data_6I4X
# 
_entry.id   6I4X 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.311 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6I4X         
WWPDB D_1200012787 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.details        '2C9W contains the same protein complex SOCS2-EloB-EloC' 
_pdbx_database_related.db_id          2C9W 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6I4X 
_pdbx_database_status.recvd_initial_deposition_date   2018-11-12 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Kung, W.W.'       1 ?                   
'Ramachandran, S.' 2 ?                   
'Makukhin, N.'     3 ?                   
'Bruno, E.'        4 ?                   
'Ciulli, A.'       5 0000-0002-8654-1670 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nat Commun' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2041-1723 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            10 
_citation.language                  ? 
_citation.page_first                2534 
_citation.page_last                 2534 
_citation.title                     'Structural insights into substrate recognition by the SOCS2 E3 ubiquitin ligase.' 
_citation.year                      2019 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/s41467-019-10190-4 
_citation.pdbx_database_id_PubMed   31182716 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Kung, W.W.'       1 ?                   
primary 'Ramachandran, S.' 2 ?                   
primary 'Makukhin, N.'     3 ?                   
primary 'Bruno, E.'        4 ?                   
primary 'Ciulli, A.'       5 0000-0002-8654-1670 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   91.53 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6I4X 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     41.287 
_cell.length_a_esd                 ? 
_cell.length_b                     56.327 
_cell.length_b_esd                 ? 
_cell.length_c                     203.392 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        4 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6I4X 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'I 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Elongin-B                            11852.389 1  ? ? ? ? 
2 polymer     man Elongin-C                            10974.616 1  ? ? ? ? 
3 polymer     man 'Suppressor of cytokine signaling 2' 19203.994 1  ? ? ? ? 
4 polymer     syn 'Erythropoietin receptor'            1322.311  1  ? ? ? ? 
5 non-polymer syn 'DI(HYDROXYETHYL)ETHER'              106.120   1  ? ? ? ? 
6 water       nat water                                18.015    11 ? ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 
;EloB,Elongin 18 kDa subunit,RNA polymerase II transcription factor SIII subunit B,SIII p18,Transcription elongation factor B polypeptide 2
;
2 
;EloC,Elongin 15 kDa subunit,RNA polymerase II transcription factor SIII subunit C,SIII p15,Transcription elongation factor B polypeptide 1
;
3 'SOCS-2,Cytokine-inducible SH2 protein 2,CIS-2,STAT-induced STAT inhibitor 2,SSI-2' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no yes 
;MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFR
ADDTFEAL(CAS)IEPFSSPPELPDVMK
;
;MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFR
ADDTFEALCIEPFSSPPELPDVMK
;
B ? 
2 'polypeptide(L)' no no  
;MMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPI
APEIALELLMAANFLDC
;
;MMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPI
APEIALELLMAANFLDC
;
C ? 
3 'polypeptide(L)' no yes 
;SMQAARLAKALRELGQTGWYWGSMTVNEAKEKLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSI
ICVKSALAAFDSVVHLIDYYVQM(CAS)KDKRTGPEAPRNGTVHLYLTKPLYTSAPSLQHLCRLTINKCTGAIWGLPLPT
RLKDYLEEYKFQV
;
;SMQAARLAKALRELGQTGWYWGSMTVNEAKEKLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSI
ICVKSALAAFDSVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPSLQHLCRLTINKCTGAIWGLPLPTRLKD
YLEEYKFQV
;
A ? 
4 'polypeptide(L)' no yes 'ASFE(PTR)TILDPS' ASFEYTILDPS D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ASP n 
1 3   VAL n 
1 4   PHE n 
1 5   LEU n 
1 6   MET n 
1 7   ILE n 
1 8   ARG n 
1 9   ARG n 
1 10  HIS n 
1 11  LYS n 
1 12  THR n 
1 13  THR n 
1 14  ILE n 
1 15  PHE n 
1 16  THR n 
1 17  ASP n 
1 18  ALA n 
1 19  LYS n 
1 20  GLU n 
1 21  SER n 
1 22  SER n 
1 23  THR n 
1 24  VAL n 
1 25  PHE n 
1 26  GLU n 
1 27  LEU n 
1 28  LYS n 
1 29  ARG n 
1 30  ILE n 
1 31  VAL n 
1 32  GLU n 
1 33  GLY n 
1 34  ILE n 
1 35  LEU n 
1 36  LYS n 
1 37  ARG n 
1 38  PRO n 
1 39  PRO n 
1 40  ASP n 
1 41  GLU n 
1 42  GLN n 
1 43  ARG n 
1 44  LEU n 
1 45  TYR n 
1 46  LYS n 
1 47  ASP n 
1 48  ASP n 
1 49  GLN n 
1 50  LEU n 
1 51  LEU n 
1 52  ASP n 
1 53  ASP n 
1 54  GLY n 
1 55  LYS n 
1 56  THR n 
1 57  LEU n 
1 58  GLY n 
1 59  GLU n 
1 60  CYS n 
1 61  GLY n 
1 62  PHE n 
1 63  THR n 
1 64  SER n 
1 65  GLN n 
1 66  THR n 
1 67  ALA n 
1 68  ARG n 
1 69  PRO n 
1 70  GLN n 
1 71  ALA n 
1 72  PRO n 
1 73  ALA n 
1 74  THR n 
1 75  VAL n 
1 76  GLY n 
1 77  LEU n 
1 78  ALA n 
1 79  PHE n 
1 80  ARG n 
1 81  ALA n 
1 82  ASP n 
1 83  ASP n 
1 84  THR n 
1 85  PHE n 
1 86  GLU n 
1 87  ALA n 
1 88  LEU n 
1 89  CAS n 
1 90  ILE n 
1 91  GLU n 
1 92  PRO n 
1 93  PHE n 
1 94  SER n 
1 95  SER n 
1 96  PRO n 
1 97  PRO n 
1 98  GLU n 
1 99  LEU n 
1 100 PRO n 
1 101 ASP n 
1 102 VAL n 
1 103 MET n 
1 104 LYS n 
2 1   MET n 
2 2   MET n 
2 3   TYR n 
2 4   VAL n 
2 5   LYS n 
2 6   LEU n 
2 7   ILE n 
2 8   SER n 
2 9   SER n 
2 10  ASP n 
2 11  GLY n 
2 12  HIS n 
2 13  GLU n 
2 14  PHE n 
2 15  ILE n 
2 16  VAL n 
2 17  LYS n 
2 18  ARG n 
2 19  GLU n 
2 20  HIS n 
2 21  ALA n 
2 22  LEU n 
2 23  THR n 
2 24  SER n 
2 25  GLY n 
2 26  THR n 
2 27  ILE n 
2 28  LYS n 
2 29  ALA n 
2 30  MET n 
2 31  LEU n 
2 32  SER n 
2 33  GLY n 
2 34  PRO n 
2 35  GLY n 
2 36  GLN n 
2 37  PHE n 
2 38  ALA n 
2 39  GLU n 
2 40  ASN n 
2 41  GLU n 
2 42  THR n 
2 43  ASN n 
2 44  GLU n 
2 45  VAL n 
2 46  ASN n 
2 47  PHE n 
2 48  ARG n 
2 49  GLU n 
2 50  ILE n 
2 51  PRO n 
2 52  SER n 
2 53  HIS n 
2 54  VAL n 
2 55  LEU n 
2 56  SER n 
2 57  LYS n 
2 58  VAL n 
2 59  CYS n 
2 60  MET n 
2 61  TYR n 
2 62  PHE n 
2 63  THR n 
2 64  TYR n 
2 65  LYS n 
2 66  VAL n 
2 67  ARG n 
2 68  TYR n 
2 69  THR n 
2 70  ASN n 
2 71  SER n 
2 72  SER n 
2 73  THR n 
2 74  GLU n 
2 75  ILE n 
2 76  PRO n 
2 77  GLU n 
2 78  PHE n 
2 79  PRO n 
2 80  ILE n 
2 81  ALA n 
2 82  PRO n 
2 83  GLU n 
2 84  ILE n 
2 85  ALA n 
2 86  LEU n 
2 87  GLU n 
2 88  LEU n 
2 89  LEU n 
2 90  MET n 
2 91  ALA n 
2 92  ALA n 
2 93  ASN n 
2 94  PHE n 
2 95  LEU n 
2 96  ASP n 
2 97  CYS n 
3 1   SER n 
3 2   MET n 
3 3   GLN n 
3 4   ALA n 
3 5   ALA n 
3 6   ARG n 
3 7   LEU n 
3 8   ALA n 
3 9   LYS n 
3 10  ALA n 
3 11  LEU n 
3 12  ARG n 
3 13  GLU n 
3 14  LEU n 
3 15  GLY n 
3 16  GLN n 
3 17  THR n 
3 18  GLY n 
3 19  TRP n 
3 20  TYR n 
3 21  TRP n 
3 22  GLY n 
3 23  SER n 
3 24  MET n 
3 25  THR n 
3 26  VAL n 
3 27  ASN n 
3 28  GLU n 
3 29  ALA n 
3 30  LYS n 
3 31  GLU n 
3 32  LYS n 
3 33  LEU n 
3 34  LYS n 
3 35  GLU n 
3 36  ALA n 
3 37  PRO n 
3 38  GLU n 
3 39  GLY n 
3 40  THR n 
3 41  PHE n 
3 42  LEU n 
3 43  ILE n 
3 44  ARG n 
3 45  ASP n 
3 46  SER n 
3 47  SER n 
3 48  HIS n 
3 49  SER n 
3 50  ASP n 
3 51  TYR n 
3 52  LEU n 
3 53  LEU n 
3 54  THR n 
3 55  ILE n 
3 56  SER n 
3 57  VAL n 
3 58  LYS n 
3 59  THR n 
3 60  SER n 
3 61  ALA n 
3 62  GLY n 
3 63  PRO n 
3 64  THR n 
3 65  ASN n 
3 66  LEU n 
3 67  ARG n 
3 68  ILE n 
3 69  GLU n 
3 70  TYR n 
3 71  GLN n 
3 72  ASP n 
3 73  GLY n 
3 74  LYS n 
3 75  PHE n 
3 76  ARG n 
3 77  LEU n 
3 78  ASP n 
3 79  SER n 
3 80  ILE n 
3 81  ILE n 
3 82  CYS n 
3 83  VAL n 
3 84  LYS n 
3 85  SER n 
3 86  ALA n 
3 87  LEU n 
3 88  ALA n 
3 89  ALA n 
3 90  PHE n 
3 91  ASP n 
3 92  SER n 
3 93  VAL n 
3 94  VAL n 
3 95  HIS n 
3 96  LEU n 
3 97  ILE n 
3 98  ASP n 
3 99  TYR n 
3 100 TYR n 
3 101 VAL n 
3 102 GLN n 
3 103 MET n 
3 104 CAS n 
3 105 LYS n 
3 106 ASP n 
3 107 LYS n 
3 108 ARG n 
3 109 THR n 
3 110 GLY n 
3 111 PRO n 
3 112 GLU n 
3 113 ALA n 
3 114 PRO n 
3 115 ARG n 
3 116 ASN n 
3 117 GLY n 
3 118 THR n 
3 119 VAL n 
3 120 HIS n 
3 121 LEU n 
3 122 TYR n 
3 123 LEU n 
3 124 THR n 
3 125 LYS n 
3 126 PRO n 
3 127 LEU n 
3 128 TYR n 
3 129 THR n 
3 130 SER n 
3 131 ALA n 
3 132 PRO n 
3 133 SER n 
3 134 LEU n 
3 135 GLN n 
3 136 HIS n 
3 137 LEU n 
3 138 CYS n 
3 139 ARG n 
3 140 LEU n 
3 141 THR n 
3 142 ILE n 
3 143 ASN n 
3 144 LYS n 
3 145 CYS n 
3 146 THR n 
3 147 GLY n 
3 148 ALA n 
3 149 ILE n 
3 150 TRP n 
3 151 GLY n 
3 152 LEU n 
3 153 PRO n 
3 154 LEU n 
3 155 PRO n 
3 156 THR n 
3 157 ARG n 
3 158 LEU n 
3 159 LYS n 
3 160 ASP n 
3 161 TYR n 
3 162 LEU n 
3 163 GLU n 
3 164 GLU n 
3 165 TYR n 
3 166 LYS n 
3 167 PHE n 
3 168 GLN n 
3 169 VAL n 
4 1   ALA n 
4 2   SER n 
4 3   PHE n 
4 4   GLU n 
4 5   PTR n 
4 6   THR n 
4 7   ILE n 
4 8   LEU n 
4 9   ASP n 
4 10  PRO n 
4 11  SER n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 104 Human ? 'ELOB, TCEB2'               ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 97  Human ? 'ELOC, TCEB1'               ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample 'Biological sequence' 1 169 Human ? 'SOCS2, CIS2, SSI2, STATI2' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
_pdbx_entity_src_syn.entity_id              4 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       1 
_pdbx_entity_src_syn.pdbx_end_seq_num       11 
_pdbx_entity_src_syn.organism_scientific    'Homo sapiens' 
_pdbx_entity_src_syn.organism_common_name   Human 
_pdbx_entity_src_syn.ncbi_taxonomy_id       9606 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP ELOB_HUMAN  Q15370 Q15370-2 1 
;MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFR
ADDTFEALCIEPFSSPPELPDVMK
;
1  
2 UNP ELOC_HUMAN  Q15369 ?        2 
;MYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIA
PEIALELLMAANFLDC
;
17 
3 UNP SOCS2_HUMAN O14508 ?        3 
;SPQAARLAKALRELGQTGWYWGSMTVNEAKEKLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSI
ICVKSKLKQFDSVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPSLQHLCRLTINKCTGAIWGLPLPTRLKD
YLEEYKFQV
;
30 
4 PDB 6I4X        6I4X   ?        4 ? 1  
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6I4X B 1 ? 104 ? Q15370 1  ? 104 ? 1  104 
2 2 6I4X C 2 ? 97  ? Q15369 17 ? 112 ? 17 112 
3 3 6I4X A 1 ? 169 ? O14508 30 ? 198 ? 30 198 
4 4 6I4X D 1 ? 11  ? 6I4X   -4 ? 6   ? -4 6   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
2 6I4X MET C 1  ? UNP Q15369 ?   ?   'initiating methionine' 16  1 
3 6I4X MET A 2  ? UNP O14508 PRO 31  conflict                31  2 
3 6I4X ALA A 86 ? UNP O14508 LYS 115 conflict                115 3 
3 6I4X ALA A 88 ? UNP O14508 LYS 117 conflict                117 4 
3 6I4X ALA A 89 ? UNP O14508 GLN 118 conflict                118 5 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                       ?                 'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                      ?                 'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                    ?                 'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'               ?                 'C4 H7 N O4'       133.103 
CAS 'L-peptide linking' n 'S-(DIMETHYLARSENIC)CYSTEINE' ?                 'C5 H12 As N O2 S' 225.141 
CYS 'L-peptide linking' y CYSTEINE                      ?                 'C3 H7 N O2 S'     121.158 
GLN 'L-peptide linking' y GLUTAMINE                     ?                 'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'               ?                 'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                       ?                 'C2 H5 N O2'       75.067  
HIS 'L-peptide linking' y HISTIDINE                     ?                 'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                         ?                 'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE                    ?                 'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                       ?                 'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                        ?                 'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                    ?                 'C5 H11 N O2 S'    149.211 
PEG non-polymer         . 'DI(HYDROXYETHYL)ETHER'       ?                 'C4 H10 O3'        106.120 
PHE 'L-peptide linking' y PHENYLALANINE                 ?                 'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                       ?                 'C5 H9 N O2'       115.130 
PTR 'L-peptide linking' n O-PHOSPHOTYROSINE             PHOSPHONOTYROSINE 'C9 H12 N O6 P'    261.168 
SER 'L-peptide linking' y SERINE                        ?                 'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                     ?                 'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                    ?                 'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                      ?                 'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                        ?                 'C5 H11 N O2'      117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6I4X 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.74 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         55.11 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            277.15 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    'Sodium cacodylate, ethanol, HEPES, magnesium chloride' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS3 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2017-12-16 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9686 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'DIAMOND BEAMLINE I24' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.9686 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   I24 
_diffrn_source.pdbx_synchrotron_site       Diamond 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6I4X 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.69 
_reflns.d_resolution_low                 29.36 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       12273 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             93.2 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  4.9 
_reflns.pdbx_Rmerge_I_obs                0.108 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            9.6 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.69 
_reflns_shell.d_res_low                   2.82 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.514 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6I4X 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.69 
_refine.ls_d_res_low                             29.36 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     12266 
_refine.ls_number_reflns_R_free                  640 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    93.00 
_refine.ls_percent_reflns_R_free                 5.22 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1986 
_refine.ls_R_factor_R_free                       0.2351 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1964 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.35 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               NONE 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 28.21 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.35 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2764 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         7 
_refine_hist.number_atoms_solvent             11 
_refine_hist.number_atoms_total               2782 
_refine_hist.d_res_high                       2.69 
_refine_hist.d_res_low                        29.36 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.002 ? 2828 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.451 ? 3834 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 8.504 ? 1710 ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.038 ? 445  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.003 ? 480  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.6880 2.8954  . . 79  1751 70.00 . . . 0.4004 . 0.2950 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.8954 3.1865  . . 137 2449 98.00 . . . 0.3064 . 0.2633 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.1865 3.6468  . . 143 2433 99.00 . . . 0.2338 . 0.2071 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.6468 4.5918  . . 144 2484 99.00 . . . 0.2189 . 0.1684 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.5918 29.3629 . . 137 2509 98.00 . . . 0.1961 . 0.1691 . . . . . . . . . . 
# 
_struct.entry_id                     6I4X 
_struct.title                        
'Crystal structure of SOCS2:Elongin C:Elongin B in complex with erythropoietin receptor peptide' 
_struct.pdbx_descriptor              'Elongin-B, Elongin-C, Suppressor of cytokine signaling 2, Erythropoietin receptor' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6I4X 
_struct_keywords.text            'Complex, SIGNALING PROTEIN' 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
G N N 6 ? 
H N N 6 ? 
I N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 THR A 23  ? LYS A 36  ? THR B 23  LYS B 36  1 ? 14 
HELX_P HELX_P2  AA2 PRO A 38  ? ASP A 40  ? PRO B 38  ASP B 40  5 ? 3  
HELX_P HELX_P3  AA3 ARG B 18  ? LEU B 22  ? ARG C 33  LEU C 37  1 ? 5  
HELX_P HELX_P4  AA4 SER B 24  ? MET B 30  ? SER C 39  MET C 45  1 ? 7  
HELX_P HELX_P5  AA5 PRO B 51  ? TYR B 68  ? PRO C 66  TYR C 83  1 ? 18 
HELX_P HELX_P6  AA6 ALA B 81  ? ASP B 96  ? ALA C 96  ASP C 111 1 ? 16 
HELX_P HELX_P7  AA7 MET C 2   ? GLY C 18  ? MET A 31  GLY A 47  1 ? 17 
HELX_P HELX_P8  AA8 THR C 25  ? LEU C 33  ? THR A 54  LEU A 62  1 ? 9  
HELX_P HELX_P9  AA9 SER C 92  ? CAS C 104 ? SER A 121 CAS A 133 1 ? 13 
HELX_P HELX_P10 AB1 SER C 133 ? LYS C 144 ? SER A 162 LYS A 173 1 ? 12 
HELX_P HELX_P11 AB2 PRO C 155 ? GLU C 164 ? PRO A 184 GLU A 193 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale both ? A LEU 88  C ? ? ? 1_555 A CAS 89  N ? ? B LEU 88  B CAS 89  1_555 ? ? ? ? ? ? ? 1.329 ? 
covale2 covale both ? A CAS 89  C ? ? ? 1_555 A ILE 90  N ? ? B CAS 89  B ILE 90  1_555 ? ? ? ? ? ? ? 1.327 ? 
covale3 covale both ? C MET 103 C ? ? ? 1_555 C CAS 104 N ? ? A MET 132 A CAS 133 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale4 covale both ? C CAS 104 C ? ? ? 1_555 C LYS 105 N ? ? A CAS 133 A LYS 134 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale5 covale both ? D GLU 4   C ? ? ? 1_555 D PTR 5   N ? ? D GLU -1  D PTR 0   1_555 ? ? ? ? ? ? ? 1.327 ? 
covale6 covale both ? D PTR 5   C ? ? ? 1_555 D THR 6   N ? ? D PTR 0   D THR 1   1_555 ? ? ? ? ? ? ? 1.328 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 4 ? 
AA2 ? 8 ? 
AA3 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? parallel      
AA2 4 5 ? anti-parallel 
AA2 5 6 ? parallel      
AA2 6 7 ? anti-parallel 
AA2 7 8 ? parallel      
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 GLN A 49 ? LEU A 50 ? GLN B 49  LEU B 50  
AA1 2 GLN A 42 ? LYS A 46 ? GLN B 42  LYS B 46  
AA1 3 ALA A 73 ? ALA A 81 ? ALA B 73  ALA B 81  
AA1 4 THR A 84 ? PHE A 85 ? THR B 84  PHE B 85  
AA2 1 GLN A 49 ? LEU A 50 ? GLN B 49  LEU B 50  
AA2 2 GLN A 42 ? LYS A 46 ? GLN B 42  LYS B 46  
AA2 3 ALA A 73 ? ALA A 81 ? ALA B 73  ALA B 81  
AA2 4 ASP A 2  ? ARG A 9  ? ASP B 2   ARG B 9   
AA2 5 THR A 12 ? LYS A 19 ? THR B 12  LYS B 19  
AA2 6 GLU B 13 ? LYS B 17 ? GLU C 28  LYS C 32  
AA2 7 TYR B 3  ? ILE B 7  ? TYR C 18  ILE C 22  
AA2 8 GLU B 44 ? ASN B 46 ? GLU C 59  ASN C 61  
AA3 1 PHE C 41 ? ASP C 45 ? PHE A 70  ASP A 74  
AA3 2 LEU C 53 ? THR C 59 ? LEU A 82  THR A 88  
AA3 3 GLY C 62 ? GLN C 71 ? GLY A 91  GLN A 100 
AA3 4 LYS C 74 ? LEU C 77 ? LYS A 103 LEU A 106 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O GLN A 49 ? O GLN B 49 N LYS A 46 ? N LYS B 46  
AA1 2 3 N TYR A 45 ? N TYR B 45 O GLY A 76 ? O GLY B 76  
AA1 3 4 N ALA A 81 ? N ALA B 81 O THR A 84 ? O THR B 84  
AA2 1 2 O GLN A 49 ? O GLN B 49 N LYS A 46 ? N LYS B 46  
AA2 2 3 N TYR A 45 ? N TYR B 45 O GLY A 76 ? O GLY B 76  
AA2 3 4 O VAL A 75 ? O VAL B 75 N MET A 6  ? N MET B 6   
AA2 4 5 N VAL A 3  ? N VAL B 3  O ALA A 18 ? O ALA B 18  
AA2 5 6 N THR A 13 ? N THR B 13 O ILE B 15 ? O ILE C 30  
AA2 6 7 O PHE B 14 ? O PHE C 29 N LEU B 6  ? N LEU C 21  
AA2 7 8 N ILE B 7  ? N ILE C 22 O VAL B 45 ? O VAL C 60  
AA3 1 2 N ARG C 44 ? N ARG A 73 O THR C 54 ? O THR A 83  
AA3 2 3 N ILE C 55 ? N ILE A 84 O LEU C 66 ? O LEU A 95  
AA3 3 4 N GLU C 69 ? N GLU A 98 O ARG C 76 ? O ARG A 105 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    A 
_struct_site.pdbx_auth_comp_id    PEG 
_struct_site.pdbx_auth_seq_id     201 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    7 
_struct_site.details              'binding site for residue PEG A 201' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 7 TRP C 21  ? TRP A 50  . ? 1_555 ? 
2 AC1 7 LYS C 32  ? LYS A 61  . ? 1_555 ? 
3 AC1 7 THR C 129 ? THR A 158 . ? 1_555 ? 
4 AC1 7 SER B 71  ? SER C 86  . ? 1_555 ? 
5 AC1 7 SER B 72  ? SER C 87  . ? 1_555 ? 
6 AC1 7 THR B 73  ? THR C 88  . ? 1_555 ? 
7 AC1 7 GLU B 74  ? GLU C 89  . ? 1_555 ? 
# 
_atom_sites.entry_id                    6I4X 
_atom_sites.fract_transf_matrix[1][1]   0.024221 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000647 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.017753 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004918 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
AS 
C  
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . MET A 1 1   ? 127.302 6.213   246.093 1.00 52.76  ? 1   MET B N   1 
ATOM   2    C  CA  . MET A 1 1   ? 127.702 5.642   244.813 1.00 61.44  ? 1   MET B CA  1 
ATOM   3    C  C   . MET A 1 1   ? 128.043 4.162   244.966 1.00 54.16  ? 1   MET B C   1 
ATOM   4    O  O   . MET A 1 1   ? 128.681 3.759   245.939 1.00 53.58  ? 1   MET B O   1 
ATOM   5    C  CB  . MET A 1 1   ? 128.891 6.410   244.234 1.00 62.22  ? 1   MET B CB  1 
ATOM   6    C  CG  . MET A 1 1   ? 128.620 7.892   244.006 1.00 63.70  ? 1   MET B CG  1 
ATOM   7    S  SD  . MET A 1 1   ? 127.470 8.201   242.650 1.00 97.25  ? 1   MET B SD  1 
ATOM   8    C  CE  . MET A 1 1   ? 125.980 8.634   243.544 1.00 60.00  ? 1   MET B CE  1 
ATOM   9    N  N   . ASP A 1 2   ? 127.614 3.358   243.997 1.00 67.33  ? 2   ASP B N   1 
ATOM   10   C  CA  . ASP A 1 2   ? 127.748 1.913   244.089 1.00 49.13  ? 2   ASP B CA  1 
ATOM   11   C  C   . ASP A 1 2   ? 129.169 1.466   243.752 1.00 49.21  ? 2   ASP B C   1 
ATOM   12   O  O   . ASP A 1 2   ? 129.918 2.144   243.044 1.00 43.73  ? 2   ASP B O   1 
ATOM   13   C  CB  . ASP A 1 2   ? 126.750 1.224   243.159 1.00 49.10  ? 2   ASP B CB  1 
ATOM   14   C  CG  . ASP A 1 2   ? 125.448 0.881   243.855 1.00 58.34  ? 2   ASP B CG  1 
ATOM   15   O  OD1 . ASP A 1 2   ? 125.498 0.302   244.960 1.00 59.57  ? 2   ASP B OD1 1 
ATOM   16   O  OD2 . ASP A 1 2   ? 124.374 1.191   243.297 1.00 66.54  ? 2   ASP B OD2 1 
ATOM   17   N  N   . VAL A 1 3   ? 129.528 0.296   244.277 1.00 52.31  ? 3   VAL B N   1 
ATOM   18   C  CA  . VAL A 1 3   ? 130.818 -0.339  244.037 1.00 43.39  ? 3   VAL B CA  1 
ATOM   19   C  C   . VAL A 1 3   ? 130.558 -1.666  243.338 1.00 39.37  ? 3   VAL B C   1 
ATOM   20   O  O   . VAL A 1 3   ? 129.702 -2.442  243.774 1.00 46.61  ? 3   VAL B O   1 
ATOM   21   C  CB  . VAL A 1 3   ? 131.596 -0.550  245.350 1.00 43.30  ? 3   VAL B CB  1 
ATOM   22   C  CG1 . VAL A 1 3   ? 132.668 -1.611  245.177 1.00 56.24  ? 3   VAL B CG1 1 
ATOM   23   C  CG2 . VAL A 1 3   ? 132.203 0.759   245.825 1.00 51.41  ? 3   VAL B CG2 1 
ATOM   24   N  N   . PHE A 1 4   ? 131.290 -1.923  242.258 1.00 31.92  ? 4   PHE B N   1 
ATOM   25   C  CA  . PHE A 1 4   ? 131.086 -3.108  241.434 1.00 44.92  ? 4   PHE B CA  1 
ATOM   26   C  C   . PHE A 1 4   ? 132.259 -4.060  241.628 1.00 45.62  ? 4   PHE B C   1 
ATOM   27   O  O   . PHE A 1 4   ? 133.414 -3.682  241.407 1.00 36.04  ? 4   PHE B O   1 
ATOM   28   C  CB  . PHE A 1 4   ? 130.914 -2.716  239.969 1.00 27.32  ? 4   PHE B CB  1 
ATOM   29   C  CG  . PHE A 1 4   ? 129.681 -1.900  239.717 1.00 26.41  ? 4   PHE B CG  1 
ATOM   30   C  CD1 . PHE A 1 4   ? 129.718 -0.517  239.792 1.00 25.64  ? 4   PHE B CD1 1 
ATOM   31   C  CD2 . PHE A 1 4   ? 128.474 -2.520  239.440 1.00 26.08  ? 4   PHE B CD2 1 
ATOM   32   C  CE1 . PHE A 1 4   ? 128.576 0.234   239.575 1.00 34.31  ? 4   PHE B CE1 1 
ATOM   33   C  CE2 . PHE A 1 4   ? 127.330 -1.776  239.221 1.00 37.06  ? 4   PHE B CE2 1 
ATOM   34   C  CZ  . PHE A 1 4   ? 127.381 -0.398  239.287 1.00 26.69  ? 4   PHE B CZ  1 
ATOM   35   N  N   . LEU A 1 5   ? 131.956 -5.292  242.032 1.00 38.95  ? 5   LEU B N   1 
ATOM   36   C  CA  . LEU A 1 5   ? 132.957 -6.227  242.517 1.00 45.50  ? 5   LEU B CA  1 
ATOM   37   C  C   . LEU A 1 5   ? 132.918 -7.537  241.741 1.00 42.28  ? 5   LEU B C   1 
ATOM   38   O  O   . LEU A 1 5   ? 131.911 -7.898  241.125 1.00 39.30  ? 5   LEU B O   1 
ATOM   39   C  CB  . LEU A 1 5   ? 132.753 -6.521  244.009 1.00 47.68  ? 5   LEU B CB  1 
ATOM   40   C  CG  . LEU A 1 5   ? 132.773 -5.325  244.959 1.00 43.81  ? 5   LEU B CG  1 
ATOM   41   C  CD1 . LEU A 1 5   ? 132.100 -5.676  246.276 1.00 45.24  ? 5   LEU B CD1 1 
ATOM   42   C  CD2 . LEU A 1 5   ? 134.202 -4.869  245.188 1.00 39.01  ? 5   LEU B CD2 1 
ATOM   43   N  N   . MET A 1 6   ? 134.043 -8.245  241.793 1.00 32.63  ? 6   MET B N   1 
ATOM   44   C  CA  . MET A 1 6   ? 134.175 -9.613  241.297 1.00 41.97  ? 6   MET B CA  1 
ATOM   45   C  C   . MET A 1 6   ? 134.603 -10.473 242.483 1.00 33.53  ? 6   MET B C   1 
ATOM   46   O  O   . MET A 1 6   ? 135.779 -10.474 242.861 1.00 37.54  ? 6   MET B O   1 
ATOM   47   C  CB  . MET A 1 6   ? 135.187 -9.699  240.157 1.00 42.39  ? 6   MET B CB  1 
ATOM   48   C  CG  . MET A 1 6   ? 134.589 -9.572  238.767 1.00 33.32  ? 6   MET B CG  1 
ATOM   49   S  SD  . MET A 1 6   ? 135.694 -10.178 237.474 1.00 53.56  ? 6   MET B SD  1 
ATOM   50   C  CE  . MET A 1 6   ? 137.123 -9.126  237.716 1.00 33.22  ? 6   MET B CE  1 
ATOM   51   N  N   . ILE A 1 7   ? 133.656 -11.192 243.079 1.00 35.02  ? 7   ILE B N   1 
ATOM   52   C  CA  . ILE A 1 7   ? 133.961 -12.084 244.195 1.00 42.71  ? 7   ILE B CA  1 
ATOM   53   C  C   . ILE A 1 7   ? 134.432 -13.411 243.608 1.00 39.78  ? 7   ILE B C   1 
ATOM   54   O  O   . ILE A 1 7   ? 133.653 -14.135 242.985 1.00 43.28  ? 7   ILE B O   1 
ATOM   55   C  CB  . ILE A 1 7   ? 132.750 -12.281 245.113 1.00 42.19  ? 7   ILE B CB  1 
ATOM   56   C  CG1 . ILE A 1 7   ? 132.040 -10.948 245.365 1.00 30.35  ? 7   ILE B CG1 1 
ATOM   57   C  CG2 . ILE A 1 7   ? 133.182 -12.915 246.428 1.00 40.04  ? 7   ILE B CG2 1 
ATOM   58   C  CD1 . ILE A 1 7   ? 132.864 -9.949  246.143 1.00 36.07  ? 7   ILE B CD1 1 
ATOM   59   N  N   . ARG A 1 8   ? 135.708 -13.732 243.807 1.00 36.04  ? 8   ARG B N   1 
ATOM   60   C  CA  . ARG A 1 8   ? 136.344 -14.852 243.129 1.00 43.34  ? 8   ARG B CA  1 
ATOM   61   C  C   . ARG A 1 8   ? 136.913 -15.837 244.138 1.00 50.84  ? 8   ARG B C   1 
ATOM   62   O  O   . ARG A 1 8   ? 137.575 -15.439 245.102 1.00 46.87  ? 8   ARG B O   1 
ATOM   63   C  CB  . ARG A 1 8   ? 137.450 -14.360 242.192 1.00 43.22  ? 8   ARG B CB  1 
ATOM   64   C  CG  . ARG A 1 8   ? 137.036 -13.199 241.301 1.00 39.84  ? 8   ARG B CG  1 
ATOM   65   C  CD  . ARG A 1 8   ? 137.854 -13.183 240.024 1.00 35.20  ? 8   ARG B CD  1 
ATOM   66   N  NE  . ARG A 1 8   ? 137.933 -14.512 239.427 1.00 48.40  ? 8   ARG B NE  1 
ATOM   67   C  CZ  . ARG A 1 8   ? 139.025 -15.008 238.855 1.00 55.47  ? 8   ARG B CZ  1 
ATOM   68   N  NH1 . ARG A 1 8   ? 140.134 -14.283 238.800 1.00 33.63  ? 8   ARG B NH1 1 
ATOM   69   N  NH2 . ARG A 1 8   ? 139.011 -16.231 238.341 1.00 55.44  ? 8   ARG B NH2 1 
ATOM   70   N  N   . ARG A 1 9   ? 136.652 -17.122 243.904 1.00 49.11  ? 9   ARG B N   1 
ATOM   71   C  CA  . ARG A 1 9   ? 137.255 -18.210 244.661 1.00 42.19  ? 9   ARG B CA  1 
ATOM   72   C  C   . ARG A 1 9   ? 137.383 -19.402 243.727 1.00 41.51  ? 9   ARG B C   1 
ATOM   73   O  O   . ARG A 1 9   ? 136.423 -19.739 243.027 1.00 43.51  ? 9   ARG B O   1 
ATOM   74   C  CB  . ARG A 1 9   ? 136.419 -18.583 245.890 1.00 41.92  ? 9   ARG B CB  1 
ATOM   75   C  CG  . ARG A 1 9   ? 136.599 -20.028 246.336 1.00 36.97  ? 9   ARG B CG  1 
ATOM   76   C  CD  . ARG A 1 9   ? 135.439 -20.504 247.198 1.00 58.09  ? 9   ARG B CD  1 
ATOM   77   N  NE  . ARG A 1 9   ? 135.228 -21.945 247.087 1.00 58.88  ? 9   ARG B NE  1 
ATOM   78   C  CZ  . ARG A 1 9   ? 135.956 -22.859 247.720 1.00 53.13  ? 9   ARG B CZ  1 
ATOM   79   N  NH1 . ARG A 1 9   ? 136.949 -22.482 248.509 1.00 55.35  ? 9   ARG B NH1 1 
ATOM   80   N  NH2 . ARG A 1 9   ? 135.694 -24.150 247.565 1.00 58.45  ? 9   ARG B NH2 1 
ATOM   81   N  N   . HIS A 1 10  ? 138.562 -20.029 243.721 1.00 37.41  ? 10  HIS B N   1 
ATOM   82   C  CA  . HIS A 1 10  ? 138.852 -21.136 242.815 1.00 45.79  ? 10  HIS B CA  1 
ATOM   83   C  C   . HIS A 1 10  ? 138.549 -20.728 241.379 1.00 35.15  ? 10  HIS B C   1 
ATOM   84   O  O   . HIS A 1 10  ? 139.160 -19.794 240.850 1.00 50.25  ? 10  HIS B O   1 
ATOM   85   C  CB  . HIS A 1 10  ? 138.052 -22.384 243.203 1.00 47.15  ? 10  HIS B CB  1 
ATOM   86   C  CG  . HIS A 1 10  ? 138.480 -23.001 244.498 1.00 50.59  ? 10  HIS B CG  1 
ATOM   87   N  ND1 . HIS A 1 10  ? 139.636 -22.635 245.152 1.00 70.98  ? 10  HIS B ND1 1 
ATOM   88   C  CD2 . HIS A 1 10  ? 137.906 -23.962 245.260 1.00 51.98  ? 10  HIS B CD2 1 
ATOM   89   C  CE1 . HIS A 1 10  ? 139.755 -23.342 246.262 1.00 58.66  ? 10  HIS B CE1 1 
ATOM   90   N  NE2 . HIS A 1 10  ? 138.719 -24.156 246.351 1.00 60.27  ? 10  HIS B NE2 1 
ATOM   91   N  N   . LYS A 1 11  ? 137.598 -21.414 240.747 1.00 32.90  ? 11  LYS B N   1 
ATOM   92   C  CA  . LYS A 1 11  ? 137.121 -21.052 239.421 1.00 48.04  ? 11  LYS B CA  1 
ATOM   93   C  C   . LYS A 1 11  ? 135.761 -20.371 239.456 1.00 53.60  ? 11  LYS B C   1 
ATOM   94   O  O   . LYS A 1 11  ? 135.211 -20.056 238.395 1.00 60.27  ? 11  LYS B O   1 
ATOM   95   C  CB  . LYS A 1 11  ? 137.064 -22.291 238.522 1.00 43.06  ? 11  LYS B CB  1 
ATOM   96   C  CG  . LYS A 1 11  ? 138.434 -22.864 238.203 1.00 45.06  ? 11  LYS B CG  1 
ATOM   97   C  CD  . LYS A 1 11  ? 138.339 -24.243 237.583 1.00 52.02  ? 11  LYS B CD  1 
ATOM   98   C  CE  . LYS A 1 11  ? 138.193 -24.153 236.076 1.00 45.42  ? 11  LYS B CE  1 
ATOM   99   N  NZ  . LYS A 1 11  ? 138.246 -25.493 235.435 1.00 57.96  ? 11  LYS B NZ  1 
ATOM   100  N  N   . THR A 1 12  ? 135.204 -20.141 240.643 1.00 44.61  ? 12  THR B N   1 
ATOM   101  C  CA  . THR A 1 12  ? 133.948 -19.419 240.769 1.00 48.43  ? 12  THR B CA  1 
ATOM   102  C  C   . THR A 1 12  ? 134.204 -17.917 240.766 1.00 39.58  ? 12  THR B C   1 
ATOM   103  O  O   . THR A 1 12  ? 135.217 -17.444 241.290 1.00 47.70  ? 12  THR B O   1 
ATOM   104  C  CB  . THR A 1 12  ? 133.223 -19.828 242.053 1.00 51.45  ? 12  THR B CB  1 
ATOM   105  O  OG1 . THR A 1 12  ? 133.178 -21.257 242.144 1.00 53.40  ? 12  THR B OG1 1 
ATOM   106  C  CG2 . THR A 1 12  ? 131.801 -19.282 242.070 1.00 42.15  ? 12  THR B CG2 1 
ATOM   107  N  N   . THR A 1 13  ? 133.284 -17.170 240.162 1.00 33.85  ? 13  THR B N   1 
ATOM   108  C  CA  . THR A 1 13  ? 133.391 -15.716 240.106 1.00 37.29  ? 13  THR B CA  1 
ATOM   109  C  C   . THR A 1 13  ? 131.991 -15.130 240.201 1.00 41.94  ? 13  THR B C   1 
ATOM   110  O  O   . THR A 1 13  ? 131.114 -15.490 239.410 1.00 51.08  ? 13  THR B O   1 
ATOM   111  C  CB  . THR A 1 13  ? 134.084 -15.259 238.820 1.00 33.86  ? 13  THR B CB  1 
ATOM   112  O  OG1 . THR A 1 13  ? 135.404 -15.813 238.764 1.00 54.61  ? 13  THR B OG1 1 
ATOM   113  C  CG2 . THR A 1 13  ? 134.176 -13.742 238.775 1.00 23.98  ? 13  THR B CG2 1 
ATOM   114  N  N   . ILE A 1 14  ? 131.784 -14.234 241.163 1.00 37.17  ? 14  ILE B N   1 
ATOM   115  C  CA  . ILE A 1 14  ? 130.482 -13.627 241.414 1.00 31.70  ? 14  ILE B CA  1 
ATOM   116  C  C   . ILE A 1 14  ? 130.547 -12.164 240.999 1.00 33.24  ? 14  ILE B C   1 
ATOM   117  O  O   . ILE A 1 14  ? 131.386 -11.405 241.499 1.00 35.31  ? 14  ILE B O   1 
ATOM   118  C  CB  . ILE A 1 14  ? 130.067 -13.762 242.888 1.00 42.65  ? 14  ILE B CB  1 
ATOM   119  C  CG1 . ILE A 1 14  ? 129.784 -15.225 243.235 1.00 46.52  ? 14  ILE B CG1 1 
ATOM   120  C  CG2 . ILE A 1 14  ? 128.849 -12.900 243.180 1.00 29.59  ? 14  ILE B CG2 1 
ATOM   121  C  CD1 . ILE A 1 14  ? 129.311 -15.434 244.660 1.00 35.60  ? 14  ILE B CD1 1 
ATOM   122  N  N   . PHE A 1 15  ? 129.665 -11.770 240.083 1.00 42.28  ? 15  PHE B N   1 
ATOM   123  C  CA  . PHE A 1 15  ? 129.508 -10.378 239.677 1.00 34.40  ? 15  PHE B CA  1 
ATOM   124  C  C   . PHE A 1 15  ? 128.371 -9.780  240.496 1.00 39.33  ? 15  PHE B C   1 
ATOM   125  O  O   . PHE A 1 15  ? 127.213 -10.183 240.348 1.00 38.50  ? 15  PHE B O   1 
ATOM   126  C  CB  . PHE A 1 15  ? 129.220 -10.266 238.181 1.00 21.61  ? 15  PHE B CB  1 
ATOM   127  C  CG  . PHE A 1 15  ? 130.429 -10.458 237.314 1.00 35.90  ? 15  PHE B CG  1 
ATOM   128  C  CD1 . PHE A 1 15  ? 130.799 -11.724 236.890 1.00 40.85  ? 15  PHE B CD1 1 
ATOM   129  C  CD2 . PHE A 1 15  ? 131.192 -9.373  236.916 1.00 31.32  ? 15  PHE B CD2 1 
ATOM   130  C  CE1 . PHE A 1 15  ? 131.911 -11.905 236.090 1.00 35.01  ? 15  PHE B CE1 1 
ATOM   131  C  CE2 . PHE A 1 15  ? 132.304 -9.547  236.114 1.00 30.70  ? 15  PHE B CE2 1 
ATOM   132  C  CZ  . PHE A 1 15  ? 132.664 -10.816 235.700 1.00 36.51  ? 15  PHE B CZ  1 
ATOM   133  N  N   . THR A 1 16  ? 128.699 -8.825  241.362 1.00 30.35  ? 16  THR B N   1 
ATOM   134  C  CA  . THR A 1 16  ? 127.698 -8.205  242.215 1.00 39.82  ? 16  THR B CA  1 
ATOM   135  C  C   . THR A 1 16  ? 128.128 -6.779  242.529 1.00 31.11  ? 16  THR B C   1 
ATOM   136  O  O   . THR A 1 16  ? 129.282 -6.393  242.323 1.00 35.39  ? 16  THR B O   1 
ATOM   137  C  CB  . THR A 1 16  ? 127.480 -9.012  243.501 1.00 46.92  ? 16  THR B CB  1 
ATOM   138  O  OG1 . THR A 1 16  ? 126.264 -8.591  244.133 1.00 42.30  ? 16  THR B OG1 1 
ATOM   139  C  CG2 . THR A 1 16  ? 128.644 -8.819  244.462 1.00 38.66  ? 16  THR B CG2 1 
ATOM   140  N  N   . ASP A 1 17  ? 127.176 -5.997  243.031 1.00 35.66  ? 17  ASP B N   1 
ATOM   141  C  CA  . ASP A 1 17  ? 127.402 -4.597  243.347 1.00 43.02  ? 17  ASP B CA  1 
ATOM   142  C  C   . ASP A 1 17  ? 126.942 -4.303  244.766 1.00 44.35  ? 17  ASP B C   1 
ATOM   143  O  O   . ASP A 1 17  ? 126.059 -4.976  245.305 1.00 54.24  ? 17  ASP B O   1 
ATOM   144  C  CB  . ASP A 1 17  ? 126.670 -3.670  242.366 1.00 39.03  ? 17  ASP B CB  1 
ATOM   145  C  CG  . ASP A 1 17  ? 125.161 -3.787  242.469 1.00 63.32  ? 17  ASP B CG  1 
ATOM   146  O  OD1 . ASP A 1 17  ? 124.622 -4.861  242.126 1.00 64.67  ? 17  ASP B OD1 1 
ATOM   147  O  OD2 . ASP A 1 17  ? 124.515 -2.808  242.897 1.00 74.59  ? 17  ASP B OD2 1 
ATOM   148  N  N   . ALA A 1 18  ? 127.552 -3.283  245.363 1.00 39.28  ? 18  ALA B N   1 
ATOM   149  C  CA  . ALA A 1 18  ? 127.185 -2.834  246.696 1.00 45.70  ? 18  ALA B CA  1 
ATOM   150  C  C   . ALA A 1 18  ? 127.568 -1.370  246.831 1.00 55.80  ? 18  ALA B C   1 
ATOM   151  O  O   . ALA A 1 18  ? 128.412 -0.859  246.091 1.00 50.29  ? 18  ALA B O   1 
ATOM   152  C  CB  . ALA A 1 18  ? 127.859 -3.676  247.785 1.00 31.66  ? 18  ALA B CB  1 
ATOM   153  N  N   . LYS A 1 19  ? 126.931 -0.693  247.779 1.00 55.80  ? 19  LYS B N   1 
ATOM   154  C  CA  . LYS A 1 19  ? 127.241 0.705   248.027 1.00 49.91  ? 19  LYS B CA  1 
ATOM   155  C  C   . LYS A 1 19  ? 128.570 0.830   248.763 1.00 38.15  ? 19  LYS B C   1 
ATOM   156  O  O   . LYS A 1 19  ? 128.942 -0.027  249.569 1.00 41.47  ? 19  LYS B O   1 
ATOM   157  C  CB  . LYS A 1 19  ? 126.125 1.374   248.831 1.00 41.59  ? 19  LYS B CB  1 
ATOM   158  C  CG  . LYS A 1 19  ? 124.758 1.313   248.162 1.00 49.41  ? 19  LYS B CG  1 
ATOM   159  C  CD  . LYS A 1 19  ? 124.215 2.703   247.855 1.00 47.18  ? 19  LYS B CD  1 
ATOM   160  C  CE  . LYS A 1 19  ? 125.047 3.411   246.796 1.00 68.73  ? 19  LYS B CE  1 
ATOM   161  N  NZ  . LYS A 1 19  ? 124.610 4.822   246.601 1.00 65.45  ? 19  LYS B NZ  1 
ATOM   162  N  N   . GLU A 1 20  ? 129.293 1.914   248.466 1.00 41.85  ? 20  GLU B N   1 
ATOM   163  C  CA  . GLU A 1 20  ? 130.607 2.115   249.068 1.00 43.39  ? 20  GLU B CA  1 
ATOM   164  C  C   . GLU A 1 20  ? 130.520 2.240   250.584 1.00 57.96  ? 20  GLU B C   1 
ATOM   165  O  O   . GLU A 1 20  ? 131.490 1.937   251.289 1.00 55.46  ? 20  GLU B O   1 
ATOM   166  C  CB  . GLU A 1 20  ? 131.275 3.353   248.468 1.00 40.26  ? 20  GLU B CB  1 
ATOM   167  C  CG  . GLU A 1 20  ? 132.744 3.511   248.837 1.00 61.03  ? 20  GLU B CG  1 
ATOM   168  C  CD  . GLU A 1 20  ? 133.416 4.652   248.097 1.00 78.19  ? 20  GLU B CD  1 
ATOM   169  O  OE1 . GLU A 1 20  ? 132.791 5.219   247.176 1.00 72.21  ? 20  GLU B OE1 1 
ATOM   170  O  OE2 . GLU A 1 20  ? 134.572 4.984   248.438 1.00 89.69  ? 20  GLU B OE2 1 
ATOM   171  N  N   . SER A 1 21  ? 129.374 2.674   251.102 1.00 59.41  ? 21  SER B N   1 
