
;
1 
2  UNP NQO2_THET8   Q56221 ? 2  
;MGFFDDKQDFLEETFAKYPPEGRRAAIMPLLRRVQQEEGWIRPERIEEIARLVGTTPTEVMGVASFYSYYQFVPTGKYHL
QVCATLSCKLAGAEELWDYLTETLGIGPGEVTPDGLFSVQKVECLGSCHTAPVIQVNDEPYVECVTRARLEALLAGLRAG
KRLEEIELPGKCGHHVHEVEV
;
1 
3  UNP NQO3_THET8   Q56223 ? 3  
;MVRVKVNDRIVEVPPGTSVMDAVFHAGYDVPLFCSEKHLSPIGACRMCLVRIGLPKKGPDGKPLLNEKGEPEIQWQPKLA
ASCVTAVADGMVVDTLSDVVREAQAGMVEFTLLNHPLDCPTCDKGGACELQDRTVEYGLYEKYYQKGPLELPVYTRFEFT
RRHVDKHHPLSPFVILDRERCIHCKRCVRYFEEVPGDEVLDFIERGVHTFIGTMDFGLPSGFSGNITDICPVGALLDLTA
RFRARNWEMEETPTTCALCPVGCGITADTRSGELLRIRAREVPEVNEIWICDAGRFGHEWADQNRLKTPLVRKEGRLVEA
TWEEAFLALKEGLKEARGEEVGLYLAHDATLEEGLLASELAKALKTPHLDFQGRTAAPASLFPPASLEDLLQADFALVLG
DPTEEAPILHLRLSEFVRDLKPPHRYNHGTPFADLQIKERMPRRTDKMALFAPYRAPLMKWAAIHEVHRPGEEREILLAL
LGDKEGSEMVAKAKEAWEKAKNPVLILGAGVLQDTVAAERARLLAERKGAKVLAMTPAANARGLEAMGVLPGAKGASWDE
PGALYAYYGFVPPEEALKGKRFVVMHLSHLHPLAERYAHVVLPAPTFYEKRGHLVNLEGRVLPLSPAPIENGEAEGALQV
LALLAEALGVRPPFRLHLEAQKALKARKVPEAMGRLSFRLKELRPKERKGAFYLRPTMWKAHQAVGKAQEAARAELWAHP
ETARAEALPEGAQVAVETPFGRVEARVVHREDVPKGHLYLSALGPAAGLRVEGRVLVPAGGEA
;
1 
4  UNP NQO4_THET8   Q56220 ? 4  
;MREEFLEEIPLDAPPEEAKELRTEVMTLNVGPQHPSTHGVLRLMVTLSGEEVLEVVPHIGYLHTGFEKTMEHRTYLQNIT
YTPRMDYLHSFAHDLAYALAVEKLLGAVVPPRAETIRVILNELSRLASHLVFLGTGLLDLGALTPFFYAFRERETILDLF
EWVTGQRFHHNYIRIGGVKEDLPEEFVPELKKLLEVLPHRIDEYEALFAESPIFYERARGVGVIPPEVAIDLGLTGGSLR
ASGVNYDVRKAYPYSGYETYTFDVPLGERGDVFDRMLVRIREMRESVKIIKQALERLEPGPVRDPNPQITPPPRHLLETS
MEAVIYHFKHYTEGFHPPKGEVYVPTESARGELGYYIVSDGGSMPYRVKVRAPSFVNLQSLPYACKGEQVPDMVAIIASL
DPVMGDVDR
;
1 
5  UNP NQO5_THET8   Q56219 ? 5  
;MRLERVLEEARAKGYPIEDNGLGNLWVVLPRERFKEEMAHYKAMGFNFLADIVGLDYLTYPDPRPERFAVVYELVSLPGW
KDGDGSRFFVRVYVPEEDPRLPTVTDLWGSANFLEREVYDLFGIVFEGHPDLRKILTPEDLEGHPLRKDYPLGETPTLFR
EGRYIIPAEFRAALTGKDPGLTFYKGGSRKGYRSLWADLKKAREVKG
;
1 
6  UNP NQO6_THET8   Q56218 ? 6  
;MALKDLFERDVQELEREGILFTTLEKLVAWGRSNSLWPATFGLACCAIEMMASTDARNDLARFGSEVFRASPRQADVMIV
AGRLSKKMAPVMRRVWEQMPDPKWVISMGACASSGGMFNNYAIVQNVDSVVPVDVYVPGCPPRPEALIYAVMQLQKKVRG
QAYNERGERLPPVAAWKRTRG
;
1 
7  UNP NQO9_THET8   Q56224 ? 7  
;MTLKALAQSLGITLKYLFSKPVTVPYPDAPVALKPRFHGRHVLTRHPNGLEKCIGCSLCAAACPAYAIYVEPAENDPENP
VSAGERYAKVYEINMLRCIFCGLCEEACPTGAIVLGYDFEMADYEYSDLVYGKEDMLVDVVGTKPQRREAKRTGKPVKVG
YVVPYVRPELEGFKAPTEGGKR
;
1 
8  UNP NQO15_THET8  Q5SKZ7 ? 8  
;MSASSERELYEAWVELLSWMREYAQAKGVRFEKEADFPDFIYRMERPYDLPTTIMTASLSDGLGEPFLLADVSPRHAKLK
RIGLRLPRAHIHLHAHYEPGKGLVTGKIPLTKERFFALADRAREALAFA
;
1 
9  UNP Q5SI52_THET8 Q5SI52 ? 9  
;MVRVGMRAAPRVSLEALKAALGGLKLSEAKVYLITDWQDKRDQARYALLLHTGKKDLLVPDAFGPAFPGGEEALSELVGL
LLAQGARRFYEAVVSPGEMTALLDLPPEELLKRVMAIANPTDPGIYLKRAA
;
1 
10 UNP NQO7_THET8   Q56217 ? 10 
;MAPIQEYVGTLIYVGVALFIGVAALLVGALLGPKKPGRAKLMPYESGNDPAGEVKRFPVHFYVVAMLFILFDVEVAFLWP
YAVSAGGLGLYGFLGVLAFTLLLFVGFLYEWWKGVMRWH
;
1 
11 UNP NQO10_THET8  Q56225 ? 11 
;MSLLEGLALFLLLLSGVLVVTLRNAIHAALALILNFLVLAGVYVALDARFLGFIQVIVYAGAIVVLFLFVIMLLFAAQGE
IGFDPLVRSRPLAALLALGVAGILAAGLWGLDLAFTQDLKGGLPQALGPLLYGDWLFVLLAVGFLLMAATVVAVALVEPG
KASRAKEAEKREEVAR
;
1 
12 UNP NQO11_THET8  Q56226 ? 12 
;MSYLLTSALLFALGVYGVLTRRTAILVFLSIELMLNAANLSLVGFARAYGLDGQVAALMVIAVAAAEVAVGLGLIVAIFR
HRESTAVDDLSELRG
;
1 
13 UNP NQO12_THET8  Q56227 ? 13 
;MALLGTILLPLLGFALLGLFGKRMREPLPGVLASGLVLASFLLGAGLLLSGGARFQAEWLPGIPFSLLLDNLSGFMLLIV
TGVGFLIHVYAIGYMGGDPGYSRFFAYFNLFIAMMLTLVLADSYPVMFIGWEGVGLASFLLIGFWYKNPQYADSARKAFI
VNRIGDLGFMLGMAILWALYGTLSISELKEAMEGPLKNPDLLALAGLLLFLGAVGKSAQIPLMVWLPDAMAGPTPVSALI
HAATMVTAGVYLIARSSFLYSVLPDVSYAIAVVGLLTAAYGALSAFGQTDIKKIVAYSTISQLGYMFLAAGVGAYWVALF
HVFTHAFFKALLFLASGSVIHALGGEQDVRKMGGLWKHLPQTRWHALIGALALGGLPLLSGFWSKDAILAATLTYPFGGV
GFYVGALLVAVLTAMYAMRWFVLVFLGEERGHHHPHEAPPVMLWPNHLLALGSVLAGYLALPHPLPNVLEPFLKPALAEV
EAHHLSLGAEWGLIALSAAVALLGLWAGFVFFQRKVFPAWYLAFEAASREAFYVDRAYNALIVNPLKALAEALFYGDRGL
LSGYFGLGGAARSLGQGLARLQTGYLRVYALLFVLGALLLLGVMRW
;
1 
14 UNP NQO13_THET8  Q56228 ? 14 
;MVVLAVLLPVVFGALLLLGLPRALGVLGAGLSFLLNLYLFLTHPGGVAHAFQAPLLPGAGVYWAFGLDGLSALFFLTIAL
TVFLGALVARVEGRFLGLALLMEGLLLGLFAARDLLVFYVFFEAALIPALLMLYLYGGEGRTRALYTFVLFTLVGSLPML
AAVLGARLLSGSPTFLLEDLLAHPLQEEAAFWVFLGFALAFAIKTPLFPLHAWLPPFHQENHPSGLADALGTLYKVGVFA
FFRFAIPLAPEGFAQAQGLLLFLAALSALYGAWVAFAAKDFKTLLAYAGLSHMGVAALGVFSGTPEGAMGGLYLLAASGV
YTGGLFLLAGRLYERTGTLEIGRYRGLAQSAPGLAALALILFLAMVGLPGLSGFPGEFLTLLGAYKASPWLAALAFLSVI
ASAAYALTAFQKTFWEEGGSGVKDLAGAEWGFALLSVLALLLMGVFPGYFARGLHPLAEAFAKLLGGGA
;
1 
15 UNP NQO14_THET8  Q56229 ? 15 
;MTLAILAVFSVALTLLGFVLPPQGVKRATLLGLALALASLLLTWGKPFAFGPYAVDGVSQVFTLLALLGALWTVGLVRSG
RFEFYLLVLYAALGMHLLASTRHLLLMLVALEALSLPLYALATWRRGQGLEAALKYFLLGALAAAFFLYGAALFYGATGS
LVLGAPGEGPLYALALGLLLVGLGFKAALAPFHFWTPDVYQGSPTPVVLFMATSVKAAAFAALLRVAAPPEALALLVALS
VVVGNLAALAQKEAKRLLAYSSIAHAGYMALALYTGNAQALGFYLLTYVLATGLAFAVLSQISPDRVPLEALRGLYRKDP
LLGLAFLVAMLSLLGLPPLAGFWGKYLAFAEAARAGAWGVLVLALVTSAVSAYYYLGLGLAVFARPEETPFRPGPPWARA
AVVAAGVLLLALGLLPGLVLPALAAGG
;
1 
16 UNP NQO8_THET8   Q60019 ? 16 
;MTWSYPVDPYWMVALKALLVVVGLLTAFAFMTLIERRLLARFQVRMGPNRVGPFGLLQPLADAIKSIFKEDIVVAQADRF
LFVLAPLISVVFALLAFGLIPFGPPGSFFGYQPWVINLDLGILYLFAVSELAVYGIFLSGWASGSKYSLLGSLRSSASLI
SYELGLGLALLAPVLLVGSLNLNDIVNWQKEHGWLFLYAFPAFLVYLIASMAEAARTPFDLPEAEQELVGGYHTEYSSIK
WALFQMAEYIHFITASALIPTLFLGGWTMPVLEVPYLWMFLKIAFFLFFFIWIRATWFRLRYDQLLRFGWGFLFPLALLW
FLVTALVVALDLPRTYLLYLSALSFLVLLGAVLYTPKPARKGGGA
;
1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1  6I1P 1 1 ? 438 ? Q56222 1 ? 438 ? 1 438 
2  2  6I1P 2 1 ? 181 ? Q56221 1 ? 181 ? 1 181 
3  3  6I1P 3 1 ? 783 ? Q56223 1 ? 783 ? 1 783 
4  4  6I1P 4 1 ? 409 ? Q56220 1 ? 409 ? 1 409 
5  5  6I1P 5 1 ? 207 ? Q56219 1 ? 207 ? 1 207 
6  6  6I1P 6 1 ? 181 ? Q56218 1 ? 181 ? 1 181 
7  7  6I1P 9 1 ? 182 ? Q56224 1 ? 182 ? 1 182 
8  8  6I1P 7 1 ? 129 ? Q5SKZ7 1 ? 129 ? 1 129 
9  9  6I1P W 1 ? 131 ? Q5SI52 1 ? 131 ? 1 131 
10 10 6I1P A 1 ? 119 ? Q56217 1 ? 119 ? 1 119 
11 11 6I1P J 1 ? 176 ? Q56225 1 ? 176 ? 1 176 
12 12 6I1P K 1 ? 95  ? Q56226 1 ? 95  ? 1 95  
13 13 6I1P L 1 ? 606 ? Q56227 1 ? 606 ? 1 606 
14 14 6I1P M 1 ? 469 ? Q56228 1 ? 469 ? 1 469 
15 15 6I1P N 1 ? 427 ? Q56229 1 ? 427 ? 1 427 
16 16 6I1P H 1 ? 365 ? Q60019 1 ? 365 ? 1 365 
17 1  6I1P B 1 ? 438 ? Q56222 1 ? 438 ? 1 438 
18 2  6I1P C 1 ? 181 ? Q56221 1 ? 181 ? 1 181 
19 3  6I1P D 1 ? 783 ? Q56223 1 ? 783 ? 1 783 
20 4  6I1P E 1 ? 409 ? Q56220 1 ? 409 ? 1 409 
21 5  6I1P F 1 ? 207 ? Q56219 1 ? 207 ? 1 207 
22 6  6I1P G 1 ? 181 ? Q56218 1 ? 181 ? 1 181 
23 7  6I1P O 1 ? 182 ? Q56224 1 ? 182 ? 1 182 
24 8  6I1P I 1 ? 129 ? Q5SKZ7 1 ? 129 ? 1 129 
25 9  6I1P X 1 ? 131 ? Q5SI52 1 ? 131 ? 1 131 
26 10 6I1P P 1 ? 119 ? Q56217 1 ? 119 ? 1 119 
27 11 6I1P R 1 ? 176 ? Q56225 1 ? 176 ? 1 176 
28 12 6I1P S 1 ? 95  ? Q56226 1 ? 95  ? 1 95  
29 13 6I1P T 1 ? 606 ? Q56227 1 ? 606 ? 1 606 
30 14 6I1P U 1 ? 469 ? Q56228 1 ? 469 ? 1 469 
31 15 6I1P V 1 ? 427 ? Q56229 1 ? 427 ? 1 427 
32 16 6I1P Q 1 ? 365 ? Q60019 1 ? 365 ? 1 365 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? hexadecameric 16 
2 author_defined_assembly ? hexadecameric 16 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,GA,HA,IA,JA,KA,LA,MA,NA,OA,PA,QA       
2 1 Q,R,S,T,U,V,W,X,Y,Z,AA,BA,CA,DA,EA,FA,RA,SA,TA,UA,VA,WA,XA,YA,ZA,AB,BB 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'gel filtration' 
_pdbx_struct_assembly_auth_evidence.details                ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 THR A  28  ? HIS A  35  ? THR 1 28  HIS 1 35  1 ? 8  
HELX_P HELX_P2   AA2 TYR A  38  ? LYS A  48  ? TYR 1 38  LYS 1 48  1 ? 11 
HELX_P HELX_P3   AA3 THR A  49  ? SER A  60  ? THR 1 49  SER 1 60  1 ? 12 
HELX_P HELX_P4   AA4 PRO A  71  ? PHE A  78  ? PRO 1 71  PHE 1 78  1 ? 8  
HELX_P HELX_P5   AA5 PHE A  101 ? VAL A  110 ? PHE 1 101 VAL 1 110 1 ? 10 
HELX_P HELX_P6   AA6 VAL A  110 ? ARG A  126 ? VAL 1 110 ARG 1 126 1 ? 17 
HELX_P HELX_P7   AA7 ARG A  139 ? ARG A  155 ? ARG 1 139 ARG 1 155 1 ? 17 
HELX_P HELX_P8   AA8 ALA A  179 ? GLY A  183 ? ALA 1 179 GLY 1 183 5 ? 5  
HELX_P HELX_P9   AA9 GLU A  184 ? GLY A  194 ? GLU 1 184 GLY 1 194 1 ? 11 
HELX_P HELX_P10  AB1 GLY A  210 ? LYS A  214 ? GLY 1 210 LYS 1 214 5 ? 5  
HELX_P HELX_P11  AB2 VAL A  221 ? ARG A  233 ? VAL 1 221 ARG 1 233 1 ? 13 
HELX_P HELX_P12  AB3 ALA A  235 ? GLN A  240 ? ALA 1 235 GLN 1 240 1 ? 6  
HELX_P HELX_P13  AB4 THR A  271 ? TRP A  279 ? THR 1 271 TRP 1 279 1 ? 9  
HELX_P HELX_P14  AB5 THR A  303 ? ASP A  308 ? THR 1 303 ASP 1 308 1 ? 6  
HELX_P HELX_P15  AB6 LEU A  316 ? GLY A  320 ? LEU 1 316 GLY 1 320 5 ? 5  
HELX_P HELX_P16  AB7 SER A  336 ? GLU A  351 ? SER 1 336 GLU 1 351 1 ? 16 
HELX_P HELX_P17  AB8 CYS A  356 ? PHE A  366 ? CYS 1 356 PHE 1 366 1 ? 11 
HELX_P HELX_P18  AB9 PHE A  366 ? THR A  376 ? PHE 1 366 THR 1 376 1 ? 11 
HELX_P HELX_P19  AC1 GLU A  380 ? LEU A  391 ? GLU 1 380 LEU 1 391 1 ? 12 
HELX_P HELX_P20  AC2 LEU A  391 ? GLY A  396 ? LEU 1 391 GLY 1 396 1 ? 6  
HELX_P HELX_P21  AC3 PRO A  401 ? GLU A  427 ? PRO 1 401 GLU 1 427 1 ? 27 
HELX_P HELX_P22  AC4 LYS B  7   ? ALA B  16  ? LYS 2 7   ALA 2 16  1 ? 10 
HELX_P HELX_P23  AC5 GLY B  22  ? ALA B  25  ? GLY 2 22  ALA 2 25  5 ? 4  
HELX_P HELX_P24  AC6 ALA B  26  ? GLY B  39  ? ALA 2 26  GLY 2 39  1 ? 14 
HELX_P HELX_P25  AC7 ARG B  42  ? GLY B  54  ? ARG 2 42  GLY 2 54  1 ? 13 
HELX_P HELX_P26  AC8 THR B  56  ? SER B  65  ? THR 2 56  SER 2 65  1 ? 10 
HELX_P HELX_P27  AC9 THR B  85  ? ALA B  91  ? THR 2 85  ALA 2 91  1 ? 7  
HELX_P HELX_P28  AD1 GLY B  92  ? GLY B  105 ? GLY 2 92  GLY 2 105 1 ? 14 
HELX_P HELX_P29  AD2 THR B  146 ? ALA B  159 ? THR 2 146 ALA 2 159 1 ? 14 
HELX_P HELX_P30  AD3 SER C  18  ? ALA C  26  ? SER 3 18  ALA 3 26  1 ? 9  
HELX_P HELX_P31  AD4 SER C  97  ? LEU C  113 ? SER 3 97  LEU 3 113 1 ? 17 
HELX_P HELX_P32  AD5 ASP C  118 ? CYS C  122 ? ASP 3 118 CYS 3 122 5 ? 5  
HELX_P HELX_P33  AD6 CYS C  128 ? GLY C  138 ? CYS 3 128 GLY 3 138 1 ? 11 
HELX_P HELX_P34  AD7 LYS C  185 ? VAL C  194 ? LYS 3 185 VAL 3 194 1 ? 10 
HELX_P HELX_P35  AD8 GLY C  224 ? CYS C  230 ? GLY 3 224 CYS 3 230 1 ? 7  
HELX_P HELX_P36  AD9 THR C  239 ? ARG C  241 ? THR 3 239 ARG 3 241 5 ? 3  
HELX_P HELX_P37  AE1 CYS C  291 ? GLY C  297 ? CYS 3 291 GLY 3 297 1 ? 7  
HELX_P HELX_P38  AE2 THR C  321 ? LEU C  333 ? THR 3 321 LEU 3 333 1 ? 13 
HELX_P HELX_P39  AE3 THR C  350 ? LEU C  364 ? THR 3 350 LEU 3 364 1 ? 15 
HELX_P HELX_P40  AE4 SER C  386 ? ALA C  393 ? SER 3 386 ALA 3 393 1 ? 8  
HELX_P HELX_P41  AE5 ASP C  401 ? ALA C  406 ? ASP 3 401 ALA 3 406 1 ? 6  
HELX_P HELX_P42  AE6 PRO C  407 ? VAL C  417 ? PRO 3 407 VAL 3 417 1 ? 11 
HELX_P HELX_P43  AE7 ALA C  456 ? TRP C  461 ? ALA 3 456 TRP 3 461 5 ? 6  
HELX_P HELX_P44  AE8 GLU C  472 ? GLY C  482 ? GLU 3 472 GLY 3 482 1 ? 11 
HELX_P HELX_P45  AE9 SER C  487 ? ALA C  500 ? SER 3 487 ALA 3 500 1 ? 14 
HELX_P HELX_P46  AF1 GLY C  508 ? GLN C  513 ? GLY 3 508 GLN 3 513 1 ? 6  
HELX_P HELX_P47  AF2 ASP C  514 ? LYS C  528 ? ASP 3 514 LYS 3 528 1 ? 15 
HELX_P HELX_P48  AF3 ASN C  540 ? GLY C  548 ? ASN 3 540 GLY 3 548 1 ? 9  
HELX_P HELX_P49  AF4 PRO C  573 ? LYS C  578 ? PRO 3 573 LYS 3 578 1 ? 6  
HELX_P HELX_P50  AF5 HIS C  591 ? ALA C  598 ? HIS 3 591 ALA 3 598 1 ? 8  
HELX_P HELX_P51  AF6 GLY C  636 ? ALA C  647 ? GLY 3 636 ALA 3 647 1 ? 12 
HELX_P HELX_P52  AF7 LEU C  656 ? ARG C  667 ? LEU 3 656 ARG 3 667 1 ? 12 
HELX_P HELX_P53  AF8 LYS C  700 ? ALA C  704 ? LYS 3 700 ALA 3 704 5 ? 5  
HELX_P HELX_P54  AF9 HIS C  719 ? ALA C  727 ? HIS 3 719 ALA 3 727 1 ? 9  
HELX_P HELX_P55  AG1 GLY D  65  ? MET D  70  ? GLY 4 65  MET 4 70  1 ? 6  
HELX_P HELX_P56  AG2 GLU D  71  ? ARG D  73  ? GLU 4 71  ARG 4 73  5 ? 3  
HELX_P HELX_P57  AG3 THR D  74  ? ILE D  79  ? THR 4 74  ILE 4 79  1 ? 6  
HELX_P HELX_P58  AG4 SER D  90  ? GLY D  106 ? SER 4 90  GLY 4 106 1 ? 17 
HELX_P HELX_P59  AG5 PRO D  110 ? LEU D  140 ? PRO 4 110 LEU 4 140 1 ? 31 
HELX_P HELX_P60  AG6 THR D  144 ? THR D  164 ? THR 4 144 THR 4 164 1 ? 21 
HELX_P HELX_P61  AG7 GLU D  185 ? GLU D  210 ? GLU 4 185 GLU 4 210 1 ? 26 
HELX_P HELX_P62  AG8 PHE D  214 ? ARG D  219 ? PHE 4 214 ARG 4 219 1 ? 6  
HELX_P HELX_P63  AG9 PRO D  225 ? LEU D  232 ? PRO 4 225 LEU 4 232 1 ? 8  
HELX_P HELX_P64  AH1 LEU D  239 ? GLY D  243 ? LEU 4 239 GLY 4 243 5 ? 5  
HELX_P HELX_P65  AH2 ASP D  247 ? TYR D  252 ? ASP 4 247 TYR 4 252 1 ? 6  
HELX_P HELX_P66  AH3 GLY D  256 ? TYR D  260 ? GLY 4 256 TYR 4 260 5 ? 5  
HELX_P HELX_P67  AH4 ASP D  271 ? ARG D  296 ? ASP 4 271 ARG 4 296 1 ? 26 
HELX_P HELX_P68  AH5 PRO D  313 ? GLU D  318 ? PRO 4 313 GLU 4 318 5 ? 6  
HELX_P HELX_P69  AH6 SER D  320 ? GLU D  333 ? SER 4 320 GLU 4 333 1 ? 14 
HELX_P HELX_P70  AH7 ALA D  372 ? ASN D  377 ? ALA 4 372 ASN 4 377 1 ? 6  
HELX_P HELX_P71  AH8 SER D  380 ? CYS D  385 ? SER 4 380 CYS 4 385 1 ? 6  
HELX_P HELX_P72  AH9 PRO D  391 ? LEU D  400 ? PRO 4 391 LEU 4 400 1 ? 10 
HELX_P HELX_P73  AI1 VAL D  403 ? ASP D  408 ? VAL 4 403 ASP 4 408 1 ? 6  
HELX_P HELX_P74  AI2 ARG E  2   ? ALA E  12  ? ARG 5 2   ALA 5 12  1 ? 11 
HELX_P HELX_P75  AI3 PRO E  30  ? MET E  44  ? PRO 5 30  MET 5 44  1 ? 15 
HELX_P HELX_P76  AI4 SER E  110 ? PHE E  122 ? SER 5 110 PHE 5 122 1 ? 13 
HELX_P HELX_P77  AI5 ILE E  166 ? PHE E  170 ? ILE 5 166 PHE 5 170 5 ? 5  
HELX_P HELX_P78  AI6 GLY E  186 ? GLY E  191 ? GLY 5 186 GLY 5 191 5 ? 6  
HELX_P HELX_P79  AI7 PHE F  21  ? SER F  35  ? PHE 6 21  SER 6 35  1 ? 15 
HELX_P HELX_P80  AI8 ALA F  44  ? ALA F  52  ? ALA 6 44  ALA 6 52  1 ? 9  
HELX_P HELX_P81  AI9 SER F  53  ? ASP F  55  ? SER 6 53  ASP 6 55  5 ? 3  
HELX_P HELX_P82  AJ1 SER F  71  ? ALA F  75  ? SER 6 71  ALA 6 75  5 ? 5  
HELX_P HELX_P83  AJ2 SER F  85  ? LYS F  87  ? SER 6 85  LYS 6 87  5 ? 3  
HELX_P HELX_P84  AJ3 MET F  88  ? GLN F  98  ? MET 6 88  GLN 6 98  1 ? 11 
HELX_P HELX_P85  AJ4 GLY F  109 ? SER F  114 ? GLY 6 109 SER 6 114 1 ? 6  
HELX_P HELX_P86  AJ5 ASN F  126 ? VAL F  130 ? ASN 6 126 VAL 6 130 5 ? 5  
HELX_P HELX_P87  AJ6 ARG F  143 ? ARG F  159 ? ARG 6 143 ARG 6 159 1 ? 17 
HELX_P HELX_P88  AJ7 LEU G  3   ? SER G  19  ? LEU 9 3   SER 9 19  1 ? 17 
HELX_P HELX_P89  AJ8 SER G  57  ? ALA G  62  ? SER 9 57  ALA 9 62  1 ? 6  
HELX_P HELX_P90  AJ9 GLY G  102 ? CYS G  108 ? GLY 9 102 CYS 9 108 1 ? 7  
HELX_P HELX_P91  AK1 GLU G  125 ? ASP G  128 ? GLU 9 125 ASP 9 128 5 ? 4  
HELX_P HELX_P92  AK2 GLY G  132 ? MET G  136 ? GLY 9 132 MET 9 136 5 ? 5  
HELX_P HELX_P93  AK3 THR G  143 ? GLY G  154 ? THR 9 143 GLY 9 154 1 ? 12 
HELX_P HELX_P94  AK4 ARG G  167 ? GLU G  171 ? ARG 9 167 GLU 9 171 5 ? 5  
HELX_P HELX_P95  AK5 SER H  4   ? GLY H  28  ? SER 7 4   GLY 7 28  1 ? 25 
HELX_P HELX_P96  AK6 PHE H  37  ? TYR H  42  ? PHE 7 37  TYR 7 42  1 ? 6  
HELX_P HELX_P97  AK7 THR H  111 ? LEU H  126 ? THR 7 111 LEU 7 126 1 ? 16 
HELX_P HELX_P98  AK8 ALA I  9   ? GLY I  22  ? ALA W 9   GLY W 22  1 ? 14 
HELX_P HELX_P99  AK9 GLY I  69  ? GLN I  84  ? GLY W 69  GLN W 84  1 ? 16 
HELX_P HELX_P100 AL1 SER I  95  ? LEU I  102 ? SER W 95  LEU W 102 1 ? 8  
HELX_P HELX_P101 AL2 PRO I  106 ? ALA I  118 ? PRO W 106 ALA W 118 1 ? 13 
HELX_P HELX_P102 AL3 ASP I  122 ? TYR I  126 ? ASP W 122 TYR W 126 5 ? 5  
HELX_P HELX_P103 AL4 ILE J  4   ? LEU J  31  ? ILE A 4   LEU A 31  1 ? 28 
HELX_P HELX_P104 AL5 GLY J  37  ? MET J  42  ? GLY A 37  MET A 42  1 ? 6  
HELX_P HELX_P105 AL6 VAL J  59  ? SER J  84  ? VAL A 59  SER A 84  1 ? 26 
HELX_P HELX_P106 AL7 LEU J  88  ? GLY J  114 ? LEU A 88  GLY A 114 1 ? 27 
HELX_P HELX_P107 AL8 SER K  2   ? LEU K  22  ? SER J 2   LEU J 22  1 ? 21 
HELX_P HELX_P108 AL9 ASN K  24  ? LEU K  46  ? ASN J 24  LEU J 46  1 ? 23 
HELX_P HELX_P109 AM1 ALA K  48  ? VAL K  58  ? ALA J 48  VAL J 58  1 ? 11 
HELX_P HELX_P110 AM2 ALA K  62  ? LEU K  74  ? ALA J 62  LEU J 74  1 ? 13 
HELX_P HELX_P111 AM3 ARG K  88  ? TRP K  109 ? ARG J 88  TRP J 109 1 ? 22 
HELX_P HELX_P112 AM4 LEU K  123 ? TYR K  132 ? LEU J 123 TYR J 132 1 ? 10 
HELX_P HELX_P113 AM5 TRP K  135 ? GLU K  158 ? TRP J 135 GLU J 158 1 ? 24 
HELX_P HELX_P114 AM6 SER L  2   ? ARG L  21  ? SER K 2   ARG K 21  1 ? 20 
HELX_P HELX_P115 AM7 THR L  23  ? GLY L  50  ? THR K 23  GLY K 50  1 ? 28 
HELX_P HELX_P116 AM8 LEU L  51  ? PHE L  79  ? LEU K 51  PHE K 79  1 ? 29 
HELX_P HELX_P117 AM9 ALA L  86  ? LEU L  90  ? ALA K 86  LEU K 90  5 ? 5  
HELX_P HELX_P118 AN1 LEU M  4   ? PHE M  20  ? LEU L 4   PHE L 20  1 ? 17 
HELX_P HELX_P119 AN2 PRO M  27  ? SER M  50  ? PRO L 27  SER L 50  1 ? 24 
HELX_P HELX_P120 AN3 ASP M  70  ? MET M  95  ? ASP L 70  MET L 95  1 ? 26 
HELX_P HELX_P121 AN4 GLY M  100 ? LEU M  120 ? GLY L 100 LEU L 120 1 ? 21 
HELX_P HELX_P122 AN5 SER M  123 ? GLY M  143 ? SER L 123 GLY L 143 1 ? 21 
HELX_P HELX_P123 AN6 PRO M  149 ? LEU M  179 ? PRO L 149 LEU L 179 1 ? 31 
HELX_P HELX_P124 AN7 SER M  184 ? GLU M  193 ? SER L 184 GLU L 193 1 ? 10 
HELX_P HELX_P125 AN8 ASN M  198 ? ALA M  218 ? ASN L 198 ALA L 218 1 ? 21 
HELX_P HELX_P126 AN9 PRO M  221 ? GLY M  232 ? PRO L 221 GLY L 232 5 ? 12 
HELX_P HELX_P127 AO1 PRO M  233 ? ALA M  242 ? PRO L 233 ALA L 242 1 ? 10 
HELX_P HELX_P128 AO2 VAL M  246 ? SER M  256 ? VAL L 246 SER L 256 1 ? 11 
HELX_P HELX_P129 AO3 SER M  256 ? SER M  261 ? SER L 256 SER L 261 1 ? 6  
HELX_P HELX_P130 AO4 LEU M  263 ? PHE M  286 ? LEU L 263 PHE L 286 1 ? 24 
HELX_P HELX_P131 AO5 ASP M  290 ? VAL M  312 ? ASP L 290 VAL L 312 1 ? 23 
HELX_P HELX_P132 AO6 ALA M  314 ? LEU M  343 ? ALA L 314 LEU L 343 1 ? 30 
HELX_P HELX_P133 AO7 GLN M  361 ? GLY M  375 ? GLN L 361 GLY L 375 1 ? 15 
HELX_P HELX_P134 AO8 LEU M  379 ? TYR M  395 ? LEU L 379 TYR L 395 1 ? 17 
HELX_P HELX_P135 AO9 GLY M  399 ? LEU M  426 ? GLY L 399 LEU L 426 1 ? 28 
HELX_P HELX_P136 AP1 PRO M  439 ? GLY M  457 ? PRO L 439 GLY L 457 1 ? 19 
HELX_P HELX_P137 AP2 TYR M  458 ? ALA M  460 ? TYR L 458 ALA L 460 5 ? 3  
HELX_P HELX_P138 AP3 VAL M  468 ? LEU M  477 ? VAL L 468 LEU L 477 1 ? 10 
HELX_P HELX_P139 AP4 GLY M  488 ? LYS M  515 ? GLY L 488 LYS L 515 1 ? 28 
HELX_P HELX_P140 AP5 PRO M  518 ? GLU M  530 ? PRO L 518 GLU L 530 1 ? 13 
HELX_P HELX_P141 AP6 TYR M  533 ? ILE M  542 ? TYR L 533 ILE L 542 1 ? 10 
HELX_P HELX_P142 AP7 ILE M  542 ? ARG M  580 ? ILE L 542 ARG L 580 1 ? 39 
HELX_P HELX_P143 AP8 TYR M  585 ? MET M  604 ? TYR L 585 MET L 604 1 ? 20 
HELX_P HELX_P144 AP9 VAL N  2   ? LEU N  18  ? VAL M 2   LEU M 18  1 ? 17 
HELX_P HELX_P145 AQ1 ARG N  22  ? LEU N  41  ? ARG M 22  LEU M 41  1 ? 20 
HELX_P HELX_P146 AQ2 GLY N  45  ? ALA N  50  ? GLY M 45  ALA M 50  5 ? 6  
HELX_P HELX_P147 AQ3 ASP N  68  ? ALA N  89  ? ASP M 68  ALA M 89  1 ? 22 
HELX_P HELX_P148 AQ4 PHE N  95  ? ALA N  112 ? PHE M 95  ALA M 112 1 ? 18 
HELX_P HELX_P149 AQ5 ASP N  114 ? ALA N  125 ? ASP M 114 ALA M 125 1 ? 12 
HELX_P HELX_P150 AQ6 ALA N  125 ? LEU N  135 ? ALA M 125 LEU M 135 1 ? 11 
HELX_P HELX_P151 AQ7 GLY N  140 ? LEU N  169 ? GLY M 140 LEU M 169 1 ? 30 
HELX_P HELX_P152 AQ8 LEU N  176 ? HIS N  183 ? LEU M 176 HIS M 183 1 ? 8  
HELX_P HELX_P153 AQ9 ALA N  189 ? ILE N  203 ? ALA M 189 ILE M 203 1 ? 15 
HELX_P HELX_P154 AR1 TRP N  213 ? GLU N  220 ? TRP M 213 GLU M 220 1 ? 8  
HELX_P HELX_P155 AR2 GLY N  225 ? TYR N  234 ? GLY M 225 TYR M 234 1 ? 10 
HELX_P HELX_P156 AR3 VAL N  236 ? PHE N  244 ? VAL M 236 PHE M 244 1 ? 9  
HELX_P HELX_P157 AR4 PHE N  244 ? ALA N  249 ? PHE M 244 ALA M 249 1 ? 6  
HELX_P HELX_P158 AR5 ALA N  249 ? ALA N  278 ? ALA M 249 ALA M 278 1 ? 30 
HELX_P HELX_P159 AR6 ASP N  280 ? SER N  302 ? ASP M 280 SER M 302 1 ? 23 
HELX_P HELX_P160 AR7 THR N  304 ? GLY N  337 ? THR M 304 GLY M 337 1 ? 34 
HELX_P HELX_P161 AR8 GLY N  346 ? ALA N  351 ? GLY M 346 ALA M 351 1 ? 6  
HELX_P HELX_P162 AR9 GLY N  353 ? VAL N  366 ? GLY M 353 VAL M 366 1 ? 14 
HELX_P HELX_P163 AS1 SER N  372 ? SER N  388 ? SER M 372 SER M 388 1 ? 17 
HELX_P HELX_P164 AS2 SER N  388 ? PHE N  396 ? SER M 388 PHE M 396 1 ? 9  
HELX_P HELX_P165 AS3 SER N  398 ? TRP N  415 ? SER M 398 TRP M 415 1 ? 18 
HELX_P HELX_P166 AS4 ALA N  426 ? PHE N  446 ? ALA M 426 PHE M 446 1 ? 21 
HELX_P HELX_P167 AS5 GLY N  453 ? LEU N  464 ? GLY M 453 LEU M 464 1 ? 12 
HELX_P HELX_P168 AS6 THR O  2   ? GLY O  17  ? THR N 2   GLY N 17  1 ? 16 
HELX_P HELX_P169 AS7 PRO O  21  ? THR O  43  ? PRO N 21  THR N 43  1 ? 23 
HELX_P HELX_P170 AS8 ASP O  56  ? VAL O  77  ? ASP N 56  VAL N 77  1 ? 22 
HELX_P HELX_P171 AS9 PHE O  82  ? SER O  100 ? PHE N 82  SER N 100 1 ? 19 
HELX_P HELX_P172 AT1 HIS O  103 ? ALA O  122 ? HIS N 103 ALA N 122 1 ? 20 
HELX_P HELX_P173 AT2 ARG O  126 ? THR O  158 ? ARG N 126 THR N 158 1 ? 33 
HELX_P HELX_P174 AT3 GLY O  169 ? ALA O  187 ? GLY N 169 ALA N 187 1 ? 19 
HELX_P HELX_P175 AT4 PHE O  194 ? SER O  203 ? PHE N 194 SER N 203 1 ? 10 
HELX_P HELX_P176 AT5 PRO O  204 ? LEU O  224 ? PRO N 204 LEU N 224 1 ? 21 
HELX_P HELX_P177 AT6 PRO O  229 ? ALA O  250 ? PRO N 229 ALA N 250 1 ? 22 
HELX_P HELX_P178 AT7 GLU O  253 ? ALA O  270 ? GLU N 253 ALA N 270 1 ? 18 
HELX_P HELX_P179 AT8 GLN O  279 ? SER O  303 ? GLN N 279 SER N 303 1 ? 25 
HELX_P HELX_P180 AT9 PRO O  308 ? ARG O  313 ? PRO N 308 ARG N 313 5 ? 6  
HELX_P HELX_P181 AU1 GLY O  314 ? ASP O  319 ? GLY N 314 ASP N 319 1 ? 6  
HELX_P HELX_P182 AU2 ASP O  319 ? GLY O  335 ? ASP N 319 GLY N 335 1 ? 17 
HELX_P HELX_P183 AU3 LEU O  339 ? GLY O  356 ? LEU N 339 GLY N 356 1 ? 18 
HELX_P HELX_P184 AU4 TRP O  358 ? LEU O  380 ? TRP N 358 LEU N 380 1 ? 23 
HELX_P HELX_P185 AU5 ALA O  381 ? ALA O  384 ? ALA N 381 ALA N 384 5 ? 4  
HELX_P HELX_P186 AU6 PRO O  395 ? LEU O  415 ? PRO N 395 LEU N 415 1 ? 21 
HELX_P HELX_P187 AU7 VAL O  419 ? LEU O  423 ? VAL N 419 LEU N 423 5 ? 5  
HELX_P HELX_P188 AU8 PRO P  9   ? GLN P  43  ? PRO H 9   GLN H 43  1 ? 35 
HELX_P HELX_P189 AU9 LEU P  57  ? ILE P  67  ? LEU H 57  ILE H 67  1 ? 11 
HELX_P HELX_P190 AV1 ASP P  78  ? LEU P  95  ? ASP H 78  LEU H 95  1 ? 18 
HELX_P HELX_P191 AV2 LEU P  120 ? SER P  143 ? LEU H 120 SER H 143 1 ? 24 
HELX_P HELX_P192 AV3 SER P  145 ? GLY P  178 ? SER H 145 GLY H 178 1 ? 34 
HELX_P HELX_P193 AV4 ASN P  181 ? HIS P  192 ? ASN H 181 HIS H 192 1 ? 12 
HELX_P HELX_P194 AV5 LEU P  195 ? GLU P  213 ? LEU H 195 GLU H 213 1 ? 19 
HELX_P HELX_P195 AV6 ILE P  239 ? PHE P  263 ? ILE H 239 PHE H 263 1 ? 25 
HELX_P HELX_P196 AV7 TYR P  276 ? TRP P  297 ? TYR H 276 TRP H 297 1 ? 22 
HELX_P HELX_P197 AV8 TYR P  302 ? PHE P  312 ? TYR H 302 PHE H 312 1 ? 11 
HELX_P HELX_P198 AV9 PHE P  312 ? ASP P  331 ? PHE H 312 ASP H 331 1 ? 20 
HELX_P HELX_P199 AW1 ARG P  334 ? ALA P  351 ? ARG H 334 ALA H 351 1 ? 18 
HELX_P HELX_P200 AW2 THR Q  28  ? HIS Q  35  ? THR B 28  HIS B 35  1 ? 8  
HELX_P HELX_P201 AW3 TYR Q  38  ? LYS Q  48  ? TYR B 38  LYS B 48  1 ? 11 
HELX_P HELX_P202 AW4 THR Q  49  ? SER Q  60  ? THR B 49  SER B 60  1 ? 12 
HELX_P HELX_P203 AW5 PRO Q  71  ? PHE Q  78  ? PRO B 71  PHE B 78  1 ? 8  
HELX_P HELX_P204 AW6 PHE Q  101 ? VAL Q  110 ? PHE B 101 VAL B 110 1 ? 10 
HELX_P HELX_P205 AW7 VAL Q  110 ? ILE Q  125 ? VAL B 110 ILE B 125 1 ? 16 
HELX_P HELX_P206 AW8 TYR Q  138 ? ARG Q  155 ? TYR B 138 ARG B 155 1 ? 18 
HELX_P HELX_P207 AW9 ALA Q  179 ? GLY Q  183 ? ALA B 179 GLY B 183 5 ? 5  
HELX_P HELX_P208 AX1 GLU Q  184 ? GLY Q  194 ? GLU B 184 GLY B 194 1 ? 11 
HELX_P HELX_P209 AX2 GLY Q  210 ? LYS Q  214 ? GLY B 210 LYS B 214 5 ? 5  
HELX_P HELX_P210 AX3 VAL Q  221 ? ARG Q  233 ? VAL B 221 ARG B 233 1 ? 13 
HELX_P HELX_P211 AX4 ALA Q  235 ? GLN Q  240 ? ALA B 235 GLN B 240 1 ? 6  
HELX_P HELX_P212 AX5 THR Q  271 ? GLU Q  278 ? THR B 271 GLU B 278 1 ? 8  
HELX_P HELX_P213 AX6 THR Q  303 ? ASP Q  308 ? THR B 303 ASP B 308 1 ? 6  
HELX_P HELX_P214 AX7 LEU Q  316 ? GLY Q  320 ? LEU B 316 GLY B 320 5 ? 5  
HELX_P HELX_P215 AX8 SER Q  336 ? GLU Q  351 ? SER B 336 GLU B 351 1 ? 16 
HELX_P HELX_P216 AX9 CYS Q  356 ? PHE Q  366 ? CYS B 356 PHE B 366 1 ? 11 
HELX_P HELX_P217 AY1 PHE Q  366 ? THR Q  376 ? PHE B 366 THR B 376 1 ? 11 
HELX_P HELX_P218 AY2 GLU Q  380 ? LEU Q  391 ? GLU B 380 LEU B 391 1 ? 12 
HELX_P HELX_P219 AY3 LEU Q  391 ? GLY Q  396 ? LEU B 391 GLY B 396 1 ? 6  
HELX_P HELX_P220 AY4 PRO Q  401 ? LYS Q  428 ? PRO B 401 LYS B 428 1 ? 28 
HELX_P HELX_P221 AY5 LYS R  7   ? LYS R  17  ? LYS C 7   LYS C 17  1 ? 11 
HELX_P HELX_P222 AY6 GLY R  22  ? ALA R  25  ? GLY C 22  ALA C 25  5 ? 4  
HELX_P HELX_P223 AY7 ALA R  26  ? GLY R  39  ? ALA C 26  GLY C 39  1 ? 14 
HELX_P HELX_P224 AY8 ARG R  42  ? GLY R  54  ? ARG C 42  GLY C 54  1 ? 13 
HELX_P HELX_P225 AY9 THR R  56  ? SER R  65  ? THR C 56  SER C 65  1 ? 10 
HELX_P HELX_P226 AZ1 THR R  85  ? ALA R  91  ? THR C 85  ALA C 91  1 ? 7  
HELX_P HELX_P227 AZ2 GLY R  92  ? GLY R  105 ? GLY C 92  GLY C 105 1 ? 14 
HELX_P HELX_P228 AZ3 THR R  146 ? ALA R  159 ? THR C 146 ALA C 159 1 ? 14 
HELX_P HELX_P229 AZ4 SER S  18  ? GLY S  27  ? SER D 18  GLY D 27  1 ? 10 
HELX_P HELX_P230 AZ5 SER S  97  ? LEU S  113 ? SER D 97  LEU D 113 1 ? 17 
HELX_P HELX_P231 AZ6 ASP S  118 ? CYS S  122 ? ASP D 118 CYS D 122 5 ? 5  
HELX_P HELX_P232 AZ7 CYS S  128 ? GLY S  138 ? CYS D 128 GLY D 138 1 ? 11 
HELX_P HELX_P233 AZ8 LYS S  185 ? VAL S  194 ? LYS D 185 VAL D 194 1 ? 10 
HELX_P HELX_P234 AZ9 GLY S  224 ? CYS S  230 ? GLY D 224 CYS D 230 1 ? 7  
HELX_P HELX_P235 BA1 THR S  239 ? ARG S  241 ? THR D 239 ARG D 241 5 ? 3  
HELX_P HELX_P236 BA2 CYS S  291 ? GLY S  297 ? CYS D 291 GLY D 297 1 ? 7  
HELX_P HELX_P237 BA3 HIS S  298 ? GLN S  303 ? HIS D 298 GLN D 303 1 ? 6  
HELX_P HELX_P238 BA4 THR S  321 ? GLU S  335 ? THR D 321 GLU D 335 1 ? 15 
HELX_P HELX_P239 BA5 THR S  350 ? LEU S  364 ? THR D 350 LEU D 364 1 ? 15 
HELX_P HELX_P240 BA6 PRO S  378 ? PHE S  382 ? PRO D 378 PHE D 382 5 ? 5  
HELX_P HELX_P241 BA7 SER S  386 ? ALA S  393 ? SER D 386 ALA D 393 1 ? 8  
HELX_P HELX_P242 BA8 ASP S  401 ? ALA S  406 ? ASP D 401 ALA D 406 1 ? 6  
HELX_P HELX_P243 BA9 ALA S  406 ? VAL S  417 ? ALA D 406 VAL D 417 1 ? 12 
HELX_P HELX_P244 BB1 ALA S  456 ? TRP S  461 ? ALA D 456 TRP D 461 5 ? 6  
HELX_P HELX_P245 BB2 GLU S  472 ? GLY S  482 ? GLU D 472 GLY D 482 1 ? 11 
HELX_P HELX_P246 BB3 SER S  487 ? ALA S  500 ? SER D 487 ALA D 500 1 ? 14 
HELX_P HELX_P247 BB4 GLY S  508 ? GLN S  513 ? GLY D 508 GLN D 513 1 ? 6  
HELX_P HELX_P248 BB5 ASP S  514 ? LYS S  528 ? ASP D 514 LYS D 528 1 ? 15 
HELX_P HELX_P249 BB6 ASN S  540 ? MET S  547 ? ASN D 540 MET D 547 1 ? 8  
HELX_P HELX_P250 BB7 PRO S  573 ? LYS S  578 ? PRO D 573 LYS D 578 1 ? 6  
HELX_P HELX_P251 BB8 HIS S  591 ? ALA S  598 ? HIS D 591 ALA D 598 1 ? 8  
HELX_P HELX_P252 BB9 GLY S  636 ? ALA S  647 ? GLY D 636 ALA D 647 1 ? 12 
HELX_P HELX_P253 BC1 LEU S  656 ? ARG S  667 ? LEU D 656 ARG D 667 1 ? 12 
HELX_P HELX_P254 BC2 LYS S  700 ? ALA S  704 ? LYS D 700 ALA D 704 5 ? 5  
HELX_P HELX_P255 BC3 HIS S  719 ? ALA S  727 ? HIS D 719 ALA D 727 1 ? 9  
HELX_P HELX_P256 BC4 GLY T  65  ? MET T  70  ? GLY E 65  MET E 70  1 ? 6  
HELX_P HELX_P257 BC5 GLU T  71  ? ARG T  73  ? GLU E 71  ARG E 73  5 ? 3  
HELX_P HELX_P258 BC6 LEU T  76  ? TYR T  81  ? LEU E 76  TYR E 81  5 ? 6  
HELX_P HELX_P259 BC7 SER T  90  ? GLY T  106 ? SER E 90  GLY E 106 1 ? 17 
HELX_P HELX_P260 BC8 PRO T  110 ? LEU T  140 ? PRO E 110 LEU E 140 1 ? 31 
HELX_P HELX_P261 BC9 THR T  144 ? THR T  164 ? THR E 144 THR E 164 1 ? 21 
HELX_P HELX_P262 BD1 GLU T  185 ? ALA T  209 ? GLU E 185 ALA E 209 1 ? 25 
HELX_P HELX_P263 BD2 PHE T  214 ? ARG T  219 ? PHE E 214 ARG E 219 1 ? 6  
HELX_P HELX_P264 BD3 PRO T  225 ? LEU T  232 ? PRO E 225 LEU E 232 1 ? 8  
HELX_P HELX_P265 BD4 LEU T  239 ? GLY T  243 ? LEU E 239 GLY E 243 5 ? 5  
HELX_P HELX_P266 BD5 ASP T  247 ? TYR T  252 ? ASP E 247 TYR E 252 1 ? 6  
HELX_P HELX_P267 BD6 GLY T  256 ? TYR T  260 ? GLY E 256 TYR E 260 5 ? 5  
HELX_P HELX_P268 BD7 ASP T  271 ? ARG T  296 ? ASP E 271 ARG E 296 1 ? 26 
HELX_P HELX_P269 BD8 PRO T  313 ? THR T  319 ? PRO E 313 THR E 319 5 ? 7  
HELX_P HELX_P270 BD9 SER T  320 ? GLU T  333 ? SER E 320 GLU E 333 1 ? 14 
HELX_P HELX_P271 BE1 ALA T  372 ? LEU T  378 ? ALA E 372 LEU E 378 1 ? 7  
HELX_P HELX_P272 BE2 SER T  380 ? CYS T  385 ? SER E 380 CYS E 385 1 ? 6  
HELX_P HELX_P273 BE3 PRO T  391 ? SER T  399 ? PRO E 391 SER E 399 1 ? 9  
HELX_P HELX_P274 BE4 VAL T  403 ? ASP T  408 ? VAL E 403 ASP E 408 1 ? 6  
HELX_P HELX_P275 BE5 ARG U  2   ? GLY U  14  ? ARG F 2   GLY F 14  1 ? 13 
HELX_P HELX_P276 BE6 PRO U  30  ? MET U  44  ? PRO F 30  MET F 44  1 ? 15 
HELX_P HELX_P277 BE7 SER U  110 ? PHE U  122 ? SER F 110 PHE F 122 1 ? 13 
HELX_P HELX_P278 BE8 ILE U  166 ? ARG U  171 ? ILE F 166 ARG F 171 1 ? 6  
HELX_P HELX_P279 BE9 GLY U  186 ? GLY U  191 ? GLY F 186 GLY F 191 5 ? 6  
HELX_P HELX_P280 BF1 PHE V  21  ? SER V  35  ? PHE G 21  SER G 35  1 ? 15 
HELX_P HELX_P281 BF2 ALA V  44  ? ALA V  52  ? ALA G 44  ALA G 52  1 ? 9  
HELX_P HELX_P282 BF3 SER V  53  ? ASP V  55  ? SER G 53  ASP G 55  5 ? 3  
HELX_P HELX_P283 BF4 SER V  85  ? LYS V  87  ? SER G 85  LYS G 87  5 ? 3  
HELX_P HELX_P284 BF5 MET V  88  ? GLN V  98  ? MET G 88  GLN G 98  1 ? 11 
HELX_P HELX_P285 BF6 GLY V  109 ? SER V  114 ? GLY G 109 SER G 114 1 ? 6  
HELX_P HELX_P286 BF7 ASN V  126 ? VAL V  130 ? ASN G 126 VAL G 130 5 ? 5  
HELX_P HELX_P287 BF8 ARG V  143 ? VAL V  158 ? ARG G 143 VAL G 158 1 ? 16 
HELX_P HELX_P288 BF9 LEU W  3   ? PHE W  18  ? LEU O 3   PHE O 18  1 ? 16 
HELX_P HELX_P289 BG1 SER W  57  ? ALA W  62  ? SER O 57  ALA O 62  1 ? 6  
HELX_P HELX_P290 BG2 GLY W  102 ? CYS W  108 ? GLY O 102 CYS O 108 1 ? 7  
HELX_P HELX_P291 BG3 GLY W  132 ? MET W  136 ? GLY O 132 MET O 136 5 ? 5  
HELX_P HELX_P292 BG4 THR W  143 ? GLY W  154 ? THR O 143 GLY O 154 1 ? 12 
HELX_P HELX_P293 BG5 ARG W  167 ? GLU W  171 ? ARG O 167 GLU O 171 5 ? 5  
HELX_P HELX_P294 BG6 SER X  4   ? GLY X  28  ? SER I 4   GLY I 28  1 ? 25 
HELX_P HELX_P295 BG7 PHE X  37  ? TYR X  42  ? PHE I 37  TYR I 42  1 ? 6  
HELX_P HELX_P296 BG8 THR X  111 ? LEU X  126 ? THR I 111 LEU I 126 1 ? 16 
HELX_P HELX_P297 BG9 ALA Y  9   ? GLY Y  22  ? ALA X 9   GLY X 22  1 ? 14 
HELX_P HELX_P298 BH1 GLY Y  69  ? GLN Y  84  ? GLY X 69  GLN X 84  1 ? 16 
HELX_P HELX_P299 BH2 SER Y  95  ? LEU Y  102 ? SER X 95  LEU X 102 1 ? 8  
HELX_P HELX_P300 BH3 LEU Y  103 ? LEU Y  105 ? LEU X 103 LEU X 105 5 ? 3  
HELX_P HELX_P301 BH4 PRO Y  106 ? ILE Y  117 ? PRO X 106 ILE X 117 1 ? 12 
HELX_P HELX_P302 BH5 ASP Y  122 ? TYR Y  126 ? ASP X 122 TYR X 126 5 ? 5  
HELX_P HELX_P303 BH6 ILE Z  4   ? LEU Z  31  ? ILE P 4   LEU P 31  1 ? 28 
HELX_P HELX_P304 BH7 GLY Z  37  ? MET Z  42  ? GLY P 37  MET P 42  1 ? 6  
HELX_P HELX_P305 BH8 VAL Z  59  ? SER Z  84  ? VAL P 59  SER P 84  1 ? 26 
HELX_P HELX_P306 BH9 LEU Z  88  ? GLY Z  114 ? LEU P 88  GLY P 114 1 ? 27 
HELX_P HELX_P307 BI1 SER AA 2   ? LEU AA 22  ? SER R 2   LEU R 22  1 ? 21 
HELX_P HELX_P308 BI2 ASN AA 24  ? LEU AA 46  ? ASN R 24  LEU R 46  1 ? 23 
HELX_P HELX_P309 BI3 ALA AA 48  ? VAL AA 58  ? ALA R 48  VAL R 58  1 ? 11 
HELX_P HELX_P310 BI4 ALA AA 62  ? LEU AA 74  ? ALA R 62  LEU R 74  1 ? 13 
HELX_P HELX_P311 BI5 ARG AA 88  ? TRP AA 109 ? ARG R 88  TRP R 109 1 ? 22 
HELX_P HELX_P312 BI6 LEU AA 123 ? TYR AA 132 ? LEU R 123 TYR R 132 1 ? 10 
HELX_P HELX_P313 BI7 TRP AA 135 ? GLU AA 158 ? TRP R 135 GLU R 158 1 ? 24 
HELX_P HELX_P314 BI8 SER BA 2   ? ARG BA 21  ? SER S 2   ARG S 21  1 ? 20 
HELX_P HELX_P315 BI9 THR BA 23  ? GLY BA 50  ? THR S 23  GLY S 50  1 ? 28 
HELX_P HELX_P316 BJ1 LEU BA 51  ? ARG BA 80  ? LEU S 51  ARG S 80  1 ? 30 
HELX_P HELX_P317 BJ2 ALA BA 86  ? LEU BA 90  ? ALA S 86  LEU S 90  5 ? 5  
HELX_P HELX_P318 BJ3 ALA CA 2   ? PHE CA 20  ? ALA T 2   PHE T 20  1 ? 19 
HELX_P HELX_P319 BJ4 PRO CA 27  ? SER CA 50  ? PRO T 27  SER T 50  1 ? 24 
HELX_P HELX_P320 BJ5 ASP CA 70  ? MET CA 95  ? ASP T 70  MET T 95  1 ? 26 
HELX_P HELX_P321 BJ6 GLY CA 100 ? LEU CA 120 ? GLY T 100 LEU T 120 1 ? 21 
HELX_P HELX_P322 BJ7 SER CA 123 ? GLY CA 143 ? SER T 123 GLY T 143 1 ? 21 
HELX_P HELX_P323 BJ8 PRO CA 149 ? LEU CA 179 ? PRO T 149 LEU T 179 1 ? 31 
HELX_P HELX_P324 BJ9 SER CA 184 ? GLU CA 193 ? SER T 184 GLU T 193 1 ? 10 
HELX_P HELX_P325 BK1 ASN CA 198 ? ALA CA 218 ? ASN T 198 ALA T 218 1 ? 21 
HELX_P HELX_P326 BK2 PRO CA 221 ? GLY CA 232 ? PRO T 221 GLY T 232 5 ? 12 
HELX_P HELX_P327 BK3 PRO CA 233 ? ALA CA 242 ? PRO T 233 ALA T 242 1 ? 10 
HELX_P HELX_P328 BK4 VAL CA 246 ? SER CA 256 ? VAL T 246 SER T 256 1 ? 11 
HELX_P HELX_P329 BK5 SER CA 256 ? VAL CA 262 ? SER T 256 VAL T 262 1 ? 7  
HELX_P HELX_P330 BK6 LEU CA 263 ? PHE CA 286 ? LEU T 263 PHE T 286 1 ? 24 
HELX_P HELX_P331 BK7 ASP CA 290 ? VAL CA 312 ? ASP T 290 VAL T 312 1 ? 23 
HELX_P HELX_P332 BK8 ALA CA 314 ? LEU CA 343 ? ALA T 314 LEU T 343 1 ? 30 
HELX_P HELX_P333 BK9 THR CA 362 ? GLY CA 375 ? THR T 362 GLY T 375 1 ? 14 
HELX_P HELX_P334 BL1 LEU CA 379 ? TYR CA 395 ? LEU T 379 TYR T 395 1 ? 17 
HELX_P HELX_P335 BL2 GLY CA 399 ? LEU CA 426 ? GLY T 399 LEU T 426 1 ? 28 
HELX_P HELX_P336 BL3 PRO CA 439 ? ALA CA 456 ? PRO T 439 ALA T 456 1 ? 18 
HELX_P HELX_P337 BL4 GLY CA 457 ? ALA CA 460 ? GLY T 457 ALA T 460 5 ? 4  
HELX_P HELX_P338 BL5 VAL CA 468 ? LYS CA 474 ? VAL T 468 LYS T 474 1 ? 7  
HELX_P HELX_P339 BL6 GLY CA 488 ? LYS CA 515 ? GLY T 488 LYS T 515 1 ? 28 
HELX_P HELX_P340 BL7 PRO CA 518 ? GLU CA 530 ? PRO T 518 GLU T 530 1 ? 13 
HELX_P HELX_P341 BL8 TYR CA 533 ? ILE CA 542 ? TYR T 533 ILE T 542 1 ? 10 
HELX_P HELX_P342 BL9 ILE CA 542 ? ARG CA 580 ? ILE T 542 ARG T 580 1 ? 39 
HELX_P HELX_P343 BM1 TYR CA 585 ? MET CA 604 ? TYR T 585 MET T 604 1 ? 20 
HELX_P HELX_P344 BM2 VAL DA 2   ? LEU DA 18  ? VAL U 2   LEU U 18  1 ? 17 
HELX_P HELX_P345 BM3 ALA DA 23  ? LEU DA 41  ? ALA U 23  LEU U 41  1 ? 19 
HELX_P HELX_P346 BM4 ASP DA 68  ? VAL DA 88  ? ASP U 68  VAL U 88  1 ? 21 
HELX_P HELX_P347 BM5 PHE DA 95  ? ALA DA 112 ? PHE U 95  ALA U 112 1 ? 18 
HELX_P HELX_P348 BM6 ASP DA 114 ? ALA DA 125 ? ASP U 114 ALA U 125 1 ? 12 
HELX_P HELX_P349 BM7 ALA DA 125 ? LEU DA 135 ? ALA U 125 LEU U 135 1 ? 11 
HELX_P HELX_P350 BM8 GLY DA 140 ? LEU DA 169 ? GLY U 140 LEU U 169 1 ? 30 
HELX_P HELX_P351 BM9 LEU DA 176 ? HIS DA 183 ? LEU U 176 HIS U 183 1 ? 8  
HELX_P HELX_P352 BN1 ALA DA 189 ? ILE DA 203 ? ALA U 189 ILE U 203 1 ? 15 
HELX_P HELX_P353 BN2 TRP DA 213 ? GLU DA 220 ? TRP U 213 GLU U 220 1 ? 8  
HELX_P HELX_P354 BN3 GLY DA 225 ? TYR DA 234 ? GLY U 225 TYR U 234 1 ? 10 
HELX_P HELX_P355 BN4 VAL DA 236 ? PHE DA 244 ? VAL U 236 PHE U 244 1 ? 9  
HELX_P HELX_P356 BN5 PHE DA 244 ? ALA DA 249 ? PHE U 244 ALA U 249 1 ? 6  
HELX_P HELX_P357 BN6 ALA DA 249 ? ALA DA 278 ? ALA U 249 ALA U 278 1 ? 30 
HELX_P HELX_P358 BN7 ASP DA 280 ? SER DA 302 ? ASP U 280 SER U 302 1 ? 23 
HELX_P HELX_P359 BN8 THR DA 304 ? GLY DA 337 ? THR U 304 GLY U 337 1 ? 34 
HELX_P HELX_P360 BN9 GLY DA 346 ? ALA DA 351 ? GLY U 346 ALA U 351 1 ? 6  
HELX_P HELX_P361 BO1 GLY DA 353 ? VAL DA 366 ? GLY U 353 VAL U 366 1 ? 14 
HELX_P HELX_P362 BO2 SER DA 372 ? SER DA 388 ? SER U 372 SER U 388 1 ? 17 
HELX_P HELX_P363 BO3 SER DA 388 ? PHE DA 396 ? SER U 388 PHE U 396 1 ? 9  
HELX_P HELX_P364 BO4 SER DA 398 ? PHE DA 414 ? SER U 398 PHE U 414 1 ? 17 
HELX_P HELX_P365 BO5 ALA DA 426 ? PHE DA 446 ? ALA U 426 PHE U 446 1 ? 21 
HELX_P HELX_P366 BO6 GLY DA 453 ? LEU DA 464 ? GLY U 453 LEU U 464 1 ? 12 
HELX_P HELX_P367 BO7 THR EA 2   ? GLY EA 17  ? THR V 2   GLY V 17  1 ? 16 
HELX_P HELX_P368 BO8 PRO EA 21  ? THR EA 43  ? PRO V 21  THR V 43  1 ? 23 
HELX_P HELX_P369 BO9 ASP EA 56  ? VAL EA 77  ? ASP V 56  VAL V 77  1 ? 22 
HELX_P HELX_P370 BP1 PHE EA 82  ? SER EA 100 ? PHE V 82  SER V 100 1 ? 19 
HELX_P HELX_P371 BP2 HIS EA 103 ? ALA EA 122 ? HIS V 103 ALA V 122 1 ? 20 
HELX_P HELX_P372 BP3 ARG EA 126 ? THR EA 158 ? ARG V 126 THR V 158 1 ? 33 
HELX_P HELX_P373 BP4 GLY EA 169 ? ALA EA 187 ? GLY V 169 ALA V 187 1 ? 19 
HELX_P HELX_P374 BP5 PHE EA 194 ? SER EA 203 ? PHE V 194 SER V 203 1 ? 10 
HELX_P HELX_P375 BP6 PRO EA 204 ? VAL EA 226 ? PRO V 204 VAL V 226 1 ? 23 
HELX_P HELX_P376 BP7 PRO EA 229 ? ALA EA 250 ? PRO V 229 ALA V 250 1 ? 22 
HELX_P HELX_P377 BP8 GLU EA 253 ? ALA EA 270 ? GLU V 253 ALA V 270 1 ? 18 
HELX_P HELX_P378 BP9 GLN EA 279 ? SER EA 303 ? GLN V 279 SER V 303 1 ? 25 
HELX_P HELX_P379 BQ1 LEU EA 309 ? ARG EA 313 ? LEU V 309 ARG V 313 5 ? 5  
HELX_P HELX_P380 BQ2 GLY EA 314 ? ASP EA 319 ? GLY V 314 ASP V 319 1 ? 6  
HELX_P HELX_P381 BQ3 ASP EA 319 ? GLY EA 335 ? ASP V 319 GLY V 335 1 ? 17 
HELX_P HELX_P382 BQ4 LEU EA 339 ? GLY EA 356 ? LEU V 339 GLY V 356 1 ? 18 
HELX_P HELX_P383 BQ5 TRP EA 358 ? LEU EA 380 ? TRP V 358 LEU V 380 1 ? 23 
HELX_P HELX_P384 BQ6 ALA EA 381 ? ALA EA 384 ? ALA V 381 ALA V 384 5 ? 4  
HELX_P HELX_P385 BQ7 PRO EA 395 ? LEU EA 415 ? PRO V 395 LEU V 415 1 ? 21 
HELX_P HELX_P386 BQ8 PRO EA 416 ? LEU EA 423 ? PRO V 416 LEU V 423 5 ? 8  
HELX_P HELX_P387 BQ9 PRO FA 9   ? GLN FA 43  ? PRO Q 9   GLN Q 43  1 ? 35 
HELX_P HELX_P388 BR1 LEU FA 57  ? ILE FA 67  ? LEU Q 57  ILE Q 67  1 ? 11 
HELX_P HELX_P389 BR2 ASP FA 78  ? LEU FA 95  ? ASP Q 78  LEU Q 95  1 ? 18 
HELX_P HELX_P390 BR3 GLY FA 121 ? SER FA 143 ? GLY Q 121 SER Q 143 1 ? 23 
HELX_P HELX_P391 BR4 SER FA 145 ? GLY FA 178 ? SER Q 145 GLY Q 178 1 ? 34 
HELX_P HELX_P392 BR5 ASN FA 181 ? HIS FA 192 ? ASN Q 181 HIS Q 192 1 ? 12 
HELX_P HELX_P393 BR6 LEU FA 195 ? GLU FA 213 ? LEU Q 195 GLU Q 213 1 ? 19 
HELX_P HELX_P394 BR7 ILE FA 239 ? PHE FA 263 ? ILE Q 239 PHE Q 263 1 ? 25 
HELX_P HELX_P395 BR8 TYR FA 276 ? TRP FA 297 ? TYR Q 276 TRP Q 297 1 ? 22 
HELX_P HELX_P396 BR9 TYR FA 302 ? PHE FA 312 ? TYR Q 302 PHE Q 312 1 ? 11 
HELX_P HELX_P397 BS1 PHE FA 312 ? ASP FA 331 ? PHE Q 312 ASP Q 331 1 ? 20 
HELX_P HELX_P398 BS2 ARG FA 334 ? ALA FA 351 ? ARG Q 334 ALA Q 351 1 ? 18 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ? ? B CYS 144 SG  ? ? ? 1_555 B  CYS 172 SG  ? ? 2 CYS 144 2 CYS 172 1_555 ? ? ? ? ? ? ? 2.092 ? ? 
disulf2  disulf ? ? R CYS 144 SG  ? ? ? 1_555 R  CYS 172 SG  ? ? C CYS 144 C CYS 172 1_555 ? ? ? ? ? ? ? 2.085 ? ? 
metalc1  metalc ? ? A CYS 353 SG  ? ? ? 1_555 GA SF4 .   FE4 ? ? 1 CYS 353 1 SF4 501 1_555 ? ? ? ? ? ? ? 2.276 ? ? 
metalc2  metalc ? ? A CYS 356 SG  ? ? ? 1_555 GA SF4 .   FE1 ? ? 1 CYS 356 1 SF4 501 1_555 ? ? ? ? ? ? ? 2.302 ? ? 
metalc3  metalc ? ? A CYS 359 SG  ? ? ? 1_555 GA SF4 .   FE2 ? ? 1 CYS 359 1 SF4 501 1_555 ? ? ? ? ? ? ? 2.317 ? ? 
metalc4  metalc ? ? B CYS 83  SG  ? ? ? 1_555 JA FES .   FE1 ? ? 2 CYS 83  2 FES 201 1_555 ? ? ? ? ? ? ? 2.317 ? ? 
metalc5  metalc ? ? B CYS 88  SG  ? ? ? 1_555 JA FES .   FE1 ? ? 2 CYS 88  2 FES 201 1_555 ? ? ? ? ? ? ? 2.319 ? ? 
metalc6  metalc ? ? B CYS 124 SG  ? ? ? 1_555 JA FES .   FE2 ? ? 2 CYS 124 2 FES 201 1_555 ? ? ? ? ? ? ? 2.326 ? ? 
metalc7  metalc ? ? B CYS 128 SG  ? ? ? 1_555 JA FES .   FE2 ? ? 2 CYS 128 2 FES 201 1_555 ? ? ? ? ? ? ? 2.325 ? ? 
metalc8  metalc ? ? C CYS 34  SG  ? ? ? 1_555 NA FES .   FE1 ? ? 3 CYS 34  3 FES 804 1_555 ? ? ? ? ? ? ? 2.335 ? ? 
metalc9  metalc ? ? C CYS 45  SG  ? ? ? 1_555 NA FES .   FE1 ? ? 3 CYS 45  3 FES 804 1_555 ? ? ? ? ? ? ? 2.298 ? ? 
metalc10 metalc ? ? C CYS 48  SG  ? ? ? 1_555 NA FES .   FE2 ? ? 3 CYS 48  3 FES 804 1_555 ? ? ? ? ? ? ? 2.308 ? ? 
metalc11 metalc ? ? C CYS 83  SG  ? ? ? 1_555 NA FES .   FE2 ? ? 3 CYS 83  3 FES 804 1_555 ? ? ? ? ? ? ? 2.339 ? ? 
metalc12 metalc ? ? C HIS 115 NE2 ? ? ? 1_555 KA SF4 .   FE3 ? ? 3 HIS 115 3 SF4 801 1_555 ? ? ? ? ? ? ? 2.163 ? ? 
metalc13 metalc ? ? C CYS 119 SG  ? ? ? 1_555 KA SF4 .   FE2 ? ? 3 CYS 119 3 SF4 801 1_555 ? ? ? ? ? ? ? 2.293 ? ? 
metalc14 metalc ? ? C CYS 122 SG  ? ? ? 1_555 KA SF4 .   FE4 ? ? 3 CYS 122 3 SF4 801 1_555 ? ? ? ? ? ? ? 2.320 ? ? 
metalc15 metalc ? ? C CYS 128 SG  ? ? ? 1_555 KA SF4 .   FE1 ? ? 3 CYS 128 3 SF4 801 1_555 ? ? ? ? ? ? ? 2.342 ? ? 
metalc16 metalc ? ? C CYS 181 SG  ? ? ? 1_555 LA SF4 .   FE2 ? ? 3 CYS 181 3 SF4 802 1_555 ? ? ? ? ? ? ? 2.331 ? ? 
metalc17 metalc ? ? C CYS 184 SG  ? ? ? 1_555 LA SF4 .   FE1 ? ? 3 CYS 184 3 SF4 802 1_555 ? ? ? ? ? ? ? 2.352 ? ? 
metalc18 metalc ? ? C CYS 187 SG  ? ? ? 1_555 LA SF4 .   FE3 ? ? 3 CYS 187 3 SF4 802 1_555 ? ? ? ? ? ? ? 2.336 ? ? 
metalc19 metalc ? ? C CYS 230 SG  ? ? ? 1_555 LA SF4 .   FE4 ? ? 3 CYS 230 3 SF4 802 1_555 ? ? ? ? ? ? ? 2.350 ? ? 
metalc20 metalc ? ? C CYS 256 SG  ? ? ? 1_555 MA SF4 .   FE1 ? ? 3 CYS 256 3 SF4 803 1_555 ? ? ? ? ? ? ? 2.317 ? ? 
metalc21 metalc ? ? C CYS 259 SG  ? ? ? 1_555 MA SF4 .   FE4 ? ? 3 CYS 259 3 SF4 803 1_555 ? ? ? ? ? ? ? 2.295 ? ? 
metalc22 metalc ? ? C CYS 263 SG  ? ? ? 1_555 MA SF4 .   FE3 ? ? 3 CYS 263 3 SF4 803 1_555 ? ? ? ? ? ? ? 2.286 ? ? 
metalc23 metalc ? ? C CYS 291 SG  ? ? ? 1_555 MA SF4 .   FE2 ? ? 3 CYS 291 3 SF4 803 1_555 ? ? ? ? ? ? ? 2.318 ? ? 
metalc24 metalc ? ? F CYS 45  SG  ? ? ? 1_555 OA SF4 .   FE3 ? ? 6 CYS 45  6 SF4 201 1_555 ? ? ? ? ? ? ? 2.260 ? ? 
metalc25 metalc ? ? F CYS 46  SG  ? ? ? 1_555 OA SF4 .   FE2 ? ? 6 CYS 46  6 SF4 201 1_555 ? ? ? ? ? ? ? 2.306 ? ? 
metalc26 metalc ? ? F CYS 111 SG  ? ? ? 1_555 OA SF4 .   FE1 ? ? 6 CYS 111 6 SF4 201 1_555 ? ? ? ? ? ? ? 2.344 ? ? 
metalc27 metalc ? ? F CYS 140 SG  ? ? ? 1_555 OA SF4 .   FE4 ? ? 6 CYS 140 6 SF4 201 1_555 ? ? ? ? ? ? ? 2.333 ? ? 
metalc28 metalc ? ? G CYS 53  SG  ? ? ? 1_555 QA SF4 .   FE3 ? ? 9 CYS 53  9 SF4 202 1_555 ? ? ? ? ? ? ? 2.314 ? ? 
metalc29 metalc ? ? G CYS 56  SG  ? ? ? 1_555 QA SF4 .   FE4 ? ? 9 CYS 56  9 SF4 202 1_555 ? ? ? ? ? ? ? 2.292 ? ? 
metalc30 metalc ? ? G CYS 59  SG  ? ? ? 1_555 QA SF4 .   FE2 ? ? 9 CYS 59  9 SF4 202 1_555 ? ? ? ? ? ? ? 2.314 ? ? 
metalc31 metalc ? ? G CYS 63  SG  ? ? ? 1_555 PA SF4 .   FE4 ? ? 9 CYS 63  9 SF4 201 1_555 ? ? ? ? ? ? ? 2.295 ? ? 
metalc32 metalc ? ? G CYS 98  SG  ? ? ? 1_555 PA SF4 .   FE2 ? ? 9 CYS 98  9 SF4 201 1_555 ? ? ? ? ? ? ? 2.339 ? ? 
metalc33 metalc ? ? G CYS 101 SG  ? ? ? 1_555 PA SF4 .   FE1 ? ? 9 CYS 101 9 SF4 201 1_555 ? ? ? ? ? ? ? 2.297 ? ? 
metalc34 metalc ? ? G CYS 104 SG  ? ? ? 1_555 PA SF4 .   FE3 ? ? 9 CYS 104 9 SF4 201 1_555 ? ? ? ? ? ? ? 2.321 ? ? 
metalc35 metalc ? ? G CYS 108 SG  ? ? ? 1_555 QA SF4 .   FE1 ? ? 9 CYS 108 9 SF4 202 1_555 ? ? ? ? ? ? ? 2.299 ? ? 
metalc36 metalc ? ? Q CYS 353 SG  ? ? ? 1_555 RA SF4 .   FE4 ? ? B CYS 353 B SF4 501 1_555 ? ? ? ? ? ? ? 2.293 ? ? 
metalc37 metalc ? ? Q CYS 356 SG  ? ? ? 1_555 RA SF4 .   FE1 ? ? B CYS 356 B SF4 501 1_555 ? ? ? ? ? ? ? 2.295 ? ? 
metalc38 metalc ? ? Q CYS 359 SG  ? ? ? 1_555 RA SF4 .   FE2 ? ? B CYS 359 B SF4 501 1_555 ? ? ? ? ? ? ? 2.314 ? ? 
metalc39 metalc ? ? Q CYS 400 SG  ? ? ? 1_555 RA SF4 .   FE3 ? ? B CYS 400 B SF4 501 1_555 ? ? ? ? ? ? ? 2.325 ? ? 
metalc40 metalc ? ? R CYS 83  SG  ? ? ? 1_555 UA FES .   FE1 ? ? C CYS 83  C FES 201 1_555 ? ? ? ? ? ? ? 2.322 ? ? 
metalc41 metalc ? ? R CYS 88  SG  ? ? ? 1_555 UA FES .   FE1 ? ? C CYS 88  C FES 201 1_555 ? ? ? ? ? ? ? 2.320 ? ? 
metalc42 metalc ? ? R CYS 124 SG  ? ? ? 1_555 UA FES .   FE2 ? ? C CYS 124 C FES 201 1_555 ? ? ? ? ? ? ? 2.329 ? ? 
metalc43 metalc ? ? R CYS 128 SG  ? ? ? 1_555 UA FES .   FE2 ? ? C CYS 128 C FES 201 1_555 ? ? ? ? ? ? ? 2.328 ? ? 
metalc44 metalc ? ? S CYS 34  SG  ? ? ? 1_555 YA FES .   FE1 ? ? D CYS 34  D FES 804 1_555 ? ? ? ? ? ? ? 2.305 ? ? 
metalc45 metalc ? ? S CYS 45  SG  ? ? ? 1_555 YA FES .   FE1 ? ? D CYS 45  D FES 804 1_555 ? ? ? ? ? ? ? 2.310 ? ? 
metalc46 metalc ? ? S CYS 48  SG  ? ? ? 1_555 YA FES .   FE2 ? ? D CYS 48  D FES 804 1_555 ? ? ? ? ? ? ? 2.316 ? ? 
metalc47 metalc ? ? S CYS 83  SG  ? ? ? 1_555 YA FES .   FE2 ? ? D CYS 83  D FES 804 1_555 ? ? ? ? ? ? ? 2.310 ? ? 
metalc48 metalc ? ? S HIS 115 NE2 ? ? ? 1_555 VA SF4 .   FE3 ? ? D HIS 115 D SF4 801 1_555 ? ? ? ? ? ? ? 2.004 ? ? 
metalc49 metalc ? ? S CYS 119 SG  ? ? ? 1_555 VA SF4 .   FE2 ? ? D CYS 119 D SF4 801 1_555 ? ? ? ? ? ? ? 2.299 ? ? 
metalc50 metalc ? ? S CYS 122 SG  ? ? ? 1_555 VA SF4 .   FE4 ? ? D CYS 122 D SF4 801 1_555 ? ? ? ? ? ? ? 2.287 ? ? 
metalc51 metalc ? ? S CYS 128 SG  ? ? ? 1_555 VA SF4 .   FE1 ? ? D CYS 128 D SF4 801 1_555 ? ? ? ? ? ? ? 2.312 ? ? 
metalc52 metalc ? ? S CYS 181 SG  ? ? ? 1_555 WA SF4 .   FE2 ? ? D CYS 181 D SF4 802 1_555 ? ? ? ? ? ? ? 2.299 ? ? 
metalc53 metalc ? ? S CYS 184 SG  ? ? ? 1_555 WA SF4 .   FE1 ? ? D CYS 184 D SF4 802 1_555 ? ? ? ? ? ? ? 2.319 ? ? 
metalc54 metalc ? ? S CYS 187 SG  ? ? ? 1_555 WA SF4 .   FE3 ? ? D CYS 187 D SF4 802 1_555 ? ? ? ? ? ? ? 2.288 ? ? 
metalc55 metalc ? ? S CYS 230 SG  ? ? ? 1_555 WA SF4 .   FE4 ? ? D CYS 230 D SF4 802 1_555 ? ? ? ? ? ? ? 2.305 ? ? 
metalc56 metalc ? ? S CYS 256 SG  ? ? ? 1_555 XA SF4 .   FE1 ? ? D CYS 256 D SF4 803 1_555 ? ? ? ? ? ? ? 2.329 ? ? 
metalc57 metalc ? ? S CYS 259 SG  ? ? ? 1_555 XA SF4 .   FE4 ? ? D CYS 259 D SF4 803 1_555 ? ? ? ? ? ? ? 2.342 ? ? 
metalc58 metalc ? ? S CYS 263 SG  ? ? ? 1_555 XA SF4 .   FE3 ? ? D CYS 263 D SF4 803 1_555 ? ? ? ? ? ? ? 2.318 ? ? 
metalc59 metalc ? ? S CYS 291 SG  ? ? ? 1_555 XA SF4 .   FE2 ? ? D CYS 291 D SF4 803 1_555 ? ? ? ? ? ? ? 2.307 ? ? 
metalc60 metalc ? ? V CYS 45  SG  ? ? ? 1_555 ZA SF4 .   FE3 ? ? G CYS 45  G SF4 201 1_555 ? ? ? ? ? ? ? 2.002 ? ? 
metalc61 metalc ? ? V CYS 46  SG  ? ? ? 1_555 ZA SF4 .   FE2 ? ? G CYS 46  G SF4 201 1_555 ? ? ? ? ? ? ? 2.318 ? ? 
metalc62 metalc ? ? V CYS 111 SG  ? ? ? 1_555 ZA SF4 .   FE1 ? ? G CYS 111 G SF4 201 1_555 ? ? ? ? ? ? ? 2.318 ? ? 
metalc63 metalc ? ? V CYS 140 SG  ? ? ? 1_555 ZA SF4 .   FE4 ? ? G CYS 140 G SF4 201 1_555 ? ? ? ? ? ? ? 2.312 ? ? 
metalc64 metalc ? ? W CYS 53  SG  ? ? ? 1_555 BB SF4 .   FE3 ? ? O CYS 53  O SF4 202 1_555 ? ? ? ? ? ? ? 2.272 ? ? 
metalc65 metalc ? ? W CYS 56  SG  ? ? ? 1_555 BB SF4 .   FE4 ? ? O CYS 56  O SF4 202 1_555 ? ? ? ? ? ? ? 2.303 ? ? 
metalc66 metalc ? ? W CYS 59  SG  ? ? ? 1_555 BB SF4 .   FE2 ? ? O CYS 59  O SF4 202 1_555 ? ? ? ? ? ? ? 2.306 ? ? 
metalc67 metalc ? ? W CYS 63  SG  ? ? ? 1_555 AB SF4 .   FE4 ? ? O CYS 63  O SF4 201 1_555 ? ? ? ? ? ? ? 2.263 ? ? 
metalc68 metalc ? ? W CYS 98  SG  ? ? ? 1_555 AB SF4 .   FE2 ? ? O CYS 98  O SF4 201 1_555 ? ? ? ? ? ? ? 2.288 ? ? 
metalc69 metalc ? ? W CYS 101 SG  ? ? ? 1_555 AB SF4 .   FE1 ? ? O CYS 101 O SF4 201 1_555 ? ? ? ? ? ? ? 2.325 ? ? 
metalc70 metalc ? ? W CYS 104 SG  ? ? ? 1_555 AB SF4 .   FE3 ? ? O CYS 104 O SF4 201 1_555 ? ? ? ? ? ? ? 2.286 ? ? 
metalc71 metalc ? ? W CYS 108 SG  ? ? ? 1_555 BB SF4 .   FE1 ? ? O CYS 108 O SF4 202 1_555 ? ? ? ? ? ? ? 2.248 ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1   SG  ? A  CYS 353 ? 1 CYS 353 ? 1_555 FE4 ? GA SF4 . ? 1 SF4 501 ? 1_555 S1 ? GA SF4 .   ? 1 SF4 501 ? 1_555 115.7 ? 