ATOM   172  C  CA  . SER A 1 21  ? 129.175 2.822   252.536 1.00 39.25  ? 21  SER B CA  1 
ATOM   173  C  C   . SER A 1 21  ? 128.686 1.542   253.206 1.00 45.82  ? 21  SER B C   1 
ATOM   174  O  O   . SER A 1 21  ? 128.465 1.544   254.422 1.00 47.79  ? 21  SER B O   1 
ATOM   175  C  CB  . SER A 1 21  ? 128.189 3.960   252.815 1.00 38.21  ? 21  SER B CB  1 
ATOM   176  O  OG  . SER A 1 21  ? 127.008 3.806   252.048 1.00 46.57  ? 21  SER B OG  1 
ATOM   177  N  N   . SER A 1 22  ? 128.515 0.458   252.455 1.00 47.41  ? 22  SER B N   1 
ATOM   178  C  CA  . SER A 1 22  ? 128.116 -0.807  253.049 1.00 52.92  ? 22  SER B CA  1 
ATOM   179  C  C   . SER A 1 22  ? 129.323 -1.505  253.673 1.00 56.13  ? 22  SER B C   1 
ATOM   180  O  O   . SER A 1 22  ? 130.474 -1.271  253.295 1.00 43.90  ? 22  SER B O   1 
ATOM   181  C  CB  . SER A 1 22  ? 127.462 -1.712  252.004 1.00 42.43  ? 22  SER B CB  1 
ATOM   182  O  OG  . SER A 1 22  ? 128.383 -2.064  250.987 1.00 51.51  ? 22  SER B OG  1 
ATOM   183  N  N   . THR A 1 23  ? 129.045 -2.373  254.640 1.00 48.40  ? 23  THR B N   1 
ATOM   184  C  CA  . THR A 1 23  ? 130.099 -3.037  255.392 1.00 56.96  ? 23  THR B CA  1 
ATOM   185  C  C   . THR A 1 23  ? 130.498 -4.356  254.737 1.00 43.92  ? 23  THR B C   1 
ATOM   186  O  O   . THR A 1 23  ? 129.771 -4.920  253.916 1.00 53.24  ? 23  THR B O   1 
ATOM   187  C  CB  . THR A 1 23  ? 129.662 -3.295  256.836 1.00 53.87  ? 23  THR B CB  1 
ATOM   188  O  OG1 . THR A 1 23  ? 128.555 -4.205  256.849 1.00 63.43  ? 23  THR B OG1 1 
ATOM   189  C  CG2 . THR A 1 23  ? 129.257 -1.994  257.512 1.00 37.19  ? 23  THR B CG2 1 
ATOM   190  N  N   . VAL A 1 24  ? 131.679 -4.843  255.124 1.00 50.64  ? 24  VAL B N   1 
ATOM   191  C  CA  . VAL A 1 24  ? 132.169 -6.124  254.622 1.00 43.86  ? 24  VAL B CA  1 
ATOM   192  C  C   . VAL A 1 24  ? 131.237 -7.253  255.044 1.00 47.02  ? 24  VAL B C   1 
ATOM   193  O  O   . VAL A 1 24  ? 130.994 -8.196  254.280 1.00 45.10  ? 24  VAL B O   1 
ATOM   194  C  CB  . VAL A 1 24  ? 133.613 -6.363  255.104 1.00 43.78  ? 24  VAL B CB  1 
ATOM   195  C  CG1 . VAL A 1 24  ? 134.009 -7.824  254.946 1.00 41.95  ? 24  VAL B CG1 1 
ATOM   196  C  CG2 . VAL A 1 24  ? 134.579 -5.460  254.352 1.00 49.65  ? 24  VAL B CG2 1 
ATOM   197  N  N   . PHE A 1 25  ? 130.689 -7.170  256.261 1.00 49.35  ? 25  PHE B N   1 
ATOM   198  C  CA  . PHE A 1 25  ? 129.776 -8.206  256.734 1.00 50.92  ? 25  PHE B CA  1 
ATOM   199  C  C   . PHE A 1 25  ? 128.560 -8.329  255.825 1.00 49.68  ? 25  PHE B C   1 
ATOM   200  O  O   . PHE A 1 25  ? 128.127 -9.442  255.502 1.00 50.61  ? 25  PHE B O   1 
ATOM   201  C  CB  . PHE A 1 25  ? 129.336 -7.914  258.169 1.00 55.04  ? 25  PHE B CB  1 
ATOM   202  C  CG  . PHE A 1 25  ? 128.306 -8.875  258.691 1.00 46.29  ? 25  PHE B CG  1 
ATOM   203  C  CD1 . PHE A 1 25  ? 128.685 -10.108 259.195 1.00 44.79  ? 25  PHE B CD1 1 
ATOM   204  C  CD2 . PHE A 1 25  ? 126.958 -8.551  258.669 1.00 38.52  ? 25  PHE B CD2 1 
ATOM   205  C  CE1 . PHE A 1 25  ? 127.743 -10.999 259.672 1.00 31.97  ? 25  PHE B CE1 1 
ATOM   206  C  CE2 . PHE A 1 25  ? 126.009 -9.438  259.143 1.00 46.02  ? 25  PHE B CE2 1 
ATOM   207  C  CZ  . PHE A 1 25  ? 126.403 -10.663 259.646 1.00 39.76  ? 25  PHE B CZ  1 
ATOM   208  N  N   . GLU A 1 26  ? 127.991 -7.197  255.405 1.00 47.23  ? 26  GLU B N   1 
ATOM   209  C  CA  . GLU A 1 26  ? 126.841 -7.243  254.509 1.00 55.61  ? 26  GLU B CA  1 
ATOM   210  C  C   . GLU A 1 26  ? 127.219 -7.794  253.141 1.00 50.52  ? 26  GLU B C   1 
ATOM   211  O  O   . GLU A 1 26  ? 126.368 -8.363  252.447 1.00 40.05  ? 26  GLU B O   1 
ATOM   212  C  CB  . GLU A 1 26  ? 126.219 -5.853  254.376 1.00 46.39  ? 26  GLU B CB  1 
ATOM   213  C  CG  . GLU A 1 26  ? 125.505 -5.377  255.632 1.00 60.73  ? 26  GLU B CG  1 
ATOM   214  C  CD  . GLU A 1 26  ? 124.441 -6.350  256.105 1.00 74.65  ? 26  GLU B CD  1 
ATOM   215  O  OE1 . GLU A 1 26  ? 123.712 -6.899  255.253 1.00 68.50  ? 26  GLU B OE1 1 
ATOM   216  O  OE2 . GLU A 1 26  ? 124.336 -6.569  257.331 1.00 83.83  ? 26  GLU B OE2 1 
ATOM   217  N  N   . LEU A 1 27  ? 128.481 -7.636  252.735 1.00 35.88  ? 27  LEU B N   1 
ATOM   218  C  CA  . LEU A 1 27  ? 128.940 -8.275  251.506 1.00 41.28  ? 27  LEU B CA  1 
ATOM   219  C  C   . LEU A 1 27  ? 128.991 -9.788  251.668 1.00 49.18  ? 27  LEU B C   1 
ATOM   220  O  O   . LEU A 1 27  ? 128.639 -10.530 250.744 1.00 49.61  ? 27  LEU B O   1 
ATOM   221  C  CB  . LEU A 1 27  ? 130.310 -7.728  251.104 1.00 44.13  ? 27  LEU B CB  1 
ATOM   222  C  CG  . LEU A 1 27  ? 130.895 -8.274  249.799 1.00 32.23  ? 27  LEU B CG  1 
ATOM   223  C  CD1 . LEU A 1 27  ? 129.918 -8.078  248.651 1.00 30.98  ? 27  LEU B CD1 1 
ATOM   224  C  CD2 . LEU A 1 27  ? 132.230 -7.613  249.487 1.00 35.60  ? 27  LEU B CD2 1 
ATOM   225  N  N   . LYS A 1 28  ? 129.424 -10.264 252.840 1.00 50.45  ? 28  LYS B N   1 
ATOM   226  C  CA  . LYS A 1 28  ? 129.406 -11.698 253.107 1.00 41.17  ? 28  LYS B CA  1 
ATOM   227  C  C   . LYS A 1 28  ? 127.983 -12.239 253.128 1.00 41.26  ? 28  LYS B C   1 
ATOM   228  O  O   . LYS A 1 28  ? 127.754 -13.399 252.767 1.00 49.86  ? 28  LYS B O   1 
ATOM   229  C  CB  . LYS A 1 28  ? 130.115 -11.995 254.429 1.00 41.66  ? 28  LYS B CB  1 
ATOM   230  C  CG  . LYS A 1 28  ? 131.610 -11.713 254.398 1.00 43.03  ? 28  LYS B CG  1 
ATOM   231  C  CD  . LYS A 1 28  ? 132.279 -12.041 255.723 1.00 38.77  ? 28  LYS B CD  1 
ATOM   232  C  CE  . LYS A 1 28  ? 133.789 -11.872 255.625 1.00 47.73  ? 28  LYS B CE  1 
ATOM   233  N  NZ  . LYS A 1 28  ? 134.481 -12.225 256.896 1.00 45.27  ? 28  LYS B NZ  1 
ATOM   234  N  N   . ARG A 1 29  ? 127.017 -11.416 253.543 1.00 48.81  ? 29  ARG B N   1 
ATOM   235  C  CA  . ARG A 1 29  ? 125.619 -11.825 253.473 1.00 51.00  ? 29  ARG B CA  1 
ATOM   236  C  C   . ARG A 1 29  ? 125.157 -11.986 252.031 1.00 48.69  ? 29  ARG B C   1 
ATOM   237  O  O   . ARG A 1 29  ? 124.292 -12.822 251.749 1.00 56.44  ? 29  ARG B O   1 
ATOM   238  C  CB  . ARG A 1 29  ? 124.739 -10.813 254.206 1.00 39.92  ? 29  ARG B CB  1 
ATOM   239  C  CG  . ARG A 1 29  ? 124.870 -10.857 255.720 1.00 39.92  ? 29  ARG B CG  1 
ATOM   240  C  CD  . ARG A 1 29  ? 124.024 -11.970 256.315 1.00 39.92  ? 29  ARG B CD  1 
ATOM   241  N  N   . ILE A 1 30  ? 125.717 -11.197 251.111 1.00 43.61  ? 30  ILE B N   1 
ATOM   242  C  CA  . ILE A 1 30  ? 125.406 -11.376 249.696 1.00 46.01  ? 30  ILE B CA  1 
ATOM   243  C  C   . ILE A 1 30  ? 125.965 -12.702 249.196 1.00 49.18  ? 30  ILE B C   1 
ATOM   244  O  O   . ILE A 1 30  ? 125.300 -13.430 248.450 1.00 52.46  ? 30  ILE B O   1 
ATOM   245  C  CB  . ILE A 1 30  ? 125.942 -10.188 248.876 1.00 55.74  ? 30  ILE B CB  1 
ATOM   246  C  CG1 . ILE A 1 30  ? 125.250 -8.891  249.303 1.00 63.16  ? 30  ILE B CG1 1 
ATOM   247  C  CG2 . ILE A 1 30  ? 125.750 -10.434 247.386 1.00 45.60  ? 30  ILE B CG2 1 
ATOM   248  C  CD1 . ILE A 1 30  ? 125.697 -7.673  248.521 1.00 60.86  ? 30  ILE B CD1 1 
ATOM   249  N  N   . VAL A 1 31  ? 127.191 -13.039 249.602 1.00 39.78  ? 31  VAL B N   1 
ATOM   250  C  CA  . VAL A 1 31  ? 127.780 -14.323 249.232 1.00 35.19  ? 31  VAL B CA  1 
ATOM   251  C  C   . VAL A 1 31  ? 126.984 -15.473 249.831 1.00 44.95  ? 31  VAL B C   1 
ATOM   252  O  O   . VAL A 1 31  ? 126.904 -16.559 249.241 1.00 45.86  ? 31  VAL B O   1 
ATOM   253  C  CB  . VAL A 1 31  ? 129.259 -14.374 249.668 1.00 36.74  ? 31  VAL B CB  1 
ATOM   254  C  CG1 . VAL A 1 31  ? 129.941 -15.617 249.115 1.00 34.61  ? 31  VAL B CG1 1 
ATOM   255  C  CG2 . VAL A 1 31  ? 129.989 -13.117 249.220 1.00 32.88  ? 31  VAL B CG2 1 
ATOM   256  N  N   . GLU A 1 32  ? 126.376 -15.257 251.000 1.00 54.50  ? 32  GLU B N   1 
ATOM   257  C  CA  . GLU A 1 32  ? 125.633 -16.325 251.662 1.00 51.84  ? 32  GLU B CA  1 
ATOM   258  C  C   . GLU A 1 32  ? 124.394 -16.720 250.867 1.00 50.57  ? 32  GLU B C   1 
ATOM   259  O  O   . GLU A 1 32  ? 124.078 -17.910 250.751 1.00 59.48  ? 32  GLU B O   1 
ATOM   260  C  CB  . GLU A 1 32  ? 125.248 -15.894 253.077 1.00 62.26  ? 32  GLU B CB  1 
ATOM   261  C  CG  . GLU A 1 32  ? 124.531 -16.967 253.879 1.00 61.23  ? 32  GLU B CG  1 
ATOM   262  C  CD  . GLU A 1 32  ? 124.022 -16.458 255.213 1.00 77.09  ? 32  GLU B CD  1 
ATOM   263  O  OE1 . GLU A 1 32  ? 123.811 -15.234 255.345 1.00 70.04  ? 32  GLU B OE1 1 
ATOM   264  O  OE2 . GLU A 1 32  ? 123.831 -17.283 256.131 1.00 75.42  ? 32  GLU B OE2 1 
ATOM   265  N  N   . GLY A 1 33  ? 123.680 -15.740 250.313 1.00 42.20  ? 33  GLY B N   1 
ATOM   266  C  CA  . GLY A 1 33  ? 122.494 -16.032 249.528 1.00 45.84  ? 33  GLY B CA  1 
ATOM   267  C  C   . GLY A 1 33  ? 122.770 -16.670 248.184 1.00 54.54  ? 33  GLY B C   1 
ATOM   268  O  O   . GLY A 1 33  ? 121.824 -17.115 247.524 1.00 62.53  ? 33  GLY B O   1 
ATOM   269  N  N   . ILE A 1 34  ? 124.031 -16.728 247.768 1.00 46.93  ? 34  ILE B N   1 
ATOM   270  C  CA  . ILE A 1 34  ? 124.424 -17.307 246.491 1.00 47.68  ? 34  ILE B CA  1 
ATOM   271  C  C   . ILE A 1 34  ? 125.092 -18.665 246.677 1.00 52.78  ? 34  ILE B C   1 
ATOM   272  O  O   . ILE A 1 34  ? 124.696 -19.652 246.057 1.00 50.31  ? 34  ILE B O   1 
ATOM   273  C  CB  . ILE A 1 34  ? 125.343 -16.342 245.708 1.00 46.87  ? 34  ILE B CB  1 
ATOM   274  C  CG1 . ILE A 1 34  ? 124.591 -15.060 245.346 1.00 44.85  ? 34  ILE B CG1 1 
ATOM   275  C  CG2 . ILE A 1 34  ? 125.884 -17.016 244.458 1.00 42.21  ? 34  ILE B CG2 1 
ATOM   276  C  CD1 . ILE A 1 34  ? 125.471 -13.994 244.730 1.00 44.61  ? 34  ILE B CD1 1 
ATOM   277  N  N   . LEU A 1 35  ? 126.107 -18.732 247.535 1.00 41.24  ? 35  LEU B N   1 
ATOM   278  C  CA  . LEU A 1 35  ? 126.898 -19.940 247.713 1.00 44.37  ? 35  LEU B CA  1 
ATOM   279  C  C   . LEU A 1 35  ? 126.499 -20.744 248.944 1.00 50.93  ? 35  LEU B C   1 
ATOM   280  O  O   . LEU A 1 35  ? 127.143 -21.756 249.238 1.00 54.66  ? 35  LEU B O   1 
ATOM   281  C  CB  . LEU A 1 35  ? 128.386 -19.583 247.782 1.00 40.64  ? 35  LEU B CB  1 
ATOM   282  C  CG  . LEU A 1 35  ? 128.932 -18.849 246.553 1.00 45.62  ? 35  LEU B CG  1 
ATOM   283  C  CD1 . LEU A 1 35  ? 130.449 -18.795 246.583 1.00 31.88  ? 35  LEU B CD1 1 
ATOM   284  C  CD2 . LEU A 1 35  ? 128.445 -19.509 245.270 1.00 37.51  ? 35  LEU B CD2 1 
ATOM   285  N  N   . LYS A 1 36  ? 125.458 -20.317 249.664 1.00 39.25  ? 36  LYS B N   1 
ATOM   286  C  CA  . LYS A 1 36  ? 124.912 -21.058 250.803 1.00 48.09  ? 36  LYS B CA  1 
ATOM   287  C  C   . LYS A 1 36  ? 125.969 -21.292 251.884 1.00 51.24  ? 36  LYS B C   1 
ATOM   288  O  O   . LYS A 1 36  ? 126.134 -22.400 252.395 1.00 59.40  ? 36  LYS B O   1 
ATOM   289  C  CB  . LYS A 1 36  ? 124.289 -22.381 250.347 1.00 50.82  ? 36  LYS B CB  1 
ATOM   290  C  CG  . LYS A 1 36  ? 123.342 -22.252 249.163 1.00 50.92  ? 36  LYS B CG  1 
ATOM   291  C  CD  . LYS A 1 36  ? 122.024 -21.613 249.570 1.00 62.33  ? 36  LYS B CD  1 
ATOM   292  C  CE  . LYS A 1 36  ? 121.020 -21.655 248.430 1.00 69.29  ? 36  LYS B CE  1 
ATOM   293  N  NZ  . LYS A 1 36  ? 120.821 -23.041 247.921 1.00 59.24  ? 36  LYS B NZ  1 
ATOM   294  N  N   . ARG A 1 37  ? 126.689 -20.228 252.233 1.00 50.70  ? 37  ARG B N   1 
ATOM   295  C  CA  . ARG A 1 37  ? 127.690 -20.297 253.291 1.00 52.74  ? 37  ARG B CA  1 
ATOM   296  C  C   . ARG A 1 37  ? 127.568 -19.078 254.199 1.00 65.11  ? 37  ARG B C   1 
ATOM   297  O  O   . ARG A 1 37  ? 127.684 -17.940 253.728 1.00 55.73  ? 37  ARG B O   1 
ATOM   298  C  CB  . ARG A 1 37  ? 129.099 -20.390 252.705 1.00 43.66  ? 37  ARG B CB  1 
ATOM   299  C  CG  . ARG A 1 37  ? 129.382 -21.672 251.934 1.00 49.22  ? 37  ARG B CG  1 
ATOM   300  C  CD  . ARG A 1 37  ? 129.343 -22.898 252.838 1.00 43.41  ? 37  ARG B CD  1 
ATOM   301  N  NE  . ARG A 1 37  ? 130.460 -22.928 253.778 1.00 53.43  ? 37  ARG B NE  1 
ATOM   302  C  CZ  . ARG A 1 37  ? 131.634 -23.498 253.528 1.00 50.47  ? 37  ARG B CZ  1 
ATOM   303  N  NH1 . ARG A 1 37  ? 131.853 -24.092 252.363 1.00 36.50  ? 37  ARG B NH1 1 
ATOM   304  N  NH2 . ARG A 1 37  ? 132.593 -23.474 254.445 1.00 53.04  ? 37  ARG B NH2 1 
ATOM   305  N  N   . PRO A 1 38  ? 127.336 -19.273 255.494 1.00 67.28  ? 38  PRO B N   1 
ATOM   306  C  CA  . PRO A 1 38  ? 127.161 -18.133 256.407 1.00 58.94  ? 38  PRO B CA  1 
ATOM   307  C  C   . PRO A 1 38  ? 128.444 -17.332 256.540 1.00 54.88  ? 38  PRO B C   1 
ATOM   308  O  O   . PRO A 1 38  ? 129.540 -17.849 256.275 1.00 55.90  ? 38  PRO B O   1 
ATOM   309  C  CB  . PRO A 1 38  ? 126.770 -18.798 257.737 1.00 65.90  ? 38  PRO B CB  1 
ATOM   310  C  CG  . PRO A 1 38  ? 127.241 -20.208 257.620 1.00 60.23  ? 38  PRO B CG  1 
ATOM   311  C  CD  . PRO A 1 38  ? 127.134 -20.565 256.170 1.00 57.52  ? 38  PRO B CD  1 
ATOM   312  N  N   . PRO A 1 39  ? 128.349 -16.062 256.948 1.00 53.72  ? 39  PRO B N   1 
ATOM   313  C  CA  . PRO A 1 39  ? 129.550 -15.208 256.990 1.00 44.71  ? 39  PRO B CA  1 
ATOM   314  C  C   . PRO A 1 39  ? 130.617 -15.681 257.959 1.00 56.60  ? 39  PRO B C   1 
ATOM   315  O  O   . PRO A 1 39  ? 131.788 -15.325 257.782 1.00 58.00  ? 39  PRO B O   1 
ATOM   316  C  CB  . PRO A 1 39  ? 128.993 -13.838 257.402 1.00 46.00  ? 39  PRO B CB  1 
ATOM   317  C  CG  . PRO A 1 39  ? 127.540 -13.889 257.056 1.00 41.39  ? 39  PRO B CG  1 
ATOM   318  C  CD  . PRO A 1 39  ? 127.127 -15.311 257.279 1.00 54.95  ? 39  PRO B CD  1 
ATOM   319  N  N   . ASP A 1 40  ? 130.259 -16.464 258.980 1.00 63.14  ? 40  ASP B N   1 
ATOM   320  C  CA  . ASP A 1 40  ? 131.264 -16.952 259.917 1.00 64.80  ? 40  ASP B CA  1 
ATOM   321  C  C   . ASP A 1 40  ? 132.253 -17.901 259.254 1.00 65.46  ? 40  ASP B C   1 
ATOM   322  O  O   . ASP A 1 40  ? 133.349 -18.111 259.786 1.00 60.07  ? 40  ASP B O   1 
ATOM   323  C  CB  . ASP A 1 40  ? 130.589 -17.642 261.103 1.00 64.25  ? 40  ASP B CB  1 
ATOM   324  C  CG  . ASP A 1 40  ? 129.609 -18.714 260.672 1.00 79.11  ? 40  ASP B CG  1 
ATOM   325  O  OD1 . ASP A 1 40  ? 129.536 -19.005 259.461 1.00 86.16  ? 40  ASP B OD1 1 
ATOM   326  O  OD2 . ASP A 1 40  ? 128.910 -19.268 261.545 1.00 67.49  ? 40  ASP B OD2 1 
ATOM   327  N  N   . GLU A 1 41  ? 131.891 -18.479 258.109 1.00 61.19  ? 41  GLU B N   1 
ATOM   328  C  CA  . GLU A 1 41  ? 132.762 -19.375 257.363 1.00 50.12  ? 41  GLU B CA  1 
ATOM   329  C  C   . GLU A 1 41  ? 133.391 -18.699 256.149 1.00 51.63  ? 41  GLU B C   1 
ATOM   330  O  O   . GLU A 1 41  ? 133.866 -19.389 255.241 1.00 66.89  ? 41  GLU B O   1 
ATOM   331  C  CB  . GLU A 1 41  ? 131.986 -20.622 256.934 1.00 58.19  ? 41  GLU B CB  1 
ATOM   332  C  CG  . GLU A 1 41  ? 131.345 -21.378 258.087 1.00 71.46  ? 41  GLU B CG  1 
ATOM   333  C  CD  . GLU A 1 41  ? 130.158 -22.214 257.650 1.00 65.02  ? 41  GLU B CD  1 
ATOM   334  O  OE1 . GLU A 1 41  ? 129.939 -22.345 256.428 1.00 69.75  ? 41  GLU B OE1 1 
ATOM   335  O  OE2 . GLU A 1 41  ? 129.444 -22.741 258.529 1.00 55.49  ? 41  GLU B OE2 1 
ATOM   336  N  N   . GLN A 1 42  ? 133.406 -17.368 256.115 1.00 53.98  ? 42  GLN B N   1 
ATOM   337  C  CA  . GLN A 1 42  ? 133.933 -16.617 254.985 1.00 49.68  ? 42  GLN B CA  1 
ATOM   338  C  C   . GLN A 1 42  ? 135.104 -15.748 255.422 1.00 43.09  ? 42  GLN B C   1 
ATOM   339  O  O   . GLN A 1 42  ? 135.161 -15.274 256.561 1.00 49.91  ? 42  GLN B O   1 
ATOM   340  C  CB  . GLN A 1 42  ? 132.855 -15.732 254.348 1.00 33.47  ? 42  GLN B CB  1 
ATOM   341  C  CG  . GLN A 1 42  ? 131.630 -16.482 253.858 1.00 32.55  ? 42  GLN B CG  1 
ATOM   342  C  CD  . GLN A 1 42  ? 130.635 -15.571 253.167 1.00 34.42  ? 42  GLN B CD  1 
ATOM   343  O  OE1 . GLN A 1 42  ? 131.011 -14.562 252.570 1.00 34.82  ? 42  GLN B OE1 1 
ATOM   344  N  NE2 . GLN A 1 42  ? 129.356 -15.921 253.247 1.00 39.42  ? 42  GLN B NE2 1 
ATOM   345  N  N   . ARG A 1 43  ? 136.036 -15.538 254.492 1.00 45.66  ? 43  ARG B N   1 
ATOM   346  C  CA  . ARG A 1 43  ? 137.187 -14.658 254.702 1.00 48.35  ? 43  ARG B CA  1 
ATOM   347  C  C   . ARG A 1 43  ? 137.408 -13.891 253.402 1.00 54.45  ? 43  ARG B C   1 
ATOM   348  O  O   . ARG A 1 43  ? 137.916 -14.448 252.425 1.00 56.32  ? 43  ARG B O   1 
ATOM   349  C  CB  . ARG A 1 43  ? 138.430 -15.445 255.098 1.00 59.80  ? 43  ARG B CB  1 
ATOM   350  C  CG  . ARG A 1 43  ? 138.605 -15.645 256.595 1.00 59.77  ? 43  ARG B CG  1 
ATOM   351  C  CD  . ARG A 1 43  ? 139.955 -16.278 256.898 1.00 61.11  ? 43  ARG B CD  1 
ATOM   352  N  NE  . ARG A 1 43  ? 140.189 -16.432 258.331 1.00 81.77  ? 43  ARG B NE  1 
ATOM   353  C  CZ  . ARG A 1 43  ? 141.311 -16.915 258.855 1.00 68.72  ? 43  ARG B CZ  1 
ATOM   354  N  NH1 . ARG A 1 43  ? 142.307 -17.289 258.064 1.00 64.93  ? 43  ARG B NH1 1 
ATOM   355  N  NH2 . ARG A 1 43  ? 141.439 -17.023 260.171 1.00 58.38  ? 43  ARG B NH2 1 
ATOM   356  N  N   . LEU A 1 44  ? 137.021 -12.618 253.392 1.00 51.27  ? 44  LEU B N   1 
ATOM   357  C  CA  . LEU A 1 44  ? 137.163 -11.782 252.210 1.00 42.26  ? 44  LEU B CA  1 
ATOM   358  C  C   . LEU A 1 44  ? 138.522 -11.095 252.208 1.00 37.14  ? 44  LEU B C   1 
ATOM   359  O  O   . LEU A 1 44  ? 139.000 -10.629 253.246 1.00 50.86  ? 44  LEU B O   1 
ATOM   360  C  CB  . LEU A 1 44  ? 136.046 -10.741 252.146 1.00 41.39  ? 44  LEU B CB  1 
ATOM   361  C  CG  . LEU A 1 44  ? 134.629 -11.287 251.952 1.00 39.97  ? 44  LEU B CG  1 
ATOM   362  C  CD1 . LEU A 1 44  ? 133.638 -10.149 251.775 1.00 42.74  ? 44  LEU B CD1 1 
ATOM   363  C  CD2 . LEU A 1 44  ? 134.571 -12.242 250.768 1.00 34.24  ? 44  LEU B CD2 1 
ATOM   364  N  N   . TYR A 1 45  ? 139.139 -11.038 251.031 1.00 45.75  ? 45  TYR B N   1 
ATOM   365  C  CA  . TYR A 1 45  ? 140.457 -10.448 250.852 1.00 51.57  ? 45  TYR B CA  1 
ATOM   366  C  C   . TYR A 1 45  ? 140.408 -9.388  249.762 1.00 47.21  ? 45  TYR B C   1 
ATOM   367  O  O   . TYR A 1 45  ? 139.731 -9.564  248.743 1.00 44.80  ? 45  TYR B O   1 
ATOM   368  C  CB  . TYR A 1 45  ? 141.499 -11.507 250.462 1.00 44.42  ? 45  TYR B CB  1 
ATOM   369  C  CG  . TYR A 1 45  ? 141.815 -12.533 251.527 1.00 55.04  ? 45  TYR B CG  1 
ATOM   370  C  CD1 . TYR A 1 45  ? 140.936 -13.572 251.801 1.00 57.43  ? 45  TYR B CD1 1 
ATOM   371  C  CD2 . TYR A 1 45  ? 143.005 -12.475 252.242 1.00 56.36  ? 45  TYR B CD2 1 
ATOM   372  C  CE1 . TYR A 1 45  ? 141.226 -14.517 252.767 1.00 64.09  ? 45  TYR B CE1 1 
ATOM   373  C  CE2 . TYR A 1 45  ? 143.303 -13.416 253.210 1.00 61.20  ? 45  TYR B CE2 1 
ATOM   374  C  CZ  . TYR A 1 45  ? 142.410 -14.435 253.468 1.00 68.81  ? 45  TYR B CZ  1 
ATOM   375  O  OH  . TYR A 1 45  ? 142.700 -15.375 254.431 1.00 80.39  ? 45  TYR B OH  1 
ATOM   376  N  N   . LYS A 1 46  ? 141.124 -8.288  249.978 1.00 42.74  ? 46  LYS B N   1 
ATOM   377  C  CA  . LYS A 1 46  ? 141.515 -7.393  248.897 1.00 44.76  ? 46  LYS B CA  1 
ATOM   378  C  C   . LYS A 1 46  ? 142.986 -7.662  248.615 1.00 53.24  ? 46  LYS B C   1 
ATOM   379  O  O   . LYS A 1 46  ? 143.850 -7.338  249.437 1.00 55.59  ? 46  LYS B O   1 
ATOM   380  C  CB  . LYS A 1 46  ? 141.287 -5.924  249.238 1.00 54.17  ? 46  LYS B CB  1 
ATOM   381  C  CG  . LYS A 1 46  ? 141.668 -5.019  248.075 1.00 42.83  ? 46  LYS B CG  1 
ATOM   382  C  CD  . LYS A 1 46  ? 141.345 -3.563  248.318 1.00 52.49  ? 46  LYS B CD  1 
ATOM   383  C  CE  . LYS A 1 46  ? 141.873 -2.713  247.176 1.00 45.39  ? 46  LYS B CE  1 
ATOM   384  N  NZ  . LYS A 1 46  ? 143.310 -3.000  246.900 1.00 51.93  ? 46  LYS B NZ  1 
ATOM   385  N  N   . ASP A 1 47  ? 143.263 -8.252  247.451 1.00 66.31  ? 47  ASP B N   1 
ATOM   386  C  CA  . ASP A 1 47  ? 144.579 -8.795  247.140 1.00 55.82  ? 47  ASP B CA  1 
ATOM   387  C  C   . ASP A 1 47  ? 144.970 -9.799  248.219 1.00 60.03  ? 47  ASP B C   1 
ATOM   388  O  O   . ASP A 1 47  ? 144.363 -10.871 248.311 1.00 65.45  ? 47  ASP B O   1 
ATOM   389  C  CB  . ASP A 1 47  ? 145.610 -7.675  246.988 1.00 52.67  ? 47  ASP B CB  1 
ATOM   390  C  CG  . ASP A 1 47  ? 145.409 -6.872  245.714 1.00 79.89  ? 47  ASP B CG  1 
ATOM   391  O  OD1 . ASP A 1 47  ? 145.579 -7.446  244.618 1.00 85.92  ? 47  ASP B OD1 1 
ATOM   392  O  OD2 . ASP A 1 47  ? 145.067 -5.675  245.806 1.00 75.38  ? 47  ASP B OD2 1 
ATOM   393  N  N   . ASP A 1 48  ? 145.958 -9.472  249.052 1.00 60.46  ? 48  ASP B N   1 
ATOM   394  C  CA  . ASP A 1 48  ? 146.358 -10.383 250.117 1.00 59.75  ? 48  ASP B CA  1 
ATOM   395  C  C   . ASP A 1 48  ? 145.865 -9.965  251.497 1.00 69.34  ? 48  ASP B C   1 
ATOM   396  O  O   . ASP A 1 48  ? 145.875 -10.794 252.414 1.00 53.95  ? 48  ASP B O   1 
ATOM   397  C  CB  . ASP A 1 48  ? 147.887 -10.533 250.152 1.00 64.03  ? 48  ASP B CB  1 
ATOM   398  C  CG  . ASP A 1 48  ? 148.608 -9.202  250.268 1.00 86.35  ? 48  ASP B CG  1 
ATOM   399  O  OD1 . ASP A 1 48  ? 148.034 -8.169  249.864 1.00 77.88  ? 48  ASP B OD1 1 
ATOM   400  O  OD2 . ASP A 1 48  ? 149.755 -9.192  250.762 1.00 103.94 ? 48  ASP B OD2 1 
ATOM   401  N  N   . GLN A 1 49  ? 145.422 -8.722  251.667 1.00 68.02  ? 49  GLN B N   1 
ATOM   402  C  CA  . GLN A 1 49  ? 145.006 -8.236  252.976 1.00 57.85  ? 49  GLN B CA  1 
ATOM   403  C  C   . GLN A 1 49  ? 143.594 -8.707  253.303 1.00 64.18  ? 49  GLN B C   1 
ATOM   404  O  O   . GLN A 1 49  ? 142.684 -8.596  252.476 1.00 61.09  ? 49  GLN B O   1 
ATOM   405  C  CB  . GLN A 1 49  ? 145.075 -6.710  253.020 1.00 51.65  ? 49  GLN B CB  1 
ATOM   406  C  CG  . GLN A 1 49  ? 144.737 -6.115  254.377 1.00 58.83  ? 49  GLN B CG  1 
ATOM   407  C  CD  . GLN A 1 49  ? 145.879 -5.304  254.956 1.00 76.83  ? 49  GLN B CD  1 
ATOM   408  O  OE1 . GLN A 1 49  ? 146.631 -4.659  254.225 1.00 82.40  ? 49  GLN B OE1 1 
ATOM   409  N  NE2 . GLN A 1 49  ? 146.015 -5.333  256.277 1.00 68.51  ? 49  GLN B NE2 1 
ATOM   410  N  N   . LEU A 1 50  ? 143.414 -9.226  254.515 1.00 54.95  ? 50  LEU B N   1 
ATOM   411  C  CA  . LEU A 1 50  ? 142.100 -9.646  254.980 1.00 49.77  ? 50  LEU B CA  1 
ATOM   412  C  C   . LEU A 1 50  ? 141.272 -8.437  255.399 1.00 59.78  ? 50  LEU B C   1 
ATOM   413  O  O   . LEU A 1 50  ? 141.795 -7.450  255.925 1.00 71.11  ? 50  LEU B O   1 
ATOM   414  C  CB  . LEU A 1 50  ? 142.226 -10.624 256.149 1.00 39.41  ? 50  LEU B CB  1 
ATOM   415  C  CG  . LEU A 1 50  ? 140.932 -11.280 256.637 1.00 49.57  ? 50  LEU B CG  1 
ATOM   416  C  CD1 . LEU A 1 50  ? 140.750 -12.648 256.001 1.00 54.27  ? 50  LEU B CD1 1 
ATOM   417  C  CD2 . LEU A 1 50  ? 140.909 -11.382 258.155 1.00 56.04  ? 50  LEU B CD2 1 
ATOM   418  N  N   . LEU A 1 51  ? 139.966 -8.523  255.162 1.00 50.74  ? 51  LEU B N   1 
ATOM   419  C  CA  . LEU A 1 51  ? 139.041 -7.433  255.433 1.00 63.87  ? 51  LEU B CA  1 
ATOM   420  C  C   . LEU A 1 51  ? 138.202 -7.748  256.664 1.00 61.03  ? 51  LEU B C   1 
ATOM   421  O  O   . LEU A 1 51  ? 137.713 -8.871  256.825 1.00 62.08  ? 51  LEU B O   1 
ATOM   422  C  CB  . LEU A 1 51  ? 138.129 -7.179  254.229 1.00 53.62  ? 51  LEU B CB  1 
ATOM   423  C  CG  . LEU A 1 51  ? 138.774 -7.317  252.847 1.00 49.00  ? 51  LEU B CG  1 
ATOM   424  C  CD1 . LEU A 1 51  ? 137.737 -7.145  251.748 1.00 44.12  ? 51  LEU B CD1 1 
ATOM   425  C  CD2 . LEU A 1 51  ? 139.910 -6.317  252.676 1.00 51.84  ? 51  LEU B CD2 1 
ATOM   426  N  N   . ASP A 1 52  ? 138.039 -6.750  257.529 1.00 65.25  ? 52  ASP B N   1 
ATOM   427  C  CA  . ASP A 1 52  ? 137.239 -6.893  258.737 1.00 64.35  ? 52  ASP B CA  1 
ATOM   428  C  C   . ASP A 1 52  ? 135.777 -6.585  258.439 1.00 61.50  ? 52  ASP B C   1 
ATOM   429  O  O   . ASP A 1 52  ? 135.466 -5.651  257.694 1.00 63.73  ? 52  ASP B O   1 
ATOM   430  C  CB  . ASP A 1 52  ? 137.757 -5.968  259.840 1.00 69.42  ? 52  ASP B CB  1 
ATOM   431  C  CG  . ASP A 1 52  ? 139.054 -6.461  260.454 1.00 87.55  ? 52  ASP B CG  1 
ATOM   432  O  OD1 . ASP A 1 52  ? 139.676 -7.378  259.877 1.00 87.40  ? 52  ASP B OD1 1 
ATOM   433  O  OD2 . ASP A 1 52  ? 139.452 -5.930  261.511 1.00 106.52 ? 52  ASP B OD2 1 
ATOM   434  N  N   . ASP A 1 53  ? 134.882 -7.377  259.038 1.00 51.68  ? 53  ASP B N   1 
ATOM   435  C  CA  . ASP A 1 53  ? 133.453 -7.247  258.772 1.00 58.99  ? 53  ASP B CA  1 
ATOM   436  C  C   . ASP A 1 53  ? 132.901 -5.878  259.147 1.00 54.59  ? 53  ASP B C   1 
ATOM   437  O  O   . ASP A 1 53  ? 131.905 -5.445  258.559 1.00 53.28  ? 53  ASP B O   1 
ATOM   438  C  CB  . ASP A 1 53  ? 132.678 -8.331  259.524 1.00 54.43  ? 53  ASP B CB  1 
ATOM   439  C  CG  . ASP A 1 53  ? 133.224 -9.721  259.270 1.00 73.50  ? 53  ASP B CG  1 
ATOM   440  O  OD1 . ASP A 1 53  ? 134.291 -9.836  258.633 1.00 72.96  ? 53  ASP B OD1 1 
ATOM   441  O  OD2 . ASP A 1 53  ? 132.580 -10.699 259.706 1.00 65.33  ? 53  ASP B OD2 1 
ATOM   442  N  N   . GLY A 1 54  ? 133.514 -5.193  260.108 1.00 48.40  ? 54  GLY B N   1 
ATOM   443  C  CA  . GLY A 1 54  ? 133.022 -3.902  260.541 1.00 50.17  ? 54  GLY B CA  1 
ATOM   444  C  C   . GLY A 1 54  ? 133.344 -2.769  259.589 1.00 59.15  ? 54  GLY B C   1 
ATOM   445  O  O   . GLY A 1 54  ? 132.527 -1.863  259.397 1.00 50.13  ? 54  GLY B O   1 
ATOM   446  N  N   . LYS A 1 55  ? 134.533 -2.806  258.990 1.00 47.93  ? 55  LYS B N   1 
ATOM   447  C  CA  . LYS A 1 55  ? 134.949 -1.750  258.078 1.00 63.20  ? 55  LYS B CA  1 
ATOM   448  C  C   . LYS A 1 55  ? 134.013 -1.669  256.878 1.00 52.27  ? 55  LYS B C   1 
ATOM   449  O  O   . LYS A 1 55  ? 133.465 -2.674  256.416 1.00 59.25  ? 55  LYS B O   1 
ATOM   450  C  CB  . LYS A 1 55  ? 136.382 -1.991  257.601 1.00 54.10  ? 55  LYS B CB  1 
ATOM   451  C  CG  . LYS A 1 55  ? 137.432 -1.857  258.689 1.00 69.80  ? 55  LYS B CG  1 
ATOM   452  C  CD  . LYS A 1 55  ? 138.834 -2.021  258.125 1.00 56.53  ? 55  LYS B CD  1 
ATOM   453  C  CE  . LYS A 1 55  ? 139.035 -3.407  257.535 1.00 79.25  ? 55  LYS B CE  1 
ATOM   454  N  NZ  . LYS A 1 55  ? 140.391 -3.562  256.941 1.00 67.74  ? 55  LYS B NZ  1 
ATOM   455  N  N   . THR A 1 56  ? 133.824 -0.452  256.380 1.00 49.36  ? 56  THR B N   1 
ATOM   456  C  CA  . THR A 1 56  ? 133.053 -0.256  255.166 1.00 53.96  ? 56  THR B CA  1 
ATOM   457  C  C   . THR A 1 56  ? 133.910 -0.578  253.946 1.00 55.76  ? 56  THR B C   1 
ATOM   458  O  O   . THR A 1 56  ? 135.142 -0.621  254.013 1.00 49.03  ? 56  THR B O   1 
ATOM   459  C  CB  . THR A 1 56  ? 132.518 1.176   255.086 1.00 50.01  ? 56  THR B CB  1 
ATOM   460  O  OG1 . THR A 1 56  ? 131.586 1.282   254.005 1.00 47.52  ? 56  THR B OG1 1 
ATOM   461  C  CG2 . THR A 1 56  ? 133.644 2.167   254.867 1.00 60.37  ? 56  THR B CG2 1 
ATOM   462  N  N   . LEU A 1 57  ? 133.237 -0.827  252.818 1.00 45.66  ? 57  LEU B N   1 
ATOM   463  C  CA  . LEU A 1 57  ? 133.963 -1.112  251.585 1.00 52.25  ? 57  LEU B CA  1 
ATOM   464  C  C   . LEU A 1 57  ? 134.854 0.055   251.183 1.00 56.57  ? 57  LEU B C   1 
ATOM   465  O  O   . LEU A 1 57  ? 135.912 -0.152  250.577 1.00 50.79  ? 57  LEU B O   1 
ATOM   466  C  CB  . LEU A 1 57  ? 132.984 -1.456  250.463 1.00 42.52  ? 57  LEU B CB  1 
ATOM   467  C  CG  . LEU A 1 57  ? 132.010 -2.601  250.755 1.00 50.02  ? 57  LEU B CG  1 
ATOM   468  C  CD1 . LEU A 1 57  ? 131.183 -2.933  249.523 1.00 56.34  ? 57  LEU B CD1 1 
ATOM   469  C  CD2 . LEU A 1 57  ? 132.754 -3.831  251.256 1.00 48.30  ? 57  LEU B CD2 1 
ATOM   470  N  N   . GLY A 1 58  ? 134.453 1.282   251.519 1.00 56.96  ? 58  GLY B N   1 
ATOM   471  C  CA  . GLY A 1 58  ? 135.317 2.423   251.268 1.00 57.36  ? 58  GLY B CA  1 
ATOM   472  C  C   . GLY A 1 58  ? 136.585 2.385   252.098 1.00 59.13  ? 58  GLY B C   1 
ATOM   473  O  O   . GLY A 1 58  ? 137.671 2.697   251.604 1.00 58.44  ? 58  GLY B O   1 
ATOM   474  N  N   . GLU A 1 59  ? 136.467 1.995   253.370 1.00 54.68  ? 59  GLU B N   1 
ATOM   475  C  CA  . GLU A 1 59  ? 137.632 1.890   254.242 1.00 56.34  ? 59  GLU B CA  1 
ATOM   476  C  C   . GLU A 1 59  ? 138.579 0.778   253.812 1.00 57.04  ? 59  GLU B C   1 
ATOM   477  O  O   . GLU A 1 59  ? 139.740 0.773   254.234 1.00 48.56  ? 59  GLU B O   1 
ATOM   478  C  CB  . GLU A 1 59  ? 137.195 1.652   255.690 1.00 60.71  ? 59  GLU B CB  1 
ATOM   479  C  CG  . GLU A 1 59  ? 136.762 2.903   256.439 1.00 57.78  ? 59  GLU B CG  1 
ATOM   480  C  CD  . GLU A 1 59  ? 136.123 2.585   257.779 1.00 72.56  ? 59  GLU B CD  1 
ATOM   481  O  OE1 . GLU A 1 59  ? 136.725 1.817   258.559 1.00 67.88  ? 59  GLU B OE1 1 
ATOM   482  O  OE2 . GLU A 1 59  ? 135.018 3.097   258.049 1.00 76.07  ? 59  GLU B OE2 1 
ATOM   483  N  N   . CYS A 1 60  ? 138.112 -0.161  252.990 1.00 55.36  ? 60  CYS B N   1 
ATOM   484  C  CA  . CYS A 1 60  ? 138.943 -1.260  252.521 1.00 62.17  ? 60  CYS B CA  1 
ATOM   485  C  C   . CYS A 1 60  ? 139.661 -0.951  251.214 1.00 67.41  ? 60  CYS B C   1 
ATOM   486  O  O   . CYS A 1 60  ? 140.503 -1.748  250.788 1.00 61.81  ? 60  CYS B O   1 
ATOM   487  C  CB  . CYS A 1 60  ? 138.095 -2.525  252.350 1.00 60.35  ? 60  CYS B CB  1 
ATOM   488  S  SG  . CYS A 1 60  ? 137.292 -3.087  253.868 1.00 78.82  ? 60  CYS B SG  1 
ATOM   489  N  N   . GLY A 1 61  ? 139.355 0.173   250.574 1.00 55.97  ? 61  GLY B N   1 
ATOM   490  C  CA  . GLY A 1 61  ? 139.993 0.553   249.333 1.00 52.18  ? 61  GLY B CA  1 
ATOM   491  C  C   . GLY A 1 61  ? 139.152 0.383   248.086 1.00 61.85  ? 61  GLY B C   1 
ATOM   492  O  O   . GLY A 1 61  ? 139.680 0.555   246.980 1.00 63.86  ? 61  GLY B O   1 
ATOM   493  N  N   . PHE A 1 62  ? 137.868 0.053   248.220 1.00 53.94  ? 62  PHE B N   1 
ATOM   494  C  CA  . PHE A 1 62  ? 136.981 -0.124  247.072 1.00 51.89  ? 62  PHE B CA  1 
ATOM   495  C  C   . PHE A 1 62  ? 136.186 1.163   246.875 1.00 63.24  ? 62  PHE B C   1 
ATOM   496  O  O   . PHE A 1 62  ? 135.040 1.295   247.303 1.00 61.61  ? 62  PHE B O   1 
ATOM   497  C  CB  . PHE A 1 62  ? 136.069 -1.329  247.276 1.00 52.15  ? 62  PHE B CB  1 
ATOM   498  C  CG  . PHE A 1 62  ? 136.805 -2.626  247.428 1.00 51.12  ? 62  PHE B CG  1 
ATOM   499  C  CD1 . PHE A 1 62  ? 137.529 -3.152  246.372 1.00 54.50  ? 62  PHE B CD1 1 
ATOM   500  C  CD2 . PHE A 1 62  ? 136.775 -3.319  248.626 1.00 51.12  ? 62  PHE B CD2 1 
ATOM   501  C  CE1 . PHE A 1 62  ? 138.209 -4.346  246.507 1.00 57.52  ? 62  PHE B CE1 1 
ATOM   502  C  CE2 . PHE A 1 62  ? 137.453 -4.513  248.768 1.00 53.38  ? 62  PHE B CE2 1 
ATOM   503  C  CZ  . PHE A 1 62  ? 138.170 -5.027  247.706 1.00 59.65  ? 62  PHE B CZ  1 
ATOM   504  N  N   . THR A 1 63  ? 136.816 2.127   246.213 1.00 71.18  ? 63  THR B N   1 
ATOM   505  C  CA  . THR A 1 63  ? 136.160 3.392   245.926 1.00 66.24  ? 63  THR B CA  1 
ATOM   506  C  C   . THR A 1 63  ? 135.350 3.290   244.636 1.00 58.55  ? 63  THR B C   1 
ATOM   507  O  O   . THR A 1 63  ? 135.608 2.448   243.772 1.00 61.35  ? 63  THR B O   1 
ATOM   508  C  CB  . THR A 1 63  ? 137.181 4.530   245.827 1.00 75.67  ? 63  THR B CB  1 
ATOM   509  O  OG1 . THR A 1 63  ? 136.508 5.789   245.962 1.00 93.85  ? 63  THR B OG1 1 
ATOM   510  C  CG2 . THR A 1 63  ? 137.912 4.495   244.494 1.00 62.92  ? 63  THR B CG2 1 
ATOM   511  N  N   . SER A 1 64  ? 134.345 4.163   244.525 1.00 61.26  ? 64  SER B N   1 
ATOM   512  C  CA  . SER A 1 64  ? 133.474 4.145   243.355 1.00 55.80  ? 64  SER B CA  1 
ATOM   513  C  C   . SER A 1 64  ? 134.230 4.512   242.086 1.00 66.30  ? 64  SER B C   1 
ATOM   514  O  O   . SER A 1 64  ? 133.867 4.060   240.994 1.00 56.24  ? 64  SER B O   1 
ATOM   515  C  CB  . SER A 1 64  ? 132.298 5.098   243.565 1.00 44.54  ? 64  SER B CB  1 
ATOM   516  O  OG  . SER A 1 64  ? 131.346 4.972   242.524 1.00 73.24  ? 64  SER B OG  1 
ATOM   517  N  N   . GLN A 1 65  ? 135.283 5.321   242.209 1.00 57.04  ? 65  GLN B N   1 
ATOM   518  C  CA  . GLN A 1 65  ? 136.040 5.768   241.048 1.00 55.13  ? 65  GLN B CA  1 
ATOM   519  C  C   . GLN A 1 65  ? 136.908 4.671   240.443 1.00 61.96  ? 65  GLN B C   1 
ATOM   520  O  O   . GLN A 1 65  ? 137.473 4.882   239.365 1.00 64.74  ? 65  GLN B O   1 
ATOM   521  C  CB  . GLN A 1 65  ? 136.913 6.966   241.426 1.00 58.23  ? 65  GLN B CB  1 
ATOM   522  N  N   . THR A 1 66  ? 137.029 3.520   241.097 1.00 67.97  ? 66  THR B N   1 
ATOM   523  C  CA  . THR A 1 66  ? 137.823 2.412   240.580 1.00 62.41  ? 66  THR B CA  1 
ATOM   524  C  C   . THR A 1 66  ? 136.997 1.176   240.268 1.00 74.54  ? 66  THR B C   1 
ATOM   525  O  O   . THR A 1 66  ? 137.191 0.561   239.216 1.00 85.87  ? 66  THR B O   1 
ATOM   526  C  CB  . THR A 1 66  ? 138.933 2.036   241.576 1.00 63.93  ? 66  THR B CB  1 
ATOM   527  O  OG1 . THR A 1 66  ? 138.357 1.764   242.859 1.00 71.80  ? 66  THR B OG1 1 
ATOM   528  C  CG2 . THR A 1 66  ? 139.946 3.164   241.702 1.00 67.25  ? 66  THR B CG2 1 
ATOM   529  N  N   . ALA A 1 67  ? 136.078 0.795   241.154 1.00 50.36  ? 67  ALA B N   1 
ATOM   530  C  CA  . ALA A 1 67  ? 135.277 -0.417  240.978 1.00 40.92  ? 67  ALA B CA  1 
ATOM   531  C  C   . ALA A 1 67  ? 134.028 -0.095  240.155 1.00 36.07  ? 67  ALA B C   1 
ATOM   532  O  O   . ALA A 1 67  ? 132.894 -0.103  240.636 1.00 44.67  ? 67  ALA B O   1 
ATOM   533  C  CB  . ALA A 1 67  ? 134.923 -1.018  242.331 1.00 36.91  ? 67  ALA B CB  1 
ATOM   534  N  N   . ARG A 1 68  ? 134.265 0.188   238.878 1.00 47.44  ? 68  ARG B N   1 
ATOM   535  C  CA  . ARG A 1 68  ? 133.228 0.557   237.928 1.00 52.14  ? 68  ARG B CA  1 
ATOM   536  C  C   . ARG A 1 68  ? 132.689 -0.677  237.215 1.00 37.99  ? 68  ARG B C   1 
ATOM   537  O  O   . ARG A 1 68  ? 133.324 -1.736  237.222 1.00 30.65  ? 68  ARG B O   1 
ATOM   538  C  CB  . ARG A 1 68  ? 133.788 1.559   236.918 1.00 55.60  ? 68  ARG B CB  1 
ATOM   539  C  CG  . ARG A 1 68  ? 134.297 2.843   237.553 1.00 58.64  ? 68  ARG B CG  1 
ATOM   540  C  CD  . ARG A 1 68  ? 135.195 3.610   236.600 1.00 61.15  ? 68  ARG B CD  1 
ATOM   541  N  NE  . ARG A 1 68  ? 136.139 2.730   235.919 1.00 85.45  ? 68  ARG B NE  1 
ATOM   542  C  CZ  . ARG A 1 68  ? 137.175 3.157   235.205 1.00 95.07  ? 68  ARG B CZ  1 
ATOM   543  N  NH1 . ARG A 1 68  ? 137.404 4.456   235.076 1.00 95.01  ? 68  ARG B NH1 1 
ATOM   544  N  NH2 . ARG A 1 68  ? 137.983 2.284   234.619 1.00 74.83  ? 68  ARG B NH2 1 
ATOM   545  N  N   . PRO A 1 69  ? 131.502 -0.581  236.601 1.00 40.50  ? 69  PRO B N   1 
ATOM   546  C  CA  . PRO A 1 69  ? 130.947 -1.762  235.915 1.00 43.55  ? 69  PRO B CA  1 
ATOM   547  C  C   . PRO A 1 69  ? 131.839 -2.294  234.808 1.00 45.54  ? 69  PRO B C   1 
ATOM   548  O  O   . PRO A 1 69  ? 131.982 -3.515  234.664 1.00 62.09  ? 69  PRO B O   1 
ATOM   549  C  CB  . PRO A 1 69  ? 129.608 -1.251  235.362 1.00 37.64  ? 69  PRO B CB  1 
ATOM   550  C  CG  . PRO A 1 69  ? 129.260 -0.088  236.211 1.00 28.08  ? 69  PRO B CG  1 
ATOM   551  C  CD  . PRO A 1 69  ? 130.559 0.552   236.592 1.00 26.39  ? 69  PRO B CD  1 
ATOM   552  N  N   . GLN A 1 70  ? 132.449 -1.409  234.018 1.00 49.04  ? 70  GLN B N   1 
ATOM   553  C  CA  . GLN A 1 70  ? 133.296 -1.843  232.915 1.00 35.68  ? 70  GLN B CA  1 
ATOM   554  C  C   . GLN A 1 70  ? 134.613 -2.452  233.381 1.00 41.31  ? 70  GLN B C   1 
ATOM   555  O  O   . GLN A 1 70  ? 135.322 -3.045  232.561 1.00 38.98  ? 70  GLN B O   1 
ATOM   556  C  CB  . GLN A 1 70  ? 133.570 -0.670  231.972 1.00 42.73  ? 70  GLN B CB  1 
ATOM   557  C  CG  . GLN A 1 70  ? 134.204 0.540   232.642 1.00 44.03  ? 70  GLN B CG  1 
ATOM   558  C  CD  . GLN A 1 70  ? 133.177 1.492   233.226 1.00 47.40  ? 70  GLN B CD  1 
ATOM   559  O  OE1 . GLN A 1 70  ? 131.987 1.179   233.290 1.00 37.98  ? 70  GLN B OE1 1 
ATOM   560  N  NE2 . GLN A 1 70  ? 133.632 2.664   233.653 1.00 48.11  ? 70  GLN B NE2 1 
ATOM   561  N  N   . ALA A 1 71  ? 134.954 -2.323  234.663 1.00 38.62  ? 71  ALA B N   1 
ATOM   562  C  CA  . ALA A 1 71  ? 136.167 -2.914  235.214 1.00 47.37  ? 71  ALA B CA  1 
ATOM   563  C  C   . ALA A 1 71  ? 136.009 -3.108  236.718 1.00 41.50  ? 71  ALA B C   1 
ATOM   564  O  O   . ALA A 1 71  ? 136.486 -2.281  237.505 1.00 46.70  ? 71  ALA B O   1 
ATOM   565  C  CB  . ALA A 1 71  ? 137.385 -2.039  234.910 1.00 27.66  ? 71  ALA B CB  1 
ATOM   566  N  N   . PRO A 1 72  ? 135.349 -4.179  237.153 1.00 50.98  ? 72  PRO B N   1 
ATOM   567  C  CA  . PRO A 1 72  ? 135.097 -4.361  238.585 1.00 36.50  ? 72  PRO B CA  1 
ATOM   568  C  C   . PRO A 1 72  ? 136.363 -4.734  239.341 1.00 34.38  ? 72  PRO B C   1 
ATOM   569  O  O   . PRO A 1 72  ? 137.310 -5.303  238.794 1.00 45.54  ? 72  PRO B O   1 
ATOM   570  C  CB  . PRO A 1 72  ? 134.074 -5.505  238.630 1.00 30.37  ? 72  PRO B CB  1 
ATOM   571  C  CG  . PRO A 1 72  ? 133.616 -5.700  237.204 1.00 35.36  ? 72  PRO B CG  1 
ATOM   572  C  CD  . PRO A 1 72  ? 134.755 -5.257  236.349 1.00 43.57  ? 72  PRO B CD  1 
ATOM   573  N  N   . ALA A 1 73  ? 136.363 -4.398  240.628 1.00 35.75  ? 73  ALA B N   1 
ATOM   574  C  CA  . ALA A 1 73  ? 137.464 -4.755  241.507 1.00 32.88  ? 73  ALA B CA  1 
ATOM   575  C  C   . ALA A 1 73  ? 137.308 -6.191  241.994 1.00 34.52  ? 73  ALA B C   1 
ATOM   576  O  O   . ALA A 1 73  ? 136.196 -6.675  242.225 1.00 37.37  ? 73  ALA B O   1 
ATOM   577  C  CB  . ALA A 1 73  ? 137.533 -3.801  242.701 1.00 44.95  ? 73  ALA B CB  1 
ATOM   578  N  N   . THR A 1 74  ? 138.439 -6.873  242.147 1.00 33.03  ? 74  THR B N   1 
ATOM   579  C  CA  . THR A 1 74  ? 138.450 -8.284  242.509 1.00 39.54  ? 74  THR B CA  1 
ATOM   580  C  C   . THR A 1 74  ? 138.556 -8.441  244.021 1.00 44.73  ? 74  THR B C   1 
ATOM   581  O  O   . THR A 1 74  ? 139.382 -7.786  244.665 1.00 35.09  ? 74  THR B O   1 
ATOM   582  C  CB  . THR A 1 74  ? 139.609 -9.007  241.820 1.00 34.19  ? 74  THR B CB  1 
ATOM   583  O  OG1 . THR A 1 74  ? 139.471 -8.886  240.398 1.00 57.72  ? 74  THR B OG1 1 
ATOM   584  C  CG2 . THR A 1 74  ? 139.620 -10.482 242.195 1.00 38.30  ? 74  THR B CG2 1 
ATOM   585  N  N   . VAL A 1 75  ? 137.715 -9.309  244.579 1.00 49.96  ? 75  VAL B N   1 
ATOM   586  C  CA  . VAL A 1 75  ? 137.710 -9.621  246.004 1.00 52.58  ? 75  VAL B CA  1 
ATOM   587  C  C   . VAL A 1 75  ? 137.877 -11.126 246.152 1.00 43.02  ? 75  VAL B C   1 
ATOM   588  O  O   . VAL A 1 75  ? 137.018 -11.898 245.706 1.00 49.27  ? 75  VAL B O   1 
ATOM   589  C  CB  . VAL A 1 75  ? 136.420 -9.147  246.691 1.00 42.08  ? 75  VAL B CB  1 
ATOM   590  C  CG1 . VAL A 1 75  ? 136.491 -9.400  248.189 1.00 43.63  ? 75  VAL B CG1 1 
ATOM   591  C  CG2 . VAL A 1 75  ? 136.173 -7.676  246.404 1.00 43.56  ? 75  VAL B CG2 1 
ATOM   592  N  N   . GLY A 1 76  ? 138.977 -11.543 246.775 1.00 40.36  ? 76  GLY B N   1 
ATOM   593  C  CA  . GLY A 1 76  ? 139.208 -12.960 247.004 1.00 39.49  ? 76  GLY B CA  1 
ATOM   594  C  C   . GLY A 1 76  ? 138.353 -13.483 248.149 1.00 41.28  ? 76  GLY B C   1 
ATOM   595  O  O   . GLY A 1 76  ? 138.112 -12.795 249.140 1.00 40.18  ? 76  GLY B O   1 
ATOM   596  N  N   . LEU A 1 77  ? 137.893 -14.723 247.998 1.00 34.30  ? 77  LEU B N   1 
ATOM   597  C  CA  . LEU A 1 77  ? 137.025 -15.362 248.978 1.00 43.08  ? 77  LEU B CA  1 
ATOM   598  C  C   . LEU A 1 77  ? 137.589 -16.726 249.340 1.00 49.74  ? 77  LEU B C   1 
ATOM   599  O  O   . LEU A 1 77  ? 137.982 -17.494 248.456 1.00 45.43  ? 77  LEU B O   1 
ATOM   600  C  CB  . LEU A 1 77  ? 135.596 -15.506 248.441 1.00 40.55  ? 77  LEU B CB  1 
ATOM   601  C  CG  . LEU A 1 77  ? 134.700 -16.525 249.148 1.00 48.51  ? 77  LEU B CG  1 
ATOM   602  C  CD1 . LEU A 1 77  ? 134.255 -16.002 250.506 1.00 60.31  ? 77  LEU B CD1 1 
ATOM   603  C  CD2 . LEU A 1 77  ? 133.499 -16.878 248.284 1.00 30.74  ? 77  LEU B CD2 1 
ATOM   604  N  N   . ALA A 1 78  ? 137.625 -17.024 250.637 1.00 59.77  ? 78  ALA B N   1 
ATOM   605  C  CA  . ALA A 1 78  ? 138.078 -18.313 251.136 1.00 55.50  ? 78  ALA B CA  1 
ATOM   606  C  C   . ALA A 1 78  ? 137.032 -18.884 252.082 1.00 57.19  ? 78  ALA B C   1 
ATOM   607  O  O   . ALA A 1 78  ? 136.426 -18.149 252.867 1.00 49.57  ? 78  ALA B O   1 
ATOM   608  C  CB  . ALA A 1 78  ? 139.429 -18.193 251.853 1.00 47.43  ? 78  ALA B CB  1 
ATOM   609  N  N   . PHE A 1 79  ? 136.822 -20.193 251.996 1.00 50.42  ? 79  PHE B N   1 
ATOM   610  C  CA  . PHE A 1 79  ? 135.864 -20.896 252.836 1.00 54.04  ? 79  PHE B CA  1 
ATOM   611  C  C   . PHE A 1 79  ? 136.586 -21.647 253.947 1.00 57.12  ? 79  PHE B C   1 
ATOM   612  O  O   . PHE A 1 79  ? 137.746 -22.044 253.802 1.00 55.59  ? 79  PHE B O   1 
ATOM   613  C  CB  . PHE A 1 79  ? 135.033 -21.882 252.012 1.00 64.96  ? 79  PHE B CB  1 
ATOM   614  C  CG  . PHE A 1 79  ? 133.942 -21.237 251.206 1.00 48.82  ? 79  PHE B CG  1 
ATOM   615  C  CD1 . PHE A 1 79  ? 133.370 -20.044 251.613 1.00 51.23  ? 79  PHE B CD1 1 
ATOM   616  C  CD2 . PHE A 1 79  ? 133.485 -21.831 250.040 1.00 46.78  ? 79  PHE B CD2 1 
ATOM   617  C  CE1 . PHE A 1 79  ? 132.363 -19.453 250.870 1.00 63.52  ? 79  PHE B CE1 1 
ATOM   618  C  CE2 . PHE A 1 79  ? 132.481 -21.247 249.293 1.00 50.28  ? 79  PHE B CE2 1 
ATOM   619  C  CZ  . PHE A 1 79  ? 131.919 -20.056 249.709 1.00 49.69  ? 79  PHE B CZ  1 
ATOM   620  N  N   . ARG A 1 80  ? 135.886 -21.844 255.060 1.00 50.82  ? 80  ARG B N   1 
ATOM   621  C  CA  . ARG A 1 80  ? 136.395 -22.641 256.169 1.00 68.40  ? 80  ARG B CA  1 
ATOM   622  C  C   . ARG A 1 80  ? 135.831 -24.051 256.061 1.00 66.40  ? 80  ARG B C   1 
ATOM   623  O  O   . ARG A 1 80  ? 134.611 -24.242 256.108 1.00 65.27  ? 80  ARG B O   1 
ATOM   624  C  CB  . ARG A 1 80  ? 136.027 -22.029 257.520 1.00 69.00  ? 80  ARG B CB  1 
ATOM   625  C  CG  . ARG A 1 80  ? 136.565 -22.822 258.705 1.00 81.52  ? 80  ARG B CG  1 
ATOM   626  C  CD  . ARG A 1 80  ? 136.317 -22.113 260.025 1.00 77.76  ? 80  ARG B CD  1 
ATOM   627  N  NE  . ARG A 1 80  ? 134.900 -22.086 260.376 1.00 70.15  ? 80  ARG B NE  1 
ATOM   628  C  CZ  . ARG A 1 80  ? 134.358 -21.217 261.221 1.00 67.24  ? 80  ARG B CZ  1 
ATOM   629  N  NH1 . ARG A 1 80  ? 133.059 -21.266 261.482 1.00 65.14  ? 80  ARG B NH1 1 
ATOM   630  N  NH2 . ARG A 1 80  ? 135.114 -20.301 261.809 1.00 71.91  ? 80  ARG B NH2 1 
ATOM   631  N  N   . ALA A 1 81  ? 136.717 -25.028 255.915 1.00 64.45  ? 81  ALA B N   1 
ATOM   632  C  CA  . ALA A 1 81  ? 136.347 -26.435 255.900 1.00 67.81  ? 81  ALA B CA  1 
ATOM   633  C  C   . ALA A 1 81  ? 136.811 -27.082 257.194 1.00 90.71  ? 81  ALA B C   1 
ATOM   634  O  O   . ALA A 1 81  ? 137.996 -27.009 257.538 1.00 97.86  ? 81  ALA B O   1 
ATOM   635  C  CB  . ALA A 1 81  ? 136.951 -27.155 254.694 1.00 65.82  ? 81  ALA B CB  1 
ATOM   636  N  N   . ASP A 1 82  ? 135.869 -27.699 257.909 1.00 91.59  ? 82  ASP B N   1 
ATOM   637  C  CA  . ASP A 1 82  ? 136.144 -28.397 259.160 1.00 88.86  ? 82  ASP B CA  1 
ATOM   638  C  C   . ASP A 1 82  ? 136.753 -27.458 260.196 1.00 89.77  ? 82  ASP B C   1 
ATOM   639  O  O   . ASP A 1 82  ? 136.069 -26.571 260.717 1.00 78.58  ? 82  ASP B O   1 
ATOM   640  C  CB  . ASP A 1 82  ? 137.061 -29.597 258.916 1.00 60.13  ? 82  ASP B CB  1 
ATOM   641  N  N   . ASP A 1 83  ? 138.042 -27.635 260.492 1.00 85.42  ? 83  ASP B N   1 
ATOM   642  C  CA  . ASP A 1 83  ? 138.631 -26.952 261.638 1.00 89.96  ? 83  ASP B CA  1 
ATOM   643  C  C   . ASP A 1 83  ? 139.156 -25.570 261.268 1.00 88.72  ? 83  ASP B C   1 
ATOM   644  O  O   . ASP A 1 83  ? 138.922 -24.595 261.992 1.00 78.51  ? 83  ASP B O   1 
ATOM   645  C  CB  . ASP A 1 83  ? 139.752 -27.806 262.229 1.00 89.37  ? 83  ASP B CB  1 
ATOM   646  N  N   . THR A 1 84  ? 139.868 -25.464 260.151 1.00 76.80  ? 84  THR B N   1 
ATOM   647  C  CA  . THR A 1 84  ? 140.605 -24.259 259.808 1.00 72.20  ? 84  THR B CA  1 
ATOM   648  C  C   . THR A 1 84  ? 140.115 -23.681 258.487 1.00 66.00  ? 84  THR B C   1 
ATOM   649  O  O   . THR A 1 84  ? 139.335 -24.295 257.755 1.00 55.90  ? 84  THR B O   1 
ATOM   650  C  CB  . THR A 1 84  ? 142.112 -24.541 259.726 1.00 69.24  ? 84  THR B CB  1 
ATOM   651  N  N   . PHE A 1 85  ? 140.593 -22.474 258.199 1.00 69.26  ? 85  PHE B N   1 
ATOM   652  C  CA  . PHE A 1 85  ? 140.302 -21.791 256.949 1.00 61.83  ? 85  PHE B CA  1 
ATOM   653  C  C   . PHE A 1 85  ? 141.290 -22.225 255.876 1.00 61.04  ? 85  PHE B C   1 
ATOM   654  O  O   . PHE A 1 85  ? 142.485 -22.382 256.140 1.00 49.59  ? 85  PHE B O   1 
ATOM   655  C  CB  . PHE A 1 85  ? 140.376 -20.274 257.131 1.00 59.75  ? 85  PHE B CB  1 
ATOM   656  C  CG  . PHE A 1 85  ? 139.066 -19.637 257.495 1.00 66.20  ? 85  PHE B CG  1 
ATOM   657  C  CD1 . PHE A 1 85  ? 138.131 -19.337 256.518 1.00 64.19  ? 85  PHE B CD1 1 
ATOM   658  C  CD2 . PHE A 1 85  ? 138.776 -19.321 258.812 1.00 70.53  ? 85  PHE B CD2 1 
ATOM   659  C  CE1 . PHE A 1 85  ? 136.926 -18.743 256.849 1.00 66.41  ? 85  PHE B CE1 1 
ATOM   660  C  CE2 . PHE A 1 85  ? 137.574 -18.727 259.150 1.00 67.11  ? 85  PHE B CE2 1 
ATOM   661  C  CZ  . PHE A 1 85  ? 136.648 -18.438 258.167 1.00 66.09  ? 85  PHE B CZ  1 
ATOM   662  N  N   . GLU A 1 86  ? 140.782 -22.415 254.663 1.00 57.31  ? 86  GLU B N   1 
ATOM   663  C  CA  . GLU A 1 86  ? 141.636 -22.749 253.537 1.00 51.02  ? 86  GLU B CA  1 
ATOM   664  C  C   . GLU A 1 86  ? 142.442 -21.529 253.097 1.00 52.75  ? 86  GLU B C   1 
ATOM   665  O  O   . GLU A 1 86  ? 142.143 -20.386 253.455 1.00 65.36  ? 86  GLU B O   1 
ATOM   666  C  CB  . GLU A 1 86  ? 140.799 -23.258 252.367 1.00 38.96  ? 86  GLU B CB  1 
ATOM   667  C  CG  . GLU A 1 86  ? 140.174 -22.133 251.567 1.00 56.18  ? 86  GLU B CG  1 
ATOM   668  C  CD  . GLU A 1 86  ? 139.007 -22.585 250.725 1.00 63.93  ? 86  GLU B CD  1 
ATOM   669  O  OE1 . GLU A 1 86  ? 138.415 -23.642 251.032 1.00 61.27  ? 86  GLU B OE1 1 
ATOM   670  O  OE2 . GLU A 1 86  ? 138.675 -21.873 249.755 1.00 71.47  ? 86  GLU B OE2 1 
ATOM   671  N  N   . ALA A 1 87  ? 143.476 -21.786 252.302 1.00 42.18  ? 87  ALA B N   1 
ATOM   672  C  CA  . ALA A 1 87  ? 144.252 -20.709 251.707 1.00 52.40  ? 87  ALA B CA  1 
ATOM   673  C  C   . ALA A 1 87  ? 143.488 -20.101 250.539 1.00 60.06  ? 87  ALA B C   1 
ATOM   674  O  O   . ALA A 1 87  ? 142.826 -20.810 249.776 1.00 55.81  ? 87  ALA B O   1 
ATOM   675  C  CB  . ALA A 1 87  ? 145.613 -21.222 251.236 1.00 44.01  ? 87  ALA B CB  1 
ATOM   676  N  N   . LEU A 1 88  ? 143.576 -18.781 250.407 1.00 55.56  ? 88  LEU B N   1 
ATOM   677  C  CA  . LEU A 1 88  ? 142.898 -18.083 249.322 1.00 56.82  ? 88  LEU B CA  1 
ATOM   678  C  C   . LEU A 1 88  ? 143.475 -18.506 247.973 1.00 48.96  ? 88  LEU B C   1 
ATOM   679  O  O   . LEU A 1 88  ? 144.644 -18.259 247.684 1.00 49.35  ? 88  LEU B O   1 
ATOM   680  C  CB  . LEU A 1 88  ? 143.012 -16.565 249.495 1.00 38.49  ? 88  LEU B CB  1 
ATOM   681  C  CG  . LEU A 1 88  ? 142.715 -15.718 248.255 1.00 47.80  ? 88  LEU B CG  1 
ATOM   682  C  CD1 . LEU A 1 88  ? 141.271 -15.897 247.809 1.00 61.76  ? 88  LEU B CD1 1 
ATOM   683  C  CD2 . LEU A 1 88  ? 143.019 -14.248 248.514 1.00 41.46  ? 88  LEU B CD2 1 
HETATM 684  N  N   . CAS A 1 89  ? 142.646 -19.152 247.159 1.00 39.27  ? 89  CAS B N   1 
HETATM 685  C  CA  . CAS A 1 89  ? 143.081 -19.605 245.850 1.00 57.57  ? 89  CAS B CA  1 
HETATM 686  C  CB  . CAS A 1 89  ? 143.137 -21.126 245.777 1.00 62.19  ? 89  CAS B CB  1 
HETATM 687  C  C   . CAS A 1 89  ? 142.154 -19.098 244.786 1.00 59.42  ? 89  CAS B C   1 
HETATM 688  O  O   . CAS A 1 89  ? 140.933 -19.365 244.842 1.00 46.56  ? 89  CAS B O   1 
HETATM 689  S  SG  . CAS A 1 89  ? 144.334 -21.554 244.556 1.00 92.65  ? 89  CAS B SG  1 
HETATM 690  AS AS  . CAS A 1 89  ? 143.157 -22.926 243.251 1.00 170.75 ? 89  CAS B AS  1 
HETATM 691  C  CE1 . CAS A 1 89  ? 144.348 -23.631 241.819 1.00 75.86  ? 89  CAS B CE1 1 
HETATM 692  C  CE2 . CAS A 1 89  ? 142.439 -24.448 244.315 1.00 71.75  ? 89  CAS B CE2 1 
ATOM   693  N  N   . ILE A 1 90  ? 142.701 -18.377 243.815 1.00 48.69  ? 90  ILE B N   1 
ATOM   694  C  CA  . ILE A 1 90  ? 141.913 -17.868 242.701 1.00 50.30  ? 90  ILE B CA  1 
ATOM   695  C  C   . ILE A 1 90  ? 142.514 -18.351 241.386 1.00 50.05  ? 90  ILE B C   1 
ATOM   696  O  O   . ILE A 1 90  ? 143.608 -17.935 241.005 1.00 60.97  ? 90  ILE B O   1 
ATOM   697  C  CB  . ILE A 1 90  ? 141.823 -16.335 242.733 1.00 49.18  ? 90  ILE B CB  1 
ATOM   698  C  CG1 . ILE A 1 90  ? 141.299 -15.858 244.089 1.00 49.35  ? 90  ILE B CG1 1 
ATOM   699  C  CG2 . ILE A 1 90  ? 140.929 -15.833 241.616 1.00 49.81  ? 90  ILE B CG2 1 
ATOM   700  C  CD1 . ILE A 1 90  ? 141.221 -14.355 244.217 1.00 41.03  ? 90  ILE B CD1 1 
ATOM   701  N  N   . GLU A 1 91  ? 141.795 -19.232 240.700 1.00 47.67  ? 91  GLU B N   1 
ATOM   702  C  CA  . GLU A 1 91  ? 142.282 -19.765 239.434 1.00 50.55  ? 91  GLU B CA  1 
ATOM   703  C  C   . GLU A 1 91  ? 142.289 -18.666 238.378 1.00 46.52  ? 91  GLU B C   1 
ATOM   704  O  O   . GLU A 1 91  ? 141.276 -17.980 238.198 1.00 55.10  ? 91  GLU B O   1 
ATOM   705  C  CB  . GLU A 1 91  ? 141.415 -20.934 238.973 1.00 55.72  ? 91  GLU B CB  1 
ATOM   706  C  CG  . GLU A 1 91  ? 141.717 -22.247 239.672 1.00 74.18  ? 91  GLU B CG  1 
ATOM   707  C  CD  . GLU A 1 91  ? 142.579 -23.166 238.831 1.00 80.45  ? 91  GLU B CD  1 
ATOM   708  O  OE1 . GLU A 1 91  ? 142.219 -24.353 238.684 1.00 89.55  ? 91  GLU B OE1 1 
ATOM   709  O  OE2 . GLU A 1 91  ? 143.617 -22.701 238.316 1.00 84.02  ? 91  GLU B OE2 1 
ATOM   710  N  N   . PRO A 1 92  ? 143.394 -18.468 237.666 1.00 47.13  ? 92  PRO B N   1 
ATOM   711  C  CA  . PRO A 1 92  ? 143.440 -17.401 236.663 1.00 46.52  ? 92  PRO B CA  1 
ATOM   712  C  C   . PRO A 1 92  ? 142.599 -17.738 235.443 1.00 33.17  ? 92  PRO B C   1 
ATOM   713  O  O   . PRO A 1 92  ? 142.350 -18.904 235.129 1.00 35.17  ? 92  PRO B O   1 
ATOM   714  C  CB  . PRO A 1 92  ? 144.927 -17.318 236.306 1.00 44.02  ? 92  PRO B CB  1 
ATOM   715  C  CG  . PRO A 1 92  ? 145.441 -18.695 236.566 1.00 40.24  ? 92  PRO B CG  1 
ATOM   716  C  CD  . PRO A 1 92  ? 144.668 -19.204 237.753 1.00 41.32  ? 92  PRO B CD  1 
ATOM   717  N  N   . PHE A 1 93  ? 142.155 -16.689 234.755 1.00 44.33  ? 93  PHE B N   1 
ATOM   718  C  CA  . PHE A 1 93  ? 141.420 -16.863 233.514 1.00 44.96  ? 93  PHE B CA  1 
ATOM   719  C  C   . PHE A 1 93  ? 142.356 -17.347 232.407 1.00 43.36  ? 93  PHE B C   1 
ATOM   720  O  O   . PHE A 1 93  ? 143.577 -17.416 232.568 1.00 40.39  ? 93  PHE B O   1 
ATOM   721  C  CB  . PHE A 1 93  ? 140.749 -15.555 233.097 1.00 35.69  ? 93  PHE B CB  1 
ATOM   722  C  CG  . PHE A 1 93  ? 139.656 -15.106 234.023 1.00 42.23  ? 93  PHE B CG  1 
ATOM   723  C  CD1 . PHE A 1 93  ? 138.825 -16.027 234.639 1.00 49.64  ? 93  PHE B CD1 1 
ATOM   724  C  CD2 . PHE A 1 93  ? 139.458 -13.758 234.273 1.00 39.38  ? 93  PHE B CD2 1 
ATOM   725  C  CE1 . PHE A 1 93  ? 137.816 -15.610 235.490 1.00 43.51  ? 93  PHE B CE1 1 
ATOM   726  C  CE2 . PHE A 1 93  ? 138.453 -13.335 235.123 1.00 43.98  ? 93  PHE B CE2 1 
ATOM   727  C  CZ  . PHE A 1 93  ? 137.631 -14.262 235.732 1.00 41.62  ? 93  PHE B CZ  1 
ATOM   728  N  N   . SER A 1 94  ? 141.763 -17.677 231.263 1.00 37.64  ? 94  SER B N   1 
ATOM   729  C  CA  . SER A 1 94  ? 142.545 -18.087 230.108 1.00 33.78  ? 94  SER B CA  1 
ATOM   730  C  C   . SER A 1 94  ? 143.304 -16.893 229.527 1.00 49.44  ? 94  SER B C   1 
ATOM   731  O  O   . SER A 1 94  ? 143.121 -15.742 229.935 1.00 44.28  ? 94  SER B O   1 
ATOM   732  C  CB  . SER A 1 94  ? 141.642 -18.720 229.050 1.00 30.95  ? 94  SER B CB  1 
ATOM   733  O  OG  . SER A 1 94  ? 140.374 -18.089 229.017 1.00 46.25  ? 94  SER B OG  1 
ATOM   734  N  N   . SER A 1 95  ? 144.172 -17.180 228.558 1.00 48.71  ? 95  SER B N   1 
ATOM   735  C  CA  . SER A 1 95  ? 145.010 -16.149 227.974 1.00 51.20  ? 95  SER B CA  1 
ATOM   736  C  C   . SER A 1 95  ? 144.670 -15.941 226.503 1.00 52.93  ? 95  SER B C   1 
ATOM   737  O  O   . SER A 1 95  ? 144.386 -16.910 225.790 1.00 50.59  ? 95  SER B O   1 
ATOM   738  C  CB  . SER A 1 95  ? 146.497 -16.508 228.109 1.00 48.38  ? 95  SER B CB  1 
ATOM   739  O  OG  . SER A 1 95  ? 146.849 -16.705 229.467 1.00 56.13  ? 95  SER B OG  1 
ATOM   740  N  N   . PRO A 1 96  ? 144.691 -14.697 226.020 1.00 55.24  ? 96  PRO B N   1 
ATOM   741  C  CA  . PRO A 1 96  ? 144.377 -14.458 224.615 1.00 61.10  ? 96  PRO B CA  1 
ATOM   742  C  C   . PRO A 1 96  ? 145.514 -14.920 223.722 1.00 66.80  ? 96  PRO B C   1 
ATOM   743  O  O   . PRO A 1 96  ? 146.688 -14.908 224.131 1.00 61.93  ? 96  PRO B O   1 
ATOM   744  C  CB  . PRO A 1 96  ? 144.194 -12.932 224.547 1.00 57.05  ? 96  PRO B CB  1 
ATOM   745  C  CG  . PRO A 1 96  ? 145.037 -12.414 225.656 1.00 58.17  ? 96  PRO B CG  1 
ATOM   746  C  CD  . PRO A 1 96  ? 144.970 -13.447 226.750 1.00 46.85  ? 96  PRO B CD  1 
ATOM   747  N  N   . PRO A 1 97  ? 145.218 -15.336 222.498 1.00 61.36  ? 97  PRO B N   1 
ATOM   748  C  CA  . PRO A 1 97  ? 146.262 -15.805 221.584 1.00 53.18  ? 97  PRO B CA  1 
ATOM   749  C  C   . PRO A 1 97  ? 147.047 -14.634 221.000 1.00 73.56  ? 97  PRO B C   1 
ATOM   750  O  O   . PRO A 1 97  ? 146.795 -13.467 221.298 1.00 82.48  ? 97  PRO B O   1 
ATOM   751  C  CB  . PRO A 1 97  ? 145.469 -16.541 220.502 1.00 48.81  ? 97  PRO B CB  1 
ATOM   752  C  CG  . PRO A 1 97  ? 144.148 -15.855 220.489 1.00 48.22  ? 97  PRO B CG  1 
ATOM   753  C  CD  . PRO A 1 97  ? 143.871 -15.462 221.914 1.00 55.36  ? 97  PRO B CD  1 
ATOM   754  N  N   . GLU A 1 98  ? 148.015 -14.972 220.152 1.00 82.08  ? 98  GLU B N   1 
ATOM   755  C  CA  . GLU A 1 98  ? 148.800 -13.954 219.470 1.00 67.22  ? 98  GLU B CA  1 
ATOM   756  C  C   . GLU A 1 98  ? 147.962 -13.278 218.393 1.00 72.36  ? 98  GLU B C   1 
ATOM   757  O  O   . GLU A 1 98  ? 147.165 -13.923 217.705 1.00 63.56  ? 98  GLU B O   1 
ATOM   758  C  CB  . GLU A 1 98  ? 150.055 -14.572 218.854 1.00 55.40  ? 98  GLU B CB  1 
ATOM   759  N  N   . LEU A 1 99  ? 148.146 -11.969 218.252 1.00 74.18  ? 99  LEU B N   1 
ATOM   760  C  CA  . LEU A 1 99  ? 147.340 -11.198 217.323 1.00 69.83  ? 99  LEU B CA  1 
ATOM   761  C  C   . LEU A 1 99  ? 147.723 -11.523 215.879 1.00 70.88  ? 99  LEU B C   1 
ATOM   762  O  O   . LEU A 1 99  ? 148.863 -11.906 215.600 1.00 80.33  ? 99  LEU B O   1 
ATOM   763  C  CB  . LEU A 1 99  ? 147.513 -9.700  217.575 1.00 60.66  ? 99  LEU B CB  1 
ATOM   764  C  CG  . LEU A 1 99  ? 147.324 -9.159  218.995 1.00 64.42  ? 99  LEU B CG  1 
ATOM   765  C  CD1 . LEU A 1 99  ? 148.628 -9.203  219.782 1.00 75.16  ? 99  LEU B CD1 1 
ATOM   766  C  CD2 . LEU A 1 99  ? 146.784 -7.739  218.946 1.00 53.02  ? 99  LEU B CD2 1 
ATOM   767  N  N   . PRO A 1 100 ? 146.784 -11.387 214.947 1.00 73.18  ? 100 PRO B N   1 
ATOM   768  C  CA  . PRO A 1 100 ? 147.115 -11.560 213.528 1.00 88.94  ? 100 PRO B CA  1 
ATOM   769  C  C   . PRO A 1 100 ? 148.086 -10.487 213.055 1.00 86.59  ? 100 PRO B C   1 
ATOM   770  O  O   . PRO A 1 100 ? 148.332 -9.482  213.725 1.00 76.09  ? 100 PRO B O   1 
ATOM   771  C  CB  . PRO A 1 100 ? 145.760 -11.440 212.824 1.00 78.94  ? 100 PRO B CB  1 
ATOM   772  C  CG  . PRO A 1 100 ? 144.753 -11.726 213.889 1.00 67.55  ? 100 PRO B CG  1 
ATOM   773  C  CD  . PRO A 1 100 ? 145.339 -11.204 215.158 1.00 73.33  ? 100 PRO B CD  1 
ATOM   774  N  N   . ASP A 1 101 ? 148.637 -10.717 211.860 1.00 90.91  ? 101 ASP B N   1 
ATOM   775  C  CA  . ASP A 1 101 ? 149.666 -9.828  211.330 1.00 93.83  ? 101 ASP B CA  1 
ATOM   776  C  C   . ASP A 1 101 ? 149.136 -8.421  211.086 1.00 77.15  ? 101 ASP B C   1 
ATOM   777  O  O   . ASP A 1 101 ? 149.891 -7.448  211.193 1.00 70.89  ? 101 ASP B O   1 
ATOM   778  C  CB  . ASP A 1 101 ? 150.240 -10.406 210.036 1.00 79.94  ? 101 ASP B CB  1 
ATOM   779  N  N   . VAL A 1 102 ? 147.847 -8.288  210.763 1.00 73.07  ? 102 VAL B N   1 
ATOM   780  C  CA  . VAL A 1 102 ? 147.300 -6.982  210.419 1.00 67.41  ? 102 VAL B CA  1 
ATOM   781  C  C   . VAL A 1 102 ? 147.159 -6.077  211.635 1.00 80.91  ? 102 VAL B C   1 
ATOM   782  O  O   . VAL A 1 102 ? 147.081 -4.852  211.483 1.00 73.48  ? 102 VAL B O   1 
ATOM   783  C  CB  . VAL A 1 102 ? 145.945 -7.143  209.707 1.00 55.45  ? 102 VAL B CB  1 
ATOM   784  C  CG1 . VAL A 1 102 ? 146.157 -7.519  208.250 1.00 60.28  ? 102 VAL B CG1 1 
ATOM   785  C  CG2 . VAL A 1 102 ? 145.104 -8.189  210.415 1.00 72.11  ? 102 VAL B CG2 1 
ATOM   786  N  N   . MET A 1 103 ? 147.125 -6.639  212.839 1.00 77.56  ? 103 MET B N   1 
ATOM   787  C  CA  . MET A 1 103 ? 146.994 -5.836  214.049 1.00 61.56  ? 103 MET B CA  1 
ATOM   788  C  C   . MET A 1 103 ? 148.330 -5.714  214.775 1.00 65.87  ? 103 MET B C   1 
ATOM   789  O  O   . MET A 1 103 ? 149.139 -4.840  214.462 1.00 63.36  ? 103 MET B O   1 
ATOM   790  C  CB  . MET A 1 103 ? 145.940 -6.437  214.982 1.00 62.03  ? 103 MET B CB  1 
ATOM   791  C  CG  . MET A 1 103 ? 144.560 -6.561  214.357 1.00 63.36  ? 103 MET B CG  1 
ATOM   792  S  SD  . MET A 1 103 ? 143.359 -7.345  215.451 1.00 60.83  ? 103 MET B SD  1 
ATOM   793  C  CE  . MET A 1 103 ? 143.128 -6.068  216.685 1.00 43.55  ? 103 MET B CE  1 
ATOM   794  N  N   . MET B 2 2   ? 116.970 -15.295 240.602 1.00 50.07  ? 17  MET C N   1 
ATOM   795  C  CA  . MET B 2 2   ? 117.559 -13.966 240.726 1.00 55.11  ? 17  MET C CA  1 
ATOM   796  C  C   . MET B 2 2   ? 118.977 -13.929 240.152 1.00 50.28  ? 17  MET C C   1 
ATOM   797  O  O   . MET B 2 2   ? 119.393 -12.923 239.584 1.00 60.91  ? 17  MET C O   1 
ATOM   798  C  CB  . MET B 2 2   ? 117.555 -13.516 242.192 1.00 63.07  ? 17  MET C CB  1 
ATOM   799  C  CG  . MET B 2 2   ? 118.137 -12.129 242.418 1.00 56.81  ? 17  MET C CG  1 
ATOM   800  S  SD  . MET B 2 2   ? 118.014 -11.595 244.135 1.00 105.36 ? 17  MET C SD  1 
ATOM   801  C  CE  . MET B 2 2   ? 118.690 -13.023 244.981 1.00 69.64  ? 17  MET C CE  1 
ATOM   802  N  N   . TYR B 2 3   ? 119.705 -15.033 240.292 1.00 44.57  ? 18  TYR C N   1 
ATOM   803  C  CA  . TYR B 2 3   ? 121.043 -15.183 239.743 1.00 44.64  ? 18  TYR C CA  1 
ATOM   804  C  C   . TYR B 2 3   ? 121.052 -16.346 238.753 1.00 57.25  ? 18  TYR C C   1 
ATOM   805  O  O   . TYR B 2 3   ? 120.209 -17.250 238.818 1.00 57.43  ? 18  TYR C O   1 
ATOM   806  C  CB  . TYR B 2 3   ? 122.078 -15.418 240.863 1.00 37.39  ? 18  TYR C CB  1 
ATOM   807  C  CG  . TYR B 2 3   ? 122.507 -14.155 241.601 1.00 58.42  ? 18  TYR C CG  1 
ATOM   808  C  CD1 . TYR B 2 3   ? 121.830 -13.708 242.738 1.00 49.27  ? 18  TYR C CD1 1 
ATOM   809  C  CD2 . TYR B 2 3   ? 123.594 -13.414 241.159 1.00 47.55  ? 18  TYR C CD2 1 
ATOM   810  C  CE1 . TYR B 2 3   ? 122.231 -12.552 243.403 1.00 43.47  ? 18  TYR C CE1 1 
ATOM   811  C  CE2 . TYR B 2 3   ? 123.997 -12.264 241.815 1.00 57.65  ? 18  TYR C CE2 1 
ATOM   812  C  CZ  . TYR B 2 3   ? 123.314 -11.838 242.934 1.00 62.29  ? 18  TYR C CZ  1 
ATOM   813  O  OH  . TYR B 2 3   ? 123.713 -10.694 243.588 1.00 50.14  ? 18  TYR C OH  1 
ATOM   814  N  N   . VAL B 2 4   ? 122.004 -16.313 237.810 1.00 53.48  ? 19  VAL C N   1 
ATOM   815  C  CA  . VAL B 2 4   ? 122.281 -17.473 236.961 1.00 41.44  ? 19  VAL C CA  1 
ATOM   816  C  C   . VAL B 2 4   ? 123.772 -17.754 236.908 1.00 39.60  ? 19  VAL C C   1 
ATOM   817  O  O   . VAL B 2 4   ? 124.604 -16.896 237.216 1.00 38.13  ? 19  VAL C O   1 
ATOM   818  C  CB  . VAL B 2 4   ? 121.778 -17.382 235.501 1.00 39.40  ? 19  VAL C CB  1 
ATOM   819  C  CG1 . VAL B 2 4   ? 120.334 -16.900 235.427 1.00 42.54  ? 19  VAL C CG1 1 
ATOM   820  C  CG2 . VAL B 2 4   ? 122.732 -16.562 234.670 1.00 57.97  ? 19  VAL C CG2 1 
ATOM   821  N  N   . LYS B 2 5   ? 124.096 -18.971 236.468 1.00 35.01  ? 20  LYS C N   1 
ATOM   822  C  CA  . LYS B 2 5   ? 125.464 -19.462 236.372 1.00 37.11  ? 20  LYS C CA  1 
ATOM   823  C  C   . LYS B 2 5   ? 125.835 -19.636 234.905 1.00 44.23  ? 20  LYS C C   1 
ATOM   824  O  O   . LYS B 2 5   ? 125.180 -20.395 234.184 1.00 43.01  ? 20  LYS C O   1 
ATOM   825  C  CB  . LYS B 2 5   ? 125.617 -20.784 237.121 1.00 29.42  ? 20  LYS C CB  1 
ATOM   826  C  CG  . LYS B 2 5   ? 126.951 -21.439 236.941 1.00 45.08  ? 20  LYS C CG  1 
ATOM   827  C  CD  . LYS B 2 5   ? 127.518 -21.862 238.276 1.00 44.12  ? 20  LYS C CD  1 
ATOM   828  C  CE  . LYS B 2 5   ? 126.543 -22.735 239.044 1.00 26.08  ? 20  LYS C CE  1 
ATOM   829  N  NZ  . LYS B 2 5   ? 127.167 -23.335 240.255 1.00 43.29  ? 20  LYS C NZ  1 
ATOM   830  N  N   . LEU B 2 6   ? 126.860 -18.912 234.462 1.00 41.60  ? 21  LEU C N   1 
ATOM   831  C  CA  . LEU B 2 6   ? 127.411 -19.038 233.118 1.00 31.69  ? 21  LEU C CA  1 
ATOM   832  C  C   . LEU B 2 6   ? 128.764 -19.726 233.230 1.00 31.13  ? 21  LEU C C   1 
ATOM   833  O  O   . LEU B 2 6   ? 129.659 -19.230 233.922 1.00 36.87  ? 21  LEU C O   1 
ATOM   834  C  CB  . LEU B 2 6   ? 127.548 -17.668 232.453 1.00 26.67  ? 21  LEU C CB  1 
ATOM   835  C  CG  . LEU B 2 6   ? 126.287 -16.802 232.456 1.00 25.19  ? 21  LEU C CG  1 
ATOM   836  C  CD1 . LEU B 2 6   ? 126.555 -15.471 231.773 1.00 36.77  ? 21  LEU C CD1 1 
ATOM   837  C  CD2 . LEU B 2 6   ? 125.130 -17.531 231.787 1.00 34.17  ? 21  LEU C CD2 1 
ATOM   838  N  N   . ILE B 2 7   ? 128.904 -20.867 232.563 1.00 39.55  ? 22  ILE C N   1 
ATOM   839  C  CA  . ILE B 2 7   ? 130.107 -21.688 232.637 1.00 43.18  ? 22  ILE C CA  1 
ATOM   840  C  C   . ILE B 2 7   ? 130.878 -21.520 231.335 1.00 31.74  ? 22  ILE C C   1 
ATOM   841  O  O   . ILE B 2 7   ? 130.341 -21.772 230.249 1.00 41.93  ? 22  ILE C O   1 
ATOM   842  C  CB  . ILE B 2 7   ? 129.768 -23.163 232.894 1.00 39.12  ? 22  ILE C CB  1 
ATOM   843  C  CG1 . ILE B 2 7   ? 128.805 -23.285 234.076 1.00 35.85  ? 22  ILE C CG1 1 
ATOM   844  C  CG2 . ILE B 2 7   ? 131.035 -23.962 233.150 1.00 21.24  ? 22  ILE C CG2 1 
ATOM   845  C  CD1 . ILE B 2 7   ? 128.373 -24.703 234.368 1.00 46.08  ? 22  ILE C CD1 1 
ATOM   846  N  N   . SER B 2 8   ? 132.135 -21.098 231.446 1.00 29.92  ? 23  SER C N   1 
ATOM   847  C  CA  . SER B 2 8   ? 132.984 -20.910 230.282 1.00 38.74  ? 23  SER C CA  1 
ATOM   848  C  C   . SER B 2 8   ? 133.453 -22.261 229.745 1.00 37.77  ? 23  SER C C   1 
ATOM   849  O  O   . SER B 2 8   ? 133.133 -23.323 230.286 1.00 48.18  ? 23  SER C O   1 
ATOM   850  C  CB  . SER B 2 8   ? 134.169 -20.012 230.631 1.00 40.43  ? 23  SER C CB  1 
ATOM   851  O  OG  . SER B 2 8   ? 135.123 -20.706 231.417 1.00 41.26  ? 23  SER C OG  1 
ATOM   852  N  N   . SER B 2 9   ? 134.231 -22.219 228.662 1.00 49.24  ? 24  SER C N   1 
ATOM   853  C  CA  . SER B 2 9   ? 134.702 -23.454 228.046 1.00 45.08  ? 24  SER C CA  1 
ATOM   854  C  C   . SER B 2 9   ? 135.777 -24.134 228.885 1.00 40.79  ? 24  SER C C   1 
ATOM   855  O  O   . SER B 2 9   ? 135.884 -25.365 228.869 1.00 39.21  ? 24  SER C O   1 
ATOM   856  C  CB  . SER B 2 9   ? 135.228 -23.173 226.639 1.00 43.09  ? 24  SER C CB  1 
ATOM   857  O  OG  . SER B 2 9   ? 136.377 -22.345 226.681 1.00 44.19  ? 24  SER C OG  1 
ATOM   858  N  N   . ASP B 2 10  ? 136.577 -23.362 229.617 1.00 40.54  ? 25  ASP C N   1 
ATOM   859  C  CA  . ASP B 2 10  ? 137.643 -23.919 230.439 1.00 35.50  ? 25  ASP C CA  1 
ATOM   860  C  C   . ASP B 2 10  ? 137.190 -24.241 231.859 1.00 42.49  ? 25  ASP C C   1 
ATOM   861  O  O   . ASP B 2 10  ? 138.032 -24.542 232.711 1.00 36.56  ? 25  ASP C O   1 
ATOM   862  C  CB  . ASP B 2 10  ? 138.839 -22.964 230.474 1.00 31.58  ? 25  ASP C CB  1 
ATOM   863  C  CG  . ASP B 2 10  ? 138.447 -21.549 230.839 1.00 43.37  ? 25  ASP C CG  1 
ATOM   864  O  OD1 . ASP B 2 10  ? 137.295 -21.159 230.555 1.00 42.76  ? 25  ASP C OD1 1 
ATOM   865  O  OD2 . ASP B 2 10  ? 139.293 -20.826 231.405 1.00 42.24  ? 25  ASP C OD2 1 
ATOM   866  N  N   . GLY B 2 11  ? 135.886 -24.184 232.134 1.00 39.85  ? 26  GLY C N   1 
ATOM   867  C  CA  . GLY B 2 11  ? 135.340 -24.619 233.402 1.00 50.78  ? 26  GLY C CA  1 
ATOM   868  C  C   . GLY B 2 11  ? 135.018 -23.515 234.387 1.00 52.75  ? 26  GLY C C   1 
ATOM   869  O  O   . GLY B 2 11  ? 134.428 -23.803 235.436 1.00 50.92  ? 26  GLY C O   1 
ATOM   870  N  N   . HIS B 2 12  ? 135.380 -22.270 234.088 1.00 52.25  ? 27  HIS C N   1 
ATOM   871  C  CA  . HIS B 2 12  ? 135.132 -21.179 235.021 1.00 45.80  ? 27  HIS C CA  1 
ATOM   872  C  C   . HIS B 2 12  ? 133.637 -20.909 235.141 1.00 45.54  ? 27  HIS C C   1 
ATOM   873  O  O   . HIS B 2 12  ? 132.928 -20.808 234.136 1.00 49.88  ? 27  HIS C O   1 
ATOM   874  C  CB  . HIS B 2 12  ? 135.865 -19.917 234.569 1.00 29.81  ? 27  HIS C CB  1 
ATOM   875  C  CG  . HIS B 2 12  ? 137.286 -19.849 235.033 1.00 34.19  ? 27  HIS C CG  1 
ATOM   876  N  ND1 . HIS B 2 12  ? 137.665 -19.170 236.171 1.00 44.28  ? 27  HIS C ND1 1 
ATOM   877  C  CD2 . HIS B 2 12  ? 138.420 -20.376 234.513 1.00 35.56  ? 27  HIS C CD2 1 
ATOM   878  C  CE1 . HIS B 2 12  ? 138.972 -19.282 236.332 1.00 47.83  ? 27  HIS C CE1 1 
ATOM   879  N  NE2 . HIS B 2 12  ? 139.454 -20.008 235.340 1.00 38.01  ? 27  HIS C NE2 1 
ATOM   880  N  N   . GLU B 2 13  ? 133.161 -20.795 236.378 1.00 41.95  ? 28  GLU C N   1 
ATOM   881  C  CA  . GLU B 2 13  ? 131.756 -20.536 236.660 1.00 40.94  ? 28  GLU C CA  1 
ATOM   882  C  C   . GLU B 2 13  ? 131.577 -19.057 236.981 1.00 44.90  ? 28  GLU C C   1 
ATOM   883  O  O   . GLU B 2 13  ? 132.183 -18.545 237.928 1.00 45.93  ? 28  GLU C O   1 
ATOM   884  C  CB  . GLU B 2 13  ? 131.264 -21.404 237.818 1.00 61.41  ? 28  GLU C CB  1 
ATOM   885  C  CG  . GLU B 2 13  ? 131.334 -22.897 237.542 1.00 68.41  ? 28  GLU C CG  1 
ATOM   886  C  CD  . GLU B 2 13  ? 130.753 -23.728 238.668 1.00 84.50  ? 28  GLU C CD  1 
ATOM   887  O  OE1 . GLU B 2 13  ? 130.235 -23.139 239.639 1.00 75.48  ? 28  GLU C OE1 1 
ATOM   888  O  OE2 . GLU B 2 13  ? 130.814 -24.972 238.580 1.00 78.57  ? 28  GLU C OE2 1 
ATOM   889  N  N   . PHE B 2 14  ? 130.751 -18.378 236.192 1.00 32.98  ? 29  PHE C N   1 
ATOM   890  C  CA  . PHE B 2 14  ? 130.451 -16.965 236.380 1.00 29.67  ? 29  PHE C CA  1 
ATOM   891  C  C   . PHE B 2 14  ? 129.003 -16.835 236.828 1.00 33.76  ? 29  PHE C C   1 
ATOM   892  O  O   . PHE B 2 14  ? 128.085 -17.206 236.088 1.00 36.34  ? 29  PHE C O   1 
ATOM   893  C  CB  . PHE B 2 14  ? 130.690 -16.176 235.094 1.00 29.21  ? 29  PHE C CB  1 
ATOM   894  C  CG  . PHE B 2 14  ? 132.130 -16.128 234.676 1.00 35.75  ? 29  PHE C CG  1 
ATOM   895  C  CD1 . PHE B 2 14  ? 132.659 -17.106 233.850 1.00 29.12  ? 29  PHE C CD1 1 
ATOM   896  C  CD2 . PHE B 2 14  ? 132.956 -15.106 235.111 1.00 34.90  ? 29  PHE C CD2 1 
ATOM   897  C  CE1 . PHE B 2 14  ? 133.983 -17.064 233.465 1.00 31.71  ? 29  PHE C CE1 1 
ATOM   898  C  CE2 . PHE B 2 14  ? 134.282 -15.059 234.730 1.00 29.35  ? 29  PHE C CE2 1 
ATOM   899  C  CZ  . PHE B 2 14  ? 134.796 -16.039 233.905 1.00 31.30  ? 29  PHE C CZ  1 
ATOM   900  N  N   . ILE B 2 15  ? 128.802 -16.314 238.032 1.00 36.67  ? 30  ILE C N   1 
ATOM   901  C  CA  . ILE B 2 15  ? 127.476 -16.176 238.620 1.00 39.14  ? 30  ILE C CA  1 
ATOM   902  C  C   . ILE B 2 15  ? 127.043 -14.724 238.448 1.00 29.76  ? 30  ILE C C   1 
ATOM   903  O  O   . ILE B 2 15  ? 127.631 -13.811 239.038 1.00 33.21  ? 30  ILE C O   1 
ATOM   904  C  CB  . ILE B 2 15  ? 127.466 -16.610 240.092 1.00 39.94  ? 30  ILE C CB  1 
ATOM   905  C  CG1 . ILE B 2 15  ? 127.801 -18.098 240.198 1.00 26.83  ? 30  ILE C CG1 1 
ATOM   906  C  CG2 . ILE B 2 15  ? 126.117 -16.321 240.722 1.00 35.68  ? 30  ILE C CG2 1 
ATOM   907  C  CD1 . ILE B 2 15  ? 128.148 -18.563 241.597 1.00 30.84  ? 30  ILE C CD1 1 
ATOM   908  N  N   . VAL B 2 16  ? 126.019 -14.520 237.623 1.00 31.89  ? 31  VAL C N   1 
ATOM   909  C  CA  . VAL B 2 16  ? 125.533 -13.207 237.238 1.00 39.27  ? 31  VAL C CA  1 
ATOM   910  C  C   . VAL B 2 16  ? 124.090 -13.084 237.714 1.00 47.65  ? 31  VAL C C   1 
ATOM   911  O  O   . VAL B 2 16  ? 123.448 -14.071 238.072 1.00 50.30  ? 31  VAL C O   1 
ATOM   912  C  CB  . VAL B 2 16  ? 125.666 -12.983 235.719 1.00 45.63  ? 31  VAL C CB  1 
ATOM   913  C  CG1 . VAL B 2 16  ? 124.863 -14.003 234.965 1.00 47.75  ? 31  VAL C CG1 1 
ATOM   914  C  CG2 . VAL B 2 16  ? 125.292 -11.556 235.293 1.00 40.89  ? 31  VAL C CG2 1 
ATOM   915  N  N   . LYS B 2 17  ? 123.596 -11.847 237.751 1.00 41.28  ? 32  LYS C N   1 
ATOM   916  C  CA  . LYS B 2 17  ? 122.178 -11.617 237.992 1.00 47.90  ? 32  LYS C CA  1 
ATOM   917  C  C   . LYS B 2 17  ? 121.368 -11.995 236.754 1.00 40.08  ? 32  LYS C C   1 
ATOM   918  O  O   . LYS B 2 17  ? 121.805 -11.778 235.618 1.00 47.65  ? 32  LYS C O   1 
ATOM   919  C  CB  . LYS B 2 17  ? 121.927 -10.157 238.363 1.00 39.84  ? 32  LYS C CB  1 
ATOM   920  C  CG  . LYS B 2 17  ? 122.624 -9.721  239.644 1.00 52.91  ? 32  LYS C CG  1 
ATOM   921  C  CD  . LYS B 2 17  ? 121.691 -8.931  240.549 1.00 54.53  ? 32  LYS C CD  1 
ATOM   922  C  CE  . LYS B 2 17  ? 121.679 -7.455  240.186 1.00 46.02  ? 32  LYS C CE  1 
ATOM   923  N  NZ  . LYS B 2 17  ? 120.891 -6.657  241.165 1.00 67.95  ? 32  LYS C NZ  1 
ATOM   924  N  N   . ARG B 2 18  ? 120.184 -12.577 236.986 1.00 41.09  ? 33  ARG C N   1 
ATOM   925  C  CA  . ARG B 2 18  ? 119.340 -13.043 235.888 1.00 45.06  ? 33  ARG C CA  1 
ATOM   926  C  C   . ARG B 2 18  ? 119.058 -11.925 234.895 1.00 51.86  ? 33  ARG C C   1 
ATOM   927  O  O   . ARG B 2 18  ? 119.249 -12.089 233.683 1.00 74.03  ? 33  ARG C O   1 
ATOM   928  C  CB  . ARG B 2 18  ? 118.025 -13.606 236.435 1.00 42.87  ? 33  ARG C CB  1 
ATOM   929  C  CG  . ARG B 2 18  ? 118.097 -15.075 236.856 1.00 56.86  ? 33  ARG C CG  1 
ATOM   930  C  CD  . ARG B 2 18  ? 116.743 -15.790 236.954 1.00 70.27  ? 33  ARG C CD  1 
ATOM   931  N  NE  . ARG B 2 18  ? 116.414 -16.449 235.694 1.00 74.53  ? 33  ARG C NE  1 
ATOM   932  C  CZ  . ARG B 2 18  ? 115.661 -15.888 234.755 1.00 77.01  ? 33  ARG C CZ  1 
ATOM   933  N  NH1 . ARG B 2 18  ? 115.186 -14.666 234.941 1.00 72.73  ? 33  ARG C NH1 1 
ATOM   934  N  NH2 . ARG B 2 18  ? 115.376 -16.535 233.633 1.00 50.84  ? 33  ARG C NH2 1 
ATOM   935  N  N   . GLU B 2 19  ? 118.604 -10.776 235.398 1.00 42.24  ? 34  GLU C N   1 
ATOM   936  C  CA  . GLU B 2 19  ? 118.252 -9.660  234.525 1.00 52.57  ? 34  GLU C CA  1 
ATOM   937  C  C   . GLU B 2 19  ? 119.464 -9.113  233.775 1.00 55.30  ? 34  GLU C C   1 
ATOM   938  O  O   . GLU B 2 19  ? 119.318 -8.554  232.680 1.00 44.59  ? 34  GLU C O   1 
ATOM   939  C  CB  . GLU B 2 19  ? 117.576 -8.558  235.344 1.00 44.27  ? 34  GLU C CB  1 
ATOM   940  C  CG  . GLU B 2 19  ? 116.301 -9.019  236.040 1.00 84.22  ? 34  GLU C CG  1 
ATOM   941  C  CD  . GLU B 2 19  ? 115.327 -9.692  235.088 1.00 86.75  ? 34  GLU C CD  1 
ATOM   942  O  OE1 . GLU B 2 19  ? 115.204 -10.934 235.135 1.00 80.16  ? 34  GLU C OE1 1 
ATOM   943  O  OE2 . GLU B 2 19  ? 114.689 -8.975  234.288 1.00 76.24  ? 34  GLU C OE2 1 
ATOM   944  N  N   . HIS B 2 20  ? 120.662 -9.273  234.337 1.00 42.05  ? 35  HIS C N   1 
ATOM   945  C  CA  . HIS B 2 20  ? 121.868 -8.852  233.637 1.00 39.15  ? 35  HIS C CA  1 
ATOM   946  C  C   . HIS B 2 20  ? 122.225 -9.824  232.520 1.00 50.23  ? 35  HIS C C   1 
ATOM   947  O  O   . HIS B 2 20  ? 122.584 -9.397  231.417 1.00 56.00  ? 35  HIS C O   1 
ATOM   948  C  CB  . HIS B 2 20  ? 123.028 -8.713  234.623 1.00 36.62  ? 35  HIS C CB  1 
ATOM   949  C  CG  . HIS B 2 20  ? 122.860 -7.593  235.602 1.00 41.04  ? 35  HIS C CG  1 
ATOM   950  N  ND1 . HIS B 2 20  ? 123.917 -7.046  236.297 1.00 36.16  ? 35  HIS C ND1 1 
ATOM   951  C  CD2 . HIS B 2 20  ? 121.756 -6.920  236.005 1.00 31.42  ? 35  HIS C CD2 1 
ATOM   952  C  CE1 . HIS B 2 20  ? 123.471 -6.083  237.085 1.00 38.66  ? 35  HIS C CE1 1 
ATOM   953  N  NE2 . HIS B 2 20  ? 122.164 -5.987  236.927 1.00 32.66  ? 35  HIS C NE2 1 
ATOM   954  N  N   . ALA B 2 21  ? 122.132 -11.131 232.783 1.00 46.81  ? 36  ALA C N   1 
ATOM   955  C  CA  . ALA B 2 21  ? 122.366 -12.119 231.736 1.00 37.42  ? 36  ALA C CA  1 
ATOM   956  C  C   . ALA B 2 21  ? 121.296 -12.076 230.655 1.00 47.67  ? 36  ALA C C   1 
ATOM   957  O  O   . ALA B 2 21  ? 121.565 -12.474 229.517 1.00 43.36  ? 36  ALA C O   1 
ATOM   958  C  CB  . ALA B 2 21  ? 122.439 -13.523 232.336 1.00 36.59  ? 36  ALA C CB  1 
ATOM   959  N  N   . LEU B 2 22  ? 120.092 -11.600 230.982 1.00 42.86  ? 37  LEU C N   1 
ATOM   960  C  CA  . LEU B 2 22  ? 119.037 -11.445 229.988 1.00 52.18  ? 37  LEU C CA  1 
ATOM   961  C  C   . LEU B 2 22  ? 119.323 -10.328 228.993 1.00 50.89  ? 37  LEU C C   1 
ATOM   962  O  O   . LEU B 2 22  ? 118.492 -10.084 228.111 1.00 52.16  ? 37  LEU C O   1 
ATOM   963  C  CB  . LEU B 2 22  ? 117.694 -11.195 230.678 1.00 48.05  ? 37  LEU C CB  1 
ATOM   964  C  CG  . LEU B 2 22  ? 117.014 -12.413 231.310 1.00 45.76  ? 37  LEU C CG  1 
ATOM   965  C  CD1 . LEU B 2 22  ? 115.596 -12.075 231.748 1.00 59.90  ? 37  LEU C CD1 1 
ATOM   966  C  CD2 . LEU B 2 22  ? 117.015 -13.596 230.355 1.00 53.29  ? 37  LEU C CD2 1 
ATOM   967  N  N   . THR B 2 23  ? 120.461 -9.639  229.121 1.00 49.91  ? 38  THR C N   1 
ATOM   968  C  CA  . THR B 2 23  ? 120.879 -8.699  228.087 1.00 47.35  ? 38  THR C CA  1 
ATOM   969  C  C   . THR B 2 23  ? 121.117 -9.410  226.762 1.00 45.31  ? 38  THR C C   1 
ATOM   970  O  O   . THR B 2 23  ? 120.843 -8.847  225.695 1.00 55.46  ? 38  THR C O   1 
ATOM   971  C  CB  . THR B 2 23  ? 122.142 -7.958  228.531 1.00 47.31  ? 38  THR C CB  1 
ATOM   972  O  OG1 . THR B 2 23  ? 121.911 -7.327  229.797 1.00 55.37  ? 38  THR C OG1 1 
ATOM   973  C  CG2 . THR B 2 23  ? 122.537 -6.900  227.511 1.00 56.78  ? 38  THR C CG2 1 
ATOM   974  N  N   . SER B 2 24  ? 121.611 -10.643 226.809 1.00 53.47  ? 39  SER C N   1 
ATOM   975  C  CA  . SER B 2 24  ? 121.837 -11.439 225.611 1.00 42.98  ? 39  SER C CA  1 
ATOM   976  C  C   . SER B 2 24  ? 120.560 -12.176 225.230 1.00 49.47  ? 39  SER C C   1 
ATOM   977  O  O   . SER B 2 24  ? 119.960 -12.864 226.062 1.00 50.76  ? 39  SER C O   1 
ATOM   978  C  CB  . SER B 2 24  ? 122.976 -12.435 225.834 1.00 31.31  ? 39  SER C CB  1 
ATOM   979  O  OG  . SER B 2 24  ? 122.814 -13.588 225.026 1.00 53.99  ? 39  SER C OG  1 
ATOM   980  N  N   . GLY B 2 25  ? 120.145 -12.025 223.971 1.00 51.11  ? 40  GLY C N   1 
ATOM   981  C  CA  . GLY B 2 25  ? 118.985 -12.757 223.493 1.00 43.38  ? 40  GLY C CA  1 
ATOM   982  C  C   . GLY B 2 25  ? 119.223 -14.249 223.397 1.00 45.15  ? 40  GLY C C   1 
ATOM   983  O  O   . GLY B 2 25  ? 118.280 -15.039 223.496 1.00 41.32  ? 40  GLY C O   1 
ATOM   984  N  N   . THR B 2 26  ? 120.480 -14.657 223.206 1.00 32.15  ? 41  THR C N   1 
ATOM   985  C  CA  . THR B 2 26  ? 120.797 -16.080 223.151 1.00 37.45  ? 41  THR C CA  1 
ATOM   986  C  C   . THR B 2 26  ? 120.642 -16.732 224.519 1.00 47.97  ? 41  THR C C   1 
ATOM   987  O  O   . THR B 2 26  ? 120.085 -17.831 224.630 1.00 48.00  ? 41  THR C O   1 
ATOM   988  C  CB  . THR B 2 26  ? 122.215 -16.283 222.617 1.00 37.98  ? 41  THR C CB  1 
ATOM   989  O  OG1 . THR B 2 26  ? 122.338 -15.654 221.335 1.00 38.97  ? 41  THR C OG1 1 
ATOM   990  C  CG2 . THR B 2 26  ? 122.528 -17.765 222.479 1.00 36.95  ? 41  THR C CG2 1 
ATOM   991  N  N   . ILE B 2 27  ? 121.131 -16.072 225.572 1.00 50.39  ? 42  ILE C N   1 