2   SG  ? A  CYS 353 ? 1 CYS 353 ? 1_555 FE4 ? GA SF4 . ? 1 SF4 501 ? 1_555 S2 ? GA SF4 .   ? 1 SF4 501 ? 1_555 105.6 ? 
3   S1  ? GA SF4 .   ? 1 SF4 501 ? 1_555 FE4 ? GA SF4 . ? 1 SF4 501 ? 1_555 S2 ? GA SF4 .   ? 1 SF4 501 ? 1_555 105.8 ? 
4   SG  ? A  CYS 353 ? 1 CYS 353 ? 1_555 FE4 ? GA SF4 . ? 1 SF4 501 ? 1_555 S3 ? GA SF4 .   ? 1 SF4 501 ? 1_555 118.8 ? 
5   S1  ? GA SF4 .   ? 1 SF4 501 ? 1_555 FE4 ? GA SF4 . ? 1 SF4 501 ? 1_555 S3 ? GA SF4 .   ? 1 SF4 501 ? 1_555 106.2 ? 
6   S2  ? GA SF4 .   ? 1 SF4 501 ? 1_555 FE4 ? GA SF4 . ? 1 SF4 501 ? 1_555 S3 ? GA SF4 .   ? 1 SF4 501 ? 1_555 103.3 ? 
7   SG  ? A  CYS 356 ? 1 CYS 356 ? 1_555 FE1 ? GA SF4 . ? 1 SF4 501 ? 1_555 S2 ? GA SF4 .   ? 1 SF4 501 ? 1_555 110.9 ? 
8   SG  ? A  CYS 356 ? 1 CYS 356 ? 1_555 FE1 ? GA SF4 . ? 1 SF4 501 ? 1_555 S3 ? GA SF4 .   ? 1 SF4 501 ? 1_555 114.2 ? 
9   S2  ? GA SF4 .   ? 1 SF4 501 ? 1_555 FE1 ? GA SF4 . ? 1 SF4 501 ? 1_555 S3 ? GA SF4 .   ? 1 SF4 501 ? 1_555 103.8 ? 
10  SG  ? A  CYS 356 ? 1 CYS 356 ? 1_555 FE1 ? GA SF4 . ? 1 SF4 501 ? 1_555 S4 ? GA SF4 .   ? 1 SF4 501 ? 1_555 114.3 ? 
11  S2  ? GA SF4 .   ? 1 SF4 501 ? 1_555 FE1 ? GA SF4 . ? 1 SF4 501 ? 1_555 S4 ? GA SF4 .   ? 1 SF4 501 ? 1_555 106.1 ? 
12  S3  ? GA SF4 .   ? 1 SF4 501 ? 1_555 FE1 ? GA SF4 . ? 1 SF4 501 ? 1_555 S4 ? GA SF4 .   ? 1 SF4 501 ? 1_555 106.8 ? 
13  SG  ? A  CYS 359 ? 1 CYS 359 ? 1_555 FE2 ? GA SF4 . ? 1 SF4 501 ? 1_555 S1 ? GA SF4 .   ? 1 SF4 501 ? 1_555 126.4 ? 
14  SG  ? A  CYS 359 ? 1 CYS 359 ? 1_555 FE2 ? GA SF4 . ? 1 SF4 501 ? 1_555 S3 ? GA SF4 .   ? 1 SF4 501 ? 1_555 107.1 ? 
15  S1  ? GA SF4 .   ? 1 SF4 501 ? 1_555 FE2 ? GA SF4 . ? 1 SF4 501 ? 1_555 S3 ? GA SF4 .   ? 1 SF4 501 ? 1_555 106.9 ? 
16  SG  ? A  CYS 359 ? 1 CYS 359 ? 1_555 FE2 ? GA SF4 . ? 1 SF4 501 ? 1_555 S4 ? GA SF4 .   ? 1 SF4 501 ? 1_555 102.5 ? 
17  S1  ? GA SF4 .   ? 1 SF4 501 ? 1_555 FE2 ? GA SF4 . ? 1 SF4 501 ? 1_555 S4 ? GA SF4 .   ? 1 SF4 501 ? 1_555 105.6 ? 
18  S3  ? GA SF4 .   ? 1 SF4 501 ? 1_555 FE2 ? GA SF4 . ? 1 SF4 501 ? 1_555 S4 ? GA SF4 .   ? 1 SF4 501 ? 1_555 107.0 ? 
19  SG  ? B  CYS 83  ? 2 CYS 83  ? 1_555 FE1 ? JA FES . ? 2 FES 201 ? 1_555 S1 ? JA FES .   ? 2 FES 201 ? 1_555 114.0 ? 
20  SG  ? B  CYS 83  ? 2 CYS 83  ? 1_555 FE1 ? JA FES . ? 2 FES 201 ? 1_555 S2 ? JA FES .   ? 2 FES 201 ? 1_555 120.0 ? 
21  S1  ? JA FES .   ? 2 FES 201 ? 1_555 FE1 ? JA FES . ? 2 FES 201 ? 1_555 S2 ? JA FES .   ? 2 FES 201 ? 1_555 90.8  ? 
22  SG  ? B  CYS 83  ? 2 CYS 83  ? 1_555 FE1 ? JA FES . ? 2 FES 201 ? 1_555 SG ? B  CYS 88  ? 2 CYS 88  ? 1_555 101.6 ? 
23  S1  ? JA FES .   ? 2 FES 201 ? 1_555 FE1 ? JA FES . ? 2 FES 201 ? 1_555 SG ? B  CYS 88  ? 2 CYS 88  ? 1_555 121.0 ? 
24  S2  ? JA FES .   ? 2 FES 201 ? 1_555 FE1 ? JA FES . ? 2 FES 201 ? 1_555 SG ? B  CYS 88  ? 2 CYS 88  ? 1_555 110.6 ? 
25  SG  ? B  CYS 124 ? 2 CYS 124 ? 1_555 FE2 ? JA FES . ? 2 FES 201 ? 1_555 S1 ? JA FES .   ? 2 FES 201 ? 1_555 109.7 ? 
26  SG  ? B  CYS 124 ? 2 CYS 124 ? 1_555 FE2 ? JA FES . ? 2 FES 201 ? 1_555 S2 ? JA FES .   ? 2 FES 201 ? 1_555 120.4 ? 
27  S1  ? JA FES .   ? 2 FES 201 ? 1_555 FE2 ? JA FES . ? 2 FES 201 ? 1_555 S2 ? JA FES .   ? 2 FES 201 ? 1_555 90.5  ? 
28  SG  ? B  CYS 124 ? 2 CYS 124 ? 1_555 FE2 ? JA FES . ? 2 FES 201 ? 1_555 SG ? B  CYS 128 ? 2 CYS 128 ? 1_555 102.5 ? 
29  S1  ? JA FES .   ? 2 FES 201 ? 1_555 FE2 ? JA FES . ? 2 FES 201 ? 1_555 SG ? B  CYS 128 ? 2 CYS 128 ? 1_555 122.9 ? 
30  S2  ? JA FES .   ? 2 FES 201 ? 1_555 FE2 ? JA FES . ? 2 FES 201 ? 1_555 SG ? B  CYS 128 ? 2 CYS 128 ? 1_555 112.0 ? 
31  SG  ? C  CYS 34  ? 3 CYS 34  ? 1_555 FE1 ? NA FES . ? 3 FES 804 ? 1_555 S1 ? NA FES .   ? 3 FES 804 ? 1_555 107.0 ? 
32  SG  ? C  CYS 34  ? 3 CYS 34  ? 1_555 FE1 ? NA FES . ? 3 FES 804 ? 1_555 S2 ? NA FES .   ? 3 FES 804 ? 1_555 106.6 ? 
33  S1  ? NA FES .   ? 3 FES 804 ? 1_555 FE1 ? NA FES . ? 3 FES 804 ? 1_555 S2 ? NA FES .   ? 3 FES 804 ? 1_555 90.1  ? 
34  SG  ? C  CYS 34  ? 3 CYS 34  ? 1_555 FE1 ? NA FES . ? 3 FES 804 ? 1_555 SG ? C  CYS 45  ? 3 CYS 45  ? 1_555 122.7 ? 
35  S1  ? NA FES .   ? 3 FES 804 ? 1_555 FE1 ? NA FES . ? 3 FES 804 ? 1_555 SG ? C  CYS 45  ? 3 CYS 45  ? 1_555 117.6 ? 
36  S2  ? NA FES .   ? 3 FES 804 ? 1_555 FE1 ? NA FES . ? 3 FES 804 ? 1_555 SG ? C  CYS 45  ? 3 CYS 45  ? 1_555 107.4 ? 
37  SG  ? C  CYS 48  ? 3 CYS 48  ? 1_555 FE2 ? NA FES . ? 3 FES 804 ? 1_555 S1 ? NA FES .   ? 3 FES 804 ? 1_555 115.1 ? 
38  SG  ? C  CYS 48  ? 3 CYS 48  ? 1_555 FE2 ? NA FES . ? 3 FES 804 ? 1_555 S2 ? NA FES .   ? 3 FES 804 ? 1_555 108.7 ? 
39  S1  ? NA FES .   ? 3 FES 804 ? 1_555 FE2 ? NA FES . ? 3 FES 804 ? 1_555 S2 ? NA FES .   ? 3 FES 804 ? 1_555 89.7  ? 
40  SG  ? C  CYS 48  ? 3 CYS 48  ? 1_555 FE2 ? NA FES . ? 3 FES 804 ? 1_555 SG ? C  CYS 83  ? 3 CYS 83  ? 1_555 118.4 ? 
41  S1  ? NA FES .   ? 3 FES 804 ? 1_555 FE2 ? NA FES . ? 3 FES 804 ? 1_555 SG ? C  CYS 83  ? 3 CYS 83  ? 1_555 106.0 ? 
42  S2  ? NA FES .   ? 3 FES 804 ? 1_555 FE2 ? NA FES . ? 3 FES 804 ? 1_555 SG ? C  CYS 83  ? 3 CYS 83  ? 1_555 115.5 ? 
43  NE2 ? C  HIS 115 ? 3 HIS 115 ? 1_555 FE3 ? KA SF4 . ? 3 SF4 801 ? 1_555 S1 ? KA SF4 .   ? 3 SF4 801 ? 1_555 126.1 ? 
44  NE2 ? C  HIS 115 ? 3 HIS 115 ? 1_555 FE3 ? KA SF4 . ? 3 SF4 801 ? 1_555 S2 ? KA SF4 .   ? 3 SF4 801 ? 1_555 98.5  ? 
45  S1  ? KA SF4 .   ? 3 SF4 801 ? 1_555 FE3 ? KA SF4 . ? 3 SF4 801 ? 1_555 S2 ? KA SF4 .   ? 3 SF4 801 ? 1_555 103.6 ? 
46  NE2 ? C  HIS 115 ? 3 HIS 115 ? 1_555 FE3 ? KA SF4 . ? 3 SF4 801 ? 1_555 S4 ? KA SF4 .   ? 3 SF4 801 ? 1_555 112.7 ? 
47  S1  ? KA SF4 .   ? 3 SF4 801 ? 1_555 FE3 ? KA SF4 . ? 3 SF4 801 ? 1_555 S4 ? KA SF4 .   ? 3 SF4 801 ? 1_555 106.9 ? 
48  S2  ? KA SF4 .   ? 3 SF4 801 ? 1_555 FE3 ? KA SF4 . ? 3 SF4 801 ? 1_555 S4 ? KA SF4 .   ? 3 SF4 801 ? 1_555 106.7 ? 
49  SG  ? C  CYS 119 ? 3 CYS 119 ? 1_555 FE2 ? KA SF4 . ? 3 SF4 801 ? 1_555 S1 ? KA SF4 .   ? 3 SF4 801 ? 1_555 115.3 ? 
50  SG  ? C  CYS 119 ? 3 CYS 119 ? 1_555 FE2 ? KA SF4 . ? 3 SF4 801 ? 1_555 S3 ? KA SF4 .   ? 3 SF4 801 ? 1_555 118.2 ? 
51  S1  ? KA SF4 .   ? 3 SF4 801 ? 1_555 FE2 ? KA SF4 . ? 3 SF4 801 ? 1_555 S3 ? KA SF4 .   ? 3 SF4 801 ? 1_555 104.1 ? 
52  SG  ? C  CYS 119 ? 3 CYS 119 ? 1_555 FE2 ? KA SF4 . ? 3 SF4 801 ? 1_555 S4 ? KA SF4 .   ? 3 SF4 801 ? 1_555 108.7 ? 
53  S1  ? KA SF4 .   ? 3 SF4 801 ? 1_555 FE2 ? KA SF4 . ? 3 SF4 801 ? 1_555 S4 ? KA SF4 .   ? 3 SF4 801 ? 1_555 107.3 ? 
54  S3  ? KA SF4 .   ? 3 SF4 801 ? 1_555 FE2 ? KA SF4 . ? 3 SF4 801 ? 1_555 S4 ? KA SF4 .   ? 3 SF4 801 ? 1_555 102.0 ? 
55  SG  ? C  CYS 122 ? 3 CYS 122 ? 1_555 FE4 ? KA SF4 . ? 3 SF4 801 ? 1_555 S1 ? KA SF4 .   ? 3 SF4 801 ? 1_555 111.1 ? 
56  SG  ? C  CYS 122 ? 3 CYS 122 ? 1_555 FE4 ? KA SF4 . ? 3 SF4 801 ? 1_555 S2 ? KA SF4 .   ? 3 SF4 801 ? 1_555 119.5 ? 
57  S1  ? KA SF4 .   ? 3 SF4 801 ? 1_555 FE4 ? KA SF4 . ? 3 SF4 801 ? 1_555 S2 ? KA SF4 .   ? 3 SF4 801 ? 1_555 104.2 ? 
58  SG  ? C  CYS 122 ? 3 CYS 122 ? 1_555 FE4 ? KA SF4 . ? 3 SF4 801 ? 1_555 S3 ? KA SF4 .   ? 3 SF4 801 ? 1_555 110.6 ? 
59  S1  ? KA SF4 .   ? 3 SF4 801 ? 1_555 FE4 ? KA SF4 . ? 3 SF4 801 ? 1_555 S3 ? KA SF4 .   ? 3 SF4 801 ? 1_555 103.7 ? 
60  S2  ? KA SF4 .   ? 3 SF4 801 ? 1_555 FE4 ? KA SF4 . ? 3 SF4 801 ? 1_555 S3 ? KA SF4 .   ? 3 SF4 801 ? 1_555 106.4 ? 
61  SG  ? C  CYS 128 ? 3 CYS 128 ? 1_555 FE1 ? KA SF4 . ? 3 SF4 801 ? 1_555 S2 ? KA SF4 .   ? 3 SF4 801 ? 1_555 112.4 ? 
62  SG  ? C  CYS 128 ? 3 CYS 128 ? 1_555 FE1 ? KA SF4 . ? 3 SF4 801 ? 1_555 S3 ? KA SF4 .   ? 3 SF4 801 ? 1_555 112.4 ? 
63  S2  ? KA SF4 .   ? 3 SF4 801 ? 1_555 FE1 ? KA SF4 . ? 3 SF4 801 ? 1_555 S3 ? KA SF4 .   ? 3 SF4 801 ? 1_555 106.0 ? 
64  SG  ? C  CYS 128 ? 3 CYS 128 ? 1_555 FE1 ? KA SF4 . ? 3 SF4 801 ? 1_555 S4 ? KA SF4 .   ? 3 SF4 801 ? 1_555 115.3 ? 
65  S2  ? KA SF4 .   ? 3 SF4 801 ? 1_555 FE1 ? KA SF4 . ? 3 SF4 801 ? 1_555 S4 ? KA SF4 .   ? 3 SF4 801 ? 1_555 107.5 ? 
66  S3  ? KA SF4 .   ? 3 SF4 801 ? 1_555 FE1 ? KA SF4 . ? 3 SF4 801 ? 1_555 S4 ? KA SF4 .   ? 3 SF4 801 ? 1_555 102.4 ? 
67  SG  ? C  CYS 181 ? 3 CYS 181 ? 1_555 FE2 ? LA SF4 . ? 3 SF4 802 ? 1_555 S1 ? LA SF4 .   ? 3 SF4 802 ? 1_555 107.2 ? 
68  SG  ? C  CYS 181 ? 3 CYS 181 ? 1_555 FE2 ? LA SF4 . ? 3 SF4 802 ? 1_555 S3 ? LA SF4 .   ? 3 SF4 802 ? 1_555 118.2 ? 
69  S1  ? LA SF4 .   ? 3 SF4 802 ? 1_555 FE2 ? LA SF4 . ? 3 SF4 802 ? 1_555 S3 ? LA SF4 .   ? 3 SF4 802 ? 1_555 106.4 ? 
70  SG  ? C  CYS 181 ? 3 CYS 181 ? 1_555 FE2 ? LA SF4 . ? 3 SF4 802 ? 1_555 S4 ? LA SF4 .   ? 3 SF4 802 ? 1_555 113.7 ? 
71  S1  ? LA SF4 .   ? 3 SF4 802 ? 1_555 FE2 ? LA SF4 . ? 3 SF4 802 ? 1_555 S4 ? LA SF4 .   ? 3 SF4 802 ? 1_555 104.4 ? 
72  S3  ? LA SF4 .   ? 3 SF4 802 ? 1_555 FE2 ? LA SF4 . ? 3 SF4 802 ? 1_555 S4 ? LA SF4 .   ? 3 SF4 802 ? 1_555 105.8 ? 
73  SG  ? C  CYS 184 ? 3 CYS 184 ? 1_555 FE1 ? LA SF4 . ? 3 SF4 802 ? 1_555 S2 ? LA SF4 .   ? 3 SF4 802 ? 1_555 113.5 ? 
74  SG  ? C  CYS 184 ? 3 CYS 184 ? 1_555 FE1 ? LA SF4 . ? 3 SF4 802 ? 1_555 S3 ? LA SF4 .   ? 3 SF4 802 ? 1_555 111.4 ? 
75  S2  ? LA SF4 .   ? 3 SF4 802 ? 1_555 FE1 ? LA SF4 . ? 3 SF4 802 ? 1_555 S3 ? LA SF4 .   ? 3 SF4 802 ? 1_555 104.5 ? 
76  SG  ? C  CYS 184 ? 3 CYS 184 ? 1_555 FE1 ? LA SF4 . ? 3 SF4 802 ? 1_555 S4 ? LA SF4 .   ? 3 SF4 802 ? 1_555 114.4 ? 
77  S2  ? LA SF4 .   ? 3 SF4 802 ? 1_555 FE1 ? LA SF4 . ? 3 SF4 802 ? 1_555 S4 ? LA SF4 .   ? 3 SF4 802 ? 1_555 106.4 ? 
78  S3  ? LA SF4 .   ? 3 SF4 802 ? 1_555 FE1 ? LA SF4 . ? 3 SF4 802 ? 1_555 S4 ? LA SF4 .   ? 3 SF4 802 ? 1_555 105.8 ? 
79  SG  ? C  CYS 187 ? 3 CYS 187 ? 1_555 FE3 ? LA SF4 . ? 3 SF4 802 ? 1_555 S1 ? LA SF4 .   ? 3 SF4 802 ? 1_555 118.2 ? 
80  SG  ? C  CYS 187 ? 3 CYS 187 ? 1_555 FE3 ? LA SF4 . ? 3 SF4 802 ? 1_555 S2 ? LA SF4 .   ? 3 SF4 802 ? 1_555 110.2 ? 
81  S1  ? LA SF4 .   ? 3 SF4 802 ? 1_555 FE3 ? LA SF4 . ? 3 SF4 802 ? 1_555 S2 ? LA SF4 .   ? 3 SF4 802 ? 1_555 104.8 ? 
82  SG  ? C  CYS 187 ? 3 CYS 187 ? 1_555 FE3 ? LA SF4 . ? 3 SF4 802 ? 1_555 S4 ? LA SF4 .   ? 3 SF4 802 ? 1_555 111.1 ? 
83  S1  ? LA SF4 .   ? 3 SF4 802 ? 1_555 FE3 ? LA SF4 . ? 3 SF4 802 ? 1_555 S4 ? LA SF4 .   ? 3 SF4 802 ? 1_555 105.0 ? 
84  S2  ? LA SF4 .   ? 3 SF4 802 ? 1_555 FE3 ? LA SF4 . ? 3 SF4 802 ? 1_555 S4 ? LA SF4 .   ? 3 SF4 802 ? 1_555 106.8 ? 
85  SG  ? C  CYS 230 ? 3 CYS 230 ? 1_555 FE4 ? LA SF4 . ? 3 SF4 802 ? 1_555 S1 ? LA SF4 .   ? 3 SF4 802 ? 1_555 108.6 ? 
86  SG  ? C  CYS 230 ? 3 CYS 230 ? 1_555 FE4 ? LA SF4 . ? 3 SF4 802 ? 1_555 S2 ? LA SF4 .   ? 3 SF4 802 ? 1_555 111.2 ? 
87  S1  ? LA SF4 .   ? 3 SF4 802 ? 1_555 FE4 ? LA SF4 . ? 3 SF4 802 ? 1_555 S2 ? LA SF4 .   ? 3 SF4 802 ? 1_555 104.6 ? 
88  SG  ? C  CYS 230 ? 3 CYS 230 ? 1_555 FE4 ? LA SF4 . ? 3 SF4 802 ? 1_555 S3 ? LA SF4 .   ? 3 SF4 802 ? 1_555 119.8 ? 
89  S1  ? LA SF4 .   ? 3 SF4 802 ? 1_555 FE4 ? LA SF4 . ? 3 SF4 802 ? 1_555 S3 ? LA SF4 .   ? 3 SF4 802 ? 1_555 107.5 ? 
90  S2  ? LA SF4 .   ? 3 SF4 802 ? 1_555 FE4 ? LA SF4 . ? 3 SF4 802 ? 1_555 S3 ? LA SF4 .   ? 3 SF4 802 ? 1_555 104.0 ? 
91  SG  ? C  CYS 256 ? 3 CYS 256 ? 1_555 FE1 ? MA SF4 . ? 3 SF4 803 ? 1_555 S2 ? MA SF4 .   ? 3 SF4 803 ? 1_555 109.1 ? 
92  SG  ? C  CYS 256 ? 3 CYS 256 ? 1_555 FE1 ? MA SF4 . ? 3 SF4 803 ? 1_555 S3 ? MA SF4 .   ? 3 SF4 803 ? 1_555 114.9 ? 
93  S2  ? MA SF4 .   ? 3 SF4 803 ? 1_555 FE1 ? MA SF4 . ? 3 SF4 803 ? 1_555 S3 ? MA SF4 .   ? 3 SF4 803 ? 1_555 104.4 ? 
94  SG  ? C  CYS 256 ? 3 CYS 256 ? 1_555 FE1 ? MA SF4 . ? 3 SF4 803 ? 1_555 S4 ? MA SF4 .   ? 3 SF4 803 ? 1_555 115.5 ? 
95  S2  ? MA SF4 .   ? 3 SF4 803 ? 1_555 FE1 ? MA SF4 . ? 3 SF4 803 ? 1_555 S4 ? MA SF4 .   ? 3 SF4 803 ? 1_555 105.9 ? 
96  S3  ? MA SF4 .   ? 3 SF4 803 ? 1_555 FE1 ? MA SF4 . ? 3 SF4 803 ? 1_555 S4 ? MA SF4 .   ? 3 SF4 803 ? 1_555 106.1 ? 
97  SG  ? C  CYS 259 ? 3 CYS 259 ? 1_555 FE4 ? MA SF4 . ? 3 SF4 803 ? 1_555 S1 ? MA SF4 .   ? 3 SF4 803 ? 1_555 113.4 ? 
98  SG  ? C  CYS 259 ? 3 CYS 259 ? 1_555 FE4 ? MA SF4 . ? 3 SF4 803 ? 1_555 S2 ? MA SF4 .   ? 3 SF4 803 ? 1_555 108.8 ? 
99  S1  ? MA SF4 .   ? 3 SF4 803 ? 1_555 FE4 ? MA SF4 . ? 3 SF4 803 ? 1_555 S2 ? MA SF4 .   ? 3 SF4 803 ? 1_555 108.3 ? 
100 SG  ? C  CYS 259 ? 3 CYS 259 ? 1_555 FE4 ? MA SF4 . ? 3 SF4 803 ? 1_555 S3 ? MA SF4 .   ? 3 SF4 803 ? 1_555 116.5 ? 
101 S1  ? MA SF4 .   ? 3 SF4 803 ? 1_555 FE4 ? MA SF4 . ? 3 SF4 803 ? 1_555 S3 ? MA SF4 .   ? 3 SF4 803 ? 1_555 105.9 ? 
102 S2  ? MA SF4 .   ? 3 SF4 803 ? 1_555 FE4 ? MA SF4 . ? 3 SF4 803 ? 1_555 S3 ? MA SF4 .   ? 3 SF4 803 ? 1_555 103.2 ? 
103 SG  ? C  CYS 263 ? 3 CYS 263 ? 1_555 FE3 ? MA SF4 . ? 3 SF4 803 ? 1_555 S1 ? MA SF4 .   ? 3 SF4 803 ? 1_555 108.3 ? 
104 SG  ? C  CYS 263 ? 3 CYS 263 ? 1_555 FE3 ? MA SF4 . ? 3 SF4 803 ? 1_555 S2 ? MA SF4 .   ? 3 SF4 803 ? 1_555 109.2 ? 
105 S1  ? MA SF4 .   ? 3 SF4 803 ? 1_555 FE3 ? MA SF4 . ? 3 SF4 803 ? 1_555 S2 ? MA SF4 .   ? 3 SF4 803 ? 1_555 107.7 ? 
106 SG  ? C  CYS 263 ? 3 CYS 263 ? 1_555 FE3 ? MA SF4 . ? 3 SF4 803 ? 1_555 S4 ? MA SF4 .   ? 3 SF4 803 ? 1_555 121.3 ? 
107 S1  ? MA SF4 .   ? 3 SF4 803 ? 1_555 FE3 ? MA SF4 . ? 3 SF4 803 ? 1_555 S4 ? MA SF4 .   ? 3 SF4 803 ? 1_555 104.4 ? 
108 S2  ? MA SF4 .   ? 3 SF4 803 ? 1_555 FE3 ? MA SF4 . ? 3 SF4 803 ? 1_555 S4 ? MA SF4 .   ? 3 SF4 803 ? 1_555 105.2 ? 
109 SG  ? C  CYS 291 ? 3 CYS 291 ? 1_555 FE2 ? MA SF4 . ? 3 SF4 803 ? 1_555 S1 ? MA SF4 .   ? 3 SF4 803 ? 1_555 106.7 ? 
110 SG  ? C  CYS 291 ? 3 CYS 291 ? 1_555 FE2 ? MA SF4 . ? 3 SF4 803 ? 1_555 S3 ? MA SF4 .   ? 3 SF4 803 ? 1_555 107.7 ? 
111 S1  ? MA SF4 .   ? 3 SF4 803 ? 1_555 FE2 ? MA SF4 . ? 3 SF4 803 ? 1_555 S3 ? MA SF4 .   ? 3 SF4 803 ? 1_555 107.8 ? 
112 SG  ? C  CYS 291 ? 3 CYS 291 ? 1_555 FE2 ? MA SF4 . ? 3 SF4 803 ? 1_555 S4 ? MA SF4 .   ? 3 SF4 803 ? 1_555 124.6 ? 
113 S1  ? MA SF4 .   ? 3 SF4 803 ? 1_555 FE2 ? MA SF4 . ? 3 SF4 803 ? 1_555 S4 ? MA SF4 .   ? 3 SF4 803 ? 1_555 104.0 ? 
114 S3  ? MA SF4 .   ? 3 SF4 803 ? 1_555 FE2 ? MA SF4 . ? 3 SF4 803 ? 1_555 S4 ? MA SF4 .   ? 3 SF4 803 ? 1_555 105.2 ? 
115 SG  ? F  CYS 45  ? 6 CYS 45  ? 1_555 FE3 ? OA SF4 . ? 6 SF4 201 ? 1_555 S1 ? OA SF4 .   ? 6 SF4 201 ? 1_555 101.0 ? 
116 SG  ? F  CYS 45  ? 6 CYS 45  ? 1_555 FE3 ? OA SF4 . ? 6 SF4 201 ? 1_555 S2 ? OA SF4 .   ? 6 SF4 201 ? 1_555 116.0 ? 
117 S1  ? OA SF4 .   ? 6 SF4 201 ? 1_555 FE3 ? OA SF4 . ? 6 SF4 201 ? 1_555 S2 ? OA SF4 .   ? 6 SF4 201 ? 1_555 105.3 ? 
118 SG  ? F  CYS 45  ? 6 CYS 45  ? 1_555 FE3 ? OA SF4 . ? 6 SF4 201 ? 1_555 S4 ? OA SF4 .   ? 6 SF4 201 ? 1_555 121.5 ? 
119 S1  ? OA SF4 .   ? 6 SF4 201 ? 1_555 FE3 ? OA SF4 . ? 6 SF4 201 ? 1_555 S4 ? OA SF4 .   ? 6 SF4 201 ? 1_555 107.7 ? 
120 S2  ? OA SF4 .   ? 6 SF4 201 ? 1_555 FE3 ? OA SF4 . ? 6 SF4 201 ? 1_555 S4 ? OA SF4 .   ? 6 SF4 201 ? 1_555 104.0 ? 
121 SG  ? F  CYS 46  ? 6 CYS 46  ? 1_555 FE2 ? OA SF4 . ? 6 SF4 201 ? 1_555 S1 ? OA SF4 .   ? 6 SF4 201 ? 1_555 107.7 ? 
122 SG  ? F  CYS 46  ? 6 CYS 46  ? 1_555 FE2 ? OA SF4 . ? 6 SF4 201 ? 1_555 S3 ? OA SF4 .   ? 6 SF4 201 ? 1_555 117.3 ? 
123 S1  ? OA SF4 .   ? 6 SF4 201 ? 1_555 FE2 ? OA SF4 . ? 6 SF4 201 ? 1_555 S3 ? OA SF4 .   ? 6 SF4 201 ? 1_555 103.0 ? 
124 SG  ? F  CYS 46  ? 6 CYS 46  ? 1_555 FE2 ? OA SF4 . ? 6 SF4 201 ? 1_555 S4 ? OA SF4 .   ? 6 SF4 201 ? 1_555 114.8 ? 
125 S1  ? OA SF4 .   ? 6 SF4 201 ? 1_555 FE2 ? OA SF4 . ? 6 SF4 201 ? 1_555 S4 ? OA SF4 .   ? 6 SF4 201 ? 1_555 107.0 ? 
126 S3  ? OA SF4 .   ? 6 SF4 201 ? 1_555 FE2 ? OA SF4 . ? 6 SF4 201 ? 1_555 S4 ? OA SF4 .   ? 6 SF4 201 ? 1_555 105.9 ? 
127 SG  ? F  CYS 111 ? 6 CYS 111 ? 1_555 FE1 ? OA SF4 . ? 6 SF4 201 ? 1_555 S2 ? OA SF4 .   ? 6 SF4 201 ? 1_555 107.6 ? 
128 SG  ? F  CYS 111 ? 6 CYS 111 ? 1_555 FE1 ? OA SF4 . ? 6 SF4 201 ? 1_555 S3 ? OA SF4 .   ? 6 SF4 201 ? 1_555 110.0 ? 
129 S2  ? OA SF4 .   ? 6 SF4 201 ? 1_555 FE1 ? OA SF4 . ? 6 SF4 201 ? 1_555 S3 ? OA SF4 .   ? 6 SF4 201 ? 1_555 107.7 ? 
130 SG  ? F  CYS 111 ? 6 CYS 111 ? 1_555 FE1 ? OA SF4 . ? 6 SF4 201 ? 1_555 S4 ? OA SF4 .   ? 6 SF4 201 ? 1_555 120.5 ? 
131 S2  ? OA SF4 .   ? 6 SF4 201 ? 1_555 FE1 ? OA SF4 . ? 6 SF4 201 ? 1_555 S4 ? OA SF4 .   ? 6 SF4 201 ? 1_555 103.5 ? 
132 S3  ? OA SF4 .   ? 6 SF4 201 ? 1_555 FE1 ? OA SF4 . ? 6 SF4 201 ? 1_555 S4 ? OA SF4 .   ? 6 SF4 201 ? 1_555 106.8 ? 
133 SG  ? F  CYS 140 ? 6 CYS 140 ? 1_555 FE4 ? OA SF4 . ? 6 SF4 201 ? 1_555 S1 ? OA SF4 .   ? 6 SF4 201 ? 1_555 108.4 ? 
134 SG  ? F  CYS 140 ? 6 CYS 140 ? 1_555 FE4 ? OA SF4 . ? 6 SF4 201 ? 1_555 S2 ? OA SF4 .   ? 6 SF4 201 ? 1_555 113.6 ? 
135 S1  ? OA SF4 .   ? 6 SF4 201 ? 1_555 FE4 ? OA SF4 . ? 6 SF4 201 ? 1_555 S2 ? OA SF4 .   ? 6 SF4 201 ? 1_555 103.9 ? 
136 SG  ? F  CYS 140 ? 6 CYS 140 ? 1_555 FE4 ? OA SF4 . ? 6 SF4 201 ? 1_555 S3 ? OA SF4 .   ? 6 SF4 201 ? 1_555 118.4 ? 
137 S1  ? OA SF4 .   ? 6 SF4 201 ? 1_555 FE4 ? OA SF4 . ? 6 SF4 201 ? 1_555 S3 ? OA SF4 .   ? 6 SF4 201 ? 1_555 103.3 ? 
138 S2  ? OA SF4 .   ? 6 SF4 201 ? 1_555 FE4 ? OA SF4 . ? 6 SF4 201 ? 1_555 S3 ? OA SF4 .   ? 6 SF4 201 ? 1_555 107.7 ? 
139 SG  ? G  CYS 53  ? 9 CYS 53  ? 1_555 FE3 ? QA SF4 . ? 9 SF4 202 ? 1_555 S1 ? QA SF4 .   ? 9 SF4 202 ? 1_555 105.7 ? 
140 SG  ? G  CYS 53  ? 9 CYS 53  ? 1_555 FE3 ? QA SF4 . ? 9 SF4 202 ? 1_555 S2 ? QA SF4 .   ? 9 SF4 202 ? 1_555 117.8 ? 
141 S1  ? QA SF4 .   ? 9 SF4 202 ? 1_555 FE3 ? QA SF4 . ? 9 SF4 202 ? 1_555 S2 ? QA SF4 .   ? 9 SF4 202 ? 1_555 105.7 ? 
142 SG  ? G  CYS 53  ? 9 CYS 53  ? 1_555 FE3 ? QA SF4 . ? 9 SF4 202 ? 1_555 S4 ? QA SF4 .   ? 9 SF4 202 ? 1_555 114.6 ? 
143 S1  ? QA SF4 .   ? 9 SF4 202 ? 1_555 FE3 ? QA SF4 . ? 9 SF4 202 ? 1_555 S4 ? QA SF4 .   ? 9 SF4 202 ? 1_555 106.2 ? 
144 S2  ? QA SF4 .   ? 9 SF4 202 ? 1_555 FE3 ? QA SF4 . ? 9 SF4 202 ? 1_555 S4 ? QA SF4 .   ? 9 SF4 202 ? 1_555 105.9 ? 
145 SG  ? G  CYS 56  ? 9 CYS 56  ? 1_555 FE4 ? QA SF4 . ? 9 SF4 202 ? 1_555 S1 ? QA SF4 .   ? 9 SF4 202 ? 1_555 116.6 ? 
146 SG  ? G  CYS 56  ? 9 CYS 56  ? 1_555 FE4 ? QA SF4 . ? 9 SF4 202 ? 1_555 S2 ? QA SF4 .   ? 9 SF4 202 ? 1_555 117.5 ? 
147 S1  ? QA SF4 .   ? 9 SF4 202 ? 1_555 FE4 ? QA SF4 . ? 9 SF4 202 ? 1_555 S2 ? QA SF4 .   ? 9 SF4 202 ? 1_555 105.7 ? 
148 SG  ? G  CYS 56  ? 9 CYS 56  ? 1_555 FE4 ? QA SF4 . ? 9 SF4 202 ? 1_555 S3 ? QA SF4 .   ? 9 SF4 202 ? 1_555 105.7 ? 
149 S1  ? QA SF4 .   ? 9 SF4 202 ? 1_555 FE4 ? QA SF4 . ? 9 SF4 202 ? 1_555 S3 ? QA SF4 .   ? 9 SF4 202 ? 1_555 104.3 ? 
150 S2  ? QA SF4 .   ? 9 SF4 202 ? 1_555 FE4 ? QA SF4 . ? 9 SF4 202 ? 1_555 S3 ? QA SF4 .   ? 9 SF4 202 ? 1_555 105.7 ? 
151 SG  ? G  CYS 59  ? 9 CYS 59  ? 1_555 FE2 ? QA SF4 . ? 9 SF4 202 ? 1_555 S1 ? QA SF4 .   ? 9 SF4 202 ? 1_555 114.0 ? 
152 SG  ? G  CYS 59  ? 9 CYS 59  ? 1_555 FE2 ? QA SF4 . ? 9 SF4 202 ? 1_555 S3 ? QA SF4 .   ? 9 SF4 202 ? 1_555 117.3 ? 
153 S1  ? QA SF4 .   ? 9 SF4 202 ? 1_555 FE2 ? QA SF4 . ? 9 SF4 202 ? 1_555 S3 ? QA SF4 .   ? 9 SF4 202 ? 1_555 104.8 ? 
154 SG  ? G  CYS 59  ? 9 CYS 59  ? 1_555 FE2 ? QA SF4 . ? 9 SF4 202 ? 1_555 S4 ? QA SF4 .   ? 9 SF4 202 ? 1_555 108.8 ? 
155 S1  ? QA SF4 .   ? 9 SF4 202 ? 1_555 FE2 ? QA SF4 . ? 9 SF4 202 ? 1_555 S4 ? QA SF4 .   ? 9 SF4 202 ? 1_555 107.0 ? 
156 S3  ? QA SF4 .   ? 9 SF4 202 ? 1_555 FE2 ? QA SF4 . ? 9 SF4 202 ? 1_555 S4 ? QA SF4 .   ? 9 SF4 202 ? 1_555 104.0 ? 
157 SG  ? G  CYS 63  ? 9 CYS 63  ? 1_555 FE4 ? PA SF4 . ? 9 SF4 201 ? 1_555 S1 ? PA SF4 .   ? 9 SF4 201 ? 1_555 113.0 ? 
158 SG  ? G  CYS 63  ? 9 CYS 63  ? 1_555 FE4 ? PA SF4 . ? 9 SF4 201 ? 1_555 S2 ? PA SF4 .   ? 9 SF4 201 ? 1_555 117.7 ? 
159 S1  ? PA SF4 .   ? 9 SF4 201 ? 1_555 FE4 ? PA SF4 . ? 9 SF4 201 ? 1_555 S2 ? PA SF4 .   ? 9 SF4 201 ? 1_555 98.4  ? 
160 SG  ? G  CYS 63  ? 9 CYS 63  ? 1_555 FE4 ? PA SF4 . ? 9 SF4 201 ? 1_555 S3 ? PA SF4 .   ? 9 SF4 201 ? 1_555 112.4 ? 
161 S1  ? PA SF4 .   ? 9 SF4 201 ? 1_555 FE4 ? PA SF4 . ? 9 SF4 201 ? 1_555 S3 ? PA SF4 .   ? 9 SF4 201 ? 1_555 103.7 ? 
162 S2  ? PA SF4 .   ? 9 SF4 201 ? 1_555 FE4 ? PA SF4 . ? 9 SF4 201 ? 1_555 S3 ? PA SF4 .   ? 9 SF4 201 ? 1_555 110.1 ? 
163 SG  ? G  CYS 98  ? 9 CYS 98  ? 1_555 FE2 ? PA SF4 . ? 9 SF4 201 ? 1_555 S1 ? PA SF4 .   ? 9 SF4 201 ? 1_555 113.2 ? 
164 SG  ? G  CYS 98  ? 9 CYS 98  ? 1_555 FE2 ? PA SF4 . ? 9 SF4 201 ? 1_555 S3 ? PA SF4 .   ? 9 SF4 201 ? 1_555 112.5 ? 
165 S1  ? PA SF4 .   ? 9 SF4 201 ? 1_555 FE2 ? PA SF4 . ? 9 SF4 201 ? 1_555 S3 ? PA SF4 .   ? 9 SF4 201 ? 1_555 104.3 ? 
166 SG  ? G  CYS 98  ? 9 CYS 98  ? 1_555 FE2 ? PA SF4 . ? 9 SF4 201 ? 1_555 S4 ? PA SF4 .   ? 9 SF4 201 ? 1_555 114.5 ? 
167 S1  ? PA SF4 .   ? 9 SF4 201 ? 1_555 FE2 ? PA SF4 . ? 9 SF4 201 ? 1_555 S4 ? PA SF4 .   ? 9 SF4 201 ? 1_555 107.0 ? 
168 S3  ? PA SF4 .   ? 9 SF4 201 ? 1_555 FE2 ? PA SF4 . ? 9 SF4 201 ? 1_555 S4 ? PA SF4 .   ? 9 SF4 201 ? 1_555 104.4 ? 
169 SG  ? G  CYS 101 ? 9 CYS 101 ? 1_555 FE1 ? PA SF4 . ? 9 SF4 201 ? 1_555 S2 ? PA SF4 .   ? 9 SF4 201 ? 1_555 108.8 ? 
170 SG  ? G  CYS 101 ? 9 CYS 101 ? 1_555 FE1 ? PA SF4 . ? 9 SF4 201 ? 1_555 S3 ? PA SF4 .   ? 9 SF4 201 ? 1_555 107.1 ? 
171 S2  ? PA SF4 .   ? 9 SF4 201 ? 1_555 FE1 ? PA SF4 . ? 9 SF4 201 ? 1_555 S3 ? PA SF4 .   ? 9 SF4 201 ? 1_555 110.1 ? 
172 SG  ? G  CYS 101 ? 9 CYS 101 ? 1_555 FE1 ? PA SF4 . ? 9 SF4 201 ? 1_555 S4 ? PA SF4 .   ? 9 SF4 201 ? 1_555 119.4 ? 
173 S2  ? PA SF4 .   ? 9 SF4 201 ? 1_555 FE1 ? PA SF4 . ? 9 SF4 201 ? 1_555 S4 ? PA SF4 .   ? 9 SF4 201 ? 1_555 107.5 ? 
174 S3  ? PA SF4 .   ? 9 SF4 201 ? 1_555 FE1 ? PA SF4 . ? 9 SF4 201 ? 1_555 S4 ? PA SF4 .   ? 9 SF4 201 ? 1_555 103.6 ? 
175 SG  ? G  CYS 104 ? 9 CYS 104 ? 1_555 FE3 ? PA SF4 . ? 9 SF4 201 ? 1_555 S1 ? PA SF4 .   ? 9 SF4 201 ? 1_555 128.5 ? 
176 SG  ? G  CYS 104 ? 9 CYS 104 ? 1_555 FE3 ? PA SF4 . ? 9 SF4 201 ? 1_555 S2 ? PA SF4 .   ? 9 SF4 201 ? 1_555 107.3 ? 
177 S1  ? PA SF4 .   ? 9 SF4 201 ? 1_555 FE3 ? PA SF4 . ? 9 SF4 201 ? 1_555 S2 ? PA SF4 .   ? 9 SF4 201 ? 1_555 98.7  ? 
178 SG  ? G  CYS 104 ? 9 CYS 104 ? 1_555 FE3 ? PA SF4 . ? 9 SF4 201 ? 1_555 S4 ? PA SF4 .   ? 9 SF4 201 ? 1_555 105.6 ? 
179 S1  ? PA SF4 .   ? 9 SF4 201 ? 1_555 FE3 ? PA SF4 . ? 9 SF4 201 ? 1_555 S4 ? PA SF4 .   ? 9 SF4 201 ? 1_555 106.9 ? 
180 S2  ? PA SF4 .   ? 9 SF4 201 ? 1_555 FE3 ? PA SF4 . ? 9 SF4 201 ? 1_555 S4 ? PA SF4 .   ? 9 SF4 201 ? 1_555 108.6 ? 
181 SG  ? G  CYS 108 ? 9 CYS 108 ? 1_555 FE1 ? QA SF4 . ? 9 SF4 202 ? 1_555 S2 ? QA SF4 .   ? 9 SF4 202 ? 1_555 117.8 ? 
182 SG  ? G  CYS 108 ? 9 CYS 108 ? 1_555 FE1 ? QA SF4 . ? 9 SF4 202 ? 1_555 S3 ? QA SF4 .   ? 9 SF4 202 ? 1_555 110.4 ? 
183 S2  ? QA SF4 .   ? 9 SF4 202 ? 1_555 FE1 ? QA SF4 . ? 9 SF4 202 ? 1_555 S3 ? QA SF4 .   ? 9 SF4 202 ? 1_555 107.1 ? 
184 SG  ? G  CYS 108 ? 9 CYS 108 ? 1_555 FE1 ? QA SF4 . ? 9 SF4 202 ? 1_555 S4 ? QA SF4 .   ? 9 SF4 202 ? 1_555 110.4 ? 
185 S2  ? QA SF4 .   ? 9 SF4 202 ? 1_555 FE1 ? QA SF4 . ? 9 SF4 202 ? 1_555 S4 ? QA SF4 .   ? 9 SF4 202 ? 1_555 105.8 ? 
186 S3  ? QA SF4 .   ? 9 SF4 202 ? 1_555 FE1 ? QA SF4 . ? 9 SF4 202 ? 1_555 S4 ? QA SF4 .   ? 9 SF4 202 ? 1_555 104.5 ? 
187 SG  ? Q  CYS 353 ? B CYS 353 ? 1_555 FE4 ? RA SF4 . ? B SF4 501 ? 1_555 S1 ? RA SF4 .   ? B SF4 501 ? 1_555 113.8 ? 
188 SG  ? Q  CYS 353 ? B CYS 353 ? 1_555 FE4 ? RA SF4 . ? B SF4 501 ? 1_555 S2 ? RA SF4 .   ? B SF4 501 ? 1_555 108.4 ? 
189 S1  ? RA SF4 .   ? B SF4 501 ? 1_555 FE4 ? RA SF4 . ? B SF4 501 ? 1_555 S2 ? RA SF4 .   ? B SF4 501 ? 1_555 105.7 ? 
190 SG  ? Q  CYS 353 ? B CYS 353 ? 1_555 FE4 ? RA SF4 . ? B SF4 501 ? 1_555 S3 ? RA SF4 .   ? B SF4 501 ? 1_555 120.1 ? 
191 S1  ? RA SF4 .   ? B SF4 501 ? 1_555 FE4 ? RA SF4 . ? B SF4 501 ? 1_555 S3 ? RA SF4 .   ? B SF4 501 ? 1_555 104.4 ? 
192 S2  ? RA SF4 .   ? B SF4 501 ? 1_555 FE4 ? RA SF4 . ? B SF4 501 ? 1_555 S3 ? RA SF4 .   ? B SF4 501 ? 1_555 103.2 ? 
193 SG  ? Q  CYS 356 ? B CYS 356 ? 1_555 FE1 ? RA SF4 . ? B SF4 501 ? 1_555 S2 ? RA SF4 .   ? B SF4 501 ? 1_555 111.8 ? 
194 SG  ? Q  CYS 356 ? B CYS 356 ? 1_555 FE1 ? RA SF4 . ? B SF4 501 ? 1_555 S3 ? RA SF4 .   ? B SF4 501 ? 1_555 114.9 ? 
195 S2  ? RA SF4 .   ? B SF4 501 ? 1_555 FE1 ? RA SF4 . ? B SF4 501 ? 1_555 S3 ? RA SF4 .   ? B SF4 501 ? 1_555 103.6 ? 
196 SG  ? Q  CYS 356 ? B CYS 356 ? 1_555 FE1 ? RA SF4 . ? B SF4 501 ? 1_555 S4 ? RA SF4 .   ? B SF4 501 ? 1_555 112.2 ? 
197 S2  ? RA SF4 .   ? B SF4 501 ? 1_555 FE1 ? RA SF4 . ? B SF4 501 ? 1_555 S4 ? RA SF4 .   ? B SF4 501 ? 1_555 106.1 ? 
198 S3  ? RA SF4 .   ? B SF4 501 ? 1_555 FE1 ? RA SF4 . ? B SF4 501 ? 1_555 S4 ? RA SF4 .   ? B SF4 501 ? 1_555 107.5 ? 
199 SG  ? Q  CYS 359 ? B CYS 359 ? 1_555 FE2 ? RA SF4 . ? B SF4 501 ? 1_555 S1 ? RA SF4 .   ? B SF4 501 ? 1_555 123.7 ? 
200 SG  ? Q  CYS 359 ? B CYS 359 ? 1_555 FE2 ? RA SF4 . ? B SF4 501 ? 1_555 S3 ? RA SF4 .   ? B SF4 501 ? 1_555 112.8 ? 
201 S1  ? RA SF4 .   ? B SF4 501 ? 1_555 FE2 ? RA SF4 . ? B SF4 501 ? 1_555 S3 ? RA SF4 .   ? B SF4 501 ? 1_555 104.5 ? 
202 SG  ? Q  CYS 359 ? B CYS 359 ? 1_555 FE2 ? RA SF4 . ? B SF4 501 ? 1_555 S4 ? RA SF4 .   ? B SF4 501 ? 1_555 102.1 ? 
203 S1  ? RA SF4 .   ? B SF4 501 ? 1_555 FE2 ? RA SF4 . ? B SF4 501 ? 1_555 S4 ? RA SF4 .   ? B SF4 501 ? 1_555 105.1 ? 
204 S3  ? RA SF4 .   ? B SF4 501 ? 1_555 FE2 ? RA SF4 . ? B SF4 501 ? 1_555 S4 ? RA SF4 .   ? B SF4 501 ? 1_555 107.5 ? 
205 SG  ? Q  CYS 400 ? B CYS 400 ? 1_555 FE3 ? RA SF4 . ? B SF4 501 ? 1_555 S1 ? RA SF4 .   ? B SF4 501 ? 1_555 114.0 ? 
206 SG  ? Q  CYS 400 ? B CYS 400 ? 1_555 FE3 ? RA SF4 . ? B SF4 501 ? 1_555 S2 ? RA SF4 .   ? B SF4 501 ? 1_555 109.4 ? 
207 S1  ? RA SF4 .   ? B SF4 501 ? 1_555 FE3 ? RA SF4 . ? B SF4 501 ? 1_555 S2 ? RA SF4 .   ? B SF4 501 ? 1_555 105.6 ? 
208 SG  ? Q  CYS 400 ? B CYS 400 ? 1_555 FE3 ? RA SF4 . ? B SF4 501 ? 1_555 S4 ? RA SF4 .   ? B SF4 501 ? 1_555 115.8 ? 
209 S1  ? RA SF4 .   ? B SF4 501 ? 1_555 FE3 ? RA SF4 . ? B SF4 501 ? 1_555 S4 ? RA SF4 .   ? B SF4 501 ? 1_555 104.9 ? 
210 S2  ? RA SF4 .   ? B SF4 501 ? 1_555 FE3 ? RA SF4 . ? B SF4 501 ? 1_555 S4 ? RA SF4 .   ? B SF4 501 ? 1_555 106.5 ? 
211 SG  ? R  CYS 83  ? C CYS 83  ? 1_555 FE1 ? UA FES . ? C FES 201 ? 1_555 S1 ? UA FES .   ? C FES 201 ? 1_555 112.2 ? 
212 SG  ? R  CYS 83  ? C CYS 83  ? 1_555 FE1 ? UA FES . ? C FES 201 ? 1_555 S2 ? UA FES .   ? C FES 201 ? 1_555 120.2 ? 
213 S1  ? UA FES .   ? C FES 201 ? 1_555 FE1 ? UA FES . ? C FES 201 ? 1_555 S2 ? UA FES .   ? C FES 201 ? 1_555 87.8  ? 
214 SG  ? R  CYS 83  ? C CYS 83  ? 1_555 FE1 ? UA FES . ? C FES 201 ? 1_555 SG ? R  CYS 88  ? C CYS 88  ? 1_555 105.3 ? 
215 S1  ? UA FES .   ? C FES 201 ? 1_555 FE1 ? UA FES . ? C FES 201 ? 1_555 SG ? R  CYS 88  ? C CYS 88  ? 1_555 111.3 ? 
216 S2  ? UA FES .   ? C FES 201 ? 1_555 FE1 ? UA FES . ? C FES 201 ? 1_555 SG ? R  CYS 88  ? C CYS 88  ? 1_555 119.0 ? 
217 SG  ? R  CYS 124 ? C CYS 124 ? 1_555 FE2 ? UA FES . ? C FES 201 ? 1_555 S1 ? UA FES .   ? C FES 201 ? 1_555 101.6 ? 
218 SG  ? R  CYS 124 ? C CYS 124 ? 1_555 FE2 ? UA FES . ? C FES 201 ? 1_555 S2 ? UA FES .   ? C FES 201 ? 1_555 116.8 ? 
219 S1  ? UA FES .   ? C FES 201 ? 1_555 FE2 ? UA FES . ? C FES 201 ? 1_555 S2 ? UA FES .   ? C FES 201 ? 1_555 87.5  ? 
220 SG  ? R  CYS 124 ? C CYS 124 ? 1_555 FE2 ? UA FES . ? C FES 201 ? 1_555 SG ? R  CYS 128 ? C CYS 128 ? 1_555 116.5 ? 
221 S1  ? UA FES .   ? C FES 201 ? 1_555 FE2 ? UA FES . ? C FES 201 ? 1_555 SG ? R  CYS 128 ? C CYS 128 ? 1_555 111.4 ? 
222 S2  ? UA FES .   ? C FES 201 ? 1_555 FE2 ? UA FES . ? C FES 201 ? 1_555 SG ? R  CYS 128 ? C CYS 128 ? 1_555 117.3 ? 
223 SG  ? S  CYS 34  ? D CYS 34  ? 1_555 FE1 ? YA FES . ? D FES 804 ? 1_555 S1 ? YA FES .   ? D FES 804 ? 1_555 108.6 ? 
224 SG  ? S  CYS 34  ? D CYS 34  ? 1_555 FE1 ? YA FES . ? D FES 804 ? 1_555 S2 ? YA FES .   ? D FES 804 ? 1_555 111.8 ? 
225 S1  ? YA FES .   ? D FES 804 ? 1_555 FE1 ? YA FES . ? D FES 804 ? 1_555 S2 ? YA FES .   ? D FES 804 ? 1_555 91.0  ? 
226 SG  ? S  CYS 34  ? D CYS 34  ? 1_555 FE1 ? YA FES . ? D FES 804 ? 1_555 SG ? S  CYS 45  ? D CYS 45  ? 1_555 112.3 ? 
227 S1  ? YA FES .   ? D FES 804 ? 1_555 FE1 ? YA FES . ? D FES 804 ? 1_555 SG ? S  CYS 45  ? D CYS 45  ? 1_555 122.1 ? 
228 S2  ? YA FES .   ? D FES 804 ? 1_555 FE1 ? YA FES . ? D FES 804 ? 1_555 SG ? S  CYS 45  ? D CYS 45  ? 1_555 109.1 ? 
229 SG  ? S  CYS 48  ? D CYS 48  ? 1_555 FE2 ? YA FES . ? D FES 804 ? 1_555 S1 ? YA FES .   ? D FES 804 ? 1_555 108.5 ? 
230 SG  ? S  CYS 48  ? D CYS 48  ? 1_555 FE2 ? YA FES . ? D FES 804 ? 1_555 S2 ? YA FES .   ? D FES 804 ? 1_555 113.5 ? 
231 S1  ? YA FES .   ? D FES 804 ? 1_555 FE2 ? YA FES . ? D FES 804 ? 1_555 S2 ? YA FES .   ? D FES 804 ? 1_555 91.0  ? 
232 SG  ? S  CYS 48  ? D CYS 48  ? 1_555 FE2 ? YA FES . ? D FES 804 ? 1_555 SG ? S  CYS 83  ? D CYS 83  ? 1_555 115.7 ? 
233 S1  ? YA FES .   ? D FES 804 ? 1_555 FE2 ? YA FES . ? D FES 804 ? 1_555 SG ? S  CYS 83  ? D CYS 83  ? 1_555 101.8 ? 
234 S2  ? YA FES .   ? D FES 804 ? 1_555 FE2 ? YA FES . ? D FES 804 ? 1_555 SG ? S  CYS 83  ? D CYS 83  ? 1_555 121.2 ? 
235 NE2 ? S  HIS 115 ? D HIS 115 ? 1_555 FE3 ? VA SF4 . ? D SF4 801 ? 1_555 S1 ? VA SF4 .   ? D SF4 801 ? 1_555 137.3 ? 
236 NE2 ? S  HIS 115 ? D HIS 115 ? 1_555 FE3 ? VA SF4 . ? D SF4 801 ? 1_555 S2 ? VA SF4 .   ? D SF4 801 ? 1_555 89.8  ? 
237 S1  ? VA SF4 .   ? D SF4 801 ? 1_555 FE3 ? VA SF4 . ? D SF4 801 ? 1_555 S2 ? VA SF4 .   ? D SF4 801 ? 1_555 103.7 ? 
238 NE2 ? S  HIS 115 ? D HIS 115 ? 1_555 FE3 ? VA SF4 . ? D SF4 801 ? 1_555 S4 ? VA SF4 .   ? D SF4 801 ? 1_555 109.1 ? 
239 S1  ? VA SF4 .   ? D SF4 801 ? 1_555 FE3 ? VA SF4 . ? D SF4 801 ? 1_555 S4 ? VA SF4 .   ? D SF4 801 ? 1_555 105.6 ? 
240 S2  ? VA SF4 .   ? D SF4 801 ? 1_555 FE3 ? VA SF4 . ? D SF4 801 ? 1_555 S4 ? VA SF4 .   ? D SF4 801 ? 1_555 106.4 ? 
241 SG  ? S  CYS 119 ? D CYS 119 ? 1_555 FE2 ? VA SF4 . ? D SF4 801 ? 1_555 S1 ? VA SF4 .   ? D SF4 801 ? 1_555 112.6 ? 
242 SG  ? S  CYS 119 ? D CYS 119 ? 1_555 FE2 ? VA SF4 . ? D SF4 801 ? 1_555 S3 ? VA SF4 .   ? D SF4 801 ? 1_555 118.9 ? 
243 S1  ? VA SF4 .   ? D SF4 801 ? 1_555 FE2 ? VA SF4 . ? D SF4 801 ? 1_555 S3 ? VA SF4 .   ? D SF4 801 ? 1_555 104.0 ? 
244 SG  ? S  CYS 119 ? D CYS 119 ? 1_555 FE2 ? VA SF4 . ? D SF4 801 ? 1_555 S4 ? VA SF4 .   ? D SF4 801 ? 1_555 108.7 ? 
245 S1  ? VA SF4 .   ? D SF4 801 ? 1_555 FE2 ? VA SF4 . ? D SF4 801 ? 1_555 S4 ? VA SF4 .   ? D SF4 801 ? 1_555 106.0 ? 
246 S3  ? VA SF4 .   ? D SF4 801 ? 1_555 FE2 ? VA SF4 . ? D SF4 801 ? 1_555 S4 ? VA SF4 .   ? D SF4 801 ? 1_555 105.7 ? 
247 SG  ? S  CYS 122 ? D CYS 122 ? 1_555 FE4 ? VA SF4 . ? D SF4 801 ? 1_555 S1 ? VA SF4 .   ? D SF4 801 ? 1_555 109.5 ? 
248 SG  ? S  CYS 122 ? D CYS 122 ? 1_555 FE4 ? VA SF4 . ? D SF4 801 ? 1_555 S2 ? VA SF4 .   ? D SF4 801 ? 1_555 114.2 ? 
249 S1  ? VA SF4 .   ? D SF4 801 ? 1_555 FE4 ? VA SF4 . ? D SF4 801 ? 1_555 S2 ? VA SF4 .   ? D SF4 801 ? 1_555 104.2 ? 
250 SG  ? S  CYS 122 ? D CYS 122 ? 1_555 FE4 ? VA SF4 . ? D SF4 801 ? 1_555 S3 ? VA SF4 .   ? D SF4 801 ? 1_555 117.3 ? 
251 S1  ? VA SF4 .   ? D SF4 801 ? 1_555 FE4 ? VA SF4 . ? D SF4 801 ? 1_555 S3 ? VA SF4 .   ? D SF4 801 ? 1_555 103.4 ? 
252 S2  ? VA SF4 .   ? D SF4 801 ? 1_555 FE4 ? VA SF4 . ? D SF4 801 ? 1_555 S3 ? VA SF4 .   ? D SF4 801 ? 1_555 107.0 ? 
253 SG  ? S  CYS 128 ? D CYS 128 ? 1_555 FE1 ? VA SF4 . ? D SF4 801 ? 1_555 S2 ? VA SF4 .   ? D SF4 801 ? 1_555 112.3 ? 
254 SG  ? S  CYS 128 ? D CYS 128 ? 1_555 FE1 ? VA SF4 . ? D SF4 801 ? 1_555 S3 ? VA SF4 .   ? D SF4 801 ? 1_555 113.0 ? 
255 S2  ? VA SF4 .   ? D SF4 801 ? 1_555 FE1 ? VA SF4 . ? D SF4 801 ? 1_555 S3 ? VA SF4 .   ? D SF4 801 ? 1_555 106.2 ? 
256 SG  ? S  CYS 128 ? D CYS 128 ? 1_555 FE1 ? VA SF4 . ? D SF4 801 ? 1_555 S4 ? VA SF4 .   ? D SF4 801 ? 1_555 113.7 ? 
257 S2  ? VA SF4 .   ? D SF4 801 ? 1_555 FE1 ? VA SF4 . ? D SF4 801 ? 1_555 S4 ? VA SF4 .   ? D SF4 801 ? 1_555 106.1 ? 
258 S3  ? VA SF4 .   ? D SF4 801 ? 1_555 FE1 ? VA SF4 . ? D SF4 801 ? 1_555 S4 ? VA SF4 .   ? D SF4 801 ? 1_555 104.9 ? 
259 SG  ? S  CYS 181 ? D CYS 181 ? 1_555 FE2 ? WA SF4 . ? D SF4 802 ? 1_555 S1 ? WA SF4 .   ? D SF4 802 ? 1_555 111.7 ? 
260 SG  ? S  CYS 181 ? D CYS 181 ? 1_555 FE2 ? WA SF4 . ? D SF4 802 ? 1_555 S3 ? WA SF4 .   ? D SF4 802 ? 1_555 115.5 ? 
261 S1  ? WA SF4 .   ? D SF4 802 ? 1_555 FE2 ? WA SF4 . ? D SF4 802 ? 1_555 S3 ? WA SF4 .   ? D SF4 802 ? 1_555 106.4 ? 
262 SG  ? S  CYS 181 ? D CYS 181 ? 1_555 FE2 ? WA SF4 . ? D SF4 802 ? 1_555 S4 ? WA SF4 .   ? D SF4 802 ? 1_555 114.9 ? 
263 S1  ? WA SF4 .   ? D SF4 802 ? 1_555 FE2 ? WA SF4 . ? D SF4 802 ? 1_555 S4 ? WA SF4 .   ? D SF4 802 ? 1_555 103.4 ? 
264 S3  ? WA SF4 .   ? D SF4 802 ? 1_555 FE2 ? WA SF4 . ? D SF4 802 ? 1_555 S4 ? WA SF4 .   ? D SF4 802 ? 1_555 103.8 ? 
265 SG  ? S  CYS 184 ? D CYS 184 ? 1_555 FE1 ? WA SF4 . ? D SF4 802 ? 1_555 S2 ? WA SF4 .   ? D SF4 802 ? 1_555 111.0 ? 
266 SG  ? S  CYS 184 ? D CYS 184 ? 1_555 FE1 ? WA SF4 . ? D SF4 802 ? 1_555 S3 ? WA SF4 .   ? D SF4 802 ? 1_555 113.2 ? 
267 S2  ? WA SF4 .   ? D SF4 802 ? 1_555 FE1 ? WA SF4 . ? D SF4 802 ? 1_555 S3 ? WA SF4 .   ? D SF4 802 ? 1_555 107.1 ? 
268 SG  ? S  CYS 184 ? D CYS 184 ? 1_555 FE1 ? WA SF4 . ? D SF4 802 ? 1_555 S4 ? WA SF4 .   ? D SF4 802 ? 1_555 117.2 ? 
269 S2  ? WA SF4 .   ? D SF4 802 ? 1_555 FE1 ? WA SF4 . ? D SF4 802 ? 1_555 S4 ? WA SF4 .   ? D SF4 802 ? 1_555 103.4 ? 
270 S3  ? WA SF4 .   ? D SF4 802 ? 1_555 FE1 ? WA SF4 . ? D SF4 802 ? 1_555 S4 ? WA SF4 .   ? D SF4 802 ? 1_555 104.1 ? 
271 SG  ? S  CYS 187 ? D CYS 187 ? 1_555 FE3 ? WA SF4 . ? D SF4 802 ? 1_555 S1 ? WA SF4 .   ? D SF4 802 ? 1_555 118.2 ? 
272 SG  ? S  CYS 187 ? D CYS 187 ? 1_555 FE3 ? WA SF4 . ? D SF4 802 ? 1_555 S2 ? WA SF4 .   ? D SF4 802 ? 1_555 115.4 ? 
273 S1  ? WA SF4 .   ? D SF4 802 ? 1_555 FE3 ? WA SF4 . ? D SF4 802 ? 1_555 S2 ? WA SF4 .   ? D SF4 802 ? 1_555 105.4 ? 
274 SG  ? S  CYS 187 ? D CYS 187 ? 1_555 FE3 ? WA SF4 . ? D SF4 802 ? 1_555 S4 ? WA SF4 .   ? D SF4 802 ? 1_555 109.2 ? 
275 S1  ? WA SF4 .   ? D SF4 802 ? 1_555 FE3 ? WA SF4 . ? D SF4 802 ? 1_555 S4 ? WA SF4 .   ? D SF4 802 ? 1_555 103.5 ? 
276 S2  ? WA SF4 .   ? D SF4 802 ? 1_555 FE3 ? WA SF4 . ? D SF4 802 ? 1_555 S4 ? WA SF4 .   ? D SF4 802 ? 1_555 103.5 ? 
277 SG  ? S  CYS 230 ? D CYS 230 ? 1_555 FE4 ? WA SF4 . ? D SF4 802 ? 1_555 S1 ? WA SF4 .   ? D SF4 802 ? 1_555 112.5 ? 
278 SG  ? S  CYS 230 ? D CYS 230 ? 1_555 FE4 ? WA SF4 . ? D SF4 802 ? 1_555 S2 ? WA SF4 .   ? D SF4 802 ? 1_555 113.2 ? 
279 S1  ? WA SF4 .   ? D SF4 802 ? 1_555 FE4 ? WA SF4 . ? D SF4 802 ? 1_555 S2 ? WA SF4 .   ? D SF4 802 ? 1_555 104.8 ? 
280 SG  ? S  CYS 230 ? D CYS 230 ? 1_555 FE4 ? WA SF4 . ? D SF4 802 ? 1_555 S3 ? WA SF4 .   ? D SF4 802 ? 1_555 113.5 ? 
281 S1  ? WA SF4 .   ? D SF4 802 ? 1_555 FE4 ? WA SF4 . ? D SF4 802 ? 1_555 S3 ? WA SF4 .   ? D SF4 802 ? 1_555 105.6 ? 
282 S2  ? WA SF4 .   ? D SF4 802 ? 1_555 FE4 ? WA SF4 . ? D SF4 802 ? 1_555 S3 ? WA SF4 .   ? D SF4 802 ? 1_555 106.5 ? 
283 SG  ? S  CYS 256 ? D CYS 256 ? 1_555 FE1 ? XA SF4 . ? D SF4 803 ? 1_555 S2 ? XA SF4 .   ? D SF4 803 ? 1_555 110.7 ? 
284 SG  ? S  CYS 256 ? D CYS 256 ? 1_555 FE1 ? XA SF4 . ? D SF4 803 ? 1_555 S3 ? XA SF4 .   ? D SF4 803 ? 1_555 111.9 ? 
285 S2  ? XA SF4 .   ? D SF4 803 ? 1_555 FE1 ? XA SF4 . ? D SF4 803 ? 1_555 S3 ? XA SF4 .   ? D SF4 803 ? 1_555 103.5 ? 
286 SG  ? S  CYS 256 ? D CYS 256 ? 1_555 FE1 ? XA SF4 . ? D SF4 803 ? 1_555 S4 ? XA SF4 .   ? D SF4 803 ? 1_555 117.0 ? 
287 S2  ? XA SF4 .   ? D SF4 803 ? 1_555 FE1 ? XA SF4 . ? D SF4 803 ? 1_555 S4 ? XA SF4 .   ? D SF4 803 ? 1_555 106.7 ? 
288 S3  ? XA SF4 .   ? D SF4 803 ? 1_555 FE1 ? XA SF4 . ? D SF4 803 ? 1_555 S4 ? XA SF4 .   ? D SF4 803 ? 1_555 106.0 ? 
289 SG  ? S  CYS 259 ? D CYS 259 ? 1_555 FE4 ? XA SF4 . ? D SF4 803 ? 1_555 S1 ? XA SF4 .   ? D SF4 803 ? 1_555 107.7 ? 
290 SG  ? S  CYS 259 ? D CYS 259 ? 1_555 FE4 ? XA SF4 . ? D SF4 803 ? 1_555 S2 ? XA SF4 .   ? D SF4 803 ? 1_555 119.5 ? 
291 S1  ? XA SF4 .   ? D SF4 803 ? 1_555 FE4 ? XA SF4 . ? D SF4 803 ? 1_555 S2 ? XA SF4 .   ? D SF4 803 ? 1_555 106.4 ? 
292 SG  ? S  CYS 259 ? D CYS 259 ? 1_555 FE4 ? XA SF4 . ? D SF4 803 ? 1_555 S3 ? XA SF4 .   ? D SF4 803 ? 1_555 111.7 ? 
293 S1  ? XA SF4 .   ? D SF4 803 ? 1_555 FE4 ? XA SF4 . ? D SF4 803 ? 1_555 S3 ? XA SF4 .   ? D SF4 803 ? 1_555 107.0 ? 
294 S2  ? XA SF4 .   ? D SF4 803 ? 1_555 FE4 ? XA SF4 . ? D SF4 803 ? 1_555 S3 ? XA SF4 .   ? D SF4 803 ? 1_555 103.9 ? 
295 SG  ? S  CYS 263 ? D CYS 263 ? 1_555 FE3 ? XA SF4 . ? D SF4 803 ? 1_555 S1 ? XA SF4 .   ? D SF4 803 ? 1_555 120.7 ? 
296 SG  ? S  CYS 263 ? D CYS 263 ? 1_555 FE3 ? XA SF4 . ? D SF4 803 ? 1_555 S2 ? XA SF4 .   ? D SF4 803 ? 1_555 113.5 ? 
297 S1  ? XA SF4 .   ? D SF4 803 ? 1_555 FE3 ? XA SF4 . ? D SF4 803 ? 1_555 S2 ? XA SF4 .   ? D SF4 803 ? 1_555 103.3 ? 
298 SG  ? S  CYS 263 ? D CYS 263 ? 1_555 FE3 ? XA SF4 . ? D SF4 803 ? 1_555 S4 ? XA SF4 .   ? D SF4 803 ? 1_555 104.1 ? 
299 S1  ? XA SF4 .   ? D SF4 803 ? 1_555 FE3 ? XA SF4 . ? D SF4 803 ? 1_555 S4 ? XA SF4 .   ? D SF4 803 ? 1_555 107.3 ? 
300 S2  ? XA SF4 .   ? D SF4 803 ? 1_555 FE3 ? XA SF4 . ? D SF4 803 ? 1_555 S4 ? XA SF4 .   ? D SF4 803 ? 1_555 107.1 ? 
301 SG  ? S  CYS 291 ? D CYS 291 ? 1_555 FE2 ? XA SF4 . ? D SF4 803 ? 1_555 S1 ? XA SF4 .   ? D SF4 803 ? 1_555 108.6 ? 
302 SG  ? S  CYS 291 ? D CYS 291 ? 1_555 FE2 ? XA SF4 . ? D SF4 803 ? 1_555 S3 ? XA SF4 .   ? D SF4 803 ? 1_555 117.5 ? 
303 S1  ? XA SF4 .   ? D SF4 803 ? 1_555 FE2 ? XA SF4 . ? D SF4 803 ? 1_555 S3 ? XA SF4 .   ? D SF4 803 ? 1_555 106.3 ? 
304 SG  ? S  CYS 291 ? D CYS 291 ? 1_555 FE2 ? XA SF4 . ? D SF4 803 ? 1_555 S4 ? XA SF4 .   ? D SF4 803 ? 1_555 112.1 ? 
305 S1  ? XA SF4 .   ? D SF4 803 ? 1_555 FE2 ? XA SF4 . ? D SF4 803 ? 1_555 S4 ? XA SF4 .   ? D SF4 803 ? 1_555 105.7 ? 
306 S3  ? XA SF4 .   ? D SF4 803 ? 1_555 FE2 ? XA SF4 . ? D SF4 803 ? 1_555 S4 ? XA SF4 .   ? D SF4 803 ? 1_555 106.0 ? 
307 SG  ? V  CYS 45  ? G CYS 45  ? 1_555 FE3 ? ZA SF4 . ? G SF4 201 ? 1_555 S1 ? ZA SF4 .   ? G SF4 201 ? 1_555 95.6  ? 
308 SG  ? V  CYS 45  ? G CYS 45  ? 1_555 FE3 ? ZA SF4 . ? G SF4 201 ? 1_555 S2 ? ZA SF4 .   ? G SF4 201 ? 1_555 118.8 ? 
309 S1  ? ZA SF4 .   ? G SF4 201 ? 1_555 FE3 ? ZA SF4 . ? G SF4 201 ? 1_555 S2 ? ZA SF4 .   ? G SF4 201 ? 1_555 107.0 ? 
310 SG  ? V  CYS 45  ? G CYS 45  ? 1_555 FE3 ? ZA SF4 . ? G SF4 201 ? 1_555 S4 ? ZA SF4 .   ? G SF4 201 ? 1_555 120.6 ? 
311 S1  ? ZA SF4 .   ? G SF4 201 ? 1_555 FE3 ? ZA SF4 . ? G SF4 201 ? 1_555 S4 ? ZA SF4 .   ? G SF4 201 ? 1_555 108.8 ? 
312 S2  ? ZA SF4 .   ? G SF4 201 ? 1_555 FE3 ? ZA SF4 . ? G SF4 201 ? 1_555 S4 ? ZA SF4 .   ? G SF4 201 ? 1_555 104.7 ? 
313 SG  ? V  CYS 46  ? G CYS 46  ? 1_555 FE2 ? ZA SF4 . ? G SF4 201 ? 1_555 S1 ? ZA SF4 .   ? G SF4 201 ? 1_555 106.0 ? 
314 SG  ? V  CYS 46  ? G CYS 46  ? 1_555 FE2 ? ZA SF4 . ? G SF4 201 ? 1_555 S3 ? ZA SF4 .   ? G SF4 201 ? 1_555 114.9 ? 
315 S1  ? ZA SF4 .   ? G SF4 201 ? 1_555 FE2 ? ZA SF4 . ? G SF4 201 ? 1_555 S3 ? ZA SF4 .   ? G SF4 201 ? 1_555 104.6 ? 
316 SG  ? V  CYS 46  ? G CYS 46  ? 1_555 FE2 ? ZA SF4 . ? G SF4 201 ? 1_555 S4 ? ZA SF4 .   ? G SF4 201 ? 1_555 116.4 ? 
317 S1  ? ZA SF4 .   ? G SF4 201 ? 1_555 FE2 ? ZA SF4 . ? G SF4 201 ? 1_555 S4 ? ZA SF4 .   ? G SF4 201 ? 1_555 107.7 ? 
318 S3  ? ZA SF4 .   ? G SF4 201 ? 1_555 FE2 ? ZA SF4 . ? G SF4 201 ? 1_555 S4 ? ZA SF4 .   ? G SF4 201 ? 1_555 106.4 ? 
319 SG  ? V  CYS 111 ? G CYS 111 ? 1_555 FE1 ? ZA SF4 . ? G SF4 201 ? 1_555 S2 ? ZA SF4 .   ? G SF4 201 ? 1_555 115.5 ? 
320 SG  ? V  CYS 111 ? G CYS 111 ? 1_555 FE1 ? ZA SF4 . ? G SF4 201 ? 1_555 S3 ? ZA SF4 .   ? G SF4 201 ? 1_555 105.2 ? 
321 S2  ? ZA SF4 .   ? G SF4 201 ? 1_555 FE1 ? ZA SF4 . ? G SF4 201 ? 1_555 S3 ? ZA SF4 .   ? G SF4 201 ? 1_555 106.0 ? 
322 SG  ? V  CYS 111 ? G CYS 111 ? 1_555 FE1 ? ZA SF4 . ? G SF4 201 ? 1_555 S4 ? ZA SF4 .   ? G SF4 201 ? 1_555 118.0 ? 
323 S2  ? ZA SF4 .   ? G SF4 201 ? 1_555 FE1 ? ZA SF4 . ? G SF4 201 ? 1_555 S4 ? ZA SF4 .   ? G SF4 201 ? 1_555 104.2 ? 
324 S3  ? ZA SF4 .   ? G SF4 201 ? 1_555 FE1 ? ZA SF4 . ? G SF4 201 ? 1_555 S4 ? ZA SF4 .   ? G SF4 201 ? 1_555 107.1 ? 
325 SG  ? V  CYS 140 ? G CYS 140 ? 1_555 FE4 ? ZA SF4 . ? G SF4 201 ? 1_555 S1 ? ZA SF4 .   ? G SF4 201 ? 1_555 115.2 ? 
326 SG  ? V  CYS 140 ? G CYS 140 ? 1_555 FE4 ? ZA SF4 . ? G SF4 201 ? 1_555 S2 ? ZA SF4 .   ? G SF4 201 ? 1_555 108.4 ? 
327 S1  ? ZA SF4 .   ? G SF4 201 ? 1_555 FE4 ? ZA SF4 . ? G SF4 201 ? 1_555 S2 ? ZA SF4 .   ? G SF4 201 ? 1_555 105.8 ? 
328 SG  ? V  CYS 140 ? G CYS 140 ? 1_555 FE4 ? ZA SF4 . ? G SF4 201 ? 1_555 S3 ? ZA SF4 .   ? G SF4 201 ? 1_555 116.7 ? 
329 S1  ? ZA SF4 .   ? G SF4 201 ? 1_555 FE4 ? ZA SF4 . ? G SF4 201 ? 1_555 S3 ? ZA SF4 .   ? G SF4 201 ? 1_555 104.3 ? 
330 S2  ? ZA SF4 .   ? G SF4 201 ? 1_555 FE4 ? ZA SF4 . ? G SF4 201 ? 1_555 S3 ? ZA SF4 .   ? G SF4 201 ? 1_555 105.5 ? 
331 SG  ? W  CYS 53  ? O CYS 53  ? 1_555 FE3 ? BB SF4 . ? O SF4 202 ? 1_555 S1 ? BB SF4 .   ? O SF4 202 ? 1_555 116.9 ? 
332 SG  ? W  CYS 53  ? O CYS 53  ? 1_555 FE3 ? BB SF4 . ? O SF4 202 ? 1_555 S2 ? BB SF4 .   ? O SF4 202 ? 1_555 122.7 ? 
333 S1  ? BB SF4 .   ? O SF4 202 ? 1_555 FE3 ? BB SF4 . ? O SF4 202 ? 1_555 S2 ? BB SF4 .   ? O SF4 202 ? 1_555 101.0 ? 
334 SG  ? W  CYS 53  ? O CYS 53  ? 1_555 FE3 ? BB SF4 . ? O SF4 202 ? 1_555 S4 ? BB SF4 .   ? O SF4 202 ? 1_555 109.5 ? 
335 S1  ? BB SF4 .   ? O SF4 202 ? 1_555 FE3 ? BB SF4 . ? O SF4 202 ? 1_555 S4 ? BB SF4 .   ? O SF4 202 ? 1_555 103.9 ? 
336 S2  ? BB SF4 .   ? O SF4 202 ? 1_555 FE3 ? BB SF4 . ? O SF4 202 ? 1_555 S4 ? BB SF4 .   ? O SF4 202 ? 1_555 100.3 ? 
337 SG  ? W  CYS 56  ? O CYS 56  ? 1_555 FE4 ? BB SF4 . ? O SF4 202 ? 1_555 S1 ? BB SF4 .   ? O SF4 202 ? 1_555 122.3 ? 
338 SG  ? W  CYS 56  ? O CYS 56  ? 1_555 FE4 ? BB SF4 . ? O SF4 202 ? 1_555 S2 ? BB SF4 .   ? O SF4 202 ? 1_555 113.9 ? 
339 S1  ? BB SF4 .   ? O SF4 202 ? 1_555 FE4 ? BB SF4 . ? O SF4 202 ? 1_555 S2 ? BB SF4 .   ? O SF4 202 ? 1_555 100.8 ? 
340 SG  ? W  CYS 56  ? O CYS 56  ? 1_555 FE4 ? BB SF4 . ? O SF4 202 ? 1_555 S3 ? BB SF4 .   ? O SF4 202 ? 1_555 106.5 ? 
341 S1  ? BB SF4 .   ? O SF4 202 ? 1_555 FE4 ? BB SF4 . ? O SF4 202 ? 1_555 S3 ? BB SF4 .   ? O SF4 202 ? 1_555 101.7 ? 
342 S2  ? BB SF4 .   ? O SF4 202 ? 1_555 FE4 ? BB SF4 . ? O SF4 202 ? 1_555 S3 ? BB SF4 .   ? O SF4 202 ? 1_555 110.9 ? 
343 SG  ? W  CYS 59  ? O CYS 59  ? 1_555 FE2 ? BB SF4 . ? O SF4 202 ? 1_555 S1 ? BB SF4 .   ? O SF4 202 ? 1_555 128.9 ? 
344 SG  ? W  CYS 59  ? O CYS 59  ? 1_555 FE2 ? BB SF4 . ? O SF4 202 ? 1_555 S3 ? BB SF4 .   ? O SF4 202 ? 1_555 113.5 ? 
345 S1  ? BB SF4 .   ? O SF4 202 ? 1_555 FE2 ? BB SF4 . ? O SF4 202 ? 1_555 S3 ? BB SF4 .   ? O SF4 202 ? 1_555 101.8 ? 
346 SG  ? W  CYS 59  ? O CYS 59  ? 1_555 FE2 ? BB SF4 . ? O SF4 202 ? 1_555 S4 ? BB SF4 .   ? O SF4 202 ? 1_555 99.7  ? 
347 S1  ? BB SF4 .   ? O SF4 202 ? 1_555 FE2 ? BB SF4 . ? O SF4 202 ? 1_555 S4 ? BB SF4 .   ? O SF4 202 ? 1_555 103.3 ? 
348 S3  ? BB SF4 .   ? O SF4 202 ? 1_555 FE2 ? BB SF4 . ? O SF4 202 ? 1_555 S4 ? BB SF4 .   ? O SF4 202 ? 1_555 107.9 ? 
349 SG  ? W  CYS 63  ? O CYS 63  ? 1_555 FE4 ? AB SF4 . ? O SF4 201 ? 1_555 S1 ? AB SF4 .   ? O SF4 201 ? 1_555 117.7 ? 
350 SG  ? W  CYS 63  ? O CYS 63  ? 1_555 FE4 ? AB SF4 . ? O SF4 201 ? 1_555 S2 ? AB SF4 .   ? O SF4 201 ? 1_555 115.0 ? 
351 S1  ? AB SF4 .   ? O SF4 201 ? 1_555 FE4 ? AB SF4 . ? O SF4 201 ? 1_555 S2 ? AB SF4 .   ? O SF4 201 ? 1_555 103.7 ? 
352 SG  ? W  CYS 63  ? O CYS 63  ? 1_555 FE4 ? AB SF4 . ? O SF4 201 ? 1_555 S3 ? AB SF4 .   ? O SF4 201 ? 1_555 109.9 ? 
353 S1  ? AB SF4 .   ? O SF4 201 ? 1_555 FE4 ? AB SF4 . ? O SF4 201 ? 1_555 S3 ? AB SF4 .   ? O SF4 201 ? 1_555 104.5 ? 
354 S2  ? AB SF4 .   ? O SF4 201 ? 1_555 FE4 ? AB SF4 . ? O SF4 201 ? 1_555 S3 ? AB SF4 .   ? O SF4 201 ? 1_555 104.9 ? 
355 SG  ? W  CYS 98  ? O CYS 98  ? 1_555 FE2 ? AB SF4 . ? O SF4 201 ? 1_555 S1 ? AB SF4 .   ? O SF4 201 ? 1_555 117.8 ? 
356 SG  ? W  CYS 98  ? O CYS 98  ? 1_555 FE2 ? AB SF4 . ? O SF4 201 ? 1_555 S3 ? AB SF4 .   ? O SF4 201 ? 1_555 108.7 ? 
357 S1  ? AB SF4 .   ? O SF4 201 ? 1_555 FE2 ? AB SF4 . ? O SF4 201 ? 1_555 S3 ? AB SF4 .   ? O SF4 201 ? 1_555 104.6 ? 
358 SG  ? W  CYS 98  ? O CYS 98  ? 1_555 FE2 ? AB SF4 . ? O SF4 201 ? 1_555 S4 ? AB SF4 .   ? O SF4 201 ? 1_555 112.8 ? 
359 S1  ? AB SF4 .   ? O SF4 201 ? 1_555 FE2 ? AB SF4 . ? O SF4 201 ? 1_555 S4 ? AB SF4 .   ? O SF4 201 ? 1_555 106.5 ? 
360 S3  ? AB SF4 .   ? O SF4 201 ? 1_555 FE2 ? AB SF4 . ? O SF4 201 ? 1_555 S4 ? AB SF4 .   ? O SF4 201 ? 1_555 105.5 ? 
361 SG  ? W  CYS 101 ? O CYS 101 ? 1_555 FE1 ? AB SF4 . ? O SF4 201 ? 1_555 S2 ? AB SF4 .   ? O SF4 201 ? 1_555 119.3 ? 
362 SG  ? W  CYS 101 ? O CYS 101 ? 1_555 FE1 ? AB SF4 . ? O SF4 201 ? 1_555 S3 ? AB SF4 .   ? O SF4 201 ? 1_555 105.7 ? 
363 S2  ? AB SF4 .   ? O SF4 201 ? 1_555 FE1 ? AB SF4 . ? O SF4 201 ? 1_555 S3 ? AB SF4 .   ? O SF4 201 ? 1_555 105.2 ? 
364 SG  ? W  CYS 101 ? O CYS 101 ? 1_555 FE1 ? AB SF4 . ? O SF4 201 ? 1_555 S4 ? AB SF4 .   ? O SF4 201 ? 1_555 116.1 ? 
365 S2  ? AB SF4 .   ? O SF4 201 ? 1_555 FE1 ? AB SF4 . ? O SF4 201 ? 1_555 S4 ? AB SF4 .   ? O SF4 201 ? 1_555 103.9 ? 
366 S3  ? AB SF4 .   ? O SF4 201 ? 1_555 FE1 ? AB SF4 . ? O SF4 201 ? 1_555 S4 ? AB SF4 .   ? O SF4 201 ? 1_555 105.3 ? 
367 SG  ? W  CYS 104 ? O CYS 104 ? 1_555 FE3 ? AB SF4 . ? O SF4 201 ? 1_555 S1 ? AB SF4 .   ? O SF4 201 ? 1_555 113.9 ? 
368 SG  ? W  CYS 104 ? O CYS 104 ? 1_555 FE3 ? AB SF4 . ? O SF4 201 ? 1_555 S2 ? AB SF4 .   ? O SF4 201 ? 1_555 115.7 ? 
369 S1  ? AB SF4 .   ? O SF4 201 ? 1_555 FE3 ? AB SF4 . ? O SF4 201 ? 1_555 S2 ? AB SF4 .   ? O SF4 201 ? 1_555 104.1 ? 
370 SG  ? W  CYS 104 ? O CYS 104 ? 1_555 FE3 ? AB SF4 . ? O SF4 201 ? 1_555 S4 ? AB SF4 .   ? O SF4 201 ? 1_555 111.7 ? 
371 S1  ? AB SF4 .   ? O SF4 201 ? 1_555 FE3 ? AB SF4 . ? O SF4 201 ? 1_555 S4 ? AB SF4 .   ? O SF4 201 ? 1_555 106.6 ? 
372 S2  ? AB SF4 .   ? O SF4 201 ? 1_555 FE3 ? AB SF4 . ? O SF4 201 ? 1_555 S4 ? AB SF4 .   ? O SF4 201 ? 1_555 103.9 ? 
373 SG  ? W  CYS 108 ? O CYS 108 ? 1_555 FE1 ? BB SF4 . ? O SF4 202 ? 1_555 S2 ? BB SF4 .   ? O SF4 202 ? 1_555 116.1 ? 
374 SG  ? W  CYS 108 ? O CYS 108 ? 1_555 FE1 ? BB SF4 . ? O SF4 202 ? 1_555 S3 ? BB SF4 .   ? O SF4 202 ? 1_555 115.5 ? 
375 S2  ? BB SF4 .   ? O SF4 202 ? 1_555 FE1 ? BB SF4 . ? O SF4 202 ? 1_555 S3 ? BB SF4 .   ? O SF4 202 ? 1_555 108.6 ? 
376 SG  ? W  CYS 108 ? O CYS 108 ? 1_555 FE1 ? BB SF4 . ? O SF4 202 ? 1_555 S4 ? BB SF4 .   ? O SF4 202 ? 1_555 108.1 ? 
377 S2  ? BB SF4 .   ? O SF4 202 ? 1_555 FE1 ? BB SF4 . ? O SF4 202 ? 1_555 S4 ? BB SF4 .   ? O SF4 202 ? 1_555 100.1 ? 
378 S3  ? BB SF4 .   ? O SF4 202 ? 1_555 FE1 ? BB SF4 . ? O SF4 202 ? 1_555 S4 ? BB SF4 .   ? O SF4 202 ? 1_555 106.9 ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  ALA 131 B  . ? ALA 131 2 PRO 132 B  ? PRO 132 2 1 -3.71  
2  HIS 34  D  . ? HIS 34  4 PRO 35  D  ? PRO 35  4 1 0.27   
3  CYS 140 F  . ? CYS 140 6 PRO 141 F  ? PRO 141 6 1 -6.20  
4  TYR 26  G  . ? TYR 26  9 PRO 27  G  ? PRO 27  9 1 1.85   
5  ILE 220 M  . ? ILE 220 L PRO 221 M  ? PRO 221 L 1 1.87   
6  LEU 20  N  . ? LEU 20  M PRO 21  N  ? PRO 21  M 1 -8.16  
7  THR 205 N  . ? THR 205 M PRO 206 N  ? PRO 206 M 1 -6.41  
8  ALA 190 O  . ? ALA 190 N PRO 191 O  ? PRO 191 N 1 -0.59  
9  PRO 337 O  . ? PRO 337 N PRO 338 O  ? PRO 338 N 1 2.38   
10 GLY 52  P  . ? GLY 52  H PRO 53  P  ? PRO 53  H 1 27.55  
11 LEU 221 P  . ? LEU 221 H PRO 222 P  ? PRO 222 H 1 -2.09  
12 ALA 131 R  . ? ALA 131 C PRO 132 R  ? PRO 132 C 1 -4.82  
13 HIS 34  T  . ? HIS 34  E PRO 35  T  ? PRO 35  E 1 -1.90  
14 CYS 140 V  . ? CYS 140 G PRO 141 V  ? PRO 141 G 1 -6.79  
15 TYR 26  W  . ? TYR 26  O PRO 27  W  ? PRO 27  O 1 1.90   
16 ILE 220 CA . ? ILE 220 T PRO 221 CA ? PRO 221 T 1 -0.07  
17 LEU 20  DA . ? LEU 20  U PRO 21  DA ? PRO 21  U 1 -11.33 
18 THR 205 DA . ? THR 205 U PRO 206 DA ? PRO 206 U 1 -8.10  
19 ALA 190 EA . ? ALA 190 V PRO 191 EA ? PRO 191 V 1 -1.59  
20 PRO 337 EA . ? PRO 337 V PRO 338 EA ? PRO 338 V 1 1.37   
21 GLY 52  FA . ? GLY 52  Q PRO 53  FA ? PRO 53  Q 1 28.19  
22 LEU 221 FA . ? LEU 221 Q PRO 222 FA ? PRO 222 Q 1 -1.54  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 4 ? 
AA2 ? 5 ? 
AA3 ? 3 ? 
AA4 ? 5 ? 
AA5 ? 3 ? 
AA6 ? 2 ? 
AA7 ? 3 ? 
AA8 ? 7 ? 
AA9 ? 5 ? 
AB1 ? 2 ? 
AB2 ? 7 ? 
AB3 ? 3 ? 
AB4 ? 3 ? 
AB5 ? 3 ? 
AB6 ? 5 ? 
AB7 ? 2 ? 
AB8 ? 2 ? 
AB9 ? 4 ? 
AC1 ? 2 ? 
AC2 ? 2 ? 
AC3 ? 3 ? 
AC4 ? 7 ? 
AC5 ? 6 ? 
AC6 ? 2 ? 
AC7 ? 2 ? 
AC8 ? 4 ? 
AC9 ? 5 ? 
AD1 ? 3 ? 
AD2 ? 5 ? 
AD3 ? 3 ? 
AD4 ? 2 ? 
AD5 ? 3 ? 
AD6 ? 7 ? 
AD7 ? 5 ? 
AD8 ? 2 ? 
AD9 ? 7 ? 
AE1 ? 3 ? 
AE2 ? 3 ? 
AE3 ? 3 ? 
AE4 ? 5 ? 
AE5 ? 2 ? 
AE6 ? 2 ? 
AE7 ? 4 ? 
AE8 ? 2 ? 
AE9 ? 2 ? 
AF1 ? 3 ? 
AF2 ? 7 ? 
AF3 ? 6 ? 
AF4 ? 2 ? 
AF5 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel      
AA1 2 3 ? parallel      
AA1 3 4 ? parallel      
AA2 1 2 ? anti-parallel 
AA2 2 3 ? parallel      
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
AA3 1 2 ? parallel      
AA3 2 3 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? parallel      
AA4 3 4 ? anti-parallel 
AA4 4 5 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA8 3 4 ? parallel      
AA8 4 5 ? parallel      
AA8 5 6 ? parallel      
AA8 6 7 ? parallel      
AA9 1 2 ? parallel      
AA9 2 3 ? parallel      
AA9 3 4 ? parallel      
AA9 4 5 ? parallel      
AB1 1 2 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB2 2 3 ? parallel      
AB2 3 4 ? anti-parallel 
AB2 4 5 ? parallel      
AB2 5 6 ? anti-parallel 
AB2 6 7 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB5 2 3 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB6 2 3 ? parallel      
AB6 3 4 ? anti-parallel 
AB6 4 5 ? anti-parallel 
AB7 1 2 ? parallel      
AB8 1 2 ? anti-parallel 
AB9 1 2 ? parallel      
AB9 2 3 ? parallel      
AB9 3 4 ? parallel      
AC1 1 2 ? parallel      
AC2 1 2 ? anti-parallel 
AC3 1 2 ? anti-parallel 
AC3 2 3 ? anti-parallel 
AC4 1 2 ? anti-parallel 
AC4 2 3 ? anti-parallel 
AC4 3 4 ? anti-parallel 
AC4 4 5 ? anti-parallel 
AC4 5 6 ? anti-parallel 
AC4 6 7 ? anti-parallel 
AC5 1 2 ? parallel      
AC5 2 3 ? anti-parallel 
AC5 3 4 ? anti-parallel 
AC5 4 5 ? parallel      
AC5 5 6 ? anti-parallel 
AC6 1 2 ? anti-parallel 
AC7 1 2 ? anti-parallel 
AC8 1 2 ? parallel      
AC8 2 3 ? parallel      
AC8 3 4 ? parallel      
AC9 1 2 ? anti-parallel 
AC9 2 3 ? parallel      
AC9 3 4 ? anti-parallel 
AC9 4 5 ? anti-parallel 
AD1 1 2 ? parallel      
AD1 2 3 ? anti-parallel 
AD2 1 2 ? anti-parallel 
AD2 2 3 ? parallel      
AD2 3 4 ? anti-parallel 
AD2 4 5 ? anti-parallel 
AD3 1 2 ? anti-parallel 
AD3 2 3 ? anti-parallel 
AD4 1 2 ? anti-parallel 
AD5 1 2 ? anti-parallel 
AD5 2 3 ? anti-parallel 
AD6 1 2 ? anti-parallel 
AD6 2 3 ? anti-parallel 
AD6 3 4 ? parallel      
AD6 4 5 ? parallel      
AD6 5 6 ? parallel      
AD6 6 7 ? parallel      
AD7 1 2 ? parallel      
AD7 2 3 ? parallel      
AD7 3 4 ? parallel      
AD7 4 5 ? parallel      
AD8 1 2 ? anti-parallel 
AD9 1 2 ? anti-parallel 
AD9 2 3 ? parallel      
AD9 3 4 ? anti-parallel 
AD9 4 5 ? parallel      
AD9 5 6 ? anti-parallel 
AD9 6 7 ? anti-parallel 
AE1 1 2 ? anti-parallel 
AE1 2 3 ? anti-parallel 
AE2 1 2 ? anti-parallel 
AE2 2 3 ? anti-parallel 
AE3 1 2 ? anti-parallel 
AE3 2 3 ? anti-parallel 
AE4 1 2 ? anti-parallel 
AE4 2 3 ? parallel      
AE4 3 4 ? anti-parallel 
AE4 4 5 ? anti-parallel 
AE5 1 2 ? parallel      
AE6 1 2 ? anti-parallel 
AE7 1 2 ? parallel      
AE7 2 3 ? parallel      
AE7 3 4 ? parallel      
AE8 1 2 ? parallel      
AE9 1 2 ? anti-parallel 
AF1 1 2 ? anti-parallel 
AF1 2 3 ? anti-parallel 
AF2 1 2 ? anti-parallel 
AF2 2 3 ? anti-parallel 
AF2 3 4 ? anti-parallel 
AF2 4 5 ? anti-parallel 
AF2 5 6 ? anti-parallel 
AF2 6 7 ? anti-parallel 
AF3 1 2 ? parallel      
AF3 2 3 ? anti-parallel 
AF3 3 4 ? anti-parallel 
AF3 4 5 ? parallel      
AF3 5 6 ? anti-parallel 
AF4 1 2 ? anti-parallel 
AF5 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ASP A  170 ? ARG A  175 ? ASP 1 170 ARG 1 175 
AA1 2 ALA A  127 ? VAL A  134 ? ALA 1 127 VAL 1 134 
AA1 3 HIS A  87  ? ALA A  93  ? HIS 1 87  ALA 1 93  
AA1 4 THR A  217 ? ASN A  220 ? THR 1 217 ASN 1 220 
AA2 1 GLY A  262 ? PRO A  267 ? GLY 1 262 PRO 1 267 
AA2 2 MET A  249 ? SER A  255 ? MET 1 249 SER 1 255 
AA2 3 GLY A  327 ? PRO A  332 ? GLY 1 327 PRO 1 332 
AA2 4 ILE A  287 ? ILE A  291 ? ILE 1 287 ILE 1 291 
AA2 5 LEU A  300 ? PRO A  301 ? LEU 1 300 PRO 1 301 
AA3 1 PHE B  117 ? VAL B  122 ? PHE 2 117 VAL 2 122 
AA3 2 TYR B  78  ? CYS B  83  ? TYR 2 78  CYS 2 83  
AA3 3 ILE B  134 ? VAL B  136 ? ILE 2 134 VAL 2 136 
AA4 1 ARG C  9   ? VAL C  13  ? ARG 3 9   VAL 3 13  
AA4 2 VAL C  2   ? VAL C  6   ? VAL 3 2   VAL 3 6   
AA4 3 MET C  91  ? ASP C  94  ? MET 3 91  ASP 3 94  
AA4 4 LEU C  49  ? GLY C  53  ? LEU 3 49  GLY 3 53  
AA4 5 ALA C  80  ? ALA C  81  ? ALA 3 80  ALA 3 81  
AA5 1 HIS C  168 ? SER C  171 ? HIS 3 168 SER 3 171 
AA5 2 VAL C  174 ? LEU C  176 ? VAL 3 174 LEU 3 176 
AA5 3 LEU C  235 ? ASP C  237 ? LEU 3 235 ASP 3 237 
AA6 1 ASP C  201 ? PHE C  202 ? ASP 3 201 PHE 3 202 
AA6 2 ILE C  211 ? GLY C  212 ? ILE 3 211 GLY 3 212 
AA7 1 GLU C  250 ? THR C  255 ? GLU 3 250 THR 3 255 
AA7 2 GLY C  264 ? THR C  269 ? GLY 3 264 THR 3 269 
AA7 3 LEU C  274 ? ALA C  279 ? LEU 3 274 ALA 3 279 
AA8 1 LEU C  317 ? GLU C  319 ? LEU 3 317 GLU 3 319 
AA8 2 LEU C  310 ? ARG C  312 ? LEU 3 310 ARG 3 312 
AA8 3 VAL C  600 ? PRO C  603 ? VAL 3 600 PRO 3 603 
AA8 4 PHE C  582 ? LEU C  587 ? PHE 3 582 LEU 3 587 
AA8 5 TYR C  565 ? TYR C  568 ? TYR 3 565 TYR 3 568 
AA8 6 VAL C  341 ? LEU C  345 ? VAL 3 341 LEU 3 345 
AA8 7 LEU C  369 ? PHE C  371 ? LEU 3 369 PHE 3 371 
AA9 1 ILE C  464 ? VAL C  467 ? ILE 3 464 VAL 3 467 
AA9 2 ALA C  449 ? ALA C  452 ? ALA 3 449 ALA 3 452 
AA9 3 PHE C  395 ? LEU C  399 ? PHE 3 395 LEU 3 399 
AA9 4 PRO C  503 ? LEU C  507 ? PRO 3 503 LEU 3 507 
AA9 5 VAL C  532 ? ALA C  534 ? VAL 3 532 ALA 3 534 
AB1 1 GLY C  612 ? VAL C  615 ? GLY 3 612 VAL 3 615 
AB1 2 VAL C  621 ? LEU C  624 ? VAL 3 621 LEU 3 624 
AB2 1 ARG C  770 ? VAL C  771 ? ARG 3 770 VAL 3 771 
AB2 2 PHE C  692 ? PRO C  696 ? PHE 3 692 PRO 3 696 
AB2 3 LEU C  758 ? ALA C  762 ? LEU 3 758 ALA 3 762 
AB2 4 GLU C  715 ? ALA C  718 ? GLU 3 715 ALA 3 718 
AB2 5 GLY C  741 ? HIS C  749 ? GLY 3 741 HIS 3 749 
AB2 6 GLN C  733 ? THR C  738 ? GLN 3 733 THR 3 738 
AB2 7 ARG C  774 ? LEU C  776 ? ARG 3 774 LEU 3 776 
AB3 1 THR D  27  ? VAL D  30  ? THR 4 27  VAL 4 30  
AB3 2 ARG D  42  ? THR D  46  ? ARG 4 42  THR 4 46  
AB3 3 GLU D  54  ? HIS D  58  ? GLU 4 54  HIS 4 58  
AB4 1 LYS D  339 ? VAL D  342 ? LYS 4 339 VAL 4 342 
AB4 2 GLY D  351 ? ASP D  360 ? GLY 4 351 ASP 4 360 
AB4 3 THR D  346 ? SER D  348 ? THR 4 346 SER 4 348 
AB5 1 LYS D  339 ? VAL D  342 ? LYS 4 339 VAL 4 342 
AB5 2 GLY D  351 ? ASP D  360 ? GLY 4 351 ASP 4 360 
AB5 3 ARG D  367 ? ARG D  371 ? ARG 4 367 ARG 4 371 
AB6 1 ILE E  17  ? ASN E  20  ? ILE 5 17  ASN 5 20  
AB6 2 ASN E  24  ? VAL E  28  ? ASN 5 24  VAL 5 28  
AB6 3 PHE E  88  ? VAL E  94  ? PHE 5 88  VAL 5 94  
AB6 4 PHE E  68  ? VAL E  75  ? PHE 5 68  VAL 5 75  
AB6 5 PHE E  48  ? ASP E  56  ? PHE 5 48  ASP 5 56  
AB7 1 ARG E  100 ? PRO E  102 ? ARG 5 100 PRO 5 102 
AB7 2 VAL E  125 ? GLU E  127 ? VAL 5 125 GLU 5 127 
AB8 1 THR E  157 ? LEU E  158 ? THR 5 157 LEU 5 158 
AB8 2 TYR E  164 ? ILE E  165 ? TYR 5 164 ILE 5 165 
AB9 1 PRO F  38  ? GLY F  42  ? PRO 6 38  GLY 6 42  
AB9 2 VAL F  77  ? ALA F  81  ? VAL 6 77  ALA 6 81  
AB9 3 TRP F  104 ? MET F  108 ? TRP 6 104 MET 6 108 
AB9 4 VAL F  135 ? VAL F  137 ? VAL 6 135 VAL 6 137 
AC1 1 VAL G  31  ? ALA G  32  ? VAL 9 31  ALA 9 32  
AC1 2 TYR G  161 ? VAL G  162 ? TYR 9 161 VAL 9 162 
AC2 1 GLY G  39  ? LEU G  43  ? GLY 9 39  LEU 9 43  
AC2 2 ILE G  113 ? GLY G  116 ? ILE 9 113 GLY 9 116 
AC3 1 ILE G  68  ? GLU G  74  ? ILE 9 68  GLU 9 74  
AC3 2 ARG G  86  ? ASN G  94  ? ARG 9 86  ASN 9 94  
AC3 3 VAL G  130 ? TYR G  131 ? VAL 9 130 TYR 9 131 
AC4 1 ARG H  30  ? ASP H  36  ? ARG 7 30  ASP 7 36  
AC4 2 ILE H  54  ? SER H  60  ? ILE 7 54  SER 7 60  
AC4 3 PRO H  66  ? VAL H  72  ? PRO 7 66  VAL 7 72  
AC4 4 ILE H  82  ? LEU H  86  ? ILE 7 82  LEU 7 86  
AC4 5 ILE H  91  ? GLU H  98  ? ILE 7 91  GLU 7 98  
AC4 6 GLY H  102 ? THR H  105 ? GLY 7 102 THR 7 105 
AC4 7 ILE H  108 ? PRO H  109 ? ILE 7 108 PRO 7 109 
AC5 1 VAL I  2   ? ARG I  3   ? VAL W 2   ARG W 3   
AC5 2 ASP I  56  ? PHE I  63  ? ASP W 56  PHE W 63  
AC5 3 TYR I  46  ? HIS I  51  ? TYR W 46  HIS W 51  
AC5 4 LYS I  30  ? THR I  35  ? LYS W 30  THR W 35  
AC5 5 PHE I  89  ? VAL I  93  ? PHE W 89  VAL W 93  
AC5 6 ASN I  119 ? PRO I  120 ? ASN W 119 PRO W 120 
AC6 1 ALA M  53  ? ALA M  57  ? ALA L 53  ALA L 57  
AC6 2 PHE M  65  ? LEU M  69  ? PHE L 65  LEU L 69  
AC7 1 PHE N  51  ? LEU N  56  ? PHE M 51  LEU M 56  
AC7 2 VAL N  61  ? PHE N  65  ? VAL M 61  PHE M 65  
AC8 1 LEU Q  171 ? ARG Q  175 ? LEU B 171 ARG B 175 
AC8 2 VAL Q  129 ? VAL Q  134 ? VAL B 129 VAL B 134 
AC8 3 TYR Q  88  ? ALA Q  93  ? TYR B 88  ALA B 93  
AC8 4 THR Q  216 ? ASN Q  220 ? THR B 216 ASN B 220 
AC9 1 GLY Q  262 ? PRO Q  267 ? GLY B 262 PRO B 267 
AC9 2 MET Q  249 ? SER Q  255 ? MET B 249 SER B 255 
AC9 3 GLY Q  327 ? PRO Q  332 ? GLY B 327 PRO B 332 
AC9 4 ILE Q  287 ? ILE Q  291 ? ILE B 287 ILE B 291 
AC9 5 LEU Q  300 ? PRO Q  301 ? LEU B 300 PRO B 301 
AD1 1 PHE R  117 ? VAL R  122 ? PHE C 117 VAL C 122 
AD1 2 TYR R  78  ? CYS R  83  ? TYR C 78  CYS C 83  
AD1 3 ILE R  134 ? VAL R  136 ? ILE C 134 VAL C 136 
AD2 1 ARG S  9   ? VAL S  13  ? ARG D 9   VAL D 13  
AD2 2 VAL S  2   ? VAL S  6   ? VAL D 2   VAL D 6   
AD2 3 MET S  91  ? ASP S  94  ? MET D 91  ASP D 94  
AD2 4 LEU S  49  ? GLY S  53  ? LEU D 49  GLY D 53  
AD2 5 ALA S  80  ? ALA S  81  ? ALA D 80  ALA D 81  
AD3 1 HIS S  168 ? SER S  171 ? HIS D 168 SER D 171 
AD3 2 VAL S  174 ? LEU S  176 ? VAL D 174 LEU D 176 
AD3 3 LEU S  235 ? ASP S  237 ? LEU D 235 ASP D 237 
AD4 1 ASP S  201 ? PHE S  202 ? ASP D 201 PHE D 202 
AD4 2 ILE S  211 ? GLY S  212 ? ILE D 211 GLY D 212 
AD5 1 GLU S  250 ? THR S  255 ? GLU D 250 THR D 255 
AD5 2 GLY S  264 ? ARG S  270 ? GLY D 264 ARG D 270 
AD5 3 GLU S  273 ? ALA S  279 ? GLU D 273 ALA D 279 
AD6 1 LEU S  317 ? GLU S  319 ? LEU D 317 GLU D 319 
AD6 2 LEU S  310 ? ARG S  312 ? LEU D 310 ARG D 312 
AD6 3 VAL S  600 ? PRO S  603 ? VAL D 600 PRO D 603 
AD6 4 PHE S  582 ? LEU S  587 ? PHE D 582 LEU D 587 
AD6 5 TYR S  565 ? TYR S  568 ? TYR D 565 TYR D 568 
AD6 6 VAL S  341 ? TYR S  344 ? VAL D 341 TYR D 344 
AD6 7 LEU S  369 ? ASP S  370 ? LEU D 369 ASP D 370 
AD7 1 ILE S  464 ? VAL S  467 ? ILE D 464 VAL D 467 
AD7 2 MET S  448 ? ALA S  452 ? MET D 448 ALA D 452 
AD7 3 PHE S  395 ? LEU S  399 ? PHE D 395 LEU D 399 
AD7 4 PRO S  503 ? LEU S  507 ? PRO D 503 LEU D 507 
AD7 5 VAL S  532 ? ALA S  534 ? VAL D 532 ALA D 534 
AD8 1 GLY S  612 ? VAL S  615 ? GLY D 612 VAL D 615 
AD8 2 VAL S  621 ? LEU S  624 ? VAL D 621 LEU D 624 
AD9 1 ARG S  770 ? VAL S  771 ? ARG D 770 VAL D 771 
AD9 2 PHE S  692 ? PRO S  696 ? PHE D 692 PRO D 696 
AD9 3 LEU S  758 ? ALA S  762 ? LEU D 758 ALA D 762 
AD9 4 GLU S  715 ? ALA S  718 ? GLU D 715 ALA D 718 
AD9 5 GLY S  741 ? HIS S  749 ? GLY D 741 HIS D 749 
AD9 6 GLN S  733 ? THR S  738 ? GLN D 733 THR D 738 
AD9 7 ARG S  774 ? LEU S  776 ? ARG D 774 LEU D 776 
AE1 1 LEU T  28  ? VAL T  30  ? LEU E 28  VAL E 30  
AE1 2 ARG T  42  ? THR T  46  ? ARG E 42  THR E 46  
AE1 3 GLU T  54  ? HIS T  58  ? GLU E 54  HIS E 58  
AE2 1 LYS T  339 ? VAL T  342 ? LYS E 339 VAL E 342 
AE2 2 GLY T  351 ? ASP T  360 ? GLY E 351 ASP E 360 
AE2 3 THR T  346 ? SER T  348 ? THR E 346 SER E 348 
AE3 1 LYS T  339 ? VAL T  342 ? LYS E 339 VAL E 342 
AE3 2 GLY T  351 ? ASP T  360 ? GLY E 351 ASP E 360 
AE3 3 ARG T  367 ? ARG T  371 ? ARG E 367 ARG E 371 
AE4 1 ILE U  17  ? ASN U  20  ? ILE F 17  ASN F 20  
AE4 2 ASN U  24  ? VAL U  28  ? ASN F 24  VAL F 28  
AE4 3 ARG U  87  ? VAL U  94  ? ARG F 87  VAL F 94  
AE4 4 PHE U  68  ? VAL U  75  ? PHE F 68  VAL F 75  
AE4 5 PHE U  48  ? ASP U  56  ? PHE F 48  ASP F 56  
AE5 1 ARG U  100 ? PRO U  102 ? ARG F 100 PRO F 102 
AE5 2 VAL U  125 ? GLU U  127 ? VAL F 125 GLU F 127 
AE6 1 THR U  157 ? LEU U  158 ? THR F 157 LEU F 158 
AE6 2 TYR U  164 ? ILE U  165 ? TYR F 164 ILE F 165 
AE7 1 PRO V  38  ? GLY V  42  ? PRO G 38  GLY G 42  
AE7 2 VAL V  77  ? ALA V  81  ? VAL G 77  ALA G 81  
AE7 3 TRP V  104 ? MET V  108 ? TRP G 104 MET G 108 
AE7 4 VAL V  135 ? VAL V  137 ? VAL G 135 VAL G 137 
AE8 1 VAL W  31  ? ALA W  32  ? VAL O 31  ALA O 32  
AE8 2 TYR W  161 ? VAL W  162 ? TYR O 161 VAL O 162 
AE9 1 HIS W  41  ? LEU W  43  ? HIS O 41  LEU O 43  
AE9 2 ILE W  113 ? LEU W  115 ? ILE O 113 LEU O 115 
AF1 1 ILE W  68  ? GLU W  74  ? ILE O 68  GLU O 74  
AF1 2 ARG W  86  ? ASN W  94  ? ARG O 86  ASN O 94  
AF1 3 VAL W  130 ? TYR W  131 ? VAL O 130 TYR O 131 
AF2 1 ARG X  30  ? ASP X  36  ? ARG I 30  ASP I 36  
AF2 2 ILE X  54  ? SER X  60  ? ILE I 54  SER I 60  
AF2 3 PRO X  66  ? VAL X  72  ? PRO I 66  VAL I 72  
AF2 4 ILE X  82  ? LEU X  86  ? ILE I 82  LEU I 86  
AF2 5 ILE X  91  ? GLU X  98  ? ILE I 91  GLU I 98  
AF2 6 GLY X  102 ? THR X  105 ? GLY I 102 THR I 105 
AF2 7 ILE X  108 ? PRO X  109 ? ILE I 108 PRO I 109 
AF3 1 VAL Y  2   ? ARG Y  3   ? VAL X 2   ARG X 3   
AF3 2 ASP Y  56  ? PHE Y  63  ? ASP X 56  PHE X 63  
AF3 3 TYR Y  46  ? HIS Y  51  ? TYR X 46  HIS X 51  
AF3 4 LYS Y  30  ? THR Y  35  ? LYS X 30  THR X 35  
AF3 5 PHE Y  89  ? VAL Y  93  ? PHE X 89  VAL X 93  
AF3 6 ALA Y  118 ? PRO Y  120 ? ALA X 118 PRO X 120 
AF4 1 ALA CA 53  ? ALA CA 57  ? ALA T 53  ALA T 57  
AF4 2 PHE CA 65  ? LEU CA 69  ? PHE T 65  LEU T 69  
AF5 1 PHE DA 51  ? LEU DA 56  ? PHE U 51  LEU U 56  
AF5 2 VAL DA 61  ? PHE DA 65  ? VAL U 61  PHE U 65  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O HIS A  174 ? O HIS 1 174 N ILE A  132 ? N ILE 1 132 
AA1 2 3 O TYR A  131 ? O TYR 1 131 N CYS A  91  ? N CYS 1 91  
AA1 3 4 N ILE A  90  ? N ILE 1 90  O THR A  217 ? O THR 1 217 
AA2 1 2 O TYR A  264 ? O TYR 1 264 N TYR A  252 ? N TYR 1 252 
AA2 2 3 N GLN A  253 ? N GLN 1 253 O VAL A  328 ? O VAL 1 328 
AA2 3 4 O ILE A  331 ? O ILE 1 331 N ALA A  289 ? N ALA 1 289 
AA2 4 5 N ILE A  290 ? N ILE 1 290 O LEU A  300 ? O LEU 1 300 
AA3 1 2 O VAL B  122 ? O VAL 2 122 N VAL B  82  ? N VAL 2 82  
AA3 2 3 N GLN B  81  ? N GLN 2 81  O GLN B  135 ? O GLN 2 135 
AA4 1 2 O VAL C  11  ? O VAL 3 11  N VAL C  4   ? N VAL 3 4   
AA4 2 3 N LYS C  5   ? N LYS 3 5   O VAL C  93  ? O VAL 3 93  
AA4 3 4 O VAL C  92  ? O VAL 3 92  N GLY C  53  ? N GLY 3 53  
AA4 4 5 N VAL C  50  ? N VAL 3 50  O ALA C  80  ? O ALA 3 80  
AA5 1 2 N HIS C  168 ? N HIS 3 168 O LEU C  176 ? O LEU 3 176 
AA5 2 3 N ILE C  175 ? N ILE 3 175 O LEU C  236 ? O LEU 3 236 
AA6 1 2 N ASP C  201 ? N ASP 3 201 O GLY C  212 ? O GLY 3 212 
AA7 1 2 N GLU C  250 ? N GLU 3 250 O THR C  269 ? O THR 3 269 
AA7 2 3 N ASP C  268 ? N ASP 3 268 O ARG C  276 ? O ARG 3 276 
AA8 1 2 O VAL C  318 ? O VAL 3 318 N VAL C  311 ? N VAL 3 311 
AA8 2 3 N LEU C  310 ? N LEU 3 310 O VAL C  601 ? O VAL 3 601 
AA8 3 4 O LEU C  602 ? O LEU 3 602 N MET C  585 ? N MET 3 585 
AA8 4 5 O VAL C  584 ? O VAL 3 584 N TYR C  568 ? N TYR 3 568 
AA8 5 6 O TYR C  567 ? O TYR 3 567 N TYR C  344 ? N TYR 3 344 
AA8 6 7 N LEU C  345 ? N LEU 3 345 O ASP C  370 ? O ASP 3 370 
AA9 1 2 O GLU C  466 ? O GLU 3 466 N LEU C  450 ? N LEU 3 450 
AA9 2 3 O PHE C  451 ? O PHE 3 451 N VAL C  398 ? N VAL 3 398 
AA9 3 4 N LEU C  397 ? N LEU 3 397 O VAL C  504 ? O VAL 3 504 
AA9 4 5 N LEU C  507 ? N LEU 3 507 O LEU C  533 ? O LEU 3 533 
AB1 1 2 N GLY C  612 ? N GLY 3 612 O LEU C  624 ? O LEU 3 624 
AB2 1 2 O VAL C  771 ? O VAL 3 771 N PHE C  692 ? N PHE 3 692 
AB2 2 3 N TYR C  693 ? N TYR 3 693 O LEU C  760 ? O LEU 3 760 
AB2 3 4 O TYR C  759 ? O TYR 3 759 N TRP C  717 ? N TRP 3 717 
AB2 4 5 N LEU C  716 ? N LEU 3 716 O VAL C  748 ? O VAL 3 748 
AB2 5 6 O ALA C  745 ? O ALA 3 745 N VAL C  734 ? N VAL 3 734 
AB2 6 7 N GLU C  737 ? N GLU 3 737 O ARG C  774 ? O ARG 3 774 
AB3 1 2 N VAL D  30  ? N VAL 4 30  O LEU D  43  ? O LEU 4 43  
AB3 2 3 N THR D  46  ? N THR 4 46  O GLU D  54  ? O GLU 4 54  
AB4 1 2 N GLY D  340 ? N GLY 4 340 O SER D  359 ? O SER 4 359 
AB4 2 3 O GLY D  351 ? O GLY 4 351 N SER D  348 ? N SER 4 348 
AB5 1 2 N GLY D  340 ? N GLY 4 340 O SER D  359 ? O SER 4 359 
AB5 2 3 N VAL D  358 ? N VAL 4 358 O ARG D  367 ? O ARG 4 367 
AB6 1 2 N GLU E  18  ? N GLU 5 18  O TRP E  26  ? O TRP 5 26  
AB6 2 3 N LEU E  25  ? N LEU 5 25  O PHE E  89  ? O PHE 5 89  
AB6 3 4 O VAL E  94  ? O VAL 5 94  N PHE E  68  ? N PHE 5 68  
AB6 4 5 O VAL E  75  ? O VAL 5 75  N PHE E  48  ? N PHE 5 48  
AB7 1 2 N LEU E  101 ? N LEU 5 101 O GLU E  127 ? O GLU 5 127 
AB8 1 2 N THR E  157 ? N THR 5 157 O ILE E  165 ? O ILE 5 165 
AB9 1 2 N ALA F  39  ? N ALA 6 39  O VAL F  77  ? O VAL 6 77  
AB9 2 3 N MET F  78  ? N MET 6 78  O TRP F  104 ? O TRP 6 104 
AB9 3 4 N SER F  107 ? N SER 6 107 O VAL F  135 ? O VAL 6 135 
AC1 1 2 N VAL G  31  ? N VAL 9 31  O VAL G  162 ? O VAL 9 162 
AC2 1 2 N VAL G  42  ? N VAL 9 42  O VAL G  114 ? O VAL 9 114 
AC3 1 2 N ALA G  73  ? N ALA 9 73  O TYR G  87  ? O TYR 9 87  
AC3 2 3 N ILE G  93  ? N ILE 9 93  O TYR G  131 ? O TYR 9 131 
AC4 1 2 N ALA H  35  ? N ALA 7 35  O THR H  56  ? O THR 7 56  
AC4 2 3 N LEU H  59  ? N LEU 7 59  O PHE H  67  ? O PHE 7 67  
AC4 3 4 N ASP H  71  ? N ASP 7 71  O GLY H  83  ? O GLY 7 83  
AC4 4 5 N LEU H  84  ? N LEU 7 84  O LEU H  93  ? O LEU 7 93  
AC4 5 6 N HIS H  96  ? N HIS 7 96  O VAL H  104 ? O VAL 7 104 
AC4 6 7 N THR H  105 ? N THR 7 105 O ILE H  108 ? O ILE 7 108 
AC5 1 2 N VAL I  2   ? N VAL W 2   O ASP I  56  ? O ASP W 56  
AC5 2 3 O LEU I  57  ? O LEU W 57  N LEU I  50  ? N LEU W 50  
AC5 3 4 O HIS I  51  ? O HIS W 51  N LYS I  30  ? N LYS W 30  
AC5 4 5 N THR I  35  ? N THR W 35  O ALA I  92  ? O ALA W 92  
AC5 5 6 N GLU I  91  ? N GLU W 91  O ASN I  119 ? O ASN W 119 
AC6 1 2 N PHE M  55  ? N PHE L 55  O LEU M  67  ? O LEU L 67  
AC7 1 2 N LEU N  55  ? N LEU M 55  O VAL N  61  ? O VAL M 61  
AC8 1 2 O HIS Q  174 ? O HIS B 174 N VAL Q  134 ? N VAL B 134 
AC8 2 3 O TYR Q  133 ? O TYR B 133 N CYS Q  91  ? N CYS B 91  
AC8 3 4 N ILE Q  90  ? N ILE B 90  O THR Q  217 ? O THR B 217 
AC9 1 2 O TYR Q  264 ? O TYR B 264 N TYR Q  252 ? N TYR B 252 
AC9 2 3 N GLN Q  253 ? N GLN B 253 O VAL Q  328 ? O VAL B 328 
AC9 3 4 O ILE Q  331 ? O ILE B 331 N ALA Q  289 ? N ALA B 289 
AC9 4 5 N ILE Q  290 ? N ILE B 290 O LEU Q  300 ? O LEU B 300 
AD1 1 2 O VAL R  122 ? O VAL C 122 N VAL R  82  ? N VAL C 82  
AD1 2 3 N GLN R  81  ? N GLN C 81  O GLN R  135 ? O GLN C 135 
AD2 1 2 O VAL S  11  ? O VAL D 11  N VAL S  4   ? N VAL D 4   
AD2 2 3 N LYS S  5   ? N LYS D 5   O VAL S  93  ? O VAL D 93  
AD2 3 4 O ASP S  94  ? O ASP D 94  N ARG S  51  ? N ARG D 51  
AD2 4 5 N VAL S  50  ? N VAL D 50  O ALA S  80  ? O ALA D 80  
AD3 1 2 N HIS S  168 ? N HIS D 168 O LEU S  176 ? O LEU D 176 
AD3 2 3 N ILE S  175 ? N ILE D 175 O LEU S  236 ? O LEU D 236 
AD4 1 2 N ASP S  201 ? N ASP D 201 O GLY S  212 ? O GLY D 212 
AD5 1 2 N THR S  252 ? N THR D 252 O ALA S  267 ? O ALA D 267 
AD5 2 3 N ASP S  268 ? N ASP D 268 O ARG S  276 ? O ARG D 276 
AD6 1 2 O VAL S  318 ? O VAL D 318 N VAL S  311 ? N VAL D 311 
AD6 2 3 N LEU S  310 ? N LEU D 310 O VAL S  601 ? O VAL D 601 
AD6 3 4 O VAL S  600 ? O VAL D 600 N MET S  585 ? N MET D 585 
AD6 4 5 O HIS S  586 ? O HIS D 586 N TYR S  568 ? N TYR D 568 
AD6 5 6 O TYR S  565 ? O TYR D 565 N GLY S  342 ? N GLY D 342 
AD6 6 7 N LEU S  343 ? N LEU D 343 O ASP S  370 ? O ASP D 370 
AD7 1 2 O ILE S  464 ? O ILE D 464 N LEU S  450 ? N LEU D 450 
AD7 2 3 O ALA S  449 ? O ALA D 449 N VAL S  398 ? N VAL D 398 
AD7 3 4 N LEU S  397 ? N LEU D 397 O ILE S  506 ? O ILE D 506 
AD7 4 5 N LEU S  505 ? N LEU D 505 O LEU S  533 ? O LEU D 533 
AD8 1 2 N GLY S  612 ? N GLY D 612 O LEU S  624 ? O LEU D 624 
AD9 1 2 O VAL S  771 ? O VAL D 771 N PHE S  692 ? N PHE D 692 
AD9 2 3 N ARG S  695 ? N ARG D 695 O LEU S  760 ? O LEU D 760 
AD9 3 4 O SER S  761 ? O SER D 761 N GLU S  715 ? N GLU D 715 
AD9 4 5 N LEU S  716 ? N LEU D 716 O VAL S  748 ? O VAL D 748 
AD9 5 6 O VAL S  743 ? O VAL D 743 N VAL S  736 ? N VAL D 736 
AD9 6 7 N GLU S  737 ? N GLU D 737 O ARG S  774 ? O ARG D 774 
AE1 1 2 N VAL T  30  ? N VAL E 30  O LEU T  43  ? O LEU E 43  
AE1 2 3 N THR T  46  ? N THR E 46  O GLU T  54  ? O GLU E 54  
AE2 1 2 N GLY T  340 ? N GLY E 340 O SER T  359 ? O SER E 359 
AE2 2 3 O GLY T  351 ? O GLY E 351 N SER T  348 ? N SER E 348 
AE3 1 2 N GLY T  340 ? N GLY E 340 O SER T  359 ? O SER E 359 
AE3 2 3 N VAL T  358 ? N VAL E 358 O ARG T  367 ? O ARG E 367 
AE4 1 2 N GLU U  18  ? N GLU F 18  O TRP U  26  ? O TRP F 26  
AE4 2 3 N VAL U  27  ? N VAL F 27  O ARG U  91  ? O ARG F 91  
AE4 3 4 O VAL U  94  ? O VAL F 94  N PHE U  68  ? N PHE F 68  
AE4 4 5 O VAL U  71  ? O VAL F 71  N VAL U  53  ? N VAL F 53  
AE5 1 2 N LEU U  101 ? N LEU F 101 O GLU U  127 ? O GLU F 127 
AE6 1 2 N THR U  157 ? N THR F 157 O ILE U  165 ? O ILE F 165 
AE7 1 2 N ALA V  39  ? N ALA G 39  O VAL V  77  ? O VAL G 77  
AE7 2 3 N MET V  78  ? N MET G 78  O ILE V  106 ? O ILE G 106 
AE7 3 4 N SER V  107 ? N SER G 107 O VAL V  135 ? O VAL G 135 
AE8 1 2 N VAL W  31  ? N VAL O 31  O VAL W  162 ? O VAL O 162 
AE9 1 2 N VAL W  42  ? N VAL O 42  O VAL W  114 ? O VAL O 114 
AF1 1 2 N GLU W  71  ? N GLU O 71  O VAL W  90  ? O VAL O 90  
AF1 2 3 N ILE W  93  ? N ILE O 93  O TYR W  131 ? O TYR O 131 
AF2 1 2 N ALA X  35  ? N ALA I 35  O THR X  56  ? O THR I 56  
AF2 2 3 N ALA X  57  ? N ALA I 57  O ALA X  70  ? O ALA I 70  
AF2 3 4 N ASP X  71  ? N ASP I 71  O GLY X  83  ? O GLY I 83  
AF2 4 5 N LEU X  84  ? N LEU I 84  O LEU X  93  ? O LEU I 93  
AF2 5 6 N HIS X  96  ? N HIS I 96  O VAL X  104 ? O VAL I 104 
AF2 6 7 N THR X  105 ? N THR I 105 O ILE X  108 ? O ILE I 108 
AF3 1 2 N VAL Y  2   ? N VAL X 2   O ASP Y  56  ? O ASP X 56  
AF3 2 3 O PHE Y  63  ? O PHE X 63  N TYR Y  46  ? N TYR X 46  
AF3 3 4 O HIS Y  51  ? O HIS X 51  N LYS Y  30  ? N LYS X 30  
AF3 4 5 N THR Y  35  ? N THR X 35  O ALA Y  92  ? O ALA X 92  
AF3 5 6 N GLU Y  91  ? N GLU X 91  O ASN Y  119 ? O ASN X 119 
AF4 1 2 N ALA CA 53  ? N ALA T 53  O LEU CA 69  ? O LEU T 69  
AF5 1 2 N LEU DA 56  ? N LEU U 56  O VAL DA 61  ? O VAL U 61  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software 1 SF4 501 ? 10 'binding site for residue SF4 1 501' 
AC2 Software 1 FMN 502 ? 14 'binding site for residue FMN 1 502' 
AC3 Software 1 NAI 503 ? 13 'binding site for residue NAI 1 503' 
AC4 Software 2 FES 201 ? 9  'binding site for residue FES 2 201' 
AC5 Software 3 SF4 801 ? 8  'binding site for residue SF4 3 801' 
AC6 Software 3 SF4 802 ? 5  'binding site for residue SF4 3 802' 
AC7 Software 3 SF4 803 ? 10 'binding site for residue SF4 3 803' 
AC8 Software 3 FES 804 ? 7  'binding site for residue FES 3 804' 
AC9 Software 6 SF4 201 ? 11 'binding site for residue SF4 6 201' 
AD1 Software 9 SF4 201 ? 9  'binding site for residue SF4 9 201' 
AD2 Software 9 SF4 202 ? 12 'binding site for residue SF4 9 202' 
AD3 Software B SF4 501 ? 8  'binding site for residue SF4 B 501' 
AD4 Software B FMN 502 ? 14 'binding site for residue FMN B 502' 
AD5 Software B NAI 503 ? 9  'binding site for residue NAI B 503' 
AD6 Software C FES 201 ? 9  'binding site for residue FES C 201' 
AD7 Software D SF4 801 ? 8  'binding site for residue SF4 D 801' 
AD8 Software D SF4 802 ? 8  'binding site for residue SF4 D 802' 
AD9 Software D SF4 803 ? 9  'binding site for residue SF4 D 803' 
AE1 Software D FES 804 ? 8  'binding site for residue FES D 804' 
AE2 Software G SF4 201 ? 11 'binding site for residue SF4 G 201' 
AE3 Software O SF4 201 ? 11 'binding site for residue SF4 O 201' 
AE4 Software O SF4 202 ? 11 'binding site for residue SF4 O 202' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 10 PRO A  199 ? PRO 1 199 . ? 1_555 ? 
2   AC1 10 SER A  352 ? SER 1 352 . ? 1_555 ? 
3   AC1 10 CYS A  353 ? CYS 1 353 . ? 1_555 ? 
4   AC1 10 GLY A  354 ? GLY 1 354 . ? 1_555 ? 
5   AC1 10 LYS A  355 ? LYS 1 355 . ? 1_555 ? 
6   AC1 10 CYS A  356 ? CYS 1 356 . ? 1_555 ? 
7   AC1 10 CYS A  359 ? CYS 1 359 . ? 1_555 ? 
8   AC1 10 SER A  398 ? SER 1 398 . ? 1_555 ? 
9   AC1 10 CYS A  400 ? CYS 1 400 . ? 1_555 ? 
10  AC1 10 ALA A  403 ? ALA 1 403 . ? 1_555 ? 
11  AC2 14 GLY A  64  ? GLY 1 64  . ? 1_555 ? 
12  AC2 14 ARG A  65  ? ARG 1 65  . ? 1_555 ? 
13  AC2 14 GLY A  66  ? GLY 1 66  . ? 1_555 ? 
14  AC2 14 LYS A  75  ? LYS 1 75  . ? 1_555 ? 
15  AC2 14 ASN A  92  ? ASN 1 92  . ? 1_555 ? 
16  AC2 14 ASP A  94  ? ASP 1 94  . ? 1_555 ? 
17  AC2 14 GLU A  184 ? GLU 1 184 . ? 1_555 ? 
18  AC2 14 GLU A  185 ? GLU 1 185 . ? 1_555 ? 
19  AC2 14 ILE A  218 ? ILE 1 218 . ? 1_555 ? 
20  AC2 14 ASN A  219 ? ASN 1 219 . ? 1_555 ? 
21  AC2 14 ASN A  220 ? ASN 1 220 . ? 1_555 ? 
22  AC2 14 THR A  223 ? THR 1 223 . ? 1_555 ? 
23  AC2 14 PRO A  401 ? PRO 1 401 . ? 1_555 ? 
24  AC2 14 NAI IA .   ? NAI 1 503 . ? 1_555 ? 
25  AC3 13 GLY A  66  ? GLY 1 66  . ? 1_555 ? 
26  AC3 13 GLY A  67  ? GLY 1 67  . ? 1_555 ? 
27  AC3 13 ALA A  68  ? ALA 1 68  . ? 1_555 ? 
28  AC3 13 PHE A  70  ? PHE 1 70  . ? 1_555 ? 
29  AC3 13 LYS A  75  ? LYS 1 75  . ? 1_555 ? 
30  AC3 13 PHE A  78  ? PHE 1 78  . ? 1_555 ? 
31  AC3 13 GLU A  97  ? GLU 1 97  . ? 1_555 ? 
32  AC3 13 TYR A  180 ? TYR 1 180 . ? 1_555 ? 
33  AC3 13 GLU A  185 ? GLU 1 185 . ? 1_555 ? 
34  AC3 13 LYS A  202 ? LYS 1 202 . ? 1_555 ? 
35  AC3 13 PHE A  205 ? PHE 1 205 . ? 1_555 ? 
36  AC3 13 THR A  325 ? THR 1 325 . ? 1_555 ? 
37  AC3 13 FMN HA .   ? FMN 1 502 . ? 1_555 ? 
38  AC4 9  CYS B  83  ? CYS 2 83  . ? 1_555 ? 
39  AC4 9  THR B  85  ? THR 2 85  . ? 1_555 ? 
40  AC4 9  SER B  87  ? SER 2 87  . ? 1_555 ? 
41  AC4 9  CYS B  88  ? CYS 2 88  . ? 1_555 ? 
42  AC4 9  CYS B  124 ? CYS 2 124 . ? 1_555 ? 
43  AC4 9  LEU B  125 ? LEU 2 125 . ? 1_555 ? 
44  AC4 9  GLY B  126 ? GLY 2 126 . ? 1_555 ? 
45  AC4 9  SER B  127 ? SER 2 127 . ? 1_555 ? 
46  AC4 9  CYS B  128 ? CYS 2 128 . ? 1_555 ? 
47  AC5 8  HIS C  115 ? HIS 3 115 . ? 1_555 ? 
48  AC5 8  ASP C  118 ? ASP 3 118 . ? 1_555 ? 
49  AC5 8  CYS C  119 ? CYS 3 119 . ? 1_555 ? 
50  AC5 8  CYS C  122 ? CYS 3 122 . ? 1_555 ? 
51  AC5 8  CYS C  128 ? CYS 3 128 . ? 1_555 ? 
52  AC5 8  VAL C  232 ? VAL 3 232 . ? 1_555 ? 
53  AC5 8  GLY C  233 ? GLY 3 233 . ? 1_555 ? 
54  AC5 8  ILE D  325 ? ILE 4 325 . ? 1_555 ? 
55  AC6 5  CYS C  181 ? CYS 3 181 . ? 1_555 ? 
56  AC6 5  CYS C  184 ? CYS 3 184 . ? 1_555 ? 
57  AC6 5  CYS C  187 ? CYS 3 187 . ? 1_555 ? 
58  AC6 5  CYS C  230 ? CYS 3 230 . ? 1_555 ? 
59  AC6 5  VAL C  232 ? VAL 3 232 . ? 1_555 ? 
60  AC7 10 CYS C  256 ? CYS 3 256 . ? 1_555 ? 
61  AC7 10 LEU C  258 ? LEU 3 258 . ? 1_555 ? 
62  AC7 10 CYS C  259 ? CYS 3 259 . ? 1_555 ? 
63  AC7 10 VAL C  261 ? VAL 3 261 . ? 1_555 ? 
64  AC7 10 GLY C  262 ? GLY 3 262 . ? 1_555 ? 
65  AC7 10 CYS C  263 ? CYS 3 263 . ? 1_555 ? 
66  AC7 10 ILE C  290 ? ILE 3 290 . ? 1_555 ? 
67  AC7 10 CYS C  291 ? CYS 3 291 . ? 1_555 ? 
68  AC7 10 PRO C  407 ? PRO 3 407 . ? 1_555 ? 
69  AC7 10 ILE C  408 ? ILE 3 408 . ? 1_555 ? 
70  AC8 7  CYS C  34  ? CYS 3 34  . ? 1_555 ? 
71  AC8 7  GLY C  43  ? GLY 3 43  . ? 1_555 ? 
72  AC8 7  ALA C  44  ? ALA 3 44  . ? 1_555 ? 
73  AC8 7  CYS C  45  ? CYS 3 45  . ? 1_555 ? 
74  AC8 7  ARG C  46  ? ARG 3 46  . ? 1_555 ? 
75  AC8 7  CYS C  48  ? CYS 3 48  . ? 1_555 ? 
76  AC8 7  CYS C  83  ? CYS 3 83  . ? 1_555 ? 
77  AC9 11 ARG D  84  ? ARG 4 84  . ? 1_555 ? 
78  AC9 11 HIS D  169 ? HIS 4 169 . ? 1_555 ? 
79  AC9 11 ALA F  44  ? ALA 6 44  . ? 1_555 ? 
80  AC9 11 CYS F  45  ? CYS 6 45  . ? 1_555 ? 
81  AC9 11 CYS F  46  ? CYS 6 46  . ? 1_555 ? 
82  AC9 11 GLY F  82  ? GLY 6 82  . ? 1_555 ? 
83  AC9 11 ARG F  83  ? ARG 6 83  . ? 1_555 ? 
84  AC9 11 ALA F  110 ? ALA 6 110 . ? 1_555 ? 
85  AC9 11 CYS F  111 ? CYS 6 111 . ? 1_555 ? 
86  AC9 11 CYS F  140 ? CYS 6 140 . ? 1_555 ? 
87  AC9 11 PRO F  141 ? PRO 6 141 . ? 1_555 ? 
88  AD1 9  ALA G  62  ? ALA 9 62  . ? 1_555 ? 
89  AD1 9  CYS G  63  ? CYS 9 63  . ? 1_555 ? 
90  AD1 9  ILE G  68  ? ILE 9 68  . ? 1_555 ? 
91  AD1 9  CYS G  98  ? CYS 9 98  . ? 1_555 ? 
92  AD1 9  ILE G  99  ? ILE 9 99  . ? 1_555 ? 
93  AD1 9  PHE G  100 ? PHE 9 100 . ? 1_555 ? 
94  AD1 9  CYS G  101 ? CYS 9 101 . ? 1_555 ? 
95  AD1 9  GLY G  102 ? GLY 9 102 . ? 1_555 ? 
96  AD1 9  CYS G  104 ? CYS 9 104 . ? 1_555 ? 
97  AD2 12 CYS G  53  ? CYS 9 53  . ? 1_555 ? 
98  AD2 12 ILE G  54  ? ILE 9 54  . ? 1_555 ? 
99  AD2 12 GLY G  55  ? GLY 9 55  . ? 1_555 ? 
100 AD2 12 CYS G  56  ? CYS 9 56  . ? 1_555 ? 
101 AD2 12 SER G  57  ? SER 9 57  . ? 1_555 ? 
102 AD2 12 CYS G  59  ? CYS 9 59  . ? 1_555 ? 
103 AD2 12 TYR G  91  ? TYR 9 91  . ? 1_555 ? 
104 AD2 12 CYS G  108 ? CYS 9 108 . ? 1_555 ? 
105 AD2 12 PRO G  109 ? PRO 9 109 . ? 1_555 ? 
106 AD2 12 THR G  110 ? THR 9 110 . ? 1_555 ? 
107 AD2 12 ALA G  112 ? ALA 9 112 . ? 1_555 ? 
108 AD2 12 ILE G  113 ? ILE 9 113 . ? 1_555 ? 
109 AD3 8  PRO Q  199 ? PRO B 199 . ? 1_555 ? 
110 AD3 8  SER Q  352 ? SER B 352 . ? 1_555 ? 
111 AD3 8  CYS Q  353 ? CYS B 353 . ? 1_555 ? 
112 AD3 8  GLY Q  354 ? GLY B 354 . ? 1_555 ? 
113 AD3 8  LYS Q  355 ? LYS B 355 . ? 1_555 ? 
114 AD3 8  CYS Q  356 ? CYS B 356 . ? 1_555 ? 
115 AD3 8  CYS Q  359 ? CYS B 359 . ? 1_555 ? 
116 AD3 8  CYS Q  400 ? CYS B 400 . ? 1_555 ? 
117 AD4 14 GLY Q  64  ? GLY B 64  . ? 1_555 ? 
118 AD4 14 ARG Q  65  ? ARG B 65  . ? 1_555 ? 
119 AD4 14 GLY Q  66  ? GLY B 66  . ? 1_555 ? 
120 AD4 14 ALA Q  68  ? ALA B 68  . ? 1_555 ? 
121 AD4 14 ASN Q  92  ? ASN B 92  . ? 1_555 ? 
122 AD4 14 ASP Q  94  ? ASP B 94  . ? 1_555 ? 
123 AD4 14 ILE Q  181 ? ILE B 181 . ? 1_555 ? 
124 AD4 14 GLY Q  183 ? GLY B 183 . ? 1_555 ? 
125 AD4 14 GLU Q  184 ? GLU B 184 . ? 1_555 ? 
126 AD4 14 GLU Q  185 ? GLU B 185 . ? 1_555 ? 
127 AD4 14 ASN Q  219 ? ASN B 219 . ? 1_555 ? 
128 AD4 14 ASN Q  220 ? ASN B 220 . ? 1_555 ? 
129 AD4 14 THR Q  223 ? THR B 223 . ? 1_555 ? 
130 AD4 14 NAI TA .   ? NAI B 503 . ? 1_555 ? 
131 AD5 9  GLY Q  66  ? GLY B 66  . ? 1_555 ? 
132 AD5 9  GLY Q  67  ? GLY B 67  . ? 1_555 ? 
133 AD5 9  PHE Q  70  ? PHE B 70  . ? 1_555 ? 
134 AD5 9  LYS Q  75  ? LYS B 75  . ? 1_555 ? 
135 AD5 9  PHE Q  78  ? PHE B 78  . ? 1_555 ? 
136 AD5 9  GLU Q  97  ? GLU B 97  . ? 1_555 ? 
137 AD5 9  TYR Q  180 ? TYR B 180 . ? 1_555 ? 
138 AD5 9  GLU Q  185 ? GLU B 185 . ? 1_555 ? 
139 AD5 9  FMN SA .   ? FMN B 502 . ? 1_555 ? 
140 AD6 9  CYS R  83  ? CYS C 83  . ? 1_555 ? 
141 AD6 9  THR R  85  ? THR C 85  . ? 1_555 ? 
142 AD6 9  SER R  87  ? SER C 87  . ? 1_555 ? 
143 AD6 9  CYS R  88  ? CYS C 88  . ? 1_555 ? 
144 AD6 9  CYS R  124 ? CYS C 124 . ? 1_555 ? 
145 AD6 9  LEU R  125 ? LEU C 125 . ? 1_555 ? 
146 AD6 9  GLY R  126 ? GLY C 126 . ? 1_555 ? 
147 AD6 9  SER R  127 ? SER C 127 . ? 1_555 ? 
148 AD6 9  CYS R  128 ? CYS C 128 . ? 1_555 ? 
149 AD7 8  HIS S  115 ? HIS D 115 . ? 1_555 ? 
150 AD7 8  ASP S  118 ? ASP D 118 . ? 1_555 ? 
151 AD7 8  CYS S  119 ? CYS D 119 . ? 1_555 ? 
152 AD7 8  CYS S  122 ? CYS D 122 . ? 1_555 ? 
153 AD7 8  GLY S  125 ? GLY D 125 . ? 1_555 ? 
154 AD7 8  CYS S  128 ? CYS D 128 . ? 1_555 ? 
155 AD7 8  VAL S  232 ? VAL D 232 . ? 1_555 ? 
156 AD7 8  GLY S  233 ? GLY D 233 . ? 1_555 ? 
157 AD8 8  CYS S  181 ? CYS D 181 . ? 1_555 ? 
158 AD8 8  ILE S  182 ? ILE D 182 . ? 1_555 ? 
159 AD8 8  CYS S  184 ? CYS D 184 . ? 1_555 ? 
160 AD8 8  CYS S  187 ? CYS D 187 . ? 1_555 ? 
161 AD8 8  CYS S  230 ? CYS D 230 . ? 1_555 ? 
162 AD8 8  VAL S  232 ? VAL D 232 . ? 1_555 ? 
163 AD8 8  ALA S  234 ? ALA D 234 . ? 1_555 ? 
164 AD8 8  LEU S  235 ? LEU D 235 . ? 1_555 ? 
165 AD9 9  CYS S  256 ? CYS D 256 . ? 1_555 ? 
166 AD9 9  LEU S  258 ? LEU D 258 . ? 1_555 ? 
167 AD9 9  CYS S  259 ? CYS D 259 . ? 1_555 ? 
168 AD9 9  VAL S  261 ? VAL D 261 . ? 1_555 ? 
169 AD9 9  GLY S  262 ? GLY D 262 . ? 1_555 ? 
170 AD9 9  CYS S  263 ? CYS D 263 . ? 1_555 ? 
171 AD9 9  ILE S  290 ? ILE D 290 . ? 1_555 ? 
172 AD9 9  CYS S  291 ? CYS D 291 . ? 1_555 ? 
173 AD9 9  PRO S  407 ? PRO D 407 . ? 1_555 ? 
174 AE1 8  LEU S  32  ? LEU D 32  . ? 1_555 ? 
175 AE1 8  CYS S  34  ? CYS D 34  . ? 1_555 ? 
176 AE1 8  GLY S  43  ? GLY D 43  . ? 1_555 ? 
177 AE1 8  ALA S  44  ? ALA D 44  . ? 1_555 ? 
178 AE1 8  CYS S  45  ? CYS D 45  . ? 1_555 ? 
179 AE1 8  ARG S  46  ? ARG D 46  . ? 1_555 ? 
180 AE1 8  CYS S  48  ? CYS D 48  . ? 1_555 ? 
181 AE1 8  CYS S  83  ? CYS D 83  . ? 1_555 ? 
182 AE2 11 ARG T  84  ? ARG E 84  . ? 1_555 ? 
183 AE2 11 HIS T  169 ? HIS E 169 . ? 1_555 ? 
184 AE2 11 ALA V  44  ? ALA G 44  . ? 1_555 ? 
185 AE2 11 CYS V  45  ? CYS G 45  . ? 1_555 ? 
186 AE2 11 CYS V  46  ? CYS G 46  . ? 1_555 ? 
187 AE2 11 GLY V  82  ? GLY G 82  . ? 1_555 ? 
188 AE2 11 ARG V  83  ? ARG G 83  . ? 1_555 ? 
189 AE2 11 ALA V  110 ? ALA G 110 . ? 1_555 ? 
190 AE2 11 CYS V  111 ? CYS G 111 . ? 1_555 ? 
191 AE2 11 CYS V  140 ? CYS G 140 . ? 1_555 ? 
192 AE2 11 PRO V  141 ? PRO G 141 . ? 1_555 ? 
193 AE3 11 HIS W  41  ? HIS O 41  . ? 1_555 ? 
194 AE3 11 CYS W  63  ? CYS O 63  . ? 1_555 ? 
195 AE3 11 PRO W  64  ? PRO O 64  . ? 1_555 ? 
196 AE3 11 ALA W  65  ? ALA O 65  . ? 1_555 ? 
197 AE3 11 ILE W  68  ? ILE O 68  . ? 1_555 ? 
198 AE3 11 CYS W  98  ? CYS O 98  . ? 1_555 ? 
199 AE3 11 ILE W  99  ? ILE O 99  . ? 1_555 ? 
200 AE3 11 PHE W  100 ? PHE O 100 . ? 1_555 ? 
201 AE3 11 CYS W  101 ? CYS O 101 . ? 1_555 ? 
202 AE3 11 GLY W  102 ? GLY O 102 . ? 1_555 ? 
203 AE3 11 CYS W  104 ? CYS O 104 . ? 1_555 ? 
204 AE4 11 CYS W  53  ? CYS O 53  . ? 1_555 ? 
205 AE4 11 ILE W  54  ? ILE O 54  . ? 1_555 ? 
206 AE4 11 GLY W  55  ? GLY O 55  . ? 1_555 ? 
207 AE4 11 CYS W  56  ? CYS O 56  . ? 1_555 ? 
208 AE4 11 SER W  57  ? SER O 57  . ? 1_555 ? 
209 AE4 11 LEU W  58  ? LEU O 58  . ? 1_555 ? 
210 AE4 11 CYS W  59  ? CYS O 59  . ? 1_555 ? 
211 AE4 11 CYS W  108 ? CYS O 108 . ? 1_555 ? 
212 AE4 11 PRO W  109 ? PRO O 109 . ? 1_555 ? 
213 AE4 11 THR W  110 ? THR O 110 . ? 1_555 ? 
214 AE4 11 ILE W  113 ? ILE O 113 . ? 1_555 ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1 SG  1 CYS 400 ? ? FE3 1 SF4 501 ? ? 1.88 
2  1 ND2 D ASN 286 ? ? O   D TRP 289 ? ? 1.96 
3  1 OE2 4 GLU 152 ? ? OH  4 TYR 204 ? ? 1.98 
4  1 NZ  9 LYS 52  ? ? O   7 MET 44  ? ? 2.03 
5  1 OH  3 TYR 190 ? ? O   3 PHE 222 ? ? 2.06 
6  1 OG  6 SER 114 ? ? O   9 LEU 96  ? ? 2.06 
7  1 NH1 M ARG 22  ? ? OE1 M GLU 92  ? ? 2.06 
8  1 O   Q TRP 292 ? ? OG1 Q THR 296 ? ? 2.07 
9  1 O   Q ALA 215 ? ? NH1 Q ARG 294 ? ? 2.07 
10 1 OG  D SER 18  ? ? O   D SER 82  ? ? 2.07 
11 1 OH  H TYR 162 ? ? O   H LEU 305 ? ? 2.07 
12 1 OH  L TYR 305 ? ? O   L ALA 406 ? ? 2.08 
13 1 ND2 B ASN 190 ? ? O   B ASN 198 ? ? 2.08 
14 1 O   H TRP 292 ? ? OG1 H THR 296 ? ? 2.08 
15 1 O   H ALA 29  ? ? OG1 H THR 32  ? ? 2.08 
16 1 O   6 GLY 160 ? ? NH1 6 ARG 169 ? ? 2.09 
17 1 OG1 4 THR 144 ? ? O   H ALA 295 ? ? 2.10 
18 1 O   G MET 50  ? ? OG  G SER 53  ? ? 2.10 
19 1 O   3 ALA 81  ? ? OG1 3 THR 85  ? ? 2.10 
20 1 OH  T TYR 305 ? ? O   T ALA 406 ? ? 2.10 
21 1 O   6 MET 50  ? ? OG  6 SER 53  ? ? 2.10 
22 1 O   1 LYS 160 ? ? OG  1 SER 168 ? ? 2.10 
23 1 OH  1 TYR 18  ? ? O   1 LYS 102 ? ? 2.11 
24 1 O   4 ASP 304 ? ? OG1 4 THR 310 ? ? 2.11 
25 1 NH2 E ARG 314 ? ? O   O CYS 108 ? ? 2.11 
26 1 NZ  P LYS 113 ? ? OE2 V GLU 83  ? ? 2.11 
27 1 O   M LEU 332 ? ? OG1 M THR 336 ? ? 2.11 
28 1 ND2 3 ASN 286 ? ? O   3 TRP 289 ? ? 2.12 
29 1 O   B ALA 372 ? ? OG1 B THR 376 ? ? 2.12 
30 1 OD1 L ASP 557 ? ? NE2 M HIS 211 ? ? 2.12 
31 1 O   H ARG 50  ? ? N   H GLY 52  ? ? 2.12 
32 1 OG  V SER 59  ? ? OG  V SER 100 ? ? 2.13 
33 1 OH  E TYR 148 ? ? O   Q PHE 42  ? ? 2.13 
34 1 O   Q ALA 29  ? ? OG1 Q THR 32  ? ? 2.13 
35 1 OD1 T ASP 557 ? ? NE2 U HIS 211 ? ? 2.13 
36 1 ND2 9 ASN 75  ? ? OG  9 SER 82  ? ? 2.13 
37 1 OH  K TYR 49  ? ? O   N GLY 156 ? ? 2.13 
38 1 OH  E TYR 81  ? ? O   G MET 117 ? ? 2.13 
39 1 OH  4 TYR 172 ? ? O   4 GLU 180 ? ? 2.13 
40 1 OE2 E GLU 185 ? ? OH  O TYR 165 ? ? 2.13 
41 1 OE1 Q GLU 35  ? ? OH  Q TYR 249 ? ? 2.14 
42 1 OG  J SER 15  ? ? O   J ALA 31  ? ? 2.14 
43 1 O   4 PRO 373 ? ? ND2 4 ASN 377 ? ? 2.14 
44 1 O   V SER 79  ? ? OH  V TYR 85  ? ? 2.14 
45 1 OH  T TYR 90  ? ? O   T LEU 334 ? ? 2.14 
46 1 OE2 D GLU 352 ? ? NE2 D GLN 661 ? ? 2.14 
47 1 OG1 V THR 2   ? ? OG  V SER 39  ? ? 2.14 
48 1 O   T GLY 584 ? ? NZ  V LYS 135 ? ? 2.14 
49 1 OE1 V GLN 128 ? ? NH2 V ARG 306 ? ? 2.14 
50 1 OE2 O GLU 171 ? ? NH2 I ARG 43  ? ? 2.14 
51 1 OD2 M ASP 68  ? ? NH2 M ARG 243 ? ? 2.14 
52 1 OD2 3 ASP 268 ? ? NH1 3 ARG 278 ? ? 2.14 
53 1 O   L LEU 553 ? ? OH  M TYR 270 ? ? 2.15 
54 1 O   A LYS 35  ? ? NZ  A LYS 40  ? ? 2.15 
55 1 O   B ALA 425 ? ? NZ  B LYS 428 ? ? 2.15 
56 1 OD1 G ASP 134 ? ? NZ  G LYS 157 ? ? 2.15 
57 1 O   4 GLN 77  ? ? OG1 4 THR 80  ? ? 2.16 
58 1 OE2 P GLU 6   ? ? OG1 Q THR 2   ? ? 2.16 
59 1 O   U PHE 217 ? ? ND2 U ASN 221 ? ? 2.16 
60 1 CD1 E LEU 47  ? ? O   E GLU 51  ? ? 2.16 
61 1 OE1 4 GLU 341 ? ? OH  4 TYR 356 ? ? 2.16 
62 1 OH  B TYR 131 ? ? O   C LYS 17  ? ? 2.16 
63 1 O   3 ALA 576 ? ? NZ  3 LYS 580 ? ? 2.17 
64 1 OH  4 TYR 148 ? ? O   H PHE 42  ? ? 2.17 
65 1 O   1 LYS 48  ? ? OH  1 TYR 123 ? ? 2.17 
66 1 OE2 1 GLU 361 ? ? NH2 3 ARG 162 ? ? 2.17 
67 1 ND2 E ASN 306 ? ? OH  F TYR 192 ? ? 2.17 
68 1 O   1 ALA 425 ? ? NZ  1 LYS 428 ? ? 2.17 
69 1 O   Q ARG 50  ? ? N   Q GLY 52  ? ? 2.17 
70 1 NH1 X ARG 45  ? ? OD2 X ASP 61  ? ? 2.17 
71 1 O   C GLY 109 ? ? NH2 I ARG 121 ? ? 2.17 
72 1 O   H GLY 265 ? ? NZ  H LYS 282 ? ? 2.17 
73 1 O   9 GLU 149 ? ? OG1 9 THR 153 ? ? 2.18 
74 1 OG  3 SER 414 ? ? NH2 3 ARG 443 ? ? 2.18 
75 1 OD1 4 ASN 171 ? ? NH1 4 ARG 174 ? ? 2.18 
76 1 O   O ARG 40  ? ? N   O GLY 116 ? ? 2.18 
77 1 ND2 4 ASN 306 ? ? OH  5 TYR 192 ? ? 2.18 
78 1 O   B LYS 160 ? ? OG  B SER 168 ? ? 2.18 
79 1 NH1 E ARG 200 ? ? OH  O TYR 16  ? ? 2.18 
80 1 OD2 D ASP 94  ? ? OG  D SER 97  ? ? 2.18 
81 1 NH1 B ARG 65  ? ? O   B MET 249 ? ? 2.19 
82 1 OE1 4 GLU 341 ? ? NH2 5 ARG 91  ? ? 2.19 
83 1 O   O GLY 172 ? ? NZ  O LYS 174 ? ? 2.19 
84 1 NH1 U ARG 345 ? ? OE1 U GLU 416 ? ? 2.19 
85 1 NZ  T LYS 157 ? ? OD2 T ASP 535 ? ? 2.19 
86 1 OD1 I ASP 120 ? ? NH1 I ARG 123 ? ? 2.19 
87 1 O   E GLU 352 ? ? NE  E ARG 371 ? ? 2.19 
88 1 OD1 H ASP 71  ? ? NZ  H LYS 240 ? ? 2.19 
89 1 O   L PHE 105 ? ? ND2 L ASN 109 ? ? 2.19 
90 1 O   4 GLU 333 ? ? OG  4 SER 363 ? ? 2.19 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CB 
_pdbx_validate_rmsd_bond.auth_asym_id_1            9 
_pdbx_validate_rmsd_bond.auth_comp_id_1            CYS 
_pdbx_validate_rmsd_bond.auth_seq_id_1             101 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            SG 
_pdbx_validate_rmsd_bond.auth_asym_id_2            9 
_pdbx_validate_rmsd_bond.auth_comp_id_2            CYS 
_pdbx_validate_rmsd_bond.auth_seq_id_2             101 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.715 
_pdbx_validate_rmsd_bond.bond_target_value         1.812 
_pdbx_validate_rmsd_bond.bond_deviation            -0.097 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.016 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CA 3 CYS 230 ? ? CB 3 CYS 230 ? ? SG  3 CYS 230 ? ? 121.95 114.20 7.75  1.10 N 
2 1 NE 3 ARG 276 ? ? CZ 3 ARG 276 ? ? NH1 3 ARG 276 ? ? 123.37 120.30 3.07  0.50 N 
3 1 CA 6 CYS 45  ? ? CB 6 CYS 45  ? ? SG  6 CYS 45  ? ? 122.23 114.20 8.03  1.10 N 
4 1 CA 9 CYS 101 ? ? CB 9 CYS 101 ? ? SG  9 CYS 101 ? ? 121.63 114.20 7.43  1.10 N 
5 1 CA O CYS 56  ? ? CB O CYS 56  ? ? SG  O CYS 56  ? ? 121.76 114.20 7.56  1.10 N 
6 1 CA O CYS 59  ? ? CB O CYS 59  ? ? SG  O CYS 59  ? ? 127.88 114.20 13.68 1.10 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1   1 GLU 1 47  ? ? -94.97  -60.67  
2   1 LYS 1 81  ? ? 72.10   -15.08  
3   1 ASP 1 82  ? ? -170.76 119.61  
4   1 GLU 1 193 ? ? -58.38  -9.51   
5   1 TRP 1 279 ? ? -92.35  -61.09  
6   1 PHE 1 366 ? ? -94.94  -60.11  
7   1 PRO 1 401 ? ? -66.99  1.59    
8   1 ASN 2 137 ? ? 68.70   -30.93  
9   1 ASP 2 138 ? ? -158.56 -2.69   
10  1 ASN 3 7   ? ? 67.12   -28.80  
11  1 ASP 3 8   ? ? -157.21 0.15    
12  1 PHE 3 33  ? ? -121.82 -52.25  
13  1 ALA 3 44  ? ? -123.33 -52.49  
14  1 ALA 3 127 ? ? -90.39  50.08   
15  1 PRO 3 172 ? ? -54.70  -4.99   
16  1 CYS 3 230 ? ? -49.18  108.91  
17  1 PRO 3 231 ? ? -66.91  3.32    
18  1 SER 3 271 ? ? 70.44   40.62   
19  1 LEU 3 275 ? ? -95.47  -62.12  
20  1 VAL 3 282 ? ? -153.47 85.31   
21  1 VAL 3 285 ? ? -123.37 -64.81  
22  1 GLU 3 287 ? ? -75.02  -74.09  
23  1 GLN 3 303 ? ? -91.06  -65.54  
24  1 GLU 3 314 ? ? -101.51 55.34   
25  1 HIS 3 468 ? ? -111.69 -169.69 
26  1 ASN 3 540 ? ? -94.46  35.11   
27  1 ARG 3 667 ? ? -69.60  1.82    
28  1 MET 3 673 ? ? 70.53   -4.82   
29  1 PHE 3 678 ? ? -161.42 119.06  
30  1 GLU 3 682 ? ? -170.57 139.55  
31  1 HIS 3 702 ? ? -68.19  3.62    
32  1 ALA 3 727 ? ? 60.98   64.95   
33  1 PRO 3 765 ? ? -85.04  43.66   
34  1 GLN 4 33  ? ? 71.91   -6.04   
35  1 SER 4 211 ? ? -58.26  109.00  
36  1 THR 4 332 ? ? -96.17  -63.03  
37  1 ASP 4 401 ? ? 52.68   70.94   
38  1 ILE 5 135 ? ? -97.22  -63.54  
39  1 CYS 6 45  ? ? -46.56  -17.56  
40  1 ALA 6 56  ? ? -92.01  46.25   
41  1 ARG 6 57  ? ? -132.72 -35.56  
42  1 PRO 6 102 ? ? -69.58  77.78   
43  1 ASN 6 126 ? ? -165.69 119.28  
44  1 CYS 6 140 ? ? -155.78 89.64   
45  1 ALA 6 175 ? ? 80.94   3.40    
46  1 ARG 6 178 ? ? -172.54 141.24  
47  1 VAL 9 22  ? ? -59.71  108.92  
48  1 THR 9 23  ? ? 177.78  161.36  
49  1 PHE 9 100 ? ? 60.36   68.61   
50  1 LEU 9 170 ? ? -96.86  35.99   
51  1 GLU 9 178 ? ? 67.99   -7.16   
52  1 ASP 7 39  ? ? -69.65  2.81    
53  1 MET 7 44  ? ? -94.36  -64.04  
54  1 ARG 7 88  ? ? 68.29   -4.32   
55  1 TRP W 37  ? ? 59.81   77.16   
56  1 GLU A 45  ? ? 62.24   65.31   
57  1 ASP A 49  ? ? 62.67   64.12   
58  1 ALA J 76  ? ? 54.41   8.61    
59  1 GLU J 158 ? ? 27.15   62.86   
60  1 LEU K 51  ? ? 73.86   -6.79   
61  1 GLU K 83  ? ? -77.22  -161.99 
62  1 SER K 84  ? ? -35.05  133.52  
63  1 PRO L 10  ? ? -83.69  39.27   
64  1 PHE L 20  ? ? -93.31  -64.28  
65  1 ASP L 70  ? ? -126.66 -168.24 
66  1 LYS L 147 ? ? -59.83  -7.86   
67  1 TYR L 151 ? ? -90.18  46.91   
68  1 LEU L 183 ? ? 58.29   19.39   
69  1 MET L 245 ? ? 70.28   -11.78  
70  1 GLN L 361 ? ? 70.88   -8.08   
71  1 PRO L 396 ? ? -63.26  -179.42 
72  1 PHE L 397 ? ? 76.83   -1.50   
73  1 HIS L 436 ? ? -142.96 33.42   
74  1 PHE L 517 ? ? 55.05   77.03   
75  1 HIS M 43  ? ? -53.12  108.84  
76  1 ARG M 90  ? ? 66.62   -1.42   
77  1 GLU M 92  ? ? 54.17   19.05   
78  1 ALA M 125 ? ? -57.77  -8.17   
79  1 LYS M 235 ? ? -99.33  37.43   
80  1 ALA M 249 ? ? -155.49 72.96   
81  1 THR M 304 ? ? 48.48   77.95   
82  1 TYR M 344 ? ? 60.59   67.64   
83  1 LEU M 397 ? ? -83.57  48.04   
84  1 GLU M 416 ? ? -74.80  -169.59 
85  1 PHE M 446 ? ? -118.05 62.02   
86  1 ASP N 56  ? ? -127.11 -168.67 
87  1 PHE N 84  ? ? -58.89  -8.63   
88  1 PRO N 191 ? ? -83.45  40.63   
89  1 THR N 213 ? ? -94.79  -64.78  
90  1 ALA N 227 ? ? -99.15  39.88   
91  1 ALA N 228 ? ? -38.94  127.39  
92  1 ALA N 278 ? ? 69.00   -6.38   
93  1 PRO N 338 ? ? -95.32  48.67   
94  1 PRO N 393 ? ? -78.95  39.94   
95  1 ALA N 424 ? ? -78.48  -159.61 
96  1 VAL H 44  ? ? -49.28  -7.39   
97  1 ASN H 49  ? ? -66.59  4.36    
98  1 ARG H 50  ? ? -73.89  -143.60 
99  1 VAL H 51  ? ? -30.24  -2.48   
100 1 PHE H 68  ? ? 75.85   -1.30   
101 1 PHE H 108 ? ? -95.39  35.29   
102 1 TRP H 194 ? ? 52.47   71.33   
103 1 ARG H 216 ? ? 179.37  175.68  
104 1 PHE H 219 ? ? 60.39   -2.98   
105 1 ASP H 220 ? ? -95.47  50.25   
106 1 HIS H 233 ? ? -148.45 -159.25 
107 1 THR H 234 ? ? 76.77   -4.33   
108 1 SER H 238 ? ? -96.72  -62.41  
109 1 LEU H 264 ? ? -78.92  -163.56 
110 1 THR H 268 ? ? 28.07   52.11   
111 1 LEU H 272 ? ? 72.47   -11.77  
112 1 GLU H 273 ? ? 34.17   49.08   
113 1 TYR H 302 ? ? 73.73   -12.60  
114 1 LEU H 332 ? ? -68.38  -72.21  
115 1 TYR B 38  ? ? 66.33   -0.13   
116 1 GLU B 47  ? ? -93.36  -60.44  
117 1 LYS B 81  ? ? 74.04   -14.00  
118 1 ASP B 82  ? ? -168.96 116.61  
119 1 GLU B 193 ? ? -59.94  -9.25   
120 1 TRP B 279 ? ? -90.96  -61.36  
121 1 PRO B 401 ? ? -67.01  1.03    
122 1 ASN C 137 ? ? 69.17   -27.59  
123 1 ASP C 138 ? ? -157.34 -2.46   
124 1 ASN D 7   ? ? 67.71   -28.39  
125 1 ASP D 8   ? ? -157.41 -0.02   
126 1 ALA D 127 ? ? -87.45  49.26   
127 1 HIS D 167 ? ? 39.85   57.50   
128 1 PRO D 172 ? ? -54.90  -5.59   
129 1 LEU D 218 ? ? 53.98   70.14   
130 1 CYS D 230 ? ? -49.82  109.37  
131 1 VAL D 282 ? ? -154.70 82.72   
132 1 VAL D 285 ? ? -123.11 -65.75  
133 1 GLU D 287 ? ? -73.70  -74.67  
134 1 GLN D 303 ? ? -90.63  -61.77  
135 1 GLU D 314 ? ? -101.15 59.62   
136 1 HIS D 468 ? ? -111.10 -169.01 
137 1 ASN D 540 ? ? -91.20  34.85   
138 1 ARG D 667 ? ? -69.16  4.58    
139 1 MET D 673 ? ? 68.84   -3.27   
140 1 PHE D 678 ? ? -160.94 119.63  
141 1 HIS D 702 ? ? -68.35  5.99    
142 1 ALA D 727 ? ? 60.50   65.03   
143 1 PRO D 765 ? ? -85.09  42.98   
144 1 GLN E 33  ? ? 72.53   -4.99   
145 1 SER E 211 ? ? -57.20  107.83  
146 1 THR E 332 ? ? -96.89  -65.21  
147 1 ASP E 401 ? ? 51.58   71.64   
148 1 ILE F 135 ? ? -94.85  -61.89  
149 1 PRO F 138 ? ? -47.73  152.14  
150 1 ALA G 56  ? ? -92.37  46.33   
151 1 ARG G 57  ? ? -132.18 -36.15  
152 1 ARG G 73  ? ? -64.89  1.24    
153 1 CYS G 140 ? ? -155.51 89.46   
154 1 ALA G 175 ? ? 81.73   5.48    
155 1 ARG G 178 ? ? -174.68 142.81  
156 1 VAL O 22  ? ? -56.61  109.64  
157 1 THR O 23  ? ? 176.83  161.03  
158 1 PHE O 100 ? ? 60.43   67.78   
159 1 LEU O 170 ? ? -96.82  33.98   
160 1 GLU O 178 ? ? 67.18   -4.51   
161 1 ASP I 39  ? ? -69.87  6.33    
162 1 MET I 44  ? ? -94.47  -62.10  
163 1 ASP I 61  ? ? -79.20  -166.12 
164 1 ARG I 88  ? ? 71.25   -6.23   
165 1 ALA I 125 ? ? -90.16  -60.44  
166 1 TRP X 37  ? ? 61.54   74.44   
167 1 PRO X 60  ? ? -68.77  -177.67 
168 1 GLU P 45  ? ? 61.53   64.79   
169 1 ALA R 76  ? ? 54.16   8.57    
170 1 VAL R 157 ? ? -84.98  -72.81  
171 1 GLU R 158 ? ? 26.02   64.38   
172 1 LEU S 51  ? ? 72.05   -8.19   
173 1 GLU S 83  ? ? -77.53  -159.63 
174 1 SER S 84  ? ? -33.36  132.38  
175 1 PRO T 10  ? ? -83.96  40.11   
176 1 PHE T 20  ? ? -92.91  -65.97  
177 1 TRP T 59  ? ? -149.51 -158.83 
178 1 LEU T 60  ? ? -39.70  135.03  
179 1 ASP T 70  ? ? -125.41 -167.64 
180 1 TYR T 151 ? ? -90.33  35.22   
181 1 ALA T 152 ? ? -124.69 -50.13  
182 1 ASN T 198 ? ? 46.95   71.08   
183 1 MET T 245 ? ? 70.47   -10.65  
184 1 GLN T 361 ? ? 73.77   -8.13   
185 1 PHE T 397 ? ? 74.81   -3.81   
186 1 HIS T 436 ? ? -142.60 33.47   
187 1 PHE T 517 ? ? 52.72   75.66   
188 1 HIS U 43  ? ? -51.79  108.93  
189 1 ARG U 90  ? ? 68.85   -0.04   
190 1 GLU U 92  ? ? 49.88   19.25   
191 1 LYS U 235 ? ? -99.90  39.09   
192 1 ALA U 249 ? ? -156.15 73.87   
193 1 THR U 304 ? ? 48.59   78.59   
194 1 LEU U 397 ? ? -85.96  46.84   
195 1 GLU U 416 ? ? -74.06  -168.04 
196 1 ASP V 56  ? ? -127.51 -169.82 
197 1 PRO V 191 ? ? -83.44  40.84   
198 1 THR V 213 ? ? -96.33  -63.67  
199 1 ALA V 227 ? ? -96.48  39.16   
200 1 ALA V 278 ? ? 71.03   -6.12   
201 1 PRO V 338 ? ? -96.37  50.66   
202 1 PRO V 393 ? ? -78.21  40.41   
203 1 ALA V 422 ? ? -109.71 77.84   
204 1 ALA V 424 ? ? -78.36  -159.46 
205 1 VAL Q 44  ? ? -49.96  -8.52   
206 1 ASN Q 49  ? ? -64.94  1.48    
207 1 ARG Q 50  ? ? -78.52  -141.99 
208 1 VAL Q 51  ? ? -32.53  -6.49   
209 1 PHE Q 68  ? ? 74.28   -3.20   
210 1 PHE Q 108 ? ? -95.59  38.09   
211 1 TRP Q 194 ? ? 53.83   70.40   
212 1 ARG Q 216 ? ? 177.88  176.66  
213 1 PHE Q 219 ? ? 61.09   -6.33   
214 1 ASP Q 220 ? ? -96.51  48.75   
215 1 TYR Q 232 ? ? 60.00   5.52    
216 1 HIS Q 233 ? ? -147.60 -157.83 
217 1 THR Q 234 ? ? 79.32   -3.30   
218 1 SER Q 238 ? ? -97.04  -64.80  
219 1 LEU Q 264 ? ? -79.60  -165.53 
220 1 THR Q 268 ? ? 26.71   51.44   
221 1 LEU Q 272 ? ? 72.56   -11.90  
222 1 GLU Q 273 ? ? 33.04   48.52   
223 1 TYR Q 302 ? ? 73.71   -9.36   
224 1 LEU Q 332 ? ? -71.62  -77.77  
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1  1 LYS 9 20  ? ? PRO 9 21  ? ? -147.01 
2  1 GLN H 43  ? ? VAL H 44  ? ? -145.02 
3  1 THR H 217 ? ? PRO H 218 ? ? 118.62  
4  1 GLY H 266 ? ? TRP H 267 ? ? -141.47 
5  1 LYS O 20  ? ? PRO O 21  ? ? -149.60 
6  1 PRO O 21  ? ? VAL O 22  ? ? -149.12 
7  1 GLU P 45  ? ? SER P 46  ? ? 149.02  
8  1 GLN Q 43  ? ? VAL Q 44  ? ? -146.64 
9  1 THR Q 217 ? ? PRO Q 218 ? ? 118.30  
10 1 GLY Q 266 ? ? TRP Q 267 ? ? -135.63 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1   ? refined 41.9888  -20.3345  149.5578 1.0213  0.8175  0.5029 -0.0261 -0.1070 -0.0198 0.0011  0.0008  
0.0044  -0.0021 -0.0035 0.0021  0.1073  -0.0724 -0.0490 0.0163  0.0405  0.0426  -0.0688 -0.0639 0.0005  
'X-RAY DIFFRACTION' 2   ? refined 25.4142  -28.8048  140.4766 0.9481  1.1647  0.7313 0.1676  0.0092  -0.1683 0.0020  0.0023  
0.0019  0.0018  0.0018  0.0002  0.0287  0.0820  0.0142  0.0108  -0.0146 0.0119  -0.0086 -0.0397 0.0000  
'X-RAY DIFFRACTION' 3   ? refined 30.6606  -26.6736  127.1990 0.6393  0.8398  0.4049 0.1051  0.0093  -0.1813 0.0013  0.0065  
-0.0002 -0.0032 -0.0012 0.0031  -0.0566 -0.0440 -0.0791 0.0270  -0.0063 0.0236  -0.0359 -0.0792 0.0002  
'X-RAY DIFFRACTION' 4   ? refined 45.6194  -31.8305  136.4602 0.3086  0.5102  0.0838 -0.1030 -0.0075 -0.0114 0.0958  0.0183  
0.0084  0.0249  -0.0248 -0.0025 0.0237  -0.0654 -0.0033 -0.0108 0.0395  -0.0415 -0.1750 0.0816  0.2496  
'X-RAY DIFFRACTION' 5   ? refined 39.9836  -33.3559  127.9194 0.3047  0.3545  0.0266 -0.1525 0.0110  0.0230  0.0337  0.2183  
0.1408  -0.0616 0.0397  -0.0699 0.0194  0.0488  0.0045  -0.1165 -0.1277 -0.0228 0.0256  -0.0323 -0.5489 
'X-RAY DIFFRACTION' 6   ? refined 49.5077  -8.6060   129.8532 0.2973  0.1279  0.2555 -0.1252 -0.0366 -0.0889 0.0241  0.0507  
0.0444  -0.0187 -0.0184 -0.0268 0.0317  -0.0199 -0.0619 -0.0506 -0.0282 -0.0435 0.0124  -0.0099 0.0942  
'X-RAY DIFFRACTION' 7   ? refined 59.3193  -5.6982   113.3652 0.3921  0.0601  0.3717 -0.0634 0.0077  -0.2005 0.0632  0.1474  
0.0034  -0.0608 0.0034  -0.0047 0.0203  -0.0600 -0.0084 0.0115  0.0279  0.0256  0.0507  -0.0306 0.2460  
'X-RAY DIFFRACTION' 8   ? refined 52.5570  -50.9022  127.5427 0.3904  0.3841  0.3984 -0.1326 -0.2358 0.0144  0.0340  0.0007  
0.0266  -0.0033 -0.0305 0.0030  0.0116  -0.0173 0.0167  0.0171  -0.0723 0.0385  0.0330  -0.1292 0.0038  
'X-RAY DIFFRACTION' 9   ? refined 58.1711  -43.5729  124.9435 0.2899  0.3300  0.1623 0.1617  -0.0098 0.0986  0.0136  0.0220  
0.0810  0.0135  0.0091  -0.0183 0.0025  -0.0402 -0.0260 0.0445  0.0218  -0.0201 0.0244  0.0324  0.1439  
'X-RAY DIFFRACTION' 10  ? refined 60.2732  -45.2280  116.4257 0.1398  0.1174  0.0952 -0.0992 -0.0842 0.0451  0.0165  0.0185  
0.0042  0.0058  0.0071  0.0005  0.0088  0.0025  -0.0141 0.0033  0.0168  0.0051  0.0070  -0.0127 0.1491  
'X-RAY DIFFRACTION' 11  ? refined 66.5612  -35.4889  122.7867 0.9556  0.9872  1.0126 -0.2052 -0.1994 0.1942  0.0054  0.0007  
0.0059  -0.0019 0.0056  -0.0019 0.0352  0.0290  0.0275  0.0067  0.0635  0.0076  0.0136  -0.0539 -0.0000 
'X-RAY DIFFRACTION' 12  ? refined 67.1991  -20.0006  129.0125 0.8831  0.5364  0.5377 -0.0405 -0.1785 -0.0696 0.0033  0.0036  
0.0057  0.0008  -0.0003 0.0026  -0.0077 0.0111  -0.0157 -0.0200 -0.0152 0.0050  -0.0037 -0.0944 -0.0001 
'X-RAY DIFFRACTION' 13  ? refined 77.0019  -18.0042  127.2440 0.9721  0.6088  0.6049 -0.1765 -0.0324 0.0416  0.0037  0.0062  
0.0046  -0.0012 0.0022  -0.0044 0.0403  0.0646  0.0531  0.0060  0.0233  0.0404  0.0298  -0.0639 0.0000  
'X-RAY DIFFRACTION' 14  ? refined 80.0136  -30.6013  124.4060 0.4899  0.5036  0.3905 0.0361  -0.1540 0.1379  0.0021  0.0012  
0.0018  -0.0016 0.0021  -0.0015 -0.0191 -0.0130 0.0169  -0.0006 0.0281  -0.0294 0.0030  0.0416  -0.0004 
'X-RAY DIFFRACTION' 15  ? refined 65.2691  -21.9505  130.1353 0.2360  0.2981  0.3833 -0.0840 0.0405  0.0040  0.0275  0.0313  
0.0488  0.0162  0.0201  0.0075  0.0118  -0.0226 -0.0113 -0.0106 0.0142  0.0205  0.0191  -0.0369 -0.0229 
'X-RAY DIFFRACTION' 16  ? refined 66.4580  -25.6476  135.8778 0.4382  0.5687  0.4739 -0.3121 -0.0687 -0.0038 0.0035  0.0028  
0.0114  0.0010  0.0029  0.0058  0.0269  -0.0168 -0.0058 -0.0259 0.0365  -0.0045 0.0038  0.0182  0.0113  
'X-RAY DIFFRACTION' 17  ? refined 77.6839  -23.4570  138.5657 0.7894  0.8583  0.6508 -0.2793 -0.3266 -0.1902 0.0016  0.0008  
0.0021  0.0000  -0.0016 0.0004  0.0002  -0.0080 0.0161  0.0136  -0.0169 0.0133  0.0032  -0.0031 -0.0223 
'X-RAY DIFFRACTION' 18  ? refined 73.5292  -33.8745  143.8426 1.5916  1.7355  1.5546 -0.1313 -0.0975 0.0859  0.0304  0.0056  
0.0032  0.0013  0.0031  -0.0024 -0.0086 0.0030  -0.0005 0.0048  -0.0179 -0.0071 -0.0002 0.0091  0.0002  
'X-RAY DIFFRACTION' 19  ? refined 64.8015  -17.0097  145.4981 1.4207  1.6046  1.1077 0.0145  -0.1768 -0.2982 0.0000  0.0015  
0.0061  -0.0011 0.0002  0.0017  0.0163  -0.0180 0.0291  0.0017  -0.0064 0.0375  -0.0169 -0.0404 -0.0000 
'X-RAY DIFFRACTION' 20  ? refined 40.4563  -20.9752  95.1888  0.3016  -0.2714 0.5622 0.0162  -0.0361 -0.0634 0.1388  0.1674  
0.0894  0.1073  -0.0144 -0.0890 0.0427  -0.0473 -0.0585 0.0174  0.0118  -0.2137 -0.3102 -0.0833 0.1471  
'X-RAY DIFFRACTION' 21  ? refined 58.2994  -24.8032  96.3018  0.1619  -0.0167 0.2112 -0.1324 -0.1165 -0.0074 0.0502  0.0010  
-0.0043 0.0108  0.0065  -0.0010 0.0467  0.0158  -0.0560 -0.0294 0.0313  -0.0814 -0.0692 0.0738  0.3824  
'X-RAY DIFFRACTION' 22  ? refined 54.4117  -43.2368  87.3084  0.1311  -0.7705 0.3865 -0.2151 -0.1334 -0.0054 0.1203  0.2224  
0.1748  0.0910  -0.1715 -0.1526 0.1052  -0.3126 0.0835  0.1927  0.0322  -0.1313 -0.1183 0.0319  0.4946  
'X-RAY DIFFRACTION' 23  ? refined 54.7026  -70.8399  60.2469  0.2069  0.0271  0.3207 0.1423  0.0138  0.0538  0.0070  0.0295  
0.0684  -0.0140 0.0214  -0.0475 -0.0317 0.0261  -0.0022 -0.0334 -0.0466 0.0180  -0.0254 -0.0049 -0.4868 
'X-RAY DIFFRACTION' 24  ? refined 37.0745  -54.8309  91.1026  0.1228  -0.5761 0.5313 0.0133  -0.1542 0.0023  -0.0341 0.0263  
0.0050  0.0187  -0.0114 -0.0159 0.0175  -0.0085 -0.1241 0.0266  0.0542  -0.0766 0.0852  -0.0529 0.6865  
'X-RAY DIFFRACTION' 25  ? refined 39.7748  -69.5959  87.7347  0.0727  -0.1330 0.7127 -0.0848 0.0037  0.2620  -0.0011 0.1944  
-0.0015 0.0606  -0.0086 0.0183  -0.0028 0.0006  -0.1160 0.1194  -0.0252 0.0385  0.0817  0.0368  0.3900  
'X-RAY DIFFRACTION' 26  ? refined 45.0817  -58.1780  65.9524  0.1551  -0.3728 0.5816 -0.1713 -0.1426 0.0418  0.0278  0.0881  
0.0183  0.0568  0.0012  0.0158  -0.0714 0.0301  -0.0860 -0.0607 -0.0552 0.0590  -0.0156 -0.0394 -0.5645 
'X-RAY DIFFRACTION' 27  ? refined 46.5967  -64.3061  86.2697  0.0169  -0.1019 0.3023 0.0235  -0.0112 -0.0579 0.0120  0.0550  
0.0622  0.0001  -0.0174 0.0194  -0.0673 -0.0110 0.0125  0.0084  -0.0544 0.0340  -0.0190 -0.0422 -1.0483 
'X-RAY DIFFRACTION' 28  ? refined 58.9941  -72.1579  96.2410  0.0594  0.1217  0.2834 -0.0767 -0.0589 0.1869  0.0163  0.0129  
0.0070  -0.0113 -0.0008 0.0041  0.0312  0.0144  0.0116  0.0030  0.0557  -0.0055 0.0179  -0.0379 0.6263  
'X-RAY DIFFRACTION' 29  ? refined 53.7795  -7.8594   50.7036  0.3031  -0.1983 0.7002 0.0335  -0.0579 0.1767  0.0567  0.2479  
0.0677  0.0751  -0.0341 -0.1385 0.0132  0.2042  0.1665  0.1618  0.0009  -0.0075 -0.2295 -0.0458 0.0643  
'X-RAY DIFFRACTION' 30  ? refined 69.3244  1.9460    54.4890  0.7463  0.0939  0.6760 -0.2738 0.0437  0.2916  0.0181  0.0517  
0.0280  -0.0232 0.0020  0.0238  0.0117  0.0368  -0.0101 -0.0070 0.0231  -0.0177 -0.0465 0.0002  0.0696  
'X-RAY DIFFRACTION' 31  ? refined 48.0442  7.9983    38.9301  0.4572  0.3656  0.5292 0.2380  -0.0943 0.1069  0.0047  0.0960  
0.0048  -0.0199 -0.0029 0.0055  0.0453  -0.0223 -0.0279 -0.0508 0.0193  -0.0286 -0.0080 -0.0379 0.1880  
'X-RAY DIFFRACTION' 32  ? refined 52.6505  -1.9715   59.0366  0.7498  -0.4519 0.8296 -0.1735 -0.0079 0.0412  -0.0183 0.1378  
0.2475  -0.0167 0.0956  -0.2003 0.1213  0.2728  0.3274  -0.1214 -0.0772 0.0026  -0.2352 -0.1337 0.5039  
'X-RAY DIFFRACTION' 33  ? refined 23.0236  5.6756    62.5321  1.5264  1.5272  1.7083 0.2594  0.0413  0.0857  0.0003  0.0029  
0.0010  0.0009  -0.0005 -0.0018 -0.0144 -0.0006 -0.0000 0.0095  -0.0267 -0.0036 -0.0060 0.0266  -0.0004 
'X-RAY DIFFRACTION' 34  ? refined 28.2138  -4.4714   65.3530  0.6252  0.3168  0.6594 0.2633  0.0063  0.1045  0.0090  0.0638  
0.0347  -0.0238 -0.0177 0.0468  0.0523  -0.0157 -0.0125 0.0568  0.0519  -0.0236 -0.0191 -0.0326 0.0991  
'X-RAY DIFFRACTION' 35  ? refined 21.8505  -2.7109   52.7449  0.5623  0.4933  0.6600 0.2861  -0.1525 0.0851  0.0051  0.0437  
0.0218  -0.0062 0.0103  -0.0139 0.0011  -0.0643 -0.0123 -0.0129 0.0222  -0.0038 -0.0078 -0.0396 -0.0077 
'X-RAY DIFFRACTION' 36  ? refined 32.9197  -12.3078  60.5006  0.1604  0.0971  0.1988 0.1761  0.0566  0.1323  0.0004  0.0124  
0.0002  -0.0022 -0.0009 0.0005  -0.0150 -0.0168 -0.0031 -0.0200 -0.0075 -0.0070 0.0096  0.0019  -0.1087 
'X-RAY DIFFRACTION' 37  ? refined 34.0375  2.5585    53.8416  0.2916  0.4001  0.5186 0.2048  0.0996  -0.0767 0.0924  0.0386  
0.0006  -0.0601 0.0150  -0.0114 -0.0131 0.0046  0.0270  -0.0107 -0.0084 0.0157  -0.0274 -0.0401 -0.0978 
'X-RAY DIFFRACTION' 38  ? refined 28.3291  -10.8685  53.3689  0.0829  0.0727  0.2239 0.1096  0.0070  0.0399  0.0259  0.0028  
0.0100  -0.0086 0.0002  0.0015  0.0068  -0.0248 0.0078  -0.0108 0.0073  -0.0067 -0.0275 -0.0118 0.1304  
'X-RAY DIFFRACTION' 39  ? refined 37.2861  -13.9106  46.6182  0.2240  0.1154  0.3464 -0.0076 -0.0536 -0.1094 0.0052  0.0109  
0.0064  0.0073  -0.0011 -0.0013 0.0034  -0.0043 0.0092  -0.0102 0.0001  0.0116  -0.0003 0.0015  0.0180  
'X-RAY DIFFRACTION' 40  ? refined 36.3334  -19.2441  44.3134  0.0009  0.0003  0.1650 0.0330  -0.0365 0.0469  0.0463  0.0212  
0.0306  0.0207  0.0041  -0.0128 -0.0101 0.0165  0.0001  -0.0116 -0.0116 -0.0203 0.0090  0.0207  -0.1248 
'X-RAY DIFFRACTION' 41  ? refined 52.2727  -30.5711  62.0117  0.1905  -0.1811 0.2528 -0.0845 -0.0704 0.0359  0.0007  0.0261  
0.0031  -0.0039 -0.0005 0.0081  -0.0055 0.0179  -0.0065 -0.0581 -0.0222 -0.0206 0.0192  0.0138  -0.1672 
'X-RAY DIFFRACTION' 42  ? refined 44.0295  -27.1045  80.7811  0.0906  0.0065  0.2218 -0.0292 -0.0604 -0.0110 0.0335  0.0051  
0.0209  -0.0056 0.0118  0.0050  0.0132  -0.0109 -0.0118 0.0120  -0.0007 -0.0193 0.0195  -0.0024 0.0000  
'X-RAY DIFFRACTION' 43  ? refined 44.1784  -10.1468  81.6920  0.0583  -0.0041 0.0945 -0.0247 0.0889  -0.0537 0.0146  0.2764  
0.0128  -0.0407 0.0084  0.0079  -0.0143 0.0127  -0.0171 0.0089  -0.0038 0.0024  -0.0046 -0.0017 -0.0789 
'X-RAY DIFFRACTION' 44  ? refined 87.3990  -29.5283  30.9472  0.2517  0.0504  0.2294 -0.0245 0.0138  0.0900  0.3091  0.1986  
0.1075  0.0315  -0.0935 0.1147  -0.0027 -0.0086 0.0301  -0.0058 -0.0028 -0.0054 -0.0373 0.0040  -0.1713 
'X-RAY DIFFRACTION' 45  ? refined 69.3890  -13.6780  41.8432  0.2067  0.0547  0.2213 0.0585  -0.0017 0.0584  0.0207  0.0636  
0.0707  0.0253  -0.0286 -0.0019 -0.0017 0.0141  -0.0592 -0.0030 -0.0767 -0.0021 0.0152  0.0378  -0.2902 
'X-RAY DIFFRACTION' 46  ? refined 74.4483  -14.6194  35.4166  0.6360  1.0861  0.7553 -0.1560 0.0932  0.2078  0.0009  0.0005  
0.0004  0.0014  0.0010  0.0009  -0.0047 0.0752  0.0242  -0.0489 -0.0475 -0.0443 -0.0353 -0.0685 0.0003  
'X-RAY DIFFRACTION' 47  ? refined 68.8604  -27.0886  43.9756  0.2574  -0.0413 0.5747 0.0253  -0.0850 0.2405  0.0251  0.0690  
0.0361  -0.0345 0.0181  -0.0198 0.0104  0.0469  0.0850  -0.1081 -0.0367 -0.1970 0.0926  0.0337  0.1884  
'X-RAY DIFFRACTION' 48  ? refined 74.8613  12.5180   32.3441  0.3748  0.1432  0.3850 -0.1461 0.0645  0.1625  0.0364  0.0027  
0.0033  0.0024  0.0098  0.0023  -0.0055 0.0002  -0.0038 0.0050  0.0059  -0.0027 -0.0183 -0.0246 -0.0957 
'X-RAY DIFFRACTION' 49  ? refined 81.5473  -6.5303   53.4136  0.1619  0.0578  0.0975 -0.1331 0.0635  -0.0372 0.0836  0.0227  
0.0323  0.0368  0.0023  0.0181  -0.0094 0.0106  0.0461  0.0080  -0.0044 -0.0057 0.0163  -0.0198 -0.0523 
'X-RAY DIFFRACTION' 50  ? refined 79.6220  -21.7221  73.8528  0.2601  0.1524  0.3109 -0.0332 -0.1479 0.0770  0.0080  0.0044  
0.0422  0.0057  0.0148  0.0104  -0.0017 -0.0008 0.0136  0.0280  0.0067  -0.0315 0.0003  -0.0017 0.0296  
'X-RAY DIFFRACTION' 51  ? refined 67.9813  -27.9599  74.2068  0.1288  0.1904  0.3114 0.1021  -0.0580 0.0157  0.0936  0.0562  
0.0213  -0.0619 -0.0227 -0.0010 -0.0179 -0.0497 0.0759  -0.0341 0.0025  -0.0318 0.0179  0.0924  0.0708  
'X-RAY DIFFRACTION' 52  ? refined 71.7770  -26.9649  73.9163  0.0755  -0.0348 0.2003 -0.0185 -0.0768 0.0229  0.0191  0.0248  
0.0873  0.0206  -0.0295 -0.0143 0.0274  -0.0283 0.0370  -0.0185 0.0482  0.0447  -0.0282 -0.0131 0.3762  
'X-RAY DIFFRACTION' 53  ? refined 75.9525  -25.7267  59.5043  0.1471  -0.0969 0.2354 -0.0260 -0.1539 -0.0230 0.0155  0.0141  
0.0045  -0.0071 -0.0057 -0.0012 0.0337  -0.0073 -0.0410 -0.0073 -0.0266 -0.0001 0.0208  0.0018  -0.0272 
'X-RAY DIFFRACTION' 54  ? refined 85.5622  -21.6045  60.1360  0.0637  0.0035  0.2060 -0.0508 -0.1283 0.0523  0.0151  0.0190  
0.0167  0.0089  0.0107  -0.0045 0.0003  -0.0168 0.0066  0.0019  -0.0042 -0.0214 -0.0010 -0.0003 -0.1145 
'X-RAY DIFFRACTION' 55  ? refined 85.7475  -11.6038  68.7373  0.4154  0.7989  0.5137 -0.0906 -0.0485 0.0292  0.0193  0.0029  
0.0161  0.0072  -0.0140 -0.0037 -0.0097 0.0057  0.0350  -0.0192 -0.1064 -0.0564 0.0205  -0.0063 -0.0005 
'X-RAY DIFFRACTION' 56  ? refined 85.5429  -25.6975  103.0399 0.5597  0.8115  0.6281 -0.1878 -0.3017 -0.1530 0.0422  0.0514  
0.0272  -0.0110 0.0022  -0.0359 0.0135  -0.0328 0.0621  0.0445  0.0023  -0.0182 0.0066  0.0697  0.0540  
'X-RAY DIFFRACTION' 57  ? refined 77.5648  -25.0471  92.4889  0.2941  0.2800  0.1935 0.0182  -0.1088 0.1005  0.1299  0.3834  
0.2983  -0.2171 0.0802  -0.2085 0.0028  0.0171  0.1014  0.0341  -0.0212 -0.1334 -0.1397 -0.0494 0.3702  
'X-RAY DIFFRACTION' 58  ? refined 73.6818  -25.5593  102.5051 0.4185  0.3208  0.4506 -0.2186 -0.0167 -0.0564 0.0261  0.0457  
0.0067  -0.0006 -0.0117 0.0098  -0.0286 -0.0718 0.0648  0.0400  -0.0539 -0.0012 0.0018  -0.0364 -0.0299 
'X-RAY DIFFRACTION' 59  ? refined 78.4087  -22.9509  112.7492 0.6941  0.5185  0.6130 -0.1703 -0.3145 -0.1116 0.0230  0.0102  
0.0206  -0.0100 -0.0005 0.0115  -0.0116 0.0677  -0.0084 0.0223  -0.0564 0.0362  0.0134  -0.0088 -0.0212 
'X-RAY DIFFRACTION' 60  ? refined 79.9941  -37.2753  112.9587 0.3482  0.5557  0.3150 -0.0413 -0.2163 -0.0208 0.0045  0.0009  
0.0326  -0.0017 0.0084  -0.0022 0.0013  0.0224  -0.0066 -0.0040 -0.0141 -0.0136 -0.0176 0.0306  -0.0385 
'X-RAY DIFFRACTION' 61  ? refined 47.6697  -53.6490  51.2979  0.5639  0.7756  0.5507 -0.1128 0.0393  0.0380  0.0062  0.0033  
0.0038  -0.0049 0.0031  -0.0014 0.0141  0.0238  -0.0017 0.0192  -0.0206 -0.0096 -0.0210 -0.0144 0.0002  
'X-RAY DIFFRACTION' 62  ? refined 48.7374  -48.6119  41.2775  0.0764  -0.0221 0.1413 0.0891  -0.0709 -0.0176 0.0584  0.0295  
0.0473  -0.0116 -0.0400 -0.0063 -0.0482 0.0218  0.0004  -0.0306 -0.0235 -0.0245 -0.0644 -0.0525 -0.2624 
'X-RAY DIFFRACTION' 63  ? refined 63.4835  -42.5392  52.8493  0.4233  0.8655  0.6887 0.1917  -0.1024 0.2655  0.0053  0.0406  
0.0304  0.0106  0.0002  -0.0251 -0.0044 -0.0278 -0.0121 -0.0114 0.0009  0.0019  -0.0027 -0.0375 -0.0016 
'X-RAY DIFFRACTION' 64  ? refined 49.6326  -47.8432  47.0724  0.0928  -0.0321 0.2693 -0.0163 -0.0292 -0.0547 0.0104  0.0014  
0.0067  0.0027  0.0046  -0.0017 0.0010  0.0105  0.0009  -0.0368 0.0126  -0.0017 -0.0175 -0.0023 -0.0069 
'X-RAY DIFFRACTION' 65  ? refined 54.7350  -43.7742  40.9686  0.0455  -0.0398 0.0382 0.0316  -0.0320 -0.0569 0.0271  0.0110  
0.0013  -0.0008 0.0034  -0.0043 0.0018  0.0345  -0.0311 0.0180  0.0013  -0.0105 0.0061  0.0037  -0.0431 
'X-RAY DIFFRACTION' 66  ? refined 48.2868  -44.7868  59.3446  0.0830  0.0137  0.1918 0.0553  0.0390  0.0849  0.0004  0.0025  
0.0027  -0.0007 -0.0010 0.0011  0.0036  0.0122  -0.0009 -0.0121 -0.0058 -0.0137 -0.0057 0.0084  0.0265  
'X-RAY DIFFRACTION' 67  ? refined 43.2643  -37.2578  54.0058  0.3928  0.6994  0.6390 0.0935  -0.1671 -0.0225 0.0022  0.0095  
0.0029  0.0024  -0.0020 -0.0054 0.0017  -0.0155 0.0262  0.0544  0.0010  0.0072  0.0130  0.0033  -0.0002 
'X-RAY DIFFRACTION' 68  ? refined 58.5603  -38.0486  42.3248  0.0489  -0.0569 0.1330 0.0062  -0.0607 0.0092  0.0022  0.0075  
0.0029  -0.0011 -0.0032 0.0019  0.0012  -0.0083 -0.0002 0.0016  0.0026  -0.0037 -0.0098 -0.0091 0.0054  
'X-RAY DIFFRACTION' 69  ? refined 67.3127  -12.2165  7.0138   0.1343  0.2925  0.1660 0.0304  0.1066  0.1427  0.0520  0.1745  
0.4865  0.0944  -0.1178 -0.1895 0.0431  0.0577  -0.0214 -0.1522 -0.0284 -0.1272 0.0555  0.2752  0.5875  
'X-RAY DIFFRACTION' 70  ? refined 56.2474  12.5106   -1.6322  0.7780  0.4034  0.4789 0.0405  0.1036  0.0076  0.0712  0.0157  
0.0448  -0.0343 0.0559  -0.0273 -0.0427 0.2025  0.0864  0.0342  -0.1417 0.0317  0.0167  0.2717  -0.0102 
'X-RAY DIFFRACTION' 71  ? refined 68.4088  -23.4285  -11.1182 0.4286  0.4090  0.5384 0.2861  -0.0129 -0.0712 0.0644  0.0187  
0.0100  -0.0020 0.0210  -0.0038 -0.0417 -0.0611 -0.0101 0.0256  -0.0011 0.0369  -0.0278 -0.0432 0.0285  
'X-RAY DIFFRACTION' 72  ? refined 65.6482  -11.2576  -5.1709  0.2128  0.3398  0.3564 0.0791  -0.1044 0.1561  0.1207  0.0880  
0.1288  -0.0520 0.1115  -0.0267 0.0166  0.0889  0.0353  0.0255  -0.0241 -0.0959 0.0256  0.1246  0.1575  
'X-RAY DIFFRACTION' 73  ? refined 50.5712  -26.2086  -13.0061 0.5926  0.2484  0.4319 0.0217  -0.0796 0.1616  0.0247  0.0013  
0.1128  0.0033  -0.0307 -0.0084 -0.0188 -0.1355 -0.1380 0.1097  0.0739  0.0204  0.0541  -0.0728 -0.0765 
'X-RAY DIFFRACTION' 74  ? refined 62.6462  1.6095    -15.3806 0.6573  0.5682  0.3882 0.0850  -0.0375 0.2810  0.0281  0.1097  
0.0588  -0.0029 0.0239  -0.0688 0.0052  0.0079  0.0194  0.0242  0.0210  0.0610  -0.0652 -0.0447 -0.0859 
'X-RAY DIFFRACTION' 75  ? refined 58.9126  -20.7568  -16.4791 0.6580  0.3588  0.3521 0.2032  0.0124  0.1468  0.0224  0.0439  
0.0397  -0.0155 0.0295  -0.0244 0.1095  0.0873  -0.0301 -0.0739 -0.0653 0.0038  0.0819  0.0794  0.0999  
'X-RAY DIFFRACTION' 76  ? refined 62.1259  -11.0393  -16.6844 0.3108  0.5574  0.1995 -0.0576 -0.0083 0.1517  0.1787  0.0937  
0.1574  -0.0707 -0.1639 0.0439  -0.1653 0.0980  0.0191  0.0524  0.0529  -0.0436 -0.0928 0.1489  -0.0428 
'X-RAY DIFFRACTION' 77  ? refined 55.5746  -4.2022   -9.6763  0.5951  0.1562  0.5764 0.0274  -0.1519 0.0856  0.2898  0.0389  
0.3190  -0.0875 0.1935  -0.1028 -0.1062 0.0711  0.1065  -0.0687 -0.1288 -0.0823 -0.0426 0.1132  0.0496  
'X-RAY DIFFRACTION' 78  ? refined 40.1491  -16.1950  2.7994   1.5186  1.6018  1.4796 0.0876  -0.0672 0.0765  0.0020  0.0343  
0.0073  -0.0021 -0.0006 0.0138  -0.0023 -0.0019 0.0042  0.0027  -0.0038 0.0007  0.0009  -0.0007 -0.0003 
'X-RAY DIFFRACTION' 79  ? refined 33.9912  -19.6643  -8.0667  0.7585  0.7305  0.7917 0.0206  -0.0519 0.1212  0.0120  0.0026  
0.0072  -0.0023 0.0034  -0.0044 -0.0001 0.0078  -0.0088 0.0010  0.0193  -0.0158 0.0124  -0.0128 0.0000  
'X-RAY DIFFRACTION' 80  ? refined -21.6714 -2.3371   -75.6700 0.8549  1.0095  0.9954 0.0386  -0.1158 0.4230  0.0223  0.0072  
0.0271  0.0125  0.0137  0.0136  -0.1892 0.0453  0.0426  -0.1399 -0.0346 0.0330  -0.1134 0.1125  -0.0554 
'X-RAY DIFFRACTION' 81  ? refined -23.0394 -24.9121  -76.2411 0.6079  1.2633  0.1368 0.0342  -0.0862 0.0750  0.0285  0.0226  
0.0963  -0.0007 -0.0169 0.0451  -0.0361 -0.0300 0.0096  -0.0322 -0.0717 0.0542  0.1282  -0.0872 -0.5034 
'X-RAY DIFFRACTION' 82  ? refined -45.5455 -22.7333  -73.7981 0.8587  1.2108  1.0302 -0.3589 -0.3126 0.3002  0.0075  0.0037  
0.0030  0.0061  0.0052  0.0038  -0.1064 0.1425  0.1126  0.0526  -0.0697 0.0160  0.0123  0.0054  0.0005  
'X-RAY DIFFRACTION' 83  ? refined -27.2784 -31.4443  -95.6901 1.0331  1.5301  0.6768 0.0694  -0.0074 -0.0929 -0.0008 -0.0000 
-0.0005 -0.0001 -0.0003 0.0003  -0.0686 0.0629  0.0492  -0.0170 -0.1269 -0.0073 -0.0108 0.0529  0.0011  
'X-RAY DIFFRACTION' 84  ? refined -28.7633 -44.9148  -66.0959 0.8879  0.7671  0.6759 0.0788  0.1776  0.0786  0.0094  0.0080  
0.0039  0.0079  -0.0026 -0.0053 -0.0123 0.0074  0.0389  0.0281  -0.0494 -0.0361 -0.0528 -0.0403 -0.0001 
'X-RAY DIFFRACTION' 85  ? refined 23.8167  -24.2027  -32.4393 0.3824  0.1644  0.2798 0.1082  0.1621  0.1138  0.0775  0.2780  
0.0100  0.1105  0.0224  0.0378  0.0737  0.0330  0.0165  0.1733  0.0057  -0.0301 -0.0492 -0.0499 0.1797  
'X-RAY DIFFRACTION' 86  ? refined 6.9692   8.7354    -49.8857 0.5416  0.6790  0.8227 0.2538  -0.2363 -0.0810 0.0322  0.0196  
0.1184  0.0242  -0.0469 -0.0289 -0.1409 -0.1055 -0.0288 -0.1363 -0.1382 0.0451  -0.0936 -0.3049 -0.1395 
'X-RAY DIFFRACTION' 87  ? refined 6.3967   -11.4926  -52.3002 0.3190  0.9452  0.2062 0.0185  -0.0699 0.2008  0.0660  0.0898  
0.1766  -0.0083 0.0509  0.1061  -0.0494 0.1766  0.0565  -0.0375 -0.1240 -0.0294 -0.0805 -0.1380 -0.6500 
'X-RAY DIFFRACTION' 88  ? refined -5.2014  -2.9461   -59.5768 0.6950  0.9690  0.6554 0.3285  -0.1657 0.2224  0.0202  0.0075  
0.0584  -0.0017 -0.0023 0.0137  0.0085  -0.0213 0.0005  -0.0750 -0.0346 0.0273  0.0188  -0.0230 -0.0153 
'X-RAY DIFFRACTION' 89  ? refined 41.9993  10.2932   -15.5567 0.5428  0.3946  0.6280 0.1620  -0.1559 0.1567  0.0735  0.0948  
0.0473  0.0767  0.0220  0.0401  -0.0171 -0.0582 -0.0180 -0.0289 0.0901  -0.0719 0.0469  -0.0554 0.0989  
'X-RAY DIFFRACTION' 90  ? refined 52.1546  -8.7267   -23.9030 0.8223  0.9454  0.2519 0.1061  0.0867  0.1337  0.0972  0.0765  
0.2946  0.0223  -0.0693 0.1157  -0.0276 0.0863  -0.0045 -0.1022 0.0559  -0.0937 0.0623  0.3082  0.1379  
'X-RAY DIFFRACTION' 91  ? refined 30.0249  -3.8585   -27.1218 0.3617  0.5124  0.4159 0.2047  -0.2110 0.1110  0.0053  -0.0041 
0.0789  -0.0068 0.0107  0.0062  -0.0253 0.0962  0.0645  -0.0692 -0.0545 0.0088  0.0392  -0.0220 -0.2725 
'X-RAY DIFFRACTION' 92  ? refined 19.1143  -6.8790   -26.7464 0.2859  0.1923  0.2633 -0.0319 -0.0291 0.1888  0.0277  0.0079  
0.0011  0.0128  0.0044  0.0013  -0.0089 -0.0237 0.0124  -0.0356 -0.0354 -0.0249 0.0589  0.0353  -0.3456 
'X-RAY DIFFRACTION' 93  ? refined 26.6477  12.7886   -30.9686 0.5824  0.5481  0.8311 0.0421  0.0880  0.0627  0.0117  0.0070  
0.0115  0.0065  0.0121  0.0075  -0.0017 -0.1044 0.0411  0.0004  -0.0735 0.0394  -0.0044 0.0200  -0.0000 
'X-RAY DIFFRACTION' 94  ? refined 88.2342  -7.4930   11.8888  0.0835  0.1758  0.3209 -0.0971 -0.0119 0.1025  0.3866  0.0522  
0.0470  0.0283  -0.0400 0.0463  -0.0463 0.1968  0.0445  -0.0255 0.0270  -0.0403 -0.0235 0.0091  0.1292  
'X-RAY DIFFRACTION' 95  ? refined 78.7290  -15.7033  19.6067  0.6663  0.9616  0.4153 0.1509  -0.1007 0.0517  0.0555  0.0214  
0.0316  0.0289  -0.0074 -0.0218 0.0166  0.1475  -0.0268 0.0230  0.0485  0.1540  0.0492  0.0866  0.0000  
'X-RAY DIFFRACTION' 96  ? refined 76.7342  -7.8554   4.5281   0.3984  0.1667  0.3308 -0.1059 0.0183  0.1158  0.5150  0.0375  
0.0583  0.1013  0.1451  0.0461  -0.0645 0.1330  0.0650  -0.1468 -0.0831 0.0688  0.0198  0.1679  -0.1194 
'X-RAY DIFFRACTION' 97  ? refined 73.2556  0.1916    11.5508  0.2679  0.2854  0.2318 0.0686  -0.0800 0.1827  0.1267  0.1051  
0.1125  -0.0597 0.1021  0.0045  0.0133  0.1027  0.0862  -0.0762 -0.0690 -0.0320 -0.0505 0.0775  0.2461  
'X-RAY DIFFRACTION' 98  ? refined 86.9322  6.4114    15.9982  0.7213  0.4248  0.7519 0.2209  -0.1605 0.2421  0.0673  0.0648  
0.1383  -0.0397 0.0933  -0.0382 0.0382  0.1012  0.0238  0.0356  -0.0472 -0.0013 -0.0604 0.0871  0.2088  
'X-RAY DIFFRACTION' 99  ? refined 66.2023  12.4997   7.8537   0.3537  0.0595  0.2672 0.0177  -0.0515 0.1524  0.1174  0.0299  
0.1416  0.0099  0.0091  0.0630  0.0604  0.0732  0.0627  -0.0708 -0.0239 -0.0236 -0.0916 0.0295  0.1437  
'X-RAY DIFFRACTION' 100 ? refined 73.4174  24.8587   12.3177  1.3894  1.2955  1.2894 -0.0864 -0.1514 0.2162  0.0030  0.0030  
0.0004  -0.0035 -0.0015 0.0007  0.0169  0.0270  0.0311  -0.0312 -0.0523 0.0171  0.0198  0.0082  -0.0002 
'X-RAY DIFFRACTION' 101 ? refined 89.8696  -103.1519 -5.9704  0.8111  1.2602  0.3327 0.1332  0.0165  -0.1766 0.0716  0.0013  
0.0044  -0.0085 0.0102  -0.0006 0.0335  0.0278  0.0137  -0.0307 -0.0212 -0.0112 0.0573  0.0219  -0.0059 
'X-RAY DIFFRACTION' 102 ? refined 72.9190  -95.1058  2.7785   0.9846  0.5669  0.8653 -0.2423 -0.3154 -0.1275 0.0009  0.0028  
0.0021  -0.0021 -0.0012 0.0023  0.0348  0.0052  0.0122  -0.0507 -0.0312 0.0033  -0.0024 0.0035  -0.0003 
'X-RAY DIFFRACTION' 103 ? refined 86.5238  -95.8587  10.9272  1.1647  1.4816  0.4600 0.1464  -0.2778 -0.1218 0.0049  0.1464  
0.0236  -0.0235 -0.0068 0.0593  -0.0545 0.0953  0.0231  -0.0488 -0.0530 0.0902  0.1811  -0.0234 0.0067  
'X-RAY DIFFRACTION' 104 ? refined 89.9943  -94.8195  10.3754  0.5909  0.9439  0.1211 0.1140  0.1346  -0.0023 0.0174  0.0066  
0.0514  -0.0082 -0.0102 0.0204  -0.0334 -0.0311 -0.0117 -0.0657 -0.0355 -0.0213 0.0734  0.0098  -0.1403 
'X-RAY DIFFRACTION' 105 ? refined 100.1212 -115.9858 17.1687  0.5133  0.3630  0.4068 0.0805  -0.0809 -0.2396 0.1771  0.1202  
0.2046  0.0204  0.1900  0.0551  -0.0189 0.1019  0.0091  0.1420  0.0245  -0.2386 0.0715  0.1070  -0.4787 
'X-RAY DIFFRACTION' 106 ? refined 107.8454 -118.0167 35.7554  0.9958  0.3408  0.9640 -0.2127 -0.0256 -0.0860 0.0414  0.0135  
0.2383  -0.0093 0.0966  -0.0069 0.0746  0.1284  -0.0163 0.0155  0.1091  -0.0370 0.0669  0.1210  -0.0025 
'X-RAY DIFFRACTION' 107 ? refined 106.5010 -118.6546 26.2250  1.2077  0.7022  1.1162 0.4121  0.0471  -0.2905 0.2606  0.0036  
0.0237  0.0317  0.0767  0.0094  0.0050  0.1565  0.0453  -0.1317 -0.0105 0.0819  -0.1023 -0.0308 -0.0695 
'X-RAY DIFFRACTION' 108 ? refined 100.5469 -73.2271  15.4728  0.5836  0.1982  0.4255 0.1233  0.0874  -0.0987 0.0015  0.0004  
0.0481  -0.0005 -0.0083 0.0028  -0.0231 0.0422  -0.0204 -0.0654 -0.0640 0.0116  -0.0559 -0.0514 -0.0566 
'X-RAY DIFFRACTION' 109 ? refined 106.0382 -80.5459  17.9872  0.8193  1.1625  0.4378 0.1776  -0.2655 0.0833  0.0246  0.1184  
0.0400  -0.0430 -0.0305 0.0609  0.0400  0.0068  -0.0026 -0.0163 0.0082  -0.0260 0.0024  -0.0182 0.0055  
'X-RAY DIFFRACTION' 110 ? refined 110.7836 -76.3016  24.3847  0.1701  0.0494  0.2447 -0.0828 0.1132  -0.0133 0.0193  0.0287  
0.0178  0.0174  -0.0062 -0.0200 -0.0151 0.0011  0.0034  -0.0161 -0.0109 -0.0253 0.0110  0.0269  0.0031  
'X-RAY DIFFRACTION' 111 ? refined 104.2128 -82.4028  29.9235  0.7105  0.6280  0.6989 0.1718  0.1203  0.0406  0.0021  0.0230  
0.0055  -0.0064 -0.0023 0.0108  0.0411  0.0248  0.0437  0.0012  0.0419  0.0205  -0.0458 -0.0587 0.0005  
'X-RAY DIFFRACTION' 112 ? refined 114.4800 -88.2324  20.2708  1.0047  1.4424  1.0851 0.0205  0.0878  0.0084  0.0077  0.0040  
0.0047  0.0058  -0.0060 -0.0046 0.0304  -0.0216 -0.0088 -0.0019 0.0735  0.0082  -0.0017 -0.0247 -0.0003 
'X-RAY DIFFRACTION' 113 ? refined 114.6379 -103.7988 14.2715  0.9358  0.8764  0.5662 -0.0034 -0.0091 -0.1156 0.0025  0.0020  
0.0061  0.0015  0.0008  0.0020  -0.0333 0.0815  0.0014  0.0069  -0.0333 0.0028  -0.0254 -0.0232 -0.0001 
'X-RAY DIFFRACTION' 114 ? refined 124.5594 -105.5919 15.6752  1.1918  1.0702  0.8679 0.1675  -0.0467 -0.1594 0.0010  0.0006  
0.0008  0.0010  0.0010  0.0010  0.0181  -0.0272 -0.0507 0.0008  0.0171  0.0150  -0.0193 -0.0586 0.0004  
'X-RAY DIFFRACTION' 115 ? refined 127.9893 -93.0538  18.4952  1.0287  1.3895  1.1059 0.0769  0.0548  0.1999  0.0019  0.0016  
0.0099  -0.0005 0.0016  -0.0041 -0.0367 -0.0138 -0.0138 0.0043  -0.0012 -0.0024 0.0158  0.0104  -0.0000 
'X-RAY DIFFRACTION' 116 ? refined 113.4706 -99.9024  10.4526  1.0263  1.4029  0.8410 0.2649  0.0964  -0.1010 0.0071  0.0031  
0.0004  0.0050  -0.0016 -0.0010 0.0668  0.0440  -0.0208 0.0501  0.0383  -0.0283 -0.0282 -0.0400 -0.0001 
'X-RAY DIFFRACTION' 117 ? refined 125.1372 -100.2193 4.6702   1.0227  1.2127  0.8621 0.2365  0.3157  -0.1112 0.0019  0.0043  
0.0040  -0.0003 -0.0030 -0.0002 -0.0034 -0.0109 0.0102  -0.0093 -0.0066 -0.0111 -0.0070 0.0070  -0.0002 
'X-RAY DIFFRACTION' 118 ? refined 115.2627 -101.3194 -1.5446  1.4460  1.4796  1.1461 0.1917  0.0360  -0.1094 0.0039  0.0001  
0.0023  0.0008  0.0028  0.0010  0.0219  0.0355  -0.0429 -0.0288 0.0075  0.0343  0.0140  -0.0094 -0.0001 
'X-RAY DIFFRACTION' 119 ? refined 87.1678  -102.4392 47.4345  0.2390  0.0897  0.2923 0.1803  -0.0583 -0.1048 0.2441  0.0231  
0.1379  0.0092  -0.0360 -0.0169 -0.0929 0.0003  0.0456  -0.0683 -0.0220 -0.1225 0.0780  -0.0587 -0.4767 
'X-RAY DIFFRACTION' 120 ? refined 104.9091 -99.1306  48.3293  0.2430  0.2149  0.3743 0.2353  0.1026  -0.0827 0.0066  0.0115  
-0.0018 0.0097  0.0032  0.0062  -0.0061 0.0345  -0.0064 0.0085  -0.0182 -0.0521 0.0586  0.0211  -0.2670 
'X-RAY DIFFRACTION' 121 ? refined 102.2430 -80.6548  55.8227  0.1309  -0.1037 0.3923 -0.1601 -0.0468 0.0828  0.0263  0.0424  
0.0114  0.0233  -0.0041 0.0022  0.0154  0.1048  -0.0173 0.0085  0.0184  -0.0761 0.0921  0.0808  0.2080  
'X-RAY DIFFRACTION' 122 ? refined 102.5302 -52.7343  82.6278  0.1583  0.0303  0.1724 -0.1052 -0.1501 0.0233  0.0983  0.0215  
0.0072  -0.0118 -0.0321 0.0095  0.0179  -0.0002 -0.0234 0.0151  -0.0119 0.0333  -0.0140 -0.0280 -0.2326 
'X-RAY DIFFRACTION' 123 ? refined 83.3240  -63.3359  49.3447  -0.0189 0.1969  0.2190 0.1094  -0.0696 0.1802  0.1337  0.0580  
0.0606  -0.0178 -0.0774 -0.0300 0.0657  0.2752  0.0030  -0.0670 0.0967  0.1139  0.0348  -0.1461 0.2117  
'X-RAY DIFFRACTION' 124 ? refined 99.0953  -49.4730  71.8148  0.0274  0.1927  0.2589 0.1367  -0.0955 0.0467  0.0083  0.0000  
0.0282  0.0006  -0.0144 -0.0011 -0.0039 -0.0122 0.0003  0.0117  0.0044  -0.0149 -0.0196 0.0464  -0.0744 
'X-RAY DIFFRACTION' 125 ? refined 93.3582  -64.9658  77.2099  0.0592  -0.0620 0.2954 0.0251  -0.0519 0.0489  0.0282  0.2406  
0.0946  -0.0791 0.0181  -0.1046 0.0332  -0.0417 -0.0640 -0.0645 -0.0672 -0.0720 0.0494  0.0372  -0.0421 
'X-RAY DIFFRACTION' 126 ? refined 94.6742  -59.3528  56.5567  0.1162  0.0345  0.3063 0.0263  0.1044  -0.0027 0.2849  0.3519  
0.1216  -0.3035 0.1270  -0.1048 -0.0245 0.1120  0.1512  -0.1387 -0.1308 -0.1690 0.0005  0.0454  -0.7720 
'X-RAY DIFFRACTION' 127 ? refined 107.0502 -51.1376  46.6345  0.1330  0.0619  0.3319 0.1095  -0.0250 0.1280  0.0098  0.0259  
0.0255  0.0099  0.0024  -0.0111 0.0045  0.0145  -0.0573 0.0632  0.0773  0.0328  -0.0002 -0.0213 0.5565  
'X-RAY DIFFRACTION' 128 ? refined 98.3934  -111.7491 114.0793 0.3591  0.3164  0.3722 -0.2276 -0.0886 0.1038  0.0017  0.0047  
0.0029  -0.0009 -0.0027 -0.0014 -0.0112 0.0191  0.0198  -0.0145 -0.0047 -0.0070 0.0073  -0.0001 0.0254  
'X-RAY DIFFRACTION' 129 ? refined 102.6355 -116.4881 86.1146  0.6632  0.2458  0.8539 -0.2192 -0.0985 0.1517  0.0061  0.0113  
0.0453  -0.0054 -0.0029 -0.0138 -0.0537 -0.0034 -0.0840 -0.0626 -0.0207 -0.0488 0.1349  -0.0019 -0.0872 
'X-RAY DIFFRACTION' 130 ? refined 117.0400 -125.1789 88.9920  0.5903  0.1063  0.6251 0.1773  -0.0023 0.0306  0.0076  0.0288  
0.0437  -0.0055 -0.0081 0.0360  0.0212  0.0075  -0.0504 0.0081  -0.0262 0.0009  0.0295  -0.0001 -0.0201 
'X-RAY DIFFRACTION' 131 ? refined 97.3160  -131.3385 109.4529 0.5532  0.2846  0.6771 -0.2900 0.0417  0.0870  0.0523  0.0796  
0.0827  -0.0002 -0.0410 -0.0641 0.0112  -0.0282 -0.0287 0.0509  -0.0189 0.0088  0.0396  0.0151  -0.0746 
'X-RAY DIFFRACTION' 132 ? refined 99.7874  -121.9358 85.2550  0.2940  0.0275  0.1613 -0.0948 -0.1370 0.1007  -0.0034 0.1930  
0.1627  0.0184  0.0068  -0.1249 0.0537  -0.0056 -0.1138 -0.1534 0.0025  -0.0447 0.1856  -0.0083 0.1563  
'X-RAY DIFFRACTION' 133 ? refined 71.1767  -128.7936 81.2927  1.3924  1.2723  1.4813 -0.1540 -0.1162 0.1020  0.0004  0.0033  
-0.0003 -0.0015 0.0002  -0.0005 0.0085  0.0089  0.0002  -0.0076 -0.0068 -0.0102 0.0235  0.0239  0.0001  
'X-RAY DIFFRACTION' 134 ? refined 76.3024  -118.1116 78.3531  0.6057  0.2825  0.5084 -0.2205 -0.1994 0.0763  0.0830  0.0967  
0.1777  0.0448  -0.0176 0.1023  0.0655  -0.0051 -0.0127 -0.0275 0.0635  -0.0283 0.0016  0.0364  0.0387  
'X-RAY DIFFRACTION' 135 ? refined 78.2853  -118.0166 86.9281  0.3735  0.2164  0.3074 -0.2920 -0.1949 0.0400  0.0071  0.0843  
0.0152  0.0247  0.0125  0.0137  0.0055  -0.0413 0.0472  0.0368  -0.0301 0.0473  0.0561  -0.0455 -0.0518 
'X-RAY DIFFRACTION' 136 ? refined 79.1090  -111.1460 92.1530  0.1647  0.2965  0.3734 -0.1724 -0.0799 -0.0587 0.0092  0.0348  
0.0169  -0.0110 0.0079  -0.0241 0.0375  0.0334  0.0268  0.0411  0.0124  0.0159  0.0074  -0.0066 0.2828  
'X-RAY DIFFRACTION' 137 ? refined 94.3355  -96.7503  87.9071  0.1620  0.1767  0.2926 -0.0869 0.1184  0.0402  0.1130  0.1641  
0.1153  0.0845  -0.1069 -0.0470 0.0267  -0.0824 -0.1053 -0.0065 -0.0025 0.0196  0.1486  -0.1335 0.1829  
'X-RAY DIFFRACTION' 138 ? refined 91.8094  -105.6736 62.1188  0.1765  -0.0117 0.1405 0.0047  -0.1072 -0.0101 -0.0001 0.0029  
0.0024  -0.0002 -0.0000 0.0012  0.0081  0.0065  0.0110  -0.0019 0.0054  0.0066  -0.0081 0.0024  0.0701  
'X-RAY DIFFRACTION' 139 ? refined 135.1471 -93.5795  112.6158 0.4383  0.4477  0.7329 -0.1020 -0.0399 0.1350  0.0095  0.0131  
0.0136  -0.0022 0.0076  0.0080  -0.0601 -0.0224 -0.0103 -0.0261 -0.0778 -0.0092 -0.0308 0.0222  0.0009  
'X-RAY DIFFRACTION' 140 ? refined 117.2677 -109.4684 101.5054 0.2512  0.2597  0.4150 -0.2161 -0.0492 -0.0056 0.0328  0.0227  
0.0155  -0.0148 0.0023  0.0135  -0.0158 0.0234  -0.0509 -0.0002 -0.0195 0.0226  0.0055  0.0260  -0.1477 
'X-RAY DIFFRACTION' 141 ? refined 117.2258 -106.1697 104.8668 0.1391  0.2995  0.2775 0.0415  -0.0323 0.1930  0.1413  0.0835  
0.0259  -0.1051 0.0471  -0.0385 0.0118  -0.0575 0.0106  -0.0031 0.0658  0.0598  0.1197  -0.0192 0.2317  
'X-RAY DIFFRACTION' 142 ? refined 115.3107 -98.4311  98.4307  0.0999  0.0488  0.3518 -0.0069 -0.0437 0.2049  0.0053  0.0506  
0.0121  -0.0089 -0.0042 -0.0164 -0.0115 0.0344  0.0805  0.0580  -0.0559 -0.1413 -0.0254 0.0557  -0.3586 
'X-RAY DIFFRACTION' 143 ? refined 130.8794 -88.5619  95.3336  0.2561  0.3565  0.4101 -0.1487 -0.0382 0.1295  0.0116  0.0165  
0.0161  0.0130  -0.0065 -0.0124 0.0079  -0.0104 -0.0006 0.0059  -0.0050 -0.0182 -0.0088 0.0210  -0.0016 
'X-RAY DIFFRACTION' 144 ? refined 120.9252 -86.4954  105.7407 0.3175  0.5864  0.4032 -0.2275 0.0068  0.1798  0.0049  -0.0001 
0.0079  0.0003  0.0066  0.0002  -0.0181 -0.0298 -0.0062 0.0305  -0.0500 0.0220  0.0607  -0.0445 -0.1806 
'X-RAY DIFFRACTION' 145 ? refined 122.5281 -135.8402 111.2786 0.9237  0.7759  0.7540 0.0944  0.0500  0.4652  0.0498  0.0810  
0.1352  -0.0298 -0.0551 0.1017  -0.0239 0.0429  0.0175  0.0046  -0.0279 -0.0401 0.0059  -0.0031 -0.0402 
'X-RAY DIFFRACTION' 146 ? refined 132.8961 -117.5621 97.0911  0.5883  0.6990  0.5654 0.0375  -0.1645 0.2147  0.0044  0.0026  
0.0061  0.0015  0.0043  -0.0014 -0.0344 0.0344  -0.0176 -0.0113 -0.0333 0.0051  -0.0141 -0.0106 0.0006  
'X-RAY DIFFRACTION' 147 ? refined 126.0281 -107.5161 75.0597  0.2022  -0.0102 0.2394 0.0672  0.0326  -0.0345 0.0772  0.0633  
0.0212  -0.0246 -0.0371 0.0003  0.0238  0.0053  -0.0032 -0.0192 0.0375  -0.0178 -0.0111 0.0114  0.2909  
'X-RAY DIFFRACTION' 148 ? refined 115.7543 -95.6058  69.2521  0.0368  -0.1387 0.2843 0.0321  0.0038  -0.0407 0.0049  0.0180  
0.0122  0.0034  0.0030  0.0134  -0.0173 0.0408  -0.0289 -0.0032 -0.0228 0.0148  0.0125  0.0246  -0.3533 
'X-RAY DIFFRACTION' 149 ? refined 119.4069 -96.5629  69.3998  0.1678  -0.0463 0.3876 0.0439  0.1257  -0.0083 0.0040  0.0097  
0.0157  0.0055  -0.0095 0.0049  -0.0175 -0.0201 0.0031  -0.0443 -0.0351 0.0482  0.0270  0.0172  -0.0374 
'X-RAY DIFFRACTION' 150 ? refined 124.7773 -101.8927 84.9095  0.3904  0.4952  0.5270 0.3142  -0.0363 0.0539  0.0112  0.0135  
0.0214  -0.0070 -0.0117 -0.0034 -0.0275 -0.1183 0.0341  0.0538  0.0720  0.0588  -0.0170 -0.0189 0.0323  
'X-RAY DIFFRACTION' 151 ? refined 130.4471 -99.8553  82.7018  0.2569  0.1219  0.3561 0.0967  -0.0342 0.1764  0.0288  0.1193  
0.0990  -0.0289 0.0572  -0.0482 0.0437  0.0048  0.0277  0.0609  -0.0109 -0.0075 0.0465  0.0586  0.2314  
'X-RAY DIFFRACTION' 152 ? refined 133.7827 -111.3271 75.0972  0.6698  0.6300  0.8134 0.0942  0.0117  0.4155  0.0005  -0.0000 
0.0016  0.0003  -0.0009 -0.0008 -0.0052 -0.0606 -0.0288 0.0378  -0.0686 -0.0202 -0.0551 0.0271  -0.0003 
'X-RAY DIFFRACTION' 153 ? refined 133.3211 -98.0388  39.9889  0.2361  0.6003  0.2233 0.1132  0.0077  -0.0951 0.0021  0.0037  
0.0001  -0.0033 0.0007  -0.0009 -0.0597 -0.0478 -0.0396 0.0237  0.0085  -0.0278 0.0897  0.1036  0.0008  
'X-RAY DIFFRACTION' 154 ? refined 125.3416 -98.9504  50.5866  0.2884  -0.0176 0.3836 0.0883  0.0409  0.0772  0.0179  0.0011  
0.1112  -0.0047 0.0301  -0.0008 0.0404  -0.0221 -0.1059 0.0635  0.0692  -0.0053 0.1439  0.0241  0.0239  
'X-RAY DIFFRACTION' 155 ? refined 121.7988 -97.8864  40.6068  0.2714  0.2840  0.2731 0.1930  0.0789  0.0313  0.0127  0.0221  
0.0092  -0.0090 0.0105  -0.0066 -0.0134 0.0022  -0.1018 0.0262  0.0282  -0.0148 0.0402  0.0303  0.0010  
'X-RAY DIFFRACTION' 156 ? refined 126.2471 -100.8337 30.4918  0.7601  0.6436  0.7603 0.4472  0.0881  0.0624  0.0823  0.0984  
0.0211  -0.0902 -0.0421 0.0454  -0.0359 0.0048  -0.0187 0.0034  -0.0073 0.0249  0.0086  -0.0628 -0.0171 
'X-RAY DIFFRACTION' 157 ? refined 127.7132 -86.6348  30.2990  0.1041  0.0705  0.3407 -0.0475 0.0799  0.0273  0.0184  0.0029  
0.0053  0.0071  0.0106  0.0042  -0.0032 0.0110  -0.0569 -0.0244 0.0204  -0.0537 0.0243  0.0148  0.1058  
'X-RAY DIFFRACTION' 158 ? refined 95.9287  -69.6065  91.5777  0.6673  0.5899  0.5763 0.0163  -0.2146 0.1219  0.0060  0.0037  
0.0043  0.0050  -0.0022 -0.0010 0.0369  -0.0233 -0.0187 -0.0257 -0.0313 -0.0120 0.0058  0.0022  -0.0001 
'X-RAY DIFFRACTION' 159 ? refined 98.8754  -66.8511  100.8519 1.2318  1.4550  1.3191 -0.0746 -0.0864 0.0702  0.0110  0.0032  
0.0057  0.0056  0.0012  -0.0010 -0.0199 0.0382  0.0200  -0.0102 -0.0175 -0.0078 -0.0274 0.0952  0.0006  
'X-RAY DIFFRACTION' 160 ? refined 90.9026  -78.9847  109.0421 1.2142  1.4551  1.2311 -0.1117 0.1308  -0.0691 0.0086  0.0451  
0.0061  0.0081  0.0045  0.0132  -0.0324 -0.0084 -0.0063 0.0120  -0.0268 0.0042  0.0093  -0.0278 0.0003  
'X-RAY DIFFRACTION' 161 ? refined 107.6185 -81.3851  92.1781  0.2144  0.4178  0.3893 0.1121  -0.0044 0.1423  0.0096  0.0434  
0.0671  0.0210  0.0233  0.0479  0.0739  -0.0723 0.0017  0.0531  -0.0383 -0.0798 0.0345  -0.1703 -0.0434 
'X-RAY DIFFRACTION' 162 ? refined 91.4250  -78.1674  98.0548  0.5647  0.6208  0.7030 0.1631  -0.0330 -0.1582 0.0102  0.0063  
0.0121  0.0045  -0.0089 0.0009  0.0424  -0.0507 -0.0088 0.0233  0.0388  0.0075  0.0618  -0.0739 -0.0005 
'X-RAY DIFFRACTION' 163 ? refined 106.0928 -72.8640  99.6050  0.1278  0.2115  0.4355 0.0300  0.0837  0.0858  0.2087  0.2183  
0.0725  -0.2099 -0.0852 0.1028  -0.1116 -0.0777 -0.0740 0.0530  0.0227  0.0022  0.0540  0.0250  0.0066  
'X-RAY DIFFRACTION' 164 ? refined 99.6254  -84.4230  102.8381 0.6375  0.7055  0.4364 0.0026  -0.1837 -0.0200 0.0109  0.0110  
0.0053  -0.0104 -0.0005 -0.0039 0.0763  0.0519  0.0385  0.0171  -0.0431 0.0390  0.0270  0.0006  0.0005  
'X-RAY DIFFRACTION' 165 ? refined 97.2983  -78.4536  83.7208  0.5998  0.4724  0.5572 -0.2436 0.1094  0.2094  0.0424  0.0093  
0.0817  -0.0123 -0.0333 -0.0090 -0.0145 0.0010  -0.0283 -0.0101 -0.0048 -0.0301 0.0149  -0.0252 -0.0401 
'X-RAY DIFFRACTION' 166 ? refined 98.4673  -85.3202  94.4549  0.1012  0.0006  0.1138 0.0715  -0.0252 -0.0030 0.0187  0.0077  
0.0711  -0.0123 -0.0348 0.0207  -0.0108 0.0235  0.0167  0.0094  -0.0151 -0.0115 -0.0378 -0.0417 -0.1803 
'X-RAY DIFFRACTION' 167 ? refined 117.9518 -102.0911 130.6627 0.1079  0.0643  0.1965 -0.0924 -0.0930 0.1012  0.0321  0.0057  
0.0177  0.0136  0.0355  0.0108  -0.0088 0.0320  0.0422  0.0500  -0.0305 -0.0901 -0.0529 0.1041  0.1626  
'X-RAY DIFFRACTION' 168 ? refined 109.0562 -125.1047 144.6224 0.4901  0.1321  0.5043 -0.0978 -0.1539 -0.1124 0.0386  0.0973  
0.0247  -0.0409 0.0200  -0.0460 -0.0462 0.0536  0.0677  -0.1193 0.0416  0.1063  -0.0527 -0.0288 0.1058  
'X-RAY DIFFRACTION' 169 ? refined 107.7260 -137.3398 148.6769 0.8139  0.5234  0.6155 0.0981  0.0416  0.3226  0.0049  0.0145  
0.0123  -0.0042 -0.0029 0.0135  0.0567  -0.0082 -0.0010 -0.0172 -0.0752 0.0233  -0.0666 0.0241  -0.0040 
'X-RAY DIFFRACTION' 170 ? refined 94.4171  -127.1067 133.6631 1.2335  1.2477  1.1576 -0.0201 -0.1919 0.1228  0.0116  0.0090  
0.0411  0.0023  -0.0168 -0.0134 -0.0054 0.0239  -0.0199 0.0044  0.0042  0.0009  -0.0036 0.0130  0.0001  
'X-RAY DIFFRACTION' 171 ? refined 116.5438 -99.2084  154.9520 0.8118  0.4823  0.5869 -0.2632 -0.1588 0.1052  0.0009  0.0063  
0.0045  -0.0021 0.0012  -0.0000 0.0640  0.0581  0.0299  -0.0495 0.0197  0.0627  -0.0692 -0.0057 -0.0000 
'X-RAY DIFFRACTION' 172 ? refined 116.8242 -111.7625 151.1603 0.2308  0.1024  0.2077 -0.0672 -0.0028 0.1408  0.0356  0.0597  
0.0561  -0.0098 0.0024  0.0552  0.0366  0.0194  0.0450  -0.0589 0.0302  0.0149  -0.1257 -0.0347 0.0013  
'X-RAY DIFFRACTION' 173 ? refined 103.8406 -111.1727 140.3358 0.3052  0.1143  0.3068 -0.1248 -0.0825 0.0579  0.0140  0.0135  
0.0050  0.0012  -0.0023 0.0016  0.0067  -0.0048 -0.0094 -0.0098 0.0033  -0.0161 0.0086  -0.0039 0.0364  
'X-RAY DIFFRACTION' 174 ? refined 93.4913  -96.1100  143.7550 1.2446  1.4102  1.1747 -0.0665 -0.0550 0.2264  0.0056  0.0026  
0.0069  0.0000  0.0021  0.0043  -0.0151 0.0145  0.0043  0.0223  -0.0269 -0.0117 -0.0390 -0.0389 0.0001  
'X-RAY DIFFRACTION' 175 ? refined 101.8571 -95.9430  165.5764 0.2306  0.0561  0.2074 0.0236  0.0104  -0.0857 0.0120  0.0500  
0.0303  0.0067  0.0040  -0.0339 0.0064  0.0068  0.0253  -0.0277 0.0171  0.0139  -0.0213 0.0219  0.0783  
'X-RAY DIFFRACTION' 176 ? refined 122.9206 -114.0491 170.6626 1.0155  1.1569  0.8139 -0.1468 0.0746  0.1477  -0.0001 0.0042  
0.0056  -0.0010 -0.0009 0.0052  0.0509  -0.0787 0.0909  0.0422  -0.0469 0.0144  0.0227  0.0469  0.0007  
'X-RAY DIFFRACTION' 177 ? refined 105.1111 -129.1364 154.0701 0.4135  0.2143  0.3899 -0.0851 -0.0943 0.1420  0.1225  0.1167  
0.2986  0.0928  -0.1002 -0.0925 0.0682  -0.1605 -0.1174 0.2296  -0.1548 -0.1740 -0.0488 0.1925  0.0816  
'X-RAY DIFFRACTION' 178 ? refined 106.6929 -101.7767 160.0255 0.4773  0.2224  0.4436 -0.2362 -0.1353 0.0884  0.0727  0.0280  
0.0389  0.0385  -0.0192 -0.0238 -0.0485 0.0990  0.0465  -0.1042 0.0816  0.0226  0.0087  -0.0626 0.1063  
'X-RAY DIFFRACTION' 179 ? refined 107.4604 -114.7704 157.3575 0.6480  0.5411  0.2776 0.0087  -0.1563 0.1762  0.0176  0.0188  
0.0632  -0.0167 -0.0337 0.0314  -0.0865 -0.1390 -0.0147 0.1250  -0.0223 -0.1267 0.0498  0.1108  -0.0111 
'X-RAY DIFFRACTION' 180 ? refined 88.1843  -107.6402 140.5576 1.1840  1.4465  1.3308 -0.1627 -0.0461 0.1905  0.0004  0.0074  
0.0006  -0.0015 -0.0002 0.0022  0.0133  0.0034  0.0235  0.0017  0.0005  0.0018  -0.0217 0.0043  0.0000  
'X-RAY DIFFRACTION' 181 ? refined 81.5374  -103.0049 151.3729 0.7086  0.8936  0.6918 0.1005  -0.1142 -0.0559 0.0167  0.0002  
0.0016  -0.0016 -0.0054 0.0003  -0.0001 -0.0201 0.0122  0.0259  0.0139  -0.0005 -0.0223 -0.0263 -0.0001 
'X-RAY DIFFRACTION' 182 ? refined 26.0276  -120.6550 219.1403 0.6681  0.5872  0.5821 -0.1499 0.0391  -0.0339 0.0095  0.0015  
0.0180  0.0033  -0.0164 -0.0057 -0.0556 0.3672  0.0355  -0.1425 0.0518  0.1270  0.0702  -0.1168 0.0003  
'X-RAY DIFFRACTION' 183 ? refined 30.7519  -101.9862 217.4673 0.3515  0.8106  0.4687 -0.0972 -0.3360 -0.0609 0.0963  0.0240  
0.0845  -0.0265 0.0229  -0.0370 0.0083  0.0112  -0.0146 -0.0220 -0.0173 0.0718  -0.0742 -0.0864 -0.4040 
'X-RAY DIFFRACTION' 184 ? refined 14.9955  -91.4815  223.0134 0.6932  1.2028  0.3340 0.2733  -0.1524 -0.1080 0.0264  0.0379  
0.0270  -0.0126 -0.0032 -0.0292 0.0278  -0.0660 -0.0413 0.0045  0.0568  0.0058  0.0062  -0.0845 0.1201  
'X-RAY DIFFRACTION' 185 ? refined 1.2488   -100.4692 215.4815 0.9714  1.3139  0.9474 0.2031  0.0600  0.1490  0.0031  0.0024  
0.0011  -0.0022 0.0002  -0.0021 -0.0555 -0.0576 -0.0656 0.0289  -0.0790 -0.0070 0.0068  0.0000  0.0002  
'X-RAY DIFFRACTION' 186 ? refined 25.6261  -98.5041  242.1863 0.9077  1.4065  1.0380 -0.2131 0.0743  0.0037  0.0040  0.0037  
0.0008  0.0043  -0.0020 -0.0015 -0.0926 0.0165  -0.0465 -0.0317 -0.1478 0.0553  -0.0193 -0.0092 -0.0006 
'X-RAY DIFFRACTION' 187 ? refined 16.2610  -79.3057  218.1839 0.9596  1.2265  0.6445 -0.0524 -0.2149 0.0633  0.0136  -0.0015 
0.0254  -0.0028 0.0089  -0.0004 0.0361  0.1274  0.0293  -0.0122 -0.0371 0.0779  -0.0110 0.0697  0.0000  
'X-RAY DIFFRACTION' 188 ? refined 71.4355  -98.2267  175.4973 0.5374  0.3183  0.5309 0.0054  -0.2046 0.0522  0.1377  0.1584  
0.0864  0.0899  -0.1099 -0.0493 -0.0177 -0.0058 0.1053  -0.1006 -0.0980 -0.1777 -0.0582 -0.0931 -0.0713 
'X-RAY DIFFRACTION' 189 ? refined 54.3242  -132.3379 193.3936 0.3397  0.1624  0.4867 -0.2048 0.0337  0.0668  0.0198  0.0387  
0.1124  -0.0198 0.0375  -0.0096 0.0010  0.0215  0.0271  0.0041  0.0026  -0.0333 -0.0102 0.0553  -0.3363 
'X-RAY DIFFRACTION' 190 ? refined 61.1017  -113.3583 193.4613 0.0802  0.3766  0.0729 -0.1994 -0.0754 0.1073  0.1213  0.2623  
0.2548  0.1769  0.1066  0.1769  -0.0910 -0.0422 -0.0145 -0.0179 -0.0854 0.0699  -0.0108 -0.0318 -1.6745 
'X-RAY DIFFRACTION' 191 ? refined 41.0963  -109.6737 199.2238 0.5050  0.7550  0.3112 0.0072  -0.2691 0.0854  0.0207  0.0918  
0.0383  0.0007  -0.0272 0.0182  -0.0004 -0.0368 0.0192  -0.0355 0.0083  -0.0606 0.0523  0.0414  -0.1459 
'X-RAY DIFFRACTION' 192 ? refined 42.7858  -119.9359 203.0181 0.4041  0.9681  0.5255 -0.1566 -0.1659 0.0239  0.2654  0.0120  
0.0267  0.0418  0.0864  0.0145  -0.0257 0.0027  -0.0990 0.0298  -0.1443 -0.0309 0.0172  -0.0995 -0.0380 
'X-RAY DIFFRACTION' 193 ? refined 88.7035  -140.2830 154.8502 0.3598  -0.0076 0.4069 -0.1568 -0.0079 0.0551  0.0068  0.0035  
-0.0011 0.0056  -0.0020 -0.0015 0.0025  -0.0015 -0.0017 -0.0049 -0.0037 0.0054  0.0068  -0.0253 0.0297  
'X-RAY DIFFRACTION' 194 ? refined 90.8501  -135.3930 169.1027 0.4862  0.4327  0.5539 -0.2802 -0.0360 0.1564  0.0949  0.0538  
0.0768  0.0450  0.0044  -0.0128 -0.0718 0.0801  0.0325  -0.0366 0.0093  0.0996  0.0352  -0.0023 -0.0683 
'X-RAY DIFFRACTION' 195 ? refined 90.2119  -126.2185 156.4029 0.2581  -0.0186 0.3703 0.0107  -0.0111 0.1093  0.0118  0.1230  
0.0555  0.0197  -0.0147 0.0319  -0.0510 0.0210  0.0132  0.0472  0.0205  -0.0002 -0.0513 -0.0395 -0.1228 
'X-RAY DIFFRACTION' 196 ? refined 93.7555  -115.7479 166.2104 0.2971  0.0837  0.2816 -0.1291 -0.1768 0.1045  0.0475  0.1183  
0.0656  0.0188  0.0005  0.0835  -0.0036 -0.0255 -0.0324 0.0707  -0.0762 -0.0209 -0.0503 0.0215  -0.3615 
'X-RAY DIFFRACTION' 197 ? refined 75.8291  -119.2273 172.4294 0.4624  0.6740  0.3583 0.0146  -0.3193 0.0935  0.0401  0.3080  
0.0014  0.1060  -0.0104 -0.0196 0.0526  0.1417  -0.0444 -0.1016 -0.0795 0.0191  -0.0847 -0.1089 -0.0980 
'X-RAY DIFFRACTION' 198 ? refined 70.0192  -124.2137 171.8600 0.5491  0.6384  0.6912 -0.1541 -0.1877 0.1654  0.0232  0.0314  
0.0149  -0.0081 0.0142  -0.0242 -0.0239 -0.1028 -0.1459 0.0280  -0.1699 -0.1377 -0.0239 -0.0382 0.0003  
'X-RAY DIFFRACTION' 199 ? refined 130.4678 -110.6752 126.8165 0.0858  0.0932  0.3064 -0.0694 -0.0887 0.2442  0.0969  0.0469  
0.0196  0.0261  -0.0388 0.0005  -0.0050 -0.0984 -0.0599 0.0023  -0.0463 0.0271  0.0110  0.0716  -0.6222 
'X-RAY DIFFRACTION' 200 ? refined 124.7297 -122.4561 132.5595 0.3917  0.1382  0.3026 0.0514  -0.0256 0.1816  0.0047  0.0437  
0.0550  0.0179  -0.0115 -0.0411 -0.0481 -0.0946 -0.1361 0.0639  -0.0269 -0.0220 0.1316  0.0753  -0.4841 
'X-RAY DIFFRACTION' 201 ? refined 116.2821 -139.5261 134.0607 0.5021  0.0336  0.4620 0.0494  0.0584  0.1883  0.0087  0.0310  
0.0039  0.0183  0.0059  0.0114  -0.0262 -0.0052 0.0128  0.0092  0.0157  -0.0123 -0.0300 0.0197  0.0316  
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1   1   ? ? ? ? ? ? ? ? ? 