ATOM   992  C  CA  . ILE B 2 27  ? 120.952 -16.592 226.925 1.00 48.60  ? 42  ILE C CA  1 
ATOM   993  C  C   . ILE B 2 27  ? 119.473 -16.629 227.284 1.00 53.31  ? 42  ILE C C   1 
ATOM   994  O  O   . ILE B 2 27  ? 118.981 -17.609 227.857 1.00 44.65  ? 42  ILE C O   1 
ATOM   995  C  CB  . ILE B 2 27  ? 121.763 -15.753 227.932 1.00 48.69  ? 42  ILE C CB  1 
ATOM   996  C  CG1 . ILE B 2 27  ? 123.245 -16.132 227.870 1.00 49.29  ? 42  ILE C CG1 1 
ATOM   997  C  CG2 . ILE B 2 27  ? 121.222 -15.932 229.345 1.00 50.17  ? 42  ILE C CG2 1 
ATOM   998  C  CD1 . ILE B 2 27  ? 124.116 -15.359 228.836 1.00 38.29  ? 42  ILE C CD1 1 
ATOM   999  N  N   . LYS B 2 28  ? 118.739 -15.567 226.941 1.00 67.47  ? 43  LYS C N   1 
ATOM   1000 C  CA  . LYS B 2 28  ? 117.300 -15.545 227.185 1.00 62.74  ? 43  LYS C CA  1 
ATOM   1001 C  C   . LYS B 2 28  ? 116.595 -16.660 226.423 1.00 64.44  ? 43  LYS C C   1 
ATOM   1002 O  O   . LYS B 2 28  ? 115.625 -17.245 226.919 1.00 77.61  ? 43  LYS C O   1 
ATOM   1003 C  CB  . LYS B 2 28  ? 116.728 -14.182 226.793 1.00 47.04  ? 43  LYS C CB  1 
ATOM   1004 C  CG  . LYS B 2 28  ? 115.226 -14.051 226.986 1.00 47.04  ? 43  LYS C CG  1 
ATOM   1005 C  CD  . LYS B 2 28  ? 114.642 -13.011 226.042 1.00 47.04  ? 43  LYS C CD  1 
ATOM   1006 C  CE  . LYS B 2 28  ? 115.368 -11.680 226.168 1.00 47.04  ? 43  LYS C CE  1 
ATOM   1007 N  NZ  . LYS B 2 28  ? 115.121 -10.795 224.996 1.00 47.04  ? 43  LYS C NZ  1 
ATOM   1008 N  N   . ALA B 2 29  ? 117.074 -16.972 225.216 1.00 68.40  ? 44  ALA C N   1 
ATOM   1009 C  CA  . ALA B 2 29  ? 116.443 -18.014 224.413 1.00 59.00  ? 44  ALA C CA  1 
ATOM   1010 C  C   . ALA B 2 29  ? 116.586 -19.384 225.064 1.00 57.68  ? 44  ALA C C   1 
ATOM   1011 O  O   . ALA B 2 29  ? 115.641 -20.181 225.057 1.00 74.36  ? 44  ALA C O   1 
ATOM   1012 C  CB  . ALA B 2 29  ? 117.036 -18.023 223.005 1.00 53.24  ? 44  ALA C CB  1 
ATOM   1013 N  N   . MET B 2 30  ? 117.757 -19.679 225.634 1.00 46.70  ? 45  MET C N   1 
ATOM   1014 C  CA  . MET B 2 30  ? 118.006 -20.958 226.289 1.00 54.54  ? 45  MET C CA  1 
ATOM   1015 C  C   . MET B 2 30  ? 117.573 -20.965 227.752 1.00 59.43  ? 45  MET C C   1 
ATOM   1016 O  O   . MET B 2 30  ? 118.151 -21.702 228.564 1.00 59.02  ? 45  MET C O   1 
ATOM   1017 C  CB  . MET B 2 30  ? 119.484 -21.337 226.163 1.00 50.94  ? 45  MET C CB  1 
ATOM   1018 C  CG  . MET B 2 30  ? 120.453 -20.323 226.749 1.00 60.23  ? 45  MET C CG  1 
ATOM   1019 S  SD  . MET B 2 30  ? 121.956 -20.142 225.764 1.00 98.09  ? 45  MET C SD  1 
ATOM   1020 C  CE  . MET B 2 30  ? 122.285 -21.844 225.317 1.00 56.49  ? 45  MET C CE  1 
ATOM   1021 N  N   . LEU B 2 31  ? 116.570 -20.168 228.110 1.00 61.54  ? 46  LEU C N   1 
ATOM   1022 C  CA  . LEU B 2 31  ? 116.033 -20.162 229.466 1.00 68.76  ? 46  LEU C CA  1 
ATOM   1023 C  C   . LEU B 2 31  ? 114.514 -20.306 229.444 1.00 71.63  ? 46  LEU C C   1 
ATOM   1024 O  O   . LEU B 2 31  ? 113.919 -20.549 228.394 1.00 70.27  ? 46  LEU C O   1 
ATOM   1025 C  CB  . LEU B 2 31  ? 116.427 -18.880 230.202 1.00 57.61  ? 46  LEU C CB  1 
ATOM   1026 C  CG  . LEU B 2 31  ? 117.892 -18.737 230.620 1.00 55.18  ? 46  LEU C CG  1 
ATOM   1027 C  CD1 . LEU B 2 31  ? 118.094 -17.462 231.423 1.00 40.79  ? 46  LEU C CD1 1 
ATOM   1028 C  CD2 . LEU B 2 31  ? 118.362 -19.953 231.403 1.00 51.38  ? 46  LEU C CD2 1 
ATOM   1029 N  N   . THR B 2 42  ? 116.965 -24.596 233.696 1.00 66.78  ? 57  THR C N   1 
ATOM   1030 C  CA  . THR B 2 42  ? 117.573 -23.271 233.654 1.00 83.33  ? 57  THR C CA  1 
ATOM   1031 C  C   . THR B 2 42  ? 118.567 -23.083 234.795 1.00 84.73  ? 57  THR C C   1 
ATOM   1032 O  O   . THR B 2 42  ? 119.054 -24.057 235.372 1.00 84.37  ? 57  THR C O   1 
ATOM   1033 C  CB  . THR B 2 42  ? 116.510 -22.159 233.726 1.00 48.61  ? 57  THR C CB  1 
ATOM   1034 N  N   . ASN B 2 43  ? 118.866 -21.821 235.101 1.00 74.36  ? 58  ASN C N   1 
ATOM   1035 C  CA  . ASN B 2 43  ? 119.767 -21.408 236.175 1.00 64.50  ? 58  ASN C CA  1 
ATOM   1036 C  C   . ASN B 2 43  ? 121.209 -21.853 235.954 1.00 68.45  ? 58  ASN C C   1 
ATOM   1037 O  O   . ASN B 2 43  ? 122.044 -21.692 236.852 1.00 72.89  ? 58  ASN C O   1 
ATOM   1038 C  CB  . ASN B 2 43  ? 119.274 -21.902 237.544 1.00 54.36  ? 58  ASN C CB  1 
ATOM   1039 N  N   . GLU B 2 44  ? 121.528 -22.399 234.781 1.00 62.90  ? 59  GLU C N   1 
ATOM   1040 C  CA  . GLU B 2 44  ? 122.889 -22.820 234.469 1.00 48.79  ? 59  GLU C CA  1 
ATOM   1041 C  C   . GLU B 2 44  ? 123.004 -23.027 232.967 1.00 43.24  ? 59  GLU C C   1 
ATOM   1042 O  O   . GLU B 2 44  ? 122.223 -23.787 232.385 1.00 44.38  ? 59  GLU C O   1 
ATOM   1043 C  CB  . GLU B 2 44  ? 123.261 -24.107 235.216 1.00 34.50  ? 59  GLU C CB  1 
ATOM   1044 N  N   . VAL B 2 45  ? 123.971 -22.353 232.347 1.00 43.59  ? 60  VAL C N   1 
ATOM   1045 C  CA  . VAL B 2 45  ? 124.181 -22.409 230.905 1.00 38.27  ? 60  VAL C CA  1 
ATOM   1046 C  C   . VAL B 2 45  ? 125.665 -22.621 230.640 1.00 42.00  ? 60  VAL C C   1 
ATOM   1047 O  O   . VAL B 2 45  ? 126.508 -21.923 231.214 1.00 44.33  ? 60  VAL C O   1 
ATOM   1048 C  CB  . VAL B 2 45  ? 123.688 -21.129 230.202 1.00 51.30  ? 60  VAL C CB  1 
ATOM   1049 C  CG1 . VAL B 2 45  ? 123.909 -21.229 228.701 1.00 38.75  ? 60  VAL C CG1 1 
ATOM   1050 C  CG2 . VAL B 2 45  ? 122.220 -20.873 230.514 1.00 49.88  ? 60  VAL C CG2 1 
ATOM   1051 N  N   . ASN B 2 46  ? 125.981 -23.577 229.771 1.00 45.00  ? 61  ASN C N   1 
ATOM   1052 C  CA  . ASN B 2 46  ? 127.353 -23.866 229.382 1.00 48.46  ? 61  ASN C CA  1 
ATOM   1053 C  C   . ASN B 2 46  ? 127.679 -23.203 228.048 1.00 51.99  ? 61  ASN C C   1 
ATOM   1054 O  O   . ASN B 2 46  ? 126.801 -22.992 227.207 1.00 54.53  ? 61  ASN C O   1 
ATOM   1055 C  CB  . ASN B 2 46  ? 127.589 -25.375 229.282 1.00 46.68  ? 61  ASN C CB  1 
ATOM   1056 C  CG  . ASN B 2 46  ? 128.128 -25.967 230.570 1.00 56.56  ? 61  ASN C CG  1 
ATOM   1057 O  OD1 . ASN B 2 46  ? 127.370 -26.466 231.402 1.00 50.72  ? 61  ASN C OD1 1 
ATOM   1058 N  ND2 . ASN B 2 46  ? 129.444 -25.915 230.741 1.00 45.99  ? 61  ASN C ND2 1 
ATOM   1059 N  N   . PHE B 2 47  ? 128.957 -22.878 227.864 1.00 53.10  ? 62  PHE C N   1 
ATOM   1060 C  CA  . PHE B 2 47  ? 129.451 -22.238 226.644 1.00 42.50  ? 62  PHE C CA  1 
ATOM   1061 C  C   . PHE B 2 47  ? 130.737 -22.948 226.232 1.00 45.40  ? 62  PHE C C   1 
ATOM   1062 O  O   . PHE B 2 47  ? 131.809 -22.668 226.776 1.00 53.19  ? 62  PHE C O   1 
ATOM   1063 C  CB  . PHE B 2 47  ? 129.683 -20.746 226.859 1.00 39.29  ? 62  PHE C CB  1 
ATOM   1064 C  CG  . PHE B 2 47  ? 128.421 -19.962 227.088 1.00 35.23  ? 62  PHE C CG  1 
ATOM   1065 C  CD1 . PHE B 2 47  ? 127.509 -19.776 226.063 1.00 36.80  ? 62  PHE C CD1 1 
ATOM   1066 C  CD2 . PHE B 2 47  ? 128.149 -19.410 228.329 1.00 30.81  ? 62  PHE C CD2 1 
ATOM   1067 C  CE1 . PHE B 2 47  ? 126.349 -19.055 226.271 1.00 41.13  ? 62  PHE C CE1 1 
ATOM   1068 C  CE2 . PHE B 2 47  ? 126.990 -18.687 228.542 1.00 35.56  ? 62  PHE C CE2 1 
ATOM   1069 C  CZ  . PHE B 2 47  ? 126.089 -18.509 227.512 1.00 38.95  ? 62  PHE C CZ  1 
ATOM   1070 N  N   . ARG B 2 48  ? 130.629 -23.859 225.265 1.00 44.22  ? 63  ARG C N   1 
ATOM   1071 C  CA  . ARG B 2 48  ? 131.758 -24.686 224.858 1.00 45.38  ? 63  ARG C CA  1 
ATOM   1072 C  C   . ARG B 2 48  ? 132.766 -23.951 223.982 1.00 45.79  ? 63  ARG C C   1 
ATOM   1073 O  O   . ARG B 2 48  ? 133.835 -24.505 223.707 1.00 57.74  ? 63  ARG C O   1 
ATOM   1074 C  CB  . ARG B 2 48  ? 131.257 -25.929 224.119 1.00 33.93  ? 63  ARG C CB  1 
ATOM   1075 N  N   . GLU B 2 49  ? 132.464 -22.729 223.542 1.00 50.09  ? 64  GLU C N   1 
ATOM   1076 C  CA  . GLU B 2 49  ? 133.346 -22.008 222.636 1.00 43.01  ? 64  GLU C CA  1 
ATOM   1077 C  C   . GLU B 2 49  ? 133.749 -20.626 223.134 1.00 45.39  ? 64  GLU C C   1 
ATOM   1078 O  O   . GLU B 2 49  ? 134.410 -19.893 222.390 1.00 48.10  ? 64  GLU C O   1 
ATOM   1079 C  CB  . GLU B 2 49  ? 132.695 -21.876 221.251 1.00 61.69  ? 64  GLU C CB  1 
ATOM   1080 C  CG  . GLU B 2 49  ? 132.494 -23.204 220.537 1.00 60.82  ? 64  GLU C CG  1 
ATOM   1081 C  CD  . GLU B 2 49  ? 132.337 -23.047 219.037 1.00 86.50  ? 64  GLU C CD  1 
ATOM   1082 O  OE1 . GLU B 2 49  ? 131.210 -23.236 218.534 1.00 102.77 ? 64  GLU C OE1 1 
ATOM   1083 O  OE2 . GLU B 2 49  ? 133.340 -22.735 218.361 1.00 86.24  ? 64  GLU C OE2 1 
ATOM   1084 N  N   . ILE B 2 50  ? 133.378 -20.250 224.353 1.00 40.14  ? 65  ILE C N   1 
ATOM   1085 C  CA  . ILE B 2 50  ? 133.718 -18.949 224.916 1.00 38.06  ? 65  ILE C CA  1 
ATOM   1086 C  C   . ILE B 2 50  ? 134.656 -19.183 226.099 1.00 49.24  ? 65  ILE C C   1 
ATOM   1087 O  O   . ILE B 2 50  ? 134.220 -19.692 227.142 1.00 49.00  ? 65  ILE C O   1 
ATOM   1088 C  CB  . ILE B 2 50  ? 132.467 -18.171 225.344 1.00 28.71  ? 65  ILE C CB  1 
ATOM   1089 C  CG1 . ILE B 2 50  ? 131.492 -18.043 224.174 1.00 25.33  ? 65  ILE C CG1 1 
ATOM   1090 C  CG2 . ILE B 2 50  ? 132.853 -16.796 225.874 1.00 26.27  ? 65  ILE C CG2 1 
ATOM   1091 C  CD1 . ILE B 2 50  ? 130.233 -17.273 224.508 1.00 34.89  ? 65  ILE C CD1 1 
ATOM   1092 N  N   . PRO B 2 51  ? 135.936 -18.835 225.989 1.00 40.20  ? 66  PRO C N   1 
ATOM   1093 C  CA  . PRO B 2 51  ? 136.852 -19.009 227.121 1.00 41.22  ? 66  PRO C CA  1 
ATOM   1094 C  C   . PRO B 2 51  ? 136.531 -18.039 228.250 1.00 42.72  ? 66  PRO C C   1 
ATOM   1095 O  O   . PRO B 2 51  ? 135.719 -17.122 228.119 1.00 42.70  ? 66  PRO C O   1 
ATOM   1096 C  CB  . PRO B 2 51  ? 138.230 -18.731 226.512 1.00 36.53  ? 66  PRO C CB  1 
ATOM   1097 C  CG  . PRO B 2 51  ? 137.946 -17.860 225.331 1.00 39.57  ? 66  PRO C CG  1 
ATOM   1098 C  CD  . PRO B 2 51  ? 136.620 -18.314 224.794 1.00 30.67  ? 66  PRO C CD  1 
ATOM   1099 N  N   . SER B 2 52  ? 137.204 -18.257 229.384 1.00 45.24  ? 67  SER C N   1 
ATOM   1100 C  CA  . SER B 2 52  ? 136.889 -17.497 230.591 1.00 45.54  ? 67  SER C CA  1 
ATOM   1101 C  C   . SER B 2 52  ? 137.283 -16.031 230.455 1.00 46.88  ? 67  SER C C   1 
ATOM   1102 O  O   . SER B 2 52  ? 136.529 -15.143 230.868 1.00 48.26  ? 67  SER C O   1 
ATOM   1103 C  CB  . SER B 2 52  ? 137.577 -18.126 231.802 1.00 36.91  ? 67  SER C CB  1 
ATOM   1104 O  OG  . SER B 2 52  ? 138.972 -18.250 231.592 1.00 50.08  ? 67  SER C OG  1 
ATOM   1105 N  N   . HIS B 2 53  ? 138.460 -15.755 229.885 1.00 42.37  ? 68  HIS C N   1 
ATOM   1106 C  CA  . HIS B 2 53  ? 138.905 -14.371 229.759 1.00 43.87  ? 68  HIS C CA  1 
ATOM   1107 C  C   . HIS B 2 53  ? 138.015 -13.559 228.829 1.00 46.95  ? 68  HIS C C   1 
ATOM   1108 O  O   . HIS B 2 53  ? 138.047 -12.325 228.883 1.00 59.91  ? 68  HIS C O   1 
ATOM   1109 C  CB  . HIS B 2 53  ? 140.358 -14.317 229.280 1.00 44.10  ? 68  HIS C CB  1 
ATOM   1110 C  CG  . HIS B 2 53  ? 140.538 -14.651 227.831 1.00 47.34  ? 68  HIS C CG  1 
ATOM   1111 N  ND1 . HIS B 2 53  ? 140.670 -15.945 227.375 1.00 54.22  ? 68  HIS C ND1 1 
ATOM   1112 C  CD2 . HIS B 2 53  ? 140.627 -13.857 226.737 1.00 46.21  ? 68  HIS C CD2 1 
ATOM   1113 C  CE1 . HIS B 2 53  ? 140.823 -15.935 226.063 1.00 45.83  ? 68  HIS C CE1 1 
ATOM   1114 N  NE2 . HIS B 2 53  ? 140.800 -14.680 225.651 1.00 50.32  ? 68  HIS C NE2 1 
ATOM   1115 N  N   . VAL B 2 54  ? 137.223 -14.218 227.989 1.00 45.82  ? 69  VAL C N   1 
ATOM   1116 C  CA  . VAL B 2 54  ? 136.245 -13.524 227.158 1.00 43.01  ? 69  VAL C CA  1 
ATOM   1117 C  C   . VAL B 2 54  ? 134.883 -13.470 227.840 1.00 34.10  ? 69  VAL C C   1 
ATOM   1118 O  O   . VAL B 2 54  ? 134.206 -12.440 227.803 1.00 23.78  ? 69  VAL C O   1 
ATOM   1119 C  CB  . VAL B 2 54  ? 136.158 -14.200 225.775 1.00 34.50  ? 69  VAL C CB  1 
ATOM   1120 C  CG1 . VAL B 2 54  ? 135.101 -13.522 224.917 1.00 17.78  ? 69  VAL C CG1 1 
ATOM   1121 C  CG2 . VAL B 2 54  ? 137.511 -14.170 225.084 1.00 39.37  ? 69  VAL C CG2 1 
ATOM   1122 N  N   . LEU B 2 55  ? 134.467 -14.570 228.475 1.00 31.50  ? 70  LEU C N   1 
ATOM   1123 C  CA  . LEU B 2 55  ? 133.176 -14.590 229.155 1.00 31.87  ? 70  LEU C CA  1 
ATOM   1124 C  C   . LEU B 2 55  ? 133.149 -13.638 230.343 1.00 37.40  ? 70  LEU C C   1 
ATOM   1125 O  O   . LEU B 2 55  ? 132.094 -13.079 230.662 1.00 46.88  ? 70  LEU C O   1 
ATOM   1126 C  CB  . LEU B 2 55  ? 132.838 -16.011 229.609 1.00 23.18  ? 70  LEU C CB  1 
ATOM   1127 C  CG  . LEU B 2 55  ? 131.409 -16.216 230.115 1.00 38.90  ? 70  LEU C CG  1 
ATOM   1128 C  CD1 . LEU B 2 55  ? 130.411 -15.669 229.107 1.00 32.56  ? 70  LEU C CD1 1 
ATOM   1129 C  CD2 . LEU B 2 55  ? 131.136 -17.685 230.396 1.00 28.27  ? 70  LEU C CD2 1 
ATOM   1130 N  N   . SER B 2 56  ? 134.289 -13.446 231.010 1.00 36.94  ? 71  SER C N   1 
ATOM   1131 C  CA  . SER B 2 56  ? 134.356 -12.470 232.092 1.00 31.23  ? 71  SER C CA  1 
ATOM   1132 C  C   . SER B 2 56  ? 134.091 -11.065 231.569 1.00 38.01  ? 71  SER C C   1 
ATOM   1133 O  O   . SER B 2 56  ? 133.327 -10.300 232.168 1.00 36.24  ? 71  SER C O   1 
ATOM   1134 C  CB  . SER B 2 56  ? 135.720 -12.541 232.782 1.00 33.46  ? 71  SER C CB  1 
ATOM   1135 O  OG  . SER B 2 56  ? 136.748 -12.057 231.936 1.00 51.83  ? 71  SER C OG  1 
ATOM   1136 N  N   . LYS B 2 57  ? 134.709 -10.713 230.439 1.00 36.00  ? 72  LYS C N   1 
ATOM   1137 C  CA  . LYS B 2 57  ? 134.470 -9.406  229.835 1.00 28.15  ? 72  LYS C CA  1 
ATOM   1138 C  C   . LYS B 2 57  ? 133.021 -9.260  229.389 1.00 26.11  ? 72  LYS C C   1 
ATOM   1139 O  O   . LYS B 2 57  ? 132.434 -8.179  229.509 1.00 28.37  ? 72  LYS C O   1 
ATOM   1140 C  CB  . LYS B 2 57  ? 135.417 -9.191  228.654 1.00 30.02  ? 72  LYS C CB  1 
ATOM   1141 C  CG  . LYS B 2 57  ? 136.567 -8.243  228.948 1.00 44.87  ? 72  LYS C CG  1 
ATOM   1142 C  CD  . LYS B 2 57  ? 136.076 -6.812  229.103 1.00 35.01  ? 72  LYS C CD  1 
ATOM   1143 C  CE  . LYS B 2 57  ? 137.231 -5.857  229.357 1.00 30.80  ? 72  LYS C CE  1 
ATOM   1144 N  NZ  . LYS B 2 57  ? 136.779 -4.442  229.478 1.00 50.05  ? 72  LYS C NZ  1 
ATOM   1145 N  N   . VAL B 2 58  ? 132.430 -10.339 228.867 1.00 25.91  ? 73  VAL C N   1 
ATOM   1146 C  CA  . VAL B 2 58  ? 131.023 -10.300 228.474 1.00 25.61  ? 73  VAL C CA  1 
ATOM   1147 C  C   . VAL B 2 58  ? 130.146 -9.978  229.677 1.00 30.86  ? 73  VAL C C   1 
ATOM   1148 O  O   . VAL B 2 58  ? 129.217 -9.165  229.589 1.00 33.35  ? 73  VAL C O   1 
ATOM   1149 C  CB  . VAL B 2 58  ? 130.612 -11.629 227.815 1.00 22.61  ? 73  VAL C CB  1 
ATOM   1150 C  CG1 . VAL B 2 58  ? 129.108 -11.673 227.602 1.00 24.42  ? 73  VAL C CG1 1 
ATOM   1151 C  CG2 . VAL B 2 58  ? 131.340 -11.821 226.496 1.00 27.34  ? 73  VAL C CG2 1 
ATOM   1152 N  N   . CYS B 2 59  ? 130.430 -10.607 230.821 1.00 31.16  ? 74  CYS C N   1 
ATOM   1153 C  CA  . CYS B 2 59  ? 129.685 -10.297 232.036 1.00 34.00  ? 74  CYS C CA  1 
ATOM   1154 C  C   . CYS B 2 59  ? 129.904 -8.849  232.458 1.00 35.10  ? 74  CYS C C   1 
ATOM   1155 O  O   . CYS B 2 59  ? 128.991 -8.205  232.988 1.00 27.90  ? 74  CYS C O   1 
ATOM   1156 C  CB  . CYS B 2 59  ? 130.091 -11.252 233.159 1.00 34.03  ? 74  CYS C CB  1 
ATOM   1157 S  SG  . CYS B 2 59  ? 129.694 -12.987 232.844 1.00 34.65  ? 74  CYS C SG  1 
ATOM   1158 N  N   . MET B 2 60  ? 131.109 -8.320  232.229 1.00 28.70  ? 75  MET C N   1 
ATOM   1159 C  CA  . MET B 2 60  ? 131.357 -6.907  232.497 1.00 30.36  ? 75  MET C CA  1 
ATOM   1160 C  C   . MET B 2 60  ? 130.505 -6.022  231.597 1.00 42.47  ? 75  MET C C   1 
ATOM   1161 O  O   . MET B 2 60  ? 130.022 -4.969  232.029 1.00 42.90  ? 75  MET C O   1 
ATOM   1162 C  CB  . MET B 2 60  ? 132.842 -6.585  232.318 1.00 20.50  ? 75  MET C CB  1 
ATOM   1163 C  CG  . MET B 2 60  ? 133.763 -7.352  233.254 1.00 22.67  ? 75  MET C CG  1 
ATOM   1164 S  SD  . MET B 2 60  ? 135.477 -6.793  233.187 1.00 39.74  ? 75  MET C SD  1 
ATOM   1165 C  CE  . MET B 2 60  ? 136.324 -8.222  233.857 1.00 55.42  ? 75  MET C CE  1 
ATOM   1166 N  N   . TYR B 2 61  ? 130.306 -6.431  230.340 1.00 37.32  ? 76  TYR C N   1 
ATOM   1167 C  CA  . TYR B 2 61  ? 129.438 -5.659  229.458 1.00 36.77  ? 76  TYR C CA  1 
ATOM   1168 C  C   . TYR B 2 61  ? 127.993 -5.691  229.940 1.00 27.24  ? 76  TYR C C   1 
ATOM   1169 O  O   . TYR B 2 61  ? 127.263 -4.705  229.787 1.00 32.51  ? 76  TYR C O   1 
ATOM   1170 C  CB  . TYR B 2 61  ? 129.522 -6.175  228.021 1.00 21.42  ? 76  TYR C CB  1 
ATOM   1171 C  CG  . TYR B 2 61  ? 128.496 -5.520  227.124 1.00 25.01  ? 76  TYR C CG  1 
ATOM   1172 C  CD1 . TYR B 2 61  ? 128.711 -4.250  226.606 1.00 20.68  ? 76  TYR C CD1 1 
ATOM   1173 C  CD2 . TYR B 2 61  ? 127.297 -6.156  226.823 1.00 23.46  ? 76  TYR C CD2 1 
ATOM   1174 C  CE1 . TYR B 2 61  ? 127.772 -3.638  225.801 1.00 23.78  ? 76  TYR C CE1 1 
ATOM   1175 C  CE2 . TYR B 2 61  ? 126.350 -5.551  226.020 1.00 23.36  ? 76  TYR C CE2 1 
ATOM   1176 C  CZ  . TYR B 2 61  ? 126.594 -4.293  225.511 1.00 34.95  ? 76  TYR C CZ  1 
ATOM   1177 O  OH  . TYR B 2 61  ? 125.656 -3.686  224.711 1.00 34.86  ? 76  TYR C OH  1 
ATOM   1178 N  N   . PHE B 2 62  ? 127.560 -6.818  230.512 1.00 33.64  ? 77  PHE C N   1 
ATOM   1179 C  CA  . PHE B 2 62  ? 126.198 -6.910  231.027 1.00 36.84  ? 77  PHE C CA  1 
ATOM   1180 C  C   . PHE B 2 62  ? 125.952 -5.861  232.103 1.00 37.17  ? 77  PHE C C   1 
ATOM   1181 O  O   . PHE B 2 62  ? 124.962 -5.122  232.054 1.00 38.16  ? 77  PHE C O   1 
ATOM   1182 C  CB  . PHE B 2 62  ? 125.936 -8.315  231.572 1.00 35.88  ? 77  PHE C CB  1 
ATOM   1183 C  CG  . PHE B 2 62  ? 125.860 -9.377  230.511 1.00 35.93  ? 77  PHE C CG  1 
ATOM   1184 C  CD1 . PHE B 2 62  ? 125.537 -9.052  229.203 1.00 44.72  ? 77  PHE C CD1 1 
ATOM   1185 C  CD2 . PHE B 2 62  ? 126.108 -10.703 230.825 1.00 37.59  ? 77  PHE C CD2 1 
ATOM   1186 C  CE1 . PHE B 2 62  ? 125.465 -10.031 228.228 1.00 45.52  ? 77  PHE C CE1 1 
ATOM   1187 C  CE2 . PHE B 2 62  ? 126.038 -11.685 229.856 1.00 44.73  ? 77  PHE C CE2 1 
ATOM   1188 C  CZ  . PHE B 2 62  ? 125.716 -11.349 228.556 1.00 50.91  ? 77  PHE C CZ  1 
ATOM   1189 N  N   . THR B 2 63  ? 126.853 -5.779  233.086 1.00 29.97  ? 78  THR C N   1 
ATOM   1190 C  CA  . THR B 2 63  ? 126.729 -4.764  234.127 1.00 45.87  ? 78  THR C CA  1 
ATOM   1191 C  C   . THR B 2 63  ? 126.830 -3.361  233.540 1.00 37.70  ? 78  THR C C   1 
ATOM   1192 O  O   . THR B 2 63  ? 126.108 -2.449  233.958 1.00 39.78  ? 78  THR C O   1 
ATOM   1193 C  CB  . THR B 2 63  ? 127.805 -4.975  235.193 1.00 46.35  ? 78  THR C CB  1 
ATOM   1194 O  OG1 . THR B 2 63  ? 127.860 -6.362  235.551 1.00 35.94  ? 78  THR C OG1 1 
ATOM   1195 C  CG2 . THR B 2 63  ? 127.499 -4.149  236.431 1.00 26.09  ? 78  THR C CG2 1 
ATOM   1196 N  N   . TYR B 2 64  ? 127.723 -3.176  232.565 1.00 38.14  ? 79  TYR C N   1 
ATOM   1197 C  CA  . TYR B 2 64  ? 127.868 -1.879  231.910 1.00 33.99  ? 79  TYR C CA  1 
ATOM   1198 C  C   . TYR B 2 64  ? 126.599 -1.498  231.157 1.00 35.77  ? 79  TYR C C   1 
ATOM   1199 O  O   . TYR B 2 64  ? 126.223 -0.321  231.114 1.00 37.10  ? 79  TYR C O   1 
ATOM   1200 C  CB  . TYR B 2 64  ? 129.078 -1.921  230.972 1.00 26.39  ? 79  TYR C CB  1 
ATOM   1201 C  CG  . TYR B 2 64  ? 129.236 -0.741  230.038 1.00 32.08  ? 79  TYR C CG  1 
ATOM   1202 C  CD1 . TYR B 2 64  ? 129.916 0.401   230.438 1.00 40.13  ? 79  TYR C CD1 1 
ATOM   1203 C  CD2 . TYR B 2 64  ? 128.738 -0.786  228.741 1.00 32.29  ? 79  TYR C CD2 1 
ATOM   1204 C  CE1 . TYR B 2 64  ? 130.076 1.475   229.582 1.00 30.49  ? 79  TYR C CE1 1 
ATOM   1205 C  CE2 . TYR B 2 64  ? 128.893 0.283   227.878 1.00 29.60  ? 79  TYR C CE2 1 
ATOM   1206 C  CZ  . TYR B 2 64  ? 129.563 1.411   228.303 1.00 34.56  ? 79  TYR C CZ  1 
ATOM   1207 O  OH  . TYR B 2 64  ? 129.721 2.476   227.448 1.00 40.62  ? 79  TYR C OH  1 
ATOM   1208 N  N   . LYS B 2 65  ? 125.919 -2.484  230.570 1.00 32.45  ? 80  LYS C N   1 
ATOM   1209 C  CA  . LYS B 2 65  ? 124.705 -2.211  229.807 1.00 37.85  ? 80  LYS C CA  1 
ATOM   1210 C  C   . LYS B 2 65  ? 123.515 -1.925  230.717 1.00 29.54  ? 80  LYS C C   1 
ATOM   1211 O  O   . LYS B 2 65  ? 122.728 -1.013  230.442 1.00 42.49  ? 80  LYS C O   1 
ATOM   1212 C  CB  . LYS B 2 65  ? 124.398 -3.389  228.881 1.00 41.25  ? 80  LYS C CB  1 
ATOM   1213 C  CG  . LYS B 2 65  ? 123.034 -3.325  228.218 1.00 43.57  ? 80  LYS C CG  1 
ATOM   1214 C  CD  . LYS B 2 65  ? 123.050 -2.393  227.019 1.00 32.79  ? 80  LYS C CD  1 
ATOM   1215 C  CE  . LYS B 2 65  ? 121.725 -2.435  226.282 1.00 52.71  ? 80  LYS C CE  1 
ATOM   1216 N  NZ  . LYS B 2 65  ? 121.283 -3.836  226.040 1.00 51.14  ? 80  LYS C NZ  1 
ATOM   1217 N  N   . VAL B 2 66  ? 123.366 -2.693  231.799 1.00 40.45  ? 81  VAL C N   1 
ATOM   1218 C  CA  . VAL B 2 66  ? 122.243 -2.483  232.708 1.00 43.26  ? 81  VAL C CA  1 
ATOM   1219 C  C   . VAL B 2 66  ? 122.393 -1.161  233.450 1.00 39.39  ? 81  VAL C C   1 
ATOM   1220 O  O   . VAL B 2 66  ? 121.415 -0.427  233.642 1.00 50.80  ? 81  VAL C O   1 
ATOM   1221 C  CB  . VAL B 2 66  ? 122.117 -3.669  233.683 1.00 34.70  ? 81  VAL C CB  1 
ATOM   1222 C  CG1 . VAL B 2 66  ? 121.050 -3.391  234.734 1.00 31.06  ? 81  VAL C CG1 1 
ATOM   1223 C  CG2 . VAL B 2 66  ? 121.799 -4.947  232.922 1.00 29.29  ? 81  VAL C CG2 1 
ATOM   1224 N  N   . ARG B 2 67  ? 123.616 -0.832  233.871 1.00 30.67  ? 82  ARG C N   1 
ATOM   1225 C  CA  . ARG B 2 67  ? 123.834 0.407   234.613 1.00 38.21  ? 82  ARG C CA  1 
ATOM   1226 C  C   . ARG B 2 67  ? 123.539 1.629   233.752 1.00 50.94  ? 82  ARG C C   1 
ATOM   1227 O  O   . ARG B 2 67  ? 122.900 2.582   234.212 1.00 67.50  ? 82  ARG C O   1 
ATOM   1228 C  CB  . ARG B 2 67  ? 125.268 0.451   235.142 1.00 49.11  ? 82  ARG C CB  1 
ATOM   1229 C  CG  . ARG B 2 67  ? 125.717 1.819   235.637 1.00 57.67  ? 82  ARG C CG  1 
ATOM   1230 C  CD  . ARG B 2 67  ? 124.896 2.285   236.830 1.00 60.28  ? 82  ARG C CD  1 
ATOM   1231 N  NE  . ARG B 2 67  ? 124.702 3.732   236.823 1.00 71.63  ? 82  ARG C NE  1 
ATOM   1232 C  CZ  . ARG B 2 67  ? 125.557 4.602   237.350 1.00 72.24  ? 82  ARG C CZ  1 
ATOM   1233 N  NH1 . ARG B 2 67  ? 126.669 4.174   237.931 1.00 59.86  ? 82  ARG C NH1 1 
ATOM   1234 N  NH2 . ARG B 2 67  ? 125.300 5.902   237.298 1.00 71.28  ? 82  ARG C NH2 1 
ATOM   1235 N  N   . TYR B 2 68  ? 123.988 1.618   232.498 1.00 52.36  ? 83  TYR C N   1 
ATOM   1236 C  CA  . TYR B 2 68  ? 123.791 2.766   231.621 1.00 46.97  ? 83  TYR C CA  1 
ATOM   1237 C  C   . TYR B 2 68  ? 122.740 2.469   230.559 1.00 64.95  ? 83  TYR C C   1 
ATOM   1238 O  O   . TYR B 2 68  ? 123.011 2.574   229.357 1.00 70.19  ? 83  TYR C O   1 
ATOM   1239 C  CB  . TYR B 2 68  ? 125.117 3.173   230.977 1.00 38.54  ? 83  TYR C CB  1 
ATOM   1240 C  CG  . TYR B 2 68  ? 126.198 3.480   231.989 1.00 38.39  ? 83  TYR C CG  1 
ATOM   1241 C  CD1 . TYR B 2 68  ? 126.218 4.694   232.664 1.00 55.72  ? 83  TYR C CD1 1 
ATOM   1242 C  CD2 . TYR B 2 68  ? 127.192 2.555   232.276 1.00 49.02  ? 83  TYR C CD2 1 
ATOM   1243 C  CE1 . TYR B 2 68  ? 127.202 4.980   233.594 1.00 45.86  ? 83  TYR C CE1 1 
ATOM   1244 C  CE2 . TYR B 2 68  ? 128.180 2.831   233.203 1.00 47.62  ? 83  TYR C CE2 1 
ATOM   1245 C  CZ  . TYR B 2 68  ? 128.179 4.043   233.861 1.00 52.95  ? 83  TYR C CZ  1 
ATOM   1246 O  OH  . TYR B 2 68  ? 129.163 4.320   234.782 1.00 45.58  ? 83  TYR C OH  1 
ATOM   1247 N  N   . THR B 2 69  ? 121.536 2.100   230.996 1.00 56.64  ? 84  THR C N   1 
ATOM   1248 C  CA  . THR B 2 69  ? 120.428 1.841   230.086 1.00 69.20  ? 84  THR C CA  1 
ATOM   1249 C  C   . THR B 2 69  ? 119.535 3.067   229.923 1.00 85.01  ? 84  THR C C   1 
ATOM   1250 O  O   . THR B 2 69  ? 119.290 3.515   228.799 1.00 78.97  ? 84  THR C O   1 
ATOM   1251 C  CB  . THR B 2 69  ? 119.603 0.649   230.584 1.00 66.85  ? 84  THR C CB  1 
ATOM   1252 N  N   . ASN B 2 70  ? 119.046 3.621   231.037 1.00 70.02  ? 85  ASN C N   1 
ATOM   1253 C  CA  . ASN B 2 70  ? 118.191 4.803   231.007 1.00 82.87  ? 85  ASN C CA  1 
ATOM   1254 C  C   . ASN B 2 70  ? 118.680 5.882   231.968 1.00 86.31  ? 85  ASN C C   1 
ATOM   1255 O  O   . ASN B 2 70  ? 117.903 6.766   232.343 1.00 110.35 ? 85  ASN C O   1 
ATOM   1256 C  CB  . ASN B 2 70  ? 116.741 4.429   231.325 1.00 60.31  ? 85  ASN C CB  1 
ATOM   1257 N  N   . SER B 2 71  ? 119.945 5.828   232.372 1.00 75.70  ? 86  SER C N   1 
ATOM   1258 C  CA  . SER B 2 71  ? 120.489 6.812   233.294 1.00 89.54  ? 86  SER C CA  1 
ATOM   1259 C  C   . SER B 2 71  ? 120.862 8.093   232.558 1.00 76.04  ? 86  SER C C   1 
ATOM   1260 O  O   . SER B 2 71  ? 121.250 8.073   231.386 1.00 84.78  ? 86  SER C O   1 
ATOM   1261 C  CB  . SER B 2 71  ? 121.713 6.251   234.019 1.00 92.03  ? 86  SER C CB  1 
ATOM   1262 N  N   . SER B 2 72  ? 120.742 9.215   233.263 1.00 80.58  ? 87  SER C N   1 
ATOM   1263 C  CA  . SER B 2 72  ? 121.029 10.527  232.698 1.00 73.38  ? 87  SER C CA  1 
ATOM   1264 C  C   . SER B 2 72  ? 122.493 10.926  232.826 1.00 58.75  ? 87  SER C C   1 
ATOM   1265 O  O   . SER B 2 72  ? 122.867 12.007  232.360 1.00 92.84  ? 87  SER C O   1 
ATOM   1266 C  CB  . SER B 2 72  ? 120.149 11.591  233.363 1.00 86.08  ? 87  SER C CB  1 
ATOM   1267 N  N   . THR B 2 73  ? 123.325 10.092  233.442 1.00 78.34  ? 88  THR C N   1 
ATOM   1268 C  CA  . THR B 2 73  ? 124.741 10.396  233.573 1.00 93.70  ? 88  THR C CA  1 
ATOM   1269 C  C   . THR B 2 73  ? 125.496 9.979   232.315 1.00 91.14  ? 88  THR C C   1 
ATOM   1270 O  O   . THR B 2 73  ? 125.063 9.097   231.567 1.00 71.91  ? 88  THR C O   1 
ATOM   1271 C  CB  . THR B 2 73  ? 125.331 9.696   234.798 1.00 51.29  ? 88  THR C CB  1 
ATOM   1272 O  OG1 . THR B 2 73  ? 126.743 9.935   234.856 1.00 51.29  ? 88  THR C OG1 1 
ATOM   1273 C  CG2 . THR B 2 73  ? 125.071 8.199   234.731 1.00 51.29  ? 88  THR C CG2 1 
ATOM   1274 N  N   . GLU B 2 74  ? 126.638 10.627  232.088 1.00 53.83  ? 89  GLU C N   1 
ATOM   1275 C  CA  . GLU B 2 74  ? 127.411 10.385  230.876 1.00 51.78  ? 89  GLU C CA  1 
ATOM   1276 C  C   . GLU B 2 74  ? 127.942 8.957   230.854 1.00 57.96  ? 89  GLU C C   1 
ATOM   1277 O  O   . GLU B 2 74  ? 128.496 8.470   231.844 1.00 61.73  ? 89  GLU C O   1 
ATOM   1278 C  CB  . GLU B 2 74  ? 128.560 11.387  230.775 1.00 59.45  ? 89  GLU C CB  1 
ATOM   1279 C  CG  . GLU B 2 74  ? 129.773 10.878  230.008 1.00 48.83  ? 89  GLU C CG  1 
ATOM   1280 C  CD  . GLU B 2 74  ? 130.669 11.997  229.510 1.00 67.59  ? 89  GLU C CD  1 
ATOM   1281 O  OE1 . GLU B 2 74  ? 131.379 11.789  228.504 1.00 70.70  ? 89  GLU C OE1 1 
ATOM   1282 O  OE2 . GLU B 2 74  ? 130.663 13.085  230.124 1.00 65.58  ? 89  GLU C OE2 1 
ATOM   1283 N  N   . ILE B 2 75  ? 127.770 8.291   229.721 1.00 54.88  ? 90  ILE C N   1 
ATOM   1284 C  CA  . ILE B 2 75  ? 128.180 6.892   229.589 1.00 47.94  ? 90  ILE C CA  1 
ATOM   1285 C  C   . ILE B 2 75  ? 129.689 6.837   229.372 1.00 50.90  ? 90  ILE C C   1 
ATOM   1286 O  O   . ILE B 2 75  ? 130.202 7.511   228.465 1.00 64.34  ? 90  ILE C O   1 
ATOM   1287 C  CB  . ILE B 2 75  ? 127.436 6.224   228.440 1.00 40.97  ? 90  ILE C CB  1 
ATOM   1288 C  CG1 . ILE B 2 75  ? 125.943 6.534   228.533 1.00 43.46  ? 90  ILE C CG1 1 
ATOM   1289 C  CG2 . ILE B 2 75  ? 127.669 4.723   228.456 1.00 45.35  ? 90  ILE C CG2 1 
ATOM   1290 C  CD1 . ILE B 2 75  ? 125.189 6.238   227.270 1.00 32.99  ? 90  ILE C CD1 1 
ATOM   1291 N  N   . PRO B 2 76  ? 130.423 6.064   230.166 1.00 47.26  ? 91  PRO C N   1 
ATOM   1292 C  CA  . PRO B 2 76  ? 131.866 5.947   229.961 1.00 47.71  ? 91  PRO C CA  1 
ATOM   1293 C  C   . PRO B 2 76  ? 132.192 4.936   228.872 1.00 46.22  ? 91  PRO C C   1 
ATOM   1294 O  O   . PRO B 2 76  ? 131.367 4.107   228.481 1.00 47.89  ? 91  PRO C O   1 
ATOM   1295 C  CB  . PRO B 2 76  ? 132.370 5.467   231.324 1.00 40.71  ? 91  PRO C CB  1 
ATOM   1296 C  CG  . PRO B 2 76  ? 131.237 4.639   231.842 1.00 48.42  ? 91  PRO C CG  1 
ATOM   1297 C  CD  . PRO B 2 76  ? 129.966 5.280   231.325 1.00 42.26  ? 91  PRO C CD  1 
ATOM   1298 N  N   . GLU B 2 77  ? 133.424 5.020   228.383 1.00 50.80  ? 92  GLU C N   1 
ATOM   1299 C  CA  . GLU B 2 77  ? 133.880 4.086   227.365 1.00 56.75  ? 92  GLU C CA  1 
ATOM   1300 C  C   . GLU B 2 77  ? 134.089 2.704   227.970 1.00 51.43  ? 92  GLU C C   1 
ATOM   1301 O  O   . GLU B 2 77  ? 134.574 2.567   229.097 1.00 45.66  ? 92  GLU C O   1 
ATOM   1302 C  CB  . GLU B 2 77  ? 135.176 4.584   226.727 1.00 50.71  ? 92  GLU C CB  1 
ATOM   1303 C  CG  . GLU B 2 77  ? 135.038 5.922   226.019 1.00 73.03  ? 92  GLU C CG  1 
ATOM   1304 C  CD  . GLU B 2 77  ? 135.512 5.875   224.580 1.00 89.54  ? 92  GLU C CD  1 
ATOM   1305 O  OE1 . GLU B 2 77  ? 136.623 5.362   224.334 1.00 100.34 ? 92  GLU C OE1 1 
ATOM   1306 O  OE2 . GLU B 2 77  ? 134.770 6.351   223.695 1.00 71.86  ? 92  GLU C OE2 1 
ATOM   1307 N  N   . PHE B 2 78  ? 133.706 1.675   227.215 1.00 51.76  ? 93  PHE C N   1 
ATOM   1308 C  CA  . PHE B 2 78  ? 133.935 0.296   227.622 1.00 33.65  ? 93  PHE C CA  1 
ATOM   1309 C  C   . PHE B 2 78  ? 135.298 -0.136  227.099 1.00 40.80  ? 93  PHE C C   1 
ATOM   1310 O  O   . PHE B 2 78  ? 135.468 -0.254  225.875 1.00 39.82  ? 93  PHE C O   1 
ATOM   1311 C  CB  . PHE B 2 78  ? 132.839 -0.613  227.082 1.00 29.49  ? 93  PHE C CB  1 
ATOM   1312 C  CG  . PHE B 2 78  ? 132.896 -2.020  227.610 1.00 32.71  ? 93  PHE C CG  1 
ATOM   1313 C  CD1 . PHE B 2 78  ? 132.416 -2.320  228.874 1.00 41.15  ? 93  PHE C CD1 1 
ATOM   1314 C  CD2 . PHE B 2 78  ? 133.418 -3.045  226.837 1.00 28.41  ? 93  PHE C CD2 1 
ATOM   1315 C  CE1 . PHE B 2 78  ? 132.463 -3.613  229.362 1.00 36.67  ? 93  PHE C CE1 1 
ATOM   1316 C  CE2 . PHE B 2 78  ? 133.467 -4.341  227.319 1.00 32.66  ? 93  PHE C CE2 1 
ATOM   1317 C  CZ  . PHE B 2 78  ? 132.988 -4.624  228.584 1.00 33.19  ? 93  PHE C CZ  1 
ATOM   1318 N  N   . PRO B 2 79  ? 136.288 -0.369  227.960 1.00 49.27  ? 94  PRO C N   1 
ATOM   1319 C  CA  . PRO B 2 79  ? 137.632 -0.700  227.464 1.00 43.91  ? 94  PRO C CA  1 
ATOM   1320 C  C   . PRO B 2 79  ? 137.677 -2.106  226.881 1.00 36.64  ? 94  PRO C C   1 
ATOM   1321 O  O   . PRO B 2 79  ? 137.191 -3.063  227.487 1.00 44.53  ? 94  PRO C O   1 
ATOM   1322 C  CB  . PRO B 2 79  ? 138.511 -0.578  228.713 1.00 49.63  ? 94  PRO C CB  1 
ATOM   1323 C  CG  . PRO B 2 79  ? 137.579 -0.839  229.850 1.00 35.44  ? 94  PRO C CG  1 
ATOM   1324 C  CD  . PRO B 2 79  ? 136.239 -0.296  229.431 1.00 35.01  ? 94  PRO C CD  1 
ATOM   1325 N  N   . ILE B 2 80  ? 138.262 -2.220  225.689 1.00 46.79  ? 95  ILE C N   1 
ATOM   1326 C  CA  . ILE B 2 80  ? 138.453 -3.500  225.015 1.00 22.39  ? 95  ILE C CA  1 
ATOM   1327 C  C   . ILE B 2 80  ? 139.878 -3.523  224.480 1.00 26.15  ? 95  ILE C C   1 
ATOM   1328 O  O   . ILE B 2 80  ? 140.211 -2.759  223.568 1.00 44.39  ? 95  ILE C O   1 
ATOM   1329 C  CB  . ILE B 2 80  ? 137.450 -3.728  223.874 1.00 23.28  ? 95  ILE C CB  1 
ATOM   1330 C  CG1 . ILE B 2 80  ? 136.015 -3.745  224.403 1.00 25.93  ? 95  ILE C CG1 1 
ATOM   1331 C  CG2 . ILE B 2 80  ? 137.762 -5.029  223.149 1.00 32.45  ? 95  ILE C CG2 1 
ATOM   1332 C  CD1 . ILE B 2 80  ? 134.972 -3.965  223.327 1.00 30.67  ? 95  ILE C CD1 1 
ATOM   1333 N  N   . ALA B 2 81  ? 140.717 -4.388  225.042 1.00 42.45  ? 96  ALA C N   1 
ATOM   1334 C  CA  . ALA B 2 81  ? 142.070 -4.534  224.538 1.00 37.94  ? 96  ALA C CA  1 
ATOM   1335 C  C   . ALA B 2 81  ? 142.050 -5.168  223.148 1.00 41.37  ? 96  ALA C C   1 
ATOM   1336 O  O   . ALA B 2 81  ? 141.191 -6.003  222.849 1.00 41.23  ? 96  ALA C O   1 
ATOM   1337 C  CB  . ALA B 2 81  ? 142.907 -5.387  225.487 1.00 46.54  ? 96  ALA C CB  1 
ATOM   1338 N  N   . PRO B 2 82  ? 142.981 -4.778  222.272 1.00 48.65  ? 97  PRO C N   1 
ATOM   1339 C  CA  . PRO B 2 82  ? 143.018 -5.384  220.931 1.00 41.23  ? 97  PRO C CA  1 
ATOM   1340 C  C   . PRO B 2 82  ? 143.284 -6.877  220.952 1.00 49.04  ? 97  PRO C C   1 
ATOM   1341 O  O   . PRO B 2 82  ? 142.879 -7.586  220.022 1.00 50.29  ? 97  PRO C O   1 
ATOM   1342 C  CB  . PRO B 2 82  ? 144.154 -4.622  220.233 1.00 43.04  ? 97  PRO C CB  1 
ATOM   1343 C  CG  . PRO B 2 82  ? 144.300 -3.350  221.007 1.00 39.86  ? 97  PRO C CG  1 
ATOM   1344 C  CD  . PRO B 2 82  ? 143.979 -3.707  222.424 1.00 42.34  ? 97  PRO C CD  1 
ATOM   1345 N  N   . GLU B 2 83  ? 143.954 -7.377  221.993 1.00 50.05  ? 98  GLU C N   1 
ATOM   1346 C  CA  . GLU B 2 83  ? 144.260 -8.799  222.090 1.00 51.74  ? 98  GLU C CA  1 
ATOM   1347 C  C   . GLU B 2 83  ? 143.012 -9.648  222.290 1.00 46.98  ? 98  GLU C C   1 
ATOM   1348 O  O   . GLU B 2 83  ? 143.063 -10.864 222.075 1.00 49.54  ? 98  GLU C O   1 
ATOM   1349 C  CB  . GLU B 2 83  ? 145.243 -9.042  223.238 1.00 58.43  ? 98  GLU C CB  1 
ATOM   1350 C  CG  . GLU B 2 83  ? 146.643 -8.479  223.006 1.00 78.00  ? 98  GLU C CG  1 
ATOM   1351 C  CD  . GLU B 2 83  ? 146.715 -6.968  223.166 1.00 79.09  ? 98  GLU C CD  1 
ATOM   1352 O  OE1 . GLU B 2 83  ? 145.695 -6.354  223.545 1.00 73.06  ? 98  GLU C OE1 1 
ATOM   1353 O  OE2 . GLU B 2 83  ? 147.794 -6.393  222.909 1.00 65.25  ? 98  GLU C OE2 1 
ATOM   1354 N  N   . ILE B 2 84  ? 141.899 -9.037  222.687 1.00 48.50  ? 99  ILE C N   1 
ATOM   1355 C  CA  . ILE B 2 84  ? 140.665 -9.763  222.968 1.00 48.95  ? 99  ILE C CA  1 
ATOM   1356 C  C   . ILE B 2 84  ? 139.527 -9.377  222.036 1.00 49.63  ? 99  ILE C C   1 
ATOM   1357 O  O   . ILE B 2 84  ? 138.485 -10.051 222.047 1.00 34.93  ? 99  ILE C O   1 
ATOM   1358 C  CB  . ILE B 2 84  ? 140.229 -9.569  224.437 1.00 43.43  ? 99  ILE C CB  1 
ATOM   1359 C  CG1 . ILE B 2 84  ? 139.423 -10.772 224.934 1.00 49.32  ? 99  ILE C CG1 1 
ATOM   1360 C  CG2 . ILE B 2 84  ? 139.440 -8.274  224.595 1.00 36.26  ? 99  ILE C CG2 1 
ATOM   1361 C  CD1 . ILE B 2 84  ? 138.788 -10.557 226.290 1.00 41.28  ? 99  ILE C CD1 1 
ATOM   1362 N  N   . ALA B 2 85  ? 139.691 -8.332  221.220 1.00 43.77  ? 100 ALA C N   1 
ATOM   1363 C  CA  . ALA B 2 85  ? 138.574 -7.800  220.445 1.00 39.65  ? 100 ALA C CA  1 
ATOM   1364 C  C   . ALA B 2 85  ? 138.052 -8.815  219.435 1.00 41.84  ? 100 ALA C C   1 
ATOM   1365 O  O   . ALA B 2 85  ? 136.842 -8.888  219.190 1.00 40.68  ? 100 ALA C O   1 
ATOM   1366 C  CB  . ALA B 2 85  ? 138.995 -6.512  219.738 1.00 40.38  ? 100 ALA C CB  1 
ATOM   1367 N  N   . LEU B 2 86  ? 138.944 -9.605  218.837 1.00 33.84  ? 101 LEU C N   1 
ATOM   1368 C  CA  . LEU B 2 86  ? 138.504 -10.585 217.848 1.00 35.67  ? 101 LEU C CA  1 
ATOM   1369 C  C   . LEU B 2 86  ? 137.686 -11.694 218.500 1.00 40.43  ? 101 LEU C C   1 
ATOM   1370 O  O   . LEU B 2 86  ? 136.618 -12.066 218.000 1.00 39.79  ? 101 LEU C O   1 
ATOM   1371 C  CB  . LEU B 2 86  ? 139.711 -11.158 217.105 1.00 40.87  ? 101 LEU C CB  1 
ATOM   1372 C  CG  . LEU B 2 86  ? 140.318 -10.207 216.070 1.00 42.19  ? 101 LEU C CG  1 
ATOM   1373 C  CD1 . LEU B 2 86  ? 141.680 -10.696 215.607 1.00 39.50  ? 101 LEU C CD1 1 
ATOM   1374 C  CD2 . LEU B 2 86  ? 139.376 -10.028 214.888 1.00 33.65  ? 101 LEU C CD2 1 
ATOM   1375 N  N   . GLU B 2 87  ? 138.171 -12.232 219.621 1.00 39.61  ? 102 GLU C N   1 
ATOM   1376 C  CA  . GLU B 2 87  ? 137.413 -13.256 220.335 1.00 40.12  ? 102 GLU C CA  1 
ATOM   1377 C  C   . GLU B 2 87  ? 136.123 -12.687 220.912 1.00 43.10  ? 102 GLU C C   1 
ATOM   1378 O  O   . GLU B 2 87  ? 135.077 -13.345 220.874 1.00 36.13  ? 102 GLU C O   1 
ATOM   1379 C  CB  . GLU B 2 87  ? 138.267 -13.866 221.446 1.00 39.11  ? 102 GLU C CB  1 
ATOM   1380 C  CG  . GLU B 2 87  ? 139.251 -14.922 220.977 1.00 59.23  ? 102 GLU C CG  1 
ATOM   1381 C  CD  . GLU B 2 87  ? 140.321 -15.212 222.009 1.00 73.26  ? 102 GLU C CD  1 
ATOM   1382 O  OE1 . GLU B 2 87  ? 140.899 -14.247 222.551 1.00 64.71  ? 102 GLU C OE1 1 
ATOM   1383 O  OE2 . GLU B 2 87  ? 140.581 -16.403 222.281 1.00 75.17  ? 102 GLU C OE2 1 
ATOM   1384 N  N   . LEU B 2 88  ? 136.180 -11.469 221.456 1.00 39.16  ? 103 LEU C N   1 
ATOM   1385 C  CA  . LEU B 2 88  ? 134.985 -10.857 222.026 1.00 29.66  ? 103 LEU C CA  1 
ATOM   1386 C  C   . LEU B 2 88  ? 133.935 -10.578 220.959 1.00 34.58  ? 103 LEU C C   1 
ATOM   1387 O  O   . LEU B 2 88  ? 132.733 -10.682 221.231 1.00 33.91  ? 103 LEU C O   1 
ATOM   1388 C  CB  . LEU B 2 88  ? 135.357 -9.568  222.762 1.00 30.68  ? 103 LEU C CB  1 
ATOM   1389 C  CG  . LEU B 2 88  ? 134.292 -8.951  223.670 1.00 30.87  ? 103 LEU C CG  1 
ATOM   1390 C  CD1 . LEU B 2 88  ? 133.884 -9.924  224.761 1.00 36.17  ? 103 LEU C CD1 1 
ATOM   1391 C  CD2 . LEU B 2 88  ? 134.793 -7.647  224.272 1.00 23.36  ? 103 LEU C CD2 1 
ATOM   1392 N  N   . LEU B 2 89  ? 134.363 -10.228 219.744 1.00 39.42  ? 104 LEU C N   1 
ATOM   1393 C  CA  . LEU B 2 89  ? 133.410 -10.000 218.662 1.00 39.22  ? 104 LEU C CA  1 
ATOM   1394 C  C   . LEU B 2 89  ? 132.696 -11.286 218.266 1.00 39.15  ? 104 LEU C C   1 
ATOM   1395 O  O   . LEU B 2 89  ? 131.508 -11.253 217.925 1.00 35.08  ? 104 LEU C O   1 
ATOM   1396 C  CB  . LEU B 2 89  ? 134.119 -9.389  217.453 1.00 41.44  ? 104 LEU C CB  1 
ATOM   1397 C  CG  . LEU B 2 89  ? 133.308 -9.330  216.156 1.00 30.38  ? 104 LEU C CG  1 
ATOM   1398 C  CD1 . LEU B 2 89  ? 132.120 -8.390  216.306 1.00 39.59  ? 104 LEU C CD1 1 
ATOM   1399 C  CD2 . LEU B 2 89  ? 134.178 -8.917  214.980 1.00 43.71  ? 104 LEU C CD2 1 
ATOM   1400 N  N   . MET B 2 90  ? 133.393 -12.422 218.309 1.00 33.56  ? 105 MET C N   1 
ATOM   1401 C  CA  . MET B 2 90  ? 132.752 -13.688 217.966 1.00 47.09  ? 105 MET C CA  1 
ATOM   1402 C  C   . MET B 2 90  ? 131.784 -14.129 219.058 1.00 31.97  ? 105 MET C C   1 
ATOM   1403 O  O   . MET B 2 90  ? 130.717 -14.680 218.764 1.00 36.01  ? 105 MET C O   1 
ATOM   1404 C  CB  . MET B 2 90  ? 133.809 -14.762 217.713 1.00 52.59  ? 105 MET C CB  1 
ATOM   1405 C  CG  . MET B 2 90  ? 134.274 -14.829 216.265 1.00 44.34  ? 105 MET C CG  1 
ATOM   1406 S  SD  . MET B 2 90  ? 135.638 -15.974 215.981 1.00 85.88  ? 105 MET C SD  1 
ATOM   1407 C  CE  . MET B 2 90  ? 136.988 -15.106 216.776 1.00 47.32  ? 105 MET C CE  1 
ATOM   1408 N  N   . ALA B 2 91  ? 132.133 -13.885 220.323 1.00 41.14  ? 106 ALA C N   1 
ATOM   1409 C  CA  . ALA B 2 91  ? 131.242 -14.258 221.417 1.00 26.43  ? 106 ALA C CA  1 
ATOM   1410 C  C   . ALA B 2 91  ? 130.022 -13.348 221.472 1.00 36.17  ? 106 ALA C C   1 
ATOM   1411 O  O   . ALA B 2 91  ? 128.913 -13.806 221.770 1.00 32.98  ? 106 ALA C O   1 
ATOM   1412 C  CB  . ALA B 2 91  ? 131.998 -14.229 222.745 1.00 27.81  ? 106 ALA C CB  1 
ATOM   1413 N  N   . ALA B 2 92  ? 130.205 -12.056 221.185 1.00 34.01  ? 107 ALA C N   1 
ATOM   1414 C  CA  . ALA B 2 92  ? 129.083 -11.124 221.229 1.00 29.89  ? 107 ALA C CA  1 
ATOM   1415 C  C   . ALA B 2 92  ? 128.083 -11.392 220.112 1.00 37.84  ? 107 ALA C C   1 
ATOM   1416 O  O   . ALA B 2 92  ? 126.880 -11.179 220.296 1.00 34.15  ? 107 ALA C O   1 
ATOM   1417 C  CB  . ALA B 2 92  ? 129.590 -9.685  221.155 1.00 33.15  ? 107 ALA C CB  1 
ATOM   1418 N  N   . ASN B 2 93  ? 128.558 -11.852 218.953 1.00 40.81  ? 108 ASN C N   1 
ATOM   1419 C  CA  . ASN B 2 93  ? 127.645 -12.207 217.872 1.00 38.62  ? 108 ASN C CA  1 
ATOM   1420 C  C   . ASN B 2 93  ? 126.896 -13.495 218.191 1.00 43.18  ? 108 ASN C C   1 
ATOM   1421 O  O   . ASN B 2 93  ? 125.713 -13.632 217.858 1.00 42.72  ? 108 ASN C O   1 
ATOM   1422 C  CB  . ASN B 2 93  ? 128.416 -12.338 216.559 1.00 49.79  ? 108 ASN C CB  1 
ATOM   1423 C  CG  . ASN B 2 93  ? 127.546 -12.818 215.416 1.00 49.37  ? 108 ASN C CG  1 
ATOM   1424 O  OD1 . ASN B 2 93  ? 127.717 -13.929 214.915 1.00 44.17  ? 108 ASN C OD1 1 
ATOM   1425 N  ND2 . ASN B 2 93  ? 126.606 -11.981 214.996 1.00 27.78  ? 108 ASN C ND2 1 
ATOM   1426 N  N   . PHE B 2 94  ? 127.570 -14.448 218.840 1.00 37.59  ? 109 PHE C N   1 
ATOM   1427 C  CA  . PHE B 2 94  ? 126.913 -15.689 219.236 1.00 44.29  ? 109 PHE C CA  1 
ATOM   1428 C  C   . PHE B 2 94  ? 125.876 -15.453 220.327 1.00 50.82  ? 109 PHE C C   1 
ATOM   1429 O  O   . PHE B 2 94  ? 124.865 -16.163 220.383 1.00 45.40  ? 109 PHE C O   1 
ATOM   1430 C  CB  . PHE B 2 94  ? 127.959 -16.705 219.699 1.00 31.07  ? 109 PHE C CB  1 
ATOM   1431 C  CG  . PHE B 2 94  ? 127.376 -17.936 220.332 1.00 50.34  ? 109 PHE C CG  1 
ATOM   1432 C  CD1 . PHE B 2 94  ? 126.705 -18.876 219.567 1.00 52.59  ? 109 PHE C CD1 1 
ATOM   1433 C  CD2 . PHE B 2 94  ? 127.506 -18.157 221.694 1.00 60.17  ? 109 PHE C CD2 1 
ATOM   1434 C  CE1 . PHE B 2 94  ? 126.171 -20.012 220.149 1.00 54.57  ? 109 PHE C CE1 1 
ATOM   1435 C  CE2 . PHE B 2 94  ? 126.974 -19.290 222.282 1.00 53.50  ? 109 PHE C CE2 1 
ATOM   1436 C  CZ  . PHE B 2 94  ? 126.306 -20.219 221.508 1.00 52.37  ? 109 PHE C CZ  1 
ATOM   1437 N  N   . LEU B 2 95  ? 126.101 -14.464 221.190 1.00 48.51  ? 110 LEU C N   1 
ATOM   1438 C  CA  . LEU B 2 95  ? 125.181 -14.157 222.275 1.00 39.67  ? 110 LEU C CA  1 
ATOM   1439 C  C   . LEU B 2 95  ? 124.136 -13.115 221.899 1.00 41.78  ? 110 LEU C C   1 
ATOM   1440 O  O   . LEU B 2 95  ? 123.124 -12.999 222.599 1.00 46.56  ? 110 LEU C O   1 
ATOM   1441 C  CB  . LEU B 2 95  ? 125.957 -13.672 223.504 1.00 35.79  ? 110 LEU C CB  1 
ATOM   1442 C  CG  . LEU B 2 95  ? 126.860 -14.706 224.177 1.00 40.65  ? 110 LEU C CG  1 
ATOM   1443 C  CD1 . LEU B 2 95  ? 127.809 -14.025 225.144 1.00 38.49  ? 110 LEU C CD1 1 
ATOM   1444 C  CD2 . LEU B 2 95  ? 126.026 -15.760 224.888 1.00 32.59  ? 110 LEU C CD2 1 
ATOM   1445 N  N   . ASP B 2 96  ? 124.352 -12.366 220.816 1.00 47.60  ? 111 ASP C N   1 
ATOM   1446 C  CA  . ASP B 2 96  ? 123.460 -11.292 220.372 1.00 53.09  ? 111 ASP C CA  1 
ATOM   1447 C  C   . ASP B 2 96  ? 123.268 -10.254 221.483 1.00 57.99  ? 111 ASP C C   1 
ATOM   1448 O  O   . ASP B 2 96  ? 122.230 -10.173 222.144 1.00 49.41  ? 111 ASP C O   1 
ATOM   1449 C  CB  . ASP B 2 96  ? 122.112 -11.848 219.899 1.00 41.63  ? 111 ASP C CB  1 
ATOM   1450 C  CG  . ASP B 2 96  ? 121.199 -10.771 219.337 1.00 65.70  ? 111 ASP C CG  1 
ATOM   1451 O  OD1 . ASP B 2 96  ? 121.490 -10.242 218.243 1.00 63.29  ? 111 ASP C OD1 1 
ATOM   1452 O  OD2 . ASP B 2 96  ? 120.188 -10.451 219.997 1.00 75.67  ? 111 ASP C OD2 1 
ATOM   1453 N  N   . CYS B 2 97  ? 124.314 -9.457  221.665 1.00 44.60  ? 112 CYS C N   1 
ATOM   1454 C  CA  . CYS B 2 97  ? 124.288 -8.390  222.659 1.00 59.83  ? 112 CYS C CA  1 
ATOM   1455 C  C   . CYS B 2 97  ? 125.298 -7.301  222.319 1.00 68.75  ? 112 CYS C C   1 
ATOM   1456 O  O   . CYS B 2 97  ? 126.082 -7.413  221.372 1.00 53.13  ? 112 CYS C O   1 
ATOM   1457 C  CB  . CYS B 2 97  ? 124.561 -8.947  224.058 1.00 59.19  ? 112 CYS C CB  1 
ATOM   1458 S  SG  . CYS B 2 97  ? 126.207 -9.661  224.282 1.00 66.20  ? 112 CYS C SG  1 
ATOM   1459 O  OXT . CYS B 2 97  ? 125.343 -6.273  222.992 1.00 55.74  ? 112 CYS C OXT 1 
ATOM   1460 N  N   . SER C 3 1   ? 125.527 5.688   191.001 1.00 63.16  ? 30  SER A N   1 
ATOM   1461 C  CA  . SER C 3 1   ? 124.717 5.996   192.173 1.00 55.55  ? 30  SER A CA  1 
ATOM   1462 C  C   . SER C 3 1   ? 124.298 7.462   192.181 1.00 42.10  ? 30  SER A C   1 
ATOM   1463 O  O   . SER C 3 1   ? 125.143 8.358   192.193 1.00 45.09  ? 30  SER A O   1 
ATOM   1464 C  CB  . SER C 3 1   ? 125.482 5.663   193.456 1.00 44.28  ? 30  SER A CB  1 
ATOM   1465 N  N   . MET C 3 2   ? 122.991 7.703   192.170 1.00 37.59  ? 31  MET A N   1 
ATOM   1466 C  CA  . MET C 3 2   ? 122.488 9.064   192.232 1.00 26.66  ? 31  MET A CA  1 
ATOM   1467 C  C   . MET C 3 2   ? 122.551 9.591   193.663 1.00 27.97  ? 31  MET A C   1 
ATOM   1468 O  O   . MET C 3 2   ? 122.712 8.836   194.627 1.00 22.10  ? 31  MET A O   1 
ATOM   1469 C  CB  . MET C 3 2   ? 121.059 9.142   191.697 1.00 34.91  ? 31  MET A CB  1 
ATOM   1470 C  CG  . MET C 3 2   ? 120.959 9.058   190.182 1.00 27.18  ? 31  MET A CG  1 
ATOM   1471 S  SD  . MET C 3 2   ? 119.253 9.121   189.603 1.00 45.44  ? 31  MET A SD  1 
ATOM   1472 C  CE  . MET C 3 2   ? 119.492 9.144   187.828 1.00 47.75  ? 31  MET A CE  1 
ATOM   1473 N  N   . GLN C 3 3   ? 122.409 10.913  193.787 1.00 31.17  ? 32  GLN A N   1 
ATOM   1474 C  CA  . GLN C 3 3   ? 122.631 11.577  195.069 1.00 34.96  ? 32  GLN A CA  1 
ATOM   1475 C  C   . GLN C 3 3   ? 121.684 11.062  196.147 1.00 33.72  ? 32  GLN A C   1 
ATOM   1476 O  O   . GLN C 3 3   ? 122.087 10.893  197.305 1.00 34.32  ? 32  GLN A O   1 
ATOM   1477 C  CB  . GLN C 3 3   ? 122.482 13.089  194.900 1.00 32.71  ? 32  GLN A CB  1 
ATOM   1478 C  CG  . GLN C 3 3   ? 122.520 13.873  196.199 1.00 48.70  ? 32  GLN A CG  1 
ATOM   1479 C  CD  . GLN C 3 3   ? 122.698 15.359  195.971 1.00 54.03  ? 32  GLN A CD  1 
ATOM   1480 O  OE1 . GLN C 3 3   ? 123.422 15.778  195.068 1.00 49.50  ? 32  GLN A OE1 1 
ATOM   1481 N  NE2 . GLN C 3 3   ? 122.034 16.167  196.788 1.00 55.71  ? 32  GLN A NE2 1 
ATOM   1482 N  N   . ALA C 3 4   ? 120.424 10.805  195.787 1.00 33.42  ? 33  ALA A N   1 
ATOM   1483 C  CA  . ALA C 3 4   ? 119.446 10.364  196.779 1.00 32.29  ? 33  ALA A CA  1 
ATOM   1484 C  C   . ALA C 3 4   ? 119.868 9.054   197.432 1.00 28.60  ? 33  ALA A C   1 
ATOM   1485 O  O   . ALA C 3 4   ? 119.713 8.880   198.646 1.00 36.10  ? 33  ALA A O   1 
ATOM   1486 C  CB  . ALA C 3 4   ? 118.068 10.222  196.135 1.00 38.28  ? 33  ALA A CB  1 
ATOM   1487 N  N   . ALA C 3 5   ? 120.406 8.120   196.643 1.00 37.91  ? 34  ALA A N   1 
ATOM   1488 C  CA  . ALA C 3 5   ? 120.899 6.872   197.215 1.00 36.78  ? 34  ALA A CA  1 
ATOM   1489 C  C   . ALA C 3 5   ? 122.139 7.109   198.067 1.00 40.06  ? 34  ALA A C   1 
ATOM   1490 O  O   . ALA C 3 5   ? 122.300 6.489   199.124 1.00 33.42  ? 34  ALA A O   1 
ATOM   1491 C  CB  . ALA C 3 5   ? 121.193 5.864   196.105 1.00 26.82  ? 34  ALA A CB  1 
ATOM   1492 N  N   . ARG C 3 6   ? 123.027 8.001   197.620 1.00 41.28  ? 35  ARG A N   1 
ATOM   1493 C  CA  . ARG C 3 6   ? 124.219 8.322   198.400 1.00 36.36  ? 35  ARG A CA  1 
ATOM   1494 C  C   . ARG C 3 6   ? 123.848 8.914   199.753 1.00 31.44  ? 35  ARG A C   1 
ATOM   1495 O  O   . ARG C 3 6   ? 124.453 8.573   200.776 1.00 33.19  ? 35  ARG A O   1 
ATOM   1496 C  CB  . ARG C 3 6   ? 125.111 9.289   197.619 1.00 37.14  ? 35  ARG A CB  1 
ATOM   1497 C  CG  . ARG C 3 6   ? 126.134 8.613   196.720 1.00 42.79  ? 35  ARG A CG  1 
ATOM   1498 C  CD  . ARG C 3 6   ? 126.205 9.289   195.356 1.00 44.35  ? 35  ARG A CD  1 
ATOM   1499 N  NE  . ARG C 3 6   ? 126.396 10.734  195.462 1.00 55.94  ? 35  ARG A NE  1 
ATOM   1500 C  CZ  . ARG C 3 6   ? 127.547 11.315  195.783 1.00 64.13  ? 35  ARG A CZ  1 
ATOM   1501 N  NH1 . ARG C 3 6   ? 128.622 10.576  196.020 1.00 57.01  ? 35  ARG A NH1 1 
ATOM   1502 N  NH2 . ARG C 3 6   ? 127.628 12.636  195.860 1.00 44.16  ? 35  ARG A NH2 1 
ATOM   1503 N  N   . LEU C 3 7   ? 122.851 9.803   199.778 1.00 39.34  ? 36  LEU A N   1 
ATOM   1504 C  CA  . LEU C 3 7   ? 122.422 10.403  201.037 1.00 31.14  ? 36  LEU A CA  1 
ATOM   1505 C  C   . LEU C 3 7   ? 121.760 9.379   201.950 1.00 32.70  ? 36  LEU A C   1 
ATOM   1506 O  O   . LEU C 3 7   ? 121.909 9.456   203.175 1.00 27.46  ? 36  LEU A O   1 
ATOM   1507 C  CB  . LEU C 3 7   ? 121.473 11.569  200.762 1.00 30.37  ? 36  LEU A CB  1 
ATOM   1508 C  CG  . LEU C 3 7   ? 120.892 12.305  201.971 1.00 30.30  ? 36  LEU A CG  1 
ATOM   1509 C  CD1 . LEU C 3 7   ? 122.003 12.849  202.849 1.00 23.12  ? 36  LEU A CD1 1 
ATOM   1510 C  CD2 . LEU C 3 7   ? 119.967 13.424  201.520 1.00 21.04  ? 36  LEU A CD2 1 
ATOM   1511 N  N   . ALA C 3 8   ? 121.036 8.415   201.378 1.00 34.29  ? 37  ALA A N   1 
ATOM   1512 C  CA  . ALA C 3 8   ? 120.383 7.397   202.195 1.00 26.70  ? 37  ALA A CA  1 
ATOM   1513 C  C   . ALA C 3 8   ? 121.404 6.503   202.888 1.00 27.02  ? 37  ALA A C   1 
ATOM   1514 O  O   . ALA C 3 8   ? 121.240 6.163   204.065 1.00 24.14  ? 37  ALA A O   1 
ATOM   1515 C  CB  . ALA C 3 8   ? 119.433 6.564   201.335 1.00 31.68  ? 37  ALA A CB  1 
ATOM   1516 N  N   . LYS C 3 9   ? 122.465 6.112   202.176 1.00 36.11  ? 38  LYS A N   1 
ATOM   1517 C  CA  . LYS C 3 9   ? 123.514 5.312   202.800 1.00 29.43  ? 38  LYS A CA  1 
ATOM   1518 C  C   . LYS C 3 9   ? 124.219 6.096   203.900 1.00 23.64  ? 38  LYS A C   1 
ATOM   1519 O  O   . LYS C 3 9   ? 124.615 5.526   204.924 1.00 33.05  ? 38  LYS A O   1 
ATOM   1520 C  CB  . LYS C 3 9   ? 124.520 4.840   201.751 1.00 19.70  ? 38  LYS A CB  1 
ATOM   1521 C  CG  . LYS C 3 9   ? 125.600 3.925   202.310 1.00 32.07  ? 38  LYS A CG  1 
ATOM   1522 C  CD  . LYS C 3 9   ? 126.786 3.807   201.369 1.00 35.52  ? 38  LYS A CD  1 
ATOM   1523 C  CE  . LYS C 3 9   ? 126.403 3.103   200.080 1.00 65.64  ? 38  LYS A CE  1 
ATOM   1524 N  NZ  . LYS C 3 9   ? 127.579 2.912   199.188 1.00 69.43  ? 38  LYS A NZ  1 
ATOM   1525 N  N   . ALA C 3 10  ? 124.383 7.406   203.707 1.00 21.97  ? 39  ALA A N   1 
ATOM   1526 C  CA  . ALA C 3 10  ? 125.001 8.232   204.738 1.00 27.66  ? 39  ALA A CA  1 
ATOM   1527 C  C   . ALA C 3 10  ? 124.134 8.318   205.986 1.00 34.87  ? 39  ALA A C   1 
ATOM   1528 O  O   . ALA C 3 10  ? 124.661 8.368   207.103 1.00 33.24  ? 39  ALA A O   1 
ATOM   1529 C  CB  . ALA C 3 10  ? 125.283 9.631   204.191 1.00 18.59  ? 39  ALA A CB  1 
ATOM   1530 N  N   . LEU C 3 11  ? 122.809 8.327   205.822 1.00 31.00  ? 40  LEU A N   1 
ATOM   1531 C  CA  . LEU C 3 11  ? 121.917 8.457   206.968 1.00 25.53  ? 40  LEU A CA  1 
ATOM   1532 C  C   . LEU C 3 11  ? 121.751 7.145   207.724 1.00 37.64  ? 40  LEU A C   1 
ATOM   1533 O  O   . LEU C 3 11  ? 121.475 7.163   208.929 1.00 37.41  ? 40  LEU A O   1 
ATOM   1534 C  CB  . LEU C 3 11  ? 120.555 8.981   206.514 1.00 21.43  ? 40  LEU A CB  1 
ATOM   1535 C  CG  . LEU C 3 11  ? 120.555 10.414  205.977 1.00 23.02  ? 40  LEU A CG  1 
ATOM   1536 C  CD1 . LEU C 3 11  ? 119.337 10.656  205.101 1.00 29.14  ? 40  LEU A CD1 1 
ATOM   1537 C  CD2 . LEU C 3 11  ? 120.612 11.420  207.118 1.00 22.99  ? 40  LEU A CD2 1 
ATOM   1538 N  N   . ARG C 3 12  ? 121.909 6.007   207.043 1.00 25.26  ? 41  ARG A N   1 
ATOM   1539 C  CA  . ARG C 3 12  ? 121.815 4.721   207.728 1.00 27.59  ? 41  ARG A CA  1 
ATOM   1540 C  C   . ARG C 3 12  ? 122.969 4.533   208.703 1.00 33.80  ? 41  ARG A C   1 
ATOM   1541 O  O   . ARG C 3 12  ? 122.772 4.042   209.821 1.00 37.58  ? 41  ARG A O   1 
ATOM   1542 C  CB  . ARG C 3 12  ? 121.780 3.582   206.709 1.00 28.66  ? 41  ARG A CB  1 
ATOM   1543 N  N   . GLU C 3 13  ? 124.182 4.918   208.296 1.00 31.97  ? 42  GLU A N   1 
ATOM   1544 C  CA  . GLU C 3 13  ? 125.328 4.830   209.195 1.00 35.66  ? 42  GLU A CA  1 
ATOM   1545 C  C   . GLU C 3 13  ? 125.171 5.756   210.392 1.00 36.26  ? 42  GLU A C   1 
ATOM   1546 O  O   . GLU C 3 13  ? 125.641 5.435   211.489 1.00 37.18  ? 42  GLU A O   1 
ATOM   1547 C  CB  . GLU C 3 13  ? 126.618 5.160   208.442 1.00 25.70  ? 42  GLU A CB  1 
ATOM   1548 C  CG  . GLU C 3 13  ? 126.759 4.463   207.100 1.00 47.06  ? 42  GLU A CG  1 
ATOM   1549 C  CD  . GLU C 3 13  ? 127.756 5.154   206.191 1.00 50.69  ? 42  GLU A CD  1 
ATOM   1550 O  OE1 . GLU C 3 13  ? 128.072 6.335   206.446 1.00 44.98  ? 42  GLU A OE1 1 
ATOM   1551 O  OE2 . GLU C 3 13  ? 128.225 4.517   205.224 1.00 43.76  ? 42  GLU A OE2 1 
ATOM   1552 N  N   . LEU C 3 14  ? 124.520 6.907   210.198 1.00 38.64  ? 43  LEU A N   1 
ATOM   1553 C  CA  . LEU C 3 14  ? 124.280 7.829   211.303 1.00 30.60  ? 43  LEU A CA  1 
ATOM   1554 C  C   . LEU C 3 14  ? 123.512 7.148   212.428 1.00 36.37  ? 43  LEU A C   1 
ATOM   1555 O  O   . LEU C 3 14  ? 123.779 7.392   213.610 1.00 33.25  ? 43  LEU A O   1 
ATOM   1556 C  CB  . LEU C 3 14  ? 123.522 9.057   210.797 1.00 31.65  ? 43  LEU A CB  1 
ATOM   1557 C  CG  . LEU C 3 14  ? 123.276 10.194  211.787 1.00 19.57  ? 43  LEU A CG  1 
ATOM   1558 C  CD1 . LEU C 3 14  ? 124.597 10.741  212.290 1.00 27.41  ? 43  LEU A CD1 1 
ATOM   1559 C  CD2 . LEU C 3 14  ? 122.450 11.293  211.138 1.00 25.68  ? 43  LEU A CD2 1 
ATOM   1560 N  N   . GLY C 3 15  ? 122.557 6.281   212.079 1.00 36.79  ? 44  GLY A N   1 
ATOM   1561 C  CA  . GLY C 3 15  ? 121.814 5.540   213.081 1.00 41.55  ? 44  GLY A CA  1 
ATOM   1562 C  C   . GLY C 3 15  ? 122.591 4.420   213.738 1.00 40.99  ? 44  GLY A C   1 
ATOM   1563 O  O   . GLY C 3 15  ? 122.188 3.946   214.805 1.00 53.67  ? 44  GLY A O   1 
ATOM   1564 N  N   . GLN C 3 16  ? 123.691 3.983   213.129 1.00 36.47  ? 45  GLN A N   1 
ATOM   1565 C  CA  . GLN C 3 16  ? 124.536 2.942   213.698 1.00 33.19  ? 45  GLN A CA  1 
ATOM   1566 C  C   . GLN C 3 16  ? 125.599 3.490   214.640 1.00 28.74  ? 45  GLN A C   1 
ATOM   1567 O  O   . GLN C 3 16  ? 126.327 2.702   215.254 1.00 39.41  ? 45  GLN A O   1 
ATOM   1568 C  CB  . GLN C 3 16  ? 125.212 2.139   212.581 1.00 36.58  ? 45  GLN A CB  1 
ATOM   1569 C  CG  . GLN C 3 16  ? 124.356 1.022   212.001 1.00 39.06  ? 45  GLN A CG  1 
ATOM   1570 C  CD  . GLN C 3 16  ? 124.216 -0.159  212.943 1.00 69.21  ? 45  GLN A CD  1 
ATOM   1571 O  OE1 . GLN C 3 16  ? 125.208 -0.699  213.432 1.00 57.75  ? 45  GLN A OE1 1 
ATOM   1572 N  NE2 . GLN C 3 16  ? 122.978 -0.566  213.201 1.00 54.35  ? 45  GLN A NE2 1 
ATOM   1573 N  N   . THR C 3 17  ? 125.707 4.813   214.771 1.00 27.36  ? 46  THR A N   1 
ATOM   1574 C  CA  . THR C 3 17  ? 126.768 5.402   215.582 1.00 34.07  ? 46  THR A CA  1 
ATOM   1575 C  C   . THR C 3 17  ? 126.491 5.247   217.072 1.00 35.00  ? 46  THR A C   1 
ATOM   1576 O  O   . THR C 3 17  ? 127.362 4.810   217.832 1.00 51.69  ? 46  THR A O   1 
ATOM   1577 C  CB  . THR C 3 17  ? 126.939 6.881   215.233 1.00 30.36  ? 46  THR A CB  1 
ATOM   1578 O  OG1 . THR C 3 17  ? 125.696 7.567   215.434 1.00 24.88  ? 46  THR A OG1 1 
ATOM   1579 C  CG2 . THR C 3 17  ? 127.376 7.043   213.788 1.00 37.97  ? 46  THR A CG2 1 
ATOM   1580 N  N   . GLY C 3 18  ? 125.288 5.604   217.507 1.00 26.99  ? 47  GLY A N   1 
ATOM   1581 C  CA  . GLY C 3 18  ? 124.981 5.657   218.918 1.00 22.64  ? 47  GLY A CA  1 
ATOM   1582 C  C   . GLY C 3 18  ? 125.148 7.021   219.549 1.00 35.86  ? 47  GLY A C   1 
ATOM   1583 O  O   . GLY C 3 18  ? 124.867 7.168   220.746 1.00 33.49  ? 47  GLY A O   1 
ATOM   1584 N  N   . TRP C 3 19  ? 125.605 8.020   218.791 1.00 34.54  ? 48  TRP A N   1 
ATOM   1585 C  CA  . TRP C 3 19  ? 125.675 9.397   219.266 1.00 26.87  ? 48  TRP A CA  1 
ATOM   1586 C  C   . TRP C 3 19  ? 124.827 10.324  218.401 1.00 29.07  ? 48  TRP A C   1 
ATOM   1587 O  O   . TRP C 3 19  ? 125.119 11.515  218.278 1.00 29.00  ? 48  TRP A O   1 
ATOM   1588 C  CB  . TRP C 3 19  ? 127.122 9.891   219.331 1.00 29.02  ? 48  TRP A CB  1 
ATOM   1589 C  CG  . TRP C 3 19  ? 128.053 9.316   218.299 1.00 39.20  ? 48  TRP A CG  1 
ATOM   1590 C  CD1 . TRP C 3 19  ? 128.713 8.123   218.361 1.00 29.66  ? 48  TRP A CD1 1 
ATOM   1591 C  CD2 . TRP C 3 19  ? 128.452 9.930   217.066 1.00 36.71  ? 48  TRP A CD2 1 
ATOM   1592 N  NE1 . TRP C 3 19  ? 129.486 7.950   217.238 1.00 27.99  ? 48  TRP A NE1 1 
ATOM   1593 C  CE2 . TRP C 3 19  ? 129.344 9.045   216.428 1.00 28.55  ? 48  TRP A CE2 1 
ATOM   1594 C  CE3 . TRP C 3 19  ? 128.135 11.138  216.438 1.00 29.63  ? 48  TRP A CE3 1 
ATOM   1595 C  CZ2 . TRP C 3 19  ? 129.921 9.330   215.192 1.00 33.15  ? 48  TRP A CZ2 1 
ATOM   1596 C  CZ3 . TRP C 3 19  ? 128.709 11.419  215.212 1.00 22.98  ? 48  TRP A CZ3 1 
ATOM   1597 C  CH2 . TRP C 3 19  ? 129.592 10.518  214.602 1.00 26.22  ? 48  TRP A CH2 1 
ATOM   1598 N  N   . TYR C 3 20  ? 123.773 9.785   217.793 1.00 33.66  ? 49  TYR A N   1 
ATOM   1599 C  CA  . TYR C 3 20  ? 122.794 10.571  217.054 1.00 31.74  ? 49  TYR A CA  1 
ATOM   1600 C  C   . TYR C 3 20  ? 121.565 10.753  217.937 1.00 33.10  ? 49  TYR A C   1 
ATOM   1601 O  O   . TYR C 3 20  ? 120.891 9.774   218.277 1.00 38.17  ? 49  TYR A O   1 
ATOM   1602 C  CB  . TYR C 3 20  ? 122.427 9.888   215.736 1.00 24.45  ? 49  TYR A CB  1 
ATOM   1603 C  CG  . TYR C 3 20  ? 121.248 10.510  215.023 1.00 25.41  ? 49  TYR A CG  1 
ATOM   1604 C  CD1 . TYR C 3 20  ? 121.197 11.878  214.782 1.00 36.53  ? 49  TYR A CD1 1 
ATOM   1605 C  CD2 . TYR C 3 20  ? 120.185 9.729   214.590 1.00 24.20  ? 49  TYR A CD2 1 
ATOM   1606 C  CE1 . TYR C 3 20  ? 120.119 12.448  214.130 1.00 27.94  ? 49  TYR A CE1 1 
ATOM   1607 C  CE2 . TYR C 3 20  ? 119.105 10.290  213.940 1.00 34.44  ? 49  TYR A CE2 1 
ATOM   1608 C  CZ  . TYR C 3 20  ? 119.077 11.649  213.711 1.00 32.12  ? 49  TYR A CZ  1 
ATOM   1609 O  OH  . TYR C 3 20  ? 118.002 12.212  213.062 1.00 20.57  ? 49  TYR A OH  1 
ATOM   1610 N  N   . TRP C 3 21  ? 121.278 12.000  218.308 1.00 30.03  ? 50  TRP A N   1 
ATOM   1611 C  CA  . TRP C 3 21  ? 120.250 12.303  219.294 1.00 34.50  ? 50  TRP A CA  1 
ATOM   1612 C  C   . TRP C 3 21  ? 118.932 12.747  218.672 1.00 38.04  ? 50  TRP A C   1 
ATOM   1613 O  O   . TRP C 3 21  ? 118.062 13.250  219.390 1.00 35.43  ? 50  TRP A O   1 
ATOM   1614 C  CB  . TRP C 3 21  ? 120.757 13.370  220.267 1.00 38.93  ? 50  TRP A CB  1 
ATOM   1615 C  CG  . TRP C 3 21  ? 121.831 12.864  221.178 1.00 39.90  ? 50  TRP A CG  1 
ATOM   1616 C  CD1 . TRP C 3 21  ? 123.120 12.573  220.841 1.00 33.84  ? 50  TRP A CD1 1 
ATOM   1617 C  CD2 . TRP C 3 21  ? 121.706 12.576  222.575 1.00 36.67  ? 50  TRP A CD2 1 
ATOM   1618 N  NE1 . TRP C 3 21  ? 123.808 12.127  221.943 1.00 28.79  ? 50  TRP A NE1 1 
ATOM   1619 C  CE2 . TRP C 3 21  ? 122.963 12.120  223.021 1.00 39.14  ? 50  TRP A CE2 1 
ATOM   1620 C  CE3 . TRP C 3 21  ? 120.655 12.662  223.493 1.00 30.35  ? 50  TRP A CE3 1 
ATOM   1621 C  CZ2 . TRP C 3 21  ? 123.196 11.751  224.342 1.00 25.99  ? 50  TRP A CZ2 1 
ATOM   1622 C  CZ3 . TRP C 3 21  ? 120.889 12.296  224.805 1.00 33.02  ? 50  TRP A CZ3 1 
ATOM   1623 C  CH2 . TRP C 3 21  ? 122.149 11.846  225.217 1.00 38.10  ? 50  TRP A CH2 1 
ATOM   1624 N  N   . GLY C 3 22  ? 118.765 12.571  217.364 1.00 34.41  ? 51  GLY A N   1 
ATOM   1625 C  CA  . GLY C 3 22  ? 117.483 12.852  216.737 1.00 32.68  ? 51  GLY A CA  1 
ATOM   1626 C  C   . GLY C 3 22  ? 117.059 14.297  216.914 1.00 39.14  ? 51  GLY A C   1 
ATOM   1627 O  O   . GLY C 3 22  ? 117.839 15.232  216.704 1.00 34.14  ? 51  GLY A O   1 
ATOM   1628 N  N   . SER C 3 23  ? 115.803 14.483  217.322 1.00 50.06  ? 52  SER A N   1 
ATOM   1629 C  CA  . SER C 3 23  ? 115.207 15.809  217.430 1.00 42.85  ? 52  SER A CA  1 
ATOM   1630 C  C   . SER C 3 23  ? 115.549 16.481  218.755 1.00 43.47  ? 52  SER A C   1 
ATOM   1631 O  O   . SER C 3 23  ? 114.671 17.042  219.418 1.00 46.40  ? 52  SER A O   1 
ATOM   1632 C  CB  . SER C 3 23  ? 113.688 15.722  217.260 1.00 48.96  ? 52  SER A CB  1 
ATOM   1633 O  OG  . SER C 3 23  ? 113.110 14.869  218.234 1.00 63.46  ? 52  SER A OG  1 
ATOM   1634 N  N   . MET C 3 24  ? 116.818 16.429  219.146 1.00 47.62  ? 53  MET A N   1 
ATOM   1635 C  CA  . MET C 3 24  ? 117.265 17.143  220.333 1.00 33.94  ? 53  MET A CA  1 
ATOM   1636 C  C   . MET C 3 24  ? 117.261 18.645  220.072 1.00 36.10  ? 53  MET A C   1 
ATOM   1637 O  O   . MET C 3 24  ? 117.572 19.099  218.968 1.00 49.50  ? 53  MET A O   1 
ATOM   1638 C  CB  . MET C 3 24  ? 118.666 16.678  220.729 1.00 43.69  ? 53  MET A CB  1 
ATOM   1639 C  CG  . MET C 3 24  ? 119.064 17.000  222.156 1.00 51.28  ? 53  MET A CG  1 
ATOM   1640 S  SD  . MET C 3 24  ? 120.769 16.514  222.486 1.00 48.58  ? 53  MET A SD  1 
ATOM   1641 C  CE  . MET C 3 24  ? 120.700 16.205  224.246 1.00 44.92  ? 53  MET A CE  1 
ATOM   1642 N  N   . THR C 3 25  ? 116.900 19.418  221.092 1.00 37.84  ? 54  THR A N   1 
ATOM   1643 C  CA  . THR C 3 25  ? 116.851 20.865  220.959 1.00 43.71  ? 54  THR A CA  1 
ATOM   1644 C  C   . THR C 3 25  ? 118.198 21.486  221.324 1.00 42.48  ? 54  THR A C   1 
ATOM   1645 O  O   . THR C 3 25  ? 119.121 20.815  221.788 1.00 40.22  ? 54  THR A O   1 
ATOM   1646 C  CB  . THR C 3 25  ? 115.741 21.457  221.830 1.00 43.64  ? 54  THR A CB  1 
ATOM   1647 O  OG1 . THR C 3 25  ? 116.167 21.493  223.197 1.00 43.64  ? 54  THR A OG1 1 
ATOM   1648 C  CG2 . THR C 3 25  ? 114.469 20.628  221.716 1.00 45.38  ? 54  THR A CG2 1 
ATOM   1649 N  N   . VAL C 3 26  ? 118.296 22.800  221.109 1.00 41.91  ? 55  VAL A N   1 
ATOM   1650 C  CA  . VAL C 3 26  ? 119.551 23.504  221.355 1.00 35.61  ? 55  VAL A CA  1 
ATOM   1651 C  C   . VAL C 3 26  ? 119.869 23.535  222.845 1.00 42.96  ? 55  VAL A C   1 
ATOM   1652 O  O   . VAL C 3 26  ? 121.021 23.335  223.250 1.00 45.12  ? 55  VAL A O   1 
ATOM   1653 C  CB  . VAL C 3 26  ? 119.495 24.921  220.757 1.00 28.78  ? 55  VAL A CB  1 
ATOM   1654 C  CG1 . VAL C 3 26  ? 120.898 25.488  220.603 1.00 31.95  ? 55  VAL A CG1 1 
ATOM   1655 C  CG2 . VAL C 3 26  ? 118.771 24.904  219.418 1.00 40.91  ? 55  VAL A CG2 1 
ATOM   1656 N  N   . ASN C 3 27  ? 118.863 23.786  223.685 1.00 50.90  ? 56  ASN A N   1 
ATOM   1657 C  CA  . ASN C 3 27  ? 119.111 23.846  225.121 1.00 41.15  ? 56  ASN A CA  1 
ATOM   1658 C  C   . ASN C 3 27  ? 119.252 22.462  225.739 1.00 40.06  ? 56  ASN A C   1 
ATOM   1659 O  O   . ASN C 3 27  ? 119.977 22.305  226.729 1.00 48.05  ? 56  ASN A O   1 
ATOM   1660 C  CB  . ASN C 3 27  ? 117.997 24.620  225.825 1.00 47.55  ? 56  ASN A CB  1 
ATOM   1661 C  CG  . ASN C 3 27  ? 118.420 25.129  227.189 1.00 72.40  ? 56  ASN A CG  1 
ATOM   1662 O  OD1 . ASN C 3 27  ? 118.319 24.418  228.188 1.00 68.33  ? 56  ASN A OD1 1 
ATOM   1663 N  ND2 . ASN C 3 27  ? 118.906 26.364  227.235 1.00 72.65  ? 56  ASN A ND2 1 
ATOM   1664 N  N   . GLU C 3 28  ? 118.569 21.456  225.186 1.00 39.72  ? 57  GLU A N   1 
ATOM   1665 C  CA  . GLU C 3 28  ? 118.743 20.093  225.677 1.00 41.17  ? 57  GLU A CA  1 
ATOM   1666 C  C   . GLU C 3 28  ? 120.182 19.626  225.494 1.00 54.92  ? 57  GLU A C   1 
ATOM   1667 O  O   . GLU C 3 28  ? 120.733 18.931  226.355 1.00 56.36  ? 57  GLU A O   1 
ATOM   1668 C  CB  . GLU C 3 28  ? 117.779 19.145  224.963 1.00 31.66  ? 57  GLU A CB  1 
ATOM   1669 C  CG  . GLU C 3 28  ? 116.350 19.195  225.478 1.00 34.06  ? 57  GLU A CG  1 
ATOM   1670 C  CD  . GLU C 3 28  ? 115.383 18.465  224.567 1.00 49.15  ? 57  GLU A CD  1 
ATOM   1671 O  OE1 . GLU C 3 28  ? 114.237 18.209  224.993 1.00 70.28  ? 57  GLU A OE1 1 
ATOM   1672 O  OE2 . GLU C 3 28  ? 115.772 18.144  223.425 1.00 53.85  ? 57  GLU A OE2 1 
ATOM   1673 N  N   . ALA C 3 29  ? 120.807 20.003  224.376 1.00 46.94  ? 58  ALA A N   1 
ATOM   1674 C  CA  . ALA C 3 29  ? 122.208 19.662  224.162 1.00 39.86  ? 58  ALA A CA  1 
ATOM   1675 C  C   . ALA C 3 29  ? 123.122 20.439  225.100 1.00 42.64  ? 58  ALA A C   1 
ATOM   1676 O  O   . ALA C 3 29  ? 124.177 19.928  225.496 1.00 45.88  ? 58  ALA A O   1 
ATOM   1677 C  CB  . ALA C 3 29  ? 122.596 19.919  222.705 1.00 42.74  ? 58  ALA A CB  1 
ATOM   1678 N  N   . LYS C 3 30  ? 122.738 21.666  225.465 1.00 51.05  ? 59  LYS A N   1 
ATOM   1679 C  CA  . LYS C 3 30  ? 123.546 22.452  226.393 1.00 46.18  ? 59  LYS A CA  1 
ATOM   1680 C  C   . LYS C 3 30  ? 123.670 21.772  227.748 1.00 53.01  ? 59  LYS A C   1 
ATOM   1681 O  O   . LYS C 3 30  ? 124.722 21.859  228.391 1.00 54.86  ? 59  LYS A O   1 
ATOM   1682 C  CB  . LYS C 3 30  ? 122.949 23.851  226.560 1.00 54.89  ? 59  LYS A CB  1 
ATOM   1683 C  CG  . LYS C 3 30  ? 123.754 24.766  227.474 1.00 51.62  ? 59  LYS A CG  1 
ATOM   1684 C  CD  . LYS C 3 30  ? 122.877 25.841  228.099 1.00 65.73  ? 59  LYS A CD  1 
ATOM   1685 C  CE  . LYS C 3 30  ? 121.965 25.263  229.169 1.00 79.51  ? 59  LYS A CE  1 
ATOM   1686 N  NZ  . LYS C 3 30  ? 122.537 25.424  230.535 1.00 39.21  ? 59  LYS A NZ  1 
ATOM   1687 N  N   . GLU C 3 31  ? 122.619 21.084  228.193 1.00 73.06  ? 60  GLU A N   1 
ATOM   1688 C  CA  . GLU C 3 31  ? 122.649 20.465  229.512 1.00 83.44  ? 60  GLU A CA  1 
ATOM   1689 C  C   . GLU C 3 31  ? 123.416 19.147  229.500 1.00 75.06  ? 60  GLU A C   1 
ATOM   1690 O  O   . GLU C 3 31  ? 124.112 18.824  230.469 1.00 73.85  ? 60  GLU A O   1 
ATOM   1691 C  CB  . GLU C 3 31  ? 121.225 20.257  230.026 1.00 57.23  ? 60  GLU A CB  1 
ATOM   1692 C  CG  . GLU C 3 31  ? 120.476 21.551  230.332 1.00 57.23  ? 60  GLU A CG  1 
ATOM   1693 C  CD  . GLU C 3 31  ? 120.922 22.213  231.626 1.00 57.23  ? 60  GLU A CD  1 
ATOM   1694 O  OE1 . GLU C 3 31  ? 122.141 22.401  231.822 1.00 57.23  ? 60  GLU A OE1 1 
ATOM   1695 O  OE2 . GLU C 3 31  ? 120.049 22.549  232.453 1.00 57.23  ? 60  GLU A OE2 1 
ATOM   1696 N  N   . LYS C 3 32  ? 123.306 18.373  228.417 1.00 43.71  ? 61  LYS A N   1 
ATOM   1697 C  CA  . LYS C 3 32  ? 124.031 17.110  228.345 1.00 42.96  ? 61  LYS A CA  1 
ATOM   1698 C  C   . LYS C 3 32  ? 125.531 17.311  228.173 1.00 39.59  ? 61  LYS A C   1 
ATOM   1699 O  O   . LYS C 3 32  ? 126.302 16.390  228.458 1.00 39.90  ? 61  LYS A O   1 
ATOM   1700 C  CB  . LYS C 3 32  ? 123.487 16.248  227.204 1.00 46.80  ? 61  LYS A CB  1 
ATOM   1701 C  CG  . LYS C 3 32  ? 122.120 15.636  227.481 1.00 40.09  ? 61  LYS A CG  1 
ATOM   1702 C  CD  . LYS C 3 32  ? 122.049 15.043  228.876 1.00 43.29  ? 61  LYS A CD  1 
ATOM   1703 C  CE  . LYS C 3 32  ? 120.850 14.121  229.041 1.00 45.99  ? 61  LYS A CE  1 
ATOM   1704 N  NZ  . LYS C 3 32  ? 120.996 12.856  228.270 1.00 59.09  ? 61  LYS A NZ  1 
ATOM   1705 N  N   . LEU C 3 33  ? 125.961 18.489  227.721 1.00 42.50  ? 62  LEU A N   1 
ATOM   1706 C  CA  . LEU C 3 33  ? 127.373 18.778  227.506 1.00 44.78  ? 62  LEU A CA  1 
ATOM   1707 C  C   . LEU C 3 33  ? 127.906 19.846  228.452 1.00 51.09  ? 62  LEU A C   1 
ATOM   1708 O  O   . LEU C 3 33  ? 129.057 20.268  228.305 1.00 45.77  ? 62  LEU A O   1 
ATOM   1709 C  CB  . LEU C 3 33  ? 127.610 19.205  226.056 1.00 31.93  ? 62  LEU A CB  1 
ATOM   1710 C  CG  . LEU C 3 33  ? 127.222 18.195  224.977 1.00 38.85  ? 62  LEU A CG  1 
ATOM   1711 C  CD1 . LEU C 3 33  ? 127.338 18.826  223.600 1.00 31.03  ? 62  LEU A CD1 1 
ATOM   1712 C  CD2 . LEU C 3 33  ? 128.090 16.953  225.080 1.00 28.22  ? 62  LEU A CD2 1 
ATOM   1713 N  N   . LYS C 3 34  ? 127.100 20.289  229.420 1.00 50.16  ? 63  LYS A N   1 
ATOM   1714 C  CA  . LYS C 3 34  ? 127.533 21.360  230.311 1.00 49.34  ? 63  LYS A CA  1 
ATOM   1715 C  C   . LYS C 3 34  ? 128.733 20.936  231.150 1.00 55.58  ? 63  LYS A C   1 
ATOM   1716 O  O   . LYS C 3 34  ? 129.650 21.734  231.380 1.00 47.92  ? 63  LYS A O   1 
ATOM   1717 C  CB  . LYS C 3 34  ? 126.376 21.792  231.212 1.00 44.28  ? 63  LYS A CB  1 
ATOM   1718 N  N   . GLU C 3 35  ? 128.751 19.686  231.611 1.00 58.33  ? 64  GLU A N   1 
ATOM   1719 C  CA  . GLU C 3 35  ? 129.811 19.190  232.480 1.00 50.37  ? 64  GLU A CA  1 
ATOM   1720 C  C   . GLU C 3 35  ? 130.696 18.150  231.803 1.00 42.74  ? 64  GLU A C   1 
ATOM   1721 O  O   . GLU C 3 35  ? 131.536 17.537  232.470 1.00 55.94  ? 64  GLU A O   1 
ATOM   1722 C  CB  . GLU C 3 35  ? 129.213 18.610  233.763 1.00 47.39  ? 64  GLU A CB  1 
ATOM   1723 C  CG  . GLU C 3 35  ? 128.427 19.613  234.589 1.00 60.17  ? 64  GLU A CG  1 
ATOM   1724 C  CD  . GLU C 3 35  ? 129.310 20.682  235.202 1.00 74.85  ? 64  GLU A CD  1 
ATOM   1725 O  OE1 . GLU C 3 35  ? 130.230 20.328  235.969 1.00 90.51  ? 64  GLU A OE1 1 
ATOM   1726 O  OE2 . GLU C 3 35  ? 129.084 21.877  234.916 1.00 70.79  ? 64  GLU A OE2 1 
ATOM   1727 N  N   . ALA C 3 36  ? 130.529 17.934  230.501 1.00 53.49  ? 65  ALA A N   1 
ATOM   1728 C  CA  . ALA C 3 36  ? 131.344 16.966  229.792 1.00 43.23  ? 65  ALA A CA  1 
ATOM   1729 C  C   . ALA C 3 36  ? 132.755 17.509  229.583 1.00 35.92  ? 65  ALA A C   1 
ATOM   1730 O  O   . ALA C 3 36  ? 132.966 18.723  229.555 1.00 43.41  ? 65  ALA A O   1 
ATOM   1731 C  CB  . ALA C 3 36  ? 130.706 16.620  228.449 1.00 43.50  ? 65  ALA A CB  1 
ATOM   1732 N  N   . PRO C 3 37  ? 133.744 16.626  229.449 1.00 36.34  ? 66  PRO A N   1 
ATOM   1733 C  CA  . PRO C 3 37  ? 135.103 17.088  229.146 1.00 31.84  ? 66  PRO A CA  1 
ATOM   1734 C  C   . PRO C 3 37  ? 135.168 17.771  227.788 1.00 32.73  ? 66  PRO A C   1 
ATOM   1735 O  O   . PRO C 3 37  ? 134.345 17.535  226.900 1.00 37.29  ? 66  PRO A O   1 
ATOM   1736 C  CB  . PRO C 3 37  ? 135.936 15.799  229.167 1.00 22.21  ? 66  PRO A CB  1 
ATOM   1737 C  CG  . PRO C 3 37  ? 134.942 14.691  229.007 1.00 31.48  ? 66  PRO A CG  1 
ATOM   1738 C  CD  . PRO C 3 37  ? 133.698 15.173  229.680 1.00 31.34  ? 66  PRO A CD  1 
ATOM   1739 N  N   . GLU C 3 38  ? 136.169 18.637  227.641 1.00 41.29  ? 67  GLU A N   1 
ATOM   1740 C  CA  . GLU C 3 38  ? 136.330 19.413  226.418 1.00 48.36  ? 67  GLU A CA  1 
ATOM   1741 C  C   . GLU C 3 38  ? 136.509 18.496  225.214 1.00 43.08  ? 67  GLU A C   1 
ATOM   1742 O  O   . GLU C 3 38  ? 137.292 17.543  225.253 1.00 51.40  ? 67  GLU A O   1 
ATOM   1743 C  CB  . GLU C 3 38  ? 137.529 20.352  226.553 1.00 52.57  ? 67  GLU A CB  1 
ATOM   1744 C  CG  . GLU C 3 38  ? 137.790 21.222  225.337 1.00 44.69  ? 67  GLU A CG  1 
ATOM   1745 C  CD  . GLU C 3 38  ? 139.185 21.816  225.341 1.00 56.89  ? 67  GLU A CD  1 
ATOM   1746 O  OE1 . GLU C 3 38  ? 139.939 21.578  224.374 1.00 70.31  ? 67  GLU A OE1 1 
ATOM   1747 O  OE2 . GLU C 3 38  ? 139.531 22.518  226.314 1.00 64.33  ? 67  GLU A OE2 1 
ATOM   1748 N  N   . GLY C 3 39  ? 135.773 18.786  224.143 1.00 41.36  ? 68  GLY A N   1 
ATOM   1749 C  CA  . GLY C 3 39  ? 135.809 17.989  222.936 1.00 40.92  ? 68  GLY A CA  1 
ATOM   1750 C  C   . GLY C 3 39  ? 134.670 17.003  222.789 1.00 43.53  ? 68  GLY A C   1 
ATOM   1751 O  O   . GLY C 3 39  ? 134.485 16.458  221.693 1.00 39.99  ? 68  GLY A O   1 
ATOM   1752 N  N   . THR C 3 40  ? 133.908 16.755  223.853 1.00 42.13  ? 69  THR A N   1 
ATOM   1753 C  CA  . THR C 3 40  ? 132.779 15.838  223.771 1.00 44.39  ? 69  THR A CA  1 
ATOM   1754 C  C   . THR C 3 40  ? 131.710 16.412  222.850 1.00 42.39  ? 69  THR A C   1 
ATOM   1755 O  O   . THR C 3 40  ? 131.337 17.583  222.967 1.00 31.18  ? 69  THR A O   1 
ATOM   1756 C  CB  . THR C 3 40  ? 132.202 15.577  225.162 1.00 36.19  ? 69  THR A CB  1 
ATOM   1757 O  OG1 . THR C 3 40  ? 133.228 15.048  226.013 1.00 39.73  ? 69  THR A OG1 1 
ATOM   1758 C  CG2 . THR C 3 40  ? 131.053 14.582  225.087 1.00 29.44  ? 69  THR A CG2 1 
ATOM   1759 N  N   . PHE C 3 41  ? 131.217 15.585  221.931 1.00 37.59  ? 70  PHE A N   1 
ATOM   1760 C  CA  . PHE C 3 41  ? 130.330 16.050  220.877 1.00 31.57  ? 70  PHE A CA  1 
ATOM   1761 C  C   . PHE C 3 41  ? 129.160 15.091  220.714 1.00 29.32  ? 70  PHE A C   1 
ATOM   1762 O  O   . PHE C 3 41  ? 129.161 13.969  221.229 1.00 30.22  ? 70  PHE A O   1 
ATOM   1763 C  CB  . PHE C 3 41  ? 131.077 16.195  219.545 1.00 29.06  ? 70  PHE A CB  1 
ATOM   1764 C  CG  . PHE C 3 41  ? 131.500 14.883  218.946 1.00 33.65  ? 70  PHE A CG  1 
ATOM   1765 C  CD1 . PHE C 3 41  ? 132.694 14.289  219.321 1.00 31.70  ? 70  PHE A CD1 1 
ATOM   1766 C  CD2 . PHE C 3 41  ? 130.702 14.239  218.014 1.00 28.11  ? 70  PHE A CD2 1 
ATOM   1767 C  CE1 . PHE C 3 41  ? 133.084 13.080  218.776 1.00 33.38  ? 70  PHE A CE1 1 
ATOM   1768 C  CE2 . PHE C 3 41  ? 131.085 13.030  217.470 1.00 23.68  ? 70  PHE A CE2 1 
ATOM   1769 C  CZ  . PHE C 3 41  ? 132.279 12.451  217.849 1.00 31.92  ? 70  PHE A CZ  1 
ATOM   1770 N  N   . LEU C 3 42  ? 128.154 15.557  219.979 1.00 24.35  ? 71  LEU A N   1 
ATOM   1771 C  CA  . LEU C 3 42  ? 127.054 14.725  219.517 1.00 25.34  ? 71  LEU A CA  1 
ATOM   1772 C  C   . LEU C 3 42  ? 126.517 15.341  218.234 1.00 37.06  ? 71  LEU A C   1 
ATOM   1773 O  O   . LEU C 3 42  ? 126.854 16.471  217.875 1.00 34.00  ? 71  LEU A O   1 
ATOM   1774 C  CB  . LEU C 3 42  ? 125.953 14.588  220.578 1.00 22.51  ? 71  LEU A CB  1 
ATOM   1775 C  CG  . LEU C 3 42  ? 125.166 15.832  221.003 1.00 35.84  ? 71  LEU A CG  1 
ATOM   1776 C  CD1 . LEU C 3 42  ? 123.891 16.000  220.184 1.00 30.19  ? 71  LEU A CD1 1 
ATOM   1777 C  CD2 . LEU C 3 42  ? 124.836 15.768  222.487 1.00 37.48  ? 71  LEU A CD2 1 
ATOM   1778 N  N   . ILE C 3 43  ? 125.675 14.584  217.538 1.00 20.57  ? 72  ILE A N   1 
ATOM   1779 C  CA  . ILE C 3 43  ? 125.045 15.049  216.310 1.00 24.36  ? 72  ILE A CA  1 
ATOM   1780 C  C   . ILE C 3 43  ? 123.538 14.873  216.445 1.00 26.10  ? 72  ILE A C   1 
ATOM   1781 O  O   . ILE C 3 43  ? 123.064 13.883  217.012 1.00 29.04  ? 72  ILE A O   1 
ATOM   1782 C  CB  . ILE C 3 43  ? 125.594 14.310  215.069 1.00 21.33  ? 72  ILE A CB  1 
ATOM   1783 C  CG1 . ILE C 3 43  ? 125.057 14.945  213.782 1.00 31.10  ? 72  ILE A CG1 1 
ATOM   1784 C  CG2 . ILE C 3 43  ? 125.279 12.824  215.133 1.00 36.97  ? 72  ILE A CG2 1 
ATOM   1785 C  CD1 . ILE C 3 43  ? 125.885 14.628  212.556 1.00 36.57  ? 72  ILE A CD1 1 
ATOM   1786 N  N   . ARG C 3 44  ? 122.789 15.849  215.937 1.00 34.81  ? 73  ARG A N   1 
ATOM   1787 C  CA  . ARG C 3 44  ? 121.346 15.884  216.118 1.00 29.50  ? 73  ARG A CA  1 
ATOM   1788 C  C   . ARG C 3 44  ? 120.712 16.553  214.908 1.00 28.07  ? 73  ARG A C   1 
ATOM   1789 O  O   . ARG C 3 44  ? 121.393 17.150  214.071 1.00 42.31  ? 73  ARG A O   1 
ATOM   1790 C  CB  . ARG C 3 44  ? 120.969 16.623  217.406 1.00 35.19  ? 73  ARG A CB  1 
ATOM   1791 C  CG  . ARG C 3 44  ? 121.588 18.010  217.507 1.00 31.36  ? 73  ARG A CG  1 
ATOM   1792 C  CD  . ARG C 3 44  ? 121.056 18.783  218.703 1.00 41.99  ? 73  ARG A CD  1 
ATOM   1793 N  NE  . ARG C 3 44  ? 121.617 20.131  218.779 1.00 35.56  ? 73  ARG A NE  1 
ATOM   1794 C  CZ  . ARG C 3 44  ? 121.149 21.175  218.101 1.00 46.77  ? 73  ARG A CZ  1 
ATOM   1795 N  NH1 . ARG C 3 44  ? 120.109 21.031  217.291 1.00 42.00  ? 73  ARG A NH1 1 
ATOM   1796 N  NH2 . ARG C 3 44  ? 121.720 22.364  218.232 1.00 40.11  ? 73  ARG A NH2 1 
ATOM   1797 N  N   . ASP C 3 45  ? 119.389 16.445  214.825 1.00 34.94  ? 74  ASP A N   1 
ATOM   1798 C  CA  . ASP C 3 45  ? 118.652 17.113  213.764 1.00 23.89  ? 74  ASP A CA  1 
ATOM   1799 C  C   . ASP C 3 45  ? 118.708 18.622  213.954 1.00 36.78  ? 74  ASP A C   1 
ATOM   1800 O  O   . ASP C 3 45  ? 118.578 19.129  215.072 1.00 43.55  ? 74  ASP A O   1 
ATOM   1801 C  CB  . ASP C 3 45  ? 117.197 16.645  213.745 1.00 20.39  ? 74  ASP A CB  1 
ATOM   1802 C  CG  . ASP C 3 45  ? 117.051 15.212  213.279 1.00 40.02  ? 74  ASP A CG  1 
ATOM   1803 O  OD1 . ASP C 3 45  ? 117.707 14.838  212.284 1.00 56.17  ? 74  ASP A OD1 1 
ATOM   1804 O  OD2 . ASP C 3 45  ? 116.275 14.461  213.906 1.00 52.31  ? 74  ASP A OD2 1 
ATOM   1805 N  N   . SER C 3 46  ? 118.910 19.342  212.855 1.00 36.54  ? 75  SER A N   1 
ATOM   1806 C  CA  . SER C 3 46  ? 118.916 20.797  212.897 1.00 36.59  ? 75  SER A CA  1 
ATOM   1807 C  C   . SER C 3 46  ? 117.488 21.322  212.825 1.00 43.53  ? 75  SER A C   1 
ATOM   1808 O  O   . SER C 3 46  ? 116.736 20.976  211.908 1.00 46.96  ? 75  SER A O   1 
ATOM   1809 C  CB  . SER C 3 46  ? 119.749 21.365  211.748 1.00 38.68  ? 75  SER A CB  1 
ATOM   1810 O  OG  . SER C 3 46  ? 119.598 22.771  211.652 1.00 38.50  ? 75  SER A OG  1 
ATOM   1811 N  N   . SER C 3 47  ? 117.114 22.155  213.798 1.00 42.31  ? 76  SER A N   1 