;chain '1' and (resid 2 through 38 )
;
'X-RAY DIFFRACTION' 2   2   ? ? ? ? ? ? ? ? ? 
;chain '1' and (resid 39 through 60 )
;
'X-RAY DIFFRACTION' 3   3   ? ? ? ? ? ? ? ? ? 
;chain '1' and (resid 61 through 86 )
;
'X-RAY DIFFRACTION' 4   4   ? ? ? ? ? ? ? ? ? 
;chain '1' and (resid 87 through 155 )
;
'X-RAY DIFFRACTION' 5   5   ? ? ? ? ? ? ? ? ? 
;chain '1' and (resid 156 through 232 )
;
'X-RAY DIFFRACTION' 6   6   ? ? ? ? ? ? ? ? ? 
;chain '1' and (resid 233 through 366 )
;
'X-RAY DIFFRACTION' 7   7   ? ? ? ? ? ? ? ? ? 
;chain '1' and (resid 367 through 438 )
;
'X-RAY DIFFRACTION' 8   8   ? ? ? ? ? ? ? ? ? 
;chain '2' and (resid 3 through 22 )
;
'X-RAY DIFFRACTION' 9   9   ? ? ? ? ? ? ? ? ? 
;chain '2' and (resid 23 through 38 )
;
'X-RAY DIFFRACTION' 10  10  ? ? ? ? ? ? ? ? ? 
;chain '2' and (resid 39 through 66 )
;
'X-RAY DIFFRACTION' 11  11  ? ? ? ? ? ? ? ? ? 
;chain '2' and (resid 67 through 77 )
;
'X-RAY DIFFRACTION' 12  12  ? ? ? ? ? ? ? ? ? 
;chain '2' and (resid 78 through 92 )
;
'X-RAY DIFFRACTION' 13  13  ? ? ? ? ? ? ? ? ? 
;chain '2' and (resid 93 through 104 )
;
'X-RAY DIFFRACTION' 14  14  ? ? ? ? ? ? ? ? ? 
;chain '2' and (resid 105 through 116 )
;
'X-RAY DIFFRACTION' 15  15  ? ? ? ? ? ? ? ? ? 
;chain '2' and (resid 117 through 132 )
;
'X-RAY DIFFRACTION' 16  16  ? ? ? ? ? ? ? ? ? 
;chain '2' and (resid 133 through 146 )
;
'X-RAY DIFFRACTION' 17  17  ? ? ? ? ? ? ? ? ? 
;chain '2' and (resid 147 through 158 )
;
'X-RAY DIFFRACTION' 18  18  ? ? ? ? ? ? ? ? ? 
;chain '2' and (resid 159 through 165 )
;
'X-RAY DIFFRACTION' 19  19  ? ? ? ? ? ? ? ? ? 
;chain '2' and (resid 166 through 180 )
;
'X-RAY DIFFRACTION' 20  20  ? ? ? ? ? ? ? ? ? 
;chain '3' and (resid 1 through 137 )
;
'X-RAY DIFFRACTION' 21  21  ? ? ? ? ? ? ? ? ? 
;chain '3' and (resid 138 through 193 )
;
'X-RAY DIFFRACTION' 22  22  ? ? ? ? ? ? ? ? ? 
;chain '3' and (resid 194 through 309 )
;
'X-RAY DIFFRACTION' 23  23  ? ? ? ? ? ? ? ? ? 
;chain '3' and (resid 310 through 350 )
;
'X-RAY DIFFRACTION' 24  24  ? ? ? ? ? ? ? ? ? 
;chain '3' and (resid 351 through 460 )
;
'X-RAY DIFFRACTION' 25  25  ? ? ? ? ? ? ? ? ? 
;chain '3' and (resid 461 through 595 )
;
'X-RAY DIFFRACTION' 26  26  ? ? ? ? ? ? ? ? ? 
;chain '3' and (resid 596 through 667 )
;
'X-RAY DIFFRACTION' 27  27  ? ? ? ? ? ? ? ? ? 
;chain '3' and (resid 668 through 719 )
;
'X-RAY DIFFRACTION' 28  28  ? ? ? ? ? ? ? ? ? 
;chain '3' and (resid 720 through 777 )
;
'X-RAY DIFFRACTION' 29  29  ? ? ? ? ? ? ? ? ? 
;chain '4' and (resid 26 through 139 )
;
'X-RAY DIFFRACTION' 30  30  ? ? ? ? ? ? ? ? ? 
;chain '4' and (resid 140 through 208 )
;
'X-RAY DIFFRACTION' 31  31  ? ? ? ? ? ? ? ? ? 
;chain '4' and (resid 209 through 247 )
;
'X-RAY DIFFRACTION' 32  32  ? ? ? ? ? ? ? ? ? 
;chain '4' and (resid 248 through 409 )
;
'X-RAY DIFFRACTION' 33  33  ? ? ? ? ? ? ? ? ? 
;chain '5' and (resid 1 through 13 )
;
'X-RAY DIFFRACTION' 34  34  ? ? ? ? ? ? ? ? ? 
;chain '5' and (resid 14 through 31 )
;
'X-RAY DIFFRACTION' 35  35  ? ? ? ? ? ? ? ? ? 
;chain '5' and (resid 32 through 43 )
;
'X-RAY DIFFRACTION' 36  36  ? ? ? ? ? ? ? ? ? 
;chain '5' and (resid 44 through 67 )
;
'X-RAY DIFFRACTION' 37  37  ? ? ? ? ? ? ? ? ? 
;chain '5' and (resid 68 through 86 )
;
'X-RAY DIFFRACTION' 38  38  ? ? ? ? ? ? ? ? ? 
;chain '5' and (resid 87 through 109 )
;
'X-RAY DIFFRACTION' 39  39  ? ? ? ? ? ? ? ? ? 
;chain '5' and (resid 110 through 121 )
;
'X-RAY DIFFRACTION' 40  40  ? ? ? ? ? ? ? ? ? 
;chain '5' and (resid 122 through 141 )
;
'X-RAY DIFFRACTION' 41  41  ? ? ? ? ? ? ? ? ? 
;chain '5' and (resid 142 through 175 )
;
'X-RAY DIFFRACTION' 42  42  ? ? ? ? ? ? ? ? ? 
;chain '5' and (resid 176 through 185 )
;
'X-RAY DIFFRACTION' 43  43  ? ? ? ? ? ? ? ? ? 
;chain '5' and (resid 186 through 196 )
;
'X-RAY DIFFRACTION' 44  44  ? ? ? ? ? ? ? ? ? 
;chain '6' and (resid 20 through 34 )
;
'X-RAY DIFFRACTION' 45  45  ? ? ? ? ? ? ? ? ? 
;chain '6' and (resid 35 through 56 )
;
'X-RAY DIFFRACTION' 46  46  ? ? ? ? ? ? ? ? ? 
;chain '6' and (resid 57 through 77 )
;
'X-RAY DIFFRACTION' 47  47  ? ? ? ? ? ? ? ? ? 
;chain '6' and (resid 78 through 181 )
;
'X-RAY DIFFRACTION' 48  48  ? ? ? ? ? ? ? ? ? 
;chain '9' and (resid 2 through 18 )
;
'X-RAY DIFFRACTION' 49  49  ? ? ? ? ? ? ? ? ? 
;chain '9' and (resid 19 through 38 )
;
'X-RAY DIFFRACTION' 50  50  ? ? ? ? ? ? ? ? ? 
;chain '9' and (resid 39 through 48 )
;
'X-RAY DIFFRACTION' 51  51  ? ? ? ? ? ? ? ? ? 
;chain '9' and (resid 49 through 74 )
;
'X-RAY DIFFRACTION' 52  52  ? ? ? ? ? ? ? ? ? 
;chain '9' and (resid 75 through 112 )
;
'X-RAY DIFFRACTION' 53  53  ? ? ? ? ? ? ? ? ? 
;chain '9' and (resid 113 through 135 )
;
'X-RAY DIFFRACTION' 54  54  ? ? ? ? ? ? ? ? ? 
;chain '9' and (resid 136 through 167 )
;
'X-RAY DIFFRACTION' 55  55  ? ? ? ? ? ? ? ? ? 
;chain '9' and (resid 168 through 181 )
;
'X-RAY DIFFRACTION' 56  56  ? ? ? ? ? ? ? ? ? 
;chain '7' and (resid 3 through 27 )
;
'X-RAY DIFFRACTION' 57  57  ? ? ? ? ? ? ? ? ? 
;chain '7' and (resid 28 through 60 )
;
'X-RAY DIFFRACTION' 58  58  ? ? ? ? ? ? ? ? ? 
;chain '7' and (resid 61 through 81 )
;
'X-RAY DIFFRACTION' 59  59  ? ? ? ? ? ? ? ? ? 
;chain '7' and (resid 82 through 111 )
;
'X-RAY DIFFRACTION' 60  60  ? ? ? ? ? ? ? ? ? 
;chain '7' and (resid 112 through 129 )
;
'X-RAY DIFFRACTION' 61  61  ? ? ? ? ? ? ? ? ? 
;chain 'W' and (resid 1 through 9 )
;
'X-RAY DIFFRACTION' 62  62  ? ? ? ? ? ? ? ? ? 
;chain 'W' and (resid 10 through 35 )
;
'X-RAY DIFFRACTION' 63  63  ? ? ? ? ? ? ? ? ? 
;chain 'W' and (resid 36 through 46 )
;
'X-RAY DIFFRACTION' 64  64  ? ? ? ? ? ? ? ? ? 
;chain 'W' and (resid 47 through 69 )
;
'X-RAY DIFFRACTION' 65  65  ? ? ? ? ? ? ? ? ? 
;chain 'W' and (resid 70 through 95 )
;
'X-RAY DIFFRACTION' 66  66  ? ? ? ? ? ? ? ? ? 
;chain 'W' and (resid 96 through 106 )
;
'X-RAY DIFFRACTION' 67  67  ? ? ? ? ? ? ? ? ? 
;chain 'W' and (resid 107 through 117 )
;
'X-RAY DIFFRACTION' 68  68  ? ? ? ? ? ? ? ? ? 
;chain 'W' and (resid 118 through 127 )
;
'X-RAY DIFFRACTION' 69  69  ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 2 through 88 )
;
'X-RAY DIFFRACTION' 70  70  ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 89 through 117 )
;
'X-RAY DIFFRACTION' 71  71  ? ? ? ? ? ? ? ? ? 
;chain 'J' and (resid 1 through 24 )
;
'X-RAY DIFFRACTION' 72  72  ? ? ? ? ? ? ? ? ? 
;chain 'J' and (resid 25 through 73 )
;
'X-RAY DIFFRACTION' 73  73  ? ? ? ? ? ? ? ? ? 
;chain 'J' and (resid 74 through 108 )
;
'X-RAY DIFFRACTION' 74  74  ? ? ? ? ? ? ? ? ? 
;chain 'J' and (resid 109 through 160 )
;
'X-RAY DIFFRACTION' 75  75  ? ? ? ? ? ? ? ? ? 
;chain 'K' and (resid 1 through 23 )
;
'X-RAY DIFFRACTION' 76  76  ? ? ? ? ? ? ? ? ? 
;chain 'K' and (resid 24 through 51 )
;
'X-RAY DIFFRACTION' 77  77  ? ? ? ? ? ? ? ? ? 
;chain 'K' and (resid 52 through 78 )
;
'X-RAY DIFFRACTION' 78  78  ? ? ? ? ? ? ? ? ? 
;chain 'K' and (resid 79 through 86 )
;
'X-RAY DIFFRACTION' 79  79  ? ? ? ? ? ? ? ? ? 
;chain 'K' and (resid 87 through 95 )
;
'X-RAY DIFFRACTION' 80  80  ? ? ? ? ? ? ? ? ? 
;chain 'L' and (resid 1 through 70 )
;
'X-RAY DIFFRACTION' 81  81  ? ? ? ? ? ? ? ? ? 
;chain 'L' and (resid 71 through 425 )
;
'X-RAY DIFFRACTION' 82  82  ? ? ? ? ? ? ? ? ? 
;chain 'L' and (resid 426 through 458 )
;
'X-RAY DIFFRACTION' 83  83  ? ? ? ? ? ? ? ? ? 
;chain 'L' and (resid 459 through 510 )
;
'X-RAY DIFFRACTION' 84  84  ? ? ? ? ? ? ? ? ? 
;chain 'L' and (resid 511 through 542 )
;
'X-RAY DIFFRACTION' 85  85  ? ? ? ? ? ? ? ? ? 
;chain 'L' and (resid 543 through 605 )
;
'X-RAY DIFFRACTION' 86  86  ? ? ? ? ? ? ? ? ? 
;chain 'M' and (resid 1 through 114 )
;
'X-RAY DIFFRACTION' 87  87  ? ? ? ? ? ? ? ? ? 
;chain 'M' and (resid 115 through 414 )
;
'X-RAY DIFFRACTION' 88  88  ? ? ? ? ? ? ? ? ? 
;chain 'M' and (resid 415 through 467 )
;
'X-RAY DIFFRACTION' 89  89  ? ? ? ? ? ? ? ? ? 
;chain 'N' and (resid 1 through 127 )
;
'X-RAY DIFFRACTION' 90  90  ? ? ? ? ? ? ? ? ? 
;chain 'N' and (resid 128 through 187 )
;
'X-RAY DIFFRACTION' 91  91  ? ? ? ? ? ? ? ? ? 
;chain 'N' and (resid 188 through 357 )
;
'X-RAY DIFFRACTION' 92  92  ? ? ? ? ? ? ? ? ? 
;chain 'N' and (resid 358 through 395 )
;
'X-RAY DIFFRACTION' 93  93  ? ? ? ? ? ? ? ? ? 
;chain 'N' and (resid 396 through 427 )
;
'X-RAY DIFFRACTION' 94  94  ? ? ? ? ? ? ? ? ? 
;chain 'H' and (resid 2 through 42 )
;
'X-RAY DIFFRACTION' 95  95  ? ? ? ? ? ? ? ? ? 
;chain 'H' and (resid 43 through 104 )
;
'X-RAY DIFFRACTION' 96  96  ? ? ? ? ? ? ? ? ? 
;chain 'H' and (resid 105 through 147 )
;
'X-RAY DIFFRACTION' 97  97  ? ? ? ? ? ? ? ? ? 
;chain 'H' and (resid 148 through 262 )
;
'X-RAY DIFFRACTION' 98  98  ? ? ? ? ? ? ? ? ? 
;chain 'H' and (resid 263 through 296 )
;
'X-RAY DIFFRACTION' 99  99  ? ? ? ? ? ? ? ? ? 
;chain 'H' and (resid 297 through 334 )
;
'X-RAY DIFFRACTION' 100 100 ? ? ? ? ? ? ? ? ? 
;chain 'H' and (resid 335 through 354 )
;
'X-RAY DIFFRACTION' 101 101 ? ? ? ? ? ? ? ? ? 
;chain 'B' and (resid 2 through 38 )
;
'X-RAY DIFFRACTION' 102 102 ? ? ? ? ? ? ? ? ? 
;chain 'B' and (resid 39 through 60 )
;
'X-RAY DIFFRACTION' 103 103 ? ? ? ? ? ? ? ? ? 
;chain 'B' and (resid 61 through 124 )
;
'X-RAY DIFFRACTION' 104 104 ? ? ? ? ? ? ? ? ? 
;chain 'B' and (resid 125 through 267 )
;
'X-RAY DIFFRACTION' 105 105 ? ? ? ? ? ? ? ? ? 
;chain 'B' and (resid 268 through 366 )
;
'X-RAY DIFFRACTION' 106 106 ? ? ? ? ? ? ? ? ? 
;chain 'B' and (resid 367 through 395 )
;
'X-RAY DIFFRACTION' 107 107 ? ? ? ? ? ? ? ? ? 
;chain 'B' and (resid 396 through 438 )
;
'X-RAY DIFFRACTION' 108 108 ? ? ? ? ? ? ? ? ? 
;chain 'C' and (resid 3 through 22 )
;
'X-RAY DIFFRACTION' 109 109 ? ? ? ? ? ? ? ? ? 
;chain 'C' and (resid 23 through 38 )
;
'X-RAY DIFFRACTION' 110 110 ? ? ? ? ? ? ? ? ? 
;chain 'C' and (resid 39 through 53 )
;
'X-RAY DIFFRACTION' 111 111 ? ? ? ? ? ? ? ? ? 
;chain 'C' and (resid 54 through 66 )
;
'X-RAY DIFFRACTION' 112 112 ? ? ? ? ? ? ? ? ? 
;chain 'C' and (resid 67 through 77 )
;
'X-RAY DIFFRACTION' 113 113 ? ? ? ? ? ? ? ? ? 
;chain 'C' and (resid 78 through 92 )
;
'X-RAY DIFFRACTION' 114 114 ? ? ? ? ? ? ? ? ? 
;chain 'C' and (resid 93 through 104 )
;
'X-RAY DIFFRACTION' 115 115 ? ? ? ? ? ? ? ? ? 
;chain 'C' and (resid 105 through 116 )
;
'X-RAY DIFFRACTION' 116 116 ? ? ? ? ? ? ? ? ? 
;chain 'C' and (resid 117 through 146 )
;
'X-RAY DIFFRACTION' 117 117 ? ? ? ? ? ? ? ? ? 
;chain 'C' and (resid 147 through 158 )
;
'X-RAY DIFFRACTION' 118 118 ? ? ? ? ? ? ? ? ? 
;chain 'C' and (resid 159 through 180 )
;
'X-RAY DIFFRACTION' 119 119 ? ? ? ? ? ? ? ? ? 
;chain 'D' and (resid 1 through 128 )
;
'X-RAY DIFFRACTION' 120 120 ? ? ? ? ? ? ? ? ? 
;chain 'D' and (resid 129 through 193 )
;
'X-RAY DIFFRACTION' 121 121 ? ? ? ? ? ? ? ? ? 
;chain 'D' and (resid 194 through 309 )
;
'X-RAY DIFFRACTION' 122 122 ? ? ? ? ? ? ? ? ? 
;chain 'D' and (resid 310 through 350 )
;
'X-RAY DIFFRACTION' 123 123 ? ? ? ? ? ? ? ? ? 
;chain 'D' and (resid 351 through 546 )
;
'X-RAY DIFFRACTION' 124 124 ? ? ? ? ? ? ? ? ? 
;chain 'D' and (resid 547 through 594 )
;
'X-RAY DIFFRACTION' 125 125 ? ? ? ? ? ? ? ? ? 
;chain 'D' and (resid 595 through 667 )
;
'X-RAY DIFFRACTION' 126 126 ? ? ? ? ? ? ? ? ? 
;chain 'D' and (resid 668 through 719 )
;
'X-RAY DIFFRACTION' 127 127 ? ? ? ? ? ? ? ? ? 
;chain 'D' and (resid 720 through 777 )
;
'X-RAY DIFFRACTION' 128 128 ? ? ? ? ? ? ? ? ? 
;chain 'E' and (resid 26 through 53 )
;
'X-RAY DIFFRACTION' 129 129 ? ? ? ? ? ? ? ? ? 
;chain 'E' and (resid 54 through 139 )
;
'X-RAY DIFFRACTION' 130 130 ? ? ? ? ? ? ? ? ? 
;chain 'E' and (resid 140 through 208 )
;
'X-RAY DIFFRACTION' 131 131 ? ? ? ? ? ? ? ? ? 
;chain 'E' and (resid 209 through 232 )
;
'X-RAY DIFFRACTION' 132 132 ? ? ? ? ? ? ? ? ? 
;chain 'E' and (resid 233 through 409 )
;
'X-RAY DIFFRACTION' 133 133 ? ? ? ? ? ? ? ? ? 
;chain 'F' and (resid 1 through 13 )
;
'X-RAY DIFFRACTION' 134 134 ? ? ? ? ? ? ? ? ? 
;chain 'F' and (resid 14 through 31 )
;
'X-RAY DIFFRACTION' 135 135 ? ? ? ? ? ? ? ? ? 
;chain 'F' and (resid 32 through 86 )
;
'X-RAY DIFFRACTION' 136 136 ? ? ? ? ? ? ? ? ? 
;chain 'F' and (resid 87 through 121 )
;
'X-RAY DIFFRACTION' 137 137 ? ? ? ? ? ? ? ? ? 
;chain 'F' and (resid 122 through 175 )
;
'X-RAY DIFFRACTION' 138 138 ? ? ? ? ? ? ? ? ? 
;chain 'F' and (resid 176 through 196 )
;
'X-RAY DIFFRACTION' 139 139 ? ? ? ? ? ? ? ? ? 
;chain 'G' and (resid 20 through 34 )
;
'X-RAY DIFFRACTION' 140 140 ? ? ? ? ? ? ? ? ? 
;chain 'G' and (resid 35 through 56 )
;
'X-RAY DIFFRACTION' 141 141 ? ? ? ? ? ? ? ? ? 
;chain 'G' and (resid 57 through 88 )
;
'X-RAY DIFFRACTION' 142 142 ? ? ? ? ? ? ? ? ? 
;chain 'G' and (resid 89 through 158 )
;
'X-RAY DIFFRACTION' 143 143 ? ? ? ? ? ? ? ? ? 
;chain 'G' and (resid 159 through 168 )
;
'X-RAY DIFFRACTION' 144 144 ? ? ? ? ? ? ? ? ? 
;chain 'G' and (resid 169 through 181 )
;
'X-RAY DIFFRACTION' 145 145 ? ? ? ? ? ? ? ? ? 
;chain 'O' and (resid 2 through 18 )
;
'X-RAY DIFFRACTION' 146 146 ? ? ? ? ? ? ? ? ? 
;chain 'O' and (resid 19 through 30 )
;
'X-RAY DIFFRACTION' 147 147 ? ? ? ? ? ? ? ? ? 
;chain 'O' and (resid 31 through 48 )
;
'X-RAY DIFFRACTION' 148 148 ? ? ? ? ? ? ? ? ? 
;chain 'O' and (resid 49 through 74 )
;
'X-RAY DIFFRACTION' 149 149 ? ? ? ? ? ? ? ? ? 
;chain 'O' and (resid 75 through 112 )
;
'X-RAY DIFFRACTION' 150 150 ? ? ? ? ? ? ? ? ? 
;chain 'O' and (resid 113 through 125 )
;
'X-RAY DIFFRACTION' 151 151 ? ? ? ? ? ? ? ? ? 
;chain 'O' and (resid 126 through 168 )
;
'X-RAY DIFFRACTION' 152 152 ? ? ? ? ? ? ? ? ? 
;chain 'O' and (resid 169 through 181 )
;
'X-RAY DIFFRACTION' 153 153 ? ? ? ? ? ? ? ? ? 
;chain 'I' and (resid 3 through 27 )
;
'X-RAY DIFFRACTION' 154 154 ? ? ? ? ? ? ? ? ? 
;chain 'I' and (resid 28 through 60 )
;
'X-RAY DIFFRACTION' 155 155 ? ? ? ? ? ? ? ? ? 
;chain 'I' and (resid 61 through 81 )
;
'X-RAY DIFFRACTION' 156 156 ? ? ? ? ? ? ? ? ? 
;chain 'I' and (resid 82 through 111 )
;
'X-RAY DIFFRACTION' 157 157 ? ? ? ? ? ? ? ? ? 
;chain 'I' and (resid 112 through 129 )
;
'X-RAY DIFFRACTION' 158 158 ? ? ? ? ? ? ? ? ? 
;chain 'X' and (resid 1 through 9 )
;
'X-RAY DIFFRACTION' 159 159 ? ? ? ? ? ? ? ? ? 
;chain 'X' and (resid 10 through 21 )
;
'X-RAY DIFFRACTION' 160 160 ? ? ? ? ? ? ? ? ? 
;chain 'X' and (resid 22 through 29 )
;
'X-RAY DIFFRACTION' 161 161 ? ? ? ? ? ? ? ? ? 
;chain 'X' and (resid 30 through 46 )
;
'X-RAY DIFFRACTION' 162 162 ? ? ? ? ? ? ? ? ? 
;chain 'X' and (resid 47 through 59 )
;
'X-RAY DIFFRACTION' 163 163 ? ? ? ? ? ? ? ? ? 
;chain 'X' and (resid 60 through 83 )
;
'X-RAY DIFFRACTION' 164 164 ? ? ? ? ? ? ? ? ? 
;chain 'X' and (resid 84 through 93 )
;
'X-RAY DIFFRACTION' 165 165 ? ? ? ? ? ? ? ? ? 
;chain 'X' and (resid 94 through 106 )
;
'X-RAY DIFFRACTION' 166 166 ? ? ? ? ? ? ? ? ? 
;chain 'X' and (resid 107 through 127 )
;
'X-RAY DIFFRACTION' 167 167 ? ? ? ? ? ? ? ? ? 
;chain 'P' and (resid 2 through 58 )
;
'X-RAY DIFFRACTION' 168 168 ? ? ? ? ? ? ? ? ? 
;chain 'P' and (resid 59 through 83 )
;
'X-RAY DIFFRACTION' 169 169 ? ? ? ? ? ? ? ? ? 
;chain 'P' and (resid 84 through 112 )
;
'X-RAY DIFFRACTION' 170 170 ? ? ? ? ? ? ? ? ? 
;chain 'P' and (resid 113 through 117 )
;
'X-RAY DIFFRACTION' 171 171 ? ? ? ? ? ? ? ? ? 
;chain 'R' and (resid 1 through 24 )
;
'X-RAY DIFFRACTION' 172 172 ? ? ? ? ? ? ? ? ? 
;chain 'R' and (resid 25 through 62 )
;
'X-RAY DIFFRACTION' 173 173 ? ? ? ? ? ? ? ? ? 
;chain 'R' and (resid 63 through 73 )
;
'X-RAY DIFFRACTION' 174 174 ? ? ? ? ? ? ? ? ? 
;chain 'R' and (resid 74 through 87 )
;
'X-RAY DIFFRACTION' 175 175 ? ? ? ? ? ? ? ? ? 
;chain 'R' and (resid 88 through 108 )
;
'X-RAY DIFFRACTION' 176 176 ? ? ? ? ? ? ? ? ? 
;chain 'R' and (resid 109 through 123 )
;
'X-RAY DIFFRACTION' 177 177 ? ? ? ? ? ? ? ? ? 
;chain 'R' and (resid 124 through 160 )
;
'X-RAY DIFFRACTION' 178 178 ? ? ? ? ? ? ? ? ? 
;chain 'S' and (resid 1 through 23 )
;
'X-RAY DIFFRACTION' 179 179 ? ? ? ? ? ? ? ? ? 
;chain 'S' and (resid 24 through 76 )
;
'X-RAY DIFFRACTION' 180 180 ? ? ? ? ? ? ? ? ? 
;chain 'S' and (resid 77 through 86 )
;
'X-RAY DIFFRACTION' 181 181 ? ? ? ? ? ? ? ? ? 
;chain 'S' and (resid 87 through 95 )
;
'X-RAY DIFFRACTION' 182 182 ? ? ? ? ? ? ? ? ? 
;chain 'T' and (resid 1 through 70 )
;
'X-RAY DIFFRACTION' 183 183 ? ? ? ? ? ? ? ? ? 
;chain 'T' and (resid 71 through 290 )
;
'X-RAY DIFFRACTION' 184 184 ? ? ? ? ? ? ? ? ? 
;chain 'T' and (resid 291 through 425 )
;
'X-RAY DIFFRACTION' 185 185 ? ? ? ? ? ? ? ? ? 
;chain 'T' and (resid 426 through 455 )
;
'X-RAY DIFFRACTION' 186 186 ? ? ? ? ? ? ? ? ? 
;chain 'T' and (resid 456 through 488 )
;
'X-RAY DIFFRACTION' 187 187 ? ? ? ? ? ? ? ? ? 
;chain 'T' and (resid 489 through 542 )
;
'X-RAY DIFFRACTION' 188 188 ? ? ? ? ? ? ? ? ? 
;chain 'T' and (resid 543 through 605 )
;
'X-RAY DIFFRACTION' 189 189 ? ? ? ? ? ? ? ? ? 
;chain 'U' and (resid 1 through 95 )
;
'X-RAY DIFFRACTION' 190 190 ? ? ? ? ? ? ? ? ? 
;chain 'U' and (resid 96 through 304 )
;
'X-RAY DIFFRACTION' 191 191 ? ? ? ? ? ? ? ? ? 
;chain 'U' and (resid 305 through 414 )
;
'X-RAY DIFFRACTION' 192 192 ? ? ? ? ? ? ? ? ? 
;chain 'U' and (resid 415 through 467 )
;
'X-RAY DIFFRACTION' 193 193 ? ? ? ? ? ? ? ? ? 
;chain 'V' and (resid 1 through 42 )
;
'X-RAY DIFFRACTION' 194 194 ? ? ? ? ? ? ? ? ? 
;chain 'V' and (resid 43 through 75 )
;
'X-RAY DIFFRACTION' 195 195 ? ? ? ? ? ? ? ? ? 
;chain 'V' and (resid 76 through 127 )
;
'X-RAY DIFFRACTION' 196 196 ? ? ? ? ? ? ? ? ? 
;chain 'V' and (resid 128 through 225 )
;
'X-RAY DIFFRACTION' 197 197 ? ? ? ? ? ? ? ? ? 
;chain 'V' and (resid 226 through 357 )
;
'X-RAY DIFFRACTION' 198 198 ? ? ? ? ? ? ? ? ? 
;chain 'V' and (resid 358 through 427 )
;
'X-RAY DIFFRACTION' 199 199 ? ? ? ? ? ? ? ? ? 
;chain 'Q' and (resid 2 through 104 )
;
'X-RAY DIFFRACTION' 200 200 ? ? ? ? ? ? ? ? ? 
;chain 'Q' and (resid 105 through 296 )
;
'X-RAY DIFFRACTION' 201 201 ? ? ? ? ? ? ? ? ? 
;chain 'Q' and (resid 297 through 354 )
;
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 1 MET 1   ? A  MET 1   
2   1 Y 1 2 MET 1   ? B  MET 1   
3   1 Y 1 2 GLY 2   ? B  GLY 2   
4   1 Y 1 2 VAL 181 ? B  VAL 181 
5   1 Y 1 3 LYS 56  ? C  LYS 56  
6   1 Y 1 3 LYS 57  ? C  LYS 57  
7   1 Y 1 3 GLY 58  ? C  GLY 58  
8   1 Y 1 3 PRO 59  ? C  PRO 59  
9   1 Y 1 3 ASP 60  ? C  ASP 60  
10  1 Y 1 3 GLY 61  ? C  GLY 61  
11  1 Y 1 3 LYS 62  ? C  LYS 62  
12  1 Y 1 3 PRO 63  ? C  PRO 63  
13  1 Y 1 3 LEU 64  ? C  LEU 64  
14  1 Y 1 3 LEU 65  ? C  LEU 65  
15  1 Y 1 3 ASN 66  ? C  ASN 66  
16  1 Y 1 3 GLU 67  ? C  GLU 67  
17  1 Y 1 3 LYS 68  ? C  LYS 68  
18  1 Y 1 3 GLY 69  ? C  GLY 69  
19  1 Y 1 3 GLU 70  ? C  GLU 70  
20  1 Y 1 3 PRO 71  ? C  PRO 71  
21  1 Y 1 3 GLU 72  ? C  GLU 72  
22  1 Y 1 3 TYR 144 ? C  TYR 144 
23  1 Y 1 3 GLN 145 ? C  GLN 145 
24  1 Y 1 3 LYS 146 ? C  LYS 146 
25  1 Y 1 3 GLY 147 ? C  GLY 147 
26  1 Y 1 3 PRO 778 ? C  PRO 778 
27  1 Y 1 3 ALA 779 ? C  ALA 779 
28  1 Y 1 3 GLY 780 ? C  GLY 780 
29  1 Y 1 3 GLY 781 ? C  GLY 781 
30  1 Y 1 3 GLU 782 ? C  GLU 782 
31  1 Y 1 3 ALA 783 ? C  ALA 783 
32  1 Y 1 4 MET 1   ? D  MET 1   
33  1 Y 1 4 ARG 2   ? D  ARG 2   
34  1 Y 1 4 GLU 3   ? D  GLU 3   
35  1 Y 1 4 GLU 4   ? D  GLU 4   
36  1 Y 1 4 PHE 5   ? D  PHE 5   
37  1 Y 1 4 LEU 6   ? D  LEU 6   
38  1 Y 1 4 GLU 7   ? D  GLU 7   
39  1 Y 1 4 GLU 8   ? D  GLU 8   
40  1 Y 1 4 ILE 9   ? D  ILE 9   
41  1 Y 1 4 PRO 10  ? D  PRO 10  
42  1 Y 1 4 LEU 11  ? D  LEU 11  
43  1 Y 1 4 ASP 12  ? D  ASP 12  
44  1 Y 1 4 ALA 13  ? D  ALA 13  
45  1 Y 1 4 PRO 14  ? D  PRO 14  
46  1 Y 1 4 PRO 15  ? D  PRO 15  
47  1 Y 1 4 GLU 16  ? D  GLU 16  
48  1 Y 1 4 GLU 17  ? D  GLU 17  
49  1 Y 1 4 ALA 18  ? D  ALA 18  
50  1 Y 1 4 LYS 19  ? D  LYS 19  
51  1 Y 1 4 GLU 20  ? D  GLU 20  
52  1 Y 1 4 LEU 21  ? D  LEU 21  
53  1 Y 1 4 ARG 22  ? D  ARG 22  
54  1 Y 1 4 THR 23  ? D  THR 23  
55  1 Y 1 4 GLU 24  ? D  GLU 24  
56  1 Y 1 4 VAL 25  ? D  VAL 25  
57  1 Y 1 5 ALA 197 ? E  ALA 197 
58  1 Y 1 5 ASP 198 ? E  ASP 198 
59  1 Y 1 5 LEU 199 ? E  LEU 199 
60  1 Y 1 5 LYS 200 ? E  LYS 200 
61  1 Y 1 5 LYS 201 ? E  LYS 201 
62  1 Y 1 5 ALA 202 ? E  ALA 202 
63  1 Y 1 5 ARG 203 ? E  ARG 203 
64  1 Y 1 5 GLU 204 ? E  GLU 204 
65  1 Y 1 5 VAL 205 ? E  VAL 205 
66  1 Y 1 5 LYS 206 ? E  LYS 206 
67  1 Y 1 5 GLY 207 ? E  GLY 207 
68  1 Y 1 6 MET 1   ? F  MET 1   
69  1 Y 1 6 ALA 2   ? F  ALA 2   
70  1 Y 1 6 LEU 3   ? F  LEU 3   
71  1 Y 1 6 LYS 4   ? F  LYS 4   
72  1 Y 1 6 ASP 5   ? F  ASP 5   
73  1 Y 1 6 LEU 6   ? F  LEU 6   
74  1 Y 1 6 PHE 7   ? F  PHE 7   
75  1 Y 1 6 GLU 8   ? F  GLU 8   
76  1 Y 1 6 ARG 9   ? F  ARG 9   
77  1 Y 1 6 ASP 10  ? F  ASP 10  
78  1 Y 1 6 VAL 11  ? F  VAL 11  
79  1 Y 1 6 GLN 12  ? F  GLN 12  
80  1 Y 1 6 GLU 13  ? F  GLU 13  
81  1 Y 1 6 LEU 14  ? F  LEU 14  
82  1 Y 1 6 GLU 15  ? F  GLU 15  
83  1 Y 1 9 MET 1   ? G  MET 1   
84  1 Y 1 9 ARG 182 ? G  ARG 182 
85  1 Y 1 7 MET 1   ? H  MET 1   
86  1 Y 1 7 SER 2   ? H  SER 2   
87  1 Y 1 W LYS 128 ? I  LYS 128 
88  1 Y 1 W ARG 129 ? I  ARG 129 
89  1 Y 1 W ALA 130 ? I  ALA 130 
90  1 Y 1 W ALA 131 ? I  ALA 131 
91  1 Y 1 A TRP 118 ? J  TRP 118 
92  1 Y 1 A HIS 119 ? J  HIS 119 
93  1 Y 1 J LYS 161 ? K  LYS 161 
94  1 Y 1 J ALA 162 ? K  ALA 162 
95  1 Y 1 J SER 163 ? K  SER 163 
96  1 Y 1 J ARG 164 ? K  ARG 164 
97  1 Y 1 J ALA 165 ? K  ALA 165 
98  1 Y 1 J LYS 166 ? K  LYS 166 
99  1 Y 1 J GLU 167 ? K  GLU 167 
100 1 Y 1 J ALA 168 ? K  ALA 168 
101 1 Y 1 J GLU 169 ? K  GLU 169 
102 1 Y 1 J LYS 170 ? K  LYS 170 
103 1 Y 1 J ARG 171 ? K  ARG 171 
104 1 Y 1 J GLU 172 ? K  GLU 172 
105 1 Y 1 J GLU 173 ? K  GLU 173 
106 1 Y 1 J VAL 174 ? K  VAL 174 
107 1 Y 1 J ALA 175 ? K  ALA 175 
108 1 Y 1 J ARG 176 ? K  ARG 176 
109 1 Y 1 L TRP 606 ? M  TRP 606 
110 1 Y 1 M GLY 468 ? N  GLY 468 
111 1 Y 1 M ALA 469 ? N  ALA 469 
112 1 Y 1 H MET 1   ? P  MET 1   
113 1 Y 1 H THR 355 ? P  THR 355 
114 1 Y 1 H PRO 356 ? P  PRO 356 
115 1 Y 1 H LYS 357 ? P  LYS 357 
116 1 Y 1 H PRO 358 ? P  PRO 358 
117 1 Y 1 H ALA 359 ? P  ALA 359 
118 1 Y 1 H ARG 360 ? P  ARG 360 
119 1 Y 1 H LYS 361 ? P  LYS 361 
120 1 Y 1 H GLY 362 ? P  GLY 362 
121 1 Y 1 H GLY 363 ? P  GLY 363 
122 1 Y 1 H GLY 364 ? P  GLY 364 
123 1 Y 1 H ALA 365 ? P  ALA 365 
124 1 Y 1 B MET 1   ? Q  MET 1   
125 1 Y 1 C MET 1   ? R  MET 1   
126 1 Y 1 C GLY 2   ? R  GLY 2   
127 1 Y 1 C VAL 181 ? R  VAL 181 
128 1 Y 1 D LYS 56  ? S  LYS 56  
129 1 Y 1 D LYS 57  ? S  LYS 57  
130 1 Y 1 D GLY 58  ? S  GLY 58  
131 1 Y 1 D PRO 59  ? S  PRO 59  
132 1 Y 1 D ASP 60  ? S  ASP 60  
133 1 Y 1 D GLY 61  ? S  GLY 61  
134 1 Y 1 D LYS 62  ? S  LYS 62  
135 1 Y 1 D PRO 63  ? S  PRO 63  
136 1 Y 1 D LEU 64  ? S  LEU 64  
137 1 Y 1 D LEU 65  ? S  LEU 65  
138 1 Y 1 D ASN 66  ? S  ASN 66  
139 1 Y 1 D GLU 67  ? S  GLU 67  
140 1 Y 1 D LYS 68  ? S  LYS 68  
141 1 Y 1 D GLY 69  ? S  GLY 69  
142 1 Y 1 D GLU 70  ? S  GLU 70  
143 1 Y 1 D PRO 71  ? S  PRO 71  
144 1 Y 1 D GLU 72  ? S  GLU 72  
145 1 Y 1 D TYR 144 ? S  TYR 144 
146 1 Y 1 D GLN 145 ? S  GLN 145 
147 1 Y 1 D LYS 146 ? S  LYS 146 
148 1 Y 1 D GLY 147 ? S  GLY 147 
149 1 Y 1 D PRO 778 ? S  PRO 778 
150 1 Y 1 D ALA 779 ? S  ALA 779 
151 1 Y 1 D GLY 780 ? S  GLY 780 
152 1 Y 1 D GLY 781 ? S  GLY 781 
153 1 Y 1 D GLU 782 ? S  GLU 782 
154 1 Y 1 D ALA 783 ? S  ALA 783 
155 1 Y 1 E MET 1   ? T  MET 1   
156 1 Y 1 E ARG 2   ? T  ARG 2   
157 1 Y 1 E GLU 3   ? T  GLU 3   
158 1 Y 1 E GLU 4   ? T  GLU 4   
159 1 Y 1 E PHE 5   ? T  PHE 5   
160 1 Y 1 E LEU 6   ? T  LEU 6   
161 1 Y 1 E GLU 7   ? T  GLU 7   
162 1 Y 1 E GLU 8   ? T  GLU 8   
163 1 Y 1 E ILE 9   ? T  ILE 9   
164 1 Y 1 E PRO 10  ? T  PRO 10  
165 1 Y 1 E LEU 11  ? T  LEU 11  
166 1 Y 1 E ASP 12  ? T  ASP 12  
167 1 Y 1 E ALA 13  ? T  ALA 13  
168 1 Y 1 E PRO 14  ? T  PRO 14  
169 1 Y 1 E PRO 15  ? T  PRO 15  
170 1 Y 1 E GLU 16  ? T  GLU 16  
171 1 Y 1 E GLU 17  ? T  GLU 17  
172 1 Y 1 E ALA 18  ? T  ALA 18  
173 1 Y 1 E LYS 19  ? T  LYS 19  
174 1 Y 1 E GLU 20  ? T  GLU 20  
175 1 Y 1 E LEU 21  ? T  LEU 21  
176 1 Y 1 E ARG 22  ? T  ARG 22  
177 1 Y 1 E THR 23  ? T  THR 23  
178 1 Y 1 E GLU 24  ? T  GLU 24  
179 1 Y 1 E VAL 25  ? T  VAL 25  
180 1 Y 1 F ALA 197 ? U  ALA 197 
181 1 Y 1 F ASP 198 ? U  ASP 198 
182 1 Y 1 F LEU 199 ? U  LEU 199 
183 1 Y 1 F LYS 200 ? U  LYS 200 
184 1 Y 1 F LYS 201 ? U  LYS 201 
185 1 Y 1 F ALA 202 ? U  ALA 202 
186 1 Y 1 F ARG 203 ? U  ARG 203 
187 1 Y 1 F GLU 204 ? U  GLU 204 
188 1 Y 1 F VAL 205 ? U  VAL 205 
189 1 Y 1 F LYS 206 ? U  LYS 206 
190 1 Y 1 F GLY 207 ? U  GLY 207 
191 1 Y 1 G MET 1   ? V  MET 1   
192 1 Y 1 G ALA 2   ? V  ALA 2   
193 1 Y 1 G LEU 3   ? V  LEU 3   
194 1 Y 1 G LYS 4   ? V  LYS 4   
195 1 Y 1 G ASP 5   ? V  ASP 5   
196 1 Y 1 G LEU 6   ? V  LEU 6   
197 1 Y 1 G PHE 7   ? V  PHE 7   
198 1 Y 1 G GLU 8   ? V  GLU 8   
199 1 Y 1 G ARG 9   ? V  ARG 9   
200 1 Y 1 G ASP 10  ? V  ASP 10  
201 1 Y 1 G VAL 11  ? V  VAL 11  
202 1 Y 1 G GLN 12  ? V  GLN 12  
203 1 Y 1 G GLU 13  ? V  GLU 13  
204 1 Y 1 G LEU 14  ? V  LEU 14  
205 1 Y 1 G GLU 15  ? V  GLU 15  
206 1 Y 1 O MET 1   ? W  MET 1   
207 1 Y 1 O ARG 182 ? W  ARG 182 
208 1 Y 1 I MET 1   ? X  MET 1   
209 1 Y 1 I SER 2   ? X  SER 2   
210 1 Y 1 X LYS 128 ? Y  LYS 128 
211 1 Y 1 X ARG 129 ? Y  ARG 129 
212 1 Y 1 X ALA 130 ? Y  ALA 130 
213 1 Y 1 X ALA 131 ? Y  ALA 131 
214 1 Y 1 P TRP 118 ? Z  TRP 118 
215 1 Y 1 P HIS 119 ? Z  HIS 119 
216 1 Y 1 R LYS 161 ? AA LYS 161 
217 1 Y 1 R ALA 162 ? AA ALA 162 
218 1 Y 1 R SER 163 ? AA SER 163 
219 1 Y 1 R ARG 164 ? AA ARG 164 
220 1 Y 1 R ALA 165 ? AA ALA 165 
221 1 Y 1 R LYS 166 ? AA LYS 166 
222 1 Y 1 R GLU 167 ? AA GLU 167 
223 1 Y 1 R ALA 168 ? AA ALA 168 
224 1 Y 1 R GLU 169 ? AA GLU 169 
225 1 Y 1 R LYS 170 ? AA LYS 170 
226 1 Y 1 R ARG 171 ? AA ARG 171 
227 1 Y 1 R GLU 172 ? AA GLU 172 
228 1 Y 1 R GLU 173 ? AA GLU 173 
229 1 Y 1 R VAL 174 ? AA VAL 174 
230 1 Y 1 R ALA 175 ? AA ALA 175 
231 1 Y 1 R ARG 176 ? AA ARG 176 
232 1 Y 1 T TRP 606 ? CA TRP 606 
233 1 Y 1 U GLY 468 ? DA GLY 468 
234 1 Y 1 U ALA 469 ? DA ALA 469 
235 1 Y 1 Q MET 1   ? FA MET 1   
236 1 Y 1 Q THR 355 ? FA THR 355 
237 1 Y 1 Q PRO 356 ? FA PRO 356 
238 1 Y 1 Q LYS 357 ? FA LYS 357 
239 1 Y 1 Q PRO 358 ? FA PRO 358 
240 1 Y 1 Q ALA 359 ? FA ALA 359 
241 1 Y 1 Q ARG 360 ? FA ARG 360 
242 1 Y 1 Q LYS 361 ? FA LYS 361 
243 1 Y 1 Q GLY 362 ? FA GLY 362 
244 1 Y 1 Q GLY 363 ? FA GLY 363 
245 1 Y 1 Q GLY 364 ? FA GLY 364 
246 1 Y 1 Q ALA 365 ? FA ALA 365 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N      N  N N 1   
ALA CA     C  N S 2   
ALA C      C  N N 3   
ALA O      O  N N 4   
ALA CB     C  N N 5   
ALA OXT    O  N N 6   
ALA H      H  N N 7   
ALA H2     H  N N 8   
ALA HA     H  N N 9   
ALA HB1    H  N N 10  
ALA HB2    H  N N 11  
ALA HB3    H  N N 12  
ALA HXT    H  N N 13  
ARG N      N  N N 14  
ARG CA     C  N S 15  
ARG C      C  N N 16  
ARG O      O  N N 17  
ARG CB     C  N N 18  
ARG CG     C  N N 19  
ARG CD     C  N N 20  
ARG NE     N  N N 21  
ARG CZ     C  N N 22  
ARG NH1    N  N N 23  
ARG NH2    N  N N 24  
ARG OXT    O  N N 25  
ARG H      H  N N 26  
ARG H2     H  N N 27  
ARG HA     H  N N 28  
ARG HB2    H  N N 29  
ARG HB3    H  N N 30  
ARG HG2    H  N N 31  
ARG HG3    H  N N 32  
ARG HD2    H  N N 33  
ARG HD3    H  N N 34  
ARG HE     H  N N 35  
ARG HH11   H  N N 36  
ARG HH12   H  N N 37  
ARG HH21   H  N N 38  
ARG HH22   H  N N 39  
ARG HXT    H  N N 40  
ASN N      N  N N 41  
ASN CA     C  N S 42  
ASN C      C  N N 43  
ASN O      O  N N 44  
ASN CB     C  N N 45  
ASN CG     C  N N 46  
ASN OD1    O  N N 47  
ASN ND2    N  N N 48  
ASN OXT    O  N N 49  
ASN H      H  N N 50  
ASN H2     H  N N 51  
ASN HA     H  N N 52  
ASN HB2    H  N N 53  
ASN HB3    H  N N 54  
ASN HD21   H  N N 55  
ASN HD22   H  N N 56  
ASN HXT    H  N N 57  
ASP N      N  N N 58  
ASP CA     C  N S 59  
ASP C      C  N N 60  
ASP O      O  N N 61  
ASP CB     C  N N 62  
ASP CG     C  N N 63  
ASP OD1    O  N N 64  
ASP OD2    O  N N 65  
ASP OXT    O  N N 66  
ASP H      H  N N 67  
ASP H2     H  N N 68  
ASP HA     H  N N 69  
ASP HB2    H  N N 70  
ASP HB3    H  N N 71  
ASP HD2    H  N N 72  
ASP HXT    H  N N 73  
CYS N      N  N N 74  
CYS CA     C  N R 75  
CYS C      C  N N 76  
CYS O      O  N N 77  
CYS CB     C  N N 78  
CYS SG     S  N N 79  
CYS OXT    O  N N 80  
CYS H      H  N N 81  
CYS H2     H  N N 82  
CYS HA     H  N N 83  
CYS HB2    H  N N 84  
CYS HB3    H  N N 85  
CYS HG     H  N N 86  
CYS HXT    H  N N 87  
FES FE1    FE N N 88  
FES FE2    FE N N 89  
FES S1     S  N N 90  
FES S2     S  N N 91  
FMN N1     N  N N 92  
FMN C2     C  N N 93  
FMN O2     O  N N 94  
FMN N3     N  N N 95  
FMN C4     C  N N 96  
FMN O4     O  N N 97  
FMN C4A    C  N N 98  
FMN N5     N  N N 99  
FMN C5A    C  Y N 100 
FMN C6     C  Y N 101 
FMN C7     C  Y N 102 
FMN C7M    C  N N 103 
FMN C8     C  Y N 104 
FMN C8M    C  N N 105 
FMN C9     C  Y N 106 
FMN C9A    C  Y N 107 
FMN N10    N  N N 108 
FMN C10    C  N N 109 
FMN "C1'"  C  N N 110 
FMN "C2'"  C  N S 111 
FMN "O2'"  O  N N 112 
FMN "C3'"  C  N S 113 
FMN "O3'"  O  N N 114 
FMN "C4'"  C  N R 115 
FMN "O4'"  O  N N 116 
FMN "C5'"  C  N N 117 
FMN "O5'"  O  N N 118 
FMN P      P  N N 119 
FMN O1P    O  N N 120 
FMN O2P    O  N N 121 
FMN O3P    O  N N 122 
FMN HN3    H  N N 123 
FMN H6     H  N N 124 
FMN HM71   H  N N 125 
FMN HM72   H  N N 126 
FMN HM73   H  N N 127 
FMN HM81   H  N N 128 
FMN HM82   H  N N 129 
FMN HM83   H  N N 130 
FMN H9     H  N N 131 
FMN "H1'1" H  N N 132 
FMN "H1'2" H  N N 133 
FMN "H2'"  H  N N 134 
FMN "HO2'" H  N N 135 
FMN "H3'"  H  N N 136 
FMN "HO3'" H  N N 137 
FMN "H4'"  H  N N 138 
FMN "HO4'" H  N N 139 
FMN "H5'1" H  N N 140 
FMN "H5'2" H  N N 141 
FMN HOP2   H  N N 142 
FMN HOP3   H  N N 143 
GLN N      N  N N 144 
GLN CA     C  N S 145 
GLN C      C  N N 146 
GLN O      O  N N 147 
GLN CB     C  N N 148 
GLN CG     C  N N 149 
GLN CD     C  N N 150 
GLN OE1    O  N N 151 
GLN NE2    N  N N 152 
GLN OXT    O  N N 153 
GLN H      H  N N 154 
GLN H2     H  N N 155 
GLN HA     H  N N 156 
GLN HB2    H  N N 157 
GLN HB3    H  N N 158 
GLN HG2    H  N N 159 
GLN HG3    H  N N 160 
GLN HE21   H  N N 161 
GLN HE22   H  N N 162 
GLN HXT    H  N N 163 
GLU N      N  N N 164 
GLU CA     C  N S 165 
GLU C      C  N N 166 
GLU O      O  N N 167 
GLU CB     C  N N 168 
GLU CG     C  N N 169 
GLU CD     C  N N 170 
GLU OE1    O  N N 171 
GLU OE2    O  N N 172 
GLU OXT    O  N N 173 
GLU H      H  N N 174 
GLU H2     H  N N 175 
GLU HA     H  N N 176 
GLU HB2    H  N N 177 
GLU HB3    H  N N 178 
GLU HG2    H  N N 179 
GLU HG3    H  N N 180 
GLU HE2    H  N N 181 
GLU HXT    H  N N 182 
GLY N      N  N N 183 
GLY CA     C  N N 184 
GLY C      C  N N 185 
GLY O      O  N N 186 
GLY OXT    O  N N 187 
GLY H      H  N N 188 
GLY H2     H  N N 189 
GLY HA2    H  N N 190 
GLY HA3    H  N N 191 
GLY HXT    H  N N 192 
HIS N      N  N N 193 
HIS CA     C  N S 194 
HIS C      C  N N 195 
HIS O      O  N N 196 
HIS CB     C  N N 197 
HIS CG     C  Y N 198 
HIS ND1    N  Y N 199 
HIS CD2    C  Y N 200 
HIS CE1    C  Y N 201 
HIS NE2    N  Y N 202 
HIS OXT    O  N N 203 
HIS H      H  N N 204 
HIS H2     H  N N 205 
HIS HA     H  N N 206 
HIS HB2    H  N N 207 
HIS HB3    H  N N 208 
HIS HD1    H  N N 209 
HIS HD2    H  N N 210 
HIS HE1    H  N N 211 
HIS HE2    H  N N 212 
HIS HXT    H  N N 213 
ILE N      N  N N 214 
ILE CA     C  N S 215 
ILE C      C  N N 216 
ILE O      O  N N 217 
ILE CB     C  N S 218 
ILE CG1    C  N N 219 
ILE CG2    C  N N 220 
ILE CD1    C  N N 221 
ILE OXT    O  N N 222 
ILE H      H  N N 223 
ILE H2     H  N N 224 
ILE HA     H  N N 225 
ILE HB     H  N N 226 
ILE HG12   H  N N 227 
ILE HG13   H  N N 228 
ILE HG21   H  N N 229 
ILE HG22   H  N N 230 
ILE HG23   H  N N 231 
ILE HD11   H  N N 232 
ILE HD12   H  N N 233 
ILE HD13   H  N N 234 
ILE HXT    H  N N 235 
LEU N      N  N N 236 
LEU CA     C  N S 237 
LEU C      C  N N 238 
LEU O      O  N N 239 
LEU CB     C  N N 240 
LEU CG     C  N N 241 
LEU CD1    C  N N 242 
LEU CD2    C  N N 243 
LEU OXT    O  N N 244 
LEU H      H  N N 245 
LEU H2     H  N N 246 
LEU HA     H  N N 247 
LEU HB2    H  N N 248 
LEU HB3    H  N N 249 
LEU HG     H  N N 250 
LEU HD11   H  N N 251 
LEU HD12   H  N N 252 
LEU HD13   H  N N 253 
LEU HD21   H  N N 254 
LEU HD22   H  N N 255 
LEU HD23   H  N N 256 
LEU HXT    H  N N 257 
LYS N      N  N N 258 
LYS CA     C  N S 259 
LYS C      C  N N 260 
LYS O      O  N N 261 
LYS CB     C  N N 262 
LYS CG     C  N N 263 
LYS CD     C  N N 264 
LYS CE     C  N N 265 
LYS NZ     N  N N 266 
LYS OXT    O  N N 267 
LYS H      H  N N 268 
LYS H2     H  N N 269 
LYS HA     H  N N 270 
LYS HB2    H  N N 271 
LYS HB3    H  N N 272 
LYS HG2    H  N N 273 
LYS HG3    H  N N 274 
LYS HD2    H  N N 275 
LYS HD3    H  N N 276 
LYS HE2    H  N N 277 
LYS HE3    H  N N 278 
LYS HZ1    H  N N 279 
LYS HZ2    H  N N 280 
LYS HZ3    H  N N 281 
LYS HXT    H  N N 282 
MET N      N  N N 283 
MET CA     C  N S 284 
MET C      C  N N 285 
MET O      O  N N 286 
MET CB     C  N N 287 
MET CG     C  N N 288 
MET SD     S  N N 289 
MET CE     C  N N 290 
MET OXT    O  N N 291 
MET H      H  N N 292 
MET H2     H  N N 293 
MET HA     H  N N 294 
MET HB2    H  N N 295 
MET HB3    H  N N 296 
MET HG2    H  N N 297 
MET HG3    H  N N 298 
MET HE1    H  N N 299 
MET HE2    H  N N 300 
MET HE3    H  N N 301 
MET HXT    H  N N 302 
NAI PA     P  N S 303 
NAI O1A    O  N N 304 
NAI O2A    O  N N 305 
NAI O5B    O  N N 306 
NAI C5B    C  N N 307 
NAI C4B    C  N R 308 
NAI O4B    O  N N 309 
NAI C3B    C  N S 310 
NAI O3B    O  N N 311 
NAI C2B    C  N R 312 
NAI O2B    O  N N 313 
NAI C1B    C  N R 314 
NAI N9A    N  Y N 315 
NAI C8A    C  Y N 316 
NAI N7A    N  Y N 317 
NAI C5A    C  Y N 318 
NAI C6A    C  Y N 319 
NAI N6A    N  N N 320 
NAI N1A    N  Y N 321 
NAI C2A    C  Y N 322 
NAI N3A    N  Y N 323 
NAI C4A    C  Y N 324 
NAI O3     O  N N 325 
NAI PN     P  N S 326 
NAI O1N    O  N N 327 
NAI O2N    O  N N 328 
NAI O5D    O  N N 329 
NAI C5D    C  N N 330 
NAI C4D    C  N R 331 
NAI O4D    O  N N 332 
NAI C3D    C  N S 333 
NAI O3D    O  N N 334 
NAI C2D    C  N R 335 
NAI O2D    O  N N 336 
NAI C1D    C  N R 337 
NAI N1N    N  N N 338 
NAI C2N    C  N N 339 
NAI C3N    C  N N 340 
NAI C7N    C  N N 341 
NAI O7N    O  N N 342 
NAI N7N    N  N N 343 
NAI C4N    C  N N 344 
NAI C5N    C  N N 345 
NAI C6N    C  N N 346 
NAI HOA2   H  N N 347 
NAI H51A   H  N N 348 
NAI H52A   H  N N 349 
NAI H4B    H  N N 350 
NAI H3B    H  N N 351 
NAI HO3A   H  N N 352 
NAI H2B    H  N N 353 
NAI HO2A   H  N N 354 
NAI H1B    H  N N 355 
NAI H8A    H  N N 356 
NAI H61A   H  N N 357 
NAI H62A   H  N N 358 
NAI H2A    H  N N 359 
NAI HO1N   H  N N 360 
NAI H51N   H  N N 361 
NAI H52N   H  N N 362 
NAI H4D    H  N N 363 
NAI H3D    H  N N 364 
NAI HO3N   H  N N 365 
NAI H2D    H  N N 366 
NAI HO2N   H  N N 367 
NAI H1D    H  N N 368 
NAI H2N    H  N N 369 
NAI H71N   H  N N 370 
NAI H72N   H  N N 371 
NAI H4N    H  N N 372 
NAI H42N   H  N N 373 
NAI H5N    H  N N 374 
NAI H6N    H  N N 375 
PHE N      N  N N 376 
PHE CA     C  N S 377 
PHE C      C  N N 378 
PHE O      O  N N 379 
PHE CB     C  N N 380 
PHE CG     C  Y N 381 
PHE CD1    C  Y N 382 
PHE CD2    C  Y N 383 
PHE CE1    C  Y N 384 
PHE CE2    C  Y N 385 
PHE CZ     C  Y N 386 
PHE OXT    O  N N 387 
PHE H      H  N N 388 
PHE H2     H  N N 389 
PHE HA     H  N N 390 
PHE HB2    H  N N 391 
PHE HB3    H  N N 392 
PHE HD1    H  N N 393 
PHE HD2    H  N N 394 
PHE HE1    H  N N 395 
PHE HE2    H  N N 396 
PHE HZ     H  N N 397 
PHE HXT    H  N N 398 
PRO N      N  N N 399 
PRO CA     C  N S 400 
PRO C      C  N N 401 
PRO O      O  N N 402 
PRO CB     C  N N 403 
PRO CG     C  N N 404 
PRO CD     C  N N 405 
PRO OXT    O  N N 406 
PRO H      H  N N 407 
PRO HA     H  N N 408 
PRO HB2    H  N N 409 
PRO HB3    H  N N 410 
PRO HG2    H  N N 411 
PRO HG3    H  N N 412 
PRO HD2    H  N N 413 
PRO HD3    H  N N 414 
PRO HXT    H  N N 415 
SER N      N  N N 416 
SER CA     C  N S 417 
SER C      C  N N 418 
SER O      O  N N 419 
SER CB     C  N N 420 
SER OG     O  N N 421 
SER OXT    O  N N 422 
SER H      H  N N 423 
SER H2     H  N N 424 
SER HA     H  N N 425 
SER HB2    H  N N 426 
SER HB3    H  N N 427 
SER HG     H  N N 428 
SER HXT    H  N N 429 
SF4 FE1    FE N N 430 
SF4 FE2    FE N N 431 
SF4 FE3    FE N N 432 
SF4 FE4    FE N N 433 
SF4 S1     S  N N 434 
SF4 S2     S  N N 435 
SF4 S3     S  N N 436 
SF4 S4     S  N N 437 
THR N      N  N N 438 
THR CA     C  N S 439 
THR C      C  N N 440 
THR O      O  N N 441 
THR CB     C  N R 442 
THR OG1    O  N N 443 
THR CG2    C  N N 444 
THR OXT    O  N N 445 
THR H      H  N N 446 
THR H2     H  N N 447 
THR HA     H  N N 448 
THR HB     H  N N 449 
THR HG1    H  N N 450 
THR HG21   H  N N 451 
THR HG22   H  N N 452 
THR HG23   H  N N 453 
THR HXT    H  N N 454 
TRP N      N  N N 455 
TRP CA     C  N S 456 
TRP C      C  N N 457 
TRP O      O  N N 458 
TRP CB     C  N N 459 
TRP CG     C  Y N 460 
TRP CD1    C  Y N 461 
TRP CD2    C  Y N 462 
TRP NE1    N  Y N 463 
TRP CE2    C  Y N 464 
TRP CE3    C  Y N 465 
TRP CZ2    C  Y N 466 
TRP CZ3    C  Y N 467 
TRP CH2    C  Y N 468 
TRP OXT    O  N N 469 
TRP H      H  N N 470 
TRP H2     H  N N 471 
TRP HA     H  N N 472 
TRP HB2    H  N N 473 
TRP HB3    H  N N 474 
TRP HD1    H  N N 475 
TRP HE1    H  N N 476 
TRP HE3    H  N N 477 
TRP HZ2    H  N N 478 
TRP HZ3    H  N N 479 
TRP HH2    H  N N 480 
TRP HXT    H  N N 481 
TYR N      N  N N 482 
TYR CA     C  N S 483 
TYR C      C  N N 484 
TYR O      O  N N 485 
TYR CB     C  N N 486 
TYR CG     C  Y N 487 
TYR CD1    C  Y N 488 
TYR CD2    C  Y N 489 
TYR CE1    C  Y N 490 
TYR CE2    C  Y N 491 
TYR CZ     C  Y N 492 
TYR OH     O  N N 493 
TYR OXT    O  N N 494 
TYR H      H  N N 495 
TYR H2     H  N N 496 
TYR HA     H  N N 497 
TYR HB2    H  N N 498 
TYR HB3    H  N N 499 
TYR HD1    H  N N 500 
TYR HD2    H  N N 501 
TYR HE1    H  N N 502 
TYR HE2    H  N N 503 
TYR HH     H  N N 504 
TYR HXT    H  N N 505 
VAL N      N  N N 506 
VAL CA     C  N S 507 
VAL C      C  N N 508 
VAL O      O  N N 509 
VAL CB     C  N N 510 
VAL CG1    C  N N 511 
VAL CG2    C  N N 512 
VAL OXT    O  N N 513 
VAL H      H  N N 514 
VAL H2     H  N N 515 
VAL HA     H  N N 516 
VAL HB     H  N N 517 
VAL HG11   H  N N 518 
VAL HG12   H  N N 519 
VAL HG13   H  N N 520 
VAL HG21   H  N N 521 
VAL HG22   H  N N 522 
VAL HG23   H  N N 523 
VAL HXT    H  N N 524 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N     CA     sing N N 1   
ALA N     H      sing N N 2   
ALA N     H2     sing N N 3   
ALA CA    C      sing N N 4   
ALA CA    CB     sing N N 5   
ALA CA    HA     sing N N 6   
ALA C     O      doub N N 7   
ALA C     OXT    sing N N 8   
ALA CB    HB1    sing N N 9   
ALA CB    HB2    sing N N 10  
ALA CB    HB3    sing N N 11  
ALA OXT   HXT    sing N N 12  
ARG N     CA     sing N N 13  
ARG N     H      sing N N 14  
ARG N     H2     sing N N 15  
ARG CA    C      sing N N 16  
ARG CA    CB     sing N N 17  
ARG CA    HA     sing N N 18  
ARG C     O      doub N N 19  
ARG C     OXT    sing N N 20  
ARG CB    CG     sing N N 21  
ARG CB    HB2    sing N N 22  
ARG CB    HB3    sing N N 23  
ARG CG    CD     sing N N 24  
ARG CG    HG2    sing N N 25  
ARG CG    HG3    sing N N 26  
ARG CD    NE     sing N N 27  
ARG CD    HD2    sing N N 28  
ARG CD    HD3    sing N N 29  
ARG NE    CZ     sing N N 30  
ARG NE    HE     sing N N 31  
ARG CZ    NH1    sing N N 32  
ARG CZ    NH2    doub N N 33  
ARG NH1   HH11   sing N N 34  
ARG NH1   HH12   sing N N 35  
ARG NH2   HH21   sing N N 36  
ARG NH2   HH22   sing N N 37  
ARG OXT   HXT    sing N N 38  
ASN N     CA     sing N N 39  
ASN N     H      sing N N 40  
ASN N     H2     sing N N 41  
ASN CA    C      sing N N 42  
ASN CA    CB     sing N N 43  
ASN CA    HA     sing N N 44  
ASN C     O      doub N N 45  
ASN C     OXT    sing N N 46  
ASN CB    CG     sing N N 47  
ASN CB    HB2    sing N N 48  
ASN CB    HB3    sing N N 49  
ASN CG    OD1    doub N N 50  
ASN CG    ND2    sing N N 51  
ASN ND2   HD21   sing N N 52  
ASN ND2   HD22   sing N N 53  
ASN OXT   HXT    sing N N 54  
ASP N     CA     sing N N 55  
ASP N     H      sing N N 56  
ASP N     H2     sing N N 57  
ASP CA    C      sing N N 58  
ASP CA    CB     sing N N 59  
ASP CA    HA     sing N N 60  
ASP C     O      doub N N 61  
ASP C     OXT    sing N N 62  
ASP CB    CG     sing N N 63  
ASP CB    HB2    sing N N 64  
ASP CB    HB3    sing N N 65  
ASP CG    OD1    doub N N 66  
ASP CG    OD2    sing N N 67  
ASP OD2   HD2    sing N N 68  
ASP OXT   HXT    sing N N 69  
CYS N     CA     sing N N 70  
CYS N     H      sing N N 71  
CYS N     H2     sing N N 72  
CYS CA    C      sing N N 73  
CYS CA    CB     sing N N 74  
CYS CA    HA     sing N N 75  
CYS C     O      doub N N 76  
CYS C     OXT    sing N N 77  
CYS CB    SG     sing N N 78  
CYS CB    HB2    sing N N 79  
CYS CB    HB3    sing N N 80  
CYS SG    HG     sing N N 81  
CYS OXT   HXT    sing N N 82  
FES FE1   S1     sing N N 83  
FES FE1   S2     sing N N 84  
FES FE2   S1     sing N N 85  
FES FE2   S2     sing N N 86  
FMN N1    C2     sing N N 87  
FMN N1    C10    doub N N 88  
FMN C2    O2     doub N N 89  
FMN C2    N3     sing N N 90  
FMN N3    C4     sing N N 91  
FMN N3    HN3    sing N N 92  
FMN C4    O4     doub N N 93  
FMN C4    C4A    sing N N 94  
FMN C4A   N5     doub N N 95  
FMN C4A   C10    sing N N 96  
FMN N5    C5A    sing N N 97  
FMN C5A   C6     doub Y N 98  
FMN C5A   C9A    sing Y N 99  
FMN C6    C7     sing Y N 100 
FMN C6    H6     sing N N 101 
FMN C7    C7M    sing N N 102 
FMN C7    C8     doub Y N 103 
FMN C7M   HM71   sing N N 104 
FMN C7M   HM72   sing N N 105 
FMN C7M   HM73   sing N N 106 
FMN C8    C8M    sing N N 107 
FMN C8    C9     sing Y N 108 
FMN C8M   HM81   sing N N 109 
FMN C8M   HM82   sing N N 110 
FMN C8M   HM83   sing N N 111 
FMN C9    C9A    doub Y N 112 
FMN C9    H9     sing N N 113 
FMN C9A   N10    sing N N 114 
FMN N10   C10    sing N N 115 
FMN N10   "C1'"  sing N N 116 
FMN "C1'" "C2'"  sing N N 117 
FMN "C1'" "H1'1" sing N N 118 
FMN "C1'" "H1'2" sing N N 119 
FMN "C2'" "O2'"  sing N N 120 
FMN "C2'" "C3'"  sing N N 121 
FMN "C2'" "H2'"  sing N N 122 
FMN "O2'" "HO2'" sing N N 123 
FMN "C3'" "O3'"  sing N N 124 
FMN "C3'" "C4'"  sing N N 125 
FMN "C3'" "H3'"  sing N N 126 
FMN "O3'" "HO3'" sing N N 127 
FMN "C4'" "O4'"  sing N N 128 
FMN "C4'" "C5'"  sing N N 129 
FMN "C4'" "H4'"  sing N N 130 
FMN "O4'" "HO4'" sing N N 131 
FMN "C5'" "O5'"  sing N N 132 
FMN "C5'" "H5'1" sing N N 133 
FMN "C5'" "H5'2" sing N N 134 
FMN "O5'" P      sing N N 135 
FMN P     O1P    doub N N 136 
FMN P     O2P    sing N N 137 
FMN P     O3P    sing N N 138 
FMN O2P   HOP2   sing N N 139 
FMN O3P   HOP3   sing N N 140 
GLN N     CA     sing N N 141 
GLN N     H      sing N N 142 
GLN N     H2     sing N N 143 
GLN CA    C      sing N N 144 
GLN CA    CB     sing N N 145 
GLN CA    HA     sing N N 146 
GLN C     O      doub N N 147 
GLN C     OXT    sing N N 148 
GLN CB    CG     sing N N 149 
GLN CB    HB2    sing N N 150 
GLN CB    HB3    sing N N 151 
GLN CG    CD     sing N N 152 
GLN CG    HG2    sing N N 153 
GLN CG    HG3    sing N N 154 
GLN CD    OE1    doub N N 155 
GLN CD    NE2    sing N N 156 
GLN NE2   HE21   sing N N 157 
GLN NE2   HE22   sing N N 158 
GLN OXT   HXT    sing N N 159 
GLU N     CA     sing N N 160 
GLU N     H      sing N N 161 
GLU N     H2     sing N N 162 
GLU CA    C      sing N N 163 
GLU CA    CB     sing N N 164 
GLU CA    HA     sing N N 165 
GLU C     O      doub N N 166 
GLU C     OXT    sing N N 167 
GLU CB    CG     sing N N 168 
GLU CB    HB2    sing N N 169 
GLU CB    HB3    sing N N 170 
GLU CG    CD     sing N N 171 
GLU CG    HG2    sing N N 172 
GLU CG    HG3    sing N N 173 
GLU CD    OE1    doub N N 174 
GLU CD    OE2    sing N N 175 
GLU OE2   HE2    sing N N 176 
GLU OXT   HXT    sing N N 177 
GLY N     CA     sing N N 178 
GLY N     H      sing N N 179 
GLY N     H2     sing N N 180 
GLY CA    C      sing N N 181 
GLY CA    HA2    sing N N 182 
GLY CA    HA3    sing N N 183 
GLY C     O      doub N N 184 
GLY C     OXT    sing N N 185 
GLY OXT   HXT    sing N N 186 
HIS N     CA     sing N N 187 
HIS N     H      sing N N 188 
HIS N     H2     sing N N 189 
HIS CA    C      sing N N 190 
HIS CA    CB     sing N N 191 
HIS CA    HA     sing N N 192 
HIS C     O      doub N N 193 
HIS C     OXT    sing N N 194 
HIS CB    CG     sing N N 195 
HIS CB    HB2    sing N N 196 
HIS CB    HB3    sing N N 197 
HIS CG    ND1    sing Y N 198 
HIS CG    CD2    doub Y N 199 
HIS ND1   CE1    doub Y N 200 
HIS ND1   HD1    sing N N 201 
HIS CD2   NE2    sing Y N 202 
HIS CD2   HD2    sing N N 203 
HIS CE1   NE2    sing Y N 204 
HIS CE1   HE1    sing N N 205 
HIS NE2   HE2    sing N N 206 
HIS OXT   HXT    sing N N 207 
ILE N     CA     sing N N 208 
ILE N     H      sing N N 209 
ILE N     H2     sing N N 210 
ILE CA    C      sing N N 211 
ILE CA    CB     sing N N 212 
ILE CA    HA     sing N N 213 
ILE C     O      doub N N 214 
ILE C     OXT    sing N N 215 
ILE CB    CG1    sing N N 216 
ILE CB    CG2    sing N N 217 
ILE CB    HB     sing N N 218 
ILE CG1   CD1    sing N N 219 
ILE CG1   HG12   sing N N 220 
ILE CG1   HG13   sing N N 221 
ILE CG2   HG21   sing N N 222 
ILE CG2   HG22   sing N N 223 
ILE CG2   HG23   sing N N 224 
ILE CD1   HD11   sing N N 225 
ILE CD1   HD12   sing N N 226 
ILE CD1   HD13   sing N N 227 
ILE OXT   HXT    sing N N 228 
LEU N     CA     sing N N 229 
LEU N     H      sing N N 230 
LEU N     H2     sing N N 231 
LEU CA    C      sing N N 232 
LEU CA    CB     sing N N 233 
LEU CA    HA     sing N N 234 
LEU C     O      doub N N 235 
LEU C     OXT    sing N N 236 
LEU CB    CG     sing N N 237 
LEU CB    HB2    sing N N 238 
LEU CB    HB3    sing N N 239 
LEU CG    CD1    sing N N 240 
LEU CG    CD2    sing N N 241 
LEU CG    HG     sing N N 242 
LEU CD1   HD11   sing N N 243 
LEU CD1   HD12   sing N N 244 
LEU CD1   HD13   sing N N 245 
LEU CD2   HD21   sing N N 246 
LEU CD2   HD22   sing N N 247 
LEU CD2   HD23   sing N N 248 
LEU OXT   HXT    sing N N 249 
LYS N     CA     sing N N 250 
LYS N     H      sing N N 251 
LYS N     H2     sing N N 252 
LYS CA    C      sing N N 253 
LYS CA    CB     sing N N 254 
LYS CA    HA     sing N N 255 
LYS C     O      doub N N 256 
LYS C     OXT    sing N N 257 
LYS CB    CG     sing N N 258 
LYS CB    HB2    sing N N 259 
LYS CB    HB3    sing N N 260 
LYS CG    CD     sing N N 261 
LYS CG    HG2    sing N N 262 
LYS CG    HG3    sing N N 263 
LYS CD    CE     sing N N 264 
LYS CD    HD2    sing N N 265 
LYS CD    HD3    sing N N 266 
LYS CE    NZ     sing N N 267 
LYS CE    HE2    sing N N 268 
LYS CE    HE3    sing N N 269 
LYS NZ    HZ1    sing N N 270 
LYS NZ    HZ2    sing N N 271 
LYS NZ    HZ3    sing N N 272 
LYS OXT   HXT    sing N N 273 
MET N     CA     sing N N 274 
MET N     H      sing N N 275 
MET N     H2     sing N N 276 
MET CA    C      sing N N 277 
MET CA    CB     sing N N 278 
MET CA    HA     sing N N 279 
MET C     O      doub N N 280 
MET C     OXT    sing N N 281 
MET CB    CG     sing N N 282 
MET CB    HB2    sing N N 283 
MET CB    HB3    sing N N 284 
MET CG    SD     sing N N 285 
MET CG    HG2    sing N N 286 
MET CG    HG3    sing N N 287 
MET SD    CE     sing N N 288 
MET CE    HE1    sing N N 289 
MET CE    HE2    sing N N 290 
MET CE    HE3    sing N N 291 
MET OXT   HXT    sing N N 292 
NAI PA    O1A    doub N N 293 
NAI PA    O2A    sing N N 294 
NAI PA    O5B    sing N N 295 
NAI PA    O3     sing N N 296 
NAI O2A   HOA2   sing N N 297 
NAI O5B   C5B    sing N N 298 
NAI C5B   C4B    sing N N 299 
NAI C5B   H51A   sing N N 300 
NAI C5B   H52A   sing N N 301 
NAI C4B   O4B    sing N N 302 
NAI C4B   C3B    sing N N 303 
NAI C4B   H4B    sing N N 304 
NAI O4B   C1B    sing N N 305 
NAI C3B   O3B    sing N N 306 
NAI C3B   C2B    sing N N 307 
NAI C3B   H3B    sing N N 308 
NAI O3B   HO3A   sing N N 309 
NAI C2B   O2B    sing N N 310 
NAI C2B   C1B    sing N N 311 
NAI C2B   H2B    sing N N 312 
NAI O2B   HO2A   sing N N 313 
NAI C1B   N9A    sing N N 314 
NAI C1B   H1B    sing N N 315 
NAI N9A   C8A    sing Y N 316 
NAI N9A   C4A    sing Y N 317 
NAI C8A   N7A    doub Y N 318 
NAI C8A   H8A    sing N N 319 
NAI N7A   C5A    sing Y N 320 
NAI C5A   C6A    sing Y N 321 
NAI C5A   C4A    doub Y N 322 
NAI C6A   N6A    sing N N 323 
NAI C6A   N1A    doub Y N 324 
NAI N6A   H61A   sing N N 325 
NAI N6A   H62A   sing N N 326 
NAI N1A   C2A    sing Y N 327 
NAI C2A   N3A    doub Y N 328 
NAI C2A   H2A    sing N N 329 
NAI N3A   C4A    sing Y N 330 
NAI O3    PN     sing N N 331 
NAI PN    O1N    sing N N 332 
NAI PN    O2N    doub N N 333 
NAI PN    O5D    sing N N 334 
NAI O1N   HO1N   sing N N 335 
NAI O5D   C5D    sing N N 336 
NAI C5D   C4D    sing N N 337 
NAI C5D   H51N   sing N N 338 
NAI C5D   H52N   sing N N 339 
NAI C4D   O4D    sing N N 340 
NAI C4D   C3D    sing N N 341 
NAI C4D   H4D    sing N N 342 
NAI O4D   C1D    sing N N 343 
NAI C3D   O3D    sing N N 344 
NAI C3D   C2D    sing N N 345 
NAI C3D   H3D    sing N N 346 
NAI O3D   HO3N   sing N N 347 
NAI C2D   O2D    sing N N 348 
NAI C2D   C1D    sing N N 349 
NAI C2D   H2D    sing N N 350 
NAI O2D   HO2N   sing N N 351 
NAI C1D   N1N    sing N N 352 
NAI C1D   H1D    sing N N 353 
NAI N1N   C2N    sing N N 354 
NAI N1N   C6N    sing N N 355 
NAI C2N   C3N    doub N N 356 
NAI C2N   H2N    sing N N 357 
NAI C3N   C7N    sing N N 358 
NAI C3N   C4N    sing N N 359 
NAI C7N   O7N    doub N N 360 
NAI C7N   N7N    sing N N 361 
NAI N7N   H71N   sing N N 362 
NAI N7N   H72N   sing N N 363 
NAI C4N   C5N    sing N N 364 
NAI C4N   H4N    sing N N 365 
NAI C4N   H42N   sing N N 366 
NAI C5N   C6N    doub N N 367 
NAI C5N   H5N    sing N N 368 
NAI C6N   H6N    sing N N 369 
PHE N     CA     sing N N 370 
PHE N     H      sing N N 371 
PHE N     H2     sing N N 372 
PHE CA    C      sing N N 373 
PHE CA    CB     sing N N 374 
PHE CA    HA     sing N N 375 
PHE C     O      doub N N 376 
PHE C     OXT    sing N N 377 
PHE CB    CG     sing N N 378 
PHE CB    HB2    sing N N 379 
PHE CB    HB3    sing N N 380 
PHE CG    CD1    doub Y N 381 
PHE CG    CD2    sing Y N 382 
PHE CD1   CE1    sing Y N 383 
PHE CD1   HD1    sing N N 384 
PHE CD2   CE2    doub Y N 385 
PHE CD2   HD2    sing N N 386 
PHE CE1   CZ     doub Y N 387 
PHE CE1   HE1    sing N N 388 
PHE CE2   CZ     sing Y N 389 
PHE CE2   HE2    sing N N 390 
PHE CZ    HZ     sing N N 391 
PHE OXT   HXT    sing N N 392 
PRO N     CA     sing N N 393 
PRO N     CD     sing N N 394 
PRO N     H      sing N N 395 
PRO CA    C      sing N N 396 
PRO CA    CB     sing N N 397 
PRO CA    HA     sing N N 398 
PRO C     O      doub N N 399 
PRO C     OXT    sing N N 400 
PRO CB    CG     sing N N 401 
PRO CB    HB2    sing N N 402 
PRO CB    HB3    sing N N 403 
PRO CG    CD     sing N N 404 
PRO CG    HG2    sing N N 405 
PRO CG    HG3    sing N N 406 
PRO CD    HD2    sing N N 407 
PRO CD    HD3    sing N N 408 
PRO OXT   HXT    sing N N 409 
SER N     CA     sing N N 410 
SER N     H      sing N N 411 
SER N     H2     sing N N 412 
SER CA    C      sing N N 413 
SER CA    CB     sing N N 414 
SER CA    HA     sing N N 415 
SER C     O      doub N N 416 
SER C     OXT    sing N N 417 
SER CB    OG     sing N N 418 
SER CB    HB2    sing N N 419 
SER CB    HB3    sing N N 420 
SER OG    HG     sing N N 421 
SER OXT   HXT    sing N N 422 
SF4 FE1   S2     sing N N 423 
SF4 FE1   S3     sing N N 424 
SF4 FE1   S4     sing N N 425 
SF4 FE2   S1     sing N N 426 
SF4 FE2   S3     sing N N 427 
SF4 FE2   S4     sing N N 428 
SF4 FE3   S1     sing N N 429 
SF4 FE3   S2     sing N N 430 
SF4 FE3   S4     sing N N 431 
SF4 FE4   S1     sing N N 432 
SF4 FE4   S2     sing N N 433 
SF4 FE4   S3     sing N N 434 
THR N     CA     sing N N 435 
THR N     H      sing N N 436 
THR N     H2     sing N N 437 
THR CA    C      sing N N 438 
THR CA    CB     sing N N 439 
THR CA    HA     sing N N 440 
THR C     O      doub N N 441 
THR C     OXT    sing N N 442 
THR CB    OG1    sing N N 443 
THR CB    CG2    sing N N 444 
THR CB    HB     sing N N 445 
THR OG1   HG1    sing N N 446 
THR CG2   HG21   sing N N 447 
THR CG2   HG22   sing N N 448 
THR CG2   HG23   sing N N 449 
THR OXT   HXT    sing N N 450 
TRP N     CA     sing N N 451 
TRP N     H      sing N N 452 
TRP N     H2     sing N N 453 
TRP CA    C      sing N N 454 
TRP CA    CB     sing N N 455 
TRP CA    HA     sing N N 456 
TRP C     O      doub N N 457 
TRP C     OXT    sing N N 458 
TRP CB    CG     sing N N 459 
TRP CB    HB2    sing N N 460 
TRP CB    HB3    sing N N 461 
TRP CG    CD1    doub Y N 462 
TRP CG    CD2    sing Y N 463 
TRP CD1   NE1    sing Y N 464 
TRP CD1   HD1    sing N N 465 
TRP CD2   CE2    doub Y N 466 
TRP CD2   CE3    sing Y N 467 
TRP NE1   CE2    sing Y N 468 
TRP NE1   HE1    sing N N 469 
TRP CE2   CZ2    sing Y N 470 
TRP CE3   CZ3    doub Y N 471 
TRP CE3   HE3    sing N N 472 
TRP CZ2   CH2    doub Y N 473 
TRP CZ2   HZ2    sing N N 474 
TRP CZ3   CH2    sing Y N 475 
TRP CZ3   HZ3    sing N N 476 
TRP CH2   HH2    sing N N 477 
TRP OXT   HXT    sing N N 478 
TYR N     CA     sing N N 479 
TYR N     H      sing N N 480 
TYR N     H2     sing N N 481 
TYR CA    C      sing N N 482 
TYR CA    CB     sing N N 483 
TYR CA    HA     sing N N 484 
TYR C     O      doub N N 485 
TYR C     OXT    sing N N 486 
TYR CB    CG     sing N N 487 
TYR CB    HB2    sing N N 488 
TYR CB    HB3    sing N N 489 
TYR CG    CD1    doub Y N 490 
TYR CG    CD2    sing Y N 491 
TYR CD1   CE1    sing Y N 492 
TYR CD1   HD1    sing N N 493 
TYR CD2   CE2    doub Y N 494 
TYR CD2   HD2    sing N N 495 
TYR CE1   CZ     doub Y N 496 
TYR CE1   HE1    sing N N 497 
TYR CE2   CZ     sing Y N 498 
TYR CE2   HE2    sing N N 499 
TYR CZ    OH     sing N N 500 
TYR OH    HH     sing N N 501 
TYR OXT   HXT    sing N N 502 
VAL N     CA     sing N N 503 
VAL N     H      sing N N 504 
VAL N     H2     sing N N 505 
VAL CA    C      sing N N 506 
VAL CA    CB     sing N N 507 
VAL CA    HA     sing N N 508 
VAL C     O      doub N N 509 
VAL C     OXT    sing N N 510 
VAL CB    CG1    sing N N 511 
VAL CB    CG2    sing N N 512 
VAL CB    HB     sing N N 513 
VAL CG1   HG11   sing N N 514 
VAL CG1   HG12   sing N N 515 
VAL CG1   HG13   sing N N 516 
VAL CG2   HG21   sing N N 517 
VAL CG2   HG22   sing N N 518 
VAL CG2   HG23   sing N N 519 
VAL OXT   HXT    sing N N 520 
# 
_pdbx_audit_support.funding_organization   'Medical Research Council (United Kingdom)' 
_pdbx_audit_support.country                'United Kingdom' 
_pdbx_audit_support.grant_number           MC_U105674180 
_pdbx_audit_support.ordinal                1 
# 
_pdbx_entity_instance_feature.ordinal        1 
_pdbx_entity_instance_feature.comp_id        NAI 
_pdbx_entity_instance_feature.asym_id        ? 