ATOM   1812 C  CA  . SER C 3 47  ? 115.793 22.771  213.792 1.00 47.35  ? 76  SER A CA  1 
ATOM   1813 C  C   . SER C 3 47  ? 115.638 23.810  212.689 1.00 41.41  ? 76  SER A C   1 
ATOM   1814 O  O   . SER C 3 47  ? 114.527 24.312  212.487 1.00 45.94  ? 76  SER A O   1 
ATOM   1815 C  CB  . SER C 3 47  ? 115.505 23.409  215.152 1.00 45.10  ? 76  SER A CB  1 
ATOM   1816 O  OG  . SER C 3 47  ? 116.579 24.235  215.564 1.00 57.51  ? 76  SER A OG  1 
ATOM   1817 N  N   . HIS C 3 48  ? 116.715 24.142  211.983 1.00 49.63  ? 77  HIS A N   1 
ATOM   1818 C  CA  . HIS C 3 48  ? 116.650 25.052  210.852 1.00 35.92  ? 77  HIS A CA  1 
ATOM   1819 C  C   . HIS C 3 48  ? 116.221 24.303  209.596 1.00 44.80  ? 77  HIS A C   1 
ATOM   1820 O  O   . HIS C 3 48  ? 116.539 23.125  209.409 1.00 49.71  ? 77  HIS A O   1 
ATOM   1821 C  CB  . HIS C 3 48  ? 118.009 25.719  210.629 1.00 46.74  ? 77  HIS A CB  1 
ATOM   1822 C  CG  . HIS C 3 48  ? 117.937 27.021  209.894 1.00 51.28  ? 77  HIS A CG  1 
ATOM   1823 N  ND1 . HIS C 3 48  ? 117.788 27.097  208.526 1.00 52.71  ? 77  HIS A ND1 1 
ATOM   1824 C  CD2 . HIS C 3 48  ? 118.002 28.299  210.337 1.00 50.13  ? 77  HIS A CD2 1 
ATOM   1825 C  CE1 . HIS C 3 48  ? 117.761 28.366  208.158 1.00 48.03  ? 77  HIS A CE1 1 
ATOM   1826 N  NE2 . HIS C 3 48  ? 117.889 29.115  209.238 1.00 55.93  ? 77  HIS A NE2 1 
ATOM   1827 N  N   . SER C 3 49  ? 115.489 25.003  208.727 1.00 45.32  ? 78  SER A N   1 
ATOM   1828 C  CA  . SER C 3 49  ? 114.976 24.375  207.514 1.00 62.51  ? 78  SER A CA  1 
ATOM   1829 C  C   . SER C 3 49  ? 116.057 24.163  206.462 1.00 47.91  ? 78  SER A C   1 
ATOM   1830 O  O   . SER C 3 49  ? 115.913 23.276  205.614 1.00 55.53  ? 78  SER A O   1 
ATOM   1831 C  CB  . SER C 3 49  ? 113.842 25.217  206.925 1.00 62.51  ? 78  SER A CB  1 
ATOM   1832 O  OG  . SER C 3 49  ? 114.177 26.594  206.916 1.00 67.35  ? 78  SER A OG  1 
ATOM   1833 N  N   . ASP C 3 50  ? 117.133 24.947  206.498 1.00 48.52  ? 79  ASP A N   1 
ATOM   1834 C  CA  . ASP C 3 50  ? 118.183 24.880  205.492 1.00 51.44  ? 79  ASP A CA  1 
ATOM   1835 C  C   . ASP C 3 50  ? 119.277 23.876  205.830 1.00 41.11  ? 79  ASP A C   1 
ATOM   1836 O  O   . ASP C 3 50  ? 120.249 23.767  205.076 1.00 39.13  ? 79  ASP A O   1 
ATOM   1837 C  CB  . ASP C 3 50  ? 118.809 26.265  205.297 1.00 57.79  ? 79  ASP A CB  1 
ATOM   1838 C  CG  . ASP C 3 50  ? 117.797 27.304  204.860 1.00 62.97  ? 79  ASP A CG  1 
ATOM   1839 O  OD1 . ASP C 3 50  ? 116.637 26.928  204.592 1.00 76.96  ? 79  ASP A OD1 1 
ATOM   1840 O  OD2 . ASP C 3 50  ? 118.162 28.496  204.789 1.00 54.85  ? 79  ASP A OD2 1 
ATOM   1841 N  N   . TYR C 3 51  ? 119.148 23.145  206.935 1.00 38.40  ? 80  TYR A N   1 
ATOM   1842 C  CA  . TYR C 3 51  ? 120.187 22.227  207.377 1.00 41.03  ? 80  TYR A CA  1 
ATOM   1843 C  C   . TYR C 3 51  ? 119.550 20.948  207.900 1.00 30.79  ? 80  TYR A C   1 
ATOM   1844 O  O   . TYR C 3 51  ? 118.463 20.969  208.483 1.00 35.51  ? 80  TYR A O   1 
ATOM   1845 C  CB  . TYR C 3 51  ? 121.067 22.858  208.466 1.00 43.04  ? 80  TYR A CB  1 
ATOM   1846 C  CG  . TYR C 3 51  ? 121.827 24.087  208.015 1.00 35.81  ? 80  TYR A CG  1 
ATOM   1847 C  CD1 . TYR C 3 51  ? 121.252 25.350  208.087 1.00 38.67  ? 80  TYR A CD1 1 
ATOM   1848 C  CD2 . TYR C 3 51  ? 123.123 23.985  207.525 1.00 39.02  ? 80  TYR A CD2 1 
ATOM   1849 C  CE1 . TYR C 3 51  ? 121.944 26.476  207.681 1.00 27.30  ? 80  TYR A CE1 1 
ATOM   1850 C  CE2 . TYR C 3 51  ? 123.823 25.106  207.115 1.00 46.63  ? 80  TYR A CE2 1 
ATOM   1851 C  CZ  . TYR C 3 51  ? 123.228 26.348  207.196 1.00 39.56  ? 80  TYR A CZ  1 
ATOM   1852 O  OH  . TYR C 3 51  ? 123.919 27.467  206.790 1.00 43.77  ? 80  TYR A OH  1 
ATOM   1853 N  N   . LEU C 3 52  ? 120.244 19.831  207.685 1.00 40.98  ? 81  LEU A N   1 
ATOM   1854 C  CA  . LEU C 3 52  ? 119.771 18.531  208.146 1.00 32.96  ? 81  LEU A CA  1 
ATOM   1855 C  C   . LEU C 3 52  ? 120.299 18.190  209.535 1.00 39.34  ? 81  LEU A C   1 
ATOM   1856 O  O   . LEU C 3 52  ? 119.536 17.756  210.403 1.00 41.50  ? 81  LEU A O   1 
ATOM   1857 C  CB  . LEU C 3 52  ? 120.177 17.435  207.155 1.00 14.67  ? 81  LEU A CB  1 
ATOM   1858 C  CG  . LEU C 3 52  ? 119.538 17.439  205.766 1.00 33.53  ? 81  LEU A CG  1 
ATOM   1859 C  CD1 . LEU C 3 52  ? 120.015 16.237  204.965 1.00 20.74  ? 81  LEU A CD1 1 
ATOM   1860 C  CD2 . LEU C 3 52  ? 118.021 17.452  205.869 1.00 29.59  ? 81  LEU A CD2 1 
ATOM   1861 N  N   . LEU C 3 53  ? 121.595 18.380  209.756 1.00 32.55  ? 82  LEU A N   1 
ATOM   1862 C  CA  . LEU C 3 53  ? 122.249 17.954  210.981 1.00 23.76  ? 82  LEU A CA  1 
ATOM   1863 C  C   . LEU C 3 53  ? 122.990 19.119  211.625 1.00 30.02  ? 82  LEU A C   1 
ATOM   1864 O  O   . LEU C 3 53  ? 123.285 20.131  210.984 1.00 26.63  ? 82  LEU A O   1 
ATOM   1865 C  CB  . LEU C 3 53  ? 123.216 16.794  210.706 1.00 14.12  ? 82  LEU A CB  1 
ATOM   1866 C  CG  . LEU C 3 53  ? 122.529 15.574  210.089 1.00 18.22  ? 82  LEU A CG  1 
ATOM   1867 C  CD1 . LEU C 3 53  ? 123.539 14.544  209.606 1.00 26.91  ? 82  LEU A CD1 1 
ATOM   1868 C  CD2 . LEU C 3 53  ? 121.561 14.963  211.089 1.00 16.85  ? 82  LEU A CD2 1 
ATOM   1869 N  N   . THR C 3 54  ? 123.281 18.958  212.913 1.00 29.14  ? 83  THR A N   1 
ATOM   1870 C  CA  . THR C 3 54  ? 123.990 19.957  213.696 1.00 31.67  ? 83  THR A CA  1 
ATOM   1871 C  C   . THR C 3 54  ? 124.897 19.247  214.688 1.00 27.06  ? 83  THR A C   1 
ATOM   1872 O  O   . THR C 3 54  ? 124.493 18.265  215.315 1.00 35.19  ? 83  THR A O   1 
ATOM   1873 C  CB  . THR C 3 54  ? 123.013 20.885  214.439 1.00 33.95  ? 83  THR A CB  1 
ATOM   1874 O  OG1 . THR C 3 54  ? 122.413 21.794  213.508 1.00 37.36  ? 83  THR A OG1 1 
ATOM   1875 C  CG2 . THR C 3 54  ? 123.731 21.682  215.521 1.00 25.24  ? 83  THR A CG2 1 
ATOM   1876 N  N   . ILE C 3 55  ? 126.127 19.735  214.811 1.00 26.64  ? 84  ILE A N   1 
ATOM   1877 C  CA  . ILE C 3 55  ? 127.087 19.217  215.778 1.00 29.73  ? 84  ILE A CA  1 
ATOM   1878 C  C   . ILE C 3 55  ? 127.020 20.084  217.026 1.00 31.88  ? 84  ILE A C   1 
ATOM   1879 O  O   . ILE C 3 55  ? 127.255 21.296  216.964 1.00 30.77  ? 84  ILE A O   1 
ATOM   1880 C  CB  . ILE C 3 55  ? 128.513 19.199  215.210 1.00 32.57  ? 84  ILE A CB  1 
ATOM   1881 C  CG1 . ILE C 3 55  ? 128.568 18.406  213.907 1.00 37.74  ? 84  ILE A CG1 1 
ATOM   1882 C  CG2 . ILE C 3 55  ? 129.480 18.616  216.228 1.00 35.51  ? 84  ILE A CG2 1 
ATOM   1883 C  CD1 . ILE C 3 55  ? 129.770 18.744  213.061 1.00 47.90  ? 84  ILE A CD1 1 
ATOM   1884 N  N   . SER C 3 56  ? 126.697 19.466  218.158 1.00 41.98  ? 85  SER A N   1 
ATOM   1885 C  CA  . SER C 3 56  ? 126.788 20.111  219.460 1.00 27.48  ? 85  SER A CA  1 
ATOM   1886 C  C   . SER C 3 56  ? 128.036 19.584  220.157 1.00 32.20  ? 85  SER A C   1 
ATOM   1887 O  O   . SER C 3 56  ? 128.128 18.387  220.448 1.00 33.76  ? 85  SER A O   1 
ATOM   1888 C  CB  . SER C 3 56  ? 125.538 19.840  220.297 1.00 38.41  ? 85  SER A CB  1 
ATOM   1889 O  OG  . SER C 3 56  ? 124.382 20.379  219.679 1.00 29.58  ? 85  SER A OG  1 
ATOM   1890 N  N   . VAL C 3 57  ? 128.996 20.471  220.410 1.00 31.53  ? 86  VAL A N   1 
ATOM   1891 C  CA  . VAL C 3 57  ? 130.289 20.093  220.966 1.00 33.89  ? 86  VAL A CA  1 
ATOM   1892 C  C   . VAL C 3 57  ? 130.566 20.940  222.201 1.00 41.83  ? 86  VAL A C   1 
ATOM   1893 O  O   . VAL C 3 57  ? 130.225 22.128  222.243 1.00 33.88  ? 86  VAL A O   1 
ATOM   1894 C  CB  . VAL C 3 57  ? 131.420 20.246  219.923 1.00 25.09  ? 86  VAL A CB  1 
ATOM   1895 C  CG1 . VAL C 3 57  ? 131.423 21.649  219.330 1.00 37.24  ? 86  VAL A CG1 1 
ATOM   1896 C  CG2 . VAL C 3 57  ? 132.777 19.906  220.529 1.00 29.64  ? 86  VAL A CG2 1 
ATOM   1897 N  N   . LYS C 3 58  ? 131.169 20.321  223.212 1.00 37.88  ? 87  LYS A N   1 
ATOM   1898 C  CA  . LYS C 3 58  ? 131.576 21.018  224.424 1.00 39.37  ? 87  LYS A CA  1 
ATOM   1899 C  C   . LYS C 3 58  ? 133.001 21.530  224.252 1.00 42.21  ? 87  LYS A C   1 
ATOM   1900 O  O   . LYS C 3 58  ? 133.926 20.745  224.017 1.00 42.04  ? 87  LYS A O   1 
ATOM   1901 C  CB  . LYS C 3 58  ? 131.477 20.092  225.636 1.00 39.22  ? 87  LYS A CB  1 
ATOM   1902 C  CG  . LYS C 3 58  ? 132.262 20.566  226.847 1.00 35.59  ? 87  LYS A CG  1 
ATOM   1903 C  CD  . LYS C 3 58  ? 131.712 21.875  227.387 1.00 36.54  ? 87  LYS A CD  1 
ATOM   1904 C  CE  . LYS C 3 58  ? 132.285 22.185  228.759 1.00 42.84  ? 87  LYS A CE  1 
ATOM   1905 N  NZ  . LYS C 3 58  ? 131.904 21.153  229.760 1.00 48.53  ? 87  LYS A NZ  1 
ATOM   1906 N  N   . THR C 3 59  ? 133.174 22.842  224.364 1.00 44.93  ? 88  THR A N   1 
ATOM   1907 C  CA  . THR C 3 59  ? 134.478 23.482  224.313 1.00 35.73  ? 88  THR A CA  1 
ATOM   1908 C  C   . THR C 3 59  ? 134.863 23.963  225.708 1.00 49.35  ? 88  THR A C   1 
ATOM   1909 O  O   . THR C 3 59  ? 134.085 23.869  226.662 1.00 46.90  ? 88  THR A O   1 
ATOM   1910 C  CB  . THR C 3 59  ? 134.477 24.641  223.313 1.00 40.34  ? 88  THR A CB  1 
ATOM   1911 O  OG1 . THR C 3 59  ? 133.710 25.729  223.843 1.00 38.82  ? 88  THR A OG1 1 
ATOM   1912 C  CG2 . THR C 3 59  ? 133.877 24.203  221.986 1.00 39.17  ? 88  THR A CG2 1 
ATOM   1913 N  N   . SER C 3 60  ? 136.085 24.487  225.822 1.00 50.23  ? 89  SER A N   1 
ATOM   1914 C  CA  . SER C 3 60  ? 136.548 25.001  227.106 1.00 47.26  ? 89  SER A CA  1 
ATOM   1915 C  C   . SER C 3 60  ? 135.689 26.162  227.588 1.00 44.08  ? 89  SER A C   1 
ATOM   1916 O  O   . SER C 3 60  ? 135.529 26.356  228.799 1.00 54.34  ? 89  SER A O   1 
ATOM   1917 C  CB  . SER C 3 60  ? 138.012 25.431  227.002 1.00 37.67  ? 89  SER A CB  1 
ATOM   1918 O  OG  . SER C 3 60  ? 138.216 26.272  225.881 1.00 61.98  ? 89  SER A OG  1 
ATOM   1919 N  N   . ALA C 3 61  ? 135.124 26.937  226.664 1.00 46.14  ? 90  ALA A N   1 
ATOM   1920 C  CA  . ALA C 3 61  ? 134.278 28.073  227.003 1.00 49.87  ? 90  ALA A CA  1 
ATOM   1921 C  C   . ALA C 3 61  ? 132.812 27.694  227.171 1.00 51.40  ? 90  ALA A C   1 
ATOM   1922 O  O   . ALA C 3 61  ? 131.994 28.568  227.477 1.00 65.31  ? 90  ALA A O   1 
ATOM   1923 C  CB  . ALA C 3 61  ? 134.408 29.162  225.934 1.00 50.09  ? 90  ALA A CB  1 
ATOM   1924 N  N   . GLY C 3 62  ? 132.460 26.426  226.979 1.00 50.16  ? 91  GLY A N   1 
ATOM   1925 C  CA  . GLY C 3 62  ? 131.093 25.987  227.121 1.00 46.17  ? 91  GLY A CA  1 
ATOM   1926 C  C   . GLY C 3 62  ? 130.577 25.295  225.876 1.00 47.82  ? 91  GLY A C   1 
ATOM   1927 O  O   . GLY C 3 62  ? 131.227 25.286  224.826 1.00 45.84  ? 91  GLY A O   1 
ATOM   1928 N  N   . PRO C 3 63  ? 129.391 24.698  225.972 1.00 48.92  ? 92  PRO A N   1 
ATOM   1929 C  CA  . PRO C 3 63  ? 128.827 23.995  224.813 1.00 37.21  ? 92  PRO A CA  1 
ATOM   1930 C  C   . PRO C 3 63  ? 128.435 24.966  223.711 1.00 31.34  ? 92  PRO A C   1 
ATOM   1931 O  O   . PRO C 3 63  ? 127.948 26.069  223.972 1.00 38.25  ? 92  PRO A O   1 
ATOM   1932 C  CB  . PRO C 3 63  ? 127.598 23.278  225.389 1.00 41.47  ? 92  PRO A CB  1 
ATOM   1933 C  CG  . PRO C 3 63  ? 127.763 23.332  226.885 1.00 42.72  ? 92  PRO A CG  1 
ATOM   1934 C  CD  . PRO C 3 63  ? 128.533 24.580  227.162 1.00 48.83  ? 92  PRO A CD  1 
ATOM   1935 N  N   . THR C 3 64  ? 128.654 24.543  222.468 1.00 38.92  ? 93  THR A N   1 
ATOM   1936 C  CA  . THR C 3 64  ? 128.278 25.327  221.300 1.00 39.45  ? 93  THR A CA  1 
ATOM   1937 C  C   . THR C 3 64  ? 127.664 24.398  220.263 1.00 44.47  ? 93  THR A C   1 
ATOM   1938 O  O   . THR C 3 64  ? 127.540 23.187  220.475 1.00 44.20  ? 93  THR A O   1 
ATOM   1939 C  CB  . THR C 3 64  ? 129.477 26.081  220.714 1.00 40.76  ? 93  THR A CB  1 
ATOM   1940 O  OG1 . THR C 3 64  ? 129.063 26.797  219.543 1.00 50.29  ? 93  THR A OG1 1 
ATOM   1941 C  CG2 . THR C 3 64  ? 130.583 25.110  220.337 1.00 36.80  ? 93  THR A CG2 1 
ATOM   1942 N  N   . ASN C 3 65  ? 127.277 24.975  219.128 1.00 38.73  ? 94  ASN A N   1 
ATOM   1943 C  CA  . ASN C 3 65  ? 126.625 24.232  218.063 1.00 34.13  ? 94  ASN A CA  1 
ATOM   1944 C  C   . ASN C 3 65  ? 127.149 24.697  216.714 1.00 36.32  ? 94  ASN A C   1 
ATOM   1945 O  O   . ASN C 3 65  ? 127.387 25.890  216.506 1.00 24.20  ? 94  ASN A O   1 
ATOM   1946 C  CB  . ASN C 3 65  ? 125.101 24.399  218.120 1.00 30.25  ? 94  ASN A CB  1 
ATOM   1947 C  CG  . ASN C 3 65  ? 124.527 24.006  219.465 1.00 38.70  ? 94  ASN A CG  1 
ATOM   1948 O  OD1 . ASN C 3 65  ? 124.120 22.863  219.668 1.00 39.52  ? 94  ASN A OD1 1 
ATOM   1949 N  ND2 . ASN C 3 65  ? 124.497 24.953  220.395 1.00 30.39  ? 94  ASN A ND2 1 
ATOM   1950 N  N   . LEU C 3 66  ? 127.323 23.744  215.802 1.00 33.45  ? 95  LEU A N   1 
ATOM   1951 C  CA  . LEU C 3 66  ? 127.819 24.020  214.460 1.00 29.24  ? 95  LEU A CA  1 
ATOM   1952 C  C   . LEU C 3 66  ? 127.043 23.157  213.480 1.00 29.31  ? 95  LEU A C   1 
ATOM   1953 O  O   . LEU C 3 66  ? 127.066 21.927  213.583 1.00 38.06  ? 95  LEU A O   1 
ATOM   1954 C  CB  . LEU C 3 66  ? 129.318 23.734  214.362 1.00 30.88  ? 95  LEU A CB  1 
ATOM   1955 C  CG  . LEU C 3 66  ? 129.959 23.727  212.976 1.00 42.34  ? 95  LEU A CG  1 
ATOM   1956 C  CD1 . LEU C 3 66  ? 129.698 25.027  212.222 1.00 31.33  ? 95  LEU A CD1 1 
ATOM   1957 C  CD2 . LEU C 3 66  ? 131.441 23.459  213.121 1.00 31.94  ? 95  LEU A CD2 1 
ATOM   1958 N  N   . ARG C 3 67  ? 126.363 23.797  212.534 1.00 26.14  ? 96  ARG A N   1 
ATOM   1959 C  CA  . ARG C 3 67  ? 125.517 23.077  211.598 1.00 35.76  ? 96  ARG A CA  1 
ATOM   1960 C  C   . ARG C 3 67  ? 126.347 22.448  210.482 1.00 38.83  ? 96  ARG A C   1 
ATOM   1961 O  O   . ARG C 3 67  ? 127.456 22.888  210.167 1.00 38.73  ? 96  ARG A O   1 
ATOM   1962 C  CB  . ARG C 3 67  ? 124.463 24.010  211.002 1.00 32.16  ? 96  ARG A CB  1 
ATOM   1963 C  CG  . ARG C 3 67  ? 123.523 24.620  212.027 1.00 36.67  ? 96  ARG A CG  1 
ATOM   1964 C  CD  . ARG C 3 67  ? 122.301 25.209  211.350 1.00 34.71  ? 96  ARG A CD  1 
ATOM   1965 N  NE  . ARG C 3 67  ? 121.428 25.906  212.287 1.00 34.65  ? 96  ARG A NE  1 
ATOM   1966 C  CZ  . ARG C 3 67  ? 121.552 27.189  212.607 1.00 37.78  ? 96  ARG A CZ  1 
ATOM   1967 N  NH1 . ARG C 3 67  ? 122.522 27.918  212.070 1.00 46.00  ? 96  ARG A NH1 1 
ATOM   1968 N  NH2 . ARG C 3 67  ? 120.709 27.744  213.467 1.00 37.88  ? 96  ARG A NH2 1 
ATOM   1969 N  N   . ILE C 3 68  ? 125.785 21.404  209.879 1.00 28.04  ? 97  ILE A N   1 
ATOM   1970 C  CA  . ILE C 3 68  ? 126.411 20.688  208.774 1.00 29.05  ? 97  ILE A CA  1 
ATOM   1971 C  C   . ILE C 3 68  ? 125.612 20.966  207.511 1.00 31.28  ? 97  ILE A C   1 
ATOM   1972 O  O   . ILE C 3 68  ? 124.394 20.752  207.478 1.00 27.79  ? 97  ILE A O   1 
ATOM   1973 C  CB  . ILE C 3 68  ? 126.488 19.177  209.052 1.00 29.11  ? 97  ILE A CB  1 
ATOM   1974 C  CG1 . ILE C 3 68  ? 127.183 18.917  210.388 1.00 34.83  ? 97  ILE A CG1 1 
ATOM   1975 C  CG2 . ILE C 3 68  ? 127.213 18.464  207.922 1.00 17.81  ? 97  ILE A CG2 1 
ATOM   1976 C  CD1 . ILE C 3 68  ? 127.323 17.453  210.713 1.00 25.76  ? 97  ILE A CD1 1 
ATOM   1977 N  N   . GLU C 3 69  ? 126.295 21.438  206.474 1.00 21.04  ? 98  GLU A N   1 
ATOM   1978 C  CA  . GLU C 3 69  ? 125.655 21.742  205.204 1.00 27.27  ? 98  GLU A CA  1 
ATOM   1979 C  C   . GLU C 3 69  ? 125.705 20.529  204.283 1.00 28.94  ? 98  GLU A C   1 
ATOM   1980 O  O   . GLU C 3 69  ? 126.666 19.754  204.295 1.00 30.91  ? 98  GLU A O   1 
ATOM   1981 C  CB  . GLU C 3 69  ? 126.333 22.937  204.530 1.00 27.85  ? 98  GLU A CB  1 
ATOM   1982 C  CG  . GLU C 3 69  ? 125.566 23.502  203.343 1.00 56.90  ? 98  GLU A CG  1 
ATOM   1983 C  CD  . GLU C 3 69  ? 126.446 24.314  202.414 1.00 67.95  ? 98  GLU A CD  1 
ATOM   1984 O  OE1 . GLU C 3 69  ? 127.685 24.171  202.490 1.00 60.14  ? 98  GLU A OE1 1 
ATOM   1985 O  OE2 . GLU C 3 69  ? 125.900 25.095  201.606 1.00 67.03  ? 98  GLU A OE2 1 
ATOM   1986 N  N   . TYR C 3 70  ? 124.650 20.366  203.487 1.00 23.41  ? 99  TYR A N   1 
ATOM   1987 C  CA  . TYR C 3 70  ? 124.583 19.320  202.469 1.00 26.72  ? 99  TYR A CA  1 
ATOM   1988 C  C   . TYR C 3 70  ? 124.317 19.991  201.126 1.00 32.20  ? 99  TYR A C   1 
ATOM   1989 O  O   . TYR C 3 70  ? 123.190 20.411  200.845 1.00 42.41  ? 99  TYR A O   1 
ATOM   1990 C  CB  . TYR C 3 70  ? 123.512 18.285  202.794 1.00 22.01  ? 99  TYR A CB  1 
ATOM   1991 C  CG  . TYR C 3 70  ? 123.530 17.095  201.863 1.00 26.95  ? 99  TYR A CG  1 
ATOM   1992 C  CD1 . TYR C 3 70  ? 124.464 16.080  202.024 1.00 29.37  ? 99  TYR A CD1 1 
ATOM   1993 C  CD2 . TYR C 3 70  ? 122.619 16.987  200.821 1.00 31.14  ? 99  TYR A CD2 1 
ATOM   1994 C  CE1 . TYR C 3 70  ? 124.488 14.989  201.175 1.00 29.60  ? 99  TYR A CE1 1 
ATOM   1995 C  CE2 . TYR C 3 70  ? 122.635 15.900  199.968 1.00 25.41  ? 99  TYR A CE2 1 
ATOM   1996 C  CZ  . TYR C 3 70  ? 123.571 14.905  200.149 1.00 37.03  ? 99  TYR A CZ  1 
ATOM   1997 O  OH  . TYR C 3 70  ? 123.589 13.822  199.299 1.00 35.68  ? 99  TYR A OH  1 
ATOM   1998 N  N   . GLN C 3 71  ? 125.357 20.094  200.303 1.00 37.47  ? 100 GLN A N   1 
ATOM   1999 C  CA  . GLN C 3 71  ? 125.255 20.692  198.980 1.00 36.36  ? 100 GLN A CA  1 
ATOM   2000 C  C   . GLN C 3 71  ? 126.015 19.822  197.992 1.00 29.55  ? 100 GLN A C   1 
ATOM   2001 O  O   . GLN C 3 71  ? 127.147 19.414  198.269 1.00 43.16  ? 100 GLN A O   1 
ATOM   2002 C  CB  . GLN C 3 71  ? 125.810 22.121  198.968 1.00 28.62  ? 100 GLN A CB  1 
ATOM   2003 N  N   . ASP C 3 72  ? 125.385 19.537  196.851 1.00 37.06  ? 101 ASP A N   1 
ATOM   2004 C  CA  . ASP C 3 72  ? 125.992 18.736  195.786 1.00 45.53  ? 101 ASP A CA  1 
ATOM   2005 C  C   . ASP C 3 72  ? 126.444 17.370  196.302 1.00 41.80  ? 101 ASP A C   1 
ATOM   2006 O  O   . ASP C 3 72  ? 127.513 16.872  195.942 1.00 40.35  ? 101 ASP A O   1 
ATOM   2007 C  CB  . ASP C 3 72  ? 127.153 19.483  195.127 1.00 36.30  ? 101 ASP A CB  1 
ATOM   2008 C  CG  . ASP C 3 72  ? 126.705 20.333  193.954 1.00 67.58  ? 101 ASP A CG  1 
ATOM   2009 O  OD1 . ASP C 3 72  ? 126.001 19.803  193.069 1.00 78.88  ? 101 ASP A OD1 1 
ATOM   2010 O  OD2 . ASP C 3 72  ? 127.052 21.533  193.919 1.00 62.51  ? 101 ASP A OD2 1 
ATOM   2011 N  N   . GLY C 3 73  ? 125.626 16.764  197.160 1.00 38.72  ? 102 GLY A N   1 
ATOM   2012 C  CA  . GLY C 3 73  ? 125.893 15.420  197.633 1.00 33.35  ? 102 GLY A CA  1 
ATOM   2013 C  C   . GLY C 3 73  ? 127.099 15.269  198.531 1.00 30.07  ? 102 GLY A C   1 
ATOM   2014 O  O   . GLY C 3 73  ? 127.655 14.172  198.618 1.00 34.18  ? 102 GLY A O   1 
ATOM   2015 N  N   . LYS C 3 74  ? 127.524 16.335  199.205 1.00 22.73  ? 103 LYS A N   1 
ATOM   2016 C  CA  . LYS C 3 74  ? 128.674 16.280  200.096 1.00 25.34  ? 103 LYS A CA  1 
ATOM   2017 C  C   . LYS C 3 74  ? 128.352 17.014  201.388 1.00 25.85  ? 103 LYS A C   1 
ATOM   2018 O  O   . LYS C 3 74  ? 127.750 18.091  201.363 1.00 37.02  ? 103 LYS A O   1 
ATOM   2019 C  CB  . LYS C 3 74  ? 129.921 16.899  199.445 1.00 35.03  ? 103 LYS A CB  1 
ATOM   2020 C  CG  . LYS C 3 74  ? 130.366 16.221  198.159 1.00 31.99  ? 103 LYS A CG  1 
ATOM   2021 C  CD  . LYS C 3 74  ? 131.202 14.983  198.444 1.00 27.07  ? 103 LYS A CD  1 
ATOM   2022 C  CE  . LYS C 3 74  ? 131.723 14.363  197.157 1.00 23.78  ? 103 LYS A CE  1 
ATOM   2023 N  NZ  . LYS C 3 74  ? 132.570 13.166  197.416 1.00 37.08  ? 103 LYS A NZ  1 
ATOM   2024 N  N   . PHE C 3 75  ? 128.752 16.427  202.512 1.00 25.21  ? 104 PHE A N   1 
ATOM   2025 C  CA  . PHE C 3 75  ? 128.599 17.065  203.812 1.00 29.04  ? 104 PHE A CA  1 
ATOM   2026 C  C   . PHE C 3 75  ? 129.830 17.906  204.123 1.00 33.47  ? 104 PHE A C   1 
ATOM   2027 O  O   . PHE C 3 75  ? 130.955 17.530  203.781 1.00 33.10  ? 104 PHE A O   1 
ATOM   2028 C  CB  . PHE C 3 75  ? 128.391 16.023  204.912 1.00 28.98  ? 104 PHE A CB  1 
ATOM   2029 C  CG  . PHE C 3 75  ? 127.034 15.381  204.894 1.00 29.89  ? 104 PHE A CG  1 
ATOM   2030 C  CD1 . PHE C 3 75  ? 125.965 15.967  205.552 1.00 27.02  ? 104 PHE A CD1 1 
ATOM   2031 C  CD2 . PHE C 3 75  ? 126.829 14.183  204.228 1.00 27.46  ? 104 PHE A CD2 1 
ATOM   2032 C  CE1 . PHE C 3 75  ? 124.715 15.375  205.541 1.00 20.60  ? 104 PHE A CE1 1 
ATOM   2033 C  CE2 . PHE C 3 75  ? 125.583 13.587  204.213 1.00 20.21  ? 104 PHE A CE2 1 
ATOM   2034 C  CZ  . PHE C 3 75  ? 124.525 14.183  204.872 1.00 16.48  ? 104 PHE A CZ  1 
ATOM   2035 N  N   . ARG C 3 76  ? 129.611 19.046  204.773 1.00 34.29  ? 105 ARG A N   1 
ATOM   2036 C  CA  . ARG C 3 76  ? 130.710 19.926  205.149 1.00 31.69  ? 105 ARG A CA  1 
ATOM   2037 C  C   . ARG C 3 76  ? 130.250 20.822  206.286 1.00 31.86  ? 105 ARG A C   1 
ATOM   2038 O  O   . ARG C 3 76  ? 129.053 21.056  206.471 1.00 34.77  ? 105 ARG A O   1 
ATOM   2039 C  CB  . ARG C 3 76  ? 131.193 20.770  203.964 1.00 29.86  ? 105 ARG A CB  1 
ATOM   2040 C  CG  . ARG C 3 76  ? 130.159 21.759  203.453 1.00 50.06  ? 105 ARG A CG  1 
ATOM   2041 C  CD  . ARG C 3 76  ? 130.742 22.673  202.383 1.00 49.13  ? 105 ARG A CD  1 
ATOM   2042 N  NE  . ARG C 3 76  ? 131.284 21.934  201.241 1.00 72.18  ? 105 ARG A NE  1 
ATOM   2043 C  CZ  . ARG C 3 76  ? 130.577 21.174  200.407 1.00 72.66  ? 105 ARG A CZ  1 
ATOM   2044 N  NH1 . ARG C 3 76  ? 131.191 20.554  199.409 1.00 79.15  ? 105 ARG A NH1 1 
ATOM   2045 N  NH2 . ARG C 3 76  ? 129.265 21.039  200.547 1.00 51.93  ? 105 ARG A NH2 1 
ATOM   2046 N  N   . LEU C 3 77  ? 131.220 21.323  207.044 1.00 27.46  ? 106 LEU A N   1 
ATOM   2047 C  CA  . LEU C 3 77  ? 130.914 22.215  208.151 1.00 20.49  ? 106 LEU A CA  1 
ATOM   2048 C  C   . LEU C 3 77  ? 130.441 23.570  207.637 1.00 32.00  ? 106 LEU A C   1 
ATOM   2049 O  O   . LEU C 3 77  ? 130.844 24.031  206.566 1.00 40.93  ? 106 LEU A O   1 
ATOM   2050 C  CB  . LEU C 3 77  ? 132.137 22.396  209.047 1.00 26.41  ? 106 LEU A CB  1 
ATOM   2051 C  CG  . LEU C 3 77  ? 132.739 21.133  209.664 1.00 34.92  ? 106 LEU A CG  1 
ATOM   2052 C  CD1 . LEU C 3 77  ? 133.862 21.496  210.622 1.00 33.56  ? 106 LEU A CD1 1 
ATOM   2053 C  CD2 . LEU C 3 77  ? 131.667 20.321  210.370 1.00 27.33  ? 106 LEU A CD2 1 
ATOM   2054 N  N   . ASP C 3 78  ? 129.570 24.206  208.416 1.00 34.64  ? 107 ASP A N   1 
ATOM   2055 C  CA  . ASP C 3 78  ? 129.084 25.535  208.071 1.00 32.02  ? 107 ASP A CA  1 
ATOM   2056 C  C   . ASP C 3 78  ? 130.209 26.552  208.217 1.00 36.18  ? 107 ASP A C   1 
ATOM   2057 O  O   . ASP C 3 78  ? 130.864 26.622  209.261 1.00 51.91  ? 107 ASP A O   1 
ATOM   2058 C  CB  . ASP C 3 78  ? 127.901 25.912  208.961 1.00 45.57  ? 107 ASP A CB  1 
ATOM   2059 C  CG  . ASP C 3 78  ? 126.937 26.865  208.279 1.00 49.98  ? 107 ASP A CG  1 
ATOM   2060 O  OD1 . ASP C 3 78  ? 127.069 27.071  207.055 1.00 39.90  ? 107 ASP A OD1 1 
ATOM   2061 O  OD2 . ASP C 3 78  ? 126.046 27.405  208.968 1.00 41.79  ? 107 ASP A OD2 1 
ATOM   2062 N  N   . SER C 3 79  ? 130.438 27.336  207.166 1.00 34.06  ? 108 SER A N   1 
ATOM   2063 C  CA  . SER C 3 79  ? 131.515 28.319  207.149 1.00 39.97  ? 108 SER A CA  1 
ATOM   2064 C  C   . SER C 3 79  ? 131.028 29.553  206.397 1.00 50.11  ? 108 SER A C   1 
ATOM   2065 O  O   . SER C 3 79  ? 129.843 29.677  206.070 1.00 48.84  ? 108 SER A O   1 
ATOM   2066 C  CB  . SER C 3 79  ? 132.787 27.718  206.535 1.00 51.33  ? 108 SER A CB  1 
ATOM   2067 O  OG  . SER C 3 79  ? 132.528 27.161  205.259 1.00 58.63  ? 108 SER A OG  1 
ATOM   2068 N  N   . ILE C 3 80  ? 131.953 30.477  206.117 1.00 80.01  ? 109 ILE A N   1 
ATOM   2069 C  CA  . ILE C 3 80  ? 131.570 31.743  205.498 1.00 87.54  ? 109 ILE A CA  1 
ATOM   2070 C  C   . ILE C 3 80  ? 131.060 31.510  204.082 1.00 77.29  ? 109 ILE A C   1 
ATOM   2071 O  O   . ILE C 3 80  ? 131.329 30.485  203.442 1.00 87.30  ? 109 ILE A O   1 
ATOM   2072 C  CB  . ILE C 3 80  ? 132.738 32.741  205.490 1.00 60.84  ? 109 ILE A CB  1 
ATOM   2073 C  CG1 . ILE C 3 80  ? 133.653 32.526  206.681 1.00 60.84  ? 109 ILE A CG1 1 
ATOM   2074 C  CG2 . ILE C 3 80  ? 132.232 34.177  205.482 1.00 60.84  ? 109 ILE A CG2 1 
ATOM   2075 C  CD1 . ILE C 3 80  ? 134.916 33.276  206.516 1.00 60.84  ? 109 ILE A CD1 1 
ATOM   2076 N  N   . ILE C 3 81  ? 130.322 32.498  203.581 1.00 85.90  ? 110 ILE A N   1 
ATOM   2077 C  CA  . ILE C 3 81  ? 129.834 32.502  202.209 1.00 91.64  ? 110 ILE A CA  1 
ATOM   2078 C  C   . ILE C 3 81  ? 131.015 32.566  201.248 1.00 78.58  ? 110 ILE A C   1 
ATOM   2079 O  O   . ILE C 3 81  ? 131.471 33.655  200.880 1.00 86.53  ? 110 ILE A O   1 
ATOM   2080 C  CB  . ILE C 3 81  ? 128.865 33.674  201.971 1.00 93.44  ? 110 ILE A CB  1 
ATOM   2081 N  N   . CYS C 3 82  ? 131.533 31.394  200.871 1.00 89.41  ? 111 CYS A N   1 
ATOM   2082 C  CA  . CYS C 3 82  ? 132.502 31.222  199.790 1.00 113.20 ? 111 CYS A CA  1 
ATOM   2083 C  C   . CYS C 3 82  ? 133.902 31.737  200.113 1.00 96.54  ? 111 CYS A C   1 
ATOM   2084 O  O   . CYS C 3 82  ? 134.829 31.532  199.322 1.00 96.88  ? 111 CYS A O   1 
ATOM   2085 C  CB  . CYS C 3 82  ? 131.995 31.886  198.505 1.00 92.66  ? 111 CYS A CB  1 
ATOM   2086 N  N   . VAL C 3 83  ? 134.082 32.400  201.257 1.00 98.23  ? 112 VAL A N   1 
ATOM   2087 C  CA  . VAL C 3 83  ? 135.426 32.826  201.640 1.00 107.04 ? 112 VAL A CA  1 
ATOM   2088 C  C   . VAL C 3 83  ? 136.294 31.615  201.957 1.00 98.69  ? 112 VAL A C   1 
ATOM   2089 O  O   . VAL C 3 83  ? 137.474 31.563  201.587 1.00 117.08 ? 112 VAL A O   1 
ATOM   2090 C  CB  . VAL C 3 83  ? 135.367 33.810  202.823 1.00 61.25  ? 112 VAL A CB  1 
ATOM   2091 C  CG1 . VAL C 3 83  ? 136.773 34.197  203.263 1.00 61.25  ? 112 VAL A CG1 1 
ATOM   2092 C  CG2 . VAL C 3 83  ? 134.566 35.045  202.446 1.00 61.25  ? 112 VAL A CG2 1 
ATOM   2093 N  N   . LYS C 3 84  ? 135.724 30.618  202.634 1.00 65.08  ? 113 LYS A N   1 
ATOM   2094 C  CA  . LYS C 3 84  ? 136.409 29.366  202.928 1.00 65.82  ? 113 LYS A CA  1 
ATOM   2095 C  C   . LYS C 3 84  ? 135.421 28.212  202.743 1.00 60.34  ? 113 LYS A C   1 
ATOM   2096 O  O   . LYS C 3 84  ? 135.166 27.417  203.643 1.00 75.97  ? 113 LYS A O   1 
ATOM   2097 C  CB  . LYS C 3 84  ? 137.001 29.380  204.336 1.00 37.24  ? 113 LYS A CB  1 
ATOM   2098 N  N   . SER C 3 85  ? 134.845 28.120  201.544 1.00 57.76  ? 114 SER A N   1 
ATOM   2099 C  CA  . SER C 3 85  ? 133.839 27.109  201.243 1.00 54.51  ? 114 SER A CA  1 
ATOM   2100 C  C   . SER C 3 85  ? 134.388 25.921  200.466 1.00 61.42  ? 114 SER A C   1 
ATOM   2101 O  O   . SER C 3 85  ? 133.683 24.917  200.327 1.00 59.30  ? 114 SER A O   1 
ATOM   2102 C  CB  . SER C 3 85  ? 132.678 27.731  200.460 1.00 74.85  ? 114 SER A CB  1 
ATOM   2103 O  OG  . SER C 3 85  ? 131.471 27.031  200.706 1.00 86.18  ? 114 SER A OG  1 
ATOM   2104 N  N   . ALA C 3 86  ? 135.610 26.011  199.947 1.00 56.35  ? 115 ALA A N   1 
ATOM   2105 C  CA  . ALA C 3 86  ? 136.287 24.859  199.358 1.00 36.30  ? 115 ALA A CA  1 
ATOM   2106 C  C   . ALA C 3 86  ? 137.108 24.213  200.466 1.00 64.41  ? 115 ALA A C   1 
ATOM   2107 O  O   . ALA C 3 86  ? 138.262 24.568  200.706 1.00 38.11  ? 115 ALA A O   1 
ATOM   2108 C  CB  . ALA C 3 86  ? 137.147 25.273  198.171 1.00 42.38  ? 115 ALA A CB  1 
ATOM   2109 N  N   . LEU C 3 87  ? 136.493 23.262  201.163 1.00 70.10  ? 116 LEU A N   1 
ATOM   2110 C  CA  . LEU C 3 87  ? 137.115 22.613  202.309 1.00 46.11  ? 116 LEU A CA  1 
ATOM   2111 C  C   . LEU C 3 87  ? 136.662 21.156  202.340 1.00 59.94  ? 116 LEU A C   1 
ATOM   2112 O  O   . LEU C 3 87  ? 136.016 20.670  201.407 1.00 63.60  ? 116 LEU A O   1 
ATOM   2113 C  CB  . LEU C 3 87  ? 136.787 23.372  203.603 1.00 49.33  ? 116 LEU A CB  1 
ATOM   2114 C  CG  . LEU C 3 87  ? 135.381 23.277  204.206 1.00 55.45  ? 116 LEU A CG  1 
ATOM   2115 C  CD1 . LEU C 3 87  ? 135.399 23.755  205.648 1.00 40.39  ? 116 LEU A CD1 1 
ATOM   2116 C  CD2 . LEU C 3 87  ? 134.363 24.071  203.401 1.00 60.00  ? 116 LEU A CD2 1 
ATOM   2117 N  N   . ALA C 3 88  ? 137.000 20.461  203.426 1.00 37.23  ? 117 ALA A N   1 
ATOM   2118 C  CA  . ALA C 3 88  ? 136.798 19.018  203.510 1.00 30.07  ? 117 ALA A CA  1 
ATOM   2119 C  C   . ALA C 3 88  ? 135.323 18.655  203.385 1.00 36.95  ? 117 ALA A C   1 
ATOM   2120 O  O   . ALA C 3 88  ? 134.493 19.098  204.185 1.00 40.30  ? 117 ALA A O   1 
ATOM   2121 C  CB  . ALA C 3 88  ? 137.366 18.490  204.826 1.00 19.62  ? 117 ALA A CB  1 
ATOM   2122 N  N   . ALA C 3 89  ? 135.005 17.835  202.384 1.00 32.54  ? 118 ALA A N   1 
ATOM   2123 C  CA  . ALA C 3 89  ? 133.640 17.406  202.116 1.00 30.73  ? 118 ALA A CA  1 
ATOM   2124 C  C   . ALA C 3 89  ? 133.627 15.919  201.797 1.00 38.50  ? 118 ALA A C   1 
ATOM   2125 O  O   . ALA C 3 89  ? 134.486 15.427  201.059 1.00 43.01  ? 118 ALA A O   1 
ATOM   2126 C  CB  . ALA C 3 89  ? 133.024 18.197  200.955 1.00 37.88  ? 118 ALA A CB  1 
ATOM   2127 N  N   . PHE C 3 90  ? 132.643 15.209  202.350 1.00 36.25  ? 119 PHE A N   1 
ATOM   2128 C  CA  . PHE C 3 90  ? 132.536 13.768  202.176 1.00 32.48  ? 119 PHE A CA  1 
ATOM   2129 C  C   . PHE C 3 90  ? 131.084 13.378  201.943 1.00 39.99  ? 119 PHE A C   1 
ATOM   2130 O  O   . PHE C 3 90  ? 130.159 14.078  202.362 1.00 37.07  ? 119 PHE A O   1 
ATOM   2131 C  CB  . PHE C 3 90  ? 133.080 13.010  203.395 1.00 30.74  ? 119 PHE A CB  1 
ATOM   2132 C  CG  . PHE C 3 90  ? 134.485 13.381  203.759 1.00 33.61  ? 119 PHE A CG  1 
ATOM   2133 C  CD1 . PHE C 3 90  ? 135.558 12.813  203.094 1.00 28.50  ? 119 PHE A CD1 1 
ATOM   2134 C  CD2 . PHE C 3 90  ? 134.734 14.300  204.765 1.00 31.21  ? 119 PHE A CD2 1 
ATOM   2135 C  CE1 . PHE C 3 90  ? 136.854 13.152  203.426 1.00 37.98  ? 119 PHE A CE1 1 
ATOM   2136 C  CE2 . PHE C 3 90  ? 136.028 14.644  205.103 1.00 33.99  ? 119 PHE A CE2 1 
ATOM   2137 C  CZ  . PHE C 3 90  ? 137.090 14.069  204.433 1.00 49.38  ? 119 PHE A CZ  1 
ATOM   2138 N  N   . ASP C 3 91  ? 130.900 12.240  201.270 1.00 36.45  ? 120 ASP A N   1 
ATOM   2139 C  CA  . ASP C 3 91  ? 129.564 11.708  201.034 1.00 26.35  ? 120 ASP A CA  1 
ATOM   2140 C  C   . ASP C 3 91  ? 128.914 11.190  202.309 1.00 28.39  ? 120 ASP A C   1 
ATOM   2141 O  O   . ASP C 3 91  ? 127.683 11.101  202.371 1.00 33.07  ? 120 ASP A O   1 
ATOM   2142 C  CB  . ASP C 3 91  ? 129.623 10.588  199.997 1.00 25.82  ? 120 ASP A CB  1 
ATOM   2143 C  CG  . ASP C 3 91  ? 130.024 11.085  198.628 1.00 51.40  ? 120 ASP A CG  1 
ATOM   2144 O  OD1 . ASP C 3 91  ? 129.510 12.140  198.206 1.00 64.35  ? 120 ASP A OD1 1 
ATOM   2145 O  OD2 . ASP C 3 91  ? 130.852 10.422  197.969 1.00 62.46  ? 120 ASP A OD2 1 
ATOM   2146 N  N   . SER C 3 92  ? 129.707 10.844  203.318 1.00 22.54  ? 121 SER A N   1 
ATOM   2147 C  CA  . SER C 3 92  ? 129.204 10.331  204.583 1.00 20.41  ? 121 SER A CA  1 
ATOM   2148 C  C   . SER C 3 92  ? 129.433 11.367  205.674 1.00 23.15  ? 121 SER A C   1 
ATOM   2149 O  O   . SER C 3 92  ? 130.540 11.902  205.805 1.00 32.81  ? 121 SER A O   1 
ATOM   2150 C  CB  . SER C 3 92  ? 129.888 9.011   204.948 1.00 24.48  ? 121 SER A CB  1 
ATOM   2151 O  OG  . SER C 3 92  ? 129.696 8.691   206.314 1.00 38.39  ? 121 SER A OG  1 
ATOM   2152 N  N   . VAL C 3 93  ? 128.386 11.651  206.451 1.00 20.76  ? 122 VAL A N   1 
ATOM   2153 C  CA  . VAL C 3 93  ? 128.527 12.613  207.538 1.00 26.17  ? 122 VAL A CA  1 
ATOM   2154 C  C   . VAL C 3 93  ? 129.307 12.007  208.701 1.00 24.54  ? 122 VAL A C   1 
ATOM   2155 O  O   . VAL C 3 93  ? 130.020 12.723  209.414 1.00 31.69  ? 122 VAL A O   1 
ATOM   2156 C  CB  . VAL C 3 93  ? 127.146 13.133  207.981 1.00 27.35  ? 122 VAL A CB  1 
ATOM   2157 C  CG1 . VAL C 3 93  ? 126.319 12.027  208.624 1.00 26.00  ? 122 VAL A CG1 1 
ATOM   2158 C  CG2 . VAL C 3 93  ? 127.296 14.318  208.924 1.00 21.12  ? 122 VAL A CG2 1 
ATOM   2159 N  N   . VAL C 3 94  ? 129.200 10.691  208.908 1.00 22.21  ? 123 VAL A N   1 
ATOM   2160 C  CA  . VAL C 3 94  ? 130.035 10.027  209.906 1.00 25.17  ? 123 VAL A CA  1 
ATOM   2161 C  C   . VAL C 3 94  ? 131.499 10.106  209.499 1.00 29.49  ? 123 VAL A C   1 
ATOM   2162 O  O   . VAL C 3 94  ? 132.382 10.343  210.334 1.00 25.23  ? 123 VAL A O   1 
ATOM   2163 C  CB  . VAL C 3 94  ? 129.579 8.569   210.103 1.00 26.43  ? 123 VAL A CB  1 
ATOM   2164 C  CG1 . VAL C 3 94  ? 130.417 7.889   211.174 1.00 15.01  ? 123 VAL A CG1 1 
ATOM   2165 C  CG2 . VAL C 3 94  ? 128.102 8.517   210.458 1.00 19.56  ? 123 VAL A CG2 1 
ATOM   2166 N  N   . HIS C 3 95  ? 131.778 9.903   208.209 1.00 27.52  ? 124 HIS A N   1 
ATOM   2167 C  CA  . HIS C 3 95  ? 133.123 10.116  207.685 1.00 22.89  ? 124 HIS A CA  1 
ATOM   2168 C  C   . HIS C 3 95  ? 133.613 11.522  207.995 1.00 23.70  ? 124 HIS A C   1 
ATOM   2169 O  O   . HIS C 3 95  ? 134.764 11.711  208.405 1.00 31.59  ? 124 HIS A O   1 
ATOM   2170 C  CB  . HIS C 3 95  ? 133.132 9.866   206.176 1.00 34.56  ? 124 HIS A CB  1 
ATOM   2171 C  CG  . HIS C 3 95  ? 134.497 9.672   205.594 1.00 33.56  ? 124 HIS A CG  1 
ATOM   2172 N  ND1 . HIS C 3 95  ? 135.646 10.115  206.214 1.00 40.01  ? 124 HIS A ND1 1 
ATOM   2173 C  CD2 . HIS C 3 95  ? 134.896 9.080   204.444 1.00 44.42  ? 124 HIS A CD2 1 
ATOM   2174 C  CE1 . HIS C 3 95  ? 136.693 9.804   205.471 1.00 25.84  ? 124 HIS A CE1 1 
ATOM   2175 N  NE2 . HIS C 3 95  ? 136.265 9.175   204.391 1.00 46.62  ? 124 HIS A NE2 1 
ATOM   2176 N  N   . LEU C 3 96  ? 132.748 12.522  207.807 1.00 23.69  ? 125 LEU A N   1 
ATOM   2177 C  CA  . LEU C 3 96  ? 133.126 13.899  208.104 1.00 25.89  ? 125 LEU A CA  1 
ATOM   2178 C  C   . LEU C 3 96  ? 133.494 14.065  209.573 1.00 32.33  ? 125 LEU A C   1 
ATOM   2179 O  O   . LEU C 3 96  ? 134.468 14.753  209.901 1.00 33.72  ? 125 LEU A O   1 
ATOM   2180 C  CB  . LEU C 3 96  ? 131.989 14.847  207.726 1.00 24.95  ? 125 LEU A CB  1 
ATOM   2181 C  CG  . LEU C 3 96  ? 132.294 16.334  207.906 1.00 21.41  ? 125 LEU A CG  1 
ATOM   2182 C  CD1 . LEU C 3 96  ? 133.450 16.747  207.011 1.00 24.42  ? 125 LEU A CD1 1 
ATOM   2183 C  CD2 . LEU C 3 96  ? 131.063 17.181  207.628 1.00 17.49  ? 125 LEU A CD2 1 
ATOM   2184 N  N   . ILE C 3 97  ? 132.733 13.439  210.470 1.00 28.77  ? 126 ILE A N   1 
ATOM   2185 C  CA  . ILE C 3 97  ? 133.031 13.546  211.895 1.00 27.35  ? 126 ILE A CA  1 
ATOM   2186 C  C   . ILE C 3 97  ? 134.301 12.776  212.232 1.00 31.37  ? 126 ILE A C   1 
ATOM   2187 O  O   . ILE C 3 97  ? 135.176 13.274  212.951 1.00 32.37  ? 126 ILE A O   1 
ATOM   2188 C  CB  . ILE C 3 97  ? 131.838 13.057  212.733 1.00 33.25  ? 126 ILE A CB  1 
ATOM   2189 C  CG1 . ILE C 3 97  ? 130.601 13.905  212.443 1.00 29.83  ? 126 ILE A CG1 1 
ATOM   2190 C  CG2 . ILE C 3 97  ? 132.176 13.113  214.208 1.00 33.15  ? 126 ILE A CG2 1 
ATOM   2191 C  CD1 . ILE C 3 97  ? 130.797 15.367  212.739 1.00 28.92  ? 126 ILE A CD1 1 
ATOM   2192 N  N   . ASP C 3 98  ? 134.420 11.548  211.719 1.00 35.17  ? 127 ASP A N   1 
ATOM   2193 C  CA  . ASP C 3 98  ? 135.616 10.751  211.971 1.00 30.02  ? 127 ASP A CA  1 
ATOM   2194 C  C   . ASP C 3 98  ? 136.864 11.447  211.444 1.00 37.16  ? 127 ASP A C   1 
ATOM   2195 O  O   . ASP C 3 98  ? 137.939 11.349  212.045 1.00 44.79  ? 127 ASP A O   1 
ATOM   2196 C  CB  . ASP C 3 98  ? 135.467 9.369   211.337 1.00 38.61  ? 127 ASP A CB  1 
ATOM   2197 C  CG  . ASP C 3 98  ? 136.495 8.380   211.847 1.00 39.32  ? 127 ASP A CG  1 
ATOM   2198 O  OD1 . ASP C 3 98  ? 137.023 8.595   212.957 1.00 46.84  ? 127 ASP A OD1 1 
ATOM   2199 O  OD2 . ASP C 3 98  ? 136.777 7.393   211.136 1.00 48.49  ? 127 ASP A OD2 1 
ATOM   2200 N  N   . TYR C 3 99  ? 136.736 12.158  210.322 1.00 31.45  ? 128 TYR A N   1 
ATOM   2201 C  CA  . TYR C 3 99  ? 137.868 12.889  209.761 1.00 24.66  ? 128 TYR A CA  1 
ATOM   2202 C  C   . TYR C 3 99  ? 138.389 13.932  210.743 1.00 31.58  ? 128 TYR A C   1 
ATOM   2203 O  O   . TYR C 3 99  ? 139.602 14.054  210.951 1.00 41.94  ? 128 TYR A O   1 
ATOM   2204 C  CB  . TYR C 3 99  ? 137.452 13.537  208.437 1.00 28.66  ? 128 TYR A CB  1 
ATOM   2205 C  CG  . TYR C 3 99  ? 138.428 14.555  207.882 1.00 28.60  ? 128 TYR A CG  1 
ATOM   2206 C  CD1 . TYR C 3 99  ? 138.313 15.904  208.199 1.00 23.01  ? 128 TYR A CD1 1 
ATOM   2207 C  CD2 . TYR C 3 99  ? 139.451 14.170  207.025 1.00 16.54  ? 128 TYR A CD2 1 
ATOM   2208 C  CE1 . TYR C 3 99  ? 139.198 16.836  207.690 1.00 36.31  ? 128 TYR A CE1 1 
ATOM   2209 C  CE2 . TYR C 3 99  ? 140.340 15.096  206.509 1.00 19.96  ? 128 TYR A CE2 1 
ATOM   2210 C  CZ  . TYR C 3 99  ? 140.208 16.428  206.845 1.00 32.43  ? 128 TYR A CZ  1 
ATOM   2211 O  OH  . TYR C 3 99  ? 141.090 17.354  206.335 1.00 31.66  ? 128 TYR A OH  1 
ATOM   2212 N  N   . TYR C 3 100 ? 137.483 14.691  211.364 1.00 37.82  ? 129 TYR A N   1 
ATOM   2213 C  CA  . TYR C 3 100 ? 137.900 15.756  212.270 1.00 29.67  ? 129 TYR A CA  1 
ATOM   2214 C  C   . TYR C 3 100 ? 138.346 15.225  213.625 1.00 39.79  ? 129 TYR A C   1 
ATOM   2215 O  O   . TYR C 3 100 ? 139.185 15.853  214.282 1.00 52.87  ? 129 TYR A O   1 
ATOM   2216 C  CB  . TYR C 3 100 ? 136.767 16.766  212.452 1.00 25.54  ? 129 TYR A CB  1 
ATOM   2217 C  CG  . TYR C 3 100 ? 136.576 17.677  211.263 1.00 22.04  ? 129 TYR A CG  1 
ATOM   2218 C  CD1 . TYR C 3 100 ? 137.576 18.555  210.869 1.00 29.27  ? 129 TYR A CD1 1 
ATOM   2219 C  CD2 . TYR C 3 100 ? 135.397 17.656  210.532 1.00 30.98  ? 129 TYR A CD2 1 
ATOM   2220 C  CE1 . TYR C 3 100 ? 137.406 19.389  209.780 1.00 21.36  ? 129 TYR A CE1 1 
ATOM   2221 C  CE2 . TYR C 3 100 ? 135.219 18.484  209.444 1.00 30.43  ? 129 TYR A CE2 1 
ATOM   2222 C  CZ  . TYR C 3 100 ? 136.224 19.349  209.071 1.00 20.64  ? 129 TYR A CZ  1 