_pdbx_entity_instance_feature.seq_num        ? 
_pdbx_entity_instance_feature.auth_comp_id   NAI 
_pdbx_entity_instance_feature.auth_asym_id   ? 
_pdbx_entity_instance_feature.auth_seq_num   ? 
_pdbx_entity_instance_feature.feature_type   'SUBJECT OF INVESTIGATION' 
_pdbx_entity_instance_feature.details        ? 
# 
_pdbx_initial_refinement_model.id               1 
_pdbx_initial_refinement_model.entity_id_list   ? 
_pdbx_initial_refinement_model.type             'experimental model' 
_pdbx_initial_refinement_model.source_name      PDB 
_pdbx_initial_refinement_model.accession_code   4HEA 
_pdbx_initial_refinement_model.details          ? 
# 
_pdbx_reflns_twin.domain_id    1 
_pdbx_reflns_twin.crystal_id   1 
_pdbx_reflns_twin.diffrn_id    1 
_pdbx_reflns_twin.type         ? 
_pdbx_reflns_twin.operator     -H,-K,H+L 
_pdbx_reflns_twin.fraction     0.470 
# 
_atom_sites.entry_id                    6I1P 
_atom_sites.fract_transf_matrix[1][1]   0.010405 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001932 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.002929 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003854 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
FE 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . THR A  1  2   ? 29.721  0.317    151.372  1.00 221.22 ? 2   THR 1 N     1 
ATOM   2     C  CA    . THR A  1  2   ? 30.076  0.627    149.993  1.00 221.27 ? 2   THR 1 CA    1 
ATOM   3     C  C     . THR A  1  2   ? 29.172  -0.139   149.028  1.00 223.32 ? 2   THR 1 C     1 
ATOM   4     O  O     . THR A  1  2   ? 28.775  -1.272   149.304  1.00 222.91 ? 2   THR 1 O     1 
ATOM   5     C  CB    . THR A  1  2   ? 31.552  0.283    149.700  1.00 219.42 ? 2   THR 1 CB    1 
ATOM   6     O  OG1   . THR A  1  2   ? 32.369  0.673    150.812  1.00 218.55 ? 2   THR 1 OG1   1 
ATOM   7     C  CG2   . THR A  1  2   ? 32.035  1.008    148.453  1.00 218.95 ? 2   THR 1 CG2   1 
ATOM   8     N  N     . GLY A  1  3   ? 28.853  0.486    147.895  1.00 225.64 ? 3   GLY 1 N     1 
ATOM   9     C  CA    . GLY A  1  3   ? 28.049  -0.142   146.872  1.00 227.25 ? 3   GLY 1 CA    1 
ATOM   10    C  C     . GLY A  1  3   ? 28.685  -1.417   146.358  1.00 228.29 ? 3   GLY 1 C     1 
ATOM   11    O  O     . GLY A  1  3   ? 29.892  -1.471   146.097  1.00 228.99 ? 3   GLY 1 O     1 
ATOM   12    N  N     . PRO A  1  4   ? 27.884  -2.480   146.215  1.00 228.16 ? 4   PRO 1 N     1 
ATOM   13    C  CA    . PRO A  1  4   ? 28.469  -3.795   145.921  1.00 227.29 ? 4   PRO 1 CA    1 
ATOM   14    C  C     . PRO A  1  4   ? 29.007  -3.914   144.503  1.00 224.45 ? 4   PRO 1 C     1 
ATOM   15    O  O     . PRO A  1  4   ? 28.240  -4.169   143.570  1.00 225.26 ? 4   PRO 1 O     1 
ATOM   16    C  CB    . PRO A  1  4   ? 27.288  -4.754   146.148  1.00 228.32 ? 4   PRO 1 CB    1 
ATOM   17    C  CG    . PRO A  1  4   ? 26.342  -3.988   147.038  1.00 228.83 ? 4   PRO 1 CG    1 
ATOM   18    C  CD    . PRO A  1  4   ? 26.454  -2.581   146.543  1.00 228.67 ? 4   PRO 1 CD    1 
ATOM   19    N  N     . ILE A  1  5   ? 30.328  -3.786   144.353  1.00 220.13 ? 5   ILE 1 N     1 
ATOM   20    C  CA    . ILE A  1  5   ? 31.054  -3.958   143.094  1.00 215.03 ? 5   ILE 1 CA    1 
ATOM   21    C  C     . ILE A  1  5   ? 32.510  -4.233   143.457  1.00 208.89 ? 5   ILE 1 C     1 
ATOM   22    O  O     . ILE A  1  5   ? 33.100  -3.512   144.270  1.00 210.41 ? 5   ILE 1 O     1 
ATOM   23    C  CB    . ILE A  1  5   ? 30.933  -2.723   142.176  1.00 216.32 ? 5   ILE 1 CB    1 
ATOM   24    C  CG1   . ILE A  1  5   ? 29.622  -2.739   141.378  1.00 216.59 ? 5   ILE 1 CG1   1 
ATOM   25    C  CG2   . ILE A  1  5   ? 32.120  -2.630   141.227  1.00 217.18 ? 5   ILE 1 CG2   1 
ATOM   26    C  CD1   . ILE A  1  5   ? 29.580  -1.757   140.220  1.00 217.00 ? 5   ILE 1 CD1   1 
ATOM   27    N  N     . LEU A  1  6   ? 33.102  -5.275   142.874  1.00 201.49 ? 6   LEU 1 N     1 
ATOM   28    C  CA    . LEU A  1  6   ? 34.474  -5.672   143.181  1.00 195.30 ? 6   LEU 1 CA    1 
ATOM   29    C  C     . LEU A  1  6   ? 35.393  -5.310   142.020  1.00 187.42 ? 6   LEU 1 C     1 
ATOM   30    O  O     . LEU A  1  6   ? 35.291  -5.886   140.931  1.00 186.26 ? 6   LEU 1 O     1 
ATOM   31    C  CB    . LEU A  1  6   ? 34.540  -7.159   143.514  1.00 196.94 ? 6   LEU 1 CB    1 
ATOM   32    C  CG    . LEU A  1  6   ? 33.856  -7.404   144.863  1.00 197.78 ? 6   LEU 1 CG    1 
ATOM   33    C  CD1   . LEU A  1  6   ? 33.728  -8.874   145.206  1.00 197.80 ? 6   LEU 1 CD1   1 
ATOM   34    C  CD2   . LEU A  1  6   ? 34.606  -6.657   145.957  1.00 197.98 ? 6   LEU 1 CD2   1 
ATOM   35    N  N     . SER A  1  7   ? 36.296  -4.352   142.262  1.00 180.77 ? 7   SER 1 N     1 
ATOM   36    C  CA    . SER A  1  7   ? 37.246  -3.893   141.256  1.00 173.54 ? 7   SER 1 CA    1 
ATOM   37    C  C     . SER A  1  7   ? 38.664  -3.733   141.796  1.00 165.56 ? 7   SER 1 C     1 
ATOM   38    O  O     . SER A  1  7   ? 39.490  -3.092   141.137  1.00 164.43 ? 7   SER 1 O     1 
ATOM   39    C  CB    . SER A  1  7   ? 36.780  -2.561   140.650  1.00 173.73 ? 7   SER 1 CB    1 
ATOM   40    O  OG    . SER A  1  7   ? 35.446  -2.643   140.181  1.00 173.95 ? 7   SER 1 OG    1 
ATOM   41    N  N     . GLY A  1  8   ? 38.973  -4.288   142.967  1.00 159.12 ? 8   GLY 1 N     1 
ATOM   42    C  CA    . GLY A  1  8   ? 40.297  -4.104   143.530  1.00 153.45 ? 8   GLY 1 CA    1 
ATOM   43    C  C     . GLY A  1  8   ? 40.502  -4.692   144.911  1.00 148.93 ? 8   GLY 1 C     1 
ATOM   44    O  O     . GLY A  1  8   ? 40.139  -5.843   145.169  1.00 148.57 ? 8   GLY 1 O     1 
ATOM   45    N  N     . LEU A  1  9   ? 41.082  -3.898   145.813  1.00 144.93 ? 9   LEU 1 N     1 
ATOM   46    C  CA    . LEU A  1  9   ? 41.482  -4.350   147.141  1.00 140.40 ? 9   LEU 1 CA    1 
ATOM   47    C  C     . LEU A  1  9   ? 40.388  -4.155   148.189  1.00 139.47 ? 9   LEU 1 C     1 
ATOM   48    O  O     . LEU A  1  9   ? 40.693  -3.940   149.370  1.00 138.49 ? 9   LEU 1 O     1 
ATOM   49    C  CB    . LEU A  1  9   ? 42.774  -3.640   147.558  1.00 136.09 ? 9   LEU 1 CB    1 
ATOM   50    C  CG    . LEU A  1  9   ? 43.620  -4.242   148.685  1.00 133.51 ? 9   LEU 1 CG    1 
ATOM   51    C  CD1   . LEU A  1  9   ? 43.585  -5.763   148.636  1.00 133.20 ? 9   LEU 1 CD1   1 
ATOM   52    C  CD2   . LEU A  1  9   ? 45.052  -3.727   148.627  1.00 132.69 ? 9   LEU 1 CD2   1 
ATOM   53    N  N     . ASP A  1  10  ? 39.121  -4.193   147.788  1.00 139.23 ? 10  ASP 1 N     1 
ATOM   54    C  CA    . ASP A  1  10  ? 38.038  -4.063   148.752  1.00 138.31 ? 10  ASP 1 CA    1 
ATOM   55    C  C     . ASP A  1  10  ? 38.101  -5.212   149.760  1.00 138.52 ? 10  ASP 1 C     1 
ATOM   56    O  O     . ASP A  1  10  ? 38.321  -6.367   149.374  1.00 138.69 ? 10  ASP 1 O     1 
ATOM   57    C  CB    . ASP A  1  10  ? 36.686  -4.046   148.036  1.00 138.04 ? 10  ASP 1 CB    1 
ATOM   58    C  CG    . ASP A  1  10  ? 35.660  -3.183   148.750  1.00 139.01 ? 10  ASP 1 CG    1 
ATOM   59    O  OD1   . ASP A  1  10  ? 36.009  -2.048   149.131  1.00 139.47 ? 10  ASP 1 OD1   1 
ATOM   60    O  OD2   . ASP A  1  10  ? 34.506  -3.626   148.922  1.00 139.65 ? 10  ASP 1 OD2   1 
ATOM   61    N  N     . PRO A  1  11  ? 37.911  -4.934   151.054  1.00 137.80 ? 11  PRO 1 N     1 
ATOM   62    C  CA    . PRO A  1  11  ? 38.234  -5.934   152.089  1.00 136.47 ? 11  PRO 1 CA    1 
ATOM   63    C  C     . PRO A  1  11  ? 37.352  -7.175   152.093  1.00 132.47 ? 11  PRO 1 C     1 
ATOM   64    O  O     . PRO A  1  11  ? 37.646  -8.107   152.853  1.00 130.28 ? 11  PRO 1 O     1 
ATOM   65    C  CB    . PRO A  1  11  ? 38.078  -5.145   153.395  1.00 137.54 ? 11  PRO 1 CB    1 
ATOM   66    C  CG    . PRO A  1  11  ? 37.147  -4.021   153.052  1.00 137.34 ? 11  PRO 1 CG    1 
ATOM   67    C  CD    . PRO A  1  11  ? 37.429  -3.665   151.627  1.00 137.18 ? 11  PRO 1 CD    1 
ATOM   68    N  N     . ARG A  1  12  ? 36.310  -7.233   151.270  1.00 131.28 ? 12  ARG 1 N     1 
ATOM   69    C  CA    . ARG A  1  12  ? 35.396  -8.367   151.228  1.00 130.63 ? 12  ARG 1 CA    1 
ATOM   70    C  C     . ARG A  1  12  ? 35.864  -9.476   150.291  1.00 128.26 ? 12  ARG 1 C     1 
ATOM   71    O  O     . ARG A  1  12  ? 35.086  -10.393  149.997  1.00 127.30 ? 12  ARG 1 O     1 
ATOM   72    C  CB    . ARG A  1  12  ? 34.000  -7.889   150.828  1.00 131.65 ? 12  ARG 1 CB    1 
ATOM   73    C  CG    . ARG A  1  12  ? 34.029  -6.618   150.003  1.00 134.01 ? 12  ARG 1 CG    1 
ATOM   74    C  CD    . ARG A  1  12  ? 32.642  -6.141   149.618  1.00 137.06 ? 12  ARG 1 CD    1 
ATOM   75    N  NE    . ARG A  1  12  ? 32.709  -5.031   148.670  1.00 139.65 ? 12  ARG 1 NE    1 
ATOM   76    C  CZ    . ARG A  1  12  ? 31.667  -4.565   147.991  1.00 140.49 ? 12  ARG 1 CZ    1 
ATOM   77    N  NH1   . ARG A  1  12  ? 30.472  -5.111   148.151  1.00 141.01 ? 12  ARG 1 NH1   1 
ATOM   78    N  NH2   . ARG A  1  12  ? 31.820  -3.547   147.156  1.00 140.06 ? 12  ARG 1 NH2   1 
ATOM   79    N  N     . PHE A  1  13  ? 37.103  -9.411   149.809  1.00 125.31 ? 13  PHE 1 N     1 
ATOM   80    C  CA    . PHE A  1  13  ? 37.613  -10.410  148.880  1.00 121.76 ? 13  PHE 1 CA    1 
ATOM   81    C  C     . PHE A  1  13  ? 38.091  -11.658  149.620  1.00 118.72 ? 13  PHE 1 C     1 
ATOM   82    O  O     . PHE A  1  13  ? 38.739  -11.570  150.669  1.00 119.47 ? 13  PHE 1 O     1 
ATOM   83    C  CB    . PHE A  1  13  ? 38.752  -9.822   148.043  1.00 121.44 ? 13  PHE 1 CB    1 
ATOM   84    C  CG    . PHE A  1  13  ? 39.402  -10.817  147.122  1.00 121.94 ? 13  PHE 1 CG    1 
ATOM   85    C  CD1   . PHE A  1  13  ? 38.692  -11.382  146.076  1.00 121.53 ? 13  PHE 1 CD1   1 
ATOM   86    C  CD2   . PHE A  1  13  ? 40.720  -11.188  147.300  1.00 122.70 ? 13  PHE 1 CD2   1 
ATOM   87    C  CE1   . PHE A  1  13  ? 39.286  -12.301  145.232  1.00 120.87 ? 13  PHE 1 CE1   1 
ATOM   88    C  CE2   . PHE A  1  13  ? 41.313  -12.105  146.454  1.00 122.08 ? 13  PHE 1 CE2   1 
ATOM   89    C  CZ    . PHE A  1  13  ? 40.593  -12.661  145.423  1.00 120.92 ? 13  PHE 1 CZ    1 
ATOM   90    N  N     . GLU A  1  14  ? 37.762  -12.825  149.064  1.00 114.22 ? 14  GLU 1 N     1 
ATOM   91    C  CA    . GLU A  1  14  ? 38.053  -14.117  149.673  1.00 108.66 ? 14  GLU 1 CA    1 
ATOM   92    C  C     . GLU A  1  14  ? 38.918  -14.950  148.736  1.00 105.21 ? 14  GLU 1 C     1 
ATOM   93    O  O     . GLU A  1  14  ? 38.460  -15.362  147.663  1.00 101.71 ? 14  GLU 1 O     1 
ATOM   94    C  CB    . GLU A  1  14  ? 36.762  -14.860  150.014  1.00 107.13 ? 14  GLU 1 CB    1 
ATOM   95    C  CG    . GLU A  1  14  ? 36.115  -14.373  151.300  1.00 107.08 ? 14  GLU 1 CG    1 
ATOM   96    C  CD    . GLU A  1  14  ? 34.921  -15.204  151.705  1.00 106.70 ? 14  GLU 1 CD    1 
ATOM   97    O  OE1   . GLU A  1  14  ? 33.902  -15.173  150.989  1.00 106.45 ? 14  GLU 1 OE1   1 
ATOM   98    O  OE2   . GLU A  1  14  ? 34.998  -15.886  152.749  1.00 106.52 ? 14  GLU 1 OE2   1 
ATOM   99    N  N     . ARG A  1  15  ? 40.150  -15.229  149.162  1.00 105.69 ? 15  ARG 1 N     1 
ATOM   100   C  CA    . ARG A  1  15  ? 41.059  -16.084  148.404  1.00 104.06 ? 15  ARG 1 CA    1 
ATOM   101   C  C     . ARG A  1  15  ? 40.560  -17.525  148.444  1.00 103.22 ? 15  ARG 1 C     1 
ATOM   102   O  O     . ARG A  1  15  ? 40.327  -18.077  149.525  1.00 100.23 ? 15  ARG 1 O     1 
ATOM   103   C  CB    . ARG A  1  15  ? 42.468  -16.007  148.998  1.00 102.66 ? 15  ARG 1 CB    1 
ATOM   104   C  CG    . ARG A  1  15  ? 42.873  -14.648  149.556  1.00 101.42 ? 15  ARG 1 CG    1 
ATOM   105   C  CD    . ARG A  1  15  ? 43.468  -13.727  148.512  1.00 101.60 ? 15  ARG 1 CD    1 
ATOM   106   N  NE    . ARG A  1  15  ? 43.323  -12.330  148.914  1.00 104.57 ? 15  ARG 1 NE    1 
ATOM   107   C  CZ    . ARG A  1  15  ? 44.143  -11.348  148.548  1.00 106.42 ? 15  ARG 1 CZ    1 
ATOM   108   N  NH1   . ARG A  1  15  ? 45.188  -11.600  147.771  1.00 107.10 ? 15  ARG 1 NH1   1 
ATOM   109   N  NH2   . ARG A  1  15  ? 43.917  -10.109  148.965  1.00 106.11 ? 15  ARG 1 NH2   1 
ATOM   110   N  N     . THR A  1  16  ? 40.388  -18.134  147.274  1.00 105.65 ? 16  THR 1 N     1 
ATOM   111   C  CA    . THR A  1  16  ? 39.877  -19.499  147.203  1.00 106.90 ? 16  THR 1 CA    1 
ATOM   112   C  C     . THR A  1  16  ? 40.851  -20.476  146.566  1.00 103.75 ? 16  THR 1 C     1 
ATOM   113   O  O     . THR A  1  16  ? 41.129  -21.533  147.146  1.00 101.75 ? 16  THR 1 O     1 
ATOM   114   C  CB    . THR A  1  16  ? 38.554  -19.524  146.420  1.00 108.56 ? 16  THR 1 CB    1 
ATOM   115   O  OG1   . THR A  1  16  ? 37.653  -18.553  146.967  1.00 109.13 ? 16  THR 1 OG1   1 
ATOM   116   C  CG2   . THR A  1  16  ? 37.930  -20.906  146.501  1.00 109.11 ? 16  THR 1 CG2   1 
ATOM   117   N  N     . LEU A  1  17  ? 41.381  -20.154  145.385  1.00 101.77 ? 17  LEU 1 N     1 
ATOM   118   C  CA    . LEU A  1  17  ? 42.225  -21.089  144.647  1.00 98.51  ? 17  LEU 1 CA    1 
ATOM   119   C  C     . LEU A  1  17  ? 43.661  -21.066  145.158  1.00 96.53  ? 17  LEU 1 C     1 
ATOM   120   O  O     . LEU A  1  17  ? 44.183  -22.085  145.624  1.00 99.56  ? 17  LEU 1 O     1 
ATOM   121   C  CB    . LEU A  1  17  ? 42.192  -20.760  143.153  1.00 99.91  ? 17  LEU 1 CB    1 
ATOM   122   C  CG    . LEU A  1  17  ? 40.824  -20.739  142.467  1.00 101.67 ? 17  LEU 1 CG    1 
ATOM   123   C  CD1   . LEU A  1  17  ? 40.971  -20.587  140.958  1.00 101.05 ? 17  LEU 1 CD1   1 
ATOM   124   C  CD2   . LEU A  1  17  ? 40.026  -21.983  142.817  1.00 102.28 ? 17  LEU 1 CD2   1 
ATOM   125   N  N     . TYR A  1  18  ? 44.315  -19.907  145.070  1.00 92.33  ? 18  TYR 1 N     1 
ATOM   126   C  CA    . TYR A  1  18  ? 45.719  -19.745  145.436  1.00 92.25  ? 18  TYR 1 CA    1 
ATOM   127   C  C     . TYR A  1  18  ? 45.949  -19.631  146.944  1.00 91.30  ? 18  TYR 1 C     1 
ATOM   128   O  O     . TYR A  1  18  ? 47.042  -19.225  147.356  1.00 91.50  ? 18  TYR 1 O     1 
ATOM   129   C  CB    . TYR A  1  18  ? 46.313  -18.518  144.734  1.00 94.80  ? 18  TYR 1 CB    1 
ATOM   130   C  CG    . TYR A  1  18  ? 47.278  -18.849  143.607  1.00 98.00  ? 18  TYR 1 CG    1 
ATOM   131   C  CD1   . TYR A  1  18  ? 46.831  -19.368  142.402  1.00 97.41  ? 18  TYR 1 CD1   1 
ATOM   132   C  CD2   . TYR A  1  18  ? 48.647  -18.675  143.765  1.00 99.31  ? 18  TYR 1 CD2   1 
ATOM   133   C  CE1   . TYR A  1  18  ? 47.721  -19.679  141.378  1.00 96.12  ? 18  TYR 1 CE1   1 
ATOM   134   C  CE2   . TYR A  1  18  ? 49.539  -18.988  142.749  1.00 98.00  ? 18  TYR 1 CE2   1 
ATOM   135   C  CZ    . TYR A  1  18  ? 49.071  -19.490  141.562  1.00 97.46  ? 18  TYR 1 CZ    1 
ATOM   136   O  OH    . TYR A  1  18  ? 49.964  -19.796  140.561  1.00 97.94  ? 18  TYR 1 OH    1 
ATOM   137   N  N     . ALA A  1  19  ? 44.952  -19.953  147.771  1.00 90.66  ? 19  ALA 1 N     1 
ATOM   138   C  CA    . ALA A  1  19  ? 45.125  -19.865  149.217  1.00 90.72  ? 19  ALA 1 CA    1 
ATOM   139   C  C     . ALA A  1  19  ? 46.221  -20.809  149.706  1.00 92.07  ? 19  ALA 1 C     1 
ATOM   140   O  O     . ALA A  1  19  ? 47.228  -20.373  150.276  1.00 90.84  ? 19  ALA 1 O     1 
ATOM   141   C  CB    . ALA A  1  19  ? 43.799  -20.171  149.913  1.00 90.87  ? 19  ALA 1 CB    1 
ATOM   142   N  N     . HIS A  1  20  ? 46.004  -22.104  149.498  1.00 94.64  ? 20  HIS 1 N     1 
ATOM   143   C  CA    . HIS A  1  20  ? 46.929  -23.138  149.959  1.00 97.74  ? 20  HIS 1 CA    1 
ATOM   144   C  C     . HIS A  1  20  ? 48.176  -23.370  149.107  1.00 92.52  ? 20  HIS 1 C     1 
ATOM   145   O  O     . HIS A  1  20  ? 48.809  -24.420  149.218  1.00 89.83  ? 20  HIS 1 O     1 
ATOM   146   C  CB    . HIS A  1  20  ? 46.183  -24.464  150.146  1.00 103.43 ? 20  HIS 1 CB    1 
ATOM   147   C  CG    . HIS A  1  20  ? 45.035  -24.383  151.103  1.00 110.57 ? 20  HIS 1 CG    1 
ATOM   148   N  ND1   . HIS A  1  20  ? 43.842  -25.041  150.891  1.00 110.97 ? 20  HIS 1 ND1   1 
ATOM   149   C  CD2   . HIS A  1  20  ? 44.897  -23.722  152.276  1.00 110.93 ? 20  HIS 1 CD2   1 
ATOM   150   C  CE1   . HIS A  1  20  ? 43.019  -24.788  151.893  1.00 112.47 ? 20  HIS 1 CE1   1 
ATOM   151   N  NE2   . HIS A  1  20  ? 43.634  -23.991  152.747  1.00 111.05 ? 20  HIS 1 NE2   1 
ATOM   152   N  N     . VAL A  1  21  ? 48.537  -22.410  148.263  1.00 91.95  ? 21  VAL 1 N     1 
ATOM   153   C  CA    . VAL A  1  21  ? 49.732  -22.580  147.447  1.00 95.32  ? 21  VAL 1 CA    1 
ATOM   154   C  C     . VAL A  1  21  ? 50.962  -22.300  148.296  1.00 98.76  ? 21  VAL 1 C     1 
ATOM   155   O  O     . VAL A  1  21  ? 51.079  -21.237  148.920  1.00 100.87 ? 21  VAL 1 O     1 
ATOM   156   C  CB    . VAL A  1  21  ? 49.687  -21.658  146.219  1.00 95.99  ? 21  VAL 1 CB    1 
ATOM   157   C  CG1   . VAL A  1  21  ? 51.078  -21.533  145.594  1.00 94.83  ? 21  VAL 1 CG1   1 
ATOM   158   C  CG2   . VAL A  1  21  ? 48.678  -22.174  145.199  1.00 96.18  ? 21  VAL 1 CG2   1 
ATOM   159   N  N     . GLY A  1  22  ? 51.879  -23.263  148.337  1.00 99.41  ? 22  GLY 1 N     1 
ATOM   160   C  CA    . GLY A  1  22  ? 53.118  -23.115  149.053  1.00 101.22 ? 22  GLY 1 CA    1 
ATOM   161   C  C     . GLY A  1  22  ? 53.089  -23.654  150.467  1.00 103.69 ? 22  GLY 1 C     1 
ATOM   162   O  O     . GLY A  1  22  ? 54.140  -24.026  150.997  1.00 102.58 ? 22  GLY 1 O     1 
ATOM   163   N  N     . LYS A  1  23  ? 51.912  -23.702  151.091  1.00 107.66 ? 23  LYS 1 N     1 
ATOM   164   C  CA    . LYS A  1  23  ? 51.819  -24.196  152.458  1.00 110.62 ? 23  LYS 1 CA    1 
ATOM   165   C  C     . LYS A  1  23  ? 52.270  -25.646  152.509  1.00 112.82 ? 23  LYS 1 C     1 
ATOM   166   O  O     . LYS A  1  23  ? 51.767  -26.492  151.766  1.00 111.01 ? 23  LYS 1 O     1 
ATOM   167   C  CB    . LYS A  1  23  ? 50.388  -24.056  152.981  1.00 110.96 ? 23  LYS 1 CB    1 
ATOM   168   C  CG    . LYS A  1  23  ? 49.808  -22.657  152.836  1.00 111.83 ? 23  LYS 1 CG    1 
ATOM   169   C  CD    . LYS A  1  23  ? 50.748  -21.615  153.418  1.00 111.64 ? 23  LYS 1 CD    1 
ATOM   170   C  CE    . LYS A  1  23  ? 50.053  -20.278  153.611  1.00 110.10 ? 23  LYS 1 CE    1 
ATOM   171   N  NZ    . LYS A  1  23  ? 50.751  -19.418  154.612  1.00 107.84 ? 23  LYS 1 NZ    1 
ATOM   172   N  N     . GLU A  1  24  ? 53.228  -25.920  153.390  1.00 114.86 ? 24  GLU 1 N     1 
ATOM   173   C  CA    . GLU A  1  24  ? 53.915  -27.203  153.393  1.00 112.38 ? 24  GLU 1 CA    1 
ATOM   174   C  C     . GLU A  1  24  ? 52.921  -28.332  153.637  1.00 103.30 ? 24  GLU 1 C     1 
ATOM   175   O  O     . GLU A  1  24  ? 52.103  -28.268  154.560  1.00 105.57 ? 24  GLU 1 O     1 
ATOM   176   C  CB    . GLU A  1  24  ? 55.010  -27.188  154.466  1.00 115.94 ? 24  GLU 1 CB    1 
ATOM   177   C  CG    . GLU A  1  24  ? 55.953  -28.383  154.473  1.00 118.76 ? 24  GLU 1 CG    1 
ATOM   178   C  CD    . GLU A  1  24  ? 56.849  -28.410  155.705  1.00 119.77 ? 24  GLU 1 CD    1 
ATOM   179   O  OE1   . GLU A  1  24  ? 56.481  -27.784  156.721  1.00 120.10 ? 24  GLU 1 OE1   1 
ATOM   180   O  OE2   . GLU A  1  24  ? 57.923  -29.046  155.657  1.00 119.61 ? 24  GLU 1 OE2   1 
ATOM   181   N  N     . GLY A  1  25  ? 52.993  -29.364  152.802  1.00 92.60  ? 25  GLY 1 N     1 
ATOM   182   C  CA    . GLY A  1  25  ? 52.048  -30.454  152.892  1.00 87.35  ? 25  GLY 1 CA    1 
ATOM   183   C  C     . GLY A  1  25  ? 50.676  -30.169  152.325  1.00 83.95  ? 25  GLY 1 C     1 
ATOM   184   O  O     . GLY A  1  25  ? 49.732  -30.901  152.636  1.00 82.87  ? 25  GLY 1 O     1 
ATOM   185   N  N     . SER A  1  26  ? 50.525  -29.118  151.509  1.00 80.85  ? 26  SER 1 N     1 
ATOM   186   C  CA    . SER A  1  26  ? 49.220  -28.822  150.922  1.00 76.72  ? 26  SER 1 CA    1 
ATOM   187   C  C     . SER A  1  26  ? 48.814  -29.836  149.863  1.00 72.99  ? 26  SER 1 C     1 
ATOM   188   O  O     . SER A  1  26  ? 47.624  -29.924  149.544  1.00 72.06  ? 26  SER 1 O     1 
ATOM   189   C  CB    . SER A  1  26  ? 49.194  -27.410  150.318  1.00 76.69  ? 26  SER 1 CB    1 
ATOM   190   O  OG    . SER A  1  26  ? 50.370  -27.118  149.583  1.00 76.61  ? 26  SER 1 OG    1 
ATOM   191   N  N     . TRP A  1  27  ? 49.767  -30.602  149.324  1.00 71.29  ? 27  TRP 1 N     1 
ATOM   192   C  CA    . TRP A  1  27  ? 49.506  -31.644  148.335  1.00 70.96  ? 27  TRP 1 CA    1 
ATOM   193   C  C     . TRP A  1  27  ? 49.114  -32.968  148.966  1.00 69.67  ? 27  TRP 1 C     1 
ATOM   194   O  O     . TRP A  1  27  ? 48.865  -33.937  148.244  1.00 63.65  ? 27  TRP 1 O     1 
ATOM   195   C  CB    . TRP A  1  27  ? 50.736  -31.855  147.439  1.00 71.79  ? 27  TRP 1 CB    1 
ATOM   196   C  CG    . TRP A  1  27  ? 51.992  -32.155  148.204  1.00 72.36  ? 27  TRP 1 CG    1 
ATOM   197   C  CD1   . TRP A  1  27  ? 52.447  -33.380  148.593  1.00 71.47  ? 27  TRP 1 CD1   1 
ATOM   198   C  CD2   . TRP A  1  27  ? 52.943  -31.200  148.698  1.00 72.01  ? 27  TRP 1 CD2   1 
ATOM   199   N  NE1   . TRP A  1  27  ? 53.627  -33.249  149.287  1.00 70.55  ? 27  TRP 1 NE1   1 
ATOM   200   C  CE2   . TRP A  1  27  ? 53.950  -31.920  149.366  1.00 71.32  ? 27  TRP 1 CE2   1 
ATOM   201   C  CE3   . TRP A  1  27  ? 53.041  -29.806  148.636  1.00 69.17  ? 27  TRP 1 CE3   1 
ATOM   202   C  CZ2   . TRP A  1  27  ? 55.038  -31.293  149.967  1.00 69.74  ? 27  TRP 1 CZ2   1 
ATOM   203   C  CZ3   . TRP A  1  27  ? 54.124  -29.191  149.232  1.00 67.37  ? 27  TRP 1 CZ3   1 
ATOM   204   C  CH2   . TRP A  1  27  ? 55.106  -29.930  149.890  1.00 67.59  ? 27  TRP 1 CH2   1 
ATOM   205   N  N     . THR A  1  28  ? 49.078  -33.042  150.286  1.00 77.30  ? 28  THR 1 N     1 
ATOM   206   C  CA    . THR A  1  28  ? 48.536  -34.218  150.932  1.00 86.02  ? 28  THR 1 CA    1 
ATOM   207   C  C     . THR A  1  28  ? 47.022  -34.148  150.847  1.00 91.73  ? 28  THR 1 C     1 
ATOM   208   O  O     . THR A  1  28  ? 46.422  -33.090  151.058  1.00 92.58  ? 28  THR 1 O     1 
ATOM   209   C  CB    . THR A  1  28  ? 48.969  -34.302  152.399  1.00 88.98  ? 28  THR 1 CB    1 
ATOM   210   O  OG1   . THR A  1  28  ? 48.576  -33.109  153.089  1.00 90.66  ? 28  THR 1 OG1   1 
ATOM   211   C  CG2   . THR A  1  28  ? 50.475  -34.472  152.515  1.00 88.68  ? 28  THR 1 CG2   1 
ATOM   212   N  N     . LEU A  1  29  ? 46.408  -35.278  150.506  1.00 94.84  ? 29  LEU 1 N     1 
ATOM   213   C  CA    . LEU A  1  29  ? 44.956  -35.355  150.547  1.00 95.60  ? 29  LEU 1 CA    1 
ATOM   214   C  C     . LEU A  1  29  ? 44.433  -34.960  151.920  1.00 96.72  ? 29  LEU 1 C     1 
ATOM   215   O  O     . LEU A  1  29  ? 43.338  -34.400  152.036  1.00 94.87  ? 29  LEU 1 O     1 
ATOM   216   C  CB    . LEU A  1  29  ? 44.509  -36.767  150.163  1.00 94.03  ? 29  LEU 1 CB    1 
ATOM   217   C  CG    . LEU A  1  29  ? 43.033  -37.083  150.363  1.00 94.79  ? 29  LEU 1 CG    1 
ATOM   218   C  CD1   . LEU A  1  29  ? 42.180  -36.108  149.593  1.00 97.48  ? 29  LEU 1 CD1   1 
ATOM   219   C  CD2   . LEU A  1  29  ? 42.749  -38.507  149.932  1.00 92.80  ? 29  LEU 1 CD2   1 
ATOM   220   N  N     . ASP A  1  30  ? 45.220  -35.220  152.963  1.00 100.29 ? 30  ASP 1 N     1 
ATOM   221   C  CA    . ASP A  1  30  ? 44.806  -34.889  154.319  1.00 104.02 ? 30  ASP 1 CA    1 
ATOM   222   C  C     . ASP A  1  30  ? 44.701  -33.381  154.511  1.00 101.95 ? 30  ASP 1 C     1 
ATOM   223   O  O     . ASP A  1  30  ? 43.792  -32.901  155.199  1.00 103.88 ? 30  ASP 1 O     1 
ATOM   224   C  CB    . ASP A  1  30  ? 45.787  -35.508  155.316  1.00 109.24 ? 30  ASP 1 CB    1 
ATOM   225   C  CG    . ASP A  1  30  ? 45.910  -37.021  155.150  1.00 112.54 ? 30  ASP 1 CG    1 
ATOM   226   O  OD1   . ASP A  1  30  ? 46.459  -37.481  154.126  1.00 113.01 ? 30  ASP 1 OD1   1 
ATOM   227   O  OD2   . ASP A  1  30  ? 45.447  -37.758  156.043  1.00 113.80 ? 30  ASP 1 OD2   1 
ATOM   228   N  N     . TYR A  1  31  ? 45.613  -32.620  153.902  1.00 96.95  ? 31  TYR 1 N     1 
ATOM   229   C  CA    . TYR A  1  31  ? 45.517  -31.163  153.949  1.00 92.60  ? 31  TYR 1 CA    1 
ATOM   230   C  C     . TYR A  1  31  ? 44.221  -30.681  153.313  1.00 94.99  ? 31  TYR 1 C     1 
ATOM   231   O  O     . TYR A  1  31  ? 43.485  -29.879  153.901  1.00 92.27  ? 31  TYR 1 O     1 
ATOM   232   C  CB    . TYR A  1  31  ? 46.715  -30.538  153.239  1.00 85.14  ? 31  TYR 1 CB    1 
ATOM   233   C  CG    . TYR A  1  31  ? 46.797  -29.044  153.400  1.00 81.63  ? 31  TYR 1 CG    1 
ATOM   234   C  CD1   . TYR A  1  31  ? 45.976  -28.194  152.677  1.00 81.37  ? 31  TYR 1 CD1   1 
ATOM   235   C  CD2   . TYR A  1  31  ? 47.696  -28.478  154.274  1.00 82.91  ? 31  TYR 1 CD2   1 
ATOM   236   C  CE1   . TYR A  1  31  ? 46.049  -26.819  152.840  1.00 81.29  ? 31  TYR 1 CE1   1 
ATOM   237   C  CE2   . TYR A  1  31  ? 47.779  -27.105  154.437  1.00 83.68  ? 31  TYR 1 CE2   1 
ATOM   238   C  CZ    . TYR A  1  31  ? 46.957  -26.280  153.719  1.00 80.01  ? 31  TYR 1 CZ    1 
ATOM   239   O  OH    . TYR A  1  31  ? 47.057  -24.920  153.898  1.00 73.73  ? 31  TYR 1 OH    1 
ATOM   240   N  N     . TYR A  1  32  ? 43.954  -31.133  152.087  1.00 98.43  ? 32  TYR 1 N     1 
ATOM   241   C  CA    . TYR A  1  32  ? 42.743  -30.731  151.383  1.00 97.59  ? 32  TYR 1 CA    1 
ATOM   242   C  C     . TYR A  1  32  ? 41.495  -31.111  152.171  1.00 98.94  ? 32  TYR 1 C     1 
ATOM   243   O  O     . TYR A  1  32  ? 40.540  -30.329  152.253  1.00 98.79  ? 32  TYR 1 O     1 
ATOM   244   C  CB    . TYR A  1  32  ? 42.728  -31.356  149.985  1.00 93.66  ? 32  TYR 1 CB    1 
ATOM   245   C  CG    . TYR A  1  32  ? 41.609  -30.864  149.092  1.00 92.30  ? 32  TYR 1 CG    1 
ATOM   246   C  CD1   . TYR A  1  32  ? 41.552  -29.546  148.663  1.00 90.43  ? 32  TYR 1 CD1   1 
ATOM   247   C  CD2   . TYR A  1  32  ? 40.608  -31.725  148.679  1.00 94.31  ? 32  TYR 1 CD2   1 
ATOM   248   C  CE1   . TYR A  1  32  ? 40.513  -29.105  147.848  1.00 90.51  ? 32  TYR 1 CE1   1 
ATOM   249   C  CE2   . TYR A  1  32  ? 39.578  -31.293  147.861  1.00 93.00  ? 32  TYR 1 CE2   1 
ATOM   250   C  CZ    . TYR A  1  32  ? 39.530  -29.989  147.455  1.00 88.66  ? 32  TYR 1 CZ    1 
ATOM   251   O  OH    . TYR A  1  32  ? 38.492  -29.586  146.650  1.00 82.73  ? 32  TYR 1 OH    1 
ATOM   252   N  N     . LEU A  1  33  ? 41.502  -32.292  152.792  1.00 98.65  ? 33  LEU 1 N     1 
ATOM   253   C  CA    . LEU A  1  33  ? 40.359  -32.722  153.592  1.00 97.21  ? 33  LEU 1 CA    1 
ATOM   254   C  C     . LEU A  1  33  ? 40.177  -31.837  154.816  1.00 96.56  ? 33  LEU 1 C     1 
ATOM   255   O  O     . LEU A  1  33  ? 39.050  -31.454  155.147  1.00 95.55  ? 33  LEU 1 O     1 
ATOM   256   C  CB    . LEU A  1  33  ? 40.534  -34.178  154.010  1.00 97.91  ? 33  LEU 1 CB    1 
ATOM   257   C  CG    . LEU A  1  33  ? 40.363  -35.196  152.886  1.00 99.27  ? 33  LEU 1 CG    1 
ATOM   258   C  CD1   . LEU A  1  33  ? 40.461  -36.614  153.430  1.00 99.50  ? 33  LEU 1 CD1   1 
ATOM   259   C  CD2   . LEU A  1  33  ? 39.043  -34.966  152.171  1.00 100.98 ? 33  LEU 1 CD2   1 
ATOM   260   N  N     . ARG A  1  34  ? 41.273  -31.524  155.511  1.00 97.87  ? 34  ARG 1 N     1 
ATOM   261   C  CA    . ARG A  1  34  ? 41.200  -30.735  156.736  1.00 100.87 ? 34  ARG 1 CA    1 
ATOM   262   C  C     . ARG A  1  34  ? 40.648  -29.332  156.505  1.00 101.19 ? 34  ARG 1 C     1 
ATOM   263   O  O     . ARG A  1  34  ? 40.218  -28.685  157.468  1.00 102.48 ? 34  ARG 1 O     1 
ATOM   264   C  CB    . ARG A  1  34  ? 42.582  -30.623  157.384  1.00 101.83 ? 34  ARG 1 CB    1 
ATOM   265   C  CG    . ARG A  1  34  ? 42.926  -31.737  158.358  1.00 102.67 ? 34  ARG 1 CG    1 
ATOM   266   C  CD    . ARG A  1  34  ? 44.364  -32.200  158.163  1.00 103.84 ? 34  ARG 1 CD    1 
ATOM   267   N  NE    . ARG A  1  34  ? 45.306  -31.085  158.195  1.00 104.12 ? 34  ARG 1 NE    1 
ATOM   268   C  CZ    . ARG A  1  34  ? 46.586  -31.178  157.849  1.00 104.09 ? 34  ARG 1 CZ    1 
ATOM   269   N  NH1   . ARG A  1  34  ? 47.082  -32.338  157.442  1.00 105.45 ? 34  ARG 1 NH1   1 
ATOM   270   N  NH2   . ARG A  1  34  ? 47.370  -30.113  157.915  1.00 103.19 ? 34  ARG 1 NH2   1 
ATOM   271   N  N     . HIS A  1  35  ? 40.656  -28.840  155.269  1.00 99.22  ? 35  HIS 1 N     1 
ATOM   272   C  CA    . HIS A  1  35  ? 40.148  -27.509  154.972  1.00 100.02 ? 35  HIS 1 CA    1 
ATOM   273   C  C     . HIS A  1  35  ? 38.765  -27.540  154.336  1.00 95.90  ? 35  HIS 1 C     1 
ATOM   274   O  O     . HIS A  1  35  ? 38.292  -26.509  153.844  1.00 95.31  ? 35  HIS 1 O     1 
ATOM   275   C  CB    . HIS A  1  35  ? 41.133  -26.762  154.072  1.00 104.40 ? 35  HIS 1 CB    1 
ATOM   276   C  CG    . HIS A  1  35  ? 42.374  -26.323  154.787  1.00 108.31 ? 35  HIS 1 CG    1 
ATOM   277   N  ND1   . HIS A  1  35  ? 43.437  -27.170  155.026  1.00 107.33 ? 35  HIS 1 ND1   1 
ATOM   278   C  CD2   . HIS A  1  35  ? 42.698  -25.140  155.364  1.00 107.11 ? 35  HIS 1 CD2   1 
ATOM   279   C  CE1   . HIS A  1  35  ? 44.374  -26.517  155.692  1.00 107.72 ? 35  HIS 1 CE1   1 
ATOM   280   N  NE2   . HIS A  1  35  ? 43.950  -25.285  155.911  1.00 106.58 ? 35  HIS 1 NE2   1 
ATOM   281   N  N     . GLY A  1  36  ? 38.106  -28.692  154.343  1.00 91.61  ? 36  GLY 1 N     1 
ATOM   282   C  CA    . GLY A  1  36  ? 36.784  -28.820  153.778  1.00 86.44  ? 36  GLY 1 CA    1 
ATOM   283   C  C     . GLY A  1  36  ? 36.763  -29.338  152.363  1.00 82.50  ? 36  GLY 1 C     1 
ATOM   284   O  O     . GLY A  1  36  ? 35.796  -29.075  151.642  1.00 86.52  ? 36  GLY 1 O     1 
ATOM   285   N  N     . GLY A  1  37  ? 37.801  -30.040  151.933  1.00 75.28  ? 37  GLY 1 N     1 
ATOM   286   C  CA    . GLY A  1  37  ? 37.847  -30.510  150.570  1.00 71.50  ? 37  GLY 1 CA    1 
ATOM   287   C  C     . GLY A  1  37  ? 36.877  -31.643  150.322  1.00 71.14  ? 37  GLY 1 C     1 
ATOM   288   O  O     . GLY A  1  37  ? 36.423  -32.322  151.238  1.00 71.83  ? 37  GLY 1 O     1 
ATOM   289   N  N     . TYR A  1  38  ? 36.518  -31.808  149.051  1.00 71.71  ? 38  TYR 1 N     1 
ATOM   290   C  CA    . TYR A  1  38  ? 35.707  -32.908  148.524  1.00 72.68  ? 38  TYR 1 CA    1 
ATOM   291   C  C     . TYR A  1  38  ? 34.282  -32.896  149.055  1.00 75.40  ? 38  TYR 1 C     1 
ATOM   292   O  O     . TYR A  1  38  ? 33.497  -33.782  148.699  1.00 76.03  ? 38  TYR 1 O     1 
ATOM   293   C  CB    . TYR A  1  38  ? 36.329  -34.285  148.802  1.00 71.24  ? 38  TYR 1 CB    1 
ATOM   294   C  CG    . TYR A  1  38  ? 37.470  -34.594  147.865  1.00 66.31  ? 38  TYR 1 CG    1 
ATOM   295   C  CD1   . TYR A  1  38  ? 37.251  -34.826  146.519  1.00 66.75  ? 38  TYR 1 CD1   1 
ATOM   296   C  CD2   . TYR A  1  38  ? 38.771  -34.639  148.328  1.00 62.89  ? 38  TYR 1 CD2   1 
ATOM   297   C  CE1   . TYR A  1  38  ? 38.303  -35.097  145.660  1.00 61.42  ? 38  TYR 1 CE1   1 
ATOM   298   C  CE2   . TYR A  1  38  ? 39.822  -34.909  147.477  1.00 61.56  ? 38  TYR 1 CE2   1 
ATOM   299   C  CZ    . TYR A  1  38  ? 39.585  -35.140  146.147  1.00 63.29  ? 38  TYR 1 CZ    1 
ATOM   300   O  OH    . TYR A  1  38  ? 40.636  -35.414  145.303  1.00 61.15  ? 38  TYR 1 OH    1 
ATOM   301   N  N     . GLU A  1  39  ? 33.922  -31.930  149.896  1.00 85.49  ? 39  GLU 1 N     1 
ATOM   302   C  CA    . GLU A  1  39  ? 32.538  -31.807  150.332  1.00 87.29  ? 39  GLU 1 CA    1 
ATOM   303   C  C     . GLU A  1  39  ? 31.640  -31.409  149.167  1.00 87.64  ? 39  GLU 1 C     1 
ATOM   304   O  O     . GLU A  1  39  ? 30.516  -31.916  149.028  1.00 89.55  ? 39  GLU 1 O     1 
ATOM   305   C  CB    . GLU A  1  39  ? 32.454  -30.771  151.453  1.00 88.60  ? 39  GLU 1 CB    1 
ATOM   306   C  CG    . GLU A  1  39  ? 32.308  -31.313  152.869  1.00 89.74  ? 39  GLU 1 CG    1 
ATOM   307   C  CD    . GLU A  1  39  ? 32.006  -30.200  153.862  1.00 88.91  ? 39  GLU 1 CD    1 
ATOM   308   O  OE1   . GLU A  1  39  ? 32.525  -29.083  153.667  1.00 87.50  ? 39  GLU 1 OE1   1 
ATOM   309   O  OE2   . GLU A  1  39  ? 31.227  -30.423  154.813  1.00 87.83  ? 39  GLU 1 OE2   1 
ATOM   310   N  N     . THR A  1  40  ? 32.135  -30.509  148.312  1.00 85.92  ? 40  THR 1 N     1 
ATOM   311   C  CA    . THR A  1  40  ? 31.342  -30.010  147.194  1.00 83.72  ? 40  THR 1 CA    1 
ATOM   312   C  C     . THR A  1  40  ? 31.032  -31.120  146.190  1.00 82.66  ? 40  THR 1 C     1 
ATOM   313   O  O     . THR A  1  40  ? 29.924  -31.182  145.645  1.00 74.26  ? 40  THR 1 O     1 
ATOM   314   C  CB    . THR A  1  40  ? 32.066  -28.834  146.534  1.00 80.82  ? 40  THR 1 CB    1 
ATOM   315   O  OG1   . THR A  1  40  ? 32.507  -27.918  147.546  1.00 78.06  ? 40  THR 1 OG1   1 
ATOM   316   C  CG2   . THR A  1  40  ? 31.137  -28.100  145.617  1.00 80.70  ? 40  THR 1 CG2   1 
ATOM   317   N  N     . ALA A  1  41  ? 31.992  -32.010  145.937  1.00 83.34  ? 41  ALA 1 N     1 
ATOM   318   C  CA    . ALA A  1  41  ? 31.714  -33.170  145.092  1.00 85.19  ? 41  ALA 1 CA    1 
ATOM   319   C  C     . ALA A  1  41  ? 30.617  -34.043  145.697  1.00 86.06  ? 41  ALA 1 C     1 
ATOM   320   O  O     . ALA A  1  41  ? 29.707  -34.497  144.992  1.00 87.28  ? 41  ALA 1 O     1 
ATOM   321   C  CB    . ALA A  1  41  ? 32.990  -33.984  144.873  1.00 84.34  ? 41  ALA 1 CB    1 
ATOM   322   N  N     . LYS A  1  42  ? 30.703  -34.305  147.006  1.00 84.14  ? 42  LYS 1 N     1 
ATOM   323   C  CA    . LYS A  1  42  ? 29.703  -35.132  147.674  1.00 82.92  ? 42  LYS 1 CA    1 
ATOM   324   C  C     . LYS A  1  42  ? 28.308  -34.542  147.527  1.00 80.83  ? 42  LYS 1 C     1 
ATOM   325   O  O     . LYS A  1  42  ? 27.348  -35.258  147.222  1.00 82.32  ? 42  LYS 1 O     1 
ATOM   326   C  CB    . LYS A  1  42  ? 30.048  -35.314  149.150  1.00 85.83  ? 42  LYS 1 CB    1 
ATOM   327   C  CG    . LYS A  1  42  ? 29.030  -36.184  149.890  1.00 89.84  ? 42  LYS 1 CG    1 
ATOM   328   C  CD    . LYS A  1  42  ? 29.322  -36.327  151.385  1.00 91.84  ? 42  LYS 1 CD    1 
ATOM   329   C  CE    . LYS A  1  42  ? 30.374  -37.406  151.636  1.00 91.37  ? 42  LYS 1 CE    1 
ATOM   330   N  NZ    . LYS A  1  42  ? 30.388  -37.907  153.041  1.00 89.13  ? 42  LYS 1 NZ    1 
ATOM   331   N  N     . ARG A  1  43  ? 28.166  -33.236  147.764  1.00 79.49  ? 43  ARG 1 N     1 
ATOM   332   C  CA    . ARG A  1  43  ? 26.836  -32.640  147.659  1.00 74.24  ? 43  ARG 1 CA    1 
ATOM   333   C  C     . ARG A  1  43  ? 26.336  -32.650  146.218  1.00 74.36  ? 43  ARG 1 C     1 
ATOM   334   O  O     . ARG A  1  43  ? 25.193  -33.048  145.955  1.00 74.42  ? 43  ARG 1 O     1 
ATOM   335   C  CB    . ARG A  1  43  ? 26.828  -31.220  148.230  1.00 74.23  ? 43  ARG 1 CB    1 
ATOM   336   C  CG    . ARG A  1  43  ? 27.946  -30.362  147.707  1.00 78.96  ? 43  ARG 1 CG    1 
ATOM   337   C  CD    . ARG A  1  43  ? 27.786  -28.887  147.962  1.00 74.25  ? 43  ARG 1 CD    1 
ATOM   338   N  NE    . ARG A  1  43  ? 26.753  -28.357  147.081  1.00 74.37  ? 43  ARG 1 NE    1 
ATOM   339   C  CZ    . ARG A  1  43  ? 26.418  -27.079  147.011  1.00 74.42  ? 43  ARG 1 CZ    1 
ATOM   340   N  NH1   . ARG A  1  43  ? 27.051  -26.187  147.758  1.00 79.37  ? 43  ARG 1 NH1   1 
ATOM   341   N  NH2   . ARG A  1  43  ? 25.468  -26.688  146.180  1.00 74.52  ? 43  ARG 1 NH2   1 
ATOM   342   N  N     . VAL A  1  44  ? 27.175  -32.231  145.263  1.00 74.39  ? 44  VAL 1 N     1 
ATOM   343   C  CA    . VAL A  1  44  ? 26.690  -32.073  143.894  1.00 84.52  ? 44  VAL 1 CA    1 
ATOM   344   C  C     . VAL A  1  44  ? 26.339  -33.426  143.278  1.00 85.53  ? 44  VAL 1 C     1 
ATOM   345   O  O     . VAL A  1  44  ? 25.341  -33.550  142.559  1.00 84.81  ? 44  VAL 1 O     1 
ATOM   346   C  CB    . VAL A  1  44  ? 27.719  -31.308  143.041  1.00 74.53  ? 44  VAL 1 CB    1 
ATOM   347   C  CG1   . VAL A  1  44  ? 27.248  -31.203  141.603  1.00 74.64  ? 44  VAL 1 CG1   1 
ATOM   348   C  CG2   . VAL A  1  44  ? 27.971  -29.924  143.612  1.00 77.85  ? 44  VAL 1 CG2   1 
ATOM   349   N  N     . LEU A  1  45  ? 27.143  -34.465  143.550  1.00 89.00  ? 45  LEU 1 N     1 
ATOM   350   C  CA    . LEU A  1  45  ? 26.948  -35.749  142.874  1.00 92.48  ? 45  LEU 1 CA    1 
ATOM   351   C  C     . LEU A  1  45  ? 25.615  -36.396  143.229  1.00 92.05  ? 45  LEU 1 C     1 
ATOM   352   O  O     . LEU A  1  45  ? 24.965  -36.995  142.366  1.00 91.30  ? 45  LEU 1 O     1 
ATOM   353   C  CB    . LEU A  1  45  ? 28.099  -36.698  143.199  1.00 97.69  ? 45  LEU 1 CB    1 
ATOM   354   C  CG    . LEU A  1  45  ? 29.346  -36.426  142.360  1.00 103.54 ? 45  LEU 1 CG    1 
ATOM   355   C  CD1   . LEU A  1  45  ? 30.478  -37.344  142.741  1.00 106.27 ? 45  LEU 1 CD1   1 
ATOM   356   C  CD2   . LEU A  1  45  ? 29.027  -36.577  140.891  1.00 105.91 ? 45  LEU 1 CD2   1 
ATOM   357   N  N     . LYS A  1  46  ? 25.200  -36.312  144.491  1.00 93.45  ? 46  LYS 1 N     1 
ATOM   358   C  CA    . LYS A  1  46  ? 23.968  -36.963  144.908  1.00 95.81  ? 46  LYS 1 CA    1 
ATOM   359   C  C     . LYS A  1  46  ? 22.762  -36.037  144.928  1.00 100.17 ? 46  LYS 1 C     1 
ATOM   360   O  O     . LYS A  1  46  ? 21.629  -36.533  144.945  1.00 99.36  ? 46  LYS 1 O     1 
ATOM   361   C  CB    . LYS A  1  46  ? 24.131  -37.595  146.292  1.00 95.05  ? 46  LYS 1 CB    1 
ATOM   362   C  CG    . LYS A  1  46  ? 25.541  -38.050  146.576  1.00 97.08  ? 46  LYS 1 CG    1 
ATOM   363   C  CD    . LYS A  1  46  ? 25.527  -39.197  147.566  1.00 100.10 ? 46  LYS 1 CD    1 
ATOM   364   C  CE    . LYS A  1  46  ? 26.892  -39.444  148.167  1.00 101.46 ? 46  LYS 1 CE    1 
ATOM   365   N  NZ    . LYS A  1  46  ? 26.802  -40.181  149.454  1.00 101.44 ? 46  LYS 1 NZ    1 
ATOM   366   N  N     . GLU A  1  47  ? 22.967  -34.717  144.925  1.00 103.88 ? 47  GLU 1 N     1 
ATOM   367   C  CA    . GLU A  1  47  ? 21.835  -33.796  144.905  1.00 104.24 ? 47  GLU 1 CA    1 
ATOM   368   C  C     . GLU A  1  47  ? 21.487  -33.345  143.487  1.00 104.92 ? 47  GLU 1 C     1 
ATOM   369   O  O     . GLU A  1  47  ? 20.385  -33.612  142.996  1.00 107.65 ? 47  GLU 1 O     1 
ATOM   370   C  CB    . GLU A  1  47  ? 22.125  -32.585  145.800  1.00 102.93 ? 47  GLU 1 CB    1 
ATOM   371   C  CG    . GLU A  1  47  ? 22.311  -32.934  147.268  1.00 102.74 ? 47  GLU 1 CG    1 
ATOM   372   C  CD    . GLU A  1  47  ? 22.785  -31.756  148.089  1.00 103.76 ? 47  GLU 1 CD    1 
ATOM   373   O  OE1   . GLU A  1  47  ? 23.156  -30.725  147.492  1.00 104.19 ? 47  GLU 1 OE1   1 
ATOM   374   O  OE2   . GLU A  1  47  ? 22.797  -31.864  149.332  1.00 104.00 ? 47  GLU 1 OE2   1 
ATOM   375   N  N     . LYS A  1  48  ? 22.425  -32.694  142.808  1.00 103.08 ? 48  LYS 1 N     1 
ATOM   376   C  CA    . LYS A  1  48  ? 22.134  -32.046  141.536  1.00 106.12 ? 48  LYS 1 CA    1 
ATOM   377   C  C     . LYS A  1  48  ? 22.214  -33.025  140.368  1.00 111.21 ? 48  LYS 1 C     1 
ATOM   378   O  O     . LYS A  1  48  ? 22.919  -34.034  140.422  1.00 118.12 ? 48  LYS 1 O     1 
ATOM   379   C  CB    . LYS A  1  48  ? 23.105  -30.888  141.296  1.00 106.91 ? 48  LYS 1 CB    1 
ATOM   380   C  CG    . LYS A  1  48  ? 22.943  -29.707  142.240  1.00 107.32 ? 48  LYS 1 CG    1 
ATOM   381   C  CD    . LYS A  1  48  ? 23.976  -28.635  141.921  1.00 108.13 ? 48  LYS 1 CD    1 
ATOM   382   C  CE    . LYS A  1  48  ? 23.858  -27.430  142.835  1.00 109.32 ? 48  LYS 1 CE    1 
ATOM   383   N  NZ    . LYS A  1  48  ? 22.560  -26.737  142.648  1.00 110.88 ? 48  LYS 1 NZ    1 
ATOM   384   N  N     . THR A  1  49  ? 21.436  -32.733  139.315  1.00 102.84 ? 49  THR 1 N     1 
ATOM   385   C  CA    . THR A  1  49  ? 21.508  -33.408  138.026  1.00 97.32  ? 49  THR 1 CA    1 
ATOM   386   C  C     . THR A  1  49  ? 22.485  -32.671  137.115  1.00 93.63  ? 49  THR 1 C     1 
ATOM   387   O  O     . THR A  1  49  ? 22.838  -31.516  137.376  1.00 96.38  ? 49  THR 1 O     1 
ATOM   388   C  CB    . THR A  1  49  ? 20.120  -33.482  137.384  1.00 95.65  ? 49  THR 1 CB    1 
ATOM   389   O  OG1   . THR A  1  49  ? 19.611  -32.161  137.174  1.00 97.53  ? 49  THR 1 OG1   1 
ATOM   390   C  CG2   . THR A  1  49  ? 19.157  -34.259  138.274  1.00 92.91  ? 49  THR 1 CG2   1 
ATOM   391   N  N     . PRO A  1  50  ? 22.970  -33.315  136.046  1.00 86.43  ? 50  PRO 1 N     1 
ATOM   392   C  CA    . PRO A  1  50  ? 23.966  -32.641  135.190  1.00 86.76  ? 50  PRO 1 CA    1 
ATOM   393   C  C     . PRO A  1  50  ? 23.495  -31.331  134.574  1.00 87.22  ? 50  PRO 1 C     1 
ATOM   394   O  O     . PRO A  1  50  ? 24.268  -30.366  134.517  1.00 86.32  ? 50  PRO 1 O     1 
ATOM   395   C  CB    . PRO A  1  50  ? 24.258  -33.694  134.115  1.00 84.91  ? 50  PRO 1 CB    1 
ATOM   396   C  CG    . PRO A  1  50  ? 23.912  -34.989  134.751  1.00 81.57  ? 50  PRO 1 CG    1 
ATOM   397   C  CD    . PRO A  1  50  ? 22.755  -34.714  135.640  1.00 81.17  ? 50  PRO 1 CD    1 
ATOM   398   N  N     . ASP A  1  51  ? 22.251  -31.262  134.102  1.00 86.44  ? 51  ASP 1 N     1 
ATOM   399   C  CA    . ASP A  1  51  ? 21.748  -30.002  133.562  1.00 83.81  ? 51  ASP 1 CA    1 
ATOM   400   C  C     . ASP A  1  51  ? 21.744  -28.904  134.614  1.00 81.53  ? 51  ASP 1 C     1 
ATOM   401   O  O     . ASP A  1  51  ? 21.965  -27.736  134.288  1.00 79.56  ? 51  ASP 1 O     1 
ATOM   402   C  CB    . ASP A  1  51  ? 20.357  -30.203  132.969  1.00 83.53  ? 51  ASP 1 CB    1 
ATOM   403   C  CG    . ASP A  1  51  ? 20.400  -30.896  131.623  1.00 83.04  ? 51  ASP 1 CG    1 
ATOM   404   O  OD1   . ASP A  1  51  ? 21.061  -30.365  130.708  1.00 82.14  ? 51  ASP 1 OD1   1 
ATOM   405   O  OD2   . ASP A  1  51  ? 19.793  -31.976  131.483  1.00 82.96  ? 51  ASP 1 OD2   1 
ATOM   406   N  N     . GLU A  1  52  ? 21.521  -29.262  135.879  1.00 83.42  ? 52  GLU 1 N     1 
ATOM   407   C  CA    . GLU A  1  52  ? 21.524  -28.260  136.940  1.00 85.28  ? 52  GLU 1 CA    1 
ATOM   408   C  C     . GLU A  1  52  ? 22.925  -27.710  137.180  1.00 85.65  ? 52  GLU 1 C     1 
ATOM   409   O  O     . GLU A  1  52  ? 23.107  -26.492  137.284  1.00 88.33  ? 52  GLU 1 O     1 
ATOM   410   C  CB    . GLU A  1  52  ? 20.961  -28.861  138.227  1.00 83.89  ? 52  GLU 1 CB    1 
ATOM   411   C  CG    . GLU A  1  52  ? 19.473  -29.153  138.218  1.00 82.38  ? 52  GLU 1 CG    1 
ATOM   412   C  CD    . GLU A  1  52  ? 18.976  -29.573  139.584  1.00 83.31  ? 52  GLU 1 CD    1 
ATOM   413   O  OE1   . GLU A  1  52  ? 19.446  -29.004  140.589  1.00 84.67  ? 52  GLU 1 OE1   1 
ATOM   414   O  OE2   . GLU A  1  52  ? 18.102  -30.459  139.658  1.00 84.14  ? 52  GLU 1 OE2   1 
ATOM   415   N  N     . VAL A  1  53  ? 23.933  -28.587  137.250  1.00 81.51  ? 53  VAL 1 N     1 
ATOM   416   C  CA    . VAL A  1  53  ? 25.300  -28.119  137.463  1.00 81.00  ? 53  VAL 1 CA    1 
ATOM   417   C  C     . VAL A  1  53  ? 25.815  -27.391  136.226  1.00 84.03  ? 53  VAL 1 C     1 
ATOM   418   O  O     . VAL A  1  53  ? 26.706  -26.540  136.333  1.00 83.26  ? 53  VAL 1 O     1 
ATOM   419   C  CB    . VAL A  1  53  ? 26.203  -29.302  137.898  1.00 77.28  ? 53  VAL 1 CB    1 
ATOM   420   C  CG1   . VAL A  1  53  ? 26.190  -30.421  136.886  1.00 76.97  ? 53  VAL 1 CG1   1 
ATOM   421   C  CG2   . VAL A  1  53  ? 27.637  -28.851  138.169  1.00 74.90  ? 53  VAL 1 CG2   1 
ATOM   422   N  N     . ILE A  1  54  ? 25.215  -27.640  135.063  1.00 87.90  ? 54  ILE 1 N     1 
ATOM   423   C  CA    . ILE A  1  54  ? 25.575  -26.891  133.863  1.00 89.54  ? 54  ILE 1 CA    1 
ATOM   424   C  C     . ILE A  1  54  ? 24.953  -25.500  133.898  1.00 92.40  ? 54  ILE 1 C     1 
ATOM   425   O  O     . ILE A  1  54  ? 25.619  -24.502  133.612  1.00 91.70  ? 54  ILE 1 O     1 
ATOM   426   C  CB    . ILE A  1  54  ? 25.146  -27.677  132.613  1.00 87.20  ? 54  ILE 1 CB    1 
ATOM   427   C  CG1   . ILE A  1  54  ? 26.057  -28.895  132.447  1.00 87.59  ? 54  ILE 1 CG1   1 
ATOM   428   C  CG2   . ILE A  1  54  ? 25.203  -26.779  131.377  1.00 85.73  ? 54  ILE 1 CG2   1 
ATOM   429   C  CD1   . ILE A  1  54  ? 25.670  -29.836  131.332  1.00 88.41  ? 54  ILE 1 CD1   1 
ATOM   430   N  N     . GLU A  1  55  ? 23.661  -25.417  134.238  1.00 93.17  ? 55  GLU 1 N     1 
ATOM   431   C  CA    . GLU A  1  55  ? 23.015  -24.126  134.445  1.00 92.69  ? 55  GLU 1 CA    1 
ATOM   432   C  C     . GLU A  1  55  ? 23.731  -23.316  135.512  1.00 92.81  ? 55  GLU 1 C     1 
ATOM   433   O  O     . GLU A  1  55  ? 23.783  -22.084  135.427  1.00 94.35  ? 55  GLU 1 O     1 
ATOM   434   C  CB    . GLU A  1  55  ? 21.547  -24.302  134.833  1.00 93.00  ? 55  GLU 1 CB    1 
ATOM   435   C  CG    . GLU A  1  55  ? 20.559  -24.099  133.701  1.00 93.14  ? 55  GLU 1 CG    1 
ATOM   436   C  CD    . GLU A  1  55  ? 20.461  -22.637  133.300  1.00 93.04  ? 55  GLU 1 CD    1 
ATOM   437   O  OE1   . GLU A  1  55  ? 21.068  -22.253  132.284  1.00 93.83  ? 55  GLU 1 OE1   1 
ATOM   438   O  OE2   . GLU A  1  55  ? 19.796  -21.859  134.009  1.00 92.21  ? 55  GLU 1 OE2   1 
ATOM   439   N  N     . GLU A  1  56  ? 24.270  -23.984  136.535  1.00 90.61  ? 56  GLU 1 N     1 
ATOM   440   C  CA    . GLU A  1  56  ? 24.967  -23.268  137.597  1.00 90.66  ? 56  GLU 1 CA    1 
ATOM   441   C  C     . GLU A  1  56  ? 26.156  -22.508  137.031  1.00 87.97  ? 56  GLU 1 C     1 
ATOM   442   O  O     . GLU A  1  56  ? 26.315  -21.306  137.270  1.00 90.57  ? 56  GLU 1 O     1 
ATOM   443   C  CB    . GLU A  1  56  ? 25.421  -24.251  138.673  1.00 94.93  ? 56  GLU 1 CB    1 
ATOM   444   C  CG    . GLU A  1  56  ? 25.811  -23.594  139.983  1.00 100.80 ? 56  GLU 1 CG    1 
ATOM   445   C  CD    . GLU A  1  56  ? 24.616  -23.281  140.861  1.00 105.47 ? 56  GLU 1 CD    1 
ATOM   446   O  OE1   . GLU A  1  56  ? 23.658  -24.083  140.863  1.00 106.51 ? 56  GLU 1 OE1   1 
ATOM   447   O  OE2   . GLU A  1  56  ? 24.628  -22.236  141.546  1.00 107.02 ? 56  GLU 1 OE2   1 
ATOM   448   N  N     . VAL A  1  57  ? 26.982  -23.191  136.239  1.00 82.21  ? 57  VAL 1 N     1 
ATOM   449   C  CA    . VAL A  1  57  ? 28.149  -22.537  135.668  1.00 79.92  ? 57  VAL 1 CA    1 
ATOM   450   C  C     . VAL A  1  57  ? 27.731  -21.568  134.567  1.00 80.77  ? 57  VAL 1 C     1 
ATOM   451   O  O     . VAL A  1  57  ? 28.402  -20.556  134.336  1.00 79.34  ? 57  VAL 1 O     1 
ATOM   452   C  CB    . VAL A  1  57  ? 29.151  -23.598  135.169  1.00 79.99  ? 57  VAL 1 CB    1 
ATOM   453   C  CG1   . VAL A  1  57  ? 30.498  -22.972  134.856  1.00 75.11  ? 57  VAL 1 CG1   1 
ATOM   454   C  CG2   . VAL A  1  57  ? 29.313  -24.691  136.208  1.00 75.04  ? 57  VAL 1 CG2   1 
ATOM   455   N  N     . LYS A  1  58  ? 26.615  -21.843  133.885  1.00 84.16  ? 58  LYS 1 N     1 
ATOM   456   C  CA    . LYS A  1  58  ? 26.097  -20.902  132.894  1.00 87.37  ? 58  LYS 1 CA    1 
ATOM   457   C  C     . LYS A  1  58  ? 25.737  -19.564  133.532  1.00 89.14  ? 58  LYS 1 C     1 
ATOM   458   O  O     . LYS A  1  58  ? 26.064  -18.499  132.991  1.00 85.34  ? 58  LYS 1 O     1 
ATOM   459   C  CB    . LYS A  1  58  ? 24.875  -21.497  132.186  1.00 86.00  ? 58  LYS 1 CB    1 
ATOM   460   C  CG    . LYS A  1  58  ? 24.524  -20.799  130.880  1.00 86.15  ? 58  LYS 1 CG    1 
ATOM   461   C  CD    . LYS A  1  58  ? 23.268  -21.371  130.225  1.00 85.39  ? 58  LYS 1 CD    1 
ATOM   462   C  CE    . LYS A  1  58  ? 23.449  -22.814  129.786  1.00 82.15  ? 58  LYS 1 CE    1 
ATOM   463   N  NZ    . LYS A  1  58  ? 22.353  -23.260  128.886  1.00 79.11  ? 58  LYS 1 NZ    1 
ATOM   464   N  N     . ARG A  1  59  ? 25.057  -19.602  134.680  1.00 92.85  ? 59  ARG 1 N     1 
ATOM   465   C  CA    . ARG A  1  59  ? 24.716  -18.380  135.399  1.00 92.78  ? 59  ARG 1 CA    1 
ATOM   466   C  C     . ARG A  1  59  ? 25.914  -17.782  136.117  1.00 86.08  ? 59  ARG 1 C     1 
ATOM   467   O  O     . ARG A  1  59  ? 25.901  -16.584  136.422  1.00 83.67  ? 59  ARG 1 O     1 
ATOM   468   C  CB    . ARG A  1  59  ? 23.596  -18.641  136.406  1.00 97.57  ? 59  ARG 1 CB    1 
ATOM   469   C  CG    . ARG A  1  59  ? 22.210  -18.680  135.790  1.00 102.79 ? 59  ARG 1 CG    1 
ATOM   470   C  CD    . ARG A  1  59  ? 21.163  -18.894  136.861  1.00 108.16 ? 59  ARG 1 CD    1 
ATOM   471   N  NE    . ARG A  1  59  ? 20.133  -19.840  136.451  1.00 112.85 ? 59  ARG 1 NE    1 
ATOM   472   C  CZ    . ARG A  1  59  ? 18.857  -19.749  136.811  1.00 115.08 ? 59  ARG 1 CZ    1 
ATOM   473   N  NH1   . ARG A  1  59  ? 18.453  -18.751  137.586  1.00 114.76 ? 59  ARG 1 NH1   1 
ATOM   474   N  NH2   . ARG A  1  59  ? 17.984  -20.659  136.401  1.00 115.79 ? 59  ARG 1 NH2   1 
ATOM   475   N  N     . SER A  1  60  ? 26.939  -18.590  136.398  1.00 82.53  ? 60  SER 1 N     1 
ATOM   476   C  CA    . SER A  1  60  ? 28.143  -18.093  137.055  1.00 84.18  ? 60  SER 1 CA    1 
ATOM   477   C  C     . SER A  1  60  ? 28.840  -17.006  136.253  1.00 87.00  ? 60  SER 1 C     1 
ATOM   478   O  O     . SER A  1  60  ? 29.654  -16.262  136.813  1.00 88.29  ? 60  SER 1 O     1 
ATOM   479   C  CB    . SER A  1  60  ? 29.113  -19.248  137.300  1.00 81.43  ? 60  SER 1 CB    1 
ATOM   480   O  OG    . SER A  1  60  ? 29.670  -19.719  136.086  1.00 81.77  ? 60  SER 1 OG    1 
ATOM   481   N  N     . GLY A  1  61  ? 28.528  -16.886  134.967  1.00 66.59  ? 61  GLY 1 N     1 
ATOM   482   C  CA    . GLY A  1  61  ? 29.273  -15.991  134.112  1.00 69.85  ? 61  GLY 1 CA    1 
ATOM   483   C  C     . GLY A  1  61  ? 30.694  -16.433  133.896  1.00 71.80  ? 61  GLY 1 C     1 
ATOM   484   O  O     . GLY A  1  61  ? 31.535  -15.621  133.501  1.00 66.41  ? 61  GLY 1 O     1 
ATOM   485   N  N     . LEU A  1  62  ? 30.990  -17.701  134.171  1.00 77.51  ? 62  LEU 1 N     1 
ATOM   486   C  CA    . LEU A  1  62  ? 32.346  -18.214  134.046  1.00 80.82  ? 62  LEU 1 CA    1 
ATOM   487   C  C     . LEU A  1  62  ? 32.677  -18.380  132.573  1.00 80.97  ? 62  LEU 1 C     1 
ATOM   488   O  O     . LEU A  1  62  ? 32.071  -19.201  131.874  1.00 79.01  ? 62  LEU 1 O     1 
ATOM   489   C  CB    . LEU A  1  62  ? 32.495  -19.531  134.796  1.00 84.37  ? 62  LEU 1 CB    1 
ATOM   490   C  CG    . LEU A  1  62  ? 33.823  -20.259  134.591  1.00 89.38  ? 62  LEU 1 CG    1 
ATOM   491   C  CD1   . LEU A  1  62  ? 35.011  -19.343  134.893  1.00 90.00  ? 62  LEU 1 CD1   1 
ATOM   492   C  CD2   . LEU A  1  62  ? 33.867  -21.526  135.437  1.00 91.28  ? 62  LEU 1 CD2   1 
ATOM   493   N  N     . ARG A  1  63  ? 33.641  -17.602  132.109  1.00 83.10  ? 63  ARG 1 N     1 
ATOM   494   C  CA    . ARG A  1  63  ? 34.109  -17.640  130.737  1.00 84.08  ? 63  ARG 1 CA    1 
ATOM   495   C  C     . ARG A  1  63  ? 35.417  -18.410  130.667  1.00 79.60  ? 63  ARG 1 C     1 
ATOM   496   O  O     . ARG A  1  63  ? 36.130  -18.558  131.661  1.00 79.37  ? 63  ARG 1 O     1 
ATOM   497   C  CB    . ARG A  1  63  ? 34.278  -16.218  130.188  1.00 89.52  ? 63  ARG 1 CB    1 
ATOM   498   C  CG    . ARG A  1  63  ? 32.958  -15.449  130.089  1.00 93.72  ? 63  ARG 1 CG    1 
ATOM   499   C  CD    . ARG A  1  63  ? 33.143  -14.003  129.653  1.00 96.18  ? 63  ARG 1 CD    1 
ATOM   500   N  NE    . ARG A  1  63  ? 32.952  -13.835  128.214  1.00 98.67  ? 63  ARG 1 NE    1 
ATOM   501   C  CZ    . ARG A  1  63  ? 33.054  -12.672  127.580  1.00 101.28 ? 63  ARG 1 CZ    1 
ATOM   502   N  NH1   . ARG A  1  63  ? 33.339  -11.569  128.256  1.00 102.87 ? 63  ARG 1 NH1   1 
ATOM   503   N  NH2   . ARG A  1  63  ? 32.868  -12.608  126.270  1.00 101.42 ? 63  ARG 1 NH2   1 
ATOM   504   N  N     . GLY A  1  64  ? 35.712  -18.919  129.479  1.00 77.61  ? 64  GLY 1 N     1 
ATOM   505   C  CA    . GLY A  1  64  ? 36.908  -19.708  129.274  1.00 78.89  ? 64  GLY 1 CA    1 
ATOM   506   C  C     . GLY A  1  64  ? 38.165  -19.061  129.807  1.00 81.60  ? 64  GLY 1 C     1 
ATOM   507   O  O     . GLY A  1  64  ? 38.441  -17.900  129.499  1.00 81.76  ? 64  GLY 1 O     1 
ATOM   508   N  N     . ARG A  1  65  ? 38.917  -19.784  130.631  1.00 84.22  ? 65  ARG 1 N     1 
ATOM   509   C  CA    . ARG A  1  65  ? 40.133  -19.244  131.224  1.00 85.95  ? 65  ARG 1 CA    1 
ATOM   510   C  C     . ARG A  1  65  ? 41.374  -19.480  130.381  1.00 82.92  ? 65  ARG 1 C     1 
ATOM   511   O  O     . ARG A  1  65  ? 42.449  -19.005  130.756  1.00 83.00  ? 65  ARG 1 O     1 
ATOM   512   C  CB    . ARG A  1  65  ? 40.360  -19.810  132.629  1.00 90.07  ? 65  ARG 1 CB    1 
ATOM   513   C  CG    . ARG A  1  65  ? 39.333  -19.352  133.646  1.00 96.31  ? 65  ARG 1 CG    1 
ATOM   514   C  CD    . ARG A  1  65  ? 39.453  -17.848  133.840  1.00 103.01 ? 65  ARG 1 CD    1 
ATOM   515   N  NE    . ARG A  1  65  ? 38.178  -17.220  134.145  1.00 108.93 ? 65  ARG 1 NE    1 
ATOM   516   C  CZ    . ARG A  1  65  ? 37.763  -16.962  135.380  1.00 112.69 ? 65  ARG 1 CZ    1 
ATOM   517   N  NH1   . ARG A  1  65  ? 38.533  -17.283  136.411  1.00 112.22 ? 65  ARG 1 NH1   1 
ATOM   518   N  NH2   . ARG A  1  65  ? 36.588  -16.385  135.587  1.00 114.80 ? 65  ARG 1 NH2   1 
ATOM   519   N  N     . GLY A  1  66  ? 41.262  -20.181  129.256  1.00 80.93  ? 66  GLY 1 N     1 
ATOM   520   C  CA    . GLY A  1  66  ? 42.417  -20.273  128.382  1.00 80.58  ? 66  GLY 1 CA    1 
ATOM   521   C  C     . GLY A  1  66  ? 42.732  -19.002  127.621  1.00 80.64  ? 66  GLY 1 C     1 
ATOM   522   O  O     . GLY A  1  66  ? 43.803  -18.916  127.010  1.00 76.48  ? 66  GLY 1 O     1 
ATOM   523   N  N     . GLY A  1  67  ? 41.845  -18.010  127.670  1.00 85.26  ? 67  GLY 1 N     1 
ATOM   524   C  CA    . GLY A  1  67  ? 41.976  -16.781  126.907  1.00 85.49  ? 67  GLY 1 CA    1 
ATOM   525   C  C     . GLY A  1  67  ? 40.824  -16.531  125.960  1.00 84.77  ? 67  GLY 1 C     1 
ATOM   526   O  O     . GLY A  1  67  ? 40.630  -15.391  125.516  1.00 83.61  ? 67  GLY 1 O     1 
ATOM   527   N  N     . ALA A  1  68  ? 40.047  -17.567  125.647  1.00 85.90  ? 68  ALA 1 N     1 
ATOM   528   C  CA    . ALA A  1  68  ? 38.936  -17.433  124.714  1.00 86.75  ? 68  ALA 1 CA    1 
ATOM   529   C  C     . ALA A  1  68  ? 37.824  -16.579  125.305  1.00 84.66  ? 68  ALA 1 C     1 
ATOM   530   O  O     . ALA A  1  68  ? 37.472  -15.527  124.762  1.00 85.85  ? 68  ALA 1 O     1 
ATOM   531   C  CB    . ALA A  1  68  ? 38.414  -18.817  124.339  1.00 89.94  ? 68  ALA 1 CB    1 
ATOM   532   N  N     . GLY A  1  69  ? 37.245  -17.024  126.411  1.00 81.86  ? 69  GLY 1 N     1 
ATOM   533   C  CA    . GLY A  1  69  ? 36.159  -16.304  127.020  1.00 80.09  ? 69  GLY 1 CA    1 
ATOM   534   C  C     . GLY A  1  69  ? 34.786  -16.838  126.710  1.00 76.96  ? 69  GLY 1 C     1 
ATOM   535   O  O     . GLY A  1  69  ? 33.801  -16.135  126.956  1.00 75.19  ? 69  GLY 1 O     1 
ATOM   536   N  N     . PHE A  1  70  ? 34.686  -18.040  126.170  1.00 76.56  ? 70  PHE 1 N     1 
ATOM   537   C  CA    . PHE A  1  70  ? 33.376  -18.579  125.832  1.00 75.91  ? 70  PHE 1 CA    1 
ATOM   538   C  C     . PHE A  1  70  ? 32.737  -19.158  127.091  1.00 75.41  ? 70  PHE 1 C     1 
ATOM   539   O  O     . PHE A  1  70  ? 33.403  -19.884  127.836  1.00 73.94  ? 70  PHE 1 O     1 
ATOM   540   C  CB    . PHE A  1  70  ? 33.483  -19.651  124.736  1.00 72.57  ? 70  PHE 1 CB    1 
ATOM   541   C  CG    . PHE A  1  70  ? 32.231  -19.789  123.891  1.00 66.91  ? 70  PHE 1 CG    1 
ATOM   542   C  CD1   . PHE A  1  70  ? 31.265  -20.726  124.198  1.00 63.53  ? 70  PHE 1 CD1   1 
ATOM   543   C  CD2   . PHE A  1  70  ? 32.016  -18.961  122.799  1.00 63.78  ? 70  PHE 1 CD2   1 
ATOM   544   C  CE1   . PHE A  1  70  ? 30.115  -20.833  123.435  1.00 61.48  ? 70  PHE 1 CE1   1 
ATOM   545   C  CE2   . PHE A  1  70  ? 30.863  -19.072  122.037  1.00 60.92  ? 70  PHE 1 CE2   1 
ATOM   546   C  CZ    . PHE A  1  70  ? 29.917  -20.007  122.359  1.00 59.95  ? 70  PHE 1 CZ    1 
ATOM   547   N  N     . PRO A  1  71  ? 31.457  -18.849  127.370  1.00 76.59  ? 71  PRO 1 N     1 
ATOM   548   C  CA    . PRO A  1  71  ? 30.827  -19.356  128.595  1.00 75.47  ? 71  PRO 1 CA    1 
ATOM   549   C  C     . PRO A  1  71  ? 30.842  -20.871  128.670  1.00 74.57  ? 71  PRO 1 C     1 
ATOM   550   O  O     . PRO A  1  71  ? 30.205  -21.570  127.872  1.00 70.62  ? 71  PRO 1 O     1 
ATOM   551   C  CB    . PRO A  1  71  ? 29.400  -18.802  128.507  1.00 75.03  ? 71  PRO 1 CB    1 
ATOM   552   C  CG    . PRO A  1  71  ? 29.547  -17.556  127.695  1.00 75.18  ? 71  PRO 1 CG    1 
ATOM   553   C  CD    . PRO A  1  71  ? 30.577  -17.898  126.660  1.00 76.76  ? 71  PRO 1 CD    1 
ATOM   554   N  N     . THR A  1  72  ? 31.599  -21.379  129.644  1.00 76.68  ? 72  THR 1 N     1 
ATOM   555   C  CA    . THR A  1  72  ? 31.752  -22.816  129.783  1.00 74.50  ? 72  THR 1 CA    1 
ATOM   556   C  C     . THR A  1  72  ? 30.415  -23.477  130.052  1.00 75.86  ? 72  THR 1 C     1 
ATOM   557   O  O     . THR A  1  72  ? 30.240  -24.652  129.725  1.00 74.73  ? 72  THR 1 O     1 
ATOM   558   C  CB    . THR A  1  72  ? 32.757  -23.138  130.890  1.00 69.30  ? 72  THR 1 CB    1 
ATOM   559   O  OG1   . THR A  1  72  ? 32.096  -23.129  132.160  1.00 68.94  ? 72  THR 1 OG1   1 
ATOM   560   C  CG2   . THR A  1  72  ? 33.869  -22.109  130.904  1.00 65.35  ? 72  THR 1 CG2   1 
ATOM   561   N  N     . GLY A  1  73  ? 29.457  -22.732  130.605  1.00 77.73  ? 73  GLY 1 N     1 
ATOM   562   C  CA    . GLY A  1  73  ? 28.114  -23.270  130.746  1.00 79.79  ? 73  GLY 1 CA    1 
ATOM   563   C  C     . GLY A  1  73  ? 27.469  -23.516  129.395  1.00 81.42  ? 73  GLY 1 C     1 
ATOM   564   O  O     . GLY A  1  73  ? 26.967  -24.609  129.123  1.00 83.71  ? 73  GLY 1 O     1 
ATOM   565   N  N     . LEU A  1  74  ? 27.480  -22.500  128.525  1.00 77.25  ? 74  LEU 1 N     1 
ATOM   566   C  CA    . LEU A  1  74  ? 26.973  -22.668  127.165  1.00 70.99  ? 74  LEU 1 CA    1 
ATOM   567   C  C     . LEU A  1  74  ? 27.833  -23.644  126.379  1.00 65.38  ? 74  LEU 1 C     1 
ATOM   568   O  O     . LEU A  1  74  ? 27.321  -24.382  125.527  1.00 66.83  ? 74  LEU 1 O     1 
ATOM   569   C  CB    . LEU A  1  74  ? 26.895  -21.312  126.466  1.00 72.01  ? 74  LEU 1 CB    1 
ATOM   570   C  CG    . LEU A  1  74  ? 26.402  -21.288  125.019  1.00 73.14  ? 74  LEU 1 CG    1 
ATOM   571   C  CD1   . LEU A  1  74  ? 24.926  -21.612  124.952  1.00 74.65  ? 74  LEU 1 CD1   1 
ATOM   572   C  CD2   . LEU A  1  74  ? 26.666  -19.931  124.398  1.00 72.05  ? 74  LEU 1 CD2   1 
ATOM   573   N  N     . LYS A  1  75  ? 29.136  -23.653  126.651  1.00 61.14  ? 75  LYS 1 N     1 
ATOM   574   C  CA    . LYS A  1  75  ? 30.034  -24.616  126.022  1.00 63.14  ? 75  LYS 1 CA    1 
ATOM   575   C  C     . LYS A  1  75  ? 29.606  -26.051  126.318  1.00 58.45  ? 75  LYS 1 C     1 
ATOM   576   O  O     . LYS A  1  75  ? 29.538  -26.894  125.416  1.00 53.56  ? 75  LYS 1 O     1 
ATOM   577   C  CB    . LYS A  1  75  ? 31.459  -24.361  126.510  1.00 63.98  ? 75  LYS 1 CB    1 
ATOM   578   C  CG    . LYS A  1  75  ? 32.509  -25.148  125.783  1.00 65.55  ? 75  LYS 1 CG    1 
ATOM   579   C  CD    . LYS A  1  75  ? 33.866  -24.923  126.410  1.00 68.38  ? 75  LYS 1 CD    1 
ATOM   580   C  CE    . LYS A  1  75  ? 34.975  -25.256  125.443  1.00 72.52  ? 75  LYS 1 CE    1 
ATOM   581   N  NZ    . LYS A  1  75  ? 36.299  -25.128  126.104  1.00 74.99  ? 75  LYS 1 NZ    1 
ATOM   582   N  N     . TRP A  1  76  ? 29.327  -26.350  127.588  1.00 62.16  ? 76  TRP 1 N     1 
ATOM   583   C  CA    . TRP A  1  76  ? 28.833  -27.671  127.955  1.00 60.19  ? 76  TRP 1 CA    1 
ATOM   584   C  C     . TRP A  1  76  ? 27.421  -27.884  127.434  1.00 60.32  ? 76  TRP 1 C     1 
ATOM   585   O  O     . TRP A  1  76  ? 27.014  -29.025  127.178  1.00 62.45  ? 76  TRP 1 O     1 
ATOM   586   C  CB    . TRP A  1  76  ? 28.875  -27.849  129.476  1.00 60.71  ? 76  TRP 1 CB    1 
ATOM   587   C  CG    . TRP A  1  76  ? 30.242  -27.692  130.090  1.00 63.46  ? 76  TRP 1 CG    1 
ATOM   588   C  CD1   . TRP A  1  76  ? 31.405  -27.449  129.433  1.00 66.16  ? 76  TRP 1 CD1   1 
ATOM   589   C  CD2   . TRP A  1  76  ? 30.582  -27.781  131.483  1.00 64.67  ? 76  TRP 1 CD2   1 
ATOM   590   N  NE1   . TRP A  1  76  ? 32.447  -27.371  130.322  1.00 64.87  ? 76  TRP 1 NE1   1 
ATOM   591   C  CE2   . TRP A  1  76  ? 31.968  -27.574  131.587  1.00 61.50  ? 76  TRP 1 CE2   1 
ATOM   592   C  CE3   . TRP A  1  76  ? 29.850  -28.015  132.648  1.00 68.22  ? 76  TRP 1 CE3   1 
ATOM   593   C  CZ2   . TRP A  1  76  ? 32.635  -27.596  132.803  1.00 58.68  ? 76  TRP 1 CZ2   1 
ATOM   594   C  CZ3   . TRP A  1  76  ? 30.517  -28.036  133.856  1.00 66.94  ? 76  TRP 1 CZ3   1 
ATOM   595   C  CH2   . TRP A  1  76  ? 31.892  -27.826  133.924  1.00 62.48  ? 76  TRP 1 CH2   1 
ATOM   596   N  N     . SER A  1  77  ? 26.669  -26.796  127.260  1.00 56.96  ? 77  SER 1 N     1 
ATOM   597   C  CA    . SER A  1  77  ? 25.338  -26.901  126.689  1.00 58.04  ? 77  SER 1 CA    1 
ATOM   598   C  C     . SER A  1  77  ? 25.396  -27.261  125.215  1.00 57.09  ? 77  SER 1 C     1 
ATOM   599   O  O     . SER A  1  77  ? 24.405  -27.756  124.670  1.00 58.59  ? 77  SER 1 O     1 
ATOM   600   C  CB    . SER A  1  77  ? 24.580  -25.585  126.891  1.00 60.01  ? 77  SER 1 CB    1 
ATOM   601   O  OG    . SER A  1  77  ? 24.829  -24.672  125.835  1.00 61.08  ? 77  SER 1 OG    1 
ATOM   602   N  N     . PHE A  1  78  ? 26.539  -27.045  124.568  1.00 55.62  ? 78  PHE 1 N     1 
ATOM   603   C  CA    . PHE A  1  78  ? 26.700  -27.480  123.189  1.00 55.84  ? 78  PHE 1 CA    1 
ATOM   604   C  C     . PHE A  1  78  ? 26.983  -28.973  123.078  1.00 54.31  ? 78  PHE 1 C     1 
ATOM   605   O  O     . PHE A  1  78  ? 26.838  -29.535  121.989  1.00 53.82  ? 78  PHE 1 O     1 
ATOM   606   C  CB    . PHE A  1  78  ? 27.819  -26.698  122.500  1.00 57.17  ? 78  PHE 1 CB    1 
ATOM   607   C  CG    . PHE A  1  78  ? 27.464  -25.267  122.208  1.00 56.05  ? 78  PHE 1 CG    1 
ATOM   608   C  CD1   . PHE A  1  78  ? 26.159  -24.904  121.941  1.00 55.73  ? 78  PHE 1 CD1   1 
ATOM   609   C  CD2   . PHE A  1  78  ? 28.444  -24.295  122.158  1.00 52.64  ? 78  PHE 1 CD2   1 
ATOM   610   C  CE1   . PHE A  1  78  ? 25.830  -23.592  121.669  1.00 54.39  ? 78  PHE 1 CE1   1 
ATOM   611   C  CE2   . PHE A  1  78  ? 28.113  -22.985  121.876  1.00 51.32  ? 78  PHE 1 CE2   1 
ATOM   612   C  CZ    . PHE A  1  78  ? 26.808  -22.636  121.634  1.00 49.43  ? 78  PHE 1 CZ    1 
ATOM   613   N  N     . MET A  1  79  ? 27.377  -29.624  124.172  1.00 55.25  ? 79  MET 1 N     1 
ATOM   614   C  CA    . MET A  1  79  ? 27.657  -31.047  124.149  1.00 60.13  ? 79  MET 1 CA    1 
ATOM   615   C  C     . MET A  1  79  ? 26.398  -31.823  123.784  1.00 64.69  ? 79  MET 1 C     1 
ATOM   616   O  O     . MET A  1  79  ? 25.281  -31.319  123.938  1.00 65.86  ? 79  MET 1 O     1 
ATOM   617   C  CB    . MET A  1  79  ? 28.159  -31.512  125.513  1.00 65.98  ? 79  MET 1 CB    1 
ATOM   618   C  CG    . MET A  1  79  ? 29.546  -31.059  125.868  1.00 68.66  ? 79  MET 1 CG    1 
ATOM   619   S  SD    . MET A  1  79  ? 30.768  -32.248  125.276  1.00 68.37  ? 79  MET 1 SD    1 
ATOM   620   C  CE    . MET A  1  79  ? 30.226  -33.774  126.039  1.00 66.20  ? 79  MET 1 CE    1 
ATOM   621   N  N     . PRO A  1  80  ? 26.552  -33.059  123.303  1.00 68.59  ? 80  PRO 1 N     1 
ATOM   622   C  CA    . PRO A  1  80  ? 25.361  -33.872  123.030  1.00 70.95  ? 80  PRO 1 CA    1 
ATOM   623   C  C     . PRO A  1  80  ? 24.523  -34.094  124.267  1.00 74.45  ? 80  PRO 1 C     1 
ATOM   624   O  O     . PRO A  1  80  ? 23.298  -34.237  124.162  1.00 78.77  ? 80  PRO 1 O     1 
ATOM   625   C  CB    . PRO A  1  80  ? 25.959  -35.181  122.503  1.00 68.80  ? 80  PRO 1 CB    1 
ATOM   626   C  CG    . PRO A  1  80  ? 27.251  -34.766  121.913  1.00 69.17  ? 80  PRO 1 CG    1 
ATOM   627   C  CD    . PRO A  1  80  ? 27.776  -33.757  122.884  1.00 70.42  ? 80  PRO 1 CD    1 
ATOM   628   N  N     . LYS A  1  81  ? 25.168  -34.165  125.431  1.00 73.51  ? 81  LYS 1 N     1 
ATOM   629   C  CA    . LYS A  1  81  ? 24.534  -34.141  126.742  1.00 76.58  ? 81  LYS 1 CA    1 
ATOM   630   C  C     . LYS A  1  81  ? 23.798  -35.443  127.029  1.00 77.00  ? 81  LYS 1 C     1 
ATOM   631   O  O     . LYS A  1  81  ? 23.435  -35.707  128.179  1.00 77.64  ? 81  LYS 1 O     1 
ATOM   632   C  CB    . LYS A  1  81  ? 23.572  -32.947  126.819  1.00 79.29  ? 81  LYS 1 CB    1 
ATOM   633   C  CG    . LYS A  1  81  ? 23.143  -32.495  128.203  1.00 77.70  ? 81  LYS 1 CG    1 
ATOM   634   C  CD    . LYS A  1  81  ? 22.530  -31.097  128.123  1.00 70.70  ? 81  LYS 1 CD    1 
ATOM   635   C  CE    . LYS A  1  81  ? 23.557  -30.028  128.442  1.00 64.82  ? 81  LYS 1 CE    1 
ATOM   636   N  NZ    . LYS A  1  81  ? 24.660  -30.009  127.438  1.00 61.60  ? 81  LYS 1 NZ    1 
ATOM   637   N  N     . ASP A  1  82  ? 23.567  -36.250  125.992  1.00 76.05  ? 82  ASP 1 N     1 
ATOM   638   C  CA    . ASP A  1  82  ? 23.257  -37.671  126.094  1.00 75.86  ? 82  ASP 1 CA    1 
ATOM   639   C  C     . ASP A  1  82  ? 23.286  -38.294  124.702  1.00 79.17  ? 82  ASP 1 C     1 
ATOM   640   O  O     . ASP A  1  82  ? 22.543  -37.856  123.817  1.00 82.44  ? 82  ASP 1 O     1 
ATOM   641   C  CB    . ASP A  1  82  ? 21.907  -37.910  126.769  1.00 73.67  ? 82  ASP 1 CB    1 
ATOM   642   C  CG    . ASP A  1  82  ? 21.888  -39.194  127.571  1.00 75.90  ? 82  ASP 1 CG    1 
ATOM   643   O  OD1   . ASP A  1  82  ? 22.203  -40.262  127.007  1.00 77.15  ? 82  ASP 1 OD1   1 
ATOM   644   O  OD2   . ASP A  1  82  ? 21.594  -39.133  128.780  1.00 76.65  ? 82  ASP 1 OD2   1 
ATOM   645   N  N     . ASP A  1  83  ? 24.162  -39.277  124.480  1.00 73.67  ? 83  ASP 1 N     1 
ATOM   646   C  CA    . ASP A  1  83  ? 24.181  -39.980  123.201  1.00 61.00  ? 83  ASP 1 CA    1 
ATOM   647   C  C     . ASP A  1  83  ? 24.382  -41.483  123.309  1.00 61.45  ? 83  ASP 1 C     1 
ATOM   648   O  O     . ASP A  1  83  ? 24.129  -42.178  122.323  1.00 59.74  ? 83  ASP 1 O     1 
ATOM   649   C  CB    . ASP A  1  83  ? 25.260  -39.390  122.286  1.00 52.47  ? 83  ASP 1 CB    1 
ATOM   650   C  CG    . ASP A  1  83  ? 26.614  -39.381  122.931  1.00 50.62  ? 83  ASP 1 CG    1 
ATOM   651   O  OD1   . ASP A  1  83  ? 26.691  -39.643  124.145  1.00 51.76  ? 83  ASP 1 OD1   1 
ATOM   652   O  OD2   . ASP A  1  83  ? 27.607  -39.091  122.238  1.00 50.04  ? 83  ASP 1 OD2   1 
ATOM   653   N  N     . GLY A  1  84  ? 24.799  -42.012  124.460  1.00 64.64  ? 84  GLY 1 N     1 
ATOM   654   C  CA    . GLY A  1  84  ? 25.127  -43.416  124.611  1.00 69.02  ? 84  GLY 1 CA    1 
ATOM   655   C  C     . GLY A  1  84  ? 26.594  -43.757  124.432  1.00 71.11  ? 84  GLY 1 C     1 
ATOM   656   O  O     . GLY A  1  84  ? 27.027  -44.827  124.875  1.00 70.25  ? 84  GLY 1 O     1 
ATOM   657   N  N     . LYS A  1  85  ? 27.365  -42.885  123.794  1.00 73.43  ? 85  LYS 1 N     1 
ATOM   658   C  CA    . LYS A  1  85  ? 28.798  -43.060  123.634  1.00 75.58  ? 85  LYS 1 CA    1 
ATOM   659   C  C     . LYS A  1  85  ? 29.534  -42.598  124.889  1.00 75.85  ? 85  LYS 1 C     1 
ATOM   660   O  O     . LYS A  1  85  ? 29.014  -41.824  125.700  1.00 72.90  ? 85  LYS 1 O     1 
ATOM   661   C  CB    . LYS A  1  85  ? 29.312  -42.278  122.431  1.00 78.41  ? 85  LYS 1 CB    1 
ATOM   662   C  CG    . LYS A  1  85  ? 28.895  -42.798  121.076  1.00 79.43  ? 85  LYS 1 CG    1 
ATOM   663   C  CD    . LYS A  1  85  ? 29.603  -41.990  119.992  1.00 81.26  ? 85  LYS 1 CD    1 
ATOM   664   C  CE    . LYS A  1  85  ? 30.059  -42.852  118.831  1.00 83.47  ? 85  LYS 1 CE    1 
ATOM   665   N  NZ    . LYS A  1  85  ? 30.398  -42.013  117.648  1.00 85.04  ? 85  LYS 1 NZ    1 
ATOM   666   N  N     . GLN A  1  86  ? 30.754  -43.100  125.051  1.00 76.05  ? 86  GLN 1 N     1 
ATOM   667   C  CA    . GLN A  1  86  ? 31.645  -42.595  126.086  1.00 74.73  ? 86  GLN 1 CA    1 
ATOM   668   C  C     . GLN A  1  86  ? 32.106  -41.179  125.748  1.00 74.74  ? 86  GLN 1 C     1 
ATOM   669   O  O     . GLN A  1  86  ? 32.408  -40.867  124.595  1.00 73.42  ? 86  GLN 1 O     1 
ATOM   670   C  CB    . GLN A  1  86  ? 32.854  -43.524  126.232  1.00 71.64  ? 86  GLN 1 CB    1 
ATOM   671   C  CG    . GLN A  1  86  ? 34.067  -42.894  126.888  1.00 69.93  ? 86  GLN 1 CG    1 
ATOM   672   C  CD    . GLN A  1  86  ? 33.956  -42.872  128.392  1.00 71.16  ? 86  GLN 1 CD    1 
ATOM   673   O  OE1   . GLN A  1  86  ? 33.087  -42.209  128.950  1.00 71.65  ? 86  GLN 1 OE1   1 
ATOM   674   N  NE2   . GLN A  1  86  ? 34.849  -43.583  129.063  1.00 72.33  ? 86  GLN 1 NE2   1 
ATOM   675   N  N     . HIS A  1  87  ? 32.138  -40.310  126.749  1.00 50.04  ? 87  HIS 1 N     1 
ATOM   676   C  CA    . HIS A  1  87  ? 32.658  -38.960  126.576  1.00 58.30  ? 87  HIS 1 CA    1 
ATOM   677   C  C     . HIS A  1  87  ? 33.941  -38.792  127.372  1.00 61.96  ? 87  HIS 1 C     1 
ATOM   678   O  O     . HIS A  1  87  ? 34.268  -39.600  128.245  1.00 64.87  ? 87  HIS 1 O     1 
ATOM   679   C  CB    . HIS A  1  87  ? 31.651  -37.883  127.004  1.00 65.65  ? 87  HIS 1 CB    1 
ATOM   680   C  CG    . HIS A  1  87  ? 30.297  -38.052  126.396  1.00 73.11  ? 87  HIS 1 CG    1 
ATOM   681   N  ND1   . HIS A  1  87  ? 29.183  -37.400  126.882  1.00 77.55  ? 87  HIS 1 ND1   1 
ATOM   682   C  CD2   . HIS A  1  87  ? 29.877  -38.790  125.340  1.00 77.13  ? 87  HIS 1 CD2   1 
ATOM   683   C  CE1   . HIS A  1  87  ? 28.132  -37.732  126.155  1.00 78.00  ? 87  HIS 1 CE1   1 
ATOM   684   N  NE2   . HIS A  1  87  ? 28.526  -38.574  125.214  1.00 77.90  ? 87  HIS 1 NE2   1 
ATOM   685   N  N     . TYR A  1  88  ? 34.689  -37.747  127.033  1.00 61.98  ? 88  TYR 1 N     1 
ATOM   686   C  CA    . TYR A  1  88  ? 35.967  -37.476  127.675  1.00 62.81  ? 88  TYR 1 CA    1 
ATOM   687   C  C     . TYR A  1  88  ? 36.011  -36.022  128.125  1.00 67.85  ? 88  TYR 1 C     1 
ATOM   688   O  O     . TYR A  1  88  ? 35.447  -35.140  127.466  1.00 73.83  ? 88  TYR 1 O     1 
ATOM   689   C  CB    . TYR A  1  88  ? 37.146  -37.766  126.723  1.00 59.20  ? 88  TYR 1 CB    1 
ATOM   690   C  CG    . TYR A  1  88  ? 37.324  -39.230  126.339  1.00 55.70  ? 88  TYR 1 CG    1 
ATOM   691   C  CD1   . TYR A  1  88  ? 38.037  -40.109  127.137  1.00 53.09  ? 88  TYR 1 CD1   1 
ATOM   692   C  CD2   . TYR A  1  88  ? 36.781  -39.725  125.172  1.00 51.24  ? 88  TYR 1 CD2   1 
ATOM   693   C  CE1   . TYR A  1  88  ? 38.198  -41.433  126.772  1.00 48.57  ? 88  TYR 1 CE1   1 
ATOM   694   C  CE2   . TYR A  1  88  ? 36.939  -41.039  124.810  1.00 48.49  ? 88  TYR 1 CE2   1 
ATOM   695   C  CZ    . TYR A  1  88  ? 37.642  -41.888  125.607  1.00 49.19  ? 88  TYR 1 CZ    1 
ATOM   696   O  OH    . TYR A  1  88  ? 37.783  -43.202  125.223  1.00 53.50  ? 88  TYR 1 OH    1 
ATOM   697   N  N     . LEU A  1  89  ? 36.635  -35.780  129.275  1.00 66.81  ? 89  LEU 1 N     1 
ATOM   698   C  CA    . LEU A  1  89  ? 36.939  -34.434  129.746  1.00 69.02  ? 89  LEU 1 CA    1 
ATOM   699   C  C     . LEU A  1  89  ? 38.445  -34.227  129.666  1.00 77.36  ? 89  LEU 1 C     1 
ATOM   700   O  O     . LEU A  1  89  ? 39.217  -35.038  130.191  1.00 76.41  ? 89  LEU 1 O     1 
ATOM   701   C  CB    . LEU A  1  89  ? 36.451  -34.210  131.180  1.00 63.80  ? 89  LEU 1 CB    1 
ATOM   702   C  CG    . LEU A  1  89  ? 36.726  -32.828  131.803  1.00 57.33  ? 89  LEU 1 CG    1 
ATOM   703   C  CD1   . LEU A  1  89  ? 36.176  -31.648  130.994  1.00 49.04  ? 89  LEU 1 CD1   1 
ATOM   704   C  CD2   . LEU A  1  89  ? 36.263  -32.777  133.255  1.00 57.55  ? 89  LEU 1 CD2   1 
ATOM   705   N  N     . ILE A  1  90  ? 38.866  -33.148  129.017  1.00 87.33  ? 90  ILE 1 N     1 
ATOM   706   C  CA    . ILE A  1  90  ? 40.276  -32.917  128.743  1.00 96.78  ? 90  ILE 1 CA    1 
ATOM   707   C  C     . ILE A  1  90  ? 40.759  -31.772  129.614  1.00 106.16 ? 90  ILE 1 C     1 
ATOM   708   O  O     . ILE A  1  90  ? 40.229  -30.655  129.549  1.00 105.67 ? 90  ILE 1 O     1 
ATOM   709   C  CB    . ILE A  1  90  ? 40.529  -32.624  127.256  1.00 95.80  ? 90  ILE 1 CB    1 
ATOM   710   C  CG1   . ILE A  1  90  ? 40.248  -33.872  126.413  1.00 93.21  ? 90  ILE 1 CG1   1 
ATOM   711   C  CG2   . ILE A  1  90  ? 41.952  -32.131  127.044  1.00 96.84  ? 90  ILE 1 CG2   1 
ATOM   712   C  CD1   . ILE A  1  90  ? 40.710  -33.778  124.975  1.00 90.08  ? 90  ILE 1 CD1   1 
ATOM   713   N  N     . CYS A  1  91  ? 41.756  -32.052  130.441  1.00 115.23 ? 91  CYS 1 N     1 
ATOM   714   C  CA    . CYS A  1  91  ? 42.454  -31.014  131.177  1.00 124.37 ? 91  CYS 1 CA    1 
ATOM   715   C  C     . CYS A  1  91  ? 43.617  -30.539  130.315  1.00 120.66 ? 91  CYS 1 C     1 
ATOM   716   O  O     . CYS A  1  91  ? 44.504  -31.333  129.981  1.00 120.85 ? 91  CYS 1 O     1 
ATOM   717   C  CB    . CYS A  1  91  ? 42.947  -31.546  132.517  1.00 139.52 ? 91  CYS 1 CB    1 
ATOM   718   S  SG    . CYS A  1  91  ? 43.699  -30.294  133.552  1.00 156.07 ? 91  CYS 1 SG    1 
ATOM   719   N  N     . ASN A  1  92  ? 43.612  -29.256  129.948  1.00 115.59 ? 92  ASN 1 N     1 
ATOM   720   C  CA    . ASN A  1  92  ? 44.653  -28.681  129.090  1.00 110.08 ? 92  ASN 1 CA    1 
ATOM   721   C  C     . ASN A  1  92  ? 45.704  -28.050  129.987  1.00 105.44 ? 92  ASN 1 C     1 
ATOM   722   O  O     . ASN A  1  92  ? 45.645  -26.864  130.317  1.00 104.26 ? 92  ASN 1 O     1 
ATOM   723   C  CB    . ASN A  1  92  ? 44.069  -27.665  128.111  1.00 109.78 ? 92  ASN 1 CB    1 
ATOM   724   C  CG    . ASN A  1  92  ? 45.099  -27.154  127.096  1.00 109.68 ? 92  ASN 1 CG    1 
ATOM   725   O  OD1   . ASN A  1  92  ? 46.197  -27.693  126.982  1.00 109.89 ? 92  ASN 1 OD1   1 
ATOM   726   N  ND2   . ASN A  1  92  ? 44.724  -26.133  126.331  1.00 109.29 ? 92  ASN 1 ND2   1 
ATOM   727   N  N     . ALA A  1  93  ? 46.681  -28.864  130.380  1.00 102.50 ? 93  ALA 1 N     1 
ATOM   728   C  CA    . ALA A  1  93  ? 47.761  -28.449  131.260  1.00 99.00  ? 93  ALA 1 CA    1 
ATOM   729   C  C     . ALA A  1  93  ? 49.010  -28.019  130.497  1.00 97.17  ? 93  ALA 1 C     1 
ATOM   730   O  O     . ALA A  1  93  ? 50.084  -27.897  131.096  1.00 97.41  ? 93  ALA 1 O     1 
ATOM   731   C  CB    . ALA A  1  93  ? 48.101  -29.574  132.237  1.00 97.11  ? 93  ALA 1 CB    1 
ATOM   732   N  N     . ASP A  1  94  ? 48.900  -27.793  129.194  1.00 94.81  ? 94  ASP 1 N     1 
ATOM   733   C  CA    . ASP A  1  94  ? 50.005  -27.242  128.421  1.00 92.18  ? 94  ASP 1 CA    1 
ATOM   734   C  C     . ASP A  1  94  ? 50.025  -25.735  128.654  1.00 94.46  ? 94  ASP 1 C     1 
ATOM   735   O  O     . ASP A  1  94  ? 49.162  -25.012  128.145  1.00 95.32  ? 94  ASP 1 O     1 
ATOM   736   C  CB    . ASP A  1  94  ? 49.832  -27.580  126.944  1.00 88.50  ? 94  ASP 1 CB    1 
ATOM   737   C  CG    . ASP A  1  94  ? 50.988  -27.102  126.100  1.00 88.54  ? 94  ASP 1 CG    1 
ATOM   738   O  OD1   . ASP A  1  94  ? 51.986  -27.838  125.971  1.00 88.41  ? 94  ASP 1 OD1   1 
ATOM   739   O  OD2   . ASP A  1  94  ? 50.898  -25.986  125.558  1.00 90.18  ? 94  ASP 1 OD2   1 
ATOM   740   N  N     . GLU A  1  95  ? 50.986  -25.258  129.444  1.00 94.62  ? 95  GLU 1 N     1 
ATOM   741   C  CA    . GLU A  1  95  ? 51.144  -23.833  129.737  1.00 92.69  ? 95  GLU 1 CA    1 
ATOM   742   C  C     . GLU A  1  95  ? 52.421  -23.376  129.036  1.00 86.96  ? 95  GLU 1 C     1 
ATOM   743   O  O     . GLU A  1  95  ? 53.528  -23.582  129.540  1.00 86.89  ? 95  GLU 1 O     1 
ATOM   744   C  CB    . GLU A  1  95  ? 51.190  -23.584  131.252  1.00 93.24  ? 95  GLU 1 CB    1 
ATOM   745   C  CG    . GLU A  1  95  ? 51.560  -22.156  131.682  1.00 91.77  ? 95  GLU 1 CG    1 
ATOM   746   C  CD    . GLU A  1  95  ? 51.674  -22.003  133.195  1.00 89.68  ? 95  GLU 1 CD    1 
ATOM   747   O  OE1   . GLU A  1  95  ? 52.423  -22.773  133.828  1.00 84.53  ? 95  GLU 1 OE1   1 
ATOM   748   O  OE2   . GLU A  1  95  ? 50.994  -21.115  133.753  1.00 87.78  ? 95  GLU 1 OE2   1 
ATOM   749   N  N     . SER A  1  96  ? 52.270  -22.757  127.870  1.00 81.83  ? 96  SER 1 N     1 
ATOM   750   C  CA    . SER A  1  96  ? 53.428  -22.391  127.080  1.00 81.55  ? 96  SER 1 CA    1 
ATOM   751   C  C     . SER A  1  96  ? 53.531  -20.913  126.732  1.00 85.50  ? 96  SER 1 C     1 
ATOM   752   O  O     . SER A  1  96  ? 54.564  -20.507  126.186  1.00 85.91  ? 96  SER 1 O     1 
ATOM   753   C  CB    . SER A  1  96  ? 53.458  -23.212  125.785  1.00 80.96  ? 96  SER 1 CB    1 
ATOM   754   O  OG    . SER A  1  96  ? 53.493  -24.592  126.086  1.00 81.57  ? 96  SER 1 OG    1 
ATOM   755   N  N     . GLU A  1  97  ? 52.524  -20.102  127.018  1.00 88.00  ? 97  GLU 1 N     1 
ATOM   756   C  CA    . GLU A  1  97  ? 52.636  -18.681  126.709  1.00 88.57  ? 97  GLU 1 CA    1 
ATOM   757   C  C     . GLU A  1  97  ? 53.664  -18.046  127.639  1.00 89.50  ? 97  GLU 1 C     1 
ATOM   758   O  O     . GLU A  1  97  ? 53.618  -18.276  128.851  1.00 88.86  ? 97  GLU 1 O     1 
ATOM   759   C  CB    . GLU A  1  97  ? 51.291  -17.975  126.861  1.00 90.20  ? 97  GLU 1 CB    1 
ATOM   760   C  CG    . GLU A  1  97  ? 51.351  -16.480  126.586  1.00 94.02  ? 97  GLU 1 CG    1 
ATOM   761   C  CD    . GLU A  1  97  ? 51.149  -16.143  125.111  1.00 97.41  ? 97  GLU 1 CD    1 
ATOM   762   O  OE1   . GLU A  1  97  ? 49.991  -15.959  124.684  1.00 97.87  ? 97  GLU 1 OE1   1 
ATOM   763   O  OE2   . GLU A  1  97  ? 52.145  -16.109  124.363  1.00 98.62  ? 97  GLU 1 OE2   1 
ATOM   764   N  N     . PRO A  1  98  ? 54.614  -17.276  127.115  1.00 93.43  ? 98  PRO 1 N     1 
ATOM   765   C  CA    . PRO A  1  98  ? 55.589  -16.603  127.984  1.00 98.94  ? 98  PRO 1 CA    1 
ATOM   766   C  C     . PRO A  1  98  ? 54.910  -15.619  128.928  1.00 103.28 ? 98  PRO 1 C     1 
ATOM   767   O  O     . PRO A  1  98  ? 53.874  -15.029  128.612  1.00 104.03 ? 98  PRO 1 O     1 
ATOM   768   C  CB    . PRO A  1  98  ? 56.513  -15.887  126.992  1.00 97.63  ? 98  PRO 1 CB    1 
ATOM   769   C  CG    . PRO A  1  98  ? 56.370  -16.683  125.726  1.00 94.19  ? 98  PRO 1 CG    1 
ATOM   770   C  CD    . PRO A  1  98  ? 54.950  -17.142  125.689  1.00 92.50  ? 98  PRO 1 CD    1 
ATOM   771   N  N     . GLY A  1  99  ? 55.511  -15.434  130.104  1.00 103.64 ? 99  GLY 1 N     1 
ATOM   772   C  CA    . GLY A  1  99  ? 54.904  -14.608  131.127  1.00 103.29 ? 99  GLY 1 CA    1 
ATOM   773   C  C     . GLY A  1  99  ? 53.784  -15.255  131.917  1.00 103.32 ? 99  GLY 1 C     1 
ATOM   774   O  O     . GLY A  1  99  ? 53.237  -14.605  132.819  1.00 103.52 ? 99  GLY 1 O     1 
ATOM   775   N  N     . SER A  1  100 ? 53.425  -16.508  131.617  1.00 102.23 ? 100 SER 1 N     1 
ATOM   776   C  CA    . SER A  1  100 ? 52.337  -17.222  132.285  1.00 98.07  ? 100 SER 1 CA    1 
ATOM   777   C  C     . SER A  1  100 ? 52.933  -18.332  133.141  1.00 89.73  ? 100 SER 1 C     1 
ATOM   778   O  O     . SER A  1  100 ? 53.459  -19.319  132.610  1.00 88.82  ? 100 SER 1 O     1 
ATOM   779   C  CB    . SER A  1  100 ? 51.347  -17.796  131.274  1.00 100.72 ? 100 SER 1 CB    1 
ATOM   780   O  OG    . SER A  1  100 ? 50.465  -18.724  131.889  1.00 101.49 ? 100 SER 1 OG    1 
ATOM   781   N  N     . PHE A  1  101 ? 52.856  -18.158  134.465  1.00 82.73  ? 101 PHE 1 N     1 
ATOM   782   C  CA    . PHE A  1  101 ? 53.366  -19.117  135.436  1.00 77.29  ? 101 PHE 1 CA    1 
ATOM   783   C  C     . PHE A  1  101 ? 52.369  -19.329  136.569  1.00 72.03  ? 101 PHE 1 C     1 
ATOM   784   O  O     . PHE A  1  101 ? 52.755  -19.708  137.681  1.00 70.85  ? 101 PHE 1 O     1 
ATOM   785   C  CB    . PHE A  1  101 ? 54.702  -18.642  136.018  1.00 78.35  ? 101 PHE 1 CB    1 
ATOM   786   C  CG    . PHE A  1  101 ? 54.739  -17.162  136.330  1.00 80.26  ? 101 PHE 1 CG    1 
ATOM   787   C  CD1   . PHE A  1  101 ? 54.358  -16.700  137.575  1.00 79.56  ? 101 PHE 1 CD1   1 
ATOM   788   C  CD2   . PHE A  1  101 ? 55.149  -16.237  135.384  1.00 81.12  ? 101 PHE 1 CD2   1 
ATOM   789   C  CE1   . PHE A  1  101 ? 54.382  -15.349  137.871  1.00 78.61  ? 101 PHE 1 CE1   1 
ATOM   790   C  CE2   . PHE A  1  101 ? 55.171  -14.878  135.680  1.00 80.33  ? 101 PHE 1 CE2   1 
ATOM   791   C  CZ    . PHE A  1  101 ? 54.787  -14.439  136.926  1.00 78.83  ? 101 PHE 1 CZ    1 
ATOM   792   N  N     . LYS A  1  102 ? 51.083  -19.102  136.306  1.00 67.35  ? 102 LYS 1 N     1 
ATOM   793   C  CA    . LYS A  1  102 ? 50.096  -19.101  137.377  1.00 58.40  ? 102 LYS 1 CA    1 
ATOM   794   C  C     . LYS A  1  102 ? 49.583  -20.511  137.669  1.00 61.01  ? 102 LYS 1 C     1 
ATOM   795   O  O     . LYS A  1  102 ? 49.509  -20.912  138.834  1.00 64.57  ? 102 LYS 1 O     1 
ATOM   796   C  CB    . LYS A  1  102 ? 48.952  -18.127  137.037  1.00 45.08  ? 102 LYS 1 CB    1 
ATOM   797   C  CG    . LYS A  1  102 ? 48.241  -18.378  135.708  1.00 35.13  ? 102 LYS 1 CG    1 
ATOM   798   C  CD    . LYS A  1  102 ? 46.853  -17.747  135.673  1.00 29.84  ? 102 LYS 1 CD    1 
ATOM   799   C  CE    . LYS A  1  102 ? 46.102  -17.947  134.343  1.00 29.67  ? 102 LYS 1 CE    1 
ATOM   800   N  NZ    . LYS A  1  102 ? 45.816  -19.369  133.948  1.00 29.79  ? 102 LYS 1 NZ    1 
ATOM   801   N  N     . ASP A  1  103 ? 49.251  -21.288  136.630  1.00 56.14  ? 103 ASP 1 N     1 
ATOM   802   C  CA    . ASP A  1  103 ? 48.676  -22.617  136.843  1.00 50.11  ? 103 ASP 1 CA    1 
ATOM   803   C  C     . ASP A  1  103 ? 49.705  -23.634  137.321  1.00 50.15  ? 103 ASP 1 C     1 
ATOM   804   O  O     . ASP A  1  103 ? 49.327  -24.667  137.893  1.00 48.91  ? 103 ASP 1 O     1 
ATOM   805   C  CB    . ASP A  1  103 ? 48.016  -23.091  135.553  1.00 45.86  ? 103 ASP 1 CB    1 
ATOM   806   C  CG    . ASP A  1  103 ? 46.890  -22.193  135.130  1.00 47.38  ? 103 ASP 1 CG    1 
ATOM   807   O  OD1   . ASP A  1  103 ? 46.371  -21.488  136.012  1.00 48.87  ? 103 ASP 1 OD1   1 
ATOM   808   O  OD2   . ASP A  1  103 ? 46.511  -22.179  133.946  1.00 49.06  ? 103 ASP 1 OD2   1 
ATOM   809   N  N     . ARG A  1  104 ? 50.987  -23.348  137.101  1.00 52.00  ? 104 ARG 1 N     1 
ATOM   810   C  CA    . ARG A  1  104 ? 52.057  -24.255  137.492  1.00 58.47  ? 104 ARG 1 CA    1 
ATOM   811   C  C     . ARG A  1  104 ? 51.944  -24.640  138.961  1.00 62.45  ? 104 ARG 1 C     1 
ATOM   812   O  O     . ARG A  1  104 ? 51.958  -25.824  139.321  1.00 65.91  ? 104 ARG 1 O     1 
ATOM   813   C  CB    . ARG A  1  104 ? 53.400  -23.580  137.218  1.00 64.34  ? 104 ARG 1 CB    1 
ATOM   814   C  CG    . ARG A  1  104 ? 54.602  -24.372  137.683  1.00 68.80  ? 104 ARG 1 CG    1 
ATOM   815   C  CD    . ARG A  1  104 ? 55.868  -23.943  136.951  1.00 71.71  ? 104 ARG 1 CD    1 
ATOM   816   N  NE    . ARG A  1  104 ? 56.683  -23.026  137.742  1.00 72.44  ? 104 ARG 1 NE    1 
ATOM   817   C  CZ    . ARG A  1  104 ? 57.756  -23.394  138.439  1.00 74.14  ? 104 ARG 1 CZ    1 
ATOM   818   N  NH1   . ARG A  1  104 ? 58.150  -24.658  138.444  1.00 72.23  ? 104 ARG 1 NH1   1 
ATOM   819   N  NH2   . ARG A  1  104 ? 58.437  -22.494  139.130  1.00 77.71  ? 104 ARG 1 NH2   1 
ATOM   820   N  N     . TYR A  1  105 ? 51.819  -23.646  139.829  1.00 64.68  ? 105 TYR 1 N     1 
ATOM   821   C  CA    . TYR A  1  105 ? 51.828  -23.916  141.256  1.00 65.39  ? 105 TYR 1 CA    1 
ATOM   822   C  C     . TYR A  1  105 ? 50.489  -24.432  141.751  1.00 64.40  ? 105 TYR 1 C     1 
ATOM   823   O  O     . TYR A  1  105 ? 50.445  -25.057  142.814  1.00 68.14  ? 105 TYR 1 O     1 
ATOM   824   C  CB    . TYR A  1  105 ? 52.245  -22.655  142.012  1.00 68.70  ? 105 TYR 1 CB    1 
ATOM   825   C  CG    . TYR A  1  105 ? 53.563  -22.139  141.493  1.00 69.88  ? 105 TYR 1 CG    1 
ATOM   826   C  CD1   . TYR A  1  105 ? 54.717  -22.888  141.620  1.00 69.41  ? 105 TYR 1 CD1   1 
ATOM   827   C  CD2   . TYR A  1  105 ? 53.644  -20.929  140.833  1.00 71.15  ? 105 TYR 1 CD2   1 
ATOM   828   C  CE1   . TYR A  1  105 ? 55.923  -22.436  141.119  1.00 70.48  ? 105 TYR 1 CE1   1 
ATOM   829   C  CE2   . TYR A  1  105 ? 54.848  -20.469  140.333  1.00 72.68  ? 105 TYR 1 CE2   1 
ATOM   830   C  CZ    . TYR A  1  105 ? 55.985  -21.229  140.472  1.00 71.57  ? 105 TYR 1 CZ    1 
ATOM   831   O  OH    . TYR A  1  105 ? 57.192  -20.777  139.981  1.00 70.77  ? 105 TYR 1 OH    1 
ATOM   832   N  N     . ILE A  1  106 ? 49.404  -24.178  141.013  1.00 61.28  ? 106 ILE 1 N     1 
ATOM   833   C  CA    . ILE A  1  106 ? 48.145  -24.869  141.286  1.00 60.98  ? 106 ILE 1 CA    1 
ATOM   834   C  C     . ILE A  1  106 ? 48.334  -26.370  141.114  1.00 56.37  ? 106 ILE 1 C     1 
ATOM   835   O  O     . ILE A  1  106 ? 47.932  -27.176  141.964  1.00 51.35  ? 106 ILE 1 O     1 
ATOM   836   C  CB    . ILE A  1  106 ? 47.021  -24.341  140.372  1.00 63.98  ? 106 ILE 1 CB    1 
ATOM   837   C  CG1   . ILE A  1  106 ? 46.602  -22.926  140.770  1.00 65.49  ? 106 ILE 1 CG1   1 
ATOM   838   C  CG2   . ILE A  1  106 ? 45.807  -25.257  140.420  1.00 64.61  ? 106 ILE 1 CG2   1 
ATOM   839   C  CD1   . ILE A  1  106 ? 45.371  -22.445  140.034  1.00 64.87  ? 106 ILE 1 CD1   1 
ATOM   840   N  N     . LEU A  1  107 ? 48.972  -26.762  140.010  1.00 58.01  ? 107 LEU 1 N     1 
ATOM   841   C  CA    . LEU A  1  107 ? 49.211  -28.180  139.751  1.00 58.88  ? 107 LEU 1 CA    1 
ATOM   842   C  C     . LEU A  1  107 ? 50.176  -28.777  140.769  1.00 64.39  ? 107 LEU 1 C     1 
ATOM   843   O  O     . LEU A  1  107 ? 50.044  -29.945  141.149  1.00 64.22  ? 107 LEU 1 O     1 
ATOM   844   C  CB    . LEU A  1  107 ? 49.764  -28.360  138.338  1.00 55.83  ? 107 LEU 1 CB    1 
ATOM   845   C  CG    . LEU A  1  107 ? 48.909  -27.843  137.186  1.00 54.88  ? 107 LEU 1 CG    1 
ATOM   846   C  CD1   . LEU A  1  107 ? 49.495  -28.302  135.869  1.00 52.78  ? 107 LEU 1 CD1   1 
ATOM   847   C  CD2   . LEU A  1  107 ? 47.467  -28.305  137.335  1.00 56.94  ? 107 LEU 1 CD2   1 
ATOM   848   N  N     . GLU A  1  108 ? 51.161  -27.993  141.206  1.00 71.54  ? 108 GLU 1 N     1 
ATOM   849   C  CA    . GLU A  1  108 ? 52.168  -28.502  142.133  1.00 78.52  ? 108 GLU 1 CA    1 
ATOM   850   C  C     . GLU A  1  108 ? 51.647  -28.626  143.568  1.00 79.40  ? 108 GLU 1 C     1 
ATOM   851   O  O     . GLU A  1  108 ? 52.031  -29.558  144.283  1.00 75.71  ? 108 GLU 1 O     1 
ATOM   852   C  CB    . GLU A  1  108 ? 53.407  -27.605  142.093  1.00 86.09  ? 108 GLU 1 CB    1 
ATOM   853   C  CG    . GLU A  1  108 ? 54.178  -27.665  140.774  1.00 92.67  ? 108 GLU 1 CG    1 
ATOM   854   C  CD    . GLU A  1  108 ? 55.553  -27.024  140.854  1.00 99.38  ? 108 GLU 1 CD    1 
ATOM   855   O  OE1   . GLU A  1  108 ? 55.974  -26.634  141.964  1.00 101.53 ? 108 GLU 1 OE1   1 
ATOM   856   O  OE2   . GLU A  1  108 ? 56.216  -26.909  139.802  1.00 101.52 ? 108 GLU 1 OE2   1 
ATOM   857   N  N     . ASP A  1  109 ? 50.800  -27.694  144.023  1.00 84.95  ? 109 ASP 1 N     1 
ATOM   858   C  CA    . ASP A  1  109 ? 50.467  -27.585  145.440  1.00 88.71  ? 109 ASP 1 CA    1 
ATOM   859   C  C     . ASP A  1  109 ? 49.011  -27.863  145.800  1.00 91.16  ? 109 ASP 1 C     1 
ATOM   860   O  O     . ASP A  1  109 ? 48.746  -28.206  146.958  1.00 92.69  ? 109 ASP 1 O     1 
ATOM   861   C  CB    . ASP A  1  109 ? 50.836  -26.192  145.974  1.00 89.40  ? 109 ASP 1 CB    1 
ATOM   862   C  CG    . ASP A  1  109 ? 52.197  -25.725  145.495  1.00 89.22  ? 109 ASP 1 CG    1 
ATOM   863   O  OD1   . ASP A  1  109 ? 53.125  -26.556  145.406  1.00 88.50  ? 109 ASP 1 OD1   1 
ATOM   864   O  OD2   . ASP A  1  109 ? 52.340  -24.520  145.205  1.00 88.59  ? 109 ASP 1 OD2   1 
ATOM   865   N  N     . VAL A  1  110 ? 48.066  -27.715  144.874  1.00 91.72  ? 110 VAL 1 N     1 
ATOM   866   C  CA    . VAL A  1  110 ? 46.655  -27.946  145.196  1.00 91.84  ? 110 VAL 1 CA    1 
ATOM   867   C  C     . VAL A  1  110 ? 45.992  -28.822  144.133  1.00 92.00  ? 110 VAL 1 C     1 
ATOM   868   O  O     . VAL A  1  110 ? 45.070  -28.366  143.439  1.00 90.96  ? 110 VAL 1 O     1 
ATOM   869   C  CB    . VAL A  1  110 ? 45.900  -26.614  145.377  1.00 88.29  ? 110 VAL 1 CB    1 
ATOM   870   C  CG1   . VAL A  1  110 ? 46.152  -26.031  146.766  1.00 88.50  ? 110 VAL 1 CG1   1 
ATOM   871   C  CG2   . VAL A  1  110 ? 46.300  -25.604  144.316  1.00 86.48  ? 110 VAL 1 CG2   1 
ATOM   872   N  N     . PRO A  1  111 ? 46.399  -30.090  143.986  1.00 90.84  ? 111 PRO 1 N     1 
ATOM   873   C  CA    . PRO A  1  111 ? 45.832  -30.904  142.897  1.00 88.78  ? 111 PRO 1 CA    1 
ATOM   874   C  C     . PRO A  1  111 ? 44.382  -31.302  143.126  1.00 88.52  ? 111 PRO 1 C     1 
ATOM   875   O  O     . PRO A  1  111 ? 43.578  -31.292  142.182  1.00 88.11  ? 111 PRO 1 O     1 
ATOM   876   C  CB    . PRO A  1  111 ? 46.757  -32.132  142.864  1.00 87.50  ? 111 PRO 1 CB    1 
ATOM   877   C  CG    . PRO A  1  111 ? 47.956  -31.767  143.718  1.00 88.07  ? 111 PRO 1 CG    1 
ATOM   878   C  CD    . PRO A  1  111 ? 47.418  -30.833  144.745  1.00 89.25  ? 111 PRO 1 CD    1 
ATOM   879   N  N     . HIS A  1  112 ? 44.020  -31.659  144.358  1.00 88.53  ? 112 HIS 1 N     1 
ATOM   880   C  CA    . HIS A  1  112 ? 42.692  -32.206  144.608  1.00 89.33  ? 112 HIS 1 CA    1 
ATOM   881   C  C     . HIS A  1  112 ? 41.578  -31.184  144.390  1.00 84.32  ? 112 HIS 1 C     1 
ATOM   882   O  O     . HIS A  1  112 ? 40.444  -31.577  144.099  1.00 84.67  ? 112 HIS 1 O     1 
ATOM   883   C  CB    . HIS A  1  112 ? 42.650  -32.807  146.012  1.00 94.42  ? 112 HIS 1 CB    1 
ATOM   884   C  CG    . HIS A  1  112 ? 43.528  -34.014  146.167  1.00 98.94  ? 112 HIS 1 CG    1 
ATOM   885   N  ND1   . HIS A  1  112 ? 43.238  -35.224  145.568  1.00 99.63  ? 112 HIS 1 ND1   1 
ATOM   886   C  CD2   . HIS A  1  112 ? 44.688  -34.198  146.844  1.00 100.75 ? 112 HIS 1 CD2   1 
ATOM   887   C  CE1   . HIS A  1  112 ? 44.179  -36.100  145.872  1.00 100.33 ? 112 HIS 1 CE1   1 
ATOM   888   N  NE2   . HIS A  1  112 ? 45.071  -35.504  146.645  1.00 100.32 ? 112 HIS 1 NE2   1 
ATOM   889   N  N     . LEU A  1  113 ? 41.875  -29.888  144.481  1.00 78.89  ? 113 LEU 1 N     1 
ATOM   890   C  CA    . LEU A  1  113 ? 40.928  -28.886  144.002  1.00 74.84  ? 113 LEU 1 CA    1 
ATOM   891   C  C     . LEU A  1  113 ? 40.587  -29.131  142.536  1.00 77.83  ? 113 LEU 1 C     1 
ATOM   892   O  O     . LEU A  1  113 ? 39.410  -29.177  142.147  1.00 79.58  ? 113 LEU 1 O     1 
ATOM   893   C  CB    . LEU A  1  113 ? 41.519  -27.490  144.198  1.00 71.55  ? 113 LEU 1 CB    1 
ATOM   894   C  CG    . LEU A  1  113 ? 40.865  -26.304  143.485  1.00 71.77  ? 113 LEU 1 CG    1 
ATOM   895   C  CD1   . LEU A  1  113 ? 39.523  -25.976  144.086  1.00 72.33  ? 113 LEU 1 CD1   1 
ATOM   896   C  CD2   . LEU A  1  113 ? 41.779  -25.092  143.510  1.00 73.76  ? 113 LEU 1 CD2   1 
ATOM   897   N  N     . LEU A  1  114 ? 41.618  -29.308  141.710  1.00 78.20  ? 114 LEU 1 N     1 
ATOM   898   C  CA    . LEU A  1  114 ? 41.401  -29.593  140.297  1.00 74.70  ? 114 LEU 1 CA    1 
ATOM   899   C  C     . LEU A  1  114 ? 40.672  -30.916  140.097  1.00 70.28  ? 114 LEU 1 C     1 
ATOM   900   O  O     . LEU A  1  114 ? 39.814  -31.025  139.214  1.00 71.79  ? 114 LEU 1 O     1 
ATOM   901   C  CB    . LEU A  1  114 ? 42.733  -29.605  139.547  1.00 72.81  ? 114 LEU 1 CB    1 
ATOM   902   C  CG    . LEU A  1  114 ? 42.688  -30.016  138.068  1.00 71.23  ? 114 LEU 1 CG    1 
ATOM   903   C  CD1   . LEU A  1  114 ? 41.939  -29.013  137.206  1.00 70.19  ? 114 LEU 1 CD1   1 
ATOM   904   C  CD2   . LEU A  1  114 ? 44.090  -30.251  137.527  1.00 72.63  ? 114 LEU 1 CD2   1 
ATOM   905   N  N     . ILE A  1  115 ? 41.013  -31.941  140.885  1.00 62.32  ? 115 ILE 1 N     1 
ATOM   906   C  CA    . ILE A  1  115 ? 40.363  -33.236  140.701  1.00 57.63  ? 115 ILE 1 CA    1 
ATOM   907   C  C     . ILE A  1  115 ? 38.878  -33.131  141.017  1.00 57.97  ? 115 ILE 1 C     1 
ATOM   908   O  O     . ILE A  1  115 ? 38.033  -33.677  140.297  1.00 57.14  ? 115 ILE 1 O     1 
ATOM   909   C  CB    . ILE A  1  115 ? 41.053  -34.315  141.556  1.00 55.35  ? 115 ILE 1 CB    1 
ATOM   910   C  CG1   . ILE A  1  115 ? 42.484  -34.553  141.062  1.00 54.43  ? 115 ILE 1 CG1   1 
ATOM   911   C  CG2   . ILE A  1  115 ? 40.260  -35.620  141.520  1.00 55.15  ? 115 ILE 1 CG2   1 
ATOM   912   C  CD1   . ILE A  1  115 ? 43.339  -35.434  141.964  1.00 52.71  ? 115 ILE 1 CD1   1 
ATOM   913   N  N     . GLU A  1  116 ? 38.530  -32.399  142.076  1.00 60.84  ? 116 GLU 1 N     1 
ATOM   914   C  CA    . GLU A  1  116 ? 37.120  -32.206  142.384  1.00 65.72  ? 116 GLU 1 CA    1 
ATOM   915   C  C     . GLU A  1  116 ? 36.423  -31.449  141.261  1.00 72.95  ? 116 GLU 1 C     1 
ATOM   916   O  O     . GLU A  1  116 ? 35.317  -31.821  140.846  1.00 73.20  ? 116 GLU 1 O     1 
ATOM   917   C  CB    . GLU A  1  116 ? 36.961  -31.481  143.721  1.00 67.17  ? 116 GLU 1 CB    1 
ATOM   918   C  CG    . GLU A  1  116 ? 35.527  -31.479  144.227  1.00 70.78  ? 116 GLU 1 CG    1 
ATOM   919   C  CD    . GLU A  1  116 ? 35.404  -31.061  145.675  1.00 73.01  ? 116 GLU 1 CD    1 
ATOM   920   O  OE1   . GLU A  1  116 ? 36.440  -30.750  146.301  1.00 73.75  ? 116 GLU 1 OE1   1 
ATOM   921   O  OE2   . GLU A  1  116 ? 34.271  -31.078  146.196  1.00 72.66  ? 116 GLU 1 OE2   1 
ATOM   922   N  N     . GLY A  1  117 ? 37.064  -30.399  140.738  1.00 78.43  ? 117 GLY 1 N     1 
ATOM   923   C  CA    . GLY A  1  117 ? 36.469  -29.667  139.627  1.00 81.00  ? 117 GLY 1 CA    1 
ATOM   924   C  C     . GLY A  1  117 ? 36.253  -30.532  138.398  1.00 80.14  ? 117 GLY 1 C     1 
ATOM   925   O  O     . GLY A  1  117 ? 35.242  -30.397  137.697  1.00 74.97  ? 117 GLY 1 O     1 
ATOM   926   N  N     . MET A  1  118 ? 37.209  -31.418  138.107  1.00 83.82  ? 118 MET 1 N     1 
ATOM   927   C  CA    . MET A  1  118 ? 37.077  -32.316  136.962  1.00 84.77  ? 118 MET 1 CA    1 
ATOM   928   C  C     . MET A  1  118 ? 35.970  -33.331  137.191  1.00 84.11  ? 118 MET 1 C     1 
ATOM   929   O  O     . MET A  1  118 ? 35.280  -33.726  136.248  1.00 83.07  ? 118 MET 1 O     1 
ATOM   930   C  CB    . MET A  1  118 ? 38.383  -33.061  136.683  1.00 84.21  ? 118 MET 1 CB    1 
ATOM   931   C  CG    . MET A  1  118 ? 39.578  -32.211  136.310  1.00 83.20  ? 118 MET 1 CG    1 
ATOM   932   S  SD    . MET A  1  118 ? 41.065  -33.209  136.053  1.00 79.17  ? 118 MET 1 SD    1 
ATOM   933   C  CE    . MET A  1  118 ? 40.714  -33.890  134.444  1.00 76.64  ? 118 MET 1 CE    1 
ATOM   934   N  N     . ILE A  1  119 ? 35.816  -33.797  138.431  1.00 85.41  ? 119 ILE 1 N     1 
ATOM   935   C  CA    . ILE A  1  119 ? 34.704  -34.684  138.749  1.00 89.76  ? 119 ILE 1 CA    1 
ATOM   936   C  C     . ILE A  1  119 ? 33.381  -33.960  138.525  1.00 89.31  ? 119 ILE 1 C     1 
ATOM   937   O  O     . ILE A  1  119 ? 32.428  -34.529  137.977  1.00 91.43  ? 119 ILE 1 O     1 
ATOM   938   C  CB    . ILE A  1  119 ? 34.838  -35.215  140.191  1.00 95.65  ? 119 ILE 1 CB    1 
ATOM   939   C  CG1   . ILE A  1  119 ? 35.998  -36.216  140.291  1.00 97.17  ? 119 ILE 1 CG1   1 
ATOM   940   C  CG2   . ILE A  1  119 ? 33.539  -35.855  140.660  1.00 98.04  ? 119 ILE 1 CG2   1 
ATOM   941   C  CD1   . ILE A  1  119 ? 36.294  -36.699  141.706  1.00 96.81  ? 119 ILE 1 CD1   1 
ATOM   942   N  N     . LEU A  1  120 ? 33.312  -32.686  138.926  1.00 84.18  ? 120 LEU 1 N     1 
ATOM   943   C  CA    . LEU A  1  120 ? 32.099  -31.896  138.720  1.00 79.39  ? 120 LEU 1 CA    1 
ATOM   944   C  C     . LEU A  1  120 ? 31.775  -31.763  137.235  1.00 79.40  ? 120 LEU 1 C     1 
ATOM   945   O  O     . LEU A  1  120 ? 30.642  -32.014  136.803  1.00 82.97  ? 120 LEU 1 O     1 
ATOM   946   C  CB    . LEU A  1  120 ? 32.252  -30.520  139.374  1.00 75.45  ? 120 LEU 1 CB    1 
ATOM   947   C  CG    . LEU A  1  120 ? 32.364  -30.526  140.904  1.00 71.18  ? 120 LEU 1 CG    1 
ATOM   948   C  CD1   . LEU A  1  120 ? 32.836  -29.187  141.475  1.00 69.03  ? 120 LEU 1 CD1   1 
ATOM   949   C  CD2   . LEU A  1  120 ? 31.016  -30.928  141.496  1.00 68.41  ? 120 LEU 1 CD2   1 
ATOM   950   N  N     . ALA A  1  121 ? 32.770  -31.381  136.435  1.00 73.78  ? 121 ALA 1 N     1 
ATOM   951   C  CA    . ALA A  1  121 ? 32.551  -31.254  134.998  1.00 64.59  ? 121 ALA 1 CA    1 
ATOM   952   C  C     . ALA A  1  121 ? 32.197  -32.602  134.368  1.00 57.27  ? 121 ALA 1 C     1 
ATOM   953   O  O     . ALA A  1  121 ? 31.364  -32.668  133.455  1.00 52.90  ? 121 ALA 1 O     1 
ATOM   954   C  CB    . ALA A  1  121 ? 33.782  -30.643  134.338  1.00 62.25  ? 121 ALA 1 CB    1 
ATOM   955   N  N     . GLY A  1  122 ? 32.822  -33.687  134.833  1.00 54.96  ? 122 GLY 1 N     1 
ATOM   956   C  CA    . GLY A  1  122 ? 32.507  -34.997  134.293  1.00 55.32  ? 122 GLY 1 CA    1 
ATOM   957   C  C     . GLY A  1  122 ? 31.097  -35.435  134.625  1.00 55.98  ? 122 GLY 1 C     1 
ATOM   958   O  O     . GLY A  1  122 ? 30.429  -36.080  133.815  1.00 58.81  ? 122 GLY 1 O     1 
ATOM   959   N  N     . TYR A  1  123 ? 30.635  -35.117  135.829  1.00 52.80  ? 123 TYR 1 N     1 
ATOM   960   C  CA    . TYR A  1  123 ? 29.233  -35.335  136.146  1.00 52.85  ? 123 TYR 1 CA    1 
ATOM   961   C  C     . TYR A  1  123 ? 28.340  -34.528  135.212  1.00 53.84  ? 123 TYR 1 C     1 
ATOM   962   O  O     . TYR A  1  123 ? 27.339  -35.044  134.699  1.00 61.32  ? 123 TYR 1 O     1 
ATOM   963   C  CB    . TYR A  1  123 ? 28.982  -34.966  137.605  1.00 53.06  ? 123 TYR 1 CB    1 
ATOM   964   C  CG    . TYR A  1  123 ? 27.564  -35.181  138.056  1.00 56.03  ? 123 TYR 1 CG    1 
ATOM   965   C  CD1   . TYR A  1  123 ? 27.011  -36.447  138.096  1.00 58.03  ? 123 TYR 1 CD1   1 
ATOM   966   C  CD2   . TYR A  1  123 ? 26.776  -34.115  138.440  1.00 57.12  ? 123 TYR 1 CD2   1 
ATOM   967   C  CE1   . TYR A  1  123 ? 25.711  -36.642  138.511  1.00 60.54  ? 123 TYR 1 CE1   1 
ATOM   968   C  CE2   . TYR A  1  123 ? 25.480  -34.300  138.854  1.00 58.13  ? 123 TYR 1 CE2   1 
ATOM   969   C  CZ    . TYR A  1  123 ? 24.950  -35.563  138.890  1.00 60.49  ? 123 TYR 1 CZ    1 
ATOM   970   O  OH    . TYR A  1  123 ? 23.650  -35.741  139.304  1.00 59.85  ? 123 TYR 1 OH    1 
ATOM   971   N  N     . ALA A  1  124 ? 28.728  -33.277  134.936  1.00 43.98  ? 124 ALA 1 N     1 
ATOM   972   C  CA    . ALA A  1  124 ? 27.923  -32.387  134.103  1.00 34.95  ? 124 ALA 1 CA    1 
ATOM   973   C  C     . ALA A  1  124 ? 27.791  -32.901  132.679  1.00 34.96  ? 124 ALA 1 C     1 
ATOM   974   O  O     . ALA A  1  124 ? 26.726  -32.772  132.063  1.00 37.07  ? 124 ALA 1 O     1 
ATOM   975   C  CB    . ALA A  1  124 ? 28.545  -30.997  134.077  1.00 32.99  ? 124 ALA 1 CB    1 
ATOM   976   N  N     . ILE A  1  125 ? 28.884  -33.424  132.120  1.00 31.95  ? 125 ILE 1 N     1 
ATOM   977   C  CA    . ILE A  1  125 ? 28.974  -33.800  130.712  1.00 28.46  ? 125 ILE 1 CA    1 
ATOM   978   C  C     . ILE A  1  125 ? 29.033  -35.319  130.515  1.00 23.45  ? 125 ILE 1 C     1 
ATOM   979   O  O     . ILE A  1  125 ? 29.375  -35.780  129.441  1.00 21.08  ? 125 ILE 1 O     1 
ATOM   980   C  CB    . ILE A  1  125 ? 30.178  -33.112  130.042  1.00 28.32  ? 125 ILE 1 CB    1 
ATOM   981   C  CG1   . ILE A  1  125 ? 31.497  -33.668  130.589  1.00 28.37  ? 125 ILE 1 CG1   1 
ATOM   982   C  CG2   . ILE A  1  125 ? 30.131  -31.600  130.239  1.00 29.95  ? 125 ILE 1 CG2   1 
ATOM   983   C  CD1   . ILE A  1  125 ? 32.748  -33.011  130.032  1.00 28.59  ? 125 ILE 1 CD1   1 
ATOM   984   N  N     . ARG A  1  126 ? 28.674  -36.102  131.528  1.00 28.19  ? 126 ARG 1 N     1 
ATOM   985   C  CA    . ARG A  1  126 ? 28.622  -37.566  131.429  1.00 36.79  ? 126 ARG 1 CA    1 
ATOM   986   C  C     . ARG A  1  126 ? 29.968  -38.177  131.015  1.00 33.54  ? 126 ARG 1 C     1 
ATOM   987   O  O     . ARG A  1  126 ? 30.029  -39.223  130.355  1.00 27.51  ? 126 ARG 1 O     1 
ATOM   988   C  CB    . ARG A  1  126 ? 27.516  -38.008  130.465  1.00 45.01  ? 126 ARG 1 CB    1 
ATOM   989   C  CG    . ARG A  1  126 ? 26.115  -37.711  130.974  1.00 50.59  ? 126 ARG 1 CG    1 
ATOM   990   C  CD    . ARG A  1  126 ? 25.715  -36.289  130.584  1.00 55.55  ? 126 ARG 1 CD    1 
ATOM   991   N  NE    . ARG A  1  126 ? 24.296  -36.031  130.787  1.00 57.59  ? 126 ARG 1 NE    1 
ATOM   992   C  CZ    . ARG A  1  126 ? 23.768  -34.822  130.922  1.00 58.60  ? 126 ARG 1 CZ    1 
ATOM   993   N  NH1   . ARG A  1  126 ? 24.530  -33.739  130.875  1.00 56.89  ? 126 ARG 1 NH1   1 
ATOM   994   N  NH2   . ARG A  1  126 ? 22.464  -34.700  131.102  1.00 62.26  ? 126 ARG 1 NH2   1 
ATOM   995   N  N     . ALA A  1  127 ? 31.050  -37.567  131.486  1.00 32.63  ? 127 ALA 1 N     1 
ATOM   996   C  CA    . ALA A  1  127 ? 32.406  -38.027  131.216  1.00 36.15  ? 127 ALA 1 CA    1 
ATOM   997   C  C     . ALA A  1  127 ? 32.817  -39.022  132.294  1.00 38.94  ? 127 ALA 1 C     1 
ATOM   998   O  O     . ALA A  1  127 ? 32.944  -38.654  133.468  1.00 37.66  ? 127 ALA 1 O     1 
ATOM   999   C  CB    . ALA A  1  127 ? 33.370  -36.847  131.181  1.00 39.99  ? 127 ALA 1 CB    1 
ATOM   1000  N  N     . THR A  1  128 ? 33.012  -40.288  131.894  1.00 42.04  ? 128 THR 1 N     1 
ATOM   1001  C  CA    . THR A  1  128 ? 33.444  -41.349  132.797  1.00 42.36  ? 128 THR 1 CA    1 
ATOM   1002  C  C     . THR A  1  128 ? 34.961  -41.473  132.872  1.00 39.33  ? 128 THR 1 C     1 
ATOM   1003  O  O     . THR A  1  128 ? 35.485  -41.918  133.901  1.00 39.67  ? 128 THR 1 O     1 
ATOM   1004  C  CB    . THR A  1  128 ? 32.861  -42.706  132.364  1.00 45.58  ? 128 THR 1 CB    1 
ATOM   1005  O  OG1   . THR A  1  128 ? 33.701  -43.293  131.364  1.00 47.36  ? 128 THR 1 OG1   1 
ATOM   1006  C  CG2   . THR A  1  128 ? 31.464  -42.553  131.783  1.00 49.27  ? 128 THR 1 CG2   1 
ATOM   1007  N  N     . VAL A  1  129 ? 35.680  -41.037  131.838  1.00 33.87  ? 129 VAL 1 N     1 
ATOM   1008  C  CA    . VAL A  1  129 ? 37.138  -41.039  131.842  1.00 30.90  ? 129 VAL 1 CA    1 
ATOM   1009  C  C     . VAL A  1  129 ? 37.600  -39.700  131.291  1.00 26.06  ? 129 VAL 1 C     1 
ATOM   1010  O  O     . VAL A  1  129 ? 36.964  -39.120  130.409  1.00 25.40  ? 129 VAL 1 O     1 
ATOM   1011  C  CB    . VAL A  1  129 ? 37.735  -42.205  131.004  1.00 33.01  ? 129 VAL 1 CB    1 
ATOM   1012  C  CG1   . VAL A  1  129 ? 39.255  -42.258  131.140  1.00 33.93  ? 129 VAL 1 CG1   1 
ATOM   1013  C  CG2   . VAL A  1  129 ? 37.111  -43.553  131.394  1.00 31.70  ? 129 VAL 1 CG2   1 
ATOM   1014  N  N     . GLY A  1  130 ? 38.712  -39.207  131.821  1.00 21.65  ? 130 GLY 1 N     1 
ATOM   1015  C  CA    . GLY A  1  130 ? 39.258  -37.949  131.373  1.00 31.51  ? 130 GLY 1 CA    1 
ATOM   1016  C  C     . GLY A  1  130 ? 40.769  -38.020  131.358  1.00 40.64  ? 130 GLY 1 C     1 
ATOM   1017  O  O     . GLY A  1  130 ? 41.384  -38.795  132.093  1.00 42.90  ? 130 GLY 1 O     1 
ATOM   1018  N  N     . TYR A  1  131 ? 41.362  -37.181  130.520  1.00 45.77  ? 131 TYR 1 N     1 
ATOM   1019  C  CA    . TYR A  1  131 ? 42.806  -37.157  130.365  1.00 50.24  ? 131 TYR 1 CA    1 
ATOM   1020  C  C     . TYR A  1  131 ? 43.355  -35.781  130.718  1.00 57.61  ? 131 TYR 1 C     1 
ATOM   1021  O  O     . TYR A  1  131 ? 42.703  -34.754  130.500  1.00 56.79  ? 131 TYR 1 O     1 
ATOM   1022  C  CB    . TYR A  1  131 ? 43.218  -37.558  128.935  1.00 44.00  ? 131 TYR 1 CB    1 
ATOM   1023  C  CG    . TYR A  1  131 ? 43.068  -39.039  128.672  1.00 42.79  ? 131 TYR 1 CG    1 
ATOM   1024  C  CD1   . TYR A  1  131 ? 41.848  -39.595  128.351  1.00 45.11  ? 131 TYR 1 CD1   1 
ATOM   1025  C  CD2   . TYR A  1  131 ? 44.151  -39.889  128.781  1.00 45.22  ? 131 TYR 1 CD2   1 
ATOM   1026  C  CE1   . TYR A  1  131 ? 41.719  -40.967  128.124  1.00 49.06  ? 131 TYR 1 CE1   1 
ATOM   1027  C  CE2   . TYR A  1  131 ? 44.030  -41.255  128.556  1.00 48.27  ? 131 TYR 1 CE2   1 
ATOM   1028  C  CZ    . TYR A  1  131 ? 42.817  -41.790  128.232  1.00 50.22  ? 131 TYR 1 CZ    1 
ATOM   1029  O  OH    . TYR A  1  131 ? 42.713  -43.148  128.017  1.00 51.88  ? 131 TYR 1 OH    1 
ATOM   1030  N  N     . ILE A  1  132 ? 44.550  -35.779  131.305  1.00 65.01  ? 132 ILE 1 N     1 
ATOM   1031  C  CA    . ILE A  1  132 ? 45.272  -34.559  131.655  1.00 70.57  ? 132 ILE 1 CA    1 
ATOM   1032  C  C     . ILE A  1  132 ? 46.564  -34.542  130.853  1.00 70.80  ? 132 ILE 1 C     1 
ATOM   1033  O  O     . ILE A  1  132 ? 47.446  -35.385  131.064  1.00 75.31  ? 132 ILE 1 O     1 
ATOM   1034  C  CB    . ILE A  1  132 ? 45.566  -34.463  133.155  1.00 73.44  ? 132 ILE 1 CB    1 
ATOM   1035  C  CG1   . ILE A  1  132 ? 44.274  -34.606  133.959  1.00 80.09  ? 132 ILE 1 CG1   1 
ATOM   1036  C  CG2   . ILE A  1  132 ? 46.257  -33.157  133.461  1.00 71.17  ? 132 ILE 1 CG2   1 
ATOM   1037  C  CD1   . ILE A  1  132 ? 44.433  -34.355  135.445  1.00 82.51  ? 132 ILE 1 CD1   1 
ATOM   1038  N  N     . TYR A  1  133 ? 46.690  -33.573  129.959  1.00 64.94  ? 133 TYR 1 N     1 
ATOM   1039  C  CA    . TYR A  1  133 ? 47.832  -33.467  129.064  1.00 62.62  ? 133 TYR 1 CA    1 
ATOM   1040  C  C     . TYR A  1  133 ? 48.736  -32.351  129.573  1.00 58.56  ? 133 TYR 1 C     1 
ATOM   1041  O  O     . TYR A  1  133 ? 48.405  -31.166  129.449  1.00 54.99  ? 133 TYR 1 O     1 
ATOM   1042  C  CB    . TYR A  1  133 ? 47.352  -33.218  127.635  1.00 67.03  ? 133 TYR 1 CB    1 
ATOM   1043  C  CG    . TYR A  1  133 ? 48.424  -33.192  126.555  1.00 69.62  ? 133 TYR 1 CG    1 
ATOM   1044  C  CD1   . TYR A  1  133 ? 49.122  -32.031  126.272  1.00 70.29  ? 133 TYR 1 CD1   1 
ATOM   1045  C  CD2   . TYR A  1  133 ? 48.730  -34.324  125.817  1.00 69.50  ? 133 TYR 1 CD2   1 
ATOM   1046  C  CE1   . TYR A  1  133 ? 50.090  -31.993  125.285  1.00 70.39  ? 133 TYR 1 CE1   1 
ATOM   1047  C  CE2   . TYR A  1  133 ? 49.707  -34.292  124.828  1.00 71.79  ? 133 TYR 1 CE2   1 
ATOM   1048  C  CZ    . TYR A  1  133 ? 50.384  -33.120  124.568  1.00 73.74  ? 133 TYR 1 CZ    1 
ATOM   1049  O  OH    . TYR A  1  133 ? 51.360  -33.058  123.592  1.00 77.89  ? 133 TYR 1 OH    1 
ATOM   1050  N  N     . VAL A  1  134 ? 49.877  -32.734  130.150  1.00 57.34  ? 134 VAL 1 N     1 
ATOM   1051  C  CA    . VAL A  1  134 ? 50.828  -31.790  130.727  1.00 55.71  ? 134 VAL 1 CA    1 
ATOM   1052  C  C     . VAL A  1  134 ? 52.074  -31.699  129.851  1.00 48.82  ? 134 VAL 1 C     1 
ATOM   1053  O  O     . VAL A  1  134 ? 52.515  -32.681  129.238  1.00 46.11  ? 134 VAL 1 O     1 
ATOM   1054  C  CB    . VAL A  1  134 ? 51.192  -32.182  132.175  1.00 55.78  ? 134 VAL 1 CB    1 
ATOM   1055  C  CG1   . VAL A  1  134 ? 49.942  -32.546  132.962  1.00 54.36  ? 134 VAL 1 CG1   1 
ATOM   1056  C  CG2   . VAL A  1  134 ? 52.174  -33.333  132.191  1.00 58.53  ? 134 VAL 1 CG2   1 
ATOM   1057  N  N     . ARG A  1  135 ? 52.644  -30.496  129.799  1.00 42.08  ? 135 ARG 1 N     1 
ATOM   1058  C  CA    . ARG A  1  135 ? 53.830  -30.243  128.994  1.00 38.55  ? 135 ARG 1 CA    1 
ATOM   1059  C  C     . ARG A  1  135 ? 55.068  -30.877  129.615  1.00 42.97  ? 135 ARG 1 C     1 
ATOM   1060  O  O     . ARG A  1  135 ? 55.168  -31.037  130.833  1.00 41.41  ? 135 ARG 1 O     1 
ATOM   1061  C  CB    . ARG A  1  135 ? 54.032  -28.744  128.812  1.00 33.01  ? 135 ARG 1 CB    1 
ATOM   1062  C  CG    . ARG A  1  135 ? 54.052  -27.924  130.080  1.00 27.24  ? 135 ARG 1 CG    1 
ATOM   1063  C  CD    . ARG A  1  135 ? 54.397  -26.496  129.729  1.00 25.29  ? 135 ARG 1 CD    1 
ATOM   1064  N  NE    . ARG A  1  135 ? 55.756  -26.396  129.217  1.00 25.44  ? 135 ARG 1 NE    1 
ATOM   1065  C  CZ    . ARG A  1  135 ? 56.306  -25.278  128.766  1.00 37.60  ? 135 ARG 1 CZ    1 
ATOM   1066  N  NH1   . ARG A  1  135 ? 55.603  -24.159  128.734  1.00 40.22  ? 135 ARG 1 NH1   1 
ATOM   1067  N  NH2   . ARG A  1  135 ? 57.555  -25.280  128.336  1.00 25.79  ? 135 ARG 1 NH2   1 
ATOM   1068  N  N     . GLY A  1  136 ? 56.031  -31.215  128.758  1.00 49.48  ? 136 GLY 1 N     1 
ATOM   1069  C  CA    . GLY A  1  136 ? 57.204  -31.969  129.164  1.00 55.92  ? 136 GLY 1 CA    1 
ATOM   1070  C  C     . GLY A  1  136 ? 58.241  -31.223  129.974  1.00 61.23  ? 136 GLY 1 C     1 
ATOM   1071  O  O     . GLY A  1  136 ? 59.307  -31.766  130.279  1.00 57.24  ? 136 GLY 1 O     1 
ATOM   1072  N  N     . GLU A  1  137 ? 57.939  -29.981  130.337  1.00 70.65  ? 137 GLU 1 N     1 
ATOM   1073  C  CA    . GLU A  1  137 ? 58.822  -29.195  131.182  1.00 79.22  ? 137 GLU 1 CA    1 
ATOM   1074  C  C     . GLU A  1  137 ? 58.381  -29.160  132.637  1.00 82.72  ? 137 GLU 1 C     1 
ATOM   1075  O  O     . GLU A  1  137 ? 59.181  -28.780  133.502  1.00 86.36  ? 137 GLU 1 O     1 
ATOM   1076  C  CB    . GLU A  1  137 ? 58.909  -27.757  130.658  1.00 83.54  ? 137 GLU 1 CB    1 
ATOM   1077  C  CG    . GLU A  1  137 ? 59.858  -27.558  129.486  1.00 87.83  ? 137 GLU 1 CG    1 
ATOM   1078  C  CD    . GLU A  1  137 ? 59.244  -27.958  128.157  1.00 91.24  ? 137 GLU 1 CD    1 
ATOM   1079  O  OE1   . GLU A  1  137 ? 58.006  -27.906  128.034  1.00 92.59  ? 137 GLU 1 OE1   1 
ATOM   1080  O  OE2   . GLU A  1  137 ? 59.999  -28.319  127.231  1.00 92.17  ? 137 GLU 1 OE2   1 
ATOM   1081  N  N     . TYR A  1  138 ? 57.136  -29.542  132.924  1.00 81.02  ? 138 TYR 1 N     1 
ATOM   1082  C  CA    . TYR A  1  138 ? 56.592  -29.552  134.284  1.00 79.21  ? 138 TYR 1 CA    1 
ATOM   1083  C  C     . TYR A  1  138 ? 56.685  -30.976  134.818  1.00 86.08  ? 138 TYR 1 C     1 
ATOM   1084  O  O     . TYR A  1  138 ? 55.808  -31.804  134.553  1.00 88.53  ? 138 TYR 1 O     1 
ATOM   1085  C  CB    . TYR A  1  138 ? 55.145  -29.066  134.294  1.00 69.78  ? 138 TYR 1 CB    1 
ATOM   1086  C  CG    . TYR A  1  138 ? 54.967  -27.579  134.065  1.00 62.49  ? 138 TYR 1 CG    1 
ATOM   1087  C  CD1   . TYR A  1  138 ? 56.043  -26.768  133.762  1.00 59.82  ? 138 TYR 1 CD1   1 
ATOM   1088  C  CD2   . TYR A  1  138 ? 53.717  -26.991  134.150  1.00 61.29  ? 138 TYR 1 CD2   1 
ATOM   1089  C  CE1   . TYR A  1  138 ? 55.878  -25.418  133.547  1.00 64.66  ? 138 TYR 1 CE1   1 
ATOM   1090  C  CE2   . TYR A  1  138 ? 53.546  -25.634  133.939  1.00 65.26  ? 138 TYR 1 CE2   1 
ATOM   1091  C  CZ    . TYR A  1  138 ? 54.629  -24.853  133.636  1.00 79.04  ? 138 TYR 1 CZ    1 
ATOM   1092  O  OH    . TYR A  1  138 ? 54.459  -23.501  133.426  1.00 95.58  ? 138 TYR 1 OH    1 
ATOM   1093  N  N     . ARG A  1  139 ? 57.749  -31.273  135.566  1.00 88.83  ? 139 ARG 1 N     1 
ATOM   1094  C  CA    . ARG A  1  139 ? 57.884  -32.601  136.152  1.00 91.63  ? 139 ARG 1 CA    1 
ATOM   1095  C  C     . ARG A  1  139 ? 57.430  -32.668  137.607  1.00 90.67  ? 139 ARG 1 C     1 
ATOM   1096  O  O     . ARG A  1  139 ? 56.835  -33.670  138.021  1.00 88.57  ? 139 ARG 1 O     1 
ATOM   1097  C  CB    . ARG A  1  139 ? 59.332  -33.095  136.041  1.00 94.20  ? 139 ARG 1 CB    1 
ATOM   1098  C  CG    . ARG A  1  139 ? 59.473  -34.557  136.420  1.00 97.80  ? 139 ARG 1 CG    1 
ATOM   1099  C  CD    . ARG A  1  139 ? 60.900  -35.045  136.372  1.00 100.89 ? 139 ARG 1 CD    1 
ATOM   1100  N  NE    . ARG A  1  139 ? 60.979  -36.477  136.627  1.00 102.59 ? 139 ARG 1 NE    1 
ATOM   1101  C  CZ    . ARG A  1  139 ? 60.978  -37.009  137.843  1.00 104.85 ? 139 ARG 1 CZ    1 
ATOM   1102  N  NH1   . ARG A  1  139 ? 60.907  -36.226  138.911  1.00 103.98 ? 139 ARG 1 NH1   1 
ATOM   1103  N  NH2   . ARG A  1  139 ? 61.051  -38.323  137.993  1.00 107.92 ? 139 ARG 1 NH2   1 
ATOM   1104  N  N     . ARG A  1  140 ? 57.681  -31.619  138.391  1.00 91.63  ? 140 ARG 1 N     1 
ATOM   1105  C  CA    . ARG A  1  140 ? 57.217  -31.605  139.776  1.00 92.04  ? 140 ARG 1 CA    1 
ATOM   1106  C  C     . ARG A  1  140 ? 55.696  -31.655  139.839  1.00 94.86  ? 140 ARG 1 C     1 
ATOM   1107  O  O     . ARG A  1  140 ? 55.114  -32.451  140.591  1.00 95.99  ? 140 ARG 1 O     1 
ATOM   1108  C  CB    . ARG A  1  140 ? 57.760  -30.366  140.494  1.00 88.40  ? 140 ARG 1 CB    1 
ATOM   1109  C  CG    . ARG A  1  140 ? 57.256  -30.148  141.915  1.00 82.53  ? 140 ARG 1 CG    1 
ATOM   1110  C  CD    . ARG A  1  140 ? 58.321  -29.416  142.725  1.00 77.94  ? 140 ARG 1 CD    1 
ATOM   1111  N  NE    . ARG A  1  140 ? 59.469  -30.272  143.021  1.00 74.69  ? 140 ARG 1 NE    1 
ATOM   1112  C  CZ    . ARG A  1  140 ? 60.657  -29.824  143.414  1.00 73.54  ? 140 ARG 1 CZ    1 
ATOM   1113  N  NH1   . ARG A  1  140 ? 60.864  -28.523  143.546  1.00 73.07  ? 140 ARG 1 NH1   1 
ATOM   1114  N  NH2   . ARG A  1  140 ? 61.641  -30.675  143.665  1.00 73.86  ? 140 ARG 1 NH2   1 
ATOM   1115  N  N     . ALA A  1  141 ? 55.037  -30.816  139.038  1.00 95.44  ? 141 ALA 1 N     1 
ATOM   1116  C  CA    . ALA A  1  141 ? 53.580  -30.811  139.000  1.00 96.84  ? 141 ALA 1 CA    1 
ATOM   1117  C  C     . ALA A  1  141 ? 53.035  -32.164  138.554  1.00 97.21  ? 141 ALA 1 C     1 
ATOM   1118  O  O     . ALA A  1  141 ? 52.021  -32.635  139.080  1.00 98.35  ? 141 ALA 1 O     1 
ATOM   1119  C  CB    . ALA A  1  141 ? 53.091  -29.694  138.081  1.00 96.76  ? 141 ALA 1 CB    1 
ATOM   1120  N  N     . ALA A  1  142 ? 53.697  -32.807  137.590  1.00 95.47  ? 142 ALA 1 N     1 
ATOM   1121  C  CA    . ALA A  1  142 ? 53.243  -34.113  137.119  1.00 95.28  ? 142 ALA 1 CA    1 
ATOM   1122  C  C     . ALA A  1  142 ? 53.379  -35.173  138.205  1.00 98.09  ? 142 ALA 1 C     1 
ATOM   1123  O  O     . ALA A  1  142 ? 52.492  -36.024  138.372  1.00 100.18 ? 142 ALA 1 O     1 
ATOM   1124  C  CB    . ALA A  1  142 ? 54.031  -34.519  135.877  1.00 94.29  ? 142 ALA 1 CB    1 
ATOM   1125  N  N     . ASP A  1  143 ? 54.488  -35.145  138.947  1.00 98.76  ? 143 ASP 1 N     1 
ATOM   1126  C  CA    . ASP A  1  143 ? 54.656  -36.081  140.055  1.00 99.21  ? 143 ASP 1 CA    1 
ATOM   1127  C  C     . ASP A  1  143 ? 53.560  -35.885  141.097  1.00 92.70  ? 143 ASP 1 C     1 
ATOM   1128  O  O     . ASP A  1  143 ? 52.935  -36.853  141.550  1.00 90.00  ? 143 ASP 1 O     1 
ATOM   1129  C  CB    . ASP A  1  143 ? 56.039  -35.903  140.687  1.00 104.71 ? 143 ASP 1 CB    1 
ATOM   1130  C  CG    . ASP A  1  143 ? 57.170  -36.394  139.793  1.00 108.20 ? 143 ASP 1 CG    1 
ATOM   1131  O  OD1   . ASP A  1  143 ? 56.921  -37.210  138.880  1.00 109.14 ? 143 ASP 1 OD1   1 
ATOM   1132  O  OD2   . ASP A  1  143 ? 58.319  -35.960  140.011  1.00 109.06 ? 143 ASP 1 OD2   1 
ATOM   1133  N  N     . ARG A  1  144 ? 53.305  -34.626  141.479  1.00 88.56  ? 144 ARG 1 N     1 
ATOM   1134  C  CA    . ARG A  1  144 ? 52.282  -34.347  142.486  1.00 84.95  ? 144 ARG 1 CA    1 
ATOM   1135  C  C     . ARG A  1  144 ? 50.887  -34.706  141.994  1.00 82.77  ? 144 ARG 1 C     1 
ATOM   1136  O  O     . ARG A  1  144 ? 50.045  -35.156  142.782  1.00 86.52  ? 144 ARG 1 O     1 
ATOM   1137  C  CB    . ARG A  1  144 ? 52.353  -32.883  142.912  1.00 83.98  ? 144 ARG 1 CB    1 
ATOM   1138  C  CG    . ARG A  1  144 ? 53.730  -32.503  143.412  1.00 85.05  ? 144 ARG 1 CG    1 
ATOM   1139  C  CD    . ARG A  1  144 ? 53.826  -32.636  144.918  1.00 86.58  ? 144 ARG 1 CD    1 
ATOM   1140  N  NE    . ARG A  1  144 ? 54.834  -31.739  145.458  1.00 88.09  ? 144 ARG 1 NE    1 
ATOM   1141  C  CZ    . ARG A  1  144 ? 56.072  -32.111  145.761  1.00 88.88  ? 144 ARG 1 CZ    1 
ATOM   1142  N  NH1   . ARG A  1  144 ? 56.454  -33.368  145.583  1.00 86.62  ? 144 ARG 1 NH1   1 
ATOM   1143  N  NH2   . ARG A  1  144 ? 56.927  -31.222  146.246  1.00 91.08  ? 144 ARG 1 NH2   1 
ATOM   1144  N  N     . LEU A  1  145 ? 50.639  -34.545  140.695  1.00 74.74  ? 145 LEU 1 N     1 
ATOM   1145  C  CA    . LEU A  1  145 ? 49.344  -34.900  140.129  1.00 66.46  ? 145 LEU 1 CA    1 
ATOM   1146  C  C     . LEU A  1  145 ? 49.121  -36.409  140.149  1.00 64.82  ? 145 LEU 1 C     1 
ATOM   1147  O  O     . LEU A  1  145 ? 48.052  -36.883  140.549  1.00 63.31  ? 145 LEU 1 O     1 
ATOM   1148  C  CB    . LEU A  1  145 ? 49.256  -34.364  138.704  1.00 60.01  ? 145 LEU 1 CB    1 
ATOM   1149  C  CG    . LEU A  1  145 ? 48.755  -32.934  138.564  1.00 58.26  ? 145 LEU 1 CG    1 
ATOM   1150  C  CD1   . LEU A  1  145 ? 48.657  -32.594  137.092  1.00 59.22  ? 145 LEU 1 CD1   1 
ATOM   1151  C  CD2   . LEU A  1  145 ? 47.416  -32.752  139.268  1.00 57.61  ? 145 LEU 1 CD2   1 
ATOM   1152  N  N     . GLU A  1  146 ? 50.118  -37.185  139.715  1.00 65.79  ? 146 GLU 1 N     1 
ATOM   1153  C  CA    . GLU A  1  146 ? 49.965  -38.636  139.747  1.00 67.00  ? 146 GLU 1 CA    1 
ATOM   1154  C  C     . GLU A  1  146 ? 49.872  -39.154  141.177  1.00 65.23  ? 146 GLU 1 C     1 
ATOM   1155  O  O     . GLU A  1  146 ? 49.125  -40.103  141.449  1.00 68.41  ? 146 GLU 1 O     1 
ATOM   1156  C  CB    . GLU A  1  146 ? 51.102  -39.318  138.993  1.00 70.16  ? 146 GLU 1 CB    1 
ATOM   1157  C  CG    . GLU A  1  146 ? 50.726  -40.705  138.530  1.00 74.47  ? 146 GLU 1 CG    1 
ATOM   1158  C  CD    . GLU A  1  146 ? 49.953  -40.678  137.234  1.00 80.74  ? 146 GLU 1 CD    1 
ATOM   1159  O  OE1   . GLU A  1  146 ? 48.733  -40.931  137.275  1.00 83.42  ? 146 GLU 1 OE1   1 
ATOM   1160  O  OE2   . GLU A  1  146 ? 50.557  -40.417  136.174  1.00 82.75  ? 146 GLU 1 OE2   1 
ATOM   1161  N  N     . GLN A  1  147 ? 50.629  -38.558  142.101  1.00 60.47  ? 147 GLN 1 N     1 
ATOM   1162  C  CA    . GLN A  1  147 ? 50.509  -38.937  143.507  1.00 60.95  ? 147 GLN 1 CA    1 
ATOM   1163  C  C     . GLN A  1  147 ? 49.093  -38.686  144.008  1.00 60.04  ? 147 GLN 1 C     1 
ATOM   1164  O  O     . GLN A  1  147 ? 48.498  -39.534  144.684  1.00 57.89  ? 147 GLN 1 O     1 
ATOM   1165  C  CB    . GLN A  1  147 ? 51.527  -38.158  144.348  1.00 62.05  ? 147 GLN 1 CB    1 
ATOM   1166  C  CG    . GLN A  1  147 ? 51.629  -38.573  145.823  1.00 62.54  ? 147 GLN 1 CG    1 
ATOM   1167  C  CD    . GLN A  1  147 ? 52.733  -37.822  146.561  1.00 63.66  ? 147 GLN 1 CD    1 
ATOM   1168  O  OE1   . GLN A  1  147 ? 53.466  -37.038  145.967  1.00 62.56  ? 147 GLN 1 OE1   1 
ATOM   1169  N  NE2   . GLN A  1  147 ? 52.852  -38.061  147.862  1.00 63.89  ? 147 GLN 1 NE2   1 
ATOM   1170  N  N     . ALA A  1  148 ? 48.537  -37.515  143.677  1.00 61.19  ? 148 ALA 1 N     1 
ATOM   1171  C  CA    . ALA A  1  148 ? 47.190  -37.180  144.121  1.00 61.63  ? 148 ALA 1 CA    1 
ATOM   1172  C  C     . ALA A  1  148 ? 46.162  -38.140  143.534  1.00 67.29  ? 148 ALA 1 C     1 
ATOM   1173  O  O     . ALA A  1  148 ? 45.227  -38.563  144.229  1.00 69.82  ? 148 ALA 1 O     1 
ATOM   1174  C  CB    . ALA A  1  148 ? 46.869  -35.735  143.742  1.00 55.81  ? 148 ALA 1 CB    1 
ATOM   1175  N  N     . ILE A  1  149 ? 46.321  -38.496  142.256  1.00 69.29  ? 149 ILE 1 N     1 
ATOM   1176  C  CA    . ILE A  1  149 ? 45.392  -39.429  141.619  1.00 71.59  ? 149 ILE 1 CA    1 
ATOM   1177  C  C     . ILE A  1  149 ? 45.486  -40.795  142.284  1.00 73.30  ? 149 ILE 1 C     1 
ATOM   1178  O  O     . ILE A  1  149 ? 44.469  -41.451  142.536  1.00 75.25  ? 149 ILE 1 O     1 
ATOM   1179  C  CB    . ILE A  1  149 ? 45.665  -39.512  140.102  1.00 71.73  ? 149 ILE 1 CB    1 
ATOM   1180  C  CG1   . ILE A  1  149 ? 45.406  -38.158  139.434  1.00 74.40  ? 149 ILE 1 CG1   1 
ATOM   1181  C  CG2   . ILE A  1  149 ? 44.816  -40.593  139.443  1.00 69.58  ? 149 ILE 1 CG2   1 
ATOM   1182  C  CD1   . ILE A  1  149 ? 45.391  -38.191  137.917  1.00 75.86  ? 149 ILE 1 CD1   1 
ATOM   1183  N  N     . LYS A  1  150 ? 46.707  -41.241  142.587  1.00 72.02  ? 150 LYS 1 N     1 
ATOM   1184  C  CA    . LYS A  1  150 ? 46.878  -42.512  143.280  1.00 73.41  ? 150 LYS 1 CA    1 
ATOM   1185  C  C     . LYS A  1  150 ? 46.192  -42.493  144.637  1.00 75.81  ? 150 LYS 1 C     1 
ATOM   1186  O  O     . LYS A  1  150 ? 45.550  -43.473  145.034  1.00 73.33  ? 150 LYS 1 O     1 
ATOM   1187  C  CB    . LYS A  1  150 ? 48.361  -42.820  143.440  1.00 75.19  ? 150 LYS 1 CB    1 
ATOM   1188  C  CG    . LYS A  1  150 ? 49.048  -43.186  142.150  1.00 79.49  ? 150 LYS 1 CG    1 
ATOM   1189  C  CD    . LYS A  1  150 ? 50.396  -43.803  142.432  1.00 84.59  ? 150 LYS 1 CD    1 
ATOM   1190  C  CE    . LYS A  1  150 ? 51.107  -44.132  141.141  1.00 87.81  ? 150 LYS 1 CE    1 
ATOM   1191  N  NZ    . LYS A  1  150 ? 51.916  -42.976  140.675  1.00 88.34  ? 150 LYS 1 NZ    1 
ATOM   1192  N  N     . GLU A  1  151 ? 46.334  -41.388  145.370  1.00 81.13  ? 151 GLU 1 N     1 
ATOM   1193  C  CA    . GLU A  1  151 ? 45.718  -41.278  146.690  1.00 80.60  ? 151 GLU 1 CA    1 
ATOM   1194  C  C     . GLU A  1  151 ? 44.197  -41.330  146.585  1.00 74.79  ? 151 GLU 1 C     1 
ATOM   1195  O  O     . GLU A  1  151 ? 43.526  -42.024  147.361  1.00 72.09  ? 151 GLU 1 O     1 
ATOM   1196  C  CB    . GLU A  1  151 ? 46.171  -39.984  147.371  1.00 81.95  ? 151 GLU 1 CB    1 
ATOM   1197  C  CG    . GLU A  1  151 ? 47.629  -39.984  147.843  1.00 82.21  ? 151 GLU 1 CG    1 
ATOM   1198  C  CD    . GLU A  1  151 ? 47.992  -38.713  148.586  1.00 83.87  ? 151 GLU 1 CD    1 
ATOM   1199  O  OE1   . GLU A  1  151 ? 47.971  -38.707  149.834  1.00 84.32  ? 151 GLU 1 OE1   1 
ATOM   1200  O  OE2   . GLU A  1  151 ? 48.255  -37.699  147.915  1.00 85.45  ? 151 GLU 1 OE2   1 
ATOM   1201  N  N     . ALA A  1  152 ? 43.635  -40.579  145.635  1.00 70.54  ? 152 ALA 1 N     1 
ATOM   1202  C  CA    . ALA A  1  152 ? 42.188  -40.582  145.451  1.00 65.58  ? 152 ALA 1 CA    1 
ATOM   1203  C  C     . ALA A  1  152 ? 41.694  -41.961  145.031  1.00 62.02  ? 152 ALA 1 C     1 
ATOM   1204  O  O     . ALA A  1  152 ? 40.600  -42.386  145.425  1.00 60.08  ? 152 ALA 1 O     1 
ATOM   1205  C  CB    . ALA A  1  152 ? 41.788  -39.528  144.421  1.00 63.87  ? 152 ALA 1 CB    1 
ATOM   1206  N  N     . ARG A  1  153 ? 42.486  -42.673  144.222  1.00 60.09  ? 153 ARG 1 N     1 
ATOM   1207  C  CA    . ARG A  1  153 ? 42.123  -44.024  143.806  1.00 57.17  ? 153 ARG 1 CA    1 
ATOM   1208  C  C     . ARG A  1  153 ? 42.162  -44.995  144.974  1.00 53.26  ? 153 ARG 1 C     1 
ATOM   1209  O  O     . ARG A  1  153 ? 41.368  -45.940  145.034  1.00 47.47  ? 153 ARG 1 O     1 
ATOM   1210  C  CB    . ARG A  1  153 ? 43.059  -44.509  142.702  1.00 56.19  ? 153 ARG 1 CB    1 
ATOM   1211  C  CG    . ARG A  1  153 ? 42.440  -44.450  141.327  1.00 57.16  ? 153 ARG 1 CG    1 
ATOM   1212  C  CD    . ARG A  1  153 ? 43.334  -45.071  140.287  1.00 57.24  ? 153 ARG 1 CD    1 
ATOM   1213  N  NE    . ARG A  1  153 ? 43.974  -44.081  139.438  1.00 57.43  ? 153 ARG 1 NE    1 
ATOM   1214  C  CZ    . ARG A  1  153 ? 44.599  -44.388  138.309  1.00 59.03  ? 153 ARG 1 CZ    1 
ATOM   1215  N  NH1   . ARG A  1  153 ? 44.654  -45.649  137.904  1.00 57.06  ? 153 ARG 1 NH1   1 
ATOM   1216  N  NH2   . ARG A  1  153 ? 45.171  -43.437  137.587  1.00 60.98  ? 153 ARG 1 NH2   1 
ATOM   1217  N  N     . ALA A  1  154 ? 43.101  -44.796  145.893  1.00 57.06  ? 154 ALA 1 N     1 
ATOM   1218  C  CA    . ALA A  1  154 ? 43.167  -45.652  147.070  1.00 58.64  ? 154 ALA 1 CA    1 
ATOM   1219  C  C     . ALA A  1  154 ? 41.972  -45.410  147.986  1.00 57.87  ? 154 ALA 1 C     1 
ATOM   1220  O  O     . ALA A  1  154 ? 41.309  -46.359  148.419  1.00 51.32  ? 154 ALA 1 O     1 
ATOM   1221  C  CB    . ALA A  1  154 ? 44.482  -45.420  147.812  1.00 59.88  ? 154 ALA 1 CB    1 
ATOM   1222  N  N     . ARG A  1  155 ? 41.679  -44.146  148.299  1.00 65.54  ? 155 ARG 1 N     1 
ATOM   1223  C  CA    . ARG A  1  155 ? 40.603  -43.825  149.234  1.00 73.98  ? 155 ARG 1 CA    1 
ATOM   1224  C  C     . ARG A  1  155 ? 39.224  -43.761  148.573  1.00 78.94  ? 155 ARG 1 C     1 
ATOM   1225  O  O     . ARG A  1  155 ? 38.291  -43.204  149.165  1.00 76.24  ? 155 ARG 1 O     1 
ATOM   1226  C  CB    . ARG A  1  155 ? 40.891  -42.511  149.965  1.00 76.63  ? 155 ARG 1 CB    1 
ATOM   1227  C  CG    . ARG A  1  155 ? 42.013  -42.602  151.000  1.00 76.57  ? 155 ARG 1 CG    1 
ATOM   1228  C  CD    . ARG A  1  155 ? 42.078  -41.349  151.860  1.00 76.15  ? 155 ARG 1 CD    1 
ATOM   1229  N  NE    . ARG A  1  155 ? 43.208  -41.356  152.782  1.00 76.75  ? 155 ARG 1 NE    1 
ATOM   1230  C  CZ    . ARG A  1  155 ? 43.522  -40.336  153.575  1.00 78.02  ? 155 ARG 1 CZ    1 
ATOM   1231  N  NH1   . ARG A  1  155 ? 42.784  -39.238  153.563  1.00 81.36  ? 155 ARG 1 NH1   1 
ATOM   1232  N  NH2   . ARG A  1  155 ? 44.574  -40.407  154.377  1.00 75.78  ? 155 ARG 1 NH2   1 
ATOM   1233  N  N     . GLY A  1  156 ? 39.083  -44.275  147.355  1.00 79.21  ? 156 GLY 1 N     1 
ATOM   1234  C  CA    . GLY A  1  156 ? 37.771  -44.477  146.773  1.00 83.03  ? 156 GLY 1 CA    1 
ATOM   1235  C  C     . GLY A  1  156 ? 37.164  -43.287  146.075  1.00 85.63  ? 156 GLY 1 C     1 
ATOM   1236  O  O     . GLY A  1  156 ? 35.945  -43.261  145.872  1.00 85.31  ? 156 GLY 1 O     1 
ATOM   1237  N  N     . TYR A  1  157 ? 37.965  -42.304  145.689  1.00 88.63  ? 157 TYR 1 N     1 
ATOM   1238  C  CA    . TYR A  1  157 ? 37.415  -41.146  145.006  1.00 91.52  ? 157 TYR 1 CA    1 
ATOM   1239  C  C     . TYR A  1  157 ? 37.287  -41.347  143.501  1.00 93.90  ? 157 TYR 1 C     1 
ATOM   1240  O  O     . TYR A  1  157 ? 36.459  -40.681  142.872  1.00 94.54  ? 157 TYR 1 O     1 
ATOM   1241  C  CB    . TYR A  1  157 ? 38.272  -39.913  145.308  1.00 91.40  ? 157 TYR 1 CB    1 
ATOM   1242  C  CG    . TYR A  1  157 ? 38.179  -39.445  146.751  1.00 91.29  ? 157 TYR 1 CG    1 
ATOM   1243  C  CD1   . TYR A  1  157 ? 37.184  -38.570  147.156  1.00 91.13  ? 157 TYR 1 CD1   1 
ATOM   1244  C  CD2   . TYR A  1  157 ? 39.085  -39.880  147.706  1.00 91.22  ? 157 TYR 1 CD2   1 
ATOM   1245  C  CE1   . TYR A  1  157 ? 37.094  -38.136  148.474  1.00 90.88  ? 157 TYR 1 CE1   1 
ATOM   1246  C  CE2   . TYR A  1  157 ? 38.999  -39.451  149.025  1.00 91.13  ? 157 TYR 1 CE2   1 
ATOM   1247  C  CZ    . TYR A  1  157 ? 38.002  -38.582  149.403  1.00 90.98  ? 157 TYR 1 CZ    1 
ATOM   1248  O  OH    . TYR A  1  157 ? 37.915  -38.156  150.711  1.00 90.81  ? 157 TYR 1 OH    1 
ATOM   1249  N  N     . LEU A  1  158 ? 38.048  -42.270  142.917  1.00 95.01  ? 158 LEU 1 N     1 
ATOM   1250  C  CA    . LEU A  1  158 ? 37.931  -42.614  141.503  1.00 96.03  ? 158 LEU 1 CA    1 
ATOM   1251  C  C     . LEU A  1  158 ? 37.692  -44.113  141.412  1.00 100.86 ? 158 LEU 1 C     1 
ATOM   1252  O  O     . LEU A  1  158 ? 38.598  -44.909  141.683  1.00 101.46 ? 158 LEU 1 O     1 
ATOM   1253  C  CB    . LEU A  1  158 ? 39.183  -42.211  140.730  1.00 93.31  ? 158 LEU 1 CB    1 
ATOM   1254  C  CG    . LEU A  1  158 ? 39.646  -40.758  140.818  1.00 95.33  ? 158 LEU 1 CG    1 
ATOM   1255  C  CD1   . LEU A  1  158 ? 40.767  -40.513  139.830  1.00 96.82  ? 158 LEU 1 CD1   1 
ATOM   1256  C  CD2   . LEU A  1  158 ? 38.487  -39.812  140.551  1.00 97.32  ? 158 LEU 1 CD2   1 
ATOM   1257  N  N     . GLY A  1  159 ? 36.479  -44.497  141.029  1.00 103.35 ? 159 GLY 1 N     1 
ATOM   1258  C  CA    . GLY A  1  159 ? 36.112  -45.897  141.062  1.00 103.38 ? 159 GLY 1 CA    1 
ATOM   1259  C  C     . GLY A  1  159 ? 34.976  -46.199  140.110  1.00 102.71 ? 159 GLY 1 C     1 
ATOM   1260  O  O     . GLY A  1  159 ? 34.499  -45.334  139.372  1.00 102.53 ? 159 GLY 1 O     1 
ATOM   1261  N  N     . LYS A  1  160 ? 34.562  -47.467  140.137  1.00 103.30 ? 160 LYS 1 N     1 
ATOM   1262  C  CA    . LYS A  1  160 ? 33.492  -47.934  139.265  1.00 105.33 ? 160 LYS 1 CA    1 
ATOM   1263  C  C     . LYS A  1  160 ? 32.204  -47.155  139.502  1.00 104.07 ? 160 LYS 1 C     1 
ATOM   1264  O  O     . LYS A  1  160 ? 31.555  -46.707  138.552  1.00 106.25 ? 160 LYS 1 O     1 
ATOM   1265  C  CB    . LYS A  1  160 ? 33.276  -49.427  139.485  1.00 106.54 ? 160 LYS 1 CB    1 
ATOM   1266  C  CG    . LYS A  1  160 ? 34.569  -50.213  139.490  1.00 108.72 ? 160 LYS 1 CG    1 
ATOM   1267  C  CD    . LYS A  1  160 ? 35.253  -50.184  138.139  1.00 109.99 ? 160 LYS 1 CD    1 
ATOM   1268  C  CE    . LYS A  1  160 ? 36.603  -50.874  138.203  1.00 110.73 ? 160 LYS 1 CE    1 
ATOM   1269  N  NZ    . LYS A  1  160 ? 36.471  -52.303  138.582  1.00 112.21 ? 160 LYS 1 NZ    1 
ATOM   1270  N  N     . ASN A  1  161 ? 31.803  -47.006  140.762  1.00 101.71 ? 161 ASN 1 N     1 
ATOM   1271  C  CA    . ASN A  1  161 ? 30.654  -46.186  141.125  1.00 93.37  ? 161 ASN 1 CA    1 
ATOM   1272  C  C     . ASN A  1  161 ? 31.058  -45.280  142.273  1.00 86.05  ? 161 ASN 1 C     1 
ATOM   1273  O  O     . ASN A  1  161 ? 31.519  -45.760  143.313  1.00 84.57  ? 161 ASN 1 O     1 
ATOM   1274  C  CB    . ASN A  1  161 ? 29.440  -47.041  141.507  1.00 89.37  ? 161 ASN 1 CB    1 
ATOM   1275  C  CG    . ASN A  1  161 ? 28.877  -47.818  140.332  1.00 86.91  ? 161 ASN 1 CG    1 
ATOM   1276  O  OD1   . ASN A  1  161 ? 27.858  -47.442  139.757  1.00 85.64  ? 161 ASN 1 OD1   1 
ATOM   1277  N  ND2   . ASN A  1  161 ? 29.537  -48.909  139.972  1.00 86.41  ? 161 ASN 1 ND2   1 
ATOM   1278  N  N     . LEU A  1  162 ? 30.890  -43.978  142.083  1.00 82.91  ? 162 LEU 1 N     1 
ATOM   1279  C  CA    . LEU A  1  162 ? 31.331  -42.996  143.061  1.00 84.15  ? 162 LEU 1 CA    1 
ATOM   1280  C  C     . LEU A  1  162 ? 30.192  -42.668  144.018  1.00 84.64  ? 162 LEU 1 C     1 
ATOM   1281  O  O     . LEU A  1  162 ? 29.112  -42.247  143.589  1.00 84.66  ? 162 LEU 1 O     1 
ATOM   1282  C  CB    . LEU A  1  162 ? 31.836  -41.733  142.364  1.00 84.10  ? 162 LEU 1 CB    1 
ATOM   1283  C  CG    . LEU A  1  162 ? 33.057  -41.929  141.467  1.00 81.10  ? 162 LEU 1 CG    1 
ATOM   1284  C  CD1   . LEU A  1  162 ? 33.591  -40.584  140.995  1.00 80.83  ? 162 LEU 1 CD1   1 
ATOM   1285  C  CD2   . LEU A  1  162 ? 34.120  -42.722  142.199  1.00 77.66  ? 162 LEU 1 CD2   1 
ATOM   1286  N  N     . PHE A  1  163 ? 30.427  -42.904  145.308  1.00 85.38  ? 163 PHE 1 N     1 
ATOM   1287  C  CA    . PHE A  1  163 ? 29.557  -42.440  146.385  1.00 89.00  ? 163 PHE 1 CA    1 
ATOM   1288  C  C     . PHE A  1  163 ? 28.140  -43.006  146.285  1.00 88.98  ? 163 PHE 1 C     1 
ATOM   1289  O  O     . PHE A  1  163 ? 27.173  -42.363  146.701  1.00 85.87  ? 163 PHE 1 O     1 
ATOM   1290  C  CB    . PHE A  1  163 ? 29.514  -40.906  146.438  1.00 93.31  ? 163 PHE 1 CB    1 
ATOM   1291  C  CG    . PHE A  1  163 ? 30.872  -40.242  146.322  1.00 95.71  ? 163 PHE 1 CG    1 
ATOM   1292  C  CD1   . PHE A  1  163 ? 31.971  -40.744  146.994  1.00 96.46  ? 163 PHE 1 CD1   1 
ATOM   1293  C  CD2   . PHE A  1  163 ? 31.030  -39.082  145.583  1.00 93.26  ? 163 PHE 1 CD2   1 
ATOM   1294  C  CE1   . PHE A  1  163 ? 33.208  -40.127  146.889  1.00 93.31  ? 163 PHE 1 CE1   1 
ATOM   1295  C  CE2   . PHE A  1  163 ? 32.266  -38.461  145.485  1.00 90.55  ? 163 PHE 1 CE2   1 
ATOM   1296  C  CZ    . PHE A  1  163 ? 33.350  -38.984  146.138  1.00 90.78  ? 163 PHE 1 CZ    1 
ATOM   1297  N  N     . GLY A  1  164 ? 28.001  -44.207  145.727  1.00 93.29  ? 164 GLY 1 N     1 
ATOM   1298  C  CA    . GLY A  1  164 ? 26.725  -44.885  145.636  1.00 95.84  ? 164 GLY 1 CA    1 
ATOM   1299  C  C     . GLY A  1  164 ? 25.892  -44.503  144.430  1.00 99.04  ? 164 GLY 1 C     1 
ATOM   1300  O  O     . GLY A  1  164 ? 25.103  -45.323  143.949  1.00 100.17 ? 164 GLY 1 O     1 
ATOM   1301  N  N     . THR A  1  165 ? 26.045  -43.278  143.933  1.00 100.27 ? 165 THR 1 N     1 
ATOM   1302  C  CA    . THR A  1  165 ? 25.293  -42.851  142.768  1.00 102.59 ? 165 THR 1 CA    1 
ATOM   1303  C  C     . THR A  1  165 ? 25.812  -43.578  141.530  1.00 106.01 ? 165 THR 1 C     1 
ATOM   1304  O  O     . THR A  1  165 ? 26.888  -44.184  141.540  1.00 107.70 ? 165 THR 1 O     1 
ATOM   1305  C  CB    . THR A  1  165 ? 25.378  -41.335  142.598  1.00 103.67 ? 165 THR 1 CB    1 
ATOM   1306  O  OG1   . THR A  1  165 ? 24.275  -40.885  141.805  1.00 105.39 ? 165 THR 1 OG1   1 
ATOM   1307  C  CG2   . THR A  1  165 ? 26.674  -40.934  141.917  1.00 104.21 ? 165 THR 1 CG2   1 
ATOM   1308  N  N     . ASP A  1  166 ? 25.042  -43.494  140.443  1.00 108.15 ? 166 ASP 1 N     1 
ATOM   1309  C  CA    . ASP A  1  166 ? 25.322  -44.243  139.221  1.00 109.76 ? 166 ASP 1 CA    1 
ATOM   1310  C  C     . ASP A  1  166 ? 26.379  -43.587  138.336  1.00 100.47 ? 166 ASP 1 C     1 
ATOM   1311  O  O     . ASP A  1  166 ? 26.464  -43.930  137.148  1.00 100.30 ? 166 ASP 1 O     1 
ATOM   1312  C  CB    . ASP A  1  166 ? 24.031  -44.432  138.419  1.00 118.35 ? 166 ASP 1 CB    1 
ATOM   1313  C  CG    . ASP A  1  166 ? 23.359  -43.115  138.087  1.00 124.95 ? 166 ASP 1 CG    1 
ATOM   1314  O  OD1   . ASP A  1  166 ? 23.429  -42.176  138.908  1.00 126.69 ? 166 ASP 1 OD1   1 
ATOM   1315  O  OD2   . ASP A  1  166 ? 22.753  -43.021  137.000  1.00 127.05 ? 166 ASP 1 OD2   1 
ATOM   1316  N  N     . PHE A  1  167 ? 27.174  -42.661  138.866  1.00 90.08  ? 167 PHE 1 N     1 
ATOM   1317  C  CA    . PHE A  1  167 ? 28.223  -42.008  138.099  1.00 79.60  ? 167 PHE 1 CA    1 
ATOM   1318  C  C     . PHE A  1  167 ? 29.571  -42.671  138.359  1.00 74.97  ? 167 PHE 1 C     1 
ATOM   1319  O  O     . PHE A  1  167 ? 29.824  -43.208  139.439  1.00 70.92  ? 167 PHE 1 O     1 
ATOM   1320  C  CB    . PHE A  1  167 ? 28.295  -40.513  138.430  1.00 74.93  ? 167 PHE 1 CB    1 
ATOM   1321  C  CG    . PHE A  1  167 ? 29.331  -39.767  137.635  1.00 73.67  ? 167 PHE 1 CG    1 
ATOM   1322  C  CD1   . PHE A  1  167 ? 29.100  -39.430  136.316  1.00 73.75  ? 167 PHE 1 CD1   1 
ATOM   1323  C  CD2   . PHE A  1  167 ? 30.527  -39.385  138.213  1.00 72.29  ? 167 PHE 1 CD2   1 
ATOM   1324  C  CE1   . PHE A  1  167 ? 30.048  -38.743  135.583  1.00 71.19  ? 167 PHE 1 CE1   1 
ATOM   1325  C  CE2   . PHE A  1  167 ? 31.476  -38.694  137.479  1.00 69.87  ? 167 PHE 1 CE2   1 
ATOM   1326  C  CZ    . PHE A  1  167 ? 31.233  -38.376  136.165  1.00 69.20  ? 167 PHE 1 CZ    1 
ATOM   1327  N  N     . SER A  1  168 ? 30.430  -42.626  137.345  1.00 77.95  ? 168 SER 1 N     1 
ATOM   1328  C  CA    . SER A  1  168 ? 31.766  -43.193  137.388  1.00 76.75  ? 168 SER 1 CA    1 
ATOM   1329  C  C     . SER A  1  168 ? 32.755  -42.156  136.888  1.00 69.61  ? 168 SER 1 C     1 
ATOM   1330  O  O     . SER A  1  168 ? 32.411  -41.302  136.071  1.00 70.16  ? 168 SER 1 O     1 
ATOM   1331  C  CB    . SER A  1  168 ? 31.870  -44.437  136.510  1.00 86.99  ? 168 SER 1 CB    1 
ATOM   1332  O  OG    . SER A  1  168 ? 30.992  -45.447  136.963  1.00 100.90 ? 168 SER 1 OG    1 
ATOM   1333  N  N     . PHE A  1  169 ? 33.999  -42.258  137.339  1.00 62.99  ? 169 PHE 1 N     1 
ATOM   1334  C  CA    . PHE A  1  169 ? 34.995  -41.294  136.891  1.00 60.15  ? 169 PHE 1 CA    1 
ATOM   1335  C  C     . PHE A  1  169 ? 36.387  -41.861  137.090  1.00 58.23  ? 169 PHE 1 C     1 
ATOM   1336  O  O     . PHE A  1  169 ? 36.640  -42.571  138.068  1.00 58.06  ? 169 PHE 1 O     1 
ATOM   1337  C  CB    . PHE A  1  169 ? 34.867  -39.963  137.638  1.00 62.51  ? 169 PHE 1 CB    1 
ATOM   1338  C  CG    . PHE A  1  169 ? 35.412  -38.797  136.873  1.00 65.39  ? 169 PHE 1 CG    1 
ATOM   1339  C  CD1   . PHE A  1  169 ? 34.668  -38.198  135.883  1.00 68.29  ? 169 PHE 1 CD1   1 
ATOM   1340  C  CD2   . PHE A  1  169 ? 36.672  -38.303  137.138  1.00 65.82  ? 169 PHE 1 CD2   1 
ATOM   1341  C  CE1   . PHE A  1  169 ? 35.162  -37.126  135.173  1.00 69.32  ? 169 PHE 1 CE1   1 
ATOM   1342  C  CE2   . PHE A  1  169 ? 37.167  -37.226  136.427  1.00 66.92  ? 169 PHE 1 CE2   1 
ATOM   1343  C  CZ    . PHE A  1  169 ? 36.410  -36.641  135.445  1.00 68.57  ? 169 PHE 1 CZ    1 
ATOM   1344  N  N     . ASP A  1  170 ? 37.285  -41.515  136.175  1.00 58.77  ? 170 ASP 1 N     1 
ATOM   1345  C  CA    . ASP A  1  170 ? 38.681  -41.910  136.281  1.00 62.70  ? 170 ASP 1 CA    1 
ATOM   1346  C  C     . ASP A  1  170 ? 39.508  -40.915  135.489  1.00 58.14  ? 170 ASP 1 C     1 
ATOM   1347  O  O     . ASP A  1  170 ? 39.040  -40.349  134.497  1.00 61.29  ? 170 ASP 1 O     1 
ATOM   1348  C  CB    . ASP A  1  170 ? 38.914  -43.339  135.751  1.00 68.81  ? 170 ASP 1 CB    1 
ATOM   1349  C  CG    . ASP A  1  170 ? 40.264  -43.923  136.173  1.00 69.80  ? 170 ASP 1 CG    1 
ATOM   1350  O  OD1   . ASP A  1  170 ? 41.172  -43.147  136.524  1.00 69.90  ? 170 ASP 1 OD1   1 
ATOM   1351  O  OD2   . ASP A  1  170 ? 40.420  -45.165  136.151  1.00 68.95  ? 170 ASP 1 OD2   1 
ATOM   1352  N  N     . LEU A  1  171 ? 40.741  -40.705  135.936  1.00 53.48  ? 171 LEU 1 N     1 
ATOM   1353  C  CA    . LEU A  1  171 ? 41.647  -39.783  135.279  1.00 54.53  ? 171 LEU 1 CA    1 
ATOM   1354  C  C     . LEU A  1  171 ? 42.926  -40.486  134.861  1.00 58.09  ? 171 LEU 1 C     1 
ATOM   1355  O  O     . LEU A  1  171 ? 43.350  -41.466  135.479  1.00 60.80  ? 171 LEU 1 O     1 
ATOM   1356  C  CB    . LEU A  1  171 ? 41.974  -38.595  136.174  1.00 50.38  ? 171 LEU 1 CB    1 
ATOM   1357  C  CG    . LEU A  1  171 ? 40.729  -37.734  136.327  1.00 45.34  ? 171 LEU 1 CG    1 
ATOM   1358  C  CD1   . LEU A  1  171 ? 41.023  -36.535  137.195  1.00 46.24  ? 171 LEU 1 CD1   1 
ATOM   1359  C  CD2   . LEU A  1  171 ? 40.228  -37.325  134.947  1.00 41.10  ? 171 LEU 1 CD2   1 
ATOM   1360  N  N     . HIS A  1  172 ? 43.531  -39.977  133.791  1.00 57.59  ? 172 HIS 1 N     1 
ATOM   1361  C  CA    . HIS A  1  172 ? 44.788  -40.504  133.290  1.00 61.21  ? 172 HIS 1 CA    1 
ATOM   1362  C  C     . HIS A  1  172 ? 45.648  -39.340  132.829  1.00 61.11  ? 172 HIS 1 C     1 
ATOM   1363  O  O     . HIS A  1  172 ? 45.155  -38.410  132.182  1.00 58.62  ? 172 HIS 1 O     1 