ATOM   2223 O  OH  . TYR C 3 100 ? 136.045 20.175  207.986 1.00 40.93  ? 129 TYR A OH  1 
ATOM   2224 N  N   . VAL C 3 101 ? 137.799 14.092  214.067 1.00 38.56  ? 130 VAL A N   1 
ATOM   2225 C  CA  . VAL C 3 101 ? 138.249 13.495  215.320 1.00 37.17  ? 130 VAL A CA  1 
ATOM   2226 C  C   . VAL C 3 101 ? 139.693 13.025  215.191 1.00 40.59  ? 130 VAL A C   1 
ATOM   2227 O  O   . VAL C 3 101 ? 140.526 13.271  216.072 1.00 39.24  ? 130 VAL A O   1 
ATOM   2228 C  CB  . VAL C 3 101 ? 137.316 12.342  215.736 1.00 48.75  ? 130 VAL A CB  1 
ATOM   2229 C  CG1 . VAL C 3 101 ? 137.913 11.569  216.903 1.00 27.90  ? 130 VAL A CG1 1 
ATOM   2230 C  CG2 . VAL C 3 101 ? 135.938 12.873  216.094 1.00 31.56  ? 130 VAL A CG2 1 
ATOM   2231 N  N   . GLN C 3 102 ? 140.013 12.352  214.082 1.00 36.85  ? 131 GLN A N   1 
ATOM   2232 C  CA  . GLN C 3 102 ? 141.373 11.867  213.878 1.00 35.36  ? 131 GLN A CA  1 
ATOM   2233 C  C   . GLN C 3 102 ? 142.354 13.009  213.647 1.00 45.29  ? 131 GLN A C   1 
ATOM   2234 O  O   . GLN C 3 102 ? 143.552 12.856  213.910 1.00 57.48  ? 131 GLN A O   1 
ATOM   2235 C  CB  . GLN C 3 102 ? 141.414 10.893  212.700 1.00 28.08  ? 131 GLN A CB  1 
ATOM   2236 C  CG  . GLN C 3 102 ? 140.507 9.688   212.863 1.00 38.68  ? 131 GLN A CG  1 
ATOM   2237 C  CD  . GLN C 3 102 ? 140.644 9.041   214.225 1.00 43.57  ? 131 GLN A CD  1 
ATOM   2238 O  OE1 . GLN C 3 102 ? 141.747 8.706   214.657 1.00 45.65  ? 131 GLN A OE1 1 
ATOM   2239 N  NE2 . GLN C 3 102 ? 139.523 8.866   214.913 1.00 48.97  ? 131 GLN A NE2 1 
ATOM   2240 N  N   . MET C 3 103 ? 141.875 14.150  213.158 1.00 40.15  ? 132 MET A N   1 
ATOM   2241 C  CA  . MET C 3 103 ? 142.746 15.291  212.901 1.00 43.54  ? 132 MET A CA  1 
ATOM   2242 C  C   . MET C 3 103 ? 143.249 15.892  214.208 1.00 41.72  ? 132 MET A C   1 
ATOM   2243 O  O   . MET C 3 103 ? 144.377 16.379  214.284 1.00 41.18  ? 132 MET A O   1 
ATOM   2244 C  CB  . MET C 3 103 ? 142.018 16.354  212.074 1.00 43.46  ? 132 MET A CB  1 
ATOM   2245 C  CG  . MET C 3 103 ? 142.891 17.540  211.687 1.00 30.39  ? 132 MET A CG  1 
ATOM   2246 S  SD  . MET C 3 103 ? 142.711 18.003  209.955 1.00 60.45  ? 132 MET A SD  1 
ATOM   2247 C  CE  . MET C 3 103 ? 143.418 16.566  209.153 1.00 42.81  ? 132 MET A CE  1 
HETATM 2248 N  N   . CAS C 3 104 ? 142.412 15.848  215.239 0.87 38.10  ? 133 CAS A N   1 
HETATM 2249 C  CA  . CAS C 3 104 ? 142.781 16.404  216.528 0.87 46.36  ? 133 CAS A CA  1 
HETATM 2250 C  CB  . CAS C 3 104 ? 141.584 17.077  217.190 0.87 46.53  ? 133 CAS A CB  1 
HETATM 2251 C  C   . CAS C 3 104 ? 143.333 15.336  217.429 0.87 57.85  ? 133 CAS A C   1 
HETATM 2252 O  O   . CAS C 3 104 ? 143.321 15.509  218.666 0.87 67.02  ? 133 CAS A O   1 
HETATM 2253 S  SG  . CAS C 3 104 ? 140.979 18.369  216.155 0.87 82.03  ? 133 CAS A SG  1 
HETATM 2254 AS AS  . CAS C 3 104 ? 142.710 19.776  216.233 0.87 118.65 ? 133 CAS A AS  1 
HETATM 2255 C  CE1 . CAS C 3 104 ? 142.077 21.619  215.818 0.87 67.05  ? 133 CAS A CE1 1 
HETATM 2256 C  CE2 . CAS C 3 104 ? 143.540 19.751  218.044 0.87 78.14  ? 133 CAS A CE2 1 
ATOM   2257 N  N   . LYS C 3 105 ? 143.819 14.242  216.851 1.00 67.28  ? 134 LYS A N   1 
ATOM   2258 C  CA  . LYS C 3 105 ? 144.412 13.167  217.638 1.00 72.12  ? 134 LYS A CA  1 
ATOM   2259 C  C   . LYS C 3 105 ? 145.793 13.572  218.145 1.00 100.62 ? 134 LYS A C   1 
ATOM   2260 O  O   . LYS C 3 105 ? 146.314 12.978  219.089 1.00 97.02  ? 134 LYS A O   1 
ATOM   2261 C  CB  . LYS C 3 105 ? 144.506 11.880  216.816 1.00 48.88  ? 134 LYS A CB  1 
ATOM   2262 C  CG  . LYS C 3 105 ? 143.265 11.004  216.887 1.00 48.88  ? 134 LYS A CG  1 
ATOM   2263 C  CD  . LYS C 3 105 ? 142.852 10.739  218.326 1.00 48.88  ? 134 LYS A CD  1 
ATOM   2264 C  CE  . LYS C 3 105 ? 141.779 9.665   218.404 1.00 48.88  ? 134 LYS A CE  1 
ATOM   2265 N  NZ  . LYS C 3 105 ? 141.017 9.737   219.680 1.00 48.88  ? 134 LYS A NZ  1 
ATOM   2266 N  N   . ASP C 3 106 ? 146.379 14.586  217.506 1.00 98.24  ? 135 ASP A N   1 
ATOM   2267 C  CA  . ASP C 3 106 ? 147.681 15.104  217.911 1.00 96.22  ? 135 ASP A CA  1 
ATOM   2268 C  C   . ASP C 3 106 ? 147.630 15.615  219.345 1.00 89.55  ? 135 ASP A C   1 
ATOM   2269 O  O   . ASP C 3 106 ? 148.158 14.975  220.259 1.00 95.72  ? 135 ASP A O   1 
ATOM   2270 C  CB  . ASP C 3 106 ? 148.135 16.222  216.969 1.00 101.88 ? 135 ASP A CB  1 
ATOM   2271 C  CG  . ASP C 3 106 ? 147.886 15.897  215.510 1.00 99.66  ? 135 ASP A CG  1 
ATOM   2272 O  OD1 . ASP C 3 106 ? 147.784 14.699  215.173 1.00 85.47  ? 135 ASP A OD1 1 
ATOM   2273 O  OD2 . ASP C 3 106 ? 147.791 16.843  214.699 1.00 92.97  ? 135 ASP A OD2 1 
ATOM   2274 N  N   . LYS C 3 107 ? 146.991 16.765  219.543 1.00 85.99  ? 136 LYS A N   1 
ATOM   2275 C  CA  . LYS C 3 107 ? 146.839 17.365  220.864 1.00 98.95  ? 136 LYS A CA  1 
ATOM   2276 C  C   . LYS C 3 107 ? 145.861 18.532  220.800 1.00 97.00  ? 136 LYS A C   1 
ATOM   2277 O  O   . LYS C 3 107 ? 146.047 19.463  220.016 1.00 91.42  ? 136 LYS A O   1 
ATOM   2278 C  CB  . LYS C 3 107 ? 148.188 17.839  221.408 1.00 87.09  ? 136 LYS A CB  1 
ATOM   2279 N  N   . VAL C 3 119 ? 136.323 29.134  214.613 1.00 68.89  ? 148 VAL A N   1 
ATOM   2280 C  CA  . VAL C 3 119 ? 137.621 28.623  215.032 1.00 75.23  ? 148 VAL A CA  1 
ATOM   2281 C  C   . VAL C 3 119 ? 137.785 27.174  214.592 1.00 76.12  ? 148 VAL A C   1 
ATOM   2282 O  O   . VAL C 3 119 ? 136.877 26.588  214.003 1.00 79.16  ? 148 VAL A O   1 
ATOM   2283 C  CB  . VAL C 3 119 ? 137.808 28.752  216.554 1.00 59.36  ? 148 VAL A CB  1 
ATOM   2284 N  N   . HIS C 3 120 ? 138.950 26.601  214.885 1.00 60.58  ? 149 HIS A N   1 
ATOM   2285 C  CA  . HIS C 3 120 ? 139.217 25.217  214.517 1.00 60.49  ? 149 HIS A CA  1 
ATOM   2286 C  C   . HIS C 3 120 ? 138.433 24.272  215.420 1.00 49.11  ? 149 HIS A C   1 
ATOM   2287 O  O   . HIS C 3 120 ? 138.438 24.418  216.646 1.00 59.80  ? 149 HIS A O   1 
ATOM   2288 C  CB  . HIS C 3 120 ? 140.713 24.924  214.605 1.00 52.33  ? 149 HIS A CB  1 
ATOM   2289 N  N   . LEU C 3 121 ? 137.760 23.302  214.808 1.00 53.64  ? 150 LEU A N   1 
ATOM   2290 C  CA  . LEU C 3 121 ? 136.916 22.374  215.546 1.00 47.22  ? 150 LEU A CA  1 
ATOM   2291 C  C   . LEU C 3 121 ? 137.760 21.317  216.249 1.00 43.77  ? 150 LEU A C   1 
ATOM   2292 O  O   . LEU C 3 121 ? 138.695 20.759  215.669 1.00 49.89  ? 150 LEU A O   1 
ATOM   2293 C  CB  . LEU C 3 121 ? 135.917 21.706  214.601 1.00 43.17  ? 150 LEU A CB  1 
ATOM   2294 C  CG  . LEU C 3 121 ? 134.812 20.873  215.251 1.00 46.89  ? 150 LEU A CG  1 
ATOM   2295 C  CD1 . LEU C 3 121 ? 133.888 21.757  216.073 1.00 42.03  ? 150 LEU A CD1 1 
ATOM   2296 C  CD2 . LEU C 3 121 ? 134.031 20.102  214.198 1.00 41.87  ? 150 LEU A CD2 1 
ATOM   2297 N  N   . TYR C 3 122 ? 137.417 21.041  217.508 1.00 38.06  ? 151 TYR A N   1 
ATOM   2298 C  CA  . TYR C 3 122 ? 138.148 20.093  218.344 1.00 40.20  ? 151 TYR A CA  1 
ATOM   2299 C  C   . TYR C 3 122 ? 137.173 19.048  218.874 1.00 40.43  ? 151 TYR A C   1 
ATOM   2300 O  O   . TYR C 3 122 ? 136.381 19.333  219.778 1.00 40.08  ? 151 TYR A O   1 
ATOM   2301 C  CB  . TYR C 3 122 ? 138.855 20.809  219.493 1.00 35.20  ? 151 TYR A CB  1 
ATOM   2302 C  CG  . TYR C 3 122 ? 139.600 19.878  220.421 1.00 28.21  ? 151 TYR A CG  1 
ATOM   2303 C  CD1 . TYR C 3 122 ? 140.706 19.169  219.977 1.00 35.69  ? 151 TYR A CD1 1 
ATOM   2304 C  CD2 . TYR C 3 122 ? 139.197 19.706  221.739 1.00 36.84  ? 151 TYR A CD2 1 
ATOM   2305 C  CE1 . TYR C 3 122 ? 141.393 18.316  220.816 1.00 44.91  ? 151 TYR A CE1 1 
ATOM   2306 C  CE2 . TYR C 3 122 ? 139.879 18.854  222.588 1.00 40.56  ? 151 TYR A CE2 1 
ATOM   2307 C  CZ  . TYR C 3 122 ? 140.977 18.161  222.120 1.00 37.59  ? 151 TYR A CZ  1 
ATOM   2308 O  OH  . TYR C 3 122 ? 141.661 17.310  222.957 1.00 54.24  ? 151 TYR A OH  1 
ATOM   2309 N  N   . LEU C 3 123 ? 137.241 17.839  218.320 1.00 43.62  ? 152 LEU A N   1 
ATOM   2310 C  CA  . LEU C 3 123 ? 136.392 16.728  218.728 1.00 30.81  ? 152 LEU A CA  1 
ATOM   2311 C  C   . LEU C 3 123 ? 137.248 15.616  219.316 1.00 35.87  ? 152 LEU A C   1 
ATOM   2312 O  O   . LEU C 3 123 ? 138.329 15.315  218.801 1.00 41.27  ? 152 LEU A O   1 
ATOM   2313 C  CB  . LEU C 3 123 ? 135.583 16.180  217.546 1.00 27.66  ? 152 LEU A CB  1 
ATOM   2314 C  CG  . LEU C 3 123 ? 134.809 17.166  216.670 1.00 39.56  ? 152 LEU A CG  1 
ATOM   2315 C  CD1 . LEU C 3 123 ? 133.947 16.421  215.660 1.00 29.09  ? 152 LEU A CD1 1 
ATOM   2316 C  CD2 . LEU C 3 123 ? 133.958 18.088  217.524 1.00 42.04  ? 152 LEU A CD2 1 
ATOM   2317 N  N   . THR C 3 124 ? 136.760 15.006  220.396 1.00 27.43  ? 153 THR A N   1 
ATOM   2318 C  CA  . THR C 3 124 ? 137.439 13.862  220.994 1.00 31.38  ? 153 THR A CA  1 
ATOM   2319 C  C   . THR C 3 124 ? 136.517 12.650  221.042 1.00 33.90  ? 153 THR A C   1 
ATOM   2320 O  O   . THR C 3 124 ? 136.492 11.845  220.106 1.00 38.66  ? 153 THR A O   1 
ATOM   2321 C  CB  . THR C 3 124 ? 137.942 14.193  222.401 1.00 41.60  ? 153 THR A CB  1 
ATOM   2322 O  OG1 . THR C 3 124 ? 136.827 14.373  223.282 1.00 47.66  ? 153 THR A OG1 1 
ATOM   2323 C  CG2 . THR C 3 124 ? 138.790 15.457  222.388 1.00 32.13  ? 153 THR A CG2 1 
ATOM   2324 N  N   . LYS C 3 125 ? 135.751 12.514  222.127 1.00 37.21  ? 154 LYS A N   1 
ATOM   2325 C  CA  . LYS C 3 125 ? 134.901 11.346  222.296 1.00 33.41  ? 154 LYS A CA  1 
ATOM   2326 C  C   . LYS C 3 125 ? 133.428 11.721  222.194 1.00 37.70  ? 154 LYS A C   1 
ATOM   2327 O  O   . LYS C 3 125 ? 133.013 12.756  222.725 1.00 49.59  ? 154 LYS A O   1 
ATOM   2328 C  CB  . LYS C 3 125 ? 135.159 10.672  223.648 1.00 33.51  ? 154 LYS A CB  1 
ATOM   2329 C  CG  . LYS C 3 125 ? 136.595 10.213  223.845 1.00 29.52  ? 154 LYS A CG  1 
ATOM   2330 C  CD  . LYS C 3 125 ? 137.019 10.339  225.299 1.00 57.43  ? 154 LYS A CD  1 
ATOM   2331 N  N   . PRO C 3 126 ? 132.620 10.904  221.525 1.00 26.70  ? 155 PRO A N   1 
ATOM   2332 C  CA  . PRO C 3 126 ? 131.197 11.220  221.381 1.00 28.67  ? 155 PRO A CA  1 
ATOM   2333 C  C   . PRO C 3 126 ? 130.415 10.911  222.649 1.00 32.70  ? 155 PRO A C   1 
ATOM   2334 O  O   . PRO C 3 126 ? 130.838 10.137  223.509 1.00 36.55  ? 155 PRO A O   1 
ATOM   2335 C  CB  . PRO C 3 126 ? 130.755 10.312  220.230 1.00 27.24  ? 155 PRO A CB  1 
ATOM   2336 C  CG  . PRO C 3 126 ? 131.654 9.129   220.344 1.00 24.37  ? 155 PRO A CG  1 
ATOM   2337 C  CD  . PRO C 3 126 ? 132.985 9.661   220.822 1.00 26.14  ? 155 PRO A CD  1 
ATOM   2338 N  N   . LEU C 3 127 ? 129.247 11.541  222.746 1.00 37.91  ? 156 LEU A N   1 
ATOM   2339 C  CA  . LEU C 3 127 ? 128.335 11.355  223.872 1.00 27.62  ? 156 LEU A CA  1 
ATOM   2340 C  C   . LEU C 3 127 ? 127.228 10.408  223.422 1.00 23.60  ? 156 LEU A C   1 
ATOM   2341 O  O   . LEU C 3 127 ? 126.303 10.809  222.712 1.00 31.63  ? 156 LEU A O   1 
ATOM   2342 C  CB  . LEU C 3 127 ? 127.775 12.693  224.343 1.00 31.76  ? 156 LEU A CB  1 
ATOM   2343 C  CG  . LEU C 3 127 ? 126.867 12.655  225.574 1.00 25.50  ? 156 LEU A CG  1 
ATOM   2344 C  CD1 . LEU C 3 127 ? 127.688 12.504  226.846 1.00 28.93  ? 156 LEU A CD1 1 
ATOM   2345 C  CD2 . LEU C 3 127 ? 125.993 13.899  225.638 1.00 36.93  ? 156 LEU A CD2 1 
ATOM   2346 N  N   . TYR C 3 128 ? 127.328 9.147   223.835 1.00 30.14  ? 157 TYR A N   1 
ATOM   2347 C  CA  . TYR C 3 128 ? 126.355 8.144   223.427 1.00 29.99  ? 157 TYR A CA  1 
ATOM   2348 C  C   . TYR C 3 128 ? 124.999 8.404   224.075 1.00 36.25  ? 157 TYR A C   1 
ATOM   2349 O  O   . TYR C 3 128 ? 124.905 8.892   225.205 1.00 27.85  ? 157 TYR A O   1 
ATOM   2350 C  CB  . TYR C 3 128 ? 126.837 6.741   223.799 1.00 32.44  ? 157 TYR A CB  1 
ATOM   2351 C  CG  . TYR C 3 128 ? 128.047 6.256   223.030 1.00 36.85  ? 157 TYR A CG  1 
ATOM   2352 C  CD1 . TYR C 3 128 ? 127.918 5.727   221.752 1.00 42.90  ? 157 TYR A CD1 1 
ATOM   2353 C  CD2 . TYR C 3 128 ? 129.316 6.306   223.593 1.00 40.17  ? 157 TYR A CD2 1 
ATOM   2354 C  CE1 . TYR C 3 128 ? 129.022 5.275   221.050 1.00 45.17  ? 157 TYR A CE1 1 
ATOM   2355 C  CE2 . TYR C 3 128 ? 130.425 5.856   222.899 1.00 37.88  ? 157 TYR A CE2 1 
ATOM   2356 C  CZ  . TYR C 3 128 ? 130.272 5.341   221.629 1.00 45.03  ? 157 TYR A CZ  1 
ATOM   2357 O  OH  . TYR C 3 128 ? 131.371 4.892   220.935 1.00 45.63  ? 157 TYR A OH  1 
ATOM   2358 N  N   . THR C 3 129 ? 123.937 8.069   223.340 1.00 38.35  ? 158 THR A N   1 
ATOM   2359 C  CA  . THR C 3 129 ? 122.592 8.150   223.901 1.00 29.04  ? 158 THR A CA  1 
ATOM   2360 C  C   . THR C 3 129 ? 122.349 7.015   224.888 1.00 32.84  ? 158 THR A C   1 
ATOM   2361 O  O   . THR C 3 129 ? 121.838 7.234   225.993 1.00 50.06  ? 158 THR A O   1 
ATOM   2362 C  CB  . THR C 3 129 ? 121.550 8.115   222.782 1.00 22.33  ? 158 THR A CB  1 
ATOM   2363 O  OG1 . THR C 3 129 ? 121.530 6.812   222.188 1.00 15.93  ? 158 THR A OG1 1 
ATOM   2364 C  CG2 . THR C 3 129 ? 121.880 9.142   221.712 1.00 30.59  ? 158 THR A CG2 1 
ATOM   2365 N  N   . SER C 3 130 ? 122.703 5.793   224.499 1.00 44.85  ? 159 SER A N   1 
ATOM   2366 C  CA  . SER C 3 130 ? 122.643 4.633   225.372 1.00 49.08  ? 159 SER A CA  1 
ATOM   2367 C  C   . SER C 3 130 ? 123.878 3.783   225.114 1.00 50.28  ? 159 SER A C   1 
ATOM   2368 O  O   . SER C 3 130 ? 124.618 4.002   224.151 1.00 44.59  ? 159 SER A O   1 
ATOM   2369 C  CB  . SER C 3 130 ? 121.361 3.819   225.149 1.00 39.59  ? 159 SER A CB  1 
ATOM   2370 O  OG  . SER C 3 130 ? 121.419 3.099   223.930 1.00 58.24  ? 159 SER A OG  1 
ATOM   2371 N  N   . ALA C 3 131 ? 124.104 2.814   225.990 1.00 54.95  ? 160 ALA A N   1 
ATOM   2372 C  CA  . ALA C 3 131 ? 125.230 1.906   225.823 1.00 39.89  ? 160 ALA A CA  1 
ATOM   2373 C  C   . ALA C 3 131 ? 125.045 1.086   224.551 1.00 36.78  ? 160 ALA A C   1 
ATOM   2374 O  O   . ALA C 3 131 ? 124.042 0.367   224.427 1.00 45.30  ? 160 ALA A O   1 
ATOM   2375 C  CB  . ALA C 3 131 ? 125.363 0.986   227.034 1.00 43.86  ? 160 ALA A CB  1 
ATOM   2376 N  N   . PRO C 3 132 ? 125.959 1.168   223.588 1.00 31.76  ? 161 PRO A N   1 
ATOM   2377 C  CA  . PRO C 3 132 ? 125.796 0.409   222.344 1.00 33.13  ? 161 PRO A CA  1 
ATOM   2378 C  C   . PRO C 3 132 ? 126.033 -1.078  222.566 1.00 35.27  ? 161 PRO A C   1 
ATOM   2379 O  O   . PRO C 3 132 ? 126.443 -1.528  223.639 1.00 41.40  ? 161 PRO A O   1 
ATOM   2380 C  CB  . PRO C 3 132 ? 126.851 1.013   221.414 1.00 33.45  ? 161 PRO A CB  1 
ATOM   2381 C  CG  . PRO C 3 132 ? 127.880 1.579   222.331 1.00 38.86  ? 161 PRO A CG  1 
ATOM   2382 C  CD  . PRO C 3 132 ? 127.158 2.024   223.569 1.00 33.28  ? 161 PRO A CD  1 
ATOM   2383 N  N   . SER C 3 133 ? 125.761 -1.849  221.516 1.00 37.18  ? 162 SER A N   1 
ATOM   2384 C  CA  . SER C 3 133 ? 125.929 -3.293  221.582 1.00 23.97  ? 162 SER A CA  1 
ATOM   2385 C  C   . SER C 3 133 ? 127.402 -3.658  221.726 1.00 31.48  ? 162 SER A C   1 
ATOM   2386 O  O   . SER C 3 133 ? 128.293 -2.929  221.284 1.00 44.37  ? 162 SER A O   1 
ATOM   2387 C  CB  . SER C 3 133 ? 125.348 -3.956  220.333 1.00 35.18  ? 162 SER A CB  1 
ATOM   2388 O  OG  . SER C 3 133 ? 126.172 -3.726  219.203 1.00 30.56  ? 162 SER A OG  1 
ATOM   2389 N  N   . LEU C 3 134 ? 127.652 -4.805  222.363 1.00 33.31  ? 163 LEU A N   1 
ATOM   2390 C  CA  . LEU C 3 134 ? 129.025 -5.282  222.497 1.00 40.23  ? 163 LEU A CA  1 
ATOM   2391 C  C   . LEU C 3 134 ? 129.635 -5.601  221.139 1.00 34.97  ? 163 LEU A C   1 
ATOM   2392 O  O   . LEU C 3 134 ? 130.851 -5.470  220.958 1.00 30.26  ? 163 LEU A O   1 
ATOM   2393 C  CB  . LEU C 3 134 ? 129.073 -6.511  223.407 1.00 30.59  ? 163 LEU A CB  1 
ATOM   2394 C  CG  . LEU C 3 134 ? 130.466 -7.075  223.703 1.00 26.95  ? 163 LEU A CG  1 
ATOM   2395 C  CD1 . LEU C 3 134 ? 131.399 -5.976  224.191 1.00 20.85  ? 163 LEU A CD1 1 
ATOM   2396 C  CD2 . LEU C 3 134 ? 130.392 -8.207  224.716 1.00 28.87  ? 163 LEU A CD2 1 
ATOM   2397 N  N   . GLN C 3 135 ? 128.809 -6.014  220.175 1.00 36.74  ? 164 GLN A N   1 
ATOM   2398 C  CA  . GLN C 3 135 ? 129.304 -6.245  218.822 1.00 35.44  ? 164 GLN A CA  1 
ATOM   2399 C  C   . GLN C 3 135 ? 129.841 -4.957  218.211 1.00 33.73  ? 164 GLN A C   1 
ATOM   2400 O  O   . GLN C 3 135 ? 130.946 -4.933  217.658 1.00 36.97  ? 164 GLN A O   1 
ATOM   2401 C  CB  . GLN C 3 135 ? 128.193 -6.832  217.951 1.00 42.70  ? 164 GLN A CB  1 
ATOM   2402 C  CG  . GLN C 3 135 ? 127.530 -8.069  218.528 1.00 49.49  ? 164 GLN A CG  1 
ATOM   2403 C  CD  . GLN C 3 135 ? 126.660 -8.785  217.515 1.00 55.20  ? 164 GLN A CD  1 
ATOM   2404 O  OE1 . GLN C 3 135 ? 127.059 -8.980  216.367 1.00 52.36  ? 164 GLN A OE1 1 
ATOM   2405 N  NE2 . GLN C 3 135 ? 125.463 -9.179  217.934 1.00 54.82  ? 164 GLN A NE2 1 
ATOM   2406 N  N   . HIS C 3 136 ? 129.070 -3.870  218.308 1.00 27.90  ? 165 HIS A N   1 
ATOM   2407 C  CA  . HIS C 3 136 ? 129.523 -2.596  217.758 1.00 28.49  ? 165 HIS A CA  1 
ATOM   2408 C  C   . HIS C 3 136 ? 130.731 -2.054  218.511 1.00 29.54  ? 165 HIS A C   1 
ATOM   2409 O  O   . HIS C 3 136 ? 131.577 -1.378  217.915 1.00 42.35  ? 165 HIS A O   1 
ATOM   2410 C  CB  . HIS C 3 136 ? 128.390 -1.571  217.781 1.00 27.13  ? 165 HIS A CB  1 
ATOM   2411 C  CG  . HIS C 3 136 ? 128.786 -0.227  217.253 1.00 34.72  ? 165 HIS A CG  1 
ATOM   2412 N  ND1 . HIS C 3 136 ? 128.936 0.028   215.907 1.00 31.99  ? 165 HIS A ND1 1 
ATOM   2413 C  CD2 . HIS C 3 136 ? 129.071 0.933   217.890 1.00 22.35  ? 165 HIS A CD2 1 
ATOM   2414 C  CE1 . HIS C 3 136 ? 129.292 1.289   215.737 1.00 41.33  ? 165 HIS A CE1 1 
ATOM   2415 N  NE2 . HIS C 3 136 ? 129.381 1.860   216.924 1.00 35.30  ? 165 HIS A NE2 1 
ATOM   2416 N  N   . LEU C 3 137 ? 130.828 -2.332  219.813 1.00 31.67  ? 166 LEU A N   1 
ATOM   2417 C  CA  . LEU C 3 137 ? 131.988 -1.887  220.578 1.00 27.63  ? 166 LEU A CA  1 
ATOM   2418 C  C   . LEU C 3 137 ? 133.257 -2.606  220.139 1.00 33.94  ? 166 LEU A C   1 
ATOM   2419 O  O   . LEU C 3 137 ? 134.339 -2.009  220.140 1.00 32.07  ? 166 LEU A O   1 
ATOM   2420 C  CB  . LEU C 3 137 ? 131.746 -2.094  222.072 1.00 34.81  ? 166 LEU A CB  1 
ATOM   2421 C  CG  . LEU C 3 137 ? 130.765 -1.119  222.723 1.00 35.72  ? 166 LEU A CG  1 
ATOM   2422 C  CD1 . LEU C 3 137 ? 130.574 -1.442  224.198 1.00 26.42  ? 166 LEU A CD1 1 
ATOM   2423 C  CD2 . LEU C 3 137 ? 131.246 0.312   222.539 1.00 22.20  ? 166 LEU A CD2 1 
ATOM   2424 N  N   . CYS C 3 138 ? 133.147 -3.883  219.766 1.00 38.48  ? 167 CYS A N   1 
ATOM   2425 C  CA  . CYS C 3 138 ? 134.305 -4.597  219.241 1.00 35.23  ? 167 CYS A CA  1 
ATOM   2426 C  C   . CYS C 3 138 ? 134.689 -4.077  217.862 1.00 36.07  ? 167 CYS A C   1 
ATOM   2427 O  O   . CYS C 3 138 ? 135.879 -3.975  217.539 1.00 34.19  ? 167 CYS A O   1 
ATOM   2428 C  CB  . CYS C 3 138 ? 134.020 -6.097  219.186 1.00 34.87  ? 167 CYS A CB  1 
ATOM   2429 S  SG  . CYS C 3 138 ? 133.737 -6.866  220.795 1.00 40.90  ? 167 CYS A SG  1 
ATOM   2430 N  N   . ARG C 3 139 ? 133.693 -3.745  217.036 1.00 37.81  ? 168 ARG A N   1 
ATOM   2431 C  CA  . ARG C 3 139 ? 133.971 -3.199  215.712 1.00 27.00  ? 168 ARG A CA  1 
ATOM   2432 C  C   . ARG C 3 139 ? 134.778 -1.911  215.807 1.00 35.38  ? 168 ARG A C   1 
ATOM   2433 O  O   . ARG C 3 139 ? 135.706 -1.692  215.020 1.00 38.41  ? 168 ARG A O   1 
ATOM   2434 C  CB  . ARG C 3 139 ? 132.661 -2.961  214.961 1.00 26.61  ? 168 ARG A CB  1 
ATOM   2435 C  CG  . ARG C 3 139 ? 132.829 -2.382  213.567 1.00 32.44  ? 168 ARG A CG  1 
ATOM   2436 C  CD  . ARG C 3 139 ? 131.583 -2.614  212.732 1.00 29.31  ? 168 ARG A CD  1 
ATOM   2437 N  NE  . ARG C 3 139 ? 130.389 -2.080  213.383 1.00 39.75  ? 168 ARG A NE  1 
ATOM   2438 C  CZ  . ARG C 3 139 ? 129.153 -2.237  212.919 1.00 36.01  ? 168 ARG A CZ  1 
ATOM   2439 N  NH1 . ARG C 3 139 ? 128.947 -2.910  211.796 1.00 42.87  ? 168 ARG A NH1 1 
ATOM   2440 N  NH2 . ARG C 3 139 ? 128.125 -1.718  213.576 1.00 36.11  ? 168 ARG A NH2 1 
ATOM   2441 N  N   . LEU C 3 140 ? 134.443 -1.048  216.769 1.00 30.47  ? 169 LEU A N   1 
ATOM   2442 C  CA  . LEU C 3 140 ? 135.193 0.191   216.945 1.00 25.84  ? 169 LEU A CA  1 
ATOM   2443 C  C   . LEU C 3 140 ? 136.627 -0.089  217.378 1.00 31.68  ? 169 LEU A C   1 
ATOM   2444 O  O   . LEU C 3 140 ? 137.565 0.550   216.889 1.00 37.34  ? 169 LEU A O   1 
ATOM   2445 C  CB  . LEU C 3 140 ? 134.490 1.092   217.961 1.00 25.45  ? 169 LEU A CB  1 
ATOM   2446 C  CG  . LEU C 3 140 ? 133.247 1.836   217.468 1.00 24.61  ? 169 LEU A CG  1 
ATOM   2447 C  CD1 . LEU C 3 140 ? 132.473 2.431   218.635 1.00 22.81  ? 169 LEU A CD1 1 
ATOM   2448 C  CD2 . LEU C 3 140 ? 133.634 2.915   216.469 1.00 31.81  ? 169 LEU A CD2 1 
ATOM   2449 N  N   . THR C 3 141 ? 136.816 -1.042  218.294 1.00 30.41  ? 170 THR A N   1 
ATOM   2450 C  CA  . THR C 3 141 ? 138.166 -1.395  218.721 1.00 27.30  ? 170 THR A CA  1 
ATOM   2451 C  C   . THR C 3 141 ? 138.962 -2.010  217.576 1.00 28.96  ? 170 THR A C   1 
ATOM   2452 O  O   . THR C 3 141 ? 140.164 -1.755  217.440 1.00 25.98  ? 170 THR A O   1 
ATOM   2453 C  CB  . THR C 3 141 ? 138.106 -2.353  219.913 1.00 27.28  ? 170 THR A CB  1 
ATOM   2454 O  OG1 . THR C 3 141 ? 137.419 -1.722  221.001 1.00 31.81  ? 170 THR A OG1 1 
ATOM   2455 C  CG2 . THR C 3 141 ? 139.507 -2.737  220.367 1.00 28.20  ? 170 THR A CG2 1 
ATOM   2456 N  N   . ILE C 3 142 ? 138.305 -2.811  216.735 1.00 27.49  ? 171 ILE A N   1 
ATOM   2457 C  CA  . ILE C 3 142 ? 138.992 -3.417  215.599 1.00 23.81  ? 171 ILE A CA  1 
ATOM   2458 C  C   . ILE C 3 142 ? 139.336 -2.359  214.556 1.00 30.76  ? 171 ILE A C   1 
ATOM   2459 O  O   . ILE C 3 142 ? 140.428 -2.376  213.973 1.00 36.96  ? 171 ILE A O   1 
ATOM   2460 C  CB  . ILE C 3 142 ? 138.136 -4.552  215.007 1.00 27.70  ? 171 ILE A CB  1 
ATOM   2461 C  CG1 . ILE C 3 142 ? 138.092 -5.741  215.970 1.00 26.34  ? 171 ILE A CG1 1 
ATOM   2462 C  CG2 . ILE C 3 142 ? 138.676 -4.988  213.653 1.00 23.28  ? 171 ILE A CG2 1 
ATOM   2463 C  CD1 . ILE C 3 142 ? 137.027 -6.763  215.636 1.00 43.73  ? 171 ILE A CD1 1 
ATOM   2464 N  N   . ASN C 3 143 ? 138.422 -1.414  214.316 1.00 33.78  ? 172 ASN A N   1 
ATOM   2465 C  CA  . ASN C 3 143 ? 138.674 -0.375  213.321 1.00 25.86  ? 172 ASN A CA  1 
ATOM   2466 C  C   . ASN C 3 143 ? 139.830 0.530   213.725 1.00 22.81  ? 172 ASN A C   1 
ATOM   2467 O  O   . ASN C 3 143 ? 140.490 1.116   212.859 1.00 33.98  ? 172 ASN A O   1 
ATOM   2468 C  CB  . ASN C 3 143 ? 137.410 0.454   213.092 1.00 23.31  ? 172 ASN A CB  1 
ATOM   2469 C  CG  . ASN C 3 143 ? 136.317 -0.329  212.392 1.00 28.66  ? 172 ASN A CG  1 
ATOM   2470 O  OD1 . ASN C 3 143 ? 136.527 -1.464  211.965 1.00 25.19  ? 172 ASN A OD1 1 
ATOM   2471 N  ND2 . ASN C 3 143 ? 135.142 0.277   212.268 1.00 27.48  ? 172 ASN A ND2 1 
ATOM   2472 N  N   . LYS C 3 144 ? 140.091 0.664   215.025 1.00 25.57  ? 173 LYS A N   1 
ATOM   2473 C  CA  . LYS C 3 144 ? 141.198 1.489   215.489 1.00 32.73  ? 173 LYS A CA  1 
ATOM   2474 C  C   . LYS C 3 144 ? 142.550 0.804   215.344 1.00 34.96  ? 173 LYS A C   1 
ATOM   2475 O  O   . LYS C 3 144 ? 143.580 1.477   215.460 1.00 42.71  ? 173 LYS A O   1 
ATOM   2476 C  CB  . LYS C 3 144 ? 140.981 1.893   216.950 1.00 24.87  ? 173 LYS A CB  1 
ATOM   2477 C  CG  . LYS C 3 144 ? 139.801 2.828   217.161 1.00 34.87  ? 173 LYS A CG  1 
ATOM   2478 C  CD  . LYS C 3 144 ? 139.893 3.558   218.490 1.00 38.18  ? 173 LYS A CD  1 
ATOM   2479 C  CE  . LYS C 3 144 ? 138.532 4.072   218.928 1.00 45.23  ? 173 LYS A CE  1 
ATOM   2480 N  NZ  . LYS C 3 144 ? 137.646 2.968   219.390 1.00 56.25  ? 173 LYS A NZ  1 
ATOM   2481 N  N   . CYS C 3 145 ? 142.574 -0.504  215.091 1.00 28.65  ? 174 CYS A N   1 
ATOM   2482 C  CA  . CYS C 3 145 ? 143.816 -1.256  214.969 1.00 36.92  ? 174 CYS A CA  1 
ATOM   2483 C  C   . CYS C 3 145 ? 144.219 -1.494  213.518 1.00 42.77  ? 174 CYS A C   1 
ATOM   2484 O  O   . CYS C 3 145 ? 145.357 -1.204  213.137 1.00 54.20  ? 174 CYS A O   1 
ATOM   2485 C  CB  . CYS C 3 145 ? 143.692 -2.597  215.700 1.00 34.42  ? 174 CYS A CB  1 
ATOM   2486 S  SG  . CYS C 3 145 ? 143.542 -2.454  217.494 1.00 65.93  ? 174 CYS A SG  1 
ATOM   2487 N  N   . THR C 3 146 ? 143.310 -2.017  212.699 1.00 41.09  ? 175 THR A N   1 
ATOM   2488 C  CA  . THR C 3 146 ? 143.614 -2.326  211.310 1.00 51.76  ? 175 THR A CA  1 
ATOM   2489 C  C   . THR C 3 146 ? 142.411 -2.000  210.439 1.00 48.15  ? 175 THR A C   1 
ATOM   2490 O  O   . THR C 3 146 ? 141.284 -1.861  210.922 1.00 51.65  ? 175 THR A O   1 
ATOM   2491 C  CB  . THR C 3 146 ? 144.004 -3.799  211.124 1.00 58.03  ? 175 THR A CB  1 
ATOM   2492 O  OG1 . THR C 3 146 ? 144.354 -4.035  209.754 1.00 48.81  ? 175 THR A OG1 1 
ATOM   2493 C  CG2 . THR C 3 146 ? 142.846 -4.710  211.509 1.00 43.86  ? 175 THR A CG2 1 
ATOM   2494 N  N   . GLY C 3 147 ? 142.668 -1.879  209.139 1.00 50.01  ? 176 GLY A N   1 
ATOM   2495 C  CA  . GLY C 3 147 ? 141.610 -1.663  208.174 1.00 35.05  ? 176 GLY A CA  1 
ATOM   2496 C  C   . GLY C 3 147 ? 141.497 -2.804  207.186 1.00 46.24  ? 176 GLY A C   1 
ATOM   2497 O  O   . GLY C 3 147 ? 140.711 -2.740  206.236 1.00 44.76  ? 176 GLY A O   1 
ATOM   2498 N  N   . ALA C 3 148 ? 142.280 -3.860  207.404 1.00 36.25  ? 177 ALA A N   1 
ATOM   2499 C  CA  . ALA C 3 148 ? 142.322 -5.015  206.508 1.00 38.55  ? 177 ALA A CA  1 
ATOM   2500 C  C   . ALA C 3 148 ? 141.453 -6.116  207.107 1.00 40.21  ? 177 ALA A C   1 
ATOM   2501 O  O   . ALA C 3 148 ? 141.910 -6.926  207.914 1.00 47.56  ? 177 ALA A O   1 
ATOM   2502 C  CB  . ALA C 3 148 ? 143.757 -5.479  206.291 1.00 44.85  ? 177 ALA A CB  1 
ATOM   2503 N  N   . ILE C 3 149 ? 140.183 -6.145  206.696 1.00 41.11  ? 178 ILE A N   1 
ATOM   2504 C  CA  . ILE C 3 149 ? 139.253 -7.141  207.221 1.00 33.59  ? 178 ILE A CA  1 
ATOM   2505 C  C   . ILE C 3 149 ? 139.570 -8.526  206.671 1.00 38.63  ? 178 ILE A C   1 
ATOM   2506 O  O   . ILE C 3 149 ? 139.307 -9.538  207.332 1.00 44.59  ? 178 ILE A O   1 
ATOM   2507 C  CB  . ILE C 3 149 ? 137.803 -6.726  206.909 1.00 34.76  ? 178 ILE A CB  1 
ATOM   2508 C  CG1 . ILE C 3 149 ? 137.608 -5.232  207.178 1.00 27.54  ? 178 ILE A CG1 1 
ATOM   2509 C  CG2 . ILE C 3 149 ? 136.820 -7.549  207.728 1.00 45.12  ? 178 ILE A CG2 1 
ATOM   2510 C  CD1 . ILE C 3 149 ? 136.236 -4.717  206.808 1.00 36.44  ? 178 ILE A CD1 1 
ATOM   2511 N  N   . TRP C 3 150 ? 140.136 -8.600  205.464 1.00 44.51  ? 179 TRP A N   1 
ATOM   2512 C  CA  . TRP C 3 150 ? 140.479 -9.892  204.877 1.00 44.75  ? 179 TRP A CA  1 
ATOM   2513 C  C   . TRP C 3 150 ? 141.550 -10.616 205.683 1.00 43.27  ? 179 TRP A C   1 
ATOM   2514 O  O   . TRP C 3 150 ? 141.557 -11.851 205.731 1.00 56.82  ? 179 TRP A O   1 
ATOM   2515 C  CB  . TRP C 3 150 ? 140.955 -9.700  203.440 1.00 47.24  ? 179 TRP A CB  1 
ATOM   2516 C  CG  . TRP C 3 150 ? 142.106 -8.764  203.365 1.00 38.43  ? 179 TRP A CG  1 
ATOM   2517 C  CD1 . TRP C 3 150 ? 142.047 -7.410  203.253 1.00 38.78  ? 179 TRP A CD1 1 
ATOM   2518 C  CD2 . TRP C 3 150 ? 143.496 -9.105  203.431 1.00 44.76  ? 179 TRP A CD2 1 
ATOM   2519 N  NE1 . TRP C 3 150 ? 143.312 -6.885  203.236 1.00 36.50  ? 179 TRP A NE1 1 
ATOM   2520 C  CE2 . TRP C 3 150 ? 144.222 -7.904  203.340 1.00 43.10  ? 179 TRP A CE2 1 
ATOM   2521 C  CE3 . TRP C 3 150 ? 144.196 -10.309 203.550 1.00 36.88  ? 179 TRP A CE3 1 
ATOM   2522 C  CZ2 . TRP C 3 150 ? 145.615 -7.869  203.364 1.00 35.83  ? 179 TRP A CZ2 1 
ATOM   2523 C  CZ3 . TRP C 3 150 ? 145.579 -10.273 203.575 1.00 30.24  ? 179 TRP A CZ3 1 
ATOM   2524 C  CH2 . TRP C 3 150 ? 146.273 -9.061  203.483 1.00 45.63  ? 179 TRP A CH2 1 
ATOM   2525 N  N   . GLY C 3 151 ? 142.458 -9.875  206.314 1.00 42.31  ? 180 GLY A N   1 
ATOM   2526 C  CA  . GLY C 3 151 ? 143.537 -10.482 207.067 1.00 52.29  ? 180 GLY A CA  1 
ATOM   2527 C  C   . GLY C 3 151 ? 143.154 -10.845 208.487 1.00 50.40  ? 180 GLY A C   1 
ATOM   2528 O  O   . GLY C 3 151 ? 144.023 -11.052 209.338 1.00 39.17  ? 180 GLY A O   1 
ATOM   2529 N  N   . LEU C 3 152 ? 141.849 -10.929 208.754 1.00 36.07  ? 181 LEU A N   1 
ATOM   2530 C  CA  . LEU C 3 152 ? 141.351 -11.243 210.082 1.00 44.27  ? 181 LEU A CA  1 
ATOM   2531 C  C   . LEU C 3 152 ? 140.784 -12.656 210.128 1.00 44.95  ? 181 LEU A C   1 
ATOM   2532 O  O   . LEU C 3 152 ? 140.095 -13.080 209.193 1.00 45.56  ? 181 LEU A O   1 
ATOM   2533 C  CB  . LEU C 3 152 ? 140.263 -10.252 210.516 1.00 34.61  ? 181 LEU A CB  1 
ATOM   2534 C  CG  . LEU C 3 152 ? 140.637 -8.771  210.605 1.00 30.20  ? 181 LEU A CG  1 
ATOM   2535 C  CD1 . LEU C 3 152 ? 139.401 -7.932  210.887 1.00 24.42  ? 181 LEU A CD1 1 
ATOM   2536 C  CD2 . LEU C 3 152 ? 141.693 -8.544  211.673 1.00 30.09  ? 181 LEU A CD2 1 
ATOM   2537 N  N   . PRO C 3 153 ? 141.053 -13.404 211.198 1.00 54.26  ? 182 PRO A N   1 
ATOM   2538 C  CA  . PRO C 3 153 ? 140.503 -14.767 211.356 1.00 57.91  ? 182 PRO A CA  1 
ATOM   2539 C  C   . PRO C 3 153 ? 139.056 -14.745 211.834 1.00 46.86  ? 182 PRO A C   1 
ATOM   2540 O  O   . PRO C 3 153 ? 138.721 -15.089 212.973 1.00 60.95  ? 182 PRO A O   1 
ATOM   2541 C  CB  . PRO C 3 153 ? 141.458 -15.385 212.382 1.00 41.68  ? 182 PRO A CB  1 
ATOM   2542 C  CG  . PRO C 3 153 ? 141.872 -14.229 213.230 1.00 42.14  ? 182 PRO A CG  1 
ATOM   2543 C  CD  . PRO C 3 153 ? 141.931 -13.028 212.319 1.00 52.90  ? 182 PRO A CD  1 
ATOM   2544 N  N   . LEU C 3 154 ? 138.161 -14.328 210.945 1.00 41.51  ? 183 LEU A N   1 
ATOM   2545 C  CA  . LEU C 3 154 ? 136.748 -14.220 211.261 1.00 50.44  ? 183 LEU A CA  1 
ATOM   2546 C  C   . LEU C 3 154 ? 135.915 -14.852 210.158 1.00 54.80  ? 183 LEU A C   1 
ATOM   2547 O  O   . LEU C 3 154 ? 136.301 -14.820 208.985 1.00 70.49  ? 183 LEU A O   1 
ATOM   2548 C  CB  . LEU C 3 154 ? 136.324 -12.754 211.435 1.00 62.26  ? 183 LEU A CB  1 
ATOM   2549 C  CG  . LEU C 3 154 ? 137.016 -11.933 212.525 1.00 43.11  ? 183 LEU A CG  1 
ATOM   2550 C  CD1 . LEU C 3 154 ? 136.677 -10.459 212.370 1.00 42.78  ? 183 LEU A CD1 1 
ATOM   2551 C  CD2 . LEU C 3 154 ? 136.629 -12.433 213.909 1.00 36.44  ? 183 LEU A CD2 1 
ATOM   2552 N  N   . PRO C 3 155 ? 134.775 -15.446 210.508 1.00 64.29  ? 184 PRO A N   1 
ATOM   2553 C  CA  . PRO C 3 155 ? 133.846 -15.911 209.474 1.00 51.37  ? 184 PRO A CA  1 
ATOM   2554 C  C   . PRO C 3 155 ? 133.339 -14.741 208.645 1.00 62.66  ? 184 PRO A C   1 
ATOM   2555 O  O   . PRO C 3 155 ? 133.185 -13.622 209.141 1.00 65.30  ? 184 PRO A O   1 
ATOM   2556 C  CB  . PRO C 3 155 ? 132.714 -16.565 210.276 1.00 66.53  ? 184 PRO A CB  1 
ATOM   2557 C  CG  . PRO C 3 155 ? 133.325 -16.889 211.607 1.00 83.58  ? 184 PRO A CG  1 
ATOM   2558 C  CD  . PRO C 3 155 ? 134.323 -15.802 211.863 1.00 76.22  ? 184 PRO A CD  1 
ATOM   2559 N  N   . THR C 3 156 ? 133.080 -15.012 207.363 1.00 79.51  ? 185 THR A N   1 
ATOM   2560 C  CA  . THR C 3 156 ? 132.681 -13.954 206.439 1.00 73.39  ? 185 THR A CA  1 
ATOM   2561 C  C   . THR C 3 156 ? 131.397 -13.256 206.870 1.00 59.31  ? 185 THR A C   1 
ATOM   2562 O  O   . THR C 3 156 ? 131.127 -12.141 206.409 1.00 52.60  ? 185 THR A O   1 
ATOM   2563 C  CB  . THR C 3 156 ? 132.515 -14.518 205.027 1.00 72.12  ? 185 THR A CB  1 
ATOM   2564 O  OG1 . THR C 3 156 ? 131.295 -15.266 204.948 1.00 62.83  ? 185 THR A OG1 1 
ATOM   2565 C  CG2 . THR C 3 156 ? 133.686 -15.424 204.674 1.00 60.40  ? 185 THR A CG2 1 
ATOM   2566 N  N   . ARG C 3 157 ? 130.600 -13.884 207.737 1.00 50.29  ? 186 ARG A N   1 
ATOM   2567 C  CA  . ARG C 3 157 ? 129.420 -13.216 208.276 1.00 63.51  ? 186 ARG A CA  1 
ATOM   2568 C  C   . ARG C 3 157 ? 129.813 -12.006 209.114 1.00 61.38  ? 186 ARG A C   1 
ATOM   2569 O  O   . ARG C 3 157 ? 129.145 -10.965 209.070 1.00 44.72  ? 186 ARG A O   1 
ATOM   2570 C  CB  . ARG C 3 157 ? 128.594 -14.205 209.102 1.00 48.46  ? 186 ARG A CB  1 
ATOM   2571 C  CG  . ARG C 3 157 ? 127.533 -13.564 209.983 1.00 59.53  ? 186 ARG A CG  1 
ATOM   2572 C  CD  . ARG C 3 157 ? 126.969 -14.566 210.979 1.00 55.29  ? 186 ARG A CD  1 
ATOM   2573 N  NE  . ARG C 3 157 ? 128.026 -15.318 211.649 1.00 69.45  ? 186 ARG A NE  1 
ATOM   2574 C  CZ  . ARG C 3 157 ? 127.809 -16.293 212.525 1.00 74.10  ? 186 ARG A CZ  1 
ATOM   2575 N  NH1 . ARG C 3 157 ? 128.833 -16.922 213.086 1.00 52.57  ? 186 ARG A NH1 1 
ATOM   2576 N  NH2 . ARG C 3 157 ? 126.569 -16.641 212.841 1.00 94.86  ? 186 ARG A NH2 1 
ATOM   2577 N  N   . LEU C 3 158 ? 130.900 -12.120 209.880 1.00 64.56  ? 187 LEU A N   1 
ATOM   2578 C  CA  . LEU C 3 158 ? 131.376 -10.991 210.670 1.00 61.19  ? 187 LEU A CA  1 
ATOM   2579 C  C   . LEU C 3 158 ? 132.170 -10.001 209.828 1.00 49.00  ? 187 LEU A C   1 
ATOM   2580 O  O   . LEU C 3 158 ? 132.142 -8.797  210.108 1.00 42.00  ? 187 LEU A O   1 
ATOM   2581 C  CB  . LEU C 3 158 ? 132.228 -11.487 211.837 1.00 50.12  ? 187 LEU A CB  1 
ATOM   2582 C  CG  . LEU C 3 158 ? 131.472 -12.284 212.900 1.00 52.56  ? 187 LEU A CG  1 
ATOM   2583 C  CD1 . LEU C 3 158 ? 132.412 -12.705 214.013 1.00 56.53  ? 187 LEU A CD1 1 
ATOM   2584 C  CD2 . LEU C 3 158 ? 130.311 -11.472 213.451 1.00 47.08  ? 187 LEU A CD2 1 
ATOM   2585 N  N   . LYS C 3 159 ? 132.884 -10.483 208.808 1.00 50.14  ? 188 LYS A N   1 
ATOM   2586 C  CA  . LYS C 3 159 ? 133.571 -9.574  207.898 1.00 42.90  ? 188 LYS A CA  1 
ATOM   2587 C  C   . LYS C 3 159 ? 132.578 -8.660  207.193 1.00 37.47  ? 188 LYS A C   1 
ATOM   2588 O  O   . LYS C 3 159 ? 132.868 -7.482  206.950 1.00 40.29  ? 188 LYS A O   1 
ATOM   2589 C  CB  . LYS C 3 159 ? 134.394 -10.367 206.883 1.00 39.10  ? 188 LYS A CB  1 
ATOM   2590 C  CG  . LYS C 3 159 ? 135.614 -11.046 207.479 1.00 43.31  ? 188 LYS A CG  1 
ATOM   2591 C  CD  . LYS C 3 159 ? 136.453 -11.730 206.414 1.00 48.26  ? 188 LYS A CD  1 
ATOM   2592 C  CE  . LYS C 3 159 ? 137.695 -12.358 207.025 1.00 40.85  ? 188 LYS A CE  1 
ATOM   2593 N  NZ  . LYS C 3 159 ? 138.445 -13.190 206.046 1.00 61.31  ? 188 LYS A NZ  1 
ATOM   2594 N  N   . ASP C 3 160 ? 131.396 -9.186  206.863 1.00 39.82  ? 189 ASP A N   1 
ATOM   2595 C  CA  . ASP C 3 160 ? 130.332 -8.343  206.330 1.00 47.52  ? 189 ASP A CA  1 
ATOM   2596 C  C   . ASP C 3 160 ? 129.884 -7.313  207.360 1.00 61.85  ? 189 ASP A C   1 
ATOM   2597 O  O   . ASP C 3 160 ? 129.552 -6.176  207.008 1.00 63.17  ? 189 ASP A O   1 
ATOM   2598 C  CB  . ASP C 3 160 ? 129.152 -9.208  205.885 1.00 39.28  ? 189 ASP A CB  1 
ATOM   2599 C  CG  . ASP C 3 160 ? 128.081 -8.411  205.162 1.00 72.74  ? 189 ASP A CG  1 
ATOM   2600 O  OD1 . ASP C 3 160 ? 128.386 -7.298  204.686 1.00 66.63  ? 189 ASP A OD1 1 
ATOM   2601 O  OD2 . ASP C 3 160 ? 126.934 -8.898  205.066 1.00 79.93  ? 189 ASP A OD2 1 
ATOM   2602 N  N   . TYR C 3 161 ? 129.874 -7.694  208.640 1.00 57.81  ? 190 TYR A N   1 
ATOM   2603 C  CA  . TYR C 3 161 ? 129.479 -6.760  209.688 1.00 51.43  ? 190 TYR A CA  1 
ATOM   2604 C  C   . TYR C 3 161 ? 130.488 -5.627  209.828 1.00 45.62  ? 190 TYR A C   1 
ATOM   2605 O  O   . TYR C 3 161 ? 130.105 -4.471  210.035 1.00 50.16  ? 190 TYR A O   1 
ATOM   2606 C  CB  . TYR C 3 161 ? 129.315 -7.502  211.016 1.00 52.41  ? 190 TYR A CB  1 
ATOM   2607 C  CG  . TYR C 3 161 ? 128.897 -6.620  212.173 1.00 53.22  ? 190 TYR A CG  1 
ATOM   2608 C  CD1 . TYR C 3 161 ? 127.662 -5.985  212.177 1.00 47.12  ? 190 TYR A CD1 1 
ATOM   2609 C  CD2 . TYR C 3 161 ? 129.735 -6.429  213.265 1.00 41.42  ? 190 TYR A CD2 1 
ATOM   2610 C  CE1 . TYR C 3 161 ? 127.274 -5.182  213.235 1.00 43.56  ? 190 TYR A CE1 1 
ATOM   2611 C  CE2 . TYR C 3 161 ? 129.356 -5.627  214.326 1.00 36.68  ? 190 TYR A CE2 1 
ATOM   2612 C  CZ  . TYR C 3 161 ? 128.124 -5.006  214.306 1.00 44.26  ? 190 TYR A CZ  1 
ATOM   2613 O  OH  . TYR C 3 161 ? 127.743 -4.206  215.359 1.00 42.21  ? 190 TYR A OH  1 
ATOM   2614 N  N   . LEU C 3 162 ? 131.782 -5.938  209.710 1.00 42.02  ? 191 LEU A N   1 
ATOM   2615 C  CA  . LEU C 3 162 ? 132.810 -4.916  209.868 1.00 43.77  ? 191 LEU A CA  1 
ATOM   2616 C  C   . LEU C 3 162 ? 132.809 -3.904  208.729 1.00 55.00  ? 191 LEU A C   1 
ATOM   2617 O  O   . LEU C 3 162 ? 133.284 -2.780  208.920 1.00 49.72  ? 191 LEU A O   1 
ATOM   2618 C  CB  . LEU C 3 162 ? 134.189 -5.568  209.982 1.00 33.98  ? 191 LEU A CB  1 
ATOM   2619 C  CG  . LEU C 3 162 ? 134.449 -6.406  211.237 1.00 38.58  ? 191 LEU A CG  1 
ATOM   2620 C  CD1 . LEU C 3 162 ? 135.896 -6.868  211.291 1.00 45.04  ? 191 LEU A CD1 1 
ATOM   2621 C  CD2 . LEU C 3 162 ? 134.090 -5.624  212.490 1.00 49.12  ? 191 LEU A CD2 1 
ATOM   2622 N  N   . GLU C 3 163 ? 132.288 -4.270  207.556 1.00 42.49  ? 192 GLU A N   1 
ATOM   2623 C  CA  . GLU C 3 163 ? 132.292 -3.347  206.427 1.00 38.81  ? 192 GLU A CA  1 
ATOM   2624 C  C   . GLU C 3 163 ? 131.175 -2.318  206.513 1.00 43.26  ? 192 GLU A C   1 
ATOM   2625 O  O   . GLU C 3 163 ? 131.306 -1.224  205.954 1.00 48.88  ? 192 GLU A O   1 
ATOM   2626 C  CB  . GLU C 3 163 ? 132.182 -4.114  205.112 1.00 48.89  ? 192 GLU A CB  1 
ATOM   2627 C  CG  . GLU C 3 163 ? 133.519 -4.414  204.483 1.00 58.00  ? 192 GLU A CG  1 
ATOM   2628 C  CD  . GLU C 3 163 ? 133.925 -3.401  203.433 1.00 54.78  ? 192 GLU A CD  1 
ATOM   2629 O  OE1 . GLU C 3 163 ? 133.038 -2.898  202.713 1.00 59.39  ? 192 GLU A OE1 1 
ATOM   2630 O  OE2 . GLU C 3 163 ? 135.136 -3.114  203.323 1.00 64.04  ? 192 GLU A OE2 1 
ATOM   2631 N  N   . GLU C 3 164 ? 130.075 -2.643  207.193 1.00 58.03  ? 193 GLU A N   1 
ATOM   2632 C  CA  . GLU C 3 164 ? 128.971 -1.700  207.309 1.00 44.53  ? 193 GLU A CA  1 
ATOM   2633 C  C   . GLU C 3 164 ? 129.301 -0.513  208.204 1.00 45.35  ? 193 GLU A C   1 
ATOM   2634 O  O   . GLU C 3 164 ? 128.522 0.445   208.243 1.00 50.29  ? 193 GLU A O   1 
ATOM   2635 C  CB  . GLU C 3 164 ? 127.723 -2.419  207.827 1.00 42.90  ? 193 GLU A CB  1 
ATOM   2636 C  CG  . GLU C 3 164 ? 126.819 -2.949  206.723 1.00 75.35  ? 193 GLU A CG  1 
ATOM   2637 C  CD  . GLU C 3 164 ? 126.346 -4.366  206.979 1.00 91.16  ? 193 GLU A CD  1 
ATOM   2638 O  OE1 . GLU C 3 164 ? 125.966 -5.052  206.006 1.00 89.02  ? 193 GLU A OE1 1 
ATOM   2639 O  OE2 . GLU C 3 164 ? 126.352 -4.794  208.152 1.00 79.49  ? 193 GLU A OE2 1 
ATOM   2640 N  N   . TYR C 3 165 ? 130.432 -0.550  208.912 1.00 40.38  ? 194 TYR A N   1 
ATOM   2641 C  CA  . TYR C 3 165 ? 130.853 0.554   209.774 1.00 43.98  ? 194 TYR A CA  1 
ATOM   2642 C  C   . TYR C 3 165 ? 132.373 0.472   209.892 1.00 34.40  ? 194 TYR A C   1 
ATOM   2643 O  O   . TYR C 3 165 ? 132.893 -0.290  210.712 1.00 40.84  ? 194 TYR A O   1 
ATOM   2644 C  CB  . TYR C 3 165 ? 130.176 0.476   211.137 1.00 30.66  ? 194 TYR A CB  1 
ATOM   2645 C  CG  . TYR C 3 165 ? 130.179 1.773   211.917 1.00 29.99  ? 194 TYR A CG  1 
ATOM   2646 C  CD1 . TYR C 3 165 ? 131.246 2.109   212.740 1.00 31.40  ? 194 TYR A CD1 1 
ATOM   2647 C  CD2 . TYR C 3 165 ? 129.109 2.655   211.839 1.00 29.64  ? 194 TYR A CD2 1 
ATOM   2648 C  CE1 . TYR C 3 165 ? 131.251 3.292   213.458 1.00 34.50  ? 194 TYR A CE1 1 
ATOM   2649 C  CE2 . TYR C 3 165 ? 129.105 3.840   212.553 1.00 33.72  ? 194 TYR A CE2 1 
ATOM   2650 C  CZ  . TYR C 3 165 ? 130.179 4.153   213.361 1.00 33.86  ? 194 TYR A CZ  1 
ATOM   2651 O  OH  . TYR C 3 165 ? 130.183 5.329   214.075 1.00 32.70  ? 194 TYR A OH  1 
ATOM   2652 N  N   . LYS C 3 166 ? 133.074 1.252   209.070 1.00 38.22  ? 195 LYS A N   1 
ATOM   2653 C  CA  . LYS C 3 166 ? 134.529 1.219   209.003 1.00 43.57  ? 195 LYS A CA  1 
ATOM   2654 C  C   . LYS C 3 166 ? 135.182 2.396   209.716 1.00 31.35  ? 195 LYS A C   1 
ATOM   2655 O  O   . LYS C 3 166 ? 136.401 2.569   209.616 1.00 40.28  ? 195 LYS A O   1 
ATOM   2656 C  CB  . LYS C 3 166 ? 134.988 1.181   207.544 1.00 33.07  ? 195 LYS A CB  1 
ATOM   2657 C  CG  . LYS C 3 166 ? 134.650 -0.110  206.818 1.00 43.12  ? 195 LYS A CG  1 
ATOM   2658 C  CD  . LYS C 3 166 ? 134.811 0.040   205.313 1.00 41.12  ? 195 LYS A CD  1 
ATOM   2659 C  CE  . LYS C 3 166 ? 133.786 1.004   204.738 1.00 52.86  ? 195 LYS A CE  1 
ATOM   2660 N  NZ  . LYS C 3 166 ? 133.912 1.135   203.259 1.00 76.21  ? 195 LYS A NZ  1 
ATOM   2661 N  N   . PHE C 3 167 ? 134.407 3.202   210.434 1.00 31.38  ? 196 PHE A N   1 
ATOM   2662 C  CA  . PHE C 3 167 ? 134.938 4.395   211.070 1.00 46.28  ? 196 PHE A CA  1 
ATOM   2663 C  C   . PHE C 3 167 ? 135.521 4.061   212.443 1.00 41.60  ? 196 PHE A C   1 
ATOM   2664 O  O   . PHE C 3 167 ? 135.312 2.978   212.997 1.00 42.00  ? 196 PHE A O   1 
ATOM   2665 C  CB  . PHE C 3 167 ? 133.847 5.457   211.191 1.00 44.53  ? 196 PHE A CB  1 
ATOM   2666 C  CG  . PHE C 3 167 ? 133.043 5.638   209.936 1.00 35.71  ? 196 PHE A CG  1 
ATOM   2667 C  CD1 . PHE C 3 167 ? 133.489 6.477   208.928 1.00 27.22  ? 196 PHE A CD1 1 
ATOM   2668 C  CD2 . PHE C 3 167 ? 131.848 4.961   209.759 1.00 33.82  ? 196 PHE A CD2 1 
ATOM   2669 C  CE1 . PHE C 3 167 ? 132.753 6.642   207.769 1.00 28.61  ? 196 PHE A CE1 1 
ATOM   2670 C  CE2 . PHE C 3 167 ? 131.108 5.122   208.603 1.00 40.17  ? 196 PHE A CE2 1 
ATOM   2671 C  CZ  . PHE C 3 167 ? 131.561 5.964   207.607 1.00 32.93  ? 196 PHE A CZ  1 
ATOM   2672 N  N   . GLN C 3 168 ? 136.269 5.018   212.992 1.00 42.25  ? 197 GLN A N   1 
ATOM   2673 C  CA  . GLN C 3 168 ? 136.918 4.853   214.285 1.00 48.77  ? 197 GLN A CA  1 
ATOM   2674 C  C   . GLN C 3 168 ? 136.196 5.573   215.416 1.00 41.55  ? 197 GLN A C   1 
ATOM   2675 O  O   . GLN C 3 168 ? 136.587 5.414   216.577 1.00 52.37  ? 197 GLN A O   1 
ATOM   2676 C  CB  . GLN C 3 168 ? 138.368 5.348   214.217 1.00 37.75  ? 197 GLN A CB  1 
ATOM   2677 C  CG  . GLN C 3 168 ? 139.239 4.600   213.219 1.00 40.69  ? 197 GLN A CG  1 
ATOM   2678 C  CD  . GLN C 3 168 ? 140.710 4.931   213.371 1.00 36.28  ? 197 GLN A CD  1 
ATOM   2679 O  OE1 . GLN C 3 168 ? 141.195 5.160   214.479 1.00 40.15  ? 197 GLN A OE1 1 
ATOM   2680 N  NE2 . GLN C 3 168 ? 141.430 4.959   212.254 1.00 42.89  ? 197 GLN A NE2 1 
ATOM   2681 N  N   . VAL C 3 169 ? 135.164 6.353   215.113 1.00 44.47  ? 198 VAL A N   1 
ATOM   2682 C  CA  . VAL C 3 169 ? 134.422 7.068   216.142 1.00 41.43  ? 198 VAL A CA  1 
ATOM   2683 C  C   . VAL C 3 169 ? 132.960 6.633   216.124 1.00 50.24  ? 198 VAL A C   1 
ATOM   2684 O  O   . VAL C 3 169 ? 132.453 6.154   215.109 1.00 42.30  ? 198 VAL A O   1 
ATOM   2685 C  CB  . VAL C 3 169 ? 134.551 8.595   215.964 1.00 34.66  ? 198 VAL A CB  1 
ATOM   2686 C  CG1 . VAL C 3 169 ? 133.722 9.071   214.780 1.00 27.76  ? 198 VAL A CG1 1 
ATOM   2687 C  CG2 . VAL C 3 169 ? 134.145 9.319   217.240 1.00 39.34  ? 198 VAL A CG2 1 
ATOM   2688 O  OXT . VAL C 3 169 ? 132.252 6.739   217.126 1.00 54.19  ? 198 VAL A OXT 1 
ATOM   2689 N  N   . SER D 4 2   ? 121.933 30.948  215.871 1.00 66.67  ? -3  SER D N   1 
ATOM   2690 C  CA  . SER D 4 2   ? 121.636 32.204  216.549 1.00 66.15  ? -3  SER D CA  1 
ATOM   2691 C  C   . SER D 4 2   ? 122.715 32.550  217.570 1.00 79.39  ? -3  SER D C   1 
ATOM   2692 O  O   . SER D 4 2   ? 123.897 32.638  217.234 1.00 65.27  ? -3  SER D O   1 
ATOM   2693 C  CB  . SER D 4 2   ? 120.271 32.133  217.234 1.00 70.03  ? -3  SER D CB  1 
ATOM   2694 O  OG  . SER D 4 2   ? 120.326 31.318  218.392 1.00 64.78  ? -3  SER D OG  1 
ATOM   2695 N  N   . PHE D 4 3   ? 122.298 32.740  218.823 1.00 75.40  ? -2  PHE D N   1 
ATOM   2696 C  CA  . PHE D 4 3   ? 123.230 33.153  219.867 1.00 69.53  ? -2  PHE D CA  1 
ATOM   2697 C  C   . PHE D 4 3   ? 124.139 32.016  220.316 1.00 60.27  ? -2  PHE D C   1 
ATOM   2698 O  O   . PHE D 4 3   ? 125.301 32.261  220.661 1.00 58.47  ? -2  PHE D O   1 
ATOM   2699 C  CB  . PHE D 4 3   ? 122.460 33.709  221.067 1.00 60.44  ? -2  PHE D CB  1 
ATOM   2700 C  CG  . PHE D 4 3   ? 121.577 34.877  220.732 1.00 69.82  ? -2  PHE D CG  1 
ATOM   2701 C  CD1 . PHE D 4 3   ? 121.943 35.780  219.746 1.00 56.90  ? -2  PHE D CD1 1 
ATOM   2702 C  CD2 . PHE D 4 3   ? 120.381 35.072  221.402 1.00 73.64  ? -2  PHE D CD2 1 
ATOM   2703 C  CE1 . PHE D 4 3   ? 121.131 36.855  219.434 1.00 58.21  ? -2  PHE D CE1 1 
ATOM   2704 C  CE2 . PHE D 4 3   ? 119.564 36.145  221.095 1.00 65.82  ? -2  PHE D CE2 1 
ATOM   2705 C  CZ  . PHE D 4 3   ? 119.941 37.038  220.110 1.00 58.79  ? -2  PHE D CZ  1 
ATOM   2706 N  N   . GLU D 4 4   ? 123.642 30.783  220.320 1.00 48.73  ? -1  GLU D N   1 
ATOM   2707 C  CA  . GLU D 4 4   ? 124.430 29.645  220.783 1.00 47.42  ? -1  GLU D CA  1 
ATOM   2708 C  C   . GLU D 4 4   ? 125.042 28.868  219.623 1.00 44.20  ? -1  GLU D C   1 
ATOM   2709 O  O   . GLU D 4 4   ? 125.496 27.736  219.796 1.00 42.65  ? -1  GLU D O   1 
ATOM   2710 C  CB  . GLU D 4 4   ? 123.567 28.711  221.635 1.00 46.32  ? -1  GLU D CB  1 
HETATM 2711 N  N   . PTR D 4 5   ? 125.056 29.475  218.443 1.00 45.41  ? 0   PTR D N   1 
HETATM 2712 C  CA  . PTR D 4 5   ? 125.611 28.812  217.270 1.00 37.51  ? 0   PTR D CA  1 
HETATM 2713 C  C   . PTR D 4 5   ? 126.926 29.428  216.815 1.00 39.46  ? 0   PTR D C   1 
HETATM 2714 O  O   . PTR D 4 5   ? 127.191 30.612  217.020 1.00 49.02  ? 0   PTR D O   1 
HETATM 2715 C  CB  . PTR D 4 5   ? 124.597 28.827  216.128 1.00 38.03  ? 0   PTR D CB  1 
HETATM 2716 C  CG  . PTR D 4 5   ? 123.658 27.648  216.176 1.00 35.52  ? 0   PTR D CG  1 
HETATM 2717 C  CD1 . PTR D 4 5   ? 122.566 27.641  217.032 1.00 35.29  ? 0   PTR D CD1 1 
HETATM 2718 C  CD2 . PTR D 4 5   ? 123.875 26.532  215.380 1.00 28.42  ? 0   PTR D CD2 1 
HETATM 2719 C  CE1 . PTR D 4 5   ? 121.709 26.559  217.087 1.00 36.66  ? 0   PTR D CE1 1 
HETATM 2720 C  CE2 . PTR D 4 5   ? 123.023 25.445  215.428 1.00 32.72  ? 0   PTR D CE2 1 
HETATM 2721 C  CZ  . PTR D 4 5   ? 121.941 25.465  216.282 1.00 43.06  ? 0   PTR D CZ  1 
HETATM 2722 O  OH  . PTR D 4 5   ? 121.138 24.444  216.330 1.00 36.20  ? 0   PTR D OH  1 
HETATM 2723 P  P   . PTR D 4 5   ? 119.822 24.396  215.403 1.00 44.08  ? 0   PTR D P   1 
HETATM 2724 O  O1P . PTR D 4 5   ? 120.224 23.984  214.041 1.00 24.80  ? 0   PTR D O1P 1 
HETATM 2725 O  O2P . PTR D 4 5   ? 118.825 23.370  215.973 1.00 43.90  ? 0   PTR D O2P 1 
HETATM 2726 O  O3P . PTR D 4 5   ? 119.163 25.788  215.351 1.00 35.71  ? 0   PTR D O3P 1 
ATOM   2727 N  N   . THR D 4 6   ? 127.749 28.593  216.192 1.00 39.68  ? 1   THR D N   1 
ATOM   2728 C  CA  . THR D 4 6   ? 129.065 28.998  215.729 1.00 33.66  ? 1   THR D CA  1 
ATOM   2729 C  C   . THR D 4 6   ? 129.178 28.802  214.221 1.00 34.25  ? 1   THR D C   1 
ATOM   2730 O  O   . THR D 4 6   ? 128.562 27.902  213.651 1.00 48.49  ? 1   THR D O   1 
ATOM   2731 C  CB  . THR D 4 6   ? 130.181 28.198  216.444 1.00 47.50  ? 1   THR D CB  1 
ATOM   2732 O  OG1 . THR D 4 6   ? 130.002 28.288  217.862 1.00 77.82  ? 1   THR D OG1 1 
ATOM   2733 C  CG2 . THR D 4 6   ? 131.562 28.730  216.085 1.00 37.49  ? 1   THR D CG2 1 
ATOM   2734 N  N   . ILE D 4 7   ? 129.952 29.674  213.580 1.00 61.60  ? 2   ILE D N   1 
ATOM   2735 C  CA  . ILE D 4 7   ? 130.359 29.505  212.194 1.00 50.81  ? 2   ILE D CA  1 
ATOM   2736 C  C   . ILE D 4 7   ? 131.881 29.482  212.160 1.00 57.49  ? 2   ILE D C   1 
ATOM   2737 O  O   . ILE D 4 7   ? 132.552 29.974  213.070 1.00 77.29  ? 2   ILE D O   1 
ATOM   2738 C  CB  . ILE D 4 7   ? 129.796 30.613  211.278 1.00 55.68  ? 2   ILE D CB  1 
ATOM   2739 C  CG1 . ILE D 4 7   ? 129.739 30.136  209.825 1.00 48.81  ? 2   ILE D CG1 1 
ATOM   2740 C  CG2 . ILE D 4 7   ? 130.620 31.884  211.404 1.00 61.07  ? 2   ILE D CG2 1 
ATOM   2741 C  CD1 . ILE D 4 7   ? 128.989 31.073  208.909 1.00 49.87  ? 2   ILE D CD1 1 
ATOM   2742 N  N   . LEU D 4 8   ? 132.428 28.885  211.109 1.00 58.42  ? 3   LEU D N   1 
ATOM   2743 C  CA  . LEU D 4 8   ? 133.876 28.803  210.980 1.00 67.38  ? 3   LEU D CA  1 
ATOM   2744 C  C   . LEU D 4 8   ? 134.391 30.012  210.210 1.00 66.54  ? 3   LEU D C   1 
ATOM   2745 O  O   . LEU D 4 8   ? 133.915 30.319  209.114 1.00 72.50  ? 3   LEU D O   1 
ATOM   2746 C  CB  . LEU D 4 8   ? 134.291 27.499  210.291 1.00 53.79  ? 3   LEU D CB  1 
ATOM   2747 C  CG  . LEU D 4 8   ? 134.606 26.357  211.267 1.00 74.26  ? 3   LEU D CG  1 
ATOM   2748 C  CD1 . LEU D 4 8   ? 133.466 26.152  212.246 1.00 41.80  ? 3   LEU D CD1 1 
ATOM   2749 C  CD2 . LEU D 4 8   ? 134.931 25.053  210.545 1.00 77.55  ? 3   LEU D CD2 1 
ATOM   2750 N  N   . ASP D 4 9   ? 135.362 30.697  210.796 1.00 92.23  ? 4   ASP D N   1 
ATOM   2751 C  CA  . ASP D 4 9   ? 135.858 31.971  210.309 1.00 111.00 ? 4   ASP D CA  1 
ATOM   2752 C  C   . ASP D 4 9   ? 137.359 32.044  210.544 1.00 132.92 ? 4   ASP D C   1 
ATOM   2753 O  O   . ASP D 4 9   ? 137.866 31.467  211.513 1.00 137.27 ? 4   ASP D O   1 
ATOM   2754 C  CB  . ASP D 4 9   ? 135.160 33.144  211.020 1.00 68.38  ? 4   ASP D CB  1 
ATOM   2755 C  CG  . ASP D 4 9   ? 135.312 34.457  210.275 1.00 68.38  ? 4   ASP D CG  1 
ATOM   2756 O  OD1 . ASP D 4 9   ? 136.378 35.094  210.404 1.00 68.38  ? 4   ASP D OD1 1 
ATOM   2757 O  OD2 . ASP D 4 9   ? 134.360 34.861  209.576 1.00 68.38  ? 4   ASP D OD2 1 
ATOM   2758 N  N   . PRO D 4 10  ? 138.103 32.722  209.658 1.00 107.09 ? 5   PRO D N   1 
ATOM   2759 C  CA  . PRO D 4 10  ? 139.524 33.012  209.855 1.00 112.08 ? 5   PRO D CA  1 
ATOM   2760 C  C   . PRO D 4 10  ? 139.741 34.288  210.662 1.00 93.57  ? 5   PRO D C   1 
ATOM   2761 O  O   . PRO D 4 10  ? 140.108 34.201  211.833 1.00 78.80  ? 5   PRO D O   1 
ATOM   2762 C  CB  . PRO D 4 10  ? 140.035 33.179  208.426 1.00 102.30 ? 5   PRO D CB  1 
ATOM   2763 C  CG  . PRO D 4 10  ? 138.874 33.756  207.708 1.00 95.24  ? 5   PRO D CG  1 
ATOM   2764 C  CD  . PRO D 4 10  ? 137.685 33.037  208.284 1.00 89.31  ? 5   PRO D CD  1 
HETATM 2765 C  C1  . PEG E 5 .   ? 125.076 13.048  230.246 1.00 52.42  ? 201 PEG A C1  1 
HETATM 2766 O  O1  . PEG E 5 .   ? 123.995 13.724  230.855 1.00 52.42  ? 201 PEG A O1  1 
HETATM 2767 C  C2  . PEG E 5 .   ? 124.677 12.331  228.993 1.00 52.42  ? 201 PEG A C2  1 
HETATM 2768 O  O2  . PEG E 5 .   ? 123.642 11.392  229.268 1.00 52.42  ? 201 PEG A O2  1 
HETATM 2769 C  C3  . PEG E 5 .   ? 123.386 10.523  228.170 1.00 52.42  ? 201 PEG A C3  1 
HETATM 2770 C  C4  . PEG E 5 .   ? 122.201 9.655   228.459 1.00 52.42  ? 201 PEG A C4  1 
HETATM 2771 O  O4  . PEG E 5 .   ? 120.999 10.398  228.546 1.00 52.42  ? 201 PEG A O4  1 
HETATM 2772 O  O   . HOH F 6 .   ? 127.388 -4.959  251.164 1.00 38.74  ? 201 HOH B O   1 
HETATM 2773 O  O   . HOH G 6 .   ? 140.131 -5.470  227.897 1.00 36.25  ? 201 HOH C O   1 
HETATM 2774 O  O   . HOH H 6 .   ? 115.806 20.850  209.354 1.00 39.68  ? 301 HOH A O   1 
HETATM 2775 O  O   . HOH H 6 .   ? 140.654 19.657  207.185 1.00 25.73  ? 302 HOH A O   1 
HETATM 2776 O  O   . HOH H 6 .   ? 127.335 9.288   207.185 1.00 22.44  ? 303 HOH A O   1 
HETATM 2777 O  O   . HOH H 6 .   ? 114.550 12.610  215.217 1.00 34.11  ? 304 HOH A O   1 
HETATM 2778 O  O   . HOH H 6 .   ? 133.171 10.946  200.037 1.00 20.65  ? 305 HOH A O   1 
HETATM 2779 O  O   . HOH H 6 .   ? 114.105 12.050  217.994 1.00 19.40  ? 306 HOH A O   1 
HETATM 2780 O  O   . HOH H 6 .   ? 132.492 9.587   202.277 1.00 27.40  ? 307 HOH A O   1 
HETATM 2781 O  O   . HOH H 6 .   ? 139.076 -5.604  203.320 0.50 12.18  ? 308 HOH A O   1 
HETATM 2782 O  O   . HOH I 6 .   ? 126.187 26.825  212.202 1.00 28.59  ? 101 HOH D O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   1   MET MET B . n 
A 1 2   ASP 2   2   2   ASP ASP B . n 
A 1 3   VAL 3   3   3   VAL VAL B . n 
A 1 4   PHE 4   4   4   PHE PHE B . n 
A 1 5   LEU 5   5   5   LEU LEU B . n 
A 1 6   MET 6   6   6   MET MET B . n 
A 1 7   ILE 7   7   7   ILE ILE B . n 
A 1 8   ARG 8   8   8   ARG ARG B . n 
A 1 9   ARG 9   9   9   ARG ARG B . n 
A 1 10  HIS 10  10  10  HIS HIS B . n 
A 1 11  LYS 11  11  11  LYS LYS B . n 
A 1 12  THR 12  12  12  THR THR B . n 
A 1 13  THR 13  13  13  THR THR B . n 
A 1 14  ILE 14  14  14  ILE ILE B . n 
A 1 15  PHE 15  15  15  PHE PHE B . n 
A 1 16  THR 16  16  16  THR THR B . n 
A 1 17  ASP 17  17  17  ASP ASP B . n 
A 1 18  ALA 18  18  18  ALA ALA B . n 
A 1 19  LYS 19  19  19  LYS LYS B . n 
A 1 20  GLU 20  20  20  GLU GLU B . n 
A 1 21  SER 21  21  21  SER SER B . n 
A 1 22  SER 22  22  22  SER SER B . n 
A 1 23  THR 23  23  23  THR THR B . n 
A 1 24  VAL 24  24  24  VAL VAL B . n 
A 1 25  PHE 25  25  25  PHE PHE B . n 
A 1 26  GLU 26  26  26  GLU GLU B . n 
A 1 27  LEU 27  27  27  LEU LEU B . n 
A 1 28  LYS 28  28  28  LYS LYS B . n 
A 1 29  ARG 29  29  29  ARG ARG B . n 
A 1 30  ILE 30  30  30  ILE ILE B . n 
A 1 31  VAL 31  31  31  VAL VAL B . n 
A 1 32  GLU 32  32  32  GLU GLU B . n 
A 1 33  GLY 33  33  33  GLY GLY B . n 
A 1 34  ILE 34  34  34  ILE ILE B . n 
A 1 35  LEU 35  35  35  LEU LEU B . n 
A 1 36  LYS 36  36  36  LYS LYS B . n 
A 1 37  ARG 37  37  37  ARG ARG B . n 
A 1 38  PRO 38  38  38  PRO PRO B . n 
A 1 39  PRO 39  39  39  PRO PRO B . n 
A 1 40  ASP 40  40  40  ASP ASP B . n 
A 1 41  GLU 41  41  41  GLU GLU B . n 
A 1 42  GLN 42  42  42  GLN GLN B . n 
A 1 43  ARG 43  43  43  ARG ARG B . n 
A 1 44  LEU 44  44  44  LEU LEU B . n 
A 1 45  TYR 45  45  45  TYR TYR B . n 
A 1 46  LYS 46  46  46  LYS LYS B . n 
A 1 47  ASP 47  47  47  ASP ASP B . n 
A 1 48  ASP 48  48  48  ASP ASP B . n 
A 1 49  GLN 49  49  49  GLN GLN B . n 
A 1 50  LEU 50  50  50  LEU LEU B . n 
A 1 51  LEU 51  51  51  LEU LEU B . n 
A 1 52  ASP 52  52  52  ASP ASP B . n 
A 1 53  ASP 53  53  53  ASP ASP B . n 
A 1 54  GLY 54  54  54  GLY GLY B . n 
A 1 55  LYS 55  55  55  LYS LYS B . n 
A 1 56  THR 56  56  56  THR THR B . n 
A 1 57  LEU 57  57  57  LEU LEU B . n 
A 1 58  GLY 58  58  58  GLY GLY B . n 
A 1 59  GLU 59  59  59  GLU GLU B . n 
A 1 60  CYS 60  60  60  CYS CYS B . n 
A 1 61  GLY 61  61  61  GLY GLY B . n 
A 1 62  PHE 62  62  62  PHE PHE B . n 
A 1 63  THR 63  63  63  THR THR B . n 
A 1 64  SER 64  64  64  SER SER B . n 
A 1 65  GLN 65  65  65  GLN GLN B . n 
A 1 66  THR 66  66  66  THR THR B . n 
A 1 67  ALA 67  67  67  ALA ALA B . n 
A 1 68  ARG 68  68  68  ARG ARG B . n 
A 1 69  PRO 69  69  69  PRO PRO B . n 
A 1 70  GLN 70  70  70  GLN GLN B . n 
A 1 71  ALA 71  71  71  ALA ALA B . n 
A 1 72  PRO 72  72  72  PRO PRO B . n 
A 1 73  ALA 73  73  73  ALA ALA B . n 
A 1 74  THR 74  74  74  THR THR B . n 
A 1 75  VAL 75  75  75  VAL VAL B . n 
A 1 76  GLY 76  76  76  GLY GLY B . n 
A 1 77  LEU 77  77  77  LEU LEU B . n 
A 1 78  ALA 78  78  78  ALA ALA B . n 
A 1 79  PHE 79  79  79  PHE PHE B . n 
A 1 80  ARG 80  80  80  ARG ARG B . n 
A 1 81  ALA 81  81  81  ALA ALA B . n 
A 1 82  ASP 82  82  82  ASP ASP B . n 
A 1 83  ASP 83  83  83  ASP ASP B . n 
A 1 84  THR 84  84  84  THR THR B . n 
A 1 85  PHE 85  85  85  PHE PHE B . n 
A 1 86  GLU 86  86  86  GLU GLU B . n 
A 1 87  ALA 87  87  87  ALA ALA B . n 
A 1 88  LEU 88  88  88  LEU LEU B . n 
A 1 89  CAS 89  89  89  CAS CAS B . n 
A 1 90  ILE 90  90  90  ILE ILE B . n 
A 1 91  GLU 91  91  91  GLU GLU B . n 
A 1 92  PRO 92  92  92  PRO PRO B . n 
A 1 93  PHE 93  93  93  PHE PHE B . n 
A 1 94  SER 94  94  94  SER SER B . n 
A 1 95  SER 95  95  95  SER SER B . n 
A 1 96  PRO 96  96  96  PRO PRO B . n 
A 1 97  PRO 97  97  97  PRO PRO B . n 
A 1 98  GLU 98  98  98  GLU GLU B . n 
A 1 99  LEU 99  99  99  LEU LEU B . n 
A 1 100 PRO 100 100 100 PRO PRO B . n 
A 1 101 ASP 101 101 101 ASP ASP B . n 
A 1 102 VAL 102 102 102 VAL VAL B . n 
A 1 103 MET 103 103 103 MET MET B . n 
A 1 104 LYS 104 104 ?   ?   ?   B . n 
B 2 1   MET 1   16  ?   ?   ?   C . n 
B 2 2   MET 2   17  17  MET MET C . n 
B 2 3   TYR 3   18  18  TYR TYR C . n 
B 2 4   VAL 4   19  19  VAL VAL C . n 
B 2 5   LYS 5   20  20  LYS LYS C . n 
B 2 6   LEU 6   21  21  LEU LEU C . n 
B 2 7   ILE 7   22  22  ILE ILE C . n 
B 2 8   SER 8   23  23  SER SER C . n 
B 2 9   SER 9   24  24  SER SER C . n 
B 2 10  ASP 10  25  25  ASP ASP C . n 
B 2 11  GLY 11  26  26  GLY GLY C . n 
B 2 12  HIS 12  27  27  HIS HIS C . n 
B 2 13  GLU 13  28  28  GLU GLU C . n 
B 2 14  PHE 14  29  29  PHE PHE C . n 
B 2 15  ILE 15  30  30  ILE ILE C . n 
B 2 16  VAL 16  31  31  VAL VAL C . n 
B 2 17  LYS 17  32  32  LYS LYS C . n 
B 2 18  ARG 18  33  33  ARG ARG C . n 
B 2 19  GLU 19  34  34  GLU GLU C . n 
B 2 20  HIS 20  35  35  HIS HIS C . n 
B 2 21  ALA 21  36  36  ALA ALA C . n 
B 2 22  LEU 22  37  37  LEU LEU C . n 
B 2 23  THR 23  38  38  THR THR C . n 
B 2 24  SER 24  39  39  SER SER C . n 
B 2 25  GLY 25  40  40  GLY GLY C . n 
B 2 26  THR 26  41  41  THR THR C . n 
B 2 27  ILE 27  42  42  ILE ILE C . n 
B 2 28  LYS 28  43  43  LYS LYS C . n 
B 2 29  ALA 29  44  44  ALA ALA C . n 
B 2 30  MET 30  45  45  MET MET C . n 
B 2 31  LEU 31  46  46  LEU LEU C . n 
B 2 32  SER 32  47  ?   ?   ?   C . n 
B 2 33  GLY 33  48  ?   ?   ?   C . n 
B 2 34  PRO 34  49  ?   ?   ?   C . n 
B 2 35  GLY 35  50  ?   ?   ?   C . n 
B 2 36  GLN 36  51  ?   ?   ?   C . n 
B 2 37  PHE 37  52  ?   ?   ?   C . n 
B 2 38  ALA 38  53  ?   ?   ?   C . n 
B 2 39  GLU 39  54  ?   ?   ?   C . n 
B 2 40  ASN 40  55  ?   ?   ?   C . n 
B 2 41  GLU 41  56  ?   ?   ?   C . n 
B 2 42  THR 42  57  57  THR THR C . n 
B 2 43  ASN 43  58  58  ASN ASN C . n 
B 2 44  GLU 44  59  59  GLU GLU C . n 
B 2 45  VAL 45  60  60  VAL VAL C . n 
B 2 46  ASN 46  61  61  ASN ASN C . n 
B 2 47  PHE 47  62  62  PHE PHE C . n 
B 2 48  ARG 48  63  63  ARG ARG C . n 
B 2 49  GLU 49  64  64  GLU GLU C . n 
B 2 50  ILE 50  65  65  ILE ILE C . n 
B 2 51  PRO 51  66  66  PRO PRO C . n 
B 2 52  SER 52  67  67  SER SER C . n 
B 2 53  HIS 53  68  68  HIS HIS C . n 
B 2 54  VAL 54  69  69  VAL VAL C . n 
B 2 55  LEU 55  70  70  LEU LEU C . n 
B 2 56  SER 56  71  71  SER SER C . n 
B 2 57  LYS 57  72  72  LYS LYS C . n 
B 2 58  VAL 58  73  73  VAL VAL C . n 
B 2 59  CYS 59  74  74  CYS CYS C . n 
B 2 60  MET 60  75  75  MET MET C . n 
B 2 61  TYR 61  76  76  TYR TYR C . n 
B 2 62  PHE 62  77  77  PHE PHE C . n 
B 2 63  THR 63  78  78  THR THR C . n 
B 2 64  TYR 64  79  79  TYR TYR C . n 
B 2 65  LYS 65  80  80  LYS LYS C . n 
B 2 66  VAL 66  81  81  VAL VAL C . n 
B 2 67  ARG 67  82  82  ARG ARG C . n 
B 2 68  TYR 68  83  83  TYR TYR C . n 
B 2 69  THR 69  84  84  THR THR C . n 
B 2 70  ASN 70  85  85  ASN ASN C . n 
B 2 71  SER 71  86  86  SER SER C . n 
B 2 72  SER 72  87  87  SER SER C . n 
B 2 73  THR 73  88  88  THR THR C . n 
B 2 74  GLU 74  89  89  GLU GLU C . n 
B 2 75  ILE 75  90  90  ILE ILE C . n 
B 2 76  PRO 76  91  91  PRO PRO C . n 
B 2 77  GLU 77  92  92  GLU GLU C . n 
B 2 78  PHE 78  93  93  PHE PHE C . n 
B 2 79  PRO 79  94  94  PRO PRO C . n 
B 2 80  ILE 80  95  95  ILE ILE C . n 
B 2 81  ALA 81  96  96  ALA ALA C . n 
B 2 82  PRO 82  97  97  PRO PRO C . n 
B 2 83  GLU 83  98  98  GLU GLU C . n 
B 2 84  ILE 84  99  99  ILE ILE C . n 
B 2 85  ALA 85  100 100 ALA ALA C . n 
B 2 86  LEU 86  101 101 LEU LEU C . n 
B 2 87  GLU 87  102 102 GLU GLU C . n 
B 2 88  LEU 88  103 103 LEU LEU C . n 
B 2 89  LEU 89  104 104 LEU LEU C . n 
B 2 90  MET 90  105 105 MET MET C . n 
B 2 91  ALA 91  106 106 ALA ALA C . n 
B 2 92  ALA 92  107 107 ALA ALA C . n 
B 2 93  ASN 93  108 108 ASN ASN C . n 
B 2 94  PHE 94  109 109 PHE PHE C . n 
B 2 95  LEU 95  110 110 LEU LEU C . n 
B 2 96  ASP 96  111 111 ASP ASP C . n 
B 2 97  CYS 97  112 112 CYS CYS C . n 
C 3 1   SER 1   30  30  SER SER A . n 
C 3 2   MET 2   31  31  MET MET A . n 
C 3 3   GLN 3   32  32  GLN GLN A . n 
C 3 4   ALA 4   33  33  ALA ALA A . n 
C 3 5   ALA 5   34  34  ALA ALA A . n 
C 3 6   ARG 6   35  35  ARG ARG A . n 
C 3 7   LEU 7   36  36  LEU LEU A . n 
C 3 8   ALA 8   37  37  ALA ALA A . n 
C 3 9   LYS 9   38  38  LYS LYS A . n 
C 3 10  ALA 10  39  39  ALA ALA A . n 
C 3 11  LEU 11  40  40  LEU LEU A . n 
C 3 12  ARG 12  41  41  ARG ARG A . n 
C 3 13  GLU 13  42  42  GLU GLU A . n 
C 3 14  LEU 14  43  43  LEU LEU A . n 
C 3 15  GLY 15  44  44  GLY GLY A . n 
C 3 16  GLN 16  45  45  GLN GLN A . n 
C 3 17  THR 17  46  46  THR THR A . n 
C 3 18  GLY 18  47  47  GLY GLY A . n 
C 3 19  TRP 19  48  48  TRP TRP A . n 
C 3 20  TYR 20  49  49  TYR TYR A . n 
C 3 21  TRP 21  50  50  TRP TRP A . n 
C 3 22  GLY 22  51  51  GLY GLY A . n 
C 3 23  SER 23  52  52  SER SER A . n 
C 3 24  MET 24  53  53  MET MET A . n 
C 3 25  THR 25  54  54  THR THR A . n 
C 3 26  VAL 26  55  55  VAL VAL A . n 
C 3 27  ASN 27  56  56  ASN ASN A . n 
C 3 28  GLU 28  57  57  GLU GLU A . n 
C 3 29  ALA 29  58  58  ALA ALA A . n 
C 3 30  LYS 30  59  59  LYS LYS A . n 
C 3 31  GLU 31  60  60  GLU GLU A . n 
C 3 32  LYS 32  61  61  LYS LYS A . n 
C 3 33  LEU 33  62  62  LEU LEU A . n 
C 3 34  LYS 34  63  63  LYS LYS A . n 
C 3 35  GLU 35  64  64  GLU GLU A . n 
C 3 36  ALA 36  65  65  ALA ALA A . n 
C 3 37  PRO 37  66  66  PRO PRO A . n 
C 3 38  GLU 38  67  67  GLU GLU A . n 
C 3 39  GLY 39  68  68  GLY GLY A . n 
C 3 40  THR 40  69  69  THR THR A . n 
C 3 41  PHE 41  70  70  PHE PHE A . n 
C 3 42  LEU 42  71  71  LEU LEU A . n 
C 3 43  ILE 43  72  72  ILE ILE A . n 
C 3 44  ARG 44  73  73  ARG ARG A . n 
C 3 45  ASP 45  74  74  ASP ASP A . n 
C 3 46  SER 46  75  75  SER SER A . n 
C 3 47  SER 47  76  76  SER SER A . n 
C 3 48  HIS 48  77  77  HIS HIS A . n 
C 3 49  SER 49  78  78  SER SER A . n 
C 3 50  ASP 50  79  79  ASP ASP A . n 
C 3 51  TYR 51  80  80  TYR TYR A . n 
C 3 52  LEU 52  81  81  LEU LEU A . n 
C 3 53  LEU 53  82  82  LEU LEU A . n 
C 3 54  THR 54  83  83  THR THR A . n 
C 3 55  ILE 55  84  84  ILE ILE A . n 
C 3 56  SER 56  85  85  SER SER A . n 
C 3 57  VAL 57  86  86  VAL VAL A . n 
C 3 58  LYS 58  87  87  LYS LYS A . n 
C 3 59  THR 59  88  88  THR THR A . n 
C 3 60  SER 60  89  89  SER SER A . n 
C 3 61  ALA 61  90  90  ALA ALA A . n 
C 3 62  GLY 62  91  91  GLY GLY A . n 
C 3 63  PRO 63  92  92  PRO PRO A . n 
C 3 64  THR 64  93  93  THR THR A . n 
C 3 65  ASN 65  94  94  ASN ASN A . n 
C 3 66  LEU 66  95  95  LEU LEU A . n 
C 3 67  ARG 67  96  96  ARG ARG A . n 
C 3 68  ILE 68  97  97  ILE ILE A . n 
C 3 69  GLU 69  98  98  GLU GLU A . n 
C 3 70  TYR 70  99  99  TYR TYR A . n 
C 3 71  GLN 71  100 100 GLN GLN A . n 
C 3 72  ASP 72  101 101 ASP ASP A . n 
C 3 73  GLY 73  102 102 GLY GLY A . n 
C 3 74  LYS 74  103 103 LYS LYS A . n 
C 3 75  PHE 75  104 104 PHE PHE A . n 
C 3 76  ARG 76  105 105 ARG ARG A . n 
C 3 77  LEU 77  106 106 LEU LEU A . n 
C 3 78  ASP 78  107 107 ASP ASP A . n 
C 3 79  SER 79  108 108 SER SER A . n 
C 3 80  ILE 80  109 109 ILE ILE A . n 
C 3 81  ILE 81  110 110 ILE ILE A . n 
C 3 82  CYS 82  111 111 CYS CYS A . n 
C 3 83  VAL 83  112 112 VAL VAL A . n 
C 3 84  LYS 84  113 113 LYS LYS A . n 
C 3 85  SER 85  114 114 SER SER A . n 
C 3 86  ALA 86  115 115 ALA ALA A . n 
C 3 87  LEU 87  116 116 LEU LEU A . n 
C 3 88  ALA 88  117 117 ALA ALA A . n 
C 3 89  ALA 89  118 118 ALA ALA A . n 
C 3 90  PHE 90  119 119 PHE PHE A . n 
C 3 91  ASP 91  120 120 ASP ASP A . n 
C 3 92  SER 92  121 121 SER SER A . n 
C 3 93  VAL 93  122 122 VAL VAL A . n 
C 3 94  VAL 94  123 123 VAL VAL A . n 
C 3 95  HIS 95  124 124 HIS HIS A . n 
C 3 96  LEU 96  125 125 LEU LEU A . n 
C 3 97  ILE 97  126 126 ILE ILE A . n 
C 3 98  ASP 98  127 127 ASP ASP A . n 
C 3 99  TYR 99  128 128 TYR TYR A . n 
C 3 100 TYR 100 129 129 TYR TYR A . n 
C 3 101 VAL 101 130 130 VAL VAL A . n 
C 3 102 GLN 102 131 131 GLN GLN A . n 
C 3 103 MET 103 132 132 MET MET A . n 
C 3 104 CAS 104 133 133 CAS CAS A . n 
C 3 105 LYS 105 134 134 LYS LYS A . n 
C 3 106 ASP 106 135 135 ASP ASP A . n 
C 3 107 LYS 107 136 136 LYS LYS A . n 
C 3 108 ARG 108 137 ?   ?   ?   A . n 
C 3 109 THR 109 138 ?   ?   ?   A . n 
C 3 110 GLY 110 139 ?   ?   ?   A . n 
C 3 111 PRO 111 140 ?   ?   ?   A . n 
C 3 112 GLU 112 141 ?   ?   ?   A . n 
C 3 113 ALA 113 142 ?   ?   ?   A . n 
C 3 114 PRO 114 143 ?   ?   ?   A . n 
C 3 115 ARG 115 144 ?   ?   ?   A . n 
C 3 116 ASN 116 145 ?   ?   ?   A . n 
C 3 117 GLY 117 146 ?   ?   ?   A . n 
C 3 118 THR 118 147 ?   ?   ?   A . n 
C 3 119 VAL 119 148 148 VAL VAL A . n 
C 3 120 HIS 120 149 149 HIS HIS A . n 
C 3 121 LEU 121 150 150 LEU LEU A . n 
C 3 122 TYR 122 151 151 TYR TYR A . n 
C 3 123 LEU 123 152 152 LEU LEU A . n 
C 3 124 THR 124 153 153 THR THR A . n 
C 3 125 LYS 125 154 154 LYS LYS A . n 
C 3 126 PRO 126 155 155 PRO PRO A . n 
C 3 127 LEU 127 156 156 LEU LEU A . n 
C 3 128 TYR 128 157 157 TYR TYR A . n 
C 3 129 THR 129 158 158 THR THR A . n 
C 3 130 SER 130 159 159 SER SER A . n 
C 3 131 ALA 131 160 160 ALA ALA A . n 
C 3 132 PRO 132 161 161 PRO PRO A . n 
C 3 133 SER 133 162 162 SER SER A . n 
C 3 134 LEU 134 163 163 LEU LEU A . n 
C 3 135 GLN 135 164 164 GLN GLN A . n 
C 3 136 HIS 136 165 165 HIS HIS A . n 
C 3 137 LEU 137 166 166 LEU LEU A . n 
C 3 138 CYS 138 167 167 CYS CYS A . n 
C 3 139 ARG 139 168 168 ARG ARG A . n 
C 3 140 LEU 140 169 169 LEU LEU A . n 
C 3 141 THR 141 170 170 THR THR A . n 
C 3 142 ILE 142 171 171 ILE ILE A . n 
C 3 143 ASN 143 172 172 ASN ASN A . n 
C 3 144 LYS 144 173 173 LYS LYS A . n 
C 3 145 CYS 145 174 174 CYS CYS A . n 
C 3 146 THR 146 175 175 THR THR A . n 
C 3 147 GLY 147 176 176 GLY GLY A . n 
C 3 148 ALA 148 177 177 ALA ALA A . n 
C 3 149 ILE 149 178 178 ILE ILE A . n 
C 3 150 TRP 150 179 179 TRP TRP A . n 
C 3 151 GLY 151 180 180 GLY GLY A . n 
C 3 152 LEU 152 181 181 LEU LEU A . n 
C 3 153 PRO 153 182 182 PRO PRO A . n 
C 3 154 LEU 154 183 183 LEU LEU A . n 
C 3 155 PRO 155 184 184 PRO PRO A . n 
C 3 156 THR 156 185 185 THR THR A . n 
C 3 157 ARG 157 186 186 ARG ARG A . n 
C 3 158 LEU 158 187 187 LEU LEU A . n 
C 3 159 LYS 159 188 188 LYS LYS A . n 
C 3 160 ASP 160 189 189 ASP ASP A . n 
C 3 161 TYR 161 190 190 TYR TYR A . n 
C 3 162 LEU 162 191 191 LEU LEU A . n 
C 3 163 GLU 163 192 192 GLU GLU A . n 
C 3 164 GLU 164 193 193 GLU GLU A . n 
C 3 165 TYR 165 194 194 TYR TYR A . n 
C 3 166 LYS 166 195 195 LYS LYS A . n 
C 3 167 PHE 167 196 196 PHE PHE A . n 
C 3 168 GLN 168 197 197 GLN GLN A . n 
C 3 169 VAL 169 198 198 VAL VAL A . n 
D 4 1   ALA 1   -4  ?   ?   ?   D . n 
D 4 2   SER 2   -3  -3  SER SER D . n 
D 4 3   PHE 3   -2  -2  PHE PHE D . n 
D 4 4   GLU 4   -1  -1  GLU GLU D . n 
D 4 5   PTR 5   0   0   PTR PTR D . n 
D 4 6   THR 6   1   1   THR THR D . n 
D 4 7   ILE 7   2   2   ILE ILE D . n 
D 4 8   LEU 8   3   3   LEU LEU D . n 
D 4 9   ASP 9   4   4   ASP ASP D . n 
D 4 10  PRO 10  5   5   PRO PRO D . n 
D 4 11  SER 11  6   ?   ?   ?   D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 5 PEG 1 201 1  PEG PEG A . 
F 6 HOH 1 201 17 HOH HOH B . 
G 6 HOH 1 201 16 HOH HOH C . 
H 6 HOH 1 301 5  HOH HOH A . 
H 6 HOH 2 302 14 HOH HOH A . 
H 6 HOH 3 303 9  HOH HOH A . 
H 6 HOH 4 304 15 HOH HOH A . 
H 6 HOH 5 305 2  HOH HOH A . 
H 6 HOH 6 306 4  HOH HOH A . 
H 6 HOH 7 307 8  HOH HOH A . 
H 6 HOH 8 308 3  HOH HOH A . 
I 6 HOH 1 101 7  HOH HOH D . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A CAS 89  B CAS 89  ? CYS 'modified residue' 
2 C CAS 104 A CAS 133 ? CYS 'modified residue' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 6130  ? 
1 MORE         -49   ? 
1 'SSA (A^2)'  16840 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     308 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   H 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2019-05-29 
2 'Structure model' 1 1 2019-06-12 
3 'Structure model' 1 2 2019-06-19 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Data collection'     
2 2 'Structure model' 'Structure summary'   
3 3 'Structure model' 'Data collection'     
4 3 'Structure model' 'Database references' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' audit_author       
2 2 'Structure model' struct             
3 3 'Structure model' citation           
4 3 'Structure model' citation_author    
5 3 'Structure model' pdbx_database_proc 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_audit_author.identifier_ORCID'    
2  2 'Structure model' '_audit_author.name'                
3  2 'Structure model' '_struct.title'                     
4  3 'Structure model' '_citation.journal_volume'          
5  3 'Structure model' '_citation.page_first'              
6  3 'Structure model' '_citation.page_last'               
7  3 'Structure model' '_citation.pdbx_database_id_PubMed' 
8  3 'Structure model' '_citation.title'                   
9  3 'Structure model' '_citation_author.identifier_ORCID' 
10 3 'Structure model' '_citation_author.name'             
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX   ? ? ? '(1.13_2998: ???)' 1 
? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot     ? ? ? .                  2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? AutoPROC ? ? ? .                  3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER   ? ? ? .                  4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 HIS B 10  ? ? 52.80   -117.62 
2  1 ASP B 47  ? ? 55.74   -110.43 
3  1 ALA B 71  ? ? -156.57 81.39   
4  1 ASP B 82  ? ? 58.98   -109.04 
5  1 LEU C 37  ? ? -69.84  0.29    
6  1 TYR C 83  ? ? -107.50 57.01   
7  1 ASP C 111 ? ? 56.71   74.73   
8  1 SER A 52  ? ? -83.88  46.12   
9  1 ILE A 110 ? ? -64.36  89.04   
10 1 CYS A 111 ? ? 71.77   -6.59   
11 1 ASP A 135 ? ? -60.10  -73.58  
12 1 THR A 153 ? ? -122.28 -88.96  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 B ARG 29  ? NE  ? A ARG 29  NE  
2  1 Y 1 B ARG 29  ? CZ  ? A ARG 29  CZ  
3  1 Y 1 B ARG 29  ? NH1 ? A ARG 29  NH1 
4  1 Y 1 B ARG 29  ? NH2 ? A ARG 29  NH2 
5  1 Y 1 B GLN 65  ? CG  ? A GLN 65  CG  
6  1 Y 1 B GLN 65  ? CD  ? A GLN 65  CD  
7  1 Y 1 B GLN 65  ? OE1 ? A GLN 65  OE1 
8  1 Y 1 B GLN 65  ? NE2 ? A GLN 65  NE2 
9  1 Y 1 B ASP 82  ? CG  ? A ASP 82  CG  
10 1 Y 1 B ASP 82  ? OD1 ? A ASP 82  OD1 
11 1 Y 1 B ASP 82  ? OD2 ? A ASP 82  OD2 
12 1 Y 1 B ASP 83  ? CG  ? A ASP 83  CG  
13 1 Y 1 B ASP 83  ? OD1 ? A ASP 83  OD1 
14 1 Y 1 B ASP 83  ? OD2 ? A ASP 83  OD2 
15 1 Y 1 B THR 84  ? OG1 ? A THR 84  OG1 
16 1 Y 1 B THR 84  ? CG2 ? A THR 84  CG2 
17 1 Y 1 B GLU 98  ? CG  ? A GLU 98  CG  
18 1 Y 1 B GLU 98  ? CD  ? A GLU 98  CD  
19 1 Y 1 B GLU 98  ? OE1 ? A GLU 98  OE1 
20 1 Y 1 B GLU 98  ? OE2 ? A GLU 98  OE2 
21 1 Y 1 B ASP 101 ? CG  ? A ASP 101 CG  
22 1 Y 1 B ASP 101 ? OD1 ? A ASP 101 OD1 
23 1 Y 1 B ASP 101 ? OD2 ? A ASP 101 OD2 
24 1 Y 1 C THR 57  ? OG1 ? B THR 42  OG1 
25 1 Y 1 C THR 57  ? CG2 ? B THR 42  CG2 
26 1 Y 1 C ASN 58  ? CG  ? B ASN 43  CG  
27 1 Y 1 C ASN 58  ? OD1 ? B ASN 43  OD1 
28 1 Y 1 C ASN 58  ? ND2 ? B ASN 43  ND2 
29 1 Y 1 C GLU 59  ? CG  ? B GLU 44  CG  
30 1 Y 1 C GLU 59  ? CD  ? B GLU 44  CD  
31 1 Y 1 C GLU 59  ? OE1 ? B GLU 44  OE1 
32 1 Y 1 C GLU 59  ? OE2 ? B GLU 44  OE2 
33 1 Y 1 C ARG 63  ? CG  ? B ARG 48  CG  
34 1 Y 1 C ARG 63  ? CD  ? B ARG 48  CD  
35 1 Y 1 C ARG 63  ? NE  ? B ARG 48  NE  
36 1 Y 1 C ARG 63  ? CZ  ? B ARG 48  CZ  
37 1 Y 1 C ARG 63  ? NH1 ? B ARG 48  NH1 
38 1 Y 1 C ARG 63  ? NH2 ? B ARG 48  NH2 
39 1 Y 1 C THR 84  ? OG1 ? B THR 69  OG1 
40 1 Y 1 C THR 84  ? CG2 ? B THR 69  CG2 
41 1 Y 1 C ASN 85  ? CG  ? B ASN 70  CG  
42 1 Y 1 C ASN 85  ? OD1 ? B ASN 70  OD1 
43 1 Y 1 C ASN 85  ? ND2 ? B ASN 70  ND2 
44 1 Y 1 C SER 86  ? OG  ? B SER 71  OG  
45 1 Y 1 C SER 87  ? OG  ? B SER 72  OG  
46 1 Y 1 A SER 30  ? OG  ? C SER 1   OG  
47 1 Y 1 A ARG 41  ? CG  ? C ARG 12  CG  
48 1 Y 1 A ARG 41  ? CD  ? C ARG 12  CD  
49 1 Y 1 A ARG 41  ? NE  ? C ARG 12  NE  
50 1 Y 1 A ARG 41  ? CZ  ? C ARG 12  CZ  
51 1 Y 1 A ARG 41  ? NH1 ? C ARG 12  NH1 
52 1 Y 1 A ARG 41  ? NH2 ? C ARG 12  NH2 
53 1 Y 1 A LYS 63  ? CG  ? C LYS 34  CG  
54 1 Y 1 A LYS 63  ? CD  ? C LYS 34  CD  
55 1 Y 1 A LYS 63  ? CE  ? C LYS 34  CE  
56 1 Y 1 A LYS 63  ? NZ  ? C LYS 34  NZ  
57 1 Y 1 A GLN 100 ? CG  ? C GLN 71  CG  
58 1 Y 1 A GLN 100 ? CD  ? C GLN 71  CD  
59 1 Y 1 A GLN 100 ? OE1 ? C GLN 71  OE1 
60 1 Y 1 A GLN 100 ? NE2 ? C GLN 71  NE2 
61 1 Y 1 A ILE 110 ? CG1 ? C ILE 81  CG1 
62 1 Y 1 A ILE 110 ? CG2 ? C ILE 81  CG2 
63 1 Y 1 A ILE 110 ? CD1 ? C ILE 81  CD1 
64 1 Y 1 A CYS 111 ? SG  ? C CYS 82  SG  
65 1 Y 1 A LYS 113 ? CG  ? C LYS 84  CG  
66 1 Y 1 A LYS 113 ? CD  ? C LYS 84  CD  
67 1 Y 1 A LYS 113 ? CE  ? C LYS 84  CE  
68 1 Y 1 A LYS 113 ? NZ  ? C LYS 84  NZ  
69 1 Y 1 A LYS 136 ? CG  ? C LYS 107 CG  
70 1 Y 1 A LYS 136 ? CD  ? C LYS 107 CD  
71 1 Y 1 A LYS 136 ? CE  ? C LYS 107 CE  
72 1 Y 1 A LYS 136 ? NZ  ? C LYS 107 NZ  
73 1 Y 1 A VAL 148 ? CG1 ? C VAL 119 CG1 
74 1 Y 1 A VAL 148 ? CG2 ? C VAL 119 CG2 
75 1 Y 1 A HIS 149 ? CG  ? C HIS 120 CG  
76 1 Y 1 A HIS 149 ? ND1 ? C HIS 120 ND1 
77 1 Y 1 A HIS 149 ? CD2 ? C HIS 120 CD2 
78 1 Y 1 A HIS 149 ? CE1 ? C HIS 120 CE1 
79 1 Y 1 A HIS 149 ? NE2 ? C HIS 120 NE2 
80 1 Y 1 A LYS 154 ? CE  ? C LYS 125 CE  
81 1 Y 1 A LYS 154 ? NZ  ? C LYS 125 NZ  
82 1 Y 1 D GLU -1  ? CG  ? D GLU 4   CG  
83 1 Y 1 D GLU -1  ? CD  ? D GLU 4   CD  
84 1 Y 1 D GLU -1  ? OE1 ? D GLU 4   OE1 
85 1 Y 1 D GLU -1  ? OE2 ? D GLU 4   OE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 B LYS 104 ? A LYS 104 
2  1 Y 1 C MET 16  ? B MET 1   
3  1 Y 1 C SER 47  ? B SER 32  
4  1 Y 1 C GLY 48  ? B GLY 33  
5  1 Y 1 C PRO 49  ? B PRO 34  
6  1 Y 1 C GLY 50  ? B GLY 35  
7  1 Y 1 C GLN 51  ? B GLN 36  
8  1 Y 1 C PHE 52  ? B PHE 37  
9  1 Y 1 C ALA 53  ? B ALA 38  
10 1 Y 1 C GLU 54  ? B GLU 39  
11 1 Y 1 C ASN 55  ? B ASN 40  
12 1 Y 1 C GLU 56  ? B GLU 41  
13 1 Y 1 A ARG 137 ? C ARG 108 
14 1 Y 1 A THR 138 ? C THR 109 
15 1 Y 1 A GLY 139 ? C GLY 110 
16 1 Y 1 A PRO 140 ? C PRO 111 
17 1 Y 1 A GLU 141 ? C GLU 112 
18 1 Y 1 A ALA 142 ? C ALA 113 
19 1 Y 1 A PRO 143 ? C PRO 114 
20 1 Y 1 A ARG 144 ? C ARG 115 
21 1 Y 1 A ASN 145 ? C ASN 116 
22 1 Y 1 A GLY 146 ? C GLY 117 
23 1 Y 1 A THR 147 ? C THR 118 
24 1 Y 1 D ALA -4  ? D ALA 1   
25 1 Y 1 D SER 6   ? D SER 11  
# 
loop_
_pdbx_audit_support.funding_organization 
_pdbx_audit_support.country 
_pdbx_audit_support.grant_number 
_pdbx_audit_support.ordinal 
'European Research Council' 'United Kingdom' 'ERC-2012-StG-311460 DrugE3CRLs'        1 
?                           'United Kingdom' 'University of Dundee, PhD Scholarship' 2 
'Wellcome Trust'            'United Kingdom' 100476/Z/12/Z                           3 
'Wellcome Trust'            'United Kingdom' 094090/Z/10/Z                           4 
# 
_pdbx_entity_instance_feature.ordinal        1 
_pdbx_entity_instance_feature.comp_id        PTR 
_pdbx_entity_instance_feature.asym_id        ? 
_pdbx_entity_instance_feature.seq_num        ? 
_pdbx_entity_instance_feature.auth_comp_id   PTR 
_pdbx_entity_instance_feature.auth_asym_id   ? 
_pdbx_entity_instance_feature.auth_seq_num   ? 
_pdbx_entity_instance_feature.feature_type   'SUBJECT OF INVESTIGATION' 
_pdbx_entity_instance_feature.details        ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
5 'DI(HYDROXYETHYL)ETHER' PEG 
6 water                   HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'gel filtration' 
_pdbx_struct_assembly_auth_evidence.details                'ITC, peptide alanine scan by SPR and NMR,' 
#