ATOM   1364  C  CB    . HIS A  1  172 ? 44.565  -41.481  132.130  1.00 65.00  ? 172 HIS 1 CB    1 
ATOM   1365  C  CG    . HIS A  1  172 ? 43.703  -42.649  132.490  1.00 66.97  ? 172 HIS 1 CG    1 
ATOM   1366  N  ND1   . HIS A  1  172 ? 44.051  -43.562  133.466  1.00 65.66  ? 172 HIS 1 ND1   1 
ATOM   1367  C  CD2   . HIS A  1  172 ? 42.490  -43.033  132.027  1.00 66.08  ? 172 HIS 1 CD2   1 
ATOM   1368  C  CE1   . HIS A  1  172 ? 43.096  -44.470  133.572  1.00 66.75  ? 172 HIS 1 CE1   1 
ATOM   1369  N  NE2   . HIS A  1  172 ? 42.137  -44.169  132.713  1.00 66.00  ? 172 HIS 1 NE2   1 
ATOM   1370  N  N     . VAL A  1  173 ? 46.923  -39.392  133.183  1.00 65.01  ? 173 VAL 1 N     1 
ATOM   1371  C  CA    . VAL A  1  173 ? 47.896  -38.352  132.867  1.00 67.23  ? 173 VAL 1 CA    1 
ATOM   1372  C  C     . VAL A  1  173 ? 48.630  -38.758  131.600  1.00 70.59  ? 173 VAL 1 C     1 
ATOM   1373  O  O     . VAL A  1  173 ? 48.874  -39.944  131.350  1.00 79.43  ? 173 VAL 1 O     1 
ATOM   1374  C  CB    . VAL A  1  173 ? 48.876  -38.125  134.039  1.00 68.10  ? 173 VAL 1 CB    1 
ATOM   1375  C  CG1   . VAL A  1  173 ? 49.688  -36.849  133.831  1.00 64.25  ? 173 VAL 1 CG1   1 
ATOM   1376  C  CG2   . VAL A  1  173 ? 48.123  -38.096  135.372  1.00 72.09  ? 173 VAL 1 CG2   1 
ATOM   1377  N  N     . HIS A  1  174 ? 48.980  -37.771  130.788  1.00 65.40  ? 174 HIS 1 N     1 
ATOM   1378  C  CA    . HIS A  1  174 ? 49.732  -37.989  129.557  1.00 64.19  ? 174 HIS 1 CA    1 
ATOM   1379  C  C     . HIS A  1  174 ? 50.700  -36.828  129.428  1.00 64.65  ? 174 HIS 1 C     1 
ATOM   1380  O  O     . HIS A  1  174 ? 50.275  -35.692  129.195  1.00 65.88  ? 174 HIS 1 O     1 
ATOM   1381  C  CB    . HIS A  1  174 ? 48.792  -38.060  128.353  1.00 69.09  ? 174 HIS 1 CB    1 
ATOM   1382  C  CG    . HIS A  1  174 ? 49.442  -38.540  127.092  1.00 68.52  ? 174 HIS 1 CG    1 
ATOM   1383  N  ND1   . HIS A  1  174 ? 49.506  -39.873  126.742  1.00 72.24  ? 174 HIS 1 ND1   1 
ATOM   1384  C  CD2   . HIS A  1  174 ? 50.040  -37.856  126.086  1.00 72.72  ? 174 HIS 1 CD2   1 
ATOM   1385  C  CE1   . HIS A  1  174 ? 50.124  -39.991  125.580  1.00 70.78  ? 174 HIS 1 CE1   1 
ATOM   1386  N  NE2   . HIS A  1  174 ? 50.457  -38.783  125.161  1.00 73.50  ? 174 HIS 1 NE2   1 
ATOM   1387  N  N     . ARG A  1  175 ? 51.992  -37.095  129.574  1.00 63.33  ? 175 ARG 1 N     1 
ATOM   1388  C  CA    . ARG A  1  175 ? 52.973  -36.024  129.537  1.00 63.88  ? 175 ARG 1 CA    1 
ATOM   1389  C  C     . ARG A  1  175 ? 53.400  -35.711  128.111  1.00 62.33  ? 175 ARG 1 C     1 
ATOM   1390  O  O     . ARG A  1  175 ? 53.650  -36.614  127.306  1.00 63.68  ? 175 ARG 1 O     1 
ATOM   1391  C  CB    . ARG A  1  175 ? 54.206  -36.369  130.370  1.00 66.02  ? 175 ARG 1 CB    1 
ATOM   1392  C  CG    . ARG A  1  175 ? 54.002  -36.373  131.872  1.00 67.37  ? 175 ARG 1 CG    1 
ATOM   1393  C  CD    . ARG A  1  175 ? 55.347  -36.499  132.556  1.00 69.33  ? 175 ARG 1 CD    1 
ATOM   1394  N  NE    . ARG A  1  175 ? 56.131  -35.277  132.406  1.00 71.29  ? 175 ARG 1 NE    1 
ATOM   1395  C  CZ    . ARG A  1  175 ? 57.456  -35.222  132.506  1.00 74.30  ? 175 ARG 1 CZ    1 
ATOM   1396  N  NH1   . ARG A  1  175 ? 58.158  -36.319  132.748  1.00 75.53  ? 175 ARG 1 NH1   1 
ATOM   1397  N  NH2   . ARG A  1  175 ? 58.082  -34.067  132.355  1.00 75.75  ? 175 ARG 1 NH2   1 
ATOM   1398  N  N     . GLY A  1  176 ? 53.474  -34.412  127.812  1.00 57.24  ? 176 GLY 1 N     1 
ATOM   1399  C  CA    . GLY A  1  176 ? 53.877  -33.930  126.511  1.00 53.51  ? 176 GLY 1 CA    1 
ATOM   1400  C  C     . GLY A  1  176 ? 55.386  -33.850  126.394  1.00 53.47  ? 176 GLY 1 C     1 
ATOM   1401  O  O     . GLY A  1  176 ? 56.134  -34.388  127.209  1.00 55.89  ? 176 GLY 1 O     1 
ATOM   1402  N  N     . ALA A  1  177 ? 55.840  -33.130  125.361  1.00 53.45  ? 177 ALA 1 N     1 
ATOM   1403  C  CA    . ALA A  1  177 ? 57.271  -33.008  125.095  1.00 52.27  ? 177 ALA 1 CA    1 
ATOM   1404  C  C     . ALA A  1  177 ? 57.656  -31.590  124.704  1.00 51.23  ? 177 ALA 1 C     1 
ATOM   1405  O  O     . ALA A  1  177 ? 58.612  -31.386  123.943  1.00 46.16  ? 177 ALA 1 O     1 
ATOM   1406  C  CB    . ALA A  1  177 ? 57.719  -33.977  124.006  1.00 53.89  ? 177 ALA 1 CB    1 
ATOM   1407  N  N     . GLY A  1  178 ? 56.900  -30.608  125.178  1.00 58.04  ? 178 GLY 1 N     1 
ATOM   1408  C  CA    . GLY A  1  178 ? 57.276  -29.226  124.996  1.00 66.15  ? 178 GLY 1 CA    1 
ATOM   1409  C  C     . GLY A  1  178 ? 57.102  -28.715  123.584  1.00 72.53  ? 178 GLY 1 C     1 
ATOM   1410  O  O     . GLY A  1  178 ? 58.090  -28.383  122.915  1.00 76.54  ? 178 GLY 1 O     1 
ATOM   1411  N  N     . ALA A  1  179 ? 55.853  -28.630  123.125  1.00 69.28  ? 179 ALA 1 N     1 
ATOM   1412  C  CA    . ALA A  1  179 ? 55.550  -28.070  121.811  1.00 63.23  ? 179 ALA 1 CA    1 
ATOM   1413  C  C     . ALA A  1  179 ? 54.336  -27.160  121.957  1.00 58.44  ? 179 ALA 1 C     1 
ATOM   1414  O  O     . ALA A  1  179 ? 53.234  -27.632  122.251  1.00 59.15  ? 179 ALA 1 O     1 
ATOM   1415  C  CB    . ALA A  1  179 ? 55.306  -29.169  120.781  1.00 60.53  ? 179 ALA 1 CB    1 
ATOM   1416  N  N     . TYR A  1  180 ? 54.563  -25.854  121.762  1.00 53.14  ? 180 TYR 1 N     1 
ATOM   1417  C  CA    . TYR A  1  180 ? 53.553  -24.819  121.994  1.00 47.44  ? 180 TYR 1 CA    1 
ATOM   1418  C  C     . TYR A  1  180 ? 52.276  -25.066  121.201  1.00 39.71  ? 180 TYR 1 C     1 
ATOM   1419  O  O     . TYR A  1  180 ? 51.165  -24.885  121.718  1.00 31.54  ? 180 TYR 1 O     1 
ATOM   1420  C  CB    . TYR A  1  180 ? 54.154  -23.448  121.654  1.00 54.32  ? 180 TYR 1 CB    1 
ATOM   1421  C  CG    . TYR A  1  180 ? 53.177  -22.289  121.690  1.00 58.20  ? 180 TYR 1 CG    1 
ATOM   1422  C  CD1   . TYR A  1  180 ? 52.227  -22.181  122.686  1.00 59.09  ? 180 TYR 1 CD1   1 
ATOM   1423  C  CD2   . TYR A  1  180 ? 53.203  -21.308  120.712  1.00 57.58  ? 180 TYR 1 CD2   1 
ATOM   1424  C  CE1   . TYR A  1  180 ? 51.322  -21.129  122.698  1.00 57.61  ? 180 TYR 1 CE1   1 
ATOM   1425  C  CE2   . TYR A  1  180 ? 52.302  -20.255  120.725  1.00 54.94  ? 180 TYR 1 CE2   1 
ATOM   1426  C  CZ    . TYR A  1  180 ? 51.367  -20.172  121.718  1.00 54.74  ? 180 TYR 1 CZ    1 
ATOM   1427  O  OH    . TYR A  1  180 ? 50.475  -19.131  121.731  1.00 54.12  ? 180 TYR 1 OH    1 
ATOM   1428  N  N     . ILE A  1  181 ? 52.410  -25.440  119.928  1.00 45.91  ? 181 ILE 1 N     1 
ATOM   1429  C  CA    . ILE A  1  181 ? 51.220  -25.620  119.105  1.00 54.67  ? 181 ILE 1 CA    1 
ATOM   1430  C  C     . ILE A  1  181 ? 50.385  -26.779  119.638  1.00 62.11  ? 181 ILE 1 C     1 
ATOM   1431  O  O     . ILE A  1  181 ? 49.158  -26.778  119.502  1.00 65.66  ? 181 ILE 1 O     1 
ATOM   1432  C  CB    . ILE A  1  181 ? 51.609  -25.831  117.631  1.00 56.08  ? 181 ILE 1 CB    1 
ATOM   1433  C  CG1   . ILE A  1  181 ? 50.353  -26.002  116.779  1.00 51.13  ? 181 ILE 1 CG1   1 
ATOM   1434  C  CG2   . ILE A  1  181 ? 52.525  -27.052  117.470  1.00 58.02  ? 181 ILE 1 CG2   1 
ATOM   1435  C  CD1   . ILE A  1  181 ? 49.481  -24.755  116.762  1.00 44.22  ? 181 ILE 1 CD1   1 
ATOM   1436  N  N     . CYS A  1  182 ? 51.031  -27.779  120.260  1.00 61.90  ? 182 CYS 1 N     1 
ATOM   1437  C  CA    . CYS A  1  182 ? 50.321  -28.915  120.843  1.00 56.92  ? 182 CYS 1 CA    1 
ATOM   1438  C  C     . CYS A  1  182 ? 49.370  -28.507  121.946  1.00 53.81  ? 182 CYS 1 C     1 
ATOM   1439  O  O     . CYS A  1  182 ? 48.561  -29.337  122.372  1.00 53.96  ? 182 CYS 1 O     1 
ATOM   1440  C  CB    . CYS A  1  182 ? 51.297  -29.950  121.382  1.00 59.06  ? 182 CYS 1 CB    1 
ATOM   1441  S  SG    . CYS A  1  182 ? 52.382  -30.599  120.143  1.00 65.45  ? 182 CYS 1 SG    1 
ATOM   1442  N  N     . GLY A  1  183 ? 49.452  -27.259  122.417  1.00 52.50  ? 183 GLY 1 N     1 
ATOM   1443  C  CA    . GLY A  1  183 ? 48.455  -26.757  123.341  1.00 51.67  ? 183 GLY 1 CA    1 
ATOM   1444  C  C     . GLY A  1  183 ? 47.131  -26.458  122.680  1.00 54.18  ? 183 GLY 1 C     1 
ATOM   1445  O  O     . GLY A  1  183 ? 46.110  -26.377  123.370  1.00 50.27  ? 183 GLY 1 O     1 
ATOM   1446  N  N     . GLU A  1  184 ? 47.131  -26.279  121.361  1.00 60.23  ? 184 GLU 1 N     1 
ATOM   1447  C  CA    . GLU A  1  184 ? 45.900  -26.039  120.622  1.00 64.32  ? 184 GLU 1 CA    1 
ATOM   1448  C  C     . GLU A  1  184 ? 44.928  -27.182  120.870  1.00 69.56  ? 184 GLU 1 C     1 
ATOM   1449  O  O     . GLU A  1  184 ? 45.296  -28.359  120.778  1.00 67.57  ? 184 GLU 1 O     1 
ATOM   1450  C  CB    . GLU A  1  184 ? 46.208  -25.912  119.130  1.00 64.60  ? 184 GLU 1 CB    1 
ATOM   1451  C  CG    . GLU A  1  184 ? 45.345  -24.932  118.344  1.00 68.25  ? 184 GLU 1 CG    1 
ATOM   1452  C  CD    . GLU A  1  184 ? 44.013  -25.506  117.903  1.00 71.46  ? 184 GLU 1 CD    1 
ATOM   1453  O  OE1   . GLU A  1  184 ? 43.865  -26.740  117.919  1.00 72.94  ? 184 GLU 1 OE1   1 
ATOM   1454  O  OE2   . GLU A  1  184 ? 43.112  -24.719  117.540  1.00 71.87  ? 184 GLU 1 OE2   1 
ATOM   1455  N  N     . GLU A  1  185 ? 43.681  -26.825  121.194  1.00 73.51  ? 185 GLU 1 N     1 
ATOM   1456  C  CA    . GLU A  1  185 ? 42.701  -27.812  121.643  1.00 74.68  ? 185 GLU 1 CA    1 
ATOM   1457  C  C     . GLU A  1  185 ? 42.461  -28.908  120.605  1.00 69.84  ? 185 GLU 1 C     1 
ATOM   1458  O  O     . GLU A  1  185 ? 42.275  -30.076  120.966  1.00 64.82  ? 185 GLU 1 O     1 
ATOM   1459  C  CB    . GLU A  1  185 ? 41.400  -27.102  122.035  1.00 75.85  ? 185 GLU 1 CB    1 
ATOM   1460  C  CG    . GLU A  1  185 ? 40.795  -26.201  120.978  1.00 78.01  ? 185 GLU 1 CG    1 
ATOM   1461  C  CD    . GLU A  1  185 ? 39.514  -25.533  121.453  1.00 83.86  ? 185 GLU 1 CD    1 
ATOM   1462  O  OE1   . GLU A  1  185 ? 38.620  -26.241  121.958  1.00 85.88  ? 185 GLU 1 OE1   1 
ATOM   1463  O  OE2   . GLU A  1  185 ? 39.401  -24.296  121.338  1.00 86.80  ? 185 GLU 1 OE2   1 
ATOM   1464  N  N     . THR A  1  186 ? 42.484  -28.558  119.314  1.00 69.10  ? 186 THR 1 N     1 
ATOM   1465  C  CA    . THR A  1  186 ? 42.336  -29.538  118.245  1.00 70.33  ? 186 THR 1 CA    1 
ATOM   1466  C  C     . THR A  1  186 ? 43.662  -30.174  117.848  1.00 72.99  ? 186 THR 1 C     1 
ATOM   1467  O  O     . THR A  1  186 ? 43.659  -31.251  117.244  1.00 76.65  ? 186 THR 1 O     1 
ATOM   1468  C  CB    . THR A  1  186 ? 41.691  -28.903  116.999  1.00 72.11  ? 186 THR 1 CB    1 
ATOM   1469  O  OG1   . THR A  1  186 ? 42.480  -27.795  116.560  1.00 73.12  ? 186 THR 1 OG1   1 
ATOM   1470  C  CG2   . THR A  1  186 ? 40.283  -28.386  117.298  1.00 73.26  ? 186 THR 1 CG2   1 
ATOM   1471  N  N     . ALA A  1  187 ? 44.791  -29.536  118.150  1.00 72.76  ? 187 ALA 1 N     1 
ATOM   1472  C  CA    . ALA A  1  187 ? 46.082  -30.165  117.897  1.00 74.49  ? 187 ALA 1 CA    1 
ATOM   1473  C  C     . ALA A  1  187 ? 46.532  -31.055  119.047  1.00 73.28  ? 187 ALA 1 C     1 
ATOM   1474  O  O     . ALA A  1  187 ? 47.256  -32.031  118.818  1.00 69.56  ? 187 ALA 1 O     1 
ATOM   1475  C  CB    . ALA A  1  187 ? 47.144  -29.095  117.618  1.00 75.22  ? 187 ALA 1 CB    1 
ATOM   1476  N  N     . LEU A  1  188 ? 46.120  -30.730  120.276  1.00 75.15  ? 188 LEU 1 N     1 
ATOM   1477  C  CA    . LEU A  1  188 ? 46.430  -31.575  121.427  1.00 75.78  ? 188 LEU 1 CA    1 
ATOM   1478  C  C     . LEU A  1  188 ? 45.866  -32.978  121.240  1.00 77.36  ? 188 LEU 1 C     1 
ATOM   1479  O  O     . LEU A  1  188 ? 46.518  -33.977  121.576  1.00 75.69  ? 188 LEU 1 O     1 
ATOM   1480  C  CB    . LEU A  1  188 ? 45.874  -30.933  122.702  1.00 73.40  ? 188 LEU 1 CB    1 
ATOM   1481  C  CG    . LEU A  1  188 ? 46.305  -31.458  124.079  1.00 73.90  ? 188 LEU 1 CG    1 
ATOM   1482  C  CD1   . LEU A  1  188 ? 46.131  -30.385  125.130  1.00 71.97  ? 188 LEU 1 CD1   1 
ATOM   1483  C  CD2   . LEU A  1  188 ? 45.515  -32.683  124.510  1.00 77.25  ? 188 LEU 1 CD2   1 
ATOM   1484  N  N     . MET A  1  189 ? 44.642  -33.064  120.718  1.00 80.73  ? 189 MET 1 N     1 
ATOM   1485  C  CA    . MET A  1  189 ? 43.993  -34.352  120.517  1.00 83.87  ? 189 MET 1 CA    1 
ATOM   1486  C  C     . MET A  1  189 ? 44.756  -35.180  119.489  1.00 84.97  ? 189 MET 1 C     1 
ATOM   1487  O  O     . MET A  1  189 ? 44.922  -36.398  119.652  1.00 84.16  ? 189 MET 1 O     1 
ATOM   1488  C  CB    . MET A  1  189 ? 42.546  -34.112  120.078  1.00 86.64  ? 189 MET 1 CB    1 
ATOM   1489  C  CG    . MET A  1  189 ? 41.711  -33.307  121.092  1.00 88.47  ? 189 MET 1 CG    1 
ATOM   1490  S  SD    . MET A  1  189 ? 39.910  -33.412  120.908  1.00 91.73  ? 189 MET 1 SD    1 
ATOM   1491  C  CE    . MET A  1  189 ? 39.633  -32.352  119.493  1.00 90.84  ? 189 MET 1 CE    1 
ATOM   1492  N  N     . ASN A  1  190 ? 45.265  -34.521  118.443  1.00 83.60  ? 190 ASN 1 N     1 
ATOM   1493  C  CA    . ASN A  1  190 ? 46.125  -35.198  117.479  1.00 79.44  ? 190 ASN 1 CA    1 
ATOM   1494  C  C     . ASN A  1  190 ? 47.396  -35.698  118.159  1.00 71.26  ? 190 ASN 1 C     1 
ATOM   1495  O  O     . ASN A  1  190 ? 47.763  -36.872  118.031  1.00 66.95  ? 190 ASN 1 O     1 
ATOM   1496  C  CB    . ASN A  1  190 ? 46.471  -34.255  116.316  1.00 79.07  ? 190 ASN 1 CB    1 
ATOM   1497  C  CG    . ASN A  1  190 ? 45.308  -34.031  115.350  1.00 77.32  ? 190 ASN 1 CG    1 
ATOM   1498  O  OD1   . ASN A  1  190 ? 44.375  -34.828  115.282  1.00 76.31  ? 190 ASN 1 OD1   1 
ATOM   1499  N  ND2   . ASN A  1  190 ? 45.379  -32.950  114.584  1.00 77.15  ? 190 ASN 1 ND2   1 
ATOM   1500  N  N     . SER A  1  191 ? 48.056  -34.824  118.925  1.00 66.54  ? 191 SER 1 N     1 
ATOM   1501  C  CA    . SER A  1  191 ? 49.332  -35.183  119.540  1.00 59.89  ? 191 SER 1 CA    1 
ATOM   1502  C  C     . SER A  1  191 ? 49.188  -36.392  120.451  1.00 57.38  ? 191 SER 1 C     1 
ATOM   1503  O  O     . SER A  1  191 ? 50.015  -37.310  120.416  1.00 59.12  ? 191 SER 1 O     1 
ATOM   1504  C  CB    . SER A  1  191 ? 49.899  -34.006  120.324  1.00 54.87  ? 191 SER 1 CB    1 
ATOM   1505  O  OG    . SER A  1  191 ? 51.179  -34.339  120.825  1.00 51.23  ? 191 SER 1 OG    1 
ATOM   1506  N  N     . LEU A  1  192 ? 48.142  -36.410  121.278  1.00 54.47  ? 192 LEU 1 N     1 
ATOM   1507  C  CA    . LEU A  1  192 ? 47.916  -37.565  122.143  1.00 51.21  ? 192 LEU 1 CA    1 
ATOM   1508  C  C     . LEU A  1  192 ? 47.553  -38.799  121.330  1.00 52.56  ? 192 LEU 1 C     1 
ATOM   1509  O  O     . LEU A  1  192 ? 48.082  -39.889  121.579  1.00 48.53  ? 192 LEU 1 O     1 
ATOM   1510  C  CB    . LEU A  1  192 ? 46.828  -37.272  123.179  1.00 45.90  ? 192 LEU 1 CB    1 
ATOM   1511  C  CG    . LEU A  1  192 ? 46.588  -38.422  124.172  1.00 41.29  ? 192 LEU 1 CG    1 
ATOM   1512  C  CD1   . LEU A  1  192 ? 46.437  -37.938  125.588  1.00 42.08  ? 192 LEU 1 CD1   1 
ATOM   1513  C  CD2   . LEU A  1  192 ? 45.355  -39.229  123.790  1.00 37.35  ? 192 LEU 1 CD2   1 
ATOM   1514  N  N     . GLU A  1  193 ? 46.667  -38.644  120.343  1.00 56.53  ? 193 GLU 1 N     1 
ATOM   1515  C  CA    . GLU A  1  193 ? 46.132  -39.782  119.605  1.00 58.70  ? 193 GLU 1 CA    1 
ATOM   1516  C  C     . GLU A  1  193 ? 47.210  -40.618  118.921  1.00 58.66  ? 193 GLU 1 C     1 
ATOM   1517  O  O     . GLU A  1  193 ? 46.900  -41.707  118.427  1.00 58.56  ? 193 GLU 1 O     1 
ATOM   1518  C  CB    . GLU A  1  193 ? 45.119  -39.271  118.569  1.00 57.26  ? 193 GLU 1 CB    1 
ATOM   1519  C  CG    . GLU A  1  193 ? 43.908  -40.169  118.343  1.00 57.93  ? 193 GLU 1 CG    1 
ATOM   1520  C  CD    . GLU A  1  193 ? 42.838  -39.533  117.464  1.00 61.92  ? 193 GLU 1 CD    1 
ATOM   1521  O  OE1   . GLU A  1  193 ? 42.310  -38.458  117.825  1.00 63.66  ? 193 GLU 1 OE1   1 
ATOM   1522  O  OE2   . GLU A  1  193 ? 42.512  -40.116  116.410  1.00 63.57  ? 193 GLU 1 OE2   1 
ATOM   1523  N  N     . GLY A  1  194 ? 48.453  -40.149  118.891  1.00 56.23  ? 194 GLY 1 N     1 
ATOM   1524  C  CA    . GLY A  1  194 ? 49.515  -40.829  118.186  1.00 54.43  ? 194 GLY 1 CA    1 
ATOM   1525  C  C     . GLY A  1  194 ? 49.834  -40.255  116.823  1.00 53.38  ? 194 GLY 1 C     1 
ATOM   1526  O  O     . GLY A  1  194 ? 50.494  -40.936  116.025  1.00 52.16  ? 194 GLY 1 O     1 
ATOM   1527  N  N     . LEU A  1  195 ? 49.357  -39.047  116.525  1.00 50.94  ? 195 LEU 1 N     1 
ATOM   1528  C  CA    . LEU A  1  195 ? 49.588  -38.341  115.272  1.00 42.14  ? 195 LEU 1 CA    1 
ATOM   1529  C  C     . LEU A  1  195 ? 50.530  -37.167  115.493  1.00 39.76  ? 195 LEU 1 C     1 
ATOM   1530  O  O     . LEU A  1  195 ? 50.873  -36.812  116.620  1.00 39.58  ? 195 LEU 1 O     1 
ATOM   1531  C  CB    . LEU A  1  195 ? 48.276  -37.818  114.676  1.00 34.19  ? 195 LEU 1 CB    1 
ATOM   1532  C  CG    . LEU A  1  195 ? 47.013  -38.664  114.764  1.00 28.28  ? 195 LEU 1 CG    1 
ATOM   1533  C  CD1   . LEU A  1  195 ? 45.804  -37.858  114.352  1.00 28.09  ? 195 LEU 1 CD1   1 
ATOM   1534  C  CD2   . LEU A  1  195 ? 47.158  -39.894  113.910  1.00 26.68  ? 195 LEU 1 CD2   1 
ATOM   1535  N  N     . ARG A  1  196 ? 50.933  -36.549  114.392  1.00 40.83  ? 196 ARG 1 N     1 
ATOM   1536  C  CA    . ARG A  1  196 ? 51.603  -35.267  114.474  1.00 46.22  ? 196 ARG 1 CA    1 
ATOM   1537  C  C     . ARG A  1  196 ? 50.569  -34.187  114.734  1.00 50.25  ? 196 ARG 1 C     1 
ATOM   1538  O  O     . ARG A  1  196 ? 49.433  -34.267  114.258  1.00 56.87  ? 196 ARG 1 O     1 
ATOM   1539  C  CB    . ARG A  1  196 ? 52.384  -34.970  113.194  1.00 49.95  ? 196 ARG 1 CB    1 
ATOM   1540  C  CG    . ARG A  1  196 ? 53.637  -35.815  113.010  1.00 50.52  ? 196 ARG 1 CG    1 
ATOM   1541  C  CD    . ARG A  1  196 ? 54.217  -35.628  111.628  1.00 48.69  ? 196 ARG 1 CD    1 
ATOM   1542  N  NE    . ARG A  1  196 ? 55.520  -34.982  111.675  1.00 43.68  ? 196 ARG 1 NE    1 
ATOM   1543  C  CZ    . ARG A  1  196 ? 55.711  -33.693  111.431  1.00 38.01  ? 196 ARG 1 CZ    1 
ATOM   1544  N  NH1   . ARG A  1  196 ? 54.682  -32.921  111.129  1.00 34.94  ? 196 ARG 1 NH1   1 
ATOM   1545  N  NH2   . ARG A  1  196 ? 56.925  -33.176  111.492  1.00 36.87  ? 196 ARG 1 NH2   1 
ATOM   1546  N  N     . ALA A  1  197 ? 50.950  -33.206  115.545  1.00 50.17  ? 197 ALA 1 N     1 
ATOM   1547  C  CA    . ALA A  1  197 ? 50.033  -32.158  115.990  1.00 56.68  ? 197 ALA 1 CA    1 
ATOM   1548  C  C     . ALA A  1  197 ? 49.890  -31.075  114.913  1.00 55.32  ? 197 ALA 1 C     1 
ATOM   1549  O  O     . ALA A  1  197 ? 50.449  -29.976  114.998  1.00 60.10  ? 197 ALA 1 O     1 
ATOM   1550  C  CB    . ALA A  1  197 ? 50.502  -31.571  117.313  1.00 62.21  ? 197 ALA 1 CB    1 
ATOM   1551  N  N     . ASN A  1  198 ? 49.155  -31.417  113.864  1.00 47.04  ? 198 ASN 1 N     1 
ATOM   1552  C  CA    . ASN A  1  198 ? 48.664  -30.414  112.941  1.00 41.59  ? 198 ASN 1 CA    1 
ATOM   1553  C  C     . ASN A  1  198 ? 47.176  -30.232  113.178  1.00 49.90  ? 198 ASN 1 C     1 
ATOM   1554  O  O     . ASN A  1  198 ? 46.439  -31.227  113.203  1.00 49.24  ? 198 ASN 1 O     1 
ATOM   1555  C  CB    . ASN A  1  198 ? 48.919  -30.801  111.490  1.00 34.17  ? 198 ASN 1 CB    1 
ATOM   1556  C  CG    . ASN A  1  198 ? 50.369  -30.992  111.205  1.00 31.81  ? 198 ASN 1 CG    1 
ATOM   1557  O  OD1   . ASN A  1  198 ? 51.211  -30.637  112.018  1.00 21.29  ? 198 ASN 1 OD1   1 
ATOM   1558  N  ND2   . ASN A  1  198 ? 50.682  -31.450  110.006  1.00 21.73  ? 198 ASN 1 ND2   1 
ATOM   1559  N  N     . PRO A  1  199 ? 46.699  -28.998  113.360  1.00 54.04  ? 199 PRO 1 N     1 
ATOM   1560  C  CA    . PRO A  1  199 ? 45.342  -28.798  113.889  1.00 59.83  ? 199 PRO 1 CA    1 
ATOM   1561  C  C     . PRO A  1  199 ? 44.257  -29.456  113.045  1.00 68.81  ? 199 PRO 1 C     1 
ATOM   1562  O  O     . PRO A  1  199 ? 44.463  -29.857  111.896  1.00 71.12  ? 199 PRO 1 O     1 
ATOM   1563  C  CB    . PRO A  1  199 ? 45.180  -27.271  113.896  1.00 50.70  ? 199 PRO 1 CB    1 
ATOM   1564  C  CG    . PRO A  1  199 ? 46.353  -26.723  113.212  1.00 44.54  ? 199 PRO 1 CG    1 
ATOM   1565  C  CD    . PRO A  1  199 ? 47.430  -27.729  113.201  1.00 47.74  ? 199 PRO 1 CD    1 
ATOM   1566  N  N     . ARG A  1  200 ? 43.087  -29.585  113.659  1.00 73.29  ? 200 ARG 1 N     1 
ATOM   1567  C  CA    . ARG A  1  200 ? 41.918  -30.158  113.017  1.00 80.67  ? 200 ARG 1 CA    1 
ATOM   1568  C  C     . ARG A  1  200 ? 40.964  -29.052  112.591  1.00 80.85  ? 200 ARG 1 C     1 
ATOM   1569  O  O     . ARG A  1  200 ? 41.138  -27.879  112.924  1.00 74.53  ? 200 ARG 1 O     1 
ATOM   1570  C  CB    . ARG A  1  200 ? 41.209  -31.140  113.957  1.00 87.06  ? 200 ARG 1 CB    1 
ATOM   1571  C  CG    . ARG A  1  200 ? 42.114  -32.198  114.562  1.00 89.94  ? 200 ARG 1 CG    1 
ATOM   1572  C  CD    . ARG A  1  200 ? 41.298  -33.249  115.293  1.00 91.02  ? 200 ARG 1 CD    1 
ATOM   1573  N  NE    . ARG A  1  200 ? 42.027  -34.502  115.452  1.00 94.19  ? 200 ARG 1 NE    1 
ATOM   1574  C  CZ    . ARG A  1  200 ? 41.584  -35.529  116.171  1.00 97.87  ? 200 ARG 1 CZ    1 
ATOM   1575  N  NH1   . ARG A  1  200 ? 40.418  -35.449  116.794  1.00 99.14  ? 200 ARG 1 NH1   1 
ATOM   1576  N  NH2   . ARG A  1  200 ? 42.302  -36.638  116.262  1.00 99.33  ? 200 ARG 1 NH2   1 
ATOM   1577  N  N     . LEU A  1  201 ? 39.936  -29.448  111.847  1.00 88.10  ? 201 LEU 1 N     1 
ATOM   1578  C  CA    . LEU A  1  201 ? 38.964  -28.497  111.332  1.00 92.04  ? 201 LEU 1 CA    1 
ATOM   1579  C  C     . LEU A  1  201 ? 38.033  -28.069  112.460  1.00 93.70  ? 201 LEU 1 C     1 
ATOM   1580  O  O     . LEU A  1  201 ? 37.466  -28.914  113.159  1.00 94.77  ? 201 LEU 1 O     1 
ATOM   1581  C  CB    . LEU A  1  201 ? 38.168  -29.133  110.193  1.00 93.29  ? 201 LEU 1 CB    1 
ATOM   1582  C  CG    . LEU A  1  201 ? 37.471  -28.214  109.195  1.00 98.63  ? 201 LEU 1 CG    1 
ATOM   1583  C  CD1   . LEU A  1  201 ? 38.502  -27.581  108.281  1.00 100.46 ? 201 LEU 1 CD1   1 
ATOM   1584  C  CD2   . LEU A  1  201 ? 36.423  -28.984  108.394  1.00 101.26 ? 201 LEU 1 CD2   1 
ATOM   1585  N  N     . LYS A  1  202 ? 37.900  -26.756  112.656  1.00 92.77  ? 202 LYS 1 N     1 
ATOM   1586  C  CA    . LYS A  1  202 ? 37.053  -26.213  113.715  1.00 90.39  ? 202 LYS 1 CA    1 
ATOM   1587  C  C     . LYS A  1  202 ? 35.555  -26.323  113.439  1.00 90.85  ? 202 LYS 1 C     1 
ATOM   1588  O  O     . LYS A  1  202 ? 34.784  -26.454  114.397  1.00 94.34  ? 202 LYS 1 O     1 
ATOM   1589  C  CB    . LYS A  1  202 ? 37.415  -24.760  114.024  1.00 88.58  ? 202 LYS 1 CB    1 
ATOM   1590  C  CG    . LYS A  1  202 ? 37.687  -24.542  115.512  1.00 85.00  ? 202 LYS 1 CG    1 
ATOM   1591  C  CD    . LYS A  1  202 ? 38.681  -23.426  115.780  1.00 79.01  ? 202 LYS 1 CD    1 
ATOM   1592  C  CE    . LYS A  1  202 ? 38.962  -23.306  117.266  1.00 71.62  ? 202 LYS 1 CE    1 
ATOM   1593  N  NZ    . LYS A  1  202 ? 40.000  -22.291  117.542  1.00 68.67  ? 202 LYS 1 NZ    1 
ATOM   1594  N  N     . PRO A  1  203 ? 35.088  -26.209  112.196  1.00 89.72  ? 203 PRO 1 N     1 
ATOM   1595  C  CA    . PRO A  1  203 ? 33.650  -26.356  111.936  1.00 92.73  ? 203 PRO 1 CA    1 
ATOM   1596  C  C     . PRO A  1  203 ? 33.070  -27.599  112.596  1.00 91.77  ? 203 PRO 1 C     1 
ATOM   1597  O  O     . PRO A  1  203 ? 31.923  -27.560  113.070  1.00 92.80  ? 203 PRO 1 O     1 
ATOM   1598  C  CB    . PRO A  1  203 ? 33.581  -26.438  110.407  1.00 97.01  ? 203 PRO 1 CB    1 
ATOM   1599  C  CG    . PRO A  1  203 ? 34.728  -25.595  109.949  1.00 94.87  ? 203 PRO 1 CG    1 
ATOM   1600  C  CD    . PRO A  1  203 ? 35.761  -25.566  111.050  1.00 90.47  ? 203 PRO 1 CD    1 
ATOM   1601  N  N     . PRO A  1  204 ? 33.810  -28.741  112.643  1.00 90.49  ? 204 PRO 1 N     1 
ATOM   1602  C  CA    . PRO A  1  204 ? 33.443  -29.806  113.591  1.00 91.58  ? 204 PRO 1 CA    1 
ATOM   1603  C  C     . PRO A  1  204 ? 34.062  -29.530  114.953  1.00 88.80  ? 204 PRO 1 C     1 
ATOM   1604  O  O     . PRO A  1  204 ? 35.283  -29.613  115.123  1.00 87.68  ? 204 PRO 1 O     1 
ATOM   1605  C  CB    . PRO A  1  204 ? 34.031  -31.071  112.945  1.00 94.34  ? 204 PRO 1 CB    1 
ATOM   1606  C  CG    . PRO A  1  204 ? 34.511  -30.680  111.590  1.00 93.32  ? 204 PRO 1 CG    1 
ATOM   1607  C  CD    . PRO A  1  204 ? 34.794  -29.224  111.657  1.00 89.95  ? 204 PRO 1 CD    1 
ATOM   1608  N  N     . PHE A  1  205 ? 33.198  -29.248  115.965  1.00 86.73  ? 205 PHE 1 N     1 
ATOM   1609  C  CA    . PHE A  1  205 ? 33.794  -28.908  117.250  1.00 83.31  ? 205 PHE 1 CA    1 
ATOM   1610  C  C     . PHE A  1  205 ? 34.015  -30.163  118.093  1.00 80.78  ? 205 PHE 1 C     1 
ATOM   1611  O  O     . PHE A  1  205 ? 33.340  -31.178  117.895  1.00 80.86  ? 205 PHE 1 O     1 
ATOM   1612  C  CB    . PHE A  1  205 ? 32.904  -27.911  118.003  1.00 83.69  ? 205 PHE 1 CB    1 
ATOM   1613  C  CG    . PHE A  1  205 ? 32.964  -26.508  117.451  1.00 87.56  ? 205 PHE 1 CG    1 
ATOM   1614  C  CD1   . PHE A  1  205 ? 34.077  -25.714  117.670  1.00 89.50  ? 205 PHE 1 CD1   1 
ATOM   1615  C  CD2   . PHE A  1  205 ? 31.920  -25.984  116.707  1.00 91.03  ? 205 PHE 1 CD2   1 
ATOM   1616  C  CE1   . PHE A  1  205 ? 34.150  -24.424  117.167  1.00 90.97  ? 205 PHE 1 CE1   1 
ATOM   1617  C  CE2   . PHE A  1  205 ? 31.991  -24.689  116.197  1.00 93.60  ? 205 PHE 1 CE2   1 
ATOM   1618  C  CZ    . PHE A  1  205 ? 33.109  -23.914  116.431  1.00 92.88  ? 205 PHE 1 CZ    1 
ATOM   1619  N  N     . PRO A  1  206 ? 34.965  -30.129  119.032  1.00 78.78  ? 206 PRO 1 N     1 
ATOM   1620  C  CA    . PRO A  1  206 ? 35.223  -31.327  119.849  1.00 77.57  ? 206 PRO 1 CA    1 
ATOM   1621  C  C     . PRO A  1  206 ? 34.035  -31.747  120.682  1.00 79.12  ? 206 PRO 1 C     1 
ATOM   1622  O  O     . PRO A  1  206 ? 33.924  -32.930  121.033  1.00 79.80  ? 206 PRO 1 O     1 
ATOM   1623  C  CB    . PRO A  1  206 ? 36.413  -30.912  120.725  1.00 76.14  ? 206 PRO 1 CB    1 
ATOM   1624  C  CG    . PRO A  1  206 ? 36.420  -29.430  120.710  1.00 77.19  ? 206 PRO 1 CG    1 
ATOM   1625  C  CD    . PRO A  1  206 ? 35.813  -28.990  119.423  1.00 78.56  ? 206 PRO 1 CD    1 
ATOM   1626  N  N     . ALA A  1  207 ? 33.120  -30.824  120.975  1.00 79.71  ? 207 ALA 1 N     1 
ATOM   1627  C  CA    . ALA A  1  207 ? 31.884  -31.210  121.640  1.00 77.82  ? 207 ALA 1 CA    1 
ATOM   1628  C  C     . ALA A  1  207 ? 31.119  -32.227  120.807  1.00 73.72  ? 207 ALA 1 C     1 
ATOM   1629  O  O     . ALA A  1  207 ? 30.427  -33.085  121.364  1.00 73.30  ? 207 ALA 1 O     1 
ATOM   1630  C  CB    . ALA A  1  207 ? 31.032  -29.969  121.912  1.00 77.21  ? 207 ALA 1 CB    1 
ATOM   1631  N  N     . GLN A  1  208 ? 31.259  -32.168  119.479  1.00 69.87  ? 208 GLN 1 N     1 
ATOM   1632  C  CA    . GLN A  1  208 ? 30.626  -33.117  118.573  1.00 65.35  ? 208 GLN 1 CA    1 
ATOM   1633  C  C     . GLN A  1  208 ? 31.589  -34.173  118.032  1.00 54.87  ? 208 GLN 1 C     1 
ATOM   1634  O  O     . GLN A  1  208 ? 31.138  -35.251  117.631  1.00 55.43  ? 208 GLN 1 O     1 
ATOM   1635  C  CB    . GLN A  1  208 ? 29.964  -32.389  117.390  1.00 68.45  ? 208 GLN 1 CB    1 
ATOM   1636  C  CG    . GLN A  1  208 ? 29.115  -31.163  117.764  1.00 72.92  ? 208 GLN 1 CG    1 
ATOM   1637  C  CD    . GLN A  1  208 ? 29.807  -29.849  117.452  1.00 77.92  ? 208 GLN 1 CD    1 
ATOM   1638  O  OE1   . GLN A  1  208 ? 30.638  -29.782  116.552  1.00 80.22  ? 208 GLN 1 OE1   1 
ATOM   1639  N  NE2   . GLN A  1  208 ? 29.469  -28.801  118.194  1.00 79.61  ? 208 GLN 1 NE2   1 
ATOM   1640  N  N     . SER A  1  209 ? 32.896  -33.901  118.006  1.00 42.50  ? 209 SER 1 N     1 
ATOM   1641  C  CA    . SER A  1  209 ? 33.861  -34.894  117.538  1.00 35.96  ? 209 SER 1 CA    1 
ATOM   1642  C  C     . SER A  1  209 ? 35.216  -34.567  118.167  1.00 34.61  ? 209 SER 1 C     1 
ATOM   1643  O  O     . SER A  1  209 ? 35.915  -33.675  117.688  1.00 39.78  ? 209 SER 1 O     1 
ATOM   1644  C  CB    . SER A  1  209 ? 33.933  -34.879  116.018  1.00 39.14  ? 209 SER 1 CB    1 
ATOM   1645  O  OG    . SER A  1  209 ? 34.404  -36.102  115.483  1.00 44.79  ? 209 SER 1 OG    1 
ATOM   1646  N  N     . GLY A  1  210 ? 35.589  -35.297  119.211  1.00 32.27  ? 210 GLY 1 N     1 
ATOM   1647  C  CA    . GLY A  1  210 ? 36.861  -35.024  119.856  1.00 33.92  ? 210 GLY 1 CA    1 
ATOM   1648  C  C     . GLY A  1  210 ? 37.841  -36.179  119.793  1.00 39.72  ? 210 GLY 1 C     1 
ATOM   1649  O  O     . GLY A  1  210 ? 38.060  -36.747  118.720  1.00 47.73  ? 210 GLY 1 O     1 
ATOM   1650  N  N     . LEU A  1  211 ? 38.451  -36.519  120.928  1.00 33.10  ? 211 LEU 1 N     1 
ATOM   1651  C  CA    . LEU A  1  211 ? 39.364  -37.657  121.008  1.00 28.35  ? 211 LEU 1 CA    1 
ATOM   1652  C  C     . LEU A  1  211 ? 38.707  -38.940  120.517  1.00 33.50  ? 211 LEU 1 C     1 
ATOM   1653  O  O     . LEU A  1  211 ? 37.645  -39.332  121.005  1.00 34.30  ? 211 LEU 1 O     1 
ATOM   1654  C  CB    . LEU A  1  211 ? 39.825  -37.859  122.450  1.00 23.68  ? 211 LEU 1 CB    1 
ATOM   1655  C  CG    . LEU A  1  211 ? 41.282  -38.259  122.622  1.00 20.87  ? 211 LEU 1 CG    1 
ATOM   1656  C  CD1   . LEU A  1  211 ? 42.121  -37.482  121.636  1.00 22.62  ? 211 LEU 1 CD1   1 
ATOM   1657  C  CD2   . LEU A  1  211 ? 41.770  -38.077  124.053  1.00 18.80  ? 211 LEU 1 CD2   1 
ATOM   1658  N  N     . TRP A  1  212 ? 39.360  -39.601  119.563  1.00 39.21  ? 212 TRP 1 N     1 
ATOM   1659  C  CA    . TRP A  1  212 ? 38.897  -40.873  119.018  1.00 46.72  ? 212 TRP 1 CA    1 
ATOM   1660  C  C     . TRP A  1  212 ? 37.432  -40.787  118.602  1.00 55.24  ? 212 TRP 1 C     1 
ATOM   1661  O  O     . TRP A  1  212 ? 36.655  -41.731  118.775  1.00 61.14  ? 212 TRP 1 O     1 
ATOM   1662  C  CB    . TRP A  1  212 ? 39.114  -42.026  120.011  1.00 46.23  ? 212 TRP 1 CB    1 
ATOM   1663  C  CG    . TRP A  1  212 ? 40.558  -42.296  120.348  1.00 47.81  ? 212 TRP 1 CG    1 
ATOM   1664  C  CD1   . TRP A  1  212 ? 41.508  -42.780  119.507  1.00 51.61  ? 212 TRP 1 CD1   1 
ATOM   1665  C  CD2   . TRP A  1  212 ? 41.196  -42.164  121.634  1.00 45.63  ? 212 TRP 1 CD2   1 
ATOM   1666  N  NE1   . TRP A  1  212 ? 42.704  -42.913  120.168  1.00 51.98  ? 212 TRP 1 NE1   1 
ATOM   1667  C  CE2   . TRP A  1  212 ? 42.534  -42.551  121.477  1.00 46.55  ? 212 TRP 1 CE2   1 
ATOM   1668  C  CE3   . TRP A  1  212 ? 40.765  -41.747  122.895  1.00 44.11  ? 212 TRP 1 CE3   1 
ATOM   1669  C  CZ2   . TRP A  1  212 ? 43.444  -42.530  122.526  1.00 43.83  ? 212 TRP 1 CZ2   1 
ATOM   1670  C  CZ3   . TRP A  1  212 ? 41.677  -41.729  123.934  1.00 43.61  ? 212 TRP 1 CZ3   1 
ATOM   1671  C  CH2   . TRP A  1  212 ? 42.995  -42.115  123.743  1.00 43.40  ? 212 TRP 1 CH2   1 
ATOM   1672  N  N     . GLY A  1  213 ? 37.042  -39.626  118.075  1.00 55.29  ? 213 GLY 1 N     1 
ATOM   1673  C  CA    . GLY A  1  213 ? 35.691  -39.421  117.604  1.00 56.27  ? 213 GLY 1 CA    1 
ATOM   1674  C  C     . GLY A  1  213 ? 34.649  -39.228  118.681  1.00 59.24  ? 213 GLY 1 C     1 
ATOM   1675  O  O     . GLY A  1  213 ? 33.477  -39.022  118.345  1.00 61.01  ? 213 GLY 1 O     1 
ATOM   1676  N  N     . LYS A  1  214 ? 35.026  -39.311  119.974  1.00 60.06  ? 214 LYS 1 N     1 
ATOM   1677  C  CA    . LYS A  1  214 ? 34.059  -39.176  121.057  1.00 60.18  ? 214 LYS 1 CA    1 
ATOM   1678  C  C     . LYS A  1  214 ? 33.827  -37.705  121.395  1.00 63.32  ? 214 LYS 1 C     1 
ATOM   1679  O  O     . LYS A  1  214 ? 34.718  -36.871  121.216  1.00 64.45  ? 214 LYS 1 O     1 
ATOM   1680  C  CB    . LYS A  1  214 ? 34.536  -39.917  122.302  1.00 58.10  ? 214 LYS 1 CB    1 
ATOM   1681  C  CG    . LYS A  1  214 ? 34.729  -41.428  122.154  1.00 55.05  ? 214 LYS 1 CG    1 
ATOM   1682  C  CD    . LYS A  1  214 ? 33.534  -42.132  121.551  1.00 49.46  ? 214 LYS 1 CD    1 
ATOM   1683  C  CE    . LYS A  1  214 ? 33.653  -43.614  121.787  1.00 45.39  ? 214 LYS 1 CE    1 
ATOM   1684  N  NZ    . LYS A  1  214 ? 35.073  -43.993  121.674  1.00 44.20  ? 214 LYS 1 NZ    1 
ATOM   1685  N  N     . PRO A  1  215 ? 32.645  -37.367  121.909  1.00 67.79  ? 215 PRO 1 N     1 
ATOM   1686  C  CA    . PRO A  1  215 ? 32.325  -35.953  122.157  1.00 75.17  ? 215 PRO 1 CA    1 
ATOM   1687  C  C     . PRO A  1  215 ? 33.053  -35.400  123.371  1.00 80.42  ? 215 PRO 1 C     1 
ATOM   1688  O  O     . PRO A  1  215 ? 32.510  -35.377  124.478  1.00 81.37  ? 215 PRO 1 O     1 
ATOM   1689  C  CB    . PRO A  1  215 ? 30.803  -35.972  122.370  1.00 76.62  ? 215 PRO 1 CB    1 
ATOM   1690  C  CG    . PRO A  1  215 ? 30.334  -37.276  121.771  1.00 73.17  ? 215 PRO 1 CG    1 
ATOM   1691  C  CD    . PRO A  1  215 ? 31.455  -38.232  122.019  1.00 67.50  ? 215 PRO 1 CD    1 
ATOM   1692  N  N     . THR A  1  216 ? 34.285  -34.953  123.181  1.00 85.76  ? 216 THR 1 N     1 
ATOM   1693  C  CA    . THR A  1  216 ? 35.073  -34.494  124.314  1.00 92.83  ? 216 THR 1 CA    1 
ATOM   1694  C  C     . THR A  1  216 ? 34.875  -32.995  124.525  1.00 94.66  ? 216 THR 1 C     1 
ATOM   1695  O  O     . THR A  1  216 ? 34.464  -32.266  123.622  1.00 96.61  ? 216 THR 1 O     1 
ATOM   1696  C  CB    . THR A  1  216 ? 36.558  -34.812  124.105  1.00 96.77  ? 216 THR 1 CB    1 
ATOM   1697  O  OG1   . THR A  1  216 ? 37.109  -33.936  123.115  1.00 98.06  ? 216 THR 1 OG1   1 
ATOM   1698  C  CG2   . THR A  1  216 ? 36.732  -36.240  123.631  1.00 98.19  ? 216 THR 1 CG2   1 
ATOM   1699  N  N     . THR A  1  217 ? 35.149  -32.544  125.749  1.00 92.92  ? 217 THR 1 N     1 
ATOM   1700  C  CA    . THR A  1  217 ? 35.094  -31.127  126.086  1.00 91.06  ? 217 THR 1 CA    1 
ATOM   1701  C  C     . THR A  1  217 ? 36.393  -30.750  126.772  1.00 86.77  ? 217 THR 1 C     1 
ATOM   1702  O  O     . THR A  1  217 ? 36.868  -31.471  127.656  1.00 85.17  ? 217 THR 1 O     1 
ATOM   1703  C  CB    . THR A  1  217 ? 33.898  -30.788  126.988  1.00 92.20  ? 217 THR 1 CB    1 
ATOM   1704  O  OG1   . THR A  1  217 ? 32.682  -30.984  126.262  1.00 93.51  ? 217 THR 1 OG1   1 
ATOM   1705  C  CG2   . THR A  1  217 ? 33.964  -29.337  127.449  1.00 90.86  ? 217 THR 1 CG2   1 
ATOM   1706  N  N     . ILE A  1  218 ? 36.962  -29.624  126.359  1.00 84.84  ? 218 ILE 1 N     1 
ATOM   1707  C  CA    . ILE A  1  218 ? 38.240  -29.147  126.864  1.00 85.45  ? 218 ILE 1 CA    1 
ATOM   1708  C  C     . ILE A  1  218 ? 37.990  -27.856  127.625  1.00 87.97  ? 218 ILE 1 C     1 
ATOM   1709  O  O     . ILE A  1  218 ? 37.338  -26.941  127.107  1.00 89.61  ? 218 ILE 1 O     1 
ATOM   1710  C  CB    . ILE A  1  218 ? 39.245  -28.920  125.722  1.00 83.46  ? 218 ILE 1 CB    1 
ATOM   1711  C  CG1   . ILE A  1  218 ? 39.369  -30.172  124.855  1.00 82.68  ? 218 ILE 1 CG1   1 
ATOM   1712  C  CG2   . ILE A  1  218 ? 40.601  -28.539  126.281  1.00 82.60  ? 218 ILE 1 CG2   1 
ATOM   1713  C  CD1   . ILE A  1  218 ? 39.719  -29.897  123.401  1.00 82.08  ? 218 ILE 1 CD1   1 
ATOM   1714  N  N     . ASN A  1  219 ? 38.490  -27.787  128.857  1.00 85.59  ? 219 ASN 1 N     1 
ATOM   1715  C  CA    . ASN A  1  219 ? 38.418  -26.575  129.656  1.00 80.11  ? 219 ASN 1 CA    1 
ATOM   1716  C  C     . ASN A  1  219 ? 39.777  -26.304  130.272  1.00 79.23  ? 219 ASN 1 C     1 
ATOM   1717  O  O     . ASN A  1  219 ? 40.583  -27.215  130.475  1.00 78.54  ? 219 ASN 1 O     1 
ATOM   1718  C  CB    . ASN A  1  219 ? 37.371  -26.642  130.781  1.00 77.05  ? 219 ASN 1 CB    1 
ATOM   1719  C  CG    . ASN A  1  219 ? 35.993  -26.197  130.334  1.00 76.54  ? 219 ASN 1 CG    1 
ATOM   1720  O  OD1   . ASN A  1  219 ? 35.004  -26.896  130.545  1.00 77.27  ? 219 ASN 1 OD1   1 
ATOM   1721  N  ND2   . ASN A  1  219 ? 35.922  -25.032  129.707  1.00 76.39  ? 219 ASN 1 ND2   1 
ATOM   1722  N  N     . ASN A  1  220 ? 40.012  -25.031  130.570  1.00 79.81  ? 220 ASN 1 N     1 
ATOM   1723  C  CA    . ASN A  1  220 ? 41.274  -24.589  131.141  1.00 78.66  ? 220 ASN 1 CA    1 
ATOM   1724  C  C     . ASN A  1  220 ? 41.379  -25.039  132.593  1.00 70.98  ? 220 ASN 1 C     1 
ATOM   1725  O  O     . ASN A  1  220 ? 40.372  -25.267  133.268  1.00 71.19  ? 220 ASN 1 O     1 
ATOM   1726  C  CB    . ASN A  1  220 ? 41.382  -23.065  131.024  1.00 85.01  ? 220 ASN 1 CB    1 
ATOM   1727  C  CG    . ASN A  1  220 ? 42.779  -22.549  131.276  1.00 90.46  ? 220 ASN 1 CG    1 
ATOM   1728  O  OD1   . ASN A  1  220 ? 43.031  -21.848  132.256  1.00 93.23  ? 220 ASN 1 OD1   1 
ATOM   1729  N  ND2   . ASN A  1  220 ? 43.701  -22.899  130.394  1.00 91.66  ? 220 ASN 1 ND2   1 
ATOM   1730  N  N     . VAL A  1  221 ? 42.618  -25.176  133.067  1.00 64.12  ? 221 VAL 1 N     1 
ATOM   1731  C  CA    . VAL A  1  221 ? 42.849  -25.622  134.438  1.00 62.22  ? 221 VAL 1 CA    1 
ATOM   1732  C  C     . VAL A  1  221 ? 42.240  -24.638  135.423  1.00 60.27  ? 221 VAL 1 C     1 
ATOM   1733  O  O     . VAL A  1  221 ? 41.587  -25.024  136.401  1.00 55.27  ? 221 VAL 1 O     1 
ATOM   1734  C  CB    . VAL A  1  221 ? 44.359  -25.787  134.684  1.00 63.29  ? 221 VAL 1 CB    1 
ATOM   1735  C  CG1   . VAL A  1  221 ? 44.630  -26.172  136.129  1.00 62.38  ? 221 VAL 1 CG1   1 
ATOM   1736  C  CG2   . VAL A  1  221 ? 44.941  -26.796  133.723  1.00 67.29  ? 221 VAL 1 CG2   1 
ATOM   1737  N  N     . GLU A  1  222 ? 42.434  -23.347  135.167  1.00 63.83  ? 222 GLU 1 N     1 
ATOM   1738  C  CA    . GLU A  1  222 ? 41.859  -22.321  136.020  1.00 61.79  ? 222 GLU 1 CA    1 
ATOM   1739  C  C     . GLU A  1  222 ? 40.339  -22.406  136.025  1.00 64.49  ? 222 GLU 1 C     1 
ATOM   1740  O  O     . GLU A  1  222 ? 39.707  -22.191  137.062  1.00 68.10  ? 222 GLU 1 O     1 
ATOM   1741  C  CB    . GLU A  1  222 ? 42.346  -20.947  135.556  1.00 59.31  ? 222 GLU 1 CB    1 
ATOM   1742  C  CG    . GLU A  1  222 ? 42.062  -19.823  136.524  1.00 61.51  ? 222 GLU 1 CG    1 
ATOM   1743  C  CD    . GLU A  1  222 ? 42.111  -18.471  135.860  1.00 61.87  ? 222 GLU 1 CD    1 
ATOM   1744  O  OE1   . GLU A  1  222 ? 42.938  -18.302  134.951  1.00 61.89  ? 222 GLU 1 OE1   1 
ATOM   1745  O  OE2   . GLU A  1  222 ? 41.328  -17.578  136.248  1.00 61.42  ? 222 GLU 1 OE2   1 
ATOM   1746  N  N     . THR A  1  223 ? 39.736  -22.744  134.879  1.00 63.01  ? 223 THR 1 N     1 
ATOM   1747  C  CA    . THR A  1  223 ? 38.284  -22.914  134.814  1.00 63.03  ? 223 THR 1 CA    1 
ATOM   1748  C  C     . THR A  1  223 ? 37.823  -24.090  135.671  1.00 63.97  ? 223 THR 1 C     1 
ATOM   1749  O  O     . THR A  1  223 ? 36.869  -23.974  136.455  1.00 68.51  ? 223 THR 1 O     1 
ATOM   1750  C  CB    . THR A  1  223 ? 37.837  -23.110  133.366  1.00 61.37  ? 223 THR 1 CB    1 
ATOM   1751  O  OG1   . THR A  1  223 ? 38.566  -22.229  132.510  1.00 61.92  ? 223 THR 1 OG1   1 
ATOM   1752  C  CG2   . THR A  1  223 ? 36.369  -22.803  133.221  1.00 61.52  ? 223 THR 1 CG2   1 
ATOM   1753  N  N     . LEU A  1  224 ? 38.476  -25.242  135.519  1.00 58.42  ? 224 LEU 1 N     1 
ATOM   1754  C  CA    . LEU A  1  224 ? 38.096  -26.400  136.316  1.00 53.38  ? 224 LEU 1 CA    1 
ATOM   1755  C  C     . LEU A  1  224 ? 38.228  -26.104  137.803  1.00 48.71  ? 224 LEU 1 C     1 
ATOM   1756  O  O     . LEU A  1  224 ? 37.342  -26.443  138.594  1.00 45.64  ? 224 LEU 1 O     1 
ATOM   1757  C  CB    . LEU A  1  224 ? 38.953  -27.605  135.926  1.00 53.01  ? 224 LEU 1 CB    1 
ATOM   1758  C  CG    . LEU A  1  224 ? 38.763  -28.123  134.502  1.00 51.38  ? 224 LEU 1 CG    1 
ATOM   1759  C  CD1   . LEU A  1  224 ? 39.707  -29.282  134.199  1.00 48.84  ? 224 LEU 1 CD1   1 
ATOM   1760  C  CD2   . LEU A  1  224 ? 37.314  -28.518  134.294  1.00 53.23  ? 224 LEU 1 CD2   1 
ATOM   1761  N  N     . ALA A  1  225 ? 39.319  -25.452  138.198  1.00 48.75  ? 225 ALA 1 N     1 
ATOM   1762  C  CA    . ALA A  1  225 ? 39.495  -25.105  139.601  1.00 51.55  ? 225 ALA 1 CA    1 
ATOM   1763  C  C     . ALA A  1  225 ? 38.432  -24.110  140.057  1.00 53.38  ? 225 ALA 1 C     1 
ATOM   1764  O  O     . ALA A  1  225 ? 37.929  -24.202  141.182  1.00 57.74  ? 225 ALA 1 O     1 
ATOM   1765  C  CB    . ALA A  1  225 ? 40.901  -24.556  139.834  1.00 52.02  ? 225 ALA 1 CB    1 
ATOM   1766  N  N     . SER A  1  226 ? 38.069  -23.159  139.193  1.00 48.20  ? 226 SER 1 N     1 
ATOM   1767  C  CA    . SER A  1  226 ? 37.048  -22.177  139.532  1.00 44.27  ? 226 SER 1 CA    1 
ATOM   1768  C  C     . SER A  1  226 ? 35.679  -22.814  139.676  1.00 45.95  ? 226 SER 1 C     1 
ATOM   1769  O  O     . SER A  1  226 ? 34.797  -22.228  140.310  1.00 48.47  ? 226 SER 1 O     1 
ATOM   1770  C  CB    . SER A  1  226 ? 36.984  -21.098  138.453  1.00 39.44  ? 226 SER 1 CB    1 
ATOM   1771  O  OG    . SER A  1  226 ? 38.175  -20.340  138.410  1.00 37.24  ? 226 SER 1 OG    1 
ATOM   1772  N  N     . VAL A  1  227 ? 35.485  -23.990  139.080  1.00 43.88  ? 227 VAL 1 N     1 
ATOM   1773  C  CA    . VAL A  1  227 ? 34.214  -24.695  139.237  1.00 39.92  ? 227 VAL 1 CA    1 
ATOM   1774  C  C     . VAL A  1  227 ? 33.935  -24.986  140.706  1.00 43.94  ? 227 VAL 1 C     1 
ATOM   1775  O  O     . VAL A  1  227 ? 32.798  -24.846  141.174  1.00 45.30  ? 227 VAL 1 O     1 
ATOM   1776  C  CB    . VAL A  1  227 ? 34.210  -25.990  138.402  1.00 27.05  ? 227 VAL 1 CB    1 
ATOM   1777  C  CG1   . VAL A  1  227 ? 32.993  -26.828  138.717  1.00 21.36  ? 227 VAL 1 CG1   1 
ATOM   1778  C  CG2   . VAL A  1  227 ? 34.250  -25.667  136.917  1.00 27.46  ? 227 VAL 1 CG2   1 
ATOM   1779  N  N     . VAL A  1  228 ? 34.967  -25.330  141.472  1.00 47.96  ? 228 VAL 1 N     1 
ATOM   1780  C  CA    . VAL A  1  228 ? 34.748  -25.863  142.818  1.00 48.51  ? 228 VAL 1 CA    1 
ATOM   1781  C  C     . VAL A  1  228 ? 34.163  -24.804  143.747  1.00 48.16  ? 228 VAL 1 C     1 
ATOM   1782  O  O     . VAL A  1  228 ? 33.122  -25.070  144.352  1.00 43.64  ? 228 VAL 1 O     1 
ATOM   1783  C  CB    . VAL A  1  228 ? 36.033  -26.470  143.404  1.00 45.12  ? 228 VAL 1 CB    1 
ATOM   1784  C  CG1   . VAL A  1  228 ? 35.761  -27.023  144.800  1.00 45.91  ? 228 VAL 1 CG1   1 
ATOM   1785  C  CG2   . VAL A  1  228 ? 36.580  -27.550  142.479  1.00 40.06  ? 228 VAL 1 CG2   1 
ATOM   1786  N  N     . PRO A  1  229 ? 34.744  -23.606  143.887  1.00 56.52  ? 229 PRO 1 N     1 
ATOM   1787  C  CA    . PRO A  1  229 ? 34.093  -22.608  144.755  1.00 63.10  ? 229 PRO 1 CA    1 
ATOM   1788  C  C     . PRO A  1  229 ? 32.688  -22.274  144.306  1.00 69.64  ? 229 PRO 1 C     1 
ATOM   1789  O  O     . PRO A  1  229 ? 31.784  -22.129  145.142  1.00 71.76  ? 229 PRO 1 O     1 
ATOM   1790  C  CB    . PRO A  1  229 ? 35.004  -21.377  144.644  1.00 61.83  ? 229 PRO 1 CB    1 
ATOM   1791  C  CG    . PRO A  1  229 ? 35.931  -21.648  143.525  1.00 61.82  ? 229 PRO 1 CG    1 
ATOM   1792  C  CD    . PRO A  1  229 ? 36.032  -23.117  143.371  1.00 60.62  ? 229 PRO 1 CD    1 
ATOM   1793  N  N     . ILE A  1  230 ? 32.492  -22.153  142.991  1.00 72.10  ? 230 ILE 1 N     1 
ATOM   1794  C  CA    . ILE A  1  230 ? 31.175  -21.847  142.441  1.00 74.62  ? 230 ILE 1 CA    1 
ATOM   1795  C  C     . ILE A  1  230 ? 30.149  -22.831  142.979  1.00 77.60  ? 230 ILE 1 C     1 
ATOM   1796  O  O     . ILE A  1  230 ? 29.125  -22.446  143.557  1.00 75.52  ? 230 ILE 1 O     1 
ATOM   1797  C  CB    . ILE A  1  230 ? 31.227  -21.873  140.902  1.00 74.76  ? 230 ILE 1 CB    1 
ATOM   1798  C  CG1   . ILE A  1  230 ? 32.022  -20.677  140.364  1.00 74.69  ? 230 ILE 1 CG1   1 
ATOM   1799  C  CG2   . ILE A  1  230 ? 29.824  -21.885  140.324  1.00 76.11  ? 230 ILE 1 CG2   1 
ATOM   1800  C  CD1   . ILE A  1  230 ? 32.144  -20.627  138.844  1.00 74.27  ? 230 ILE 1 CD1   1 
ATOM   1801  N  N     . MET A  1  231 ? 30.440  -24.124  142.843  1.00 81.22  ? 231 MET 1 N     1 
ATOM   1802  C  CA    . MET A  1  231 ? 29.532  -25.137  143.359  1.00 82.05  ? 231 MET 1 CA    1 
ATOM   1803  C  C     . MET A  1  231 ? 29.505  -25.146  144.877  1.00 85.73  ? 231 MET 1 C     1 
ATOM   1804  O  O     . MET A  1  231 ? 28.509  -25.574  145.465  1.00 90.04  ? 231 MET 1 O     1 
ATOM   1805  C  CB    . MET A  1  231 ? 29.938  -26.514  142.839  1.00 78.03  ? 231 MET 1 CB    1 
ATOM   1806  C  CG    . MET A  1  231 ? 29.943  -26.620  141.344  1.00 76.96  ? 231 MET 1 CG    1 
ATOM   1807  S  SD    . MET A  1  231 ? 28.439  -25.948  140.634  1.00 79.00  ? 231 MET 1 SD    1 
ATOM   1808  C  CE    . MET A  1  231 ? 27.178  -27.014  141.332  1.00 80.05  ? 231 MET 1 CE    1 
ATOM   1809  N  N     . GLU A  1  232 ? 30.570  -24.666  145.514  1.00 84.29  ? 232 GLU 1 N     1 
ATOM   1810  C  CA    . GLU A  1  232 ? 30.691  -24.733  146.963  1.00 84.21  ? 232 GLU 1 CA    1 
ATOM   1811  C  C     . GLU A  1  232 ? 29.875  -23.635  147.630  1.00 88.22  ? 232 GLU 1 C     1 
ATOM   1812  O  O     . GLU A  1  232 ? 28.905  -23.912  148.343  1.00 91.76  ? 232 GLU 1 O     1 
ATOM   1813  C  CB    . GLU A  1  232 ? 32.159  -24.614  147.378  1.00 82.03  ? 232 GLU 1 CB    1 
ATOM   1814  C  CG    . GLU A  1  232 ? 32.371  -24.526  148.881  1.00 78.43  ? 232 GLU 1 CG    1 
ATOM   1815  C  CD    . GLU A  1  232 ? 33.819  -24.288  149.254  1.00 74.94  ? 232 GLU 1 CD    1 
ATOM   1816  O  OE1   . GLU A  1  232 ? 34.461  -23.423  148.634  1.00 72.92  ? 232 GLU 1 OE1   1 
ATOM   1817  O  OE2   . GLU A  1  232 ? 34.328  -24.987  150.151  1.00 74.00  ? 232 GLU 1 OE2   1 
ATOM   1818  N  N     . ARG A  1  233 ? 30.243  -22.375  147.391  1.00 88.90  ? 233 ARG 1 N     1 
ATOM   1819  C  CA    . ARG A  1  233 ? 29.563  -21.237  148.005  1.00 88.92  ? 233 ARG 1 CA    1 
ATOM   1820  C  C     . ARG A  1  233 ? 29.053  -20.326  146.898  1.00 93.60  ? 233 ARG 1 C     1 
ATOM   1821  O  O     . ARG A  1  233 ? 29.677  -19.319  146.560  1.00 93.62  ? 233 ARG 1 O     1 
ATOM   1822  C  CB    . ARG A  1  233 ? 30.517  -20.472  148.989  1.00 83.48  ? 233 ARG 1 CB    1 
ATOM   1823  C  CG    . ARG A  1  233 ? 31.905  -20.102  148.439  1.00 75.53  ? 233 ARG 1 CG    1 
ATOM   1824  C  CD    . ARG A  1  233 ? 32.865  -19.813  149.583  1.00 65.15  ? 233 ARG 1 CD    1 
ATOM   1825  N  NE    . ARG A  1  233 ? 34.261  -19.808  149.168  1.00 55.81  ? 233 ARG 1 NE    1 
ATOM   1826  C  CZ    . ARG A  1  233 ? 35.228  -19.187  149.835  1.00 48.54  ? 233 ARG 1 CZ    1 
ATOM   1827  N  NH1   . ARG A  1  233 ? 34.952  -18.536  150.956  1.00 43.64  ? 233 ARG 1 NH1   1 
ATOM   1828  N  NH2   . ARG A  1  233 ? 36.473  -19.225  149.391  1.00 49.39  ? 233 ARG 1 NH2   1 
ATOM   1829  N  N     . GLY A  1  234 ? 27.896  -20.674  146.344  1.00 98.84  ? 234 GLY 1 N     1 
ATOM   1830  C  CA    . GLY A  1  234 ? 27.179  -19.760  145.476  1.00 102.04 ? 234 GLY 1 CA    1 
ATOM   1831  C  C     . GLY A  1  234 ? 27.782  -19.569  144.099  1.00 104.18 ? 234 GLY 1 C     1 
ATOM   1832  O  O     . GLY A  1  234 ? 29.007  -19.566  143.943  1.00 105.32 ? 234 GLY 1 O     1 
ATOM   1833  N  N     . ALA A  1  235 ? 26.933  -19.405  143.089  1.00 105.36 ? 235 ALA 1 N     1 
ATOM   1834  C  CA    . ALA A  1  235 ? 27.399  -18.865  141.820  1.00 109.67 ? 235 ALA 1 CA    1 
ATOM   1835  C  C     . ALA A  1  235 ? 27.366  -17.342  141.806  1.00 115.62 ? 235 ALA 1 C     1 
ATOM   1836  O  O     . ALA A  1  235 ? 28.224  -16.712  141.174  1.00 114.65 ? 235 ALA 1 O     1 
ATOM   1837  C  CB    . ALA A  1  235 ? 26.555  -19.418  140.667  1.00 108.42 ? 235 ALA 1 CB    1 
ATOM   1838  N  N     . ASP A  1  236 ? 26.393  -16.742  142.499  1.00 119.76 ? 236 ASP 1 N     1 
ATOM   1839  C  CA    . ASP A  1  236 ? 26.359  -15.289  142.643  1.00 119.20 ? 236 ASP 1 CA    1 
ATOM   1840  C  C     . ASP A  1  236 ? 27.608  -14.782  143.349  1.00 120.24 ? 236 ASP 1 C     1 
ATOM   1841  O  O     . ASP A  1  236 ? 28.145  -13.726  142.998  1.00 120.80 ? 236 ASP 1 O     1 
ATOM   1842  C  CB    . ASP A  1  236 ? 25.105  -14.862  143.408  1.00 118.22 ? 236 ASP 1 CB    1 
ATOM   1843  C  CG    . ASP A  1  236 ? 23.839  -14.979  142.576  1.00 119.20 ? 236 ASP 1 CG    1 
ATOM   1844  O  OD1   . ASP A  1  236 ? 23.713  -14.246  141.573  1.00 120.40 ? 236 ASP 1 OD1   1 
ATOM   1845  O  OD2   . ASP A  1  236 ? 22.965  -15.797  142.931  1.00 119.37 ? 236 ASP 1 OD2   1 
ATOM   1846  N  N     . TRP A  1  237 ? 28.076  -15.523  144.358  1.00 123.65 ? 237 TRP 1 N     1 
ATOM   1847  C  CA    . TRP A  1  237 ? 29.337  -15.188  145.008  1.00 130.11 ? 237 TRP 1 CA    1 
ATOM   1848  C  C     . TRP A  1  237 ? 30.467  -15.105  143.990  1.00 135.38 ? 237 TRP 1 C     1 
ATOM   1849  O  O     . TRP A  1  237 ? 31.315  -14.209  144.066  1.00 135.49 ? 237 TRP 1 O     1 
ATOM   1850  C  CB    . TRP A  1  237 ? 29.660  -16.212  146.099  1.00 131.46 ? 237 TRP 1 CB    1 
ATOM   1851  C  CG    . TRP A  1  237 ? 31.048  -16.068  146.617  1.00 130.31 ? 237 TRP 1 CG    1 
ATOM   1852  C  CD1   . TRP A  1  237 ? 31.469  -15.262  147.629  1.00 128.25 ? 237 TRP 1 CD1   1 
ATOM   1853  C  CD2   . TRP A  1  237 ? 32.211  -16.742  146.127  1.00 130.20 ? 237 TRP 1 CD2   1 
ATOM   1854  N  NE1   . TRP A  1  237 ? 32.826  -15.390  147.802  1.00 127.90 ? 237 TRP 1 NE1   1 
ATOM   1855  C  CE2   . TRP A  1  237 ? 33.304  -16.295  146.890  1.00 130.27 ? 237 TRP 1 CE2   1 
ATOM   1856  C  CE3   . TRP A  1  237 ? 32.434  -17.678  145.116  1.00 129.52 ? 237 TRP 1 CE3   1 
ATOM   1857  C  CZ2   . TRP A  1  237 ? 34.600  -16.756  146.674  1.00 132.36 ? 237 TRP 1 CZ2   1 
ATOM   1858  C  CZ3   . TRP A  1  237 ? 33.721  -18.134  144.905  1.00 129.81 ? 237 TRP 1 CZ3   1 
ATOM   1859  C  CH2   . TRP A  1  237 ? 34.786  -17.674  145.678  1.00 131.77 ? 237 TRP 1 CH2   1 
ATOM   1860  N  N     . PHE A  1  238 ? 30.502  -16.038  143.034  1.00 140.36 ? 238 PHE 1 N     1 
ATOM   1861  C  CA    . PHE A  1  238 ? 31.483  -15.951  141.957  1.00 146.20 ? 238 PHE 1 CA    1 
ATOM   1862  C  C     . PHE A  1  238 ? 31.266  -14.689  141.133  1.00 151.23 ? 238 PHE 1 C     1 
ATOM   1863  O  O     . PHE A  1  238 ? 32.185  -13.884  140.952  1.00 150.74 ? 238 PHE 1 O     1 
ATOM   1864  C  CB    . PHE A  1  238 ? 31.412  -17.191  141.065  1.00 147.08 ? 238 PHE 1 CB    1 
ATOM   1865  C  CG    . PHE A  1  238 ? 32.409  -17.179  139.941  1.00 147.46 ? 238 PHE 1 CG    1 
ATOM   1866  C  CD1   . PHE A  1  238 ? 33.700  -17.631  140.135  1.00 147.45 ? 238 PHE 1 CD1   1 
ATOM   1867  C  CD2   . PHE A  1  238 ? 32.059  -16.692  138.693  1.00 147.13 ? 238 PHE 1 CD2   1 
ATOM   1868  C  CE1   . PHE A  1  238 ? 34.617  -17.611  139.105  1.00 147.05 ? 238 PHE 1 CE1   1 
ATOM   1869  C  CE2   . PHE A  1  238 ? 32.977  -16.666  137.663  1.00 146.83 ? 238 PHE 1 CE2   1 
ATOM   1870  C  CZ    . PHE A  1  238 ? 34.255  -17.127  137.870  1.00 146.72 ? 238 PHE 1 CZ    1 
ATOM   1871  N  N     . ALA A  1  239 ? 30.041  -14.496  140.640  1.00 156.58 ? 239 ALA 1 N     1 
ATOM   1872  C  CA    . ALA A  1  239 ? 29.697  -13.340  139.815  1.00 160.67 ? 239 ALA 1 CA    1 
ATOM   1873  C  C     . ALA A  1  239 ? 29.824  -12.016  140.562  1.00 162.56 ? 239 ALA 1 C     1 
ATOM   1874  O  O     . ALA A  1  239 ? 29.669  -10.956  139.944  1.00 162.37 ? 239 ALA 1 O     1 
ATOM   1875  C  CB    . ALA A  1  239 ? 28.276  -13.497  139.267  1.00 160.98 ? 239 ALA 1 CB    1 
ATOM   1876  N  N     . GLN A  1  240 ? 30.104  -12.051  141.865  1.00 163.54 ? 240 GLN 1 N     1 
ATOM   1877  C  CA    . GLN A  1  240 ? 30.254  -10.846  142.671  1.00 164.21 ? 240 GLN 1 CA    1 
ATOM   1878  C  C     . GLN A  1  240 ? 31.503  -10.047  142.314  1.00 161.07 ? 240 GLN 1 C     1 
ATOM   1879  O  O     . GLN A  1  240 ? 31.629  -8.897   142.749  1.00 161.42 ? 240 GLN 1 O     1 
ATOM   1880  C  CB    . GLN A  1  240 ? 30.295  -11.252  144.148  1.00 168.69 ? 240 GLN 1 CB    1 
ATOM   1881  C  CG    . GLN A  1  240 ? 30.349  -10.132  145.171  1.00 173.06 ? 240 GLN 1 CG    1 
ATOM   1882  C  CD    . GLN A  1  240 ? 30.467  -10.663  146.586  1.00 176.64 ? 240 GLN 1 CD    1 
ATOM   1883  O  OE1   . GLN A  1  240 ? 29.606  -11.405  147.058  1.00 178.07 ? 240 GLN 1 OE1   1 
ATOM   1884  N  NE2   . GLN A  1  240 ? 31.540  -10.286  147.269  1.00 177.62 ? 240 GLN 1 NE2   1 
ATOM   1885  N  N     . MET A  1  241 ? 32.398  -10.597  141.500  1.00 157.45 ? 241 MET 1 N     1 
ATOM   1886  C  CA    . MET A  1  241 ? 33.667  -9.961   141.178  1.00 153.10 ? 241 MET 1 CA    1 
ATOM   1887  C  C     . MET A  1  241 ? 33.677  -9.554   139.712  1.00 151.68 ? 241 MET 1 C     1 
ATOM   1888  O  O     . MET A  1  241 ? 33.311  -10.349  138.841  1.00 151.38 ? 241 MET 1 O     1 
ATOM   1889  C  CB    . MET A  1  241 ? 34.837  -10.905  141.472  1.00 149.50 ? 241 MET 1 CB    1 
ATOM   1890  C  CG    . MET A  1  241 ? 35.242  -10.960  142.933  1.00 145.38 ? 241 MET 1 CG    1 
ATOM   1891  S  SD    . MET A  1  241 ? 36.415  -12.265  143.326  1.00 142.50 ? 241 MET 1 SD    1 
ATOM   1892  C  CE    . MET A  1  241 ? 35.305  -13.637  143.606  1.00 142.79 ? 241 MET 1 CE    1 
ATOM   1893  N  N     . GLY A  1  242 ? 34.087  -8.314   139.443  1.00 150.00 ? 242 GLY 1 N     1 
ATOM   1894  C  CA    . GLY A  1  242 ? 34.277  -7.863   138.080  1.00 147.75 ? 242 GLY 1 CA    1 
ATOM   1895  C  C     . GLY A  1  242 ? 33.083  -7.144   137.484  1.00 145.11 ? 242 GLY 1 C     1 
ATOM   1896  O  O     . GLY A  1  242 ? 32.036  -6.948   138.108  1.00 145.32 ? 242 GLY 1 O     1 
ATOM   1897  N  N     . THR A  1  243 ? 33.254  -6.756   136.221  1.00 141.76 ? 243 THR 1 N     1 
ATOM   1898  C  CA    . THR A  1  243 ? 32.288  -5.923   135.515  1.00 138.19 ? 243 THR 1 CA    1 
ATOM   1899  C  C     . THR A  1  243 ? 31.150  -6.808   134.997  1.00 136.20 ? 243 THR 1 C     1 
ATOM   1900  O  O     . THR A  1  243 ? 31.035  -7.980   135.363  1.00 137.62 ? 243 THR 1 O     1 
ATOM   1901  C  CB    . THR A  1  243 ? 32.996  -5.152   134.399  1.00 136.64 ? 243 THR 1 CB    1 
ATOM   1902  O  OG1   . THR A  1  243 ? 34.304  -4.777   134.843  1.00 135.70 ? 243 THR 1 OG1   1 
ATOM   1903  C  CG2   . THR A  1  243 ? 32.244  -3.876   134.050  1.00 136.19 ? 243 THR 1 CG2   1 
ATOM   1904  N  N     . GLU A  1  244 ? 30.290  -6.256   134.134  1.00 133.48 ? 244 GLU 1 N     1 
ATOM   1905  C  CA    . GLU A  1  244 ? 29.104  -6.975   133.678  1.00 132.49 ? 244 GLU 1 CA    1 
ATOM   1906  C  C     . GLU A  1  244 ? 29.427  -8.061   132.663  1.00 130.18 ? 244 GLU 1 C     1 
ATOM   1907  O  O     . GLU A  1  244 ? 28.625  -8.987   132.491  1.00 129.84 ? 244 GLU 1 O     1 
ATOM   1908  C  CB    . GLU A  1  244 ? 28.085  -6.001   133.081  1.00 134.40 ? 244 GLU 1 CB    1 
ATOM   1909  C  CG    . GLU A  1  244 ? 26.655  -6.518   133.096  1.00 135.42 ? 244 GLU 1 CG    1 
ATOM   1910  C  CD    . GLU A  1  244 ? 25.755  -5.758   132.143  1.00 136.24 ? 244 GLU 1 CD    1 
ATOM   1911  O  OE1   . GLU A  1  244 ? 25.811  -4.510   132.140  1.00 136.75 ? 244 GLU 1 OE1   1 
ATOM   1912  O  OE2   . GLU A  1  244 ? 25.002  -6.406   131.388  1.00 136.18 ? 244 GLU 1 OE2   1 
ATOM   1913  N  N     . GLN A  1  245 ? 30.571  -7.973   131.985  1.00 127.35 ? 245 GLN 1 N     1 
ATOM   1914  C  CA    . GLN A  1  245 ? 31.003  -9.007   131.055  1.00 121.88 ? 245 GLN 1 CA    1 
ATOM   1915  C  C     . GLN A  1  245 ? 32.138  -9.856   131.598  1.00 119.19 ? 245 GLN 1 C     1 
ATOM   1916  O  O     . GLN A  1  245 ? 32.456  -10.888  131.000  1.00 117.79 ? 245 GLN 1 O     1 
ATOM   1917  C  CB    . GLN A  1  245 ? 31.460  -8.374   129.733  1.00 118.69 ? 245 GLN 1 CB    1 
ATOM   1918  C  CG    . GLN A  1  245 ? 30.355  -8.069   128.749  1.00 115.65 ? 245 GLN 1 CG    1 
ATOM   1919  C  CD    . GLN A  1  245 ? 30.862  -8.014   127.329  1.00 113.52 ? 245 GLN 1 CD    1 
ATOM   1920  O  OE1   . GLN A  1  245 ? 31.686  -7.171   126.988  1.00 112.78 ? 245 GLN 1 OE1   1 
ATOM   1921  N  NE2   . GLN A  1  245 ? 30.364  -8.907   126.487  1.00 113.66 ? 245 GLN 1 NE2   1 
ATOM   1922  N  N     . SER A  1  246 ? 32.743  -9.457   132.712  1.00 120.01 ? 246 SER 1 N     1 
ATOM   1923  C  CA    . SER A  1  246 ? 33.848  -10.174  133.342  1.00 122.58 ? 246 SER 1 CA    1 
ATOM   1924  C  C     . SER A  1  246 ? 33.454  -10.477  134.787  1.00 124.68 ? 246 SER 1 C     1 
ATOM   1925  O  O     . SER A  1  246 ? 33.714  -9.679   135.691  1.00 123.32 ? 246 SER 1 O     1 
ATOM   1926  C  CB    . SER A  1  246 ? 35.143  -9.357   133.268  1.00 122.29 ? 246 SER 1 CB    1 
ATOM   1927  O  OG    . SER A  1  246 ? 35.596  -9.208   131.933  1.00 122.61 ? 246 SER 1 OG    1 
ATOM   1928  N  N     . LYS A  1  247 ? 32.815  -11.624  135.001  1.00 125.93 ? 247 LYS 1 N     1 
ATOM   1929  C  CA    . LYS A  1  247 ? 32.434  -12.049  136.341  1.00 122.83 ? 247 LYS 1 CA    1 
ATOM   1930  C  C     . LYS A  1  247 ? 33.508  -12.947  136.946  1.00 121.93 ? 247 LYS 1 C     1 
ATOM   1931  O  O     . LYS A  1  247 ? 34.221  -13.667  136.239  1.00 121.04 ? 247 LYS 1 O     1 
ATOM   1932  C  CB    . LYS A  1  247 ? 31.086  -12.773  136.319  1.00 120.61 ? 247 LYS 1 CB    1 
ATOM   1933  C  CG    . LYS A  1  247 ? 29.934  -11.908  135.816  1.00 120.70 ? 247 LYS 1 CG    1 
ATOM   1934  C  CD    . LYS A  1  247 ? 29.671  -10.748  136.772  1.00 121.83 ? 247 LYS 1 CD    1 
ATOM   1935  C  CE    . LYS A  1  247 ? 28.484  -9.896   136.338  1.00 120.25 ? 247 LYS 1 CE    1 
ATOM   1936  N  NZ    . LYS A  1  247 ? 28.325  -8.679   137.188  1.00 117.30 ? 247 LYS 1 NZ    1 
ATOM   1937  N  N     . GLY A  1  248 ? 33.614  -12.896  138.271  1.00 121.48 ? 248 GLY 1 N     1 
ATOM   1938  C  CA    . GLY A  1  248 ? 34.540  -13.737  138.999  1.00 120.68 ? 248 GLY 1 CA    1 
ATOM   1939  C  C     . GLY A  1  248 ? 35.916  -13.126  139.160  1.00 119.98 ? 248 GLY 1 C     1 
ATOM   1940  O  O     . GLY A  1  248 ? 36.208  -11.998  138.749  1.00 120.49 ? 248 GLY 1 O     1 
ATOM   1941  N  N     . MET A  1  249 ? 36.791  -13.924  139.764  1.00 117.87 ? 249 MET 1 N     1 
ATOM   1942  C  CA    . MET A  1  249 ? 38.169  -13.549  140.029  1.00 114.71 ? 249 MET 1 CA    1 
ATOM   1943  C  C     . MET A  1  249 ? 39.069  -14.031  138.897  1.00 113.66 ? 249 MET 1 C     1 
ATOM   1944  O  O     . MET A  1  249 ? 38.627  -14.695  137.956  1.00 114.42 ? 249 MET 1 O     1 
ATOM   1945  C  CB    . MET A  1  249 ? 38.626  -14.130  141.364  1.00 113.33 ? 249 MET 1 CB    1 
ATOM   1946  C  CG    . MET A  1  249 ? 38.785  -15.644  141.354  1.00 113.30 ? 249 MET 1 CG    1 
ATOM   1947  S  SD    . MET A  1  249 ? 37.213  -16.497  141.059  1.00 113.55 ? 249 MET 1 SD    1 
ATOM   1948  C  CE    . MET A  1  249 ? 37.649  -18.220  141.307  1.00 113.00 ? 249 MET 1 CE    1 
ATOM   1949  N  N     . LYS A  1  250 ? 40.352  -13.695  138.991  1.00 111.53 ? 250 LYS 1 N     1 
ATOM   1950  C  CA    . LYS A  1  250 ? 41.322  -14.049  137.972  1.00 108.71 ? 250 LYS 1 CA    1 
ATOM   1951  C  C     . LYS A  1  250 ? 42.686  -14.144  138.636  1.00 106.53 ? 250 LYS 1 C     1 
ATOM   1952  O  O     . LYS A  1  250 ? 42.999  -13.380  139.554  1.00 105.46 ? 250 LYS 1 O     1 
ATOM   1953  C  CB    . LYS A  1  250 ? 41.336  -13.008  136.841  1.00 106.99 ? 250 LYS 1 CB    1 
ATOM   1954  C  CG    . LYS A  1  250 ? 42.381  -13.238  135.768  1.00 105.60 ? 250 LYS 1 CG    1 
ATOM   1955  C  CD    . LYS A  1  250 ? 42.108  -14.508  134.986  1.00 105.39 ? 250 LYS 1 CD    1 
ATOM   1956  C  CE    . LYS A  1  250 ? 43.021  -14.622  133.776  1.00 105.07 ? 250 LYS 1 CE    1 
ATOM   1957  N  NZ    . LYS A  1  250 ? 44.452  -14.588  134.180  1.00 104.74 ? 250 LYS 1 NZ    1 
ATOM   1958  N  N     . LEU A  1  251 ? 43.488  -15.093  138.172  1.00 106.11 ? 251 LEU 1 N     1 
ATOM   1959  C  CA    . LEU A  1  251 ? 44.845  -15.287  138.672  1.00 106.18 ? 251 LEU 1 CA    1 
ATOM   1960  C  C     . LEU A  1  251 ? 45.784  -14.450  137.815  1.00 106.68 ? 251 LEU 1 C     1 
ATOM   1961  O  O     . LEU A  1  251 ? 46.228  -14.876  136.751  1.00 109.96 ? 251 LEU 1 O     1 
ATOM   1962  C  CB    . LEU A  1  251 ? 45.209  -16.765  138.642  1.00 106.45 ? 251 LEU 1 CB    1 
ATOM   1963  C  CG    . LEU A  1  251 ? 44.674  -17.727  139.707  1.00 105.51 ? 251 LEU 1 CG    1 
ATOM   1964  C  CD1   . LEU A  1  251 ? 43.196  -17.539  140.025  1.00 104.55 ? 251 LEU 1 CD1   1 
ATOM   1965  C  CD2   . LEU A  1  251 ? 44.927  -19.137  139.238  1.00 104.76 ? 251 LEU 1 CD2   1 
ATOM   1966  N  N     . TYR A  1  252 ? 46.085  -13.240  138.271  1.00 105.78 ? 252 TYR 1 N     1 
ATOM   1967  C  CA    . TYR A  1  252 ? 47.014  -12.385  137.554  1.00 107.89 ? 252 TYR 1 CA    1 
ATOM   1968  C  C     . TYR A  1  252 ? 48.439  -12.812  137.882  1.00 111.25 ? 252 TYR 1 C     1 
ATOM   1969  O  O     . TYR A  1  252 ? 48.709  -13.359  138.952  1.00 112.19 ? 252 TYR 1 O     1 
ATOM   1970  C  CB    . TYR A  1  252 ? 46.807  -10.914  137.949  1.00 107.87 ? 252 TYR 1 CB    1 
ATOM   1971  C  CG    . TYR A  1  252 ? 45.455  -10.341  137.563  1.00 106.17 ? 252 TYR 1 CG    1 
ATOM   1972  C  CD1   . TYR A  1  252 ? 44.337  -10.569  138.350  1.00 105.17 ? 252 TYR 1 CD1   1 
ATOM   1973  C  CD2   . TYR A  1  252 ? 45.296  -9.577   136.418  1.00 105.56 ? 252 TYR 1 CD2   1 
ATOM   1974  C  CE1   . TYR A  1  252 ? 43.097  -10.058  138.009  1.00 104.06 ? 252 TYR 1 CE1   1 
ATOM   1975  C  CE2   . TYR A  1  252 ? 44.053  -9.061   136.069  1.00 104.80 ? 252 TYR 1 CE2   1 
ATOM   1976  C  CZ    . TYR A  1  252 ? 42.960  -9.305   136.869  1.00 104.53 ? 252 TYR 1 CZ    1 
ATOM   1977  O  OH    . TYR A  1  252 ? 41.727  -8.794   136.531  1.00 105.32 ? 252 TYR 1 OH    1 
ATOM   1978  N  N     . GLN A  1  253 ? 49.348  -12.581  136.940  1.00 113.88 ? 253 GLN 1 N     1 
ATOM   1979  C  CA    . GLN A  1  253 ? 50.769  -12.776  137.186  1.00 117.78 ? 253 GLN 1 CA    1 
ATOM   1980  C  C     . GLN A  1  253 ? 51.535  -11.699  136.434  1.00 117.37 ? 253 GLN 1 C     1 
ATOM   1981  O  O     . GLN A  1  253 ? 51.072  -11.196  135.411  1.00 117.39 ? 253 GLN 1 O     1 
ATOM   1982  C  CB    . GLN A  1  253 ? 51.270  -14.175  136.773  1.00 122.22 ? 253 GLN 1 CB    1 
ATOM   1983  C  CG    . GLN A  1  253 ? 51.123  -14.538  135.300  1.00 127.26 ? 253 GLN 1 CG    1 
ATOM   1984  C  CD    . GLN A  1  253 ? 49.736  -15.020  134.938  1.00 131.23 ? 253 GLN 1 CD    1 
ATOM   1985  O  OE1   . GLN A  1  253 ? 48.833  -15.021  135.770  1.00 134.41 ? 253 GLN 1 OE1   1 
ATOM   1986  N  NE2   . GLN A  1  253 ? 49.560  -15.437  133.687  1.00 131.30 ? 253 GLN 1 NE2   1 
ATOM   1987  N  N     . ILE A  1  254 ? 52.693  -11.319  136.969  1.00 115.84 ? 254 ILE 1 N     1 
ATOM   1988  C  CA    . ILE A  1  254 ? 53.487  -10.238  136.394  1.00 112.78 ? 254 ILE 1 CA    1 
ATOM   1989  C  C     . ILE A  1  254 ? 54.961  -10.621  136.453  1.00 106.37 ? 254 ILE 1 C     1 
ATOM   1990  O  O     . ILE A  1  254 ? 55.404  -11.301  137.388  1.00 106.37 ? 254 ILE 1 O     1 
ATOM   1991  C  CB    . ILE A  1  254 ? 53.215  -8.889   137.105  1.00 115.64 ? 254 ILE 1 CB    1 
ATOM   1992  C  CG1   . ILE A  1  254 ? 53.933  -7.739   136.389  1.00 116.47 ? 254 ILE 1 CG1   1 
ATOM   1993  C  CG2   . ILE A  1  254 ? 53.613  -8.953   138.576  1.00 116.25 ? 254 ILE 1 CG2   1 
ATOM   1994  C  CD1   . ILE A  1  254 ? 53.794  -6.394   137.077  1.00 116.21 ? 254 ILE 1 CD1   1 
ATOM   1995  N  N     . SER A  1  255 ? 55.709  -10.199  135.432  1.00 100.11 ? 255 SER 1 N     1 
ATOM   1996  C  CA    . SER A  1  255 ? 57.145  -10.422  135.343  1.00 94.86  ? 255 SER 1 CA    1 
ATOM   1997  C  C     . SER A  1  255 ? 57.795  -9.217   134.676  1.00 94.99  ? 255 SER 1 C     1 
ATOM   1998  O  O     . SER A  1  255 ? 57.141  -8.430   133.981  1.00 95.46  ? 255 SER 1 O     1 
ATOM   1999  C  CB    . SER A  1  255 ? 57.481  -11.688  134.551  1.00 90.74  ? 255 SER 1 CB    1 
ATOM   2000  O  OG    . SER A  1  255 ? 56.668  -11.786  133.399  1.00 89.34  ? 255 SER 1 OG    1 
ATOM   2001  N  N     . GLY A  1  256 ? 59.099  -9.080   134.897  1.00 93.95  ? 256 GLY 1 N     1 
ATOM   2002  C  CA    . GLY A  1  256 ? 59.847  -7.979   134.348  1.00 94.01  ? 256 GLY 1 CA    1 
ATOM   2003  C  C     . GLY A  1  256 ? 60.677  -7.281   135.405  1.00 97.58  ? 256 GLY 1 C     1 
ATOM   2004  O  O     . GLY A  1  256 ? 60.896  -7.804   136.504  1.00 96.13  ? 256 GLY 1 O     1 
ATOM   2005  N  N     . PRO A  1  257 ? 61.154  -6.072   135.089  1.00 102.56 ? 257 PRO 1 N     1 
ATOM   2006  C  CA    . PRO A  1  257 ? 61.959  -5.313   136.056  1.00 104.59 ? 257 PRO 1 CA    1 
ATOM   2007  C  C     . PRO A  1  257 ? 61.122  -4.712   137.177  1.00 107.99 ? 257 PRO 1 C     1 
ATOM   2008  O  O     . PRO A  1  257 ? 61.053  -3.486   137.309  1.00 108.58 ? 257 PRO 1 O     1 
ATOM   2009  C  CB    . PRO A  1  257 ? 62.601  -4.214   135.191  1.00 102.79 ? 257 PRO 1 CB    1 
ATOM   2010  C  CG    . PRO A  1  257 ? 62.333  -4.610   133.753  1.00 101.93 ? 257 PRO 1 CG    1 
ATOM   2011  C  CD    . PRO A  1  257 ? 61.060  -5.379   133.795  1.00 103.02 ? 257 PRO 1 CD    1 
ATOM   2012  N  N     . VAL A  1  258 ? 60.475  -5.554   137.983  1.00 109.88 ? 258 VAL 1 N     1 
ATOM   2013  C  CA    . VAL A  1  258 ? 59.670  -5.090   139.105  1.00 111.58 ? 258 VAL 1 CA    1 
ATOM   2014  C  C     . VAL A  1  258 ? 60.245  -5.684   140.388  1.00 114.64 ? 258 VAL 1 C     1 
ATOM   2015  O  O     . VAL A  1  258 ? 61.021  -6.643   140.363  1.00 116.14 ? 258 VAL 1 O     1 
ATOM   2016  C  CB    . VAL A  1  258 ? 58.176  -5.449   138.938  1.00 110.39 ? 258 VAL 1 CB    1 
ATOM   2017  C  CG1   . VAL A  1  258 ? 57.903  -6.878   139.362  1.00 110.23 ? 258 VAL 1 CG1   1 
ATOM   2018  C  CG2   . VAL A  1  258 ? 57.304  -4.465   139.682  1.00 109.89 ? 258 VAL 1 CG2   1 
ATOM   2019  N  N     . LYS A  1  259 ? 59.850  -5.099   141.523  1.00 114.62 ? 259 LYS 1 N     1 
ATOM   2020  C  CA    . LYS A  1  259 ? 60.462  -5.461   142.801  1.00 113.77 ? 259 LYS 1 CA    1 
ATOM   2021  C  C     . LYS A  1  259 ? 60.129  -6.895   143.203  1.00 112.20 ? 259 LYS 1 C     1 
ATOM   2022  O  O     . LYS A  1  259 ? 61.029  -7.684   143.512  1.00 111.43 ? 259 LYS 1 O     1 
ATOM   2023  C  CB    . LYS A  1  259 ? 60.036  -4.476   143.890  1.00 114.39 ? 259 LYS 1 CB    1 
ATOM   2024  C  CG    . LYS A  1  259 ? 60.673  -4.747   145.245  1.00 114.90 ? 259 LYS 1 CG    1 
ATOM   2025  C  CD    . LYS A  1  259 ? 60.484  -3.567   146.185  1.00 115.25 ? 259 LYS 1 CD    1 
ATOM   2026  C  CE    . LYS A  1  259 ? 61.123  -3.826   147.533  1.00 115.07 ? 259 LYS 1 CE    1 
ATOM   2027  N  NZ    . LYS A  1  259 ? 62.481  -4.408   147.387  1.00 114.95 ? 259 LYS 1 NZ    1 
ATOM   2028  N  N     . ARG A  1  260 ? 58.848  -7.259   143.208  1.00 111.82 ? 260 ARG 1 N     1 
ATOM   2029  C  CA    . ARG A  1  260 ? 58.428  -8.612   143.576  1.00 110.10 ? 260 ARG 1 CA    1 
ATOM   2030  C  C     . ARG A  1  260 ? 57.409  -9.126   142.564  1.00 107.15 ? 260 ARG 1 C     1 
ATOM   2031  O  O     . ARG A  1  260 ? 56.194  -9.097   142.799  1.00 106.33 ? 260 ARG 1 O     1 
ATOM   2032  C  CB    . ARG A  1  260 ? 57.904  -8.656   145.016  1.00 108.66 ? 260 ARG 1 CB    1 
ATOM   2033  C  CG    . ARG A  1  260 ? 56.797  -7.659   145.352  1.00 106.52 ? 260 ARG 1 CG    1 
ATOM   2034  C  CD    . ARG A  1  260 ? 56.466  -7.683   146.839  1.00 103.39 ? 260 ARG 1 CD    1 
ATOM   2035  N  NE    . ARG A  1  260 ? 57.326  -6.778   147.599  1.00 99.78  ? 260 ARG 1 NE    1 
ATOM   2036  C  CZ    . ARG A  1  260 ? 57.029  -5.509   147.872  1.00 93.83  ? 260 ARG 1 CZ    1 
ATOM   2037  N  NH1   . ARG A  1  260 ? 55.886  -4.984   147.458  1.00 91.59  ? 260 ARG 1 NH1   1 
ATOM   2038  N  NH2   . ARG A  1  260 ? 57.877  -4.768   148.566  1.00 91.43  ? 260 ARG 1 NH2   1 
ATOM   2039  N  N     . PRO A  1  261 ? 57.882  -9.653   141.436  1.00 103.58 ? 261 PRO 1 N     1 
ATOM   2040  C  CA    . PRO A  1  261 ? 56.970  -10.235  140.449  1.00 102.65 ? 261 PRO 1 CA    1 
ATOM   2041  C  C     . PRO A  1  261 ? 56.378  -11.536  140.961  1.00 99.30  ? 261 PRO 1 C     1 
ATOM   2042  O  O     . PRO A  1  261 ? 56.827  -12.109  141.955  1.00 97.60  ? 261 PRO 1 O     1 
ATOM   2043  C  CB    . PRO A  1  261 ? 57.865  -10.460  139.228  1.00 102.47 ? 261 PRO 1 CB    1 
ATOM   2044  C  CG    . PRO A  1  261 ? 59.229  -10.606  139.790  1.00 101.03 ? 261 PRO 1 CG    1 
ATOM   2045  C  CD    . PRO A  1  261 ? 59.287  -9.725   140.999  1.00 100.99 ? 261 PRO 1 CD    1 
ATOM   2046  N  N     . GLY A  1  262 ? 55.345  -11.994  140.279  1.00 96.77  ? 262 GLY 1 N     1 
ATOM   2047  C  CA    . GLY A  1  262 ? 54.737  -13.242  140.702  1.00 93.68  ? 262 GLY 1 CA    1 
ATOM   2048  C  C     . GLY A  1  262 ? 53.235  -13.228  140.469  1.00 90.01  ? 262 GLY 1 C     1 
ATOM   2049  O  O     . GLY A  1  262 ? 52.738  -12.499  139.613  1.00 89.59  ? 262 GLY 1 O     1 
ATOM   2050  N  N     . VAL A  1  263 ? 52.538  -14.041  141.268  1.00 87.03  ? 263 VAL 1 N     1 
ATOM   2051  C  CA    . VAL A  1  263 ? 51.118  -14.332  141.091  1.00 83.40  ? 263 VAL 1 CA    1 
ATOM   2052  C  C     . VAL A  1  263 ? 50.298  -13.648  142.178  1.00 83.76  ? 263 VAL 1 C     1 
ATOM   2053  O  O     . VAL A  1  263 ? 50.717  -13.577  143.341  1.00 83.67  ? 263 VAL 1 O     1 
ATOM   2054  C  CB    . VAL A  1  263 ? 50.866  -15.852  141.105  1.00 78.96  ? 263 VAL 1 CB    1 
ATOM   2055  C  CG1   . VAL A  1  263 ? 49.443  -16.163  140.674  1.00 76.18  ? 263 VAL 1 CG1   1 
ATOM   2056  C  CG2   . VAL A  1  263 ? 51.891  -16.575  140.238  1.00 78.94  ? 263 VAL 1 CG2   1 
ATOM   2057  N  N     . TYR A  1  264 ? 49.110  -13.172  141.797  1.00 83.10  ? 264 TYR 1 N     1 
ATOM   2058  C  CA    . TYR A  1  264 ? 48.123  -12.602  142.714  1.00 80.35  ? 264 TYR 1 CA    1 
ATOM   2059  C  C     . TYR A  1  264 ? 46.733  -13.019  142.252  1.00 72.70  ? 264 TYR 1 C     1 
ATOM   2060  O  O     . TYR A  1  264 ? 46.368  -12.777  141.098  1.00 76.34  ? 264 TYR 1 O     1 
ATOM   2061  C  CB    . TYR A  1  264 ? 48.238  -11.071  142.766  1.00 86.18  ? 264 TYR 1 CB    1 
ATOM   2062  C  CG    . TYR A  1  264 ? 49.589  -10.558  143.241  1.00 94.44  ? 264 TYR 1 CG    1 
ATOM   2063  C  CD1   . TYR A  1  264 ? 49.869  -10.436  144.595  1.00 98.37  ? 264 TYR 1 CD1   1 
ATOM   2064  C  CD2   . TYR A  1  264 ? 50.585  -10.207  142.344  1.00 96.84  ? 264 TYR 1 CD2   1 
ATOM   2065  C  CE1   . TYR A  1  264 ? 51.105  -9.972   145.044  1.00 98.57  ? 264 TYR 1 CE1   1 
ATOM   2066  C  CE2   . TYR A  1  264 ? 51.826  -9.743   142.787  1.00 98.01  ? 264 TYR 1 CE2   1 
ATOM   2067  C  CZ    . TYR A  1  264 ? 52.079  -9.629   144.136  1.00 97.67  ? 264 TYR 1 CZ    1 
ATOM   2068  O  OH    . TYR A  1  264 ? 53.303  -9.170   144.575  1.00 95.94  ? 264 TYR 1 OH    1 
ATOM   2069  N  N     . GLU A  1  265 ? 45.962  -13.663  143.130  1.00 60.52  ? 265 GLU 1 N     1 
ATOM   2070  C  CA    . GLU A  1  265 ? 44.568  -14.003  142.829  1.00 47.98  ? 265 GLU 1 CA    1 
ATOM   2071  C  C     . GLU A  1  265 ? 43.712  -12.779  143.128  1.00 40.10  ? 265 GLU 1 C     1 
ATOM   2072  O  O     . GLU A  1  265 ? 43.327  -12.544  144.274  1.00 29.16  ? 265 GLU 1 O     1 
ATOM   2073  C  CB    . GLU A  1  265 ? 44.112  -15.205  143.651  1.00 44.45  ? 265 GLU 1 CB    1 
ATOM   2074  C  CG    . GLU A  1  265 ? 42.702  -15.720  143.293  1.00 40.70  ? 265 GLU 1 CG    1 
ATOM   2075  C  CD    . GLU A  1  265 ? 42.154  -16.742  144.280  1.00 32.57  ? 265 GLU 1 CD    1 
ATOM   2076  O  OE1   . GLU A  1  265 ? 42.942  -17.393  144.984  1.00 30.09  ? 265 GLU 1 OE1   1 
ATOM   2077  O  OE2   . GLU A  1  265 ? 40.921  -16.881  144.363  1.00 28.39  ? 265 GLU 1 OE2   1 
ATOM   2078  N  N     . LEU A  1  266 ? 43.349  -12.031  142.098  1.00 46.87  ? 266 LEU 1 N     1 
ATOM   2079  C  CA    . LEU A  1  266 ? 42.710  -10.734  142.241  1.00 58.01  ? 266 LEU 1 CA    1 
ATOM   2080  C  C     . LEU A  1  266 ? 41.410  -10.689  141.456  1.00 64.30  ? 266 LEU 1 C     1 
ATOM   2081  O  O     . LEU A  1  266 ? 41.241  -11.423  140.479  1.00 64.94  ? 266 LEU 1 O     1 
ATOM   2082  C  CB    . LEU A  1  266 ? 43.643  -9.615   141.746  1.00 61.44  ? 266 LEU 1 CB    1 
ATOM   2083  C  CG    . LEU A  1  266 ? 45.038  -9.413   142.336  1.00 60.93  ? 266 LEU 1 CG    1 
ATOM   2084  C  CD1   . LEU A  1  266 ? 45.900  -8.638   141.359  1.00 61.56  ? 266 LEU 1 CD1   1 
ATOM   2085  C  CD2   . LEU A  1  266 ? 44.911  -8.638   143.639  1.00 58.32  ? 266 LEU 1 CD2   1 
ATOM   2086  N  N     . PRO A  1  267 ? 40.469  -9.832   141.854  1.00 68.55  ? 267 PRO 1 N     1 
ATOM   2087  C  CA    . PRO A  1  267 ? 39.230  -9.699   141.081  1.00 73.80  ? 267 PRO 1 CA    1 
ATOM   2088  C  C     . PRO A  1  267 ? 39.501  -9.187   139.675  1.00 83.72  ? 267 PRO 1 C     1 
ATOM   2089  O  O     . PRO A  1  267 ? 40.564  -8.642   139.374  1.00 85.89  ? 267 PRO 1 O     1 
ATOM   2090  C  CB    . PRO A  1  267 ? 38.408  -8.693   141.896  1.00 69.31  ? 267 PRO 1 CB    1 
ATOM   2091  C  CG    . PRO A  1  267 ? 39.412  -7.934   142.679  1.00 67.38  ? 267 PRO 1 CG    1 
ATOM   2092  C  CD    . PRO A  1  267 ? 40.495  -8.913   143.007  1.00 67.65  ? 267 PRO 1 CD    1 
ATOM   2093  N  N     . MET A  1  268 ? 38.537  -9.413   138.792  1.00 91.43  ? 268 MET 1 N     1 
ATOM   2094  C  CA    . MET A  1  268 ? 38.636  -8.899   137.433  1.00 99.56  ? 268 MET 1 CA    1 
ATOM   2095  C  C     . MET A  1  268 ? 38.326  -7.405   137.435  1.00 102.49 ? 268 MET 1 C     1 
ATOM   2096  O  O     . MET A  1  268 ? 37.254  -6.991   137.888  1.00 103.64 ? 268 MET 1 O     1 
ATOM   2097  C  CB    . MET A  1  268 ? 37.692  -9.656   136.504  1.00 103.73 ? 268 MET 1 CB    1 
ATOM   2098  C  CG    . MET A  1  268 ? 38.151  -9.667   135.062  1.00 107.75 ? 268 MET 1 CG    1 
ATOM   2099  S  SD    . MET A  1  268 ? 39.273  -11.035  134.737  1.00 111.94 ? 268 MET 1 SD    1 
ATOM   2100  C  CE    . MET A  1  268 ? 38.119  -12.355  134.378  1.00 114.59 ? 268 MET 1 CE    1 
ATOM   2101  N  N     . GLY A  1  269 ? 39.263  -6.594   136.949  1.00 102.50 ? 269 GLY 1 N     1 
ATOM   2102  C  CA    . GLY A  1  269 ? 39.060  -5.158   136.844  1.00 103.24 ? 269 GLY 1 CA    1 
ATOM   2103  C  C     . GLY A  1  269 ? 40.055  -4.305   137.604  1.00 104.94 ? 269 GLY 1 C     1 
ATOM   2104  O  O     . GLY A  1  269 ? 39.977  -3.071   137.509  1.00 103.34 ? 269 GLY 1 O     1 
ATOM   2105  N  N     . THR A  1  270 ? 40.970  -4.891   138.377  1.00 108.62 ? 270 THR 1 N     1 
ATOM   2106  C  CA    . THR A  1  270 ? 41.979  -4.108   139.079  1.00 110.91 ? 270 THR 1 CA    1 
ATOM   2107  C  C     . THR A  1  270 ? 42.822  -3.317   138.085  1.00 117.72 ? 270 THR 1 C     1 
ATOM   2108  O  O     . THR A  1  270 ? 43.175  -3.815   137.015  1.00 118.95 ? 270 THR 1 O     1 
ATOM   2109  C  CB    . THR A  1  270 ? 42.886  -5.015   139.921  1.00 104.60 ? 270 THR 1 CB    1 
ATOM   2110  O  OG1   . THR A  1  270 ? 43.739  -5.777   139.061  1.00 100.97 ? 270 THR 1 OG1   1 
ATOM   2111  C  CG2   . THR A  1  270 ? 42.070  -5.961   140.789  1.00 102.50 ? 270 THR 1 CG2   1 
ATOM   2112  N  N     . THR A  1  271 ? 43.144  -2.077   138.437  1.00 122.84 ? 271 THR 1 N     1 
ATOM   2113  C  CA    . THR A  1  271 ? 43.934  -1.249   137.540  1.00 129.06 ? 271 THR 1 CA    1 
ATOM   2114  C  C     . THR A  1  271 ? 45.375  -1.745   137.496  1.00 130.96 ? 271 THR 1 C     1 
ATOM   2115  O  O     . THR A  1  271 ? 45.878  -2.352   138.445  1.00 129.49 ? 271 THR 1 O     1 
ATOM   2116  C  CB    . THR A  1  271 ? 43.900  0.216    137.985  1.00 133.68 ? 271 THR 1 CB    1 
ATOM   2117  O  OG1   . THR A  1  271 ? 44.434  0.327    139.311  1.00 134.37 ? 271 THR 1 OG1   1 
ATOM   2118  C  CG2   . THR A  1  271 ? 42.474  0.762    137.963  1.00 135.46 ? 271 THR 1 CG2   1 
ATOM   2119  N  N     . PHE A  1  272 ? 46.036  -1.493   136.364  1.00 134.63 ? 272 PHE 1 N     1 
ATOM   2120  C  CA    . PHE A  1  272 ? 47.435  -1.885   136.217  1.00 138.24 ? 272 PHE 1 CA    1 
ATOM   2121  C  C     . PHE A  1  272 ? 48.296  -1.224   137.283  1.00 137.97 ? 272 PHE 1 C     1 
ATOM   2122  O  O     . PHE A  1  272 ? 49.242  -1.831   137.799  1.00 137.45 ? 272 PHE 1 O     1 
ATOM   2123  C  CB    . PHE A  1  272 ? 47.940  -1.521   134.819  1.00 142.10 ? 272 PHE 1 CB    1 
ATOM   2124  C  CG    . PHE A  1  272 ? 47.174  -2.183   133.707  1.00 146.64 ? 272 PHE 1 CG    1 
ATOM   2125  C  CD1   . PHE A  1  272 ? 45.947  -1.692   133.299  1.00 148.70 ? 272 PHE 1 CD1   1 
ATOM   2126  C  CD2   . PHE A  1  272 ? 47.679  -3.303   133.072  1.00 147.79 ? 272 PHE 1 CD2   1 
ATOM   2127  C  CE1   . PHE A  1  272 ? 45.242  -2.306   132.284  1.00 148.78 ? 272 PHE 1 CE1   1 
ATOM   2128  C  CE2   . PHE A  1  272 ? 46.975  -3.915   132.054  1.00 148.24 ? 272 PHE 1 CE2   1 
ATOM   2129  C  CZ    . PHE A  1  272 ? 45.757  -3.415   131.663  1.00 148.31 ? 272 PHE 1 CZ    1 
ATOM   2130  N  N     . ARG A  1  273 ? 47.975  0.028    137.616  1.00 138.46 ? 273 ARG 1 N     1 
ATOM   2131  C  CA    . ARG A  1  273 ? 48.682  0.750    138.667  1.00 137.14 ? 273 ARG 1 CA    1 
ATOM   2132  C  C     . ARG A  1  273 ? 48.628  -0.007   139.989  1.00 134.31 ? 273 ARG 1 C     1 
ATOM   2133  O  O     . ARG A  1  273 ? 49.652  -0.175   140.664  1.00 133.48 ? 273 ARG 1 O     1 
ATOM   2134  C  CB    . ARG A  1  273 ? 48.073  2.146    138.808  1.00 137.05 ? 273 ARG 1 CB    1 
ATOM   2135  C  CG    . ARG A  1  273 ? 48.716  3.029    139.850  1.00 139.08 ? 273 ARG 1 CG    1 
ATOM   2136  C  CD    . ARG A  1  273 ? 47.921  4.312    140.005  1.00 142.05 ? 273 ARG 1 CD    1 
ATOM   2137  N  NE    . ARG A  1  273 ? 47.697  4.966    138.719  1.00 143.88 ? 273 ARG 1 NE    1 
ATOM   2138  C  CZ    . ARG A  1  273 ? 48.610  5.688    138.074  1.00 144.79 ? 273 ARG 1 CZ    1 
ATOM   2139  N  NH1   . ARG A  1  273 ? 49.819  5.860    138.592  1.00 144.86 ? 273 ARG 1 NH1   1 
ATOM   2140  N  NH2   . ARG A  1  273 ? 48.308  6.242    136.909  1.00 145.02 ? 273 ARG 1 NH2   1 
ATOM   2141  N  N     . GLU A  1  274 ? 47.439  -0.485   140.366  1.00 130.03 ? 274 GLU 1 N     1 
ATOM   2142  C  CA    . GLU A  1  274 ? 47.309  -1.253   141.600  1.00 120.71 ? 274 GLU 1 CA    1 
ATOM   2143  C  C     . GLU A  1  274 ? 48.173  -2.502   141.554  1.00 113.59 ? 274 GLU 1 C     1 
ATOM   2144  O  O     . GLU A  1  274 ? 48.890  -2.812   142.512  1.00 113.04 ? 274 GLU 1 O     1 
ATOM   2145  C  CB    . GLU A  1  274 ? 45.848  -1.633   141.850  1.00 116.29 ? 274 GLU 1 CB    1 
ATOM   2146  C  CG    . GLU A  1  274 ? 45.697  -2.732   142.907  1.00 111.29 ? 274 GLU 1 CG    1 
ATOM   2147  C  CD    . GLU A  1  274 ? 44.255  -3.053   143.251  1.00 108.17 ? 274 GLU 1 CD    1 
ATOM   2148  O  OE1   . GLU A  1  274 ? 43.367  -2.229   142.961  1.00 107.33 ? 274 GLU 1 OE1   1 
ATOM   2149  O  OE2   . GLU A  1  274 ? 44.009  -4.137   143.816  1.00 107.33 ? 274 GLU 1 OE2   1 
ATOM   2150  N  N     . LEU A  1  275 ? 48.129  -3.225   140.435  1.00 108.63 ? 275 LEU 1 N     1 
ATOM   2151  C  CA    . LEU A  1  275 ? 48.851  -4.489   140.349  1.00 108.46 ? 275 LEU 1 CA    1 
ATOM   2152  C  C     . LEU A  1  275 ? 50.355  -4.268   140.448  1.00 108.75 ? 275 LEU 1 C     1 
ATOM   2153  O  O     . LEU A  1  275 ? 51.037  -4.915   141.250  1.00 110.13 ? 275 LEU 1 O     1 
ATOM   2154  C  CB    . LEU A  1  275 ? 48.486  -5.215   139.051  1.00 107.42 ? 275 LEU 1 CB    1 
ATOM   2155  C  CG    . LEU A  1  275 ? 48.581  -6.750   139.012  1.00 105.22 ? 275 LEU 1 CG    1 
ATOM   2156  C  CD1   . LEU A  1  275 ? 47.907  -7.299   137.772  1.00 104.32 ? 275 LEU 1 CD1   1 
ATOM   2157  C  CD2   . LEU A  1  275 ? 50.024  -7.240   139.061  1.00 103.98 ? 275 LEU 1 CD2   1 
ATOM   2158  N  N     . ILE A  1  276 ? 50.893  -3.344   139.652  1.00 107.08 ? 276 ILE 1 N     1 
ATOM   2159  C  CA    . ILE A  1  276 ? 52.342  -3.178   139.616  1.00 107.40 ? 276 ILE 1 CA    1 
ATOM   2160  C  C     . ILE A  1  276 ? 52.846  -2.545   140.908  1.00 110.38 ? 276 ILE 1 C     1 
ATOM   2161  O  O     . ILE A  1  276 ? 53.905  -2.921   141.424  1.00 110.25 ? 276 ILE 1 O     1 
ATOM   2162  C  CB    . ILE A  1  276 ? 52.756  -2.356   138.381  1.00 105.59 ? 276 ILE 1 CB    1 
ATOM   2163  C  CG1   . ILE A  1  276 ? 52.197  -2.990   137.108  1.00 104.75 ? 276 ILE 1 CG1   1 
ATOM   2164  C  CG2   . ILE A  1  276 ? 54.276  -2.240   138.286  1.00 104.91 ? 276 ILE 1 CG2   1 
ATOM   2165  C  CD1   . ILE A  1  276 ? 51.940  -1.997   135.988  1.00 103.44 ? 276 ILE 1 CD1   1 
ATOM   2166  N  N     . TYR A  1  277 ? 52.096  -1.594   141.463  1.00 114.36 ? 277 TYR 1 N     1 
ATOM   2167  C  CA    . TYR A  1  277 ? 52.634  -0.766   142.538  1.00 117.44 ? 277 TYR 1 CA    1 
ATOM   2168  C  C     . TYR A  1  277 ? 52.305  -1.310   143.927  1.00 117.37 ? 277 TYR 1 C     1 
ATOM   2169  O  O     . TYR A  1  277 ? 53.209  -1.505   144.744  1.00 117.73 ? 277 TYR 1 O     1 
ATOM   2170  C  CB    . TYR A  1  277 ? 52.151  0.679    142.357  1.00 118.28 ? 277 TYR 1 CB    1 
ATOM   2171  C  CG    . TYR A  1  277 ? 52.955  1.359    141.272  1.00 117.92 ? 277 TYR 1 CG    1 
ATOM   2172  C  CD1   . TYR A  1  277 ? 54.272  1.730    141.488  1.00 117.83 ? 277 TYR 1 CD1   1 
ATOM   2173  C  CD2   . TYR A  1  277 ? 52.424  1.554    140.006  1.00 117.90 ? 277 TYR 1 CD2   1 
ATOM   2174  C  CE1   . TYR A  1  277 ? 55.024  2.319    140.486  1.00 118.48 ? 277 TYR 1 CE1   1 
ATOM   2175  C  CE2   . TYR A  1  277 ? 53.172  2.143    138.999  1.00 118.76 ? 277 TYR 1 CE2   1 
ATOM   2176  C  CZ    . TYR A  1  277 ? 54.471  2.520    139.243  1.00 119.21 ? 277 TYR 1 CZ    1 
ATOM   2177  O  OH    . TYR A  1  277 ? 55.220  3.106    138.246  1.00 119.85 ? 277 TYR 1 OH    1 
ATOM   2178  N  N     . GLU A  1  278 ? 51.025  -1.554   144.211  1.00 115.65 ? 278 GLU 1 N     1 
ATOM   2179  C  CA    . GLU A  1  278 ? 50.657  -2.131   145.500  1.00 112.56 ? 278 GLU 1 CA    1 
ATOM   2180  C  C     . GLU A  1  278 ? 51.271  -3.512   145.675  1.00 109.24 ? 278 GLU 1 C     1 
ATOM   2181  O  O     . GLU A  1  278 ? 51.841  -3.822   146.727  1.00 110.84 ? 278 GLU 1 O     1 
ATOM   2182  C  CB    . GLU A  1  278 ? 49.134  -2.206   145.633  1.00 113.45 ? 278 GLU 1 CB    1 
ATOM   2183  C  CG    . GLU A  1  278 ? 48.421  -0.868   145.613  1.00 115.67 ? 278 GLU 1 CG    1 
ATOM   2184  C  CD    . GLU A  1  278 ? 48.382  -0.213   146.981  1.00 116.77 ? 278 GLU 1 CD    1 
ATOM   2185  O  OE1   . GLU A  1  278 ? 49.455  -0.048   147.597  1.00 117.18 ? 278 GLU 1 OE1   1 
ATOM   2186  O  OE2   . GLU A  1  278 ? 47.279  0.141    147.443  1.00 116.98 ? 278 GLU 1 OE2   1 
ATOM   2187  N  N     . TRP A  1  279 ? 51.176  -4.353   144.648  1.00 105.49 ? 279 TRP 1 N     1 
ATOM   2188  C  CA    . TRP A  1  279 ? 51.541  -5.761   144.770  1.00 103.92 ? 279 TRP 1 CA    1 
ATOM   2189  C  C     . TRP A  1  279 ? 52.995  -6.047   144.391  1.00 97.38  ? 279 TRP 1 C     1 
ATOM   2190  O  O     . TRP A  1  279 ? 53.780  -6.506   145.227  1.00 96.66  ? 279 TRP 1 O     1 
ATOM   2191  C  CB    . TRP A  1  279 ? 50.572  -6.597   143.931  1.00 108.17 ? 279 TRP 1 CB    1 
ATOM   2192  C  CG    . TRP A  1  279 ? 49.167  -6.284   144.295  1.00 114.21 ? 279 TRP 1 CG    1 
ATOM   2193  C  CD1   . TRP A  1  279 ? 48.260  -5.588   143.556  1.00 116.86 ? 279 TRP 1 CD1   1 
ATOM   2194  C  CD2   . TRP A  1  279 ? 48.523  -6.596   145.532  1.00 117.98 ? 279 TRP 1 CD2   1 
ATOM   2195  N  NE1   . TRP A  1  279 ? 47.075  -5.477   144.242  1.00 119.24 ? 279 TRP 1 NE1   1 
ATOM   2196  C  CE2   . TRP A  1  279 ? 47.213  -6.087   145.461  1.00 120.27 ? 279 TRP 1 CE2   1 
ATOM   2197  C  CE3   . TRP A  1  279 ? 48.921  -7.273   146.687  1.00 117.69 ? 279 TRP 1 CE3   1 
ATOM   2198  C  CZ2   . TRP A  1  279 ? 46.303  -6.230   146.499  1.00 120.57 ? 279 TRP 1 CZ2   1 
ATOM   2199  C  CZ3   . TRP A  1  279 ? 48.016  -7.413   147.714  1.00 118.20 ? 279 TRP 1 CZ3   1 
ATOM   2200  C  CH2   . TRP A  1  279 ? 46.723  -6.895   147.616  1.00 119.56 ? 279 TRP 1 CH2   1 
ATOM   2201  N  N     . ALA A  1  280 ? 53.371  -5.768   143.148  1.00 90.43  ? 280 ALA 1 N     1 
ATOM   2202  C  CA    . ALA A  1  280 ? 54.705  -6.106   142.663  1.00 78.42  ? 280 ALA 1 CA    1 
ATOM   2203  C  C     . ALA A  1  280 ? 55.793  -5.147   143.137  1.00 63.53  ? 280 ALA 1 C     1 
ATOM   2204  O  O     . ALA A  1  280 ? 56.972  -5.391   142.853  1.00 51.41  ? 280 ALA 1 O     1 
ATOM   2205  C  CB    . ALA A  1  280 ? 54.692  -6.179   141.135  1.00 78.38  ? 280 ALA 1 CB    1 
ATOM   2206  N  N     . GLY A  1  281 ? 55.434  -4.079   143.848  1.00 64.35  ? 281 GLY 1 N     1 
ATOM   2207  C  CA    . GLY A  1  281 ? 56.406  -3.183   144.439  1.00 67.54  ? 281 GLY 1 CA    1 
ATOM   2208  C  C     . GLY A  1  281 ? 56.924  -2.091   143.531  1.00 67.46  ? 281 GLY 1 C     1 
ATOM   2209  O  O     . GLY A  1  281 ? 57.927  -1.449   143.866  1.00 59.46  ? 281 GLY 1 O     1 
ATOM   2210  N  N     . GLY A  1  282 ? 56.281  -1.864   142.391  1.00 73.71  ? 282 GLY 1 N     1 
ATOM   2211  C  CA    . GLY A  1  282 ? 56.703  -0.841   141.470  1.00 78.34  ? 282 GLY 1 CA    1 
ATOM   2212  C  C     . GLY A  1  282 ? 57.907  -1.283   140.666  1.00 82.43  ? 282 GLY 1 C     1 
ATOM   2213  O  O     . GLY A  1  282 ? 58.750  -2.047   141.142  1.00 81.55  ? 282 GLY 1 O     1 
ATOM   2214  N  N     . PRO A  1  283 ? 58.026  -0.785   139.436  1.00 88.40  ? 283 PRO 1 N     1 
ATOM   2215  C  CA    . PRO A  1  283 ? 59.115  -1.232   138.559  1.00 92.45  ? 283 PRO 1 CA    1 
ATOM   2216  C  C     . PRO A  1  283 ? 60.480  -0.880   139.128  1.00 95.63  ? 283 PRO 1 C     1 
ATOM   2217  O  O     . PRO A  1  283 ? 60.621  -0.023   140.000  1.00 100.21 ? 283 PRO 1 O     1 
ATOM   2218  C  CB    . PRO A  1  283 ? 58.853  -0.471   137.251  1.00 92.75  ? 283 PRO 1 CB    1 
ATOM   2219  C  CG    . PRO A  1  283 ? 57.412  -0.063   137.323  1.00 92.43  ? 283 PRO 1 CG    1 
ATOM   2220  C  CD    . PRO A  1  283 ? 57.132  0.175    138.766  1.00 90.61  ? 283 PRO 1 CD    1 
ATOM   2221  N  N     . LEU A  1  284 ? 61.502  -1.554   138.602  1.00 94.89  ? 284 LEU 1 N     1 
ATOM   2222  C  CA    . LEU A  1  284 ? 62.876  -1.257   138.971  1.00 97.24  ? 284 LEU 1 CA    1 
ATOM   2223  C  C     . LEU A  1  284 ? 63.556  -0.331   137.979  1.00 104.64 ? 284 LEU 1 C     1 
ATOM   2224  O  O     . LEU A  1  284 ? 64.542  0.321    138.336  1.00 105.65 ? 284 LEU 1 O     1 
ATOM   2225  C  CB    . LEU A  1  284 ? 63.692  -2.547   139.093  1.00 93.87  ? 284 LEU 1 CB    1 
ATOM   2226  C  CG    . LEU A  1  284 ? 63.023  -3.682   139.865  1.00 89.87  ? 284 LEU 1 CG    1 
ATOM   2227  C  CD1   . LEU A  1  284 ? 63.677  -5.003   139.498  1.00 90.15  ? 284 LEU 1 CD1   1 
ATOM   2228  C  CD2   . LEU A  1  284 ? 63.059  -3.437   141.362  1.00 88.08  ? 284 LEU 1 CD2   1 
ATOM   2229  N  N     . GLU A  1  285 ? 63.043  -0.247   136.760  1.00 110.96 ? 285 GLU 1 N     1 
ATOM   2230  C  CA    . GLU A  1  285 ? 63.597  0.600    135.719  1.00 116.40 ? 285 GLU 1 CA    1 
ATOM   2231  C  C     . GLU A  1  285 ? 62.438  1.275    135.004  1.00 117.94 ? 285 GLU 1 C     1 
ATOM   2232  O  O     . GLU A  1  285 ? 61.289  0.842    135.136  1.00 117.17 ? 285 GLU 1 O     1 
ATOM   2233  C  CB    . GLU A  1  285 ? 64.442  -0.217   134.732  1.00 118.02 ? 285 GLU 1 CB    1 
ATOM   2234  C  CG    . GLU A  1  285 ? 65.621  -0.922   135.376  1.00 119.76 ? 285 GLU 1 CG    1 
ATOM   2235  C  CD    . GLU A  1  285 ? 66.822  -0.015   135.517  1.00 123.14 ? 285 GLU 1 CD    1 
ATOM   2236  O  OE1   . GLU A  1  285 ? 67.094  0.761    134.580  1.00 124.36 ? 285 GLU 1 OE1   1 
ATOM   2237  O  OE2   . GLU A  1  285 ? 67.491  -0.069   136.568  1.00 124.40 ? 285 GLU 1 OE2   1 
ATOM   2238  N  N     . PRO A  1  286 ? 62.699  2.347    134.253  1.00 118.36 ? 286 PRO 1 N     1 
ATOM   2239  C  CA    . PRO A  1  286 ? 61.608  2.970    133.493  1.00 118.18 ? 286 PRO 1 CA    1 
ATOM   2240  C  C     . PRO A  1  286 ? 61.109  2.020    132.417  1.00 116.83 ? 286 PRO 1 C     1 
ATOM   2241  O  O     . PRO A  1  286 ? 61.891  1.481    131.631  1.00 116.92 ? 286 PRO 1 O     1 
ATOM   2242  C  CB    . PRO A  1  286 ? 62.255  4.227    132.896  1.00 117.56 ? 286 PRO 1 CB    1 
ATOM   2243  C  CG    . PRO A  1  286 ? 63.471  4.467    133.726  1.00 116.65 ? 286 PRO 1 CG    1 
ATOM   2244  C  CD    . PRO A  1  286 ? 63.950  3.115    134.134  1.00 117.34 ? 286 PRO 1 CD    1 
ATOM   2245  N  N     . ILE A  1  287 ? 59.798  1.817    132.387  1.00 114.56 ? 287 ILE 1 N     1 
ATOM   2246  C  CA    . ILE A  1  287 ? 59.165  0.915    131.436  1.00 113.23 ? 287 ILE 1 CA    1 
ATOM   2247  C  C     . ILE A  1  287 ? 58.688  1.717    130.240  1.00 109.97 ? 287 ILE 1 C     1 
ATOM   2248  O  O     . ILE A  1  287 ? 58.104  2.799    130.387  1.00 110.88 ? 287 ILE 1 O     1 
ATOM   2249  C  CB    . ILE A  1  287 ? 58.005  0.139    132.088  1.00 115.44 ? 287 ILE 1 CB    1 
ATOM   2250  C  CG1   . ILE A  1  287 ? 58.477  -1.229   132.592  1.00 118.08 ? 287 ILE 1 CG1   1 
ATOM   2251  C  CG2   . ILE A  1  287 ? 56.841  -0.027   131.134  1.00 114.70 ? 287 ILE 1 CG2   1 
ATOM   2252  C  CD1   . ILE A  1  287 ? 59.661  -1.203   133.520  1.00 119.65 ? 287 ILE 1 CD1   1 
ATOM   2253  N  N     . GLN A  1  288 ? 58.942  1.188    129.046  1.00 106.29 ? 288 GLN 1 N     1 
ATOM   2254  C  CA    . GLN A  1  288 ? 58.440  1.805    127.829  1.00 104.36 ? 288 GLN 1 CA    1 
ATOM   2255  C  C     . GLN A  1  288 ? 57.084  1.251    127.428  1.00 104.03 ? 288 GLN 1 C     1 
ATOM   2256  O  O     . GLN A  1  288 ? 56.299  1.970    126.801  1.00 102.22 ? 288 GLN 1 O     1 
ATOM   2257  C  CB    . GLN A  1  288 ? 59.446  1.628    126.687  1.00 103.52 ? 288 GLN 1 CB    1 
ATOM   2258  C  CG    . GLN A  1  288 ? 59.673  0.190    126.258  1.00 104.13 ? 288 GLN 1 CG    1 
ATOM   2259  C  CD    . GLN A  1  288 ? 60.760  0.049    125.209  1.00 104.65 ? 288 GLN 1 CD    1 
ATOM   2260  O  OE1   . GLN A  1  288 ? 60.948  0.926    124.368  1.00 107.12 ? 288 GLN 1 OE1   1 
ATOM   2261  N  NE2   . GLN A  1  288 ? 61.486  -1.059   125.259  1.00 102.90 ? 288 GLN 1 NE2   1 
ATOM   2262  N  N     . ALA A  1  289 ? 56.779  0.002    127.793  1.00 106.08 ? 289 ALA 1 N     1 
ATOM   2263  C  CA    . ALA A  1  289 ? 55.481  -0.582   127.461  1.00 105.50 ? 289 ALA 1 CA    1 
ATOM   2264  C  C     . ALA A  1  289 ? 55.244  -1.813   128.330  1.00 102.42 ? 289 ALA 1 C     1 
ATOM   2265  O  O     . ALA A  1  289 ? 56.113  -2.238   129.094  1.00 104.96 ? 289 ALA 1 O     1 
ATOM   2266  C  CB    . ALA A  1  289 ? 55.394  -0.945   125.974  1.00 106.44 ? 289 ALA 1 CB    1 
ATOM   2267  N  N     . ILE A  1  290 ? 54.044  -2.378   128.214  1.00 95.62  ? 290 ILE 1 N     1 
ATOM   2268  C  CA    . ILE A  1  290 ? 53.680  -3.586   128.944  1.00 89.09  ? 290 ILE 1 CA    1 
ATOM   2269  C  C     . ILE A  1  290 ? 52.926  -4.514   128.006  1.00 83.29  ? 290 ILE 1 C     1 
ATOM   2270  O  O     . ILE A  1  290 ? 52.197  -4.070   127.116  1.00 79.51  ? 290 ILE 1 O     1 
ATOM   2271  C  CB    . ILE A  1  290 ? 52.829  -3.287   130.205  1.00 88.72  ? 290 ILE 1 CB    1 
ATOM   2272  C  CG1   . ILE A  1  290 ? 51.595  -2.452   129.847  1.00 87.64  ? 290 ILE 1 CG1   1 
ATOM   2273  C  CG2   . ILE A  1  290 ? 53.670  -2.599   131.275  1.00 88.82  ? 290 ILE 1 CG2   1 
ATOM   2274  C  CD1   . ILE A  1  290 ? 50.306  -3.254   129.760  1.00 84.85  ? 290 ILE 1 CD1   1 
ATOM   2275  N  N     . ILE A  1  291 ? 53.098  -5.813   128.213  1.00 84.52  ? 291 ILE 1 N     1 
ATOM   2276  C  CA    . ILE A  1  291 ? 52.324  -6.806   127.472  1.00 85.76  ? 291 ILE 1 CA    1 
ATOM   2277  C  C     . ILE A  1  291 ? 51.361  -7.434   128.470  1.00 88.88  ? 291 ILE 1 C     1 
ATOM   2278  O  O     . ILE A  1  291 ? 51.789  -8.238   129.313  1.00 88.32  ? 291 ILE 1 O     1 
ATOM   2279  C  CB    . ILE A  1  291 ? 53.231  -7.858   126.813  1.00 84.53  ? 291 ILE 1 CB    1 
ATOM   2280  C  CG1   . ILE A  1  291 ? 54.264  -7.187   125.913  1.00 84.70  ? 291 ILE 1 CG1   1 
ATOM   2281  C  CG2   . ILE A  1  291 ? 52.413  -8.769   125.953  1.00 83.97  ? 291 ILE 1 CG2   1 
ATOM   2282  C  CD1   . ILE A  1  291 ? 55.241  -8.160   125.285  1.00 83.51  ? 291 ILE 1 CD1   1 
ATOM   2283  N  N     . PRO A  1  292 ? 50.069  -7.044   128.445  1.00 92.87  ? 292 PRO 1 N     1 
ATOM   2284  C  CA    . PRO A  1  292 ? 49.129  -7.435   129.509  1.00 95.78  ? 292 PRO 1 CA    1 
ATOM   2285  C  C     . PRO A  1  292 ? 48.804  -8.916   129.579  1.00 99.48  ? 292 PRO 1 C     1 
ATOM   2286  O  O     . PRO A  1  292 ? 49.019  -9.546   130.618  1.00 101.75 ? 292 PRO 1 O     1 
ATOM   2287  C  CB    . PRO A  1  292 ? 47.871  -6.613   129.180  1.00 95.53  ? 292 PRO 1 CB    1 
ATOM   2288  C  CG    . PRO A  1  292 ? 47.980  -6.312   127.728  1.00 95.69  ? 292 PRO 1 CG    1 
ATOM   2289  C  CD    . PRO A  1  292 ? 49.441  -6.159   127.446  1.00 94.35  ? 292 PRO 1 CD    1 
ATOM   2290  N  N     . GLY A  1  293 ? 48.295  -9.486   128.489  1.00 102.07 ? 293 GLY 1 N     1 
ATOM   2291  C  CA    . GLY A  1  293 ? 47.693  -10.806  128.551  1.00 104.60 ? 293 GLY 1 CA    1 
ATOM   2292  C  C     . GLY A  1  293 ? 48.698  -11.927  128.703  1.00 107.80 ? 293 GLY 1 C     1 
ATOM   2293  O  O     . GLY A  1  293 ? 48.747  -12.585  129.744  1.00 108.98 ? 293 GLY 1 O     1 
ATOM   2294  N  N     . GLY A  1  294 ? 49.509  -12.143  127.674  1.00 109.78 ? 294 GLY 1 N     1 
ATOM   2295  C  CA    . GLY A  1  294 ? 50.560  -13.141  127.685  1.00 110.37 ? 294 GLY 1 CA    1 
ATOM   2296  C  C     . GLY A  1  294 ? 51.738  -12.590  126.913  1.00 110.06 ? 294 GLY 1 C     1 
ATOM   2297  O  O     . GLY A  1  294 ? 52.182  -11.473  127.188  1.00 114.36 ? 294 GLY 1 O     1 
ATOM   2298  N  N     . SER A  1  295 ? 52.274  -13.363  125.975  1.00 104.23 ? 295 SER 1 N     1 
ATOM   2299  C  CA    . SER A  1  295 ? 53.142  -12.805  124.947  1.00 100.36 ? 295 SER 1 CA    1 
ATOM   2300  C  C     . SER A  1  295 ? 52.380  -12.399  123.693  1.00 95.72  ? 295 SER 1 C     1 
ATOM   2301  O  O     . SER A  1  295 ? 52.752  -11.416  123.041  1.00 96.21  ? 295 SER 1 O     1 
ATOM   2302  C  CB    . SER A  1  295 ? 54.228  -13.807  124.563  1.00 102.47 ? 295 SER 1 CB    1 
ATOM   2303  O  OG    . SER A  1  295 ? 54.965  -13.335  123.452  1.00 106.13 ? 295 SER 1 OG    1 
ATOM   2304  N  N     . SER A  1  296 ? 51.312  -13.126  123.354  1.00 90.12  ? 296 SER 1 N     1 
ATOM   2305  C  CA    . SER A  1  296 ? 50.525  -12.896  122.149  1.00 83.78  ? 296 SER 1 CA    1 
ATOM   2306  C  C     . SER A  1  296 ? 49.757  -11.582  122.176  1.00 83.13  ? 296 SER 1 C     1 
ATOM   2307  O  O     . SER A  1  296 ? 49.135  -11.224  121.169  1.00 81.70  ? 296 SER 1 O     1 
ATOM   2308  C  CB    . SER A  1  296 ? 49.547  -14.061  121.952  1.00 78.62  ? 296 SER 1 CB    1 
ATOM   2309  O  OG    . SER A  1  296 ? 50.223  -15.305  121.891  1.00 74.49  ? 296 SER 1 OG    1 
ATOM   2310  N  N     . THR A  1  297 ? 49.797  -10.861  123.250  1.00 84.06  ? 297 THR 1 N     1 
ATOM   2311  C  CA    . THR A  1  297 ? 48.931  -9.698   123.198  1.00 87.15  ? 297 THR 1 CA    1 
ATOM   2312  C  C     . THR A  1  297 ? 49.703  -8.459   122.740  1.00 90.46  ? 297 THR 1 C     1 
ATOM   2313  O  O     . THR A  1  297 ? 50.891  -8.307   123.044  1.00 88.61  ? 297 THR 1 O     1 
ATOM   2314  C  CB    . THR A  1  297 ? 48.295  -9.455   124.568  1.00 86.07  ? 297 THR 1 CB    1 
ATOM   2315  O  OG1   . THR A  1  297 ? 49.307  -9.445   125.582  1.00 86.68  ? 297 THR 1 OG1   1 
ATOM   2316  C  CG2   . THR A  1  297 ? 47.292  -10.549  124.881  1.00 84.29  ? 297 THR 1 CG2   1 
ATOM   2317  N  N     . PRO A  1  298 ? 49.051  -7.573   121.992  1.00 93.91  ? 298 PRO 1 N     1 
ATOM   2318  C  CA    . PRO A  1  298 ? 49.718  -6.360   121.515  1.00 95.29  ? 298 PRO 1 CA    1 
ATOM   2319  C  C     . PRO A  1  298 ? 50.146  -5.488   122.680  1.00 97.95  ? 298 PRO 1 C     1 
ATOM   2320  O  O     . PRO A  1  298 ? 49.410  -5.352   123.668  1.00 96.51  ? 298 PRO 1 O     1 
ATOM   2321  C  CB    . PRO A  1  298 ? 48.636  -5.670   120.670  1.00 93.09  ? 298 PRO 1 CB    1 
ATOM   2322  C  CG    . PRO A  1  298 ? 47.715  -6.775   120.274  1.00 92.32  ? 298 PRO 1 CG    1 
ATOM   2323  C  CD    . PRO A  1  298 ? 47.688  -7.696   121.451  1.00 93.81  ? 298 PRO 1 CD    1 
ATOM   2324  N  N     . PRO A  1  299 ? 51.343  -4.912   122.621  1.00 101.65 ? 299 PRO 1 N     1 
ATOM   2325  C  CA    . PRO A  1  299 ? 51.783  -4.025   123.700  1.00 103.60 ? 299 PRO 1 CA    1 
ATOM   2326  C  C     . PRO A  1  299 ? 51.009  -2.716   123.703  1.00 105.81 ? 299 PRO 1 C     1 
ATOM   2327  O  O     . PRO A  1  299 ? 50.563  -2.222   122.663  1.00 105.11 ? 299 PRO 1 O     1 
ATOM   2328  C  CB    . PRO A  1  299 ? 53.264  -3.795   123.383  1.00 102.24 ? 299 PRO 1 CB    1 
ATOM   2329  C  CG    . PRO A  1  299 ? 53.361  -3.999   121.910  1.00 101.50 ? 299 PRO 1 CG    1 
ATOM   2330  C  CD    . PRO A  1  299 ? 52.391  -5.101   121.603  1.00 102.11 ? 299 PRO 1 CD    1 
ATOM   2331  N  N     . LEU A  1  300 ? 50.853  -2.157   124.901  1.00 108.75 ? 300 LEU 1 N     1 
ATOM   2332  C  CA    . LEU A  1  300 ? 50.225  -0.865   125.104  1.00 112.72 ? 300 LEU 1 CA    1 
ATOM   2333  C  C     . LEU A  1  300 ? 51.211  0.097    125.754  1.00 113.93 ? 300 LEU 1 C     1 
ATOM   2334  O  O     . LEU A  1  300 ? 52.076  -0.318   126.534  1.00 111.15 ? 300 LEU 1 O     1 
ATOM   2335  C  CB    . LEU A  1  300 ? 48.968  -0.981   125.975  1.00 115.22 ? 300 LEU 1 CB    1 
ATOM   2336  C  CG    . LEU A  1  300 ? 47.856  -1.845   125.376  1.00 114.86 ? 300 LEU 1 CG    1 
ATOM   2337  C  CD1   . LEU A  1  300 ? 46.680  -1.961   126.333  1.00 114.83 ? 300 LEU 1 CD1   1 
ATOM   2338  C  CD2   . LEU A  1  300 ? 47.410  -1.269   124.035  1.00 114.06 ? 300 LEU 1 CD2   1 
ATOM   2339  N  N     . PRO A  1  301 ? 51.120  1.385    125.436  1.00 118.10 ? 301 PRO 1 N     1 
ATOM   2340  C  CA    . PRO A  1  301 ? 52.071  2.346    125.995  1.00 123.21 ? 301 PRO 1 CA    1 
ATOM   2341  C  C     . PRO A  1  301 ? 51.946  2.442    127.508  1.00 128.18 ? 301 PRO 1 C     1 
ATOM   2342  O  O     . PRO A  1  301 ? 50.971  1.994    128.116  1.00 128.81 ? 301 PRO 1 O     1 
ATOM   2343  C  CB    . PRO A  1  301 ? 51.687  3.666    125.313  1.00 121.40 ? 301 PRO 1 CB    1 
ATOM   2344  C  CG    . PRO A  1  301 ? 50.883  3.255    124.103  1.00 119.00 ? 301 PRO 1 CG    1 
ATOM   2345  C  CD    . PRO A  1  301 ? 50.162  2.021    124.517  1.00 117.38 ? 301 PRO 1 CD    1 
ATOM   2346  N  N     . PHE A  1  302 ? 52.981  3.012    128.119  1.00 131.42 ? 302 PHE 1 N     1 
ATOM   2347  C  CA    . PHE A  1  302 ? 53.007  3.249    129.559  1.00 132.59 ? 302 PHE 1 CA    1 
ATOM   2348  C  C     . PHE A  1  302 ? 52.451  4.647    129.802  1.00 135.17 ? 302 PHE 1 C     1 
ATOM   2349  O  O     . PHE A  1  302 ? 53.181  5.639    129.784  1.00 134.44 ? 302 PHE 1 O     1 
ATOM   2350  C  CB    . PHE A  1  302 ? 54.425  3.088    130.094  1.00 130.93 ? 302 PHE 1 CB    1 
ATOM   2351  C  CG    . PHE A  1  302 ? 54.488  2.644    131.521  1.00 129.58 ? 302 PHE 1 CG    1 
ATOM   2352  C  CD1   . PHE A  1  302 ? 53.779  1.537    131.943  1.00 129.59 ? 302 PHE 1 CD1   1 
ATOM   2353  C  CD2   . PHE A  1  302 ? 55.275  3.317    132.434  1.00 129.17 ? 302 PHE 1 CD2   1 
ATOM   2354  C  CE1   . PHE A  1  302 ? 53.836  1.125    133.255  1.00 129.68 ? 302 PHE 1 CE1   1 
ATOM   2355  C  CE2   . PHE A  1  302 ? 55.337  2.905    133.748  1.00 129.23 ? 302 PHE 1 CE2   1 
ATOM   2356  C  CZ    . PHE A  1  302 ? 54.617  1.808    134.157  1.00 129.30 ? 302 PHE 1 CZ    1 
ATOM   2357  N  N     . THR A  1  303 ? 51.138  4.729    130.019  1.00 137.94 ? 303 THR 1 N     1 
ATOM   2358  C  CA    . THR A  1  303 ? 50.448  6.006    130.132  1.00 140.57 ? 303 THR 1 CA    1 
ATOM   2359  C  C     . THR A  1  303 ? 49.573  6.010    131.379  1.00 142.36 ? 303 THR 1 C     1 
ATOM   2360  O  O     . THR A  1  303 ? 49.116  4.960    131.841  1.00 141.68 ? 303 THR 1 O     1 
ATOM   2361  C  CB    . THR A  1  303 ? 49.590  6.286    128.884  1.00 141.44 ? 303 THR 1 CB    1 
ATOM   2362  O  OG1   . THR A  1  303 ? 50.377  6.065    127.708  1.00 142.45 ? 303 THR 1 OG1   1 
ATOM   2363  C  CG2   . THR A  1  303 ? 49.096  7.728    128.864  1.00 140.81 ? 303 THR 1 CG2   1 
ATOM   2364  N  N     . GLU A  1  304 ? 49.347  7.208    131.923  1.00 144.84 ? 304 GLU 1 N     1 
ATOM   2365  C  CA    . GLU A  1  304 ? 48.447  7.360    133.063  1.00 147.38 ? 304 GLU 1 CA    1 
ATOM   2366  C  C     . GLU A  1  304 ? 47.021  6.954    132.715  1.00 149.30 ? 304 GLU 1 C     1 
ATOM   2367  O  O     . GLU A  1  304 ? 46.374  6.218    133.469  1.00 151.31 ? 304 GLU 1 O     1 
ATOM   2368  C  CB    . GLU A  1  304 ? 48.496  8.794    133.583  1.00 148.04 ? 304 GLU 1 CB    1 
ATOM   2369  C  CG    . GLU A  1  304 ? 49.845  9.163    134.152  1.00 148.71 ? 304 GLU 1 CG    1 
ATOM   2370  C  CD    . GLU A  1  304 ? 50.138  8.421    135.437  1.00 148.34 ? 304 GLU 1 CD    1 
ATOM   2371  O  OE1   . GLU A  1  304 ? 49.435  8.660    136.442  1.00 148.00 ? 304 GLU 1 OE1   1 
ATOM   2372  O  OE2   . GLU A  1  304 ? 51.061  7.584    135.437  1.00 147.97 ? 304 GLU 1 OE2   1 
ATOM   2373  N  N     . GLU A  1  305 ? 46.503  7.429    131.579  1.00 148.81 ? 305 GLU 1 N     1 
ATOM   2374  C  CA    . GLU A  1  305 ? 45.179  6.985    131.160  1.00 148.80 ? 305 GLU 1 CA    1 
ATOM   2375  C  C     . GLU A  1  305 ? 45.161  5.500    130.819  1.00 149.65 ? 305 GLU 1 C     1 
ATOM   2376  O  O     . GLU A  1  305 ? 44.079  4.913    130.716  1.00 150.45 ? 305 GLU 1 O     1 
ATOM   2377  C  CB    . GLU A  1  305 ? 44.675  7.814    129.977  1.00 148.43 ? 305 GLU 1 CB    1 
ATOM   2378  C  CG    . GLU A  1  305 ? 43.153  7.858    129.907  1.00 148.19 ? 305 GLU 1 CG    1 
ATOM   2379  C  CD    . GLU A  1  305 ? 42.633  8.710    128.773  1.00 147.91 ? 305 GLU 1 CD    1 
ATOM   2380  O  OE1   . GLU A  1  305 ? 42.558  8.201    127.638  1.00 147.93 ? 305 GLU 1 OE1   1 
ATOM   2381  O  OE2   . GLU A  1  305 ? 42.297  9.888    129.016  1.00 147.64 ? 305 GLU 1 OE2   1 
ATOM   2382  N  N     . VAL A  1  306 ? 46.329  4.890    130.639  1.00 149.50 ? 306 VAL 1 N     1 
ATOM   2383  C  CA    . VAL A  1  306 ? 46.430  3.443    130.481  1.00 150.81 ? 306 VAL 1 CA    1 
ATOM   2384  C  C     . VAL A  1  306 ? 46.553  2.757    131.837  1.00 150.46 ? 306 VAL 1 C     1 
ATOM   2385  O  O     . VAL A  1  306 ? 45.933  1.719    132.076  1.00 148.92 ? 306 VAL 1 O     1 
ATOM   2386  C  CB    . VAL A  1  306 ? 47.615  3.092    129.555  1.00 152.74 ? 306 VAL 1 CB    1 
ATOM   2387  C  CG1   . VAL A  1  306 ? 47.909  1.594    129.585  1.00 153.37 ? 306 VAL 1 CG1   1 
ATOM   2388  C  CG2   . VAL A  1  306 ? 47.329  3.551    128.130  1.00 153.54 ? 306 VAL 1 CG2   1 
ATOM   2389  N  N     . LEU A  1  307 ? 47.353  3.326    132.743  1.00 151.00 ? 307 LEU 1 N     1 
ATOM   2390  C  CA    . LEU A  1  307 ? 47.520  2.744    134.072  1.00 150.07 ? 307 LEU 1 CA    1 
ATOM   2391  C  C     . LEU A  1  307 ? 46.197  2.646    134.827  1.00 150.84 ? 307 LEU 1 C     1 
ATOM   2392  O  O     . LEU A  1  307 ? 46.057  1.808    135.724  1.00 151.94 ? 307 LEU 1 O     1 
ATOM   2393  C  CB    . LEU A  1  307 ? 48.531  3.560    134.875  1.00 148.27 ? 307 LEU 1 CB    1 
ATOM   2394  C  CG    . LEU A  1  307 ? 50.001  3.238    134.599  1.00 148.69 ? 307 LEU 1 CG    1 
ATOM   2395  C  CD1   . LEU A  1  307 ? 50.910  4.313    135.175  1.00 149.13 ? 307 LEU 1 CD1   1 
ATOM   2396  C  CD2   . LEU A  1  307 ? 50.362  1.868    135.149  1.00 149.52 ? 307 LEU 1 CD2   1 
ATOM   2397  N  N     . ASP A  1  308 ? 45.225  3.490    134.490  1.00 151.14 ? 308 ASP 1 N     1 
ATOM   2398  C  CA    . ASP A  1  308 ? 43.915  3.477    135.130  1.00 152.04 ? 308 ASP 1 CA    1 
ATOM   2399  C  C     . ASP A  1  308 ? 42.972  2.447    134.525  1.00 149.57 ? 308 ASP 1 C     1 
ATOM   2400  O  O     . ASP A  1  308 ? 41.805  2.387    134.927  1.00 148.70 ? 308 ASP 1 O     1 
ATOM   2401  C  CB    . ASP A  1  308 ? 43.259  4.857    135.025  1.00 155.47 ? 308 ASP 1 CB    1 
ATOM   2402  C  CG    . ASP A  1  308 ? 43.916  5.892    135.915  1.00 158.14 ? 308 ASP 1 CG    1 
ATOM   2403  O  OD1   . ASP A  1  308 ? 43.869  5.732    137.150  1.00 159.13 ? 308 ASP 1 OD1   1 
ATOM   2404  O  OD2   . ASP A  1  308 ? 44.447  6.889    135.378  1.00 158.61 ? 308 ASP 1 OD2   1 
ATOM   2405  N  N     . THR A  1  309 ? 43.447  1.636    133.592  1.00 147.67 ? 309 THR 1 N     1 
ATOM   2406  C  CA    . THR A  1  309 ? 42.561  0.761    132.836  1.00 145.06 ? 309 THR 1 CA    1 
ATOM   2407  C  C     . THR A  1  309 ? 42.217  -0.480   133.648  1.00 138.80 ? 309 THR 1 C     1 
ATOM   2408  O  O     . THR A  1  309 ? 43.110  -1.099   134.236  1.00 137.44 ? 309 THR 1 O     1 
ATOM   2409  C  CB    . THR A  1  309 ? 43.203  0.354    131.513  1.00 147.35 ? 309 THR 1 CB    1 
ATOM   2410  O  OG1   . THR A  1  309 ? 43.505  1.527    130.747  1.00 148.94 ? 309 THR 1 OG1   1 
ATOM   2411  C  CG2   . THR A  1  309 ? 42.274  -0.550   130.709  1.00 146.99 ? 309 THR 1 CG2   1 
ATOM   2412  N  N     . PRO A  1  310 ? 40.940  -0.851   133.736  1.00 133.70 ? 310 PRO 1 N     1 
ATOM   2413  C  CA    . PRO A  1  310 ? 40.584  -2.109   134.400  1.00 128.24 ? 310 PRO 1 CA    1 
ATOM   2414  C  C     . PRO A  1  310 ? 40.912  -3.286   133.493  1.00 122.89 ? 310 PRO 1 C     1 
ATOM   2415  O  O     . PRO A  1  310 ? 40.459  -3.352   132.349  1.00 123.56 ? 310 PRO 1 O     1 
ATOM   2416  C  CB    . PRO A  1  310 ? 39.070  -1.982   134.628  1.00 128.74 ? 310 PRO 1 CB    1 
ATOM   2417  C  CG    . PRO A  1  310 ? 38.714  -0.556   134.265  1.00 131.03 ? 310 PRO 1 CG    1 
ATOM   2418  C  CD    . PRO A  1  310 ? 39.755  -0.090   133.313  1.00 133.10 ? 310 PRO 1 CD    1 
ATOM   2419  N  N     . MET A  1  311 ? 41.707  -4.212   134.013  1.00 117.28 ? 311 MET 1 N     1 
ATOM   2420  C  CA    . MET A  1  311 ? 42.032  -5.444   133.304  1.00 111.66 ? 311 MET 1 CA    1 
ATOM   2421  C  C     . MET A  1  311 ? 40.792  -6.330   133.235  1.00 106.76 ? 311 MET 1 C     1 
ATOM   2422  O  O     . MET A  1  311 ? 40.375  -6.906   134.245  1.00 104.27 ? 311 MET 1 O     1 
ATOM   2423  C  CB    . MET A  1  311 ? 43.199  -6.134   134.005  1.00 110.40 ? 311 MET 1 CB    1 
ATOM   2424  C  CG    . MET A  1  311 ? 44.258  -5.139   134.501  1.00 108.03 ? 311 MET 1 CG    1 
ATOM   2425  S  SD    . MET A  1  311 ? 45.566  -5.805   135.552  1.00 106.28 ? 311 MET 1 SD    1 
ATOM   2426  C  CE    . MET A  1  311 ? 46.655  -6.541   134.341  1.00 107.23 ? 311 MET 1 CE    1 
ATOM   2427  N  N     . SER A  1  312 ? 40.190  -6.429   132.049  1.00 104.76 ? 312 SER 1 N     1 
ATOM   2428  C  CA    . SER A  1  312 ? 38.954  -7.185   131.875  1.00 101.37 ? 312 SER 1 CA    1 
ATOM   2429  C  C     . SER A  1  312 ? 38.801  -7.597   130.418  1.00 94.30  ? 312 SER 1 C     1 
ATOM   2430  O  O     . SER A  1  312 ? 39.573  -7.192   129.545  1.00 94.62  ? 312 SER 1 O     1 
ATOM   2431  C  CB    . SER A  1  312 ? 37.731  -6.374   132.314  1.00 103.86 ? 312 SER 1 CB    1 
ATOM   2432  O  OG    . SER A  1  312 ? 37.421  -5.370   131.362  1.00 104.24 ? 312 SER 1 OG    1 
ATOM   2433  N  N     . TYR A  1  313 ? 37.776  -8.415   130.170  1.00 89.27  ? 313 TYR 1 N     1 
ATOM   2434  C  CA    . TYR A  1  313 ? 37.465  -8.877   128.823  1.00 88.86  ? 313 TYR 1 CA    1 
ATOM   2435  C  C     . TYR A  1  313 ? 36.895  -7.780   127.937  1.00 93.29  ? 313 TYR 1 C     1 
ATOM   2436  O  O     . TYR A  1  313 ? 36.752  -7.994   126.731  1.00 91.96  ? 313 TYR 1 O     1 
ATOM   2437  C  CB    . TYR A  1  313 ? 36.465  -10.045  128.882  1.00 84.05  ? 313 TYR 1 CB    1 
ATOM   2438  C  CG    . TYR A  1  313 ? 37.053  -11.400  129.255  1.00 77.12  ? 313 TYR 1 CG    1 
ATOM   2439  C  CD1   . TYR A  1  313 ? 38.412  -11.560  129.454  1.00 75.27  ? 313 TYR 1 CD1   1 
ATOM   2440  C  CD2   . TYR A  1  313 ? 36.243  -12.510  129.418  1.00 71.43  ? 313 TYR 1 CD2   1 
ATOM   2441  C  CE1   . TYR A  1  313 ? 38.946  -12.792  129.787  1.00 71.93  ? 313 TYR 1 CE1   1 
ATOM   2442  C  CE2   . TYR A  1  313 ? 36.773  -13.744  129.761  1.00 68.34  ? 313 TYR 1 CE2   1 
ATOM   2443  C  CZ    . TYR A  1  313 ? 38.125  -13.879  129.943  1.00 68.56  ? 313 TYR 1 CZ    1 
ATOM   2444  O  OH    . TYR A  1  313 ? 38.665  -15.102  130.282  1.00 66.92  ? 313 TYR 1 OH    1 
ATOM   2445  N  N     . GLU A  1  314 ? 36.589  -6.618   128.488  1.00 99.92  ? 314 GLU 1 N     1 
ATOM   2446  C  CA    . GLU A  1  314 ? 35.957  -5.559   127.713  1.00 106.67 ? 314 GLU 1 CA    1 
ATOM   2447  C  C     . GLU A  1  314 ? 36.785  -4.289   127.642  1.00 111.27 ? 314 GLU 1 C     1 
ATOM   2448  O  O     . GLU A  1  314 ? 36.879  -3.681   126.572  1.00 111.72 ? 314 GLU 1 O     1 
ATOM   2449  C  CB    . GLU A  1  314 ? 34.580  -5.240   128.298  1.00 108.35 ? 314 GLU 1 CB    1 
ATOM   2450  C  CG    . GLU A  1  314 ? 34.542  -5.278   129.811  1.00 111.08 ? 314 GLU 1 CG    1 
ATOM   2451  C  CD    . GLU A  1  314 ? 33.152  -5.524   130.344  1.00 115.49 ? 314 GLU 1 CD    1 
ATOM   2452  O  OE1   . GLU A  1  314 ? 32.171  -5.147   129.667  1.00 117.08 ? 314 GLU 1 OE1   1 
ATOM   2453  O  OE2   . GLU A  1  314 ? 33.038  -6.100   131.441  1.00 117.53 ? 314 GLU 1 OE2   1 
ATOM   2454  N  N     . HIS A  1  315 ? 37.381  -3.867   128.760  1.00 114.65 ? 315 HIS 1 N     1 
ATOM   2455  C  CA    . HIS A  1  315 ? 38.110  -2.605   128.784  1.00 118.16 ? 315 HIS 1 CA    1 
ATOM   2456  C  C     . HIS A  1  315 ? 39.367  -2.671   127.929  1.00 118.96 ? 315 HIS 1 C     1 
ATOM   2457  O  O     . HIS A  1  315 ? 39.759  -1.665   127.328  1.00 121.21 ? 315 HIS 1 O     1 
ATOM   2458  C  CB    . HIS A  1  315 ? 38.447  -2.226   130.223  1.00 121.94 ? 315 HIS 1 CB    1 
ATOM   2459  C  CG    . HIS A  1  315 ? 37.252  -2.173   131.124  1.00 125.31 ? 315 HIS 1 CG    1 
ATOM   2460  N  ND1   . HIS A  1  315 ? 36.645  -3.308   131.617  1.00 126.10 ? 315 HIS 1 ND1   1 
ATOM   2461  C  CD2   . HIS A  1  315 ? 36.543  -1.125   131.608  1.00 125.69 ? 315 HIS 1 CD2   1 
ATOM   2462  C  CE1   . HIS A  1  315 ? 35.618  -2.963   132.372  1.00 126.38 ? 315 HIS 1 CE1   1 
ATOM   2463  N  NE2   . HIS A  1  315 ? 35.533  -1.645   132.382  1.00 126.00 ? 315 HIS 1 NE2   1 
ATOM   2464  N  N     . LEU A  1  316 ? 40.007  -3.839   127.858  1.00 118.00 ? 316 LEU 1 N     1 
ATOM   2465  C  CA    . LEU A  1  316 ? 41.142  -3.994   126.957  1.00 119.18 ? 316 LEU 1 CA    1 
ATOM   2466  C  C     . LEU A  1  316 ? 40.672  -4.112   125.514  1.00 121.11 ? 316 LEU 1 C     1 
ATOM   2467  O  O     . LEU A  1  316 ? 41.333  -3.609   124.598  1.00 120.25 ? 316 LEU 1 O     1 
ATOM   2468  C  CB    . LEU A  1  316 ? 41.970  -5.218   127.352  1.00 118.41 ? 316 LEU 1 CB    1 
ATOM   2469  C  CG    . LEU A  1  316 ? 42.922  -5.027   128.533  1.00 116.60 ? 316 LEU 1 CG    1 
ATOM   2470  C  CD1   . LEU A  1  316 ? 43.067  -6.319   129.315  1.00 114.47 ? 316 LEU 1 CD1   1 
ATOM   2471  C  CD2   . LEU A  1  316 ? 44.281  -4.520   128.055  1.00 116.29 ? 316 LEU 1 CD2   1 
ATOM   2472  N  N     . GLN A  1  317 ? 39.528  -4.768   125.305  1.00 123.13 ? 317 GLN 1 N     1 
ATOM   2473  C  CA    . GLN A  1  317 ? 38.921  -4.833   123.981  1.00 125.07 ? 317 GLN 1 CA    1 
ATOM   2474  C  C     . GLN A  1  317 ? 38.751  -3.438   123.386  1.00 125.44 ? 317 GLN 1 C     1 
ATOM   2475  O  O     . GLN A  1  317 ? 39.114  -3.192   122.231  1.00 125.40 ? 317 GLN 1 O     1 
ATOM   2476  C  CB    . GLN A  1  317 ? 37.577  -5.563   124.072  1.00 126.25 ? 317 GLN 1 CB    1 
ATOM   2477  C  CG    . GLN A  1  317 ? 36.566  -5.188   122.999  1.00 127.91 ? 317 GLN 1 CG    1 
ATOM   2478  C  CD    . GLN A  1  317 ? 36.811  -5.900   121.686  1.00 128.86 ? 317 GLN 1 CD    1 
ATOM   2479  O  OE1   . GLN A  1  317 ? 37.365  -6.998   121.652  1.00 128.90 ? 317 GLN 1 OE1   1 
ATOM   2480  N  NE2   . GLN A  1  317 ? 36.401  -5.271   120.590  1.00 129.07 ? 317 GLN 1 NE2   1 
ATOM   2481  N  N     . ALA A  1  318 ? 38.212  -2.506   124.172  1.00 125.81 ? 318 ALA 1 N     1 
ATOM   2482  C  CA    . ALA A  1  318 ? 38.023  -1.136   123.708  1.00 127.23 ? 318 ALA 1 CA    1 
ATOM   2483  C  C     . ALA A  1  318 ? 39.327  -0.353   123.583  1.00 127.07 ? 318 ALA 1 C     1 
ATOM   2484  O  O     . ALA A  1  318 ? 39.301  0.766    123.058  1.00 126.52 ? 318 ALA 1 O     1 
ATOM   2485  C  CB    . ALA A  1  318 ? 37.066  -0.398   124.645  1.00 128.80 ? 318 ALA 1 CB    1 
ATOM   2486  N  N     . LYS A  1  319 ? 40.455  -0.896   124.049  1.00 127.28 ? 319 LYS 1 N     1 
ATOM   2487  C  CA    . LYS A  1  319 ? 41.752  -0.239   123.916  1.00 125.74 ? 319 LYS 1 CA    1 
ATOM   2488  C  C     . LYS A  1  319 ? 42.648  -0.877   122.860  1.00 123.81 ? 319 LYS 1 C     1 
ATOM   2489  O  O     . LYS A  1  319 ? 43.798  -0.450   122.699  1.00 125.73 ? 319 LYS 1 O     1 
ATOM   2490  C  CB    . LYS A  1  319 ? 42.482  -0.213   125.270  1.00 124.34 ? 319 LYS 1 CB    1 
ATOM   2491  C  CG    . LYS A  1  319 ? 43.438  0.977    125.452  1.00 123.16 ? 319 LYS 1 CG    1 
ATOM   2492  C  CD    . LYS A  1  319 ? 42.683  2.279    125.710  1.00 121.95 ? 319 LYS 1 CD    1 
ATOM   2493  C  CE    . LYS A  1  319 ? 43.596  3.503    125.638  1.00 119.48 ? 319 LYS 1 CE    1 
ATOM   2494  N  NZ    . LYS A  1  319 ? 42.869  4.736    125.209  1.00 117.08 ? 319 LYS 1 NZ    1 
ATOM   2495  N  N     . GLY A  1  320 ? 42.156  -1.873   122.124  1.00 117.78 ? 320 GLY 1 N     1 
ATOM   2496  C  CA    . GLY A  1  320 ? 42.903  -2.489   121.055  1.00 111.74 ? 320 GLY 1 CA    1 
ATOM   2497  C  C     . GLY A  1  320 ? 43.588  -3.792   121.421  1.00 107.23 ? 320 GLY 1 C     1 
ATOM   2498  O  O     . GLY A  1  320 ? 43.774  -4.640   120.545  1.00 110.62 ? 320 GLY 1 O     1 
ATOM   2499  N  N     . SER A  1  321 ? 43.985  -3.969   122.677  1.00 100.62 ? 321 SER 1 N     1 
ATOM   2500  C  CA    . SER A  1  321 ? 44.635  -5.204   123.087  1.00 96.27  ? 321 SER 1 CA    1 
ATOM   2501  C  C     . SER A  1  321 ? 43.587  -6.172   123.633  1.00 96.53  ? 321 SER 1 C     1 
ATOM   2502  O  O     . SER A  1  321 ? 42.381  -5.960   123.495  1.00 98.28  ? 321 SER 1 O     1 
ATOM   2503  C  CB    . SER A  1  321 ? 45.736  -4.919   124.102  1.00 93.47  ? 321 SER 1 CB    1 
ATOM   2504  O  OG    . SER A  1  321 ? 46.625  -6.016   124.194  1.00 89.93  ? 321 SER 1 OG    1 
ATOM   2505  N  N     . MET A  1  322 ? 44.036  -7.249   124.270  1.00 96.25  ? 322 MET 1 N     1 
ATOM   2506  C  CA    . MET A  1  322 ? 43.118  -8.255   124.779  1.00 100.04 ? 322 MET 1 CA    1 
ATOM   2507  C  C     . MET A  1  322 ? 43.727  -8.895   126.017  1.00 103.87 ? 322 MET 1 C     1 
ATOM   2508  O  O     . MET A  1  322 ? 44.940  -8.844   126.233  1.00 106.43 ? 322 MET 1 O     1 
ATOM   2509  C  CB    . MET A  1  322 ? 42.823  -9.314   123.717  1.00 102.44 ? 322 MET 1 CB    1 
ATOM   2510  C  CG    . MET A  1  322 ? 44.081  -9.908   123.112  1.00 106.07 ? 322 MET 1 CG    1 
ATOM   2511  S  SD    . MET A  1  322 ? 43.789  -10.865  121.616  1.00 108.34 ? 322 MET 1 SD    1 
ATOM   2512  C  CE    . MET A  1  322 ? 43.454  -9.550   120.448  1.00 107.28 ? 322 MET 1 CE    1 
ATOM   2513  N  N     . LEU A  1  323 ? 42.875  -9.526   126.818  1.00 104.29 ? 323 LEU 1 N     1 
ATOM   2514  C  CA    . LEU A  1  323 ? 43.294  -10.119  128.086  1.00 105.24 ? 323 LEU 1 CA    1 
ATOM   2515  C  C     . LEU A  1  323 ? 43.381  -11.626  127.900  1.00 103.99 ? 323 LEU 1 C     1 
ATOM   2516  O  O     . LEU A  1  323 ? 42.414  -12.354  128.126  1.00 105.50 ? 323 LEU 1 O     1 
ATOM   2517  C  CB    . LEU A  1  323 ? 42.322  -9.761   129.200  1.00 108.99 ? 323 LEU 1 CB    1 
ATOM   2518  C  CG    . LEU A  1  323 ? 42.703  -10.296  130.578  1.00 112.51 ? 323 LEU 1 CG    1 
ATOM   2519  C  CD1   . LEU A  1  323 ? 43.947  -9.583   131.100  1.00 114.04 ? 323 LEU 1 CD1   1 
ATOM   2520  C  CD2   . LEU A  1  323 ? 41.540  -10.176  131.546  1.00 113.51 ? 323 LEU 1 CD2   1 
ATOM   2521  N  N     . GLY A  1  324 ? 44.550  -12.097  127.484  1.00 102.91 ? 324 GLY 1 N     1 
ATOM   2522  C  CA    . GLY A  1  324 ? 44.710  -13.519  127.265  1.00 102.80 ? 324 GLY 1 CA    1 
ATOM   2523  C  C     . GLY A  1  324 ? 44.812  -14.291  128.562  1.00 102.34 ? 324 GLY 1 C     1 
ATOM   2524  O  O     . GLY A  1  324 ? 43.904  -15.057  128.903  1.00 101.94 ? 324 GLY 1 O     1 
ATOM   2525  N  N     . THR A  1  325 ? 45.909  -14.095  129.298  1.00 102.43 ? 325 THR 1 N     1 
ATOM   2526  C  CA    . THR A  1  325 ? 46.144  -14.805  130.548  1.00 102.11 ? 325 THR 1 CA    1 
ATOM   2527  C  C     . THR A  1  325 ? 46.313  -13.893  131.757  1.00 102.82 ? 325 THR 1 C     1 
ATOM   2528  O  O     . THR A  1  325 ? 46.466  -14.400  132.874  1.00 103.43 ? 325 THR 1 O     1 
ATOM   2529  C  CB    . THR A  1  325 ? 47.379  -15.719  130.432  1.00 98.74  ? 325 THR 1 CB    1 
ATOM   2530  O  OG1   . THR A  1  325 ? 48.434  -15.048  129.727  1.00 98.60  ? 325 THR 1 OG1   1 
ATOM   2531  C  CG2   . THR A  1  325 ? 47.027  -16.981  129.705  1.00 97.11  ? 325 THR 1 CG2   1 
ATOM   2532  N  N     . GLY A  1  326 ? 46.256  -12.574  131.587  1.00 101.26 ? 326 GLY 1 N     1 
ATOM   2533  C  CA    . GLY A  1  326 ? 46.612  -11.712  132.696  1.00 99.99  ? 326 GLY 1 CA    1 
ATOM   2534  C  C     . GLY A  1  326 ? 48.078  -11.748  133.058  1.00 98.29  ? 326 GLY 1 C     1 
ATOM   2535  O  O     . GLY A  1  326 ? 48.468  -11.181  134.084  1.00 99.55  ? 326 GLY 1 O     1 
ATOM   2536  N  N     . GLY A  1  327 ? 48.902  -12.410  132.249  1.00 94.94  ? 327 GLY 1 N     1 
ATOM   2537  C  CA    . GLY A  1  327 ? 50.326  -12.470  132.498  1.00 92.16  ? 327 GLY 1 CA    1 
ATOM   2538  C  C     . GLY A  1  327 ? 51.018  -11.276  131.889  1.00 89.95  ? 327 GLY 1 C     1 
ATOM   2539  O  O     . GLY A  1  327 ? 51.313  -11.257  130.690  1.00 88.34  ? 327 GLY 1 O     1 
ATOM   2540  N  N     . VAL A  1  328 ? 51.281  -10.277  132.719  1.00 89.60  ? 328 VAL 1 N     1 
ATOM   2541  C  CA    . VAL A  1  328 ? 51.851  -9.012   132.281  1.00 88.14  ? 328 VAL 1 CA    1 
ATOM   2542  C  C     . VAL A  1  328 ? 53.365  -9.139   132.292  1.00 90.61  ? 328 VAL 1 C     1 
ATOM   2543  O  O     . VAL A  1  328 ? 53.952  -9.760   133.185  1.00 90.16  ? 328 VAL 1 O     1 
ATOM   2544  C  CB    . VAL A  1  328 ? 51.375  -7.856   133.184  1.00 83.35  ? 328 VAL 1 CB    1 
ATOM   2545  C  CG1   . VAL A  1  328 ? 51.665  -6.507   132.533  1.00 83.36  ? 328 VAL 1 CG1   1 
ATOM   2546  C  CG2   . VAL A  1  328 ? 49.890  -7.992   133.510  1.00 80.25  ? 328 VAL 1 CG2   1 
ATOM   2547  N  N     . ILE A  1  329 ? 54.000  -8.576   131.272  1.00 92.37  ? 329 ILE 1 N     1 
ATOM   2548  C  CA    . ILE A  1  329 ? 55.452  -8.463   131.229  1.00 94.92  ? 329 ILE 1 CA    1 
ATOM   2549  C  C     . ILE A  1  329 ? 55.812  -7.009   130.974  1.00 95.89  ? 329 ILE 1 C     1 
ATOM   2550  O  O     . ILE A  1  329 ? 55.270  -6.377   130.060  1.00 94.31  ? 329 ILE 1 O     1 
ATOM   2551  C  CB    . ILE A  1  329 ? 56.087  -9.388   130.174  1.00 97.22  ? 329 ILE 1 CB    1 
ATOM   2552  C  CG1   . ILE A  1  329 ? 55.700  -10.840  130.453  1.00 95.95  ? 329 ILE 1 CG1   1 
ATOM   2553  C  CG2   . ILE A  1  329 ? 57.601  -9.259   130.185  1.00 100.06 ? 329 ILE 1 CG2   1 
ATOM   2554  C  CD1   . ILE A  1  329 ? 56.269  -11.831  129.459  1.00 95.28  ? 329 ILE 1 CD1   1 
ATOM   2555  N  N     . LEU A  1  330 ? 56.705  -6.476   131.796  1.00 98.80  ? 330 LEU 1 N     1 
ATOM   2556  C  CA    . LEU A  1  330 ? 57.111  -5.083   131.687  1.00 100.96 ? 330 LEU 1 CA    1 
ATOM   2557  C  C     . LEU A  1  330 ? 58.297  -4.977   130.737  1.00 99.96  ? 330 LEU 1 C     1 
ATOM   2558  O  O     . LEU A  1  330 ? 59.312  -5.655   130.928  1.00 100.10 ? 330 LEU 1 O     1 
ATOM   2559  C  CB    . LEU A  1  330 ? 57.468  -4.518   133.062  1.00 103.22 ? 330 LEU 1 CB    1 
ATOM   2560  C  CG    . LEU A  1  330 ? 56.596  -4.877   134.270  1.00 103.87 ? 330 LEU 1 CG    1 
ATOM   2561  C  CD1   . LEU A  1  330 ? 57.091  -4.152   135.519  1.00 103.81 ? 330 LEU 1 CD1   1 
ATOM   2562  C  CD2   . LEU A  1  330 ? 55.122  -4.568   134.003  1.00 103.15 ? 330 LEU 1 CD2   1 
ATOM   2563  N  N     . ILE A  1  331 ? 58.158  -4.159   129.698  1.00 100.47 ? 331 ILE 1 N     1 
ATOM   2564  C  CA    . ILE A  1  331 ? 59.229  -3.908   128.740  1.00 104.64 ? 331 ILE 1 CA    1 
ATOM   2565  C  C     . ILE A  1  331 ? 59.814  -2.539   129.071  1.00 110.05 ? 331 ILE 1 C     1 
ATOM   2566  O  O     . ILE A  1  331 ? 59.101  -1.524   128.945  1.00 113.67 ? 331 ILE 1 O     1 
ATOM   2567  C  CB    . ILE A  1  331 ? 58.722  -3.950   127.296  1.00 105.18 ? 331 ILE 1 CB    1 
ATOM   2568  C  CG1   . ILE A  1  331 ? 57.857  -5.184   127.075  1.00 109.24 ? 331 ILE 1 CG1   1 
ATOM   2569  C  CG2   . ILE A  1  331 ? 59.888  -3.939   126.326  1.00 105.11 ? 331 ILE 1 CG2   1 
ATOM   2570  C  CD1   . ILE A  1  331 ? 57.593  -5.470   125.628  1.00 111.91 ? 331 ILE 1 CD1   1 
ATOM   2571  N  N     . PRO A  1  332 ? 61.064  -2.460   129.505  1.00 111.43 ? 332 PRO 1 N     1 
ATOM   2572  C  CA    . PRO A  1  332 ? 61.674  -1.176   129.844  1.00 110.59 ? 332 PRO 1 CA    1 
ATOM   2573  C  C     . PRO A  1  332 ? 62.273  -0.485   128.624  1.00 107.67 ? 332 PRO 1 C     1 
ATOM   2574  O  O     . PRO A  1  332 ? 62.464  -1.082   127.564  1.00 106.44 ? 332 PRO 1 O     1 
ATOM   2575  C  CB    . PRO A  1  332 ? 62.772  -1.584   130.833  1.00 113.05 ? 332 PRO 1 CB    1 
ATOM   2576  C  CG    . PRO A  1  332 ? 63.186  -2.940   130.346  1.00 113.76 ? 332 PRO 1 CG    1 
ATOM   2577  C  CD    . PRO A  1  332 ? 61.908  -3.600   129.906  1.00 112.79 ? 332 PRO 1 CD    1 
ATOM   2578  N  N     . GLU A  1  333 ? 62.562  0.804    128.802  1.00 106.10 ? 333 GLU 1 N     1 
ATOM   2579  C  CA    . GLU A  1  333 ? 63.231  1.571    127.761  1.00 104.53 ? 333 GLU 1 CA    1 
ATOM   2580  C  C     . GLU A  1  333 ? 64.658  1.099    127.524  1.00 98.62  ? 333 GLU 1 C     1 
ATOM   2581  O  O     . GLU A  1  333 ? 65.226  1.390    126.466  1.00 95.10  ? 333 GLU 1 O     1 
ATOM   2582  C  CB    . GLU A  1  333 ? 63.211  3.056    128.119  1.00 107.67 ? 333 GLU 1 CB    1 
ATOM   2583  C  CG    . GLU A  1  333 ? 61.812  3.631    128.241  1.00 109.86 ? 333 GLU 1 CG    1 
ATOM   2584  C  CD    . GLU A  1  333 ? 61.803  4.995    128.873  1.00 114.12 ? 333 GLU 1 CD    1 
ATOM   2585  O  OE1   . GLU A  1  333 ? 62.743  5.291    129.636  1.00 116.34 ? 333 GLU 1 OE1   1 
ATOM   2586  O  OE2   . GLU A  1  333 ? 60.859  5.768    128.614  1.00 115.99 ? 333 GLU 1 OE2   1 
ATOM   2587  N  N     . ARG A  1  334 ? 65.245  0.382    128.481  1.00 98.92  ? 334 ARG 1 N     1 
ATOM   2588  C  CA    . ARG A  1  334 ? 66.615  -0.091   128.332  1.00 102.82 ? 334 ARG 1 CA    1 
ATOM   2589  C  C     . ARG A  1  334 ? 66.742  -1.174   127.269  1.00 106.26 ? 334 ARG 1 C     1 
ATOM   2590  O  O     . ARG A  1  334 ? 67.856  -1.442   126.803  1.00 107.28 ? 334 ARG 1 O     1 
ATOM   2591  C  CB    . ARG A  1  334 ? 67.144  -0.610   129.671  1.00 103.90 ? 334 ARG 1 CB    1 
ATOM   2592  C  CG    . ARG A  1  334 ? 68.660  -0.586   129.779  1.00 105.66 ? 334 ARG 1 CG    1 
ATOM   2593  C  CD    . ARG A  1  334 ? 69.130  -0.420   131.213  1.00 108.02 ? 334 ARG 1 CD    1 
ATOM   2594  N  NE    . ARG A  1  334 ? 68.549  -1.403   132.123  1.00 110.67 ? 334 ARG 1 NE    1 
ATOM   2595  C  CZ    . ARG A  1  334 ? 69.202  -2.465   132.591  1.00 112.48 ? 334 ARG 1 CZ    1 
ATOM   2596  N  NH1   . ARG A  1  334 ? 70.462  -2.685   132.242  1.00 112.58 ? 334 ARG 1 NH1   1 
ATOM   2597  N  NH2   . ARG A  1  334 ? 68.593  -3.303   133.416  1.00 113.52 ? 334 ARG 1 NH2   1 
ATOM   2598  N  N     . VAL A  1  335 ? 65.636  -1.794   126.869  1.00 107.46 ? 335 VAL 1 N     1 
ATOM   2599  C  CA    . VAL A  1  335 ? 65.615  -2.784   125.798  1.00 106.41 ? 335 VAL 1 CA    1 
ATOM   2600  C  C     . VAL A  1  335 ? 64.714  -2.262   124.689  1.00 103.70 ? 335 VAL 1 C     1 
ATOM   2601  O  O     . VAL A  1  335 ? 63.593  -1.815   124.956  1.00 102.65 ? 335 VAL 1 O     1 
ATOM   2602  C  CB    . VAL A  1  335 ? 65.115  -4.151   126.304  1.00 107.01 ? 335 VAL 1 CB    1 
ATOM   2603  C  CG1   . VAL A  1  335 ? 65.116  -5.178   125.178  1.00 107.73 ? 335 VAL 1 CG1   1 
ATOM   2604  C  CG2   . VAL A  1  335 ? 65.952  -4.630   127.485  1.00 106.58 ? 335 VAL 1 CG2   1 
ATOM   2605  N  N     . SER A  1  336 ? 65.193  -2.330   123.451  1.00 101.66 ? 336 SER 1 N     1 
ATOM   2606  C  CA    . SER A  1  336 ? 64.410  -1.825   122.335  1.00 99.85  ? 336 SER 1 CA    1 
ATOM   2607  C  C     . SER A  1  336 ? 63.223  -2.739   122.056  1.00 96.96  ? 336 SER 1 C     1 
ATOM   2608  O  O     . SER A  1  336 ? 63.317  -3.963   122.172  1.00 94.54  ? 336 SER 1 O     1 
ATOM   2609  C  CB    . SER A  1  336 ? 65.285  -1.694   121.085  1.00 99.88  ? 336 SER 1 CB    1 
ATOM   2610  O  OG    . SER A  1  336 ? 64.555  -1.183   119.982  1.00 98.93  ? 336 SER 1 OG    1 
ATOM   2611  N  N     . MET A  1  337 ? 62.088  -2.121   121.721  1.00 98.54  ? 337 MET 1 N     1 
ATOM   2612  C  CA    . MET A  1  337 ? 60.907  -2.866   121.283  1.00 99.78  ? 337 MET 1 CA    1 
ATOM   2613  C  C     . MET A  1  337 ? 61.248  -3.820   120.146  1.00 98.24  ? 337 MET 1 C     1 
ATOM   2614  O  O     . MET A  1  337 ? 60.693  -4.924   120.058  1.00 95.93  ? 337 MET 1 O     1 
ATOM   2615  C  CB    . MET A  1  337 ? 59.819  -1.888   120.837  1.00 100.15 ? 337 MET 1 CB    1 
ATOM   2616  C  CG    . MET A  1  337 ? 58.718  -1.635   121.836  1.00 98.70  ? 337 MET 1 CG    1 
ATOM   2617  S  SD    . MET A  1  337 ? 57.514  -2.965   121.774  1.00 98.58  ? 337 MET 1 SD    1 
ATOM   2618  C  CE    . MET A  1  337 ? 56.482  -2.520   123.160  1.00 99.91  ? 337 MET 1 CE    1 
ATOM   2619  N  N     . VAL A  1  338 ? 62.140  -3.388   119.249  1.00 98.91  ? 338 VAL 1 N     1 
ATOM   2620  C  CA    . VAL A  1  338 ? 62.568  -4.225   118.134  1.00 99.52  ? 338 VAL 1 CA    1 
ATOM   2621  C  C     . VAL A  1  338 ? 63.126  -5.547   118.642  1.00 93.68  ? 338 VAL 1 C     1 
ATOM   2622  O  O     . VAL A  1  338 ? 62.812  -6.608   118.101  1.00 87.14  ? 338 VAL 1 O     1 
ATOM   2623  C  CB    . VAL A  1  338 ? 63.594  -3.468   117.267  1.00 104.29 ? 338 VAL 1 CB    1 
ATOM   2624  C  CG1   . VAL A  1  338 ? 64.193  -4.384   116.202  1.00 105.45 ? 338 VAL 1 CG1   1 
ATOM   2625  C  CG2   . VAL A  1  338 ? 62.966  -2.227   116.635  1.00 104.75 ? 338 VAL 1 CG2   1 
ATOM   2626  N  N     . ASP A  1  339 ? 63.943  -5.507   119.697  1.00 94.88  ? 339 ASP 1 N     1 
ATOM   2627  C  CA    . ASP A  1  339 ? 64.524  -6.732   120.242  1.00 93.05  ? 339 ASP 1 CA    1 
ATOM   2628  C  C     . ASP A  1  339 ? 63.469  -7.605   120.916  1.00 93.13  ? 339 ASP 1 C     1 
ATOM   2629  O  O     . ASP A  1  339 ? 63.520  -8.841   120.830  1.00 93.19  ? 339 ASP 1 O     1 
ATOM   2630  C  CB    . ASP A  1  339 ? 65.638  -6.381   121.225  1.00 92.60  ? 339 ASP 1 CB    1 
ATOM   2631  C  CG    . ASP A  1  339 ? 66.449  -7.584   121.628  1.00 95.99  ? 339 ASP 1 CG    1 
ATOM   2632  O  OD1   . ASP A  1  339 ? 67.105  -8.183   120.754  1.00 97.67  ? 339 ASP 1 OD1   1 
ATOM   2633  O  OD2   . ASP A  1  339 ? 66.424  -7.940   122.820  1.00 97.76  ? 339 ASP 1 OD2   1 
ATOM   2634  N  N     . ALA A  1  340 ? 62.500  -6.981   121.588  1.00 95.25  ? 340 ALA 1 N     1 
ATOM   2635  C  CA    . ALA A  1  340 ? 61.422  -7.740   122.216  1.00 97.89  ? 340 ALA 1 CA    1 
ATOM   2636  C  C     . ALA A  1  340 ? 60.621  -8.521   121.180  1.00 97.83  ? 340 ALA 1 C     1 
ATOM   2637  O  O     . ALA A  1  340 ? 60.457  -9.744   121.291  1.00 97.20  ? 340 ALA 1 O     1 
ATOM   2638  C  CB    . ALA A  1  340 ? 60.515  -6.797   123.009  1.00 99.51  ? 340 ALA 1 CB    1 
ATOM   2639  N  N     . MET A  1  341 ? 60.120  -7.826   120.152  1.00 97.90  ? 341 MET 1 N     1 
ATOM   2640  C  CA    . MET A  1  341 ? 59.352  -8.502   119.110  1.00 96.81  ? 341 MET 1 CA    1 
ATOM   2641  C  C     . MET A  1  341 ? 60.232  -9.412   118.268  1.00 94.90  ? 341 MET 1 C     1 
ATOM   2642  O  O     . MET A  1  341 ? 59.742  -10.384  117.696  1.00 91.40  ? 341 MET 1 O     1 
ATOM   2643  C  CB    . MET A  1  341 ? 58.640  -7.480   118.229  1.00 99.13  ? 341 MET 1 CB    1 
ATOM   2644  C  CG    . MET A  1  341 ? 58.104  -6.310   119.006  1.00 101.15 ? 341 MET 1 CG    1 
ATOM   2645  S  SD    . MET A  1  341 ? 57.222  -6.921   120.447  1.00 101.29 ? 341 MET 1 SD    1 
ATOM   2646  C  CE    . MET A  1  341 ? 55.761  -7.631   119.701  1.00 99.35  ? 341 MET 1 CE    1 
ATOM   2647  N  N     . TRP A  1  342 ? 61.527  -9.107   118.182  1.00 97.47  ? 342 TRP 1 N     1 
ATOM   2648  C  CA    . TRP A  1  342 ? 62.501  -10.030  117.623  1.00 94.75  ? 342 TRP 1 CA    1 
ATOM   2649  C  C     . TRP A  1  342 ? 62.386  -11.385  118.296  1.00 90.17  ? 342 TRP 1 C     1 
ATOM   2650  O  O     . TRP A  1  342 ? 62.149  -12.407  117.640  1.00 92.13  ? 342 TRP 1 O     1 
ATOM   2651  C  CB    . TRP A  1  342 ? 63.910  -9.464   117.819  1.00 97.39  ? 342 TRP 1 CB    1 
ATOM   2652  C  CG    . TRP A  1  342 ? 64.877  -9.846   116.763  1.00 101.95 ? 342 TRP 1 CG    1 
ATOM   2653  C  CD1   . TRP A  1  342 ? 65.426  -9.025   115.828  1.00 102.62 ? 342 TRP 1 CD1   1 
ATOM   2654  C  CD2   . TRP A  1  342 ? 65.394  -11.157  116.503  1.00 107.17 ? 342 TRP 1 CD2   1 
ATOM   2655  N  NE1   . TRP A  1  342 ? 66.266  -9.736   115.013  1.00 107.00 ? 342 TRP 1 NE1   1 
ATOM   2656  C  CE2   . TRP A  1  342 ? 66.262  -11.049  115.402  1.00 108.36 ? 342 TRP 1 CE2   1 
ATOM   2657  C  CE3   . TRP A  1  342 ? 65.214  -12.408  117.097  1.00 107.28 ? 342 TRP 1 CE3   1 
ATOM   2658  C  CZ2   . TRP A  1  342 ? 66.947  -12.145  114.880  1.00 105.60 ? 342 TRP 1 CZ2   1 
ATOM   2659  C  CZ3   . TRP A  1  342 ? 65.894  -13.494  116.575  1.00 104.08 ? 342 TRP 1 CZ3   1 
ATOM   2660  C  CH2   . TRP A  1  342 ? 66.750  -13.356  115.479  1.00 103.06 ? 342 TRP 1 CH2   1 
ATOM   2661  N  N     . ASN A  1  343 ? 62.566  -11.400  119.619  1.00 87.00  ? 343 ASN 1 N     1 
ATOM   2662  C  CA    . ASN A  1  343 ? 62.518  -12.664  120.349  1.00 86.65  ? 343 ASN 1 CA    1 
ATOM   2663  C  C     . ASN A  1  343 ? 61.136  -13.297  120.241  1.00 85.67  ? 343 ASN 1 C     1 
ATOM   2664  O  O     . ASN A  1  343 ? 61.011  -14.523  120.142  1.00 86.79  ? 343 ASN 1 O     1 
ATOM   2665  C  CB    . ASN A  1  343 ? 62.918  -12.461  121.814  1.00 85.30  ? 343 ASN 1 CB    1 
ATOM   2666  C  CG    . ASN A  1  343 ? 63.101  -13.781  122.566  1.00 81.53  ? 343 ASN 1 CG    1 
ATOM   2667  O  OD1   . ASN A  1  343 ? 62.135  -14.409  122.996  1.00 80.05  ? 343 ASN 1 OD1   1 
ATOM   2668  N  ND2   . ASN A  1  343 ? 64.349  -14.200  122.725  1.00 79.23  ? 343 ASN 1 ND2   1 
ATOM   2669  N  N     . LEU A  1  344 ? 60.086  -12.475  120.241  1.00 83.68  ? 344 LEU 1 N     1 
ATOM   2670  C  CA    . LEU A  1  344 ? 58.733  -13.012  120.121  1.00 85.95  ? 344 LEU 1 CA    1 
ATOM   2671  C  C     . LEU A  1  344 ? 58.545  -13.752  118.798  1.00 85.52  ? 344 LEU 1 C     1 
ATOM   2672  O  O     . LEU A  1  344 ? 58.012  -14.867  118.765  1.00 85.56  ? 344 LEU 1 O     1 
ATOM   2673  C  CB    . LEU A  1  344 ? 57.713  -11.882  120.253  1.00 89.53  ? 344 LEU 1 CB    1 
ATOM   2674  C  CG    . LEU A  1  344 ? 57.608  -11.258  121.646  1.00 89.09  ? 344 LEU 1 CG    1 
ATOM   2675  C  CD1   . LEU A  1  344 ? 56.295  -10.502  121.828  1.00 88.41  ? 344 LEU 1 CD1   1 
ATOM   2676  C  CD2   . LEU A  1  344 ? 57.801  -12.311  122.723  1.00 87.56  ? 344 LEU 1 CD2   1 
ATOM   2677  N  N     . THR A  1  345 ? 58.977  -13.137  117.692  1.00 84.33  ? 345 THR 1 N     1 
ATOM   2678  C  CA    . THR A  1  345 ? 58.795  -13.742  116.378  1.00 81.86  ? 345 THR 1 CA    1 
ATOM   2679  C  C     . THR A  1  345 ? 59.685  -14.962  116.208  1.00 78.08  ? 345 THR 1 C     1 
ATOM   2680  O  O     . THR A  1  345 ? 59.267  -15.956  115.607  1.00 77.23  ? 345 THR 1 O     1 
ATOM   2681  C  CB    . THR A  1  345 ? 59.068  -12.719  115.274  1.00 85.16  ? 345 THR 1 CB    1 
ATOM   2682  O  OG1   . THR A  1  345 ? 60.403  -12.213  115.408  1.00 89.98  ? 345 THR 1 OG1   1 
ATOM   2683  C  CG2   . THR A  1  345 ? 58.069  -11.566  115.323  1.00 84.10  ? 345 THR 1 CG2   1 
ATOM   2684  N  N     . ARG A  1  346 ? 60.908  -14.924  116.749  1.00 77.82  ? 346 ARG 1 N     1 
ATOM   2685  C  CA    . ARG A  1  346 ? 61.756  -16.113  116.684  1.00 82.54  ? 346 ARG 1 CA    1 
ATOM   2686  C  C     . ARG A  1  346 ? 61.149  -17.258  117.493  1.00 85.68  ? 346 ARG 1 C     1 
ATOM   2687  O  O     . ARG A  1  346 ? 61.203  -18.425  117.078  1.00 84.33  ? 346 ARG 1 O     1 
ATOM   2688  C  CB    . ARG A  1  346 ? 63.180  -15.794  117.164  1.00 84.18  ? 346 ARG 1 CB    1 
ATOM   2689  C  CG    . ARG A  1  346 ? 63.368  -15.700  118.682  1.00 86.78  ? 346 ARG 1 CG    1 
ATOM   2690  C  CD    . ARG A  1  346 ? 64.802  -15.372  119.096  1.00 89.64  ? 346 ARG 1 CD    1 
ATOM   2691  N  NE    . ARG A  1  346 ? 65.776  -16.129  118.316  1.00 92.65  ? 346 ARG 1 NE    1 
ATOM   2692  C  CZ    . ARG A  1  346 ? 66.276  -17.312  118.676  1.00 93.45  ? 346 ARG 1 CZ    1 
ATOM   2693  N  NH1   . ARG A  1  346 ? 65.907  -17.882  119.819  1.00 92.03  ? 346 ARG 1 NH1   1 
ATOM   2694  N  NH2   . ARG A  1  346 ? 67.152  -17.923  117.891  1.00 93.66  ? 346 ARG 1 NH2   1 
ATOM   2695  N  N     . PHE A  1  347 ? 60.513  -16.935  118.622  1.00 87.25  ? 347 PHE 1 N     1 
ATOM   2696  C  CA    . PHE A  1  347 ? 59.864  -17.956  119.433  1.00 86.72  ? 347 PHE 1 CA    1 
ATOM   2697  C  C     . PHE A  1  347 ? 58.683  -18.562  118.689  1.00 84.18  ? 347 PHE 1 C     1 
ATOM   2698  O  O     . PHE A  1  347 ? 58.578  -19.787  118.567  1.00 87.20  ? 347 PHE 1 O     1 
ATOM   2699  C  CB    . PHE A  1  347 ? 59.439  -17.342  120.770  1.00 87.19  ? 347 PHE 1 CB    1 
ATOM   2700  C  CG    . PHE A  1  347 ? 58.248  -18.002  121.402  1.00 87.53  ? 347 PHE 1 CG    1 
ATOM   2701  C  CD1   . PHE A  1  347 ? 57.015  -17.376  121.410  1.00 88.69  ? 347 PHE 1 CD1   1 
ATOM   2702  C  CD2   . PHE A  1  347 ? 58.364  -19.236  122.012  1.00 88.89  ? 347 PHE 1 CD2   1 
ATOM   2703  C  CE1   . PHE A  1  347 ? 55.918  -17.979  121.998  1.00 91.50  ? 347 PHE 1 CE1   1 
ATOM   2704  C  CE2   . PHE A  1  347 ? 57.272  -19.842  122.603  1.00 91.28  ? 347 PHE 1 CE2   1 
ATOM   2705  C  CZ    . PHE A  1  347 ? 56.050  -19.213  122.596  1.00 92.92  ? 347 PHE 1 CZ    1 
ATOM   2706  N  N     . TYR A  1  348 ? 57.801  -17.716  118.147  1.00 78.52  ? 348 TYR 1 N     1 
ATOM   2707  C  CA    . TYR A  1  348 ? 56.660  -18.222  117.383  1.00 73.85  ? 348 TYR 1 CA    1 
ATOM   2708  C  C     . TYR A  1  348 ? 57.103  -18.981  116.142  1.00 69.01  ? 348 TYR 1 C     1 
ATOM   2709  O  O     . TYR A  1  348 ? 56.385  -19.870  115.672  1.00 67.42  ? 348 TYR 1 O     1 
ATOM   2710  C  CB    . TYR A  1  348 ? 55.714  -17.080  117.014  1.00 73.72  ? 348 TYR 1 CB    1 
ATOM   2711  C  CG    . TYR A  1  348 ? 54.816  -16.675  118.156  1.00 73.30  ? 348 TYR 1 CG    1 
ATOM   2712  C  CD1   . TYR A  1  348 ? 53.686  -17.408  118.459  1.00 73.70  ? 348 TYR 1 CD1   1 
ATOM   2713  C  CD2   . TYR A  1  348 ? 55.130  -15.607  118.966  1.00 75.36  ? 348 TYR 1 CD2   1 
ATOM   2714  C  CE1   . TYR A  1  348 ? 52.871  -17.061  119.510  1.00 74.39  ? 348 TYR 1 CE1   1 
ATOM   2715  C  CE2   . TYR A  1  348 ? 54.322  -15.258  120.028  1.00 78.13  ? 348 TYR 1 CE2   1 
ATOM   2716  C  CZ    . TYR A  1  348 ? 53.193  -15.989  120.293  1.00 77.60  ? 348 TYR 1 CZ    1 
ATOM   2717  O  OH    . TYR A  1  348 ? 52.375  -15.652  121.345  1.00 80.33  ? 348 TYR 1 OH    1 
ATOM   2718  N  N     . ALA A  1  349 ? 58.271  -18.642  115.597  1.00 67.42  ? 349 ALA 1 N     1 
ATOM   2719  C  CA    . ALA A  1  349 ? 58.810  -19.400  114.475  1.00 70.48  ? 349 ALA 1 CA    1 
ATOM   2720  C  C     . ALA A  1  349 ? 59.313  -20.766  114.923  1.00 71.13  ? 349 ALA 1 C     1 
ATOM   2721  O  O     . ALA A  1  349 ? 59.243  -21.733  114.155  1.00 70.32  ? 349 ALA 1 O     1 
ATOM   2722  C  CB    . ALA A  1  349 ? 59.930  -18.609  113.804  1.00 72.33  ? 349 ALA 1 CB    1 
ATOM   2723  N  N     . HIS A  1  350 ? 59.860  -20.854  116.141  1.00 70.59  ? 350 HIS 1 N     1 
ATOM   2724  C  CA    . HIS A  1  350 ? 60.312  -22.145  116.653  1.00 67.90  ? 350 HIS 1 CA    1 
ATOM   2725  C  C     . HIS A  1  350 ? 59.156  -23.130  116.757  1.00 62.65  ? 350 HIS 1 C     1 
ATOM   2726  O  O     . HIS A  1  350 ? 59.358  -24.339  116.608  1.00 63.85  ? 350 HIS 1 O     1 
ATOM   2727  C  CB    . HIS A  1  350 ? 60.994  -21.978  118.018  1.00 69.17  ? 350 HIS 1 CB    1 
ATOM   2728  C  CG    . HIS A  1  350 ? 61.528  -23.258  118.597  1.00 69.18  ? 350 HIS 1 CG    1 
ATOM   2729  N  ND1   . HIS A  1  350 ? 62.737  -23.805  118.213  1.00 69.03  ? 350 HIS 1 ND1   1 
ATOM   2730  C  CD2   . HIS A  1  350 ? 61.021  -24.093  119.536  1.00 68.76  ? 350 HIS 1 CD2   1 
ATOM   2731  C  CE1   . HIS A  1  350 ? 62.947  -24.922  118.887  1.00 68.42  ? 350 HIS 1 CE1   1 
ATOM   2732  N  NE2   . HIS A  1  350 ? 61.920  -25.120  119.695  1.00 68.57  ? 350 HIS 1 NE2   1 
ATOM   2733  N  N     . GLU A  1  351 ? 57.941  -22.633  116.980  1.00 59.25  ? 351 GLU 1 N     1 
ATOM   2734  C  CA    . GLU A  1  351 ? 56.829  -23.456  117.432  1.00 61.59  ? 351 GLU 1 CA    1 
ATOM   2735  C  C     . GLU A  1  351 ? 55.740  -23.644  116.373  1.00 58.07  ? 351 GLU 1 C     1 
ATOM   2736  O  O     . GLU A  1  351 ? 54.654  -24.145  116.697  1.00 51.78  ? 351 GLU 1 O     1 
ATOM   2737  C  CB    . GLU A  1  351 ? 56.223  -22.832  118.695  1.00 65.25  ? 351 GLU 1 CB    1 
ATOM   2738  C  CG    . GLU A  1  351 ? 57.170  -22.777  119.896  1.00 67.43  ? 351 GLU 1 CG    1 
ATOM   2739  C  CD    . GLU A  1  351 ?